data_3M9M
# 
_entry.id   3M9M 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3M9M         
NDB   NA0498       
RCSB  RCSB058281   
WWPDB D_1000058281 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3M9N . unspecified 
PDB 3M9O . unspecified 
# 
_pdbx_database_status.entry_id                        3M9M 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-03-22 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wong, J.H.Y.' 1 
'Ling, H.'     2 
# 
_citation.id                        primary 
_citation.title                     
'Structural insight into dynamic bypass of the major cisplatin-DNA adduct by Y-family polymerase Dpo4.' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            29 
_citation.page_first                2059 
_citation.page_last                 2069 
_citation.year                      2010 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20512114 
_citation.pdbx_database_id_DOI      10.1038/emboj.2010.101 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wong, J.H.'  1 
primary 'Brown, J.A.' 2 
primary 'Suo, Z.'     3 
primary 'Blum, P.'    4 
primary 'Nohmi, T.'   5 
primary 'Ling, H.'    6 
# 
_cell.entry_id           3M9M 
_cell.length_a           98.576 
_cell.length_b           101.193 
_cell.length_c           52.418 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3M9M 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase IV'                                                    40257.879 1  2.7.7.7 ? ? ? 
2 polymer     syn 
;DNA (5'-D(*GP*GP*GP*GP*GP*AP*AP*GP*GP*AP*AP*AP*G)-3')
;
4154.722  1  ?       ? ? ? 
3 polymer     syn 
;DNA (5'-D(*TP*CP*TP*GP*GP*CP*TP*TP*TP*CP*CP*TP*TP*CP*CP*CP*CP*C)-3')
;
5345.439  1  ?       ? ? ? 
4 non-polymer syn "CYTIDINE-5'-TRIPHOSPHATE"                                             483.156   1  ?       ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                                          40.078    4  ?       ? ? ? 
6 non-polymer syn GLYCEROL                                                               92.094    3  ?       ? ? ? 
7 non-polymer syn Cisplatin                                                              300.045   1  ?       ? ? ? 
8 water       nat water                                                                  18.015    51 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pol IV' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
;MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
B ? 
2 polydeoxyribonucleotide no no '(DG)(DG)(DG)(DG)(DG)(DA)(DA)(DG)(DG)(DA)(DA)(DA)(DG)' GGGGGAAGGAAAG P ? 
3 polydeoxyribonucleotide no no '(DT)(DC)(DT)(DG)(DG)(DC)(DT)(DT)(DT)(DC)(DC)(DT)(DT)(DC)(DC)(DC)(DC)(DC)' TCTGGCTTTCCTTCCCCC T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ILE n 
1 3   VAL n 
1 4   LEU n 
1 5   PHE n 
1 6   VAL n 
1 7   ASP n 
1 8   PHE n 
1 9   ASP n 
1 10  TYR n 
1 11  PHE n 
1 12  TYR n 
1 13  ALA n 
1 14  GLN n 
1 15  VAL n 
1 16  GLU n 
1 17  GLU n 
1 18  VAL n 
1 19  LEU n 
1 20  ASN n 
1 21  PRO n 
1 22  SER n 
1 23  LEU n 
1 24  LYS n 
1 25  GLY n 
1 26  LYS n 
1 27  PRO n 
1 28  VAL n 
1 29  VAL n 
1 30  VAL n 
1 31  CYS n 
1 32  VAL n 
1 33  PHE n 
1 34  SER n 
1 35  GLY n 
1 36  ARG n 
1 37  PHE n 
1 38  GLU n 
1 39  ASP n 
1 40  SER n 
1 41  GLY n 
1 42  ALA n 
1 43  VAL n 
1 44  ALA n 
1 45  THR n 
1 46  ALA n 
1 47  ASN n 
1 48  TYR n 
1 49  GLU n 
1 50  ALA n 
1 51  ARG n 
1 52  LYS n 
1 53  PHE n 
1 54  GLY n 
1 55  VAL n 
1 56  LYS n 
1 57  ALA n 
1 58  GLY n 
1 59  ILE n 
1 60  PRO n 
1 61  ILE n 
1 62  VAL n 
1 63  GLU n 
1 64  ALA n 
1 65  LYS n 
1 66  LYS n 
1 67  ILE n 
1 68  LEU n 
1 69  PRO n 
1 70  ASN n 
1 71  ALA n 
1 72  VAL n 
1 73  TYR n 
1 74  LEU n 
1 75  PRO n 
1 76  MET n 
1 77  ARG n 
1 78  LYS n 
1 79  GLU n 
1 80  VAL n 
1 81  TYR n 
1 82  GLN n 
1 83  GLN n 
1 84  VAL n 
1 85  SER n 
1 86  SER n 
1 87  ARG n 
1 88  ILE n 
1 89  MET n 
1 90  ASN n 
1 91  LEU n 
1 92  LEU n 
1 93  ARG n 
1 94  GLU n 
1 95  TYR n 
1 96  SER n 
1 97  GLU n 
1 98  LYS n 
1 99  ILE n 
1 100 GLU n 
1 101 ILE n 
1 102 ALA n 
1 103 SER n 
1 104 ILE n 
1 105 ASP n 
1 106 GLU n 
1 107 ALA n 
1 108 TYR n 
1 109 LEU n 
1 110 ASP n 
1 111 ILE n 
1 112 SER n 
1 113 ASP n 
1 114 LYS n 
1 115 VAL n 
1 116 ARG n 
1 117 ASP n 
1 118 TYR n 
1 119 ARG n 
1 120 GLU n 
1 121 ALA n 
1 122 TYR n 
1 123 ASN n 
1 124 LEU n 
1 125 GLY n 
1 126 LEU n 
1 127 GLU n 
1 128 ILE n 
1 129 LYS n 
1 130 ASN n 
1 131 LYS n 
1 132 ILE n 
1 133 LEU n 
1 134 GLU n 
1 135 LYS n 
1 136 GLU n 
1 137 LYS n 
1 138 ILE n 
1 139 THR n 
1 140 VAL n 
1 141 THR n 
1 142 VAL n 
1 143 GLY n 
1 144 ILE n 
1 145 SER n 
1 146 LYS n 
1 147 ASN n 
1 148 LYS n 
1 149 VAL n 
1 150 PHE n 
1 151 ALA n 
1 152 LYS n 
1 153 ILE n 
1 154 ALA n 
1 155 ALA n 
1 156 ASP n 
1 157 MET n 
1 158 ALA n 
1 159 LYS n 
1 160 PRO n 
1 161 ASN n 
1 162 GLY n 
1 163 ILE n 
1 164 LYS n 
1 165 VAL n 
1 166 ILE n 
1 167 ASP n 
1 168 ASP n 
1 169 GLU n 
1 170 GLU n 
1 171 VAL n 
1 172 LYS n 
1 173 ARG n 
1 174 LEU n 
1 175 ILE n 
1 176 ARG n 
1 177 GLU n 
1 178 LEU n 
1 179 ASP n 
1 180 ILE n 
1 181 ALA n 
1 182 ASP n 
1 183 VAL n 
1 184 PRO n 
1 185 GLY n 
1 186 ILE n 
1 187 GLY n 
1 188 ASN n 
1 189 ILE n 
1 190 THR n 
1 191 ALA n 
1 192 GLU n 
1 193 LYS n 
1 194 LEU n 
1 195 LYS n 
1 196 LYS n 
1 197 LEU n 
1 198 GLY n 
1 199 ILE n 
1 200 ASN n 
1 201 LYS n 
1 202 LEU n 
1 203 VAL n 
1 204 ASP n 
1 205 THR n 
1 206 LEU n 
1 207 SER n 
1 208 ILE n 
1 209 GLU n 
1 210 PHE n 
1 211 ASP n 
1 212 LYS n 
1 213 LEU n 
1 214 LYS n 
1 215 GLY n 
1 216 MET n 
1 217 ILE n 
1 218 GLY n 
1 219 GLU n 
1 220 ALA n 
1 221 LYS n 
1 222 ALA n 
1 223 LYS n 
1 224 TYR n 
1 225 LEU n 
1 226 ILE n 
1 227 SER n 
1 228 LEU n 
1 229 ALA n 
1 230 ARG n 
1 231 ASP n 
1 232 GLU n 
1 233 TYR n 
1 234 ASN n 
1 235 GLU n 
1 236 PRO n 
1 237 ILE n 
1 238 ARG n 
1 239 THR n 
1 240 ARG n 
1 241 VAL n 
1 242 ARG n 
1 243 LYS n 
1 244 SER n 
1 245 ILE n 
1 246 GLY n 
1 247 ARG n 
1 248 ILE n 
1 249 VAL n 
1 250 THR n 
1 251 MET n 
1 252 LYS n 
1 253 ARG n 
1 254 ASN n 
1 255 SER n 
1 256 ARG n 
1 257 ASN n 
1 258 LEU n 
1 259 GLU n 
1 260 GLU n 
1 261 ILE n 
1 262 LYS n 
1 263 PRO n 
1 264 TYR n 
1 265 LEU n 
1 266 PHE n 
1 267 ARG n 
1 268 ALA n 
1 269 ILE n 
1 270 GLU n 
1 271 GLU n 
1 272 SER n 
1 273 TYR n 
1 274 TYR n 
1 275 LYS n 
1 276 LEU n 
1 277 ASP n 
1 278 LYS n 
1 279 ARG n 
1 280 ILE n 
1 281 PRO n 
1 282 LYS n 
1 283 ALA n 
1 284 ILE n 
1 285 HIS n 
1 286 VAL n 
1 287 VAL n 
1 288 ALA n 
1 289 VAL n 
1 290 THR n 
1 291 GLU n 
1 292 ASP n 
1 293 LEU n 
1 294 ASP n 
1 295 ILE n 
1 296 VAL n 
1 297 SER n 
1 298 ARG n 
1 299 GLY n 
1 300 ARG n 
1 301 THR n 
1 302 PHE n 
1 303 PRO n 
1 304 HIS n 
1 305 GLY n 
1 306 ILE n 
1 307 SER n 
1 308 LYS n 
1 309 GLU n 
1 310 THR n 
1 311 ALA n 
1 312 TYR n 
1 313 SER n 
1 314 GLU n 
1 315 SER n 
1 316 VAL n 
1 317 LYS n 
1 318 LEU n 
1 319 LEU n 
1 320 GLN n 
1 321 LYS n 
1 322 ILE n 
1 323 LEU n 
1 324 GLU n 
1 325 GLU n 
1 326 ASP n 
1 327 GLU n 
1 328 ARG n 
1 329 LYS n 
1 330 ILE n 
1 331 ARG n 
1 332 ARG n 
1 333 ILE n 
1 334 GLY n 
1 335 VAL n 
1 336 ARG n 
1 337 PHE n 
1 338 SER n 
1 339 LYS n 
1 340 PHE n 
1 341 ILE n 
1 342 GLU n 
1 343 ALA n 
1 344 ILE n 
1 345 GLY n 
1 346 LEU n 
1 347 ASP n 
1 348 LYS n 
1 349 PHE n 
1 350 PHE n 
1 351 ASP n 
1 352 THR n 
2 1   DG  n 
2 2   DG  n 
2 3   DG  n 
2 4   DG  n 
2 5   DG  n 
2 6   DA  n 
2 7   DA  n 
2 8   DG  n 
2 9   DG  n 
2 10  DA  n 
2 11  DA  n 
2 12  DA  n 
2 13  DG  n 
3 1   DT  n 
3 2   DC  n 
3 3   DT  n 
3 4   DG  n 
3 5   DG  n 
3 6   DC  n 
3 7   DT  n 
3 8   DT  n 
3 9   DT  n 
3 10  DC  n 
3 11  DC  n 
3 12  DT  n 
3 13  DT  n 
3 14  DC  n 
3 15  DC  n 
3 16  DC  n 
3 17  DC  n 
3 18  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'dbh, dpo4, SSO2448' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    P2 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Sulfolobus solfataricus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2287 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? ? 'synthetic DNA oligo'                      
4 1 sample ? ? ? ? ? 'cisplatin modified guanine di-nucleotide' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPO42_SULSO Q97W02 1 
;MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
1 ? 
2 PDB 3M9M        3M9M   2 ? ? ? 
3 PDB 3M9M        3M9M   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3M9M B 1 ? 352 ? Q97W02 1 ? 352 ? 1 352 
2 2 3M9M P 1 ? 13  ? 3M9M   1 ? 13  ? 1 13  
3 3 3M9M T 1 ? 18  ? 3M9M   0 ? 17  ? 0 17  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'       133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                               'Ca 2'             40.078  
CPT non-polymer         . Cisplatin                            'diammine(dichloro)platinum'    'Cl2 H6 N2 Pt'     300.045 
CTP non-polymer         . "CYTIDINE-5'-TRIPHOSPHATE"           ?                               'C9 H16 N3 O14 P3' 483.156 
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'   307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'       75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'         92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'       119.119 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'      117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3M9M 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.63 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   53.18 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'hanging drop' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    
'0.2M calcium acetate, 5% glycerol, 15% PEG 3350, 200mM NaCl, pH 7.5, hanging drop, temperature 298K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC Q315' 
_diffrn_detector.pdbx_collection_date   2008-03-12 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Cryo-Cooled Si(111) double crystal' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0781 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.pdbx_wavelength_list        1.0781 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
# 
_reflns.entry_id                     3M9M 
_reflns.d_resolution_high            2.900 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   12009 
_reflns.pdbx_Rmerge_I_obs            0.061 
_reflns.pdbx_netI_over_sigmaI        10.700 
_reflns.pdbx_chi_squared             1.161 
_reflns.pdbx_redundancy              3.500 
_reflns.percent_possible_obs         98.600 
_reflns.observed_criterion_sigma_F   1 
_reflns.observed_criterion_sigma_I   1 
_reflns.number_all                   12180 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
2.90 3.00  ? ? ? 0.670 ? ? 1.081 3.40 ? 1166 99.40 ? 1  
3.00 3.12  ? ? ? 0.434 ? ? 1.249 3.40 ? 1182 99.20 ? 2  
3.12 3.27  ? ? ? 0.229 ? ? 1.092 3.50 ? 1214 99.20 ? 3  
3.27 3.44  ? ? ? 0.146 ? ? 1.066 3.50 ? 1157 99.60 ? 4  
3.44 3.65  ? ? ? 0.105 ? ? 1.074 3.50 ? 1192 98.80 ? 5  
3.65 3.94  ? ? ? 0.073 ? ? 1.089 3.50 ? 1193 99.00 ? 6  
3.94 4.33  ? ? ? 0.049 ? ? 1.130 3.50 ? 1194 99.20 ? 7  
4.33 4.96  ? ? ? 0.047 ? ? 1.431 3.50 ? 1216 98.90 ? 8  
4.96 6.24  ? ? ? 0.044 ? ? 1.352 3.40 ? 1232 98.60 ? 9  
6.24 50.00 ? ? ? 0.023 ? ? 1.035 3.30 ? 1263 95.00 ? 10 
# 
_refine.entry_id                                 3M9M 
_refine.ls_d_res_high                            2.900 
_refine.ls_d_res_low                             45.00 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    98.500 
_refine.ls_number_reflns_obs                     11987 
_refine.ls_number_reflns_all                     12007 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            Random 
_refine.details                                  ? 
_refine.ls_R_factor_all                          0.286 
_refine.ls_R_factor_obs                          0.286 
_refine.ls_R_factor_R_work                       0.285 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.309 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 6.700 
_refine.ls_number_reflns_R_free                  818 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               63.213 
_refine.solvent_model_param_bsol                 32.470 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -11.092 
_refine.aniso_B[2][2]                            3.739 
_refine.aniso_B[3][3]                            7.353 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1JX4' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.748 
_refine.B_iso_max                                137.45 
_refine.B_iso_min                                17.73 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2743 
_refine_hist.pdbx_number_atoms_nucleic_acid   554 
_refine_hist.pdbx_number_atoms_ligand         53 
_refine_hist.number_atoms_solvent             51 
_refine_hist.number_atoms_total               3401 
_refine_hist.d_res_high                       2.900 
_refine_hist.d_res_low                        45.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d     ? 0.006 1.500 ? 'X-RAY DIFFRACTION' ? 
c_angle_deg  ? 1.510 2.000 ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it  ? 3.452 1.500 ? 'X-RAY DIFFRACTION' ? 
c_scbond_it  ? 3.918 2.000 ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it ? 5.641 2.000 ? 'X-RAY DIFFRACTION' ? 
c_scangle_it ? 6.451 2.500 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param           ? 'X-RAY DIFFRACTION' 
2 dna-rna_jw_020210_gg1.param ? 'X-RAY DIFFRACTION' 
3 ion.param                   ? 'X-RAY DIFFRACTION' 
4 water_rep.param             ? 'X-RAY DIFFRACTION' 
5 ctp_par_121707.txt          ? 'X-RAY DIFFRACTION' 
6 gol_xplor_par.txt           ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3M9M 
_struct.title                     'Crystal Structure of Dpo4 in complex with DNA containing the major cisplatin lesion' 
_struct.pdbx_descriptor           'DNA polymerase IV (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3M9M 
_struct_keywords.text            
;Dpo4, translesion DNA synthesis, TLS, cisplatin, Y-family DNA polymerase, protein-DNA complex, DNA, DNA damage, DNA repair, DNA replication, DNA-binding, DNA-directed DNA polymerase, Magnesium, Metal-binding, Mutator protein, Nucleotidyltransferase, Transferase, Transferase-DNA complex
;
_struct_keywords.pdbx_keywords   Transferase/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 6 ? 
J N N 6 ? 
K N N 6 ? 
L N N 7 ? 
M N N 8 ? 
N N N 8 ? 
O N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 10  ? VAL A 18  ? TYR B 10  VAL B 18  1 ? 9  
HELX_P HELX_P2  2  ASN A 20  ? LYS A 24  ? ASN B 20  LYS B 24  5 ? 5  
HELX_P HELX_P3  3  ASN A 47  ? LYS A 52  ? ASN B 47  LYS B 52  1 ? 6  
HELX_P HELX_P4  4  PRO A 60  ? LEU A 68  ? PRO B 60  LEU B 68  1 ? 9  
HELX_P HELX_P5  5  ARG A 77  ? ARG A 93  ? ARG B 77  ARG B 93  1 ? 17 
HELX_P HELX_P6  6  ASP A 117 ? LYS A 137 ? ASP B 117 LYS B 137 1 ? 21 
HELX_P HELX_P7  7  ASN A 147 ? LYS A 159 ? ASN B 147 LYS B 159 1 ? 13 
HELX_P HELX_P8  8  ASP A 167 ? LEU A 178 ? ASP B 167 LEU B 178 1 ? 12 
HELX_P HELX_P9  9  ASP A 179 ? VAL A 183 ? ASP B 179 VAL B 183 5 ? 5  
HELX_P HELX_P10 10 GLY A 187 ? LYS A 196 ? GLY B 187 LYS B 196 1 ? 10 
HELX_P HELX_P11 11 LYS A 201 ? LEU A 206 ? LYS B 201 LEU B 206 5 ? 6  
HELX_P HELX_P12 12 PHE A 210 ? GLY A 215 ? PHE B 210 GLY B 215 1 ? 6  
HELX_P HELX_P13 13 GLY A 218 ? ARG A 230 ? GLY B 218 ARG B 230 1 ? 13 
HELX_P HELX_P14 14 ASN A 257 ? ASP A 277 ? ASN B 257 ASP B 277 1 ? 21 
HELX_P HELX_P15 15 SER A 307 ? ASP A 326 ? SER B 307 ASP B 326 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? C DG  5   N7    ? ? ? 1_555 L CPT .  PT1 ? ? T DG  4    T CPT 1004 1_555 ? ? ? ? ? ? ?            1.937 ? 
metalc2  metalc ? ? C DG  4   N7    ? ? ? 1_555 L CPT .  PT1 ? ? T DG  3    T CPT 1004 1_555 ? ? ? ? ? ? ?            1.973 ? 
metalc3  metalc ? ? A ASP 7   OD1   ? ? ? 1_555 F CA  .  CA  ? ? B ASP 7    B CA  354  1_555 ? ? ? ? ? ? ?            2.328 ? 
metalc4  metalc ? ? A PHE 8   O     ? ? ? 1_555 F CA  .  CA  ? ? B PHE 8    B CA  354  1_555 ? ? ? ? ? ? ?            2.491 ? 
metalc5  metalc ? ? D CTP .   O2B   ? ? ? 1_555 F CA  .  CA  ? ? B CTP 2001 B CA  354  1_555 ? ? ? ? ? ? ?            2.533 ? 
metalc6  metalc ? ? A ASP 105 OD2   ? ? ? 1_555 F CA  .  CA  ? ? B ASP 105  B CA  354  1_555 ? ? ? ? ? ? ?            2.569 ? 
metalc7  metalc ? ? A ALA 181 O     ? ? ? 1_555 G CA  .  CA  ? ? B ALA 181  B CA  355  1_555 ? ? ? ? ? ? ?            2.739 ? 
metalc8  metalc ? ? A GLU 106 OE2   ? ? ? 1_555 E CA  .  CA  ? ? B GLU 106  B CA  353  1_555 ? ? ? ? ? ? ?            2.763 ? 
metalc9  metalc ? ? A ILE 186 O     ? ? ? 1_555 G CA  .  CA  ? ? B ILE 186  B CA  355  1_555 ? ? ? ? ? ? ?            2.817 ? 
metalc10 metalc ? ? D CTP .   "O5'" ? ? ? 1_555 E CA  .  CA  ? ? B CTP 2001 B CA  353  1_555 ? ? ? ? ? ? ?            2.990 ? 
metalc11 metalc ? ? A ASP 105 OD1   ? ? ? 1_555 E CA  .  CA  ? ? B ASP 105  B CA  353  1_555 ? ? ? ? ? ? ?            3.087 ? 
metalc12 metalc ? ? D CTP .   O1A   ? ? ? 1_555 F CA  .  CA  ? ? B CTP 2001 B CA  354  1_555 ? ? ? ? ? ? ?            3.142 ? 
hydrog1  hydrog ? ? B DG  1   N1    ? ? ? 1_555 C DC  18 N3  ? ? P DG  1    T DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DG  1   N2    ? ? ? 1_555 C DC  18 O2  ? ? P DG  1    T DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  1   O6    ? ? ? 1_555 C DC  18 N4  ? ? P DG  1    T DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DG  2   N1    ? ? ? 1_555 C DC  17 N3  ? ? P DG  2    T DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  2   N2    ? ? ? 1_555 C DC  17 O2  ? ? P DG  2    T DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  2   O6    ? ? ? 1_555 C DC  17 N4  ? ? P DG  2    T DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  3   N1    ? ? ? 1_555 C DC  16 N3  ? ? P DG  3    T DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  3   N2    ? ? ? 1_555 C DC  16 O2  ? ? P DG  3    T DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DG  3   O6    ? ? ? 1_555 C DC  16 N4  ? ? P DG  3    T DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DG  4   N1    ? ? ? 1_555 C DC  15 N3  ? ? P DG  4    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DG  4   N2    ? ? ? 1_555 C DC  15 O2  ? ? P DG  4    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DG  4   O6    ? ? ? 1_555 C DC  15 N4  ? ? P DG  4    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  5   N1    ? ? ? 1_555 C DC  14 N3  ? ? P DG  5    T DC  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  5   N2    ? ? ? 1_555 C DC  14 O2  ? ? P DG  5    T DC  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  5   O6    ? ? ? 1_555 C DC  14 N4  ? ? P DG  5    T DC  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DA  6   N1    ? ? ? 1_555 C DT  13 N3  ? ? P DA  6    T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DA  6   N6    ? ? ? 1_555 C DT  13 O4  ? ? P DA  6    T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DA  7   N1    ? ? ? 1_555 C DT  12 N3  ? ? P DA  7    T DT  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DA  7   N6    ? ? ? 1_555 C DT  12 O4  ? ? P DA  7    T DT  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DG  8   N1    ? ? ? 1_555 C DC  11 N3  ? ? P DG  8    T DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DG  8   N2    ? ? ? 1_555 C DC  11 O2  ? ? P DG  8    T DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DG  8   O6    ? ? ? 1_555 C DC  11 N4  ? ? P DG  8    T DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DG  9   N1    ? ? ? 1_555 C DC  10 N3  ? ? P DG  9    T DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DG  9   N2    ? ? ? 1_555 C DC  10 O2  ? ? P DG  9    T DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DG  9   O6    ? ? ? 1_555 C DC  10 N4  ? ? P DG  9    T DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DA  10  N1    ? ? ? 1_555 C DT  9  N3  ? ? P DA  10   T DT  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DA  10  N6    ? ? ? 1_555 C DT  9  O4  ? ? P DA  10   T DT  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DA  11  N1    ? ? ? 1_555 C DT  8  N3  ? ? P DA  11   T DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DA  11  N6    ? ? ? 1_555 C DT  8  O4  ? ? P DA  11   T DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DA  12  N1    ? ? ? 1_555 C DT  7  N3  ? ? P DA  12   T DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DA  12  N6    ? ? ? 1_555 C DT  7  O4  ? ? P DA  12   T DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           159 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            159 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    160 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     160 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.00 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 99  ? SER A 103 ? ILE B 99  SER B 103 
A 2 GLU A 106 ? ASP A 110 ? GLU B 106 ASP B 110 
A 3 VAL A 3   ? PHE A 8   ? VAL B 3   PHE B 8   
A 4 VAL A 140 ? SER A 145 ? VAL B 140 SER B 145 
A 5 ILE A 163 ? VAL A 165 ? ILE B 163 VAL B 165 
B 1 GLY A 41  ? ALA A 46  ? GLY B 41  ALA B 46  
B 2 VAL A 28  ? PHE A 33  ? VAL B 28  PHE B 33  
B 3 VAL A 72  ? PRO A 75  ? VAL B 72  PRO B 75  
C 1 ILE A 245 ? SER A 255 ? ILE B 245 SER B 255 
C 2 ILE A 330 ? PHE A 340 ? ILE B 330 PHE B 340 
C 3 PRO A 281 ? THR A 290 ? PRO B 281 THR B 290 
C 4 ILE A 295 ? THR A 301 ? ILE B 295 THR B 301 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 100 ? N GLU B 100 O TYR A 108 ? O TYR B 108 
A 2 3 O LEU A 109 ? O LEU B 109 N LEU A 4   ? N LEU B 4   
A 3 4 N VAL A 3   ? N VAL B 3   O SER A 145 ? O SER B 145 
A 4 5 N ILE A 144 ? N ILE B 144 O LYS A 164 ? O LYS B 164 
B 1 2 O ALA A 42  ? O ALA B 42  N VAL A 32  ? N VAL B 32  
B 2 3 N CYS A 31  ? N CYS B 31  O LEU A 74  ? O LEU B 74  
C 1 2 N VAL A 249 ? N VAL B 249 O ILE A 333 ? O ILE B 333 
C 2 3 O SER A 338 ? O SER B 338 N ALA A 283 ? N ALA B 283 
C 3 4 N VAL A 286 ? N VAL B 286 O ARG A 298 ? O ARG B 298 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE CTP B 2001' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA B 353'   
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA B 354'   
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CA B 355'   
AC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CA B 356'   
AC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE GOL B 357'  
AC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE GOL P 14'   
AC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE GOL P 15'   
AC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CPT T 1004' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 PHE A 8   ? PHE B 8    . ? 1_555 ? 
