data_3M0A
# 
_entry.id   3M0A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3M0A         
RCSB  RCSB057945   
WWPDB D_1000057945 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3M06 . unspecified 
PDB 3M0D . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3M0A 
_pdbx_database_status.recvd_initial_deposition_date   2010-03-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kabaleeswaran, V.' 1 
'Wu, H.'            2 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structures of the TRAF2: cIAP2 and the TRAF1: TRAF2: cIAP2 complexes: affinity, specificity, and regulation.' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            38 
_citation.page_first                101 
_citation.page_last                 113 
_citation.year                      2010 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20385093 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2010.03.009 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zheng, C.'         1 
primary 'Kabaleeswaran, V.' 2 
primary 'Wang, Y.'          3 
primary 'Cheng, G.'         4 
primary 'Wu, H.'            5 
# 
_cell.entry_id           3M0A 
_cell.length_a           92.123 
_cell.length_b           92.123 
_cell.length_c           85.971 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              24 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3M0A 
_symmetry.space_group_name_H-M             'I 41' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                80 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'TNF receptor-associated factor 2'            7572.612 3  ? ? 'Residues 266-329' ? 
2 polymer     man 'Baculoviral IAP repeat-containing protein 3' 8581.972 1  ? ? 'Residues 26-99'   ? 
3 non-polymer syn 'ZINC ION'                                    65.409   1  ? ? ?                  ? 
4 water       nat water                                         18.015   36 ? ? ?                  ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Tumor necrosis factor type 2 receptor-associated protein 3' 
2 
;Inhibitor of apoptosis protein 1, IAP-1, hIAP-1, hIAP1, C-IAP2, TNFR2-TRAF-signaling complex protein 1, IAP homolog C, Apoptosis inhibitor 2, API2, RING finger protein 49
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no SELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLE          
SELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLE          A,B,C ? 
2 'polypeptide(L)' no no MLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSL 
MLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSL D     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  GLU n 
1 3  LEU n 
1 4  LEU n 
1 5  GLN n 
1 6  ARG n 
1 7  CYS n 
1 8  GLU n 
1 9  SER n 
1 10 LEU n 
1 11 GLU n 
1 12 LYS n 
1 13 LYS n 
1 14 THR n 
1 15 ALA n 
1 16 THR n 
1 17 PHE n 
1 18 GLU n 
1 19 ASN n 
1 20 ILE n 
1 21 VAL n 
1 22 CYS n 
1 23 VAL n 
1 24 LEU n 
1 25 ASN n 
1 26 ARG n 
1 27 GLU n 
1 28 VAL n 
1 29 GLU n 
1 30 ARG n 
1 31 VAL n 
1 32 ALA n 
1 33 MET n 
1 34 THR n 
1 35 ALA n 
1 36 GLU n 
1 37 ALA n 
1 38 CYS n 
1 39 SER n 
1 40 ARG n 
1 41 GLN n 
1 42 HIS n 
1 43 ARG n 
1 44 LEU n 
1 45 ASP n 
1 46 GLN n 
1 47 ASP n 
1 48 LYS n 
1 49 ILE n 
1 50 GLU n 
1 51 ALA n 
1 52 LEU n 
1 53 SER n 
1 54 SER n 
1 55 LYS n 
1 56 VAL n 
1 57 GLN n 
1 58 GLN n 
1 59 LEU n 
1 60 GLU n 
1 61 ARG n 
1 62 SER n 
1 63 ILE n 
1 64 GLY n 
1 65 LEU n 
1 66 GLU n 
2 1  MET n 
2 2  LEU n 
2 3  SER n 
2 4  CYS n 
2 5  GLU n 
2 6  LEU n 
2 7  TYR n 
2 8  ARG n 
2 9  MET n 
2 10 SER n 
2 11 THR n 
2 12 TYR n 
2 13 SER n 
2 14 THR n 
2 15 PHE n 
2 16 PRO n 
2 17 ALA n 
2 18 GLY n 
2 19 VAL n 
2 20 PRO n 
2 21 VAL n 
2 22 SER n 
2 23 GLU n 
2 24 ARG n 
2 25 SER n 
2 26 LEU n 
2 27 ALA n 
2 28 ARG n 
2 29 ALA n 
2 30 GLY n 
2 31 PHE n 
2 32 TYR n 
2 33 TYR n 
2 34 THR n 
2 35 GLY n 
2 36 VAL n 
2 37 ASN n 
2 38 ASP n 
2 39 LYS n 
2 40 VAL n 
2 41 LYS n 
2 42 CYS n 
2 43 PHE n 
2 44 CYS n 
2 45 CYS n 
2 46 GLY n 
2 47 LEU n 
2 48 MET n 
2 49 LEU n 
2 50 ASP n 
2 51 ASN n 
2 52 TRP n 
2 53 LYS n 
2 54 ARG n 
2 55 GLY n 
2 56 ASP n 
2 57 SER n 
2 58 PRO n 
2 59 THR n 
2 60 GLU n 
2 61 LYS n 
2 62 HIS n 
2 63 LYS n 
2 64 LYS n 
2 65 LEU n 
2 66 TYR n 
2 67 PRO n 
2 68 SER n 
2 69 CYS n 
2 70 ARG n 
2 71 PHE n 
2 72 VAL n 
2 73 GLN n 
2 74 SER n 
2 75 LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? TRAF2                            ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 
469008 ? ? ? ? ? ? 'BL21(DE3) RIPL' ? ? ? ? ? ? ? plasmid ? ? ? pET26B ? ? 
2 1 sample ? ? ? human ? 'BIRC3, API2, IAP1, MIHC, RNF49' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 
469008 ? ? ? ? ? ? 'BL21(DE3) RIPL' ? ? ? ? ? ? ? plasmid ? ? ? pET26B ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP TRAF2_HUMAN Q12933 1 SELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIG           266 ? 
2 UNP BIRC3_HUMAN Q13489 2 LSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSL 26  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3M0A A 1 ? 64 ? Q12933 266 ? 329 ? 266 329 
2 1 3M0A B 1 ? 64 ? Q12933 266 ? 329 ? 266 329 
3 1 3M0A C 1 ? 64 ? Q12933 266 ? 329 ? 266 329 
4 2 3M0A D 2 ? 75 ? Q13489 26  ? 99  ? 26  99  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3M0A LEU A 65 ? UNP Q12933 ? ? 'EXPRESSION TAG'        330 1 
1 3M0A GLU A 66 ? UNP Q12933 ? ? 'EXPRESSION TAG'        331 2 
2 3M0A LEU B 65 ? UNP Q12933 ? ? 'EXPRESSION TAG'        330 3 
2 3M0A GLU B 66 ? UNP Q12933 ? ? 'EXPRESSION TAG'        331 4 
3 3M0A LEU C 65 ? UNP Q12933 ? ? 'EXPRESSION TAG'        330 5 
3 3M0A GLU C 66 ? UNP Q12933 ? ? 'EXPRESSION TAG'        331 6 
4 3M0A MET D 1  ? UNP Q13489 ? ? 'INITIATING METHIONINE' 25  7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          3M0A 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.91 
_exptl_crystal.density_percent_sol   57.79 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.pdbx_mosaicity        0.525 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.pdbx_details    '8% PEG 3350, 6% Tacsimate, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2009-03-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si-111 double cryst' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.2822 1.0 
2 1.2832 1.0 
3 1.2664 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.2822,1.2832,1.2664 
# 
_reflns.entry_id                     3M0A 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.600 
_reflns.number_obs                   11032 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         88.70 
_reflns.pdbx_Rmerge_I_obs            0.049 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.80 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.60 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             1.51 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_rejects 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.percent_possible_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.60 2.69  ? ? ? ? 0.393 ? ? ? ? 1002 ? ? ? ? 46.40  ? 2.50 1.080 1  1 
2.69 2.80  ? ? ? ? 0.309 ? ? ? ? 1476 ? ? ? ? 68.70  ? 3.00 1.062 2  1 
2.80 2.93  ? ? ? ? 0.229 ? ? ? ? 1732 ? ? ? ? 80.90  ? 3.20 1.133 3  1 
2.93 3.08  ? ? ? ? 0.178 ? ? ? ? 2091 ? ? ? ? 96.40  ? 3.50 1.217 4  1 
3.08 3.28  ? ? ? ? 0.129 ? ? ? ? 2156 ? ? ? ? 100.00 ? 3.80 1.278 5  1 
3.28 3.53  ? ? ? ? 0.084 ? ? ? ? 2167 ? ? ? ? 100.00 ? 3.80 1.474 6  1 
3.53 3.88  ? ? ? ? 0.056 ? ? ? ? 2158 ? ? ? ? 100.00 ? 3.80 1.539 7  1 
3.88 4.45  ? ? ? ? 0.040 ? ? ? ? 2126 ? ? ? ? 100.00 ? 3.80 1.742 8  1 
4.45 5.60  ? ? ? ? 0.039 ? ? ? ? 2139 ? ? ? ? 99.00  ? 3.80 2.028 9  1 
5.60 50.00 ? ? ? ? 0.028 ? ? ? ? 2058 ? ? ? ? 95.30  ? 3.60 1.905 10 1 
# 
_refine.entry_id                                 3M0A 
_refine.ls_d_res_high                            2.610 
_refine.ls_d_res_low                             32.600 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    87.850 
_refine.ls_number_reflns_obs                     9689 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'U VALUES      : WITH TLS ADDED' 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.227 
_refine.ls_R_factor_R_free                       0.268 
_refine.ls_percent_reflns_R_free                 4.700 
_refine.ls_number_reflns_R_free                  459 
_refine.ls_number_reflns_R_work                  9230 
_refine.B_iso_mean                               74.253 
_refine.aniso_B[1][1]                            -2.670 
_refine.aniso_B[2][2]                            -2.670 
_refine.aniso_B[3][3]                            5.340 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.950 
_refine.correlation_coeff_Fo_to_Fc_free          0.928 
_refine.pdbx_overall_ESU_R                       0.660 
_refine.pdbx_overall_ESU_R_Free                  0.326 
_refine.overall_SU_ML                            0.234 
_refine.overall_SU_B                             25.240 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_R_factor_all                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1889 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             36 
_refine_hist.number_atoms_total               1926 
_refine_hist.d_res_high                       2.610 
_refine_hist.d_res_low                        32.600 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       1910 0.019  0.021  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    2588 1.878  1.969  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 256  7.104  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 70   39.528 23.571 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 312  22.514 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 14   21.065 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         320  0.116  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   1401 0.006  0.020  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            1298 0.750  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           2047 1.454  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            612  2.492  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           541  4.141  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.610 
_refine_ls_shell.d_res_low                        2.674 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               40.100 
_refine_ls_shell.number_reflns_R_work             312 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.419 
_refine_ls_shell.R_factor_R_free                  0.525 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             12 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                324 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  3M0A 
_struct.title                     'Crystal structure of TRAF2:cIAP2 complex' 
_struct.pdbx_descriptor           'TNF receptor-associated factor 2, Baculoviral IAP repeat-containing protein 3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3M0A 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
'TRAF2: cIAP2 and the TRAF1: TRAF2: cIAP2 complexes, Apoptosis, Metal-binding, Phosphoprotein, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 2  ? ILE A 63 ? GLU A 267 ILE A 328 1 ? 62 
HELX_P HELX_P2 2 GLU B 2  ? CYS B 38 ? GLU B 267 CYS B 303 1 ? 37 
HELX_P HELX_P3 3 LEU B 44 ? ILE B 63 ? LEU B 309 ILE B 328 1 ? 20 
HELX_P HELX_P4 4 GLU C 2  ? ILE C 63 ? GLU C 267 ILE C 328 1 ? 62 
HELX_P HELX_P5 5 SER D 3  ? THR D 11 ? SER D 27  THR D 35  1 ? 9  
HELX_P HELX_P6 6 TYR D 12 ? PHE D 15 ? TYR D 36  PHE D 39  5 ? 4  
HELX_P HELX_P7 7 SER D 22 ? ALA D 29 ? SER D 46  ALA D 53  1 ? 8  
HELX_P HELX_P8 8 SER D 57 ? TYR D 66 ? SER D 81  TYR D 90  1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? D CYS 42 SG  ? ? ? 1_555 E ZN . ZN ? ? D CYS 66 D ZN 401 1_555 ? ? ? ? ? ? ? 2.215 ? 
metalc2 metalc ? ? D HIS 62 NE2 ? ? ? 1_555 E ZN . ZN ? ? D HIS 86 D ZN 401 1_555 ? ? ? ? ? ? ? 2.233 ? 
metalc3 metalc ? ? D CYS 45 SG  ? ? ? 1_555 E ZN . ZN ? ? D CYS 69 D ZN 401 1_555 ? ? ? ? ? ? ? 2.369 ? 
metalc4 metalc ? ? D CYS 69 SG  ? ? ? 1_555 E ZN . ZN ? ? D CYS 93 D ZN 401 1_555 ? ? ? ? ? ? ? 2.389 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE D 31 ? TYR D 33 ? PHE D 55 TYR D 57 
A 2 VAL D 40 ? CYS D 42 ? VAL D 64 CYS D 66 
A 3 MET D 48 ? LEU D 49 ? MET D 72 LEU D 73 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR D 32 ? N TYR D 56 O LYS D 41 ? O LYS D 65 
A 2 3 N VAL D 40 ? N VAL D 64 O LEU D 49 ? O LEU D 73 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE ZN D 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS D 42 ? CYS D 66 . ? 1_555 ? 
2 AC1 4 CYS D 45 ? CYS D 69 . ? 1_555 ? 
3 AC1 4 HIS D 62 ? HIS D 86 . ? 1_555 ? 
4 AC1 4 CYS D 69 ? CYS D 93 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3M0A 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3M0A 
_atom_sites.fract_transf_matrix[1][1]   0.010855 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010855 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011632 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLU A 1 2  ? 18.986 41.527  64.955 1.00 117.44 ? 267 GLU A N   1 
ATOM   2    C  CA  . GLU A 1 2  ? 20.348 41.105  64.508 1.00 115.85 ? 267 GLU A CA  1 
ATOM   3    C  C   . GLU A 1 2  ? 21.180 40.706  65.715 1.00 113.65 ? 267 GLU A C   1 
ATOM   4    O  O   . GLU A 1 2  ? 20.793 39.783  66.416 1.00 113.52 ? 267 GLU A O   1 
ATOM   5    C  CB  . GLU A 1 2  ? 21.067 42.159  63.656 1.00 116.79 ? 267 GLU A CB  1 
ATOM   6    C  CG  . GLU A 1 2  ? 22.203 41.588  62.793 1.00 116.31 ? 267 GLU A CG  1 
ATOM   7    C  CD  . GLU A 1 2  ? 22.606 42.523  61.663 1.00 119.28 ? 267 GLU A CD  1 
ATOM   8    O  OE1 . GLU A 1 2  ? 23.721 43.069  61.746 1.00 119.43 ? 267 GLU A OE1 1 
ATOM   9    O  OE2 . GLU A 1 2  ? 21.817 42.723  60.705 1.00 120.89 ? 267 GLU A OE2 1 
ATOM   10   N  N   . LEU A 1 3  ? 22.287 41.390  65.990 1.00 90.91  ? 268 LEU A N   1 
ATOM   11   C  CA  . LEU A 1 3  ? 23.289 40.817  66.888 1.00 88.38  ? 268 LEU A CA  1 
ATOM   12   C  C   . LEU A 1 3  ? 22.804 40.123  68.170 1.00 87.40  ? 268 LEU A C   1 
ATOM   13   O  O   . LEU A 1 3  ? 23.333 39.076  68.519 1.00 86.28  ? 268 LEU A O   1 
ATOM   14   C  CB  . LEU A 1 3  ? 24.411 41.793  67.193 1.00 87.96  ? 268 LEU A CB  1 
ATOM   15   C  CG  . LEU A 1 3  ? 25.752 41.135  66.886 1.00 86.32  ? 268 LEU A CG  1 
ATOM   16   C  CD1 . LEU A 1 3  ? 26.137 41.324  65.417 1.00 86.91  ? 268 LEU A CD1 1 
ATOM   17   C  CD2 . LEU A 1 3  ? 26.801 41.698  67.775 1.00 85.56  ? 268 LEU A CD2 1 
ATOM   18   N  N   . LEU A 1 4  ? 21.788 40.664  68.838 1.00 89.60  ? 269 LEU A N   1 
ATOM   19   C  CA  . LEU A 1 4  ? 21.276 40.093  70.110 1.00 88.75  ? 269 LEU A CA  1 
ATOM   20   C  C   . LEU A 1 4  ? 20.279 38.943  69.967 1.00 88.35  ? 269 LEU A C   1 
ATOM   21   O  O   . LEU A 1 4  ? 20.090 38.155  70.882 1.00 87.06  ? 269 LEU A O   1 
ATOM   22   C  CB  . LEU A 1 4  ? 20.622 41.179  70.957 1.00 90.41  ? 269 LEU A CB  1 
ATOM   23   C  CG  . LEU A 1 4  ? 21.515 42.310  71.444 1.00 90.28  ? 269 LEU A CG  1 
ATOM   24   C  CD1 . LEU A 1 4  ? 20.709 43.577  71.398 1.00 93.34  ? 269 LEU A CD1 1 
ATOM   25   C  CD2 . LEU A 1 4  ? 22.043 42.062  72.834 1.00 89.37  ? 269 LEU A CD2 1 
ATOM   26   N  N   . GLN A 1 5  ? 19.614 38.897  68.826 1.00 115.84 ? 270 GLN A N   1 
ATOM   27   C  CA  . GLN A 1 5  ? 18.767 37.785  68.458 1.00 115.99 ? 270 GLN A CA  1 
ATOM   28   C  C   . GLN A 1 5  ? 19.625 36.596  68.062 1.00 112.52 ? 270 GLN A C   1 
ATOM   29   O  O   . GLN A 1 5  ? 19.298 35.461  68.351 1.00 111.27 ? 270 GLN A O   1 
ATOM   30   C  CB  . GLN A 1 5  ? 17.860 38.197  67.293 1.00 118.51 ? 270 GLN A CB  1 
ATOM   31   C  CG  . GLN A 1 5  ? 16.724 39.136  67.702 1.00 125.41 ? 270 GLN A CG  1 
ATOM   32   C  CD  . GLN A 1 5  ? 15.474 38.377  68.162 1.00 131.78 ? 270 GLN A CD  1 
ATOM   33   O  OE1 . GLN A 1 5  ? 14.524 38.231  67.391 1.00 135.59 ? 270 GLN A OE1 1 
ATOM   34   N  NE2 . GLN A 1 5  ? 15.476 37.881  69.411 1.00 132.02 ? 270 GLN A NE2 1 
ATOM   35   N  N   . ARG A 1 6  ? 20.721 36.885  67.381 1.00 104.55 ? 271 ARG A N   1 
ATOM   36   C  CA  . ARG A 1 6  ? 21.639 35.878  66.943 1.00 102.16 ? 271 ARG A CA  1 
ATOM   37   C  C   . ARG A 1 6  ? 22.352 35.270  68.134 1.00 99.92  ? 271 ARG A C   1 
ATOM   38   O  O   . ARG A 1 6  ? 22.823 34.145  68.074 1.00 98.88  ? 271 ARG A O   1 
ATOM   39   C  CB  . ARG A 1 6  ? 22.635 36.461  65.951 1.00 101.92 ? 271 ARG A CB  1 
ATOM   40   C  CG  . ARG A 1 6  ? 22.036 36.664  64.577 1.00 103.99 ? 271 ARG A CG  1 
ATOM   41   C  CD  . ARG A 1 6  ? 23.059 36.453  63.473 1.00 105.53 ? 271 ARG A CD  1 
ATOM   42   N  NE  . ARG A 1 6  ? 23.655 37.691  62.984 1.00 108.63 ? 271 ARG A NE  1 
ATOM   43   C  CZ  . ARG A 1 6  ? 24.578 37.747  62.026 1.00 110.16 ? 271 ARG A CZ  1 
ATOM   44   N  NH1 . ARG A 1 6  ? 25.015 36.627  61.468 1.00 109.42 ? 271 ARG A NH1 1 
ATOM   45   N  NH2 . ARG A 1 6  ? 25.069 38.923  61.630 1.00 113.28 ? 271 ARG A NH2 1 
ATOM   46   N  N   . CYS A 1 7  ? 22.381 36.016  69.222 1.00 90.43  ? 272 CYS A N   1 
ATOM   47   C  CA  . CYS A 1 7  ? 23.069 35.622  70.420 1.00 87.89  ? 272 CYS A CA  1 
ATOM   48   C  C   . CYS A 1 7  ? 22.163 34.800  71.342 1.00 87.60  ? 272 CYS A C   1 
ATOM   49   O  O   . CYS A 1 7  ? 22.589 33.780  71.915 1.00 85.98  ? 272 CYS A O   1 
ATOM   50   C  CB  . CYS A 1 7  ? 23.535 36.874  71.123 1.00 87.83  ? 272 CYS A CB  1 
ATOM   51   S  SG  . CYS A 1 7  ? 24.651 36.528  72.384 1.00 86.95  ? 272 CYS A SG  1 
ATOM   52   N  N   . GLU A 1 8  ? 20.929 35.269  71.501 1.00 91.18  ? 273 GLU A N   1 
ATOM   53   C  CA  . GLU A 1 8  ? 19.862 34.537  72.162 1.00 91.30  ? 273 GLU A CA  1 
ATOM   54   C  C   . GLU A 1 8  ? 19.808 33.159  71.534 1.00 89.59  ? 273 GLU A C   1 
ATOM   55   O  O   . GLU A 1 8  ? 20.075 32.208  72.205 1.00 88.99  ? 273 GLU A O   1 
ATOM   56   C  CB  . GLU A 1 8  ? 18.529 35.239  71.915 1.00 94.06  ? 273 GLU A CB  1 
ATOM   57   C  CG  . GLU A 1 8  ? 17.510 35.365  73.035 1.00 97.16  ? 273 GLU A CG  1 
ATOM   58   C  CD  . GLU A 1 8  ? 16.542 36.579  72.768 1.00 105.85 ? 273 GLU A CD  1 
ATOM   59   O  OE1 . GLU A 1 8  ? 16.993 37.768  72.741 1.00 105.24 ? 273 GLU A OE1 1 
ATOM   60   O  OE2 . GLU A 1 8  ? 15.317 36.347  72.560 1.00 110.07 ? 273 GLU A OE2 1 
ATOM   61   N  N   . SER A 1 9  ? 19.512 33.063  70.240 1.00 83.03  ? 274 SER A N   1 
ATOM   62   C  CA  . SER A 1 9  ? 19.332 31.790  69.555 1.00 81.93  ? 274 SER A CA  1 
ATOM   63   C  C   . SER A 1 9  ? 20.550 30.852  69.645 1.00 79.57  ? 274 SER A C   1 
ATOM   64   O  O   . SER A 1 9  ? 20.410 29.641  69.931 1.00 78.64  ? 274 SER A O   1 
ATOM   65   C  CB  . SER A 1 9  ? 18.964 32.020  68.102 1.00 82.85  ? 274 SER A CB  1 
ATOM   66   O  OG  . SER A 1 9  ? 20.098 32.492  67.399 1.00 84.55  ? 274 SER A OG  1 
ATOM   67   N  N   . LEU A 1 10 ? 21.732 31.411  69.414 1.00 80.80  ? 275 LEU A N   1 
ATOM   68   C  CA  . LEU A 1 10 ? 22.977 30.693  69.578 1.00 78.69  ? 275 LEU A CA  1 
ATOM   69   C  C   . LEU A 1 10 ? 23.030 30.053  70.967 1.00 78.20  ? 275 LEU A C   1 
ATOM   70   O  O   . LEU A 1 10 ? 23.331 28.861  71.115 1.00 77.00  ? 275 LEU A O   1 
ATOM   71   C  CB  . LEU A 1 10 ? 24.135 31.656  69.403 1.00 77.98  ? 275 LEU A CB  1 
ATOM   72   C  CG  . LEU A 1 10 ? 25.327 31.307  68.547 1.00 76.16  ? 275 LEU A CG  1 
ATOM   73   C  CD1 . LEU A 1 10 ? 24.819 30.758  67.258 1.00 77.96  ? 275 LEU A CD1 1 
ATOM   74   C  CD2 . LEU A 1 10 ? 26.176 32.542  68.342 1.00 74.97  ? 275 LEU A CD2 1 
ATOM   75   N  N   . GLU A 1 11 ? 22.692 30.833  71.981 1.00 82.70  ? 276 GLU A N   1 
ATOM   76   C  CA  . GLU A 1 11 ? 22.787 30.343  73.337 1.00 82.60  ? 276 GLU A CA  1 
ATOM   77   C  C   . GLU A 1 11 ? 21.707 29.301  73.628 1.00 82.23  ? 276 GLU A C   1 
ATOM   78   O  O   . GLU A 1 11 ? 21.934 28.402  74.469 1.00 81.86  ? 276 GLU A O   1 
ATOM   79   C  CB  . GLU A 1 11 ? 22.856 31.496  74.371 1.00 83.87  ? 276 GLU A CB  1 
ATOM   80   C  CG  . GLU A 1 11 ? 21.546 31.883  75.089 1.00 88.92  ? 276 GLU A CG  1 
ATOM   81   C  CD  . GLU A 1 11 ? 21.408 33.413  75.446 1.00 94.61  ? 276 GLU A CD  1 
ATOM   82   O  OE1 . GLU A 1 11 ? 22.460 34.134  75.464 1.00 94.69  ? 276 GLU A OE1 1 
ATOM   83   O  OE2 . GLU A 1 11 ? 20.242 33.856  75.733 1.00 94.90  ? 276 GLU A OE2 1 
ATOM   84   N  N   . LYS A 1 12 ? 20.579 29.382  72.912 1.00 73.09  ? 277 LYS A N   1 
ATOM   85   C  CA  . LYS A 1 12 ? 19.486 28.381  73.019 1.00 72.81  ? 277 LYS A CA  1 
ATOM   86   C  C   . LYS A 1 12 ? 19.838 27.040  72.350 1.00 71.92  ? 277 LYS A C   1 
ATOM   87   O  O   . LYS A 1 12 ? 19.618 25.966  72.926 1.00 71.19  ? 277 LYS A O   1 
ATOM   88   C  CB  . LYS A 1 12 ? 18.198 28.926  72.433 1.00 73.77  ? 277 LYS A CB  1 
ATOM   89   C  CG  . LYS A 1 12 ? 17.073 27.935  72.286 1.00 73.13  ? 277 LYS A CG  1 
ATOM   90   C  CD  . LYS A 1 12 ? 15.734 28.667  72.333 1.00 75.11  ? 277 LYS A CD  1 
ATOM   91   C  CE  . LYS A 1 12 ? 14.516 27.765  72.121 1.00 77.28  ? 277 LYS A CE  1 
ATOM   92   N  NZ  . LYS A 1 12 ? 13.213 28.488  72.312 1.00 78.09  ? 277 LYS A NZ  1 
ATOM   93   N  N   . LYS A 1 13 ? 20.370 27.134  71.125 1.00 84.20  ? 278 LYS A N   1 
ATOM   94   C  CA  . LYS A 1 13 ? 20.926 26.016  70.362 1.00 82.44  ? 278 LYS A CA  1 
ATOM   95   C  C   . LYS A 1 13 ? 21.991 25.280  71.201 1.00 80.60  ? 278 LYS A C   1 
ATOM   96   O  O   . LYS A 1 13 ? 21.940 24.045  71.416 1.00 80.22  ? 278 LYS A O   1 
ATOM   97   C  CB  . LYS A 1 13 ? 21.532 26.544  69.030 1.00 82.53  ? 278 LYS A CB  1 
ATOM   98   C  CG  . LYS A 1 13 ? 20.619 26.400  67.812 1.00 85.29  ? 278 LYS A CG  1 
ATOM   99   C  CD  . LYS A 1 13 ? 21.317 26.588  66.468 1.00 89.89  ? 278 LYS A CD  1 
ATOM   100  C  CE  . LYS A 1 13 ? 20.994 28.010  65.869 1.00 98.59  ? 278 LYS A CE  1 
ATOM   101  N  NZ  . LYS A 1 13 ? 19.522 28.275  65.612 1.00 100.26 ? 278 LYS A NZ  1 
ATOM   102  N  N   . THR A 1 14 ? 22.928 26.082  71.683 1.00 73.27  ? 279 THR A N   1 
ATOM   103  C  CA  . THR A 1 14 ? 24.074 25.630  72.389 1.00 71.57  ? 279 THR A CA  1 
ATOM   104  C  C   . THR A 1 14 ? 23.660 24.856  73.622 1.00 70.88  ? 279 THR A C   1 
ATOM   105  O  O   . THR A 1 14 ? 24.122 23.732  73.826 1.00 70.70  ? 279 THR A O   1 
ATOM   106  C  CB  . THR A 1 14 ? 24.948 26.848  72.735 1.00 71.63  ? 279 THR A CB  1 
ATOM   107  O  OG1 . THR A 1 14 ? 25.755 27.140  71.610 1.00 71.36  ? 279 THR A OG1 1 
ATOM   108  C  CG2 . THR A 1 14 ? 25.898 26.573  73.901 1.00 72.83  ? 279 THR A CG2 1 
ATOM   109  N  N   . ALA A 1 15 ? 22.795 25.447  74.440 1.00 66.73  ? 280 ALA A N   1 
ATOM   110  C  CA  . ALA A 1 15 ? 22.330 24.791  75.665 1.00 67.01  ? 280 ALA A CA  1 
ATOM   111  C  C   . ALA A 1 15 ? 21.642 23.434  75.412 1.00 66.90  ? 280 ALA A C   1 
ATOM   112  O  O   . ALA A 1 15 ? 21.856 22.488  76.213 1.00 66.58  ? 280 ALA A O   1 
ATOM   113  C  CB  . ALA A 1 15 ? 21.406 25.691  76.463 1.00 68.03  ? 280 ALA A CB  1 
ATOM   114  N  N   . THR A 1 16 ? 20.838 23.353  74.328 1.00 74.12  ? 281 THR A N   1 
ATOM   115  C  CA  . THR A 1 16 ? 20.063 22.126  73.986 1.00 73.85  ? 281 THR A CA  1 
ATOM   116  C  C   . THR A 1 16 ? 20.971 21.053  73.384 1.00 72.07  ? 281 THR A C   1 
ATOM   117  O  O   . THR A 1 16 ? 20.854 19.826  73.695 1.00 69.69  ? 281 THR A O   1 
ATOM   118  C  CB  . THR A 1 16 ? 18.874 22.370  72.972 1.00 74.83  ? 281 THR A CB  1 
ATOM   119  O  OG1 . THR A 1 16 ? 18.208 23.600  73.240 1.00 74.97  ? 281 THR A OG1 1 
ATOM   120  C  CG2 . THR A 1 16 ? 17.873 21.243  73.083 1.00 74.67  ? 281 THR A CG2 1 
ATOM   121  N  N   . PHE A 1 17 ? 21.842 21.552  72.487 1.00 70.14  ? 282 PHE A N   1 
ATOM   122  C  CA  . PHE A 1 17 ? 22.834 20.713  71.856 1.00 68.49  ? 282 PHE A CA  1 
ATOM   123  C  C   . PHE A 1 17 ? 23.524 19.992  72.985 1.00 66.54  ? 282 PHE A C   1 
ATOM   124  O  O   . PHE A 1 17 ? 23.575 18.784  72.991 1.00 66.12  ? 282 PHE A O   1 
ATOM   125  C  CB  . PHE A 1 17 ? 23.808 21.506  70.986 1.00 68.64  ? 282 PHE A CB  1 
ATOM   126  C  CG  . PHE A 1 17 ? 24.987 20.695  70.526 1.00 70.80  ? 282 PHE A CG  1 
ATOM   127  C  CD1 . PHE A 1 17 ? 24.822 19.680  69.590 1.00 73.56  ? 282 PHE A CD1 1 
ATOM   128  C  CD2 . PHE A 1 17 ? 26.265 20.893  71.083 1.00 73.12  ? 282 PHE A CD2 1 
ATOM   129  C  CE1 . PHE A 1 17 ? 25.941 18.895  69.191 1.00 73.80  ? 282 PHE A CE1 1 
ATOM   130  C  CE2 . PHE A 1 17 ? 27.395 20.108  70.709 1.00 70.72  ? 282 PHE A CE2 1 
ATOM   131  C  CZ  . PHE A 1 17 ? 27.239 19.138  69.763 1.00 71.63  ? 282 PHE A CZ  1 
ATOM   132  N  N   . GLU A 1 18 ? 23.983 20.730  73.984 1.00 68.90  ? 283 GLU A N   1 
ATOM   133  C  CA  . GLU A 1 18 ? 24.660 20.103  75.134 1.00 68.01  ? 283 GLU A CA  1 
ATOM   134  C  C   . GLU A 1 18 ? 23.798 18.964  75.788 1.00 67.17  ? 283 GLU A C   1 
ATOM   135  O  O   . GLU A 1 18 ? 24.335 18.034  76.392 1.00 67.70  ? 283 GLU A O   1 
ATOM   136  C  CB  . GLU A 1 18 ? 25.153 21.213  76.125 1.00 68.60  ? 283 GLU A CB  1 
ATOM   137  N  N   . ASN A 1 19 ? 22.476 18.978  75.616 1.00 65.21  ? 284 ASN A N   1 
ATOM   138  C  CA  . ASN A 1 19 ? 21.649 17.929  76.249 1.00 64.13  ? 284 ASN A CA  1 
ATOM   139  C  C   . ASN A 1 19 ? 21.281 16.739  75.357 1.00 62.78  ? 284 ASN A C   1 
ATOM   140  O  O   . ASN A 1 19 ? 21.200 15.578  75.821 1.00 61.69  ? 284 ASN A O   1 
ATOM   141  C  CB  . ASN A 1 19 ? 20.405 18.569  76.831 1.00 65.61  ? 284 ASN A CB  1 
ATOM   142  C  CG  . ASN A 1 19 ? 20.660 19.209  78.173 1.00 65.71  ? 284 ASN A CG  1 
ATOM   143  O  OD1 . ASN A 1 19 ? 21.048 18.511  79.137 1.00 61.53  ? 284 ASN A OD1 1 
ATOM   144  N  ND2 . ASN A 1 19 ? 20.437 20.548  78.256 1.00 61.09  ? 284 ASN A ND2 1 
ATOM   145  N  N   . ILE A 1 20 ? 21.016 17.075  74.094 1.00 61.29  ? 285 ILE A N   1 
ATOM   146  C  CA  . ILE A 1 20 ? 20.950 16.143  72.978 1.00 60.18  ? 285 ILE A CA  1 
ATOM   147  C  C   . ILE A 1 20 ? 22.164 15.183  72.967 1.00 59.49  ? 285 ILE A C   1 
ATOM   148  O  O   . ILE A 1 20 ? 21.999 13.956  72.905 1.00 60.46  ? 285 ILE A O   1 
ATOM   149  C  CB  . ILE A 1 20 ? 20.823 16.916  71.623 1.00 59.81  ? 285 ILE A CB  1 
ATOM   150  C  CG1 . ILE A 1 20 ? 19.441 17.545  71.495 1.00 60.40  ? 285 ILE A CG1 1 
ATOM   151  C  CG2 . ILE A 1 20 ? 21.120 16.008  70.434 1.00 58.18  ? 285 ILE A CG2 1 
ATOM   152  C  CD1 . ILE A 1 20 ? 19.359 18.584  70.437 1.00 62.19  ? 285 ILE A CD1 1 
ATOM   153  N  N   . VAL A 1 21 ? 23.374 15.723  73.064 1.00 58.87  ? 286 VAL A N   1 
ATOM   154  C  CA  . VAL A 1 21 ? 24.523 14.871  73.204 1.00 57.43  ? 286 VAL A CA  1 
ATOM   155  C  C   . VAL A 1 21 ? 24.421 13.925  74.385 1.00 58.36  ? 286 VAL A C   1 
ATOM   156  O  O   . VAL A 1 21 ? 24.831 12.787  74.259 1.00 59.07  ? 286 VAL A O   1 
ATOM   157  C  CB  . VAL A 1 21 ? 25.838 15.615  73.401 1.00 56.97  ? 286 VAL A CB  1 
ATOM   158  C  CG1 . VAL A 1 21 ? 26.883 14.549  73.687 1.00 55.70  ? 286 VAL A CG1 1 
ATOM   159  C  CG2 . VAL A 1 21 ? 26.215 16.406  72.179 1.00 52.60  ? 286 VAL A CG2 1 
ATOM   160  N  N   . CYS A 1 22 ? 23.928 14.359  75.545 1.00 61.13  ? 287 CYS A N   1 
ATOM   161  C  CA  . CYS A 1 22 ? 23.847 13.386  76.667 1.00 62.42  ? 287 CYS A CA  1 
ATOM   162  C  C   . CYS A 1 22 ? 22.850 12.353  76.327 1.00 62.10  ? 287 CYS A C   1 
ATOM   163  O  O   . CYS A 1 22 ? 23.019 11.247  76.775 1.00 62.50  ? 287 CYS A O   1 
ATOM   164  C  CB  . CYS A 1 22 ? 23.411 13.951  78.015 1.00 63.11  ? 287 CYS A CB  1 
ATOM   165  S  SG  . CYS A 1 22 ? 24.459 15.240  78.594 1.00 69.45  ? 287 CYS A SG  1 
ATOM   166  N  N   . VAL A 1 23 ? 21.802 12.722  75.577 1.00 56.88  ? 288 VAL A N   1 
ATOM   167  C  CA  . VAL A 1 23 ? 20.770 11.781  75.229 1.00 56.79  ? 288 VAL A CA  1 
ATOM   168  C  C   . VAL A 1 23 ? 21.499 10.727  74.418 1.00 56.23  ? 288 VAL A C   1 
ATOM   169  O  O   . VAL A 1 23 ? 21.437 9.480   74.674 1.00 53.87  ? 288 VAL A O   1 
ATOM   170  C  CB  . VAL A 1 23 ? 19.700 12.440  74.356 1.00 57.32  ? 288 VAL A CB  1 
ATOM   171  C  CG1 . VAL A 1 23 ? 18.854 11.406  73.664 1.00 57.11  ? 288 VAL A CG1 1 
ATOM   172  C  CG2 . VAL A 1 23 ? 18.821 13.327  75.192 1.00 59.94  ? 288 VAL A CG2 1 
ATOM   173  N  N   . LEU A 1 24 ? 22.232 11.272  73.457 1.00 62.55  ? 289 LEU A N   1 
ATOM   174  C  CA  . LEU A 1 24 ? 22.954 10.504  72.514 1.00 62.85  ? 289 LEU A CA  1 
ATOM   175  C  C   . LEU A 1 24 ? 23.898 9.551   73.175 1.00 63.05  ? 289 LEU A C   1 
ATOM   176  O  O   . LEU A 1 24 ? 23.954 8.404   72.812 1.00 62.91  ? 289 LEU A O   1 
ATOM   177  C  CB  . LEU A 1 24 ? 23.772 11.438  71.737 1.00 62.90  ? 289 LEU A CB  1 
ATOM   178  C  CG  . LEU A 1 24 ? 23.963 10.774  70.431 1.00 66.14  ? 289 LEU A CG  1 
ATOM   179  C  CD1 . LEU A 1 24 ? 23.014 11.607  69.552 1.00 70.49  ? 289 LEU A CD1 1 
ATOM   180  C  CD2 . LEU A 1 24 ? 25.450 10.990  70.052 1.00 68.20  ? 289 LEU A CD2 1 
ATOM   181  N  N   . ASN A 1 25 ? 24.657 10.011  74.153 1.00 62.82  ? 290 ASN A N   1 
ATOM   182  C  CA  . ASN A 1 25 ? 25.643 9.128   74.678 1.00 63.59  ? 290 ASN A CA  1 
ATOM   183  C  C   . ASN A 1 25 ? 25.175 8.321   75.862 1.00 64.26  ? 290 ASN A C   1 
ATOM   184  O  O   . ASN A 1 25 ? 25.819 7.377   76.273 1.00 65.12  ? 290 ASN A O   1 
ATOM   185  C  CB  . ASN A 1 25 ? 26.963 9.867   74.876 1.00 64.86  ? 290 ASN A CB  1 
ATOM   186  C  CG  . ASN A 1 25 ? 27.072 10.500  76.185 1.00 66.13  ? 290 ASN A CG  1 
ATOM   187  O  OD1 . ASN A 1 25 ? 26.806 9.848   77.199 1.00 69.20  ? 290 ASN A OD1 1 
ATOM   188  N  ND2 . ASN A 1 25 ? 27.515 11.761  76.210 1.00 63.58  ? 290 ASN A ND2 1 
ATOM   189  N  N   . ARG A 1 26 ? 24.028 8.693   76.388 1.00 63.98  ? 291 ARG A N   1 
ATOM   190  C  CA  . ARG A 1 26 ? 23.233 7.840   77.248 1.00 65.41  ? 291 ARG A CA  1 
ATOM   191  C  C   . ARG A 1 26 ? 22.626 6.665   76.419 1.00 65.02  ? 291 ARG A C   1 
ATOM   192  O  O   . ARG A 1 26 ? 22.329 5.590   76.941 1.00 64.95  ? 291 ARG A O   1 
ATOM   193  C  CB  . ARG A 1 26 ? 22.149 8.706   77.921 1.00 66.79  ? 291 ARG A CB  1 
ATOM   194  C  CG  . ARG A 1 26 ? 20.970 7.978   78.581 1.00 69.65  ? 291 ARG A CG  1 
ATOM   195  C  CD  . ARG A 1 26 ? 21.360 7.284   79.873 1.00 72.12  ? 291 ARG A CD  1 
ATOM   196  N  NE  . ARG A 1 26 ? 20.501 6.140   80.096 1.00 77.94  ? 291 ARG A NE  1 
ATOM   197  C  CZ  . ARG A 1 26 ? 20.874 5.016   80.713 1.00 83.18  ? 291 ARG A CZ  1 
ATOM   198  N  NH1 . ARG A 1 26 ? 22.118 4.849   81.221 1.00 85.77  ? 291 ARG A NH1 1 
ATOM   199  N  NH2 . ARG A 1 26 ? 19.992 4.037   80.818 1.00 83.20  ? 291 ARG A NH2 1 
ATOM   200  N  N   . GLU A 1 27 ? 22.435 6.897   75.123 1.00 64.52  ? 292 GLU A N   1 
ATOM   201  C  CA  . GLU A 1 27 ? 22.013 5.866   74.175 1.00 64.16  ? 292 GLU A CA  1 
ATOM   202  C  C   . GLU A 1 27 ? 23.200 4.984   73.930 1.00 63.45  ? 292 GLU A C   1 
ATOM   203  O  O   . GLU A 1 27 ? 23.033 3.799   73.731 1.00 62.95  ? 292 GLU A O   1 
ATOM   204  C  CB  . GLU A 1 27 ? 21.581 6.475   72.833 1.00 64.85  ? 292 GLU A CB  1 
ATOM   205  C  CG  . GLU A 1 27 ? 20.111 6.767   72.677 1.00 66.84  ? 292 GLU A CG  1 
ATOM   206  C  CD  . GLU A 1 27 ? 19.310 5.539   73.018 1.00 72.80  ? 292 GLU A CD  1 
ATOM   207  O  OE1 . GLU A 1 27 ? 19.264 4.590   72.185 1.00 72.45  ? 292 GLU A OE1 1 
ATOM   208  O  OE2 . GLU A 1 27 ? 18.755 5.514   74.147 1.00 76.76  ? 292 GLU A OE2 1 
ATOM   209  N  N   . VAL A 1 28 ? 24.397 5.562   73.960 1.00 60.08  ? 293 VAL A N   1 
ATOM   210  C  CA  . VAL A 1 28 ? 25.609 4.799   73.756 1.00 60.14  ? 293 VAL A CA  1 
ATOM   211  C  C   . VAL A 1 28 ? 25.804 3.797   74.908 1.00 61.95  ? 293 VAL A C   1 
ATOM   212  O  O   . VAL A 1 28 ? 26.208 2.652   74.665 1.00 60.63  ? 293 VAL A O   1 
ATOM   213  C  CB  . VAL A 1 28 ? 26.849 5.713   73.526 1.00 59.72  ? 293 VAL A CB  1 
ATOM   214  C  CG1 . VAL A 1 28 ? 28.143 4.942   73.462 1.00 58.49  ? 293 VAL A CG1 1 
ATOM   215  C  CG2 . VAL A 1 28 ? 26.705 6.477   72.239 1.00 60.46  ? 293 VAL A CG2 1 
ATOM   216  N  N   . GLU A 1 29 ? 25.478 4.200   76.152 1.00 70.44  ? 294 GLU A N   1 
ATOM   217  C  CA  . GLU A 1 29 ? 25.651 3.289   77.324 1.00 71.77  ? 294 GLU A CA  1 
ATOM   218  C  C   . GLU A 1 29 ? 24.646 2.203   77.270 1.00 72.17  ? 294 GLU A C   1 
ATOM   219  O  O   . GLU A 1 29 ? 24.942 1.063   77.596 1.00 72.25  ? 294 GLU A O   1 
ATOM   220  C  CB  . GLU A 1 29 ? 25.543 4.013   78.668 1.00 72.76  ? 294 GLU A CB  1 
ATOM   221  C  CG  . GLU A 1 29 ? 26.712 4.946   78.896 1.00 77.09  ? 294 GLU A CG  1 
ATOM   222  C  CD  . GLU A 1 29 ? 26.410 6.139   79.776 1.00 81.94  ? 294 GLU A CD  1 
ATOM   223  O  OE1 . GLU A 1 29 ? 25.806 7.127   79.308 1.00 83.16  ? 294 GLU A OE1 1 
ATOM   224  O  OE2 . GLU A 1 29 ? 26.810 6.090   80.949 1.00 86.97  ? 294 GLU A OE2 1 
ATOM   225  N  N   . ARG A 1 30 ? 23.432 2.552   76.871 1.00 70.51  ? 295 ARG A N   1 
ATOM   226  C  CA  . ARG A 1 30 ? 22.431 1.532   76.766 1.00 71.24  ? 295 ARG A CA  1 
ATOM   227  C  C   . ARG A 1 30 ? 22.896 0.510   75.764 1.00 70.78  ? 295 ARG A C   1 
ATOM   228  O  O   . ARG A 1 30 ? 22.910 -0.664  76.052 1.00 71.52  ? 295 ARG A O   1 
ATOM   229  C  CB  . ARG A 1 30 ? 21.096 2.092   76.338 1.00 71.56  ? 295 ARG A CB  1 
ATOM   230  C  CG  . ARG A 1 30 ? 20.067 1.018   76.189 1.00 72.78  ? 295 ARG A CG  1 
ATOM   231  C  CD  . ARG A 1 30 ? 18.671 1.537   76.087 1.00 79.06  ? 295 ARG A CD  1 
ATOM   232  N  NE  . ARG A 1 30 ? 18.457 2.275   74.833 1.00 87.10  ? 295 ARG A NE  1 
ATOM   233  C  CZ  . ARG A 1 30 ? 18.346 1.711   73.625 1.00 90.62  ? 295 ARG A CZ  1 
ATOM   234  N  NH1 . ARG A 1 30 ? 18.452 0.368   73.506 1.00 90.04  ? 295 ARG A NH1 1 
ATOM   235  N  NH2 . ARG A 1 30 ? 18.130 2.489   72.543 1.00 90.14  ? 295 ARG A NH2 1 
ATOM   236  N  N   . VAL A 1 31 ? 23.292 0.949   74.586 1.00 71.54  ? 296 VAL A N   1 
ATOM   237  C  CA  . VAL A 1 31 ? 23.712 0.006   73.581 1.00 71.56  ? 296 VAL A CA  1 
ATOM   238  C  C   . VAL A 1 31 ? 24.933 -0.805  74.020 1.00 72.69  ? 296 VAL A C   1 
ATOM   239  O  O   . VAL A 1 31 ? 24.867 -2.046  74.020 1.00 73.99  ? 296 VAL A O   1 
ATOM   240  C  CB  . VAL A 1 31 ? 23.980 0.675   72.264 1.00 70.88  ? 296 VAL A CB  1 
ATOM   241  C  CG1 . VAL A 1 31 ? 24.696 -0.271  71.353 1.00 70.32  ? 296 VAL A CG1 1 
ATOM   242  C  CG2 . VAL A 1 31 ? 22.665 1.130   71.634 1.00 70.67  ? 296 VAL A CG2 1 
ATOM   243  N  N   . ALA A 1 32 ? 26.021 -0.150  74.421 1.00 59.34  ? 297 ALA A N   1 
ATOM   244  C  CA  . ALA A 1 32 ? 27.200 -0.875  74.920 1.00 60.30  ? 297 ALA A CA  1 
ATOM   245  C  C   . ALA A 1 32 ? 26.890 -1.953  75.977 1.00 62.60  ? 297 ALA A C   1 
ATOM   246  O  O   . ALA A 1 32 ? 27.626 -2.961  76.094 1.00 63.02  ? 297 ALA A O   1 
ATOM   247  C  CB  . ALA A 1 32 ? 28.197 0.082   75.467 1.00 60.37  ? 297 ALA A CB  1 
ATOM   248  N  N   . MET A 1 33 ? 25.812 -1.730  76.737 1.00 71.89  ? 298 MET A N   1 
ATOM   249  C  CA  . MET A 1 33 ? 25.385 -2.647  77.786 1.00 74.48  ? 298 MET A CA  1 
ATOM   250  C  C   . MET A 1 33 ? 24.748 -3.894  77.170 1.00 75.58  ? 298 MET A C   1 
ATOM   251  O  O   . MET A 1 33 ? 24.916 -4.996  77.722 1.00 76.01  ? 298 MET A O   1 
ATOM   252  C  CB  . MET A 1 33 ? 24.452 -1.974  78.818 1.00 75.56  ? 298 MET A CB  1 
ATOM   253  N  N   . THR A 1 34 ? 24.044 -3.733  76.035 1.00 75.55  ? 299 THR A N   1 
ATOM   254  C  CA  . THR A 1 34 ? 23.521 -4.890  75.302 1.00 76.01  ? 299 THR A CA  1 
ATOM   255  C  C   . THR A 1 34 ? 24.617 -5.613  74.447 1.00 77.01  ? 299 THR A C   1 
ATOM   256  O  O   . THR A 1 34 ? 24.523 -6.814  74.212 1.00 77.53  ? 299 THR A O   1 
ATOM   257  C  CB  . THR A 1 34 ? 22.243 -4.571  74.479 1.00 75.36  ? 299 THR A CB  1 
ATOM   258  O  OG1 . THR A 1 34 ? 22.610 -3.831  73.333 1.00 74.31  ? 299 THR A OG1 1 
ATOM   259  C  CG2 . THR A 1 34 ? 21.177 -3.783  75.280 1.00 74.17  ? 299 THR A CG2 1 
ATOM   260  N  N   . ALA A 1 35 ? 25.672 -4.894  74.032 1.00 91.16  ? 300 ALA A N   1 
ATOM   261  C  CA  . ALA A 1 35 ? 26.852 -5.474  73.317 1.00 91.77  ? 300 ALA A CA  1 
ATOM   262  C  C   . ALA A 1 35 ? 27.674 -6.453  74.144 1.00 93.76  ? 300 ALA A C   1 
ATOM   263  O  O   . ALA A 1 35 ? 27.850 -7.600  73.741 1.00 94.70  ? 300 ALA A O   1 
ATOM   264  C  CB  . ALA A 1 35 ? 27.756 -4.378  72.769 1.00 90.72  ? 300 ALA A CB  1 
ATOM   265  N  N   . GLU A 1 36 ? 28.194 -5.994  75.281 1.00 92.92  ? 301 GLU A N   1 
ATOM   266  C  CA  . GLU A 1 36 ? 28.829 -6.877  76.259 1.00 95.21  ? 301 GLU A CA  1 
ATOM   267  C  C   . GLU A 1 36 ? 27.920 -8.076  76.707 1.00 96.73  ? 301 GLU A C   1 
ATOM   268  O  O   . GLU A 1 36 ? 28.436 -9.124  77.133 1.00 97.76  ? 301 GLU A O   1 
ATOM   269  C  CB  . GLU A 1 36 ? 29.378 -6.079  77.462 1.00 95.91  ? 301 GLU A CB  1 
ATOM   270  N  N   . ALA A 1 37 ? 26.593 -7.945  76.588 1.00 82.20  ? 302 ALA A N   1 
ATOM   271  C  CA  . ALA A 1 37 ? 25.700 -9.044  76.952 1.00 83.69  ? 302 ALA A CA  1 
ATOM   272  C  C   . ALA A 1 37 ? 25.745 -10.158 75.901 1.00 84.56  ? 302 ALA A C   1 
ATOM   273  O  O   . ALA A 1 37 ? 25.633 -11.333 76.212 1.00 85.92  ? 302 ALA A O   1 
ATOM   274  C  CB  . ALA A 1 37 ? 24.310 -8.565  77.128 1.00 82.93  ? 302 ALA A CB  1 
ATOM   275  N  N   . CYS A 1 38 ? 25.915 -9.792  74.649 1.00 92.06  ? 303 CYS A N   1 
ATOM   276  C  CA  . CYS A 1 38 ? 25.944 -10.775 73.619 1.00 92.46  ? 303 CYS A CA  1 
ATOM   277  C  C   . CYS A 1 38 ? 27.339 -11.318 73.401 1.00 93.62  ? 303 CYS A C   1 
ATOM   278  O  O   . CYS A 1 38 ? 27.482 -12.443 72.914 1.00 94.18  ? 303 CYS A O   1 
ATOM   279  C  CB  . CYS A 1 38 ? 25.430 -10.156 72.348 1.00 91.15  ? 303 CYS A CB  1 
ATOM   280  S  SG  . CYS A 1 38 ? 23.816 -9.589  72.579 1.00 91.89  ? 303 CYS A SG  1 
ATOM   281  N  N   . SER A 1 39 ? 28.360 -10.519 73.716 1.00 98.15  ? 304 SER A N   1 
ATOM   282  C  CA  . SER A 1 39 ? 29.747 -10.916 73.451 1.00 99.70  ? 304 SER A CA  1 
ATOM   283  C  C   . SER A 1 39 ? 30.202 -11.948 74.461 1.00 101.87 ? 304 SER A C   1 
ATOM   284  O  O   . SER A 1 39 ? 31.027 -12.803 74.138 1.00 102.62 ? 304 SER A O   1 
ATOM   285  C  CB  . SER A 1 39 ? 30.679 -9.715  73.483 1.00 99.25  ? 304 SER A CB  1 
ATOM   286  O  OG  . SER A 1 39 ? 30.678 -9.034  72.241 1.00 98.90  ? 304 SER A OG  1 
ATOM   287  N  N   . ARG A 1 40 ? 29.655 -11.837 75.679 1.00 109.81 ? 305 ARG A N   1 
ATOM   288  C  CA  . ARG A 1 40 ? 29.785 -12.825 76.760 1.00 111.84 ? 305 ARG A CA  1 
ATOM   289  C  C   . ARG A 1 40 ? 28.936 -14.054 76.451 1.00 112.82 ? 305 ARG A C   1 
ATOM   290  O  O   . ARG A 1 40 ? 29.134 -15.132 77.033 1.00 114.19 ? 305 ARG A O   1 
ATOM   291  C  CB  . ARG A 1 40 ? 29.322 -12.227 78.090 1.00 112.20 ? 305 ARG A CB  1 
ATOM   292  N  N   . GLN A 1 41 ? 27.980 -13.882 75.536 1.00 103.48 ? 306 GLN A N   1 
ATOM   293  C  CA  . GLN A 1 41 ? 27.141 -14.986 75.056 1.00 103.74 ? 306 GLN A CA  1 
ATOM   294  C  C   . GLN A 1 41 ? 27.725 -15.826 73.927 1.00 103.48 ? 306 GLN A C   1 
ATOM   295  O  O   . GLN A 1 41 ? 27.187 -16.864 73.616 1.00 103.36 ? 306 GLN A O   1 
ATOM   296  C  CB  . GLN A 1 41 ? 25.709 -14.515 74.775 1.00 103.13 ? 306 GLN A CB  1 
ATOM   297  C  CG  . GLN A 1 41 ? 24.915 -14.454 76.070 1.00 104.62 ? 306 GLN A CG  1 
ATOM   298  C  CD  . GLN A 1 41 ? 25.566 -15.326 77.173 1.00 106.64 ? 306 GLN A CD  1 
ATOM   299  O  OE1 . GLN A 1 41 ? 25.788 -16.536 76.992 1.00 106.65 ? 306 GLN A OE1 1 
ATOM   300  N  NE2 . GLN A 1 41 ? 25.894 -14.702 78.298 1.00 106.78 ? 306 GLN A NE2 1 
ATOM   301  N  N   . HIS A 1 42 ? 28.813 -15.358 73.317 1.00 125.74 ? 307 HIS A N   1 
ATOM   302  C  CA  . HIS A 1 42 ? 29.702 -16.227 72.574 1.00 126.84 ? 307 HIS A CA  1 
ATOM   303  C  C   . HIS A 1 42 ? 30.540 -17.042 73.541 1.00 128.55 ? 307 HIS A C   1 
ATOM   304  O  O   . HIS A 1 42 ? 30.633 -18.254 73.394 1.00 129.14 ? 307 HIS A O   1 
ATOM   305  C  CB  . HIS A 1 42 ? 30.678 -15.467 71.701 1.00 126.64 ? 307 HIS A CB  1 
ATOM   306  C  CG  . HIS A 1 42 ? 32.035 -16.105 71.664 1.00 130.03 ? 307 HIS A CG  1 
ATOM   307  N  ND1 . HIS A 1 42 ? 33.170 -15.478 72.143 1.00 132.97 ? 307 HIS A ND1 1 
ATOM   308  C  CD2 . HIS A 1 42 ? 32.429 -17.344 71.268 1.00 132.22 ? 307 HIS A CD2 1 
ATOM   309  C  CE1 . HIS A 1 42 ? 34.209 -16.287 72.008 1.00 134.84 ? 307 HIS A CE1 1 
ATOM   310  N  NE2 . HIS A 1 42 ? 33.784 -17.431 71.490 1.00 134.97 ? 307 HIS A NE2 1 
ATOM   311  N  N   . ARG A 1 43 ? 31.180 -16.362 74.500 1.00 135.19 ? 308 ARG A N   1 
ATOM   312  C  CA  . ARG A 1 43 ? 32.156 -16.989 75.433 1.00 136.87 ? 308 ARG A CA  1 
ATOM   313  C  C   . ARG A 1 43 ? 31.597 -18.177 76.222 1.00 137.88 ? 308 ARG A C   1 
ATOM   314  O  O   . ARG A 1 43 ? 32.289 -19.196 76.388 1.00 139.47 ? 308 ARG A O   1 
ATOM   315  C  CB  . ARG A 1 43 ? 32.768 -15.958 76.397 1.00 137.37 ? 308 ARG A CB  1 
ATOM   316  N  N   . LEU A 1 44 ? 30.360 -18.039 76.706 1.00 106.60 ? 309 LEU A N   1 
ATOM   317  C  CA  . LEU A 1 44 ? 29.640 -19.139 77.350 1.00 107.20 ? 309 LEU A CA  1 
ATOM   318  C  C   . LEU A 1 44 ? 29.210 -20.198 76.306 1.00 106.33 ? 309 LEU A C   1 
ATOM   319  O  O   . LEU A 1 44 ? 29.131 -21.396 76.603 1.00 107.48 ? 309 LEU A O   1 
ATOM   320  C  CB  . LEU A 1 44 ? 28.419 -18.598 78.125 1.00 107.38 ? 309 LEU A CB  1 
ATOM   321  C  CG  . LEU A 1 44 ? 27.672 -19.301 79.289 1.00 109.11 ? 309 LEU A CG  1 
ATOM   322  C  CD1 . LEU A 1 44 ? 26.648 -20.362 78.824 1.00 108.85 ? 309 LEU A CD1 1 
ATOM   323  C  CD2 . LEU A 1 44 ? 28.613 -19.846 80.418 1.00 111.97 ? 309 LEU A CD2 1 
ATOM   324  N  N   . ASP A 1 45 ? 28.936 -19.751 75.081 1.00 123.88 ? 310 ASP A N   1 
ATOM   325  C  CA  . ASP A 1 45 ? 28.435 -20.644 74.041 1.00 121.85 ? 310 ASP A CA  1 
ATOM   326  C  C   . ASP A 1 45 ? 29.587 -21.209 73.187 1.00 121.38 ? 310 ASP A C   1 
ATOM   327  O  O   . ASP A 1 45 ? 29.397 -22.160 72.448 1.00 121.59 ? 310 ASP A O   1 
ATOM   328  C  CB  . ASP A 1 45 ? 27.333 -19.947 73.209 1.00 120.10 ? 310 ASP A CB  1 
ATOM   329  C  CG  . ASP A 1 45 ? 25.952 -19.892 73.941 1.00 119.13 ? 310 ASP A CG  1 
ATOM   330  O  OD1 . ASP A 1 45 ? 25.803 -20.545 75.015 1.00 119.57 ? 310 ASP A OD1 1 
ATOM   331  O  OD2 . ASP A 1 45 ? 25.019 -19.210 73.423 1.00 114.87 ? 310 ASP A OD2 1 
ATOM   332  N  N   . GLN A 1 46 ? 30.776 -20.625 73.291 1.00 100.17 ? 311 GLN A N   1 
ATOM   333  C  CA  . GLN A 1 46 ? 31.990 -21.295 72.845 1.00 100.17 ? 311 GLN A CA  1 
ATOM   334  C  C   . GLN A 1 46 ? 32.212 -22.502 73.774 1.00 101.31 ? 311 GLN A C   1 
ATOM   335  O  O   . GLN A 1 46 ? 32.294 -23.631 73.315 1.00 101.74 ? 311 GLN A O   1 
ATOM   336  C  CB  . GLN A 1 46 ? 33.204 -20.349 72.888 1.00 100.57 ? 311 GLN A CB  1 
ATOM   337  N  N   . ASP A 1 47 ? 32.259 -22.253 75.085 1.00 119.89 ? 312 ASP A N   1 
ATOM   338  C  CA  . ASP A 1 47 ? 32.593 -23.274 76.105 1.00 120.56 ? 312 ASP A CA  1 
ATOM   339  C  C   . ASP A 1 47 ? 31.601 -24.477 76.252 1.00 119.67 ? 312 ASP A C   1 
ATOM   340  O  O   . ASP A 1 47 ? 32.027 -25.567 76.638 1.00 120.92 ? 312 ASP A O   1 
ATOM   341  C  CB  . ASP A 1 47 ? 32.919 -22.595 77.466 1.00 121.78 ? 312 ASP A CB  1 
ATOM   342  N  N   . LYS A 1 48 ? 30.311 -24.282 75.948 1.00 84.93  ? 313 LYS A N   1 
ATOM   343  C  CA  . LYS A 1 48 ? 29.337 -25.391 75.929 1.00 83.67  ? 313 LYS A CA  1 
ATOM   344  C  C   . LYS A 1 48 ? 29.327 -26.140 74.564 1.00 82.33  ? 313 LYS A C   1 
ATOM   345  O  O   . LYS A 1 48 ? 29.172 -27.363 74.515 1.00 83.11  ? 313 LYS A O   1 
ATOM   346  C  CB  . LYS A 1 48 ? 27.931 -24.980 76.412 1.00 81.98  ? 313 LYS A CB  1 
ATOM   347  N  N   . ILE A 1 49 ? 29.544 -25.446 73.454 1.00 104.88 ? 314 ILE A N   1 
ATOM   348  C  CA  . ILE A 1 49 ? 29.770 -26.188 72.210 1.00 103.13 ? 314 ILE A CA  1 
ATOM   349  C  C   . ILE A 1 49 ? 31.164 -26.852 72.122 1.00 103.56 ? 314 ILE A C   1 
ATOM   350  O  O   . ILE A 1 49 ? 31.278 -27.888 71.504 1.00 104.21 ? 314 ILE A O   1 
ATOM   351  C  CB  . ILE A 1 49 ? 29.463 -25.356 70.944 1.00 101.38 ? 314 ILE A CB  1 
ATOM   352  C  CG1 . ILE A 1 49 ? 27.956 -25.159 70.795 1.00 100.11 ? 314 ILE A CG1 1 
ATOM   353  C  CG2 . ILE A 1 49 ? 30.014 -26.045 69.691 1.00 101.11 ? 314 ILE A CG2 1 
ATOM   354  C  CD1 . ILE A 1 49 ? 27.593 -23.946 69.945 1.00 100.25 ? 314 ILE A CD1 1 
ATOM   355  N  N   . GLU A 1 50 ? 32.207 -26.273 72.724 1.00 92.87  ? 315 GLU A N   1 
ATOM   356  C  CA  . GLU A 1 50 ? 33.549 -26.860 72.660 1.00 93.30  ? 315 GLU A CA  1 
ATOM   357  C  C   . GLU A 1 50 ? 33.581 -28.149 73.457 1.00 94.66  ? 315 GLU A C   1 
ATOM   358  O  O   . GLU A 1 50 ? 34.461 -28.986 73.267 1.00 96.02  ? 315 GLU A O   1 
ATOM   359  C  CB  . GLU A 1 50 ? 34.608 -25.918 73.229 1.00 94.11  ? 315 GLU A CB  1 
ATOM   360  N  N   . ALA A 1 51 ? 32.614 -28.280 74.358 1.00 86.17  ? 316 ALA A N   1 
ATOM   361  C  CA  . ALA A 1 51 ? 32.520 -29.406 75.254 1.00 87.43  ? 316 ALA A CA  1 
ATOM   362  C  C   . ALA A 1 51 ? 31.774 -30.570 74.589 1.00 86.82  ? 316 ALA A C   1 
ATOM   363  O  O   . ALA A 1 51 ? 32.211 -31.724 74.639 1.00 88.53  ? 316 ALA A O   1 
ATOM   364  C  CB  . ALA A 1 51 ? 31.821 -28.986 76.524 1.00 87.61  ? 316 ALA A CB  1 
ATOM   365  N  N   . LEU A 1 52 ? 30.646 -30.248 73.972 1.00 92.26  ? 317 LEU A N   1 
ATOM   366  C  CA  . LEU A 1 52 ? 29.856 -31.205 73.263 1.00 90.64  ? 317 LEU A CA  1 
ATOM   367  C  C   . LEU A 1 52 ? 30.520 -31.642 71.999 1.00 90.65  ? 317 LEU A C   1 
ATOM   368  O  O   . LEU A 1 52 ? 30.438 -32.788 71.638 1.00 91.89  ? 317 LEU A O   1 
ATOM   369  C  CB  . LEU A 1 52 ? 28.523 -30.611 72.928 1.00 88.15  ? 317 LEU A CB  1 
ATOM   370  C  CG  . LEU A 1 52 ? 27.538 -30.864 74.036 1.00 88.43  ? 317 LEU A CG  1 
ATOM   371  C  CD1 . LEU A 1 52 ? 28.179 -30.645 75.384 1.00 90.12  ? 317 LEU A CD1 1 