2  AC1 17 ASP A 9   ? ASP B 9    . ? 1_555 ? 
3  AC1 17 TYR A 10  ? TYR B 10   . ? 1_555 ? 
4  AC1 17 PHE A 11  ? PHE B 11   . ? 1_555 ? 
5  AC1 17 TYR A 12  ? TYR B 12   . ? 1_555 ? 
6  AC1 17 THR A 45  ? THR B 45   . ? 1_555 ? 
7  AC1 17 TYR A 48  ? TYR B 48   . ? 1_555 ? 
8  AC1 17 ARG A 51  ? ARG B 51   . ? 1_555 ? 
9  AC1 17 ALA A 57  ? ALA B 57   . ? 1_555 ? 
10 AC1 17 ASP A 105 ? ASP B 105  . ? 1_555 ? 
11 AC1 17 LYS A 159 ? LYS B 159  . ? 1_555 ? 
12 AC1 17 CA  E .   ? CA  B 353  . ? 1_555 ? 
13 AC1 17 CA  F .   ? CA  B 354  . ? 1_555 ? 
14 AC1 17 HOH M .   ? HOH B 377  . ? 1_555 ? 
15 AC1 17 HOH M .   ? HOH B 378  . ? 1_555 ? 
16 AC1 17 HOH M .   ? HOH B 379  . ? 1_555 ? 
17 AC1 17 DG  C 5   ? DG  T 4    . ? 1_555 ? 
18 AC2 4  ASP A 105 ? ASP B 105  . ? 1_555 ? 
19 AC2 4  GLU A 106 ? GLU B 106  . ? 1_555 ? 
20 AC2 4  CA  F .   ? CA  B 354  . ? 1_555 ? 
21 AC2 4  CTP D .   ? CTP B 2001 . ? 1_555 ? 
22 AC3 5  ASP A 7   ? ASP B 7    . ? 1_555 ? 
23 AC3 5  PHE A 8   ? PHE B 8    . ? 1_555 ? 
24 AC3 5  ASP A 105 ? ASP B 105  . ? 1_555 ? 
25 AC3 5  CA  E .   ? CA  B 353  . ? 1_555 ? 
26 AC3 5  CTP D .   ? CTP B 2001 . ? 1_555 ? 
27 AC4 2  ALA A 181 ? ALA B 181  . ? 1_555 ? 
28 AC4 2  ILE A 186 ? ILE B 186  . ? 1_555 ? 
29 AC5 1  ASP A 156 ? ASP B 156  . ? 1_555 ? 
30 AC6 2  GLY A 185 ? GLY B 185  . ? 1_555 ? 
31 AC6 2  DC  C 11  ? DC  T 10   . ? 1_555 ? 
32 AC7 3  DG  B 2   ? DG  P 2    . ? 1_555 ? 
33 AC7 3  DG  B 3   ? DG  P 3    . ? 1_555 ? 
34 AC7 3  DG  B 4   ? DG  P 4    . ? 1_555 ? 
35 AC8 3  DA  B 6   ? DA  P 6    . ? 1_555 ? 
36 AC8 3  DA  B 7   ? DA  P 7    . ? 1_555 ? 
37 AC8 3  DC  C 14  ? DC  T 13   . ? 1_555 ? 
38 AC9 2  DG  C 4   ? DG  T 3    . ? 1_555 ? 
39 AC9 2  DG  C 5   ? DG  T 4    . ? 1_555 ? 
# 
_atom_sites.entry_id                    3M9M 
_atom_sites.fract_transf_matrix[1][1]   0.010144 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009882 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019077 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
PT 
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? 47.790  -19.142 -15.294 1.00 64.73  ? 1    MET B N     1 
ATOM   2    C  CA    . MET A 1 1   ? 46.834  -18.009 -15.138 1.00 65.04  ? 1    MET B CA    1 
ATOM   3    C  C     . MET A 1 1   ? 46.727  -17.440 -13.728 1.00 63.75  ? 1    MET B C     1 
ATOM   4    O  O     . MET A 1 1   ? 47.072  -18.090 -12.740 1.00 63.85  ? 1    MET B O     1 
ATOM   5    C  CB    . MET A 1 1   ? 45.432  -18.429 -15.585 1.00 65.47  ? 1    MET B CB    1 
ATOM   6    C  CG    . MET A 1 1   ? 45.176  -18.297 -17.071 1.00 63.78  ? 1    MET B CG    1 
ATOM   7    S  SD    . MET A 1 1   ? 43.426  -18.502 -17.458 1.00 61.91  ? 1    MET B SD    1 
ATOM   8    C  CE    . MET A 1 1   ? 43.371  -20.243 -17.951 1.00 59.71  ? 1    MET B CE    1 
ATOM   9    N  N     . ILE A 1 2   ? 46.244  -16.204 -13.670 1.00 62.50  ? 2    ILE B N     1 
ATOM   10   C  CA    . ILE A 1 2   ? 46.003  -15.471 -12.435 1.00 60.23  ? 2    ILE B CA    1 
ATOM   11   C  C     . ILE A 1 2   ? 44.699  -14.732 -12.716 1.00 57.57  ? 2    ILE B C     1 
ATOM   12   O  O     . ILE A 1 2   ? 44.697  -13.587 -13.165 1.00 57.18  ? 2    ILE B O     1 
ATOM   13   C  CB    . ILE A 1 2   ? 47.143  -14.464 -12.123 1.00 61.63  ? 2    ILE B CB    1 
ATOM   14   C  CG1   . ILE A 1 2   ? 48.264  -15.187 -11.371 1.00 62.62  ? 2    ILE B CG1   1 
ATOM   15   C  CG2   . ILE A 1 2   ? 46.610  -13.281 -11.316 1.00 62.49  ? 2    ILE B CG2   1 
ATOM   16   C  CD1   . ILE A 1 2   ? 49.264  -14.269 -10.691 1.00 62.06  ? 2    ILE B CD1   1 
ATOM   17   N  N     . VAL A 1 3   ? 43.581  -15.403 -12.467 1.00 54.16  ? 3    VAL B N     1 
ATOM   18   C  CA    . VAL A 1 3   ? 42.282  -14.810 -12.745 1.00 52.76  ? 3    VAL B CA    1 
ATOM   19   C  C     . VAL A 1 3   ? 41.745  -13.838 -11.699 1.00 50.94  ? 3    VAL B C     1 
ATOM   20   O  O     . VAL A 1 3   ? 41.965  -13.997 -10.499 1.00 51.35  ? 3    VAL B O     1 
ATOM   21   C  CB    . VAL A 1 3   ? 41.223  -15.907 -13.011 1.00 50.35  ? 3    VAL B CB    1 
ATOM   22   C  CG1   . VAL A 1 3   ? 39.872  -15.273 -13.269 1.00 48.22  ? 3    VAL B CG1   1 
ATOM   23   C  CG2   . VAL A 1 3   ? 41.636  -16.739 -14.220 1.00 46.91  ? 3    VAL B CG2   1 
ATOM   24   N  N     . LEU A 1 4   ? 41.043  -12.818 -12.186 1.00 50.65  ? 4    LEU B N     1 
ATOM   25   C  CA    . LEU A 1 4   ? 40.442  -11.792 -11.340 1.00 50.44  ? 4    LEU B CA    1 
ATOM   26   C  C     . LEU A 1 4   ? 38.939  -11.705 -11.595 1.00 48.66  ? 4    LEU B C     1 
ATOM   27   O  O     . LEU A 1 4   ? 38.499  -11.306 -12.673 1.00 49.77  ? 4    LEU B O     1 
ATOM   28   C  CB    . LEU A 1 4   ? 41.101  -10.437 -11.605 1.00 51.62  ? 4    LEU B CB    1 
ATOM   29   C  CG    . LEU A 1 4   ? 40.345  -9.232  -11.040 1.00 53.38  ? 4    LEU B CG    1 
ATOM   30   C  CD1   . LEU A 1 4   ? 41.327  -8.150  -10.631 1.00 54.36  ? 4    LEU B CD1   1 
ATOM   31   C  CD2   . LEU A 1 4   ? 39.349  -8.717  -12.073 1.00 54.68  ? 4    LEU B CD2   1 
ATOM   32   N  N     . PHE A 1 5   ? 38.159  -12.059 -10.580 1.00 48.90  ? 5    PHE B N     1 
ATOM   33   C  CA    . PHE A 1 5   ? 36.702  -12.072 -10.677 1.00 48.04  ? 5    PHE B CA    1 
ATOM   34   C  C     . PHE A 1 5   ? 36.023  -10.909 -9.956  1.00 46.83  ? 5    PHE B C     1 
ATOM   35   O  O     . PHE A 1 5   ? 36.361  -10.593 -8.815  1.00 45.96  ? 5    PHE B O     1 
ATOM   36   C  CB    . PHE A 1 5   ? 36.195  -13.403 -10.104 1.00 46.86  ? 5    PHE B CB    1 
ATOM   37   C  CG    . PHE A 1 5   ? 34.708  -13.605 -10.207 1.00 47.84  ? 5    PHE B CG    1 
ATOM   38   C  CD1   . PHE A 1 5   ? 34.083  -13.700 -11.446 1.00 47.76  ? 5    PHE B CD1   1 
ATOM   39   C  CD2   . PHE A 1 5   ? 33.940  -13.762 -9.058  1.00 47.68  ? 5    PHE B CD2   1 
ATOM   40   C  CE1   . PHE A 1 5   ? 32.715  -13.953 -11.538 1.00 46.81  ? 5    PHE B CE1   1 
ATOM   41   C  CE2   . PHE A 1 5   ? 32.571  -14.015 -9.138  1.00 46.41  ? 5    PHE B CE2   1 
ATOM   42   C  CZ    . PHE A 1 5   ? 31.959  -14.112 -10.381 1.00 46.47  ? 5    PHE B CZ    1 
ATOM   43   N  N     . VAL A 1 6   ? 35.075  -10.269 -10.630 1.00 44.50  ? 6    VAL B N     1 
ATOM   44   C  CA    . VAL A 1 6   ? 34.332  -9.177  -10.020 1.00 45.48  ? 6    VAL B CA    1 
ATOM   45   C  C     . VAL A 1 6   ? 32.881  -9.626  -9.964  1.00 41.47  ? 6    VAL B C     1 
ATOM   46   O  O     . VAL A 1 6   ? 32.380  -10.262 -10.889 1.00 43.17  ? 6    VAL B O     1 
ATOM   47   C  CB    . VAL A 1 6   ? 34.423  -7.871  -10.833 1.00 46.77  ? 6    VAL B CB    1 
ATOM   48   C  CG1   . VAL A 1 6   ? 33.859  -6.716  -10.013 1.00 46.43  ? 6    VAL B CG1   1 
ATOM   49   C  CG2   . VAL A 1 6   ? 35.862  -7.594  -11.218 1.00 46.41  ? 6    VAL B CG2   1 
ATOM   50   N  N     . ASP A 1 7   ? 32.210  -9.291  -8.873  1.00 39.53  ? 7    ASP B N     1 
ATOM   51   C  CA    . ASP A 1 7   ? 30.827  -9.682  -8.682  1.00 35.92  ? 7    ASP B CA    1 
ATOM   52   C  C     . ASP A 1 7   ? 30.130  -8.557  -7.900  1.00 33.26  ? 7    ASP B C     1 
ATOM   53   O  O     . ASP A 1 7   ? 30.207  -8.507  -6.674  1.00 31.79  ? 7    ASP B O     1 
ATOM   54   C  CB    . ASP A 1 7   ? 30.813  -11.018 -7.920  1.00 34.30  ? 7    ASP B CB    1 
ATOM   55   C  CG    . ASP A 1 7   ? 29.432  -11.536 -7.681  1.00 34.76  ? 7    ASP B CG    1 
ATOM   56   O  OD1   . ASP A 1 7   ? 28.606  -10.707 -7.307  1.00 37.27  ? 7    ASP B OD1   1 
ATOM   57   O  OD2   . ASP A 1 7   ? 29.174  -12.748 -7.845  1.00 34.95  ? 7    ASP B OD2   1 
ATOM   58   N  N     . PHE A 1 8   ? 29.467  -7.648  -8.620  1.00 31.73  ? 8    PHE B N     1 
ATOM   59   C  CA    . PHE A 1 8   ? 28.773  -6.506  -8.004  1.00 32.27  ? 8    PHE B CA    1 
ATOM   60   C  C     . PHE A 1 8   ? 27.863  -6.973  -6.883  1.00 33.52  ? 8    PHE B C     1 
ATOM   61   O  O     . PHE A 1 8   ? 27.089  -7.890  -7.072  1.00 33.41  ? 8    PHE B O     1 
ATOM   62   C  CB    . PHE A 1 8   ? 27.917  -5.751  -9.031  1.00 27.89  ? 8    PHE B CB    1 
ATOM   63   C  CG    . PHE A 1 8   ? 28.625  -5.450  -10.321 1.00 23.49  ? 8    PHE B CG    1 
ATOM   64   C  CD1   . PHE A 1 8   ? 30.014  -5.504  -10.407 1.00 22.11  ? 8    PHE B CD1   1 
ATOM   65   C  CD2   . PHE A 1 8   ? 27.898  -5.106  -11.456 1.00 22.51  ? 8    PHE B CD2   1 
ATOM   66   C  CE1   . PHE A 1 8   ? 30.664  -5.224  -11.600 1.00 22.52  ? 8    PHE B CE1   1 
ATOM   67   C  CE2   . PHE A 1 8   ? 28.540  -4.825  -12.654 1.00 22.78  ? 8    PHE B CE2   1 
ATOM   68   C  CZ    . PHE A 1 8   ? 29.924  -4.884  -12.726 1.00 22.65  ? 8    PHE B CZ    1 
ATOM   69   N  N     . ASP A 1 9   ? 27.925  -6.320  -5.727  1.00 37.89  ? 9    ASP B N     1 
ATOM   70   C  CA    . ASP A 1 9   ? 27.104  -6.731  -4.587  1.00 43.62  ? 9    ASP B CA    1 
ATOM   71   C  C     . ASP A 1 9   ? 25.630  -6.369  -4.667  1.00 42.38  ? 9    ASP B C     1 
ATOM   72   O  O     . ASP A 1 9   ? 25.273  -5.332  -5.224  1.00 43.36  ? 9    ASP B O     1 
ATOM   73   C  CB    . ASP A 1 9   ? 27.707  -6.185  -3.298  1.00 47.26  ? 9    ASP B CB    1 
ATOM   74   C  CG    . ASP A 1 9   ? 29.112  -6.682  -3.076  1.00 53.10  ? 9    ASP B CG    1 
ATOM   75   O  OD1   . ASP A 1 9   ? 29.372  -7.861  -3.401  1.00 60.01  ? 9    ASP B OD1   1 
ATOM   76   O  OD2   . ASP A 1 9   ? 29.954  -5.908  -2.580  1.00 58.85  ? 9    ASP B OD2   1 
ATOM   77   N  N     . TYR A 1 10  ? 24.796  -7.233  -4.080  1.00 44.23  ? 10   TYR B N     1 
ATOM   78   C  CA    . TYR A 1 10  ? 23.335  -7.095  -4.073  1.00 46.09  ? 10   TYR B CA    1 
ATOM   79   C  C     . TYR A 1 10  ? 22.911  -6.101  -5.140  1.00 41.30  ? 10   TYR B C     1 
ATOM   80   O  O     . TYR A 1 10  ? 22.062  -5.237  -4.935  1.00 40.74  ? 10   TYR B O     1 
ATOM   81   C  CB    . TYR A 1 10  ? 22.834  -6.689  -2.675  1.00 53.77  ? 10   TYR B CB    1 
ATOM   82   C  CG    . TYR A 1 10  ? 23.359  -5.379  -2.123  1.00 64.12  ? 10   TYR B CG    1 
ATOM   83   C  CD1   . TYR A 1 10  ? 22.706  -4.177  -2.387  1.00 69.74  ? 10   TYR B CD1   1 
ATOM   84   C  CD2   . TYR A 1 10  ? 24.486  -5.347  -1.302  1.00 69.11  ? 10   TYR B CD2   1 
ATOM   85   C  CE1   . TYR A 1 10  ? 23.157  -2.977  -1.842  1.00 75.20  ? 10   TYR B CE1   1 
ATOM   86   C  CE2   . TYR A 1 10  ? 24.946  -4.153  -0.752  1.00 74.97  ? 10   TYR B CE2   1 
ATOM   87   C  CZ    . TYR A 1 10  ? 24.275  -2.972  -1.024  1.00 76.44  ? 10   TYR B CZ    1 
ATOM   88   O  OH    . TYR A 1 10  ? 24.709  -1.791  -0.466  1.00 78.62  ? 10   TYR B OH    1 
ATOM   89   N  N     . PHE A 1 11  ? 23.510  -6.294  -6.310  1.00 37.18  ? 11   PHE B N     1 
ATOM   90   C  CA    . PHE A 1 11  ? 23.348  -5.444  -7.477  1.00 34.12  ? 11   PHE B CA    1 
ATOM   91   C  C     . PHE A 1 11  ? 22.059  -4.672  -7.745  1.00 34.60  ? 11   PHE B C     1 
ATOM   92   O  O     . PHE A 1 11  ? 22.019  -3.470  -7.500  1.00 33.62  ? 11   PHE B O     1 
ATOM   93   C  CB    . PHE A 1 11  ? 23.758  -6.221  -8.730  1.00 28.89  ? 11   PHE B CB    1 
ATOM   94   C  CG    . PHE A 1 11  ? 24.056  -5.343  -9.895  1.00 24.75  ? 11   PHE B CG    1 
ATOM   95   C  CD1   . PHE A 1 11  ? 24.739  -4.144  -9.707  1.00 22.97  ? 11   PHE B CD1   1 
ATOM   96   C  CD2   . PHE A 1 11  ? 23.645  -5.690  -11.173 1.00 23.24  ? 11   PHE B CD2   1 
ATOM   97   C  CE1   . PHE A 1 11  ? 25.002  -3.299  -10.774 1.00 21.47  ? 11   PHE B CE1   1 
ATOM   98   C  CE2   . PHE A 1 11  ? 23.905  -4.850  -12.249 1.00 22.48  ? 11   PHE B CE2   1 
ATOM   99   C  CZ    . PHE A 1 11  ? 24.585  -3.652  -12.049 1.00 21.53  ? 11   PHE B CZ    1 
ATOM   100  N  N     . TYR A 1 12  ? 21.018  -5.318  -8.258  1.00 34.82  ? 12   TYR B N     1 
ATOM   101  C  CA    . TYR A 1 12  ? 19.791  -4.578  -8.546  1.00 36.96  ? 12   TYR B CA    1 
ATOM   102  C  C     . TYR A 1 12  ? 19.373  -3.694  -7.377  1.00 39.03  ? 12   TYR B C     1 
ATOM   103  O  O     . TYR A 1 12  ? 18.969  -2.546  -7.574  1.00 38.31  ? 12   TYR B O     1 
ATOM   104  C  CB    . TYR A 1 12  ? 18.641  -5.523  -8.899  1.00 35.04  ? 12   TYR B CB    1 
ATOM   105  C  CG    . TYR A 1 12  ? 18.829  -6.307  -10.176 1.00 34.75  ? 12   TYR B CG    1 
ATOM   106  C  CD1   . TYR A 1 12  ? 20.003  -6.210  -10.926 1.00 34.51  ? 12   TYR B CD1   1 
ATOM   107  C  CD2   . TYR A 1 12  ? 17.833  -7.167  -10.625 1.00 34.59  ? 12   TYR B CD2   1 
ATOM   108  C  CE1   . TYR A 1 12  ? 20.173  -6.958  -12.095 1.00 34.71  ? 12   TYR B CE1   1 
ATOM   109  C  CE2   . TYR A 1 12  ? 17.993  -7.913  -11.777 1.00 34.62  ? 12   TYR B CE2   1 
ATOM   110  C  CZ    . TYR A 1 12  ? 19.156  -7.808  -12.509 1.00 34.87  ? 12   TYR B CZ    1 
ATOM   111  O  OH    . TYR A 1 12  ? 19.273  -8.549  -13.660 1.00 35.30  ? 12   TYR B OH    1 
ATOM   112  N  N     . ALA A 1 13  ? 19.476  -4.221  -6.163  1.00 41.08  ? 13   ALA B N     1 
ATOM   113  C  CA    . ALA A 1 13  ? 19.089  -3.450  -4.991  1.00 43.76  ? 13   ALA B CA    1 
ATOM   114  C  C     . ALA A 1 13  ? 20.061  -2.315  -4.684  1.00 47.10  ? 13   ALA B C     1 
ATOM   115  O  O     . ALA A 1 13  ? 19.685  -1.334  -4.047  1.00 50.20  ? 13   ALA B O     1 
ATOM   116  C  CB    . ALA A 1 13  ? 18.957  -4.362  -3.789  1.00 44.69  ? 13   ALA B CB    1 
ATOM   117  N  N     . GLN A 1 14  ? 21.307  -2.439  -5.124  1.00 50.43  ? 14   GLN B N     1 
ATOM   118  C  CA    . GLN A 1 14  ? 22.278  -1.384  -4.864  1.00 49.48  ? 14   GLN B CA    1 
ATOM   119  C  C     . GLN A 1 14  ? 21.955  -0.235  -5.803  1.00 51.09  ? 14   GLN B C     1 
ATOM   120  O  O     . GLN A 1 14  ? 21.786  0.911   -5.382  1.00 48.91  ? 14   GLN B O     1 
ATOM   121  C  CB    . GLN A 1 14  ? 23.698  -1.889  -5.124  1.00 51.42  ? 14   GLN B CB    1 
ATOM   122  C  CG    . GLN A 1 14  ? 24.796  -1.073  -4.454  1.00 51.83  ? 14   GLN B CG    1 
ATOM   123  C  CD    . GLN A 1 14  ? 26.177  -1.652  -4.697  1.00 50.41  ? 14   GLN B CD    1 
ATOM   124  O  OE1   . GLN A 1 14  ? 26.329  -2.851  -4.932  1.00 48.46  ? 14   GLN B OE1   1 
ATOM   125  N  NE2   . GLN A 1 14  ? 27.194  -0.804  -4.622  1.00 47.51  ? 14   GLN B NE2   1 
ATOM   126  N  N     . VAL A 1 15  ? 21.857  -0.565  -7.085  1.00 48.15  ? 15   VAL B N     1 
ATOM   127  C  CA    . VAL A 1 15  ? 21.551  0.414   -8.113  1.00 46.50  ? 15   VAL B CA    1 
ATOM   128  C  C     . VAL A 1 15  ? 20.251  1.141   -7.802  1.00 50.62  ? 15   VAL B C     1 
ATOM   129  O  O     . VAL A 1 15  ? 19.836  2.029   -8.537  1.00 49.66  ? 15   VAL B O     1 
ATOM   130  C  CB    . VAL A 1 15  ? 21.462  -0.263  -9.495  1.00 47.43  ? 15   VAL B CB    1 
ATOM   131  C  CG1   . VAL A 1 15  ? 21.047  0.741   -10.557 1.00 41.89  ? 15   VAL B CG1   1 
ATOM   132  C  CG2   . VAL A 1 15  ? 22.809  -0.865  -9.842  1.00 43.06  ? 15   VAL B CG2   1 
ATOM   133  N  N     . GLU A 1 16  ? 19.598  0.753   -6.714  1.00 51.42  ? 16   GLU B N     1 
ATOM   134  C  CA    . GLU A 1 16  ? 18.371  1.421   -6.311  1.00 51.14  ? 16   GLU B CA    1 
ATOM   135  C  C     . GLU A 1 16  ? 18.709  2.323   -5.131  1.00 54.34  ? 16   GLU B C     1 
ATOM   136  O  O     . GLU A 1 16  ? 18.148  3.409   -4.992  1.00 56.34  ? 16   GLU B O     1 
ATOM   137  C  CB    . GLU A 1 16  ? 17.287  0.411   -5.924  1.00 50.46  ? 16   GLU B CB    1 
ATOM   138  C  CG    . GLU A 1 16  ? 16.667  -0.319  -7.117  1.00 45.04  ? 16   GLU B CG    1 
ATOM   139  C  CD    . GLU A 1 16  ? 15.813  0.580   -8.008  1.00 42.33  ? 16   GLU B CD    1 
ATOM   140  O  OE1   . GLU A 1 16  ? 15.954  1.820   -7.946  1.00 41.23  ? 16   GLU B OE1   1 
ATOM   141  O  OE2   . GLU A 1 16  ? 15.004  0.036   -8.788  1.00 40.76  ? 16   GLU B OE2   1 
ATOM   142  N  N     . GLU A 1 17  ? 19.640  1.863   -4.294  1.00 57.61  ? 17   GLU B N     1 
ATOM   143  C  CA    . GLU A 1 17  ? 20.102  2.616   -3.125  1.00 55.96  ? 17   GLU B CA    1 
ATOM   144  C  C     . GLU A 1 17  ? 21.127  3.652   -3.585  1.00 57.85  ? 17   GLU B C     1 
ATOM   145  O  O     . GLU A 1 17  ? 21.757  4.327   -2.768  1.00 56.80  ? 17   GLU B O     1 
ATOM   146  C  CB    . GLU A 1 17  ? 20.775  1.687   -2.098  1.00 60.68  ? 17   GLU B CB    1 
ATOM   147  C  CG    . GLU A 1 17  ? 19.872  0.672   -1.403  1.00 61.31  ? 17   GLU B CG    1 
ATOM   148  C  CD    . GLU A 1 17  ? 20.627  -0.172  -0.381  1.00 59.60  ? 17   GLU B CD    1 
ATOM   149  O  OE1   . GLU A 1 17  ? 21.869  -0.255  -0.479  1.00 56.88  ? 17   GLU B OE1   1 
ATOM   150  O  OE2   . GLU A 1 17  ? 19.982  -0.763  0.511   1.00 56.03  ? 17   GLU B OE2   1 
ATOM   151  N  N     . VAL A 1 18  ? 21.288  3.766   -4.901  1.00 54.87  ? 18   VAL B N     1 
ATOM   152  C  CA    . VAL A 1 18  ? 22.240  4.696   -5.499  1.00 49.06  ? 18   VAL B CA    1 
ATOM   153  C  C     . VAL A 1 18  ? 21.537  5.826   -6.257  1.00 51.82  ? 18   VAL B C     1 
ATOM   154  O  O     . VAL A 1 18  ? 22.160  6.826   -6.617  1.00 49.34  ? 18   VAL B O     1 
ATOM   155  C  CB    . VAL A 1 18  ? 23.211  3.926   -6.434  1.00 51.61  ? 18   VAL B CB    1 
ATOM   156  C  CG1   . VAL A 1 18  ? 24.066  4.886   -7.247  1.00 46.58  ? 18   VAL B CG1   1 
ATOM   157  C  CG2   . VAL A 1 18  ? 24.094  3.015   -5.589  1.00 46.31  ? 18   VAL B CG2   1 
ATOM   158  N  N     . LEU A 1 19  ? 20.237  5.662   -6.489  1.00 50.41  ? 19   LEU B N     1 
ATOM   159  C  CA    . LEU A 1 19  ? 19.432  6.669   -7.180  1.00 49.40  ? 19   LEU B CA    1 
ATOM   160  C  C     . LEU A 1 19  ? 18.397  7.190   -6.192  1.00 46.82  ? 19   LEU B C     1 
ATOM   161  O  O     . LEU A 1 19  ? 17.507  7.969   -6.533  1.00 47.38  ? 19   LEU B O     1 
ATOM   162  C  CB    . LEU A 1 19  ? 18.737  6.065   -8.405  1.00 51.80  ? 19   LEU B CB    1 
ATOM   163  C  CG    . LEU A 1 19  ? 19.664  5.639   -9.548  1.00 52.14  ? 19   LEU B CG    1 
ATOM   164  C  CD1   . LEU A 1 19  ? 20.652  4.607   -9.040  1.00 54.45  ? 19   LEU B CD1   1 
ATOM   165  C  CD2   . LEU A 1 19  ? 18.850  5.077   -10.703 1.00 53.57  ? 19   LEU B CD2   1 
ATOM   166  N  N     . ASN A 1 20  ? 18.533  6.730   -4.957  1.00 46.64  ? 20   ASN B N     1 
ATOM   167  C  CA    . ASN A 1 20  ? 17.662  7.125   -3.861  1.00 46.52  ? 20   ASN B CA    1 
ATOM   168  C  C     . ASN A 1 20  ? 18.405  6.679   -2.608  1.00 46.02  ? 20   ASN B C     1 
ATOM   169  O  O     . ASN A 1 20  ? 18.008  5.727   -1.933  1.00 44.90  ? 20   ASN B O     1 
ATOM   170  C  CB    . ASN A 1 20  ? 16.306  6.424   -3.954  1.00 43.59  ? 20   ASN B CB    1 
ATOM   171  C  CG    . ASN A 1 20  ? 15.288  7.013   -3.003  1.00 43.06  ? 20   ASN B CG    1 
ATOM   172  O  OD1   . ASN A 1 20  ? 15.648  7.599   -1.987  1.00 43.94  ? 20   ASN B OD1   1 
ATOM   173  N  ND2   . ASN A 1 20  ? 14.009  6.852   -3.323  1.00 43.93  ? 20   ASN B ND2   1 
ATOM   174  N  N     . PRO A 1 21  ? 19.510  7.371   -2.291  1.00 44.05  ? 21   PRO B N     1 