ATOM   372  C  CD2 . LEU A 1 52 ? 26.358 -29.976 73.841 1.00 87.81  ? 317 LEU A CD2 1 
ATOM   373  N  N   . SER A 1 53 ? 31.168 -30.733 71.300 1.00 93.77  ? 318 SER A N   1 
ATOM   374  C  CA  . SER A 1 53 ? 32.001 -31.119 70.182 1.00 94.22  ? 318 SER A CA  1 
ATOM   375  C  C   . SER A 1 53 ? 32.943 -32.279 70.594 1.00 96.71  ? 318 SER A C   1 
ATOM   376  O  O   . SER A 1 53 ? 33.355 -33.092 69.755 1.00 97.17  ? 318 SER A O   1 
ATOM   377  C  CB  . SER A 1 53 ? 32.789 -29.893 69.709 1.00 93.51  ? 318 SER A CB  1 
ATOM   378  O  OG  . SER A 1 53 ? 33.778 -30.198 68.739 1.00 94.98  ? 318 SER A OG  1 
ATOM   379  N  N   . SER A 1 54 ? 33.252 -32.356 71.892 1.00 106.30 ? 319 SER A N   1 
ATOM   380  C  CA  . SER A 1 54 ? 34.245 -33.302 72.424 1.00 109.98 ? 319 SER A CA  1 
ATOM   381  C  C   . SER A 1 54 ? 33.685 -34.628 72.853 1.00 111.17 ? 319 SER A C   1 
ATOM   382  O  O   . SER A 1 54 ? 34.232 -35.655 72.488 1.00 113.85 ? 319 SER A O   1 
ATOM   383  C  CB  . SER A 1 54 ? 34.995 -32.711 73.601 1.00 112.28 ? 319 SER A CB  1 
ATOM   384  O  OG  . SER A 1 54 ? 36.131 -32.049 73.120 1.00 114.15 ? 319 SER A OG  1 
ATOM   385  N  N   . LYS A 1 55 ? 32.626 -34.587 73.659 1.00 96.35  ? 320 LYS A N   1 
ATOM   386  C  CA  . LYS A 1 55 ? 31.854 -35.770 74.032 1.00 97.29  ? 320 LYS A CA  1 
ATOM   387  C  C   . LYS A 1 55 ? 31.493 -36.610 72.799 1.00 94.84  ? 320 LYS A C   1 
ATOM   388  O  O   . LYS A 1 55 ? 31.610 -37.829 72.798 1.00 96.73  ? 320 LYS A O   1 
ATOM   389  C  CB  . LYS A 1 55 ? 30.592 -35.360 74.819 1.00 96.54  ? 320 LYS A CB  1 
ATOM   390  C  CG  . LYS A 1 55 ? 30.870 -34.858 76.256 1.00 101.80 ? 320 LYS A CG  1 
ATOM   391  C  CD  . LYS A 1 55 ? 29.614 -34.850 77.177 1.00 105.44 ? 320 LYS A CD  1 
ATOM   392  C  CE  . LYS A 1 55 ? 29.883 -35.519 78.586 1.00 112.64 ? 320 LYS A CE  1 
ATOM   393  N  NZ  . LYS A 1 55 ? 30.721 -34.742 79.582 1.00 116.54 ? 320 LYS A NZ  1 
ATOM   394  N  N   . VAL A 1 56 ? 31.118 -35.919 71.742 1.00 92.02  ? 321 VAL A N   1 
ATOM   395  C  CA  . VAL A 1 56 ? 30.670 -36.514 70.529 1.00 89.80  ? 321 VAL A CA  1 
ATOM   396  C  C   . VAL A 1 56 ? 31.801 -37.094 69.696 1.00 91.97  ? 321 VAL A C   1 
ATOM   397  O  O   . VAL A 1 56 ? 31.554 -37.954 68.858 1.00 91.72  ? 321 VAL A O   1 
ATOM   398  C  CB  . VAL A 1 56 ? 29.857 -35.498 69.736 1.00 86.39  ? 321 VAL A CB  1 
ATOM   399  C  CG1 . VAL A 1 56 ? 29.637 -35.947 68.329 1.00 85.04  ? 321 VAL A CG1 1 
ATOM   400  C  CG2 . VAL A 1 56 ? 28.544 -35.273 70.414 1.00 84.49  ? 321 VAL A CG2 1 
ATOM   401  N  N   . GLN A 1 57 ? 33.034 -36.626 69.892 1.00 142.19 ? 322 GLN A N   1 
ATOM   402  C  CA  . GLN A 1 57 ? 34.199 -37.333 69.288 1.00 146.51 ? 322 GLN A CA  1 
ATOM   403  C  C   . GLN A 1 57 ? 34.749 -38.434 70.227 1.00 152.07 ? 322 GLN A C   1 
ATOM   404  O  O   . GLN A 1 57 ? 35.641 -39.205 69.849 1.00 155.93 ? 322 GLN A O   1 
ATOM   405  C  CB  . GLN A 1 57 ? 35.334 -36.387 68.755 1.00 148.24 ? 322 GLN A CB  1 
ATOM   406  C  CG  . GLN A 1 57 ? 36.010 -36.942 67.429 1.00 152.62 ? 322 GLN A CG  1 
ATOM   407  C  CD  . GLN A 1 57 ? 37.458 -36.486 67.152 1.00 158.96 ? 322 GLN A CD  1 
ATOM   408  O  OE1 . GLN A 1 57 ? 37.730 -35.300 66.970 1.00 157.41 ? 322 GLN A OE1 1 
ATOM   409  N  NE2 . GLN A 1 57 ? 38.376 -37.454 67.069 1.00 172.39 ? 322 GLN A NE2 1 
ATOM   410  N  N   . GLN A 1 58 ? 34.220 -38.482 71.451 1.00 102.54 ? 323 GLN A N   1 
ATOM   411  C  CA  . GLN A 1 58 ? 34.533 -39.554 72.368 1.00 109.66 ? 323 GLN A CA  1 
ATOM   412  C  C   . GLN A 1 58 ? 33.602 -40.706 72.016 1.00 106.93 ? 323 GLN A C   1 
ATOM   413  O  O   . GLN A 1 58 ? 34.045 -41.851 71.891 1.00 117.25 ? 323 GLN A O   1 
ATOM   414  C  CB  . GLN A 1 58 ? 34.407 -39.117 73.835 1.00 110.67 ? 323 GLN A CB  1 
ATOM   415  C  CG  . GLN A 1 58 ? 35.558 -38.220 74.335 1.00 118.62 ? 323 GLN A CG  1 
ATOM   416  C  CD  . GLN A 1 58 ? 36.943 -38.791 74.051 1.00 134.38 ? 323 GLN A CD  1 
ATOM   417  O  OE1 . GLN A 1 58 ? 37.670 -38.285 73.195 1.00 131.90 ? 323 GLN A OE1 1 
ATOM   418  N  NE2 . GLN A 1 58 ? 37.306 -39.855 74.763 1.00 150.50 ? 323 GLN A NE2 1 
ATOM   419  N  N   . LEU A 1 59 ? 32.328 -40.395 71.796 1.00 107.13 ? 324 LEU A N   1 
ATOM   420  C  CA  . LEU A 1 59 ? 31.378 -41.399 71.365 1.00 104.68 ? 324 LEU A CA  1 
ATOM   421  C  C   . LEU A 1 59 ? 31.720 -41.923 70.004 1.00 103.62 ? 324 LEU A C   1 
ATOM   422  O  O   . LEU A 1 59 ? 31.622 -43.105 69.746 1.00 106.62 ? 324 LEU A O   1 
ATOM   423  C  CB  . LEU A 1 59 ? 29.984 -40.832 71.327 1.00 98.83  ? 324 LEU A CB  1 
ATOM   424  C  CG  . LEU A 1 59 ? 29.521 -40.218 72.631 1.00 99.38  ? 324 LEU A CG  1 
ATOM   425  C  CD1 . LEU A 1 59 ? 28.029 -39.967 72.557 1.00 93.88  ? 324 LEU A CD1 1 
ATOM   426  C  CD2 . LEU A 1 59 ? 29.897 -41.089 73.837 1.00 106.63 ? 324 LEU A CD2 1 
ATOM   427  N  N   . GLU A 1 60 ? 32.128 -41.036 69.125 1.00 92.71  ? 325 GLU A N   1 
ATOM   428  C  CA  . GLU A 1 60 ? 32.500 -41.442 67.802 1.00 92.01  ? 325 GLU A CA  1 
ATOM   429  C  C   . GLU A 1 60 ? 33.685 -42.375 67.846 1.00 98.68  ? 325 GLU A C   1 
ATOM   430  O  O   . GLU A 1 60 ? 33.758 -43.282 67.037 1.00 101.30 ? 325 GLU A O   1 
ATOM   431  C  CB  . GLU A 1 60 ? 32.827 -40.224 66.952 1.00 89.86  ? 325 GLU A CB  1 
ATOM   432  N  N   . ARG A 1 61 ? 34.601 -42.165 68.786 1.00 95.51  ? 326 ARG A N   1 
ATOM   433  C  CA  . ARG A 1 61 ? 35.758 -43.048 68.919 1.00 115.76 ? 326 ARG A CA  1 
ATOM   434  C  C   . ARG A 1 61 ? 35.363 -44.376 69.578 1.00 125.77 ? 326 ARG A C   1 
ATOM   435  O  O   . ARG A 1 61 ? 35.857 -45.434 69.196 1.00 139.94 ? 326 ARG A O   1 
ATOM   436  C  CB  . ARG A 1 61 ? 36.924 -42.367 69.651 1.00 128.45 ? 326 ARG A CB  1 
ATOM   437  C  CG  . ARG A 1 61 ? 37.533 -41.182 68.903 1.00 125.84 ? 326 ARG A CG  1 
ATOM   438  C  CD  . ARG A 1 61 ? 38.440 -41.581 67.760 1.00 135.90 ? 326 ARG A CD  1 
ATOM   439  N  NE  . ARG A 1 61 ? 39.827 -41.669 68.205 1.00 158.76 ? 326 ARG A NE  1 
ATOM   440  C  CZ  . ARG A 1 61 ? 40.875 -41.691 67.391 1.00 165.77 ? 326 ARG A CZ  1 
ATOM   441  N  NH1 . ARG A 1 61 ? 40.710 -41.626 66.075 1.00 152.85 ? 326 ARG A NH1 1 
ATOM   442  N  NH2 . ARG A 1 61 ? 42.096 -41.776 67.899 1.00 187.70 ? 326 ARG A NH2 1 
ATOM   443  N  N   . SER A 1 62 ? 34.455 -44.324 70.546 1.00 130.28 ? 327 SER A N   1 
ATOM   444  C  CA  . SER A 1 62 ? 33.909 -45.542 71.128 1.00 138.00 ? 327 SER A CA  1 
ATOM   445  C  C   . SER A 1 62 ? 33.363 -46.452 70.041 1.00 132.68 ? 327 SER A C   1 
ATOM   446  O  O   . SER A 1 62 ? 33.809 -47.583 69.913 1.00 146.59 ? 327 SER A O   1 
ATOM   447  C  CB  . SER A 1 62 ? 32.816 -45.218 72.133 1.00 129.48 ? 327 SER A CB  1 
ATOM   448  O  OG  . SER A 1 62 ? 33.330 -44.423 73.179 1.00 136.32 ? 327 SER A OG  1 
ATOM   449  N  N   . ILE A 1 63 ? 32.408 -45.950 69.258 1.00 126.45 ? 328 ILE A N   1 
ATOM   450  C  CA  . ILE A 1 63 ? 31.889 -46.673 68.098 1.00 123.57 ? 328 ILE A CA  1 
ATOM   451  C  C   . ILE A 1 63 ? 32.935 -46.645 66.974 1.00 130.83 ? 328 ILE A C   1 
ATOM   452  O  O   . ILE A 1 63 ? 32.628 -46.671 65.781 1.00 121.17 ? 328 ILE A O   1 
ATOM   453  C  CB  . ILE A 1 63 ? 30.563 -46.061 67.600 1.00 108.61 ? 328 ILE A CB  1 
ATOM   454  C  CG1 . ILE A 1 63 ? 29.520 -46.054 68.710 1.00 107.22 ? 328 ILE A CG1 1 
ATOM   455  C  CG2 . ILE A 1 63 ? 30.023 -46.831 66.412 1.00 116.82 ? 328 ILE A CG2 1 
ATOM   456  C  CD1 . ILE A 1 63 ? 28.232 -45.353 68.321 1.00 104.53 ? 328 ILE A CD1 1 
ATOM   457  N  N   . GLU B 1 2  ? 25.856 42.340  79.296 1.00 119.42 ? 267 GLU B N   1 
ATOM   458  C  CA  . GLU B 1 2  ? 25.149 41.565  78.235 1.00 118.97 ? 267 GLU B CA  1 
ATOM   459  C  C   . GLU B 1 2  ? 26.073 41.246  77.017 1.00 116.32 ? 267 GLU B C   1 
ATOM   460  O  O   . GLU B 1 2  ? 27.105 40.589  77.180 1.00 116.26 ? 267 GLU B O   1 
ATOM   461  C  CB  . GLU B 1 2  ? 23.856 42.273  77.782 1.00 120.44 ? 267 GLU B CB  1 
ATOM   462  C  CG  . GLU B 1 2  ? 22.545 41.955  78.541 1.00 125.44 ? 267 GLU B CG  1 
ATOM   463  C  CD  . GLU B 1 2  ? 21.301 42.623  77.863 1.00 130.48 ? 267 GLU B CD  1 
ATOM   464  O  OE1 . GLU B 1 2  ? 20.706 41.993  76.947 1.00 130.46 ? 267 GLU B OE1 1 
ATOM   465  O  OE2 . GLU B 1 2  ? 20.927 43.775  78.241 1.00 132.11 ? 267 GLU B OE2 1 
ATOM   466  N  N   . LEU B 1 3  ? 25.720 41.730  75.822 1.00 92.03  ? 268 LEU B N   1 
ATOM   467  C  CA  . LEU B 1 3  ? 26.220 41.177  74.562 1.00 89.18  ? 268 LEU B CA  1 
ATOM   468  C  C   . LEU B 1 3  ? 27.647 40.660  74.462 1.00 87.97  ? 268 LEU B C   1 
ATOM   469  O  O   . LEU B 1 3  ? 27.871 39.608  73.888 1.00 87.78  ? 268 LEU B O   1 
ATOM   470  C  CB  . LEU B 1 3  ? 25.941 42.110  73.409 1.00 88.73  ? 268 LEU B CB  1 
ATOM   471  C  CG  . LEU B 1 3  ? 25.913 41.381  72.086 1.00 87.90  ? 268 LEU B CG  1 
ATOM   472  C  CD1 . LEU B 1 3  ? 24.864 40.257  72.154 1.00 87.74  ? 268 LEU B CD1 1 
ATOM   473  C  CD2 . LEU B 1 3  ? 25.605 42.327  70.954 1.00 88.73  ? 268 LEU B CD2 1 
ATOM   474  N  N   . LEU B 1 4  ? 28.601 41.392  75.006 1.00 96.39  ? 269 LEU B N   1 
ATOM   475  C  CA  . LEU B 1 4  ? 30.023 41.043  74.890 1.00 95.47  ? 269 LEU B CA  1 
ATOM   476  C  C   . LEU B 1 4  ? 30.510 39.911  75.820 1.00 94.27  ? 269 LEU B C   1 
ATOM   477  O  O   . LEU B 1 4  ? 31.489 39.214  75.487 1.00 93.31  ? 269 LEU B O   1 
ATOM   478  C  CB  . LEU B 1 4  ? 30.870 42.290  75.171 1.00 97.01  ? 269 LEU B CB  1 
ATOM   479  C  CG  . LEU B 1 4  ? 32.296 42.372  74.615 1.00 99.32  ? 269 LEU B CG  1 
ATOM   480  C  CD1 . LEU B 1 4  ? 32.246 42.883  73.162 1.00 102.69 ? 269 LEU B CD1 1 
ATOM   481  C  CD2 . LEU B 1 4  ? 33.211 43.289  75.451 1.00 101.20 ? 269 LEU B CD2 1 
ATOM   482  N  N   . GLN B 1 5  ? 29.893 39.796  77.008 1.00 82.51  ? 270 GLN B N   1 
ATOM   483  C  CA  . GLN B 1 5  ? 30.180 38.707  77.971 1.00 81.57  ? 270 GLN B CA  1 
ATOM   484  C  C   . GLN B 1 5  ? 29.307 37.434  77.654 1.00 80.24  ? 270 GLN B C   1 
ATOM   485  O  O   . GLN B 1 5  ? 29.804 36.292  77.710 1.00 78.87  ? 270 GLN B O   1 
ATOM   486  C  CB  . GLN B 1 5  ? 30.051 39.175  79.429 1.00 81.79  ? 270 GLN B CB  1 
ATOM   487  N  N   . ARG B 1 6  ? 28.038 37.676  77.294 1.00 89.47  ? 271 ARG B N   1 
ATOM   488  C  CA  . ARG B 1 6  ? 27.111 36.691  76.830 1.00 87.75  ? 271 ARG B CA  1 
ATOM   489  C  C   . ARG B 1 6  ? 27.705 36.080  75.581 1.00 86.45  ? 271 ARG B C   1 
ATOM   490  O  O   . ARG B 1 6  ? 27.569 34.867  75.299 1.00 85.73  ? 271 ARG B O   1 
ATOM   491  C  CB  . ARG B 1 6  ? 25.811 37.379  76.511 1.00 88.14  ? 271 ARG B CB  1 
ATOM   492  C  CG  . ARG B 1 6  ? 24.792 36.479  75.951 1.00 89.79  ? 271 ARG B CG  1 
ATOM   493  C  CD  . ARG B 1 6  ? 23.654 37.255  75.374 1.00 94.47  ? 271 ARG B CD  1 
ATOM   494  N  NE  . ARG B 1 6  ? 22.831 37.917  76.375 1.00 99.75  ? 271 ARG B NE  1 
ATOM   495  C  CZ  . ARG B 1 6  ? 21.523 38.127  76.234 1.00 104.93 ? 271 ARG B CZ  1 
ATOM   496  N  NH1 . ARG B 1 6  ? 20.904 37.698  75.135 1.00 106.22 ? 271 ARG B NH1 1 
ATOM   497  N  NH2 . ARG B 1 6  ? 20.825 38.749  77.193 1.00 108.92 ? 271 ARG B NH2 1 
ATOM   498  N  N   . CYS B 1 7  ? 28.430 36.904  74.850 1.00 90.30  ? 272 CYS B N   1 
ATOM   499  C  CA  . CYS B 1 7  ? 29.112 36.383  73.703 1.00 88.55  ? 272 CYS B CA  1 
ATOM   500  C  C   . CYS B 1 7  ? 30.372 35.580  74.047 1.00 87.12  ? 272 CYS B C   1 
ATOM   501  O  O   . CYS B 1 7  ? 30.622 34.545  73.435 1.00 85.78  ? 272 CYS B O   1 
ATOM   502  C  CB  . CYS B 1 7  ? 29.399 37.485  72.722 1.00 88.62  ? 272 CYS B CB  1 
ATOM   503  S  SG  . CYS B 1 7  ? 30.275 36.828  71.364 1.00 90.84  ? 272 CYS B SG  1 
ATOM   504  N  N   . GLU B 1 8  ? 31.159 36.026  75.033 1.00 80.12  ? 273 GLU B N   1 
ATOM   505  C  CA  . GLU B 1 8  ? 32.420 35.289  75.423 1.00 79.22  ? 273 GLU B CA  1 
ATOM   506  C  C   . GLU B 1 8  ? 32.106 33.908  76.005 1.00 78.18  ? 273 GLU B C   1 
ATOM   507  O  O   . GLU B 1 8  ? 32.898 32.949  75.901 1.00 77.73  ? 273 GLU B O   1 
ATOM   508  C  CB  . GLU B 1 8  ? 33.311 36.079  76.404 1.00 79.38  ? 273 GLU B CB  1 
ATOM   509  N  N   . SER B 1 9  ? 30.946 33.843  76.648 1.00 84.74  ? 274 SER B N   1 
ATOM   510  C  CA  . SER B 1 9  ? 30.395 32.620  77.192 1.00 83.39  ? 274 SER B CA  1 
ATOM   511  C  C   . SER B 1 9  ? 30.130 31.614  76.039 1.00 80.86  ? 274 SER B C   1 
ATOM   512  O  O   . SER B 1 9  ? 30.625 30.489  76.076 1.00 80.05  ? 274 SER B O   1 
ATOM   513  C  CB  . SER B 1 9  ? 29.134 32.958  77.974 1.00 84.04  ? 274 SER B CB  1 
ATOM   514  O  OG  . SER B 1 9  ? 28.728 31.850  78.724 1.00 87.86  ? 274 SER B OG  1 
ATOM   515  N  N   . LEU B 1 10 ? 29.417 32.055  74.997 1.00 72.68  ? 275 LEU B N   1 
ATOM   516  C  CA  . LEU B 1 10 ? 29.262 31.274  73.779 1.00 69.92  ? 275 LEU B CA  1 
ATOM   517  C  C   . LEU B 1 10 ? 30.540 30.740  73.156 1.00 69.87  ? 275 LEU B C   1 
ATOM   518  O  O   . LEU B 1 10 ? 30.528 29.689  72.531 1.00 69.18  ? 275 LEU B O   1 
ATOM   519  C  CB  . LEU B 1 10 ? 28.476 32.030  72.739 1.00 68.46  ? 275 LEU B CB  1 
ATOM   520  C  CG  . LEU B 1 10 ? 26.987 32.171  73.060 1.00 66.91  ? 275 LEU B CG  1 
ATOM   521  C  CD1 . LEU B 1 10 ? 26.277 33.017  71.978 1.00 63.44  ? 275 LEU B CD1 1 
ATOM   522  C  CD2 . LEU B 1 10 ? 26.281 30.829  73.319 1.00 62.93  ? 275 LEU B CD2 1 
ATOM   523  N  N   . GLU B 1 11 ? 31.641 31.455  73.323 1.00 82.04  ? 276 GLU B N   1 
ATOM   524  C  CA  . GLU B 1 11 ? 32.966 30.944  72.927 1.00 82.59  ? 276 GLU B CA  1 
ATOM   525  C  C   . GLU B 1 11 ? 33.549 29.876  73.867 1.00 82.80  ? 276 GLU B C   1 
ATOM   526  O  O   . GLU B 1 11 ? 33.860 28.770  73.369 1.00 83.09  ? 276 GLU B O   1 
ATOM   527  C  CB  . GLU B 1 11 ? 33.960 32.072  72.630 1.00 83.81  ? 276 GLU B CB  1 
ATOM   528  C  CG  . GLU B 1 11 ? 33.808 32.572  71.176 1.00 86.90  ? 276 GLU B CG  1 
ATOM   529  C  CD  . GLU B 1 11 ? 34.366 33.996  70.915 1.00 92.54  ? 276 GLU B CD  1 
ATOM   530  O  OE1 . GLU B 1 11 ? 34.163 34.497  69.758 1.00 90.29  ? 276 GLU B OE1 1 
ATOM   531  O  OE2 . GLU B 1 11 ? 34.986 34.593  71.854 1.00 92.86  ? 276 GLU B OE2 1 
ATOM   532  N  N   . LYS B 1 12 ? 33.663 30.147  75.182 1.00 68.04  ? 277 LYS B N   1 
ATOM   533  C  CA  . LYS B 1 12 ? 34.105 29.108  76.144 1.00 67.28  ? 277 LYS B CA  1 
ATOM   534  C  C   . LYS B 1 12 ? 33.381 27.757  75.862 1.00 66.47  ? 277 LYS B C   1 
ATOM   535  O  O   . LYS B 1 12 ? 34.025 26.743  75.509 1.00 66.88  ? 277 LYS B O   1 
ATOM   536  C  CB  . LYS B 1 12 ? 33.952 29.563  77.626 1.00 67.67  ? 277 LYS B CB  1 
ATOM   537  N  N   . LYS B 1 13 ? 32.049 27.754  75.987 1.00 84.11  ? 278 LYS B N   1 
ATOM   538  C  CA  . LYS B 1 13 ? 31.240 26.548  75.788 1.00 82.99  ? 278 LYS B CA  1 
ATOM   539  C  C   . LYS B 1 13 ? 31.470 25.957  74.395 1.00 81.94  ? 278 LYS B C   1 
ATOM   540  O  O   . LYS B 1 13 ? 31.887 24.794  74.287 1.00 82.70  ? 278 LYS B O   1 
ATOM   541  C  CB  . LYS B 1 13 ? 29.729 26.774  76.060 1.00 81.99  ? 278 LYS B CB  1 
ATOM   542  N  N   . THR B 1 14 ? 31.256 26.741  73.336 1.00 75.55  ? 279 THR B N   1 
ATOM   543  C  CA  . THR B 1 14 ? 31.314 26.198  71.980 1.00 73.76  ? 279 THR B CA  1 
ATOM   544  C  C   . THR B 1 14 ? 32.654 25.520  71.754 1.00 74.03  ? 279 THR B C   1 
ATOM   545  O  O   . THR B 1 14 ? 32.798 24.665  70.892 1.00 73.14  ? 279 THR B O   1 
ATOM   546  C  CB  . THR B 1 14 ? 31.154 27.296  70.988 1.00 73.22  ? 279 THR B CB  1 
ATOM   547  O  OG1 . THR B 1 14 ? 29.765 27.598  70.869 1.00 73.40  ? 279 THR B OG1 1 
ATOM   548  C  CG2 . THR B 1 14 ? 31.656 26.882  69.656 1.00 72.60  ? 279 THR B CG2 1 
ATOM   549  N  N   . ALA B 1 15 ? 33.636 25.895  72.560 1.00 74.38  ? 280 ALA B N   1 
ATOM   550  C  CA  . ALA B 1 15 ? 34.972 25.380  72.385 1.00 75.19  ? 280 ALA B CA  1 
ATOM   551  C  C   . ALA B 1 15 ? 35.061 24.008  73.003 1.00 75.90  ? 280 ALA B C   1 
ATOM   552  O  O   . ALA B 1 15 ? 35.763 23.148  72.480 1.00 77.28  ? 280 ALA B O   1 
ATOM   553  C  CB  . ALA B 1 15 ? 36.002 26.317  73.001 1.00 76.52  ? 280 ALA B CB  1 
ATOM   554  N  N   . THR B 1 16 ? 34.361 23.773  74.106 1.00 75.24  ? 281 THR B N   1 
ATOM   555  C  CA  . THR B 1 16 ? 34.382 22.451  74.666 1.00 73.62  ? 281 THR B CA  1 
ATOM   556  C  C   . THR B 1 16 ? 33.750 21.462  73.688 1.00 72.43  ? 281 THR B C   1 
ATOM   557  O  O   . THR B 1 16 ? 34.110 20.272  73.668 1.00 73.14  ? 281 THR B O   1 
ATOM   558  C  CB  . THR B 1 16 ? 33.608 22.400  75.972 1.00 74.48  ? 281 THR B CB  1 
ATOM   559  O  OG1 . THR B 1 16 ? 32.203 22.351  75.697 1.00 73.64  ? 281 THR B OG1 1 
ATOM   560  C  CG2 . THR B 1 16 ? 33.902 23.609  76.799 1.00 74.71  ? 281 THR B CG2 1 
ATOM   561  N  N   . PHE B 1 17 ? 32.772 21.925  72.912 1.00 76.01  ? 282 PHE B N   1 
ATOM   562  C  CA  . PHE B 1 17 ? 32.000 21.034  71.993 1.00 73.80  ? 282 PHE B CA  1 
ATOM   563  C  C   . PHE B 1 17 ? 32.873 20.269  71.037 1.00 72.54  ? 282 PHE B C   1 
ATOM   564  O  O   . PHE B 1 17 ? 32.612 19.093  70.791 1.00 72.48  ? 282 PHE B O   1 
ATOM   565  C  CB  . PHE B 1 17 ? 31.042 21.821  71.136 1.00 73.48  ? 282 PHE B CB  1 
ATOM   566  C  CG  . PHE B 1 17 ? 29.879 22.379  71.890 1.00 75.40  ? 282 PHE B CG  1 
ATOM   567  C  CD1 . PHE B 1 17 ? 29.654 22.007  73.230 1.00 76.08  ? 282 PHE B CD1 1 
ATOM   568  C  CD2 . PHE B 1 17 ? 28.957 23.221  71.245 1.00 73.59  ? 282 PHE B CD2 1 
ATOM   569  C  CE1 . PHE B 1 17 ? 28.538 22.496  73.944 1.00 75.99  ? 282 PHE B CE1 1 
ATOM   570  C  CE2 . PHE B 1 17 ? 27.868 23.733  71.937 1.00 76.88  ? 282 PHE B CE2 1 
ATOM   571  C  CZ  . PHE B 1 17 ? 27.651 23.368  73.311 1.00 77.38  ? 282 PHE B CZ  1 
ATOM   572  N  N   . GLU B 1 18 ? 33.909 20.912  70.485 1.00 69.22  ? 283 GLU B N   1 
ATOM   573  C  CA  . GLU B 1 18 ? 34.842 20.205  69.557 1.00 67.96  ? 283 GLU B CA  1 
ATOM   574  C  C   . GLU B 1 18 ? 35.279 18.886  70.155 1.00 68.05  ? 283 GLU B C   1 
ATOM   575  O  O   . GLU B 1 18 ? 35.160 17.833  69.499 1.00 67.73  ? 283 GLU B O   1 
ATOM   576  C  CB  . GLU B 1 18 ? 36.049 21.049  69.099 1.00 67.21  ? 283 GLU B CB  1 
ATOM   577  N  N   . ASN B 1 19 ? 35.743 18.924  71.407 1.00 69.38  ? 284 ASN B N   1 
ATOM   578  C  CA  . ASN B 1 19 ? 36.218 17.715  72.030 1.00 70.07  ? 284 ASN B CA  1 
ATOM   579  C  C   . ASN B 1 19 ? 35.106 16.727  72.399 1.00 68.50  ? 284 ASN B C   1 
ATOM   580  O  O   . ASN B 1 19 ? 35.231 15.516  72.161 1.00 68.39  ? 284 ASN B O   1 
ATOM   581  C  CB  . ASN B 1 19 ? 37.151 17.978  73.189 1.00 72.26  ? 284 ASN B CB  1 
ATOM   582  C  CG  . ASN B 1 19 ? 37.772 16.688  73.689 1.00 79.24  ? 284 ASN B CG  1 
ATOM   583  O  OD1 . ASN B 1 19 ? 38.505 15.975  72.945 1.00 84.56  ? 284 ASN B OD1 1 
ATOM   584  N  ND2 . ASN B 1 19 ? 37.411 16.312  74.921 1.00 84.75  ? 284 ASN B ND2 1 
ATOM   585  N  N   . ILE B 1 20 ? 34.001 17.241  72.917 1.00 63.20  ? 285 ILE B N   1 
ATOM   586  C  CA  . ILE B 1 20 ? 32.831 16.412  73.178 1.00 61.55  ? 285 ILE B CA  1 
ATOM   587  C  C   . ILE B 1 20 ? 32.390 15.641  71.967 1.00 60.36  ? 285 ILE B C   1 
ATOM   588  O  O   . ILE B 1 20 ? 32.003 14.490  72.046 1.00 61.73  ? 285 ILE B O   1 
ATOM   589  C  CB  . ILE B 1 20 ? 31.727 17.266  73.673 1.00 62.09  ? 285 ILE B CB  1 
ATOM   590  C  CG1 . ILE B 1 20 ? 32.097 17.819  75.068 1.00 63.67  ? 285 ILE B CG1 1 
ATOM   591  C  CG2 . ILE B 1 20 ? 30.431 16.526  73.649 1.00 60.37  ? 285 ILE B CG2 1 
ATOM   592  C  CD1 . ILE B 1 20 ? 30.878 18.212  75.915 1.00 67.16  ? 285 ILE B CD1 1 
ATOM   593  N  N   . VAL B 1 21 ? 32.463 16.240  70.814 1.00 63.94  ? 286 VAL B N   1 
ATOM   594  C  CA  . VAL B 1 21 ? 32.089 15.516  69.607 1.00 63.34  ? 286 VAL B CA  1 
ATOM   595  C  C   . VAL B 1 21 ? 33.192 14.535  69.150 1.00 64.61  ? 286 VAL B C   1 
ATOM   596  O  O   . VAL B 1 21 ? 32.877 13.444  68.659 1.00 64.91  ? 286 VAL B O   1 
ATOM   597  C  CB  . VAL B 1 21 ? 31.594 16.513  68.479 1.00 63.68  ? 286 VAL B CB  1 
ATOM   598  C  CG1 . VAL B 1 21 ? 31.588 15.880  67.079 1.00 62.33  ? 286 VAL B CG1 1 
ATOM   599  C  CG2 . VAL B 1 21 ? 30.205 17.073  68.813 1.00 59.64  ? 286 VAL B CG2 1 
ATOM   600  N  N   . CYS B 1 22 ? 34.471 14.820  69.347 1.00 70.83  ? 287 CYS B N   1 
ATOM   601  C  CA  . CYS B 1 22 ? 35.440 13.715  69.096 1.00 73.26  ? 287 CYS B CA  1 
ATOM   602  C  C   . CYS B 1 22 ? 35.229 12.455  69.927 1.00 72.87  ? 287 CYS B C   1 
ATOM   603  O  O   . CYS B 1 22 ? 35.207 11.346  69.364 1.00 74.30  ? 287 CYS B O   1 
ATOM   604  C  CB  . CYS B 1 22 ? 36.889 14.134  69.297 1.00 74.88  ? 287 CYS B CB  1 
ATOM   605  S  SG  . CYS B 1 22 ? 37.415 15.220  68.003 1.00 84.31  ? 287 CYS B SG  1 
ATOM   606  N  N   . VAL B 1 23 ? 35.160 12.609  71.255 1.00 60.35  ? 288 VAL B N   1 
ATOM   607  C  CA  . VAL B 1 23 ? 34.889 11.518  72.167 1.00 59.25  ? 288 VAL B CA  1 
ATOM   608  C  C   . VAL B 1 23 ? 33.646 10.723  71.696 1.00 58.58  ? 288 VAL B C   1 
ATOM   609  O  O   . VAL B 1 23 ? 33.740 9.517   71.380 1.00 58.06  ? 288 VAL B O   1 
ATOM   610  C  CB  . VAL B 1 23 ? 34.732 12.110  73.581 1.00 60.61  ? 288 VAL B CB  1 
ATOM   611  C  CG1 . VAL B 1 23 ? 34.165 11.071  74.626 1.00 60.75  ? 288 VAL B CG1 1 
ATOM   612  C  CG2 . VAL B 1 23 ? 36.048 12.679  74.006 1.00 60.41  ? 288 VAL B CG2 1 
ATOM   613  N  N   . LEU B 1 24 ? 32.486 11.391  71.603 1.00 66.75  ? 289 LEU B N   1 
ATOM   614  C  CA  . LEU B 1 24 ? 31.249 10.696  71.224 1.00 65.86  ? 289 LEU B CA  1 
ATOM   615  C  C   . LEU B 1 24 ? 31.435 9.862   69.951 1.00 65.80  ? 289 LEU B C   1 
ATOM   616  O  O   . LEU B 1 24 ? 30.862 8.743   69.783 1.00 65.29  ? 289 LEU B O   1 
ATOM   617  C  CB  . LEU B 1 24 ? 30.235 11.732  70.907 1.00 64.69  ? 289 LEU B CB  1 
ATOM   618  C  CG  . LEU B 1 24 ? 28.914 11.498  71.577 1.00 65.26  ? 289 LEU B CG  1 
ATOM   619  C  CD1 . LEU B 1 24 ? 27.944 12.450  70.874 1.00 67.32  ? 289 LEU B CD1 1 
ATOM   620  C  CD2 . LEU B 1 24 ? 28.463 10.114  71.447 1.00 63.93  ? 289 LEU B CD2 1 
ATOM   621  N  N   . ASN B 1 25 ? 32.206 10.449  69.025 1.00 64.90  ? 290 ASN B N   1 
ATOM   622  C  CA  . ASN B 1 25 ? 32.431 9.872   67.710 1.00 64.56  ? 290 ASN B CA  1 
ATOM   623  C  C   . ASN B 1 25 ? 33.063 8.544   67.918 1.00 65.77  ? 290 ASN B C   1 
ATOM   624  O  O   . ASN B 1 25 ? 32.449 7.528   67.521 1.00 65.27  ? 290 ASN B O   1 
ATOM   625  C  CB  . ASN B 1 25 ? 33.321 10.776  66.837 1.00 64.93  ? 290 ASN B CB  1 
ATOM   626  C  CG  . ASN B 1 25 ? 33.711 10.140  65.524 1.00 63.06  ? 290 ASN B CG  1 
ATOM   627  O  OD1 . ASN B 1 25 ? 32.908 9.535   64.839 1.00 61.16  ? 290 ASN B OD1 1 
ATOM   628  N  ND2 . ASN B 1 25 ? 34.955 10.285  65.176 1.00 63.80  ? 290 ASN B ND2 1 
ATOM   629  N  N   . ARG B 1 26 ? 34.248 8.553   68.567 1.00 63.78  ? 291 ARG B N   1 
ATOM   630  C  CA  . ARG B 1 26 ? 34.993 7.316   68.961 1.00 65.78  ? 291 ARG B CA  1 
ATOM   631  C  C   . ARG B 1 26 ? 34.097 6.270   69.675 1.00 65.06  ? 291 ARG B C   1 
ATOM   632  O  O   . ARG B 1 26 ? 34.026 5.082   69.300 1.00 65.26  ? 291 ARG B O   1 
ATOM   633  C  CB  . ARG B 1 26 ? 36.236 7.650   69.842 1.00 68.13  ? 291 ARG B CB  1 
ATOM   634  C  CG  . ARG B 1 26 ? 37.257 8.704   69.228 1.00 73.37  ? 291 ARG B CG  1 
ATOM   635  C  CD  . ARG B 1 26 ? 38.664 8.861   69.972 1.00 82.12  ? 291 ARG B CD  1 
ATOM   636  N  NE  . ARG B 1 26 ? 39.371 10.101  69.551 1.00 85.32  ? 291 ARG B NE  1 
ATOM   637  C  CZ  . ARG B 1 26 ? 39.557 11.179  70.328 1.00 88.92  ? 291 ARG B CZ  1 
ATOM   638  N  NH1 . ARG B 1 26 ? 39.133 11.168  71.591 1.00 90.03  ? 291 ARG B NH1 1 
ATOM   639  N  NH2 . ARG B 1 26 ? 40.173 12.276  69.860 1.00 90.57  ? 291 ARG B NH2 1 
ATOM   640  N  N   . GLU B 1 27 ? 33.382 6.727   70.677 1.00 65.74  ? 292 GLU B N   1 
ATOM   641  C  CA  . GLU B 1 27 ? 32.633 5.836   71.480 1.00 66.39  ? 292 GLU B CA  1 
ATOM   642  C  C   . GLU B 1 27 ? 31.544 5.206   70.659 1.00 63.73  ? 292 GLU B C   1 
ATOM   643  O  O   . GLU B 1 27 ? 31.277 3.982   70.758 1.00 64.22  ? 292 GLU B O   1 
ATOM   644  C  CB  . GLU B 1 27 ? 32.056 6.622   72.628 1.00 68.96  ? 292 GLU B CB  1 
ATOM   645  C  CG  . GLU B 1 27 ? 33.143 7.059   73.626 1.00 77.91  ? 292 GLU B CG  1 
ATOM   646  C  CD  . GLU B 1 27 ? 32.581 7.884   74.783 1.00 89.38  ? 292 GLU B CD  1 
ATOM   647  O  OE1 . GLU B 1 27 ? 31.503 8.550   74.563 1.00 93.62  ? 292 GLU B OE1 1 
ATOM   648  O  OE2 . GLU B 1 27 ? 33.229 7.873   75.888 1.00 93.04  ? 292 GLU B OE2 1 
ATOM   649  N  N   . VAL B 1 28 ? 30.921 6.014   69.823 1.00 55.46  ? 293 VAL B N   1 
ATOM   650  C  CA  . VAL B 1 28 ? 29.989 5.433   68.880 1.00 52.40  ? 293 VAL B CA  1 
ATOM   651  C  C   . VAL B 1 28 ? 30.729 4.498   67.939 1.00 53.18  ? 293 VAL B C   1 
ATOM   652  O  O   . VAL B 1 28 ? 30.203 3.419   67.653 1.00 53.98  ? 293 VAL B O   1 
ATOM   653  C  CB  . VAL B 1 28 ? 29.203 6.465   68.074 1.00 52.21  ? 293 VAL B CB  1 
ATOM   654  C  CG1 . VAL B 1 28 ? 28.235 5.743   67.135 1.00 46.09  ? 293 VAL B CG1 1 
ATOM   655  C  CG2 . VAL B 1 28 ? 28.478 7.453   69.020 1.00 47.79  ? 293 VAL B CG2 1 
ATOM   656  N  N   . GLU B 1 29 ? 31.947 4.827   67.487 1.00 59.61  ? 294 GLU B N   1 
ATOM   657  C  CA  . GLU B 1 29 ? 32.612 3.897   66.552 1.00 60.08  ? 294 GLU B CA  1 
ATOM   658  C  C   . GLU B 1 29 ? 32.953 2.636   67.292 1.00 61.95  ? 294 GLU B C   1 
ATOM   659  O  O   . GLU B 1 29 ? 32.708 1.534   66.764 1.00 62.93  ? 294 GLU B O   1 
ATOM   660  C  CB  . GLU B 1 29 ? 33.902 4.445   65.981 1.00 60.45  ? 294 GLU B CB  1 
ATOM   661  C  CG  . GLU B 1 29 ? 34.195 3.901   64.623 1.00 59.76  ? 294 GLU B CG  1 
ATOM   662  C  CD  . GLU B 1 29 ? 35.609 4.252   64.090 1.00 66.26  ? 294 GLU B CD  1 
ATOM   663  O  OE1 . GLU B 1 29 ? 36.229 5.328   64.444 1.00 67.79  ? 294 GLU B OE1 1 
ATOM   664  O  OE2 . GLU B 1 29 ? 36.114 3.415   63.282 1.00 66.89  ? 294 GLU B OE2 1 
ATOM   665  N  N   . ARG B 1 30 ? 33.516 2.777   68.508 1.00 57.54  ? 295 ARG B N   1 
ATOM   666  C  CA  . ARG B 1 30 ? 33.876 1.615   69.337 1.00 58.35  ? 295 ARG B CA  1 
ATOM   667  C  C   . ARG B 1 30 ? 32.664 0.740   69.443 1.00 58.58  ? 295 ARG B C   1 
ATOM   668  O  O   . ARG B 1 30 ? 32.697 -0.459  69.185 1.00 58.41  ? 295 ARG B O   1 
ATOM   669  C  CB  . ARG B 1 30 ? 34.328 2.028   70.762 1.00 59.93  ? 295 ARG B CB  1 
ATOM   670  N  N   . VAL B 1 31 ? 31.543 1.319   69.800 1.00 60.01  ? 296 VAL B N   1 
ATOM   671  C  CA  . VAL B 1 31 ? 30.442 0.412   69.992 1.00 60.99  ? 296 VAL B CA  1 
ATOM   672  C  C   . VAL B 1 31 ? 30.028 -0.267  68.697 1.00 60.56  ? 296 VAL B C   1 
ATOM   673  O  O   . VAL B 1 31 ? 29.539 -1.389  68.697 1.00 60.57  ? 296 VAL B O   1 
ATOM   674  C  CB  . VAL B 1 31 ? 29.290 1.117   70.668 1.00 61.33  ? 296 VAL B CB  1 
ATOM   675  C  CG1 . VAL B 1 31 ? 28.317 0.082   71.108 1.00 62.59  ? 296 VAL B CG1 1 
ATOM   676  C  CG2 . VAL B 1 31 ? 29.824 1.842   71.922 1.00 65.17  ? 296 VAL B CG2 1 
ATOM   677  N  N   . ALA B 1 32 ? 30.212 0.379   67.565 1.00 57.89  ? 297 ALA B N   1 
ATOM   678  C  CA  . ALA B 1 32 ? 29.642 -0.215  66.368 1.00 59.17  ? 297 ALA B CA  1 
ATOM   679  C  C   . ALA B 1 32 ? 30.532 -1.327  65.934 1.00 61.70  ? 297 ALA B C   1 
ATOM   680  O  O   . ALA B 1 32 ? 30.112 -2.222  65.226 1.00 62.71  ? 297 ALA B O   1 
ATOM   681  C  CB  . ALA B 1 32 ? 29.491 0.799   65.269 1.00 58.90  ? 297 ALA B CB  1 
ATOM   682  N  N   . MET B 1 33 ? 31.781 -1.298  66.358 1.00 71.71  ? 298 MET B N   1 
ATOM   683  C  CA  . MET B 1 33 ? 32.666 -2.379  66.016 1.00 74.13  ? 298 MET B CA  1 
ATOM   684  C  C   . MET B 1 33 ? 32.463 -3.578  66.885 1.00 74.85  ? 298 MET B C   1 
ATOM   685  O  O   . MET B 1 33 ? 32.497 -4.698  66.382 1.00 74.58  ? 298 MET B O   1 
ATOM   686  C  CB  . MET B 1 33 ? 34.091 -1.927  66.084 1.00 75.65  ? 298 MET B CB  1 
ATOM   687  C  CG  . MET B 1 33 ? 34.438 -1.232  64.821 1.00 83.20  ? 298 MET B CG  1 
ATOM   688  S  SD  . MET B 1 33 ? 36.194 -0.820  64.828 1.00 100.10 ? 298 MET B SD  1 
ATOM   689  C  CE  . MET B 1 33 ? 36.825 -2.253  63.875 1.00 98.89  ? 298 MET B CE  1 
ATOM   690  N  N   . THR B 1 34 ? 32.328 -3.341  68.181 1.00 67.12  ? 299 THR B N   1 
ATOM   691  C  CA  . THR B 1 34 ? 31.915 -4.333  69.132 1.00 69.10  ? 299 THR B CA  1 
ATOM   692  C  C   . THR B 1 34 ? 30.682 -5.048  68.674 1.00 70.32  ? 299 THR B C   1 
ATOM   693  O  O   . THR B 1 34 ? 30.658 -6.267  68.712 1.00 71.56  ? 299 THR B O   1 
ATOM   694  C  CB  . THR B 1 34 ? 31.521 -3.665  70.372 1.00 69.23  ? 299 THR B CB  1 
ATOM   695  O  OG1 . THR B 1 34 ? 32.691 -3.131  70.959 1.00 71.64  ? 299 THR B OG1 1 
ATOM   696  C  CG2 . THR B 1 34 ? 30.956 -4.607  71.300 1.00 70.73  ? 299 THR B CG2 1 
ATOM   697  N  N   . ALA B 1 35 ? 29.663 -4.314  68.232 1.00 69.29  ? 300 ALA B N   1 
ATOM   698  C  CA  . ALA B 1 35 ? 28.414 -4.944  67.815 1.00 70.94  ? 300 ALA B CA  1 
ATOM   699  C  C   . ALA B 1 35 ? 28.515 -5.769  66.530 1.00 72.54  ? 300 ALA B C   1 
ATOM   700  O  O   . ALA B 1 35 ? 27.736 -6.681  66.309 1.00 71.97  ? 300 ALA B O   1 
ATOM   701  C  CB  . ALA B 1 35 ? 27.354 -3.899  67.648 1.00 70.24  ? 300 ALA B CB  1 
ATOM   702  N  N   . GLU B 1 36 ? 29.438 -5.418  65.649 1.00 89.84  ? 301 GLU B N   1 
ATOM   703  C  CA  . GLU B 1 36 ? 29.596 -6.169  64.416 1.00 93.00  ? 301 GLU B CA  1 
ATOM   704  C  C   . GLU B 1 36 ? 30.554 -7.360  64.581 1.00 94.74  ? 301 GLU B C   1 
ATOM   705  O  O   . GLU B 1 36 ? 30.404 -8.364  63.884 1.00 94.84  ? 301 GLU B O   1 
ATOM   706  C  CB  . GLU B 1 36 ? 29.992 -5.255  63.250 1.00 93.45  ? 301 GLU B CB  1 
ATOM   707  C  CG  . GLU B 1 36 ? 30.274 -5.971  61.887 1.00 100.28 ? 301 GLU B CG  1 
ATOM   708  C  CD  . GLU B 1 36 ? 29.070 -6.789  61.258 1.00 107.50 ? 301 GLU B CD  1 
ATOM   709  O  OE1 . GLU B 1 36 ? 29.256 -7.317  60.122 1.00 109.50 ? 301 GLU B OE1 1 
ATOM   710  O  OE2 . GLU B 1 36 ? 27.960 -6.915  61.867 1.00 110.39 ? 301 GLU B OE2 1 
ATOM   711  N  N   . ALA B 1 37 ? 31.528 -7.256  65.489 1.00 84.18  ? 302 ALA B N   1 
ATOM   712  C  CA  . ALA B 1 37 ? 32.273 -8.434  65.939 1.00 86.03  ? 302 ALA B CA  1 
ATOM   713  C  C   . ALA B 1 37 ? 31.288 -9.384  66.598 1.00 87.34  ? 302 ALA B C   1 
ATOM   714  O  O   . ALA B 1 37 ? 31.184 -10.527 66.188 1.00 86.62  ? 302 ALA B O   1 
ATOM   715  C  CB  . ALA B 1 37 ? 33.416 -8.070  66.916 1.00 86.45  ? 302 ALA B CB  1 
ATOM   716  N  N   . CYS B 1 38 ? 30.568 -8.885  67.603 1.00 88.14  ? 303 CYS B N   1 
ATOM   717  C  CA  . CYS B 1 38 ? 29.590 -9.653  68.413 1.00 91.40  ? 303 CYS B CA  1 
ATOM   718  C  C   . CYS B 1 38 ? 28.539 -10.415 67.614 1.00 91.72  ? 303 CYS B C   1 
ATOM   719  O  O   . CYS B 1 38 ? 27.950 -11.362 68.107 1.00 91.93  ? 303 CYS B O   1 
ATOM   720  C  CB  . CYS B 1 38 ? 28.852 -8.679  69.357 1.00 92.28  ? 303 CYS B CB  1 
ATOM   721  S  SG  . CYS B 1 38 ? 27.906 -9.313  70.851 1.00 97.29  ? 303 CYS B SG  1 
ATOM   722  N  N   . SER B 1 39 ? 28.295 -9.966  66.387 1.00 100.62 ? 304 SER B N   1 
ATOM   723  C  CA  . SER B 1 39 ? 27.227 -10.495 65.522 1.00 101.51 ? 304 SER B CA  1 
ATOM   724  C  C   . SER B 1 39 ? 27.855 -11.382 64.466 1.00 102.45 ? 304 SER B C   1 
ATOM   725  O  O   . SER B 1 39 ? 27.203 -11.831 63.539 1.00 102.89 ? 304 SER B O   1 
ATOM   726  C  CB  . SER B 1 39 ? 26.452 -9.346  64.837 1.00 100.57 ? 304 SER B CB  1 
ATOM   727  O  OG  . SER B 1 39 ? 25.046 -9.521  64.918 1.00 99.34  ? 304 SER B OG  1 
ATOM   728  N  N   . ARG B 1 40 ? 29.144 -11.611 64.594 1.00 108.25 ? 305 ARG B N   1 
ATOM   729  C  CA  . ARG B 1 40 ? 29.817 -12.594 63.776 1.00 109.66 ? 305 ARG B CA  1 
ATOM   730  C  C   . ARG B 1 40 ? 30.316 -13.716 64.710 1.00 110.52 ? 305 ARG B C   1 
ATOM   731  O  O   . ARG B 1 40 ? 30.863 -14.710 64.269 1.00 110.82 ? 305 ARG B O   1 
ATOM   732  C  CB  . ARG B 1 40 ? 30.957 -11.918 63.030 1.00 109.94 ? 305 ARG B CB  1 
ATOM   733  C  CG  . ARG B 1 40 ? 31.169 -12.407 61.625 1.00 112.51 ? 305 ARG B CG  1 
ATOM   734  C  CD  . ARG B 1 40 ? 32.523 -11.940 61.100 1.00 116.29 ? 305 ARG B CD  1 
ATOM   735  N  NE  . ARG B 1 40 ? 32.654 -10.478 61.037 1.00 117.81 ? 305 ARG B NE  1 
ATOM   736  C  CZ  . ARG B 1 40 ? 32.463 -9.735  59.942 1.00 119.01 ? 305 ARG B CZ  1 
ATOM   737  N  NH1 . ARG B 1 40 ? 32.113 -10.294 58.776 1.00 118.61 ? 305 ARG B NH1 1 
ATOM   738  N  NH2 . ARG B 1 40 ? 32.627 -8.414  60.021 1.00 119.55 ? 305 ARG B NH2 1 
ATOM   739  N  N   . GLN B 1 41 ? 30.113 -13.508 66.009 1.00 114.64 ? 306 GLN B N   1 
ATOM   740  C  CA  . GLN B 1 41 ? 30.297 -14.506 67.060 1.00 116.08 ? 306 GLN B CA  1 
ATOM   741  C  C   . GLN B 1 41 ? 29.060 -15.370 67.183 1.00 116.09 ? 306 GLN B C   1 
ATOM   742  O  O   . GLN B 1 41 ? 29.127 -16.452 67.728 1.00 116.73 ? 306 GLN B O   1 
ATOM   743  C  CB  . GLN B 1 41 ? 30.571 -13.831 68.426 1.00 117.13 ? 306 GLN B CB  1 
ATOM   744  C  CG  . GLN B 1 41 ? 32.024 -13.374 68.674 1.00 118.89 ? 306 GLN B CG  1 
ATOM   745  C  CD  . GLN B 1 41 ? 33.094 -14.352 68.089 1.00 121.10 ? 306 GLN B CD  1 
ATOM   746  O  OE1 . GLN B 1 41 ? 32.953 -14.877 66.961 1.00 118.25 ? 306 GLN B OE1 1 
ATOM   747  N  NE2 . GLN B 1 41 ? 34.176 -14.572 68.856 1.00 122.90 ? 306 GLN B NE2 1 
ATOM   748  N  N   . HIS B 1 42 ? 27.932 -14.871 66.694 1.00 118.40 ? 307 HIS B N   1 
ATOM   749  C  CA  . HIS B 1 42 ? 26.646 -15.568 66.776 1.00 119.09 ? 307 HIS B CA  1 
ATOM   750  C  C   . HIS B 1 42 ? 26.335 -16.214 65.406 1.00 118.32 ? 307 HIS B C   1 
ATOM   751  O  O   . HIS B 1 42 ? 25.467 -17.098 65.327 1.00 118.58 ? 307 HIS B O   1 
ATOM   752  C  CB  . HIS B 1 42 ? 25.547 -14.581 67.246 1.00 119.42 ? 307 HIS B CB  1 
ATOM   753  C  CG  . HIS B 1 42 ? 24.248 -15.218 67.675 1.00 122.13 ? 307 HIS B CG  1 
ATOM   754  N  ND1 . HIS B 1 42 ? 23.073 -15.087 66.948 1.00 123.43 ? 307 HIS B ND1 1 
ATOM   755  C  CD2 . HIS B 1 42 ? 23.921 -15.934 68.781 1.00 124.80 ? 307 HIS B CD2 1 
ATOM   756  C  CE1 . HIS B 1 42 ? 22.094 -15.723 67.570 1.00 123.59 ? 307 HIS B CE1 1 
ATOM   757  N  NE2 . HIS B 1 42 ? 22.584 -16.252 68.679 1.00 125.52 ? 307 HIS B NE2 1 
ATOM   758  N  N   . ARG B 1 43 ? 27.042 -15.789 64.340 1.00 103.94 ? 308 ARG B N   1 
ATOM   759  C  CA  . ARG B 1 43 ? 26.966 -16.477 63.027 1.00 103.27 ? 308 ARG B CA  1 
ATOM   760  C  C   . ARG B 1 43 ? 27.644 -17.840 63.126 1.00 103.91 ? 308 ARG B C   1 
ATOM   761  O  O   . ARG B 1 43 ? 27.294 -18.761 62.357 1.00 104.21 ? 308 ARG B O   1 
ATOM   762  C  CB  . ARG B 1 43 ? 27.567 -15.663 61.857 1.00 102.23 ? 308 ARG B CB  1 
ATOM   763  N  N   . LEU B 1 44 ? 28.586 -17.956 64.089 1.00 103.84 ? 309 LEU B N   1 
ATOM   764  C  CA  . LEU B 1 44 ? 29.476 -19.147 64.293 1.00 103.87 ? 309 LEU B CA  1 
ATOM   765  C  C   . LEU B 1 44 ? 29.104 -20.027 65.485 1.00 104.07 ? 309 LEU B C   1 
ATOM   766  O  O   . LEU B 1 44 ? 29.227 -21.243 65.404 1.00 104.34 ? 309 LEU B O   1 
ATOM   767  C  CB  . LEU B 1 44 ? 30.965 -18.755 64.330 1.00 104.11 ? 309 LEU B CB  1 
ATOM   768  C  CG  . LEU B 1 44 ? 31.487 -18.491 62.900 1.00 104.43 ? 309 LEU B CG  1 
ATOM   769  C  CD1 . LEU B 1 44 ? 32.699 -17.523 62.831 1.00 104.94 ? 309 LEU B CD1 1 
ATOM   770  C  CD2 . LEU B 1 44 ? 31.738 -19.805 62.114 1.00 105.81 ? 309 LEU B CD2 1 
ATOM   771  N  N   . ASP B 1 45 ? 28.638 -19.415 66.576 1.00 115.36 ? 310 ASP B N   1 
ATOM   772  C  CA  . ASP B 1 45 ? 27.877 -20.144 67.604 1.00 115.57 ? 310 ASP B CA  1 
ATOM   773  C  C   . ASP B 1 45 ? 26.610 -20.808 67.012 1.00 114.92 ? 310 ASP B C   1 
ATOM   774  O  O   . ASP B 1 45 ? 26.032 -21.699 67.643 1.00 115.92 ? 310 ASP B O   1 
ATOM   775  C  CB  . ASP B 1 45 ? 27.513 -19.241 68.806 1.00 116.01 ? 310 ASP B CB  1 
ATOM   776  C  CG  . ASP B 1 45 ? 28.754 -18.762 69.612 1.00 117.02 ? 310 ASP B CG  1 
ATOM   777  O  OD1 . ASP B 1 45 ? 29.854 -19.348 69.428 1.00 115.82 ? 310 ASP B OD1 1 
ATOM   778  O  OD2 . ASP B 1 45 ? 28.618 -17.794 70.419 1.00 116.56 ? 310 ASP B OD2 1 
ATOM   779  N  N   . GLN B 1 46 ? 26.192 -20.379 65.807 1.00 117.36 ? 311 GLN B N   1 
ATOM   780  C  CA  . GLN B 1 46 ? 25.074 -21.007 65.040 1.00 116.05 ? 311 GLN B CA  1 
ATOM   781  C  C   . GLN B 1 46 ? 25.553 -22.119 64.070 1.00 115.15 ? 311 GLN B C   1 
ATOM   782  O  O   . GLN B 1 46 ? 24.808 -23.085 63.800 1.00 115.54 ? 311 GLN B O   1 
ATOM   783  C  CB  . GLN B 1 46 ? 24.184 -19.968 64.314 1.00 114.81 ? 311 GLN B CB  1 
ATOM   784  N  N   . ASP B 1 47 ? 26.785 -22.010 63.569 1.00 111.14 ? 312 ASP B N   1 
ATOM   785  C  CA  . ASP B 1 47 ? 27.331 -23.095 62.740 1.00 110.13 ? 312 ASP B CA  1 
ATOM   786  C  C   . ASP B 1 47 ? 27.879 -24.281 63.539 1.00 109.14 ? 312 ASP B C   1 
ATOM   787  O  O   . ASP B 1 47 ? 27.714 -25.429 63.136 1.00 109.03 ? 312 ASP B O   1 
ATOM   788  C  CB  . ASP B 1 47 ? 28.388 -22.582 61.760 1.00 110.55 ? 312 ASP B CB  1 
ATOM   789  C  CG  . ASP B 1 47 ? 27.845 -21.519 60.832 1.00 112.90 ? 312 ASP B CG  1 
ATOM   790  O  OD1 . ASP B 1 47 ? 26.581 -21.404 60.701 1.00 112.61 ? 312 ASP B OD1 1 
ATOM   791  O  OD2 . ASP B 1 47 ? 28.704 -20.791 60.254 1.00 116.79 ? 312 ASP B OD2 1 
ATOM   792  N  N   . LYS B 1 48 ? 28.544 -23.992 64.650 1.00 84.89  ? 313 LYS B N   1 
ATOM   793  C  CA  . LYS B 1 48 ? 29.066 -25.015 65.529 1.00 84.24  ? 313 LYS B CA  1 
ATOM   794  C  C   . LYS B 1 48 ? 27.887 -25.910 65.989 1.00 83.26  ? 313 LYS B C   1 
ATOM   795  O  O   . LYS B 1 48 ? 27.921 -27.156 65.849 1.00 82.91  ? 313 LYS B O   1 
ATOM   796  C  CB  . LYS B 1 48 ? 29.829 -24.371 66.703 1.00 84.81  ? 313 LYS B CB  1 
ATOM   797  N  N   . ILE B 1 49 ? 26.835 -25.245 66.482 1.00 90.52  ? 314 ILE B N   1 
ATOM   798  C  CA  . ILE B 1 49 ? 25.568 -25.883 66.858 1.00 88.80  ? 314 ILE B CA  1 
ATOM   799  C  C   . ILE B 1 49 ? 25.016 -26.735 65.736 1.00 87.38  ? 314 ILE B C   1 
ATOM   800  O  O   . ILE B 1 49 ? 24.453 -27.794 65.970 1.00 87.51  ? 314 ILE B O   1 
ATOM   801  C  CB  . ILE B 1 49 ? 24.518 -24.840 67.253 1.00 88.43  ? 314 ILE B CB  1 
ATOM   802  C  CG1 . ILE B 1 49 ? 24.506 -24.665 68.777 1.00 89.49  ? 314 ILE B CG1 1 
ATOM   803  C  CG2 . ILE B 1 49 ? 23.112 -25.220 66.709 1.00 88.01  ? 314 ILE B CG2 1 
ATOM   804  C  CD1 . ILE B 1 49 ? 24.133 -23.244 69.277 1.00 86.57  ? 314 ILE B CD1 1 
ATOM   805  N  N   . GLU B 1 50 ? 25.182 -26.273 64.508 1.00 101.20 ? 315 GLU B N   1 
ATOM   806  C  CA  . GLU B 1 50 ? 24.563 -26.969 63.392 1.00 99.75  ? 315 GLU B CA  1 
ATOM   807  C  C   . GLU B 1 50 ? 25.400 -28.210 63.002 1.00 98.76  ? 315 GLU B C   1 
ATOM   808  O  O   . GLU B 1 50 ? 24.842 -29.306 62.836 1.00 99.36  ? 315 GLU B O   1 
ATOM   809  C  CB  . GLU B 1 50 ? 24.180 -25.997 62.228 1.00 99.09  ? 315 GLU B CB  1 
ATOM   810  N  N   . ALA B 1 51 ? 26.720 -28.062 62.925 1.00 73.47  ? 316 ALA B N   1 
ATOM   811  C  CA  . ALA B 1 51 ? 27.578 -29.213 62.645 1.00 73.04  ? 316 ALA B CA  1 
ATOM   812  C  C   . ALA B 1 51 ? 27.676 -30.195 63.845 1.00 73.81  ? 316 ALA B C   1 
ATOM   813  O  O   . ALA B 1 51 ? 27.902 -31.391 63.646 1.00 74.33  ? 316 ALA B O   1 
ATOM   814  C  CB  . ALA B 1 51 ? 28.975 -28.790 62.175 1.00 72.65  ? 316 ALA B CB  1 
ATOM   815  N  N   . LEU B 1 52 ? 27.520 -29.701 65.071 1.00 74.62  ? 317 LEU B N   1 
ATOM   816  C  CA  . LEU B 1 52 ? 27.487 -30.581 66.192 1.00 74.93  ? 317 LEU B CA  1 
ATOM   817  C  C   . LEU B 1 52 ? 26.161 -31.395 66.181 1.00 75.28  ? 317 LEU B C   1 
ATOM   818  O  O   . LEU B 1 52 ? 26.153 -32.645 66.231 1.00 75.87  ? 317 LEU B O   1 
ATOM   819  C  CB  . LEU B 1 52 ? 27.647 -29.781 67.459 1.00 75.21  ? 317 LEU B CB  1 
ATOM   820  C  CG  . LEU B 1 52 ? 27.537 -30.640 68.699 1.00 76.75  ? 317 LEU B CG  1 
ATOM   821  C  CD1 . LEU B 1 52 ? 28.821 -31.423 68.926 1.00 76.55  ? 317 LEU B CD1 1 
ATOM   822  C  CD2 . LEU B 1 52 ? 27.254 -29.698 69.803 1.00 78.20  ? 317 LEU B CD2 1 
ATOM   823  N  N   . SER B 1 53 ? 25.045 -30.689 66.084 1.00 83.83  ? 318 SER B N   1 
ATOM   824  C  CA  . SER B 1 53 ? 23.730 -31.309 65.979 1.00 83.50  ? 318 SER B CA  1 
ATOM   825  C  C   . SER B 1 53 ? 23.546 -32.378 64.881 1.00 83.32  ? 318 SER B C   1 
ATOM   826  O  O   . SER B 1 53 ? 22.678 -33.282 64.998 1.00 83.45  ? 318 SER B O   1 
ATOM   827  C  CB  . SER B 1 53 ? 22.694 -30.222 65.789 1.00 82.92  ? 318 SER B CB  1 
ATOM   828  O  OG  . SER B 1 53 ? 21.433 -30.801 65.548 1.00 84.43  ? 318 SER B OG  1 
ATOM   829  N  N   . SER B 1 54 ? 24.329 -32.283 63.806 1.00 81.83  ? 319 SER B N   1 
ATOM   830  C  CA  . SER B 1 54 ? 24.297 -33.353 62.777 1.00 81.07  ? 319 SER B CA  1 
ATOM   831  C  C   . SER B 1 54 ? 25.281 -34.586 62.972 1.00 81.79  ? 319 SER B C   1 
ATOM   832  O  O   . SER B 1 54 ? 25.157 -35.628 62.289 1.00 81.91  ? 319 SER B O   1 
ATOM   833  C  CB  . SER B 1 54 ? 24.412 -32.740 61.381 1.00 79.58  ? 319 SER B CB  1 
ATOM   834  O  OG  . SER B 1 54 ? 25.763 -32.723 60.991 1.00 79.97  ? 319 SER B OG  1 
ATOM   835  N  N   . LYS B 1 55 ? 26.244 -34.462 63.889 1.00 77.04  ? 320 LYS B N   1 
ATOM   836  C  CA  . LYS B 1 55 ? 27.128 -35.567 64.219 1.00 77.85  ? 320 LYS B CA  1 
ATOM   837  C  C   . LYS B 1 55 ? 26.384 -36.382 65.232 1.00 77.85  ? 320 LYS B C   1 
ATOM   838  O  O   . LYS B 1 55 ? 26.481 -37.594 65.247 1.00 77.84  ? 320 LYS B O   1 
ATOM   839  C  CB  . LYS B 1 55 ? 28.457 -35.092 64.787 1.00 78.54  ? 320 LYS B CB  1 
ATOM   840  C  CG  . LYS B 1 55 ? 29.301 -34.356 63.787 1.00 80.68  ? 320 LYS B CG  1 
ATOM   841  C  CD  . LYS B 1 55 ? 30.721 -34.074 64.315 1.00 87.41  ? 320 LYS B CD  1 
ATOM   842  C  CE  . LYS B 1 55 ? 31.661 -33.623 63.158 1.00 89.19  ? 320 LYS B CE  1 
ATOM   843  N  NZ  . LYS B 1 55 ? 33.048 -34.210 63.202 1.00 92.11  ? 320 LYS B NZ  1 
ATOM   844  N  N   . VAL B 1 56 ? 25.603 -35.711 66.058 1.00 77.40  ? 321 VAL B N   1 
ATOM   845  C  CA  . VAL B 1 56 ? 24.691 -36.461 66.883 1.00 78.65  ? 321 VAL B CA  1 
ATOM   846  C  C   . VAL B 1 56 ? 23.620 -37.259 66.088 1.00 78.66  ? 321 VAL B C   1 
ATOM   847  O  O   . VAL B 1 56 ? 23.305 -38.397 66.462 1.00 80.36  ? 321 VAL B O   1 
ATOM   848  C  CB  . VAL B 1 56 ? 24.043 -35.621 68.031 1.00 78.09  ? 321 VAL B CB  1 
ATOM   849  C  CG1 . VAL B 1 56 ? 25.025 -34.611 68.559 1.00 77.44  ? 321 VAL B CG1 1 
ATOM   850  C  CG2 . VAL B 1 56 ? 22.753 -35.009 67.597 1.00 76.57  ? 321 VAL B CG2 1 
ATOM   851  N  N   . GLN B 1 57 ? 23.057 -36.675 65.034 1.00 76.67  ? 322 GLN B N   1 
ATOM   852  C  CA  . GLN B 1 57 ? 22.105 -37.381 64.219 1.00 76.77  ? 322 GLN B CA  1 
ATOM   853  C  C   . GLN B 1 57 ? 22.914 -38.495 63.590 1.00 77.80  ? 322 GLN B C   1 
ATOM   854  O  O   . GLN B 1 57 ? 22.512 -39.648 63.728 1.00 79.24  ? 322 GLN B O   1 
ATOM   855  C  CB  . GLN B 1 57 ? 21.414 -36.507 63.159 1.00 75.82  ? 322 GLN B CB  1 
ATOM   856  N  N   . GLN B 1 58 ? 24.072 -38.192 62.989 1.00 67.08  ? 323 GLN B N   1 
ATOM   857  C  CA  . GLN B 1 58 ? 24.947 -39.255 62.437 1.00 68.62  ? 323 GLN B CA  1 
ATOM   858  C  C   . GLN B 1 58 ? 25.159 -40.431 63.472 1.00 71.50  ? 323 GLN B C   1 
ATOM   859  O  O   . GLN B 1 58 ? 25.018 -41.629 63.144 1.00 71.53  ? 323 GLN B O   1 
ATOM   860  C  CB  . GLN B 1 58 ? 26.265 -38.705 61.843 1.00 67.47  ? 323 GLN B CB  1 
ATOM   861  N  N   . LEU B 1 59 ? 25.413 -40.077 64.726 1.00 90.29  ? 324 LEU B N   1 
ATOM   862  C  CA  . LEU B 1 59 ? 25.558 -41.046 65.785 1.00 92.97  ? 324 LEU B CA  1 
ATOM   863  C  C   . LEU B 1 59 ? 24.303 -41.799 66.148 1.00 95.30  ? 324 LEU B C   1 
ATOM   864  O  O   . LEU B 1 59 ? 24.379 -43.007 66.401 1.00 97.94  ? 324 LEU B O   1 
ATOM   865  C  CB  . LEU B 1 59 ? 26.055 -40.384 67.044 1.00 93.40  ? 324 LEU B CB  1 
ATOM   866  C  CG  . LEU B 1 59 ? 27.558 -40.256 67.161 1.00 93.83  ? 324 LEU B CG  1 
ATOM   867  C  CD1 . LEU B 1 59 ? 27.803 -39.238 68.235 1.00 95.61  ? 324 LEU B CD1 1 
ATOM   868  C  CD2 . LEU B 1 59 ? 28.226 -41.575 67.489 1.00 93.65  ? 324 LEU B CD2 1 
ATOM   869  N  N   . GLU B 1 60 ? 23.146 -41.155 66.232 1.00 87.18  ? 325 GLU B N   1 
ATOM   870  C  CA  . GLU B 1 60 ? 22.044 -41.944 66.760 1.00 89.30  ? 325 GLU B CA  1 
ATOM   871  C  C   . GLU B 1 60 ? 21.367 -42.800 65.711 1.00 89.62  ? 325 GLU B C   1 
ATOM   872  O  O   . GLU B 1 60 ? 20.577 -43.687 66.041 1.00 90.25  ? 325 GLU B O   1 
ATOM   873  C  CB  . GLU B 1 60 ? 21.057 -41.103 67.531 1.00 89.43  ? 325 GLU B CB  1 
ATOM   874  C  CG  . GLU B 1 60 ? 20.506 -39.939 66.822 1.00 90.44  ? 325 GLU B CG  1 
ATOM   875  C  CD  . GLU B 1 60 ? 19.769 -39.025 67.807 1.00 97.53  ? 325 GLU B CD  1 
ATOM   876  O  OE1 . GLU B 1 60 ? 20.227 -38.920 68.988 1.00 98.11  ? 325 GLU B OE1 1 
ATOM   877  O  OE2 . GLU B 1 60 ? 18.727 -38.420 67.415 1.00 100.24 ? 325 GLU B OE2 1 
ATOM   878  N  N   . ARG B 1 61 ? 21.661 -42.506 64.443 1.00 95.13  ? 326 ARG B N   1 
ATOM   879  C  CA  . ARG B 1 61 ? 21.297 -43.384 63.326 1.00 95.91  ? 326 ARG B CA  1 
ATOM   880  C  C   . ARG B 1 61 ? 22.218 -44.619 63.444 1.00 97.92  ? 326 ARG B C   1 
ATOM   881  O  O   . ARG B 1 61 ? 21.764 -45.763 63.307 1.00 98.37  ? 326 ARG B O   1 
ATOM   882  C  CB  . ARG B 1 61 ? 21.427 -42.674 61.962 1.00 93.98  ? 326 ARG B CB  1 
ATOM   883  N  N   . SER B 1 62 ? 23.490 -44.380 63.773 1.00 105.23 ? 327 SER B N   1 
ATOM   884  C  CA  . SER B 1 62 ? 24.438 -45.450 63.926 1.00 107.54 ? 327 SER B CA  1 
ATOM   885  C  C   . SER B 1 62 ? 24.041 -46.472 65.024 1.00 109.86 ? 327 SER B C   1 
ATOM   886  O  O   . SER B 1 62 ? 24.304 -47.672 64.865 1.00 111.58 ? 327 SER B O   1 
ATOM   887  C  CB  . SER B 1 62 ? 25.831 -44.895 64.145 1.00 107.34 ? 327 SER B CB  1 
ATOM   888  O  OG  . SER B 1 62 ? 26.670 -45.905 64.686 1.00 111.89 ? 327 SER B OG  1 
ATOM   889  N  N   . ILE B 1 63 ? 23.421 -46.010 66.118 1.00 106.50 ? 328 ILE B N   1 
ATOM   890  C  CA  . ILE B 1 63 ? 22.836 -46.903 67.150 1.00 108.08 ? 328 ILE B CA  1 
ATOM   891  C  C   . ILE B 1 63 ? 21.279 -46.819 67.068 1.00 108.80 ? 328 ILE B C   1 
ATOM   892  O  O   . ILE B 1 63 ? 20.485 -46.818 68.027 1.00 110.42 ? 328 ILE B O   1 
ATOM   893  C  CB  . ILE B 1 63 ? 23.400 -46.626 68.587 1.00 108.78 ? 328 ILE B CB  1 
ATOM   894  C  CG1 . ILE B 1 63 ? 22.630 -45.520 69.301 1.00 107.74 ? 328 ILE B CG1 1 
ATOM   895  C  CG2 . ILE B 1 63 ? 24.870 -46.220 68.532 1.00 108.98 ? 328 ILE B CG2 1 
ATOM   896  C  CD1 . ILE B 1 63 ? 22.887 -45.446 70.767 1.00 108.05 ? 328 ILE B CD1 1 
ATOM   897  N  N   . GLU C 1 2  ? 33.955 42.340  63.919 1.00 110.41 ? 267 GLU C N   1 
ATOM   898  C  CA  . GLU C 1 2  ? 34.548 41.423  64.934 1.00 111.09 ? 267 GLU C CA  1 
ATOM   899  C  C   . GLU C 1 2  ? 33.451 40.630  65.678 1.00 109.99 ? 267 GLU C C   1 
ATOM   900  O  O   . GLU C 1 2  ? 33.391 39.417  65.513 1.00 109.21 ? 267 GLU C O   1 
ATOM   901  C  CB  . GLU C 1 2  ? 35.528 42.113  65.918 1.00 112.51 ? 267 GLU C CB  1 
ATOM   902  C  CG  . GLU C 1 2  ? 35.167 41.825  67.424 1.00 114.38 ? 267 GLU C CG  1 
ATOM   903  C  CD  . GLU C 1 2  ? 36.335 41.721  68.415 1.00 117.19 ? 267 GLU C CD  1 
ATOM   904  O  OE1 . GLU C 1 2  ? 37.282 40.941  68.175 1.00 117.79 ? 267 GLU C OE1 1 
ATOM   905  O  OE2 . GLU C 1 2  ? 36.268 42.391  69.474 1.00 118.68 ? 267 GLU C OE2 1 
ATOM   906  N  N   . LEU C 1 3  ? 32.601 41.292  66.484 1.00 114.94 ? 268 LEU C N   1 
ATOM   907  C  CA  . LEU C 1 3  ? 31.483 40.607  67.183 1.00 113.23 ? 268 LEU C CA  1 
ATOM   908  C  C   . LEU C 1 3  ? 30.391 40.253  66.174 1.00 111.59 ? 268 LEU C C   1 
ATOM   909  O  O   . LEU C 1 3  ? 29.744 39.212  66.263 1.00 110.46 ? 268 LEU C O   1 
ATOM   910  C  CB  . LEU C 1 3  ? 30.916 41.471  68.311 1.00 114.12 ? 268 LEU C CB  1 
ATOM   911  C  CG  . LEU C 1 3  ? 30.195 40.776  69.472 1.00 114.18 ? 268 LEU C CG  1 
ATOM   912  C  CD1 . LEU C 1 3  ? 31.186 39.968  70.321 1.00 114.36 ? 268 LEU C CD1 1 
ATOM   913  C  CD2 . LEU C 1 3  ? 29.444 41.783  70.365 1.00 115.84 ? 268 LEU C CD2 1 
ATOM   914  N  N   . LEU C 1 4  ? 30.214 41.151  65.208 1.00 105.04 ? 269 LEU C N   1 
ATOM   915  C  CA  . LEU C 1 4  ? 29.530 40.860  63.963 1.00 103.32 ? 269 LEU C CA  1 
ATOM   916  C  C   . LEU C 1 4  ? 30.031 39.538  63.312 1.00 101.11 ? 269 LEU C C   1 
ATOM   917  O  O   . LEU C 1 4  ? 29.290 38.914  62.556 1.00 100.52 ? 269 LEU C O   1 
ATOM   918  C  CB  . LEU C 1 4  ? 29.720 42.072  63.024 1.00 104.50 ? 269 LEU C CB  1 
ATOM   919  N  N   . GLN C 1 5  ? 31.259 39.112  63.660 1.00 89.34  ? 270 GLN C N   1 
ATOM   920  C  CA  . GLN C 1 5  ? 32.021 38.017  62.976 1.00 87.35  ? 270 GLN C CA  1 
ATOM   921  C  C   . GLN C 1 5  ? 32.494 36.769  63.819 1.00 85.07  ? 270 GLN C C   1 
ATOM   922  O  O   . GLN C 1 5  ? 32.723 35.682  63.286 1.00 83.69  ? 270 GLN C O   1 
ATOM   923  C  CB  . GLN C 1 5  ? 33.239 38.627  62.242 1.00 88.25  ? 270 GLN C CB  1 
ATOM   924  N  N   . ARG C 1 6  ? 32.674 36.983  65.121 1.00 95.85  ? 271 ARG C N   1 
ATOM   925  C  CA  . ARG C 1 6  ? 33.014 35.981  66.128 1.00 93.61  ? 271 ARG C CA  1 
ATOM   926  C  C   . ARG C 1 6  ? 31.795 35.079  66.283 1.00 90.98  ? 271 ARG C C   1 
ATOM   927  O  O   . ARG C 1 6  ? 31.862 33.890  66.644 1.00 89.72  ? 271 ARG C O   1 
ATOM   928  C  CB  . ARG C 1 6  ? 33.231 36.705  67.489 1.00 95.11  ? 271 ARG C CB  1 
ATOM   929  C  CG  . ARG C 1 6  ? 34.674 37.136  67.874 1.00 96.88  ? 271 ARG C CG  1 
ATOM   930  C  CD  . ARG C 1 6  ? 34.675 38.207  69.007 1.00 100.41 ? 271 ARG C CD  1 
ATOM   931  N  NE  . ARG C 1 6  ? 34.689 37.676  70.380 1.00 102.30 ? 271 ARG C NE  1 
ATOM   932  C  CZ  . ARG C 1 6  ? 34.743 38.425  71.492 1.00 104.76 ? 271 ARG C CZ  1 
ATOM   933  N  NH1 . ARG C 1 6  ? 34.784 39.754  71.439 1.00 105.86 ? 271 ARG C NH1 1 
ATOM   934  N  NH2 . ARG C 1 6  ? 34.746 37.840  72.678 1.00 105.03 ? 271 ARG C NH2 1 
ATOM   935  N  N   . CYS C 1 7  ? 30.681 35.731  66.013 1.00 84.50  ? 272 CYS C N   1 
ATOM   936  C  CA  . CYS C 1 7  ? 29.408 35.278  66.345 1.00 82.34  ? 272 CYS C CA  1 
ATOM   937  C  C   . CYS C 1 7  ? 28.907 34.557  65.138 1.00 80.71  ? 272 CYS C C   1 
ATOM   938  O  O   . CYS C 1 7  ? 28.299 33.526  65.289 1.00 80.30  ? 272 CYS C O   1 
ATOM   939  C  CB  . CYS C 1 7  ? 28.567 36.487  66.672 1.00 82.91  ? 272 CYS C CB  1 
ATOM   940  S  SG  . CYS C 1 7  ? 26.841 36.213  66.726 1.00 85.57  ? 272 CYS C SG  1 
ATOM   941  N  N   . GLU C 1 8  ? 29.161 35.069  63.931 1.00 85.66  ? 273 GLU C N   1 
ATOM   942  C  CA  . GLU C 1 8  ? 28.897 34.280  62.670 1.00 83.18  ? 273 GLU C CA  1 
ATOM   943  C  C   . GLU C 1 8  ? 29.757 33.013  62.587 1.00 81.00  ? 273 GLU C C   1 
ATOM   944  O  O   . GLU C 1 8  ? 29.357 32.019  61.978 1.00 80.89  ? 273 GLU C O   1 
ATOM   945  C  CB  . GLU C 1 8  ? 29.094 35.110  61.394 1.00 84.14  ? 273 GLU C CB  1 
ATOM   946  N  N   . SER C 1 9  ? 30.936 33.072  63.196 1.00 68.18  ? 274 SER C N   1 
ATOM   947  C  CA  . SER C 1 9  ? 31.781 31.935  63.404 1.00 65.47  ? 274 SER C CA  1 
ATOM   948  C  C   . SER C 1 9  ? 31.126 30.865  64.353 1.00 63.58  ? 274 SER C C   1 
ATOM   949  O  O   . SER C 1 9  ? 31.045 29.674  64.022 1.00 62.68  ? 274 SER C O   1 
ATOM   950  C  CB  . SER C 1 9  ? 33.090 32.462  63.952 1.00 65.46  ? 274 SER C CB  1 
ATOM   951  O  OG  . SER C 1 9  ? 34.104 31.530  63.711 1.00 67.77  ? 274 SER C OG  1 
ATOM   952  N  N   . LEU C 1 10 ? 30.665 31.306  65.523 1.00 67.22  ? 275 LEU C N   1 
ATOM   953  C  CA  . LEU C 1 10 ? 29.878 30.492  66.446 1.00 65.59  ? 275 LEU C CA  1 
ATOM   954  C  C   . LEU C 1 10 ? 28.709 29.771  65.788 1.00 64.61  ? 275 LEU C C   1 
ATOM   955  O  O   . LEU C 1 10 ? 28.511 28.567  65.989 1.00 64.98  ? 275 LEU C O   1 
ATOM   956  C  CB  . LEU C 1 10 ? 29.402 31.324  67.646 1.00 65.68  ? 275 LEU C CB  1 
ATOM   957  C  CG  . LEU C 1 10 ? 30.559 31.908  68.448 1.00 66.61  ? 275 LEU C CG  1 
ATOM   958  C  CD1 . LEU C 1 10 ? 30.048 32.389  69.735 1.00 68.01  ? 275 LEU C CD1 1 
ATOM   959  C  CD2 . LEU C 1 10 ? 31.679 30.879  68.674 1.00 67.74  ? 275 LEU C CD2 1 
ATOM   960  N  N   . GLU C 1 11 ? 27.970 30.486  64.975 1.00 70.11  ? 276 GLU C N   1 
ATOM   961  C  CA  . GLU C 1 11 ? 26.892 29.911  64.154 1.00 71.30  ? 276 GLU C CA  1 
ATOM   962  C  C   . GLU C 1 11 ? 27.286 28.702  63.312 1.00 70.27  ? 276 GLU C C   1 
ATOM   963  O  O   . GLU C 1 11 ? 26.511 27.728  63.221 1.00 70.73  ? 276 GLU C O   1 
ATOM   964  C  CB  . GLU C 1 11 ? 26.288 30.964  63.209 1.00 72.24  ? 276 GLU C CB  1 
ATOM   965  C  CG  . GLU C 1 11 ? 24.922 31.446  63.618 1.00 76.51  ? 276 GLU C CG  1 
ATOM   966  C  CD  . GLU C 1 11 ? 24.804 32.986  63.548 1.00 83.96  ? 276 GLU C CD  1 
ATOM   967  O  OE1 . GLU C 1 11 ? 25.864 33.646  63.475 1.00 87.39  ? 276 GLU C OE1 1 
ATOM   968  O  OE2 . GLU C 1 11 ? 23.662 33.539  63.561 1.00 85.92  ? 276 GLU C OE2 1 
ATOM   969  N  N   . LYS C 1 12 ? 28.476 28.792  62.714 1.00 64.35  ? 277 LYS C N   1 
ATOM   970  C  CA  . LYS C 1 12 ? 28.996 27.830  61.749 1.00 63.50  ? 277 LYS C CA  1 
ATOM   971  C  C   . LYS C 1 12 ? 29.522 26.586  62.424 1.00 61.48  ? 277 LYS C C   1 
ATOM   972  O  O   . LYS C 1 12 ? 29.243 25.455  61.937 1.00 60.34  ? 277 LYS C O   1 
ATOM   973  C  CB  . LYS C 1 12 ? 30.168 28.452  60.965 1.00 65.04  ? 277 LYS C CB  1 
ATOM   974  C  CG  . LYS C 1 12 ? 29.770 29.335  59.766 1.00 69.77  ? 277 LYS C CG  1 
ATOM   975  C  CD  . LYS C 1 12 ? 31.049 29.822  59.038 1.00 80.05  ? 277 LYS C CD  1 
ATOM   976  C  CE  . LYS C 1 12 ? 30.752 30.704  57.785 1.00 83.81  ? 277 LYS C CE  1 
ATOM   977  N  NZ  . LYS C 1 12 ? 31.644 31.947  57.776 1.00 85.79  ? 277 LYS C NZ  1 
ATOM   978  N  N   . LYS C 1 13 ? 30.283 26.809  63.519 1.00 59.42  ? 278 LYS C N   1 
ATOM   979  C  CA  . LYS C 1 13 ? 31.041 25.768  64.182 1.00 57.25  ? 278 LYS C CA  1 
ATOM   980  C  C   . LYS C 1 13 ? 29.957 24.918  64.786 1.00 57.06  ? 278 LYS C C   1 
ATOM   981  O  O   . LYS C 1 13 ? 29.885 23.669  64.607 1.00 57.70  ? 278 LYS C O   1 
ATOM   982  C  CB  . LYS C 1 13 ? 32.026 26.377  65.198 1.00 57.53  ? 278 LYS C CB  1 
ATOM   983  N  N   . THR C 1 14 ? 29.014 25.603  65.396 1.00 58.66  ? 279 THR C N   1 
ATOM   984  C  CA  . THR C 1 14 ? 27.816 24.984  65.992 1.00 58.70  ? 279 THR C CA  1 
ATOM   985  C  C   . THR C 1 14 ? 26.926 24.089  65.025 1.00 57.52  ? 279 THR C C   1 
ATOM   986  O  O   . THR C 1 14 ? 26.628 22.887  65.305 1.00 57.63  ? 279 THR C O   1 
ATOM   987  C  CB  . THR C 1 14 ? 27.044 26.173  66.626 1.00 60.54  ? 279 THR C CB  1 
ATOM   988  O  OG1 . THR C 1 14 ? 27.641 26.502  67.914 1.00 61.90  ? 279 THR C OG1 1 
ATOM   989  C  CG2 . THR C 1 14 ? 25.526 25.912  66.692 1.00 61.55  ? 279 THR C CG2 1 
ATOM   990  N  N   . ALA C 1 15 ? 26.528 24.633  63.873 1.00 50.76  ? 280 ALA C N   1 
ATOM   991  C  CA  . ALA C 1 15 ? 25.751 23.828  62.920 1.00 48.83  ? 280 ALA C CA  1 
ATOM   992  C  C   . ALA C 1 15 ? 26.483 22.565  62.531 1.00 47.42  ? 280 ALA C C   1 
ATOM   993  O  O   . ALA C 1 15 ? 25.890 21.488  62.381 1.00 46.16  ? 280 ALA C O   1 
ATOM   994  C  CB  . ALA C 1 15 ? 25.464 24.604  61.699 1.00 48.30  ? 280 ALA C CB  1 
ATOM   995  N  N   . THR C 1 16 ? 27.792 22.693  62.339 1.00 53.13  ? 281 THR C N   1 
ATOM   996  C  CA  . THR C 1 16 ? 28.592 21.507  62.020 1.00 52.15  ? 281 THR C CA  1 
ATOM   997  C  C   . THR C 1 16 ? 28.463 20.461  63.138 1.00 52.58  ? 281 THR C C   1 
ATOM   998  O  O   . THR C 1 16 ? 28.148 19.247  62.876 1.00 53.87  ? 281 THR C O   1 
ATOM   999  C  CB  . THR C 1 16 ? 30.058 21.868  61.724 1.00 51.62  ? 281 THR C CB  1 
ATOM   1000 O  OG1 . THR C 1 16 ? 30.101 22.775  60.614 1.00 51.11  ? 281 THR C OG1 1 
ATOM   1001 C  CG2 . THR C 1 16 ? 30.815 20.663  61.291 1.00 51.10  ? 281 THR C CG2 1 
ATOM   1002 N  N   . PHE C 1 17 ? 28.673 20.869  64.386 1.00 50.82  ? 282 PHE C N   1 
ATOM   1003 C  CA  . PHE C 1 17 ? 28.455 19.898  65.475 1.00 49.59  ? 282 PHE C CA  1 
ATOM   1004 C  C   . PHE C 1 17 ? 27.068 19.347  65.422 1.00 50.00  ? 282 PHE C C   1 
ATOM   1005 O  O   . PHE C 1 17 ? 26.917 18.154  65.455 1.00 49.45  ? 282 PHE C O   1 
ATOM   1006 C  CB  . PHE C 1 17 ? 28.700 20.567  66.815 1.00 51.34  ? 282 PHE C CB  1 
ATOM   1007 C  CG  . PHE C 1 17 ? 30.081 21.180  66.916 1.00 51.81  ? 282 PHE C CG  1 
ATOM   1008 C  CD1 . PHE C 1 17 ? 31.179 20.512  66.313 1.00 50.34  ? 282 PHE C CD1 1 
ATOM   1009 C  CD2 . PHE C 1 17 ? 30.279 22.387  67.576 1.00 52.00  ? 282 PHE C CD2 1 
ATOM   1010 C  CE1 . PHE C 1 17 ? 32.459 21.040  66.376 1.00 54.32  ? 282 PHE C CE1 1 
ATOM   1011 C  CE2 . PHE C 1 17 ? 31.586 22.954  67.666 1.00 57.14  ? 282 PHE C CE2 1 
ATOM   1012 C  CZ  . PHE C 1 17 ? 32.675 22.300  67.058 1.00 56.55  ? 282 PHE C CZ  1 
ATOM   1013 N  N   . GLU C 1 18 ? 26.021 20.180  65.326 1.00 50.34  ? 283 GLU C N   1 
ATOM   1014 C  CA  . GLU C 1 18 ? 24.669 19.593  65.332 1.00 50.55  ? 283 GLU C CA  1 
ATOM   1015 C  C   . GLU C 1 18 ? 24.585 18.586  64.177 1.00 52.49  ? 283 GLU C C   1 
ATOM   1016 O  O   . GLU C 1 18 ? 24.113 17.446  64.339 1.00 53.92  ? 283 GLU C O   1 
ATOM   1017 C  CB  . GLU C 1 18 ? 23.614 20.673  65.206 1.00 51.25  ? 283 GLU C CB  1 
ATOM   1018 N  N   . ASN C 1 19 ? 25.075 18.956  62.999 1.00 55.82  ? 284 ASN C N   1 
ATOM   1019 C  CA  . ASN C 1 19 ? 24.997 18.010  61.913 1.00 57.23  ? 284 ASN C CA  1 
ATOM   1020 C  C   . ASN C 1 19 ? 25.750 16.737  62.193 1.00 57.15  ? 284 ASN C C   1 
ATOM   1021 O  O   . ASN C 1 19 ? 25.236 15.654  61.850 1.00 58.86  ? 284 ASN C O   1 
ATOM   1022 C  CB  . ASN C 1 19 ? 25.419 18.598  60.572 1.00 58.33  ? 284 ASN C CB  1 
ATOM   1023 C  CG  . ASN C 1 19 ? 24.353 19.559  59.987 1.00 61.38  ? 284 ASN C CG  1 
ATOM   1024 O  OD1 . ASN C 1 19 ? 24.608 20.727  59.806 1.00 62.04  ? 284 ASN C OD1 1 
ATOM   1025 N  ND2 . ASN C 1 19 ? 23.171 19.040  59.668 1.00 65.76  ? 284 ASN C ND2 1 
ATOM   1026 N  N   . ILE C 1 20 ? 26.940 16.809  62.795 1.00 49.25  ? 285 ILE C N   1 
ATOM   1027 C  CA  . ILE C 1 20 ? 27.712 15.573  62.984 1.00 49.05  ? 285 ILE C CA  1 
ATOM   1028 C  C   . ILE C 1 20 ? 27.011 14.682  63.969 1.00 50.36  ? 285 ILE C C   1 
ATOM   1029 O  O   . ILE C 1 20 ? 26.948 13.460  63.774 1.00 50.30  ? 285 ILE C O   1 
ATOM   1030 C  CB  . ILE C 1 20 ? 29.104 15.829  63.553 1.00 48.98  ? 285 ILE C CB  1 
ATOM   1031 C  CG1 . ILE C 1 20 ? 30.001 16.414  62.495 1.00 49.36  ? 285 ILE C CG1 1 
ATOM   1032 C  CG2 . ILE C 1 20 ? 29.762 14.509  64.070 1.00 46.46  ? 285 ILE C CG2 1 
ATOM   1033 C  CD1 . ILE C 1 20 ? 31.286 16.844  63.091 1.00 50.62  ? 285 ILE C CD1 1 
ATOM   1034 N  N   . VAL C 1 21 ? 26.471 15.276  65.041 1.00 58.83  ? 286 VAL C N   1 
ATOM   1035 C  CA  . VAL C 1 21 ? 25.812 14.483  66.116 1.00 60.09  ? 286 VAL C CA  1 
ATOM   1036 C  C   . VAL C 1 21 ? 24.501 13.835  65.643 1.00 61.48  ? 286 VAL C C   1 
ATOM   1037 O  O   . VAL C 1 21 ? 24.057 12.756  66.138 1.00 63.27  ? 286 VAL C O   1 
ATOM   1038 C  CB  . VAL C 1 21 ? 25.595 15.376  67.341 1.00 60.71  ? 286 VAL C CB  1 
ATOM   1039 C  CG1 . VAL C 1 21 ? 24.425 14.933  68.158 1.00 60.53  ? 286 VAL C CG1 1 
ATOM   1040 C  CG2 . VAL C 1 21 ? 26.938 15.550  68.125 1.00 59.77  ? 286 VAL C CG2 1 
ATOM   1041 N  N   . CYS C 1 22 ? 23.886 14.483  64.672 1.00 57.76  ? 287 CYS C N   1 
ATOM   1042 C  CA  . CYS C 1 22 ? 22.725 13.909  64.008 1.00 59.95  ? 287 CYS C CA  1 
ATOM   1043 C  C   . CYS C 1 22 ? 23.045 12.586  63.216 1.00 58.80  ? 287 CYS C C   1 
ATOM   1044 O  O   . CYS C 1 22 ? 22.249 11.607  63.215 1.00 60.27  ? 287 CYS C O   1 
ATOM   1045 C  CB  . CYS C 1 22 ? 22.083 14.992  63.157 1.00 61.41  ? 287 CYS C CB  1 
ATOM   1046 S  SG  . CYS C 1 22 ? 21.185 14.347  61.783 1.00 72.87  ? 287 CYS C SG  1 
ATOM   1047 N  N   . VAL C 1 23 ? 24.233 12.529  62.613 1.00 55.43  ? 288 VAL C N   1 
ATOM   1048 C  CA  . VAL C 1 23 ? 24.747 11.283  62.001 1.00 53.09  ? 288 VAL C CA  1 
ATOM   1049 C  C   . VAL C 1 23 ? 25.085 10.198  63.045 1.00 52.75  ? 288 VAL C C   1 
ATOM   1050 O  O   . VAL C 1 23 ? 24.851 8.982   62.824 1.00 52.76  ? 288 VAL C O   1 
ATOM   1051 C  CB  . VAL C 1 23 ? 25.972 11.532  61.099 1.00 51.19  ? 288 VAL C CB  1 
ATOM   1052 C  CG1 . VAL C 1 23 ? 26.445 10.225  60.551 1.00 51.68  ? 288 VAL C CG1 1 
ATOM   1053 C  CG2 . VAL C 1 23 ? 25.628 12.499  59.959 1.00 50.27  ? 288 VAL C CG2 1 
ATOM   1054 N  N   . LEU C 1 24 ? 25.644 10.610  64.178 1.00 53.76  ? 289 LEU C N   1 
ATOM   1055 C  CA  . LEU C 1 24 ? 26.005 9.618   65.169 1.00 53.27  ? 289 LEU C CA  1 
ATOM   1056 C  C   . LEU C 1 24 ? 24.727 9.053   65.767 1.00 56.07  ? 289 LEU C C   1 
ATOM   1057 O  O   . LEU C 1 24 ? 24.629 7.837   65.966 1.00 56.44  ? 289 LEU C O   1 
ATOM   1058 C  CB  . LEU C 1 24 ? 26.878 10.241  66.228 1.00 51.75  ? 289 LEU C CB  1 
ATOM   1059 C  CG  . LEU C 1 24 ? 28.201 10.681  65.562 1.00 47.79  ? 289 LEU C CG  1 
ATOM   1060 C  CD1 . LEU C 1 24 ? 28.837 11.744  66.369 1.00 40.71  ? 289 LEU C CD1 1 
ATOM   1061 C  CD2 . LEU C 1 24 ? 29.179 9.522   65.299 1.00 41.82  ? 289 LEU C CD2 1 
ATOM   1062 N  N   . ASN C 1 25 ? 23.713 9.899   66.022 1.00 61.14  ? 290 ASN C N   1 
ATOM   1063 C  CA  . ASN C 1 25 ? 22.392 9.344   66.475 1.00 62.83  ? 290 ASN C CA  1 
ATOM   1064 C  C   . ASN C 1 25 ? 21.927 8.194   65.571 1.00 64.22  ? 290 ASN C C   1 
ATOM   1065 O  O   . ASN C 1 25 ? 21.411 7.183   66.050 1.00 65.01  ? 290 ASN C O   1 
ATOM   1066 C  CB  . ASN C 1 25 ? 21.316 10.430  66.460 1.00 63.50  ? 290 ASN C CB  1 
ATOM   1067 C  CG  . ASN C 1 25 ? 19.999 10.014  67.202 1.00 67.68  ? 290 ASN C CG  1 
ATOM   1068 O  OD1 . ASN C 1 25 ? 19.753 8.807   67.543 1.00 67.76  ? 290 ASN C OD1 1 
ATOM   1069 N  ND2 . ASN C 1 25 ? 19.131 11.043  67.458 1.00 69.12  ? 290 ASN C ND2 1 
ATOM   1070 N  N   . ARG C 1 26 ? 22.055 8.384   64.254 1.00 60.08  ? 291 ARG C N   1 
ATOM   1071 C  CA  . ARG C 1 26 ? 21.610 7.387   63.302 1.00 61.97  ? 291 ARG C CA  1 
ATOM   1072 C  C   . ARG C 1 26 ? 22.487 6.180   63.395 1.00 61.38  ? 291 ARG C C   1 
ATOM   1073 O  O   . ARG C 1 26 ? 21.974 5.057   63.417 1.00 62.19  ? 291 ARG C O   1 
ATOM   1074 C  CB  . ARG C 1 26 ? 21.658 7.907   61.880 1.00 63.04  ? 291 ARG C CB  1 
ATOM   1075 C  CG  . ARG C 1 26 ? 20.431 8.629   61.512 1.00 69.90  ? 291 ARG C CG  1 
ATOM   1076 C  CD  . ARG C 1 26 ? 20.022 8.182   60.125 1.00 81.05  ? 291 ARG C CD  1 
ATOM   1077 N  NE  . ARG C 1 26 ? 21.105 8.456   59.179 1.00 86.08  ? 291 ARG C NE  1 
ATOM   1078 C  CZ  . ARG C 1 26 ? 21.400 9.675   58.689 1.00 87.20  ? 291 ARG C CZ  1 
ATOM   1079 N  NH1 . ARG C 1 26 ? 20.671 10.744  59.052 1.00 86.92  ? 291 ARG C NH1 1 
ATOM   1080 N  NH2 . ARG C 1 26 ? 22.433 9.827   57.837 1.00 83.48  ? 291 ARG C NH2 1 
ATOM   1081 N  N   . GLU C 1 27 ? 23.811 6.399   63.449 1.00 64.87  ? 292 GLU C N   1 
ATOM   1082 C  CA  . GLU C 1 27 ? 24.742 5.289   63.602 1.00 63.62  ? 292 GLU C CA  1 
ATOM   1083 C  C   . GLU C 1 27 ? 24.400 4.453   64.830 1.00 64.27  ? 292 GLU C C   1 
ATOM   1084 O  O   . GLU C 1 27 ? 24.176 3.209   64.681 1.00 64.82  ? 292 GLU C O   1 
ATOM   1085 C  CB  . GLU C 1 27 ? 26.152 5.791   63.703 1.00 62.84  ? 292 GLU C CB  1 
ATOM   1086 C  CG  . GLU C 1 27 ? 27.137 4.682   63.721 1.00 61.30  ? 292 GLU C CG  1 
ATOM   1087 C  CD  . GLU C 1 27 ? 28.578 5.126   63.352 1.00 63.79  ? 292 GLU C CD  1 
ATOM   1088 O  OE1 . GLU C 1 27 ? 28.926 6.378   63.481 1.00 59.36  ? 292 GLU C OE1 1 
ATOM   1089 O  OE2 . GLU C 1 27 ? 29.357 4.174   62.932 1.00 62.41  ? 292 GLU C OE2 1 
ATOM   1090 N  N   . VAL C 1 28 ? 24.297 5.097   66.010 1.00 60.31  ? 293 VAL C N   1 
ATOM   1091 C  CA  . VAL C 1 28 ? 23.985 4.330   67.221 1.00 62.48  ? 293 VAL C CA  1 
ATOM   1092 C  C   . VAL C 1 28 ? 22.698 3.560   67.067 1.00 63.96  ? 293 VAL C C   1 
ATOM   1093 O  O   . VAL C 1 28 ? 22.659 2.461   67.536 1.00 64.40  ? 293 VAL C O   1 
ATOM   1094 C  CB  . VAL C 1 28 ? 23.918 5.089   68.612 1.00 62.64  ? 293 VAL C CB  1 
ATOM   1095 C  CG1 . VAL C 1 28 ? 25.196 5.752   68.932 1.00 64.54  ? 293 VAL C CG1 1 
ATOM   1096 C  CG2 . VAL C 1 28 ? 22.783 6.129   68.685 1.00 65.97  ? 293 VAL C CG2 1 
ATOM   1097 N  N   . GLU C 1 29 ? 21.647 4.097   66.434 1.00 58.63  ? 294 GLU C N   1 
ATOM   1098 C  CA  . GLU C 1 29 ? 20.357 3.343   66.422 1.00 60.39  ? 294 GLU C CA  1 
ATOM   1099 C  C   . GLU C 1 29 ? 20.387 2.156   65.475 1.00 61.27  ? 294 GLU C C   1 
ATOM   1100 O  O   . GLU C 1 29 ? 19.617 1.224   65.683 1.00 62.43  ? 294 GLU C O   1 
ATOM   1101 C  CB  . GLU C 1 29 ? 19.132 4.194   66.084 1.00 61.00  ? 294 GLU C CB  1 
ATOM   1102 C  CG  . GLU C 1 29 ? 18.893 5.379   66.943 1.00 63.90  ? 294 GLU C CG  1 
ATOM   1103 C  CD  . GLU C 1 29 ? 18.976 5.093   68.441 1.00 66.76  ? 294 GLU C CD  1 
ATOM   1104 O  OE1 . GLU C 1 29 ? 18.418 4.064   68.864 1.00 64.07  ? 294 GLU C OE1 1 
ATOM   1105 O  OE2 . GLU C 1 29 ? 19.593 5.926   69.189 1.00 68.38  ? 294 GLU C OE2 1 
ATOM   1106 N  N   . ARG C 1 30 ? 21.220 2.215   64.421 1.00 64.28  ? 295 ARG C N   1 
ATOM   1107 C  CA  . ARG C 1 30 ? 21.463 1.052   63.552 1.00 65.55  ? 295 ARG C CA  1 
ATOM   1108 C  C   . ARG C 1 30 ? 22.164 0.010   64.424 1.00 64.30  ? 295 ARG C C   1 
ATOM   1109 O  O   . ARG C 1 30 ? 21.758 -1.165  64.481 1.00 64.17  ? 295 ARG C O   1 
ATOM   1110 C  CB  . ARG C 1 30 ? 22.320 1.389   62.298 1.00 65.71  ? 295 ARG C CB  1 
ATOM   1111 C  CG  . ARG C 1 30 ? 21.574 2.116   61.147 1.00 71.08  ? 295 ARG C CG  1 
ATOM   1112 C  CD  . ARG C 1 30 ? 22.350 2.195   59.776 1.00 78.46  ? 295 ARG C CD  1 
ATOM   1113 N  NE  . ARG C 1 30 ? 22.987 3.505   59.502 1.00 82.67  ? 295 ARG C NE  1 
ATOM   1114 C  CZ  . ARG C 1 30 ? 24.286 3.777   59.701 1.00 85.02  ? 295 ARG C CZ  1 
ATOM   1115 N  NH1 . ARG C 1 30 ? 25.121 2.842   60.188 1.00 84.47  ? 295 ARG C NH1 1 
ATOM   1116 N  NH2 . ARG C 1 30 ? 24.770 4.995   59.417 1.00 86.08  ? 295 ARG C NH2 1 
ATOM   1117 N  N   . VAL C 1 31 ? 23.200 0.457   65.131 1.00 62.45  ? 296 VAL C N   1 
ATOM   1118 C  CA  . VAL C 1 31 ? 23.925 -0.434  66.010 1.00 62.02  ? 296 VAL C CA  1 
ATOM   1119 C  C   . VAL C 1 31 ? 22.982 -1.072  67.042 1.00 63.70  ? 296 VAL C C   1 
ATOM   1120 O  O   . VAL C 1 31 ? 23.039 -2.290  67.255 1.00 64.78  ? 296 VAL C O   1 
ATOM   1121 C  CB  . VAL C 1 31 ? 25.068 0.280   66.684 1.00 60.86  ? 296 VAL C CB  1 
ATOM   1122 C  CG1 . VAL C 1 31 ? 25.806 -0.667  67.589 1.00 59.16  ? 296 VAL C CG1 1 
ATOM   1123 C  CG2 . VAL C 1 31 ? 26.017 0.832   65.634 1.00 61.79  ? 296 VAL C CG2 1 
ATOM   1124 N  N   . ALA C 1 32 ? 22.063 -0.312  67.641 1.00 56.73  ? 297 ALA C N   1 
ATOM   1125 C  CA  . ALA C 1 32 ? 21.051 -0.944  68.534 1.00 59.42  ? 297 ALA C CA  1 
ATOM   1126 C  C   . ALA C 1 32 ? 20.220 -2.067  67.904 1.00 62.07  ? 297 ALA C C   1 
ATOM   1127 O  O   . ALA C 1 32 ? 19.923 -3.031  68.586 1.00 62.36  ? 297 ALA C O   1 
ATOM   1128 C  CB  . ALA C 1 32 ? 20.146 0.072   69.247 1.00 58.76  ? 297 ALA C CB  1 
ATOM   1129 N  N   . MET C 1 33 ? 19.874 -1.945  66.626 1.00 76.64  ? 298 MET C N   1 
ATOM   1130 C  CA  . MET C 1 33 ? 19.062 -2.945  65.956 1.00 81.65  ? 298 MET C CA  1 
ATOM   1131 C  C   . MET C 1 33 ? 19.836 -4.237  65.801 1.00 81.31  ? 298 MET C C   1 
ATOM   1132 O  O   . MET C 1 33 ? 19.283 -5.310  65.896 1.00 81.29  ? 298 MET C O   1 
ATOM   1133 C  CB  . MET C 1 33 ? 18.666 -2.474  64.587 1.00 83.72  ? 298 MET C CB  1 
ATOM   1134 C  CG  . MET C 1 33 ? 17.320 -1.791  64.534 1.00 92.29  ? 298 MET C CG  1 
ATOM   1135 S  SD  . MET C 1 33 ? 16.973 -1.297  62.795 1.00 108.67 ? 298 MET C SD  1 
ATOM   1136 C  CE  . MET C 1 33 ? 18.565 -0.659  62.094 1.00 100.64 ? 298 MET C CE  1 
ATOM   1137 N  N   . THR C 1 34 ? 21.120 -4.078  65.540 1.00 80.45  ? 299 THR C N   1 
ATOM   1138 C  CA  . THR C 1 34 ? 22.073 -5.150  65.498 1.00 81.42  ? 299 THR C CA  1 
ATOM   1139 C  C   . THR C 1 34 ? 22.154 -5.883  66.837 1.00 82.81  ? 299 THR C C   1 
ATOM   1140 O  O   . THR C 1 34 ? 21.950 -7.097  66.896 1.00 84.09  ? 299 THR C O   1 
ATOM   1141 C  CB  . THR C 1 34 ? 23.456 -4.600  65.190 1.00 79.13  ? 299 THR C CB  1 
ATOM   1142 O  OG1 . THR C 1 34 ? 23.484 -4.175  63.831 1.00 80.46  ? 299 THR C OG1 1 
ATOM   1143 C  CG2 . THR C 1 34 ? 24.556 -5.661  65.418 1.00 80.11  ? 299 THR C CG2 1 
ATOM   1144 N  N   . ALA C 1 35 ? 22.480 -5.153  67.906 1.00 86.62  ? 300 ALA C N   1 
ATOM   1145 C  CA  . ALA C 1 35 ? 22.641 -5.762  69.212 1.00 86.06  ? 300 ALA C CA  1 
ATOM   1146 C  C   . ALA C 1 35 ? 21.347 -6.439  69.607 1.00 88.23  ? 300 ALA C C   1 
ATOM   1147 O  O   . ALA C 1 35 ? 21.419 -7.546  70.076 1.00 88.72  ? 300 ALA C O   1 
ATOM   1148 C  CB  . ALA C 1 35 ? 23.066 -4.717  70.228 1.00 85.00  ? 300 ALA C CB  1 
ATOM   1149 N  N   . GLU C 1 36 ? 20.190 -5.797  69.377 1.00 74.22  ? 301 GLU C N   1 
ATOM   1150 C  CA  . GLU C 1 36 ? 18.877 -6.340  69.750 1.00 78.44  ? 301 GLU C CA  1 
ATOM   1151 C  C   . GLU C 1 36 ? 18.576 -7.619  68.946 1.00 81.79  ? 301 GLU C C   1 
ATOM   1152 O  O   . GLU C 1 36 ? 18.345 -8.675  69.544 1.00 83.33  ? 301 GLU C O   1 
ATOM   1153 C  CB  . GLU C 1 36 ? 17.727 -5.319  69.614 1.00 78.82  ? 301 GLU C CB  1 
ATOM   1154 N  N   . ALA C 1 37 ? 18.591 -7.535  67.609 1.00 91.63  ? 302 ALA C N   1 
ATOM   1155 C  CA  . ALA C 1 37 ? 18.356 -8.690  66.722 1.00 94.17  ? 302 ALA C CA  1 
ATOM   1156 C  C   . ALA C 1 37 ? 19.188 -9.894  67.159 1.00 94.97  ? 302 ALA C C   1 
ATOM   1157 O  O   . ALA C 1 37 ? 18.685 -11.039 67.199 1.00 96.31  ? 302 ALA C O   1 
ATOM   1158 C  CB  . ALA C 1 37 ? 18.672 -8.332  65.277 1.00 93.79  ? 302 ALA C CB  1 
ATOM   1159 N  N   . CYS C 1 38 ? 20.442 -9.604  67.521 1.00 91.88  ? 303 CYS C N   1 
ATOM   1160 C  CA  . CYS C 1 38 ? 21.464 -10.593 67.939 1.00 92.70  ? 303 CYS C CA  1 
ATOM   1161 C  C   . CYS C 1 38 ? 21.338 -11.110 69.384 1.00 94.32  ? 303 CYS C C   1 
ATOM   1162 O  O   . CYS C 1 38 ? 21.677 -12.279 69.685 1.00 94.43  ? 303 CYS C O   1 
ATOM   1163 C  CB  . CYS C 1 38 ? 22.878 -10.019 67.689 1.00 90.67  ? 303 CYS C CB  1 
ATOM   1164 S  SG  . CYS C 1 38 ? 24.301 -10.792 68.547 1.00 87.81  ? 303 CYS C SG  1 
ATOM   1165 N  N   . SER C 1 39 ? 20.879 -10.245 70.281 1.00 96.24  ? 304 SER C N   1 
ATOM   1166 C  CA  . SER C 1 39 ? 20.673 -10.689 71.637 1.00 98.55  ? 304 SER C CA  1 
ATOM   1167 C  C   . SER C 1 39 ? 19.495 -11.656 71.680 1.00 102.33 ? 304 SER C C   1 
ATOM   1168 O  O   . SER C 1 39 ? 19.591 -12.705 72.321 1.00 102.65 ? 304 SER C O   1 
ATOM   1169 C  CB  . SER C 1 39 ? 20.436 -9.515  72.574 1.00 97.97  ? 304 SER C CB  1 
ATOM   1170 O  OG  . SER C 1 39 ? 20.413 -9.968  73.911 1.00 98.05  ? 304 SER C OG  1 
ATOM   1171 N  N   . ARG C 1 40 ? 18.409 -11.296 70.984 1.00 122.89 ? 305 ARG C N   1 
ATOM   1172 C  CA  . ARG C 1 40 ? 17.131 -11.988 71.084 1.00 127.32 ? 305 ARG C CA  1 
ATOM   1173 C  C   . ARG C 1 40 ? 17.075 -13.254 70.251 1.00 129.05 ? 305 ARG C C   1 
ATOM   1174 O  O   . ARG C 1 40 ? 16.209 -14.095 70.517 1.00 131.36 ? 305 ARG C O   1 
ATOM   1175 C  CB  . ARG C 1 40 ? 15.974 -11.049 70.768 1.00 129.15 ? 305 ARG C CB  1 
ATOM   1176 C  CG  . ARG C 1 40 ? 15.702 -10.080 71.904 1.00 131.73 ? 305 ARG C CG  1 
ATOM   1177 C  CD  . ARG C 1 40 ? 14.321 -9.429  71.782 1.00 139.87 ? 305 ARG C CD  1 
ATOM   1178 N  NE  . ARG C 1 40 ? 14.251 -8.447  70.691 1.00 143.59 ? 305 ARG C NE  1 
ATOM   1179 C  CZ  . ARG C 1 40 ? 13.128 -8.036  70.096 1.00 147.13 ? 305 ARG C CZ  1 
ATOM   1180 N  NH1 . ARG C 1 40 ? 11.936 -8.514  70.463 1.00 150.18 ? 305 ARG C NH1 1 
ATOM   1181 N  NH2 . ARG C 1 40 ? 13.202 -7.139  69.117 1.00 147.60 ? 305 ARG C NH2 1 
ATOM   1182 N  N   . GLN C 1 41 ? 18.006 -13.386 69.282 1.00 111.32 ? 306 GLN C N   1 
ATOM   1183 C  CA  . GLN C 1 41 ? 18.267 -14.652 68.505 1.00 112.95 ? 306 GLN C CA  1 
ATOM   1184 C  C   . GLN C 1 41 ? 18.979 -15.778 69.318 1.00 113.25 ? 306 GLN C C   1 
ATOM   1185 O  O   . GLN C 1 41 ? 18.513 -16.935 69.343 1.00 115.21 ? 306 GLN C O   1 
ATOM   1186 C  CB  . GLN C 1 41 ? 19.002 -14.396 67.168 1.00 111.35 ? 306 GLN C CB  1 
ATOM   1187 N  N   . HIS C 1 42 ? 20.091 -15.450 69.981 1.00 142.80 ? 307 HIS C N   1 
ATOM   1188 C  CA  . HIS C 1 42 ? 20.698 -16.351 70.992 1.00 142.60 ? 307 HIS C CA  1 
ATOM   1189 C  C   . HIS C 1 42 ? 19.671 -16.987 71.949 1.00 143.33 ? 307 HIS C C   1 
ATOM   1190 O  O   . HIS C 1 42 ? 19.897 -18.092 72.414 1.00 143.49 ? 307 HIS C O   1 
ATOM   1191 C  CB  . HIS C 1 42 ? 21.807 -15.630 71.805 1.00 141.59 ? 307 HIS C CB  1 
ATOM   1192 C  CG  . HIS C 1 42 ? 21.895 -16.077 73.242 1.00 145.34 ? 307 HIS C CG  1 
ATOM   1193 N  ND1 . HIS C 1 42 ? 22.734 -17.095 73.659 1.00 147.41 ? 307 HIS C ND1 1 
ATOM   1194 C  CD2 . HIS C 1 42 ? 21.220 -15.667 74.353 1.00 148.78 ? 307 HIS C CD2 1 
ATOM   1195 C  CE1 . HIS C 1 42 ? 22.581 -17.282 74.963 1.00 148.67 ? 307 HIS C CE1 1 
ATOM   1196 N  NE2 . HIS C 1 42 ? 21.664 -16.435 75.407 1.00 149.51 ? 307 HIS C NE2 1 
ATOM   1197 N  N   . ARG C 1 43 ? 18.581 -16.285 72.277 1.00 119.89 ? 308 ARG C N   1 
ATOM   1198 C  CA  . ARG C 1 43 ? 17.490 -16.870 73.055 1.00 121.17 ? 308 ARG C CA  1 
ATOM   1199 C  C   . ARG C 1 43 ? 17.127 -18.287 72.494 1.00 122.04 ? 308 ARG C C   1 
ATOM   1200 O  O   . ARG C 1 43 ? 17.025 -19.264 73.249 1.00 122.32 ? 308 ARG C O   1 
ATOM   1201 C  CB  . ARG C 1 43 ? 16.296 -15.904 73.083 1.00 123.02 ? 308 ARG C CB  1 
ATOM   1202 N  N   . LEU C 1 44 ? 16.985 -18.383 71.166 1.00 119.63 ? 309 LEU C N   1 
ATOM   1203 C  CA  . LEU C 1 44 ? 16.866 -19.652 70.455 1.00 119.55 ? 309 LEU C CA  1 
ATOM   1204 C  C   . LEU C 1 44 ? 18.115 -20.535 70.640 1.00 116.98 ? 309 LEU C C   1 
ATOM   1205 O  O   . LEU C 1 44 ? 18.007 -21.622 71.206 1.00 118.09 ? 309 LEU C O   1 
ATOM   1206 C  CB  . LEU C 1 44 ? 16.585 -19.409 68.968 1.00 120.28 ? 309 LEU C CB  1 
ATOM   1207 N  N   . ASP C 1 45 ? 19.282 -20.075 70.166 1.00 117.37 ? 310 ASP C N   1 
ATOM   1208 C  CA  . ASP C 1 45 ? 20.617 -20.755 70.355 1.00 114.49 ? 310 ASP C CA  1 
ATOM   1209 C  C   . ASP C 1 45 ? 20.933 -21.420 71.748 1.00 112.95 ? 310 ASP C C   1 
ATOM   1210 O  O   . ASP C 1 45 ? 21.753 -22.340 71.830 1.00 112.29 ? 310 ASP C O   1 
ATOM   1211 C  CB  . ASP C 1 45 ? 21.805 -19.819 69.935 1.00 112.55 ? 310 ASP C CB  1 
ATOM   1212 C  CG  . ASP C 1 45 ? 22.018 -19.724 68.378 1.00 113.92 ? 310 ASP C CG  1 
ATOM   1213 O  OD1 . ASP C 1 45 ? 21.063 -19.997 67.599 1.00 116.76 ? 310 ASP C OD1 1 
ATOM   1214 O  OD2 . ASP C 1 45 ? 23.148 -19.364 67.928 1.00 111.87 ? 310 ASP C OD2 1 
ATOM   1215 N  N   . GLN C 1 46 ? 20.309 -20.946 72.830 1.00 104.66 ? 311 GLN C N   1 
ATOM   1216 C  CA  . GLN C 1 46 ? 20.442 -21.546 74.183 1.00 102.97 ? 311 GLN C CA  1 
ATOM   1217 C  C   . GLN C 1 46 ? 19.469 -22.715 74.358 1.00 104.11 ? 311 GLN C C   1 
ATOM   1218 O  O   . GLN C 1 46 ? 19.668 -23.584 75.211 1.00 103.90 ? 311 GLN C O   1 
ATOM   1219 C  CB  . GLN C 1 46 ? 20.242 -20.499 75.305 1.00 102.86 ? 311 GLN C CB  1 
ATOM   1220 N  N   . ASP C 1 47 ? 18.425 -22.737 73.535 1.00 108.91 ? 312 ASP C N   1 
ATOM   1221 C  CA  . ASP C 1 47 ? 17.497 -23.854 73.498 1.00 109.85 ? 312 ASP C CA  1 
ATOM   1222 C  C   . ASP C 1 47 ? 18.012 -25.029 72.652 1.00 108.57 ? 312 ASP C C   1 
ATOM   1223 O  O   . ASP C 1 47 ? 17.940 -26.204 73.068 1.00 109.29 ? 312 ASP C O   1 
ATOM   1224 C  CB  . ASP C 1 47 ? 16.141 -23.374 72.995 1.00 112.91 ? 312 ASP C CB  1 
ATOM   1225 C  CG  . ASP C 1 47 ? 15.136 -23.199 74.116 1.00 115.20 ? 312 ASP C CG  1 
ATOM   1226 O  OD1 . ASP C 1 47 ? 13.997 -23.693 73.945 1.00 119.12 ? 312 ASP C OD1 1 
ATOM   1227 O  OD2 . ASP C 1 47 ? 15.479 -22.599 75.163 1.00 112.76 ? 312 ASP C OD2 1 
ATOM   1228 N  N   . LYS C 1 48 ? 18.539 -24.730 71.470 1.00 105.43 ? 313 LYS C N   1 
ATOM   1229 C  CA  . LYS C 1 48 ? 19.067 -25.800 70.664 1.00 103.69 ? 313 LYS C CA  1 
ATOM   1230 C  C   . LYS C 1 48 ? 20.243 -26.470 71.367 1.00 100.37 ? 313 LYS C C   1 
ATOM   1231 O  O   . LYS C 1 48 ? 20.398 -27.682 71.297 1.00 101.14 ? 313 LYS C O   1 
ATOM   1232 C  CB  . LYS C 1 48 ? 19.420 -25.324 69.277 1.00 103.34 ? 313 LYS C CB  1 
ATOM   1233 C  CG  . LYS C 1 48 ? 18.214 -24.836 68.481 1.00 106.66 ? 313 LYS C CG  1 
ATOM   1234 C  CD  . LYS C 1 48 ? 18.540 -24.770 66.951 1.00 110.05 ? 313 LYS C CD  1 
ATOM   1235 C  CE  . LYS C 1 48 ? 18.007 -23.470 66.273 1.00 111.37 ? 313 LYS C CE  1 
ATOM   1236 N  NZ  . LYS C 1 48 ? 18.351 -23.312 64.817 1.00 111.79 ? 313 LYS C NZ  1 
ATOM   1237 N  N   . ILE C 1 49 ? 21.029 -25.682 72.084 1.00 90.17  ? 314 ILE C N   1 
ATOM   1238 C  CA  . ILE C 1 49 ? 22.108 -26.211 72.918 1.00 87.23  ? 314 ILE C CA  1 
ATOM   1239 C  C   . ILE C 1 49 ? 21.593 -27.130 74.033 1.00 87.68  ? 314 ILE C C   1 
ATOM   1240 O  O   . ILE C 1 49 ? 22.169 -28.192 74.256 1.00 87.42  ? 314 ILE C O   1 
ATOM   1241 C  CB  . ILE C 1 49 ? 23.014 -25.101 73.498 1.00 84.36  ? 314 ILE C CB  1 
ATOM   1242 N  N   . GLU C 1 50 ? 20.501 -26.756 74.704 1.00 83.66  ? 315 GLU C N   1 
ATOM   1243 C  CA  . GLU C 1 50 ? 19.937 -27.597 75.753 1.00 83.77  ? 315 GLU C CA  1 
ATOM   1244 C  C   . GLU C 1 50 ? 19.385 -28.904 75.210 1.00 85.46  ? 315 GLU C C   1 
ATOM   1245 O  O   . GLU C 1 50 ? 19.587 -29.937 75.855 1.00 85.88  ? 315 GLU C O   1 
ATOM   1246 C  CB  . GLU C 1 50 ? 18.871 -26.870 76.552 1.00 85.24  ? 315 GLU C CB  1 
ATOM   1247 N  N   . ALA C 1 51 ? 18.707 -28.860 74.051 1.00 87.97  ? 316 ALA C N   1 
ATOM   1248 C  CA  . ALA C 1 51 ? 18.219 -30.062 73.335 1.00 89.39  ? 316 ALA C CA  1 
ATOM   1249 C  C   . ALA C 1 51 ? 19.351 -31.065 73.022 1.00 88.10  ? 316 ALA C C   1 
ATOM   1250 O  O   . ALA C 1 51 ? 19.221 -32.297 73.221 1.00 88.95  ? 316 ALA C O   1 
ATOM   1251 C  CB  . ALA C 1 51 ? 17.501 -29.664 72.051 1.00 90.58  ? 316 ALA C CB  1 
ATOM   1252 N  N   . LEU C 1 52 ? 20.454 -30.507 72.529 1.00 89.76  ? 317 LEU C N   1 
ATOM   1253 C  CA  . LEU C 1 52 ? 21.665 -31.243 72.232 1.00 88.11  ? 317 LEU C CA  1 
ATOM   1254 C  C   . LEU C 1 52 ? 22.220 -31.984 73.425 1.00 87.29  ? 317 LEU C C   1 
ATOM   1255 O  O   . LEU C 1 52 ? 22.174 -33.185 73.463 1.00 88.33  ? 317 LEU C O   1 
ATOM   1256 C  CB  . LEU C 1 52 ? 22.738 -30.293 71.705 1.00 85.74  ? 317 LEU C CB  1 
ATOM   1257 C  CG  . LEU C 1 52 ? 22.691 -29.860 70.252 1.00 86.16  ? 317 LEU C CG  1 
ATOM   1258 C  CD1 . LEU C 1 52 ? 24.046 -29.333 69.899 1.00 83.01  ? 317 LEU C CD1 1 
ATOM   1259 C  CD2 . LEU C 1 52 ? 22.302 -31.033 69.347 1.00 90.13  ? 317 LEU C CD2 1 
ATOM   1260 N  N   . SER C 1 53 ? 22.751 -31.256 74.397 1.00 99.84  ? 318 SER C N   1 
ATOM   1261 C  CA  . SER C 1 53 ? 23.384 -31.854 75.566 1.00 99.33  ? 318 SER C CA  1 
ATOM   1262 C  C   . SER C 1 53 ? 22.419 -32.841 76.198 1.00 101.58 ? 318 SER C C   1 
ATOM   1263 O  O   . SER C 1 53 ? 22.856 -33.760 76.873 1.00 101.59 ? 318 SER C O   1 
ATOM   1264 C  CB  . SER C 1 53 ? 23.790 -30.784 76.587 1.00 97.63  ? 318 SER C CB  1 
ATOM   1265 O  OG  . SER C 1 53 ? 22.633 -30.192 77.137 1.00 99.59  ? 318 SER C OG  1 
ATOM   1266 N  N   . SER C 1 54 ? 21.114 -32.652 75.980 1.00 89.80  ? 319 SER C N   1 
ATOM   1267 C  CA  . SER C 1 54 ? 20.145 -33.661 76.405 1.00 92.50  ? 319 SER C CA  1 
ATOM   1268 C  C   . SER C 1 54 ? 20.229 -34.897 75.544 1.00 93.09  ? 319 SER C C   1 
ATOM   1269 O  O   . SER C 1 54 ? 20.244 -35.996 76.078 1.00 94.23  ? 319 SER C O   1 
ATOM   1270 C  CB  . SER C 1 54 ? 18.700 -33.156 76.446 1.00 95.22  ? 319 SER C CB  1 
ATOM   1271 O  OG  . SER C 1 54 ? 18.269 -33.070 77.795 1.00 96.31  ? 319 SER C OG  1 
ATOM   1272 N  N   . LYS C 1 55 ? 20.269 -34.727 74.225 1.00 100.76 ? 320 LYS C N   1 
ATOM   1273 C  CA  . LYS C 1 55 ? 20.489 -35.866 73.336 1.00 100.82 ? 320 LYS C CA  1 
ATOM   1274 C  C   . LYS C 1 55 ? 21.858 -36.536 73.598 1.00 98.22  ? 320 LYS C C   1 
ATOM   1275 O  O   . LYS C 1 55 ? 21.953 -37.753 73.631 1.00 99.20  ? 320 LYS C O   1 
ATOM   1276 C  CB  . LYS C 1 55 ? 20.338 -35.478 71.872 1.00 100.99 ? 320 LYS C CB  1 
ATOM   1277 C  CG  . LYS C 1 55 ? 18.941 -35.102 71.476 1.00 105.97 ? 320 LYS C CG  1 
ATOM   1278 C  CD  . LYS C 1 55 ? 18.801 -35.207 69.961 1.00 112.29 ? 320 LYS C CD  1 
ATOM   1279 C  CE  . LYS C 1 55 ? 17.993 -34.066 69.325 1.00 117.59 ? 320 LYS C CE  1 
ATOM   1280 N  NZ  . LYS C 1 55 ? 16.546 -34.025 69.735 1.00 124.87 ? 320 LYS C NZ  1 
ATOM   1281 N  N   . VAL C 1 56 ? 22.903 -35.755 73.840 1.00 84.57  ? 321 VAL C N   1 
ATOM   1282 C  CA  . VAL C 1 56 ? 24.251 -36.315 74.034 1.00 81.95  ? 321 VAL C CA  1 
ATOM   1283 C  C   . VAL C 1 56 ? 24.354 -37.121 75.344 1.00 82.57  ? 321 VAL C C   1 
ATOM   1284 O  O   . VAL C 1 56 ? 25.116 -38.108 75.421 1.00 81.59  ? 321 VAL C O   1 
ATOM   1285 C  CB  . VAL C 1 56 ? 25.352 -35.208 73.982 1.00 79.28  ? 321 VAL C CB  1 
ATOM   1286 C  CG1 . VAL C 1 56 ? 26.715 -35.770 74.188 1.00 75.62  ? 321 VAL C CG1 1 
ATOM   1287 C  CG2 . VAL C 1 56 ? 25.342 -34.488 72.653 1.00 79.31  ? 321 VAL C CG2 1 
ATOM   1288 N  N   . GLN C 1 57 ? 23.617 -36.696 76.382 1.00 84.52  ? 322 GLN C N   1 
ATOM   1289 C  CA  . GLN C 1 57 ? 23.576 -37.487 77.624 1.00 85.01  ? 322 GLN C CA  1 
ATOM   1290 C  C   . GLN C 1 57 ? 22.825 -38.839 77.378 1.00 87.22  ? 322 GLN C C   1 
ATOM   1291 O  O   . GLN C 1 57 ? 23.362 -39.870 77.716 1.00 86.48  ? 322 GLN C O   1 
ATOM   1292 C  CB  . GLN C 1 57 ? 23.085 -36.677 78.850 1.00 84.83  ? 322 GLN C CB  1 
ATOM   1293 N  N   . GLN C 1 58 ? 21.647 -38.831 76.743 1.00 91.00  ? 323 GLN C N   1 
ATOM   1294 C  CA  . GLN C 1 58 ? 20.952 -40.058 76.422 1.00 93.72  ? 323 GLN C CA  1 
ATOM   1295 C  C   . GLN C 1 58 ? 21.816 -40.949 75.535 1.00 93.29  ? 323 GLN C C   1 
ATOM   1296 O  O   . GLN C 1 58 ? 21.819 -42.162 75.676 1.00 95.04  ? 323 GLN C O   1 
ATOM   1297 C  CB  . GLN C 1 58 ? 19.608 -39.782 75.748 1.00 96.57  ? 323 GLN C CB  1 
ATOM   1298 N  N   . LEU C 1 59 ? 22.567 -40.354 74.626 1.00 86.48  ? 324 LEU C N   1 
ATOM   1299 C  CA  . LEU C 1 59 ? 23.447 -41.101 73.716 1.00 85.31  ? 324 LEU C CA  1 
ATOM   1300 C  C   . LEU C 1 59 ? 24.678 -41.596 74.434 1.00 83.70  ? 324 LEU C C   1 
ATOM   1301 O  O   . LEU C 1 59 ? 25.252 -42.605 74.057 1.00 84.33  ? 324 LEU C O   1 
ATOM   1302 C  CB  . LEU C 1 59 ? 23.893 -40.172 72.600 1.00 84.04  ? 324 LEU C CB  1 
ATOM   1303 C  CG  . LEU C 1 59 ? 24.532 -40.611 71.299 1.00 83.61  ? 324 LEU C CG  1 
ATOM   1304 C  CD1 . LEU C 1 59 ? 23.762 -41.816 70.746 1.00 87.88  ? 324 LEU C CD1 1 
ATOM   1305 C  CD2 . LEU C 1 59 ? 24.584 -39.439 70.281 1.00 78.74  ? 324 LEU C CD2 1 
ATOM   1306 N  N   . GLU C 1 60 ? 25.101 -40.860 75.459 1.00 98.70  ? 325 GLU C N   1 
ATOM   1307 C  CA  . GLU C 1 60 ? 26.231 -41.245 76.314 1.00 97.06  ? 325 GLU C CA  1 
ATOM   1308 C  C   . GLU C 1 60 ? 25.837 -42.434 77.223 1.00 98.76  ? 325 GLU C C   1 
ATOM   1309 O  O   . GLU C 1 60 ? 26.693 -43.192 77.649 1.00 97.88  ? 325 GLU C O   1 
ATOM   1310 C  CB  . GLU C 1 60 ? 26.754 -40.030 77.132 1.00 94.99  ? 325 GLU C CB  1 
ATOM   1311 N  N   . ARG C 1 61 ? 24.536 -42.596 77.489 1.00 97.48  ? 326 ARG C N   1 
ATOM   1312 C  CA  . ARG C 1 61 ? 24.016 -43.593 78.434 1.00 99.17  ? 326 ARG C CA  1 
ATOM   1313 C  C   . ARG C 1 61 ? 23.605 -44.913 77.710 1.00 101.43 ? 326 ARG C C   1 
ATOM   1314 O  O   . ARG C 1 61 ? 23.327 -45.952 78.335 1.00 102.82 ? 326 ARG C O   1 
ATOM   1315 C  CB  . ARG C 1 61 ? 22.863 -43.006 79.273 1.00 100.53 ? 326 ARG C CB  1 
ATOM   1316 N  N   . SER C 1 62 ? 23.578 -44.861 76.389 1.00 104.09 ? 327 SER C N   1 
ATOM   1317 C  CA  . SER C 1 62 ? 23.390 -46.055 75.632 1.00 105.41 ? 327 SER C CA  1 
ATOM   1318 C  C   . SER C 1 62 ? 24.752 -46.666 75.382 1.00 103.51 ? 327 SER C C   1 
ATOM   1319 O  O   . SER C 1 62 ? 24.921 -47.865 75.580 1.00 104.83 ? 327 SER C O   1 
ATOM   1320 C  CB  . SER C 1 62 ? 22.680 -45.756 74.333 1.00 106.76 ? 327 SER C CB  1 
ATOM   1321 O  OG  . SER C 1 62 ? 21.392 -45.276 74.633 1.00 109.66 ? 327 SER C OG  1 
ATOM   1322 N  N   . ILE C 1 63 ? 25.725 -45.849 74.970 1.00 99.03  ? 328 ILE C N   1 
ATOM   1323 C  CA  . ILE C 1 63 ? 27.090 -46.348 74.618 1.00 95.68  ? 328 ILE C CA  1 
ATOM   1324 C  C   . ILE C 1 63 ? 28.005 -46.667 75.839 1.00 94.00  ? 328 ILE C C   1 
ATOM   1325 O  O   . ILE C 1 63 ? 28.329 -45.858 76.754 1.00 91.71  ? 328 ILE C O   1 
ATOM   1326 C  CB  . ILE C 1 63 ? 27.777 -45.466 73.508 1.00 93.77  ? 328 ILE C CB  1 
ATOM   1327 C  CG1 . ILE C 1 63 ? 26.863 -45.419 72.282 1.00 95.31  ? 328 ILE C CG1 1 
ATOM   1328 C  CG2 . ILE C 1 63 ? 29.171 -45.982 73.146 1.00 89.05  ? 328 ILE C CG2 1 
ATOM   1329 C  CD1 . ILE C 1 63 ? 26.776 -44.058 71.612 1.00 96.83  ? 328 ILE C CD1 1 
ATOM   1330 N  N   . MET D 2 1  ? 40.817 22.925  62.082 1.00 71.53  ? 25  MET D N   1 
ATOM   1331 C  CA  . MET D 2 1  ? 40.729 22.599  63.582 1.00 74.06  ? 25  MET D CA  1 
ATOM   1332 C  C   . MET D 2 1  ? 40.116 21.253  64.090 1.00 72.20  ? 25  MET D C   1 
ATOM   1333 O  O   . MET D 2 1  ? 40.140 20.970  65.280 1.00 73.40  ? 25  MET D O   1 
ATOM   1334 C  CB  . MET D 2 1  ? 40.106 23.785  64.373 1.00 75.85  ? 25  MET D CB  1 
ATOM   1335 N  N   . LEU D 2 2  ? 39.617 20.422  63.177 1.00 81.60  ? 26  LEU D N   1 
ATOM   1336 C  CA  . LEU D 2 2  ? 38.880 19.181  63.484 1.00 78.99  ? 26  LEU D CA  1 
ATOM   1337 C  C   . LEU D 2 2  ? 38.922 18.318  62.215 1.00 76.76  ? 26  LEU D C   1 
ATOM   1338 O  O   . LEU D 2 2  ? 38.852 18.878  61.123 1.00 76.91  ? 26  LEU D O   1 
ATOM   1339 C  CB  . LEU D 2 2  ? 37.420 19.517  63.829 1.00 78.16  ? 26  LEU D CB  1 
ATOM   1340 C  CG  . LEU D 2 2  ? 36.473 18.327  64.021 1.00 76.19  ? 26  LEU D CG  1 
ATOM   1341 C  CD1 . LEU D 2 2  ? 37.351 17.125  64.408 1.00 78.77  ? 26  LEU D CD1 1 
ATOM   1342 C  CD2 . LEU D 2 2  ? 35.327 18.566  65.037 1.00 70.42  ? 26  LEU D CD2 1 
ATOM   1343 N  N   . SER D 2 3  ? 39.023 16.987  62.335 1.00 64.26  ? 27  SER D N   1 
ATOM   1344 C  CA  . SER D 2 3  ? 39.513 16.151  61.239 1.00 61.52  ? 27  SER D CA  1 
ATOM   1345 C  C   . SER D 2 3  ? 38.696 16.338  59.965 1.00 59.30  ? 27  SER D C   1 
ATOM   1346 O  O   . SER D 2 3  ? 37.456 16.465  60.039 1.00 58.45  ? 27  SER D O   1 
ATOM   1347 C  CB  . SER D 2 3  ? 39.486 14.694  61.658 1.00 61.80  ? 27  SER D CB  1 
ATOM   1348 O  OG  . SER D 2 3  ? 38.419 13.986  61.025 1.00 61.26  ? 27  SER D OG  1 
ATOM   1349 N  N   . CYS D 2 4  ? 39.341 16.334  58.790 1.00 66.25  ? 28  CYS D N   1 
ATOM   1350 C  CA  . CYS D 2 4  ? 38.574 16.391  57.519 1.00 63.58  ? 28  CYS D CA  1 
ATOM   1351 C  C   . CYS D 2 4  ? 37.446 15.392  57.501 1.00 61.83  ? 28  CYS D C   1 
ATOM   1352 O  O   . CYS D 2 4  ? 36.293 15.779  57.238 1.00 61.28  ? 28  CYS D O   1 
ATOM   1353 C  CB  . CYS D 2 4  ? 39.442 16.168  56.317 1.00 63.45  ? 28  CYS D CB  1 
ATOM   1354 S  SG  . CYS D 2 4  ? 40.731 17.392  56.230 1.00 68.22  ? 28  CYS D SG  1 
ATOM   1355 N  N   . GLU D 2 5  ? 37.772 14.135  57.839 1.00 57.52  ? 29  GLU D N   1 
ATOM   1356 C  CA  . GLU D 2 5  ? 36.807 13.032  57.878 1.00 55.57  ? 29  GLU D CA  1 
ATOM   1357 C  C   . GLU D 2 5  ? 35.505 13.462  58.544 1.00 53.93  ? 29  GLU D C   1 
ATOM   1358 O  O   . GLU D 2 5  ? 34.409 13.321  57.958 1.00 52.66  ? 29  GLU D O   1 
ATOM   1359 C  CB  . GLU D 2 5  ? 37.377 11.783  58.569 1.00 56.50  ? 29  GLU D CB  1 
ATOM   1360 C  CG  . GLU D 2 5  ? 36.393 10.643  58.557 1.00 60.60  ? 29  GLU D CG  1 
ATOM   1361 C  CD  . GLU D 2 5  ? 36.896 9.310   59.155 1.00 69.62  ? 29  GLU D CD  1 
ATOM   1362 O  OE1 . GLU D 2 5  ? 36.484 8.959   60.320 1.00 69.72  ? 29  GLU D OE1 1 
ATOM   1363 O  OE2 . GLU D 2 5  ? 37.658 8.609   58.427 1.00 73.01  ? 29  GLU D OE2 1 
ATOM   1364 N  N   . LEU D 2 6  ? 35.617 14.014  59.753 1.00 59.32  ? 30  LEU D N   1 
ATOM   1365 C  CA  . LEU D 2 6  ? 34.429 14.515  60.437 1.00 57.45  ? 30  LEU D CA  1 
ATOM   1366 C  C   . LEU D 2 6  ? 33.754 15.668  59.721 1.00 55.12  ? 30  LEU D C   1 
ATOM   1367 O  O   . LEU D 2 6  ? 32.532 15.774  59.769 1.00 56.22  ? 30  LEU D O   1 
ATOM   1368 C  CB  . LEU D 2 6  ? 34.727 14.928  61.853 1.00 59.13  ? 30  LEU D CB  1 
ATOM   1369 C  CG  . LEU D 2 6  ? 35.049 13.721  62.696 1.00 60.78  ? 30  LEU D CG  1 
ATOM   1370 C  CD1 . LEU D 2 6  ? 35.505 14.187  64.094 1.00 64.11  ? 30  LEU D CD1 1 
ATOM   1371 C  CD2 . LEU D 2 6  ? 33.795 13.003  62.818 1.00 60.46  ? 30  LEU D CD2 1 
ATOM   1372 N  N   . TYR D 2 7  ? 34.490 16.534  59.041 1.00 53.01  ? 31  TYR D N   1 
ATOM   1373 C  CA  . TYR D 2 7  ? 33.764 17.536  58.272 1.00 50.37  ? 31  TYR D CA  1 
ATOM   1374 C  C   . TYR D 2 7  ? 32.986 16.843  57.182 1.00 48.22  ? 31  TYR D C   1 
ATOM   1375 O  O   . TYR D 2 7  ? 31.805 17.137  57.011 1.00 48.50  ? 31  TYR D O   1 
ATOM   1376 C  CB  . TYR D 2 7  ? 34.662 18.579  57.673 1.00 51.19  ? 31  TYR D CB  1 
ATOM   1377 C  CG  . TYR D 2 7  ? 34.839 19.732  58.631 1.00 55.16  ? 31  TYR D CG  1 
ATOM   1378 C  CD1 . TYR D 2 7  ? 35.981 19.817  59.456 1.00 59.53  ? 31  TYR D CD1 1 
ATOM   1379 C  CD2 . TYR D 2 7  ? 33.838 20.711  58.764 1.00 55.81  ? 31  TYR D CD2 1 
ATOM   1380 C  CE1 . TYR D 2 7  ? 36.135 20.893  60.356 1.00 65.37  ? 31  TYR D CE1 1 
ATOM   1381 C  CE2 . TYR D 2 7  ? 33.955 21.776  59.636 1.00 58.00  ? 31  TYR D CE2 1 
ATOM   1382 C  CZ  . TYR D 2 7  ? 35.100 21.891  60.424 1.00 66.02  ? 31  TYR D CZ  1 
ATOM   1383 O  OH  . TYR D 2 7  ? 35.195 22.976  61.300 1.00 68.92  ? 31  TYR D OH  1 
ATOM   1384 N  N   . ARG D 2 8  ? 33.603 15.900  56.493 1.00 47.07  ? 32  ARG D N   1 
ATOM   1385 C  CA  . ARG D 2 8  ? 32.889 15.062  55.491 1.00 46.71  ? 32  ARG D CA  1 
ATOM   1386 C  C   . ARG D 2 8  ? 31.757 14.282  56.101 1.00 46.90  ? 32  ARG D C   1 
ATOM   1387 O  O   . ARG D 2 8  ? 30.699 14.068  55.489 1.00 46.32  ? 32  ARG D O   1 
ATOM   1388 C  CB  . ARG D 2 8  ? 33.849 14.058  54.826 1.00 47.29  ? 32  ARG D CB  1 
ATOM   1389 C  CG  . ARG D 2 8  ? 34.631 14.836  53.777 1.00 47.35  ? 32  ARG D CG  1 
ATOM   1390 C  CD  . ARG D 2 8  ? 35.834 14.095  53.302 1.00 58.50  ? 32  ARG D CD  1 
ATOM   1391 N  NE  . ARG D 2 8  ? 36.244 12.852  53.999 1.00 57.89  ? 32  ARG D NE  1 
ATOM   1392 C  CZ  . ARG D 2 8  ? 37.546 12.624  54.280 1.00 59.22  ? 32  ARG D CZ  1 
ATOM   1393 N  NH1 . ARG D 2 8  ? 38.432 13.566  53.981 1.00 57.12  ? 32  ARG D NH1 1 
ATOM   1394 N  NH2 . ARG D 2 8  ? 37.988 11.510  54.860 1.00 57.16  ? 32  ARG D NH2 1 
ATOM   1395 N  N   . MET D 2 9  ? 31.904 13.905  57.357 1.00 50.78  ? 33  MET D N   1 
ATOM   1396 C  CA  . MET D 2 9  ? 30.797 13.166  57.897 1.00 51.81  ? 33  MET D CA  1 
ATOM   1397 C  C   . MET D 2 9  ? 29.597 14.102  58.098 1.00 50.45  ? 33  MET D C   1 
ATOM   1398 O  O   . MET D 2 9  ? 28.441 13.655  58.009 1.00 51.66  ? 33  MET D O   1 
ATOM   1399 C  CB  . MET D 2 9  ? 31.221 12.467  59.201 1.00 54.35  ? 33  MET D CB  1 
ATOM   1400 C  CG  . MET D 2 9  ? 30.112 11.606  59.825 1.00 60.39  ? 33  MET D CG  1 
ATOM   1401 S  SD  . MET D 2 9  ? 30.889 10.288  60.871 1.00 72.11  ? 33  MET D SD  1 
ATOM   1402 C  CE  . MET D 2 9  ? 30.559 11.131  62.435 1.00 66.59  ? 33  MET D CE  1 
ATOM   1403 N  N   . SER D 2 10 ? 29.838 15.381  58.381 1.00 44.87  ? 34  SER D N   1 
ATOM   1404 C  CA  . SER D 2 10 ? 28.708 16.212  58.747 1.00 44.15  ? 34  SER D CA  1 
ATOM   1405 C  C   . SER D 2 10 ? 27.863 16.361  57.538 1.00 44.54  ? 34  SER D C   1 
ATOM   1406 O  O   . SER D 2 10 ? 26.628 16.615  57.685 1.00 46.88  ? 34  SER D O   1 
ATOM   1407 C  CB  . SER D 2 10 ? 29.125 17.626  59.173 1.00 44.27  ? 34  SER D CB  1 
ATOM   1408 O  OG  . SER D 2 10 ? 29.882 18.208  58.129 1.00 41.82  ? 34  SER D OG  1 
ATOM   1409 N  N   . THR D 2 11 ? 28.433 16.240  56.325 1.00 42.51  ? 35  THR D N   1 
ATOM   1410 C  CA  . THR D 2 11 ? 27.460 16.438  55.188 1.00 43.27  ? 35  THR D CA  1 
ATOM   1411 C  C   . THR D 2 11 ? 26.459 15.285  55.093 1.00 46.44  ? 35  THR D C   1 