ATOM   175  C  CA    . PRO A 1 21  ? 20.371  7.100   -1.137  1.00 48.38  ? 21   PRO B CA    1 
ATOM   176  C  C     . PRO A 1 21  ? 19.627  6.919   0.178   1.00 50.85  ? 21   PRO B C     1 
ATOM   177  O  O     . PRO A 1 21  ? 20.137  6.287   1.095   1.00 53.36  ? 21   PRO B O     1 
ATOM   178  C  CB    . PRO A 1 21  ? 21.301  8.311   -1.105  1.00 47.47  ? 21   PRO B CB    1 
ATOM   179  C  CG    . PRO A 1 21  ? 21.372  8.724   -2.538  1.00 45.65  ? 21   PRO B CG    1 
ATOM   180  C  CD    . PRO A 1 21  ? 19.936  8.607   -2.971  1.00 46.37  ? 21   PRO B CD    1 
ATOM   181  N  N     . SER A 1 22  ? 18.423  7.470   0.275   1.00 55.52  ? 22   SER B N     1 
ATOM   182  C  CA    . SER A 1 22  ? 17.655  7.352   1.507   1.00 58.06  ? 22   SER B CA    1 
ATOM   183  C  C     . SER A 1 22  ? 17.425  5.893   1.881   1.00 58.39  ? 22   SER B C     1 
ATOM   184  O  O     . SER A 1 22  ? 17.086  5.587   3.019   1.00 56.72  ? 22   SER B O     1 
ATOM   185  C  CB    . SER A 1 22  ? 16.306  8.068   1.372   1.00 57.39  ? 22   SER B CB    1 
ATOM   186  O  OG    . SER A 1 22  ? 15.473  7.437   0.416   1.00 63.02  ? 22   SER B OG    1 
ATOM   187  N  N     . LEU A 1 23  ? 17.638  4.997   0.924   1.00 58.16  ? 23   LEU B N     1 
ATOM   188  C  CA    . LEU A 1 23  ? 17.424  3.576   1.149   1.00 61.74  ? 23   LEU B CA    1 
ATOM   189  C  C     . LEU A 1 23  ? 18.490  2.868   1.979   1.00 60.16  ? 23   LEU B C     1 
ATOM   190  O  O     . LEU A 1 23  ? 18.180  1.915   2.695   1.00 60.64  ? 23   LEU B O     1 
ATOM   191  C  CB    . LEU A 1 23  ? 17.275  2.859   -0.194  1.00 64.77  ? 23   LEU B CB    1 
ATOM   192  C  CG    . LEU A 1 23  ? 16.307  3.487   -1.202  1.00 63.73  ? 23   LEU B CG    1 
ATOM   193  C  CD1   . LEU A 1 23  ? 16.155  2.561   -2.394  1.00 66.85  ? 23   LEU B CD1   1 
ATOM   194  C  CD2   . LEU A 1 23  ? 14.959  3.735   -0.552  1.00 66.38  ? 23   LEU B CD2   1 
ATOM   195  N  N     . LYS A 1 24  ? 19.741  3.314   1.888   1.00 61.22  ? 24   LYS B N     1 
ATOM   196  C  CA    . LYS A 1 24  ? 20.802  2.663   2.651   1.00 61.34  ? 24   LYS B CA    1 
ATOM   197  C  C     . LYS A 1 24  ? 20.430  2.619   4.120   1.00 59.96  ? 24   LYS B C     1 
ATOM   198  O  O     . LYS A 1 24  ? 20.055  3.631   4.710   1.00 60.53  ? 24   LYS B O     1 
ATOM   199  C  CB    . LYS A 1 24  ? 22.146  3.377   2.477   1.00 59.98  ? 24   LYS B CB    1 
ATOM   200  C  CG    . LYS A 1 24  ? 22.115  4.617   1.616   1.00 65.60  ? 24   LYS B CG    1 
ATOM   201  C  CD    . LYS A 1 24  ? 23.437  4.792   0.892   1.00 70.34  ? 24   LYS B CD    1 
ATOM   202  C  CE    . LYS A 1 24  ? 23.933  6.224   0.953   1.00 73.98  ? 24   LYS B CE    1 
ATOM   203  N  NZ    . LYS A 1 24  ? 25.256  6.362   0.285   1.00 75.48  ? 24   LYS B NZ    1 
ATOM   204  N  N     . GLY A 1 25  ? 20.528  1.434   4.704   1.00 60.61  ? 25   GLY B N     1 
ATOM   205  C  CA    . GLY A 1 25  ? 20.180  1.278   6.099   1.00 61.24  ? 25   GLY B CA    1 
ATOM   206  C  C     . GLY A 1 25  ? 18.821  0.619   6.222   1.00 61.32  ? 25   GLY B C     1 
ATOM   207  O  O     . GLY A 1 25  ? 18.572  -0.122  7.170   1.00 63.04  ? 25   GLY B O     1 
ATOM   208  N  N     . LYS A 1 26  ? 17.943  0.894   5.260   1.00 61.17  ? 26   LYS B N     1 
ATOM   209  C  CA    . LYS A 1 26  ? 16.598  0.321   5.243   1.00 60.08  ? 26   LYS B CA    1 
ATOM   210  C  C     . LYS A 1 26  ? 16.595  -0.936  4.382   1.00 55.32  ? 26   LYS B C     1 
ATOM   211  O  O     . LYS A 1 26  ? 17.342  -1.028  3.407   1.00 55.32  ? 26   LYS B O     1 
ATOM   212  C  CB    . LYS A 1 26  ? 15.593  1.316   4.653   1.00 64.44  ? 26   LYS B CB    1 
ATOM   213  C  CG    . LYS A 1 26  ? 15.577  2.673   5.327   1.00 72.40  ? 26   LYS B CG    1 
ATOM   214  C  CD    . LYS A 1 26  ? 14.409  3.538   4.851   1.00 78.09  ? 26   LYS B CD    1 
ATOM   215  C  CE    . LYS A 1 26  ? 14.833  4.543   3.794   1.00 81.79  ? 26   LYS B CE    1 
ATOM   216  N  NZ    . LYS A 1 26  ? 13.831  5.626   3.567   1.00 83.40  ? 26   LYS B NZ    1 
ATOM   217  N  N     . PRO A 1 27  ? 15.756  -1.925  4.727   1.00 51.98  ? 27   PRO B N     1 
ATOM   218  C  CA    . PRO A 1 27  ? 15.749  -3.128  3.896   1.00 47.52  ? 27   PRO B CA    1 
ATOM   219  C  C     . PRO A 1 27  ? 15.039  -2.838  2.583   1.00 45.46  ? 27   PRO B C     1 
ATOM   220  O  O     . PRO A 1 27  ? 13.926  -2.313  2.571   1.00 45.16  ? 27   PRO B O     1 
ATOM   221  C  CB    . PRO A 1 27  ? 14.985  -4.128  4.750   1.00 48.96  ? 27   PRO B CB    1 
ATOM   222  C  CG    . PRO A 1 27  ? 13.968  -3.260  5.409   1.00 48.79  ? 27   PRO B CG    1 
ATOM   223  C  CD    . PRO A 1 27  ? 14.790  -2.052  5.833   1.00 50.84  ? 27   PRO B CD    1 
ATOM   224  N  N     . VAL A 1 28  ? 15.698  -3.170  1.481   1.00 43.21  ? 28   VAL B N     1 
ATOM   225  C  CA    . VAL A 1 28  ? 15.135  -2.967  0.154   1.00 38.13  ? 28   VAL B CA    1 
ATOM   226  C  C     . VAL A 1 28  ? 14.857  -4.322  -0.477  1.00 37.69  ? 28   VAL B C     1 
ATOM   227  O  O     . VAL A 1 28  ? 15.552  -5.293  -0.193  1.00 35.86  ? 28   VAL B O     1 
ATOM   228  C  CB    . VAL A 1 28  ? 16.105  -2.193  -0.741  1.00 39.52  ? 28   VAL B CB    1 
ATOM   229  C  CG1   . VAL A 1 28  ? 15.738  -2.393  -2.193  1.00 42.03  ? 28   VAL B CG1   1 
ATOM   230  C  CG2   . VAL A 1 28  ? 16.056  -0.724  -0.394  1.00 41.73  ? 28   VAL B CG2   1 
ATOM   231  N  N     . VAL A 1 29  ? 13.855  -4.389  -1.345  1.00 33.87  ? 29   VAL B N     1 
ATOM   232  C  CA    . VAL A 1 29  ? 13.507  -5.653  -1.976  1.00 28.97  ? 29   VAL B CA    1 
ATOM   233  C  C     . VAL A 1 29  ? 13.023  -5.465  -3.427  1.00 32.58  ? 29   VAL B C     1 
ATOM   234  O  O     . VAL A 1 29  ? 11.875  -5.082  -3.656  1.00 30.60  ? 29   VAL B O     1 
ATOM   235  C  CB    . VAL A 1 29  ? 12.415  -6.358  -1.126  1.00 28.49  ? 29   VAL B CB    1 
ATOM   236  C  CG1   . VAL A 1 29  ? 12.176  -7.768  -1.626  1.00 23.36  ? 29   VAL B CG1   1 
ATOM   237  C  CG2   . VAL A 1 29  ? 12.834  -6.372  0.350   1.00 23.55  ? 29   VAL B CG2   1 
ATOM   238  N  N     . VAL A 1 30  ? 13.891  -5.724  -4.404  1.00 32.96  ? 30   VAL B N     1 
ATOM   239  C  CA    . VAL A 1 30  ? 13.493  -5.573  -5.806  1.00 32.52  ? 30   VAL B CA    1 
ATOM   240  C  C     . VAL A 1 30  ? 12.684  -6.791  -6.221  1.00 37.31  ? 30   VAL B C     1 
ATOM   241  O  O     . VAL A 1 30  ? 13.200  -7.906  -6.248  1.00 39.33  ? 30   VAL B O     1 
ATOM   242  C  CB    . VAL A 1 30  ? 14.706  -5.457  -6.750  1.00 32.88  ? 30   VAL B CB    1 
ATOM   243  C  CG1   . VAL A 1 30  ? 14.233  -5.096  -8.155  1.00 30.75  ? 30   VAL B CG1   1 
ATOM   244  C  CG2   . VAL A 1 30  ? 15.676  -4.416  -6.226  1.00 30.80  ? 30   VAL B CG2   1 
ATOM   245  N  N     . CYS A 1 31  ? 11.418  -6.582  -6.557  1.00 41.75  ? 31   CYS B N     1 
ATOM   246  C  CA    . CYS A 1 31  ? 10.573  -7.704  -6.933  1.00 44.26  ? 31   CYS B CA    1 
ATOM   247  C  C     . CYS A 1 31  ? 10.170  -7.729  -8.386  1.00 44.97  ? 31   CYS B C     1 
ATOM   248  O  O     . CYS A 1 31  ? 10.210  -6.717  -9.085  1.00 44.45  ? 31   CYS B O     1 
ATOM   249  C  CB    . CYS A 1 31  ? 9.282   -7.703  -6.118  1.00 46.08  ? 31   CYS B CB    1 
ATOM   250  S  SG    . CYS A 1 31  ? 9.368   -6.876  -4.525  1.00 51.82  ? 31   CYS B SG    1 
ATOM   251  N  N     . VAL A 1 32  ? 9.769   -8.913  -8.824  1.00 43.29  ? 32   VAL B N     1 
ATOM   252  C  CA    . VAL A 1 32  ? 9.271   -9.105  -10.167 1.00 44.45  ? 32   VAL B CA    1 
ATOM   253  C  C     . VAL A 1 32  ? 7.776   -9.330  -9.986  1.00 45.59  ? 32   VAL B C     1 
ATOM   254  O  O     . VAL A 1 32  ? 7.358   -10.380 -9.499  1.00 44.75  ? 32   VAL B O     1 
ATOM   255  C  CB    . VAL A 1 32  ? 9.870   -10.342 -10.831 1.00 43.39  ? 32   VAL B CB    1 
ATOM   256  C  CG1   . VAL A 1 32  ? 8.925   -10.853 -11.899 1.00 36.81  ? 32   VAL B CG1   1 
ATOM   257  C  CG2   . VAL A 1 32  ? 11.190  -9.994  -11.463 1.00 39.39  ? 32   VAL B CG2   1 
ATOM   258  N  N     . PHE A 1 33  ? 6.976   -8.335  -10.354 1.00 48.30  ? 33   PHE B N     1 
ATOM   259  C  CA    . PHE A 1 33  ? 5.524   -8.434  -10.231 1.00 49.68  ? 33   PHE B CA    1 
ATOM   260  C  C     . PHE A 1 33  ? 4.958   -9.082  -11.500 1.00 52.59  ? 33   PHE B C     1 
ATOM   261  O  O     . PHE A 1 33  ? 4.876   -8.442  -12.550 1.00 54.05  ? 33   PHE B O     1 
ATOM   262  C  CB    . PHE A 1 33  ? 4.902   -7.039  -10.037 1.00 48.30  ? 33   PHE B CB    1 
ATOM   263  C  CG    . PHE A 1 33  ? 5.260   -6.366  -8.725  1.00 46.91  ? 33   PHE B CG    1 
ATOM   264  C  CD1   . PHE A 1 33  ? 5.052   -7.011  -7.510  1.00 45.48  ? 33   PHE B CD1   1 
ATOM   265  C  CD2   . PHE A 1 33  ? 5.750   -5.060  -8.707  1.00 46.59  ? 33   PHE B CD2   1 
ATOM   266  C  CE1   . PHE A 1 33  ? 5.325   -6.366  -6.295  1.00 44.57  ? 33   PHE B CE1   1 
ATOM   267  C  CE2   . PHE A 1 33  ? 6.024   -4.409  -7.500  1.00 45.40  ? 33   PHE B CE2   1 
ATOM   268  C  CZ    . PHE A 1 33  ? 5.809   -5.063  -6.294  1.00 44.60  ? 33   PHE B CZ    1 
ATOM   269  N  N     . SER A 1 34  ? 4.560   -10.347 -11.391 1.00 57.55  ? 34   SER B N     1 
ATOM   270  C  CA    . SER A 1 34  ? 4.023   -11.109 -12.523 1.00 61.42  ? 34   SER B CA    1 
ATOM   271  C  C     . SER A 1 34  ? 2.759   -10.536 -13.156 1.00 67.16  ? 34   SER B C     1 
ATOM   272  O  O     . SER A 1 34  ? 2.678   -10.402 -14.375 1.00 64.48  ? 34   SER B O     1 
ATOM   273  C  CB    . SER A 1 34  ? 3.743   -12.542 -12.094 1.00 63.27  ? 34   SER B CB    1 
ATOM   274  O  OG    . SER A 1 34  ? 2.689   -12.568 -11.153 1.00 62.75  ? 34   SER B OG    1 
ATOM   275  N  N     . GLY A 1 35  ? 1.753   -10.243 -12.341 1.00 68.50  ? 35   GLY B N     1 
ATOM   276  C  CA    . GLY A 1 35  ? 0.540   -9.669  -12.892 1.00 73.83  ? 35   GLY B CA    1 
ATOM   277  C  C     . GLY A 1 35  ? -0.756  -10.458 -12.899 1.00 75.07  ? 35   GLY B C     1 
ATOM   278  O  O     . GLY A 1 35  ? -1.505  -10.385 -13.874 1.00 75.79  ? 35   GLY B O     1 
ATOM   279  N  N     . ARG A 1 36  ? -1.034  -11.218 -11.846 1.00 77.62  ? 36   ARG B N     1 
ATOM   280  C  CA    . ARG A 1 36  ? -2.299  -11.942 -11.787 1.00 79.41  ? 36   ARG B CA    1 
ATOM   281  C  C     . ARG A 1 36  ? -2.982  -11.823 -10.431 1.00 80.29  ? 36   ARG B C     1 
ATOM   282  O  O     . ARG A 1 36  ? -3.842  -12.631 -10.088 1.00 78.31  ? 36   ARG B O     1 
ATOM   283  C  CB    . ARG A 1 36  ? -2.144  -13.418 -12.171 1.00 77.71  ? 36   ARG B CB    1 
ATOM   284  C  CG    . ARG A 1 36  ? -0.746  -13.984 -12.174 1.00 81.22  ? 36   ARG B CG    1 
ATOM   285  C  CD    . ARG A 1 36  ? -0.846  -15.433 -12.624 1.00 83.54  ? 36   ARG B CD    1 
ATOM   286  N  NE    . ARG A 1 36  ? -1.559  -15.537 -13.896 1.00 85.30  ? 36   ARG B NE    1 
ATOM   287  C  CZ    . ARG A 1 36  ? -2.481  -16.454 -14.183 1.00 85.68  ? 36   ARG B CZ    1 
ATOM   288  N  NH1   . ARG A 1 36  ? -2.829  -17.370 -13.289 1.00 85.27  ? 36   ARG B NH1   1 
ATOM   289  N  NH2   . ARG A 1 36  ? -3.060  -16.450 -15.375 1.00 86.06  ? 36   ARG B NH2   1 
ATOM   290  N  N     . PHE A 1 37  ? -2.577  -10.805 -9.673  1.00 82.21  ? 37   PHE B N     1 
ATOM   291  C  CA    . PHE A 1 37  ? -3.139  -10.479 -8.360  1.00 86.89  ? 37   PHE B CA    1 
ATOM   292  C  C     . PHE A 1 37  ? -2.188  -9.685  -7.475  1.00 89.70  ? 37   PHE B C     1 
ATOM   293  O  O     . PHE A 1 37  ? -0.974  -9.677  -7.689  1.00 91.53  ? 37   PHE B O     1 
ATOM   294  C  CB    . PHE A 1 37  ? -3.653  -11.733 -7.618  1.00 85.73  ? 37   PHE B CB    1 
ATOM   295  C  CG    . PHE A 1 37  ? -2.577  -12.639 -7.065  1.00 83.27  ? 37   PHE B CG    1 
ATOM   296  C  CD1   . PHE A 1 37  ? -1.856  -12.289 -5.925  1.00 82.62  ? 37   PHE B CD1   1 
ATOM   297  C  CD2   . PHE A 1 37  ? -2.349  -13.887 -7.638  1.00 82.44  ? 37   PHE B CD2   1 
ATOM   298  C  CE1   . PHE A 1 37  ? -0.930  -13.173 -5.361  1.00 83.21  ? 37   PHE B CE1   1 
ATOM   299  C  CE2   . PHE A 1 37  ? -1.428  -14.778 -7.083  1.00 83.13  ? 37   PHE B CE2   1 
ATOM   300  C  CZ    . PHE A 1 37  ? -0.718  -14.420 -5.941  1.00 83.37  ? 37   PHE B CZ    1 
ATOM   301  N  N     . GLU A 1 38  ? -2.764  -9.005  -6.486  1.00 93.80  ? 38   GLU B N     1 
ATOM   302  C  CA    . GLU A 1 38  ? -2.003  -8.185  -5.556  1.00 95.35  ? 38   GLU B CA    1 
ATOM   303  C  C     . GLU A 1 38  ? -0.744  -8.902  -5.092  1.00 93.39  ? 38   GLU B C     1 
ATOM   304  O  O     . GLU A 1 38  ? -0.804  -9.955  -4.459  1.00 95.72  ? 38   GLU B O     1 
ATOM   305  C  CB    . GLU A 1 38  ? -2.861  -7.814  -4.338  1.00 100.89 ? 38   GLU B CB    1 
ATOM   306  C  CG    . GLU A 1 38  ? -2.180  -6.864  -3.347  1.00 112.65 ? 38   GLU B CG    1 
ATOM   307  C  CD    . GLU A 1 38  ? -2.140  -5.422  -3.828  1.00 118.22 ? 38   GLU B CD    1 
ATOM   308  O  OE1   . GLU A 1 38  ? -1.861  -5.196  -5.024  1.00 121.66 ? 38   GLU B OE1   1 
ATOM   309  O  OE2   . GLU A 1 38  ? -2.378  -4.513  -3.004  1.00 121.24 ? 38   GLU B OE2   1 
ATOM   310  N  N     . ASP A 1 39  ? 0.396   -8.322  -5.440  1.00 89.09  ? 39   ASP B N     1 
ATOM   311  C  CA    . ASP A 1 39  ? 1.695   -8.851  -5.060  1.00 82.75  ? 39   ASP B CA    1 
ATOM   312  C  C     . ASP A 1 39  ? 2.004   -10.292 -5.470  1.00 78.95  ? 39   ASP B C     1 
ATOM   313  O  O     . ASP A 1 39  ? 2.396   -11.108 -4.634  1.00 76.52  ? 39   ASP B O     1 
ATOM   314  C  CB    . ASP A 1 39  ? 1.884   -8.694  -3.547  1.00 84.02  ? 39   ASP B CB    1 
ATOM   315  C  CG    . ASP A 1 39  ? 1.673   -7.263  -3.077  1.00 83.81  ? 39   ASP B CG    1 
ATOM   316  O  OD1   . ASP A 1 39  ? 2.226   -6.338  -3.709  1.00 81.77  ? 39   ASP B OD1   1 
ATOM   317  O  OD2   . ASP A 1 39  ? 0.960   -7.063  -2.071  1.00 82.00  ? 39   ASP B OD2   1 
ATOM   318  N  N     . SER A 1 40  ? 1.825   -10.614 -6.747  1.00 71.52  ? 40   SER B N     1 
ATOM   319  C  CA    . SER A 1 40  ? 2.162   -11.952 -7.214  1.00 64.44  ? 40   SER B CA    1 
ATOM   320  C  C     . SER A 1 40  ? 3.422   -11.784 -8.059  1.00 60.80  ? 40   SER B C     1 
ATOM   321  O  O     . SER A 1 40  ? 3.515   -10.868 -8.876  1.00 60.66  ? 40   SER B O     1 
ATOM   322  C  CB    . SER A 1 40  ? 1.030   -12.565 -8.047  1.00 64.89  ? 40   SER B CB    1 
ATOM   323  O  OG    . SER A 1 40  ? 0.995   -12.024 -9.351  1.00 56.72  ? 40   SER B OG    1 
ATOM   324  N  N     . GLY A 1 41  ? 4.390   -12.663 -7.837  1.00 56.76  ? 41   GLY B N     1 
ATOM   325  C  CA    . GLY A 1 41  ? 5.652   -12.602 -8.551  1.00 50.73  ? 41   GLY B CA    1 
ATOM   326  C  C     . GLY A 1 41  ? 6.696   -13.145 -7.600  1.00 47.12  ? 41   GLY B C     1 
ATOM   327  O  O     . GLY A 1 41  ? 6.397   -14.049 -6.825  1.00 48.39  ? 41   GLY B O     1 
ATOM   328  N  N     . ALA A 1 42  ? 7.912   -12.619 -7.633  1.00 45.11  ? 42   ALA B N     1 
ATOM   329  C  CA    . ALA A 1 42  ? 8.927   -13.113 -6.712  1.00 42.76  ? 42   ALA B CA    1 
ATOM   330  C  C     . ALA A 1 42  ? 9.987   -12.067 -6.440  1.00 39.60  ? 42   ALA B C     1 
ATOM   331  O  O     . ALA A 1 42  ? 9.976   -10.990 -7.033  1.00 38.96  ? 42   ALA B O     1 
ATOM   332  C  CB    . ALA A 1 42  ? 9.564   -14.378 -7.253  1.00 44.15  ? 42   ALA B CB    1 
ATOM   333  N  N     . VAL A 1 43  ? 10.907  -12.385 -5.541  1.00 36.90  ? 43   VAL B N     1 
ATOM   334  C  CA    . VAL A 1 43  ? 11.956  -11.445 -5.197  1.00 37.72  ? 43   VAL B CA    1 
ATOM   335  C  C     . VAL A 1 43  ? 13.192  -11.647 -6.060  1.00 33.07  ? 43   VAL B C     1 
ATOM   336  O  O     . VAL A 1 43  ? 13.789  -12.723 -6.073  1.00 33.52  ? 43   VAL B O     1 
ATOM   337  C  CB    . VAL A 1 43  ? 12.359  -11.576 -3.716  1.00 37.67  ? 43   VAL B CB    1 
ATOM   338  C  CG1   . VAL A 1 43  ? 13.000  -10.296 -3.247  1.00 39.87  ? 43   VAL B CG1   1 
ATOM   339  C  CG2   . VAL A 1 43  ? 11.149  -11.887 -2.867  1.00 39.43  ? 43   VAL B CG2   1 
ATOM   340  N  N     . ALA A 1 44  ? 13.564  -10.607 -6.798  1.00 31.30  ? 44   ALA B N     1 
ATOM   341  C  CA    . ALA A 1 44  ? 14.746  -10.664 -7.643  1.00 31.49  ? 44   ALA B CA    1 
ATOM   342  C  C     . ALA A 1 44  ? 15.920  -10.627 -6.679  1.00 30.96  ? 44   ALA B C     1 
ATOM   343  O  O     . ALA A 1 44  ? 16.647  -11.604 -6.536  1.00 30.96  ? 44   ALA B O     1 
ATOM   344  C  CB    . ALA A 1 44  ? 14.784  -9.464  -8.576  1.00 26.42  ? 44   ALA B CB    1 
ATOM   345  N  N     . THR A 1 45  ? 16.091  -9.496  -6.006  1.00 32.98  ? 45   THR B N     1 
ATOM   346  C  CA    . THR A 1 45  ? 17.156  -9.366  -5.026  1.00 38.73  ? 45   THR B CA    1 
ATOM   347  C  C     . THR A 1 45  ? 16.704  -8.512  -3.849  1.00 36.62  ? 45   THR B C     1 
ATOM   348  O  O     . THR A 1 45  ? 15.678  -7.835  -3.911  1.00 39.42  ? 45   THR B O     1 
ATOM   349  C  CB    . THR A 1 45  ? 18.430  -8.760  -5.639  1.00 39.25  ? 45   THR B CB    1 
ATOM   350  O  OG1   . THR A 1 45  ? 19.482  -8.797  -4.669  1.00 43.12  ? 45   THR B OG1   1 
ATOM   351  C  CG2   . THR A 1 45  ? 18.193  -7.322  -6.057  1.00 43.26  ? 45   THR B CG2   1 
ATOM   352  N  N     . ALA A 1 46  ? 17.473  -8.553  -2.770  1.00 38.45  ? 46   ALA B N     1 
ATOM   353  C  CA    . ALA A 1 46  ? 17.142  -7.791  -1.574  1.00 38.58  ? 46   ALA B CA    1 
ATOM   354  C  C     . ALA A 1 46  ? 18.429  -7.419  -0.856  1.00 37.84  ? 46   ALA B C     1 
ATOM   355  O  O     . ALA A 1 46  ? 19.197  -8.306  -0.482  1.00 36.45  ? 46   ALA B O     1 
ATOM   356  C  CB    . ALA A 1 46  ? 16.265  -8.631  -0.660  1.00 38.81  ? 46   ALA B CB    1 
ATOM   357  N  N     . ASN A 1 47  ? 18.670  -6.126  -0.653  1.00 37.32  ? 47   ASN B N     1 
ATOM   358  C  CA    . ASN A 1 47  ? 19.895  -5.713  0.020   1.00 40.83  ? 47   ASN B CA    1 
ATOM   359  C  C     . ASN A 1 47  ? 20.153  -6.549  1.275   1.00 42.20  ? 47   ASN B C     1 
ATOM   360  O  O     . ASN A 1 47  ? 19.279  -7.288  1.731   1.00 42.34  ? 47   ASN B O     1 
ATOM   361  C  CB    . ASN A 1 47  ? 19.864  -4.212  0.341   1.00 40.92  ? 47   ASN B CB    1 
ATOM   362  C  CG    . ASN A 1 47  ? 18.814  -3.843  1.365   1.00 39.75  ? 47   ASN B CG    1 
ATOM   363  O  OD1   . ASN A 1 47  ? 18.029  -4.681  1.807   1.00 39.71  ? 47   ASN B OD1   1 
ATOM   364  N  ND2   . ASN A 1 47  ? 18.795  -2.572  1.750   1.00 40.58  ? 47   ASN B ND2   1 
ATOM   365  N  N     . TYR A 1 48  ? 21.351  -6.441  1.837   1.00 44.51  ? 48   TYR B N     1 
ATOM   366  C  CA    . TYR A 1 48  ? 21.672  -7.265  2.993   1.00 47.69  ? 48   TYR B CA    1 
ATOM   367  C  C     . TYR A 1 48  ? 20.873  -7.028  4.256   1.00 49.54  ? 48   TYR B C     1 
ATOM   368  O  O     . TYR A 1 48  ? 20.805  -7.911  5.110   1.00 50.39  ? 48   TYR B O     1 
ATOM   369  C  CB    . TYR A 1 48  ? 23.167  -7.209  3.309   1.00 45.94  ? 48   TYR B CB    1 