ATOM   1412 O  O   . THR D 2 11 ? 25.576 15.294  54.207 1.00 48.09  ? 35  THR D O   1 
ATOM   1413 C  CB  . THR D 2 11 ? 28.108 16.390  53.856 1.00 42.40  ? 35  THR D CB  1 
ATOM   1414 O  OG1 . THR D 2 11 ? 28.708 15.070  53.736 1.00 39.63  ? 35  THR D OG1 1 
ATOM   1415 C  CG2 . THR D 2 11 ? 29.170 17.577  53.748 1.00 38.47  ? 35  THR D CG2 1 
ATOM   1416 N  N   . TYR D 2 12 ? 26.619 14.224  55.900 1.00 41.97  ? 36  TYR D N   1 
ATOM   1417 C  CA  . TYR D 2 12 ? 25.595 13.145  55.785 1.00 44.22  ? 36  TYR D CA  1 
ATOM   1418 C  C   . TYR D 2 12 ? 24.327 13.374  56.603 1.00 47.26  ? 36  TYR D C   1 
ATOM   1419 O  O   . TYR D 2 12 ? 23.464 12.499  56.603 1.00 49.39  ? 36  TYR D O   1 
ATOM   1420 C  CB  . TYR D 2 12 ? 26.194 11.756  56.078 1.00 43.93  ? 36  TYR D CB  1 
ATOM   1421 C  CG  . TYR D 2 12 ? 27.191 11.337  54.986 1.00 44.26  ? 36  TYR D CG  1 
ATOM   1422 C  CD1 . TYR D 2 12 ? 26.770 10.615  53.861 1.00 42.19  ? 36  TYR D CD1 1 
ATOM   1423 C  CD2 . TYR D 2 12 ? 28.520 11.740  55.035 1.00 44.23  ? 36  TYR D CD2 1 
ATOM   1424 C  CE1 . TYR D 2 12 ? 27.634 10.282  52.853 1.00 40.69  ? 36  TYR D CE1 1 
ATOM   1425 C  CE2 . TYR D 2 12 ? 29.409 11.376  54.012 1.00 44.19  ? 36  TYR D CE2 1 
ATOM   1426 C  CZ  . TYR D 2 12 ? 28.955 10.675  52.932 1.00 44.43  ? 36  TYR D CZ  1 
ATOM   1427 O  OH  . TYR D 2 12 ? 29.853 10.347  51.912 1.00 49.83  ? 36  TYR D OH  1 
ATOM   1428 N  N   . SER D 2 13 ? 24.166 14.495  57.315 1.00 53.62  ? 37  SER D N   1 
ATOM   1429 C  CA  . SER D 2 13 ? 22.971 14.625  58.198 1.00 57.15  ? 37  SER D CA  1 
ATOM   1430 C  C   . SER D 2 13 ? 21.622 14.421  57.469 1.00 60.26  ? 37  SER D C   1 
ATOM   1431 O  O   . SER D 2 13 ? 20.622 14.038  58.066 1.00 63.21  ? 37  SER D O   1 
ATOM   1432 C  CB  . SER D 2 13 ? 22.953 15.974  58.852 1.00 57.02  ? 37  SER D CB  1 
ATOM   1433 O  OG  . SER D 2 13 ? 23.168 16.979  57.860 1.00 60.17  ? 37  SER D OG  1 
ATOM   1434 N  N   . THR D 2 14 ? 21.639 14.650  56.164 1.00 63.33  ? 38  THR D N   1 
ATOM   1435 C  CA  . THR D 2 14 ? 20.498 14.605  55.254 1.00 65.45  ? 38  THR D CA  1 
ATOM   1436 C  C   . THR D 2 14 ? 20.494 13.326  54.476 1.00 66.35  ? 38  THR D C   1 
ATOM   1437 O  O   . THR D 2 14 ? 19.638 13.103  53.641 1.00 69.33  ? 38  THR D O   1 
ATOM   1438 C  CB  . THR D 2 14 ? 20.664 15.695  54.147 1.00 64.82  ? 38  THR D CB  1 
ATOM   1439 O  OG1 . THR D 2 14 ? 22.056 15.744  53.742 1.00 66.13  ? 38  THR D OG1 1 
ATOM   1440 C  CG2 . THR D 2 14 ? 20.241 17.064  54.651 1.00 64.83  ? 38  THR D CG2 1 
ATOM   1441 N  N   . PHE D 2 15 ? 21.480 12.483  54.670 1.00 56.79  ? 39  PHE D N   1 
ATOM   1442 C  CA  . PHE D 2 15 ? 21.539 11.246  53.865 1.00 57.75  ? 39  PHE D CA  1 
ATOM   1443 C  C   . PHE D 2 15 ? 20.215 10.452  53.983 1.00 61.42  ? 39  PHE D C   1 
ATOM   1444 O  O   . PHE D 2 15 ? 19.665 10.297  55.069 1.00 62.02  ? 39  PHE D O   1 
ATOM   1445 C  CB  . PHE D 2 15 ? 22.713 10.400  54.319 1.00 54.79  ? 39  PHE D CB  1 
ATOM   1446 C  CG  . PHE D 2 15 ? 23.269 9.503   53.282 1.00 52.51  ? 39  PHE D CG  1 
ATOM   1447 C  CD1 . PHE D 2 15 ? 23.696 10.017  52.057 1.00 52.05  ? 39  PHE D CD1 1 
ATOM   1448 C  CD2 . PHE D 2 15 ? 23.432 8.140   53.545 1.00 50.49  ? 39  PHE D CD2 1 
ATOM   1449 C  CE1 . PHE D 2 15 ? 24.241 9.160   51.069 1.00 52.88  ? 39  PHE D CE1 1 
ATOM   1450 C  CE2 . PHE D 2 15 ? 23.990 7.285   52.617 1.00 53.08  ? 39  PHE D CE2 1 
ATOM   1451 C  CZ  . PHE D 2 15 ? 24.407 7.783   51.355 1.00 53.77  ? 39  PHE D CZ  1 
ATOM   1452 N  N   . PRO D 2 16 ? 19.677 9.971   52.862 1.00 64.86  ? 40  PRO D N   1 
ATOM   1453 C  CA  . PRO D 2 16 ? 18.416 9.175   52.993 1.00 69.14  ? 40  PRO D CA  1 
ATOM   1454 C  C   . PRO D 2 16 ? 18.592 7.826   53.759 1.00 71.06  ? 40  PRO D C   1 
ATOM   1455 O  O   . PRO D 2 16 ? 19.661 7.169   53.670 1.00 70.64  ? 40  PRO D O   1 
ATOM   1456 C  CB  . PRO D 2 16 ? 18.022 8.953   51.541 1.00 70.25  ? 40  PRO D CB  1 
ATOM   1457 C  CG  . PRO D 2 16 ? 19.406 8.918   50.797 1.00 68.28  ? 40  PRO D CG  1 
ATOM   1458 C  CD  . PRO D 2 16 ? 20.173 10.017  51.469 1.00 64.93  ? 40  PRO D CD  1 
ATOM   1459 N  N   . ALA D 2 17 ? 17.575 7.441   54.530 1.00 69.73  ? 41  ALA D N   1 
ATOM   1460 C  CA  . ALA D 2 17 ? 17.648 6.200   55.378 1.00 72.76  ? 41  ALA D CA  1 
ATOM   1461 C  C   . ALA D 2 17 ? 17.578 4.871   54.621 1.00 74.95  ? 41  ALA D C   1 
ATOM   1462 O  O   . ALA D 2 17 ? 17.143 4.821   53.492 1.00 75.22  ? 41  ALA D O   1 
ATOM   1463 C  CB  . ALA D 2 17 ? 16.616 6.232   56.542 1.00 74.26  ? 41  ALA D CB  1 
ATOM   1464 N  N   . GLY D 2 18 ? 18.069 3.807   55.231 1.00 80.57  ? 42  GLY D N   1 
ATOM   1465 C  CA  . GLY D 2 18 ? 17.950 2.497   54.602 1.00 85.54  ? 42  GLY D CA  1 
ATOM   1466 C  C   . GLY D 2 18 ? 18.876 2.253   53.429 1.00 86.04  ? 42  GLY D C   1 
ATOM   1467 O  O   . GLY D 2 18 ? 18.825 1.214   52.769 1.00 88.47  ? 42  GLY D O   1 
ATOM   1468 N  N   . VAL D 2 19 ? 19.721 3.232   53.181 1.00 78.76  ? 43  VAL D N   1 
ATOM   1469 C  CA  . VAL D 2 19 ? 20.924 3.022   52.419 1.00 79.10  ? 43  VAL D CA  1 
ATOM   1470 C  C   . VAL D 2 19 ? 21.773 1.947   53.156 1.00 80.08  ? 43  VAL D C   1 
ATOM   1471 O  O   . VAL D 2 19 ? 22.073 2.089   54.355 1.00 80.29  ? 43  VAL D O   1 
ATOM   1472 C  CB  . VAL D 2 19 ? 21.659 4.353   52.326 1.00 76.44  ? 43  VAL D CB  1 
ATOM   1473 C  CG1 . VAL D 2 19 ? 22.079 4.868   53.811 1.00 76.74  ? 43  VAL D CG1 1 
ATOM   1474 C  CG2 . VAL D 2 19 ? 22.805 4.247   51.350 1.00 74.92  ? 43  VAL D CG2 1 
ATOM   1475 N  N   . PRO D 2 20 ? 22.141 0.855   52.468 1.00 92.18  ? 44  PRO D N   1 
ATOM   1476 C  CA  . PRO D 2 20 ? 22.788 -0.231  53.226 1.00 93.37  ? 44  PRO D CA  1 
ATOM   1477 C  C   . PRO D 2 20 ? 24.300 -0.067  53.364 1.00 91.43  ? 44  PRO D C   1 
ATOM   1478 O  O   . PRO D 2 20 ? 25.008 -1.078  53.528 1.00 93.73  ? 44  PRO D O   1 
ATOM   1479 C  CB  . PRO D 2 20 ? 22.490 -1.463  52.380 1.00 96.85  ? 44  PRO D CB  1 
ATOM   1480 C  CG  . PRO D 2 20 ? 22.537 -0.908  50.935 1.00 96.25  ? 44  PRO D CG  1 
ATOM   1481 C  CD  . PRO D 2 20 ? 21.959 0.505   51.041 1.00 94.12  ? 44  PRO D CD  1 
ATOM   1482 N  N   . VAL D 2 21 ? 24.786 1.177   53.286 1.00 91.17  ? 45  VAL D N   1 
ATOM   1483 C  CA  . VAL D 2 21 ? 26.200 1.481   53.580 1.00 88.38  ? 45  VAL D CA  1 
ATOM   1484 C  C   . VAL D 2 21 ? 26.409 2.579   54.600 1.00 84.84  ? 45  VAL D C   1 
ATOM   1485 O  O   . VAL D 2 21 ? 25.544 3.460   54.787 1.00 85.14  ? 45  VAL D O   1 
ATOM   1486 C  CB  . VAL D 2 21 ? 27.005 1.774   52.353 1.00 88.12  ? 45  VAL D CB  1 
ATOM   1487 C  CG1 . VAL D 2 21 ? 28.412 2.031   52.762 1.00 88.30  ? 45  VAL D CG1 1 
ATOM   1488 C  CG2 . VAL D 2 21 ? 26.992 0.547   51.430 1.00 90.84  ? 45  VAL D CG2 1 
ATOM   1489 N  N   . SER D 2 22 ? 27.533 2.494   55.309 1.00 75.79  ? 46  SER D N   1 
ATOM   1490 C  CA  . SER D 2 22 ? 27.762 3.385   56.427 1.00 72.31  ? 46  SER D CA  1 
ATOM   1491 C  C   . SER D 2 22 ? 28.061 4.800   55.906 1.00 69.30  ? 46  SER D C   1 
ATOM   1492 O  O   . SER D 2 22 ? 28.855 4.973   54.955 1.00 67.69  ? 46  SER D O   1 
ATOM   1493 C  CB  . SER D 2 22 ? 28.910 2.881   57.305 1.00 73.25  ? 46  SER D CB  1 
ATOM   1494 O  OG  . SER D 2 22 ? 28.543 2.900   58.684 1.00 74.70  ? 46  SER D OG  1 
ATOM   1495 N  N   . GLU D 2 23 ? 27.412 5.805   56.516 1.00 65.38  ? 47  GLU D N   1 
ATOM   1496 C  CA  . GLU D 2 23 ? 27.895 7.181   56.398 1.00 61.95  ? 47  GLU D CA  1 
ATOM   1497 C  C   . GLU D 2 23 ? 29.381 7.228   56.782 1.00 60.65  ? 47  GLU D C   1 
ATOM   1498 O  O   . GLU D 2 23 ? 30.220 7.666   56.004 1.00 59.27  ? 47  GLU D O   1 
ATOM   1499 C  CB  . GLU D 2 23 ? 27.095 8.128   57.296 1.00 61.86  ? 47  GLU D CB  1 
ATOM   1500 C  CG  . GLU D 2 23 ? 25.650 8.398   56.843 1.00 63.24  ? 47  GLU D CG  1 
ATOM   1501 C  CD  . GLU D 2 23 ? 24.692 7.438   57.458 1.00 67.40  ? 47  GLU D CD  1 
ATOM   1502 O  OE1 . GLU D 2 23 ? 24.471 7.549   58.690 1.00 68.32  ? 47  GLU D OE1 1 
ATOM   1503 O  OE2 . GLU D 2 23 ? 24.212 6.540   56.719 1.00 74.50  ? 47  GLU D OE2 1 
ATOM   1504 N  N   . ARG D 2 24 ? 29.709 6.715   57.972 1.00 59.80  ? 48  ARG D N   1 
ATOM   1505 C  CA  . ARG D 2 24 ? 31.101 6.636   58.461 1.00 59.00  ? 48  ARG D CA  1 
ATOM   1506 C  C   . ARG D 2 24 ? 32.054 6.029   57.447 1.00 60.01  ? 48  ARG D C   1 
ATOM   1507 O  O   . ARG D 2 24 ? 33.115 6.588   57.197 1.00 60.36  ? 48  ARG D O   1 
ATOM   1508 C  CB  . ARG D 2 24 ? 31.173 5.862   59.761 1.00 59.32  ? 48  ARG D CB  1 
ATOM   1509 C  CG  . ARG D 2 24 ? 32.554 5.770   60.274 1.00 57.31  ? 48  ARG D CG  1 
ATOM   1510 C  CD  . ARG D 2 24 ? 32.539 4.950   61.541 1.00 57.10  ? 48  ARG D CD  1 
ATOM   1511 N  NE  . ARG D 2 24 ? 31.836 5.641   62.617 1.00 53.49  ? 48  ARG D NE  1 
ATOM   1512 C  CZ  . ARG D 2 24 ? 32.325 6.686   63.274 1.00 47.99  ? 48  ARG D CZ  1 
ATOM   1513 N  NH1 . ARG D 2 24 ? 33.521 7.144   62.986 1.00 47.21  ? 48  ARG D NH1 1 
ATOM   1514 N  NH2 . ARG D 2 24 ? 31.635 7.238   64.238 1.00 46.75  ? 48  ARG D NH2 1 
ATOM   1515 N  N   . SER D 2 25 ? 31.667 4.914   56.837 1.00 63.92  ? 49  SER D N   1 
ATOM   1516 C  CA  . SER D 2 25 ? 32.529 4.313   55.838 1.00 65.76  ? 49  SER D CA  1 
ATOM   1517 C  C   . SER D 2 25 ? 32.634 5.128   54.527 1.00 63.28  ? 49  SER D C   1 
ATOM   1518 O  O   . SER D 2 25 ? 33.672 5.114   53.888 1.00 63.98  ? 49  SER D O   1 
ATOM   1519 C  CB  . SER D 2 25 ? 32.108 2.862   55.553 1.00 69.11  ? 49  SER D CB  1 
ATOM   1520 O  OG  . SER D 2 25 ? 31.109 2.803   54.531 1.00 74.07  ? 49  SER D OG  1 
ATOM   1521 N  N   . LEU D 2 26 ? 31.563 5.811   54.117 1.00 62.61  ? 50  LEU D N   1 
ATOM   1522 C  CA  . LEU D 2 26 ? 31.610 6.747   52.969 1.00 59.74  ? 50  LEU D CA  1 
ATOM   1523 C  C   . LEU D 2 26 ? 32.603 7.934   53.189 1.00 59.21  ? 50  LEU D C   1 
ATOM   1524 O  O   . LEU D 2 26 ? 33.549 8.140   52.395 1.00 57.96  ? 50  LEU D O   1 
ATOM   1525 C  CB  . LEU D 2 26 ? 30.207 7.241   52.667 1.00 57.30  ? 50  LEU D CB  1 
ATOM   1526 C  CG  . LEU D 2 26 ? 29.286 6.088   52.255 1.00 59.21  ? 50  LEU D CG  1 
ATOM   1527 C  CD1 . LEU D 2 26 ? 27.732 6.397   52.516 1.00 57.32  ? 50  LEU D CD1 1 
ATOM   1528 C  CD2 . LEU D 2 26 ? 29.552 5.702   50.796 1.00 53.23  ? 50  LEU D CD2 1 
ATOM   1529 N  N   . ALA D 2 27 ? 32.389 8.698   54.276 1.00 65.05  ? 51  ALA D N   1 
ATOM   1530 C  CA  . ALA D 2 27 ? 33.268 9.795   54.624 1.00 64.08  ? 51  ALA D CA  1 
ATOM   1531 C  C   . ALA D 2 27 ? 34.697 9.270   54.816 1.00 66.23  ? 51  ALA D C   1 
ATOM   1532 O  O   . ALA D 2 27 ? 35.688 9.936   54.426 1.00 65.94  ? 51  ALA D O   1 
ATOM   1533 C  CB  . ALA D 2 27 ? 32.809 10.456  55.861 1.00 63.53  ? 51  ALA D CB  1 
ATOM   1534 N  N   . ARG D 2 28 ? 34.830 8.084   55.413 1.00 63.36  ? 52  ARG D N   1 
ATOM   1535 C  CA  . ARG D 2 28 ? 36.189 7.565   55.661 1.00 64.56  ? 52  ARG D CA  1 
ATOM   1536 C  C   . ARG D 2 28 ? 36.871 7.355   54.319 1.00 63.71  ? 52  ARG D C   1 
ATOM   1537 O  O   . ARG D 2 28 ? 38.034 7.681   54.212 1.00 64.77  ? 52  ARG D O   1 
ATOM   1538 C  CB  . ARG D 2 28 ? 36.173 6.281   56.497 1.00 66.60  ? 52  ARG D CB  1 
ATOM   1539 C  CG  . ARG D 2 28 ? 37.533 5.669   56.814 1.00 71.24  ? 52  ARG D CG  1 
ATOM   1540 C  CD  . ARG D 2 28 ? 37.437 4.816   58.076 1.00 74.76  ? 52  ARG D CD  1 
ATOM   1541 N  NE  . ARG D 2 28 ? 37.251 5.600   59.314 1.00 77.68  ? 52  ARG D NE  1 
ATOM   1542 C  CZ  . ARG D 2 28 ? 36.886 5.074   60.493 1.00 79.83  ? 52  ARG D CZ  1 
ATOM   1543 N  NH1 . ARG D 2 28 ? 36.654 3.746   60.590 1.00 78.72  ? 52  ARG D NH1 1 
ATOM   1544 N  NH2 . ARG D 2 28 ? 36.738 5.867   61.570 1.00 77.01  ? 52  ARG D NH2 1 
ATOM   1545 N  N   . ALA D 2 29 ? 36.148 6.886   53.299 1.00 58.50  ? 53  ALA D N   1 
ATOM   1546 C  CA  . ALA D 2 29 ? 36.777 6.613   51.995 1.00 58.62  ? 53  ALA D CA  1 
ATOM   1547 C  C   . ALA D 2 29 ? 37.083 7.873   51.211 1.00 57.27  ? 53  ALA D C   1 
ATOM   1548 O  O   . ALA D 2 29 ? 37.633 7.812   50.092 1.00 58.21  ? 53  ALA D O   1 
ATOM   1549 C  CB  . ALA D 2 29 ? 35.959 5.652   51.134 1.00 58.60  ? 53  ALA D CB  1 
ATOM   1550 N  N   . GLY D 2 30 ? 36.702 9.021   51.783 1.00 71.04  ? 54  GLY D N   1 
ATOM   1551 C  CA  . GLY D 2 30 ? 36.960 10.342  51.175 1.00 67.72  ? 54  GLY D CA  1 
ATOM   1552 C  C   . GLY D 2 30 ? 35.808 11.008  50.476 1.00 66.17  ? 54  GLY D C   1 
ATOM   1553 O  O   . GLY D 2 30 ? 36.036 12.012  49.751 1.00 68.73  ? 54  GLY D O   1 
ATOM   1554 N  N   . PHE D 2 31 ? 34.578 10.534  50.685 1.00 53.88  ? 55  PHE D N   1 
ATOM   1555 C  CA  . PHE D 2 31 ? 33.430 11.012  49.899 1.00 52.78  ? 55  PHE D CA  1 
ATOM   1556 C  C   . PHE D 2 31 ? 32.541 11.792  50.807 1.00 52.22  ? 55  PHE D C   1 
ATOM   1557 O  O   . PHE D 2 31 ? 32.275 11.281  51.951 1.00 53.14  ? 55  PHE D O   1 
ATOM   1558 C  CB  . PHE D 2 31 ? 32.535 9.842   49.512 1.00 54.96  ? 55  PHE D CB  1 
ATOM   1559 C  CG  . PHE D 2 31 ? 33.141 8.932   48.542 1.00 59.27  ? 55  PHE D CG  1 
ATOM   1560 C  CD1 . PHE D 2 31 ? 33.324 9.356   47.203 1.00 63.88  ? 55  PHE D CD1 1 
ATOM   1561 C  CD2 . PHE D 2 31 ? 33.578 7.671   48.945 1.00 61.00  ? 55  PHE D CD2 1 
ATOM   1562 C  CE1 . PHE D 2 31 ? 33.932 8.510   46.220 1.00 64.91  ? 55  PHE D CE1 1 
ATOM   1563 C  CE2 . PHE D 2 31 ? 34.167 6.825   48.012 1.00 67.61  ? 55  PHE D CE2 1 
ATOM   1564 C  CZ  . PHE D 2 31 ? 34.338 7.257   46.607 1.00 66.70  ? 55  PHE D CZ  1 
ATOM   1565 N  N   . TYR D 2 32 ? 32.015 12.933  50.344 1.00 49.61  ? 56  TYR D N   1 
ATOM   1566 C  CA  . TYR D 2 32 ? 31.032 13.618  51.133 1.00 50.27  ? 56  TYR D CA  1 
ATOM   1567 C  C   . TYR D 2 32 ? 29.711 13.637  50.384 1.00 51.37  ? 56  TYR D C   1 
ATOM   1568 O  O   . TYR D 2 32 ? 29.680 13.413  49.166 1.00 52.72  ? 56  TYR D O   1 
ATOM   1569 C  CB  . TYR D 2 32 ? 31.455 15.049  51.313 1.00 50.53  ? 56  TYR D CB  1 
ATOM   1570 C  CG  . TYR D 2 32 ? 31.628 15.870  50.045 1.00 48.09  ? 56  TYR D CG  1 
ATOM   1571 C  CD1 . TYR D 2 32 ? 32.888 16.230  49.641 1.00 48.66  ? 56  TYR D CD1 1 
ATOM   1572 C  CD2 . TYR D 2 32 ? 30.519 16.401  49.332 1.00 49.44  ? 56  TYR D CD2 1 
ATOM   1573 C  CE1 . TYR D 2 32 ? 33.105 17.062  48.520 1.00 51.63  ? 56  TYR D CE1 1 
ATOM   1574 C  CE2 . TYR D 2 32 ? 30.716 17.250  48.172 1.00 46.15  ? 56  TYR D CE2 1 
ATOM   1575 C  CZ  . TYR D 2 32 ? 32.010 17.546  47.773 1.00 50.61  ? 56  TYR D CZ  1 
ATOM   1576 O  OH  . TYR D 2 32 ? 32.313 18.362  46.667 1.00 56.32  ? 56  TYR D OH  1 
ATOM   1577 N  N   . TYR D 2 33 ? 28.638 13.960  51.061 1.00 46.00  ? 57  TYR D N   1 
ATOM   1578 C  CA  . TYR D 2 33 ? 27.347 13.730  50.468 1.00 48.01  ? 57  TYR D CA  1 
ATOM   1579 C  C   . TYR D 2 33 ? 27.005 14.876  49.527 1.00 50.53  ? 57  TYR D C   1 
ATOM   1580 O  O   . TYR D 2 33 ? 27.245 16.050  49.839 1.00 51.02  ? 57  TYR D O   1 
ATOM   1581 C  CB  . TYR D 2 33 ? 26.272 13.648  51.570 1.00 48.01  ? 57  TYR D CB  1 
ATOM   1582 C  CG  . TYR D 2 33 ? 24.835 13.343  51.052 1.00 50.06  ? 57  TYR D CG  1 
ATOM   1583 C  CD1 . TYR D 2 33 ? 24.632 12.503  49.962 1.00 49.15  ? 57  TYR D CD1 1 
ATOM   1584 C  CD2 . TYR D 2 33 ? 23.689 13.933  51.650 1.00 49.29  ? 57  TYR D CD2 1 
ATOM   1585 C  CE1 . TYR D 2 33 ? 23.383 12.237  49.500 1.00 52.02  ? 57  TYR D CE1 1 
ATOM   1586 C  CE2 . TYR D 2 33 ? 22.440 13.656  51.179 1.00 50.39  ? 57  TYR D CE2 1 
ATOM   1587 C  CZ  . TYR D 2 33 ? 22.306 12.806  50.101 1.00 52.89  ? 57  TYR D CZ  1 
ATOM   1588 O  OH  . TYR D 2 33 ? 21.075 12.497  49.611 1.00 56.27  ? 57  TYR D OH  1 
ATOM   1589 N  N   . THR D 2 34 ? 26.369 14.559  48.404 1.00 56.76  ? 58  THR D N   1 
ATOM   1590 C  CA  . THR D 2 34 ? 25.968 15.595  47.500 1.00 58.46  ? 58  THR D CA  1 
ATOM   1591 C  C   . THR D 2 34 ? 24.587 16.147  47.776 1.00 61.54  ? 58  THR D C   1 
ATOM   1592 O  O   . THR D 2 34 ? 24.260 17.249  47.341 1.00 64.69  ? 58  THR D O   1 
ATOM   1593 C  CB  . THR D 2 34 ? 25.991 15.092  46.073 1.00 59.50  ? 58  THR D CB  1 
ATOM   1594 O  OG1 . THR D 2 34 ? 25.084 13.983  45.954 1.00 60.15  ? 58  THR D OG1 1 
ATOM   1595 C  CG2 . THR D 2 34 ? 27.421 14.724  45.668 1.00 56.37  ? 58  THR D CG2 1 
ATOM   1596 N  N   . GLY D 2 35 ? 23.725 15.428  48.469 1.00 61.30  ? 59  GLY D N   1 
ATOM   1597 C  CA  . GLY D 2 35 ? 22.398 16.001  48.726 1.00 62.71  ? 59  GLY D CA  1 
ATOM   1598 C  C   . GLY D 2 35 ? 21.399 15.593  47.676 1.00 65.42  ? 59  GLY D C   1 
ATOM   1599 O  O   . GLY D 2 35 ? 20.263 16.082  47.685 1.00 66.11  ? 59  GLY D O   1 
ATOM   1600 N  N   . VAL D 2 36 ? 21.853 14.710  46.783 1.00 56.24  ? 60  VAL D N   1 
ATOM   1601 C  CA  . VAL D 2 36 ? 21.038 14.093  45.742 1.00 59.94  ? 60  VAL D CA  1 
ATOM   1602 C  C   . VAL D 2 36 ? 21.044 12.576  45.965 1.00 61.16  ? 60  VAL D C   1 
ATOM   1603 O  O   . VAL D 2 36 ? 22.104 11.931  45.926 1.00 60.40  ? 60  VAL D O   1 
ATOM   1604 C  CB  . VAL D 2 36 ? 21.525 14.449  44.281 1.00 60.00  ? 60  VAL D CB  1 
ATOM   1605 N  N   . ASN D 2 37 ? 19.847 12.035  46.214 1.00 77.76  ? 61  ASN D N   1 
ATOM   1606 C  CA  . ASN D 2 37 ? 19.618 10.600  46.330 1.00 80.24  ? 61  ASN D CA  1 
ATOM   1607 C  C   . ASN D 2 37 ? 20.622 10.072  47.305 1.00 78.41  ? 61  ASN D C   1 
ATOM   1608 O  O   . ASN D 2 37 ? 20.751 10.601  48.423 1.00 76.69  ? 61  ASN D O   1 
ATOM   1609 C  CB  . ASN D 2 37 ? 19.781 9.864   44.966 1.00 83.38  ? 61  ASN D CB  1 
ATOM   1610 C  CG  . ASN D 2 37 ? 18.890 10.454  43.828 1.00 88.62  ? 61  ASN D CG  1 
ATOM   1611 O  OD1 . ASN D 2 37 ? 17.727 10.879  44.050 1.00 93.33  ? 61  ASN D OD1 1 
ATOM   1612 N  ND2 . ASN D 2 37 ? 19.454 10.496  42.607 1.00 91.49  ? 61  ASN D ND2 1 
ATOM   1613 N  N   . ASP D 2 38 ? 21.374 9.052   46.864 1.00 79.31  ? 62  ASP D N   1 
ATOM   1614 C  CA  . ASP D 2 38 ? 22.496 8.518   47.664 1.00 77.52  ? 62  ASP D CA  1 
ATOM   1615 C  C   . ASP D 2 38 ? 23.834 8.722   46.986 1.00 74.51  ? 62  ASP D C   1 
ATOM   1616 O  O   . ASP D 2 38 ? 24.781 7.989   47.267 1.00 73.88  ? 62  ASP D O   1 
ATOM   1617 C  CB  . ASP D 2 38 ? 22.278 7.057   48.117 1.00 79.56  ? 62  ASP D CB  1 
ATOM   1618 C  CG  . ASP D 2 38 ? 22.272 6.060   46.963 1.00 85.75  ? 62  ASP D CG  1 
ATOM   1619 O  OD1 . ASP D 2 38 ? 22.558 4.862   47.232 1.00 90.22  ? 62  ASP D OD1 1 
ATOM   1620 O  OD2 . ASP D 2 38 ? 21.986 6.458   45.797 1.00 92.37  ? 62  ASP D OD2 1 
ATOM   1621 N  N   . LYS D 2 39 ? 23.890 9.741   46.123 1.00 66.34  ? 63  LYS D N   1 
ATOM   1622 C  CA  . LYS D 2 39 ? 25.097 10.091  45.412 1.00 63.59  ? 63  LYS D CA  1 
ATOM   1623 C  C   . LYS D 2 39 ? 26.029 10.835  46.374 1.00 60.25  ? 63  LYS D C   1 
ATOM   1624 O  O   . LYS D 2 39 ? 25.591 11.806  47.073 1.00 59.32  ? 63  LYS D O   1 
ATOM   1625 C  CB  . LYS D 2 39 ? 24.751 10.917  44.165 1.00 64.58  ? 63  LYS D CB  1 
ATOM   1626 C  CG  . LYS D 2 39 ? 25.867 11.025  43.078 1.00 67.60  ? 63  LYS D CG  1 
ATOM   1627 C  CD  . LYS D 2 39 ? 25.395 11.737  41.777 1.00 73.77  ? 63  LYS D CD  1 
ATOM   1628 C  CE  . LYS D 2 39 ? 25.074 13.268  42.032 1.00 76.44  ? 63  LYS D CE  1 
ATOM   1629 N  NZ  . LYS D 2 39 ? 24.291 14.013  40.968 1.00 80.47  ? 63  LYS D NZ  1 
ATOM   1630 N  N   . VAL D 2 40 ? 27.282 10.369  46.443 1.00 51.01  ? 64  VAL D N   1 
ATOM   1631 C  CA  . VAL D 2 40 ? 28.308 11.042  47.215 1.00 48.32  ? 64  VAL D CA  1 
ATOM   1632 C  C   . VAL D 2 40 ? 29.478 11.368  46.324 1.00 49.05  ? 64  VAL D C   1 
ATOM   1633 O  O   . VAL D 2 40 ? 29.593 10.806  45.243 1.00 50.12  ? 64  VAL D O   1 
ATOM   1634 C  CB  . VAL D 2 40 ? 28.862 10.189  48.370 1.00 48.86  ? 64  VAL D CB  1 
ATOM   1635 C  CG1 . VAL D 2 40 ? 27.742 9.720   49.315 1.00 46.34  ? 64  VAL D CG1 1 
ATOM   1636 C  CG2 . VAL D 2 40 ? 29.688 9.010   47.830 1.00 47.76  ? 64  VAL D CG2 1 
ATOM   1637 N  N   . LYS D 2 41 ? 30.387 12.233  46.787 1.00 56.06  ? 65  LYS D N   1 
ATOM   1638 C  CA  . LYS D 2 41 ? 31.466 12.701  45.932 1.00 57.68  ? 65  LYS D CA  1 
ATOM   1639 C  C   . LYS D 2 41 ? 32.840 12.857  46.646 1.00 58.12  ? 65  LYS D C   1 
ATOM   1640 O  O   . LYS D 2 41 ? 32.912 13.400  47.760 1.00 58.69  ? 65  LYS D O   1 
ATOM   1641 C  CB  . LYS D 2 41 ? 30.985 14.000  45.287 1.00 58.14  ? 65  LYS D CB  1 
ATOM   1642 C  CG  . LYS D 2 41 ? 31.932 14.652  44.255 1.00 61.29  ? 65  LYS D CG  1 
ATOM   1643 C  CD  . LYS D 2 41 ? 31.422 16.034  43.879 1.00 61.98  ? 65  LYS D CD  1 
ATOM   1644 C  CE  . LYS D 2 41 ? 32.275 16.631  42.815 1.00 64.97  ? 65  LYS D CE  1 
ATOM   1645 N  NZ  . LYS D 2 41 ? 31.591 17.865  42.354 1.00 67.67  ? 65  LYS D NZ  1 
ATOM   1646 N  N   . CYS D 2 42 ? 33.919 12.377  46.034 1.00 57.43  ? 66  CYS D N   1 
ATOM   1647 C  CA  . CYS D 2 42 ? 35.189 12.373  46.727 1.00 58.05  ? 66  CYS D CA  1 
ATOM   1648 C  C   . CYS D 2 42 ? 35.691 13.786  46.652 1.00 58.09  ? 66  CYS D C   1 
ATOM   1649 O  O   . CYS D 2 42 ? 35.832 14.349  45.552 1.00 58.08  ? 66  CYS D O   1 
ATOM   1650 C  CB  . CYS D 2 42 ? 36.191 11.412  46.083 1.00 59.33  ? 66  CYS D CB  1 
ATOM   1651 S  SG  . CYS D 2 42 ? 38.010 11.720  46.576 1.00 63.10  ? 66  CYS D SG  1 
ATOM   1652 N  N   . PHE D 2 43 ? 35.962 14.385  47.816 1.00 58.31  ? 67  PHE D N   1 
ATOM   1653 C  CA  . PHE D 2 43 ? 36.495 15.779  47.826 1.00 58.79  ? 67  PHE D CA  1 
ATOM   1654 C  C   . PHE D 2 43 ? 37.802 15.947  47.022 1.00 59.65  ? 67  PHE D C   1 
ATOM   1655 O  O   . PHE D 2 43 ? 38.190 17.045  46.666 1.00 58.58  ? 67  PHE D O   1 
ATOM   1656 C  CB  . PHE D 2 43 ? 36.757 16.255  49.258 1.00 58.32  ? 67  PHE D CB  1 
ATOM   1657 C  CG  . PHE D 2 43 ? 38.019 15.727  49.820 1.00 61.68  ? 67  PHE D CG  1 
ATOM   1658 C  CD1 . PHE D 2 43 ? 39.100 16.582  50.069 1.00 65.36  ? 67  PHE D CD1 1 
ATOM   1659 C  CD2 . PHE D 2 43 ? 38.161 14.353  50.074 1.00 65.87  ? 67  PHE D CD2 1 
ATOM   1660 C  CE1 . PHE D 2 43 ? 40.379 16.078  50.592 1.00 67.68  ? 67  PHE D CE1 1 
ATOM   1661 C  CE2 . PHE D 2 43 ? 39.417 13.821  50.587 1.00 68.29  ? 67  PHE D CE2 1 
ATOM   1662 C  CZ  . PHE D 2 43 ? 40.536 14.698  50.858 1.00 66.49  ? 67  PHE D CZ  1 
ATOM   1663 N  N   . CYS D 2 44 ? 38.490 14.847  46.796 1.00 60.64  ? 68  CYS D N   1 
ATOM   1664 C  CA  . CYS D 2 44 ? 39.757 14.919  46.145 1.00 63.97  ? 68  CYS D CA  1 
ATOM   1665 C  C   . CYS D 2 44 ? 39.642 14.820  44.615 1.00 65.31  ? 68  CYS D C   1 
ATOM   1666 O  O   . CYS D 2 44 ? 40.110 15.682  43.848 1.00 65.07  ? 68  CYS D O   1 
ATOM   1667 C  CB  . CYS D 2 44 ? 40.640 13.797  46.650 1.00 64.51  ? 68  CYS D CB  1 
ATOM   1668 S  SG  . CYS D 2 44 ? 42.343 14.097  46.140 1.00 70.09  ? 68  CYS D SG  1 
ATOM   1669 N  N   . CYS D 2 45 ? 39.047 13.736  44.157 1.00 65.14  ? 69  CYS D N   1 
ATOM   1670 C  CA  . CYS D 2 45 ? 39.174 13.481  42.753 1.00 67.18  ? 69  CYS D CA  1 
ATOM   1671 C  C   . CYS D 2 45 ? 37.928 13.877  41.985 1.00 67.35  ? 69  CYS D C   1 
ATOM   1672 O  O   . CYS D 2 45 ? 37.983 13.978  40.755 1.00 68.86  ? 69  CYS D O   1 
ATOM   1673 C  CB  . CYS D 2 45 ? 39.519 12.028  42.541 1.00 68.27  ? 69  CYS D CB  1 
ATOM   1674 S  SG  . CYS D 2 45 ? 38.257 11.002  43.167 1.00 67.79  ? 69  CYS D SG  1 
ATOM   1675 N  N   . GLY D 2 46 ? 36.817 14.104  42.700 1.00 63.51  ? 70  GLY D N   1 
ATOM   1676 C  CA  . GLY D 2 46 ? 35.525 14.472  42.076 1.00 64.07  ? 70  GLY D CA  1 
ATOM   1677 C  C   . GLY D 2 46 ? 34.637 13.286  41.649 1.00 65.72  ? 70  GLY D C   1 
ATOM   1678 O  O   . GLY D 2 46 ? 33.582 13.458  40.960 1.00 64.94  ? 70  GLY D O   1 
ATOM   1679 N  N   . LEU D 2 47 ? 35.066 12.090  42.085 1.00 68.77  ? 71  LEU D N   1 
ATOM   1680 C  CA  . LEU D 2 47 ? 34.435 10.816  41.712 1.00 71.15  ? 71  LEU D CA  1 
ATOM   1681 C  C   . LEU D 2 47 ? 33.057 10.730  42.325 1.00 71.11  ? 71  LEU D C   1 
ATOM   1682 O  O   . LEU D 2 47 ? 32.911 10.866  43.550 1.00 69.26  ? 71  LEU D O   1 
ATOM   1683 C  CB  . LEU D 2 47 ? 35.311 9.606   42.122 1.00 71.79  ? 71  LEU D CB  1 
ATOM   1684 C  CG  . LEU D 2 47 ? 34.730 8.176   42.141 1.00 73.41  ? 71  LEU D CG  1 
ATOM   1685 C  CD1 . LEU D 2 47 ? 34.380 7.655   40.770 1.00 74.62  ? 71  LEU D CD1 1 
ATOM   1686 C  CD2 . LEU D 2 47 ? 35.668 7.198   42.790 1.00 72.51  ? 71  LEU D CD2 1 
ATOM   1687 N  N   . MET D 2 48 ? 32.061 10.520  41.464 1.00 71.42  ? 72  MET D N   1 
ATOM   1688 C  CA  . MET D 2 48 ? 30.690 10.373  41.918 1.00 72.44  ? 72  MET D CA  1 
ATOM   1689 C  C   . MET D 2 48 ? 30.171 8.958   41.845 1.00 75.17  ? 72  MET D C   1 
ATOM   1690 O  O   . MET D 2 48 ? 30.153 8.333   40.791 1.00 77.62  ? 72  MET D O   1 
ATOM   1691 C  CB  . MET D 2 48 ? 29.792 11.275  41.131 1.00 72.16  ? 72  MET D CB  1 
ATOM   1692 C  CG  . MET D 2 48 ? 29.408 12.463  41.925 1.00 72.21  ? 72  MET D CG  1 
ATOM   1693 S  SD  . MET D 2 48 ? 29.007 13.869  40.885 1.00 73.85  ? 72  MET D SD  1 
ATOM   1694 C  CE  . MET D 2 48 ? 30.544 14.051  39.917 1.00 74.70  ? 72  MET D CE  1 
ATOM   1695 N  N   . LEU D 2 49 ? 29.735 8.458   42.983 1.00 78.54  ? 73  LEU D N   1 
ATOM   1696 C  CA  . LEU D 2 49 ? 29.157 7.130   43.053 1.00 81.92  ? 73  LEU D CA  1 
ATOM   1697 C  C   . LEU D 2 49 ? 27.754 7.217   43.627 1.00 82.50  ? 73  LEU D C   1 
ATOM   1698 O  O   . LEU D 2 49 ? 27.546 8.037   44.508 1.00 81.69  ? 73  LEU D O   1 
ATOM   1699 C  CB  . LEU D 2 49 ? 30.044 6.228   43.914 1.00 81.96  ? 73  LEU D CB  1 
ATOM   1700 C  CG  . LEU D 2 49 ? 31.449 6.024   43.309 1.00 84.79  ? 73  LEU D CG  1 
ATOM   1701 C  CD1 . LEU D 2 49 ? 32.362 5.231   44.222 1.00 83.75  ? 73  LEU D CD1 1 
ATOM   1702 C  CD2 . LEU D 2 49 ? 31.396 5.368   41.901 1.00 89.60  ? 73  LEU D CD2 1 
ATOM   1703 N  N   . ASP D 2 50 ? 26.801 6.416   43.115 1.00 84.53  ? 74  ASP D N   1 
ATOM   1704 C  CA  . ASP D 2 50 ? 25.453 6.284   43.713 1.00 85.60  ? 74  ASP D CA  1 
ATOM   1705 C  C   . ASP D 2 50 ? 24.913 4.852   43.622 1.00 88.35  ? 74  ASP D C   1 
ATOM   1706 O  O   . ASP D 2 50 ? 25.692 3.939   43.384 1.00 88.62  ? 74  ASP D O   1 
ATOM   1707 C  CB  . ASP D 2 50 ? 24.448 7.376   43.240 1.00 85.69  ? 74  ASP D CB  1 
ATOM   1708 C  CG  . ASP D 2 50 ? 23.891 7.141   41.832 1.00 89.55  ? 74  ASP D CG  1 
ATOM   1709 O  OD1 . ASP D 2 50 ? 22.945 7.878   41.482 1.00 91.06  ? 74  ASP D OD1 1 
ATOM   1710 O  OD2 . ASP D 2 50 ? 24.359 6.240   41.094 1.00 92.03  ? 74  ASP D OD2 1 
ATOM   1711 N  N   . ASN D 2 51 ? 23.608 4.675   43.888 1.00 94.27  ? 75  ASN D N   1 
ATOM   1712 C  CA  . ASN D 2 51 ? 22.920 3.378   43.897 1.00 98.22  ? 75  ASN D CA  1 
ATOM   1713 C  C   . ASN D 2 51 ? 23.691 2.311   44.676 1.00 98.60  ? 75  ASN D C   1 
ATOM   1714 O  O   . ASN D 2 51 ? 24.063 1.301   44.092 1.00 101.31 ? 75  ASN D O   1 
ATOM   1715 C  CB  . ASN D 2 51 ? 22.687 2.912   42.445 1.00 101.84 ? 75  ASN D CB  1 
ATOM   1716 C  CG  . ASN D 2 51 ? 21.481 1.960   42.271 1.00 107.16 ? 75  ASN D CG  1 
ATOM   1717 O  OD1 . ASN D 2 51 ? 20.799 1.577   43.228 1.00 109.02 ? 75  ASN D OD1 1 
ATOM   1718 N  ND2 . ASN D 2 51 ? 21.224 1.582   41.017 1.00 112.41 ? 75  ASN D ND2 1 
ATOM   1719 N  N   . TRP D 2 52 ? 23.931 2.529   45.974 1.00 96.43  ? 76  TRP D N   1 
ATOM   1720 C  CA  . TRP D 2 52 ? 24.788 1.634   46.797 1.00 96.71  ? 76  TRP D CA  1 
ATOM   1721 C  C   . TRP D 2 52 ? 24.037 0.345   47.215 1.00 100.61 ? 76  TRP D C   1 
ATOM   1722 O  O   . TRP D 2 52 ? 22.869 0.429   47.622 1.00 101.57 ? 76  TRP D O   1 
ATOM   1723 C  CB  . TRP D 2 52 ? 25.369 2.361   48.064 1.00 93.42  ? 76  TRP D CB  1 
ATOM   1724 C  CG  . TRP D 2 52 ? 26.380 3.543   47.803 1.00 87.66  ? 76  TRP D CG  1 
ATOM   1725 C  CD1 . TRP D 2 52 ? 26.050 4.844   47.593 1.00 83.29  ? 76  TRP D CD1 1 
ATOM   1726 C  CD2 . TRP D 2 52 ? 27.838 3.493   47.734 1.00 82.43  ? 76  TRP D CD2 1 
ATOM   1727 N  NE1 . TRP D 2 52 ? 27.179 5.596   47.366 1.00 80.27  ? 76  TRP D NE1 1 
ATOM   1728 C  CE2 . TRP D 2 52 ? 28.288 4.799   47.456 1.00 79.14  ? 76  TRP D CE2 1 
ATOM   1729 C  CE3 . TRP D 2 52 ? 28.793 2.473   47.860 1.00 82.48  ? 76  TRP D CE3 1 
ATOM   1730 C  CZ2 . TRP D 2 52 ? 29.666 5.124   47.302 1.00 77.34  ? 76  TRP D CZ2 1 
ATOM   1731 C  CZ3 . TRP D 2 52 ? 30.182 2.802   47.724 1.00 79.84  ? 76  TRP D CZ3 1 
ATOM   1732 C  CH2 . TRP D 2 52 ? 30.592 4.116   47.448 1.00 77.73  ? 76  TRP D CH2 1 
ATOM   1733 N  N   . LYS D 2 53 ? 24.692 -0.825  47.128 1.00 87.47  ? 77  LYS D N   1 
ATOM   1734 C  CA  . LYS D 2 53 ? 24.090 -2.103  47.594 1.00 91.42  ? 77  LYS D CA  1 
ATOM   1735 C  C   . LYS D 2 53 ? 24.829 -2.686  48.831 1.00 91.77  ? 77  LYS D C   1 
ATOM   1736 O  O   . LYS D 2 53 ? 25.867 -2.162  49.237 1.00 89.70  ? 77  LYS D O   1 
ATOM   1737 C  CB  . LYS D 2 53 ? 23.952 -3.124  46.445 1.00 94.41  ? 77  LYS D CB  1 
ATOM   1738 N  N   . ARG D 2 54 ? 24.284 -3.740  49.448 1.00 95.29  ? 78  ARG D N   1 
ATOM   1739 C  CA  . ARG D 2 54 ? 24.935 -4.359  50.614 1.00 95.81  ? 78  ARG D CA  1 
ATOM   1740 C  C   . ARG D 2 54 ? 26.294 -4.964  50.215 1.00 97.29  ? 78  ARG D C   1 
ATOM   1741 O  O   . ARG D 2 54 ? 26.525 -5.292  49.028 1.00 98.72  ? 78  ARG D O   1 
ATOM   1742 C  CB  . ARG D 2 54 ? 24.016 -5.388  51.300 1.00 98.44  ? 78  ARG D CB  1 
ATOM   1743 N  N   . GLY D 2 55 ? 27.199 -5.052  51.198 1.00 100.75 ? 79  GLY D N   1 
ATOM   1744 C  CA  . GLY D 2 55 ? 28.562 -5.614  51.021 1.00 102.62 ? 79  GLY D CA  1 
ATOM   1745 C  C   . GLY D 2 55 ? 29.522 -4.888  50.069 1.00 101.26 ? 79  GLY D C   1 
ATOM   1746 O  O   . GLY D 2 55 ? 30.659 -5.351  49.880 1.00 102.53 ? 79  GLY D O   1 
ATOM   1747 N  N   . ASP D 2 56 ? 29.032 -3.787  49.453 1.00 99.73  ? 80  ASP D N   1 
ATOM   1748 C  CA  . ASP D 2 56 ? 29.814 -2.731  48.722 1.00 96.80  ? 80  ASP D CA  1 
ATOM   1749 C  C   . ASP D 2 56 ? 30.907 -2.160  49.615 1.00 94.41  ? 80  ASP D C   1 
ATOM   1750 O  O   . ASP D 2 56 ? 30.678 -1.893  50.802 1.00 93.47  ? 80  ASP D O   1 
ATOM   1751 C  CB  . ASP D 2 56 ? 28.908 -1.549  48.321 1.00 93.95  ? 80  ASP D CB  1 
ATOM   1752 C  CG  . ASP D 2 56 ? 28.181 -1.748  46.989 1.00 96.60  ? 80  ASP D CG  1 
ATOM   1753 O  OD1 . ASP D 2 56 ? 28.453 -0.976  46.044 1.00 95.11  ? 80  ASP D OD1 1 
ATOM   1754 O  OD2 . ASP D 2 56 ? 27.320 -2.648  46.874 1.00 101.09 ? 80  ASP D OD2 1 
ATOM   1755 N  N   . SER D 2 57 ? 32.103 -1.981  49.084 1.00 93.51  ? 81  SER D N   1 
ATOM   1756 C  CA  . SER D 2 57 ? 33.107 -1.316  49.893 1.00 91.49  ? 81  SER D CA  1 
ATOM   1757 C  C   . SER D 2 57 ? 33.480 -0.024  49.191 1.00 88.97  ? 81  SER D C   1 
ATOM   1758 O  O   . SER D 2 57 ? 34.056 -0.088  48.092 1.00 90.04  ? 81  SER D O   1 
ATOM   1759 C  CB  . SER D 2 57 ? 34.329 -2.194  50.151 1.00 93.95  ? 81  SER D CB  1 
ATOM   1760 O  OG  . SER D 2 57 ? 35.363 -1.468  50.809 1.00 92.80  ? 81  SER D OG  1 
ATOM   1761 N  N   . PRO D 2 58 ? 33.123 1.147   49.811 1.00 89.00  ? 82  PRO D N   1 
ATOM   1762 C  CA  . PRO D 2 58 ? 33.435 2.480   49.274 1.00 86.29  ? 82  PRO D CA  1 
ATOM   1763 C  C   . PRO D 2 58 ? 34.947 2.635   49.085 1.00 86.72  ? 82  PRO D C   1 
ATOM   1764 O  O   . PRO D 2 58 ? 35.405 3.124   48.029 1.00 86.34  ? 82  PRO D O   1 
ATOM   1765 C  CB  . PRO D 2 58 ? 32.916 3.427   50.355 1.00 83.78  ? 82  PRO D CB  1 
ATOM   1766 C  CG  . PRO D 2 58 ? 31.941 2.637   51.143 1.00 84.65  ? 82  PRO D CG  1 
ATOM   1767 C  CD  . PRO D 2 58 ? 32.427 1.234   51.115 1.00 87.93  ? 82  PRO D CD  1 
ATOM   1768 N  N   . THR D 2 59 ? 35.707 2.161   50.081 1.00 80.54  ? 83  THR D N   1 
ATOM   1769 C  CA  . THR D 2 59 ? 37.172 2.086   50.004 1.00 81.21  ? 83  THR D CA  1 
ATOM   1770 C  C   . THR D 2 59 ? 37.658 1.329   48.754 1.00 83.14  ? 83  THR D C   1 
ATOM   1771 O  O   . THR D 2 59 ? 38.373 1.903   47.937 1.00 82.59  ? 83  THR D O   1 
ATOM   1772 C  CB  . THR D 2 59 ? 37.767 1.493   51.301 1.00 82.79  ? 83  THR D CB  1 
ATOM   1773 O  OG1 . THR D 2 59 ? 37.067 2.011   52.449 1.00 80.64  ? 83  THR D OG1 1 
ATOM   1774 C  CG2 . THR D 2 59 ? 39.231 1.846   51.398 1.00 83.49  ? 83  THR D CG2 1 
ATOM   1775 N  N   . GLU D 2 60 ? 37.245 0.063   48.596 1.00 89.02  ? 84  GLU D N   1 
ATOM   1776 C  CA  . GLU D 2 60 ? 37.576 -0.723  47.383 1.00 91.91  ? 84  GLU D CA  1 
ATOM   1777 C  C   . GLU D 2 60 ? 37.085 -0.027  46.101 1.00 90.13  ? 84  GLU D C   1 
ATOM   1778 O  O   . GLU D 2 60 ? 37.899 0.376   45.293 1.00 90.30  ? 84  GLU D O   1 
ATOM   1779 C  CB  . GLU D 2 60 ? 37.094 -2.199  47.458 1.00 95.23  ? 84  GLU D CB  1 
ATOM   1780 N  N   . LYS D 2 61 ? 35.769 0.131   45.951 1.00 85.39  ? 85  LYS D N   1 
ATOM   1781 C  CA  . LYS D 2 61 ? 35.134 0.770   44.783 1.00 84.06  ? 85  LYS D CA  1 
ATOM   1782 C  C   . LYS D 2 61 ? 35.760 2.106   44.359 1.00 82.07  ? 85  LYS D C   1 
ATOM   1783 O  O   . LYS D 2 61 ? 35.715 2.451   43.178 1.00 81.35  ? 85  LYS D O   1 
ATOM   1784 C  CB  . LYS D 2 61 ? 33.643 0.960   45.058 1.00 82.64  ? 85  LYS D CB  1 
ATOM   1785 C  CG  . LYS D 2 61 ? 32.750 1.069   43.835 1.00 84.02  ? 85  LYS D CG  1 
ATOM   1786 C  CD  . LYS D 2 61 ? 31.274 0.828   44.197 1.00 85.52  ? 85  LYS D CD  1 
ATOM   1787 C  CE  . LYS D 2 61 ? 30.493 0.075   43.094 1.00 91.51  ? 85  LYS D CE  1 
ATOM   1788 N  NZ  . LYS D 2 61 ? 29.468 0.877   42.337 1.00 91.38  ? 85  LYS D NZ  1 
ATOM   1789 N  N   . HIS D 2 62 ? 36.290 2.865   45.336 1.00 83.03  ? 86  HIS D N   1 
ATOM   1790 C  CA  . HIS D 2 62 ? 37.121 4.080   45.098 1.00 81.76  ? 86  HIS D CA  1 
ATOM   1791 C  C   . HIS D 2 62 ? 38.384 3.589   44.335 1.00 85.73  ? 86  HIS D C   1 
ATOM   1792 O  O   . HIS D 2 62 ? 38.521 3.914   43.149 1.00 86.48  ? 86  HIS D O   1 
ATOM   1793 C  CB  . HIS D 2 62 ? 37.444 4.850   46.445 1.00 79.16  ? 86  HIS D CB  1 
ATOM   1794 C  CG  . HIS D 2 62 ? 37.795 6.328   46.318 1.00 71.72  ? 86  HIS D CG  1 
ATOM   1795 N  ND1 . HIS D 2 62 ? 38.009 7.123   47.427 1.00 62.45  ? 86  HIS D ND1 1 
ATOM   1796 C  CD2 . HIS D 2 62 ? 37.987 7.138   45.241 1.00 67.21  ? 86  HIS D CD2 1 
ATOM   1797 C  CE1 . HIS D 2 62 ? 38.316 8.351   47.043 1.00 60.52  ? 86  HIS D CE1 1 
ATOM   1798 N  NE2 . HIS D 2 62 ? 38.297 8.391   45.722 1.00 62.34  ? 86  HIS D NE2 1 
ATOM   1799 N  N   . LYS D 2 63 ? 39.261 2.776   44.975 1.00 89.86  ? 87  LYS D N   1 
ATOM   1800 C  CA  . LYS D 2 63 ? 40.497 2.219   44.308 1.00 94.17  ? 87  LYS D CA  1 
ATOM   1801 C  C   . LYS D 2 63 ? 40.234 1.704   42.840 1.00 96.96  ? 87  LYS D C   1 
ATOM   1802 O  O   . LYS D 2 63 ? 40.866 2.166   41.901 1.00 98.02  ? 87  LYS D O   1 
ATOM   1803 C  CB  . LYS D 2 63 ? 41.257 1.198   45.215 1.00 96.04  ? 87  LYS D CB  1 
ATOM   1804 N  N   . LYS D 2 64 ? 39.259 0.808   42.660 1.00 97.11  ? 88  LYS D N   1 
ATOM   1805 C  CA  . LYS D 2 64 ? 38.829 0.295   41.343 1.00 99.99  ? 88  LYS D CA  1 
ATOM   1806 C  C   . LYS D 2 64 ? 38.514 1.344   40.276 1.00 98.46  ? 88  LYS D C   1 
ATOM   1807 O  O   . LYS D 2 64 ? 38.738 1.098   39.107 1.00 100.98 ? 88  LYS D O   1 
ATOM   1808 C  CB  . LYS D 2 64 ? 37.585 -0.611  41.485 1.00 101.27 ? 88  LYS D CB  1 
ATOM   1809 C  CG  . LYS D 2 64 ? 37.832 -2.073  41.947 1.00 106.63 ? 88  LYS D CG  1 
ATOM   1810 C  CD  . LYS D 2 64 ? 36.644 -2.619  42.845 1.00 109.60 ? 88  LYS D CD  1 
ATOM   1811 C  CE  . LYS D 2 64 ? 35.628 -3.506  42.115 1.00 111.14 ? 88  LYS D CE  1 
ATOM   1812 N  NZ  . LYS D 2 64 ? 36.137 -4.909  42.076 1.00 116.24 ? 88  LYS D NZ  1 
ATOM   1813 N  N   . LEU D 2 65 ? 37.967 2.492   40.659 1.00 104.31 ? 89  LEU D N   1 
ATOM   1814 C  CA  . LEU D 2 65 ? 37.376 3.414   39.665 1.00 103.63 ? 89  LEU D CA  1 
ATOM   1815 C  C   . LEU D 2 65 ? 38.227 4.614   39.281 1.00 102.47 ? 89  LEU D C   1 
ATOM   1816 O  O   . LEU D 2 65 ? 37.959 5.247   38.256 1.00 102.96 ? 89  LEU D O   1 
ATOM   1817 C  CB  . LEU D 2 65 ? 35.944 3.867   40.051 1.00 101.49 ? 89  LEU D CB  1 
ATOM   1818 C  CG  . LEU D 2 65 ? 34.734 3.124   39.427 1.00 104.92 ? 89  LEU D CG  1 
ATOM   1819 C  CD1 . LEU D 2 65 ? 34.381 1.829   40.194 1.00 107.01 ? 89  LEU D CD1 1 
ATOM   1820 C  CD2 . LEU D 2 65 ? 33.456 4.011   39.205 1.00 104.08 ? 89  LEU D CD2 1 
ATOM   1821 N  N   . TYR D 2 66 ? 39.253 4.913   40.083 1.00 105.55 ? 90  TYR D N   1 
ATOM   1822 C  CA  . TYR D 2 66 ? 40.065 6.132   39.939 1.00 103.71 ? 90  TYR D CA  1 
ATOM   1823 C  C   . TYR D 2 66 ? 41.277 6.075   40.874 1.00 103.57 ? 90  TYR D C   1 
ATOM   1824 O  O   . TYR D 2 66 ? 41.284 6.724   41.924 1.00 101.29 ? 90  TYR D O   1 
ATOM   1825 C  CB  . TYR D 2 66 ? 39.213 7.341   40.300 1.00 100.46 ? 90  TYR D CB  1 
ATOM   1826 C  CG  . TYR D 2 66 ? 39.665 8.670   39.721 1.00 100.49 ? 90  TYR D CG  1 
ATOM   1827 C  CD1 . TYR D 2 66 ? 38.818 9.403   38.867 1.00 99.23  ? 90  TYR D CD1 1 
ATOM   1828 C  CD2 . TYR D 2 66 ? 40.924 9.212   40.034 1.00 101.57 ? 90  TYR D CD2 1 
ATOM   1829 C  CE1 . TYR D 2 66 ? 39.210 10.624  38.336 1.00 98.66  ? 90  TYR D CE1 1 
ATOM   1830 C  CE2 . TYR D 2 66 ? 41.333 10.439  39.495 1.00 101.06 ? 90  TYR D CE2 1 
ATOM   1831 C  CZ  . TYR D 2 66 ? 40.468 11.140  38.653 1.00 100.17 ? 90  TYR D CZ  1 
ATOM   1832 O  OH  . TYR D 2 66 ? 40.861 12.365  38.150 1.00 100.35 ? 90  TYR D OH  1 
ATOM   1833 N  N   . PRO D 2 67 ? 42.307 5.298   40.497 1.00 96.89  ? 91  PRO D N   1 
ATOM   1834 C  CA  . PRO D 2 67 ? 43.394 5.014   41.460 1.00 97.19  ? 91  PRO D CA  1 
ATOM   1835 C  C   . PRO D 2 67 ? 44.469 6.113   41.528 1.00 96.14  ? 91  PRO D C   1 
ATOM   1836 O  O   . PRO D 2 67 ? 45.326 6.082   42.428 1.00 96.59  ? 91  PRO D O   1 
ATOM   1837 C  CB  . PRO D 2 67 ? 43.969 3.685   40.964 1.00 101.09 ? 91  PRO D CB  1 
ATOM   1838 C  CG  . PRO D 2 67 ? 43.253 3.398   39.609 1.00 102.54 ? 91  PRO D CG  1 
ATOM   1839 C  CD  . PRO D 2 67 ? 42.521 4.639   39.201 1.00 99.55  ? 91  PRO D CD  1 
ATOM   1840 N  N   . SER D 2 68 ? 44.383 7.080   40.595 1.00 101.15 ? 92  SER D N   1 
ATOM   1841 C  CA  . SER D 2 68 ? 45.304 8.240   40.466 1.00 99.66  ? 92  SER D CA  1 
ATOM   1842 C  C   . SER D 2 68 ? 45.091 9.296   41.542 1.00 95.90  ? 92  SER D C   1 
ATOM   1843 O  O   . SER D 2 68 ? 45.758 10.340  41.545 1.00 96.10  ? 92  SER D O   1 
ATOM   1844 C  CB  . SER D 2 68 ? 45.133 8.909   39.080 1.00 99.76  ? 92  SER D CB  1 
ATOM   1845 O  OG  . SER D 2 68 ? 43.812 8.739   38.573 1.00 98.91  ? 92  SER D OG  1 
ATOM   1846 N  N   . CYS D 2 69 ? 44.091 9.044   42.381 1.00 85.65  ? 93  CYS D N   1 
ATOM   1847 C  CA  . CYS D 2 69 ? 43.603 10.018  43.343 1.00 81.31  ? 93  CYS D CA  1 
ATOM   1848 C  C   . CYS D 2 69 ? 44.625 10.180  44.446 1.00 80.16  ? 93  CYS D C   1 
ATOM   1849 O  O   . CYS D 2 69 ? 44.943 9.230   45.162 1.00 81.34  ? 93  CYS D O   1 
ATOM   1850 C  CB  . CYS D 2 69 ? 42.237 9.594   43.887 1.00 79.53  ? 93  CYS D CB  1 
ATOM   1851 S  SG  . CYS D 2 69 ? 41.551 10.708  45.135 1.00 78.65  ? 93  CYS D SG  1 
ATOM   1852 N  N   . ARG D 2 70 ? 45.140 11.394  44.581 1.00 77.98  ? 94  ARG D N   1 
ATOM   1853 C  CA  . ARG D 2 70 ? 46.083 11.680  45.629 1.00 77.59  ? 94  ARG D CA  1 
ATOM   1854 C  C   . ARG D 2 70 ? 45.567 11.169  46.931 1.00 75.94  ? 94  ARG D C   1 
ATOM   1855 O  O   . ARG D 2 70 ? 46.326 10.722  47.755 1.00 77.55  ? 94  ARG D O   1 
ATOM   1856 C  CB  . ARG D 2 70 ? 46.306 13.173  45.753 1.00 77.04  ? 94  ARG D CB  1 
ATOM   1857 N  N   . PHE D 2 71 ? 44.267 11.264  47.135 1.00 76.63  ? 95  PHE D N   1 
ATOM   1858 C  CA  . PHE D 2 71 ? 43.661 10.738  48.376 1.00 74.34  ? 95  PHE D CA  1 
ATOM   1859 C  C   . PHE D 2 71 ? 43.634 9.219   48.476 1.00 77.22  ? 95  PHE D C   1 
ATOM   1860 O  O   . PHE D 2 71 ? 44.043 8.657   49.493 1.00 78.11  ? 95  PHE D O   1 
ATOM   1861 C  CB  . PHE D 2 71 ? 42.240 11.253  48.617 1.00 69.49  ? 95  PHE D CB  1 
ATOM   1862 C  CG  . PHE D 2 71 ? 41.701 10.868  49.978 1.00 61.85  ? 95  PHE D CG  1 
ATOM   1863 C  CD1 . PHE D 2 71 ? 42.264 11.382  51.139 1.00 54.49  ? 95  PHE D CD1 1 
ATOM   1864 C  CD2 . PHE D 2 71 ? 40.669 9.961   50.110 1.00 55.70  ? 95  PHE D CD2 1 
ATOM   1865 C  CE1 . PHE D 2 71 ? 41.781 11.008  52.423 1.00 48.23  ? 95  PHE D CE1 1 
ATOM   1866 C  CE2 . PHE D 2 71 ? 40.190 9.571   51.390 1.00 50.49  ? 95  PHE D CE2 1 
ATOM   1867 C  CZ  . PHE D 2 71 ? 40.751 10.101  52.537 1.00 47.74  ? 95  PHE D CZ  1 
ATOM   1868 N  N   . VAL D 2 72 ? 43.111 8.573   47.439 1.00 72.24  ? 96  VAL D N   1 
ATOM   1869 C  CA  . VAL D 2 72 ? 42.918 7.127   47.467 1.00 76.40  ? 96  VAL D CA  1 
ATOM   1870 C  C   . VAL D 2 72 ? 44.226 6.394   47.726 1.00 81.21  ? 96  VAL D C   1 
ATOM   1871 O  O   . VAL D 2 72 ? 44.210 5.289   48.291 1.00 82.51  ? 96  VAL D O   1 
ATOM   1872 C  CB  . VAL D 2 72 ? 42.278 6.570   46.170 1.00 76.66  ? 96  VAL D CB  1 
ATOM   1873 C  CG1 . VAL D 2 72 ? 43.209 6.718   44.987 1.00 78.39  ? 96  VAL D CG1 1 
ATOM   1874 C  CG2 . VAL D 2 72 ? 41.945 5.114   46.357 1.00 78.88  ? 96  VAL D CG2 1 
ATOM   1875 N  N   . GLN D 2 73 ? 45.338 7.041   47.318 1.00 96.54  ? 97  GLN D N   1 
ATOM   1876 C  CA  . GLN D 2 73 ? 46.721 6.529   47.443 1.00 101.65 ? 97  GLN D CA  1 
ATOM   1877 C  C   . GLN D 2 73 ? 46.943 5.911   48.834 1.00 103.97 ? 97  GLN D C   1 
ATOM   1878 O  O   . GLN D 2 73 ? 47.743 4.948   48.950 1.00 107.71 ? 97  GLN D O   1 
ATOM   1879 C  CB  . GLN D 2 73 ? 47.780 7.614   47.153 1.00 102.28 ? 97  GLN D CB  1 
ATOM   1880 C  CG  . GLN D 2 73 ? 48.779 7.288   46.000 1.00 107.15 ? 97  GLN D CG  1 
ATOM   1881 C  CD  . GLN D 2 73 ? 48.210 7.583   44.570 1.00 108.08 ? 97  GLN D CD  1 
ATOM   1882 O  OE1 . GLN D 2 73 ? 48.663 8.514   43.857 1.00 106.56 ? 97  GLN D OE1 1 
ATOM   1883 N  NE2 . GLN D 2 73 ? 47.218 6.783   44.157 1.00 107.10 ? 97  GLN D NE2 1 
ATOM   1884 N  N   . SER D 2 74 ? 46.227 6.426   49.864 1.00 92.37  ? 98  SER D N   1 
ATOM   1885 C  CA  . SER D 2 74 ? 46.217 5.773   51.181 1.00 93.37  ? 98  SER D CA  1 
ATOM   1886 C  C   . SER D 2 74 ? 45.146 4.687   51.388 1.00 92.97  ? 98  SER D C   1 
ATOM   1887 O  O   . SER D 2 74 ? 43.949 4.955   51.301 1.00 90.56  ? 98  SER D O   1 
ATOM   1888 C  CB  . SER D 2 74 ? 46.169 6.788   52.299 1.00 91.71  ? 98  SER D CB  1 
ATOM   1889 O  OG  . SER D 2 74 ? 46.355 6.066   53.502 1.00 94.05  ? 98  SER D OG  1 
HETATM 1890 ZN ZN  . ZN  E 3 .  ? 39.187 10.386  45.257 1.00 68.90  ? 401 ZN  D ZN  1 
HETATM 1891 O  O   . HOH F 4 .  ? 33.995 -13.442 75.830 1.00 82.73  ? 2   HOH A O   1 
HETATM 1892 O  O   . HOH F 4 .  ? 21.052 15.894  79.923 1.00 39.49  ? 6   HOH A O   1 
HETATM 1893 O  O   . HOH F 4 .  ? 17.855 32.244  74.597 1.00 61.34  ? 7   HOH A O   1 
HETATM 1894 O  O   . HOH F 4 .  ? 24.606 9.221   80.658 1.00 62.32  ? 8   HOH A O   1 
HETATM 1895 O  O   . HOH F 4 .  ? 19.083 39.113  73.741 1.00 75.56  ? 19  HOH A O   1 
HETATM 1896 O  O   . HOH F 4 .  ? 24.329 10.729  79.041 1.00 76.26  ? 29  HOH A O   1 
HETATM 1897 O  O   . HOH F 4 .  ? 36.852 -35.856 71.622 1.00 92.74  ? 32  HOH A O   1 
HETATM 1898 O  O   . HOH G 4 .  ? 35.479 -2.220  69.431 1.00 65.28  ? 12  HOH B O   1 
HETATM 1899 O  O   . HOH G 4 .  ? 24.423 -43.296 60.820 1.00 83.50  ? 15  HOH B O   1 
HETATM 1900 O  O   . HOH G 4 .  ? 28.779 -38.604 64.599 1.00 57.99  ? 16  HOH B O   1 
HETATM 1901 O  O   . HOH G 4 .  ? 31.947 -37.840 65.008 1.00 76.63  ? 18  HOH B O   1 
HETATM 1902 O  O   . HOH G 4 .  ? 37.013 21.111  72.953 1.00 61.13  ? 20  HOH B O   1 
HETATM 1903 O  O   . HOH G 4 .  ? 32.535 -19.945 69.530 1.00 63.57  ? 27  HOH B O   1 
HETATM 1904 O  O   . HOH G 4 .  ? 30.953 13.016  74.368 1.00 68.34  ? 28  HOH B O   1 
HETATM 1905 O  O   . HOH G 4 .  ? 32.236 3.297   73.742 1.00 60.20  ? 31  HOH B O   1 
HETATM 1906 O  O   . HOH H 4 .  ? 29.876 2.149   61.447 1.00 64.20  ? 4   HOH C O   1 
HETATM 1907 O  O   . HOH H 4 .  ? 21.344 -22.939 64.710 1.00 74.75  ? 9   HOH C O   1 
HETATM 1908 O  O   . HOH H 4 .  ? 20.050 -42.731 77.813 1.00 79.05  ? 11  HOH C O   1 
HETATM 1909 O  O   . HOH H 4 .  ? 28.375 25.149  59.395 1.00 53.77  ? 14  HOH C O   1 
HETATM 1910 O  O   . HOH H 4 .  ? 26.179 0.509   61.280 1.00 59.58  ? 22  HOH C O   1 
HETATM 1911 O  O   . HOH H 4 .  ? 20.225 -39.120 72.379 1.00 64.58  ? 30  HOH C O   1 
HETATM 1912 O  O   . HOH H 4 .  ? 19.622 -36.984 78.918 1.00 79.40  ? 34  HOH C O   1 
HETATM 1913 O  O   . HOH I 4 .  ? 27.110 4.502   40.632 1.00 54.41  ? 1   HOH D O   1 
HETATM 1914 O  O   . HOH I 4 .  ? 40.698 13.118  58.155 1.00 43.71  ? 3   HOH D O   1 
HETATM 1915 O  O   . HOH I 4 .  ? 27.916 6.327   60.436 1.00 73.17  ? 5   HOH D O   1 
HETATM 1916 O  O   . HOH I 4 .  ? 21.946 5.045   40.538 1.00 68.42  ? 10  HOH D O   1 
HETATM 1917 O  O   . HOH I 4 .  ? 36.133 1.964   57.690 1.00 72.91  ? 13  HOH D O   1 
HETATM 1918 O  O   . HOH I 4 .  ? 25.722 -0.413  57.147 1.00 67.65  ? 17  HOH D O   1 
HETATM 1919 O  O   . HOH I 4 .  ? 19.230 8.420   56.808 1.00 65.80  ? 21  HOH D O   1 
HETATM 1920 O  O   . HOH I 4 .  ? 31.416 10.066  38.063 1.00 62.13  ? 23  HOH D O   1 
HETATM 1921 O  O   . HOH I 4 .  ? 28.297 -0.369  56.283 1.00 61.21  ? 24  HOH D O   1 
HETATM 1922 O  O   . HOH I 4 .  ? 24.151 17.815  55.720 1.00 55.19  ? 100 HOH D O   1 
HETATM 1923 O  O   . HOH I 4 .  ? 39.222 7.927   61.322 1.00 72.68  ? 101 HOH D O   1 
HETATM 1924 O  O   . HOH I 4 .  ? 38.491 21.249  67.767 1.00 60.41  ? 102 HOH D O   1 
HETATM 1925 O  O   . HOH I 4 .  ? 41.725 7.411   63.426 1.00 72.03  ? 103 HOH D O   1 
HETATM 1926 O  O   . HOH I 4 .  ? 49.896 10.854  44.457 1.00 67.77  ? 104 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLU A 2  ? 1.7571 1.0465 1.6585 0.0905  -0.1179 0.0776  267 GLU A N   
2    C CA  . GLU A 2  ? 1.7583 1.0321 1.6116 0.0722  -0.1148 0.0688  267 GLU A CA  
3    C C   . GLU A 2  ? 1.7267 1.0192 1.5724 0.0773  -0.0899 0.0560  267 GLU A C   
4    O O   . GLU A 2  ? 1.7069 1.0287 1.5776 0.0831  -0.0799 0.0582  267 GLU A O   
5    C CB  . GLU A 2  ? 1.7976 1.0307 1.6091 0.0615  -0.1256 0.0640  267 GLU A CB  