ATOM   370  C  CG    . TYR A 1 48  ? 23.998  -7.988  2.319   1.00 44.56  ? 48   TYR B CG    1 
ATOM   371  C  CD1   . TYR A 1 48  ? 24.242  -7.482  1.047   1.00 44.85  ? 48   TYR B CD1   1 
ATOM   372  C  CD2   . TYR A 1 48  ? 24.527  -9.239  2.644   1.00 43.56  ? 48   TYR B CD2   1 
ATOM   373  C  CE1   . TYR A 1 48  ? 24.991  -8.195  0.118   1.00 45.29  ? 48   TYR B CE1   1 
ATOM   374  C  CE2   . TYR A 1 48  ? 25.282  -9.964  1.716   1.00 44.72  ? 48   TYR B CE2   1 
ATOM   375  C  CZ    . TYR A 1 48  ? 25.509  -9.428  0.456   1.00 45.34  ? 48   TYR B CZ    1 
ATOM   376  O  OH    . TYR A 1 48  ? 26.271  -10.099 -0.469  1.00 45.33  ? 48   TYR B OH    1 
ATOM   377  N  N     . GLU A 1 49  ? 20.267  -5.855  4.391   1.00 53.74  ? 49   GLU B N     1 
ATOM   378  C  CA    . GLU A 1 49  ? 19.467  -5.590  5.576   1.00 56.89  ? 49   GLU B CA    1 
ATOM   379  C  C     . GLU A 1 49  ? 18.191  -6.417  5.487   1.00 56.14  ? 49   GLU B C     1 
ATOM   380  O  O     . GLU A 1 49  ? 17.571  -6.739  6.501   1.00 57.85  ? 49   GLU B O     1 
ATOM   381  C  CB    . GLU A 1 49  ? 19.127  -4.099  5.686   1.00 61.31  ? 49   GLU B CB    1 
ATOM   382  C  CG    . GLU A 1 49  ? 20.258  -3.217  6.234   1.00 71.58  ? 49   GLU B CG    1 
ATOM   383  C  CD    . GLU A 1 49  ? 21.270  -2.786  5.181   1.00 76.31  ? 49   GLU B CD    1 
ATOM   384  O  OE1   . GLU A 1 49  ? 20.882  -2.065  4.238   1.00 78.61  ? 49   GLU B OE1   1 
ATOM   385  O  OE2   . GLU A 1 49  ? 22.455  -3.160  5.301   1.00 79.12  ? 49   GLU B OE2   1 
ATOM   386  N  N     . ALA A 1 50  ? 17.807  -6.777  4.269   1.00 55.53  ? 50   ALA B N     1 
ATOM   387  C  CA    . ALA A 1 50  ? 16.598  -7.560  4.093   1.00 53.89  ? 50   ALA B CA    1 
ATOM   388  C  C     . ALA A 1 50  ? 16.867  -9.052  4.205   1.00 51.83  ? 50   ALA B C     1 
ATOM   389  O  O     . ALA A 1 50  ? 16.012  -9.801  4.672   1.00 49.34  ? 50   ALA B O     1 
ATOM   390  C  CB    . ALA A 1 50  ? 15.968  -7.251  2.759   1.00 56.22  ? 50   ALA B CB    1 
ATOM   391  N  N     . ARG A 1 51  ? 18.049  -9.487  3.784   1.00 49.98  ? 51   ARG B N     1 
ATOM   392  C  CA    . ARG A 1 51  ? 18.367  -10.906 3.842   1.00 51.59  ? 51   ARG B CA    1 
ATOM   393  C  C     . ARG A 1 51  ? 18.501  -11.394 5.269   1.00 51.36  ? 51   ARG B C     1 
ATOM   394  O  O     . ARG A 1 51  ? 18.102  -12.515 5.581   1.00 52.31  ? 51   ARG B O     1 
ATOM   395  C  CB    . ARG A 1 51  ? 19.655  -11.211 3.079   1.00 47.15  ? 51   ARG B CB    1 
ATOM   396  C  CG    . ARG A 1 51  ? 19.680  -10.632 1.689   1.00 43.67  ? 51   ARG B CG    1 
ATOM   397  C  CD    . ARG A 1 51  ? 20.891  -11.076 0.903   1.00 43.92  ? 51   ARG B CD    1 
ATOM   398  N  NE    . ARG A 1 51  ? 20.932  -10.399 -0.387  1.00 45.46  ? 51   ARG B NE    1 
ATOM   399  C  CZ    . ARG A 1 51  ? 21.800  -10.679 -1.350  1.00 45.70  ? 51   ARG B CZ    1 
ATOM   400  N  NH1   . ARG A 1 51  ? 22.705  -11.631 -1.171  1.00 46.42  ? 51   ARG B NH1   1 
ATOM   401  N  NH2   . ARG A 1 51  ? 21.765  -10.005 -2.489  1.00 45.19  ? 51   ARG B NH2   1 
ATOM   402  N  N     . LYS A 1 52  ? 19.060  -10.553 6.136   1.00 54.62  ? 52   LYS B N     1 
ATOM   403  C  CA    . LYS A 1 52  ? 19.243  -10.922 7.536   1.00 57.62  ? 52   LYS B CA    1 
ATOM   404  C  C     . LYS A 1 52  ? 17.960  -11.491 8.108   1.00 54.23  ? 52   LYS B C     1 
ATOM   405  O  O     . LYS A 1 52  ? 17.981  -12.189 9.119   1.00 57.17  ? 52   LYS B O     1 
ATOM   406  C  CB    . LYS A 1 52  ? 19.639  -9.712  8.392   1.00 61.11  ? 52   LYS B CB    1 
ATOM   407  C  CG    . LYS A 1 52  ? 21.003  -9.116  8.112   1.00 74.76  ? 52   LYS B CG    1 
ATOM   408  C  CD    . LYS A 1 52  ? 21.334  -8.024  9.126   1.00 86.71  ? 52   LYS B CD    1 
ATOM   409  C  CE    . LYS A 1 52  ? 20.132  -7.117  9.364   1.00 95.14  ? 52   LYS B CE    1 
ATOM   410  N  NZ    . LYS A 1 52  ? 20.515  -5.738  9.755   1.00 98.87  ? 52   LYS B NZ    1 
ATOM   411  N  N     . PHE A 1 53  ? 16.844  -11.193 7.452   1.00 52.88  ? 53   PHE B N     1 
ATOM   412  C  CA    . PHE A 1 53  ? 15.545  -11.644 7.922   1.00 50.72  ? 53   PHE B CA    1 
ATOM   413  C  C     . PHE A 1 53  ? 14.836  -12.736 7.144   1.00 50.27  ? 53   PHE B C     1 
ATOM   414  O  O     . PHE A 1 53  ? 13.672  -13.028 7.422   1.00 47.82  ? 53   PHE B O     1 
ATOM   415  C  CB    . PHE A 1 53  ? 14.621  -10.445 8.044   1.00 48.89  ? 53   PHE B CB    1 
ATOM   416  C  CG    . PHE A 1 53  ? 14.910  -9.604  9.230   1.00 49.16  ? 53   PHE B CG    1 
ATOM   417  C  CD1   . PHE A 1 53  ? 14.651  -10.090 10.502  1.00 49.58  ? 53   PHE B CD1   1 
ATOM   418  C  CD2   . PHE A 1 53  ? 15.466  -8.340  9.088   1.00 48.98  ? 53   PHE B CD2   1 
ATOM   419  C  CE1   . PHE A 1 53  ? 14.939  -9.333  11.619  1.00 48.98  ? 53   PHE B CE1   1 
ATOM   420  C  CE2   . PHE A 1 53  ? 15.759  -7.572  10.202  1.00 48.35  ? 53   PHE B CE2   1 
ATOM   421  C  CZ    . PHE A 1 53  ? 15.494  -8.071  11.473  1.00 48.66  ? 53   PHE B CZ    1 
ATOM   422  N  N     . GLY A 1 54  ? 15.510  -13.338 6.172   1.00 48.76  ? 54   GLY B N     1 
ATOM   423  C  CA    . GLY A 1 54  ? 14.868  -14.400 5.422   1.00 49.58  ? 54   GLY B CA    1 
ATOM   424  C  C     . GLY A 1 54  ? 14.445  -14.058 4.007   1.00 49.02  ? 54   GLY B C     1 
ATOM   425  O  O     . GLY A 1 54  ? 14.187  -14.959 3.209   1.00 49.32  ? 54   GLY B O     1 
ATOM   426  N  N     . VAL A 1 55  ? 14.363  -12.769 3.692   1.00 51.23  ? 55   VAL B N     1 
ATOM   427  C  CA    . VAL A 1 55  ? 13.974  -12.335 2.353   1.00 52.24  ? 55   VAL B CA    1 
ATOM   428  C  C     . VAL A 1 55  ? 15.175  -12.490 1.429   1.00 51.30  ? 55   VAL B C     1 
ATOM   429  O  O     . VAL A 1 55  ? 16.229  -11.907 1.678   1.00 51.84  ? 55   VAL B O     1 
ATOM   430  C  CB    . VAL A 1 55  ? 13.554  -10.846 2.333   1.00 51.08  ? 55   VAL B CB    1 
ATOM   431  C  CG1   . VAL A 1 55  ? 12.982  -10.484 0.970   1.00 53.53  ? 55   VAL B CG1   1 
ATOM   432  C  CG2   . VAL A 1 55  ? 12.541  -10.570 3.428   1.00 53.97  ? 55   VAL B CG2   1 
ATOM   433  N  N     . LYS A 1 56  ? 15.024  -13.277 0.370   1.00 50.06  ? 56   LYS B N     1 
ATOM   434  C  CA    . LYS A 1 56  ? 16.116  -13.475 -0.573  1.00 50.64  ? 56   LYS B CA    1 
ATOM   435  C  C     . LYS A 1 56  ? 15.572  -13.749 -1.961  1.00 46.87  ? 56   LYS B C     1 
ATOM   436  O  O     . LYS A 1 56  ? 14.362  -13.847 -2.155  1.00 46.64  ? 56   LYS B O     1 
ATOM   437  C  CB    . LYS A 1 56  ? 17.004  -14.637 -0.135  1.00 54.75  ? 56   LYS B CB    1 
ATOM   438  C  CG    . LYS A 1 56  ? 16.327  -15.994 -0.159  1.00 63.52  ? 56   LYS B CG    1 
ATOM   439  C  CD    . LYS A 1 56  ? 17.352  -17.071 0.126   1.00 72.39  ? 56   LYS B CD    1 
ATOM   440  C  CE    . LYS A 1 56  ? 16.756  -18.464 0.114   1.00 78.09  ? 56   LYS B CE    1 
ATOM   441  N  NZ    . LYS A 1 56  ? 17.816  -19.466 0.413   1.00 81.18  ? 56   LYS B NZ    1 
ATOM   442  N  N     . ALA A 1 57  ? 16.468  -13.873 -2.930  1.00 44.29  ? 57   ALA B N     1 
ATOM   443  C  CA    . ALA A 1 57  ? 16.042  -14.133 -4.290  1.00 41.34  ? 57   ALA B CA    1 
ATOM   444  C  C     . ALA A 1 57  ? 15.200  -15.393 -4.308  1.00 39.36  ? 57   ALA B C     1 
ATOM   445  O  O     . ALA A 1 57  ? 15.630  -16.443 -3.835  1.00 38.11  ? 57   ALA B O     1 
ATOM   446  C  CB    . ALA A 1 57  ? 17.242  -14.303 -5.192  1.00 41.27  ? 57   ALA B CB    1 
ATOM   447  N  N     . GLY A 1 58  ? 13.988  -15.282 -4.833  1.00 39.25  ? 58   GLY B N     1 
ATOM   448  C  CA    . GLY A 1 58  ? 13.137  -16.450 -4.906  1.00 40.79  ? 58   GLY B CA    1 
ATOM   449  C  C     . GLY A 1 58  ? 11.818  -16.427 -4.171  1.00 44.99  ? 58   GLY B C     1 
ATOM   450  O  O     . GLY A 1 58  ? 10.762  -16.472 -4.800  1.00 48.17  ? 58   GLY B O     1 
ATOM   451  N  N     . ILE A 1 59  ? 11.863  -16.370 -2.846  1.00 47.05  ? 59   ILE B N     1 
ATOM   452  C  CA    . ILE A 1 59  ? 10.632  -16.376 -2.083  1.00 44.98  ? 59   ILE B CA    1 
ATOM   453  C  C     . ILE A 1 59  ? 9.637   -15.371 -2.650  1.00 44.80  ? 59   ILE B C     1 
ATOM   454  O  O     . ILE A 1 59  ? 9.994   -14.252 -3.003  1.00 47.59  ? 59   ILE B O     1 
ATOM   455  C  CB    . ILE A 1 59  ? 10.902  -16.126 -0.580  1.00 45.98  ? 59   ILE B CB    1 
ATOM   456  C  CG1   . ILE A 1 59  ? 11.604  -14.786 -0.366  1.00 43.11  ? 59   ILE B CG1   1 
ATOM   457  C  CG2   . ILE A 1 59  ? 11.754  -17.255 -0.033  1.00 44.68  ? 59   ILE B CG2   1 
ATOM   458  C  CD1   . ILE A 1 59  ? 10.688  -13.706 0.145   1.00 39.30  ? 59   ILE B CD1   1 
ATOM   459  N  N     . PRO A 1 60  ? 8.369   -15.787 -2.777  1.00 47.90  ? 60   PRO B N     1 
ATOM   460  C  CA    . PRO A 1 60  ? 7.276   -14.971 -3.306  1.00 45.70  ? 60   PRO B CA    1 
ATOM   461  C  C     . PRO A 1 60  ? 7.219   -13.613 -2.642  1.00 45.97  ? 60   PRO B C     1 
ATOM   462  O  O     . PRO A 1 60  ? 7.511   -13.477 -1.456  1.00 49.26  ? 60   PRO B O     1 
ATOM   463  C  CB    . PRO A 1 60  ? 6.036   -15.796 -2.980  1.00 45.60  ? 60   PRO B CB    1 
ATOM   464  C  CG    . PRO A 1 60  ? 6.545   -17.187 -2.998  1.00 44.11  ? 60   PRO B CG    1 
ATOM   465  C  CD    . PRO A 1 60  ? 7.855   -17.068 -2.269  1.00 44.93  ? 60   PRO B CD    1 
ATOM   466  N  N     . ILE A 1 61  ? 6.830   -12.613 -3.416  1.00 48.68  ? 61   ILE B N     1 
ATOM   467  C  CA    . ILE A 1 61  ? 6.699   -11.260 -2.913  1.00 47.83  ? 61   ILE B CA    1 
ATOM   468  C  C     . ILE A 1 61  ? 5.773   -11.286 -1.712  1.00 46.92  ? 61   ILE B C     1 
ATOM   469  O  O     . ILE A 1 61  ? 5.825   -10.415 -0.842  1.00 46.90  ? 61   ILE B O     1 
ATOM   470  C  CB    . ILE A 1 61  ? 6.077   -10.364 -3.986  1.00 48.09  ? 61   ILE B CB    1 
ATOM   471  C  CG1   . ILE A 1 61  ? 7.019   -10.292 -5.184  1.00 50.27  ? 61   ILE B CG1   1 
ATOM   472  C  CG2   . ILE A 1 61  ? 5.765   -8.991  -3.416  1.00 48.76  ? 61   ILE B CG2   1 
ATOM   473  C  CD1   . ILE A 1 61  ? 6.490   -9.483  -6.318  1.00 53.34  ? 61   ILE B CD1   1 
ATOM   474  N  N     . VAL A 1 62  ? 4.933   -12.310 -1.670  1.00 48.15  ? 62   VAL B N     1 
ATOM   475  C  CA    . VAL A 1 62  ? 3.961   -12.449 -0.608  1.00 47.04  ? 62   VAL B CA    1 
ATOM   476  C  C     . VAL A 1 62  ? 4.512   -12.981 0.720   1.00 50.15  ? 62   VAL B C     1 
ATOM   477  O  O     . VAL A 1 62  ? 3.935   -12.718 1.776   1.00 48.35  ? 62   VAL B O     1 
ATOM   478  C  CB    . VAL A 1 62  ? 2.775   -13.298 -1.122  1.00 46.02  ? 62   VAL B CB    1 
ATOM   479  C  CG1   . VAL A 1 62  ? 2.522   -14.484 -0.213  1.00 45.51  ? 62   VAL B CG1   1 
ATOM   480  C  CG2   . VAL A 1 62  ? 1.538   -12.405 -1.272  1.00 43.04  ? 62   VAL B CG2   1 
ATOM   481  N  N     . GLU A 1 63  ? 5.618   -13.723 0.671   1.00 51.08  ? 63   GLU B N     1 
ATOM   482  C  CA    . GLU A 1 63  ? 6.244   -14.240 1.891   1.00 54.22  ? 63   GLU B CA    1 
ATOM   483  C  C     . GLU A 1 63  ? 7.136   -13.120 2.378   1.00 51.67  ? 63   GLU B C     1 
ATOM   484  O  O     . GLU A 1 63  ? 7.295   -12.896 3.580   1.00 53.00  ? 63   GLU B O     1 
ATOM   485  C  CB    . GLU A 1 63  ? 7.112   -15.468 1.602   1.00 59.87  ? 63   GLU B CB    1 
ATOM   486  C  CG    . GLU A 1 63  ? 6.392   -16.578 0.870   1.00 71.40  ? 63   GLU B CG    1 
ATOM   487  C  CD    . GLU A 1 63  ? 5.127   -17.011 1.579   1.00 78.70  ? 63   GLU B CD    1 
ATOM   488  O  OE1   . GLU A 1 63  ? 4.313   -16.134 1.932   1.00 84.08  ? 63   GLU B OE1   1 
ATOM   489  O  OE2   . GLU A 1 63  ? 4.941   -18.229 1.775   1.00 84.09  ? 63   GLU B OE2   1 
ATOM   490  N  N     . ALA A 1 64  ? 7.725   -12.417 1.420   1.00 50.93  ? 64   ALA B N     1 
ATOM   491  C  CA    . ALA A 1 64  ? 8.594   -11.306 1.742   1.00 49.01  ? 64   ALA B CA    1 
ATOM   492  C  C     . ALA A 1 64  ? 7.833   -10.343 2.638   1.00 48.32  ? 64   ALA B C     1 
ATOM   493  O  O     . ALA A 1 64  ? 8.310   -9.968  3.704   1.00 47.36  ? 64   ALA B O     1 
ATOM   494  C  CB    . ALA A 1 64  ? 9.031   -10.605 0.474   1.00 47.73  ? 64   ALA B CB    1 
ATOM   495  N  N     . LYS A 1 65  ? 6.633   -9.964  2.212   1.00 47.60  ? 65   LYS B N     1 
ATOM   496  C  CA    . LYS A 1 65  ? 5.830   -9.025  2.980   1.00 47.67  ? 65   LYS B CA    1 
ATOM   497  C  C     . LYS A 1 65  ? 5.288   -9.547  4.307   1.00 49.52  ? 65   LYS B C     1 
ATOM   498  O  O     . LYS A 1 65  ? 4.881   -8.759  5.161   1.00 50.17  ? 65   LYS B O     1 
ATOM   499  C  CB    . LYS A 1 65  ? 4.696   -8.486  2.112   1.00 48.08  ? 65   LYS B CB    1 
ATOM   500  C  CG    . LYS A 1 65  ? 5.208   -7.703  0.919   1.00 46.18  ? 65   LYS B CG    1 
ATOM   501  C  CD    . LYS A 1 65  ? 4.084   -6.972  0.230   1.00 44.48  ? 65   LYS B CD    1 
ATOM   502  C  CE    . LYS A 1 65  ? 4.569   -6.301  -1.039  1.00 43.62  ? 65   LYS B CE    1 
ATOM   503  N  NZ    . LYS A 1 65  ? 3.507   -5.450  -1.637  1.00 42.99  ? 65   LYS B NZ    1 
ATOM   504  N  N     . LYS A 1 66  ? 5.278   -10.866 4.482   1.00 51.47  ? 66   LYS B N     1 
ATOM   505  C  CA    . LYS A 1 66  ? 4.816   -11.472 5.730   1.00 51.69  ? 66   LYS B CA    1 
ATOM   506  C  C     . LYS A 1 66  ? 5.960   -11.376 6.734   1.00 52.50  ? 66   LYS B C     1 
ATOM   507  O  O     . LYS A 1 66  ? 5.747   -11.246 7.942   1.00 52.61  ? 66   LYS B O     1 
ATOM   508  C  CB    . LYS A 1 66  ? 4.465   -12.946 5.507   1.00 51.88  ? 66   LYS B CB    1 
ATOM   509  C  CG    . LYS A 1 66  ? 2.986   -13.276 5.640   1.00 51.60  ? 66   LYS B CG    1 
ATOM   510  C  CD    . LYS A 1 66  ? 2.680   -14.719 5.228   1.00 51.79  ? 66   LYS B CD    1 
ATOM   511  C  CE    . LYS A 1 66  ? 2.466   -14.852 3.718   1.00 51.51  ? 66   LYS B CE    1 
ATOM   512  N  NZ    . LYS A 1 66  ? 2.036   -16.217 3.275   1.00 50.47  ? 66   LYS B NZ    1 
ATOM   513  N  N     . ILE A 1 67  ? 7.178   -11.439 6.207   1.00 52.50  ? 67   ILE B N     1 
ATOM   514  C  CA    . ILE A 1 67  ? 8.389   -11.377 7.012   1.00 53.88  ? 67   ILE B CA    1 
ATOM   515  C  C     . ILE A 1 67  ? 8.840   -9.949  7.304   1.00 51.88  ? 67   ILE B C     1 
ATOM   516  O  O     . ILE A 1 67  ? 9.087   -9.597  8.456   1.00 52.70  ? 67   ILE B O     1 
ATOM   517  C  CB    . ILE A 1 67  ? 9.523   -12.144 6.313   1.00 54.33  ? 67   ILE B CB    1 
ATOM   518  C  CG1   . ILE A 1 67  ? 9.293   -13.646 6.482   1.00 54.69  ? 67   ILE B CG1   1 
ATOM   519  C  CG2   . ILE A 1 67  ? 10.875  -11.725 6.867   1.00 54.14  ? 67   ILE B CG2   1 
ATOM   520  C  CD1   . ILE A 1 67  ? 10.157  -14.497 5.591   1.00 56.44  ? 67   ILE B CD1   1 
ATOM   521  N  N     . LEU A 1 68  ? 8.954   -9.132  6.263   1.00 50.25  ? 68   LEU B N     1 
ATOM   522  C  CA    . LEU A 1 68  ? 9.369   -7.741  6.423   1.00 50.52  ? 68   LEU B CA    1 
ATOM   523  C  C     . LEU A 1 68  ? 8.345   -6.816  5.773   1.00 49.97  ? 68   LEU B C     1 
ATOM   524  O  O     . LEU A 1 68  ? 8.672   -6.055  4.864   1.00 47.99  ? 68   LEU B O     1 
ATOM   525  C  CB    . LEU A 1 68  ? 10.741  -7.518  5.783   1.00 49.92  ? 68   LEU B CB    1 
ATOM   526  C  CG    . LEU A 1 68  ? 11.986  -7.717  6.648   1.00 49.46  ? 68   LEU B CG    1 
ATOM   527  C  CD1   . LEU A 1 68  ? 13.222  -7.527  5.790   1.00 50.78  ? 68   LEU B CD1   1 
ATOM   528  C  CD2   . LEU A 1 68  ? 11.988  -6.714  7.789   1.00 50.77  ? 68   LEU B CD2   1 
ATOM   529  N  N     . PRO A 1 69  ? 7.094   -6.855  6.257   1.00 48.14  ? 69   PRO B N     1 
ATOM   530  C  CA    . PRO A 1 69  ? 5.962   -6.059  5.771   1.00 52.26  ? 69   PRO B CA    1 
ATOM   531  C  C     . PRO A 1 69  ? 6.200   -4.568  5.574   1.00 52.57  ? 69   PRO B C     1 
ATOM   532  O  O     . PRO A 1 69  ? 5.505   -3.931  4.784   1.00 50.70  ? 69   PRO B O     1 
ATOM   533  C  CB    . PRO A 1 69  ? 4.882   -6.328  6.816   1.00 48.26  ? 69   PRO B CB    1 
ATOM   534  C  CG    . PRO A 1 69  ? 5.671   -6.525  8.053   1.00 47.48  ? 69   PRO B CG    1 
ATOM   535  C  CD    . PRO A 1 69  ? 6.764   -7.444  7.566   1.00 47.95  ? 69   PRO B CD    1 
ATOM   536  N  N     . ASN A 1 70  ? 7.168   -4.002  6.282   1.00 53.63  ? 70   ASN B N     1 
ATOM   537  C  CA    . ASN A 1 70  ? 7.422   -2.574  6.146   1.00 58.70  ? 70   ASN B CA    1 
ATOM   538  C  C     . ASN A 1 70  ? 8.674   -2.199  5.360   1.00 55.46  ? 70   ASN B C     1 
ATOM   539  O  O     . ASN A 1 70  ? 9.216   -1.110  5.534   1.00 57.25  ? 70   ASN B O     1 
ATOM   540  C  CB    . ASN A 1 70  ? 7.453   -1.920  7.531   1.00 67.97  ? 70   ASN B CB    1 
ATOM   541  C  CG    . ASN A 1 70  ? 6.061   -1.677  8.091   1.00 76.17  ? 70   ASN B CG    1 
ATOM   542  O  OD1   . ASN A 1 70  ? 5.225   -1.043  7.446   1.00 84.77  ? 70   ASN B OD1   1 
ATOM   543  N  ND2   . ASN A 1 70  ? 5.808   -2.173  9.299   1.00 84.95  ? 70   ASN B ND2   1 
ATOM   544  N  N     . ALA A 1 71  ? 9.121   -3.086  4.477   1.00 51.79  ? 71   ALA B N     1 
ATOM   545  C  CA    . ALA A 1 71  ? 10.310  -2.812  3.678   1.00 46.39  ? 71   ALA B CA    1 
ATOM   546  C  C     . ALA A 1 71  ? 9.978   -2.097  2.372   1.00 43.01  ? 71   ALA B C     1 
ATOM   547  O  O     . ALA A 1 71  ? 8.832   -2.077  1.930   1.00 40.76  ? 71   ALA B O     1 
ATOM   548  C  CB    . ALA A 1 71  ? 11.051  -4.110  3.384   1.00 43.81  ? 71   ALA B CB    1 
ATOM   549  N  N     . VAL A 1 72  ? 10.997  -1.504  1.760   1.00 38.96  ? 72   VAL B N     1 
ATOM   550  C  CA    . VAL A 1 72  ? 10.830  -0.798  0.499   1.00 34.64  ? 72   VAL B CA    1 
ATOM   551  C  C     . VAL A 1 72  ? 10.800  -1.816  -0.628  1.00 36.54  ? 72   VAL B C     1 
ATOM   552  O  O     . VAL A 1 72  ? 11.840  -2.326  -1.039  1.00 35.64  ? 72   VAL B O     1 
ATOM   553  C  CB    . VAL A 1 72  ? 12.000  0.162   0.235   1.00 33.61  ? 72   VAL B CB    1 
ATOM   554  C  CG1   . VAL A 1 72  ? 11.580  1.235   -0.753  1.00 30.46  ? 72   VAL B CG1   1 
ATOM   555  C  CG2   . VAL A 1 72  ? 12.469  0.770   1.532   1.00 32.15  ? 72   VAL B CG2   1 
ATOM   556  N  N     . TYR A 1 73  ? 9.603   -2.120  -1.114  1.00 36.69  ? 73   TYR B N     1 
ATOM   557  C  CA    . TYR A 1 73  ? 9.440   -3.070  -2.207  1.00 36.92  ? 73   TYR B CA    1 
ATOM   558  C  C     . TYR A 1 73  ? 9.359   -2.262  -3.493  1.00 37.89  ? 73   TYR B C     1 
ATOM   559  O  O     . TYR A 1 73  ? 8.449   -1.450  -3.675  1.00 39.02  ? 73   TYR B O     1 
ATOM   560  C  CB    . TYR A 1 73  ? 8.163   -3.900  -2.011  1.00 36.47  ? 73   TYR B CB    1 
ATOM   561  C  CG    . TYR A 1 73  ? 8.231   -4.838  -0.823  1.00 35.85  ? 73   TYR B CG    1 
ATOM   562  C  CD1   . TYR A 1 73  ? 8.606   -6.175  -0.976  1.00 35.30  ? 73   TYR B CD1   1 
ATOM   563  C  CD2   . TYR A 1 73  ? 7.969   -4.373  0.464   1.00 36.23  ? 73   TYR B CD2   1 
ATOM   564  C  CE1   . TYR A 1 73  ? 8.723   -7.023  0.131   1.00 35.39  ? 73   TYR B CE1   1 
ATOM   565  C  CE2   . TYR A 1 73  ? 8.085   -5.207  1.571   1.00 35.47  ? 73   TYR B CE2   1 