6    C CG  . GLU A 2  ? 1.8124 1.0268 1.5800 0.0381  -0.1283 0.0578  267 GLU A CG  
7    C CD  . GLU A 2  ? 1.8776 1.0482 1.6062 0.0240  -0.1440 0.0568  267 GLU A CD  
8    O OE1 . GLU A 2  ? 1.8976 1.0498 1.5904 0.0178  -0.1343 0.0430  267 GLU A OE1 
9    O OE2 . GLU A 2  ? 1.9025 1.0557 1.6352 0.0186  -0.1664 0.0695  267 GLU A OE2 
10   N N   . LEU A 3  ? 1.4557 0.7310 1.2675 0.0752  -0.0802 0.0428  268 LEU A N   
11   C CA  . LEU A 3  ? 1.4241 0.7127 1.2214 0.0746  -0.0609 0.0304  268 LEU A CA  
12   C C   . LEU A 3  ? 1.3903 0.7122 1.2181 0.0882  -0.0448 0.0311  268 LEU A C   
13   O O   . LEU A 3  ? 1.3733 0.7094 1.1956 0.0828  -0.0371 0.0272  268 LEU A O   
14   C CB  . LEU A 3  ? 1.4371 0.7049 1.2002 0.0740  -0.0516 0.0159  268 LEU A CB  
15   C CG  . LEU A 3  ? 1.4296 0.6904 1.1597 0.0574  -0.0478 0.0044  268 LEU A CG  
16   C CD1 . LEU A 3  ? 1.4565 0.6875 1.1581 0.0378  -0.0638 0.0049  268 LEU A CD1 
17   C CD2 . LEU A 3  ? 1.4285 0.6848 1.1377 0.0619  -0.0317 -0.0112 268 LEU A CD2 
18   N N   . LEU A 4  ? 1.4039 0.7370 1.2636 0.1046  -0.0400 0.0360  269 LEU A N   
19   C CA  . LEU A 4  ? 1.3745 0.7364 1.2614 0.1167  -0.0226 0.0356  269 LEU A CA  
20   C C   . LEU A 4  ? 1.3501 0.7363 1.2704 0.1162  -0.0272 0.0470  269 LEU A C   
21   O O   . LEU A 4  ? 1.3222 0.7302 1.2557 0.1206  -0.0134 0.0458  269 LEU A O   
22   C CB  . LEU A 4  ? 1.3879 0.7514 1.2959 0.1339  -0.0123 0.0339  269 LEU A CB  
23   C CG  . LEU A 4  ? 1.4025 0.7465 1.2813 0.1376  -0.0025 0.0218  269 LEU A CG  
24   C CD1 . LEU A 4  ? 1.4376 0.7721 1.3368 0.1494  -0.0061 0.0249  269 LEU A CD1 
25   C CD2 . LEU A 4  ? 1.3898 0.7455 1.2603 0.1433  0.0199  0.0119  269 LEU A CD2 
26   N N   . GLN A 5  ? 1.6959 1.0764 1.6290 0.1105  -0.0470 0.0580  270 GLN A N   
27   C CA  . GLN A 5  ? 1.6821 1.0824 1.6426 0.1070  -0.0545 0.0691  270 GLN A CA  
28   C C   . GLN A 5  ? 1.6460 1.0482 1.5809 0.0911  -0.0557 0.0673  270 GLN A C   
29   O O   . GLN A 5  ? 1.6178 1.0419 1.5682 0.0898  -0.0512 0.0711  270 GLN A O   
30   C CB  . GLN A 5  ? 1.7115 1.1009 1.6904 0.1048  -0.0779 0.0813  270 GLN A CB  
31   C CG  . GLN A 5  ? 1.7840 1.1786 1.8026 0.1220  -0.0780 0.0848  270 GLN A CG  
32   C CD  . GLN A 5  ? 1.8374 1.2636 1.9058 0.1304  -0.0736 0.0920  270 GLN A CD  
33   O OE1 . GLN A 5  ? 1.8754 1.3046 1.9720 0.1295  -0.0915 0.1032  270 GLN A OE1 
34   N NE2 . GLN A 5  ? 1.8299 1.2783 1.9079 0.1375  -0.0502 0.0854  270 GLN A NE2 
35   N N   . ARG A 6  ? 1.5661 0.9441 1.4624 0.0786  -0.0617 0.0608  271 ARG A N   
36   C CA  . ARG A 6  ? 1.5444 0.9211 1.4160 0.0627  -0.0626 0.0568  271 ARG A CA  
37   C C   . ARG A 6  ? 1.5131 0.9054 1.3782 0.0669  -0.0435 0.0466  271 ARG A C   
38   O O   . ARG A 6  ? 1.4990 0.9005 1.3573 0.0577  -0.0420 0.0451  271 ARG A O   
39   C CB  . ARG A 6  ? 1.5649 0.9099 1.3976 0.0479  -0.0717 0.0503  271 ARG A CB  
40   C CG  . ARG A 6  ? 1.5973 0.9242 1.4295 0.0375  -0.0936 0.0616  271 ARG A CG  
41   C CD  . ARG A 6  ? 1.6383 0.9401 1.4312 0.0152  -0.1012 0.0559  271 ARG A CD  
42   N NE  . ARG A 6  ? 1.6993 0.9675 1.4608 0.0101  -0.1057 0.0489  271 ARG A NE  
43   C CZ  . ARG A 6  ? 1.7403 0.9812 1.4640 -0.0100 -0.1109 0.0418  271 ARG A CZ  
44   N NH1 . ARG A 6  ? 1.7328 0.9771 1.4476 -0.0263 -0.1118 0.0407  271 ARG A NH1 
45   N NH2 . ARG A 6  ? 1.8001 1.0094 1.4946 -0.0143 -0.1143 0.0352  271 ARG A NH2 
46   N N   . CYS A 7  ? 1.3911 0.7857 1.2591 0.0808  -0.0297 0.0401  272 CYS A N   
47   C CA  . CYS A 7  ? 1.3590 0.7634 1.2171 0.0853  -0.0126 0.0301  272 CYS A CA  
48   C C   . CYS A 7  ? 1.3367 0.7677 1.2241 0.0942  -0.0027 0.0361  272 CYS A C   
49   O O   . CYS A 7  ? 1.3144 0.7568 1.1956 0.0911  0.0046  0.0329  272 CYS A O   
50   C CB  . CYS A 7  ? 1.3675 0.7584 1.2113 0.0946  -0.0026 0.0202  272 CYS A CB  
51   S SG  . CYS A 7  ? 1.3624 0.7568 1.1844 0.0965  0.0143  0.0066  272 CYS A SG  
52   N N   . GLU A 8  ? 1.3685 0.8081 1.2878 0.1050  -0.0022 0.0440  273 GLU A N   
53   C CA  . GLU A 8  ? 1.3509 0.8151 1.3029 0.1119  0.0058  0.0506  273 GLU A CA  
54   C C   . GLU A 8  ? 1.3246 0.8002 1.2791 0.1003  -0.0030 0.0575  273 GLU A C   
55   O O   . GLU A 8  ? 1.3148 0.8021 1.2643 0.0985  0.0063  0.0550  273 GLU A O   
56   C CB  . GLU A 8  ? 1.3716 0.8408 1.3614 0.1216  0.0008  0.0589  273 GLU A CB  
57   C CG  . GLU A 8  ? 1.3938 0.8810 1.4170 0.1353  0.0174  0.0588  273 GLU A CG  
58   C CD  . GLU A 8  ? 1.4946 0.9778 1.5495 0.1462  0.0119  0.0624  273 GLU A CD  
59   O OE1 . GLU A 8  ? 1.4984 0.9622 1.5380 0.1504  0.0112  0.0569  273 GLU A OE1 
60   O OE2 . GLU A 8  ? 1.5289 1.0279 1.6254 0.1506  0.0074  0.0707  273 GLU A OE2 
61   N N   . SER A 9  ? 1.2417 0.7117 1.2013 0.0915  -0.0213 0.0661  274 SER A N   
62   C CA  . SER A 9  ? 1.2226 0.7033 1.1871 0.0801  -0.0303 0.0739  274 SER A CA  
63   C C   . SER A 9  ? 1.2032 0.6822 1.1378 0.0689  -0.0265 0.0662  274 SER A C   
64   O O   . SER A 9  ? 1.1836 0.6793 1.1251 0.0657  -0.0227 0.0691  274 SER A O   
65   C CB  . SER A 9  ? 1.2374 0.7055 1.2048 0.0709  -0.0516 0.0832  274 SER A CB  
66   O OG  . SER A 9  ? 1.2799 0.7223 1.2105 0.0598  -0.0583 0.0761  274 SER A OG  
67   N N   . LEU A 10 ? 1.2362 0.6947 1.1391 0.0632  -0.0275 0.0560  275 LEU A N   
68   C CA  . LEU A 10 ? 1.2191 0.6745 1.0961 0.0541  -0.0233 0.0460  275 LEU A CA  
69   C C   . LEU A 10 ? 1.2062 0.6778 1.0874 0.0626  -0.0082 0.0420  275 LEU A C   
70   O O   . LEU A 10 ? 1.1886 0.6701 1.0671 0.0564  -0.0072 0.0418  275 LEU A O   
71   C CB  . LEU A 10 ? 1.2280 0.6599 1.0750 0.0506  -0.0230 0.0335  275 LEU A CB  
72   C CG  . LEU A 10 ? 1.2187 0.6359 1.0393 0.0338  -0.0293 0.0251  275 LEU A CG  
73   C CD1 . LEU A 10 ? 1.2399 0.6555 1.0666 0.0208  -0.0436 0.0356  275 LEU A CD1 
74   C CD2 . LEU A 10 ? 1.2200 0.6129 1.0155 0.0322  -0.0288 0.0140  275 LEU A CD2 
75   N N   . GLU A 11 ? 1.2606 0.7335 1.1479 0.0762  0.0035  0.0393  276 GLU A N   
76   C CA  . GLU A 11 ? 1.2567 0.7396 1.1421 0.0830  0.0183  0.0347  276 GLU A CA  
77   C C   . GLU A 11 ? 1.2363 0.7408 1.1473 0.0846  0.0215  0.0447  276 GLU A C   
78   O O   . GLU A 11 ? 1.2314 0.7433 1.1356 0.0841  0.0296  0.0422  276 GLU A O   
79   C CB  . GLU A 11 ? 1.2774 0.7522 1.1570 0.0953  0.0314  0.0273  276 GLU A CB  
80   C CG  . GLU A 11 ? 1.3279 0.8146 1.2362 0.1076  0.0423  0.0329  276 GLU A CG  
81   C CD  . GLU A 11 ? 1.4035 0.8783 1.3129 0.1182  0.0491  0.0281  276 GLU A CD  
82   O OE1 . GLU A 11 ? 1.4197 0.8767 1.3014 0.1171  0.0489  0.0188  276 GLU A OE1 
83   O OE2 . GLU A 11 ? 1.3941 0.8780 1.3335 0.1276  0.0552  0.0331  276 GLU A OE2 
84   N N   . LYS A 12 ? 1.1082 0.6215 1.0474 0.0856  0.0141  0.0557  277 LYS A N   
85   C CA  . LYS A 12 ? 1.0884 0.6230 1.0550 0.0858  0.0158  0.0655  277 LYS A CA  
86   C C   . LYS A 12 ? 1.0777 0.6181 1.0369 0.0726  0.0066  0.0696  277 LYS A C   
87   O O   . LYS A 12 ? 1.0626 0.6165 1.0258 0.0714  0.0132  0.0715  277 LYS A O   
88   C CB  . LYS A 12 ? 1.0865 0.6283 1.0880 0.0911  0.0092  0.0752  277 LYS A CB  
89   C CG  . LYS A 12 ? 1.0611 0.6244 1.0930 0.0897  0.0079  0.0856  277 LYS A CG  
90   C CD  . LYS A 12 ? 1.0698 0.6424 1.1417 0.1005  0.0091  0.0909  277 LYS A CD  
91   C CE  . LYS A 12 ? 1.0779 0.6729 1.1854 0.0994  0.0071  0.1009  277 LYS A CE  
92   N NZ  . LYS A 12 ? 1.0702 0.6757 1.2214 0.1111  0.0102  0.1038  277 LYS A NZ  
93   N N   . LYS A 13 ? 1.2409 0.7696 1.1886 0.0620  -0.0082 0.0706  278 LYS A N   
94   C CA  . LYS A 13 ? 1.2223 0.7516 1.1586 0.0475  -0.0170 0.0721  278 LYS A CA  
95   C C   . LYS A 13 ? 1.2063 0.7353 1.1209 0.0455  -0.0086 0.0620  278 LYS A C   
96   O O   . LYS A 13 ? 1.1966 0.7376 1.1138 0.0410  -0.0072 0.0647  278 LYS A O   
97   C CB  . LYS A 13 ? 1.2352 0.7450 1.1555 0.0360  -0.0313 0.0709  278 LYS A CB  
98   C CG  . LYS A 13 ? 1.2640 0.7754 1.2014 0.0288  -0.0461 0.0840  278 LYS A CG  
99   C CD  . LYS A 13 ? 1.3368 0.8267 1.2519 0.0127  -0.0597 0.0825  278 LYS A CD  
100  C CE  . LYS A 13 ? 1.4539 0.9245 1.3676 0.0155  -0.0690 0.0848  278 LYS A CE  
101  N NZ  . LYS A 13 ? 1.4610 0.9409 1.4076 0.0229  -0.0776 0.0988  278 LYS A NZ  
102  N N   . THR A 14 ? 1.1253 0.6397 1.0191 0.0491  -0.0036 0.0503  279 THR A N   
103  C CA  . THR A 14 ? 1.1127 0.6220 0.9846 0.0472  0.0015  0.0392  279 THR A CA  
104  C C   . THR A 14 ? 1.0981 0.6201 0.9750 0.0539  0.0121  0.0410  279 THR A C   
105  O O   . THR A 14 ? 1.0968 0.6228 0.9664 0.0480  0.0108  0.0394  279 THR A O   
106  C CB  . THR A 14 ? 1.1259 0.6174 0.9781 0.0519  0.0054  0.0272  279 THR A CB  
107  O OG1 . THR A 14 ? 1.1317 0.6091 0.9707 0.0407  -0.0045 0.0220  279 THR A OG1 
108  C CG2 . THR A 14 ? 1.1488 0.6362 0.9822 0.0551  0.0133  0.0161  279 THR A CG2 
109  N N   . ALA A 15 ? 1.0400 0.5667 0.9287 0.0653  0.0227  0.0438  280 ALA A N   
110  C CA  . ALA A 15 ? 1.0398 0.5755 0.9307 0.0706  0.0349  0.0449  280 ALA A CA  
111  C C   . ALA A 15 ? 1.0279 0.5802 0.9337 0.0645  0.0321  0.0544  280 ALA A C   
112  O O   . ALA A 15 ? 1.0268 0.5812 0.9216 0.0628  0.0371  0.0528  280 ALA A O   
113  C CB  . ALA A 15 ? 1.0474 0.5855 0.9520 0.0824  0.0481  0.0458  280 ALA A CB  
114  N N   . THR A 16 ? 1.1084 0.6707 1.0373 0.0609  0.0236  0.0643  281 THR A N   
115  C CA  . THR A 16 ? 1.0937 0.6729 1.0396 0.0550  0.0206  0.0744  281 THR A CA  
116  C C   . THR A 16 ? 1.0771 0.6539 1.0073 0.0426  0.0107  0.0731  281 THR A C   
117  O O   . THR A 16 ? 1.0441 0.6300 0.9738 0.0384  0.0124  0.0761  281 THR A O   
118  C CB  . THR A 16 ? 1.0919 0.6821 1.0692 0.0547  0.0128  0.0860  281 THR A CB  
119  O OG1 . THR A 16 ? 1.0887 0.6777 1.0823 0.0656  0.0181  0.0857  281 THR A OG1 
120  C CG2 . THR A 16 ? 1.0765 0.6862 1.0743 0.0525  0.0158  0.0950  281 THR A CG2 
121  N N   . PHE A 17 ? 1.0610 0.6249 0.9792 0.0363  0.0008  0.0682  282 PHE A N   
122  C CA  . PHE A 17 ? 1.0465 0.6056 0.9503 0.0240  -0.0077 0.0641  282 PHE A CA  
123  C C   . PHE A 17 ? 1.0274 0.5853 0.9157 0.0261  -0.0013 0.0567  282 PHE A C   
124  O O   . PHE A 17 ? 1.0195 0.5847 0.9081 0.0200  -0.0035 0.0593  282 PHE A O   
125  C CB  . PHE A 17 ? 1.0590 0.6008 0.9482 0.0174  -0.0153 0.0560  282 PHE A CB  
126  C CG  . PHE A 17 ? 1.0933 0.6290 0.9679 0.0051  -0.0211 0.0478  282 PHE A CG  
127  C CD1 . PHE A 17 ? 1.1236 0.6661 1.0051 -0.0073 -0.0286 0.0542  282 PHE A CD1 
128  C CD2 . PHE A 17 ? 1.1329 0.6568 0.9885 0.0058  -0.0186 0.0332  282 PHE A CD2 
129  C CE1 . PHE A 17 ? 1.1322 0.6692 1.0026 -0.0190 -0.0327 0.0452  282 PHE A CE1 
130  C CE2 . PHE A 17 ? 1.1072 0.6263 0.9537 -0.0052 -0.0236 0.0238  282 PHE A CE2 
131  C CZ  . PHE A 17 ? 1.1140 0.6395 0.9682 -0.0176 -0.0301 0.0294  282 PHE A CZ  
132  N N   . GLU A 18 ? 1.0650 0.6130 0.9398 0.0349  0.0065  0.0481  283 GLU A N   
133  C CA  . GLU A 18 ? 1.0614 0.6044 0.9184 0.0369  0.0111  0.0410  283 GLU A CA  
134  C C   . GLU A 18 ? 1.0441 0.5997 0.9082 0.0373  0.0165  0.0495  283 GLU A C   
135  O O   . GLU A 18 ? 1.0566 0.6088 0.9069 0.0346  0.0155  0.0462  283 GLU A O   
136  C CB  . GLU A 18 ? 1.0788 0.6079 0.9197 0.0464  0.0190  0.0314  283 GLU A CB  
137  N N   . ASN A 19 ? 1.0074 0.5769 0.8933 0.0399  0.0213  0.0601  284 ASN A N   
138  C CA  . ASN A 19 ? 0.9880 0.5686 0.8799 0.0396  0.0280  0.0670  284 ASN A CA  
139  C C   . ASN A 19 ? 0.9622 0.5563 0.8670 0.0299  0.0199  0.0758  284 ASN A C   
140  O O   . ASN A 19 ? 0.9491 0.5469 0.8480 0.0261  0.0215  0.0782  284 ASN A O   
141  C CB  . ASN A 19 ? 0.9985 0.5867 0.9075 0.0484  0.0412  0.0714  284 ASN A CB  
142  C CG  . ASN A 19 ? 1.0103 0.5854 0.9009 0.0562  0.0537  0.0631  284 ASN A CG  
143  O OD1 . ASN A 19 ? 0.9673 0.5343 0.8363 0.0546  0.0580  0.0595  284 ASN A OD1 
144  N ND2 . ASN A 19 ? 0.9507 0.5218 0.8485 0.0643  0.0594  0.0601  284 ASN A ND2 
145  N N   . ILE A 20 ? 0.9362 0.5356 0.8571 0.0256  0.0112  0.0810  285 ILE A N   
146  C CA  . ILE A 20 ? 0.9166 0.5241 0.8457 0.0141  0.0007  0.0877  285 ILE A CA  
147  C C   . ILE A 20 ? 0.9168 0.5168 0.8265 0.0058  -0.0052 0.0807  285 ILE A C   
148  O O   . ILE A 20 ? 0.9259 0.5339 0.8375 -0.0005 -0.0070 0.0854  285 ILE A O   
149  C CB  . ILE A 20 ? 0.9090 0.5143 0.8490 0.0096  -0.0094 0.0912  285 ILE A CB  
150  C CG1 . ILE A 20 ? 0.9042 0.5203 0.8703 0.0165  -0.0067 0.1007  285 ILE A CG1 
151  C CG2 . ILE A 20 ? 0.8877 0.4950 0.8278 -0.0050 -0.0206 0.0951  285 ILE A CG2 
152  C CD1 . ILE A 20 ? 0.9273 0.5357 0.8999 0.0149  -0.0165 0.1028  285 ILE A CD1 
153  N N   . VAL A 21 ? 0.9199 0.5047 0.8123 0.0060  -0.0080 0.0688  286 VAL A N   
154  C CA  . VAL A 21 ? 0.9089 0.4866 0.7866 -0.0002 -0.0132 0.0605  286 VAL A CA  
155  C C   . VAL A 21 ? 0.9232 0.5021 0.7919 0.0032  -0.0085 0.0613  286 VAL A C   
156  O O   . VAL A 21 ? 0.9328 0.5131 0.7986 -0.0039 -0.0142 0.0609  286 VAL A O   
157  C CB  . VAL A 21 ? 0.9141 0.4751 0.7755 0.0013  -0.0155 0.0459  286 VAL A CB  
158  C CG1 . VAL A 21 ? 0.9031 0.4590 0.7543 -0.0041 -0.0213 0.0380  286 VAL A CG1 
159  C CG2 . VAL A 21 ? 0.8595 0.4149 0.7240 -0.0052 -0.0210 0.0425  286 VAL A CG2 
160  N N   . CYS A 22 ? 0.9613 0.5376 0.8238 0.0130  0.0017  0.0617  287 CYS A N   
161  C CA  . CYS A 22 ? 0.9830 0.5565 0.8321 0.0139  0.0057  0.0624  287 CYS A CA  
162  C C   . CYS A 22 ? 0.9690 0.5582 0.8322 0.0087  0.0070  0.0738  287 CYS A C   
163  O O   . CYS A 22 ? 0.9782 0.5653 0.8312 0.0049  0.0051  0.0746  287 CYS A O   
164  C CB  . CYS A 22 ? 0.9984 0.5641 0.8355 0.0232  0.0184  0.0609  287 CYS A CB  
165  S SG  . CYS A 22 ? 1.0911 0.6378 0.9100 0.0303  0.0190  0.0480  287 CYS A SG  
166  N N   . VAL A 23 ? 0.8903 0.4940 0.7767 0.0087  0.0096  0.0826  288 VAL A N   
167  C CA  . VAL A 23 ? 0.8785 0.4985 0.7808 0.0038  0.0110  0.0937  288 VAL A CA  
168  C C   . VAL A 23 ? 0.8723 0.4927 0.7712 -0.0072 -0.0009 0.0937  288 VAL A C   
169  O O   . VAL A 23 ? 0.8433 0.4667 0.7370 -0.0123 -0.0017 0.0968  288 VAL A O   
170  C CB  . VAL A 23 ? 0.8714 0.5053 0.8011 0.0049  0.0116  0.1021  288 VAL A CB  
171  C CG1 . VAL A 23 ? 0.8575 0.5080 0.8045 -0.0028 0.0087  0.1131  288 VAL A CG1 
172  C CG2 . VAL A 23 ? 0.9010 0.5371 0.8395 0.0156  0.0247  0.1024  288 VAL A CG2 
173  N N   . LEU A 24 ? 0.9534 0.5690 0.8542 -0.0113 -0.0094 0.0890  289 LEU A N   
174  C CA  . LEU A 24 ? 0.9575 0.5726 0.8580 -0.0227 -0.0196 0.0873  289 LEU A CA  
175  C C   . LEU A 24 ? 0.9682 0.5748 0.8526 -0.0248 -0.0228 0.0799  289 LEU A C   
176  O O   . LEU A 24 ? 0.9640 0.5757 0.8508 -0.0329 -0.0273 0.0831  289 LEU A O   
177  C CB  . LEU A 24 ? 0.9621 0.5673 0.8604 -0.0254 -0.0252 0.0793  289 LEU A CB  
178  C CG  . LEU A 24 ? 0.9995 0.6084 0.9051 -0.0394 -0.0334 0.0820  289 LEU A CG  
179  C CD1 . LEU A 24 ? 1.0482 0.6625 0.9677 -0.0402 -0.0344 0.0911  289 LEU A CD1 
180  C CD2 . LEU A 24 ? 1.0341 0.6284 0.9286 -0.0454 -0.0390 0.0671  289 LEU A CD2 
181  N N   . ASN A 25 ? 0.9755 0.5680 0.8433 -0.0175 -0.0214 0.0700  290 ASN A N   
182  C CA  . ASN A 25 ? 0.9931 0.5758 0.8473 -0.0200 -0.0277 0.0624  290 ASN A CA  
183  C C   . ASN A 25 ? 1.0067 0.5868 0.8481 -0.0165 -0.0235 0.0670  290 ASN A C   
184  O O   . ASN A 25 ? 1.0239 0.5960 0.8545 -0.0193 -0.0302 0.0632  290 ASN A O   
185  C CB  . ASN A 25 ? 1.0179 0.5850 0.8617 -0.0172 -0.0326 0.0477  290 ASN A CB  
186  C CG  . ASN A 25 ? 1.0437 0.5986 0.8702 -0.0068 -0.0274 0.0434  290 ASN A CG  
187  O OD1 . ASN A 25 ? 1.0886 0.6386 0.9021 -0.0041 -0.0253 0.0464  290 ASN A OD1 
188  N ND2 . ASN A 25 ? 1.0151 0.5623 0.8382 -0.0016 -0.0253 0.0358  290 ASN A ND2 
189  N N   . ARG A 26 ? 1.0007 0.5866 0.8438 -0.0109 -0.0122 0.0747  291 ARG A N   
190  C CA  . ARG A 26 ? 1.0210 0.6083 0.8560 -0.0107 -0.0054 0.0816  291 ARG A CA  
191  C C   . ARG A 26 ? 1.0059 0.6090 0.8555 -0.0198 -0.0083 0.0913  291 ARG A C   
192  O O   . ARG A 26 ? 1.0085 0.6106 0.8488 -0.0230 -0.0072 0.0954  291 ARG A O   
193  C CB  . ARG A 26 ? 1.0366 0.6270 0.8742 -0.0029 0.0095  0.0854  291 ARG A CB  
194  C CG  . ARG A 26 ? 1.0711 0.6677 0.9078 -0.0041 0.0206  0.0935  291 ARG A CG  
195  C CD  . ARG A 26 ? 1.1193 0.6963 0.9246 -0.0047 0.0218  0.0897  291 ARG A CD  
196  N NE  . ARG A 26 ? 1.1914 0.7747 0.9954 -0.0105 0.0270  0.0977  291 ARG A NE  
197  C CZ  . ARG A 26 ? 1.2702 0.8398 1.0507 -0.0156 0.0220  0.0974  291 ARG A CZ  
198  N NH1 . ARG A 26 ? 1.3179 0.8661 1.0749 -0.0150 0.0103  0.0894  291 ARG A NH1 
199  N NH2 . ARG A 26 ? 1.2678 0.8445 1.0488 -0.0213 0.0281  0.1050  291 ARG A NH2 
200  N N   . GLU A 27 ? 0.9883 0.6044 0.8589 -0.0246 -0.0121 0.0951  292 GLU A N   
201  C CA  . GLU A 27 ? 0.9746 0.6043 0.8588 -0.0346 -0.0164 0.1034  292 GLU A CA  
202  C C   . GLU A 27 ? 0.9714 0.5926 0.8469 -0.0416 -0.0272 0.0965  292 GLU A C   
203  O O   . GLU A 27 ? 0.9629 0.5894 0.8396 -0.0486 -0.0300 0.1015  292 GLU A O   
204  C CB  . GLU A 27 ? 0.9723 0.6137 0.8779 -0.0388 -0.0190 0.1086  292 GLU A CB  
205  C CG  . GLU A 27 ? 0.9862 0.6432 0.9105 -0.0361 -0.0115 0.1199  292 GLU A CG  
206  C CD  . GLU A 27 ? 1.0575 0.7247 0.9837 -0.0398 -0.0070 0.1281  292 GLU A CD  
207  O OE1 . GLU A 27 ? 1.0485 0.7233 0.9810 -0.0499 -0.0131 0.1335  292 GLU A OE1 
208  O OE2 . GLU A 27 ? 1.1104 0.7763 1.0299 -0.0333 0.0035  0.1284  292 GLU A OE2 
209  N N   . VAL A 28 ? 0.9356 0.5437 0.8037 -0.0398 -0.0331 0.0844  293 VAL A N   
210  C CA  . VAL A 28 ? 0.9405 0.5401 0.8043 -0.0459 -0.0436 0.0753  293 VAL A CA  
211  C C   . VAL A 28 ? 0.9724 0.5622 0.8191 -0.0436 -0.0461 0.0747  293 VAL A C   
212  O O   . VAL A 28 ? 0.9554 0.5449 0.8033 -0.0505 -0.0534 0.0741  293 VAL A O   
213  C CB  . VAL A 28 ? 0.9396 0.5276 0.8019 -0.0446 -0.0487 0.0610  293 VAL A CB  
214  C CG1 . VAL A 28 ? 0.9275 0.5064 0.7884 -0.0498 -0.0592 0.0494  293 VAL A CG1 
215  C CG2 . VAL A 28 ? 0.9418 0.5369 0.8183 -0.0504 -0.0478 0.0618  293 VAL A CG2 
216  N N   . GLU A 29 ? 1.0889 0.6691 0.9184 -0.0347 -0.0399 0.0751  294 GLU A N   
217  C CA  . GLU A 29 ? 1.1180 0.6837 0.9253 -0.0334 -0.0429 0.0747  294 GLU A CA  
218  C C   . GLU A 29 ? 1.1191 0.6950 0.9280 -0.0390 -0.0385 0.0864  294 GLU A C   
219  O O   . GLU A 29 ? 1.1262 0.6945 0.9246 -0.0431 -0.0454 0.0867  294 GLU A O   
220  C CB  . GLU A 29 ? 1.1433 0.6932 0.9282 -0.0246 -0.0364 0.0720  294 GLU A CB  
221  C CG  . GLU A 29 ? 1.2047 0.7408 0.9836 -0.0192 -0.0428 0.0592  294 GLU A CG  
222  C CD  . GLU A 29 ? 1.2735 0.8008 1.0391 -0.0106 -0.0326 0.0574  294 GLU A CD  
223  O OE1 . GLU A 29 ? 1.2803 0.8194 1.0600 -0.0075 -0.0232 0.0600  294 GLU A OE1 
224  O OE2 . GLU A 29 ? 1.3526 0.8592 1.0928 -0.0073 -0.0348 0.0531  294 GLU A OE2 
225  N N   . ARG A 30 ? 1.0878 0.6806 0.9106 -0.0390 -0.0273 0.0958  295 ARG A N   
226  C CA  . ARG A 30 ? 1.0920 0.6962 0.9187 -0.0447 -0.0224 0.1066  295 ARG A CA  
227  C C   . ARG A 30 ? 1.0803 0.6912 0.9177 -0.0543 -0.0328 0.1077  295 ARG A C   
228  O O   . ARG A 30 ? 1.0943 0.7012 0.9221 -0.0589 -0.0362 0.1104  295 ARG A O   
229  C CB  . ARG A 30 ? 1.0832 0.7064 0.9293 -0.0436 -0.0106 0.1157  295 ARG A CB  
230  C CG  . ARG A 30 ? 1.0924 0.7285 0.9444 -0.0500 -0.0056 0.1263  295 ARG A CG  
231  C CD  . ARG A 30 ? 1.1602 0.8131 1.0306 -0.0476 0.0072  0.1341  295 ARG A CD  
232  N NE  . ARG A 30 ? 1.2481 0.9160 1.1452 -0.0483 0.0036  0.1372  295 ARG A NE  
233  C CZ  . ARG A 30 ? 1.2834 0.9637 1.1962 -0.0572 -0.0036 0.1433  295 ARG A CZ  
234  N NH1 . ARG A 30 ? 1.2779 0.9592 1.1840 -0.0654 -0.0073 0.1466  295 ARG A NH1 
235  N NH2 . ARG A 30 ? 1.2674 0.9571 1.2005 -0.0583 -0.0073 0.1461  295 ARG A NH2 
236  N N   . VAL A 31 ? 1.0811 0.7004 0.9369 -0.0581 -0.0374 0.1053  296 VAL A N   
237  C CA  . VAL A 31 ? 1.0758 0.7010 0.9422 -0.0687 -0.0455 0.1057  296 VAL A CA  
238  C C   . VAL A 31 ? 1.0992 0.7088 0.9541 -0.0702 -0.0565 0.0960  296 VAL A C   
239  O O   . VAL A 31 ? 1.1163 0.7265 0.9686 -0.0761 -0.0601 0.0999  296 VAL A O   
240  C CB  . VAL A 31 ? 1.0586 0.6915 0.9431 -0.0742 -0.0479 0.1035  296 VAL A CB  
241  C CG1 . VAL A 31 ? 1.0486 0.6825 0.9408 -0.0858 -0.0560 0.1000  296 VAL A CG1 
242  C CG2 . VAL A 31 ? 1.0455 0.6951 0.9446 -0.0753 -0.0404 0.1156  296 VAL A CG2 
243  N N   . ALA A 32 ? 0.9370 0.5322 0.7855 -0.0648 -0.0623 0.0835  297 ALA A N   
244  C CA  . ALA A 32 ? 0.9574 0.5366 0.7972 -0.0651 -0.0746 0.0734  297 ALA A CA  
245  C C   . ALA A 32 ? 0.9967 0.5653 0.8163 -0.0640 -0.0771 0.0789  297 ALA A C   
246  O O   . ALA A 32 ? 1.0059 0.5654 0.8231 -0.0674 -0.0885 0.0743  297 ALA A O   
247  C CB  . ALA A 32 ? 0.9654 0.5298 0.7984 -0.0575 -0.0792 0.0605  297 ALA A CB  
248  N N   . MET A 33 ? 1.1191 0.6879 0.9243 -0.0597 -0.0663 0.0879  298 MET A N   
249  C CA  . MET A 33 ? 1.1639 0.7204 0.9454 -0.0598 -0.0661 0.0933  298 MET A CA  
250  C C   . MET A 33 ? 1.1709 0.7402 0.9605 -0.0690 -0.0651 0.1028  298 MET A C   
251  O O   . MET A 33 ? 1.1859 0.7426 0.9595 -0.0719 -0.0719 0.1041  298 MET A O   
252  C CB  . MET A 33 ? 1.1856 0.7365 0.9487 -0.0538 -0.0526 0.0980  298 MET A CB  
253  N N   . THR A 34 ? 1.1550 0.7476 0.9681 -0.0738 -0.0579 0.1096  299 THR A N   
254  C CA  . THR A 34 ? 1.1531 0.7589 0.9761 -0.0835 -0.0577 0.1181  299 THR A CA  
255  C C   . THR A 34 ? 1.1618 0.7667 0.9974 -0.0907 -0.0704 0.1112  299 THR A C   
256  O O   . THR A 34 ? 1.1676 0.7746 1.0035 -0.0979 -0.0737 0.1155  299 THR A O   
257  C CB  . THR A 34 ? 1.1308 0.7603 0.9724 -0.0868 -0.0460 0.1292  299 THR A CB  
258  O OG1 . THR A 34 ? 1.1072 0.7463 0.9697 -0.0893 -0.0485 0.1259  299 THR A OG1 
259  C CG2 . THR A 34 ? 1.1170 0.7487 0.9522 -0.0794 -0.0326 0.1340  299 THR A CG2 
260  N N   . ALA A 35 ? 1.3390 0.9399 1.1850 -0.0892 -0.0767 0.0996  300 ALA A N   
261  C CA  . ALA A 35 ? 1.3430 0.9409 1.2028 -0.0959 -0.0878 0.0894  300 ALA A CA  
262  C C   . ALA A 35 ? 1.3784 0.9580 1.2262 -0.0943 -0.1004 0.0831  300 ALA A C   
263  O O   . ALA A 35 ? 1.3875 0.9689 1.2418 -0.1018 -0.1057 0.0840  300 ALA A O   
264  C CB  . ALA A 35 ? 1.3259 0.9224 1.1985 -0.0947 -0.0899 0.0770  300 ALA A CB  
265  N N   . GLU A 36 ? 1.3799 0.9407 1.2100 -0.0848 -0.1061 0.0765  301 GLU A N   
266  C CA  . GLU A 36 ? 1.4216 0.9609 1.2349 -0.0823 -0.1196 0.0725  301 GLU A CA  
267  C C   . GLU A 36 ? 1.4477 0.9845 1.2431 -0.0864 -0.1175 0.0852  301 GLU A C   
268  O O   . GLU A 36 ? 1.4686 0.9904 1.2554 -0.0881 -0.1301 0.0829  301 GLU A O   
269  C CB  . GLU A 36 ? 1.4445 0.9623 1.2373 -0.0720 -0.1252 0.0651  301 GLU A CB  
270  N N   . ALA A 37 ? 1.2604 0.8113 1.0517 -0.0884 -0.1022 0.0978  302 ALA A N   
271  C CA  . ALA A 37 ? 1.2848 0.8347 1.0604 -0.0932 -0.0984 0.1090  302 ALA A CA  
272  C C   . ALA A 37 ? 1.2851 0.8481 1.0795 -0.1033 -0.1018 0.1120  302 ALA A C   
273  O O   . ALA A 37 ? 1.3091 0.8639 1.0914 -0.1075 -0.1067 0.1162  302 ALA A O   
274  C CB  . ALA A 37 ? 1.2731 0.8350 1.0427 -0.0925 -0.0810 0.1198  302 ALA A CB  
275  N N   . CYS A 38 ? 1.3646 0.9462 1.1869 -0.1080 -0.0990 0.1097  303 CYS A N   
276  C CA  . CYS A 38 ? 1.3601 0.9535 1.1995 -0.1187 -0.1007 0.1122  303 CYS A CA  
277  C C   . CYS A 38 ? 1.3746 0.9571 1.2256 -0.1208 -0.1154 0.0989  303 CYS A C   
278  O O   . CYS A 38 ? 1.3781 0.9632 1.2372 -0.1288 -0.1195 0.1000  303 CYS A O   
279  C CB  . CYS A 38 ? 1.3287 0.9446 1.1902 -0.1248 -0.0908 0.1162  303 CYS A CB  
280  S SG  . CYS A 38 ? 1.3359 0.9654 1.1901 -0.1220 -0.0755 0.1307  303 CYS A SG  
281  N N   . SER A 39 ? 1.4345 1.0059 1.2889 -0.1139 -0.1228 0.0858  304 SER A N   
282  C CA  . SER A 39 ? 1.4514 1.0139 1.3230 -0.1157 -0.1365 0.0707  304 SER A CA  
283  C C   . SER A 39 ? 1.4912 1.0324 1.3471 -0.1122 -0.1513 0.0689  304 SER A C   
284  O O   . SER A 39 ? 1.4968 1.0337 1.3685 -0.1164 -0.1622 0.0608  304 SER A O   
285  C CB  . SER A 39 ? 1.4443 1.0017 1.3252 -0.1096 -0.1396 0.0566  304 SER A CB  
286  O OG  . SER A 39 ? 1.4270 1.0013 1.3293 -0.1166 -0.1301 0.0536  304 SER A OG  
287  N N   . ARG A 40 ? 1.6072 1.1336 1.4314 -0.1051 -0.1516 0.0762  305 ARG A N   
288  C CA  . ARG A 40 ? 1.6494 1.1518 1.4484 -0.1029 -0.1644 0.0784  305 ARG A CA  
289  C C   . ARG A 40 ? 1.6610 1.1707 1.4549 -0.1115 -0.1595 0.0906  305 ARG A C   
290  O O   . ARG A 40 ? 1.6895 1.1811 1.4682 -0.1127 -0.1712 0.0919  305 ARG A O   
291  C CB  . ARG A 40 ? 1.6720 1.1558 1.4352 -0.0951 -0.1624 0.0830  305 ARG A CB  
292  N N   . GLN A 41 ? 1.5303 1.0653 1.3361 -0.1178 -0.1428 0.0996  306 GLN A N   
293  C CA  . GLN A 41 ? 1.5301 1.0761 1.3353 -0.1271 -0.1365 0.1110  306 GLN A CA  
294  C C   . GLN A 41 ? 1.5142 1.0704 1.3473 -0.1364 -0.1413 0.1063  306 GLN A C   
295  O O   . GLN A 41 ? 1.5115 1.0732 1.3426 -0.1440 -0.1386 0.1146  306 GLN A O   
296  C CB  . GLN A 41 ? 1.5171 1.0828 1.3186 -0.1296 -0.1173 0.1242  306 GLN A CB  
297  C CG  . GLN A 41 ? 1.5523 1.1034 1.3194 -0.1245 -0.1123 0.1314  306 GLN A CG  
298  C CD  . GLN A 41 ? 1.5973 1.1171 1.3374 -0.1223 -0.1282 0.1278  306 GLN A CD  
299  O OE1 . GLN A 41 ? 1.5991 1.1139 1.3392 -0.1281 -0.1364 0.1291  306 GLN A OE1 
300  N NE2 . GLN A 41 ? 1.6143 1.1118 1.3312 -0.1142 -0.1333 0.1231  306 GLN A NE2 
301  N N   . HIS A 42 ? 1.7868 1.3452 1.6456 -0.1363 -0.1472 0.0924  307 HIS A N   
302  C CA  . HIS A 42 ? 1.7922 1.3515 1.6756 -0.1436 -0.1556 0.0832  307 HIS A CA  
303  C C   . HIS A 42 ? 1.8254 1.3596 1.6995 -0.1381 -0.1749 0.0763  307 HIS A C   
304  O O   . HIS A 42 ? 1.8330 1.3635 1.7103 -0.1437 -0.1810 0.0778  307 HIS A O   
305  C CB  . HIS A 42 ? 1.7771 1.3439 1.6909 -0.1459 -0.1556 0.0680  307 HIS A CB  
306  C CG  . HIS A 42 ? 1.8169 1.3720 1.7518 -0.1465 -0.1709 0.0516  307 HIS A CG  
307  N ND1 . HIS A 42 ? 1.8555 1.3975 1.7994 -0.1383 -0.1824 0.0358  307 HIS A ND1 
308  C CD2 . HIS A 42 ? 1.8401 1.3938 1.7897 -0.1538 -0.1773 0.0483  307 HIS A CD2 
309  C CE1 . HIS A 42 ? 1.8743 1.4085 1.8405 -0.1405 -0.1954 0.0228  307 HIS A CE1 
310  N NE2 . HIS A 42 ? 1.8726 1.4132 1.8425 -0.1497 -0.1925 0.0301  307 HIS A NE2 
311  N N   . ARG A 43 ? 1.9191 1.4351 1.7825 -0.1274 -0.1854 0.0683  308 ARG A N   
312  C CA  . ARG A 43 ? 1.9517 1.4404 1.8084 -0.1214 -0.2076 0.0596  308 ARG A CA  
313  C C   . ARG A 43 ? 1.9803 1.4516 1.8067 -0.1226 -0.2145 0.0710  308 ARG A C   
314  O O   . ARG A 43 ? 2.0034 1.4600 1.8357 -0.1235 -0.2312 0.0656  308 ARG A O   
315  C CB  . ARG A 43 ? 1.9680 1.4390 1.8125 -0.1100 -0.2166 0.0514  308 ARG A CB  
316  N N   . LEU A 44 ? 1.5944 1.0665 1.3893 -0.1230 -0.2017 0.0859  309 LEU A N   
317  C CA  . LEU A 44 ? 1.6173 1.0749 1.3810 -0.1265 -0.2037 0.0977  309 LEU A CA  
318  C C   . LEU A 44 ? 1.5940 1.0706 1.3754 -0.1374 -0.1966 0.1038  309 LEU A C   
319  O O   . LEU A 44 ? 1.6176 1.0807 1.3854 -0.1412 -0.2048 0.1083  309 LEU A O   
320  C CB  . LEU A 44 ? 1.6324 1.0870 1.3603 -0.1248 -0.1890 0.1100  309 LEU A CB  
321  C CG  . LEU A 44 ? 1.6781 1.1077 1.3597 -0.1263 -0.1900 0.1204  309 LEU A CG  
322  C CD1 . LEU A 44 ? 1.6722 1.1143 1.3490 -0.1364 -0.1787 0.1327  309 LEU A CD1 
323  C CD2 . LEU A 44 ? 1.7361 1.1256 1.3928 -0.1218 -0.2152 0.1142  309 LEU A CD2 
324  N N   . ASP A 45 ? 1.7970 1.3031 1.6068 -0.1431 -0.1818 0.1041  310 ASP A N   
325  C CA  . ASP A 45 ? 1.7599 1.2849 1.5848 -0.1546 -0.1731 0.1107  310 ASP A CA  
326  C C   . ASP A 45 ? 1.7412 1.2691 1.6016 -0.1596 -0.1828 0.0975  310 ASP A C   
327  O O   . ASP A 45 ? 1.7369 1.2742 1.6087 -0.1693 -0.1795 0.1010  310 ASP A O   
328  C CB  . ASP A 45 ? 1.7262 1.2792 1.5579 -0.1599 -0.1517 0.1205  310 ASP A CB  
329  C CG  . ASP A 45 ? 1.7247 1.2775 1.5242 -0.1586 -0.1400 0.1356  310 ASP A CG  
330  O OD1 . ASP A 45 ? 1.7477 1.2783 1.5170 -0.1561 -0.1469 0.1393  310 ASP A OD1 
331  O OD2 . ASP A 45 ? 1.6617 1.2358 1.4670 -0.1609 -0.1240 0.1432  310 ASP A OD2 
332  N N   . GLN A 46 ? 1.4693 0.9889 1.3478 -0.1534 -0.1942 0.0817  311 GLN A N   
333  C CA  . GLN A 46 ? 1.4606 0.9754 1.3702 -0.1561 -0.2074 0.0668  311 GLN A CA  
334  C C   . GLN A 46 ? 1.4896 0.9789 1.3808 -0.1530 -0.2257 0.0689  311 GLN A C   
335  O O   . GLN A 46 ? 1.4908 0.9816 1.3934 -0.1603 -0.2286 0.0694  311 GLN A O   
336  C CB  . GLN A 46 ? 1.4596 0.9697 1.3920 -0.1493 -0.2160 0.0484  311 GLN A CB  
337  N N   . ASP A 47 ? 1.7435 1.2082 1.6036 -0.1430 -0.2378 0.0708  312 ASP A N   
338  C CA  . ASP A 47 ? 1.7697 1.2032 1.6078 -0.1393 -0.2590 0.0717  312 ASP A CA  
339  C C   . ASP A 47 ? 1.7690 1.1979 1.5798 -0.1466 -0.2547 0.0874  312 ASP A C   
340  O O   . ASP A 47 ? 1.7935 1.2018 1.5990 -0.1470 -0.2720 0.0860  312 ASP A O   
341  C CB  . ASP A 47 ? 1.8045 1.2097 1.6129 -0.1280 -0.2730 0.0694  312 ASP A CB  
342  N N   . LYS A 48 ? 1.3282 0.7755 1.1230 -0.1524 -0.2327 0.1015  313 LYS A N   
343  C CA  . LYS A 48 ? 1.3194 0.7668 1.0928 -0.1606 -0.2258 0.1155  313 LYS A CA  
344  C C   . LYS A 48 ? 1.2830 0.7549 1.0903 -0.1716 -0.2176 0.1152  313 LYS A C   
345  O O   . LYS A 48 ? 1.2972 0.7623 1.0982 -0.1775 -0.2220 0.1200  313 LYS A O   
346  C CB  . LYS A 48 ? 1.3084 0.7600 1.0464 -0.1619 -0.2078 0.1305  313 LYS A CB  
347  N N   . ILE A 49 ? 1.5484 1.0462 1.3904 -0.1751 -0.2065 0.1089  314 ILE A N   
348  C CA  . ILE A 49 ? 1.5097 1.0249 1.3840 -0.1862 -0.2015 0.1056  314 ILE A CA  
349  C C   . ILE A 49 ? 1.5102 1.0118 1.4129 -0.1850 -0.2205 0.0891  314 ILE A C   
350  O O   . ILE A 49 ? 1.5120 1.0177 1.4299 -0.1936 -0.2207 0.0885  314 ILE A O   
351  C CB  . ILE A 49 ? 1.4692 1.0145 1.3683 -0.1938 -0.1824 0.1052  314 ILE A CB  
352  C CG1 . ILE A 49 ? 1.4552 1.0165 1.3322 -0.1983 -0.1640 0.1233  314 ILE A CG1 
353  C CG2 . ILE A 49 ? 1.4498 1.0076 1.3842 -0.2058 -0.1795 0.0972  314 ILE A CG2 
354  C CD1 . ILE A 49 ? 1.4443 1.0284 1.3364 -0.2011 -0.1489 0.1239  314 ILE A CD1 
355  N N   . GLU A 50 ? 1.3770 0.8630 1.2886 -0.1748 -0.2363 0.0753  315 GLU A N   
356  C CA  . GLU A 50 ? 1.3759 0.8497 1.3194 -0.1729 -0.2553 0.0582  315 GLU A CA  
357  C C   . GLU A 50 ? 1.4085 0.8567 1.3315 -0.1711 -0.2733 0.0632  315 GLU A C   
358  O O   . GLU A 50 ? 1.4196 0.8595 1.3693 -0.1721 -0.2876 0.0522  315 GLU A O   
359  C CB  . GLU A 50 ? 1.3862 0.8478 1.3419 -0.1616 -0.2694 0.0428  315 GLU A CB  
360  N N   . ALA A 51 ? 1.3214 0.7559 1.1969 -0.1688 -0.2722 0.0792  316 ALA A N   
361  C CA  . ALA A 51 ? 1.3570 0.7625 1.2026 -0.1674 -0.2889 0.0858  316 ALA A CA  
362  C C   . ALA A 51 ? 1.3462 0.7629 1.1894 -0.1792 -0.2779 0.0964  316 ALA A C   
363  O O   . ALA A 51 ? 1.3708 0.7730 1.2198 -0.1813 -0.2921 0.0938  316 ALA A O   
364  C CB  . ALA A 51 ? 1.3840 0.7676 1.1771 -0.1615 -0.2909 0.0971  316 ALA A CB  
365  N N   . LEU A 52 ? 1.4093 0.8516 1.2447 -0.1867 -0.2530 0.1083  317 LEU A N   
366  C CA  . LEU A 52 ? 1.3845 0.8410 1.2183 -0.1985 -0.2400 0.1188  317 LEU A CA  
367  C C   . LEU A 52 ? 1.3631 0.8379 1.2435 -0.2068 -0.2369 0.1085  317 LEU A C   
368  O O   . LEU A 52 ? 1.3778 0.8516 1.2621 -0.2143 -0.2378 0.1113  317 LEU A O   
369  C CB  . LEU A 52 ? 1.3509 0.8304 1.1681 -0.2037 -0.2155 0.1329  317 LEU A CB  
370  C CG  . LEU A 52 ? 1.3772 0.8387 1.1441 -0.2019 -0.2143 0.1468  317 LEU A CG  
371  C CD1 . LEU A 52 ? 1.4186 0.8449 1.1605 -0.1906 -0.2352 0.1413  317 LEU A CD1 
372  C CD2 . LEU A 52 ? 1.3655 0.8493 1.1217 -0.2039 -0.1918 0.1573  317 LEU A CD2 
373  N N   . SER A 53 ? 1.3857 0.8765 1.3007 -0.2064 -0.2320 0.0960  318 SER A N   
374  C CA  . SER A 53 ? 1.3719 0.8753 1.3327 -0.2145 -0.2305 0.0823  318 SER A CA  
375  C C   . SER A 53 ? 1.4068 0.8872 1.3805 -0.2115 -0.2530 0.0726  318 SER A C   
376  O O   . SER A 53 ? 1.4000 0.8878 1.4041 -0.2206 -0.2511 0.0655  318 SER A O   
377  C CB  . SER A 53 ? 1.3490 0.8634 1.3407 -0.2119 -0.2273 0.0669  318 SER A CB  
378  O OG  . SER A 53 ? 1.3496 0.8720 1.3874 -0.2194 -0.2271 0.0496  318 SER A OG  
379  N N   . SER A 54 ? 1.5461 0.9972 1.4956 -0.1994 -0.2746 0.0725  319 SER A N   
380  C CA  . SER A 54 ? 1.5973 1.0223 1.5592 -0.1942 -0.3008 0.0623  319 SER A CA  
381  C C   . SER A 54 ? 1.6281 1.0356 1.5602 -0.1978 -0.3078 0.0749  319 SER A C   
382  O O   . SER A 54 ? 1.6554 1.0583 1.6119 -0.2017 -0.3167 0.0681  319 SER A O   
383  C CB  . SER A 54 ? 1.6386 1.0369 1.5906 -0.1797 -0.3241 0.0545  319 SER A CB  
384  O OG  . SER A 54 ? 1.6433 1.0511 1.6428 -0.1765 -0.3281 0.0342  319 SER A OG  
385  N N   . LYS A 55 ? 1.4616 0.8580 1.3414 -0.1966 -0.3038 0.0923  320 LYS A N   
386  C CA  . LYS A 55 ? 1.4904 0.8719 1.3344 -0.2021 -0.3052 0.1066  320 LYS A CA  
387  C C   . LYS A 55 ? 1.4433 0.8495 1.3106 -0.2156 -0.2885 0.1096  320 LYS A C   
388  O O   . LYS A 55 ? 1.4719 0.8653 1.3382 -0.2196 -0.2976 0.1109  320 LYS A O   
389  C CB  . LYS A 55 ? 1.5012 0.8767 1.2902 -0.2018 -0.2938 0.1239  320 LYS A CB  
390  C CG  . LYS A 55 ? 1.5912 0.9321 1.3446 -0.1904 -0.3130 0.1232  320 LYS A CG  
391  C CD  . LYS A 55 ? 1.6626 0.9884 1.3551 -0.1926 -0.3036 0.1402  320 LYS A CD  
392  C CE  . LYS A 55 ? 1.7860 1.0614 1.4324 -0.1882 -0.3299 0.1426  320 LYS A CE  
393  N NZ  . LYS A 55 ? 1.8479 1.0956 1.4845 -0.1766 -0.3514 0.1338  320 LYS A NZ  
394  N N   . VAL A 56 ? 1.3893 0.8291 1.2782 -0.2227 -0.2651 0.1098  321 VAL A N   
395  C CA  . VAL A 56 ? 1.3467 0.8111 1.2541 -0.2368 -0.2467 0.1138  321 VAL A CA  
396  C C   . VAL A 56 ? 1.3563 0.8246 1.3137 -0.2415 -0.2528 0.0967  321 VAL A C   
397  O O   . VAL A 56 ? 1.3452 0.8251 1.3145 -0.2535 -0.2425 0.0995  321 VAL A O   
398  C CB  . VAL A 56 ? 1.2924 0.7879 1.2022 -0.2430 -0.2214 0.1204  321 VAL A CB  
399  C CG1 . VAL A 56 ? 1.2580 0.7787 1.1943 -0.2585 -0.2037 0.1209  321 VAL A CG1 
400  C CG2 . VAL A 56 ? 1.2843 0.7785 1.1473 -0.2418 -0.2121 0.1388  321 VAL A CG2 
401  N N   . GLN A 57 ? 1.9850 1.4444 1.9732 -0.2328 -0.2685 0.0784  322 GLN A N   
402  C CA  . GLN A 57 ? 2.0238 1.4818 2.0612 -0.2361 -0.2778 0.0600  322 GLN A CA  
403  C C   . GLN A 57 ? 2.1076 1.5326 2.1378 -0.2283 -0.3060 0.0575  322 GLN A C   
404  O O   . GLN A 57 ? 2.1450 1.5656 2.2140 -0.2303 -0.3161 0.0435  322 GLN A O   
405  C CB  . GLN A 57 ? 2.0259 1.4949 2.1116 -0.2339 -0.2777 0.0380  322 GLN A CB  
406  C CG  . GLN A 57 ? 2.0584 1.5439 2.1966 -0.2474 -0.2671 0.0223  322 GLN A CG  
407  C CD  . GLN A 57 ? 2.1207 1.6061 2.3128 -0.2439 -0.2757 -0.0046 322 GLN A CD  
408  O OE1 . GLN A 57 ? 2.0943 1.5898 2.2966 -0.2419 -0.2688 -0.0125 322 GLN A OE1 
409  N NE2 . GLN A 57 ? 2.2821 1.7570 2.5109 -0.2442 -0.2897 -0.0194 322 GLN A NE2 
410  N N   . GLN A 58 ? 1.5051 0.9056 1.4854 -0.2199 -0.3187 0.0706  323 GLN A N   
411  C CA  . GLN A 58 ? 1.6129 0.9786 1.5752 -0.2143 -0.3448 0.0721  323 GLN A CA  
412  C C   . GLN A 58 ? 1.5847 0.9536 1.5246 -0.2259 -0.3331 0.0870  323 GLN A C   
413  O O   . GLN A 58 ? 1.7144 1.0712 1.6696 -0.2284 -0.3450 0.0826  323 GLN A O   
414  C CB  . GLN A 58 ? 1.6520 0.9859 1.5671 -0.2022 -0.3636 0.0789  323 GLN A CB  
415  C CG  . GLN A 58 ? 1.7484 1.0711 1.6875 -0.1895 -0.3831 0.0623  323 GLN A CG  
416  C CD  . GLN A 58 ? 1.9321 1.2476 1.9264 -0.1860 -0.4041 0.0416  323 GLN A CD  
417  O OE1 . GLN A 58 ? 1.8755 1.2141 1.9220 -0.1875 -0.3962 0.0250  323 GLN A OE1 
418  N NE2 . GLN A 58 ? 2.1509 1.4332 2.1342 -0.1819 -0.4309 0.0420  323 GLN A NE2 
419  N N   . LEU A 59 ? 1.5921 0.9786 1.4996 -0.2331 -0.3091 0.1037  324 LEU A N   
420  C CA  . LEU A 59 ? 1.5652 0.9589 1.4532 -0.2452 -0.2950 0.1177  324 LEU A CA  
421  C C   . LEU A 59 ? 1.5282 0.9460 1.4629 -0.2568 -0.2823 0.1095  324 LEU A C   
422  O O   . LEU A 59 ? 1.5678 0.9803 1.5029 -0.2639 -0.2836 0.1126  324 LEU A O   
423  C CB  . LEU A 59 ? 1.4975 0.9086 1.3490 -0.2504 -0.2713 0.1352  324 LEU A CB  
424  C CG  . LEU A 59 ? 1.5277 0.9170 1.3314 -0.2409 -0.2787 0.1434  324 LEU A CG  
425  C CD1 . LEU A 59 ? 1.4639 0.8702 1.2329 -0.2481 -0.2542 0.1610  324 LEU A CD1 
426  C CD2 . LEU A 59 ? 1.6446 0.9902 1.4168 -0.2344 -0.3062 0.1442  324 LEU A CD2 
427  N N   . GLU A 60 ? 1.3689 0.8119 1.3418 -0.2596 -0.2696 0.0985  325 GLU A N   
428  C CA  . GLU A 60 ? 1.3383 0.8026 1.3550 -0.2724 -0.2560 0.0890  325 GLU A CA  
429  C C   . GLU A 60 ? 1.4167 0.8636 1.4691 -0.2697 -0.2761 0.0726  325 GLU A C   
430  O O   . GLU A 60 ? 1.4402 0.8948 1.5140 -0.2811 -0.2683 0.0699  325 GLU A O   
431  C CB  . GLU A 60 ? 1.2922 0.7814 1.3406 -0.2757 -0.2407 0.0784  325 GLU A CB  
432  N N   . ARG A 61 ? 1.3822 0.8050 1.4418 -0.2551 -0.3024 0.0616  326 ARG A N   
433  C CA  . ARG A 61 ? 1.6327 1.0367 1.7288 -0.2509 -0.3251 0.0453  326 ARG A CA  
434  C C   . ARG A 61 ? 1.7793 1.1571 1.8422 -0.2505 -0.3399 0.0575  326 ARG A C   
435  O O   . ARG A 61 ? 1.9512 1.3238 2.0420 -0.2549 -0.3464 0.0499  326 ARG A O   
436  C CB  . ARG A 61 ? 1.7913 1.1785 1.9107 -0.2357 -0.3498 0.0282  326 ARG A CB  
437  C CG  . ARG A 61 ? 1.7362 1.1479 1.8973 -0.2371 -0.3362 0.0118  326 ARG A CG  
438  C CD  . ARG A 61 ? 1.8372 1.2645 2.0619 -0.2468 -0.3284 -0.0092 326 ARG A CD  
439  N NE  . ARG A 61 ? 2.1179 1.5280 2.3864 -0.2356 -0.3549 -0.0316 326 ARG A NE  
440  C CZ  . ARG A 61 ? 2.1818 1.6036 2.5132 -0.2406 -0.3512 -0.0558 326 ARG A CZ  
441  N NH1 . ARG A 61 ? 2.0013 1.4502 2.3562 -0.2577 -0.3215 -0.0608 326 ARG A NH1 
442  N NH2 . ARG A 61 ? 2.4518 1.8570 2.8231 -0.2291 -0.3774 -0.0758 326 ARG A NH2 
443  N N   . SER A 62 ? 1.8621 1.2229 1.8651 -0.2461 -0.3440 0.0761  327 SER A N   
444  C CA  . SER A 62 ? 1.9812 1.3174 1.9448 -0.2481 -0.3541 0.0896  327 SER A CA  
445  C C   . SER A 62 ? 1.9033 1.2604 1.8775 -0.2639 -0.3326 0.0952  327 SER A C   
446  O O   . SER A 62 ? 2.0782 1.4226 2.0690 -0.2663 -0.3439 0.0903  327 SER A O   
447  C CB  . SER A 62 ? 1.9008 1.2220 1.7970 -0.2452 -0.3525 0.1091  327 SER A CB  
448  O OG  . SER A 62 ? 1.9992 1.2978 1.8825 -0.2314 -0.3729 0.1042  327 SER A OG  
449  N N   . ILE A 63 ? 1.8169 1.2054 1.7822 -0.2745 -0.3025 0.1053  328 ILE A N   
450  C CA  . ILE A 63 ? 1.7687 1.1801 1.7464 -0.2910 -0.2800 0.1102  328 ILE A CA  
451  C C   . ILE A 63 ? 1.8329 1.2622 1.8757 -0.2970 -0.2744 0.0894  328 ILE A C   
452  O O   . ILE A 63 ? 1.6954 1.1514 1.7571 -0.3118 -0.2502 0.0895  328 ILE A O   
453  C CB  . ILE A 63 ? 1.5794 1.0180 1.5292 -0.3005 -0.2513 0.1268  328 ILE A CB  
454  C CG1 . ILE A 63 ? 1.5879 1.0098 1.4761 -0.2954 -0.2543 0.1454  328 ILE A CG1 
455  C CG2 . ILE A 63 ? 1.6725 1.1329 1.6332 -0.3182 -0.2294 0.1324  328 ILE A CG2 
456  C CD1 . ILE A 63 ? 1.5529 1.0013 1.4175 -0.3028 -0.2280 0.1604  328 ILE A CD1 
457  N N   . GLU B 2  ? 1.9344 1.0909 1.5122 -0.0526 -0.1445 -0.0185 267 GLU B N   
458  C CA  . GLU B 2  ? 1.9092 1.0934 1.5175 -0.0490 -0.1370 -0.0171 267 GLU B CA  
459  C C   . GLU B 2  ? 1.8611 1.0717 1.4868 -0.0572 -0.1483 -0.0082 267 GLU B C   
460  O O   . GLU B 2  ? 1.8596 1.0788 1.4791 -0.0631 -0.1531 -0.0040 267 GLU B O   
461  C CB  . GLU B 2  ? 1.9242 1.1045 1.5475 -0.0413 -0.1315 -0.0221 267 GLU B CB  
462  C CG  . GLU B 2  ? 1.9906 1.1619 1.6136 -0.0309 -0.1137 -0.0313 267 GLU B CG  
463  C CD  . GLU B 2  ? 2.0469 1.2198 1.6909 -0.0234 -0.1099 -0.0359 267 GLU B CD  
464  O OE1 . GLU B 2  ? 2.0301 1.2263 1.7006 -0.0206 -0.1049 -0.0346 267 GLU B OE1 
465  O OE2 . GLU B 2  ? 2.0783 1.2288 1.7124 -0.0200 -0.1125 -0.0410 267 GLU B OE2 
466  N N   . LEU B 3  ? 1.5424 0.7653 1.1889 -0.0577 -0.1528 -0.0056 268 LEU B N   
467  C CA  . LEU B 3  ? 1.4894 0.7415 1.1575 -0.0633 -0.1583 0.0014  268 LEU B CA  
468  C C   . LEU B 3  ? 1.4713 0.7365 1.1348 -0.0728 -0.1674 0.0076  268 LEU B C   
469  O O   . LEU B 3  ? 1.4556 0.7452 1.1345 -0.0739 -0.1648 0.0108  268 LEU B O   
470  C CB  . LEU B 3  ? 1.4775 0.7335 1.1603 -0.0654 -0.1664 0.0041  268 LEU B CB  
471  C CG  . LEU B 3  ? 1.4480 0.7346 1.1573 -0.0676 -0.1664 0.0092  268 LEU B CG  
472  C CD1 . LEU B 3  ? 1.4369 0.7357 1.1611 -0.0583 -0.1504 0.0051  268 LEU B CD1 
473  C CD2 . LEU B 3  ? 1.4538 0.7420 1.1756 -0.0699 -0.1748 0.0119  268 LEU B CD2 
474  N N   . LEU B 4  ? 1.5901 0.8393 1.2331 -0.0793 -0.1784 0.0091  269 LEU B N   
475  C CA  . LEU B 4  ? 1.5755 0.8370 1.2148 -0.0889 -0.1888 0.0146  269 LEU B CA  
476  C C   . LEU B 4  ? 1.5634 0.8264 1.1920 -0.0876 -0.1840 0.0134  269 LEU B C   
477  O O   . LEU B 4  ? 1.5427 0.8251 1.1776 -0.0933 -0.1896 0.0177  269 LEU B O   
478  C CB  . LEU B 4  ? 1.6075 0.8502 1.2283 -0.0968 -0.2028 0.0164  269 LEU B CB  
479  C CG  . LEU B 4  ? 1.6310 0.8888 1.2539 -0.1090 -0.2167 0.0229  269 LEU B CG  
480  C CD1 . LEU B 4  ? 1.6618 0.9358 1.3044 -0.1144 -0.2226 0.0276  269 LEU B CD1 
481  C CD2 . LEU B 4  ? 1.6709 0.9058 1.2684 -0.1156 -0.2283 0.0231  269 LEU B CD2 
482  N N   . GLN B 5  ? 1.4276 0.6688 1.0386 -0.0806 -0.1748 0.0076  270 GLN B N   
483  C CA  . GLN B 5  ? 1.4207 0.6595 1.0190 -0.0784 -0.1691 0.0059  270 GLN B CA  
484  C C   . GLN B 5  ? 1.3918 0.6488 1.0082 -0.0715 -0.1548 0.0045  270 GLN B C   
485  O O   . GLN B 5  ? 1.3687 0.6398 0.9882 -0.0724 -0.1537 0.0065  270 GLN B O   
486  C CB  . GLN B 5  ? 1.4448 0.6503 1.0125 -0.0758 -0.1667 0.0007  270 GLN B CB  
487  N N   . ARG B 6  ? 1.5046 0.7613 1.1336 -0.0649 -0.1449 0.0010  271 ARG B N   
488  C CA  . ARG B 6  ? 1.4704 0.7446 1.1193 -0.0588 -0.1322 -0.0003 271 ARG B CA  
489  C C   . ARG B 6  ? 1.4359 0.7409 1.1079 -0.0636 -0.1383 0.0060  271 ARG B C   
490  O O   . ARG B 6  ? 1.4164 0.7400 1.1011 -0.0614 -0.1316 0.0069  271 ARG B O   
491  C CB  . ARG B 6  ? 1.4735 0.7420 1.1332 -0.0523 -0.1248 -0.0047 271 ARG B CB  
492  C CG  . ARG B 6  ? 1.4808 0.7678 1.1631 -0.0463 -0.1124 -0.0063 271 ARG B CG  
493  C CD  . ARG B 6  ? 1.5355 0.8209 1.2331 -0.0409 -0.1086 -0.0096 271 ARG B CD  
494  N NE  . ARG B 6  ? 1.6158 0.8756 1.2985 -0.0347 -0.1008 -0.0174 271 ARG B NE  
495  C CZ  . ARG B 6  ? 1.6773 0.9361 1.3735 -0.0268 -0.0907 -0.0232 271 ARG B CZ  
496  N NH1 . ARG B 6  ? 1.6768 0.9583 1.4009 -0.0244 -0.0877 -0.0216 271 ARG B NH1 
497  N NH2 . ARG B 6  ? 1.7404 0.9757 1.4224 -0.0213 -0.0834 -0.0310 271 ARG B NH2 
498  N N   . CYS B 7  ? 1.4815 0.7918 1.1579 -0.0707 -0.1513 0.0104  272 CYS B N   
499  C CA  . CYS B 7  ? 1.4432 0.7820 1.1393 -0.0764 -0.1576 0.0162  272 CYS B CA  
500  C C   . CYS B 7  ? 1.4244 0.7722 1.1135 -0.0814 -0.1637 0.0189  272 CYS B C   
501  O O   . CYS B 7  ? 1.3941 0.7659 1.0992 -0.0819 -0.1620 0.0213  272 CYS B O   
502  C CB  . CYS B 7  ? 1.4401 0.7828 1.1442 -0.0828 -0.1686 0.0199  272 CYS B CB  
503  S SG  . CYS B 7  ? 1.4492 0.8267 1.1757 -0.0905 -0.1754 0.0264  272 CYS B SG  
504  N N   . GLU B 8  ? 1.3501 0.6787 1.0155 -0.0849 -0.1709 0.0183  273 GLU B N   
505  C CA  . GLU B 8  ? 1.3385 0.6747 0.9969 -0.0896 -0.1782 0.0206  273 GLU B CA  
506  C C   . GLU B 8  ? 1.3249 0.6639 0.9815 -0.0833 -0.1680 0.0183  273 GLU B C   
507  O O   . GLU B 8  ? 1.3121 0.6672 0.9739 -0.0853 -0.1716 0.0205  273 GLU B O   
508  C CB  . GLU B 8  ? 1.3568 0.6701 0.9893 -0.0946 -0.1887 0.0202  273 GLU B CB  
509  N N   . SER B 9  ? 1.4162 0.7386 1.0649 -0.0757 -0.1555 0.0137  274 SER B N   
510  C CA  . SER B 9  ? 1.3998 0.7223 1.0462 -0.0696 -0.1438 0.0111  274 SER B CA  
511  C C   . SER B 9  ? 1.3480 0.7013 1.0229 -0.0680 -0.1392 0.0136  274 SER B C   
512  O O   . SER B 9  ? 1.3328 0.6981 1.0105 -0.0680 -0.1394 0.0150  274 SER B O   
513  C CB  . SER B 9  ? 1.4198 0.7194 1.0542 -0.0628 -0.1309 0.0053  274 SER B CB  
514  O OG  . SER B 9  ? 1.4727 0.7672 1.0984 -0.0582 -0.1203 0.0027  274 SER B OG  
515  N N   . LEU B 10 ? 1.2334 0.5989 0.9290 -0.0670 -0.1363 0.0142  275 LEU B N   
516  C CA  . LEU B 10 ? 1.1796 0.5746 0.9024 -0.0668 -0.1341 0.0171  275 LEU B CA  
517  C C   . LEU B 10 ? 1.1685 0.5856 0.9004 -0.0732 -0.1447 0.0217  275 LEU B C   
518  O O   . LEU B 10 ? 1.1471 0.5858 0.8957 -0.0718 -0.1413 0.0230  275 LEU B O   
519  C CB  . LEU B 10 ? 1.1525 0.5550 0.8936 -0.0662 -0.1328 0.0176  275 LEU B CB  
520  C CG  . LEU B 10 ? 1.1366 0.5267 0.8791 -0.0580 -0.1195 0.0125  275 LEU B CG  
521  C CD1 . LEU B 10 ? 1.0842 0.4811 0.8452 -0.0575 -0.1206 0.0131  275 LEU B CD1 
522  C CD2 . LEU B 10 ? 1.0819 0.4792 0.8301 -0.0519 -0.1061 0.0101  275 LEU B CD2 
523  N N   . GLU B 11 ? 1.3279 0.7401 1.0493 -0.0801 -0.1573 0.0237  276 GLU B N   
524  C CA  . GLU B 11 ? 1.3261 0.7580 1.0540 -0.0863 -0.1676 0.0271  276 GLU B CA  
525  C C   . GLU B 11 ? 1.3342 0.7623 1.0497 -0.0841 -0.1679 0.0258  276 GLU B C   
526  O O   . GLU B 11 ? 1.3257 0.7754 1.0558 -0.0833 -0.1672 0.0270  276 GLU B O   
527  C CB  . GLU B 11 ? 1.3427 0.7744 1.0672 -0.0955 -0.1813 0.0299  276 GLU B CB  
528  C CG  . GLU B 11 ? 1.3679 0.8194 1.1144 -0.1000 -0.1836 0.0332  276 GLU B CG  
529  C CD  . GLU B 11 ? 1.4441 0.8877 1.1842 -0.1086 -0.1948 0.0355  276 GLU B CD  
530  O OE1 . GLU B 11 ? 1.4063 0.8625 1.1617 -0.1126 -0.1968 0.0383  276 GLU B OE1 
531  O OE2 . GLU B 11 ? 1.4615 0.8857 1.1809 -0.1115 -0.2018 0.0347  276 GLU B OE2 
532  N N   . LYS B 12 ? 1.1652 0.5659 0.8542 -0.0828 -0.1688 0.0234  277 LYS B N   
533  C CA  . LYS B 12 ? 1.1628 0.5563 0.8374 -0.0802 -0.1688 0.0221  277 LYS B CA  
534  C C   . LYS B 12 ? 1.1438 0.5504 0.8313 -0.0739 -0.1574 0.0213  277 LYS B C   
535  O O   . LYS B 12 ? 1.1391 0.5646 0.8373 -0.0742 -0.1610 0.0228  277 LYS B O   
536  C CB  . LYS B 12 ? 1.1899 0.5485 0.8326 -0.0785 -0.1677 0.0189  277 LYS B CB  
537  N N   . LYS B 13 ? 1.3702 0.7677 1.0578 -0.0683 -0.1439 0.0187  278 LYS B N   
538  C CA  . LYS B 13 ? 1.3492 0.7564 1.0475 -0.0625 -0.1321 0.0177  278 LYS B CA  
539  C C   . LYS B 13 ? 1.3150 0.7554 1.0428 -0.0638 -0.1342 0.0208  278 LYS B C   
540  O O   . LYS B 13 ? 1.3185 0.7718 1.0520 -0.0626 -0.1350 0.0216  278 LYS B O   
541  C CB  . LYS B 13 ? 1.3417 0.7356 1.0381 -0.0568 -0.1171 0.0139  278 LYS B CB  
542  N N   . THR B 14 ? 1.2238 0.6774 0.9693 -0.0665 -0.1360 0.0225  279 THR B N   
543  C CA  . THR B 14 ? 1.1819 0.6659 0.9547 -0.0676 -0.1363 0.0251  279 THR B CA  
544  C C   . THR B 14 ? 1.1781 0.6792 0.9554 -0.0716 -0.1466 0.0272  279 THR B C   