ATOM   566  C  CZ    . TYR A 1 73  ? 8.463   -6.527  1.401   1.00 35.49  ? 73   TYR B CZ    1 
ATOM   567  O  OH    . TYR A 1 73  ? 8.602   -7.332  2.510   1.00 34.19  ? 73   TYR B OH    1 
ATOM   568  N  N     . LEU A 1 74  ? 10.320  -2.475  -4.381  1.00 37.79  ? 74   LEU B N     1 
ATOM   569  C  CA    . LEU A 1 74  ? 10.342  -1.742  -5.633  1.00 38.16  ? 74   LEU B CA    1 
ATOM   570  C  C     . LEU A 1 74  ? 10.268  -2.711  -6.792  1.00 38.41  ? 74   LEU B C     1 
ATOM   571  O  O     . LEU A 1 74  ? 10.718  -3.852  -6.692  1.00 37.05  ? 74   LEU B O     1 
ATOM   572  C  CB    . LEU A 1 74  ? 11.627  -0.926  -5.736  1.00 39.54  ? 74   LEU B CB    1 
ATOM   573  C  CG    . LEU A 1 74  ? 12.089  -0.290  -4.424  1.00 40.27  ? 74   LEU B CG    1 
ATOM   574  C  CD1   . LEU A 1 74  ? 13.527  0.199   -4.566  1.00 39.72  ? 74   LEU B CD1   1 
ATOM   575  C  CD2   . LEU A 1 74  ? 11.136  0.836   -4.039  1.00 40.04  ? 74   LEU B CD2   1 
ATOM   576  N  N     . PRO A 1 75  ? 9.702   -2.262  -7.917  1.00 37.72  ? 75   PRO B N     1 
ATOM   577  C  CA    . PRO A 1 75  ? 9.568   -3.088  -9.112  1.00 37.69  ? 75   PRO B CA    1 
ATOM   578  C  C     . PRO A 1 75  ? 10.923  -3.124  -9.800  1.00 37.86  ? 75   PRO B C     1 
ATOM   579  O  O     . PRO A 1 75  ? 11.735  -2.214  -9.633  1.00 35.01  ? 75   PRO B O     1 
ATOM   580  C  CB    . PRO A 1 75  ? 8.546   -2.321  -9.923  1.00 36.17  ? 75   PRO B CB    1 
ATOM   581  C  CG    . PRO A 1 75  ? 9.012   -0.909  -9.699  1.00 36.93  ? 75   PRO B CG    1 
ATOM   582  C  CD    . PRO A 1 75  ? 9.274   -0.879  -8.195  1.00 36.48  ? 75   PRO B CD    1 
ATOM   583  N  N     . MET A 1 76  ? 11.157  -4.168  -10.580 1.00 37.33  ? 76   MET B N     1 
ATOM   584  C  CA    . MET A 1 76  ? 12.417  -4.316  -11.284 1.00 39.89  ? 76   MET B CA    1 
ATOM   585  C  C     . MET A 1 76  ? 12.604  -3.351  -12.444 1.00 40.35  ? 76   MET B C     1 
ATOM   586  O  O     . MET A 1 76  ? 11.770  -3.271  -13.346 1.00 41.50  ? 76   MET B O     1 
ATOM   587  C  CB    . MET A 1 76  ? 12.555  -5.738  -11.808 1.00 40.94  ? 76   MET B CB    1 
ATOM   588  C  CG    . MET A 1 76  ? 13.762  -6.454  -11.280 1.00 41.76  ? 76   MET B CG    1 
ATOM   589  S  SD    . MET A 1 76  ? 14.161  -7.818  -12.353 1.00 43.69  ? 76   MET B SD    1 
ATOM   590  C  CE    . MET A 1 76  ? 15.449  -7.061  -13.328 1.00 45.29  ? 76   MET B CE    1 
ATOM   591  N  N     . ARG A 1 77  ? 13.710  -2.618  -12.403 1.00 42.41  ? 77   ARG B N     1 
ATOM   592  C  CA    . ARG A 1 77  ? 14.071  -1.682  -13.456 1.00 43.40  ? 77   ARG B CA    1 
ATOM   593  C  C     . ARG A 1 77  ? 15.293  -2.319  -14.096 1.00 41.99  ? 77   ARG B C     1 
ATOM   594  O  O     . ARG A 1 77  ? 16.426  -1.950  -13.803 1.00 41.23  ? 77   ARG B O     1 
ATOM   595  C  CB    . ARG A 1 77  ? 14.423  -0.312  -12.870 1.00 45.01  ? 77   ARG B CB    1 
ATOM   596  C  CG    . ARG A 1 77  ? 13.230  0.425   -12.289 1.00 51.67  ? 77   ARG B CG    1 
ATOM   597  C  CD    . ARG A 1 77  ? 13.395  1.915   -12.470 1.00 56.97  ? 77   ARG B CD    1 
ATOM   598  N  NE    . ARG A 1 77  ? 14.057  2.549   -11.337 1.00 60.69  ? 77   ARG B NE    1 
ATOM   599  C  CZ    . ARG A 1 77  ? 14.655  3.732   -11.400 1.00 62.60  ? 77   ARG B CZ    1 
ATOM   600  N  NH1   . ARG A 1 77  ? 14.678  4.400   -12.546 1.00 63.67  ? 77   ARG B NH1   1 
ATOM   601  N  NH2   . ARG A 1 77  ? 15.220  4.254   -10.320 1.00 63.90  ? 77   ARG B NH2   1 
ATOM   602  N  N     . LYS A 1 78  ? 15.047  -3.291  -14.966 1.00 41.72  ? 78   LYS B N     1 
ATOM   603  C  CA    . LYS A 1 78  ? 16.117  -4.025  -15.625 1.00 43.83  ? 78   LYS B CA    1 
ATOM   604  C  C     . LYS A 1 78  ? 16.898  -3.228  -16.660 1.00 45.36  ? 78   LYS B C     1 
ATOM   605  O  O     . LYS A 1 78  ? 18.122  -3.332  -16.727 1.00 45.17  ? 78   LYS B O     1 
ATOM   606  C  CB    . LYS A 1 78  ? 15.544  -5.292  -16.266 1.00 39.62  ? 78   LYS B CB    1 
ATOM   607  C  CG    . LYS A 1 78  ? 16.570  -6.199  -16.946 1.00 36.06  ? 78   LYS B CG    1 
ATOM   608  C  CD    . LYS A 1 78  ? 17.549  -6.810  -15.952 1.00 35.89  ? 78   LYS B CD    1 
ATOM   609  C  CE    . LYS A 1 78  ? 18.498  -7.806  -16.622 1.00 36.98  ? 78   LYS B CE    1 
ATOM   610  N  NZ    . LYS A 1 78  ? 17.866  -9.112  -16.990 1.00 36.25  ? 78   LYS B NZ    1 
ATOM   611  N  N     . GLU A 1 79  ? 16.199  -2.436  -17.468 1.00 48.23  ? 79   GLU B N     1 
ATOM   612  C  CA    . GLU A 1 79  ? 16.870  -1.645  -18.491 1.00 51.38  ? 79   GLU B CA    1 
ATOM   613  C  C     . GLU A 1 79  ? 17.864  -0.682  -17.844 1.00 49.57  ? 79   GLU B C     1 
ATOM   614  O  O     . GLU A 1 79  ? 18.875  -0.323  -18.451 1.00 51.99  ? 79   GLU B O     1 
ATOM   615  C  CB    . GLU A 1 79  ? 15.855  -0.850  -19.327 1.00 56.87  ? 79   GLU B CB    1 
ATOM   616  C  CG    . GLU A 1 79  ? 14.393  -1.230  -19.125 1.00 72.23  ? 79   GLU B CG    1 
ATOM   617  C  CD    . GLU A 1 79  ? 13.851  -0.781  -17.779 1.00 81.08  ? 79   GLU B CD    1 
ATOM   618  O  OE1   . GLU A 1 79  ? 14.167  0.351   -17.361 1.00 88.33  ? 79   GLU B OE1   1 
ATOM   619  O  OE2   . GLU A 1 79  ? 13.100  -1.553  -17.146 1.00 87.52  ? 79   GLU B OE2   1 
ATOM   620  N  N     . VAL A 1 80  ? 17.574  -0.282  -16.607 1.00 49.46  ? 80   VAL B N     1 
ATOM   621  C  CA    . VAL A 1 80  ? 18.411  0.654   -15.852 1.00 44.78  ? 80   VAL B CA    1 
ATOM   622  C  C     . VAL A 1 80  ? 19.626  0.027   -15.178 1.00 45.43  ? 80   VAL B C     1 
ATOM   623  O  O     . VAL A 1 80  ? 20.678  0.659   -15.053 1.00 42.95  ? 80   VAL B O     1 
ATOM   624  C  CB    . VAL A 1 80  ? 17.602  1.356   -14.748 1.00 44.56  ? 80   VAL B CB    1 
ATOM   625  C  CG1   . VAL A 1 80  ? 18.515  2.280   -13.945 1.00 44.85  ? 80   VAL B CG1   1 
ATOM   626  C  CG2   . VAL A 1 80  ? 16.447  2.128   -15.357 1.00 45.48  ? 80   VAL B CG2   1 
ATOM   627  N  N     . TYR A 1 81  ? 19.468  -1.202  -14.708 1.00 41.97  ? 81   TYR B N     1 
ATOM   628  C  CA    . TYR A 1 81  ? 20.564  -1.888  -14.051 1.00 40.68  ? 81   TYR B CA    1 
ATOM   629  C  C     . TYR A 1 81  ? 21.516  -2.311  -15.145 1.00 41.06  ? 81   TYR B C     1 
ATOM   630  O  O     . TYR A 1 81  ? 22.725  -2.419  -14.945 1.00 41.47  ? 81   TYR B O     1 
ATOM   631  C  CB    . TYR A 1 81  ? 20.049  -3.120  -13.321 1.00 40.43  ? 81   TYR B CB    1 
ATOM   632  C  CG    . TYR A 1 81  ? 18.798  -2.880  -12.518 1.00 37.66  ? 81   TYR B CG    1 
ATOM   633  C  CD1   . TYR A 1 81  ? 18.550  -1.638  -11.928 1.00 37.56  ? 81   TYR B CD1   1 
ATOM   634  C  CD2   . TYR A 1 81  ? 17.897  -3.914  -12.281 1.00 36.45  ? 81   TYR B CD2   1 
ATOM   635  C  CE1   . TYR A 1 81  ? 17.440  -1.438  -11.119 1.00 36.83  ? 81   TYR B CE1   1 
ATOM   636  C  CE2   . TYR A 1 81  ? 16.786  -3.727  -11.471 1.00 36.96  ? 81   TYR B CE2   1 
ATOM   637  C  CZ    . TYR A 1 81  ? 16.566  -2.487  -10.891 1.00 37.00  ? 81   TYR B CZ    1 
ATOM   638  O  OH    . TYR A 1 81  ? 15.488  -2.301  -10.061 1.00 37.71  ? 81   TYR B OH    1 
ATOM   639  N  N     . GLN A 1 82  ? 20.941  -2.544  -16.318 1.00 41.61  ? 82   GLN B N     1 
ATOM   640  C  CA    . GLN A 1 82  ? 21.701  -2.971  -17.479 1.00 42.19  ? 82   GLN B CA    1 
ATOM   641  C  C     . GLN A 1 82  ? 22.715  -1.920  -17.922 1.00 42.16  ? 82   GLN B C     1 
ATOM   642  O  O     . GLN A 1 82  ? 23.830  -2.256  -18.304 1.00 42.55  ? 82   GLN B O     1 
ATOM   643  C  CB    . GLN A 1 82  ? 20.746  -3.315  -18.627 1.00 41.44  ? 82   GLN B CB    1 
ATOM   644  C  CG    . GLN A 1 82  ? 21.448  -3.708  -19.908 1.00 43.21  ? 82   GLN B CG    1 
ATOM   645  C  CD    . GLN A 1 82  ? 22.440  -4.835  -19.699 1.00 43.97  ? 82   GLN B CD    1 
ATOM   646  O  OE1   . GLN A 1 82  ? 22.059  -5.993  -19.525 1.00 45.36  ? 82   GLN B OE1   1 
ATOM   647  N  NE2   . GLN A 1 82  ? 23.724  -4.497  -19.707 1.00 44.83  ? 82   GLN B NE2   1 
ATOM   648  N  N     . GLN A 1 83  ? 22.334  -0.649  -17.865 1.00 43.03  ? 83   GLN B N     1 
ATOM   649  C  CA    . GLN A 1 83  ? 23.238  0.429   -18.256 1.00 43.06  ? 83   GLN B CA    1 
ATOM   650  C  C     . GLN A 1 83  ? 24.325  0.628   -17.209 1.00 42.78  ? 83   GLN B C     1 
ATOM   651  O  O     . GLN A 1 83  ? 25.514  0.636   -17.526 1.00 41.11  ? 83   GLN B O     1 
ATOM   652  C  CB    . GLN A 1 83  ? 22.448  1.719   -18.475 1.00 44.05  ? 83   GLN B CB    1 
ATOM   653  C  CG    . GLN A 1 83  ? 21.879  1.811   -19.874 1.00 47.91  ? 83   GLN B CG    1 
ATOM   654  C  CD    . GLN A 1 83  ? 20.894  2.930   -20.041 1.00 49.57  ? 83   GLN B CD    1 
ATOM   655  O  OE1   . GLN A 1 83  ? 21.063  4.007   -19.485 1.00 50.78  ? 83   GLN B OE1   1 
ATOM   656  N  NE2   . GLN A 1 83  ? 19.865  2.690   -20.835 1.00 50.75  ? 83   GLN B NE2   1 
ATOM   657  N  N     . VAL A 1 84  ? 23.906  0.792   -15.962 1.00 42.03  ? 84   VAL B N     1 
ATOM   658  C  CA    . VAL A 1 84  ? 24.842  0.949   -14.860 1.00 40.95  ? 84   VAL B CA    1 
ATOM   659  C  C     . VAL A 1 84  ? 25.887  -0.157  -14.968 1.00 43.38  ? 84   VAL B C     1 
ATOM   660  O  O     . VAL A 1 84  ? 27.080  0.080   -14.789 1.00 43.49  ? 84   VAL B O     1 
ATOM   661  C  CB    . VAL A 1 84  ? 24.125  0.797   -13.519 1.00 40.40  ? 84   VAL B CB    1 
ATOM   662  C  CG1   . VAL A 1 84  ? 25.136  0.813   -12.382 1.00 38.05  ? 84   VAL B CG1   1 
ATOM   663  C  CG2   . VAL A 1 84  ? 23.090  1.897   -13.368 1.00 38.61  ? 84   VAL B CG2   1 
ATOM   664  N  N     . SER A 1 85  ? 25.427  -1.369  -15.263 1.00 43.67  ? 85   SER B N     1 
ATOM   665  C  CA    . SER A 1 85  ? 26.321  -2.513  -15.391 1.00 44.58  ? 85   SER B CA    1 
ATOM   666  C  C     . SER A 1 85  ? 27.379  -2.294  -16.466 1.00 45.30  ? 85   SER B C     1 
ATOM   667  O  O     . SER A 1 85  ? 28.573  -2.473  -16.224 1.00 44.75  ? 85   SER B O     1 
ATOM   668  C  CB    . SER A 1 85  ? 25.518  -3.775  -15.715 1.00 45.93  ? 85   SER B CB    1 
ATOM   669  O  OG    . SER A 1 85  ? 26.379  -4.875  -15.946 1.00 47.20  ? 85   SER B OG    1 
ATOM   670  N  N     . SER A 1 86  ? 26.928  -1.909  -17.655 1.00 45.04  ? 86   SER B N     1 
ATOM   671  C  CA    . SER A 1 86  ? 27.821  -1.671  -18.779 1.00 42.34  ? 86   SER B CA    1 
ATOM   672  C  C     . SER A 1 86  ? 28.823  -0.585  -18.455 1.00 42.59  ? 86   SER B C     1 
ATOM   673  O  O     . SER A 1 86  ? 30.013  -0.730  -18.733 1.00 41.90  ? 86   SER B O     1 
ATOM   674  C  CB    . SER A 1 86  ? 27.016  -1.280  -20.015 1.00 43.98  ? 86   SER B CB    1 
ATOM   675  O  OG    . SER A 1 86  ? 26.092  -2.300  -20.337 1.00 39.22  ? 86   SER B OG    1 
ATOM   676  N  N     . ARG A 1 87  ? 28.351  0.510   -17.871 1.00 42.89  ? 87   ARG B N     1 
ATOM   677  C  CA    . ARG A 1 87  ? 29.269  1.576   -17.528 1.00 42.84  ? 87   ARG B CA    1 
ATOM   678  C  C     . ARG A 1 87  ? 30.386  0.985   -16.674 1.00 43.96  ? 87   ARG B C     1 
ATOM   679  O  O     . ARG A 1 87  ? 31.560  1.243   -16.936 1.00 43.01  ? 87   ARG B O     1 
ATOM   680  C  CB    . ARG A 1 87  ? 28.556  2.714   -16.794 1.00 41.26  ? 87   ARG B CB    1 
ATOM   681  C  CG    . ARG A 1 87  ? 27.598  3.509   -17.678 1.00 39.83  ? 87   ARG B CG    1 
ATOM   682  C  CD    . ARG A 1 87  ? 27.372  4.910   -17.122 1.00 37.93  ? 87   ARG B CD    1 
ATOM   683  N  NE    . ARG A 1 87  ? 26.947  4.874   -15.728 1.00 35.46  ? 87   ARG B NE    1 
ATOM   684  C  CZ    . ARG A 1 87  ? 25.681  4.839   -15.331 1.00 33.84  ? 87   ARG B CZ    1 
ATOM   685  N  NH1   . ARG A 1 87  ? 24.703  4.844   -16.224 1.00 31.99  ? 87   ARG B NH1   1 
ATOM   686  N  NH2   . ARG A 1 87  ? 25.395  4.792   -14.039 1.00 33.30  ? 87   ARG B NH2   1 
ATOM   687  N  N     . ILE A 1 88  ? 30.036  0.174   -15.676 1.00 43.90  ? 88   ILE B N     1 
ATOM   688  C  CA    . ILE A 1 88  ? 31.065  -0.438  -14.838 1.00 46.44  ? 88   ILE B CA    1 
ATOM   689  C  C     . ILE A 1 88  ? 31.941  -1.364  -15.671 1.00 48.09  ? 88   ILE B C     1 
ATOM   690  O  O     . ILE A 1 88  ? 33.165  -1.334  -15.549 1.00 49.37  ? 88   ILE B O     1 
ATOM   691  C  CB    . ILE A 1 88  ? 30.480  -1.278  -13.681 1.00 45.62  ? 88   ILE B CB    1 
ATOM   692  C  CG1   . ILE A 1 88  ? 29.731  -0.385  -12.694 1.00 41.42  ? 88   ILE B CG1   1 
ATOM   693  C  CG2   . ILE A 1 88  ? 31.612  -1.985  -12.934 1.00 41.38  ? 88   ILE B CG2   1 
ATOM   694  C  CD1   . ILE A 1 88  ? 29.200  -1.150  -11.504 1.00 39.88  ? 88   ILE B CD1   1 
ATOM   695  N  N     . MET A 1 89  ? 31.320  -2.192  -16.508 1.00 52.19  ? 89   MET B N     1 
ATOM   696  C  CA    . MET A 1 89  ? 32.095  -3.106  -17.337 1.00 53.92  ? 89   MET B CA    1 
ATOM   697  C  C     . MET A 1 89  ? 33.183  -2.322  -18.050 1.00 56.37  ? 89   MET B C     1 
ATOM   698  O  O     . MET A 1 89  ? 34.362  -2.658  -17.951 1.00 56.87  ? 89   MET B O     1 
ATOM   699  C  CB    . MET A 1 89  ? 31.206  -3.824  -18.357 1.00 53.03  ? 89   MET B CB    1 
ATOM   700  C  CG    . MET A 1 89  ? 30.297  -4.884  -17.748 1.00 53.16  ? 89   MET B CG    1 
ATOM   701  S  SD    . MET A 1 89  ? 31.158  -5.990  -16.603 1.00 51.45  ? 89   MET B SD    1 
ATOM   702  C  CE    . MET A 1 89  ? 29.789  -6.593  -15.608 1.00 49.26  ? 89   MET B CE    1 
ATOM   703  N  N     . ASN A 1 90  ? 32.787  -1.268  -18.754 1.00 58.48  ? 90   ASN B N     1 
ATOM   704  C  CA    . ASN A 1 90  ? 33.746  -0.433  -19.461 1.00 60.48  ? 90   ASN B CA    1 
ATOM   705  C  C     . ASN A 1 90  ? 34.906  -0.034  -18.556 1.00 62.27  ? 90   ASN B C     1 
ATOM   706  O  O     . ASN A 1 90  ? 36.049  0.034   -19.004 1.00 63.04  ? 90   ASN B O     1 
ATOM   707  C  CB    . ASN A 1 90  ? 33.063  0.820   -20.009 1.00 61.39  ? 90   ASN B CB    1 
ATOM   708  C  CG    . ASN A 1 90  ? 32.135  0.512   -21.158 1.00 61.40  ? 90   ASN B CG    1 
ATOM   709  O  OD1   . ASN A 1 90  ? 32.463  -0.292  -22.031 1.00 60.31  ? 90   ASN B OD1   1 
ATOM   710  N  ND2   . ASN A 1 90  ? 30.974  1.155   -21.174 1.00 60.51  ? 90   ASN B ND2   1 
ATOM   711  N  N     . LEU A 1 91  ? 34.618  0.233   -17.285 1.00 62.35  ? 91   LEU B N     1 
ATOM   712  C  CA    . LEU A 1 91  ? 35.674  0.609   -16.349 1.00 62.03  ? 91   LEU B CA    1 
ATOM   713  C  C     . LEU A 1 91  ? 36.690  -0.524  -16.225 1.00 60.20  ? 91   LEU B C     1 
ATOM   714  O  O     . LEU A 1 91  ? 37.893  -0.280  -16.140 1.00 60.52  ? 91   LEU B O     1 
ATOM   715  C  CB    . LEU A 1 91  ? 35.103  0.920   -14.958 1.00 64.57  ? 91   LEU B CB    1 
ATOM   716  C  CG    . LEU A 1 91  ? 34.255  2.174   -14.719 1.00 66.10  ? 91   LEU B CG    1 
ATOM   717  C  CD1   . LEU A 1 91  ? 33.831  2.212   -13.255 1.00 67.70  ? 91   LEU B CD1   1 
ATOM   718  C  CD2   . LEU A 1 91  ? 35.046  3.427   -15.069 1.00 67.60  ? 91   LEU B CD2   1 
ATOM   719  N  N     . LEU A 1 92  ? 36.201  -1.760  -16.218 1.00 59.00  ? 92   LEU B N     1 
ATOM   720  C  CA    . LEU A 1 92  ? 37.069  -2.925  -16.089 1.00 58.15  ? 92   LEU B CA    1 
ATOM   721  C  C     . LEU A 1 92  ? 37.852  -3.268  -17.347 1.00 59.53  ? 92   LEU B C     1 
ATOM   722  O  O     . LEU A 1 92  ? 38.900  -3.909  -17.269 1.00 57.34  ? 92   LEU B O     1 
ATOM   723  C  CB    . LEU A 1 92  ? 36.252  -4.141  -15.649 1.00 52.81  ? 92   LEU B CB    1 
ATOM   724  C  CG    . LEU A 1 92  ? 35.767  -4.081  -14.200 1.00 49.38  ? 92   LEU B CG    1 
ATOM   725  C  CD1   . LEU A 1 92  ? 34.694  -5.130  -13.961 1.00 47.61  ? 92   LEU B CD1   1 
ATOM   726  C  CD2   . LEU A 1 92  ? 36.954  -4.279  -13.265 1.00 46.95  ? 92   LEU B CD2   1 
ATOM   727  N  N     . ARG A 1 93  ? 37.353  -2.850  -18.505 1.00 62.45  ? 93   ARG B N     1 
ATOM   728  C  CA    . ARG A 1 93  ? 38.044  -3.138  -19.755 1.00 67.64  ? 93   ARG B CA    1 
ATOM   729  C  C     . ARG A 1 93  ? 39.423  -2.486  -19.852 1.00 71.65  ? 93   ARG B C     1 
ATOM   730  O  O     . ARG A 1 93  ? 40.218  -2.845  -20.720 1.00 75.29  ? 93   ARG B O     1 
ATOM   731  C  CB    . ARG A 1 93  ? 37.193  -2.716  -20.953 1.00 66.61  ? 93   ARG B CB    1 
ATOM   732  C  CG    . ARG A 1 93  ? 36.189  -3.766  -21.404 1.00 65.90  ? 93   ARG B CG    1 
ATOM   733  C  CD    . ARG A 1 93  ? 35.562  -3.364  -22.730 1.00 67.15  ? 93   ARG B CD    1 
ATOM   734  N  NE    . ARG A 1 93  ? 34.112  -3.237  -22.636 1.00 68.77  ? 93   ARG B NE    1 
ATOM   735  C  CZ    . ARG A 1 93  ? 33.282  -4.263  -22.484 1.00 69.67  ? 93   ARG B CZ    1 
ATOM   736  N  NH1   . ARG A 1 93  ? 33.759  -5.497  -22.412 1.00 69.74  ? 93   ARG B NH1   1 
ATOM   737  N  NH2   . ARG A 1 93  ? 31.974  -4.055  -22.403 1.00 69.90  ? 93   ARG B NH2   1 
ATOM   738  N  N     . GLU A 1 94  ? 39.713  -1.532  -18.973 1.00 78.03  ? 94   GLU B N     1 
ATOM   739  C  CA    . GLU A 1 94  ? 41.018  -0.875  -19.000 1.00 81.95  ? 94   GLU B CA    1 
ATOM   740  C  C     . GLU A 1 94  ? 42.083  -1.735  -18.322 1.00 81.30  ? 94   GLU B C     1 
ATOM   741  O  O     . GLU A 1 94  ? 43.218  -1.824  -18.791 1.00 82.16  ? 94   GLU B O     1 
ATOM   742  C  CB    . GLU A 1 94  ? 40.963  0.499   -18.315 1.00 86.24  ? 94   GLU B CB    1 
ATOM   743  C  CG    . GLU A 1 94  ? 40.412  1.635   -19.177 1.00 99.47  ? 94   GLU B CG    1 
ATOM   744  C  CD    . GLU A 1 94  ? 41.256  2.903   -19.088 1.00 105.68 ? 94   GLU B CD    1 
ATOM   745  O  OE1   . GLU A 1 94  ? 42.426  2.873   -19.526 1.00 109.06 ? 94   GLU B OE1   1 
ATOM   746  O  OE2   . GLU A 1 94  ? 40.755  3.927   -18.578 1.00 108.91 ? 94   GLU B OE2   1 
ATOM   747  N  N     . TYR A 1 95  ? 41.704  -2.375  -17.222 1.00 78.94  ? 95   TYR B N     1 
ATOM   748  C  CA    . TYR A 1 95  ? 42.616  -3.218  -16.459 1.00 77.31  ? 95   TYR B CA    1 
ATOM   749  C  C     . TYR A 1 95  ? 42.982  -4.535  -17.147 1.00 74.82  ? 95   TYR B C     1 
ATOM   750  O  O     . TYR A 1 95  ? 43.703  -5.356  -16.579 1.00 73.02  ? 95   TYR B O     1 
ATOM   751  C  CB    . TYR A 1 95  ? 42.023  -3.470  -15.072 1.00 78.10  ? 95   TYR B CB    1 
ATOM   752  C  CG    . TYR A 1 95  ? 41.775  -2.184  -14.309 1.00 76.77  ? 95   TYR B CG    1 
ATOM   753  C  CD1   . TYR A 1 95  ? 42.833  -1.459  -13.759 1.00 77.04  ? 95   TYR B CD1   1 
ATOM   754  C  CD2   . TYR A 1 95  ? 40.484  -1.679  -14.158 1.00 76.91  ? 95   TYR B CD2   1 
ATOM   755  C  CE1   . TYR A 1 95  ? 42.611  -0.264  -13.076 1.00 78.23  ? 95   TYR B CE1   1 
ATOM   756  C  CE2   . TYR A 1 95  ? 40.251  -0.483  -13.478 1.00 78.07  ? 95   TYR B CE2   1 
ATOM   757  C  CZ    . TYR A 1 95  ? 41.319  0.217   -12.938 1.00 78.49  ? 95   TYR B CZ    1 
ATOM   758  O  OH    . TYR A 1 95  ? 41.096  1.389   -12.247 1.00 78.88  ? 95   TYR B OH    1 
ATOM   759  N  N     . SER A 1 96  ? 42.474  -4.730  -18.364 1.00 73.82  ? 96   SER B N     1 
ATOM   760  C  CA    . SER A 1 96  ? 42.777  -5.915  -19.175 1.00 74.44  ? 96   SER B CA    1 
ATOM   761  C  C     . SER A 1 96  ? 41.921  -6.046  -20.432 1.00 74.52  ? 96   SER B C     1 
ATOM   762  O  O     . SER A 1 96  ? 40.724  -5.758  -20.421 1.00 74.86  ? 96   SER B O     1 
ATOM   763  C  CB    . SER A 1 96  ? 42.663  -7.208  -18.366 1.00 68.29  ? 96   SER B CB    1 
ATOM   764  O  OG    . SER A 1 96  ? 43.100  -8.300  -19.160 1.00 65.10  ? 96   SER B OG    1 
ATOM   765  N  N     . GLU A 1 97  ? 42.554  -6.499  -21.511 1.00 78.56  ? 97   GLU B N     1 
ATOM   766  C  CA    . GLU A 1 97  ? 41.886  -6.669  -22.797 1.00 84.20  ? 97   GLU B CA    1 
ATOM   767  C  C     . GLU A 1 97  ? 41.127  -7.990  -22.868 1.00 81.32  ? 97   GLU B C     1 
ATOM   768  O  O     . GLU A 1 97  ? 40.168  -8.126  -23.629 1.00 84.32  ? 97   GLU B O     1 
ATOM   769  C  CB    . GLU A 1 97  ? 42.907  -6.619  -23.939 1.00 88.10  ? 97   GLU B CB    1 
ATOM   770  C  CG    . GLU A 1 97  ? 43.915  -5.479  -23.865 1.00 105.82 ? 97   GLU B CG    1 
ATOM   771  C  CD    . GLU A 1 97  ? 44.887  -5.629  -22.711 1.00 117.05 ? 97   GLU B CD    1 
ATOM   772  O  OE1   . GLU A 1 97  ? 45.403  -6.749  -22.512 1.00 125.54 ? 97   GLU B OE1   1 
ATOM   773  O  OE2   . GLU A 1 97  ? 45.140  -4.626  -22.011 1.00 125.54 ? 97   GLU B OE2   1 
ATOM   774  N  N     . LYS A 1 98  ? 41.580  -8.962  -22.081 1.00 80.57  ? 98   LYS B N     1 
ATOM   775  C  CA    . LYS A 1 98  ? 40.960  -10.282 -22.025 1.00 78.37  ? 98   LYS B CA    1 
ATOM   776  C  C     . LYS A 1 98  ? 39.925  -10.262 -20.913 1.00 73.79  ? 98   LYS B C     1 
ATOM   777  O  O     . LYS A 1 98  ? 40.248  -10.479 -19.743 1.00 73.42  ? 98   LYS B O     1 
ATOM   778  C  CB    . LYS A 1 98  ? 42.016  -11.349 -21.727 1.00 79.08  ? 98   LYS B CB    1 
ATOM   779  C  CG    . LYS A 1 98  ? 43.161  -11.352 -22.720 1.00 85.11  ? 98   LYS B CG    1 
ATOM   780  C  CD    . LYS A 1 98  ? 44.230  -12.372 -22.365 1.00 90.45  ? 98   LYS B CD    1 
ATOM   781  C  CE    . LYS A 1 98  ? 45.382  -12.291 -23.356 1.00 93.80  ? 98   LYS B CE    1 
ATOM   782  N  NZ    . LYS A 1 98  ? 46.464  -13.274 -23.079 1.00 95.46  ? 98   LYS B NZ    1 
ATOM   783  N  N     . ILE A 1 99  ? 38.678  -10.000 -21.280 1.00 69.16  ? 99   ILE B N     1 
ATOM   784  C  CA    . ILE A 1 99  ? 37.620  -9.930  -20.292 1.00 66.05  ? 99   ILE B CA    1 
ATOM   785  C  C     . ILE A 1 99  ? 36.402  -10.733 -20.717 1.00 61.06  ? 99   ILE B C     1 
ATOM   786  O  O     . ILE A 1 99  ? 36.018  -10.733 -21.887 1.00 60.11  ? 99   ILE B O     1 
ATOM   787  C  CB    . ILE A 1 99  ? 37.211  -8.461  -20.054 1.00 66.01  ? 99   ILE B CB    1 
ATOM   788  C  CG1   . ILE A 1 99  ? 36.292  -8.360  -18.837 1.00 66.78  ? 99   ILE B CG1   1 
ATOM   789  C  CG2   . ILE A 1 99  ? 36.518  -7.904  -21.292 1.00 65.68  ? 99   ILE B CG2   1 
ATOM   790  C  CD1   . ILE A 1 99  ? 35.979  -6.937  -18.433 1.00 69.10  ? 99   ILE B CD1   1 
ATOM   791  N  N     . GLU A 1 100 ? 35.807  -11.436 -19.761 1.00 55.88  ? 100  GLU B N     1 
ATOM   792  C  CA    . GLU A 1 100 ? 34.623  -12.229 -20.040 1.00 51.74  ? 100  GLU B CA    1 
ATOM   793  C  C     . GLU A 1 100 ? 33.497  -11.700 -19.171 1.00 48.00  ? 100  GLU B C     1 
ATOM   794  O  O     . GLU A 1 100 ? 33.605  -11.672 -17.947 1.00 47.93  ? 100  GLU B O     1 
ATOM   795  C  CB    . GLU A 1 100 ? 34.873  -13.711 -19.731 1.00 52.15  ? 100  GLU B CB    1 
ATOM   796  C  CG    . GLU A 1 100 ? 33.801  -14.653 -20.273 1.00 54.30  ? 100  GLU B CG    1 
ATOM   797  C  CD    . GLU A 1 100 ? 34.068  -16.116 -19.950 1.00 56.28  ? 100  GLU B CD    1 
ATOM   798  O  OE1   . GLU A 1 100 ? 35.139  -16.635 -20.331 1.00 57.51  ? 100  GLU B OE1   1 
ATOM   799  O  OE2   . GLU A 1 100 ? 33.198  -16.752 -19.317 1.00 58.04  ? 100  GLU B OE2   1 
ATOM   800  N  N     . ILE A 1 101 ? 32.431  -11.251 -19.821 1.00 44.97  ? 101  ILE B N     1 
ATOM   801  C  CA    . ILE A 1 101 ? 31.262  -10.739 -19.126 1.00 41.06  ? 101  ILE B CA    1 
ATOM   802  C  C     . ILE A 1 101 ? 30.303  -11.908 -18.963 1.00 40.68  ? 101  ILE B C     1 
ATOM   803  O  O     . ILE A 1 101 ? 29.533  -12.239 -19.865 1.00 39.15  ? 101  ILE B O     1 
ATOM   804  C  CB    . ILE A 1 101 ? 30.604  -9.609  -19.927 1.00 38.78  ? 101  ILE B CB    1 
ATOM   805  C  CG1   . ILE A 1 101 ? 31.509  -8.375  -19.895 1.00 38.08  ? 101  ILE B CG1   1 
ATOM   806  C  CG2   . ILE A 1 101 ? 29.235  -9.292  -19.359 1.00 39.17  ? 101  ILE B CG2   1 
ATOM   807  C  CD1   . ILE A 1 101 ? 31.061  -7.263  -20.802 1.00 36.95  ? 101  ILE B CD1   1 
ATOM   808  N  N     . ALA A 1 102 ? 30.386  -12.535 -17.794 1.00 38.24  ? 102  ALA B N     1 
ATOM   809  C  CA    . ALA A 1 102 ? 29.584  -13.701 -17.448 1.00 36.76  ? 102  ALA B CA    1 
ATOM   810  C  C     . ALA A 1 102 ? 28.105  -13.402 -17.317 1.00 36.38  ? 102  ALA B C     1 
ATOM   811  O  O     . ALA A 1 102 ? 27.270  -14.079 -17.915 1.00 37.92  ? 102  ALA B O     1 
ATOM   812  C  CB    . ALA A 1 102 ? 30.094  -14.300 -16.153 1.00 35.27  ? 102  ALA B CB    1 
ATOM   813  N  N     . SER A 1 103 ? 27.784  -12.401 -16.512 1.00 35.95  ? 103  SER B N     1 
ATOM   814  C  CA    . SER A 1 103 ? 26.400  -12.027 -16.300 1.00 34.13  ? 103  SER B CA    1 
ATOM   815  C  C     . SER A 1 103 ? 26.279  -10.513 -16.347 1.00 33.93  ? 103  SER B C     1 
ATOM   816  O  O     . SER A 1 103 ? 27.218  -9.818  -16.733 1.00 32.65  ? 103  SER B O     1 
ATOM   817  C  CB    . SER A 1 103 ? 25.921  -12.545 -14.944 1.00 33.62  ? 103  SER B CB    1 
ATOM   818  O  OG    . SER A 1 103 ? 26.582  -11.865 -13.890 1.00 33.41  ? 103  SER B OG    1 
ATOM   819  N  N     . ILE A 1 104 ? 25.117  -10.010 -15.952 1.00 32.26  ? 104  ILE B N     1 
ATOM   820  C  CA    . ILE A 1 104 ? 24.875  -8.578  -15.941 1.00 30.31  ? 104  ILE B CA    1 
ATOM   821  C  C     . ILE A 1 104 ? 25.651  -7.947  -14.793 1.00 33.44  ? 104  ILE B C     1 
ATOM   822  O  O     . ILE A 1 104 ? 25.685  -6.726  -14.657 1.00 32.90  ? 104  ILE B O     1 
ATOM   823  C  CB    . ILE A 1 104 ? 23.386  -8.270  -15.725 1.00 27.97  ? 104  ILE B CB    1 
ATOM   824  C  CG1   . ILE A 1 104 ? 23.120  -6.770  -15.850 1.00 24.28  ? 104  ILE B CG1   1 
ATOM   825  C  CG2   . ILE A 1 104 ? 22.978  -8.680  -14.324 1.00 27.77  ? 104  ILE B CG2   1 
ATOM   826  C  CD1   . ILE A 1 104 ? 21.664  -6.434  -15.675 1.00 21.10  ? 104  ILE B CD1   1 
ATOM   827  N  N     . ASP A 1 105 ? 26.272  -8.780  -13.964 1.00 35.83  ? 105  ASP B N     1 
ATOM   828  C  CA    . ASP A 1 105 ? 27.017  -8.265  -12.822 1.00 37.64  ? 105  ASP B CA    1 
ATOM   829  C  C     . ASP A 1 105 ? 28.176  -9.168  -12.392 1.00 38.23  ? 105  ASP B C     1 
ATOM   830  O  O     . ASP A 1 105 ? 28.490  -9.285  -11.203 1.00 39.10  ? 105  ASP B O     1 
ATOM   831  C  CB    . ASP A 1 105 ? 26.057  -8.072  -11.660 1.00 38.93  ? 105  ASP B CB    1 
ATOM   832  C  CG    . ASP A 1 105 ? 25.816  -9.344  -10.902 1.00 40.47  ? 105  ASP B CG    1 
ATOM   833  O  OD1   . ASP A 1 105 ? 25.900  -10.434 -11.508 1.00 42.09  ? 105  ASP B OD1   1 
ATOM   834  O  OD2   . ASP A 1 105 ? 25.540  -9.242  -9.698  1.00 40.96  ? 105  ASP B OD2   1 
ATOM   835  N  N     . GLU A 1 106 ? 28.817  -9.791  -13.371 1.00 38.83  ? 106  GLU B N     1 
ATOM   836  C  CA    . GLU A 1 106 ? 29.939  -10.685 -13.120 1.00 39.04  ? 106  GLU B CA    1 
ATOM   837  C  C     . GLU A 1 106 ? 30.920  -10.596 -14.275 1.00 37.73  ? 106  GLU B C     1 
ATOM   838  O  O     . GLU A 1 106 ? 30.529  -10.744 -15.427 1.00 37.92  ? 106  GLU B O     1 
ATOM   839  C  CB    . GLU A 1 106 ? 29.439  -12.125 -13.005 1.00 40.60  ? 106  GLU B CB    1 
ATOM   840  C  CG    . GLU A 1 106 ? 29.258  -12.633 -11.594 1.00 44.55  ? 106  GLU B CG    1 
ATOM   841  C  CD    . GLU A 1 106 ? 28.617  -14.005 -11.557 1.00 47.62  ? 106  GLU B CD    1 
ATOM   842  O  OE1   . GLU A 1 106 ? 28.506  -14.651 -12.621 1.00 49.00  ? 106  GLU B OE1   1 
ATOM   843  O  OE2   . GLU A 1 106 ? 28.230  -14.442 -10.456 1.00 48.96  ? 106  GLU B OE2   1 
ATOM   844  N  N     . ALA A 1 107 ? 32.190  -10.353 -13.975 1.00 36.37  ? 107  ALA B N     1 
ATOM   845  C  CA    . ALA A 1 107 ? 33.194  -10.277 -15.024 1.00 37.31  ? 107  ALA B CA    1 
ATOM   846  C  C     . ALA A 1 107 ? 34.491  -10.940 -14.592 1.00 37.68  ? 107  ALA B C     1 
ATOM   847  O  O     . ALA A 1 107 ? 34.928  -10.789 -13.453 1.00 37.56  ? 107  ALA B O     1 
ATOM   848  C  CB    . ALA A 1 107 ? 33.449  -8.832  -15.408 1.00 33.00  ? 107  ALA B CB    1 
ATOM   849  N  N     . TYR A 1 108 ? 35.093  -11.681 -15.516 1.00 40.57  ? 108  TYR B N     1 
ATOM   850  C  CA    . TYR A 1 108 ? 36.350  -12.375 -15.272 1.00 44.95  ? 108  TYR B CA    1 
ATOM   851  C  C     . TYR A 1 108 ? 37.438  -11.651 -16.035 1.00 47.05  ? 108  TYR B C     1 
ATOM   852  O  O     . TYR A 1 108 ? 37.289  -11.377 -17.224 1.00 47.24  ? 108  TYR B O     1 
ATOM   853  C  CB    . TYR A 1 108 ? 36.293  -13.810 -15.796 1.00 46.61  ? 108  TYR B CB    1 
ATOM   854  C  CG    . TYR A 1 108 ? 35.362  -14.740 -15.061 1.00 50.31  ? 108  TYR B CG    1 
ATOM   855  C  CD1   . TYR A 1 108 ? 35.782  -15.423 -13.921 1.00 52.36  ? 108  TYR B CD1   1 
ATOM   856  C  CD2   . TYR A 1 108 ? 34.067  -14.964 -15.525 1.00 52.69  ? 108  TYR B CD2   1 
ATOM   857  C  CE1   . TYR A 1 108 ? 34.935  -16.311 -13.263 1.00 55.36  ? 108  TYR B CE1   1 
ATOM   858  C  CE2   . TYR A 1 108 ? 33.214  -15.845 -14.877 1.00 56.05  ? 108  TYR B CE2   1 
ATOM   859  C  CZ    . TYR A 1 108 ? 33.653  -16.516 -13.748 1.00 56.53  ? 108  TYR B CZ    1 
ATOM   860  O  OH    . TYR A 1 108 ? 32.810  -17.391 -13.106 1.00 57.66  ? 108  TYR B OH    1 
ATOM   861  N  N     . LEU A 1 109 ? 38.535  -11.343 -15.365 1.00 51.56  ? 109  LEU B N     1 
ATOM   862  C  CA    . LEU A 1 109 ? 39.630  -10.676 -16.041 1.00 56.19  ? 109  LEU B CA    1 
ATOM   863  C  C     . LEU A 1 109 ? 40.845  -11.574 -15.972 1.00 61.79  ? 109  LEU B C     1 
ATOM   864  O  O     . LEU A 1 109 ? 41.165  -12.109 -14.912 1.00 62.88  ? 109  LEU B O     1 
ATOM   865  C  CB    . LEU A 1 109 ? 39.956  -9.335  -15.377 1.00 52.64  ? 109  LEU B CB    1 
ATOM   866  C  CG    . LEU A 1 109 ? 39.058  -8.117  -15.613 1.00 51.42  ? 109  LEU B CG    1 
ATOM   867  C  CD1   . LEU A 1 109 ? 37.687  -8.333  -15.002 1.00 49.30  ? 109  LEU B CD1   1 
ATOM   868  C  CD2   . LEU A 1 109 ? 39.719  -6.896  -14.996 1.00 49.10  ? 109  LEU B CD2   1 
ATOM   869  N  N     . ASP A 1 110 ? 41.502  -11.769 -17.107 1.00 67.04  ? 110  ASP B N     1 
ATOM   870  C  CA    . ASP A 1 110 ? 42.708  -12.572 -17.124 1.00 72.81  ? 110  ASP B CA    1 
ATOM   871  C  C     . ASP A 1 110 ? 43.837  -11.556 -17.113 1.00 75.54  ? 110  ASP B C     1 
ATOM   872  O  O     . ASP A 1 110 ? 44.127  -10.931 -18.132 1.00 75.37  ? 110  ASP B O     1 
ATOM   873  C  CB    . ASP A 1 110 ? 42.803  -13.420 -18.388 1.00 79.21  ? 110  ASP B CB    1 
ATOM   874  C  CG    . ASP A 1 110 ? 44.064  -14.257 -18.419 1.00 85.90  ? 110  ASP B CG    1 
ATOM   875  O  OD1   . ASP A 1 110 ? 44.930  -14.051 -17.542 1.00 90.08  ? 110  ASP B OD1   1 
ATOM   876  O  OD2   . ASP A 1 110 ? 44.194  -15.112 -19.319 1.00 89.65  ? 110  ASP B OD2   1 
ATOM   877  N  N     . ILE A 1 111 ? 44.466  -11.380 -15.959 1.00 74.21  ? 111  ILE B N     1 
ATOM   878  C  CA    . ILE A 1 111 ? 45.547  -10.414 -15.836 1.00 70.63  ? 111  ILE B CA    1 
ATOM   879  C  C     . ILE A 1 111 ? 46.913  -11.079 -15.766 1.00 76.78  ? 111  ILE B C     1 
ATOM   880  O  O     . ILE A 1 111 ? 47.743  -10.734 -14.925 1.00 77.25  ? 111  ILE B O     1 
ATOM   881  C  CB    . ILE A 1 111 ? 45.341  -9.537  -14.592 1.00 68.81  ? 111  ILE B CB    1 
ATOM   882  C  CG1   . ILE A 1 111 ? 45.298  -10.407 -13.335 1.00 62.51  ? 111  ILE B CG1   1 
ATOM   883  C  CG2   . ILE A 1 111 ? 44.040  -8.765  -14.724 1.00 65.60  ? 111  ILE B CG2   1 
ATOM   884  C  CD1   . ILE A 1 111 ? 45.079  -9.618  -12.061 1.00 53.91  ? 111  ILE B CD1   1 
ATOM   885  N  N     . SER A 1 112 ? 47.143  -12.026 -16.670 1.00 81.18  ? 112  SER B N     1 
ATOM   886  C  CA    . SER A 1 112 ? 48.402  -12.759 -16.716 1.00 82.84  ? 112  SER B CA    1 
ATOM   887  C  C     . SER A 1 112 ? 49.437  -12.095 -17.618 1.00 85.27  ? 112  SER B C     1 
ATOM   888  O  O     . SER A 1 112 ? 50.460  -12.689 -17.961 1.00 84.88  ? 112  SER B O     1 
ATOM   889  C  CB    . SER A 1 112 ? 48.142  -14.195 -17.168 1.00 86.11  ? 112  SER B CB    1 
ATOM   890  O  OG    . SER A 1 112 ? 47.290  -14.854 -16.245 1.00 87.22  ? 112  SER B OG    1 
ATOM   891  N  N     . ASP A 1 113 ? 49.146  -10.858 -17.999 1.00 85.94  ? 113  ASP B N     1 
ATOM   892  C  CA    . ASP A 1 113 ? 50.019  -10.034 -18.826 1.00 87.99  ? 113  ASP B CA    1 
ATOM   893  C  C     . ASP A 1 113 ? 49.835  -8.651  -18.220 1.00 86.39  ? 113  ASP B C     1 
ATOM   894  O  O     . ASP A 1 113 ? 50.150  -7.639  -18.843 1.00 86.54  ? 113  ASP B O     1 
ATOM   895  C  CB    . ASP A 1 113 ? 49.547  -10.006 -20.287 1.00 91.37  ? 113  ASP B CB    1 
ATOM   896  C  CG    . ASP A 1 113 ? 49.837  -11.297 -21.030 1.00 91.76  ? 113  ASP B CG    1 
ATOM   897  O  OD1   . ASP A 1 113 ? 50.298  -12.267 -20.396 1.00 93.78  ? 113  ASP B OD1   1 
ATOM   898  O  OD2   . ASP A 1 113 ? 49.598  -11.341 -22.255 1.00 93.25  ? 113  ASP B OD2   1 
ATOM   899  N  N     . LYS A 1 114 ? 49.310  -8.629  -16.995 1.00 84.74  ? 114  LYS B N     1 
ATOM   900  C  CA    . LYS A 1 114 ? 49.033  -7.383  -16.290 1.00 81.87  ? 114  LYS B CA    1 
ATOM   901  C  C     . LYS A 1 114 ? 49.600  -7.305  -14.870 1.00 78.91  ? 114  LYS B C     1 
ATOM   902  O  O     . LYS A 1 114 ? 49.577  -6.240  -14.253 1.00 79.54  ? 114  LYS B O     1 
ATOM   903  C  CB    . LYS A 1 114 ? 47.522  -7.150  -16.262 1.00 81.46  ? 114  LYS B CB    1 
ATOM   904  C  CG    . LYS A 1 114 ? 46.858  -7.285  -17.627 1.00 82.94  ? 114  LYS B CG    1 
ATOM   905  C  CD    . LYS A 1 114 ? 47.287  -6.172  -18.571 1.00 86.26  ? 114  LYS B CD    1 
ATOM   906  C  CE    . LYS A 1 114 ? 46.769  -6.416  -19.977 1.00 89.24  ? 114  LYS B CE    1 
ATOM   907  N  NZ    . LYS A 1 114 ? 47.235  -5.375  -20.933 1.00 90.47  ? 114  LYS B NZ    1 
ATOM   908  N  N     . VAL A 1 115 ? 50.072  -8.428  -14.336 1.00 79.83  ? 115  VAL B N     1 
ATOM   909  C  CA    . VAL A 1 115 ? 50.679  -8.444  -13.004 1.00 80.55  ? 115  VAL B CA    1 
ATOM   910  C  C     . VAL A 1 115 ? 51.622  -9.636  -12.943 1.00 83.07  ? 115  VAL B C     1 
ATOM   911  O  O     . VAL A 1 115 ? 51.716  -10.402 -13.901 1.00 79.93  ? 115  VAL B O     1 
ATOM   912  C  CB    . VAL A 1 115 ? 49.635  -8.536  -11.846 1.00 76.12  ? 115  VAL B CB    1 
ATOM   913  C  CG1   . VAL A 1 115 ? 48.472  -7.593  -12.103 1.00 75.93  ? 115  VAL B CG1   1 
ATOM   914  C  CG2   . VAL A 1 115 ? 49.162  -9.960  -11.669 1.00 75.81  ? 115  VAL B CG2   1 
ATOM   915  N  N     . ARG A 1 116 ? 52.307  -9.809  -11.819 1.00 85.43  ? 116  ARG B N     1 
ATOM   916  C  CA    . ARG A 1 116 ? 53.272  -10.894 -11.707 1.00 91.17  ? 116  ARG B CA    1 
ATOM   917  C  C     . ARG A 1 116 ? 53.010  -11.936 -10.623 1.00 90.70  ? 116  ARG B C     1 
ATOM   918  O  O     . ARG A 1 116 ? 53.332  -13.111 -10.798 1.00 95.13  ? 116  ARG B O     1 
ATOM   919  C  CB    . ARG A 1 116 ? 54.662  -10.285 -11.522 1.00 96.00  ? 116  ARG B CB    1 
ATOM   920  C  CG    . ARG A 1 116 ? 54.901  -9.092  -12.443 1.00 104.35 ? 116  ARG B CG    1 
ATOM   921  C  CD    . ARG A 1 116 ? 56.345  -8.626  -12.425 1.00 114.24 ? 116  ARG B CD    1 
ATOM   922  N  NE    . ARG A 1 116 ? 56.573  -7.485  -11.544 1.00 122.74 ? 116  ARG B NE    1 
ATOM   923  C  CZ    . ARG A 1 116 ? 57.466  -7.470  -10.561 1.00 126.29 ? 116  ARG B CZ    1 
ATOM   924  N  NH1   . ARG A 1 116 ? 58.214  -8.538  -10.326 1.00 127.88 ? 116  ARG B NH1   1 
ATOM   925  N  NH2   . ARG A 1 116 ? 57.624  -6.380  -9.823  1.00 127.84 ? 116  ARG B NH2   1 
ATOM   926  N  N     . ASP A 1 117 ? 52.427  -11.511 -9.508  1.00 92.74  ? 117  ASP B N     1 
ATOM   927  C  CA    . ASP A 1 117 ? 52.142  -12.414 -8.395  1.00 90.91  ? 117  ASP B CA    1 
ATOM   928  C  C     . ASP A 1 117 ? 50.780  -12.097 -7.788  1.00 88.75  ? 117  ASP B C     1 
ATOM   929  O  O     . ASP A 1 117 ? 50.134  -11.131 -8.188  1.00 87.55  ? 117  ASP B O     1 
ATOM   930  C  CB    . ASP A 1 117 ? 53.241  -12.280 -7.339  1.00 91.63  ? 117  ASP B CB    1 
ATOM   931  C  CG    . ASP A 1 117 ? 53.550  -10.832 -7.002  1.00 97.28  ? 117  ASP B CG    1 
ATOM   932  O  OD1   . ASP A 1 117 ? 53.612  -10.008 -7.937  1.00 100.28 ? 117  ASP B OD1   1 
ATOM   933  O  OD2   . ASP A 1 117 ? 53.743  -10.519 -5.810  1.00 100.49 ? 117  ASP B OD2   1 
ATOM   934  N  N     . TYR A 1 118 ? 50.340  -12.904 -6.827  1.00 86.72  ? 118  TYR B N     1 
ATOM   935  C  CA    . TYR A 1 118 ? 49.044  -12.668 -6.199  1.00 87.96  ? 118  TYR B CA    1 
ATOM   936  C  C     . TYR A 1 118 ? 49.014  -11.412 -5.336  1.00 88.37  ? 118  TYR B C     1 
ATOM   937  O  O     . TYR A 1 118 ? 47.941  -10.898 -5.020  1.00 86.74  ? 118  TYR B O     1 
ATOM   938  C  CB    . TYR A 1 118 ? 48.605  -13.884 -5.372  1.00 84.69  ? 118  TYR B CB    1 
ATOM   939  C  CG    . TYR A 1 118 ? 48.026  -15.006 -6.208  1.00 80.82  ? 118  TYR B CG    1 
ATOM   940  C  CD1   . TYR A 1 118 ? 47.357  -14.734 -7.403  1.00 79.33  ? 118  TYR B CD1   1 
ATOM   941  C  CD2   . TYR A 1 118 ? 48.112  -16.335 -5.791  1.00 79.97  ? 118  TYR B CD2   1 
ATOM   942  C  CE1   . TYR A 1 118 ? 46.790  -15.754 -8.162  1.00 79.14  ? 118  TYR B CE1   1 
ATOM   943  C  CE2   . TYR A 1 118 ? 47.546  -17.363 -6.543  1.00 80.03  ? 118  TYR B CE2   1 
ATOM   944  C  CZ    . TYR A 1 118 ? 46.888  -17.065 -7.726  1.00 79.80  ? 118  TYR B CZ    1 
ATOM   945  O  OH    . TYR A 1 118 ? 46.322  -18.075 -8.469  1.00 80.16  ? 118  TYR B OH    1 
ATOM   946  N  N     . ARG A 1 119 ? 50.192  -10.920 -4.957  1.00 90.24  ? 119  ARG B N     1 
ATOM   947  C  CA    . ARG A 1 119 ? 50.291  -9.706  -4.152  1.00 94.46  ? 119  ARG B CA    1 
ATOM   948  C  C     . ARG A 1 119 ? 49.982  -8.523  -5.060  1.00 91.78  ? 119  ARG B C     1 
ATOM   949  O  O     . ARG A 1 119 ? 49.369  -7.545  -4.636  1.00 93.77  ? 119  ARG B O     1 
ATOM   950  C  CB    . ARG A 1 119 ? 51.699  -9.548  -3.570  1.00 95.46  ? 119  ARG B CB    1 
ATOM   951  C  CG    . ARG A 1 119 ? 51.877  -8.306  -2.692  1.00 104.96 ? 119  ARG B CG    1 
ATOM   952  C  CD    . ARG A 1 119 ? 53.341  -8.062  -2.333  1.00 115.85 ? 119  ARG B CD    1 
ATOM   953  N  NE    . ARG A 1 119 ? 54.145  -7.679  -3.493  1.00 124.30 ? 119  ARG B NE    1 
ATOM   954  C  CZ    . ARG A 1 119 ? 54.145  -6.470  -4.048  1.00 127.44 ? 119  ARG B CZ    1 
ATOM   955  N  NH1   . ARG A 1 119 ? 53.383  -5.504  -3.552  1.00 128.69 ? 119  ARG B NH1   1 
ATOM   956  N  NH2   . ARG A 1 119 ? 54.903  -6.227  -5.109  1.00 128.71 ? 119  ARG B NH2   1 