545  O O   . THR B 14 ? 1.1524 0.6775 0.9490 -0.0712 -0.1459 0.0285  279 THR B O   
546  C CB  . THR B 14 ? 1.1681 0.6601 0.9540 -0.0717 -0.1400 0.0271  279 THR B CB  
547  O OG1 . THR B 14 ? 1.1713 0.6556 0.9620 -0.0665 -0.1292 0.0249  279 THR B OG1 
548  C CG2 . THR B 14 ? 1.1421 0.6645 0.9517 -0.0756 -0.1445 0.0303  279 THR B CG2 
549  N N   . ALA B 15 ? 1.1926 0.6812 0.9521 -0.0751 -0.1563 0.0272  280 ALA B N   
550  C CA  . ALA B 15 ? 1.1961 0.7007 0.9602 -0.0791 -0.1673 0.0286  280 ALA B CA  
551  C C   . ALA B 15 ? 1.2073 0.7105 0.9660 -0.0738 -0.1644 0.0270  280 ALA B C   
552  O O   . ALA B 15 ? 1.2131 0.7376 0.9856 -0.0742 -0.1690 0.0278  280 ALA B O   
553  C CB  . ALA B 15 ? 1.2225 0.7145 0.9705 -0.0852 -0.1795 0.0290  280 ALA B CB  
554  N N   . THR B 16 ? 1.2142 0.6922 0.9525 -0.0688 -0.1568 0.0248  281 THR B N   
555  C CA  . THR B 16 ? 1.1967 0.6718 0.9286 -0.0641 -0.1539 0.0236  281 THR B CA  
556  C C   . THR B 16 ? 1.1663 0.6640 0.9216 -0.0605 -0.1456 0.0241  281 THR B C   
557  O O   . THR B 16 ? 1.1708 0.6779 0.9303 -0.0579 -0.1468 0.0240  281 THR B O   
558  C CB  . THR B 16 ? 1.2269 0.6705 0.9323 -0.0601 -0.1455 0.0210  281 THR B CB  
559  O OG1 . THR B 16 ? 1.2143 0.6567 0.9270 -0.0560 -0.1308 0.0197  281 THR B OG1 
560  C CG2 . THR B 16 ? 1.2449 0.6650 0.9287 -0.0634 -0.1511 0.0203  281 THR B CG2 
561  N N   . PHE B 17 ? 1.2044 0.7094 0.9742 -0.0598 -0.1372 0.0244  282 PHE B N   
562  C CA  . PHE B 17 ? 1.1627 0.6872 0.9541 -0.0562 -0.1282 0.0247  282 PHE B CA  
563  C C   . PHE B 17 ? 1.1306 0.6836 0.9419 -0.0579 -0.1352 0.0264  282 PHE B C   
564  O O   . PHE B 17 ? 1.1236 0.6867 0.9436 -0.0540 -0.1304 0.0260  282 PHE B O   
565  C CB  . PHE B 17 ? 1.1515 0.6825 0.9579 -0.0565 -0.1217 0.0251  282 PHE B CB  
566  C CG  . PHE B 17 ? 1.1882 0.6954 0.9812 -0.0529 -0.1115 0.0225  282 PHE B CG  
567  C CD1 . PHE B 17 ? 1.2131 0.6957 0.9819 -0.0498 -0.1066 0.0199  282 PHE B CD1 
568  C CD2 . PHE B 17 ? 1.1606 0.6699 0.9654 -0.0525 -0.1062 0.0222  282 PHE B CD2 
569  C CE1 . PHE B 17 ? 1.2232 0.6843 0.9798 -0.0466 -0.0957 0.0167  282 PHE B CE1 
570  C CE2 . PHE B 17 ? 1.2129 0.7012 1.0069 -0.0488 -0.0965 0.0189  282 PHE B CE2 
571  C CZ  . PHE B 17 ? 1.2354 0.6997 1.0051 -0.0458 -0.0907 0.0159  282 PHE B CZ  
572  N N   . GLU B 18 ? 1.0815 0.6480 0.9004 -0.0640 -0.1464 0.0280  283 GLU B N   
573  C CA  . GLU B 18 ? 1.0493 0.6448 0.8879 -0.0662 -0.1533 0.0289  283 GLU B CA  
574  C C   . GLU B 18 ? 1.0527 0.6472 0.8856 -0.0617 -0.1550 0.0274  283 GLU B C   
575  O O   . GLU B 18 ? 1.0374 0.6499 0.8861 -0.0586 -0.1518 0.0272  283 GLU B O   
576  C CB  . GLU B 18 ? 1.0339 0.6419 0.8779 -0.0741 -0.1657 0.0303  283 GLU B CB  
577  N N   . ASN B 19 ? 1.0848 0.6570 0.8943 -0.0610 -0.1600 0.0263  284 ASN B N   
578  C CA  . ASN B 19 ? 1.0973 0.6659 0.8992 -0.0569 -0.1633 0.0249  284 ASN B CA  
579  C C   . ASN B 19 ? 1.0830 0.6405 0.8791 -0.0505 -0.1512 0.0241  284 ASN B C   
580  O O   . ASN B 19 ? 1.0754 0.6436 0.8795 -0.0469 -0.1510 0.0236  284 ASN B O   
581  C CB  . ASN B 19 ? 1.1389 0.6883 0.9184 -0.0584 -0.1740 0.0241  284 ASN B CB  
582  C CG  . ASN B 19 ? 1.2292 0.7778 1.0036 -0.0543 -0.1797 0.0228  284 ASN B CG  
583  O OD1 . ASN B 19 ? 1.2818 0.8555 1.0756 -0.0538 -0.1857 0.0223  284 ASN B OD1 
584  N ND2 . ASN B 19 ? 1.3174 0.8372 1.0657 -0.0509 -0.1770 0.0219  284 ASN B ND2 
585  N N   . ILE B 20 ? 1.0269 0.5640 0.8103 -0.0492 -0.1408 0.0237  285 ILE B N   
586  C CA  . ILE B 20 ? 1.0102 0.5383 0.7900 -0.0441 -0.1277 0.0227  285 ILE B CA  
587  C C   . ILE B 20 ? 0.9778 0.5318 0.7840 -0.0421 -0.1223 0.0234  285 ILE B C   
588  O O   . ILE B 20 ? 0.9948 0.5491 0.8016 -0.0381 -0.1170 0.0228  285 ILE B O   
589  C CB  . ILE B 20 ? 1.0275 0.5358 0.7957 -0.0438 -0.1174 0.0216  285 ILE B CB  
590  C CG1 . ILE B 20 ? 1.0679 0.5461 0.8053 -0.0450 -0.1216 0.0205  285 ILE B CG1 
591  C CG2 . ILE B 20 ? 1.0056 0.5111 0.7772 -0.0394 -0.1028 0.0205  285 ILE B CG2 
592  C CD1 . ILE B 20 ? 1.1264 0.5792 0.8461 -0.0430 -0.1086 0.0182  285 ILE B CD1 
593  N N   . VAL B 21 ? 1.0087 0.5843 0.8363 -0.0451 -0.1240 0.0246  286 VAL B N   
594  C CA  . VAL B 21 ? 0.9844 0.5853 0.8371 -0.0435 -0.1196 0.0253  286 VAL B CA  
595  C C   . VAL B 21 ? 0.9901 0.6109 0.8538 -0.0433 -0.1287 0.0252  286 VAL B C   
596  O O   . VAL B 21 ? 0.9860 0.6188 0.8614 -0.0397 -0.1244 0.0249  286 VAL B O   
597  C CB  . VAL B 21 ? 0.9777 0.5931 0.8489 -0.0469 -0.1169 0.0268  286 VAL B CB  
598  C CG1 . VAL B 21 ? 0.9417 0.5868 0.8397 -0.0470 -0.1162 0.0277  286 VAL B CG1 
599  C CG2 . VAL B 21 ? 0.9341 0.5325 0.7993 -0.0446 -0.1051 0.0259  286 VAL B CG2 
600  N N   . CYS B 22 ? 1.0689 0.6933 0.9290 -0.0465 -0.1412 0.0251  287 CYS B N   
601  C CA  . CYS B 22 ? 1.0912 0.7320 0.9603 -0.0446 -0.1491 0.0239  287 CYS B CA  
602  C C   . CYS B 22 ? 1.0957 0.7216 0.9514 -0.0386 -0.1469 0.0227  287 CYS B C   
603  O O   . CYS B 22 ? 1.1045 0.7452 0.9734 -0.0352 -0.1456 0.0220  287 CYS B O   
604  C CB  . CYS B 22 ? 1.1105 0.7569 0.9776 -0.0486 -0.1634 0.0233  287 CYS B CB  
605  S SG  . CYS B 22 ? 1.2137 0.8868 1.1027 -0.0564 -0.1677 0.0246  287 CYS B SG  
606  N N   . VAL B 23 ? 0.9559 0.5525 0.7846 -0.0377 -0.1474 0.0223  288 VAL B N   
607  C CA  . VAL B 23 ? 0.9542 0.5316 0.7654 -0.0329 -0.1450 0.0214  288 VAL B CA  
608  C C   . VAL B 23 ? 0.9415 0.5227 0.7618 -0.0294 -0.1314 0.0217  288 VAL B C   
609  O O   . VAL B 23 ? 0.9290 0.5197 0.7573 -0.0258 -0.1320 0.0211  288 VAL B O   
610  C CB  . VAL B 23 ? 0.9930 0.5367 0.7730 -0.0338 -0.1446 0.0213  288 VAL B CB  
611  C CG1 . VAL B 23 ? 1.0109 0.5293 0.7681 -0.0297 -0.1390 0.0207  288 VAL B CG1 
612  C CG2 . VAL B 23 ? 0.9937 0.5353 0.7661 -0.0368 -0.1595 0.0209  288 VAL B CG2 
613  N N   . LEU B 24 ? 1.0469 0.6219 0.8674 -0.0303 -0.1195 0.0222  289 LEU B N   
614  C CA  . LEU B 24 ? 1.0320 0.6095 0.8607 -0.0273 -0.1064 0.0221  289 LEU B CA  
615  C C   . LEU B 24 ? 1.0126 0.6195 0.8680 -0.0258 -0.1078 0.0224  289 LEU B C   
616  O O   . LEU B 24 ? 1.0040 0.6131 0.8636 -0.0223 -0.1016 0.0222  289 LEU B O   
617  C CB  . LEU B 24 ? 1.0155 0.5923 0.8503 -0.0290 -0.0967 0.0224  289 LEU B CB  
618  C CG  . LEU B 24 ? 1.0333 0.5905 0.8559 -0.0267 -0.0826 0.0212  289 LEU B CG  
619  C CD1 . LEU B 24 ? 1.0515 0.6168 0.8895 -0.0277 -0.0743 0.0211  289 LEU B CD1 
620  C CD2 . LEU B 24 ? 1.0139 0.5746 0.8405 -0.0234 -0.0770 0.0210  289 LEU B CD2 
621  N N   . ASN B 25 ? 0.9876 0.6172 0.8610 -0.0289 -0.1156 0.0230  290 ASN B N   
622  C CA  . ASN B 25 ? 0.9647 0.6240 0.8643 -0.0285 -0.1171 0.0231  290 ASN B CA  
623  C C   . ASN B 25 ? 0.9797 0.6414 0.8778 -0.0245 -0.1228 0.0217  290 ASN B C   
624  O O   . ASN B 25 ? 0.9688 0.6361 0.8749 -0.0211 -0.1165 0.0214  290 ASN B O   
625  C CB  . ASN B 25 ? 0.9571 0.6378 0.8722 -0.0337 -0.1255 0.0236  290 ASN B CB  
626  C CG  . ASN B 25 ? 0.9148 0.6261 0.8553 -0.0337 -0.1279 0.0232  290 ASN B CG  
627  O OD1 . ASN B 25 ? 0.8835 0.6040 0.8364 -0.0314 -0.1200 0.0234  290 ASN B OD1 
628  N ND2 . ASN B 25 ? 0.9161 0.6436 0.8645 -0.0365 -0.1386 0.0222  290 ASN B ND2 
629  N N   . ARG B 26 ? 0.9600 0.6162 0.8472 -0.0249 -0.1348 0.0207  291 ARG B N   
630  C CA  . ARG B 26 ? 0.9874 0.6421 0.8699 -0.0206 -0.1428 0.0189  291 ARG B CA  
631  C C   . ARG B 26 ? 0.9907 0.6240 0.8574 -0.0161 -0.1349 0.0191  291 ARG B C   
632  O O   . ARG B 26 ? 0.9879 0.6291 0.8626 -0.0122 -0.1344 0.0183  291 ARG B O   
633  C CB  . ARG B 26 ? 1.0256 0.6699 0.8933 -0.0217 -0.1565 0.0179  291 ARG B CB  
634  C CG  . ARG B 26 ? 1.0803 0.7451 0.9622 -0.0270 -0.1654 0.0175  291 ARG B CG  
635  C CD  . ARG B 26 ? 1.1960 0.8560 1.0680 -0.0279 -0.1810 0.0157  291 ARG B CD  
636  N NE  . ARG B 26 ? 1.2290 0.9026 1.1100 -0.0345 -0.1868 0.0160  291 ARG B NE  
637  C CZ  . ARG B 26 ? 1.2864 0.9420 1.1501 -0.0385 -0.1902 0.0170  291 ARG B CZ  
638  N NH1 . ARG B 26 ? 1.3204 0.9438 1.1566 -0.0364 -0.1885 0.0177  291 ARG B NH1 
639  N NH2 . ARG B 26 ? 1.2999 0.9688 1.1727 -0.0450 -0.1953 0.0174  291 ARG B NH2 
640  N N   . GLU B 27 ? 1.0157 0.6221 0.8599 -0.0171 -0.1282 0.0200  292 GLU B N   
641  C CA  . GLU B 27 ? 1.0375 0.6214 0.8635 -0.0142 -0.1212 0.0201  292 GLU B CA  
642  C C   . GLU B 27 ? 0.9945 0.5904 0.8368 -0.0125 -0.1093 0.0205  292 GLU B C   
643  O O   . GLU B 27 ? 1.0031 0.5946 0.8424 -0.0092 -0.1073 0.0202  292 GLU B O   
644  C CB  . GLU B 27 ? 1.0882 0.6432 0.8886 -0.0165 -0.1152 0.0206  292 GLU B CB  
645  C CG  . GLU B 27 ? 1.2141 0.7524 0.9936 -0.0177 -0.1277 0.0202  292 GLU B CG  
646  C CD  . GLU B 27 ? 1.3784 0.8867 1.1308 -0.0202 -0.1217 0.0203  292 GLU B CD  
647  O OE1 . GLU B 27 ? 1.4309 0.9387 1.1878 -0.0217 -0.1090 0.0204  292 GLU B OE1 
648  O OE2 . GLU B 27 ? 1.4406 0.9265 1.1681 -0.0205 -0.1299 0.0201  292 GLU B OE2 
649  N N   . VAL B 28 ? 0.8789 0.4896 0.7385 -0.0148 -0.1022 0.0211  293 VAL B N   
650  C CA  . VAL B 28 ? 0.8288 0.4547 0.7075 -0.0134 -0.0926 0.0214  293 VAL B CA  
651  C C   . VAL B 28 ? 0.8243 0.4741 0.7221 -0.0110 -0.1002 0.0207  293 VAL B C   
652  O O   . VAL B 28 ? 0.8318 0.4844 0.7348 -0.0081 -0.0953 0.0205  293 VAL B O   
653  C CB  . VAL B 28 ? 0.8169 0.4550 0.7119 -0.0161 -0.0848 0.0222  293 VAL B CB  
654  C CG1 . VAL B 28 ? 0.7281 0.3810 0.6423 -0.0143 -0.0756 0.0223  293 VAL B CG1 
655  C CG2 . VAL B 28 ? 0.7749 0.3893 0.6515 -0.0179 -0.0774 0.0221  293 VAL B CG2 
656  N N   . GLU B 29 ? 0.8969 0.5635 0.8047 -0.0122 -0.1120 0.0199  294 GLU B N   
657  C CA  . GLU B 29 ? 0.8882 0.5789 0.8155 -0.0097 -0.1182 0.0184  294 GLU B CA  
658  C C   . GLU B 29 ? 0.9211 0.5979 0.8346 -0.0050 -0.1232 0.0172  294 GLU B C   
659  O O   . GLU B 29 ? 0.9274 0.6129 0.8508 -0.0015 -0.1212 0.0165  294 GLU B O   
660  C CB  . GLU B 29 ? 0.8814 0.5933 0.8220 -0.0121 -0.1297 0.0172  294 GLU B CB  
661  C CG  . GLU B 29 ? 0.8536 0.5962 0.8207 -0.0114 -0.1311 0.0158  294 GLU B CG  
662  C CD  . GLU B 29 ? 0.9240 0.6889 0.9045 -0.0137 -0.1430 0.0136  294 GLU B CD  
663  O OE1 . GLU B 29 ? 0.9463 0.7085 0.9210 -0.0181 -0.1487 0.0141  294 GLU B OE1 
664  O OE2 . GLU B 29 ? 0.9191 0.7054 0.9168 -0.0113 -0.1467 0.0111  294 GLU B OE2 
665  N N   . ARG B 30 ? 0.8807 0.5348 0.7707 -0.0048 -0.1301 0.0170  295 ARG B N   
666  C CA  . ARG B 30 ? 0.9024 0.5390 0.7755 -0.0004 -0.1362 0.0160  295 ARG B CA  
667  C C   . ARG B 30 ? 0.9113 0.5360 0.7785 0.0014  -0.1245 0.0171  295 ARG B C   
668  O O   . ARG B 30 ? 0.9065 0.5348 0.7780 0.0052  -0.1263 0.0163  295 ARG B O   
669  C CB  . ARG B 30 ? 0.9418 0.5495 0.7856 -0.0014 -0.1426 0.0164  295 ARG B CB  
670  N N   . VAL B 31 ? 0.9370 0.5480 0.7950 -0.0014 -0.1121 0.0188  296 VAL B N   
671  C CA  . VAL B 31 ? 0.9557 0.5546 0.8070 -0.0001 -0.1013 0.0195  296 VAL B CA  
672  C C   . VAL B 31 ? 0.9331 0.5572 0.8108 0.0017  -0.0971 0.0192  296 VAL B C   
673  O O   . VAL B 31 ? 0.9357 0.5545 0.8112 0.0041  -0.0933 0.0192  296 VAL B O   
674  C CB  . VAL B 31 ? 0.9714 0.5509 0.8081 -0.0034 -0.0881 0.0206  296 VAL B CB  
675  C CG1 . VAL B 31 ? 0.9967 0.5598 0.8215 -0.0025 -0.0784 0.0210  296 VAL B CG1 
676  C CG2 . VAL B 31 ? 1.0370 0.5921 0.8471 -0.0053 -0.0935 0.0207  296 VAL B CG2 
677  N N   . ALA B 32 ? 0.8820 0.5331 0.7845 0.0004  -0.0977 0.0189  297 ALA B N   
678  C CA  . ALA B 32 ? 0.8833 0.5558 0.8090 0.0016  -0.0920 0.0188  297 ALA B CA  
679  C C   . ALA B 32 ? 0.9085 0.5932 0.8425 0.0057  -0.1020 0.0169  297 ALA B C   
680  O O   . ALA B 32 ? 0.9137 0.6088 0.8601 0.0079  -0.0985 0.0164  297 ALA B O   
681  C CB  . ALA B 32 ? 0.8646 0.5606 0.8126 -0.0015 -0.0893 0.0192  297 ALA B CB  
682  N N   . MET B 33 ? 1.0379 0.7213 0.9655 0.0070  -0.1149 0.0154  298 MET B N   
683  C CA  . MET B 33 ? 1.0623 0.7565 0.9978 0.0117  -0.1251 0.0128  298 MET B CA  
684  C C   . MET B 33 ? 1.0863 0.7562 1.0017 0.0154  -0.1264 0.0128  298 MET B C   
685  O O   . MET B 33 ? 1.0773 0.7550 1.0015 0.0193  -0.1283 0.0114  298 MET B O   
686  C CB  . MET B 33 ? 1.0771 0.7812 1.0159 0.0118  -0.1388 0.0106  298 MET B CB  
687  C CG  . MET B 33 ? 1.1533 0.8893 1.1187 0.0090  -0.1390 0.0096  298 MET B CG  
688  S SD  . MET B 33 ? 1.3600 1.1111 1.3322 0.0089  -0.1554 0.0062  298 MET B SD  
689  C CE  . MET B 33 ? 1.3298 1.1046 1.3231 0.0151  -0.1617 0.0017  298 MET B CE  
690  N N   . THR B 34 ? 1.0073 0.6478 0.8952 0.0141  -0.1262 0.0143  299 THR B N   
691  C CA  . THR B 34 ? 1.0498 0.6621 0.9138 0.0160  -0.1250 0.0152  299 THR B CA  
692  C C   . THR B 34 ? 1.0632 0.6760 0.9328 0.0158  -0.1124 0.0164  299 THR B C   
693  O O   . THR B 34 ? 1.0824 0.6888 0.9478 0.0191  -0.1149 0.0159  299 THR B O   
694  C CB  . THR B 34 ? 1.0701 0.6537 0.9068 0.0124  -0.1206 0.0171  299 THR B CB  
695  O OG1 . THR B 34 ? 1.1053 0.6838 0.9327 0.0127  -0.1336 0.0161  299 THR B OG1 
696  C CG2 . THR B 34 ? 1.1071 0.6616 0.9186 0.0129  -0.1172 0.0183  299 THR B CG2 
697  N N   . ALA B 35 ? 1.0443 0.6646 0.9237 0.0121  -0.0993 0.0177  300 ALA B N   
698  C CA  . ALA B 35 ? 1.0630 0.6840 0.9485 0.0115  -0.0867 0.0187  300 ALA B CA  
699  C C   . ALA B 35 ? 1.0662 0.7128 0.9771 0.0147  -0.0888 0.0174  300 ALA B C   
700  O O   . ALA B 35 ? 1.0595 0.7032 0.9719 0.0154  -0.0823 0.0179  300 ALA B O   
701  C CB  . ALA B 35 ? 1.0512 0.6749 0.9426 0.0072  -0.0734 0.0200  300 ALA B CB  
702  N N   . GLU B 36 ? 1.2701 0.9423 1.2013 0.0160  -0.0972 0.0156  301 GLU B N   
703  C CA  . GLU B 36 ? 1.2939 0.9908 1.2487 0.0189  -0.0994 0.0138  301 GLU B CA  
704  C C   . GLU B 36 ? 1.3183 1.0125 1.2690 0.0245  -0.1118 0.0113  301 GLU B C   
705  O O   . GLU B 36 ? 1.3125 1.0165 1.2746 0.0276  -0.1118 0.0100  301 GLU B O   
706  C CB  . GLU B 36 ? 1.2810 1.0085 1.2613 0.0170  -0.1006 0.0129  301 GLU B CB  
707  C CG  . GLU B 36 ? 1.3497 1.1052 1.3552 0.0196  -0.1033 0.0105  301 GLU B CG  
708  C CD  . GLU B 36 ? 1.4376 1.1953 1.4514 0.0201  -0.0931 0.0115  301 GLU B CD  
709  O OE1 . GLU B 36 ? 1.4488 1.2289 1.4826 0.0219  -0.0949 0.0096  301 GLU B OE1 
710  O OE2 . GLU B 36 ? 1.4851 1.2232 1.4859 0.0184  -0.0833 0.0139  301 GLU B OE2 
711  N N   . ALA B 37 ? 1.1944 0.8751 1.1291 0.0261  -0.1227 0.0104  302 ALA B N   
712  C CA  . ALA B 37 ? 1.2248 0.8945 1.1494 0.0316  -0.1343 0.0083  302 ALA B CA  
713  C C   . ALA B 37 ? 1.2570 0.9000 1.1616 0.0316  -0.1275 0.0106  302 ALA B C   
714  O O   . ALA B 37 ? 1.2455 0.8907 1.1550 0.0352  -0.1291 0.0095  302 ALA B O   
715  C CB  . ALA B 37 ? 1.2397 0.8966 1.1484 0.0328  -0.1474 0.0072  302 ALA B CB  
716  N N   . CYS B 38 ? 1.2829 0.9010 1.1649 0.0273  -0.1195 0.0136  303 CYS B N   
717  C CA  . CYS B 38 ? 1.3416 0.9309 1.2004 0.0256  -0.1116 0.0160  303 CYS B CA  
718  C C   . CYS B 38 ? 1.3384 0.9364 1.2103 0.0253  -0.1012 0.0165  303 CYS B C   
719  O O   . CYS B 38 ? 1.3532 0.9308 1.2090 0.0249  -0.0977 0.0178  303 CYS B O   
720  C CB  . CYS B 38 ? 1.3659 0.9351 1.2052 0.0198  -0.1012 0.0184  303 CYS B CB  
721  S SG  . CYS B 38 ? 1.4570 0.9826 1.2571 0.0161  -0.0929 0.0211  303 CYS B SG  
722  N N   . SER B 39 ? 1.4317 1.0594 1.3321 0.0249  -0.0962 0.0157  304 SER B N   
723  C CA  . SER B 39 ? 1.4340 1.0729 1.3499 0.0239  -0.0855 0.0163  304 SER B CA  
724  C C   . SER B 39 ? 1.4323 1.0923 1.3680 0.0290  -0.0940 0.0136  304 SER B C   
725  O O   . SER B 39 ? 1.4275 1.1018 1.3800 0.0290  -0.0878 0.0135  304 SER B O   
726  C CB  . SER B 39 ? 1.4102 1.0669 1.3442 0.0197  -0.0742 0.0173  304 SER B CB  
727  O OG  . SER B 39 ? 1.3982 1.0463 1.3298 0.0163  -0.0599 0.0191  304 SER B OG  
728  N N   . ARG B 40 ? 1.5053 1.1681 1.4398 0.0335  -0.1084 0.0111  305 ARG B N   
729  C CA  . ARG B 40 ? 1.5125 1.1915 1.4624 0.0392  -0.1175 0.0077  305 ARG B CA  
730  C C   . ARG B 40 ? 1.5396 1.1927 1.4669 0.0436  -0.1278 0.0070  305 ARG B C   
731  O O   . ARG B 40 ? 1.5388 1.1983 1.4734 0.0491  -0.1366 0.0040  305 ARG B O   
732  C CB  . ARG B 40 ? 1.4996 1.2069 1.4705 0.0411  -0.1260 0.0043  305 ARG B CB  
733  C CG  . ARG B 40 ? 1.5131 1.2501 1.5115 0.0440  -0.1273 0.0011  305 ARG B CG  
734  C CD  . ARG B 40 ? 1.5474 1.3087 1.5623 0.0463  -0.1381 -0.0031 305 ARG B CD  
735  N NE  . ARG B 40 ? 1.5615 1.3332 1.5816 0.0409  -0.1350 -0.0016 305 ARG B NE  
736  C CZ  . ARG B 40 ? 1.5611 1.3584 1.6024 0.0373  -0.1291 -0.0016 305 ARG B CZ  
737  N NH1 . ARG B 40 ? 1.5434 1.3597 1.6035 0.0383  -0.1253 -0.0030 305 ARG B NH1 
738  N NH2 . ARG B 40 ? 1.5657 1.3683 1.6084 0.0324  -0.1275 -0.0001 305 ARG B NH2 
739  N N   . GLN B 41 ? 1.6113 1.2343 1.5103 0.0409  -0.1269 0.0097  306 GLN B N   
740  C CA  . GLN B 41 ? 1.6492 1.2407 1.5206 0.0431  -0.1343 0.0103  306 GLN B CA  
741  C C   . GLN B 41 ? 1.6584 1.2332 1.5191 0.0403  -0.1235 0.0130  306 GLN B C   
742  O O   . GLN B 41 ? 1.6800 1.2327 1.5226 0.0424  -0.1294 0.0133  306 GLN B O   
743  C CB  . GLN B 41 ? 1.6805 1.2457 1.5241 0.0403  -0.1371 0.0122  306 GLN B CB  
744  C CG  . GLN B 41 ? 1.7003 1.2714 1.5454 0.0442  -0.1530 0.0094  306 GLN B CG  
745  C CD  . GLN B 41 ? 1.7190 1.3039 1.5783 0.0523  -0.1682 0.0049  306 GLN B CD  
746  O OE1 . GLN B 41 ? 1.6676 1.2753 1.5503 0.0549  -0.1661 0.0028  306 GLN B OE1 
747  N NE2 . GLN B 41 ? 1.7509 1.3221 1.5965 0.0565  -0.1839 0.0030  306 GLN B NE2 
748  N N   . HIS B 42 ? 1.6806 1.2655 1.5524 0.0352  -0.1080 0.0148  307 HIS B N   
749  C CA  . HIS B 42 ? 1.6964 1.2679 1.5605 0.0315  -0.0959 0.0173  307 HIS B CA  
750  C C   . HIS B 42 ? 1.6692 1.2660 1.5606 0.0339  -0.0937 0.0156  307 HIS B C   
751  O O   . HIS B 42 ? 1.6769 1.2644 1.5642 0.0322  -0.0872 0.0170  307 HIS B O   
752  C CB  . HIS B 42 ? 1.7053 1.2694 1.5626 0.0242  -0.0800 0.0200  307 HIS B CB  
753  C CG  . HIS B 42 ? 1.7509 1.2954 1.5941 0.0192  -0.0671 0.0224  307 HIS B CG  
754  N ND1 . HIS B 42 ? 1.7566 1.3156 1.6176 0.0157  -0.0531 0.0230  307 HIS B ND1 
755  C CD2 . HIS B 42 ? 1.8060 1.3174 1.6185 0.0163  -0.0658 0.0243  307 HIS B CD2 
756  C CE1 . HIS B 42 ? 1.7718 1.3088 1.6152 0.0110  -0.0436 0.0249  307 HIS B CE1 
757  N NE2 . HIS B 42 ? 1.8161 1.3238 1.6294 0.0111  -0.0508 0.0258  307 HIS B NE2 
758  N N   . ARG B 43 ? 1.4678 1.0957 1.3860 0.0374  -0.0992 0.0127  308 ARG B N   
759  C CA  . ARG B 43 ? 1.4430 1.0948 1.3859 0.0406  -0.0997 0.0105  308 ARG B CA  
760  C C   . ARG B 43 ? 1.4569 1.0987 1.3924 0.0468  -0.1121 0.0081  308 ARG B C   
761  O O   . ARG B 43 ? 1.4545 1.1039 1.4009 0.0488  -0.1111 0.0071  308 ARG B O   
762  C CB  . ARG B 43 ? 1.4083 1.0955 1.3805 0.0420  -0.1020 0.0078  308 ARG B CB  
763  N N   . LEU B 44 ? 1.4685 1.0922 1.3849 0.0499  -0.1241 0.0073  309 LEU B N   
764  C CA  . LEU B 44 ? 1.4750 1.0882 1.3835 0.0570  -0.1393 0.0044  309 LEU B CA  
765  C C   . LEU B 44 ? 1.5017 1.0756 1.3769 0.0558  -0.1411 0.0073  309 LEU B C   
766  O O   . LEU B 44 ? 1.5100 1.0742 1.3803 0.0600  -0.1482 0.0061  309 LEU B O   
767  C CB  . LEU B 44 ? 1.4717 1.0968 1.3872 0.0626  -0.1543 0.0003  309 LEU B CB  
768  C CG  . LEU B 44 ? 1.4508 1.1159 1.4011 0.0658  -0.1557 -0.0041 309 LEU B CG  
769  C CD1 . LEU B 44 ? 1.4472 1.1311 1.4090 0.0675  -0.1643 -0.0073 309 LEU B CD1 
770  C CD2 . LEU B 44 ? 1.4614 1.1351 1.4237 0.0724  -0.1624 -0.0081 309 LEU B CD2 
771  N N   . ASP B 45 ? 1.6602 1.2111 1.5120 0.0499  -0.1347 0.0111  310 ASP B N   
772  C CA  . ASP B 45 ? 1.6855 1.1999 1.5059 0.0457  -0.1304 0.0148  310 ASP B CA  
773  C C   . ASP B 45 ? 1.6743 1.1908 1.5015 0.0419  -0.1174 0.0165  310 ASP B C   
774  O O   . ASP B 45 ? 1.7037 1.1927 1.5081 0.0390  -0.1153 0.0190  310 ASP B O   
775  C CB  . ASP B 45 ? 1.7068 1.1988 1.5025 0.0391  -0.1234 0.0182  310 ASP B CB  
776  C CG  . ASP B 45 ? 1.7274 1.2093 1.5094 0.0424  -0.1378 0.0169  310 ASP B CG  
777  O OD1 . ASP B 45 ? 1.7092 1.1952 1.4960 0.0499  -0.1541 0.0137  310 ASP B OD1 
778  O OD2 . ASP B 45 ? 1.7303 1.2007 1.4977 0.0377  -0.1328 0.0189  310 ASP B OD2 
779  N N   . GLN B 46 ? 1.6844 1.2328 1.5421 0.0415  -0.1093 0.0153  311 GLN B N   
780  C CA  . GLN B 46 ? 1.6614 1.2171 1.5309 0.0387  -0.0984 0.0163  311 GLN B CA  
781  C C   . GLN B 46 ? 1.6403 1.2093 1.5256 0.0456  -0.1081 0.0129  311 GLN B C   
782  O O   . GLN B 46 ? 1.6482 1.2101 1.5318 0.0442  -0.1038 0.0139  311 GLN B O   
783  C CB  . GLN B 46 ? 1.6303 1.2099 1.5221 0.0338  -0.0834 0.0172  311 GLN B CB  
784  N N   . ASP B 47 ? 1.5784 1.1660 1.4784 0.0527  -0.1209 0.0087  312 ASP B N   
785  C CA  . ASP B 47 ? 1.5576 1.1561 1.4709 0.0599  -0.1310 0.0047  312 ASP B CA  
786  C C   . ASP B 47 ? 1.5627 1.1320 1.4521 0.0646  -0.1444 0.0041  312 ASP B C   
787  O O   . ASP B 47 ? 1.5624 1.1274 1.4527 0.0675  -0.1478 0.0029  312 ASP B O   
788  C CB  . ASP B 47 ? 1.5421 1.1749 1.4834 0.0656  -0.1386 -0.0003 312 ASP B CB  
789  C CG  . ASP B 47 ? 1.5543 1.2159 1.5196 0.0611  -0.1264 0.0003  312 ASP B CG  
790  O OD1 . ASP B 47 ? 1.5516 1.2102 1.5169 0.0549  -0.1126 0.0039  312 ASP B OD1 
791  O OD2 . ASP B 47 ? 1.5888 1.2757 1.5728 0.0636  -0.1312 -0.0029 312 ASP B OD2 
792  N N   . LYS B 48 ? 1.2695 0.8186 1.1375 0.0653  -0.1526 0.0048  313 LYS B N   
793  C CA  . LYS B 48 ? 1.2802 0.7982 1.1224 0.0693  -0.1661 0.0046  313 LYS B CA  
794  C C   . LYS B 48 ? 1.2847 0.7740 1.1046 0.0633  -0.1577 0.0091  313 LYS B C   
795  O O   . LYS B 48 ? 1.2863 0.7635 1.1003 0.0669  -0.1650 0.0081  313 LYS B O   
796  C CB  . LYS B 48 ? 1.3003 0.8004 1.1217 0.0694  -0.1743 0.0054  313 LYS B CB  
797  N N   . ILE B 49 ? 1.3834 0.8635 1.1926 0.0540  -0.1419 0.0137  314 ILE B N   
798  C CA  . ILE B 49 ? 1.3751 0.8326 1.1665 0.0464  -0.1302 0.0179  314 ILE B CA  
799  C C   . ILE B 49 ? 1.3454 0.8182 1.1565 0.0477  -0.1268 0.0166  314 ILE B C   
800  O O   . ILE B 49 ? 1.3595 0.8107 1.1548 0.0453  -0.1260 0.0185  314 ILE B O   
801  C CB  . ILE B 49 ? 1.3718 0.8287 1.1595 0.0369  -0.1119 0.0215  314 ILE B CB  
802  C CG1 . ILE B 49 ? 1.4097 0.8303 1.1601 0.0319  -0.1122 0.0247  314 ILE B CG1 
803  C CG2 . ILE B 49 ? 1.3621 0.8235 1.1582 0.0304  -0.0961 0.0235  314 ILE B CG2 
804  C CD1 . ILE B 49 ? 1.3722 0.7963 1.1207 0.0261  -0.1004 0.0263  314 ILE B CD1 
805  N N   . GLU B 50 ? 1.4970 1.0064 1.3417 0.0511  -0.1248 0.0134  315 GLU B N   
806  C CA  . GLU B 50 ? 1.4668 0.9921 1.3310 0.0515  -0.1200 0.0123  315 GLU B CA  
807  C C   . GLU B 50 ? 1.4548 0.9774 1.3204 0.0604  -0.1361 0.0084  315 GLU B C   
808  O O   . GLU B 50 ? 1.4687 0.9785 1.3279 0.0596  -0.1356 0.0092  315 GLU B O   
809  C CB  . GLU B 50 ? 1.4348 0.9980 1.3323 0.0500  -0.1095 0.0111  315 GLU B CB  
810  N N   . ALA B 51 ? 1.1288 0.6614 1.0014 0.0687  -0.1505 0.0040  316 ALA B N   
811  C CA  . ALA B 51 ? 1.1242 0.6532 0.9978 0.0780  -0.1667 -0.0005 316 ALA B CA  
812  C C   . ALA B 51 ? 1.1602 0.6463 0.9979 0.0783  -0.1764 0.0019  316 ALA B C   
813  O O   . ALA B 51 ? 1.1717 0.6473 1.0053 0.0836  -0.1863 -0.0003 316 ALA B O   
814  C CB  . ALA B 51 ? 1.1042 0.6583 0.9978 0.0869  -0.1793 -0.0067 316 ALA B CB  
815  N N   . LEU B 52 ? 1.1876 0.6486 0.9988 0.0726  -0.1739 0.0062  317 LEU B N   
816  C CA  . LEU B 52 ? 1.2174 0.6367 0.9929 0.0713  -0.1814 0.0091  317 LEU B CA  
817  C C   . LEU B 52 ? 1.2317 0.6335 0.9951 0.0634  -0.1698 0.0133  317 LEU B C   
818  O O   . LEU B 52 ? 1.2501 0.6318 1.0006 0.0658  -0.1781 0.0132  317 LEU B O   
819  C CB  . LEU B 52 ? 1.2363 0.6345 0.9869 0.0667  -0.1810 0.0124  317 LEU B CB  
820  C CG  . LEU B 52 ? 1.2849 0.6368 0.9946 0.0638  -0.1878 0.0161  317 LEU B CG  
821  C CD1 . LEU B 52 ? 1.2889 0.6285 0.9913 0.0744  -0.2109 0.0122  317 LEU B CD1 
822  C CD2 . LEU B 52 ? 1.3164 0.6511 1.0038 0.0559  -0.1800 0.0202  317 LEU B CD2 
823  N N   . SER B 53 ? 1.3354 0.7457 1.1040 0.0542  -0.1509 0.0167  318 SER B N   
824  C CA  . SER B 53 ? 1.3371 0.7365 1.0992 0.0460  -0.1379 0.0203  318 SER B CA  
825  C C   . SER B 53 ? 1.3252 0.7361 1.1045 0.0501  -0.1411 0.0178  318 SER B C   
826  O O   . SER B 53 ? 1.3378 0.7293 1.1035 0.0445  -0.1361 0.0206  318 SER B O   
827  C CB  . SER B 53 ? 1.3196 0.7364 1.0946 0.0376  -0.1180 0.0227  318 SER B CB  
828  O OG  . SER B 53 ? 1.3408 0.7522 1.1148 0.0301  -0.1054 0.0253  318 SER B OG  
829  N N   . SER B 54 ? 1.2861 0.7282 1.0949 0.0592  -0.1488 0.0124  319 SER B N   
830  C CA  . SER B 54 ? 1.2682 0.7200 1.0921 0.0642  -0.1538 0.0092  319 SER B CA  
831  C C   . SER B 54 ? 1.2881 0.7203 1.0990 0.0737  -0.1742 0.0058  319 SER B C   
832  O O   . SER B 54 ? 1.2874 0.7201 1.1047 0.0772  -0.1786 0.0036  319 SER B O   
833  C CB  . SER B 54 ? 1.2217 0.7173 1.0845 0.0678  -0.1492 0.0051  319 SER B CB  
834  O OG  . SER B 54 ? 1.2168 0.7285 1.0933 0.0786  -0.1641 -0.0009 319 SER B OG  
835  N N   . LYS B 55 ? 1.2397 0.6547 1.0329 0.0781  -0.1871 0.0050  320 LYS B N   
836  C CA  . LYS B 55 ? 1.2621 0.6552 1.0405 0.0867  -0.2067 0.0021  320 LYS B CA  
837  C C   . LYS B 55 ? 1.2892 0.6385 1.0302 0.0791  -0.2055 0.0080  320 LYS B C   
838  O O   . LYS B 55 ? 1.3000 0.6288 1.0287 0.0826  -0.2159 0.0073  320 LYS B O   
839  C CB  . LYS B 55 ? 1.2722 0.6647 1.0474 0.0944  -0.2216 -0.0012 320 LYS B CB  
840  C CG  . LYS B 55 ? 1.2727 0.7082 1.0845 0.1020  -0.2241 -0.0077 320 LYS B CG  
841  C CD  . LYS B 55 ? 1.3589 0.7935 1.1687 0.1107  -0.2414 -0.0119 320 LYS B CD  
842  C CE  . LYS B 55 ? 1.3539 0.8325 1.2023 0.1194  -0.2459 -0.0199 320 LYS B CE  
843  N NZ  . LYS B 55 ? 1.3895 0.8681 1.2422 0.1321  -0.2673 -0.0272 320 LYS B NZ  
844  N N   . VAL B 56 ? 1.2943 0.6294 1.0171 0.0682  -0.1921 0.0139  321 VAL B N   
845  C CA  . VAL B 56 ? 1.3339 0.6309 1.0235 0.0589  -0.1871 0.0196  321 VAL B CA  
846  C C   . VAL B 56 ? 1.3296 0.6308 1.0283 0.0541  -0.1773 0.0208  321 VAL B C   
847  O O   . VAL B 56 ? 1.3692 0.6396 1.0444 0.0516  -0.1822 0.0231  321 VAL B O   
848  C CB  . VAL B 56 ? 1.3411 0.6193 1.0065 0.0474  -0.1741 0.0254  321 VAL B CB  
849  C CG1 . VAL B 56 ? 1.3312 0.6150 0.9961 0.0520  -0.1811 0.0237  321 VAL B CG1 
850  C CG2 . VAL B 56 ? 1.3109 0.6075 0.9910 0.0376  -0.1516 0.0279  321 VAL B CG2 
851  N N   . GLN B 57 ? 1.2817 0.6189 1.0127 0.0525  -0.1641 0.0194  322 GLN B N   
852  C CA  . GLN B 57 ? 1.2771 0.6207 1.0192 0.0487  -0.1558 0.0200  322 GLN B CA  
853  C C   . GLN B 57 ? 1.2882 0.6314 1.0365 0.0597  -0.1734 0.0151  322 GLN B C   
854  O O   . GLN B 57 ? 1.3206 0.6387 1.0514 0.0575  -0.1771 0.0168  322 GLN B O   
855  C CB  . GLN B 57 ? 1.2404 0.6235 1.0170 0.0457  -0.1399 0.0191  322 GLN B CB  
856  N N   . GLN B 58 ? 1.1367 0.5048 0.9071 0.0713  -0.1848 0.0089  323 GLN B N   
857  C CA  . GLN B 58 ? 1.1543 0.5220 0.9308 0.0829  -0.2027 0.0031  323 GLN B CA  
858  C C   . GLN B 58 ? 1.2192 0.5397 0.9578 0.0836  -0.2168 0.0054  323 GLN B C   
859  O O   . GLN B 58 ? 1.2259 0.5327 0.9591 0.0861  -0.2238 0.0043  323 GLN B O   
860  C CB  . GLN B 58 ? 1.1206 0.5193 0.9234 0.0950  -0.2135 -0.0042 323 GLN B CB  
861  N N   . LEU B 59 ? 1.4751 0.7695 1.1860 0.0804  -0.2201 0.0089  324 LEU B N   
862  C CA  . LEU B 59 ? 1.5373 0.7855 1.2097 0.0795  -0.2323 0.0119  324 LEU B CA  
863  C C   . LEU B 59 ? 1.5845 0.8038 1.2326 0.0675  -0.2223 0.0182  324 LEU B C   
864  O O   . LEU B 59 ? 1.6350 0.8241 1.2620 0.0691  -0.2340 0.0187  324 LEU B O   
865  C CB  . LEU B 59 ? 1.5577 0.7853 1.2056 0.0776  -0.2367 0.0146  324 LEU B CB  
866  C CG  . LEU B 59 ? 1.5593 0.7924 1.2134 0.0909  -0.2568 0.0088  324 LEU B CG  
867  C CD1 . LEU B 59 ? 1.5912 0.8137 1.2280 0.0865  -0.2548 0.0120  324 LEU B CD1 
868  C CD2 . LEU B 59 ? 1.5741 0.7759 1.2081 0.0990  -0.2784 0.0066  324 LEU B CD2 
869  N N   . GLU B 60 ? 1.4792 0.7048 1.1282 0.0551  -0.2013 0.0229  325 GLU B N   
870  C CA  . GLU B 60 ? 1.5262 0.7194 1.1475 0.0432  -0.1934 0.0288  325 GLU B CA  
871  C C   . GLU B 60 ? 1.5213 0.7250 1.1589 0.0425  -0.1895 0.0277  325 GLU B C   
872  O O   . GLU B 60 ? 1.5461 0.7217 1.1613 0.0341  -0.1864 0.0318  325 GLU B O   
873  C CB  . GLU B 60 ? 1.5348 0.7210 1.1422 0.0292  -0.1738 0.0346  325 GLU B CB  
874  C CG  . GLU B 60 ? 1.5232 0.7496 1.1635 0.0264  -0.1563 0.0336  325 GLU B CG  
875  C CD  . GLU B 60 ? 1.6223 0.8380 1.2452 0.0144  -0.1400 0.0384  325 GLU B CD  
876  O OE1 . GLU B 60 ? 1.6500 0.8361 1.2416 0.0128  -0.1466 0.0407  325 GLU B OE1 
877  O OE2 . GLU B 60 ? 1.6442 0.8802 1.2842 0.0065  -0.1209 0.0397  325 GLU B OE2 
878  N N   . ARG B 61 ? 1.5647 0.8089 1.2411 0.0507  -0.1893 0.0222  326 ARG B N   
879  C CA  . ARG B 61 ? 1.5647 0.8206 1.2589 0.0533  -0.1900 0.0196  326 ARG B CA  
880  C C   . ARG B 61 ? 1.6035 0.8347 1.2824 0.0635  -0.2125 0.0163  326 ARG B C   
881  O O   . ARG B 61 ? 1.6201 0.8308 1.2867 0.0612  -0.2160 0.0175  326 ARG B O   
882  C CB  . ARG B 61 ? 1.5091 0.8143 1.2473 0.0592  -0.1840 0.0144  326 ARG B CB  
883  N N   . SER B 62 ? 1.6964 0.9276 1.3743 0.0743  -0.2280 0.0123  327 SER B N   
884  C CA  . SER B 62 ? 1.7373 0.9465 1.4024 0.0851  -0.2504 0.0085  327 SER B CA  
885  C C   . SER B 62 ? 1.7992 0.9554 1.4196 0.0779  -0.2567 0.0144  327 SER B C   
886  O O   . SER B 62 ? 1.8309 0.9672 1.4415 0.0836  -0.2710 0.0124  327 SER B O   
887  C CB  . SER B 62 ? 1.7284 0.9484 1.4015 0.0970  -0.2648 0.0032  327 SER B CB  
888  O OG  . SER B 62 ? 1.8040 0.9922 1.4550 0.1055  -0.2868 0.0010  327 SER B OG  
889  N N   . ILE B 63 ? 1.7735 0.9066 1.3664 0.0655  -0.2464 0.0215  328 ILE B N   
890  C CA  . ILE B 63 ? 1.8248 0.9080 1.3739 0.0555  -0.2484 0.0281  328 ILE B CA  
891  C C   . ILE B 63 ? 1.8344 0.9183 1.3811 0.0391  -0.2250 0.0339  328 ILE B C   
892  O O   . ILE B 63 ? 1.8746 0.9299 1.3909 0.0255  -0.2149 0.0405  328 ILE B O   
893  C CB  . ILE B 63 ? 1.8570 0.9061 1.3702 0.0538  -0.2572 0.0315  328 ILE B CB  
894  C CG1 . ILE B 63 ? 1.8465 0.8967 1.3503 0.0404  -0.2371 0.0370  328 ILE B CG1 
895  C CG2 . ILE B 63 ? 1.8499 0.9136 1.3773 0.0693  -0.2750 0.0251  328 ILE B CG2 
896  C CD1 . ILE B 63 ? 1.8781 0.8874 1.3397 0.0352  -0.2432 0.0416  328 ILE B CD1 
897  N N   . GLU C 2  ? 1.6257 1.1511 1.4182 -0.0847 0.0015  0.0282  267 GLU C N   
898  C CA  . GLU C 2  ? 1.6340 1.1599 1.4271 -0.0817 -0.0072 0.0139  267 GLU C CA  
899  C C   . GLU C 2  ? 1.6250 1.1498 1.4041 -0.0695 -0.0089 0.0162  267 GLU C C   
900  O O   . GLU C 2  ? 1.6094 1.1507 1.3893 -0.0695 -0.0106 0.0138  267 GLU C O   
901  C CB  . GLU C 2  ? 1.6567 1.1635 1.4546 -0.0823 -0.0141 0.0015  267 GLU C CB  
902  C CG  . GLU C 2  ? 1.6917 1.1805 1.4738 -0.0687 -0.0216 -0.0063 267 GLU C CG  
903  C CD  . GLU C 2  ? 1.7293 1.2075 1.5159 -0.0684 -0.0327 -0.0239 267 GLU C CD  
904  O OE1 . GLU C 2  ? 1.7270 1.2219 1.5268 -0.0755 -0.0362 -0.0328 267 GLU C OE1 
905  O OE2 . GLU C 2  ? 1.7609 1.2126 1.5359 -0.0596 -0.0385 -0.0287 267 GLU C OE2 
906  N N   . LEU C 3  ? 1.6986 1.2036 1.4651 -0.0588 -0.0079 0.0214  268 LEU C N   
907  C CA  . LEU C 3  ? 1.6813 1.1844 1.4364 -0.0460 -0.0072 0.0263  268 LEU C CA  
908  C C   . LEU C 3  ? 1.6538 1.1746 1.4116 -0.0471 -0.0015 0.0410  268 LEU C C   
909  O O   . LEU C 3  ? 1.6357 1.1679 1.3936 -0.0426 -0.0018 0.0436  268 LEU C O   
910  C CB  . LEU C 3  ? 1.7072 1.1819 1.4469 -0.0328 -0.0065 0.0289  268 LEU C CB  
911  C CG  . LEU C 3  ? 1.7154 1.1805 1.4423 -0.0169 -0.0067 0.0289  268 LEU C CG  
912  C CD1 . LEU C 3  ? 1.7195 1.1813 1.4443 -0.0146 -0.0148 0.0114  268 LEU C CD1 
913  C CD2 . LEU C 3  ? 1.7521 1.1879 1.4613 -0.0025 -0.0033 0.0363  268 LEU C CD2 
914  N N   . LEU C 4  ? 1.5694 1.0916 1.3301 -0.0531 0.0034  0.0503  269 LEU C N   
915  C CA  . LEU C 4  ? 1.5401 1.0806 1.3050 -0.0572 0.0067  0.0616  269 LEU C CA  
916  C C   . LEU C 4  ? 1.5024 1.0648 1.2744 -0.0641 0.0027  0.0554  269 LEU C C   
917  O O   . LEU C 4  ? 1.4898 1.0665 1.2631 -0.0643 0.0025  0.0631  269 LEU C O   
918  C CB  . LEU C 4  ? 1.5562 1.0922 1.3221 -0.0635 0.0124  0.0684  269 LEU C CB  
919  N N   . GLN C 5  ? 1.3515 0.9152 1.1277 -0.0689 -0.0013 0.0414  270 GLN C N   
920  C CA  . GLN C 5  ? 1.3182 0.9005 1.1002 -0.0764 -0.0041 0.0347  270 GLN C CA  
921  C C   . GLN C 5  ? 1.2877 0.8752 1.0693 -0.0738 -0.0100 0.0221  270 GLN C C   
922  O O   . GLN C 5  ? 1.2645 0.8677 1.0475 -0.0774 -0.0121 0.0193  270 GLN C O   
923  C CB  . GLN C 5  ? 1.3264 0.9099 1.1167 -0.0866 -0.0014 0.0311  270 GLN C CB  
924  N N   . ARG C 6  ? 1.4307 1.0027 1.2083 -0.0667 -0.0127 0.0143  271 ARG C N   
925  C CA  . ARG C 6  ? 1.4039 0.9752 1.1778 -0.0609 -0.0176 0.0027  271 ARG C CA  
926  C C   . ARG C 6  ? 1.3700 0.9477 1.1392 -0.0531 -0.0161 0.0102  271 ARG C C   
927  O O   . ARG C 6  ? 1.3521 0.9373 1.1197 -0.0502 -0.0186 0.0040  271 ARG C O   
928  C CB  . ARG C 6  ? 1.4335 0.9803 1.2000 -0.0519 -0.0204 -0.0045 271 ARG C CB  
929  C CG  . ARG C 6  ? 1.4565 0.9956 1.2289 -0.0572 -0.0265 -0.0188 271 ARG C CG  
930  C CD  . ARG C 6  ? 1.5139 1.0240 1.2771 -0.0484 -0.0299 -0.0226 271 ARG C CD  
931  N NE  . ARG C 6  ? 1.5475 1.0424 1.2969 -0.0348 -0.0353 -0.0326 271 ARG C NE  
932  C CZ  . ARG C 6  ? 1.5924 1.0589 1.3291 -0.0244 -0.0400 -0.0379 271 ARG C CZ  
933  N NH1 . ARG C 6  ? 1.6118 1.0618 1.3485 -0.0267 -0.0404 -0.0344 271 ARG C NH1 
934  N NH2 . ARG C 6  ? 1.6055 1.0578 1.3272 -0.0104 -0.0443 -0.0468 271 ARG C NH2 
935  N N   . CYS C 7  ? 1.2896 0.8633 1.0578 -0.0496 -0.0117 0.0242  272 CYS C N   
936  C CA  . CYS C 7  ? 1.2624 0.8369 1.0291 -0.0406 -0.0094 0.0338  272 CYS C CA  
937  C C   . CYS C 7  ? 1.2324 0.8278 1.0066 -0.0475 -0.0105 0.0411  272 CYS C C   
938  O O   . CYS C 7  ? 1.2233 0.8272 1.0005 -0.0439 -0.0118 0.0431  272 CYS C O   
939  C CB  . CYS C 7  ? 1.2765 0.8348 1.0388 -0.0332 -0.0043 0.0451  272 CYS C CB  
940  S SG  . CYS C 7  ? 1.3078 0.8700 1.0737 -0.0236 0.0004  0.0625  272 CYS C SG  
941  N N   . GLU C 8  ? 1.2917 0.8942 1.0686 -0.0567 -0.0103 0.0451  273 GLU C N   
942  C CA  . GLU C 8  ? 1.2531 0.8739 1.0335 -0.0633 -0.0134 0.0496  273 GLU C CA  
943  C C   . GLU C 8  ? 1.2221 0.8537 1.0019 -0.0677 -0.0179 0.0379  273 GLU C C   
944  O O   . GLU C 8  ? 1.2162 0.8602 0.9969 -0.0695 -0.0220 0.0401  273 GLU C O   
945  C CB  . GLU C 8  ? 1.2649 0.8878 1.0444 -0.0703 -0.0114 0.0558  273 GLU C CB  
946  N N   . SER C 9  ? 1.0621 0.6884 0.8402 -0.0692 -0.0179 0.0255  274 SER C N   
947  C CA  . SER C 9  ? 1.0255 0.6598 0.8023 -0.0713 -0.0214 0.0135  274 SER C CA  
948  C C   . SER C 9  ? 1.0021 0.6367 0.7770 -0.0627 -0.0232 0.0112  274 SER C C   
949  O O   . SER C 9  ? 0.9871 0.6332 0.7613 -0.0644 -0.0262 0.0093  274 SER C O   
950  C CB  . SER C 9  ? 1.0276 0.6541 0.8056 -0.0737 -0.0213 0.0019  274 SER C CB  
951  O OG  . SER C 9  ? 1.0531 0.6904 0.8313 -0.0785 -0.0239 -0.0080 274 SER C OG  
952  N N   . LEU C 10 ? 1.0538 0.6738 0.8266 -0.0528 -0.0206 0.0119  275 LEU C N   
953  C CA  . LEU C 10 ? 1.0345 0.6516 0.8060 -0.0424 -0.0194 0.0131  275 LEU C CA  
954  C C   . LEU C 10 ? 1.0151 0.6453 0.7946 -0.0432 -0.0200 0.0247  275 LEU C C   
955  O O   . LEU C 10 ? 1.0169 0.6542 0.7980 -0.0412 -0.0216 0.0220  275 LEU C O   
956  C CB  . LEU C 10 ? 1.0443 0.6407 0.8106 -0.0300 -0.0150 0.0161  275 LEU C CB  
957  C CG  . LEU C 10 ? 1.0641 0.6451 0.8218 -0.0279 -0.0170 0.0026  275 LEU C CG  
958  C CD1 . LEU C 10 ? 1.0926 0.6510 0.8404 -0.0127 -0.0135 0.0043  275 LEU C CD1 
959  C CD2 . LEU C 10 ? 1.0769 0.6649 0.8321 -0.0306 -0.0216 -0.0130 275 LEU C CD2 
960  N N   . GLU C 11 ? 1.0819 0.7149 0.8669 -0.0462 -0.0196 0.0371  276 GLU C N   
961  C CA  . GLU C 11 ? 1.0896 0.7355 0.8840 -0.0484 -0.0227 0.0481  276 GLU C CA  
962  C C   . GLU C 11 ? 1.0720 0.7323 0.8657 -0.0562 -0.0296 0.0424  276 GLU C C   
963  O O   . GLU C 11 ? 1.0725 0.7408 0.8739 -0.0551 -0.0331 0.0465  276 GLU C O   
964  C CB  . GLU C 11 ? 1.1001 0.7468 0.8976 -0.0516 -0.0225 0.0603  276 GLU C CB  
965  C CG  . GLU C 11 ? 1.1527 0.7952 0.9592 -0.0432 -0.0187 0.0748  276 GLU C CG  
966  C CD  . GLU C 11 ? 1.2525 0.8834 1.0543 -0.0414 -0.0135 0.0817  276 GLU C CD  
967  O OE1 . GLU C 11 ? 1.3014 0.9251 1.0939 -0.0457 -0.0122 0.0734  276 GLU C OE1 
968  O OE2 . GLU C 11 ? 1.2756 0.9047 1.0842 -0.0357 -0.0105 0.0956  276 GLU C OE2 
969  N N   . LYS C 12 ? 0.9991 0.6615 0.7843 -0.0637 -0.0312 0.0336  277 LYS C N   
970  C CA  . LYS C 12 ? 0.9863 0.6598 0.7666 -0.0708 -0.0370 0.0288  277 LYS C CA  
971  C C   . LYS C 12 ? 0.9608 0.6374 0.7376 -0.0691 -0.0383 0.0176  277 LYS C C   
972  O O   . LYS C 12 ? 0.9439 0.6289 0.7200 -0.0713 -0.0438 0.0175  277 LYS C O   
973  C CB  . LYS C 12 ? 1.0084 0.6815 0.7813 -0.0777 -0.0355 0.0244  277 LYS C CB  
974  C CG  . LYS C 12 ? 1.0686 0.7416 0.8407 -0.0810 -0.0355 0.0352  277 LYS C CG  
975  C CD  . LYS C 12 ? 1.2013 0.8735 0.9669 -0.0870 -0.0319 0.0307  277 LYS C CD  
976  C CE  . LYS C 12 ? 1.2508 0.9209 1.0127 -0.0890 -0.0303 0.0413  277 LYS C CE  
977  N NZ  . LYS C 12 ? 1.2777 0.9402 1.0418 -0.0917 -0.0220 0.0405  277 LYS C NZ  
978  N N   . LYS C 13 ? 0.9385 0.6069 0.7121 -0.0649 -0.0340 0.0080  278 LYS C N   
979  C CA  . LYS C 13 ? 0.9126 0.5824 0.6802 -0.0628 -0.0347 -0.0046 278 LYS C CA  
980  C C   . LYS C 13 ? 0.9084 0.5785 0.6810 -0.0557 -0.0343 -0.0001 278 LYS C C   
981  O O   . LYS C 13 ? 0.9145 0.5923 0.6856 -0.0569 -0.0374 -0.0030 278 LYS C O   
982  C CB  . LYS C 13 ? 0.9211 0.5801 0.6847 -0.0590 -0.0317 -0.0152 278 LYS C CB  
983  N N   . THR C 14 ? 0.9292 0.5909 0.7087 -0.0485 -0.0301 0.0090  279 THR C N   
984  C CA  . THR C 14 ? 0.9268 0.5880 0.7157 -0.0405 -0.0276 0.0171  279 THR C CA  
985  C C   . THR C 14 ? 0.9035 0.5785 0.7035 -0.0463 -0.0339 0.0254  279 THR C C   
986  O O   . THR C 14 ? 0.9021 0.5814 0.7061 -0.0443 -0.0348 0.0237  279 THR C O   
987  C CB  . THR C 14 ? 0.9526 0.6015 0.7462 -0.0321 -0.0213 0.0274  279 THR C CB  
988  O OG1 . THR C 14 ? 0.9790 0.6115 0.7614 -0.0220 -0.0160 0.0187  279 THR C OG1 
989  C CG2 . THR C 14 ? 0.9587 0.6111 0.7689 -0.0268 -0.0190 0.0428  279 THR C CG2 
990  N N   . ALA C 15 ? 0.8144 0.4955 0.6188 -0.0534 -0.0390 0.0338  280 ALA C N   
991  C CA  . ALA C 15 ? 0.7833 0.4754 0.5966 -0.0586 -0.0476 0.0404  280 ALA C CA  
992  C C   . ALA C 15 ? 0.7668 0.4647 0.5701 -0.0637 -0.0534 0.0296  280 ALA C C   
993  O O   . ALA C 15 ? 0.7466 0.4500 0.5573 -0.0646 -0.0587 0.0315  280 ALA C O   
994  C CB  . ALA C 15 ? 0.7755 0.4708 0.5889 -0.0645 -0.0531 0.0482  280 ALA C CB  
995  N N   . THR C 16 ? 0.8451 0.5415 0.6321 -0.0673 -0.0523 0.0188  281 THR C N   
996  C CA  . THR C 16 ? 0.8352 0.5361 0.6102 -0.0710 -0.0565 0.0084  281 THR C CA  
997  C C   . THR C 16 ? 0.8402 0.5398 0.6178 -0.0648 -0.0531 0.0028  281 THR C C   
998  O O   . THR C 16 ? 0.8547 0.5591 0.6330 -0.0665 -0.0583 0.0019  281 THR C O   
999  C CB  . THR C 16 ? 0.8338 0.5337 0.5937 -0.0749 -0.0542 -0.0014 281 THR C CB  
1000 O OG1 . THR C 16 ? 0.8280 0.5283 0.5857 -0.0799 -0.0562 0.0052  281 THR C OG1 
1001 C CG2 . THR C 16 ? 0.8300 0.5347 0.5767 -0.0781 -0.0581 -0.0102 281 THR C CG2 
1002 N N   . PHE C 17 ? 0.8204 0.5120 0.5985 -0.0566 -0.0446 -0.0009 282 PHE C N   
1003 C CA  . PHE C 17 ? 0.8055 0.4937 0.5851 -0.0484 -0.0399 -0.0049 282 PHE C CA  
1004 C C   . PHE C 17 ? 0.8034 0.4953 0.6011 -0.0468 -0.0413 0.0069  282 PHE C C   
1005 O O   . PHE C 17 ? 0.7948 0.4902 0.5938 -0.0471 -0.0433 0.0043  282 PHE C O   
1006 C CB  . PHE C 17 ? 0.8331 0.5084 0.6092 -0.0374 -0.0310 -0.0086 282 PHE C CB  
1007 C CG  . PHE C 17 ? 0.8450 0.5164 0.6072 -0.0394 -0.0311 -0.0206 282 PHE C CG  
1008 C CD1 . PHE C 17 ? 0.8274 0.5067 0.5787 -0.0467 -0.0355 -0.0311 282 PHE C CD1 
1009 C CD2 . PHE C 17 ? 0.8518 0.5115 0.6125 -0.0340 -0.0272 -0.0208 282 PHE C CD2 
1010 C CE1 . PHE C 17 ? 0.8812 0.5587 0.6241 -0.0490 -0.0356 -0.0412 282 PHE C CE1 
1011 C CE2 . PHE C 17 ? 0.9211 0.5774 0.6726 -0.0368 -0.0287 -0.0322 282 PHE C CE2 
1012 C CZ  . PHE C 17 ? 0.9125 0.5788 0.6573 -0.0446 -0.0327 -0.0419 282 PHE C CZ  
1013 N N   . GLU C 18 ? 0.8027 0.4940 0.6160 -0.0451 -0.0404 0.0206  283 GLU C N   
1014 C CA  . GLU C 18 ? 0.7963 0.4924 0.6319 -0.0434 -0.0417 0.0327  283 GLU C CA  
1015 C C   . GLU C 18 ? 0.8172 0.5234 0.6539 -0.0537 -0.0543 0.0313  283 GLU C C   
1016 O O   . GLU C 18 ? 0.8310 0.5403 0.6774 -0.0533 -0.0562 0.0319  283 GLU C O   
1017 C CB  . GLU C 18 ? 0.7998 0.4956 0.6520 -0.0412 -0.0402 0.0480  283 GLU C CB  
1018 N N   . ASN C 19 ? 0.8620 0.5718 0.6871 -0.0622 -0.0630 0.0291  284 ASN C N   
1019 C CA  . ASN C 19 ? 0.8790 0.5947 0.7010 -0.0701 -0.0757 0.0276  284 ASN C CA  
1020 C C   . ASN C 19 ? 0.8826 0.5977 0.6912 -0.0704 -0.0755 0.0156  284 ASN C C   
1021 O O   . ASN C 19 ? 0.9012 0.6193 0.7161 -0.0734 -0.0834 0.0167  284 ASN C O   
1022 C CB  . ASN C 19 ? 0.8972 0.6139 0.7052 -0.0771 -0.0841 0.0277  284 ASN C CB  
1023 C CG  . ASN C 19 ? 0.9301 0.6487 0.7535 -0.0778 -0.0887 0.0414  284 ASN C CG  
1024 O OD1 . ASN C 19 ? 0.9411 0.6569 0.7592 -0.0773 -0.0844 0.0440  284 ASN C OD1 
1025 N ND2 . ASN C 19 ? 0.9774 0.7008 0.8204 -0.0791 -0.0978 0.0502  284 ASN C ND2 
1026 N N   . ILE C 20 ? 0.7898 0.5009 0.5807 -0.0674 -0.0676 0.0041  285 ILE C N   
1027 C CA  . ILE C 20 ? 0.7922 0.5031 0.5682 -0.0675 -0.0677 -0.0076 285 ILE C CA  
1028 C C   . ILE C 20 ? 0.8050 0.5142 0.5942 -0.0611 -0.0626 -0.0061 285 ILE C C   
1029 O O   . ILE C 20 ? 0.8045 0.5153 0.5913 -0.0634 -0.0672 -0.0095 285 ILE C O   
1030 C CB  . ILE C 20 ? 0.7988 0.5062 0.5561 -0.0645 -0.0602 -0.0201 285 ILE C CB  
1031 C CG1 . ILE C 20 ? 0.8075 0.5172 0.5506 -0.0714 -0.0645 -0.0228 285 ILE C CG1 
1032 C CG2 . ILE C 20 ? 0.7714 0.4780 0.5156 -0.0616 -0.0579 -0.0317 285 ILE C CG2 
1033 C CD1 . ILE C 20 ? 0.8280 0.5353 0.5598 -0.0688 -0.0573 -0.0334 285 ILE C CD1 
1034 N N   . VAL C 21 ? 0.9094 0.6138 0.7120 -0.0522 -0.0524 -0.0004 286 VAL C N   
1035 C CA  . VAL C 21 ? 0.9224 0.6231 0.7378 -0.0433 -0.0441 0.0022  286 VAL C CA  
1036 C C   . VAL C 21 ? 0.9292 0.6362 0.7705 -0.0474 -0.0508 0.0143  286 VAL C C   
1037 O O   . VAL C 21 ? 0.9487 0.6549 0.8002 -0.0441 -0.0476 0.0151  286 VAL C O   
1038 C CB  . VAL C 21 ? 0.9319 0.6231 0.7517 -0.0309 -0.0311 0.0061  286 VAL C CB  
1039 C CG1 . VAL C 21 ? 0.9233 0.6113 0.7653 -0.0218 -0.0226 0.0171  286 VAL C CG1 
1040 C CG2 . VAL C 21 ? 0.9315 0.6139 0.7257 -0.0245 -0.0248 -0.0091 286 VAL C CG2 
1041 N N   . CYS C 22 ? 0.8763 0.5892 0.7290 -0.0544 -0.0604 0.0236  287 CYS C N   
1042 C CA  . CYS C 22 ? 0.8937 0.6134 0.7709 -0.0602 -0.0710 0.0339  287 CYS C CA  
1043 C C   . CYS C 22 ? 0.8819 0.6034 0.7486 -0.0683 -0.0835 0.0258  287 CYS C C   
1044 O O   . CYS C 22 ? 0.8934 0.6171 0.7797 -0.0701 -0.0883 0.0304  287 CYS C O   
1045 C CB  . CYS C 22 ? 0.9069 0.6311 0.7952 -0.0646 -0.0790 0.0446  287 CYS C CB  
1046 S SG  . CYS C 22 ? 1.0445 0.7760 0.9484 -0.0750 -0.1000 0.0510  287 CYS C SG  
1047 N N   . VAL C 23 ? 0.8503 0.5698 0.6862 -0.0724 -0.0877 0.0139  288 VAL C N   
1048 C CA  . VAL C 23 ? 0.8268 0.5450 0.6453 -0.0778 -0.0969 0.0048  288 VAL C CA  
1049 C C   . VAL C 23 ? 0.8251 0.5397 0.6395 -0.0720 -0.0869 -0.0030 288 VAL C C   
1050 O O   . VAL C 23 ? 0.8251 0.5386 0.6408 -0.0751 -0.0933 -0.0051 288 VAL C O   
1051 C CB  . VAL C 23 ? 0.8143 0.5305 0.6001 -0.0820 -0.1019 -0.0046 288 VAL C CB  
1052 C CG1 . VAL C 23 ? 0.8279 0.5409 0.5946 -0.0858 -0.1101 -0.0129 288 VAL C CG1 
1053 C CG2 . VAL C 23 ? 0.8018 0.5195 0.5889 -0.0869 -0.1120 0.0031  288 VAL C CG2 
1054 N N   . LEU C 24 ? 0.8411 0.5522 0.6492 -0.0630 -0.0717 -0.0076 289 LEU C N   
1055 C CA  . LEU C 24 ? 0.8389 0.5451 0.6400 -0.0559 -0.0617 -0.0154 289 LEU C CA  
1056 C C   . LEU C 24 ? 0.8642 0.5701 0.6960 -0.0519 -0.0575 -0.0046 289 LEU C C   
1057 O O   . LEU C 24 ? 0.8693 0.5731 0.7019 -0.0516 -0.0569 -0.0078 289 LEU C O   
1058 C CB  . LEU C 24 ? 0.8264 0.5270 0.6127 -0.0460 -0.0482 -0.0231 289 LEU C CB  
1059 C CG  . LEU C 24 ? 0.7846 0.4870 0.5442 -0.0512 -0.0530 -0.0337 289 LEU C CG  
1060 C CD1 . LEU C 24 ? 0.6986 0.3965 0.4517 -0.0440 -0.0439 -0.0377 289 LEU C CD1 
1061 C CD2 . LEU C 24 ? 0.7173 0.4193 0.4525 -0.0535 -0.0556 -0.0462 289 LEU C CD2 
1062 N N   . ASN C 25 ? 0.9189 0.6269 0.7774 -0.0489 -0.0541 0.0091  290 ASN C N   
1063 C CA  . ASN C 25 ? 0.9281 0.6374 0.8218 -0.0458 -0.0504 0.0220  290 ASN C CA  
1064 C C   . ASN C 25 ? 0.9406 0.6544 0.8452 -0.0566 -0.0656 0.0228  290 ASN C C   
1065 O O   . ASN C 25 ? 0.9455 0.6577 0.8667 -0.0543 -0.0613 0.0255  290 ASN C O   
1066 C CB  . ASN C 25 ? 0.9257 0.6392 0.8478 -0.0443 -0.0495 0.0382  290 ASN C CB  
1067 C CG  . ASN C 25 ? 0.9654 0.6797 0.9266 -0.0377 -0.0403 0.0534  290 ASN C CG  
1068 O OD1 . ASN C 25 ? 0.9634 0.6762 0.9349 -0.0366 -0.0374 0.0528  290 ASN C OD1 
1069 N ND2 . ASN C 25 ? 0.9753 0.6917 0.9593 -0.0327 -0.0348 0.0682  290 ASN C ND2 
1070 N N   . ARG C 26 ? 0.8896 0.6076 0.7856 -0.0677 -0.0835 0.0211  291 ARG C N   
1071 C CA  . ARG C 26 ? 0.9106 0.6302 0.8139 -0.0775 -0.1010 0.0214  291 ARG C CA  
1072 C C   . ARG C 26 ? 0.9140 0.6272 0.7910 -0.0778 -0.1002 0.0080  291 ARG C C   
1073 O O   . ARG C 26 ? 0.9203 0.6318 0.8111 -0.0804 -0.1044 0.0091  291 ARG C O   
1074 C CB  . ARG C 26 ? 0.9269 0.6487 0.8195 -0.0867 -0.1199 0.0217  291 ARG C CB  
1075 C CG  . ARG C 26 ? 1.0004 0.7289 0.9266 -0.0891 -0.1275 0.0365  291 ARG C CG  
1076 C CD  . ARG C 26 ? 1.1415 0.8697 1.0682 -0.0991 -0.1520 0.0370  291 ARG C CD  
1077 N NE  . ARG C 26 ? 1.2211 0.9435 1.1060 -0.1018 -0.1596 0.0267  291 ARG C NE  
1078 C CZ  . ARG C 26 ? 1.2390 0.9625 1.1116 -0.1012 -0.1595 0.0285  291 ARG C CZ  
1079 N NH1 . ARG C 26 ? 1.2250 0.9550 1.1226 -0.0981 -0.1533 0.0398  291 ARG C NH1 
1080 N NH2 . ARG C 26 ? 1.2065 0.9238 1.0416 -0.1029 -0.1647 0.0196  291 ARG C NH2 
1081 N N   . GLU C 27 ? 0.9716 0.6813 0.8118 -0.0752 -0.0948 -0.0045 292 GLU C N   
1082 C CA  . GLU C 27 ? 0.9670 0.6708 0.7796 -0.0741 -0.0924 -0.0176 292 GLU C CA  
1083 C C   . GLU C 27 ? 0.9718 0.6720 0.7983 -0.0659 -0.0780 -0.0171 292 GLU C C   