ATOM   957  N  N     . GLU A 1 120 ? 50.418  -8.619  -6.312  1.00 92.86  ? 120  GLU B N     1 
ATOM   958  C  CA    . GLU A 1 120 ? 50.168  -7.569  -7.291  1.00 93.82  ? 120  GLU B CA    1 
ATOM   959  C  C     . GLU A 1 120 ? 48.729  -7.684  -7.751  1.00 92.03  ? 120  GLU B C     1 
ATOM   960  O  O     . GLU A 1 120 ? 48.058  -6.683  -7.994  1.00 92.98  ? 120  GLU B O     1 
ATOM   961  C  CB    . GLU A 1 120 ? 51.098  -7.722  -8.490  1.00 93.44  ? 120  GLU B CB    1 
ATOM   962  C  CG    . GLU A 1 120 ? 52.479  -7.150  -8.277  1.00 102.12 ? 120  GLU B CG    1 
ATOM   963  C  CD    . GLU A 1 120 ? 53.414  -7.470  -9.421  1.00 107.67 ? 120  GLU B CD    1 
ATOM   964  O  OE1   . GLU A 1 120 ? 53.032  -7.237  -10.587 1.00 111.90 ? 120  GLU B OE1   1 
ATOM   965  O  OE2   . GLU A 1 120 ? 54.532  -7.953  -9.152  1.00 111.78 ? 120  GLU B OE2   1 
ATOM   966  N  N     . ALA A 1 121 ? 48.263  -8.920  -7.875  1.00 89.79  ? 121  ALA B N     1 
ATOM   967  C  CA    . ALA A 1 121 ? 46.896  -9.171  -8.292  1.00 87.60  ? 121  ALA B CA    1 
ATOM   968  C  C     . ALA A 1 121 ? 45.979  -8.526  -7.264  1.00 87.26  ? 121  ALA B C     1 
ATOM   969  O  O     . ALA A 1 121 ? 45.093  -7.743  -7.603  1.00 86.61  ? 121  ALA B O     1 
ATOM   970  C  CB    . ALA A 1 121 ? 46.638  -10.669 -8.361  1.00 89.63  ? 121  ALA B CB    1 
ATOM   971  N  N     . TYR A 1 122 ? 46.214  -8.851  -6.000  1.00 84.63  ? 122  TYR B N     1 
ATOM   972  C  CA    . TYR A 1 122 ? 45.416  -8.318  -4.907  1.00 82.31  ? 122  TYR B CA    1 
ATOM   973  C  C     . TYR A 1 122 ? 45.376  -6.797  -4.891  1.00 84.61  ? 122  TYR B C     1 
ATOM   974  O  O     . TYR A 1 122 ? 44.350  -6.204  -4.556  1.00 84.83  ? 122  TYR B O     1 
ATOM   975  C  CB    . TYR A 1 122 ? 45.971  -8.804  -3.579  1.00 76.89  ? 122  TYR B CB    1 
ATOM   976  C  CG    . TYR A 1 122 ? 45.165  -8.375  -2.381  1.00 69.65  ? 122  TYR B CG    1 
ATOM   977  C  CD1   . TYR A 1 122 ? 44.180  -9.205  -1.852  1.00 65.81  ? 122  TYR B CD1   1 
ATOM   978  C  CD2   . TYR A 1 122 ? 45.432  -7.169  -1.733  1.00 65.50  ? 122  TYR B CD2   1 
ATOM   979  C  CE1   . TYR A 1 122 ? 43.491  -8.854  -0.699  1.00 61.39  ? 122  TYR B CE1   1 
ATOM   980  C  CE2   . TYR A 1 122 ? 44.747  -6.809  -0.581  1.00 61.02  ? 122  TYR B CE2   1 
ATOM   981  C  CZ    . TYR A 1 122 ? 43.783  -7.658  -0.066  1.00 60.23  ? 122  TYR B CZ    1 
ATOM   982  O  OH    . TYR A 1 122 ? 43.138  -7.334  1.103   1.00 59.39  ? 122  TYR B OH    1 
ATOM   983  N  N     . ASN A 1 123 ? 46.492  -6.161  -5.229  1.00 84.70  ? 123  ASN B N     1 
ATOM   984  C  CA    . ASN A 1 123 ? 46.531  -4.708  -5.228  1.00 85.16  ? 123  ASN B CA    1 
ATOM   985  C  C     . ASN A 1 123 ? 45.730  -4.164  -6.404  1.00 85.06  ? 123  ASN B C     1 
ATOM   986  O  O     . ASN A 1 123 ? 45.069  -3.133  -6.292  1.00 84.32  ? 123  ASN B O     1 
ATOM   987  C  CB    . ASN A 1 123 ? 47.978  -4.211  -5.284  1.00 89.93  ? 123  ASN B CB    1 
ATOM   988  C  CG    . ASN A 1 123 ? 48.796  -4.662  -4.084  1.00 93.29  ? 123  ASN B CG    1 
ATOM   989  O  OD1   . ASN A 1 123 ? 48.395  -4.471  -2.934  1.00 94.96  ? 123  ASN B OD1   1 
ATOM   990  N  ND2   . ASN A 1 123 ? 49.954  -5.254  -4.347  1.00 94.95  ? 123  ASN B ND2   1 
ATOM   991  N  N     . LEU A 1 124 ? 45.784  -4.866  -7.530  1.00 82.74  ? 124  LEU B N     1 
ATOM   992  C  CA    . LEU A 1 124 ? 45.041  -4.440  -8.704  1.00 78.72  ? 124  LEU B CA    1 
ATOM   993  C  C     . LEU A 1 124 ? 43.557  -4.552  -8.385  1.00 81.28  ? 124  LEU B C     1 
ATOM   994  O  O     . LEU A 1 124 ? 42.744  -3.772  -8.883  1.00 83.00  ? 124  LEU B O     1 
ATOM   995  C  CB    . LEU A 1 124 ? 45.392  -5.317  -9.907  1.00 70.54  ? 124  LEU B CB    1 
ATOM   996  C  CG    . LEU A 1 124 ? 44.763  -4.917  -11.242 1.00 60.23  ? 124  LEU B CG    1 
ATOM   997  C  CD1   . LEU A 1 124 ? 45.091  -3.466  -11.564 1.00 50.77  ? 124  LEU B CD1   1 
ATOM   998  C  CD2   . LEU A 1 124 ? 45.285  -5.830  -12.329 1.00 51.06  ? 124  LEU B CD2   1 
ATOM   999  N  N     . GLY A 1 125 ? 43.212  -5.529  -7.551  1.00 82.05  ? 125  GLY B N     1 
ATOM   1000 C  CA    . GLY A 1 125 ? 41.827  -5.713  -7.167  1.00 81.46  ? 125  GLY B CA    1 
ATOM   1001 C  C     . GLY A 1 125 ? 41.335  -4.472  -6.450  1.00 83.87  ? 125  GLY B C     1 
ATOM   1002 O  O     . GLY A 1 125 ? 40.401  -3.812  -6.902  1.00 86.68  ? 125  GLY B O     1 
ATOM   1003 N  N     . LEU A 1 126 ? 41.972  -4.154  -5.328  1.00 83.35  ? 126  LEU B N     1 
ATOM   1004 C  CA    . LEU A 1 126 ? 41.614  -2.975  -4.549  1.00 82.17  ? 126  LEU B CA    1 
ATOM   1005 C  C     . LEU A 1 126 ? 41.557  -1.741  -5.443  1.00 83.45  ? 126  LEU B C     1 
ATOM   1006 O  O     . LEU A 1 126 ? 40.627  -0.942  -5.347  1.00 80.08  ? 126  LEU B O     1 
ATOM   1007 C  CB    . LEU A 1 126 ? 42.629  -2.766  -3.423  1.00 74.55  ? 126  LEU B CB    1 
ATOM   1008 C  CG    . LEU A 1 126 ? 42.349  -3.522  -2.121  1.00 66.08  ? 126  LEU B CG    1 
ATOM   1009 C  CD1   . LEU A 1 126 ? 43.639  -3.790  -1.369  1.00 59.55  ? 126  LEU B CD1   1 
ATOM   1010 C  CD2   . LEU A 1 126 ? 41.389  -2.703  -1.278  1.00 59.76  ? 126  LEU B CD2   1 
ATOM   1011 N  N     . GLU A 1 127 ? 42.550  -1.584  -6.313  1.00 82.93  ? 127  GLU B N     1 
ATOM   1012 C  CA    . GLU A 1 127 ? 42.563  -0.441  -7.217  1.00 83.67  ? 127  GLU B CA    1 
ATOM   1013 C  C     . GLU A 1 127 ? 41.224  -0.442  -7.949  1.00 81.07  ? 127  GLU B C     1 
ATOM   1014 O  O     . GLU A 1 127 ? 40.536  0.577   -8.016  1.00 85.01  ? 127  GLU B O     1 
ATOM   1015 C  CB    . GLU A 1 127 ? 43.718  -0.559  -8.222  1.00 90.31  ? 127  GLU B CB    1 
ATOM   1016 C  CG    . GLU A 1 127 ? 43.976  0.712   -9.026  1.00 101.29 ? 127  GLU B CG    1 
ATOM   1017 C  CD    . GLU A 1 127 ? 45.154  0.587   -9.979  1.00 108.49 ? 127  GLU B CD    1 
ATOM   1018 O  OE1   . GLU A 1 127 ? 46.266  0.251   -9.519  1.00 114.76 ? 127  GLU B OE1   1 
ATOM   1019 O  OE2   . GLU A 1 127 ? 44.969  0.833   -11.189 1.00 114.69 ? 127  GLU B OE2   1 
ATOM   1020 N  N     . ILE A 1 128 ? 40.857  -1.609  -8.474  1.00 80.22  ? 128  ILE B N     1 
ATOM   1021 C  CA    . ILE A 1 128 ? 39.608  -1.787  -9.203  1.00 71.57  ? 128  ILE B CA    1 
ATOM   1022 C  C     . ILE A 1 128 ? 38.398  -1.442  -8.337  1.00 73.99  ? 128  ILE B C     1 
ATOM   1023 O  O     . ILE A 1 128 ? 37.610  -0.565  -8.693  1.00 68.23  ? 128  ILE B O     1 
ATOM   1024 C  CB    . ILE A 1 128 ? 39.495  -3.240  -9.738  1.00 68.03  ? 128  ILE B CB    1 
ATOM   1025 C  CG1   . ILE A 1 128 ? 40.471  -3.426  -10.904 1.00 68.44  ? 128  ILE B CG1   1 
ATOM   1026 C  CG2   . ILE A 1 128 ? 38.072  -3.542  -10.185 1.00 70.88  ? 128  ILE B CG2   1 
ATOM   1027 C  CD1   . ILE A 1 128 ? 40.582  -4.847  -11.413 1.00 62.76  ? 128  ILE B CD1   1 
ATOM   1028 N  N     . LYS A 1 129 ? 38.245  -2.120  -7.205  1.00 71.97  ? 129  LYS B N     1 
ATOM   1029 C  CA    . LYS A 1 129 ? 37.123  -1.832  -6.322  1.00 74.47  ? 129  LYS B CA    1 
ATOM   1030 C  C     . LYS A 1 129 ? 36.966  -0.325  -6.168  1.00 77.97  ? 129  LYS B C     1 
ATOM   1031 O  O     . LYS A 1 129 ? 35.898  0.225   -6.442  1.00 81.04  ? 129  LYS B O     1 
ATOM   1032 C  CB    . LYS A 1 129 ? 37.337  -2.491  -4.958  1.00 74.35  ? 129  LYS B CB    1 
ATOM   1033 C  CG    . LYS A 1 129 ? 37.004  -3.975  -4.958  1.00 67.76  ? 129  LYS B CG    1 
ATOM   1034 C  CD    . LYS A 1 129 ? 37.522  -4.685  -3.719  1.00 63.58  ? 129  LYS B CD    1 
ATOM   1035 C  CE    . LYS A 1 129 ? 36.920  -4.119  -2.446  1.00 61.95  ? 129  LYS B CE    1 
ATOM   1036 N  NZ    . LYS A 1 129 ? 35.437  -4.245  -2.429  1.00 60.91  ? 129  LYS B NZ    1 
ATOM   1037 N  N     . ASN A 1 130 ? 38.041  0.342   -5.754  1.00 81.80  ? 130  ASN B N     1 
ATOM   1038 C  CA    . ASN A 1 130 ? 38.020  1.789   -5.571  1.00 82.93  ? 130  ASN B CA    1 
ATOM   1039 C  C     . ASN A 1 130 ? 37.528  2.502   -6.821  1.00 79.31  ? 130  ASN B C     1 
ATOM   1040 O  O     . ASN A 1 130 ? 36.510  3.190   -6.779  1.00 79.03  ? 130  ASN B O     1 
ATOM   1041 C  CB    . ASN A 1 130 ? 39.411  2.310   -5.199  1.00 89.22  ? 130  ASN B CB    1 
ATOM   1042 C  CG    . ASN A 1 130 ? 39.909  1.748   -3.886  1.00 99.27  ? 130  ASN B CG    1 
ATOM   1043 O  OD1   . ASN A 1 130 ? 39.158  1.648   -2.916  1.00 106.97 ? 130  ASN B OD1   1 
ATOM   1044 N  ND2   . ASN A 1 130 ? 41.186  1.388   -3.841  1.00 106.63 ? 130  ASN B ND2   1 
ATOM   1045 N  N     . LYS A 1 131 ? 38.250  2.349   -7.928  1.00 73.97  ? 131  LYS B N     1 
ATOM   1046 C  CA    . LYS A 1 131 ? 37.842  2.988   -9.174  1.00 68.68  ? 131  LYS B CA    1 
ATOM   1047 C  C     . LYS A 1 131 ? 36.319  2.919   -9.292  1.00 68.49  ? 131  LYS B C     1 
ATOM   1048 O  O     . LYS A 1 131 ? 35.655  3.944   -9.443  1.00 67.08  ? 131  LYS B O     1 
ATOM   1049 C  CB    . LYS A 1 131 ? 38.493  2.290   -10.373 1.00 68.60  ? 131  LYS B CB    1 
ATOM   1050 C  CG    . LYS A 1 131 ? 37.859  2.640   -11.713 1.00 61.28  ? 131  LYS B CG    1 
ATOM   1051 C  CD    . LYS A 1 131 ? 38.199  4.055   -12.167 1.00 56.70  ? 131  LYS B CD    1 
ATOM   1052 C  CE    . LYS A 1 131 ? 39.611  4.126   -12.730 1.00 54.97  ? 131  LYS B CE    1 
ATOM   1053 N  NZ    . LYS A 1 131 ? 39.965  5.478   -13.243 1.00 53.85  ? 131  LYS B NZ    1 
ATOM   1054 N  N     . ILE A 1 132 ? 35.777  1.706   -9.199  1.00 65.90  ? 132  ILE B N     1 
ATOM   1055 C  CA    . ILE A 1 132 ? 34.334  1.478   -9.285  1.00 59.10  ? 132  ILE B CA    1 
ATOM   1056 C  C     . ILE A 1 132 ? 33.569  2.324   -8.268  1.00 63.99  ? 132  ILE B C     1 
ATOM   1057 O  O     . ILE A 1 132 ? 32.573  2.970   -8.601  1.00 60.83  ? 132  ILE B O     1 
ATOM   1058 C  CB    . ILE A 1 132 ? 33.993  -0.028  -9.059  1.00 57.81  ? 132  ILE B CB    1 
ATOM   1059 C  CG1   . ILE A 1 132 ? 34.513  -0.858  -10.240 1.00 57.41  ? 132  ILE B CG1   1 
ATOM   1060 C  CG2   . ILE A 1 132 ? 32.488  -0.217  -8.887  1.00 59.63  ? 132  ILE B CG2   1 
ATOM   1061 C  CD1   . ILE A 1 132 ? 34.177  -2.344  -10.173 1.00 49.90  ? 132  ILE B CD1   1 
ATOM   1062 N  N     . LEU A 1 133 ? 34.043  2.316   -7.027  1.00 64.97  ? 133  LEU B N     1 
ATOM   1063 C  CA    . LEU A 1 133 ? 33.411  3.080   -5.961  1.00 66.31  ? 133  LEU B CA    1 
ATOM   1064 C  C     . LEU A 1 133 ? 33.487  4.572   -6.253  1.00 71.44  ? 133  LEU B C     1 
ATOM   1065 O  O     . LEU A 1 133 ? 32.589  5.332   -5.887  1.00 72.41  ? 133  LEU B O     1 
ATOM   1066 C  CB    . LEU A 1 133 ? 34.096  2.800   -4.625  1.00 61.31  ? 133  LEU B CB    1 
ATOM   1067 C  CG    . LEU A 1 133 ? 33.364  3.421   -3.434  1.00 54.50  ? 133  LEU B CG    1 
ATOM   1068 C  CD1   . LEU A 1 133 ? 32.018  2.732   -3.268  1.00 48.02  ? 133  LEU B CD1   1 
ATOM   1069 C  CD2   . LEU A 1 133 ? 34.195  3.277   -2.173  1.00 47.93  ? 133  LEU B CD2   1 
ATOM   1070 N  N     . GLU A 1 134 ? 34.566  4.987   -6.908  1.00 76.81  ? 134  GLU B N     1 
ATOM   1071 C  CA    . GLU A 1 134 ? 34.749  6.391   -7.245  1.00 81.38  ? 134  GLU B CA    1 
ATOM   1072 C  C     . GLU A 1 134 ? 33.752  6.806   -8.326  1.00 76.66  ? 134  GLU B C     1 
ATOM   1073 O  O     . GLU A 1 134 ? 32.929  7.697   -8.120  1.00 78.91  ? 134  GLU B O     1 
ATOM   1074 C  CB    . GLU A 1 134 ? 36.188  6.642   -7.734  1.00 88.62  ? 134  GLU B CB    1 
ATOM   1075 C  CG    . GLU A 1 134 ? 37.280  6.368   -6.689  1.00 107.27 ? 134  GLU B CG    1 
ATOM   1076 C  CD    . GLU A 1 134 ? 38.698  6.519   -7.237  1.00 117.90 ? 134  GLU B CD    1 
ATOM   1077 O  OE1   . GLU A 1 134 ? 38.974  5.982   -8.329  1.00 125.37 ? 134  GLU B OE1   1 
ATOM   1078 O  OE2   . GLU A 1 134 ? 39.540  7.160   -6.569  1.00 125.31 ? 134  GLU B OE2   1 
ATOM   1079 N  N     . LYS A 1 135 ? 33.817  6.127   -9.465  1.00 72.38  ? 135  LYS B N     1 
ATOM   1080 C  CA    . LYS A 1 135 ? 32.963  6.426   -10.609 1.00 67.33  ? 135  LYS B CA    1 
ATOM   1081 C  C     . LYS A 1 135 ? 31.459  6.177   -10.469 1.00 61.53  ? 135  LYS B C     1 
ATOM   1082 O  O     . LYS A 1 135 ? 30.655  6.987   -10.931 1.00 59.62  ? 135  LYS B O     1 
ATOM   1083 C  CB    . LYS A 1 135 ? 33.484  5.665   -11.831 1.00 65.98  ? 135  LYS B CB    1 
ATOM   1084 C  CG    . LYS A 1 135 ? 34.932  5.979   -12.192 1.00 67.70  ? 135  LYS B CG    1 
ATOM   1085 C  CD    . LYS A 1 135 ? 35.060  7.302   -12.934 1.00 71.68  ? 135  LYS B CD    1 
ATOM   1086 C  CE    . LYS A 1 135 ? 36.508  7.573   -13.321 1.00 74.68  ? 135  LYS B CE    1 
ATOM   1087 N  NZ    . LYS A 1 135 ? 36.643  8.719   -14.264 1.00 76.48  ? 135  LYS B NZ    1 
ATOM   1088 N  N     . GLU A 1 136 ? 31.071  5.072   -9.835  1.00 57.16  ? 136  GLU B N     1 
ATOM   1089 C  CA    . GLU A 1 136 ? 29.648  4.747   -9.709  1.00 54.61  ? 136  GLU B CA    1 
ATOM   1090 C  C     . GLU A 1 136 ? 29.127  4.467   -8.297  1.00 53.20  ? 136  GLU B C     1 
ATOM   1091 O  O     . GLU A 1 136 ? 27.981  4.043   -8.145  1.00 52.65  ? 136  GLU B O     1 
ATOM   1092 C  CB    . GLU A 1 136 ? 29.327  3.531   -10.582 1.00 49.79  ? 136  GLU B CB    1 
ATOM   1093 C  CG    . GLU A 1 136 ? 29.709  3.668   -12.047 1.00 47.96  ? 136  GLU B CG    1 
ATOM   1094 C  CD    . GLU A 1 136 ? 28.669  4.404   -12.868 1.00 48.79  ? 136  GLU B CD    1 
ATOM   1095 O  OE1   . GLU A 1 136 ? 27.545  4.610   -12.366 1.00 50.14  ? 136  GLU B OE1   1 
ATOM   1096 O  OE2   . GLU A 1 136 ? 28.973  4.760   -14.026 1.00 49.15  ? 136  GLU B OE2   1 
ATOM   1097 N  N     . LYS A 1 137 ? 29.950  4.702   -7.278  1.00 54.46  ? 137  LYS B N     1 
ATOM   1098 C  CA    . LYS A 1 137 ? 29.574  4.446   -5.882  1.00 56.30  ? 137  LYS B CA    1 
ATOM   1099 C  C     . LYS A 1 137 ? 28.893  3.095   -5.689  1.00 55.10  ? 137  LYS B C     1 
ATOM   1100 O  O     . LYS A 1 137 ? 27.927  2.962   -4.933  1.00 56.68  ? 137  LYS B O     1 
ATOM   1101 C  CB    . LYS A 1 137 ? 28.672  5.557   -5.325  1.00 59.82  ? 137  LYS B CB    1 
ATOM   1102 C  CG    . LYS A 1 137 ? 27.261  5.621   -5.896  1.00 67.73  ? 137  LYS B CG    1 
ATOM   1103 C  CD    . LYS A 1 137 ? 27.163  6.609   -7.046  1.00 74.29  ? 137  LYS B CD    1 
ATOM   1104 C  CE    . LYS A 1 137 ? 27.229  8.041   -6.546  1.00 78.72  ? 137  LYS B CE    1 
ATOM   1105 N  NZ    . LYS A 1 137 ? 28.433  8.291   -5.709  1.00 80.62  ? 137  LYS B NZ    1 
ATOM   1106 N  N     . ILE A 1 138 ? 29.416  2.092   -6.382  1.00 54.54  ? 138  ILE B N     1 
ATOM   1107 C  CA    . ILE A 1 138 ? 28.895  0.737   -6.295  1.00 52.04  ? 138  ILE B CA    1 
ATOM   1108 C  C     . ILE A 1 138 ? 29.975  -0.174  -5.726  1.00 52.34  ? 138  ILE B C     1 
ATOM   1109 O  O     . ILE A 1 138 ? 31.050  -0.296  -6.306  1.00 50.66  ? 138  ILE B O     1 
ATOM   1110 C  CB    . ILE A 1 138 ? 28.483  0.208   -7.688  1.00 51.08  ? 138  ILE B CB    1 
ATOM   1111 C  CG1   . ILE A 1 138 ? 27.182  0.872   -8.139  1.00 52.52  ? 138  ILE B CG1   1 
ATOM   1112 C  CG2   . ILE A 1 138 ? 28.269  -1.293  -7.635  1.00 54.43  ? 138  ILE B CG2   1 
ATOM   1113 C  CD1   . ILE A 1 138 ? 25.986  0.464   -7.304  1.00 51.40  ? 138  ILE B CD1   1 
ATOM   1114 N  N     . THR A 1 139 ? 29.714  -0.804  -4.588  1.00 48.28  ? 139  THR B N     1 
ATOM   1115 C  CA    . THR A 1 139 ? 30.715  -1.702  -4.024  1.00 47.56  ? 139  THR B CA    1 
ATOM   1116 C  C     . THR A 1 139 ? 30.592  -3.044  -4.719  1.00 46.74  ? 139  THR B C     1 
ATOM   1117 O  O     . THR A 1 139 ? 29.505  -3.450  -5.129  1.00 47.57  ? 139  THR B O     1 
ATOM   1118 C  CB    . THR A 1 139 ? 30.522  -1.927  -2.524  1.00 50.06  ? 139  THR B CB    1 
ATOM   1119 O  OG1   . THR A 1 139 ? 29.359  -2.732  -2.307  1.00 48.87  ? 139  THR B OG1   1 
ATOM   1120 C  CG2   . THR A 1 139 ? 30.358  -0.603  -1.818  1.00 50.10  ? 139  THR B CG2   1 
ATOM   1121 N  N     . VAL A 1 140 ? 31.717  -3.733  -4.851  1.00 45.62  ? 140  VAL B N     1 
ATOM   1122 C  CA    . VAL A 1 140 ? 31.738  -5.024  -5.512  1.00 40.22  ? 140  VAL B CA    1 
ATOM   1123 C  C     . VAL A 1 140 ? 32.785  -5.889  -4.829  1.00 42.33  ? 140  VAL B C     1 
ATOM   1124 O  O     . VAL A 1 140 ? 33.680  -5.371  -4.161  1.00 40.19  ? 140  VAL B O     1 
ATOM   1125 C  CB    . VAL A 1 140 ? 32.118  -4.862  -6.986  1.00 38.14  ? 140  VAL B CB    1 
ATOM   1126 C  CG1   . VAL A 1 140 ? 31.359  -3.695  -7.582  1.00 35.96  ? 140  VAL B CG1   1 
ATOM   1127 C  CG2   . VAL A 1 140 ? 33.616  -4.637  -7.115  1.00 36.43  ? 140  VAL B CG2   1 
ATOM   1128 N  N     . THR A 1 141 ? 32.682  -7.201  -4.999  1.00 42.99  ? 141  THR B N     1 
ATOM   1129 C  CA    . THR A 1 141 ? 33.642  -8.107  -4.387  1.00 45.72  ? 141  THR B CA    1 
ATOM   1130 C  C     . THR A 1 141 ? 34.635  -8.626  -5.418  1.00 47.25  ? 141  THR B C     1 
ATOM   1131 O  O     . THR A 1 141 ? 34.308  -8.758  -6.596  1.00 48.98  ? 141  THR B O     1 
ATOM   1132 C  CB    . THR A 1 141 ? 32.927  -9.295  -3.720  1.00 46.56  ? 141  THR B CB    1 
ATOM   1133 O  OG1   . THR A 1 141 ? 32.136  -8.820  -2.624  1.00 46.46  ? 141  THR B OG1   1 
ATOM   1134 C  CG2   . THR A 1 141 ? 33.935  -10.302 -3.205  1.00 47.22  ? 141  THR B CG2   1 
ATOM   1135 N  N     . VAL A 1 142 ? 35.855  -8.910  -4.978  1.00 48.58  ? 142  VAL B N     1 
ATOM   1136 C  CA    . VAL A 1 142 ? 36.874  -9.419  -5.883  1.00 50.44  ? 142  VAL B CA    1 
ATOM   1137 C  C     . VAL A 1 142 ? 37.429  -10.750 -5.398  1.00 49.43  ? 142  VAL B C     1 
ATOM   1138 O  O     . VAL A 1 142 ? 37.629  -10.953 -4.200  1.00 49.51  ? 142  VAL B O     1 
ATOM   1139 C  CB    . VAL A 1 142 ? 38.046  -8.428  -6.034  1.00 50.35  ? 142  VAL B CB    1 
ATOM   1140 C  CG1   . VAL A 1 142 ? 39.132  -9.039  -6.912  1.00 51.40  ? 142  VAL B CG1   1 
ATOM   1141 C  CG2   . VAL A 1 142 ? 37.550  -7.126  -6.641  1.00 51.75  ? 142  VAL B CG2   1 
ATOM   1142 N  N     . GLY A 1 143 ? 37.665  -11.651 -6.347  1.00 49.08  ? 143  GLY B N     1 
ATOM   1143 C  CA    . GLY A 1 143 ? 38.212  -12.960 -6.039  1.00 48.05  ? 143  GLY B CA    1 
ATOM   1144 C  C     . GLY A 1 143 ? 39.306  -13.268 -7.043  1.00 47.02  ? 143  GLY B C     1 
ATOM   1145 O  O     . GLY A 1 143 ? 39.063  -13.266 -8.250  1.00 47.36  ? 143  GLY B O     1 
ATOM   1146 N  N     . ILE A 1 144 ? 40.513  -13.528 -6.556  1.00 46.71  ? 144  ILE B N     1 
ATOM   1147 C  CA    . ILE A 1 144 ? 41.631  -13.816 -7.445  1.00 43.44  ? 144  ILE B CA    1 
ATOM   1148 C  C     . ILE A 1 144 ? 42.179  -15.214 -7.231  1.00 43.41  ? 144  ILE B C     1 
ATOM   1149 O  O     . ILE A 1 144 ? 42.291  -15.673 -6.094  1.00 42.42  ? 144  ILE B O     1 
ATOM   1150 C  CB    . ILE A 1 144 ? 42.790  -12.837 -7.219  1.00 44.04  ? 144  ILE B CB    1 
ATOM   1151 C  CG1   . ILE A 1 144 ? 42.283  -11.399 -7.275  1.00 45.15  ? 144  ILE B CG1   1 