1084 O O   . GLU C 27 ? 0.9793 0.6760 0.8077 -0.0691 -0.0829 -0.0193 292 GLU C O   
1085 C CB  . GLU C 27 ? 0.9690 0.6712 0.7473 -0.0707 -0.0858 -0.0292 292 GLU C CB  
1086 C CG  . GLU C 27 ? 0.9611 0.6582 0.7099 -0.0699 -0.0846 -0.0422 292 GLU C CG  
1087 C CD  . GLU C 27 ? 1.0039 0.7012 0.7185 -0.0699 -0.0836 -0.0528 292 GLU C CD  
1088 O OE1 . GLU C 27 ? 0.9465 0.6472 0.6618 -0.0680 -0.0790 -0.0515 292 GLU C OE1 
1089 O OE2 . GLU C 27 ? 0.9966 0.6901 0.6845 -0.0716 -0.0872 -0.0620 292 GLU C OE2 
1090 N N   . VAL C 28 ? 0.9189 0.6179 0.7548 -0.0548 -0.0607 -0.0137 293 VAL C N   
1091 C CA  . VAL C 28 ? 0.9448 0.6378 0.7913 -0.0444 -0.0449 -0.0126 293 VAL C CA  
1092 C C   . VAL C 28 ? 0.9505 0.6458 0.8338 -0.0488 -0.0496 -0.0008 293 VAL C C   
1093 O O   . VAL C 28 ? 0.9576 0.6476 0.8417 -0.0457 -0.0434 -0.0036 293 VAL C O   
1094 C CB  . VAL C 28 ? 0.9470 0.6346 0.7985 -0.0287 -0.0246 -0.0090 293 VAL C CB  
1095 C CG1 . VAL C 28 ? 0.9835 0.6673 0.8013 -0.0233 -0.0200 -0.0216 293 VAL C CG1 
1096 C CG2 . VAL C 28 ? 0.9766 0.6685 0.8613 -0.0273 -0.0231 0.0079  293 VAL C CG2 
1097 N N   . GLU C 29 ? 0.8700 0.5728 0.7847 -0.0558 -0.0603 0.0124  294 GLU C N   
1098 C CA  . GLU C 29 ? 0.8774 0.5829 0.8340 -0.0594 -0.0638 0.0248  294 GLU C CA  
1099 C C   . GLU C 29 ? 0.8909 0.5948 0.8423 -0.0711 -0.0820 0.0187  294 GLU C C   
1100 O O   . GLU C 29 ? 0.8966 0.5996 0.8760 -0.0726 -0.0821 0.0247  294 GLU C O   
1101 C CB  . GLU C 29 ? 0.8688 0.5834 0.8654 -0.0628 -0.0702 0.0419  294 GLU C CB  
1102 C CG  . GLU C 29 ? 0.9024 0.6176 0.9080 -0.0514 -0.0536 0.0507  294 GLU C CG  
1103 C CD  . GLU C 29 ? 0.9417 0.6478 0.9471 -0.0352 -0.0285 0.0517  294 GLU C CD  
1104 O OE1 . GLU C 29 ? 0.9010 0.6050 0.9283 -0.0331 -0.0225 0.0564  294 GLU C OE1 
1105 O OE2 . GLU C 29 ? 0.9718 0.6716 0.9549 -0.0239 -0.0151 0.0478  294 GLU C OE2 
1106 N N   . ARG C 30 ? 0.9408 0.6434 0.8582 -0.0788 -0.0975 0.0079  295 ARG C N   
1107 C CA  . ARG C 30 ? 0.9642 0.6610 0.8655 -0.0877 -0.1140 -0.0002 295 ARG C CA  
1108 C C   . ARG C 30 ? 0.9577 0.6465 0.8390 -0.0806 -0.0990 -0.0101 295 ARG C C   
1109 O O   . ARG C 30 ? 0.9538 0.6378 0.8466 -0.0833 -0.1017 -0.0100 295 ARG C O   
1110 C CB  . ARG C 30 ? 0.9796 0.6742 0.8430 -0.0944 -0.1306 -0.0092 295 ARG C CB  
1111 C CG  . ARG C 30 ? 1.0409 0.7399 0.9200 -0.1026 -0.1508 -0.0006 295 ARG C CG  
1112 C CD  . ARG C 30 ? 1.1498 0.8423 0.9890 -0.1083 -0.1687 -0.0091 295 ARG C CD  
1113 N NE  . ARG C 30 ? 1.2081 0.9043 1.0288 -0.1057 -0.1645 -0.0097 295 ARG C NE  
1114 C CZ  . ARG C 30 ? 1.2502 0.9444 1.0358 -0.1011 -0.1532 -0.0196 295 ARG C CZ  
1115 N NH1 . ARG C 30 ? 1.2526 0.9416 1.0153 -0.0978 -0.1447 -0.0301 295 ARG C NH1 
1116 N NH2 . ARG C 30 ? 1.2662 0.9639 1.0405 -0.0997 -0.1501 -0.0188 295 ARG C NH2 
1117 N N   . VAL C 31 ? 0.9444 0.6315 0.7970 -0.0711 -0.0833 -0.0187 296 VAL C N   
1118 C CA  . VAL C 31 ? 0.9486 0.6280 0.7797 -0.0626 -0.0684 -0.0287 296 VAL C CA  
1119 C C   . VAL C 31 ? 0.9596 0.6362 0.8245 -0.0555 -0.0541 -0.0197 296 VAL C C   
1120 O O   . VAL C 31 ? 0.9771 0.6467 0.8374 -0.0550 -0.0513 -0.0242 296 VAL C O   
1121 C CB  . VAL C 31 ? 0.9443 0.6227 0.7454 -0.0526 -0.0546 -0.0380 296 VAL C CB  
1122 C CG1 . VAL C 31 ? 0.9332 0.6033 0.7114 -0.0428 -0.0401 -0.0488 296 VAL C CG1 
1123 C CG2 . VAL C 31 ? 0.9652 0.6466 0.7360 -0.0597 -0.0675 -0.0459 296 VAL C CG2 
1124 N N   . ALA C 32 ? 0.8582 0.5392 0.7580 -0.0501 -0.0449 -0.0059 297 ALA C N   
1125 C CA  . ALA C 32 ? 0.8809 0.5591 0.8177 -0.0434 -0.0310 0.0055  297 ALA C CA  
1126 C C   . ALA C 32 ? 0.9050 0.5836 0.8697 -0.0548 -0.0446 0.0107  297 ALA C C   
1127 O O   . ALA C 32 ? 0.9065 0.5789 0.8839 -0.0496 -0.0327 0.0127  297 ALA C O   
1128 C CB  . ALA C 32 ? 0.8598 0.5420 0.8307 -0.0347 -0.0183 0.0215  297 ALA C CB  
1129 N N   . MET C 33 ? 1.0849 0.7694 1.0578 -0.0694 -0.0693 0.0125  298 MET C N   
1130 C CA  . MET C 33 ? 1.1395 0.8232 1.1396 -0.0808 -0.0859 0.0170  298 MET C CA  
1131 C C   . MET C 33 ? 1.1500 0.8223 1.1170 -0.0829 -0.0888 0.0029  298 MET C C   
1132 O O   . MET C 33 ? 1.1444 0.8118 1.1325 -0.0862 -0.0903 0.0058  298 MET C O   
1133 C CB  . MET C 33 ? 1.1614 0.8508 1.1686 -0.0942 -0.1134 0.0197  298 MET C CB  
1134 C CG  . MET C 33 ? 1.2482 0.9488 1.3095 -0.0969 -0.1177 0.0378  298 MET C CG  
1135 S SD  . MET C 33 ? 1.4543 1.1589 1.5155 -0.1119 -0.1533 0.0382  298 MET C SD  
1136 C CE  . MET C 33 ? 1.3778 1.0766 1.3694 -0.1108 -0.1577 0.0210  298 MET C CE  
1137 N N   . THR C 34 ? 1.1576 0.8258 1.0733 -0.0809 -0.0895 -0.0116 299 THR C N   
1138 C CA  . THR C 34 ? 1.1866 0.8442 1.0628 -0.0801 -0.0886 -0.0259 299 THR C CA  
1139 C C   . THR C 34 ? 1.2054 0.8567 1.0843 -0.0677 -0.0637 -0.0270 299 THR C C   
1140 O O   . THR C 34 ? 1.2231 0.8662 1.1059 -0.0698 -0.0641 -0.0288 299 THR C O   
1141 C CB  . THR C 34 ? 1.1747 0.8317 1.0003 -0.0773 -0.0886 -0.0390 299 THR C CB  
1142 O OG1 . THR C 34 ? 1.1941 0.8530 1.0099 -0.0882 -0.1120 -0.0394 299 THR C OG1 
1143 C CG2 . THR C 34 ? 1.2048 0.8514 0.9878 -0.0727 -0.0819 -0.0537 299 THR C CG2 
1144 N N   . ALA C 35 ? 1.2547 0.9076 1.1288 -0.0539 -0.0424 -0.0265 300 ALA C N   
1145 C CA  . ALA C 35 ? 1.2515 0.8960 1.1222 -0.0392 -0.0179 -0.0283 300 ALA C CA  
1146 C C   . ALA C 35 ? 1.2632 0.9062 1.1828 -0.0396 -0.0119 -0.0140 300 ALA C C   
1147 O O   . ALA C 35 ? 1.2741 0.9076 1.1893 -0.0353 -0.0023 -0.0175 300 ALA C O   
1148 C CB  . ALA C 35 ? 1.2415 0.8865 1.1016 -0.0239 0.0009  -0.0287 300 ALA C CB  
1149 N N   . GLU C 36 ? 1.0671 0.7194 1.0334 -0.0448 -0.0179 0.0021  301 GLU C N   
1150 C CA  . GLU C 36 ? 1.1022 0.7551 1.1230 -0.0454 -0.0119 0.0183  301 GLU C CA  
1151 C C   . GLU C 36 ? 1.1427 0.7915 1.1734 -0.0595 -0.0300 0.0155  301 GLU C C   
1152 O O   . GLU C 36 ? 1.1612 0.8015 1.2033 -0.0553 -0.0176 0.0169  301 GLU C O   
1153 C CB  . GLU C 36 ? 1.0867 0.7521 1.1561 -0.0482 -0.0157 0.0365  301 GLU C CB  
1154 N N   . ALA C 37 ? 1.2682 0.9209 1.2926 -0.0753 -0.0589 0.0114  302 ALA C N   
1155 C CA  . ALA C 37 ? 1.3013 0.9472 1.3293 -0.0890 -0.0804 0.0074  302 ALA C CA  
1156 C C   . ALA C 37 ? 1.3284 0.9601 1.3200 -0.0836 -0.0693 -0.0055 302 ALA C C   
1157 O O   . ALA C 37 ? 1.3411 0.9651 1.3530 -0.0880 -0.0710 -0.0032 302 ALA C O   
1158 C CB  . ALA C 37 ? 1.3040 0.9512 1.3082 -0.1019 -0.1106 0.0002  302 ALA C CB  
1159 N N   . CYS C 38 ? 1.3076 0.9360 1.2475 -0.0736 -0.0574 -0.0185 303 CYS C N   
1160 C CA  . CYS C 38 ? 1.3370 0.9528 1.2326 -0.0664 -0.0461 -0.0328 303 CYS C CA  
1161 C C   . CYS C 38 ? 1.3562 0.9654 1.2620 -0.0506 -0.0157 -0.0295 303 CYS C C   
1162 O O   . CYS C 38 ? 1.3675 0.9648 1.2557 -0.0474 -0.0082 -0.0367 303 CYS C O   
1163 C CB  . CYS C 38 ? 1.3301 0.9464 1.1685 -0.0623 -0.0471 -0.0476 303 CYS C CB  
1164 S SG  . CYS C 38 ? 1.3163 0.9211 1.0989 -0.0477 -0.0263 -0.0646 303 CYS C SG  
1165 N N   . SER C 39 ? 1.3702 0.9853 1.3013 -0.0394 0.0023  -0.0188 304 SER C N   
1166 C CA  . SER C 39 ? 1.3988 1.0055 1.3404 -0.0225 0.0315  -0.0140 304 SER C CA  
1167 C C   . SER C 39 ? 1.4310 1.0345 1.4228 -0.0284 0.0325  -0.0011 304 SER C C   
1168 O O   . SER C 39 ? 1.4408 1.0324 1.4272 -0.0209 0.0482  -0.0036 304 SER C O   
1169 C CB  . SER C 39 ? 1.3856 0.9965 1.3401 -0.0076 0.0504  -0.0047 304 SER C CB  
1170 O OG  . SER C 39 ? 1.3911 0.9898 1.3447 0.0119  0.0796  -0.0022 304 SER C OG  
1171 N N   . ARG C 40 ? 1.6714 1.2858 1.7121 -0.0418 0.0154  0.0125  305 ARG C N   
1172 C CA  . ARG C 40 ? 1.7074 1.3220 1.8083 -0.0473 0.0166  0.0283  305 ARG C CA  
1173 C C   . ARG C 40 ? 1.7319 1.3389 1.8324 -0.0626 -0.0036 0.0216  305 ARG C C   
1174 O O   . ARG C 40 ? 1.7478 1.3510 1.8921 -0.0652 0.0016  0.0319  305 ARG C O   
1175 C CB  . ARG C 40 ? 1.7069 1.3369 1.8632 -0.0540 0.0074  0.0463  305 ARG C CB  
1176 C CG  . ARG C 40 ? 1.7339 1.3672 1.9041 -0.0357 0.0348  0.0583  305 ARG C CG  
1177 C CD  . ARG C 40 ? 1.8102 1.4573 2.0470 -0.0404 0.0312  0.0804  305 ARG C CD  
1178 N NE  . ARG C 40 ? 1.8531 1.5132 2.0895 -0.0536 0.0044  0.0795  305 ARG C NE  
1179 C CZ  . ARG C 40 ? 1.8758 1.5491 2.1655 -0.0645 -0.0113 0.0945  305 ARG C CZ  
1180 N NH1 . ARG C 40 ? 1.8920 1.5688 2.2452 -0.0652 -0.0036 0.1129  305 ARG C NH1 
1181 N NH2 . ARG C 40 ? 1.8816 1.5645 2.1620 -0.0746 -0.0347 0.0916  305 ARG C NH2 
1182 N N   . GLN C 41 ? 1.5251 1.1284 1.5761 -0.0716 -0.0252 0.0049  306 GLN C N   
1183 C CA  . GLN C 41 ? 1.5565 1.1472 1.5879 -0.0832 -0.0436 -0.0057 306 GLN C CA  
1184 C C   . GLN C 41 ? 1.5765 1.1516 1.5747 -0.0719 -0.0219 -0.0155 306 GLN C C   
1185 O O   . GLN C 41 ? 1.5983 1.1632 1.6161 -0.0768 -0.0224 -0.0133 306 GLN C O   
1186 C CB  . GLN C 41 ? 1.5512 1.1411 1.5387 -0.0947 -0.0733 -0.0188 306 GLN C CB  
1187 N N   . HIS C 42 ? 1.9680 1.5406 1.9172 -0.0569 -0.0033 -0.0263 307 HIS C N   
1188 C CA  . HIS C 42 ? 1.9794 1.5382 1.9006 -0.0420 0.0224  -0.0337 307 HIS C CA  
1189 C C   . HIS C 42 ? 1.9737 1.5272 1.9449 -0.0348 0.0445  -0.0190 307 HIS C C   
1190 O O   . HIS C 42 ? 1.9850 1.5244 1.9426 -0.0290 0.0577  -0.0238 307 HIS C O   
1191 C CB  . HIS C 42 ? 1.9816 1.5411 1.8570 -0.0238 0.0420  -0.0434 307 HIS C CB  
1192 C CG  . HIS C 42 ? 2.0339 1.5827 1.9057 -0.0029 0.0755  -0.0420 307 HIS C CG  
1193 N ND1 . HIS C 42 ? 2.0790 1.6136 1.9085 0.0060  0.0874  -0.0550 307 HIS C ND1 
1194 C CD2 . HIS C 42 ? 2.0667 1.6152 1.9711 0.0120  0.1001  -0.0286 307 HIS C CD2 
1195 C CE1 . HIS C 42 ? 2.0958 1.6216 1.9313 0.0257  0.1175  -0.0503 307 HIS C CE1 
1196 N NE2 . HIS C 42 ? 2.0891 1.6223 1.9694 0.0301  0.1260  -0.0340 307 HIS C NE2 
1197 N N   . ARG C 43 ? 1.6547 1.2186 1.6821 -0.0338 0.0505  -0.0007 308 ARG C N   
1198 C CA  . ARG C 43 ? 1.6537 1.2137 1.7365 -0.0286 0.0699  0.0161  308 ARG C CA  
1199 C C   . ARG C 43 ? 1.6628 1.2126 1.7615 -0.0427 0.0567  0.0145  308 ARG C C   
1200 O O   . ARG C 43 ? 1.6689 1.2057 1.7730 -0.0339 0.0779  0.0164  308 ARG C O   
1201 C CB  . ARG C 43 ? 1.6513 1.2266 1.7965 -0.0313 0.0688  0.0366  308 ARG C CB  
1202 N N   . LEU C 44 ? 1.6300 1.1837 1.7318 -0.0636 0.0215  0.0102  309 LEU C N   
1203 C CA  . LEU C 44 ? 1.6329 1.1742 1.7352 -0.0778 0.0029  0.0044  309 LEU C CA  
1204 C C   . LEU C 44 ? 1.6288 1.1531 1.6628 -0.0701 0.0115  -0.0145 309 LEU C C   
1205 O O   . LEU C 44 ? 1.6458 1.1566 1.6847 -0.0653 0.0274  -0.0140 309 LEU C O   
1206 C CB  . LEU C 44 ? 1.6380 1.1847 1.7472 -0.0990 -0.0382 0.0019  309 LEU C CB  
1207 N N   . ASP C 45 ? 1.6541 1.1790 1.6262 -0.0686 0.0020  -0.0302 310 ASP C N   
1208 C CA  . ASP C 45 ? 1.6457 1.1568 1.5477 -0.0594 0.0111  -0.0486 310 ASP C CA  
1209 C C   . ASP C 45 ? 1.6341 1.1340 1.5234 -0.0392 0.0478  -0.0499 310 ASP C C   
1210 O O   . ASP C 45 ? 1.6459 1.1316 1.4891 -0.0346 0.0531  -0.0629 310 ASP C O   
1211 C CB  . ASP C 45 ? 1.6372 1.1556 1.4835 -0.0562 0.0032  -0.0616 310 ASP C CB  
1212 C CG  . ASP C 45 ? 1.6613 1.1798 1.4875 -0.0741 -0.0336 -0.0684 310 ASP C CG  
1213 O OD1 . ASP C 45 ? 1.6848 1.2022 1.5494 -0.0896 -0.0564 -0.0607 310 ASP C OD1 
1214 O OD2 . ASP C 45 ? 1.6533 1.1722 1.4251 -0.0719 -0.0400 -0.0811 310 ASP C OD2 
1215 N N   . GLN C 46 ? 1.5149 1.0199 1.4419 -0.0259 0.0733  -0.0365 311 GLN C N   
1216 C CA  . GLN C 46 ? 1.4998 0.9923 1.4201 -0.0050 0.1092  -0.0352 311 GLN C CA  
1217 C C   . GLN C 46 ? 1.5024 0.9842 1.4690 -0.0100 0.1158  -0.0242 311 GLN C C   
1218 O O   . GLN C 46 ? 1.5093 0.9759 1.4627 0.0038  0.1408  -0.0261 311 GLN C O   
1219 C CB  . GLN C 46 ? 1.4914 0.9903 1.4265 0.0145  0.1351  -0.0254 311 GLN C CB  
1220 N N   . ASP C 47 ? 1.5426 1.0319 1.5635 -0.0297 0.0928  -0.0129 312 ASP C N   
1221 C CA  . ASP C 47 ? 1.5417 1.0217 1.6103 -0.0387 0.0926  -0.0032 312 ASP C CA  
1222 C C   . ASP C 47 ? 1.5427 1.0072 1.5754 -0.0517 0.0717  -0.0181 312 ASP C C   
1223 O O   . ASP C 47 ? 1.5569 1.0051 1.5907 -0.0484 0.0855  -0.0186 312 ASP C O   
1224 C CB  . ASP C 47 ? 1.5499 1.0447 1.6953 -0.0541 0.0756  0.0155  312 ASP C CB  
1225 C CG  . ASP C 47 ? 1.5572 1.0559 1.7640 -0.0413 0.1065  0.0372  312 ASP C CG  
1226 O OD1 . ASP C 47 ? 1.5840 1.0843 1.8577 -0.0527 0.1011  0.0523  312 ASP C OD1 
1227 O OD2 . ASP C 47 ? 1.5323 1.0310 1.7208 -0.0194 0.1360  0.0394  312 ASP C OD2 
1228 N N   . LYS C 48 ? 1.5130 0.9809 1.5119 -0.0654 0.0394  -0.0298 313 LYS C N   
1229 C CA  . LYS C 48 ? 1.5098 0.9607 1.4692 -0.0757 0.0199  -0.0437 313 LYS C CA  
1230 C C   . LYS C 48 ? 1.4941 0.9306 1.3891 -0.0587 0.0439  -0.0580 313 LYS C C   
1231 O O   . LYS C 48 ? 1.5155 0.9338 1.3937 -0.0610 0.0444  -0.0641 313 LYS C O   
1232 C CB  . LYS C 48 ? 1.5131 0.9680 1.4454 -0.0909 -0.0176 -0.0527 313 LYS C CB  
1233 C CG  . LYS C 48 ? 1.5304 0.9965 1.5256 -0.1087 -0.0451 -0.0396 313 LYS C CG  
1234 C CD  . LYS C 48 ? 1.5860 1.0470 1.5483 -0.1246 -0.0862 -0.0503 313 LYS C CD  
1235 C CE  . LYS C 48 ? 1.5866 1.0666 1.5782 -0.1329 -0.1072 -0.0426 313 LYS C CE  
1236 N NZ  . LYS C 48 ? 1.6059 1.0796 1.5620 -0.1454 -0.1451 -0.0525 313 LYS C NZ  
1237 N N   . ILE C 49 ? 1.3735 0.8177 1.2348 -0.0413 0.0641  -0.0629 314 ILE C N   
1238 C CA  . ILE C 49 ? 1.3593 0.7914 1.1638 -0.0222 0.0897  -0.0755 314 ILE C CA  
1239 C C   . ILE C 49 ? 1.3612 0.7797 1.1907 -0.0097 0.1207  -0.0675 314 ILE C C   
1240 O O   . ILE C 49 ? 1.3761 0.7775 1.1681 -0.0037 0.1306  -0.0774 314 ILE C O   
1241 C CB  . ILE C 49 ? 1.3314 0.7746 1.0992 -0.0057 0.1035  -0.0820 314 ILE C CB  
1242 N N   . GLU C 50 ? 1.2869 0.7122 1.1796 -0.0055 0.1365  -0.0489 315 GLU C N   
1243 C CA  . GLU C 50 ? 1.2832 0.6951 1.2044 0.0071  0.1675  -0.0390 315 GLU C CA  
1244 C C   . GLU C 50 ? 1.3013 0.6994 1.2464 -0.0087 0.1556  -0.0371 315 GLU C C   
1245 O O   . GLU C 50 ? 1.3180 0.6981 1.2471 0.0020  0.1776  -0.0399 315 GLU C O   
1246 C CB  . GLU C 50 ? 1.2773 0.6992 1.2623 0.0159  0.1874  -0.0177 315 GLU C CB  
1247 N N   . ALA C 51 ? 1.3188 0.7238 1.3000 -0.0331 0.1210  -0.0327 316 ALA C N   
1248 C CA  . ALA C 51 ? 1.3349 0.7256 1.3359 -0.0512 0.1016  -0.0329 316 ALA C CA  
1249 C C   . ALA C 51 ? 1.3501 0.7205 1.2766 -0.0497 0.0974  -0.0530 316 ALA C C   
1250 O O   . ALA C 51 ? 1.3670 0.7182 1.2945 -0.0501 0.1058  -0.0540 316 ALA C O   
1251 C CB  . ALA C 51 ? 1.3337 0.7349 1.3729 -0.0760 0.0604  -0.0283 316 ALA C CB  
1252 N N   . LEU C 52 ? 1.3907 0.7658 1.2540 -0.0476 0.0848  -0.0683 317 LEU C N   
1253 C CA  . LEU C 52 ? 1.4006 0.7598 1.1875 -0.0438 0.0817  -0.0872 317 LEU C CA  
1254 C C   . LEU C 52 ? 1.4050 0.7504 1.1613 -0.0222 0.1189  -0.0919 317 LEU C C   
1255 O O   . LEU C 52 ? 1.4271 0.7531 1.1759 -0.0238 0.1233  -0.0946 317 LEU C O   
1256 C CB  . LEU C 52 ? 1.3850 0.7558 1.1170 -0.0416 0.0684  -0.0996 317 LEU C CB  
1257 C CG  . LEU C 52 ? 1.3901 0.7660 1.1177 -0.0615 0.0278  -0.1028 317 LEU C CG  
1258 C CD1 . LEU C 52 ? 1.3722 0.7522 1.0296 -0.0546 0.0231  -0.1177 317 LEU C CD1 
1259 C CD2 . LEU C 52 ? 1.4464 0.8019 1.1764 -0.0783 0.0030  -0.1052 317 LEU C CD2 
1260 N N   . SER C 53 ? 1.5675 0.9215 1.3045 -0.0014 0.1449  -0.0932 318 SER C N   
1261 C CA  . SER C 53 ? 1.5776 0.9181 1.2783 0.0222  0.1802  -0.0991 318 SER C CA  
1262 C C   . SER C 53 ? 1.5953 0.9211 1.3432 0.0245  0.2006  -0.0864 318 SER C C   
1263 O O   . SER C 53 ? 1.6117 0.9197 1.3285 0.0388  0.2239  -0.0924 318 SER C O   
1264 C CB  . SER C 53 ? 1.5559 0.9079 1.2455 0.0442  0.2041  -0.0984 318 SER C CB  
1265 O OG  . SER C 53 ? 1.5554 0.9162 1.3126 0.0465  0.2162  -0.0790 318 SER C OG  
1266 N N   . SER C 54 ? 1.4182 0.7516 1.2421 0.0107  0.1921  -0.0686 319 SER C N   
1267 C CA  . SER C 54 ? 1.4400 0.7595 1.3151 0.0090  0.2073  -0.0557 319 SER C CA  
1268 C C   . SER C 54 ? 1.4588 0.7603 1.3179 -0.0080 0.1859  -0.0643 319 SER C C   
1269 O O   . SER C 54 ? 1.4822 0.7640 1.3342 -0.0004 0.2062  -0.0650 319 SER C O   
1270 C CB  . SER C 54 ? 1.4397 0.7728 1.4056 -0.0007 0.2053  -0.0329 319 SER C CB  
1271 O OG  . SER C 54 ? 1.4449 0.7754 1.4392 0.0217  0.2463  -0.0191 319 SER C OG  
1272 N N   . LYS C 55 ? 1.5567 0.8628 1.4091 -0.0299 0.1454  -0.0706 320 LYS C N   
1273 C CA  . LYS C 55 ? 1.5733 0.8590 1.3983 -0.0446 0.1223  -0.0810 320 LYS C CA  
1274 C C   . LYS C 55 ? 1.5749 0.8442 1.3128 -0.0294 0.1365  -0.0997 320 LYS C C   
1275 O O   . LYS C 55 ? 1.6004 0.8474 1.3212 -0.0299 0.1416  -0.1043 320 LYS C O   
1276 C CB  . LYS C 55 ? 1.5728 0.8645 1.3999 -0.0680 0.0761  -0.0848 320 LYS C CB  
1277 C CG  . LYS C 55 ? 1.6033 0.9067 1.5164 -0.0856 0.0574  -0.0676 320 LYS C CG  
1278 C CD  . LYS C 55 ? 1.6871 0.9850 1.5943 -0.1089 0.0095  -0.0741 320 LYS C CD  
1279 C CE  . LYS C 55 ? 1.7293 1.0494 1.6891 -0.1222 -0.0159 -0.0636 320 LYS C CE  
1280 N NZ  . LYS C 55 ? 1.7860 1.1159 1.8424 -0.1294 -0.0103 -0.0425 320 LYS C NZ  
1281 N N   . VAL C 56 ? 1.4160 0.6962 1.1010 -0.0152 0.1442  -0.1099 321 VAL C N   
1282 C CA  . VAL C 56 ? 1.4146 0.6818 1.0173 -0.0009 0.1555  -0.1277 321 VAL C CA  
1283 C C   . VAL C 56 ? 1.4302 0.6823 1.0248 0.0207  0.1964  -0.1267 321 VAL C C   
1284 O O   . VAL C 56 ? 1.4423 0.6753 0.9824 0.0279  0.2044  -0.1388 321 VAL C O   
1285 C CB  . VAL C 56 ? 1.3916 0.6760 0.9445 0.0089  0.1531  -0.1383 321 VAL C CB  
1286 C CG1 . VAL C 56 ? 1.3756 0.6485 0.8489 0.0235  0.1645  -0.1555 321 VAL C CG1 
1287 C CG2 . VAL C 56 ? 1.3878 0.6841 0.9415 -0.0110 0.1143  -0.1400 321 VAL C CG2 
1288 N N   . GLN C 57 ? 1.4356 0.6949 1.0809 0.0327  0.2233  -0.1122 322 GLN C N   
1289 C CA  . GLN C 57 ? 1.4483 0.6906 1.0912 0.0541  0.2631  -0.1091 322 GLN C CA  
1290 C C   . GLN C 57 ? 1.4729 0.6941 1.1470 0.0414  0.2614  -0.1031 322 GLN C C   
1291 O O   . GLN C 57 ? 1.4844 0.6849 1.1167 0.0513  0.2772  -0.1118 322 GLN C O   
1292 C CB  . GLN C 57 ? 1.4304 0.6823 1.1105 0.0743  0.2948  -0.0955 322 GLN C CB  
1293 N N   . GLN C 58 ? 1.4956 0.7218 1.2401 0.0192  0.2403  -0.0894 323 GLN C N   
1294 C CA  . GLN C 58 ? 1.5261 0.7327 1.3022 0.0050  0.2342  -0.0844 323 GLN C CA  
1295 C C   . GLN C 58 ? 1.5492 0.7370 1.2582 -0.0041 0.2117  -0.1029 323 GLN C C   
1296 O O   . GLN C 58 ? 1.5831 0.7474 1.2806 -0.0035 0.2211  -0.1056 323 GLN C O   
1297 C CB  . GLN C 58 ? 1.5299 0.7473 1.3918 -0.0192 0.2087  -0.0681 323 GLN C CB  
1298 N N   . LEU C 59 ? 1.4752 0.6723 1.1383 -0.0116 0.1831  -0.1153 324 LEU C N   
1299 C CA  . LEU C 59 ? 1.4891 0.6684 1.0837 -0.0189 0.1607  -0.1324 324 LEU C CA  
1300 C C   . LEU C 59 ? 1.4978 0.6656 1.0166 0.0043  0.1888  -0.1462 324 LEU C C   
1301 O O   . LEU C 59 ? 1.5298 0.6758 0.9984 0.0030  0.1835  -0.1573 324 LEU C O   
1302 C CB  . LEU C 59 ? 1.4764 0.6706 1.0461 -0.0308 0.1254  -0.1396 324 LEU C CB  
1303 C CG  . LEU C 59 ? 1.4944 0.6741 1.0083 -0.0440 0.0907  -0.1531 324 LEU C CG  
1304 C CD1 . LEU C 59 ? 1.5485 0.7028 1.0877 -0.0610 0.0732  -0.1502 324 LEU C CD1 
1305 C CD2 . LEU C 59 ? 1.4259 0.6246 0.9412 -0.0562 0.0577  -0.1538 324 LEU C CD2 
1306 N N   . GLU C 60 ? 1.6865 0.8684 1.1951 0.0261  0.2175  -0.1458 325 GLU C N   
1307 C CA  . GLU C 60 ? 1.6913 0.8639 1.1328 0.0514  0.2471  -0.1581 325 GLU C CA  
1308 C C   . GLU C 60 ? 1.7167 0.8659 1.1699 0.0631  0.2791  -0.1532 325 GLU C C   
1309 O O   . GLU C 60 ? 1.7306 0.8635 1.1247 0.0788  0.2973  -0.1647 325 GLU C O   
1310 C CB  . GLU C 60 ? 1.6619 0.8555 1.0919 0.0713  0.2654  -0.1592 325 GLU C CB  
1311 N N   . ARG C 61 ? 1.6752 0.8228 1.2057 0.0553  0.2857  -0.1356 326 ARG C N   
1312 C CA  . ARG C 61 ? 1.6956 0.8229 1.2495 0.0672  0.3195  -0.1272 326 ARG C CA  
1313 C C   . ARG C 61 ? 1.7293 0.8327 1.2918 0.0479  0.3030  -0.1279 326 ARG C C   
1314 O O   . ARG C 61 ? 1.7514 0.8333 1.3221 0.0559  0.3282  -0.1239 326 ARG C O   
1315 C CB  . ARG C 61 ? 1.6822 0.8208 1.3165 0.0732  0.3415  -0.1059 326 ARG C CB  
1316 N N   . SER C 62 ? 1.7635 0.8689 1.3225 0.0234  0.2605  -0.1331 327 SER C N   
1317 C CA  . SER C 62 ? 1.7909 0.8713 1.3431 0.0066  0.2412  -0.1372 327 SER C CA  
1318 C C   . SER C 62 ? 1.8046 0.8688 1.2597 0.0162  0.2405  -0.1572 327 SER C C   
1319 O O   . SER C 62 ? 1.8387 0.8767 1.2678 0.0204  0.2531  -0.1617 327 SER C O   
1320 C CB  . SER C 62 ? 1.7924 0.8789 1.3852 -0.0228 0.1950  -0.1332 327 SER C CB  
1321 O OG  . SER C 62 ? 1.7932 0.8943 1.4790 -0.0308 0.1981  -0.1137 327 SER C OG  
1322 N N   . ILE C 63 ? 1.7603 0.8398 1.1625 0.0204  0.2272  -0.1685 328 ILE C N   
1323 C CA  . ILE C 63 ? 1.7536 0.8200 1.0620 0.0290  0.2238  -0.1872 328 ILE C CA  
1324 C C   . ILE C 63 ? 1.7512 0.8124 1.0081 0.0591  0.2655  -0.1949 328 ILE C C   
1325 O O   . ILE C 63 ? 1.7168 0.7956 0.9723 0.0784  0.2892  -0.1942 328 ILE C O   
1326 C CB  . ILE C 63 ? 1.7364 0.8182 1.0082 0.0192  0.1893  -0.1959 328 ILE C CB  
1327 C CG1 . ILE C 63 ? 1.7424 0.8212 1.0579 -0.0091 0.1481  -0.1896 328 ILE C CG1 
1328 C CG2 . ILE C 63 ? 1.7122 0.7810 0.8903 0.0288  0.1873  -0.2133 328 ILE C CG2 
1329 C CD1 . ILE C 63 ? 1.7463 0.8518 1.0811 -0.0189 0.1226  -0.1868 328 ILE C CD1 
1330 N N   . MET D 1  ? 0.8714 0.9566 0.8900 -0.1151 -0.0577 -0.0665 25  MET D N   
1331 C CA  . MET D 1  ? 0.9097 1.0002 0.9039 -0.1248 -0.0724 -0.0671 25  MET D CA  
1332 C C   . MET D 1  ? 0.8855 0.9822 0.8757 -0.1076 -0.0788 -0.0567 25  MET D C   
1333 O O   . MET D 1  ? 0.9052 1.0082 0.8755 -0.1157 -0.0911 -0.0551 25  MET D O   
1334 C CB  . MET D 1  ? 0.9594 1.0119 0.9107 -0.1421 -0.0650 -0.0834 25  MET D CB  
1335 N N   . LEU D 2  ? 0.9997 1.0938 1.0067 -0.0861 -0.0707 -0.0494 26  LEU D N   
1336 C CA  . LEU D 2  ? 0.9700 1.0608 0.9705 -0.0712 -0.0726 -0.0408 26  LEU D CA  
1337 C C   . LEU D 2  ? 0.9312 1.0265 0.9590 -0.0522 -0.0656 -0.0329 26  LEU D C   
1338 O O   . LEU D 2  ? 0.9319 1.0199 0.9704 -0.0496 -0.0540 -0.0379 26  LEU D O   
1339 C CB  . LEU D 2  ? 0.9804 1.0397 0.9495 -0.0706 -0.0609 -0.0493 26  LEU D CB  
1340 C CG  . LEU D 2  ? 0.9601 1.0133 0.9215 -0.0582 -0.0594 -0.0417 26  LEU D CG  
1341 C CD1 . LEU D 2  ? 0.9812 1.0561 0.9556 -0.0533 -0.0745 -0.0273 26  LEU D CD1 
1342 C CD2 . LEU D 2  ? 0.9047 0.9393 0.8316 -0.0635 -0.0543 -0.0475 26  LEU D CD2 
1343 N N   . SER D 3  ? 0.7677 0.8710 0.8031 -0.0395 -0.0713 -0.0209 27  SER D N   
1344 C CA  . SER D 3  ? 0.7213 0.8322 0.7838 -0.0234 -0.0664 -0.0131 27  SER D CA  
1345 C C   . SER D 3  ? 0.7004 0.7903 0.7623 -0.0174 -0.0499 -0.0205 27  SER D C   
1346 O O   . SER D 3  ? 0.7038 0.7729 0.7443 -0.0190 -0.0436 -0.0261 27  SER D O   
1347 C CB  . SER D 3  ? 0.7260 0.8353 0.7868 -0.0104 -0.0718 -0.0002 27  SER D CB  
1348 O OG  . SER D 3  ? 0.7322 0.8139 0.7815 -0.0021 -0.0601 -0.0020 27  SER D OG  
1349 N N   . CYS D 4  ? 0.7781 0.8759 0.8631 -0.0104 -0.0427 -0.0196 28  CYS D N   
1350 C CA  . CYS D 4  ? 0.7516 0.8309 0.8333 -0.0046 -0.0283 -0.0251 28  CYS D CA  
1351 C C   . CYS D 4  ? 0.7419 0.8014 0.8059 0.0015  -0.0253 -0.0240 28  CYS D C   
1352 O O   . CYS D 4  ? 0.7446 0.7907 0.7931 -0.0017 -0.0190 -0.0299 28  CYS D O   
1353 C CB  . CYS D 4  ? 0.7390 0.8279 0.8440 0.0041  -0.0206 -0.0226 28  CYS D CB  
1354 S SG  . CYS D 4  ? 0.7831 0.8982 0.9109 -0.0067 -0.0222 -0.0237 28  CYS D SG  
1355 N N   . GLU D 5  ? 0.6869 0.7454 0.7531 0.0099  -0.0297 -0.0154 29  GLU D N   
1356 C CA  . GLU D 5  ? 0.6758 0.7121 0.7236 0.0132  -0.0267 -0.0135 29  GLU D CA  
1357 C C   . GLU D 5  ? 0.6651 0.6935 0.6904 0.0026  -0.0274 -0.0184 29  GLU D C   
1358 O O   . GLU D 5  ? 0.6565 0.6734 0.6709 0.0003  -0.0199 -0.0227 29  GLU D O   
1359 C CB  . GLU D 5  ? 0.6883 0.7214 0.7369 0.0222  -0.0330 -0.0016 29  GLU D CB  
1360 C CG  . GLU D 5  ? 0.7572 0.7614 0.7839 0.0228  -0.0280 -0.0001 29  GLU D CG  
1361 C CD  . GLU D 5  ? 0.8769 0.8681 0.9002 0.0337  -0.0313 0.0132  29  GLU D CD  
1362 O OE1 . GLU D 5  ? 0.8857 0.8715 0.8917 0.0289  -0.0389 0.0199  29  GLU D OE1 
1363 O OE2 . GLU D 5  ? 0.9182 0.9018 0.9539 0.0481  -0.0245 0.0173  29  GLU D OE2 
1364 N N   . LEU D 6  ? 0.7330 0.7697 0.7510 -0.0045 -0.0359 -0.0178 30  LEU D N   
1365 C CA  . LEU D 6  ? 0.7189 0.7486 0.7154 -0.0131 -0.0338 -0.0229 30  LEU D CA  
1366 C C   . LEU D 6  ? 0.6897 0.7181 0.6864 -0.0152 -0.0240 -0.0320 30  LEU D C   
1367 O O   . LEU D 6  ? 0.7095 0.7328 0.6939 -0.0168 -0.0178 -0.0344 30  LEU D O   
1368 C CB  . LEU D 6  ? 0.7424 0.7781 0.7262 -0.0211 -0.0433 -0.0220 30  LEU D CB  
1369 C CG  . LEU D 6  ? 0.7657 0.8009 0.7427 -0.0184 -0.0528 -0.0103 30  LEU D CG  
1370 C CD1 . LEU D 6  ? 0.8092 0.8548 0.7721 -0.0279 -0.0647 -0.0088 30  LEU D CD1 
1371 C CD2 . LEU D 6  ? 0.7730 0.7918 0.7323 -0.0196 -0.0462 -0.0092 30  LEU D CD2 
1372 N N   . TYR D 7  ? 0.6565 0.6904 0.6672 -0.0145 -0.0217 -0.0356 31  TYR D N   
1373 C CA  . TYR D 7  ? 0.6254 0.6542 0.6343 -0.0138 -0.0112 -0.0415 31  TYR D CA  
1374 C C   . TYR D 7  ? 0.5982 0.6251 0.6089 -0.0079 -0.0052 -0.0396 31  TYR D C   
1375 O O   . TYR D 7  ? 0.6047 0.6311 0.6070 -0.0075 0.0006  -0.0408 31  TYR D O   
1376 C CB  . TYR D 7  ? 0.6309 0.6619 0.6519 -0.0154 -0.0082 -0.0448 31  TYR D CB  
1377 C CG  . TYR D 7  ? 0.6871 0.7122 0.6963 -0.0251 -0.0092 -0.0507 31  TYR D CG  
1378 C CD1 . TYR D 7  ? 0.7382 0.7731 0.7507 -0.0349 -0.0199 -0.0508 31  TYR D CD1 
1379 C CD2 . TYR D 7  ? 0.7061 0.7156 0.6989 -0.0247 0.0007  -0.0561 31  TYR D CD2 
1380 C CE1 . TYR D 7  ? 0.8208 0.8465 0.8165 -0.0480 -0.0208 -0.0585 31  TYR D CE1 
1381 C CE2 . TYR D 7  ? 0.7439 0.7397 0.7201 -0.0339 0.0027  -0.0635 31  TYR D CE2 
1382 C CZ  . TYR D 7  ? 0.8438 0.8455 0.8191 -0.0475 -0.0080 -0.0660 31  TYR D CZ  
1383 O OH  . TYR D 7  ? 0.8940 0.8778 0.8468 -0.0602 -0.0055 -0.0756 31  TYR D OH  
1384 N N   . ARG D 8  ? 0.5805 0.6073 0.6008 -0.0037 -0.0062 -0.0364 32  ARG D N   
1385 C CA  . ARG D 8  ? 0.5792 0.6003 0.5952 -0.0017 -0.0010 -0.0362 32  ARG D CA  
1386 C C   . ARG D 8  ? 0.5882 0.6048 0.5889 -0.0070 -0.0026 -0.0345 32  ARG D C   
1387 O O   . ARG D 8  ? 0.5825 0.6009 0.5765 -0.0104 0.0014  -0.0356 32  ARG D O   
1388 C CB  . ARG D 8  ? 0.5860 0.6006 0.6101 0.0042  0.0001  -0.0340 32  ARG D CB  
1389 C CG  . ARG D 8  ? 0.5799 0.6013 0.6181 0.0082  0.0059  -0.0363 32  ARG D CG  
1390 C CD  . ARG D 8  ? 0.7171 0.7374 0.7684 0.0161  0.0086  -0.0337 32  ARG D CD  
1391 N NE  . ARG D 8  ? 0.7120 0.7246 0.7629 0.0216  0.0044  -0.0280 32  ARG D NE  
1392 C CZ  . ARG D 8  ? 0.7185 0.7426 0.7891 0.0302  0.0021  -0.0218 32  ARG D CZ  
1393 N NH1 . ARG D 8  ? 0.6784 0.7230 0.7689 0.0301  0.0030  -0.0223 32  ARG D NH1 
1394 N NH2 . ARG D 8  ? 0.6943 0.7117 0.7660 0.0389  -0.0010 -0.0139 32  ARG D NH2 
1395 N N   . MET D 9  ? 0.6405 0.6543 0.6346 -0.0094 -0.0087 -0.0312 33  MET D N   
1396 C CA  . MET D 9  ? 0.6602 0.6695 0.6390 -0.0160 -0.0084 -0.0290 33  MET D CA  
1397 C C   . MET D 9  ? 0.6402 0.6622 0.6145 -0.0193 -0.0036 -0.0319 33  MET D C   
1398 O O   . MET D 9  ? 0.6560 0.6832 0.6236 -0.0251 -0.0005 -0.0307 33  MET D O   
1399 C CB  . MET D 9  ? 0.6980 0.6996 0.6675 -0.0175 -0.0156 -0.0228 33  MET D CB  
1400 C CG  . MET D 9  ? 0.7830 0.7771 0.7345 -0.0261 -0.0141 -0.0193 33  MET D CG  
1401 S SD  . MET D 9  ? 0.9416 0.9166 0.8815 -0.0243 -0.0216 -0.0081 33  MET D SD  
1402 C CE  . MET D 9  ? 0.8721 0.8597 0.7985 -0.0304 -0.0261 -0.0075 33  MET D CE  
1403 N N   . SER D 10 ? 0.5667 0.5936 0.5444 -0.0159 -0.0020 -0.0353 34  SER D N   
1404 C CA  . SER D 10 ? 0.5570 0.5920 0.5286 -0.0157 0.0049  -0.0369 34  SER D CA  
1405 C C   . SER D 10 ? 0.5553 0.6024 0.5348 -0.0125 0.0104  -0.0357 34  SER D C   
1406 O O   . SER D 10 ? 0.5805 0.6422 0.5583 -0.0120 0.0160  -0.0336 34  SER D O   
1407 C CB  . SER D 10 ? 0.5608 0.5906 0.5305 -0.0124 0.0084  -0.0419 34  SER D CB  
1408 O OG  . SER D 10 ? 0.5264 0.5539 0.5085 -0.0080 0.0095  -0.0434 34  SER D OG  
1409 N N   . THR D 11 ? 0.5271 0.5725 0.5154 -0.0100 0.0096  -0.0361 35  THR D N   
1410 C CA  . THR D 11 ? 0.5303 0.5913 0.5226 -0.0082 0.0138  -0.0338 35  THR D CA  
1411 C C   . THR D 11 ? 0.5689 0.6402 0.5554 -0.0184 0.0116  -0.0315 35  THR D C   
1412 O O   . THR D 11 ? 0.5826 0.6728 0.5718 -0.0205 0.0127  -0.0289 35  THR D O   
1413 C CB  . THR D 11 ? 0.5188 0.5761 0.5161 -0.0060 0.0138  -0.0347 35  THR D CB  
1414 O OG1 . THR D 11 ? 0.4896 0.5336 0.4825 -0.0121 0.0099  -0.0365 35  THR D OG1 
1415 C CG2 . THR D 11 ? 0.4698 0.5177 0.4741 0.0018  0.0170  -0.0365 35  THR D CG2 
1416 N N   . TYR D 12 ? 0.5193 0.5782 0.4969 -0.0265 0.0081  -0.0316 36  TYR D N   
1417 C CA  . TYR D 12 ? 0.5481 0.6140 0.5179 -0.0399 0.0074  -0.0296 36  TYR D CA  
1418 C C   . TYR D 12 ? 0.5790 0.6678 0.5489 -0.0441 0.0108  -0.0257 36  TYR D C   
1419 O O   . TYR D 12 ? 0.6048 0.7026 0.5694 -0.0580 0.0104  -0.0236 36  TYR D O   
1420 C CB  . TYR D 12 ? 0.5579 0.5961 0.5152 -0.0478 0.0043  -0.0301 36  TYR D CB  
1421 C CG  . TYR D 12 ? 0.5684 0.5876 0.5258 -0.0440 0.0042  -0.0338 36  TYR D CG  
1422 C CD1 . TYR D 12 ? 0.5466 0.5615 0.4950 -0.0540 0.0057  -0.0372 36  TYR D CD1 
1423 C CD2 . TYR D 12 ? 0.5685 0.5774 0.5345 -0.0315 0.0034  -0.0344 36  TYR D CD2 
1424 C CE1 . TYR D 12 ? 0.5347 0.5311 0.4802 -0.0499 0.0083  -0.0416 36  TYR D CE1 
1425 C CE2 . TYR D 12 ? 0.5721 0.5669 0.5399 -0.0268 0.0059  -0.0374 36  TYR D CE2 
1426 C CZ  . TYR D 12 ? 0.5815 0.5685 0.5380 -0.0349 0.0092  -0.0413 36  TYR D CZ  
1427 O OH  . TYR D 12 ? 0.6557 0.6265 0.6110 -0.0293 0.0142  -0.0452 36  TYR D OH  
1428 N N   . SER D 13 ? 0.6552 0.7526 0.6295 -0.0337 0.0155  -0.0250 37  SER D N   
1429 C CA  . SER D 13 ? 0.6932 0.8116 0.6667 -0.0365 0.0216  -0.0212 37  SER D CA  
1430 C C   . SER D 13 ? 0.7167 0.8718 0.7009 -0.0428 0.0233  -0.0159 37  SER D C   
1431 O O   . SER D 13 ? 0.7473 0.9228 0.7316 -0.0514 0.0270  -0.0118 37  SER D O   
1432 C CB  . SER D 13 ? 0.6907 0.8101 0.6657 -0.0222 0.0295  -0.0225 37  SER D CB  
1433 O OG  . SER D 13 ? 0.7258 0.8485 0.7117 -0.0096 0.0316  -0.0226 37  SER D OG  
1434 N N   . THR D 14 ? 0.7494 0.9147 0.7420 -0.0399 0.0202  -0.0152 38  THR D N   
1435 C CA  . THR D 14 ? 0.7594 0.9642 0.7632 -0.0451 0.0189  -0.0092 38  THR D CA  
1436 C C   . THR D 14 ? 0.7760 0.9753 0.7697 -0.0660 0.0112  -0.0123 38  THR D C   
1437 O O   . THR D 14 ? 0.8016 1.0323 0.8003 -0.0762 0.0074  -0.0087 38  THR D O   
1438 C CB  . THR D 14 ? 0.7446 0.9596 0.7587 -0.0289 0.0192  -0.0062 38  THR D CB  
1439 O OG1 . THR D 14 ? 0.7767 0.9539 0.7821 -0.0250 0.0167  -0.0132 38  THR D OG1 
1440 C CG2 . THR D 14 ? 0.7365 0.9647 0.7619 -0.0076 0.0293  -0.0006 38  THR D CG2 
1441 N N   . PHE D 15 ? 0.6738 0.8323 0.6517 -0.0725 0.0088  -0.0188 39  PHE D N   
1442 C CA  . PHE D 15 ? 0.6960 0.8392 0.6592 -0.0916 0.0042  -0.0233 39  PHE D CA  
1443 C C   . PHE D 15 ? 0.7346 0.9041 0.6950 -0.1150 0.0031  -0.0202 39  PHE D C   
1444 O O   . PHE D 15 ? 0.7386 0.9169 0.7008 -0.1194 0.0067  -0.0161 39  PHE D O   
1445 C CB  . PHE D 15 ? 0.6800 0.7743 0.6275 -0.0920 0.0046  -0.0284 39  PHE D CB  
1446 C CG  . PHE D 15 ? 0.6656 0.7318 0.5978 -0.1006 0.0034  -0.0350 39  PHE D CG  
1447 C CD1 . PHE D 15 ? 0.6577 0.7273 0.5929 -0.0933 0.0028  -0.0384 39  PHE D CD1 
1448 C CD2 . PHE D 15 ? 0.6588 0.6893 0.5704 -0.1149 0.0049  -0.0378 39  PHE D CD2 
1449 C CE1 . PHE D 15 ? 0.6840 0.7240 0.6010 -0.1011 0.0041  -0.0459 39  PHE D CE1 
1450 C CE2 . PHE D 15 ? 0.7088 0.7055 0.6024 -0.1212 0.0070  -0.0451 39  PHE D CE2 
1451 C CZ  . PHE D 15 ? 0.7152 0.7169 0.6111 -0.1145 0.0070  -0.0500 39  PHE D CZ  
1452 N N   . PRO D 16 ? 0.7749 0.9596 0.7301 -0.1319 -0.0018 -0.0220 40  PRO D N   
1453 C CA  . PRO D 16 ? 0.8206 1.0331 0.7733 -0.1590 -0.0036 -0.0192 40  PRO D CA  
1454 C C   . PRO D 16 ? 0.8669 1.0368 0.7964 -0.1787 -0.0004 -0.0233 40  PRO D C   
1455 O O   . PRO D 16 ? 0.8863 1.0018 0.7958 -0.1768 0.0011  -0.0302 40  PRO D O   
1456 C CB  . PRO D 16 ? 0.8303 1.0619 0.7770 -0.1745 -0.0111 -0.0220 40  PRO D CB  
1457 C CG  . PRO D 16 ? 0.8273 1.0095 0.7577 -0.1625 -0.0103 -0.0311 40  PRO D CG  
1458 C CD  . PRO D 16 ? 0.7812 0.9572 0.7285 -0.1315 -0.0058 -0.0272 40  PRO D CD  
1459 N N   . ALA D 17 ? 0.8408 1.0348 0.7737 -0.1953 0.0020  -0.0178 41  ALA D N   
1460 C CA  . ALA D 17 ? 0.9007 1.0536 0.8102 -0.2142 0.0065  -0.0191 41  ALA D CA  
1461 C C   . ALA D 17 ? 0.9491 1.0683 0.8303 -0.2445 0.0049  -0.0270 41  ALA D C   
1462 O O   . ALA D 17 ? 0.9459 1.0862 0.8259 -0.2589 -0.0007 -0.0314 41  ALA D O   
1463 C CB  . ALA D 17 ? 0.9048 1.0919 0.8250 -0.2228 0.0119  -0.0100 41  ALA D CB  
1464 N N   . GLY D 18 ? 1.0478 1.1105 0.9031 -0.2531 0.0103  -0.0288 42  GLY D N   
1465 C CA  . GLY D 18 ? 1.1349 1.1568 0.9583 -0.2833 0.0118  -0.0369 42  GLY D CA  
1466 C C   . GLY D 18 ? 1.1607 1.1422 0.9664 -0.2772 0.0113  -0.0482 42  GLY D C   
1467 O O   . GLY D 18 ? 1.2148 1.1572 0.9897 -0.3016 0.0141  -0.0574 42  GLY D O   
1468 N N   . VAL D 19 ? 1.0596 1.0494 0.8835 -0.2454 0.0092  -0.0478 43  VAL D N   
1469 C CA  . VAL D 19 ? 1.0841 1.0277 0.8935 -0.2309 0.0123  -0.0561 43  VAL D CA  
1470 C C   . VAL D 19 ? 1.1270 1.0024 0.9133 -0.2263 0.0210  -0.0554 43  VAL D C   
1471 O O   . VAL D 19 ? 1.1275 0.9999 0.9234 -0.2116 0.0218  -0.0458 43  VAL D O   
1472 C CB  . VAL D 19 ? 1.0326 1.0019 0.8700 -0.1977 0.0092  -0.0527 43  VAL D CB  
1473 C CG1 . VAL D 19 ? 1.0295 1.0019 0.8844 -0.1759 0.0102  -0.0426 43  VAL D CG1 
1474 C CG2 . VAL D 19 ? 1.0289 0.9625 0.8553 -0.1844 0.0128  -0.0610 43  VAL D CG2 
1475 N N   . PRO D 20 ? 1.3100 1.1290 1.0635 -0.2385 0.0282  -0.0649 44  PRO D N   
1476 C CA  . PRO D 20 ? 1.3544 1.1082 1.0850 -0.2342 0.0377  -0.0614 44  PRO D CA  
1477 C C   . PRO D 20 ? 1.3368 1.0615 1.0756 -0.1970 0.0418  -0.0582 44  PRO D C   
1478 O O   . PRO D 20 ? 1.3941 1.0572 1.1099 -0.1904 0.0517  -0.0574 44  PRO D O   
1479 C CB  . PRO D 20 ? 1.4297 1.1315 1.1188 -0.2636 0.0459  -0.0738 44  PRO D CB  
1480 C CG  . PRO D 20 ? 1.4140 1.1385 1.1047 -0.2651 0.0424  -0.0861 44  PRO D CG  
1481 C CD  . PRO D 20 ? 1.3457 1.1533 1.0772 -0.2572 0.0292  -0.0787 44  PRO D CD  
1482 N N   . VAL D 21 ? 1.3083 1.0765 1.0793 -0.1732 0.0350  -0.0556 45  VAL D N   
1483 C CA  . VAL D 21 ? 1.2727 1.0269 1.0585 -0.1394 0.0369  -0.0503 45  VAL D CA  
1484 C C   . VAL D 21 ? 1.2034 1.0004 1.0197 -0.1216 0.0281  -0.0400 45  VAL D C   
1485 O O   . VAL D 21 ? 1.1862 1.0309 1.0180 -0.1291 0.0216  -0.0390 45  VAL D O   
1486 C CB  . VAL D 21 ? 1.2703 1.0188 1.0591 -0.1262 0.0410  -0.0593 45  VAL D CB  
1487 C CG1 . VAL D 21 ? 1.2691 1.0095 1.0766 -0.0939 0.0429  -0.0520 45  VAL D CG1 
1488 C CG2 . VAL D 21 ? 1.3359 1.0284 1.0871 -0.1415 0.0528  -0.0706 45  VAL D CG2 
1489 N N   . SER D 22 ? 1.0923 0.8717 0.9157 -0.0983 0.0285  -0.0317 46  SER D N   
1490 C CA  . SER D 22 ? 1.0301 0.8426 0.8748 -0.0854 0.0202  -0.0223 46  SER D CA  
1491 C C   . SER D 22 ? 0.9689 0.8236 0.8406 -0.0736 0.0153  -0.0268 46  SER D C   
1492 O O   . SER D 22 ? 0.9479 0.7972 0.8267 -0.0623 0.0185  -0.0320 46  SER D O   
1493 C CB  . SER D 22 ? 1.0508 0.8372 0.8950 -0.0655 0.0198  -0.0109 46  SER D CB  
1494 O OG  . SER D 22 ? 1.0677 0.8626 0.9078 -0.0692 0.0143  -0.0005 46  SER D OG  
1495 N N   . GLU D 23 ? 0.9017 0.7956 0.7866 -0.0762 0.0096  -0.0247 47  GLU D N   
1496 C CA  . GLU D 23 ? 0.8401 0.7654 0.7485 -0.0618 0.0057  -0.0261 47  GLU D CA  
1497 C C   . GLU D 23 ? 0.8244 0.7376 0.7424 -0.0425 0.0034  -0.0215 47  GLU D C   
1498 O O   . GLU D 23 ? 0.8013 0.7182 0.7326 -0.0313 0.0048  -0.0249 47  GLU D O   
1499 C CB  . GLU D 23 ? 0.8256 0.7835 0.7414 -0.0647 0.0025  -0.0233 47  GLU D CB  
1500 C CG  . GLU D 23 ? 0.8337 0.8190 0.7501 -0.0793 0.0045  -0.0259 47  GLU D CG  
1501 C CD  . GLU D 23 ? 0.8937 0.8729 0.7941 -0.0979 0.0065  -0.0223 47  GLU D CD  
1502 O OE1 . GLU D 23 ? 0.9048 0.8887 0.8023 -0.0978 0.0064  -0.0165 47  GLU D OE1 
1503 O OE2 . GLU D 23 ? 0.9921 0.9587 0.8798 -0.1142 0.0086  -0.0257 47  GLU D OE2 
1504 N N   . ARG D 24 ? 0.8202 0.7209 0.7311 -0.0393 -0.0001 -0.0124 48  ARG D N   
1505 C CA  . ARG D 24 ? 0.8086 0.7036 0.7296 -0.0215 -0.0043 -0.0048 48  ARG D CA  
1506 C C   . ARG D 24 ? 0.8266 0.7006 0.7528 -0.0091 0.0022  -0.0062 48  ARG D C   
1507 O O   . ARG D 24 ? 0.8190 0.7083 0.7660 0.0049  0.0004  -0.0054 48  ARG D O   
1508 C CB  . ARG D 24 ? 0.8228 0.7018 0.7290 -0.0212 -0.0085 0.0072  48  ARG D CB  
1509 C CG  . ARG D 24 ? 0.7930 0.6734 0.7111 -0.0029 -0.0148 0.0174  48  ARG D CG  
1510 C CD  . ARG D 24 ? 0.8022 0.6657 0.7018 -0.0028 -0.0193 0.0315  48  ARG D CD  
1511 N NE  . ARG D 24 ? 0.7524 0.6369 0.6431 -0.0149 -0.0257 0.0318  48  ARG D NE  
1512 C CZ  . ARG D 24 ? 0.6693 0.5838 0.5704 -0.0121 -0.0352 0.0318  48  ARG D CZ  
1513 N NH1 . ARG D 24 ? 0.6465 0.5775 0.5698 0.0007  -0.0408 0.0328  48  ARG D NH1 
1514 N NH2 . ARG D 24 ? 0.6539 0.5808 0.5414 -0.0232 -0.0380 0.0308  48  ARG D NH2 
1515 N N   . SER D 25 ? 0.8945 0.7334 0.8008 -0.0155 0.0110  -0.0091 49  SER D N   
1516 C CA  . SER D 25 ? 0.9258 0.7398 0.8328 -0.0031 0.0206  -0.0119 49  SER D CA  
1517 C C   . SER D 25 ? 0.8843 0.7170 0.8031 -0.0031 0.0245  -0.0235 49  SER D C   
1518 O O   . SER D 25 ? 0.8904 0.7194 0.8210 0.0124  0.0306  -0.0241 49  SER D O   
1519 C CB  . SER D 25 ? 0.9961 0.7581 0.8719 -0.0113 0.0311  -0.0134 49  SER D CB  
1520 O OG  . SER D 25 ? 1.0662 0.8228 0.9254 -0.0322 0.0362  -0.0269 49  SER D OG  
1521 N N   . LEU D 26 ? 0.8698 0.7236 0.7854 -0.0195 0.0219  -0.0312 50  LEU D N   
1522 C CA  . LEU D 26 ? 0.8225 0.6983 0.7490 -0.0190 0.0239  -0.0393 50  LEU D CA  
1523 C C   . LEU D 26 ? 0.7963 0.7018 0.7516 -0.0037 0.0196  -0.0355 50  LEU D C   
1524 O O   . LEU D 26 ? 0.7763 0.6827 0.7431 0.0074  0.0255  -0.0376 50  LEU D O   
1525 C CB  . LEU D 26 ? 0.7870 0.6840 0.7062 -0.0374 0.0204  -0.0441 50  LEU D CB  
1526 C CG  . LEU D 26 ? 0.8291 0.7004 0.7201 -0.0570 0.0246  -0.0492 50  LEU D CG  
1527 C CD1 . LEU D 26 ? 0.7967 0.6971 0.6841 -0.0774 0.0184  -0.0490 50  LEU D CD1 
1528 C CD2 . LEU D 26 ? 0.7647 0.6163 0.6414 -0.0595 0.0331  -0.0592 50  LEU D CD2 
1529 N N   . ALA D 27 ? 0.8594 0.7877 0.8243 -0.0050 0.0106  -0.0306 51  ALA D N   
1530 C CA  . ALA D 27 ? 0.8316 0.7842 0.8188 0.0044  0.0059  -0.0280 51  ALA D CA  
1531 C C   . ALA D 27 ? 0.8563 0.8033 0.8570 0.0195  0.0062  -0.0214 51  ALA D C   
1532 O O   . ALA D 27 ? 0.8398 0.8042 0.8614 0.0278  0.0072  -0.0212 51  ALA D O   
1533 C CB  . ALA D 27 ? 0.8196 0.7879 0.8065 -0.0009 -0.0024 -0.0249 51  ALA D CB  
1534 N N   . ARG D 28 ? 0.8309 0.7553 0.8211 0.0238  0.0060  -0.0143 52  ARG D N   
1535 C CA  . ARG D 28 ? 0.8411 0.7647 0.8473 0.0420  0.0062  -0.0047 52  ARG D CA  
1536 C C   . ARG D 28 ? 0.8303 0.7456 0.8448 0.0523  0.0192  -0.0097 52  ARG D C   
1537 O O   . ARG D 28 ? 0.8284 0.7646 0.8682 0.0653  0.0197  -0.0049 52  ARG D O   
1538 C CB  . ARG D 28 ? 0.8815 0.7771 0.8721 0.0474  0.0053  0.0060  52  ARG D CB  
1539 C CG  . ARG D 28 ? 0.9341 0.8306 0.9421 0.0699  0.0053  0.0197  52  ARG D CG  
1540 C CD  . ARG D 28 ? 0.9887 0.8694 0.9823 0.0732  -0.0018 0.0341  52  ARG D CD  
1541 N NE  . ARG D 28 ? 1.0150 0.9261 1.0103 0.0633  -0.0182 0.0389  52  ARG D NE  
1542 C CZ  . ARG D 28 ? 1.0521 0.9524 1.0286 0.0600  -0.0256 0.0496  52  ARG D CZ  
1543 N NH1 . ARG D 28 ? 1.0593 0.9170 1.0147 0.0657  -0.0180 0.0577  52  ARG D NH1 
1544 N NH2 . ARG D 28 ? 1.0077 0.9357 0.9828 0.0499  -0.0392 0.0519  52  ARG D NH2 
1545 N N   . ALA D 29 ? 0.7802 0.6692 0.7733 0.0446  0.0297  -0.0197 53  ALA D N   
1546 C CA  . ALA D 29 ? 0.7855 0.6618 0.7801 0.0537  0.0442  -0.0258 53  ALA D CA  
1547 C C   . ALA D 29 ? 0.7521 0.6596 0.7644 0.0522  0.0450  -0.0312 53  ALA D C   
1548 O O   . ALA D 29 ? 0.7653 0.6671 0.7794 0.0589  0.0576  -0.0362 53  ALA D O   
1549 C CB  . ALA D 29 ? 0.8105 0.6451 0.7708 0.0435  0.0553  -0.0359 53  ALA D CB  
1550 N N   . GLY D 30 ? 0.9134 0.8502 0.9357 0.0430  0.0334  -0.0303 54  GLY D N   
1551 C CA  . GLY D 30 ? 0.8574 0.8207 0.8948 0.0406  0.0339  -0.0338 54  GLY D CA  
1552 C C   . GLY D 30 ? 0.8426 0.8073 0.8643 0.0273  0.0344  -0.0412 54  GLY D C   
1553 O O   . GLY D 30 ? 0.8672 0.8470 0.8974 0.0269  0.0378  -0.0434 54  GLY D O   
1554 N N   . PHE D 31 ? 0.6980 0.6508 0.6984 0.0164  0.0309  -0.0437 55  PHE D N   
1555 C CA  . PHE D 31 ? 0.6868 0.6456 0.6731 0.0047  0.0313  -0.0490 55  PHE D CA  
1556 C C   . PHE D 31 ? 0.6724 0.6500 0.6618 -0.0015 0.0222  -0.0458 55  PHE D C   
1557 O O   . PHE D 31 ? 0.6867 0.6595 0.6730 -0.0041 0.0167  -0.0424 55  PHE D O   
1558 C CB  . PHE D 31 ? 0.7308 0.6669 0.6905 -0.0068 0.0337  -0.0539 55  PHE D CB  
1559 C CG  . PHE D 31 ? 0.7991 0.7073 0.7454 -0.0033 0.0451  -0.0597 55  PHE D CG  
1560 C CD1 . PHE D 31 ? 0.8581 0.7699 0.7992 -0.0035 0.0525  -0.0653 55  PHE D CD1 
1561 C CD2 . PHE D 31 ? 0.8349 0.7108 0.7720 0.0017  0.0504  -0.0590 55  PHE D CD2 
1562 C CE1 . PHE D 31 ? 0.8863 0.7690 0.8109 0.0002  0.0663  -0.0724 55  PHE D CE1 
1563 C CE2 . PHE D 31 ? 0.9340 0.7786 0.8562 0.0071  0.0644  -0.0653 55  PHE D CE2 
1564 C CZ  . PHE D 31 ? 0.9237 0.7720 0.8387 0.0057  0.0730  -0.0732 55  PHE D CZ  
1565 N N   . TYR D 32 ? 0.6321 0.6283 0.6247 -0.0034 0.0219  -0.0461 56  TYR D N   
1566 C CA  . TYR D 32 ? 0.6350 0.6467 0.6283 -0.0073 0.0165  -0.0433 56  TYR D CA  
1567 C C   . TYR D 32 ? 0.6487 0.6723 0.6308 -0.0155 0.0165  -0.0436 56  TYR D C   
1568 O O   . TYR D 32 ? 0.6694 0.6907 0.6430 -0.0182 0.0198  -0.0463 56  TYR D O   
1569 C CB  . TYR D 32 ? 0.6300 0.6532 0.6368 -0.0007 0.0173  -0.0415 56  TYR D CB  
1570 C CG  . TYR D 32 ? 0.5967 0.6248 0.6057 0.0029  0.0233  -0.0415 56  TYR D CG  
1571 C CD1 . TYR D 32 ? 0.6016 0.6259 0.6213 0.0078  0.0278  -0.0421 56  TYR D CD1 
1572 C CD2 . TYR D 32 ? 0.6122 0.6526 0.6139 0.0017  0.0242  -0.0389 56  TYR D CD2 
1573 C CE1 . TYR D 32 ? 0.6381 0.6652 0.6583 0.0105  0.0345  -0.0409 56  TYR D CE1 
1574 C CE2 . TYR D 32 ? 0.5694 0.6133 0.5709 0.0062  0.0297  -0.0365 56  TYR D CE2 
1575 C CZ  . TYR D 32 ? 0.6264 0.6610 0.6355 0.0098  0.0354  -0.0380 56  TYR D CZ  
1576 O OH  . TYR D 32 ? 0.6991 0.7344 0.7065 0.0132  0.0422  -0.0350 56  TYR D OH  
1577 N N   . TYR D 33 ? 0.5754 0.6149 0.5577 -0.0192 0.0131  -0.0404 57  TYR D N   
1578 C CA  . TYR D 33 ? 0.5976 0.6547 0.5718 -0.0288 0.0115  -0.0391 57  TYR D CA  
1579 C C   . TYR D 33 ? 0.6210 0.6984 0.6007 -0.0219 0.0131  -0.0350 57  TYR D C   
1580 O O   . TYR D 33 ? 0.6223 0.7037 0.6127 -0.0101 0.0159  -0.0315 57  TYR D O   
1581 C CB  . TYR D 33 ? 0.5919 0.6645 0.5675 -0.0343 0.0088  -0.0354 57  TYR D CB  
1582 C CG  . TYR D 33 ? 0.6101 0.7104 0.5815 -0.0469 0.0061  -0.0325 57  TYR D CG  
1583 C CD1 . TYR D 33 ? 0.6044 0.7015 0.5617 -0.0606 0.0040  -0.0364 57  TYR D CD1 
1584 C CD2 . TYR D 33 ? 0.5863 0.7184 0.5680 -0.0453 0.0062  -0.0257 57  TYR D CD2 
1585 C CE1 . TYR D 33 ? 0.6320 0.7587 0.5858 -0.0751 -0.0004 -0.0337 57  TYR D CE1 
1586 C CE2 . TYR D 33 ? 0.5890 0.7541 0.5714 -0.0570 0.0029  -0.0214 57  TYR D CE2 
1587 C CZ  . TYR D 33 ? 0.6258 0.7893 0.5944 -0.0732 -0.0016 -0.0254 57  TYR D CZ  
1588 O OH  . TYR D 33 ? 0.6563 0.8566 0.6249 -0.0888 -0.0068 -0.0214 57  TYR D OH  
1589 N N   . THR D 34 ? 0.6991 0.7888 0.6688 -0.0301 0.0112  -0.0347 58  THR D N   
1590 C CA  . THR D 34 ? 0.7122 0.8234 0.6855 -0.0228 0.0117  -0.0280 58  THR D CA  
1591 C C   . THR D 34 ? 0.7361 0.8835 0.7184 -0.0210 0.0084  -0.0186 58  THR D C   
1592 O O   . THR D 34 ? 0.7679 0.9325 0.7574 -0.0084 0.0103  -0.0097 58  THR D O   
1593 C CB  . THR D 34 ? 0.7313 0.8420 0.6875 -0.0320 0.0106  -0.0309 58  THR D CB  
1594 O OG1 . THR D 34 ? 0.7409 0.8607 0.6840 -0.0513 0.0047  -0.0342 58  THR D OG1 
1595 C CG2 . THR D 34 ? 0.7052 0.7819 0.6546 -0.0291 0.0175  -0.0390 58  THR D CG2 
1596 N N   . GLY D 35 ? 0.7284 0.8896 0.7112 -0.0322 0.0047  -0.0187 59  GLY D N   
1597 C CA  . GLY D 35 ? 0.7282 0.9306 0.7240 -0.0284 0.0033  -0.0083 59  GLY D CA  
1598 C C   . GLY D 35 ? 0.7520 0.9902 0.7435 -0.0418 -0.0045 -0.0034 59  GLY D C   
1599 O O   . GLY D 35 ? 0.7415 1.0234 0.7471 -0.0377 -0.0067 0.0079  59  GLY D O   
1600 N N   . VAL D 36 ? 0.6485 0.8684 0.6199 -0.0575 -0.0081 -0.0119 60  VAL D N   
1601 C CA  . VAL D 36 ? 0.6907 0.9375 0.6493 -0.0774 -0.0168 -0.0112 60  VAL D CA  
1602 C C   . VAL D 36 ? 0.7209 0.9432 0.6598 -0.1035 -0.0184 -0.0236 60  VAL D C   
1603 O O   . VAL D 36 ? 0.7326 0.9070 0.6551 -0.1054 -0.0129 -0.0348 60  VAL D O   
1604 C CB  . VAL D 36 ? 0.6980 0.9405 0.6413 -0.0747 -0.0182 -0.0109 60  VAL D CB  
1605 N N   . ASN D 37 ? 0.9189 1.1749 0.8605 -0.1229 -0.0246 -0.0205 61  ASN D N   
1606 C CA  . ASN D 37 ? 0.9645 1.2000 0.8843 -0.1524 -0.0262 -0.0309 61  ASN D CA  
1607 C C   . ASN D 37 ? 0.9613 1.1427 0.8755 -0.1456 -0.0173 -0.0387 61  ASN D C   
1608 O O   . ASN D 37 ? 0.9324 1.1157 0.8657 -0.1291 -0.0134 -0.0332 61  ASN D O   
1609 C CB  . ASN D 37 ? 1.0206 1.2394 0.9079 -0.1736 -0.0300 -0.0412 61  ASN D CB  
1610 C CG  . ASN D 37 ? 1.0675 1.3428 0.9570 -0.1798 -0.0413 -0.0322 61  ASN D CG  
1611 O OD1 . ASN D 37 ? 1.0995 1.4346 1.0119 -0.1822 -0.0489 -0.0191 61  ASN D OD1 
1612 N ND2 . ASN D 37 ? 1.1171 1.3758 0.9832 -0.1811 -0.0418 -0.0377 61  ASN D ND2 
1613 N N   . ASP D 38 ? 0.9983 1.1305 0.8847 -0.1570 -0.0134 -0.0511 62  ASP D N   
1614 C CA  . ASP D 38 ? 0.9950 1.0745 0.8760 -0.1467 -0.0049 -0.0566 62  ASP D CA  
1615 C C   . ASP D 38 ? 0.9699 1.0165 0.8446 -0.1297 0.0016  -0.0622 62  ASP D C   
1616 O O   . ASP D 38 ? 0.9806 0.9818 0.8447 -0.1252 0.0089  -0.0682 62  ASP D O   
1617 C CB  . ASP D 38 ? 1.0405 1.0846 0.8980 -0.1699 -0.0021 -0.0634 62  ASP D CB  
1618 C CG  . ASP D 38 ? 1.1403 1.1551 0.9627 -0.1929 -0.0003 -0.0757 62  ASP D CG  
1619 O OD1 . ASP D 38 ? 1.2220 1.1863 1.0197 -0.2050 0.0066  -0.0833 62  ASP D OD1 
1620 O OD2 . ASP D 38 ? 1.2183 1.2570 1.0343 -0.1989 -0.0052 -0.0778 62  ASP D OD2 
1621 N N   . LYS D 39 ? 0.8552 0.9273 0.7381 -0.1191 -0.0005 -0.0585 63  LYS D N   
1622 C CA  . LYS D 39 ? 0.8294 0.8781 0.7088 -0.1036 0.0064  -0.0623 63  LYS D CA  
1623 C C   . LYS D 39 ? 0.7812 0.8228 0.6854 -0.0797 0.0105  -0.0573 63  LYS D C   
1624 O O   . LYS D 39 ? 0.7528 0.8228 0.6784 -0.0700 0.0069  -0.0484 63  LYS D O   
1625 C CB  . LYS D 39 ? 0.8330 0.9114 0.7093 -0.1029 0.0026  -0.0584 63  LYS D CB  
1626 C CG  . LYS D 39 ? 0.8847 0.9372 0.7467 -0.0948 0.0111  -0.0645 63  LYS D CG  
1627 C CD  . LYS D 39 ? 0.9563 1.0382 0.8083 -0.0977 0.0063  -0.0595 63  LYS D CD  
1628 C CE  . LYS D 39 ? 0.9679 1.0878 0.8489 -0.0780 0.0024  -0.0433 63  LYS D CE  
1629 N NZ  . LYS D 39 ? 1.0078 1.1662 0.8833 -0.0791 -0.0051 -0.0326 63  LYS D NZ  
1630 N N   . VAL D 40 ? 0.6776 0.6823 0.5782 -0.0707 0.0184  -0.0628 64  VAL D N   
1631 C CA  . VAL D 40 ? 0.6374 0.6381 0.5603 -0.0509 0.0212  -0.0586 64  VAL D CA  
1632 C C   . VAL D 40 ? 0.6504 0.6389 0.5745 -0.0395 0.0292  -0.0614 64  VAL D C   
1633 O O   . VAL D 40 ? 0.6757 0.6493 0.5794 -0.0461 0.0345  -0.0681 64  VAL D O   
1634 C CB  . VAL D 40 ? 0.6522 0.6273 0.5769 -0.0481 0.0225  -0.0590 64  VAL D CB  
1635 C CG1 . VAL D 40 ? 0.6193 0.6020 0.5395 -0.0613 0.0165  -0.0561 64  VAL D CG1 
1636 C CG2 . VAL D 40 ? 0.6574 0.5928 0.5646 -0.0481 0.0314  -0.0662 64  VAL D CG2 
1637 N N   . LYS D 41 ? 0.7301 0.7236 0.6762 -0.0242 0.0310  -0.0570 65  LYS D N   
1638 C CA  . LYS D 41 ? 0.7507 0.7394 0.7015 -0.0145 0.0393  -0.0581 65  LYS D CA  
1639 C C   . LYS D 41 ? 0.7509 0.7336 0.7237 -0.0013 0.0430  -0.0560 65  LYS D C   
1640 O O   . LYS D 41 ? 0.7493 0.7425 0.7382 0.0020  0.0368  -0.0514 65  LYS D O   
1641 C CB  . LYS D 41 ? 0.7475 0.7600 0.7015 -0.0130 0.0377  -0.0526 65  LYS D CB  
1642 C CG  . LYS D 41 ? 0.7877 0.7978 0.7433 -0.0057 0.0469  -0.0522 65  LYS D CG  
1643 C CD  . LYS D 41 ? 0.7885 0.8186 0.7480 -0.0022 0.0450  -0.0437 65  LYS D CD  
1644 C CE  . LYS D 41 ? 0.8284 0.8544 0.7857 0.0026  0.0548  -0.0423 65  LYS D CE  
1645 N NZ  . LYS D 41 ? 0.8582 0.8998 0.8133 0.0059  0.0529  -0.0322 65  LYS D NZ  
1646 N N   . CYS D 42 ? 0.7469 0.7149 0.7202 0.0056  0.0530  -0.0593 66  CYS D N   
1647 C CA  . CYS D 42 ? 0.7465 0.7158 0.7435 0.0176  0.0553  -0.0557 66  CYS D CA  
1648 C C   . CYS D 42 ? 0.7333 0.7245 0.7494 0.0206  0.0552  -0.0514 66  CYS D C   
1649 O O   . CYS D 42 ? 0.7337 0.7278 0.7452 0.0203  0.0627  -0.0524 66  CYS D O   
1650 C CB  . CYS D 42 ? 0.7700 0.7197 0.7645 0.0267  0.0684  -0.0591 66  CYS D CB  
1651 S SG  . CYS D 42 ? 0.7986 0.7666 0.8324 0.0441  0.0732  -0.0515 66  CYS D SG  
1652 N N   . PHE D 43 ? 0.7257 0.7297 0.7600 0.0218  0.0473  -0.0468 67  PHE D N   
1653 C CA  . PHE D 43 ? 0.7214 0.7410 0.7715 0.0216  0.0480  -0.0438 67  PHE D CA  
1654 C C   . PHE D 43 ? 0.7253 0.7508 0.7903 0.0269  0.0589  -0.0431 67  PHE D C   
1655 O O   . PHE D 43 ? 0.7063 0.7405 0.7790 0.0243  0.0628  -0.0411 67  PHE D O   
1656 C CB  . PHE D 43 ? 0.7075 0.7369 0.7715 0.0197  0.0383  -0.0409 67  PHE D CB  
1657 C CG  . PHE D 43 ? 0.7404 0.7786 0.8246 0.0250  0.0367  -0.0379 67  PHE D CG  
1658 C CD1 . PHE D 43 ? 0.7737 0.8303 0.8796 0.0228  0.0363  -0.0353 67  PHE D CD1 
1659 C CD2 . PHE D 43 ? 0.7973 0.8262 0.8793 0.0321  0.0361  -0.0365 67  PHE D CD2 
1660 C CE1 . PHE D 43 ? 0.7886 0.8639 0.9192 0.0285  0.0335  -0.0299 67  PHE D CE1 
1661 C CE2 . PHE D 43 ? 0.8163 0.8576 0.9209 0.0414  0.0349  -0.0303 67  PHE D CE2 
1662 C CZ  . PHE D 43 ? 0.7753 0.8446 0.9065 0.0398  0.0326  -0.0264 67  PHE D CZ  
1663 N N   . CYS D 44 ? 0.7385 0.7582 0.8074 0.0348  0.0650  -0.0440 68  CYS D N   
1664 C CA  . CYS D 44 ? 0.7714 0.8010 0.8582 0.0417  0.0767  -0.0425 68  CYS D CA  
1665 C C   . CYS D 44 ? 0.7990 0.8162 0.8665 0.0421  0.0910  -0.0471 68  CYS D C   
1666 O O   . CYS D 44 ? 0.7910 0.8177 0.8635 0.0401  0.0994  -0.0456 68  CYS D O   
1667 C CB  . CYS D 44 ? 0.7725 0.8033 0.8752 0.0541  0.0787  -0.0395 68  CYS D CB  
1668 S SG  . CYS D 44 ? 0.8225 0.8808 0.9597 0.0634  0.0917  -0.0343 68  CYS D SG  
1669 N N   . CYS D 45 ? 0.8129 0.8068 0.8554 0.0430  0.0947  -0.0531 69  CYS D N   
1670 C CA  . CYS D 45 ? 0.8495 0.8306 0.8724 0.0437  0.1097  -0.0585 69  CYS D CA  
1671 C C   . CYS D 45 ? 0.8640 0.8388 0.8561 0.0314  0.1056  -0.0616 69  CYS D C   
1672 O O   . CYS D 45 ? 0.8915 0.8603 0.8647 0.0293  0.1162  -0.0647 69  CYS D O   
1673 C CB  . CYS D 45 ? 0.8755 0.8314 0.8870 0.0525  0.1205  -0.0643 69  CYS D CB  
1674 S SG  . CYS D 45 ? 0.8869 0.8168 0.8720 0.0440  0.1092  -0.0690 69  CYS D SG  
1675 N N   . GLY D 46 ? 0.8157 0.7947 0.8029 0.0238  0.0905  -0.0597 70  GLY D N   
1676 C CA  . GLY D 46 ? 0.8301 0.8115 0.7926 0.0133  0.0843  -0.0599 70  GLY D CA  
1677 C C   . GLY D 46 ? 0.8674 0.8310 0.7986 0.0034  0.0827  -0.0680 70  GLY D C   
1678 O O   . GLY D 46 ? 0.8628 0.8329 0.7716 -0.0074 0.0773  -0.0682 70  GLY D O   
1679 N N   . LEU D 47 ? 0.9140 0.8556 0.8435 0.0065  0.0873  -0.0737 71  LEU D N   
1680 C CA  . LEU D 47 ? 0.9641 0.8783 0.8610 -0.0042 0.0894  -0.0833 71  LEU D CA  
1681 C C   . LEU D 47 ? 0.9628 0.8868 0.8522 -0.0183 0.0738  -0.0817 71  LEU D C   
1682 O O   . LEU D 47 ? 0.9295 0.8629 0.8392 -0.0150 0.0652  -0.0759 71  LEU D O   
1683 C CB  . LEU D 47 ? 0.9822 0.8654 0.8803 0.0061  0.1003  -0.0877 71  LEU D CB  
1684 C CG  . LEU D 47 ? 1.0261 0.8709 0.8921 -0.0042 0.1031  -0.0969 71  LEU D CG  
1685 C CD1 . LEU D 47 ? 1.0635 0.8841 0.8875 -0.0175 0.1129  -0.1094 71  LEU D CD1 
1686 C CD2 . LEU D 47 ? 1.0211 0.8380 0.8961 0.0121  0.1132  -0.0959 71  LEU D CD2 
1687 N N   . MET D 48 ? 0.9763 0.9011 0.8364 -0.0349 0.0704  -0.0865 72  MET D N   
1688 C CA  . MET D 48 ? 0.9863 0.9263 0.8398 -0.0506 0.0564  -0.0847 72  MET D CA  
1689 C C   . MET D 48 ? 1.0410 0.9511 0.8641 -0.0683 0.0578  -0.0952 72  MET D C   
1690 O O   . MET D 48 ? 1.0902 0.9785 0.8804 -0.0796 0.0649  -0.1055 72  MET D O   
1691 C CB  . MET D 48 ? 0.9737 0.9470 0.8210 -0.0580 0.0481  -0.0790 72  MET D CB  
1692 C CG  . MET D 48 ? 0.9533 0.9595 0.8308 -0.0481 0.0393  -0.0663 72  MET D CG  
1693 S SD  . MET D 48 ? 0.9636 1.0015 0.8407 -0.0434 0.0364  -0.0555 72  MET D SD  
1694 C CE  . MET D 48 ? 0.9849 0.9981 0.8553 -0.0335 0.0529  -0.0600 72  MET D CE  
1695 N N   . LEU D 49 ? 1.0823 0.9887 0.9132 -0.0723 0.0518  -0.0929 73  LEU D N   
1696 C CA  . LEU D 49 ? 1.1451 1.0207 0.9469 -0.0918 0.0530  -0.1017 73  LEU D CA  
1697 C C   . LEU D 49 ? 1.1410 1.0475 0.9460 -0.1100 0.0385  -0.0966 73  LEU D C   
1698 O O   . LEU D 49 ? 1.1105 1.0480 0.9453 -0.0998 0.0310  -0.0859 73  LEU D O   
1699 C CB  . LEU D 49 ? 1.1579 0.9930 0.9632 -0.0793 0.0625  -0.1026 73  LEU D CB  
1700 C CG  . LEU D 49 ? 1.2036 1.0104 1.0076 -0.0597 0.0792  -0.1070 73  LEU D CG  
1701 C CD1 . LEU D 49 ? 1.1977 0.9728 1.0118 -0.0424 0.0875  -0.1035 73  LEU D CD1 
1702 C CD2 . LEU D 49 ? 1.2889 1.0645 1.0509 -0.0730 0.0909  -0.1216 73  LEU D CD2 
1703 N N   . ASP D 50 ? 1.1792 1.0789 0.9536 -0.1376 0.0352  -0.1044 74  ASP D N   
1704 C CA  . ASP D 50 ? 1.1816 1.1112 0.9595 -0.1582 0.0229  -0.0997 74  ASP D CA  
1705 C C   . ASP D 50 ? 1.2411 1.1337 0.9823 -0.1878 0.0258  -0.1110 74  ASP D C   
1706 O O   . ASP D 50 ? 1.2718 1.1076 0.9878 -0.1866 0.0390  -0.1214 74  ASP D O   
1707 C CB  . ASP D 50 ? 1.1567 1.1496 0.9494 -0.1628 0.0096  -0.0905 74  ASP D CB  
1708 C CG  . ASP D 50 ? 1.2131 1.2152 0.9742 -0.1856 0.0054  -0.0977 74  ASP D CG  
1709 O OD1 . ASP D 50 ? 1.2103 1.2671 0.9824 -0.1914 -0.0070 -0.0882 74  ASP D OD1 
1710 O OD2 . ASP D 50 ? 1.2719 1.2283 0.9965 -0.1974 0.0144  -0.1121 74  ASP D OD2 
1711 N N   . ASN D 51 ? 1.3057 1.2300 1.0460 -0.2130 0.0147  -0.1081 75  ASN D N   
1712 C CA  . ASN D 51 ? 1.3769 1.2715 1.0834 -0.2471 0.0160  -0.1178 75  ASN D CA  
1713 C C   . ASN D 51 ? 1.4093 1.2357 1.1014 -0.2408 0.0300  -0.1223 75  ASN D C   
1714 O O   . ASN D 51 ? 1.4759 1.2444 1.1289 -0.2525 0.0414  -0.1359 75  ASN D O   
1715 C CB  . ASN D 51 ? 1.4412 1.3223 1.1061 -0.2726 0.0164  -0.1321 75  ASN D CB  
1716 C CG  . ASN D 51 ? 1.5184 1.3999 1.1531 -0.3180 0.0100  -0.1399 75  ASN D CG  
1717 O OD1 . ASN D 51 ? 1.5357 1.4260 1.1805 -0.3315 0.0066  -0.1344 75  ASN D OD1 
1718 N ND2 . ASN D 51 ? 1.6012 1.4737 1.1963 -0.3440 0.0086  -0.1531 75  ASN D ND2 
1719 N N   . TRP D 52 ? 1.3707 1.2020 1.0913 -0.2221 0.0297  -0.1107 76  TRP D N   
1720 C CA  . TRP D 52 ? 1.3973 1.1685 1.1088 -0.2093 0.0418  -0.1105 76  TRP D CA  
1721 C C   . TRP D 52 ? 1.4697 1.2031 1.1497 -0.2404 0.0453  -0.1148 76  TRP D C   
1722 O O   . TRP D 52 ? 1.4668 1.2386 1.1536 -0.2634 0.0355  -0.1101 76  TRP D O   
1723 C CB  . TRP D 52 ? 1.3358 1.1275 1.0864 -0.1790 0.0388  -0.0956 76  TRP D CB  
1724 C CG  . TRP D 52 ? 1.2449 1.0610 1.0250 -0.1471 0.0383  -0.0914 76  TRP D CG  
1725 C CD1 . TRP D 52 ? 1.1626 1.0339 0.9684 -0.1405 0.0291  -0.0860 76  TRP D CD1 
1726 C CD2 . TRP D 52 ? 1.1865 0.9725 0.9727 -0.1196 0.0484  -0.0914 76  TRP D CD2 
1727 N NE1 . TRP D 52 ? 1.1173 0.9910 0.9414 -0.1144 0.0328  -0.0840 76  TRP D NE1 
1728 C CE2 . TRP D 52 ? 1.1220 0.9483 0.9367 -0.1016 0.0441  -0.0870 76  TRP D CE2 
1729 C CE3 . TRP D 52 ? 1.2109 0.9409 0.9818 -0.1078 0.0616  -0.0936 76  TRP D CE3 
1730 C CZ2 . TRP D 52 ? 1.0971 0.9140 0.9273 -0.0755 0.0516  -0.0854 76  TRP D CZ2 
1731 C CZ3 . TRP D 52 ? 1.1731 0.8977 0.9628 -0.0778 0.0691  -0.0906 76  TRP D CZ3 
1732 C CH2 . TRP D 52 ? 1.1212 0.8912 0.9408 -0.0639 0.0636  -0.0869 76  TRP D CH2 
1733 N N   . LYS D 53 ? 1.3396 0.9981 0.9859 -0.2407 0.0605  -0.1227 77  LYS D N   
1734 C CA  . LYS D 53 ? 1.4170 1.0271 1.0295 -0.2691 0.0667  -0.1260 77  LYS D CA  
1735 C C   . LYS D 53 ? 1.4350 1.0005 1.0514 -0.2463 0.0756  -0.1145 77  LYS D C   
1736 O O   . LYS D 53 ? 1.3976 0.9694 1.0413 -0.2094 0.0769  -0.1054 77  LYS D O   
1737 C CB  . LYS D 53 ? 1.4917 1.0445 1.0508 -0.2974 0.0777  -0.1456 77  LYS D CB  
1738 N N   . ARG D 54 ? 1.5026 1.0262 1.0919 -0.2692 0.0810  -0.1134 78  ARG D N   
1739 C CA  . ARG D 54 ? 1.5243 1.0031 1.1128 -0.2484 0.0893  -0.1002 78  ARG D CA  
1740 C C   . ARG D 54 ? 1.5707 0.9830 1.1428 -0.2184 0.1066  -0.1034 78  ARG D C   
1741 O O   . ARG D 54 ? 1.6087 0.9884 1.1540 -0.2247 0.1168  -0.1196 78  ARG D O   
1742 C CB  . ARG D 54 ? 1.5792 1.0232 1.1380 -0.2818 0.0930  -0.0977 78  ARG D CB  
1743 N N   . GLY D 55 ? 1.6135 1.0112 1.2032 -0.1847 0.1096  -0.0871 79  GLY D N   
1744 C CA  . GLY D 55 ? 1.6579 1.0003 1.2407 -0.1496 0.1261  -0.0847 79  GLY D CA  
1745 C C   . GLY D 55 ? 1.6259 0.9914 1.2300 -0.1235 0.1291  -0.0913 79  GLY D C   
1746 O O   . GLY D 55 ? 1.6566 0.9811 1.2581 -0.0933 0.1444  -0.0888 79  GLY D O   
1747 N N   . ASP D 56 ? 1.5784 1.0083 1.2025 -0.1354 0.1158  -0.0986 80  ASP D N   
1748 C CA  . ASP D 56 ? 1.5171 0.9898 1.1711 -0.1124 0.1136  -0.1011 80  ASP D CA  
1749 C C   . ASP D 56 ? 1.4635 0.9634 1.1602 -0.0744 0.1095  -0.0836 80  ASP D C   
1750 O O   . ASP D 56 ? 1.4367 0.9622 1.1526 -0.0721 0.0976  -0.0698 80  ASP D O   
1751 C CB  . ASP D 56 ? 1.4510 0.9949 1.1237 -0.1315 0.0963  -0.1050 80  ASP D CB  
1752 C CG  . ASP D 56 ? 1.4987 1.0343 1.1374 -0.1618 0.0989  -0.1233 80  ASP D CG  
1753 O OD1 . ASP D 56 ? 1.4671 1.0318 1.1147 -0.1555 0.0976  -0.1291 80  ASP D OD1 
1754 O OD2 . ASP D 56 ? 1.5790 1.0810 1.1808 -0.1941 0.1016  -0.1317 80  ASP D OD2 
1755 N N   . SER D 57 ? 1.4486 0.9447 1.1596 -0.0458 0.1194  -0.0837 81  SER D N   
1756 C CA  . SER D 57 ? 1.3958 0.9295 1.1508 -0.0141 0.1125  -0.0672 81  SER D CA  
1757 C C   . SER D 57 ? 1.3356 0.9246 1.1202 -0.0072 0.1068  -0.0713 81  SER D C   
1758 O O   . SER D 57 ? 1.3565 0.9308 1.1339 0.0008  0.1204  -0.0808 81  SER D O   
1759 C CB  . SER D 57 ? 1.4412 0.9315 1.1969 0.0181  0.1280  -0.0575 81  SER D CB  
1760 O OG  . SER D 57 ? 1.3958 0.9328 1.1973 0.0469  0.1197  -0.0417 81  SER D OG  
1761 N N   . PRO D 58 ? 1.3060 0.9548 1.1206 -0.0110 0.0884  -0.0644 82  PRO D N   
1762 C CA  . PRO D 58 ? 1.2452 0.9452 1.0880 -0.0051 0.0824  -0.0662 82  PRO D CA  
1763 C C   . PRO D 58 ? 1.2408 0.9451 1.1089 0.0249  0.0913  -0.0607 82  PRO D C   
1764 O O   . PRO D 58 ? 1.2308 0.9458 1.1039 0.0297  0.0990  -0.0679 82  PRO D O   
1765 C CB  . PRO D 58 ? 1.1899 0.9368 1.0564 -0.0101 0.0643  -0.0570 82  PRO D CB  
1766 C CG  . PRO D 58 ? 1.2154 0.9408 1.0599 -0.0275 0.0606  -0.0546 82  PRO D CG  
1767 C CD  . PRO D 58 ? 1.2851 0.9504 1.1054 -0.0204 0.0745  -0.0541 82  PRO D CD  
1768 N N   . THR D 59 ? 1.1603 0.8568 1.0431 0.0447  0.0910  -0.0470 83  THR D N   
1769 C CA  . THR D 59 ? 1.1586 0.8599 1.0672 0.0749  0.1003  -0.0387 83  THR D CA  
1770 C C   . THR D 59 ? 1.2040 0.8628 1.0922 0.0842  0.1238  -0.0493 83  THR D C   
1771 O O   . THR D 59 ? 1.1842 0.8646 1.0894 0.0943  0.1314  -0.0530 83  THR D O   
1772 C CB  . THR D 59 ? 1.1758 0.8720 1.0978 0.0937  0.0954  -0.0202 83  THR D CB  
1773 O OG1 . THR D 59 ? 1.1379 0.8612 1.0649 0.0795  0.0757  -0.0135 83  THR D OG1 
1774 C CG2 . THR D 59 ? 1.1600 0.8897 1.1226 0.1224  0.0974  -0.0085 83  THR D CG2 
1775 N N   . GLU D 60 ? 1.3125 0.9085 1.1612 0.0790  0.1365  -0.0549 84  GLU D N   
1776 C CA  . GLU D 60 ? 1.3761 0.9212 1.1950 0.0842  0.1612  -0.0683 84  GLU D CA  
1777 C C   . GLU D 60 ? 1.3532 0.9137 1.1577 0.0636  0.1626  -0.0859 84  GLU D C   
1778 O O   . GLU D 60 ? 1.3463 0.9208 1.1639 0.0780  0.1738  -0.0890 84  GLU D O   
1779 C CB  . GLU D 60 ? 1.4601 0.9267 1.2315 0.0769  0.1750  -0.0732 84  GLU D CB  
1780 N N   . LYS D 61 ? 1.3009 0.8631 1.0804 0.0305  0.1509  -0.0953 85  LYS D N   
1781 C CA  . LYS D 61 ? 1.2838 0.8637 1.0465 0.0085  0.1488  -0.1097 85  LYS D CA  
1782 C C   . LYS D 61 ? 1.2277 0.8642 1.0265 0.0207  0.1444  -0.1057 85  LYS D C   
1783 O O   . LYS D 61 ? 1.2227 0.8622 1.0060 0.0131  0.1512  -0.1164 85  LYS D O   
1784 C CB  . LYS D 61 ? 1.2656 0.8613 1.0130 -0.0247 0.1307  -0.1128 85  LYS D CB  
1785 C CG  . LYS D 61 ? 1.2946 0.8896 1.0080 -0.0532 0.1303  -0.1286 85  LYS D CG  
1786 C CD  . LYS D 61 ? 1.3183 0.9188 1.0125 -0.0868 0.1157  -0.1310 85  LYS D CD  
1787 C CE  . LYS D 61 ? 1.4237 0.9883 1.0648 -0.1189 0.1221  -0.1495 85  LYS D CE  
1788 N NZ  . LYS D 61 ? 1.4070 1.0213 1.0436 -0.1441 0.1067  -0.1537 85  LYS D NZ  
1789 N N   . HIS D 62 ? 1.2104 0.8905 1.0538 0.0366  0.1324  -0.0904 86  HIS D N   
1790 C CA  . HIS D 62 ? 1.1653 0.8948 1.0465 0.0503  0.1303  -0.0846 86  HIS D CA  
1791 C C   . HIS D 62 ? 1.2216 0.9303 1.1054 0.0735  0.1537  -0.0868 86  HIS D C   
1792 O O   . HIS D 62 ? 1.2351 0.9442 1.1065 0.0699  0.1646  -0.0964 86  HIS D O   
1793 C CB  . HIS D 62 ? 1.1036 0.8773 1.0270 0.0594  0.1128  -0.0687 86  HIS D CB  
1794 C CG  . HIS D 62 ? 0.9815 0.8072 0.9362 0.0603  0.1048  -0.0649 86  HIS D CG  
1795 N ND1 . HIS D 62 ? 0.8415 0.7040 0.8272 0.0633  0.0895  -0.0539 86  HIS D ND1 
1796 C CD2 . HIS D 62 ? 0.9182 0.7608 0.8746 0.0576  0.1108  -0.0703 86  HIS D CD2 
1797 C CE1 . HIS D 62 ? 0.7993 0.6960 0.8042 0.0618  0.0872  -0.0535 86  HIS D CE1 
1798 N NE2 . HIS D 62 ? 0.8313 0.7174 0.8198 0.0589  0.0998  -0.0623 86  HIS D NE2 
1799 N N   . LYS D 63 ? 1.2756 0.9656 1.1732 0.0977  0.1627  -0.0773 87  LYS D N   
1800 C CA  . LYS D 63 ? 1.3346 1.0054 1.2379 0.1247  0.1880  -0.0775 87  LYS D CA  
1801 C C   . LYS D 63 ? 1.4013 1.0256 1.2572 0.1149  0.2097  -0.0974 87  LYS D C   
1802 O O   . LYS D 63 ? 1.4076 1.0469 1.2699 0.1221  0.2228  -0.1019 87  LYS D O   
1803 C CB  . LYS D 63 ? 1.3615 1.0094 1.2784 0.1525  0.1953  -0.0634 87  LYS D CB  
1804 N N   . LYS D 64 ? 1.4375 1.0079 1.2443 0.0951  0.2123  -0.1096 88  LYS D N   
1805 C CA  . LYS D 64 ? 1.5072 1.0311 1.2607 0.0783  0.2294  -0.1304 88  LYS D CA  
1806 C C   . LYS D 64 ? 1.4780 1.0376 1.2255 0.0609  0.2247  -0.1391 88  LYS D C   
1807 O O   . LYS D 64 ? 1.5293 1.0622 1.2453 0.0590  0.2440  -0.1527 88  LYS D O   
1808 C CB  . LYS D 64 ? 1.5567 1.0303 1.2608 0.0493  0.2247  -0.1412 88  LYS D CB  
1809 C CG  . LYS D 64 ? 1.6570 1.0584 1.3362 0.0618  0.2424  -0.1412 88  LYS D CG  
1810 C CD  . LYS D 64 ? 1.7089 1.0887 1.3669 0.0355  0.2260  -0.1398 88  LYS D CD  
1811 C CE  . LYS D 64 ? 1.7709 1.0891 1.3630 0.0002  0.2341  -0.1610 88  LYS D CE  
1812 N NZ  . LYS D 64 ? 1.8765 1.1075 1.4326 0.0148  0.2620  -0.1660 88  LYS D NZ  
1813 N N   . LEU D 65 ? 1.5246 1.1406 1.2981 0.0483  0.2004  -0.1313 89  LEU D N   
1814 C CA  . LEU D 65 ? 1.5114 1.1551 1.2707 0.0280  0.1935  -0.1384 89  LEU D CA  
1815 C C   . LEU D 65 ? 1.4690 1.1605 1.2640 0.0422  0.1955  -0.1304 89  LEU D C   
1816 O O   . LEU D 65 ? 1.4766 1.1812 1.2543 0.0300  0.1964  -0.1362 89  LEU D O   
1817 C CB  . LEU D 65 ? 1.4787 1.1466 1.2308 0.0000  0.1678  -0.1373 89  LEU D CB  
1818 C CG  . LEU D 65 ? 1.5515 1.1859 1.2492 -0.0318 0.1658  -0.1524 89  LEU D CG  
1819 C CD1 . LEU D 65 ? 1.6012 1.1862 1.2786 -0.0381 0.1687  -0.1557 89  LEU D CD1 
1820 C CD2 . LEU D 65 ? 1.5266 1.2067 1.2212 -0.0577 0.1428  -0.1506 89  LEU D CD2 
1821 N N   . TYR D 66 ? 1.4833 1.2009 1.3262 0.0664  0.1961  -0.1166 90  TYR D N   
1822 C CA  . TYR D 66 ? 1.4300 1.1978 1.3126 0.0767  0.1953  -0.1072 90  TYR D CA  
1823 C C   . TYR D 66 ? 1.4049 1.1943 1.3362 0.1029  0.1982  -0.0931 90  TYR D C   
1824 O O   . TYR D 66 ? 1.3529 1.1781 1.3177 0.1029  0.1793  -0.0814 90  TYR D O   
1825 C CB  . TYR D 66 ? 1.3717 1.1794 1.2661 0.0591  0.1711  -0.1013 90  TYR D CB  
1826 C CG  . TYR D 66 ? 1.3524 1.1990 1.2668 0.0595  0.1718  -0.0961 90  TYR D CG  
1827 C CD1 . TYR D 66 ? 1.3418 1.1967 1.2317 0.0416  0.1658  -0.0998 90  TYR D CD1 
1828 C CD2 . TYR D 66 ? 1.3415 1.2183 1.2994 0.0767  0.1778  -0.0861 90  TYR D CD2 
1829 C CE1 . TYR D 66 ? 1.3196 1.2046 1.2244 0.0419  0.1675  -0.0936 90  TYR D CE1 
1830 C CE2 . TYR D 66 ? 1.3191 1.2278 1.2929 0.0740  0.1796  -0.0814 90  TYR D CE2 
1831 C CZ  . TYR D 66 ? 1.3170 1.2262 1.2627 0.0571  0.1751  -0.0851 90  TYR D CZ  
1832 O OH  . TYR D 66 ? 1.3059 1.2418 1.2650 0.0548  0.1776  -0.0787 90  TYR D OH  
1833 N N   . PRO D 67 ? 1.3259 1.0949 1.2605 0.1256  0.2222  -0.0938 91  PRO D N   
1834 C CA  . PRO D 67 ? 1.3079 1.0971 1.2879 0.1523  0.2239  -0.0783 91  PRO D CA  
1835 C C   . PRO D 67 ? 1.2566 1.1078 1.2885 0.1620  0.2227  -0.0664 91  PRO D C   
1836 O O   . PRO D 67 ? 1.2375 1.1199 1.3126 0.1799  0.2182  -0.0515 91  PRO D O   
1837 C CB  . PRO D 67 ? 1.3809 1.1196 1.3405 0.1741  0.2524  -0.0837 91  PRO D CB  
1838 C CG  . PRO D 67 ? 1.4342 1.1270 1.3348 0.1553  0.2670  -0.1049 91  PRO D CG  
1839 C CD  . PRO D 67 ? 1.3860 1.1138 1.2825 0.1287  0.2491  -0.1081 91  PRO D CD  
1840 N N   . SER D 68 ? 1.3160 1.1855 1.3419 0.1481  0.2257  -0.0722 92  SER D N   
1841 C CA  . SER D 68 ? 1.2648 1.1888 1.3328 0.1506  0.2265  -0.0630 92  SER D CA  
1842 C C   . SER D 68 ? 1.1936 1.1587 1.2914 0.1381  0.1994  -0.0529 92  SER D C   
1843 O O   . SER D 68 ? 1.1712 1.1790 1.3013 0.1349  0.1974  -0.0458 92  SER D O   
1844 C CB  . SER D 68 ? 1.2757 1.1966 1.3181 0.1375  0.2389  -0.0724 92  SER D CB  
1845 O OG  . SER D 68 ? 1.2943 1.1787 1.2851 0.1177  0.2323  -0.0848 92  SER D OG  
1846 N N   . CYS D 69 ? 1.0747 1.0230 1.1565 0.1283  0.1803  -0.0538 93  CYS D N   
1847 C CA  . CYS D 69 ? 1.0054 0.9815 1.1024 0.1136  0.1558  -0.0479 93  CYS D CA  
1848 C C   . CYS D 69 ? 0.9623 0.9774 1.1058 0.1251  0.1475  -0.0340 93  CYS D C   
1849 O O   . CYS D 69 ? 0.9766 0.9848 1.1291 0.1405  0.1464  -0.0274 93  CYS D O   
1850 C CB  . CYS D 69 ? 1.0030 0.9503 1.0684 0.1009  0.1410  -0.0529 93  CYS D CB  
1851 S SG  . CYS D 69 ? 0.9776 0.9537 1.0572 0.0851  0.1140  -0.0466 93  CYS D SG  
1852 N N   . ARG D 70 ? 0.9119 0.9678 1.0834 0.1166  0.1412  -0.0287 94  ARG D N   
1853 C CA  . ARG D 70 ? 0.8782 0.9772 1.0928 0.1217  0.1304  -0.0161 94  ARG D CA  
1854 C C   . ARG D 70 ? 0.8614 0.9524 1.0716 0.1222  0.1116  -0.0115 94  ARG D C   
1855 O O   . ARG D 70 ? 0.8651 0.9788 1.1026 0.1352  0.1059  0.0001  94  ARG D O   
1856 C CB  . ARG D 70 ? 0.8541 0.9868 1.0863 0.1029  0.1216  -0.0144 94  ARG D CB  
1857 N N   . PHE D 71 ? 0.8908 0.9532 1.0674 0.1079  0.1015  -0.0192 95  PHE D N   
1858 C CA  . PHE D 71 ? 0.8685 0.9200 1.0363 0.1068  0.0850  -0.0152 95  PHE D CA  
1859 C C   . PHE D 71 ? 0.9206 0.9387 1.0748 0.1240  0.0928  -0.0128 95  PHE D C   
1860 O O   . PHE D 71 ? 0.9243 0.9505 1.0929 0.1351  0.0845  -0.0013 95  PHE D O   
1861 C CB  . PHE D 71 ? 0.8229 0.8567 0.9609 0.0871  0.0734  -0.0230 95  PHE D CB  
1862 C CG  . PHE D 71 ? 0.7298 0.7587 0.8615 0.0843  0.0570  -0.0180 95  PHE D CG  
1863 C CD1 . PHE D 71 ? 0.6182 0.6790 0.7732 0.0825  0.0424  -0.0092 95  PHE D CD1 
1864 C CD2 . PHE D 71 ? 0.6741 0.6672 0.7751 0.0818  0.0566  -0.0219 95  PHE D CD2 
1865 C CE1 . PHE D 71 ? 0.5437 0.5996 0.6893 0.0796  0.0277  -0.0041 95  PHE D CE1 
1866 C CE2 . PHE D 71 ? 0.6120 0.6003 0.7061 0.0789  0.0430  -0.0160 95  PHE D CE2 
1867 C CZ  . PHE D 71 ? 0.5597 0.5790 0.6753 0.0788  0.0289  -0.0070 95  PHE D CZ  
1868 N N   . VAL D 72 ? 0.8813 0.8593 1.0041 0.1247  0.1084  -0.0234 96  VAL D N   
1869 C CA  . VAL D 72 ? 0.9564 0.8900 1.0566 0.1370  0.1179  -0.0240 96  VAL D CA  
1870 C C   . VAL D 72 ? 1.0041 0.9476 1.1337 0.1656  0.1281  -0.0111 96  VAL D C   
1871 O O   . VAL D 72 ? 1.0335 0.9481 1.1536 0.1791  0.1300  -0.0046 96  VAL D O   
1872 C CB  . VAL D 72 ? 0.9888 0.8765 1.0476 0.1309  0.1355  -0.0396 96  VAL D CB  
1873 C CG1 . VAL D 72 ? 1.0050 0.8999 1.0735 0.1426  0.1567  -0.0432 96  VAL D CG1 
1874 C CG2 . VAL D 72 ? 1.0441 0.8789 1.0739 0.1386  0.1437  -0.0413 96  VAL D CG2 
1875 N N   . GLN D 73 ? 1.1720 1.1581 1.3381 0.1744  0.1350  -0.0061 97  GLN D N   
1876 C CA  . GLN D 73 ? 1.2155 1.2269 1.4197 0.2031  0.1461  0.0081  97  GLN D CA  
1877 C C   . GLN D 73 ? 1.2370 1.2571 1.4563 0.2160  0.1305  0.0251  97  GLN D C   
1878 O O   . GLN D 73 ? 1.2806 1.2965 1.5154 0.2452  0.1425  0.0373  97  GLN D O   
1879 C CB  . GLN D 73 ? 1.1882 1.2612 1.4366 0.2021  0.1472  0.0136  97  GLN D CB  
1880 C CG  . GLN D 73 ? 1.2429 1.3212 1.5070 0.2229  0.1763  0.0133  97  GLN D CG  
1881 C CD  . GLN D 73 ? 1.2782 1.3231 1.5052 0.2093  0.1940  -0.0055 97  GLN D CD  
1882 O OE1 . GLN D 73 ? 1.2438 1.3190 1.4859 0.2007  0.2010  -0.0078 97  GLN D OE1 
1883 N NE2 . GLN D 73 ? 1.3033 1.2860 1.4800 0.2056  0.2007  -0.0184 97  GLN D NE2 
1884 N N   . SER D 74 ? 1.0891 1.1189 1.3014 0.1961  0.1057  0.0265  98  SER D N   
1885 C CA  . SER D 74 ? 1.1014 1.1302 1.3161 0.2050  0.0907  0.0414  98  SER D CA  
1886 C C   . SER D 74 ? 1.1332 1.0970 1.3021 0.2037  0.0937  0.0368  98  SER D C   
1887 O O   . SER D 74 ? 1.1220 1.0608 1.2582 0.1798  0.0881  0.0235  98  SER D O   
1888 C CB  . SER D 74 ? 1.0597 1.1338 1.2909 0.1866  0.0641  0.0472  98  SER D CB  
1889 O OG  . SER D 74 ? 1.0873 1.1640 1.3223 0.1989  0.0515  0.0641  98  SER D OG  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  SER 1  266 ?   ?   ?   A . n 
A 1 2  GLU 2  267 267 GLU GLU A . n 
A 1 3  LEU 3  268 268 LEU LEU A . n 
A 1 4  LEU 4  269 269 LEU LEU A . n 
A 1 5  GLN 5  270 270 GLN GLN A . n 
A 1 6  ARG 6  271 271 ARG ARG A . n 
A 1 7  CYS 7  272 272 CYS CYS A . n 
A 1 8  GLU 8  273 273 GLU GLU A . n 
A 1 9  SER 9  274 274 SER SER A . n 
A 1 10 LEU 10 275 275 LEU LEU A . n 
A 1 11 GLU 11 276 276 GLU GLU A . n 
A 1 12 LYS 12 277 277 LYS LYS A . n 
A 1 13 LYS 13 278 278 LYS LYS A . n 
A 1 14 THR 14 279 279 THR THR A . n 
A 1 15 ALA 15 280 280 ALA ALA A . n 
A 1 16 THR 16 281 281 THR THR A . n 
A 1 17 PHE 17 282 282 PHE PHE A . n 
A 1 18 GLU 18 283 283 GLU GLU A . n 
A 1 19 ASN 19 284 284 ASN ASN A . n 
A 1 20 ILE 20 285 285 ILE ILE A . n 
A 1 21 VAL 21 286 286 VAL VAL A . n 
A 1 22 CYS 22 287 287 CYS CYS A . n 
A 1 23 VAL 23 288 288 VAL VAL A . n 
A 1 24 LEU 24 289 289 LEU LEU A . n 
A 1 25 ASN 25 290 290 ASN ASN A . n 
A 1 26 ARG 26 291 291 ARG ARG A . n 
A 1 27 GLU 27 292 292 GLU GLU A . n 
A 1 28 VAL 28 293 293 VAL VAL A . n 
A 1 29 GLU 29 294 294 GLU GLU A . n 
A 1 30 ARG 30 295 295 ARG ARG A . n 
A 1 31 VAL 31 296 296 VAL VAL A . n 
A 1 32 ALA 32 297 297 ALA ALA A . n 
A 1 33 MET 33 298 298 MET MET A . n 
A 1 34 THR 34 299 299 THR THR A . n 
A 1 35 ALA 35 300 300 ALA ALA A . n 
A 1 36 GLU 36 301 301 GLU GLU A . n 
A 1 37 ALA 37 302 302 ALA ALA A . n 
A 1 38 CYS 38 303 303 CYS CYS A . n 
A 1 39 SER 39 304 304 SER SER A . n 
A 1 40 ARG 40 305 305 ARG ARG A . n 
A 1 41 GLN 41 306 306 GLN GLN A . n 
A 1 42 HIS 42 307 307 HIS HIS A . n 
A 1 43 ARG 43 308 308 ARG ARG A . n 
A 1 44 LEU 44 309 309 LEU LEU A . n 
A 1 45 ASP 45 310 310 ASP ASP A . n 
A 1 46 GLN 46 311 311 GLN GLN A . n 
A 1 47 ASP 47 312 312 ASP ASP A . n 
A 1 48 LYS 48 313 313 LYS LYS A . n 
A 1 49 ILE 49 314 314 ILE ILE A . n 
A 1 50 GLU 50 315 315 GLU GLU A . n 
A 1 51 ALA 51 316 316 ALA ALA A . n 
A 1 52 LEU 52 317 317 LEU LEU A . n 
A 1 53 SER 53 318 318 SER SER A . n 
A 1 54 SER 54 319 319 SER SER A . n 
A 1 55 LYS 55 320 320 LYS LYS A . n 
A 1 56 VAL 56 321 321 VAL VAL A . n 
A 1 57 GLN 57 322 322 GLN GLN A . n 
A 1 58 GLN 58 323 323 GLN GLN A . n 
A 1 59 LEU 59 324 324 LEU LEU A . n 
A 1 60 GLU 60 325 325 GLU GLU A . n 
A 1 61 ARG 61 326 326 ARG ARG A . n 
A 1 62 SER 62 327 327 SER SER A . n 
A 1 63 ILE 63 328 328 ILE ILE A . n 
A 1 64 GLY 64 329 ?   ?   ?   A . n 
A 1 65 LEU 65 330 ?   ?   ?   A . n 
A 1 66 GLU 66 331 ?   ?   ?   A . n 
B 1 1  SER 1  266 ?   ?   ?   B . n 
B 1 2  GLU 2  267 267 GLU GLU B . n 
B 1 3  LEU 3  268 268 LEU LEU B . n 
B 1 4  LEU 4  269 269 LEU LEU B . n 
B 1 5  GLN 5  270 270 GLN GLN B . n 
B 1 6  ARG 6  271 271 ARG ARG B . n 
B 1 7  CYS 7  272 272 CYS CYS B . n 
B 1 8  GLU 8  273 273 GLU GLU B . n 
B 1 9  SER 9  274 274 SER SER B . n 
B 1 10 LEU 10 275 275 LEU LEU B . n 
B 1 11 GLU 11 276 276 GLU GLU B . n 
B 1 12 LYS 12 277 277 LYS LYS B . n 
B 1 13 LYS 13 278 278 LYS LYS B . n 
B 1 14 THR 14 279 279 THR THR B . n 
B 1 15 ALA 15 280 280 ALA ALA B . n 
B 1 16 THR 16 281 281 THR THR B . n 
B 1 17 PHE 17 282 282 PHE PHE B . n 
B 1 18 GLU 18 283 283 GLU GLU B . n 
B 1 19 ASN 19 284 284 ASN ASN B . n 
B 1 20 ILE 20 285 285 ILE ILE B . n 
B 1 21 VAL 21 286 286 VAL VAL B . n 
B 1 22 CYS 22 287 287 CYS CYS B . n 
B 1 23 VAL 23 288 288 VAL VAL B . n 
B 1 24 LEU 24 289 289 LEU LEU B . n 
B 1 25 ASN 25 290 290 ASN ASN B . n 
B 1 26 ARG 26 291 291 ARG ARG B . n 
B 1 27 GLU 27 292 292 GLU GLU B . n 
B 1 28 VAL 28 293 293 VAL VAL B . n 
B 1 29 GLU 29 294 294 GLU GLU B . n 
B 1 30 ARG 30 295 295 ARG ARG B . n 
B 1 31 VAL 31 296 296 VAL VAL B . n 
B 1 32 ALA 32 297 297 ALA ALA B . n 
B 1 33 MET 33 298 298 MET MET B . n 
B 1 34 THR 34 299 299 THR THR B . n 
B 1 35 ALA 35 300 300 ALA ALA B . n 
B 1 36 GLU 36 301 301 GLU GLU B . n 
B 1 37 ALA 37 302 302 ALA ALA B . n 
B 1 38 CYS 38 303 303 CYS CYS B . n 
B 1 39 SER 39 304 304 SER SER B . n 
B 1 40 ARG 40 305 305 ARG ARG B . n 
B 1 41 GLN 41 306 306 GLN GLN B . n 
B 1 42 HIS 42 307 307 HIS HIS B . n 
B 1 43 ARG 43 308 308 ARG ARG B . n 
B 1 44 LEU 44 309 309 LEU LEU B . n 
B 1 45 ASP 45 310 310 ASP ASP B . n 
B 1 46 GLN 46 311 311 GLN GLN B . n 
B 1 47 ASP 47 312 312 ASP ASP B . n 
B 1 48 LYS 48 313 313 LYS LYS B . n 
B 1 49 ILE 49 314 314 ILE ILE B . n 
B 1 50 GLU 50 315 315 GLU GLU B . n 
B 1 51 ALA 51 316 316 ALA ALA B . n 
B 1 52 LEU 52 317 317 LEU LEU B . n 
B 1 53 SER 53 318 318 SER SER B . n 
B 1 54 SER 54 319 319 SER SER B . n 
B 1 55 LYS 55 320 320 LYS LYS B . n 
B 1 56 VAL 56 321 321 VAL VAL B . n 
B 1 57 GLN 57 322 322 GLN GLN B . n 
B 1 58 GLN 58 323 323 GLN GLN B . n 
B 1 59 LEU 59 324 324 LEU LEU B . n 
B 1 60 GLU 60 325 325 GLU GLU B . n 
B 1 61 ARG 61 326 326 ARG ARG B . n 
B 1 62 SER 62 327 327 SER SER B . n 
B 1 63 ILE 63 328 328 ILE ILE B . n 
B 1 64 GLY 64 329 ?   ?   ?   B . n 
B 1 65 LEU 65 330 ?   ?   ?   B . n 
B 1 66 GLU 66 331 ?   ?   ?   B . n 
C 1 1  SER 1  266 ?   ?   ?   C . n 
C 1 2  GLU 2  267 267 GLU GLU C . n 
C 1 3  LEU 3  268 268 LEU LEU C . n 
C 1 4  LEU 4  269 269 LEU LEU C . n 
C 1 5  GLN 5  270 270 GLN GLN C . n 
C 1 6  ARG 6  271 271 ARG ARG C . n 
C 1 7  CYS 7  272 272 CYS CYS C . n 
C 1 8  GLU 8  273 273 GLU GLU C . n 
C 1 9  SER 9  274 274 SER SER C . n 
C 1 10 LEU 10 275 275 LEU LEU C . n 
C 1 11 GLU 11 276 276 GLU GLU C . n 
C 1 12 LYS 12 277 277 LYS LYS C . n 
C 1 13 LYS 13 278 278 LYS LYS C . n 
C 1 14 THR 14 279 279 THR THR C . n 
C 1 15 ALA 15 280 280 ALA ALA C . n 
C 1 16 THR 16 281 281 THR THR C . n 
C 1 17 PHE 17 282 282 PHE PHE C . n 
C 1 18 GLU 18 283 283 GLU GLU C . n 
C 1 19 ASN 19 284 284 ASN ASN C . n 
C 1 20 ILE 20 285 285 ILE ILE C . n 
C 1 21 VAL 21 286 286 VAL VAL C . n 
C 1 22 CYS 22 287 287 CYS CYS C . n 
C 1 23 VAL 23 288 288 VAL VAL C . n 
C 1 24 LEU 24 289 289 LEU LEU C . n 
C 1 25 ASN 25 290 290 ASN ASN C . n 
C 1 26 ARG 26 291 291 ARG ARG C . n 
C 1 27 GLU 27 292 292 GLU GLU C . n 
C 1 28 VAL 28 293 293 VAL VAL C . n 
C 1 29 GLU 29 294 294 GLU GLU C . n 
C 1 30 ARG 30 295 295 ARG ARG C . n 
C 1 31 VAL 31 296 296 VAL VAL C . n 
C 1 32 ALA 32 297 297 ALA ALA C . n 
C 1 33 MET 33 298 298 MET MET C . n 
C 1 34 THR 34 299 299 THR THR C . n 
C 1 35 ALA 35 300 300 ALA ALA C . n 
C 1 36 GLU 36 301 301 GLU GLU C . n 
C 1 37 ALA 37 302 302 ALA ALA C . n 
C 1 38 CYS 38 303 303 CYS CYS C . n 
C 1 39 SER 39 304 304 SER SER C . n 
C 1 40 ARG 40 305 305 ARG ARG C . n 
C 1 41 GLN 41 306 306 GLN GLN C . n 
C 1 42 HIS 42 307 307 HIS HIS C . n 
C 1 43 ARG 43 308 308 ARG ARG C . n 
C 1 44 LEU 44 309 309 LEU LEU C . n 
C 1 45 ASP 45 310 310 ASP ASP C . n 
C 1 46 GLN 46 311 311 GLN GLN C . n 
C 1 47 ASP 47 312 312 ASP ASP C . n 
C 1 48 LYS 48 313 313 LYS LYS C . n 
C 1 49 ILE 49 314 314 ILE ILE C . n 
C 1 50 GLU 50 315 315 GLU GLU C . n 
C 1 51 ALA 51 316 316 ALA ALA C . n 
C 1 52 LEU 52 317 317 LEU LEU C . n 
C 1 53 SER 53 318 318 SER SER C . n 
C 1 54 SER 54 319 319 SER SER C . n 
C 1 55 LYS 55 320 320 LYS LYS C . n 
C 1 56 VAL 56 321 321 VAL VAL C . n 
C 1 57 GLN 57 322 322 GLN GLN C . n 
C 1 58 GLN 58 323 323 GLN GLN C . n 
C 1 59 LEU 59 324 324 LEU LEU C . n 
C 1 60 GLU 60 325 325 GLU GLU C . n 
C 1 61 ARG 61 326 326 ARG ARG C . n 
C 1 62 SER 62 327 327 SER SER C . n 
C 1 63 ILE 63 328 328 ILE ILE C . n 
C 1 64 GLY 64 329 ?   ?   ?   C . n 
C 1 65 LEU 65 330 ?   ?   ?   C . n 
C 1 66 GLU 66 331 ?   ?   ?   C . n 
D 2 1  MET 1  25  25  MET MET D . n 
D 2 2  LEU 2  26  26  LEU LEU D . n 
D 2 3  SER 3  27  27  SER SER D . n 
D 2 4  CYS 4  28  28  CYS CYS D . n 
D 2 5  GLU 5  29  29  GLU GLU D . n 
D 2 6  LEU 6  30  30  LEU LEU D . n 
D 2 7  TYR 7  31  31  TYR TYR D . n 
D 2 8  ARG 8  32  32  ARG ARG D . n 
D 2 9  MET 9  33  33  MET MET D . n 
D 2 10 SER 10 34  34  SER SER D . n 
D 2 11 THR 11 35  35  THR THR D . n 
D 2 12 TYR 12 36  36  TYR TYR D . n 
D 2 13 SER 13 37  37  SER SER D . n 
D 2 14 THR 14 38  38  THR THR D . n 
D 2 15 PHE 15 39  39  PHE PHE D . n 
D 2 16 PRO 16 40  40  PRO PRO D . n 
D 2 17 ALA 17 41  41  ALA ALA D . n 
D 2 18 GLY 18 42  42  GLY GLY D . n 
D 2 19 VAL 19 43  43  VAL VAL D . n 
D 2 20 PRO 20 44  44  PRO PRO D . n 
D 2 21 VAL 21 45  45  VAL VAL D . n 
D 2 22 SER 22 46  46  SER SER D . n 
D 2 23 GLU 23 47  47  GLU GLU D . n 
D 2 24 ARG 24 48  48  ARG ARG D . n 
D 2 25 SER 25 49  49  SER SER D . n 
D 2 26 LEU 26 50  50  LEU LEU D . n 
D 2 27 ALA 27 51  51  ALA ALA D . n 
D 2 28 ARG 28 52  52  ARG ARG D . n 
D 2 29 ALA 29 53  53  ALA ALA D . n 
D 2 30 GLY 30 54  54  GLY GLY D . n 
D 2 31 PHE 31 55  55  PHE PHE D . n 
D 2 32 TYR 32 56  56  TYR TYR D . n 
D 2 33 TYR 33 57  57  TYR TYR D . n 
D 2 34 THR 34 58  58  THR THR D . n 
D 2 35 GLY 35 59  59  GLY GLY D . n 
D 2 36 VAL 36 60  60  VAL VAL D . n 
D 2 37 ASN 37 61  61  ASN ASN D . n 
D 2 38 ASP 38 62  62  ASP ASP D . n 
D 2 39 LYS 39 63  63  LYS LYS D . n 
D 2 40 VAL 40 64  64  VAL VAL D . n 
D 2 41 LYS 41 65  65  LYS LYS D . n 
D 2 42 CYS 42 66  66  CYS CYS D . n 
D 2 43 PHE 43 67  67  PHE PHE D . n 
D 2 44 CYS 44 68  68  CYS CYS D . n 
D 2 45 CYS 45 69  69  CYS CYS D . n 
D 2 46 GLY 46 70  70  GLY GLY D . n 
D 2 47 LEU 47 71  71  LEU LEU D . n 
D 2 48 MET 48 72  72  MET MET D . n 
D 2 49 LEU 49 73  73  LEU LEU D . n 
D 2 50 ASP 50 74  74  ASP ASP D . n 
D 2 51 ASN 51 75  75  ASN ASN D . n 
D 2 52 TRP 52 76  76  TRP TRP D . n 
D 2 53 LYS 53 77  77  LYS LYS D . n 
D 2 54 ARG 54 78  78  ARG ARG D . n 
D 2 55 GLY 55 79  79  GLY GLY D . n 
D 2 56 ASP 56 80  80  ASP ASP D . n 
D 2 57 SER 57 81  81  SER SER D . n 
D 2 58 PRO 58 82  82  PRO PRO D . n 
D 2 59 THR 59 83  83  THR THR D . n 
D 2 60 GLU 60 84  84  GLU GLU D . n 
D 2 61 LYS 61 85  85  LYS LYS D . n 
D 2 62 HIS 62 86  86  HIS HIS D . n 
D 2 63 LYS 63 87  87  LYS LYS D . n 
D 2 64 LYS 64 88  88  LYS LYS D . n 
D 2 65 LEU 65 89  89  LEU LEU D . n 
D 2 66 TYR 66 90  90  TYR TYR D . n 
D 2 67 PRO 67 91  91  PRO PRO D . n 
D 2 68 SER 68 92  92  SER SER D . n 
D 2 69 CYS 69 93  93  CYS CYS D . n 
D 2 70 ARG 70 94  94  ARG ARG D . n 
D 2 71 PHE 71 95  95  PHE PHE D . n 
D 2 72 VAL 72 96  96  VAL VAL D . n 
D 2 73 GLN 73 97  97  GLN GLN D . n 
D 2 74 SER 74 98  98  SER SER D . n 
D 2 75 LEU 75 99  ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 ZN  1  401 401 ZN  ZN  D . 
F 4 HOH 1  2   2   HOH HOH A . 
F 4 HOH 2  6   6   HOH HOH A . 
F 4 HOH 3  7   7   HOH HOH A . 
F 4 HOH 4  8   8   HOH HOH A . 
F 4 HOH 5  19  19  HOH HOH A . 
F 4 HOH 6  29  29  HOH HOH A . 
F 4 HOH 7  32  32  HOH HOH A . 
G 4 HOH 1  12  12  HOH HOH B . 
G 4 HOH 2  15  15  HOH HOH B . 
G 4 HOH 3  16  16  HOH HOH B . 
G 4 HOH 4  18  18  HOH HOH B . 
G 4 HOH 5  20  20  HOH HOH B . 
G 4 HOH 6  27  27  HOH HOH B . 
G 4 HOH 7  28  28  HOH HOH B . 
G 4 HOH 8  31  31  HOH HOH B . 
H 4 HOH 1  4   4   HOH HOH C . 
H 4 HOH 2  9   9   HOH HOH C . 
H 4 HOH 3  11  11  HOH HOH C . 
H 4 HOH 4  14  14  HOH HOH C . 
H 4 HOH 5  22  22  HOH HOH C . 
H 4 HOH 6  30  30  HOH HOH C . 
H 4 HOH 7  34  34  HOH HOH C . 
I 4 HOH 1  1   1   HOH HOH D . 
I 4 HOH 2  3   3   HOH HOH D . 
I 4 HOH 3  5   5   HOH HOH D . 
I 4 HOH 4  10  10  HOH HOH D . 
I 4 HOH 5  13  13  HOH HOH D . 
I 4 HOH 6  17  17  HOH HOH D . 
I 4 HOH 7  21  21  HOH HOH D . 
I 4 HOH 8  23  23  HOH HOH D . 
I 4 HOH 9  24  24  HOH HOH D . 
I 4 HOH 10 100 25  HOH HOH D . 
I 4 HOH 11 101 26  HOH HOH D . 
I 4 HOH 12 102 33  HOH HOH D . 
I 4 HOH 13 103 35  HOH HOH D . 
I 4 HOH 14 104 36  HOH HOH D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7690  ? 
1 MORE         -88   ? 
1 'SSA (A^2)'  13730 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG  ? D CYS 42 ? D CYS 66 ? 1_555 ZN ? E ZN . ? D ZN 401 ? 1_555 NE2 ? D HIS 62 ? D HIS 86 ? 1_555 101.7 ? 
2 SG  ? D CYS 42 ? D CYS 66 ? 1_555 ZN ? E ZN . ? D ZN 401 ? 1_555 SG  ? D CYS 45 ? D CYS 69 ? 1_555 99.2  ? 
3 NE2 ? D HIS 62 ? D HIS 86 ? 1_555 ZN ? E ZN . ? D ZN 401 ? 1_555 SG  ? D CYS 45 ? D CYS 69 ? 1_555 105.0 ? 
4 SG  ? D CYS 42 ? D CYS 66 ? 1_555 ZN ? E ZN . ? D ZN 401 ? 1_555 SG  ? D CYS 69 ? D CYS 93 ? 1_555 118.4 ? 
5 NE2 ? D HIS 62 ? D HIS 86 ? 1_555 ZN ? E ZN . ? D ZN 401 ? 1_555 SG  ? D CYS 69 ? D CYS 93 ? 1_555 121.7 ? 
6 SG  ? D CYS 45 ? D CYS 69 ? 1_555 ZN ? E ZN . ? D ZN 401 ? 1_555 SG  ? D CYS 69 ? D CYS 93 ? 1_555 108.0 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-04-28 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2015-07-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 26.1772 -0.5856 72.7212 0.7974 0.4074 0.6700 -0.0781 -0.0654 0.0844  0.2082 2.0399 0.4717 0.9457  0.0795  0.6788  
-0.0748 0.3323 -0.0000 -0.1434 0.0429  0.0086  0.3893  -0.0228 -0.2601 'X-RAY DIFFRACTION' 
2 ? refined 29.3830 -0.9014 68.8999 0.7681 0.3829 0.6400 0.0025  -0.0910 0.0196  0.2936 0.8732 0.6865 0.2495  0.3071  0.2967  
0.0344  0.0069 -0.0000 0.0179  -0.0211 -0.0201 0.6164  0.0721  0.1433  'X-RAY DIFFRACTION' 
3 ? refined 24.1122 -0.7409 68.1228 0.7183 0.3896 0.5504 -0.0410 -0.0343 -0.0303 0.2589 1.9310 0.6871 -1.1566 -0.0839 -0.4605 
-0.2023 0.4239 0.0022  0.1870  -0.0376 0.9205  -0.0740 0.1264  -0.0700 'X-RAY DIFFRACTION' 
4 ? refined 32.1626 8.8609  50.0993 0.5763 0.4935 0.5232 -0.0122 0.0325  -0.0533 2.1381 2.3286 4.1531 0.6026  -1.1326 -0.8355 
-0.1061 0.0046 0.0000  0.0931  -0.3008 -0.3090 -0.2036 0.6955  -0.1376 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
1 1 . . . . ? 'X-RAY DIFFRACTION' A 267 A 328 ? 
2 2 . . . . ? 'X-RAY DIFFRACTION' B 267 B 328 ? 
3 3 . . . . ? 'X-RAY DIFFRACTION' C 267 C 328 ? 
4 4 . . . . ? 'X-RAY DIFFRACTION' D 25  D 99  ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.5.0072 ? 1 
HKL-2000  'data reduction' .        ? 2 
SCALEPACK 'data scaling'   .        ? 3 
SOLVE     phasing          .        ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A LEU 289 ? ? CG A LEU 289 ? ? CD1 A LEU 289 ? ? 100.48 111.00 -10.52 1.70 N 
2 1 CA B CYS 303 ? ? CB B CYS 303 ? ? SG  B CYS 303 ? ? 120.93 114.20 6.73   1.10 N 
3 1 NE D ARG 32  ? ? CZ D ARG 32  ? ? NH2 D ARG 32  ? ? 123.48 120.30 3.18   0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP C 310 ? ? -39.63  -25.74  
2 1 LEU C 317 ? ? -57.23  -70.34  
3 1 ASN D 61  ? ? 51.13   -126.04 
4 1 TYR D 90  ? ? -171.71 77.09   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLU 283 ? CG  ? A GLU 18 CG  
2   1 Y 1 A GLU 283 ? CD  ? A GLU 18 CD  
3   1 Y 1 A GLU 283 ? OE1 ? A GLU 18 OE1 
4   1 Y 1 A GLU 283 ? OE2 ? A GLU 18 OE2 
5   1 Y 1 A MET 298 ? CG  ? A MET 33 CG  
6   1 Y 1 A MET 298 ? SD  ? A MET 33 SD  
7   1 Y 1 A MET 298 ? CE  ? A MET 33 CE  
8   1 Y 1 A GLU 301 ? CG  ? A GLU 36 CG  
9   1 Y 1 A GLU 301 ? CD  ? A GLU 36 CD  
10  1 Y 1 A GLU 301 ? OE1 ? A GLU 36 OE1 
11  1 Y 1 A GLU 301 ? OE2 ? A GLU 36 OE2 
12  1 Y 1 A ARG 305 ? CG  ? A ARG 40 CG  
13  1 Y 1 A ARG 305 ? CD  ? A ARG 40 CD  
14  1 Y 1 A ARG 305 ? NE  ? A ARG 40 NE  
15  1 Y 1 A ARG 305 ? CZ  ? A ARG 40 CZ  
16  1 Y 1 A ARG 305 ? NH1 ? A ARG 40 NH1 
17  1 Y 1 A ARG 305 ? NH2 ? A ARG 40 NH2 
18  1 Y 1 A ARG 308 ? CG  ? A ARG 43 CG  
19  1 Y 1 A ARG 308 ? CD  ? A ARG 43 CD  
20  1 Y 1 A ARG 308 ? NE  ? A ARG 43 NE  
21  1 Y 1 A ARG 308 ? CZ  ? A ARG 43 CZ  
22  1 Y 1 A ARG 308 ? NH1 ? A ARG 43 NH1 
23  1 Y 1 A ARG 308 ? NH2 ? A ARG 43 NH2 
24  1 Y 1 A GLN 311 ? CG  ? A GLN 46 CG  
25  1 Y 1 A GLN 311 ? CD  ? A GLN 46 CD  
26  1 Y 1 A GLN 311 ? OE1 ? A GLN 46 OE1 
27  1 Y 1 A GLN 311 ? NE2 ? A GLN 46 NE2 
28  1 Y 1 A ASP 312 ? CG  ? A ASP 47 CG  
29  1 Y 1 A ASP 312 ? OD1 ? A ASP 47 OD1 
30  1 Y 1 A ASP 312 ? OD2 ? A ASP 47 OD2 
31  1 Y 1 A LYS 313 ? CG  ? A LYS 48 CG  
32  1 Y 1 A LYS 313 ? CD  ? A LYS 48 CD  
33  1 Y 1 A LYS 313 ? CE  ? A LYS 48 CE  
34  1 Y 1 A LYS 313 ? NZ  ? A LYS 48 NZ  
35  1 Y 1 A GLU 315 ? CG  ? A GLU 50 CG  
36  1 Y 1 A GLU 315 ? CD  ? A GLU 50 CD  
37  1 Y 1 A GLU 315 ? OE1 ? A GLU 50 OE1 
38  1 Y 1 A GLU 315 ? OE2 ? A GLU 50 OE2 
39  1 Y 1 A GLU 325 ? CG  ? A GLU 60 CG  
40  1 Y 1 A GLU 325 ? CD  ? A GLU 60 CD  
41  1 Y 1 A GLU 325 ? OE1 ? A GLU 60 OE1 
42  1 Y 1 A GLU 325 ? OE2 ? A GLU 60 OE2 
43  1 Y 1 B GLN 270 ? CG  ? B GLN 5  CG  
44  1 Y 1 B GLN 270 ? CD  ? B GLN 5  CD  
45  1 Y 1 B GLN 270 ? OE1 ? B GLN 5  OE1 
46  1 Y 1 B GLN 270 ? NE2 ? B GLN 5  NE2 
47  1 Y 1 B GLU 273 ? CG  ? B GLU 8  CG  
48  1 Y 1 B GLU 273 ? CD  ? B GLU 8  CD  
49  1 Y 1 B GLU 273 ? OE1 ? B GLU 8  OE1 
50  1 Y 1 B GLU 273 ? OE2 ? B GLU 8  OE2 
51  1 Y 1 B LYS 277 ? CG  ? B LYS 12 CG  
52  1 Y 1 B LYS 277 ? CD  ? B LYS 12 CD  
53  1 Y 1 B LYS 277 ? CE  ? B LYS 12 CE  
54  1 Y 1 B LYS 277 ? NZ  ? B LYS 12 NZ  
55  1 Y 1 B LYS 278 ? CG  ? B LYS 13 CG  
56  1 Y 1 B LYS 278 ? CD  ? B LYS 13 CD  
57  1 Y 1 B LYS 278 ? CE  ? B LYS 13 CE  
58  1 Y 1 B LYS 278 ? NZ  ? B LYS 13 NZ  
59  1 Y 1 B GLU 283 ? CG  ? B GLU 18 CG  
60  1 Y 1 B GLU 283 ? CD  ? B GLU 18 CD  
61  1 Y 1 B GLU 283 ? OE1 ? B GLU 18 OE1 
62  1 Y 1 B GLU 283 ? OE2 ? B GLU 18 OE2 
63  1 Y 1 B ARG 295 ? CG  ? B ARG 30 CG  
64  1 Y 1 B ARG 295 ? CD  ? B ARG 30 CD  
65  1 Y 1 B ARG 295 ? NE  ? B ARG 30 NE  
66  1 Y 1 B ARG 295 ? CZ  ? B ARG 30 CZ  
67  1 Y 1 B ARG 295 ? NH1 ? B ARG 30 NH1 
68  1 Y 1 B ARG 295 ? NH2 ? B ARG 30 NH2 
69  1 Y 1 B ARG 308 ? CG  ? B ARG 43 CG  
70  1 Y 1 B ARG 308 ? CD  ? B ARG 43 CD  
71  1 Y 1 B ARG 308 ? NE  ? B ARG 43 NE  
72  1 Y 1 B ARG 308 ? CZ  ? B ARG 43 CZ  
73  1 Y 1 B ARG 308 ? NH1 ? B ARG 43 NH1 
74  1 Y 1 B ARG 308 ? NH2 ? B ARG 43 NH2 
75  1 Y 1 B GLN 311 ? CG  ? B GLN 46 CG  
76  1 Y 1 B GLN 311 ? CD  ? B GLN 46 CD  
77  1 Y 1 B GLN 311 ? OE1 ? B GLN 46 OE1 
78  1 Y 1 B GLN 311 ? NE2 ? B GLN 46 NE2 
79  1 Y 1 B LYS 313 ? CG  ? B LYS 48 CG  
80  1 Y 1 B LYS 313 ? CD  ? B LYS 48 CD  
81  1 Y 1 B LYS 313 ? CE  ? B LYS 48 CE  
82  1 Y 1 B LYS 313 ? NZ  ? B LYS 48 NZ  
83  1 Y 1 B GLU 315 ? CG  ? B GLU 50 CG  
84  1 Y 1 B GLU 315 ? CD  ? B GLU 50 CD  
85  1 Y 1 B GLU 315 ? OE1 ? B GLU 50 OE1 
86  1 Y 1 B GLU 315 ? OE2 ? B GLU 50 OE2 
87  1 Y 1 B GLN 322 ? CG  ? B GLN 57 CG  
88  1 Y 1 B GLN 322 ? CD  ? B GLN 57 CD  
89  1 Y 1 B GLN 322 ? OE1 ? B GLN 57 OE1 
90  1 Y 1 B GLN 322 ? NE2 ? B GLN 57 NE2 
91  1 Y 1 B GLN 323 ? CG  ? B GLN 58 CG  
92  1 Y 1 B GLN 323 ? CD  ? B GLN 58 CD  
93  1 Y 1 B GLN 323 ? OE1 ? B GLN 58 OE1 
94  1 Y 1 B GLN 323 ? NE2 ? B GLN 58 NE2 
95  1 Y 1 B ARG 326 ? CG  ? B ARG 61 CG  
96  1 Y 1 B ARG 326 ? CD  ? B ARG 61 CD  
97  1 Y 1 B ARG 326 ? NE  ? B ARG 61 NE  
98  1 Y 1 B ARG 326 ? CZ  ? B ARG 61 CZ  
99  1 Y 1 B ARG 326 ? NH1 ? B ARG 61 NH1 
100 1 Y 1 B ARG 326 ? NH2 ? B ARG 61 NH2 
101 1 Y 1 C LEU 269 ? CG  ? C LEU 4  CG  
102 1 Y 1 C LEU 269 ? CD1 ? C LEU 4  CD1 
103 1 Y 1 C LEU 269 ? CD2 ? C LEU 4  CD2 
104 1 Y 1 C GLN 270 ? CG  ? C GLN 5  CG  
105 1 Y 1 C GLN 270 ? CD  ? C GLN 5  CD  
106 1 Y 1 C GLN 270 ? OE1 ? C GLN 5  OE1 
107 1 Y 1 C GLN 270 ? NE2 ? C GLN 5  NE2 
108 1 Y 1 C GLU 273 ? CG  ? C GLU 8  CG  
109 1 Y 1 C GLU 273 ? CD  ? C GLU 8  CD  
110 1 Y 1 C GLU 273 ? OE1 ? C GLU 8  OE1 
111 1 Y 1 C GLU 273 ? OE2 ? C GLU 8  OE2 
112 1 Y 1 C LYS 278 ? CG  ? C LYS 13 CG  
113 1 Y 1 C LYS 278 ? CD  ? C LYS 13 CD  
114 1 Y 1 C LYS 278 ? CE  ? C LYS 13 CE  
115 1 Y 1 C LYS 278 ? NZ  ? C LYS 13 NZ  
116 1 Y 1 C GLU 283 ? CG  ? C GLU 18 CG  
117 1 Y 1 C GLU 283 ? CD  ? C GLU 18 CD  
118 1 Y 1 C GLU 283 ? OE1 ? C GLU 18 OE1 
119 1 Y 1 C GLU 283 ? OE2 ? C GLU 18 OE2 
120 1 Y 1 C GLU 301 ? CG  ? C GLU 36 CG  
121 1 Y 1 C GLU 301 ? CD  ? C GLU 36 CD  
122 1 Y 1 C GLU 301 ? OE1 ? C GLU 36 OE1 
123 1 Y 1 C GLU 301 ? OE2 ? C GLU 36 OE2 
124 1 Y 1 C GLN 306 ? CG  ? C GLN 41 CG  
125 1 Y 1 C GLN 306 ? CD  ? C GLN 41 CD  
126 1 Y 1 C GLN 306 ? OE1 ? C GLN 41 OE1 
127 1 Y 1 C GLN 306 ? NE2 ? C GLN 41 NE2 
128 1 Y 1 C ARG 308 ? CG  ? C ARG 43 CG  
129 1 Y 1 C ARG 308 ? CD  ? C ARG 43 CD  
130 1 Y 1 C ARG 308 ? NE  ? C ARG 43 NE  
131 1 Y 1 C ARG 308 ? CZ  ? C ARG 43 CZ  
132 1 Y 1 C ARG 308 ? NH1 ? C ARG 43 NH1 
133 1 Y 1 C ARG 308 ? NH2 ? C ARG 43 NH2 
134 1 Y 1 C LEU 309 ? CG  ? C LEU 44 CG  
135 1 Y 1 C LEU 309 ? CD1 ? C LEU 44 CD1 
136 1 Y 1 C LEU 309 ? CD2 ? C LEU 44 CD2 
137 1 Y 1 C GLN 311 ? CG  ? C GLN 46 CG  
138 1 Y 1 C GLN 311 ? CD  ? C GLN 46 CD  
139 1 Y 1 C GLN 311 ? OE1 ? C GLN 46 OE1 
140 1 Y 1 C GLN 311 ? NE2 ? C GLN 46 NE2 
141 1 Y 1 C ILE 314 ? CG1 ? C ILE 49 CG1 
142 1 Y 1 C ILE 314 ? CG2 ? C ILE 49 CG2 
143 1 Y 1 C ILE 314 ? CD1 ? C ILE 49 CD1 
144 1 Y 1 C GLU 315 ? CG  ? C GLU 50 CG  
145 1 Y 1 C GLU 315 ? CD  ? C GLU 50 CD  
146 1 Y 1 C GLU 315 ? OE1 ? C GLU 50 OE1 
147 1 Y 1 C GLU 315 ? OE2 ? C GLU 50 OE2 
148 1 Y 1 C GLN 322 ? CG  ? C GLN 57 CG  
149 1 Y 1 C GLN 322 ? CD  ? C GLN 57 CD  
150 1 Y 1 C GLN 322 ? OE1 ? C GLN 57 OE1 
151 1 Y 1 C GLN 322 ? NE2 ? C GLN 57 NE2 
152 1 Y 1 C GLN 323 ? CG  ? C GLN 58 CG  
153 1 Y 1 C GLN 323 ? CD  ? C GLN 58 CD  
154 1 Y 1 C GLN 323 ? OE1 ? C GLN 58 OE1 
155 1 Y 1 C GLN 323 ? NE2 ? C GLN 58 NE2 
156 1 Y 1 C GLU 325 ? CG  ? C GLU 60 CG  
157 1 Y 1 C GLU 325 ? CD  ? C GLU 60 CD  
158 1 Y 1 C GLU 325 ? OE1 ? C GLU 60 OE1 
159 1 Y 1 C GLU 325 ? OE2 ? C GLU 60 OE2 
160 1 Y 1 C ARG 326 ? CG  ? C ARG 61 CG  
161 1 Y 1 C ARG 326 ? CD  ? C ARG 61 CD  
162 1 Y 1 C ARG 326 ? NE  ? C ARG 61 NE  
163 1 Y 1 C ARG 326 ? CZ  ? C ARG 61 CZ  
164 1 Y 1 C ARG 326 ? NH1 ? C ARG 61 NH1 
165 1 Y 1 C ARG 326 ? NH2 ? C ARG 61 NH2 
166 1 Y 1 D MET 25  ? CG  ? D MET 1  CG  
167 1 Y 1 D MET 25  ? SD  ? D MET 1  SD  
168 1 Y 1 D MET 25  ? CE  ? D MET 1  CE  
169 1 Y 1 D VAL 60  ? CG1 ? D VAL 36 CG1 
170 1 Y 1 D VAL 60  ? CG2 ? D VAL 36 CG2 
171 1 Y 1 D LYS 77  ? CG  ? D LYS 53 CG  
172 1 Y 1 D LYS 77  ? CD  ? D LYS 53 CD  
173 1 Y 1 D LYS 77  ? CE  ? D LYS 53 CE  
174 1 Y 1 D LYS 77  ? NZ  ? D LYS 53 NZ  
175 1 Y 1 D ARG 78  ? CG  ? D ARG 54 CG  
176 1 Y 1 D ARG 78  ? CD  ? D ARG 54 CD  
177 1 Y 1 D ARG 78  ? NE  ? D ARG 54 NE  
178 1 Y 1 D ARG 78  ? CZ  ? D ARG 54 CZ  
179 1 Y 1 D ARG 78  ? NH1 ? D ARG 54 NH1 
180 1 Y 1 D ARG 78  ? NH2 ? D ARG 54 NH2 
181 1 Y 1 D GLU 84  ? CG  ? D GLU 60 CG  
182 1 Y 1 D GLU 84  ? CD  ? D GLU 60 CD  
183 1 Y 1 D GLU 84  ? OE1 ? D GLU 60 OE1 
184 1 Y 1 D GLU 84  ? OE2 ? D GLU 60 OE2 
185 1 Y 1 D LYS 87  ? CG  ? D LYS 63 CG  
186 1 Y 1 D LYS 87  ? CD  ? D LYS 63 CD  
187 1 Y 1 D LYS 87  ? CE  ? D LYS 63 CE  
188 1 Y 1 D LYS 87  ? NZ  ? D LYS 63 NZ  
189 1 Y 1 D ARG 94  ? CG  ? D ARG 70 CG  
190 1 Y 1 D ARG 94  ? CD  ? D ARG 70 CD  
191 1 Y 1 D ARG 94  ? NE  ? D ARG 70 NE  
192 1 Y 1 D ARG 94  ? CZ  ? D ARG 70 CZ  
193 1 Y 1 D ARG 94  ? NH1 ? D ARG 70 NH1 
194 1 Y 1 D ARG 94  ? NH2 ? D ARG 70 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 266 ? A SER 1  
2  1 Y 1 A GLY 329 ? A GLY 64 
3  1 Y 1 A LEU 330 ? A LEU 65 
4  1 Y 1 A GLU 331 ? A GLU 66 
5  1 Y 1 B SER 266 ? B SER 1  
6  1 Y 1 B GLY 329 ? B GLY 64 
7  1 Y 1 B LEU 330 ? B LEU 65 
8  1 Y 1 B GLU 331 ? B GLU 66 
9  1 Y 1 C SER 266 ? C SER 1  
10 1 Y 1 C GLY 329 ? C GLY 64 
11 1 Y 1 C LEU 330 ? C LEU 65 
12 1 Y 1 C GLU 331 ? C GLU 66 
13 1 Y 1 D LEU 99  ? D LEU 75 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'ZINC ION' ZN  
4 water      HOH 
#