ATOM   1152 C  CG2   . ILE A 1 144 ? 43.857  -13.054 -8.279  1.00 45.45  ? 144  ILE B CG2   1 
ATOM   1153 C  CD1   . ILE A 1 144 ? 43.250  -10.392 -6.691  1.00 42.96  ? 144  ILE B CD1   1 
ATOM   1154 N  N     . SER A 1 145 ? 42.528  -15.881 -8.327  1.00 42.55  ? 145  SER B N     1 
ATOM   1155 C  CA    . SER A 1 145 ? 43.089  -17.216 -8.245  1.00 42.89  ? 145  SER B CA    1 
ATOM   1156 C  C     . SER A 1 145 ? 43.577  -17.746 -9.592  1.00 43.22  ? 145  SER B C     1 
ATOM   1157 O  O     . SER A 1 145 ? 43.664  -17.003 -10.565 1.00 42.89  ? 145  SER B O     1 
ATOM   1158 C  CB    . SER A 1 145 ? 42.080  -18.180 -7.630  1.00 40.99  ? 145  SER B CB    1 
ATOM   1159 O  OG    . SER A 1 145 ? 42.765  -19.203 -6.923  1.00 37.92  ? 145  SER B OG    1 
ATOM   1160 N  N     . LYS A 1 146 ? 43.876  -19.040 -9.642  1.00 44.23  ? 146  LYS B N     1 
ATOM   1161 C  CA    . LYS A 1 146 ? 44.411  -19.676 -10.845 1.00 46.59  ? 146  LYS B CA    1 
ATOM   1162 C  C     . LYS A 1 146 ? 43.476  -20.033 -11.995 1.00 45.05  ? 146  LYS B C     1 
ATOM   1163 O  O     . LYS A 1 146 ? 43.925  -20.532 -13.027 1.00 47.19  ? 146  LYS B O     1 
ATOM   1164 C  CB    . LYS A 1 146 ? 45.206  -20.915 -10.439 1.00 48.82  ? 146  LYS B CB    1 
ATOM   1165 C  CG    . LYS A 1 146 ? 44.535  -21.755 -9.371  1.00 55.43  ? 146  LYS B CG    1 
ATOM   1166 C  CD    . LYS A 1 146 ? 45.377  -22.974 -9.067  1.00 62.98  ? 146  LYS B CD    1 
ATOM   1167 C  CE    . LYS A 1 146 ? 45.498  -23.853 -10.297 1.00 68.66  ? 146  LYS B CE    1 
ATOM   1168 N  NZ    . LYS A 1 146 ? 46.647  -24.789 -10.196 1.00 71.49  ? 146  LYS B NZ    1 
ATOM   1169 N  N     . ASN A 1 147 ? 42.186  -19.796 -11.834 1.00 45.37  ? 147  ASN B N     1 
ATOM   1170 C  CA    . ASN A 1 147 ? 41.261  -20.088 -12.910 1.00 43.54  ? 147  ASN B CA    1 
ATOM   1171 C  C     . ASN A 1 147 ? 39.955  -19.412 -12.580 1.00 41.61  ? 147  ASN B C     1 
ATOM   1172 O  O     . ASN A 1 147 ? 39.783  -18.876 -11.490 1.00 40.52  ? 147  ASN B O     1 
ATOM   1173 C  CB    . ASN A 1 147 ? 41.053  -21.599 -13.069 1.00 43.71  ? 147  ASN B CB    1 
ATOM   1174 C  CG    . ASN A 1 147 ? 40.530  -22.249 -11.811 1.00 45.62  ? 147  ASN B CG    1 
ATOM   1175 O  OD1   . ASN A 1 147 ? 39.700  -21.678 -11.108 1.00 47.02  ? 147  ASN B OD1   1 
ATOM   1176 N  ND2   . ASN A 1 147 ? 41.000  -23.457 -11.526 1.00 46.87  ? 147  ASN B ND2   1 
ATOM   1177 N  N     . LYS A 1 148 ? 39.031  -19.427 -13.525 1.00 39.39  ? 148  LYS B N     1 
ATOM   1178 C  CA    . LYS A 1 148 ? 37.745  -18.804 -13.294 1.00 37.83  ? 148  LYS B CA    1 
ATOM   1179 C  C     . LYS A 1 148 ? 36.980  -19.463 -12.140 1.00 37.70  ? 148  LYS B C     1 
ATOM   1180 O  O     . LYS A 1 148 ? 36.445  -18.770 -11.276 1.00 36.79  ? 148  LYS B O     1 
ATOM   1181 C  CB    . LYS A 1 148 ? 36.915  -18.839 -14.578 1.00 38.48  ? 148  LYS B CB    1 
ATOM   1182 C  CG    . LYS A 1 148 ? 37.522  -18.032 -15.727 1.00 38.43  ? 148  LYS B CG    1 
ATOM   1183 C  CD    . LYS A 1 148 ? 36.535  -17.884 -16.876 1.00 38.56  ? 148  LYS B CD    1 
ATOM   1184 C  CE    . LYS A 1 148 ? 36.216  -19.215 -17.536 1.00 38.16  ? 148  LYS B CE    1 
ATOM   1185 N  NZ    . LYS A 1 148 ? 35.055  -19.078 -18.464 1.00 38.46  ? 148  LYS B NZ    1 
ATOM   1186 N  N     . VAL A 1 149 ? 36.944  -20.794 -12.105 1.00 35.70  ? 149  VAL B N     1 
ATOM   1187 C  CA    . VAL A 1 149 ? 36.213  -21.500 -11.049 1.00 34.22  ? 149  VAL B CA    1 
ATOM   1188 C  C     . VAL A 1 149 ? 36.618  -21.140 -9.627  1.00 37.26  ? 149  VAL B C     1 
ATOM   1189 O  O     . VAL A 1 149 ? 35.759  -20.931 -8.770  1.00 36.12  ? 149  VAL B O     1 
ATOM   1190 C  CB    . VAL A 1 149 ? 36.335  -23.039 -11.172 1.00 32.40  ? 149  VAL B CB    1 
ATOM   1191 C  CG1   . VAL A 1 149 ? 35.649  -23.710 -9.979  1.00 28.39  ? 149  VAL B CG1   1 
ATOM   1192 C  CG2   . VAL A 1 149 ? 35.698  -23.515 -12.463 1.00 27.74  ? 149  VAL B CG2   1 
ATOM   1193 N  N     . PHE A 1 150 ? 37.917  -21.081 -9.361  1.00 40.85  ? 150  PHE B N     1 
ATOM   1194 C  CA    . PHE A 1 150 ? 38.354  -20.766 -8.013  1.00 43.98  ? 150  PHE B CA    1 
ATOM   1195 C  C     . PHE A 1 150 ? 38.399  -19.277 -7.737  1.00 45.22  ? 150  PHE B C     1 
ATOM   1196 O  O     . PHE A 1 150 ? 38.453  -18.859 -6.584  1.00 47.01  ? 150  PHE B O     1 
ATOM   1197 C  CB    . PHE A 1 150 ? 39.700  -21.432 -7.723  1.00 46.09  ? 150  PHE B CB    1 
ATOM   1198 C  CG    . PHE A 1 150 ? 39.573  -22.876 -7.324  1.00 48.43  ? 150  PHE B CG    1 
ATOM   1199 C  CD1   . PHE A 1 150 ? 39.137  -23.222 -6.047  1.00 49.03  ? 150  PHE B CD1   1 
ATOM   1200 C  CD2   . PHE A 1 150 ? 39.840  -23.891 -8.236  1.00 49.43  ? 150  PHE B CD2   1 
ATOM   1201 C  CE1   . PHE A 1 150 ? 38.968  -24.558 -5.685  1.00 49.73  ? 150  PHE B CE1   1 
ATOM   1202 C  CE2   . PHE A 1 150 ? 39.673  -25.232 -7.884  1.00 49.98  ? 150  PHE B CE2   1 
ATOM   1203 C  CZ    . PHE A 1 150 ? 39.236  -25.565 -6.606  1.00 50.24  ? 150  PHE B CZ    1 
ATOM   1204 N  N     . ALA A 1 151 ? 38.372  -18.473 -8.792  1.00 47.48  ? 151  ALA B N     1 
ATOM   1205 C  CA    . ALA A 1 151 ? 38.363  -17.033 -8.605  1.00 48.20  ? 151  ALA B CA    1 
ATOM   1206 C  C     . ALA A 1 151 ? 36.945  -16.715 -8.149  1.00 48.02  ? 151  ALA B C     1 
ATOM   1207 O  O     . ALA A 1 151 ? 36.733  -15.941 -7.216  1.00 47.95  ? 151  ALA B O     1 
ATOM   1208 C  CB    . ALA A 1 151 ? 38.678  -16.324 -9.910  1.00 48.12  ? 151  ALA B CB    1 
ATOM   1209 N  N     . LYS A 1 152 ? 35.974  -17.338 -8.810  1.00 45.17  ? 152  LYS B N     1 
ATOM   1210 C  CA    . LYS A 1 152 ? 34.576  -17.142 -8.462  1.00 43.31  ? 152  LYS B CA    1 
ATOM   1211 C  C     . LYS A 1 152 ? 34.372  -17.576 -7.020  1.00 42.14  ? 152  LYS B C     1 
ATOM   1212 O  O     . LYS A 1 152 ? 33.895  -16.800 -6.193  1.00 41.86  ? 152  LYS B O     1 
ATOM   1213 C  CB    . LYS A 1 152 ? 33.676  -17.967 -9.377  1.00 43.84  ? 152  LYS B CB    1 
ATOM   1214 C  CG    . LYS A 1 152 ? 32.208  -17.794 -9.087  1.00 42.27  ? 152  LYS B CG    1 
ATOM   1215 C  CD    . LYS A 1 152 ? 31.389  -18.339 -10.228 1.00 43.63  ? 152  LYS B CD    1 
ATOM   1216 C  CE    . LYS A 1 152 ? 29.937  -18.002 -10.027 1.00 45.02  ? 152  LYS B CE    1 
ATOM   1217 N  NZ    . LYS A 1 152 ? 29.790  -16.546 -9.760  1.00 45.88  ? 152  LYS B NZ    1 
ATOM   1218 N  N     . ILE A 1 153 ? 34.743  -18.818 -6.722  1.00 41.76  ? 153  ILE B N     1 
ATOM   1219 C  CA    . ILE A 1 153 ? 34.601  -19.340 -5.371  1.00 39.05  ? 153  ILE B CA    1 
ATOM   1220 C  C     . ILE A 1 153 ? 35.195  -18.349 -4.369  1.00 39.11  ? 153  ILE B C     1 
ATOM   1221 O  O     . ILE A 1 153 ? 34.626  -18.127 -3.301  1.00 39.13  ? 153  ILE B O     1 
ATOM   1222 C  CB    . ILE A 1 153 ? 35.304  -20.708 -5.213  1.00 37.83  ? 153  ILE B CB    1 
ATOM   1223 C  CG1   . ILE A 1 153 ? 34.704  -21.716 -6.199  1.00 37.95  ? 153  ILE B CG1   1 
ATOM   1224 C  CG2   . ILE A 1 153 ? 35.143  -21.210 -3.784  1.00 37.40  ? 153  ILE B CG2   1 
ATOM   1225 C  CD1   . ILE A 1 153 ? 35.407  -23.064 -6.223  1.00 36.93  ? 153  ILE B CD1   1 
ATOM   1226 N  N     . ALA A 1 154 ? 36.330  -17.750 -4.711  1.00 38.68  ? 154  ALA B N     1 
ATOM   1227 C  CA    . ALA A 1 154 ? 36.962  -16.778 -3.824  1.00 38.66  ? 154  ALA B CA    1 
ATOM   1228 C  C     . ALA A 1 154 ? 35.965  -15.690 -3.440  1.00 38.96  ? 154  ALA B C     1 
ATOM   1229 O  O     . ALA A 1 154 ? 35.744  -15.417 -2.259  1.00 38.81  ? 154  ALA B O     1 
ATOM   1230 C  CB    . ALA A 1 154 ? 38.171  -16.158 -4.507  1.00 39.43  ? 154  ALA B CB    1 
ATOM   1231 N  N     . ALA A 1 155 ? 35.366  -15.075 -4.457  1.00 38.63  ? 155  ALA B N     1 
ATOM   1232 C  CA    . ALA A 1 155 ? 34.390  -14.013 -4.259  1.00 39.43  ? 155  ALA B CA    1 
ATOM   1233 C  C     . ALA A 1 155 ? 33.188  -14.505 -3.461  1.00 39.56  ? 155  ALA B C     1 
ATOM   1234 O  O     . ALA A 1 155 ? 32.672  -13.778 -2.608  1.00 37.39  ? 155  ALA B O     1 
ATOM   1235 C  CB    . ALA A 1 155 ? 33.935  -13.461 -5.603  1.00 37.02  ? 155  ALA B CB    1 
ATOM   1236 N  N     . ASP A 1 156 ? 32.735  -15.729 -3.740  1.00 42.50  ? 156  ASP B N     1 
ATOM   1237 C  CA    . ASP A 1 156 ? 31.598  -16.293 -3.012  1.00 46.53  ? 156  ASP B CA    1 
ATOM   1238 C  C     . ASP A 1 156 ? 31.882  -16.195 -1.522  1.00 47.82  ? 156  ASP B C     1 
ATOM   1239 O  O     . ASP A 1 156 ? 30.998  -15.894 -0.720  1.00 49.74  ? 156  ASP B O     1 
ATOM   1240 C  CB    . ASP A 1 156 ? 31.380  -17.773 -3.359  1.00 47.57  ? 156  ASP B CB    1 
ATOM   1241 C  CG    . ASP A 1 156 ? 30.680  -17.977 -4.689  1.00 48.56  ? 156  ASP B CG    1 
ATOM   1242 O  OD1   . ASP A 1 156 ? 30.117  -17.004 -5.229  1.00 50.84  ? 156  ASP B OD1   1 
ATOM   1243 O  OD2   . ASP A 1 156 ? 30.681  -19.123 -5.189  1.00 50.37  ? 156  ASP B OD2   1 
ATOM   1244 N  N     . MET A 1 157 ? 33.134  -16.450 -1.163  1.00 51.65  ? 157  MET B N     1 
ATOM   1245 C  CA    . MET A 1 157 ? 33.561  -16.422 0.228   1.00 54.42  ? 157  MET B CA    1 
ATOM   1246 C  C     . MET A 1 157 ? 33.743  -15.026 0.809   1.00 55.46  ? 157  MET B C     1 
ATOM   1247 O  O     . MET A 1 157 ? 33.540  -14.821 2.005   1.00 54.70  ? 157  MET B O     1 
ATOM   1248 C  CB    . MET A 1 157 ? 34.872  -17.192 0.380   1.00 56.47  ? 157  MET B CB    1 
ATOM   1249 C  CG    . MET A 1 157 ? 34.784  -18.654 -0.017  1.00 63.15  ? 157  MET B CG    1 
ATOM   1250 S  SD    . MET A 1 157 ? 36.374  -19.483 0.130   1.00 65.43  ? 157  MET B SD    1 
ATOM   1251 C  CE    . MET A 1 157 ? 37.350  -18.495 -0.982  1.00 67.92  ? 157  MET B CE    1 
ATOM   1252 N  N     . ALA A 1 158 ? 34.117  -14.066 -0.029  1.00 54.28  ? 158  ALA B N     1 
ATOM   1253 C  CA    . ALA A 1 158 ? 34.355  -12.716 0.459   1.00 54.39  ? 158  ALA B CA    1 
ATOM   1254 C  C     . ALA A 1 158 ? 33.190  -11.744 0.380   1.00 54.28  ? 158  ALA B C     1 
ATOM   1255 O  O     . ALA A 1 158 ? 33.170  -10.756 1.116   1.00 54.72  ? 158  ALA B O     1 
ATOM   1256 C  CB    . ALA A 1 158 ? 35.560  -12.123 -0.244  1.00 59.98  ? 158  ALA B CB    1 
ATOM   1257 N  N     . LYS A 1 159 ? 32.226  -11.993 -0.500  1.00 54.61  ? 159  LYS B N     1 
ATOM   1258 C  CA    . LYS A 1 159 ? 31.106  -11.070 -0.591  1.00 51.85  ? 159  LYS B CA    1 
ATOM   1259 C  C     . LYS A 1 159 ? 30.442  -10.942 0.769   1.00 50.44  ? 159  LYS B C     1 
ATOM   1260 O  O     . LYS A 1 159 ? 30.411  -11.895 1.548   1.00 49.59  ? 159  LYS B O     1 
ATOM   1261 C  CB    . LYS A 1 159 ? 30.084  -11.529 -1.631  1.00 52.38  ? 159  LYS B CB    1 
ATOM   1262 C  CG    . LYS A 1 159 ? 29.483  -12.902 -1.406  1.00 50.77  ? 159  LYS B CG    1 
ATOM   1263 C  CD    . LYS A 1 159 ? 28.586  -13.252 -2.582  1.00 48.74  ? 159  LYS B CD    1 
ATOM   1264 C  CE    . LYS A 1 159 ? 29.317  -13.010 -3.900  1.00 46.49  ? 159  LYS B CE    1 
ATOM   1265 N  NZ    . LYS A 1 159 ? 28.420  -13.155 -5.075  1.00 45.45  ? 159  LYS B NZ    1 
ATOM   1266 N  N     . PRO A 1 160 ? 29.902  -9.753  1.072   1.00 53.97  ? 160  PRO B N     1 
ATOM   1267 C  CA    . PRO A 1 160 ? 29.925  -8.600  0.168   1.00 50.86  ? 160  PRO B CA    1 
ATOM   1268 C  C     . PRO A 1 160 ? 31.089  -7.644  0.423   1.00 51.05  ? 160  PRO B C     1 
ATOM   1269 O  O     . PRO A 1 160 ? 31.851  -7.814  1.374   1.00 50.86  ? 160  PRO B O     1 
ATOM   1270 C  CB    . PRO A 1 160 ? 28.587  -7.945  0.444   1.00 52.85  ? 160  PRO B CB    1 
ATOM   1271 C  CG    . PRO A 1 160 ? 28.488  -8.097  1.930   1.00 52.75  ? 160  PRO B CG    1 
ATOM   1272 C  CD    . PRO A 1 160 ? 28.952  -9.528  2.176   1.00 52.32  ? 160  PRO B CD    1 
ATOM   1273 N  N     . ASN A 1 161 ? 31.197  -6.638  -0.443  1.00 52.77  ? 161  ASN B N     1 
ATOM   1274 C  CA    . ASN A 1 161 ? 32.224  -5.597  -0.389  1.00 52.45  ? 161  ASN B CA    1 
ATOM   1275 C  C     . ASN A 1 161 ? 33.600  -6.064  0.086   1.00 52.95  ? 161  ASN B C     1 
ATOM   1276 O  O     . ASN A 1 161 ? 34.139  -5.530  1.057   1.00 54.57  ? 161  ASN B O     1 
ATOM   1277 C  CB    . ASN A 1 161 ? 31.736  -4.438  0.491   1.00 51.39  ? 161  ASN B CB    1 
ATOM   1278 C  CG    . ASN A 1 161 ? 32.685  -3.249  0.484   1.00 50.32  ? 161  ASN B CG    1 
ATOM   1279 O  OD1   . ASN A 1 161 ? 33.691  -3.237  -0.226  1.00 48.69  ? 161  ASN B OD1   1 
ATOM   1280 N  ND2   . ASN A 1 161 ? 32.361  -2.237  1.278   1.00 49.33  ? 161  ASN B ND2   1 
ATOM   1281 N  N     . GLY A 1 162 ? 34.178  -7.042  -0.609  1.00 53.61  ? 162  GLY B N     1 
ATOM   1282 C  CA    . GLY A 1 162 ? 35.483  -7.543  -0.212  1.00 53.11  ? 162  GLY B CA    1 
ATOM   1283 C  C     . GLY A 1 162 ? 36.474  -7.824  -1.330  1.00 54.23  ? 162  GLY B C     1 
ATOM   1284 O  O     . GLY A 1 162 ? 36.310  -7.370  -2.464  1.00 54.82  ? 162  GLY B O     1 
ATOM   1285 N  N     . ILE A 1 163 ? 37.514  -8.579  -0.991  1.00 53.77  ? 163  ILE B N     1 
ATOM   1286 C  CA    . ILE A 1 163 ? 38.563  -8.953  -1.928  1.00 54.23  ? 163  ILE B CA    1 
ATOM   1287 C  C     . ILE A 1 163 ? 39.285  -10.153 -1.332  1.00 54.63  ? 163  ILE B C     1 
ATOM   1288 O  O     . ILE A 1 163 ? 39.504  -10.207 -0.119  1.00 53.49  ? 163  ILE B O     1 
ATOM   1289 C  CB    . ILE A 1 163 ? 39.563  -7.811  -2.115  1.00 53.18  ? 163  ILE B CB    1 
ATOM   1290 C  CG1   . ILE A 1 163 ? 40.589  -8.187  -3.184  1.00 51.84  ? 163  ILE B CG1   1 
ATOM   1291 C  CG2   . ILE A 1 163 ? 40.247  -7.516  -0.793  1.00 51.91  ? 163  ILE B CG2   1 
ATOM   1292 C  CD1   . ILE A 1 163 ? 41.204  -6.989  -3.862  1.00 51.49  ? 163  ILE B CD1   1 
ATOM   1293 N  N     . LYS A 1 164 ? 39.668  -11.105 -2.175  1.00 54.31  ? 164  LYS B N     1 
ATOM   1294 C  CA    . LYS A 1 164 ? 40.326  -12.301 -1.677  1.00 55.19  ? 164  LYS B CA    1 
ATOM   1295 C  C     . LYS A 1 164 ? 41.117  -13.085 -2.715  1.00 57.58  ? 164  LYS B C     1 
ATOM   1296 O  O     . LYS A 1 164 ? 40.982  -12.880 -3.919  1.00 57.79  ? 164  LYS B O     1 
ATOM   1297 C  CB    . LYS A 1 164 ? 39.271  -13.211 -1.033  1.00 54.91  ? 164  LYS B CB    1 
ATOM   1298 C  CG    . LYS A 1 164 ? 39.605  -14.689 -1.053  1.00 54.64  ? 164  LYS B CG    1 
ATOM   1299 C  CD    . LYS A 1 164 ? 39.782  -15.246 0.343   1.00 56.25  ? 164  LYS B CD    1 
ATOM   1300 C  CE    . LYS A 1 164 ? 40.340  -16.661 0.303   1.00 58.33  ? 164  LYS B CE    1 
ATOM   1301 N  NZ    . LYS A 1 164 ? 40.577  -17.211 1.666   1.00 59.66  ? 164  LYS B NZ    1 
ATOM   1302 N  N     . VAL A 1 165 ? 41.947  -13.995 -2.222  1.00 60.93  ? 165  VAL B N     1 
ATOM   1303 C  CA    . VAL A 1 165 ? 42.755  -14.840 -3.079  1.00 60.26  ? 165  VAL B CA    1 
ATOM   1304 C  C     . VAL A 1 165 ? 42.828  -16.238 -2.493  1.00 66.20  ? 165  VAL B C     1 
ATOM   1305 O  O     . VAL A 1 165 ? 42.990  -16.409 -1.286  1.00 64.35  ? 165  VAL B O     1 
ATOM   1306 C  CB    . VAL A 1 165 ? 44.192  -14.309 -3.212  1.00 61.41  ? 165  VAL B CB    1 
ATOM   1307 C  CG1   . VAL A 1 165 ? 45.043  -15.306 -3.976  1.00 63.10  ? 165  VAL B CG1   1 
ATOM   1308 C  CG2   . VAL A 1 165 ? 44.186  -12.966 -3.919  1.00 62.12  ? 165  VAL B CG2   1 
ATOM   1309 N  N     . ILE A 1 166 ? 42.688  -17.234 -3.357  1.00 68.47  ? 166  ILE B N     1 
ATOM   1310 C  CA    . ILE A 1 166 ? 42.775  -18.621 -2.940  1.00 70.50  ? 166  ILE B CA    1 
ATOM   1311 C  C     . ILE A 1 166 ? 44.011  -19.133 -3.676  1.00 75.12  ? 166  ILE B C     1 
ATOM   1312 O  O     . ILE A 1 166 ? 43.899  -19.815 -4.696  1.00 76.30  ? 166  ILE B O     1 
ATOM   1313 C  CB    . ILE A 1 166 ? 41.529  -19.431 -3.382  1.00 72.98  ? 166  ILE B CB    1 
ATOM   1314 C  CG1   . ILE A 1 166 ? 40.319  -18.512 -3.551  1.00 72.82  ? 166  ILE B CG1   1 
ATOM   1315 C  CG2   . ILE A 1 166 ? 41.159  -20.432 -2.314  1.00 72.50  ? 166  ILE B CG2   1 
ATOM   1316 C  CD1   . ILE A 1 166 ? 39.023  -19.261 -3.832  1.00 70.91  ? 166  ILE B CD1   1 
ATOM   1317 N  N     . ASP A 1 167 ? 45.189  -18.771 -3.169  1.00 77.59  ? 167  ASP B N     1 
ATOM   1318 C  CA    . ASP A 1 167 ? 46.447  -19.174 -3.788  1.00 79.17  ? 167  ASP B CA    1 
ATOM   1319 C  C     . ASP A 1 167 ? 46.534  -20.676 -4.016  1.00 78.19  ? 167  ASP B C     1 
ATOM   1320 O  O     . ASP A 1 167 ? 45.722  -21.445 -3.503  1.00 77.20  ? 167  ASP B O     1 
ATOM   1321 C  CB    . ASP A 1 167 ? 47.644  -18.714 -2.946  1.00 81.45  ? 167  ASP B CB    1 
ATOM   1322 C  CG    . ASP A 1 167 ? 47.612  -19.262 -1.535  1.00 84.44  ? 167  ASP B CG    1 
ATOM   1323 O  OD1   . ASP A 1 167 ? 47.085  -20.376 -1.337  1.00 87.65  ? 167  ASP B OD1   1 
ATOM   1324 O  OD2   . ASP A 1 167 ? 48.130  -18.586 -0.621  1.00 87.03  ? 167  ASP B OD2   1 
ATOM   1325 N  N     . ASP A 1 168 ? 47.541  -21.077 -4.785  1.00 79.02  ? 168  ASP B N     1 
ATOM   1326 C  CA    . ASP A 1 168 ? 47.773  -22.473 -5.134  1.00 80.63  ? 168  ASP B CA    1 
ATOM   1327 C  C     . ASP A 1 168 ? 47.674  -23.458 -3.974  1.00 79.49  ? 168  ASP B C     1 
ATOM   1328 O  O     . ASP A 1 168 ? 47.233  -24.591 -4.159  1.00 80.71  ? 168  ASP B O     1 
ATOM   1329 C  CB    . ASP A 1 168 ? 49.136  -22.604 -5.821  1.00 78.99  ? 168  ASP B CB    1 
ATOM   1330 C  CG    . ASP A 1 168 ? 49.157  -21.966 -7.200  1.00 77.94  ? 168  ASP B CG    1 
ATOM   1331 O  OD1   . ASP A 1 168 ? 48.377  -21.020 -7.434  1.00 80.01  ? 168  ASP B OD1   1 
ATOM   1332 O  OD2   . ASP A 1 168 ? 49.962  -22.404 -8.047  1.00 79.78  ? 168  ASP B OD2   1 
ATOM   1333 N  N     . GLU A 1 169 ? 48.078  -23.032 -2.783  1.00 82.43  ? 169  GLU B N     1 
ATOM   1334 C  CA    . GLU A 1 169 ? 48.025  -23.898 -1.611  1.00 85.75  ? 169  GLU B CA    1 
ATOM   1335 C  C     . GLU A 1 169 ? 46.597  -24.111 -1.118  1.00 80.82  ? 169  GLU B C     1 
ATOM   1336 O  O     . GLU A 1 169 ? 46.213  -25.224 -0.753  1.00 81.59  ? 169  GLU B O     1 
ATOM   1337 C  CB    . GLU A 1 169 ? 48.890  -23.306 -0.494  1.00 88.34  ? 169  GLU B CB    1 
ATOM   1338 C  CG    . GLU A 1 169 ? 48.706  -23.952 0.870   1.00 107.04 ? 169  GLU B CG    1 
ATOM   1339 C  CD    . GLU A 1 169 ? 49.812  -23.582 1.839   1.00 118.44 ? 169  GLU B CD    1 
ATOM   1340 O  OE1   . GLU A 1 169 ? 50.258  -22.416 1.821   1.00 126.65 ? 169  GLU B OE1   1 
ATOM   1341 O  OE2   . GLU A 1 169 ? 50.232  -24.458 2.625   1.00 126.54 ? 169  GLU B OE2   1 
ATOM   1342 N  N     . GLU A 1 170 ? 45.815  -23.039 -1.114  1.00 77.42  ? 170  GLU B N     1 
ATOM   1343 C  CA    . GLU A 1 170 ? 44.433  -23.106 -0.660  1.00 75.33  ? 170  GLU B CA    1 
ATOM   1344 C  C     . GLU A 1 170 ? 43.603  -24.018 -1.565  1.00 71.32  ? 170  GLU B C     1 
ATOM   1345 O  O     . GLU A 1 170 ? 42.813  -24.831 -1.087  1.00 70.29  ? 170  GLU B O     1 
ATOM   1346 C  CB    . GLU A 1 170 ? 43.836  -21.700 -0.635  1.00 74.70  ? 170  GLU B CB    1 
ATOM   1347 C  CG    . GLU A 1 170 ? 42.490  -21.616 0.050   1.00 78.27  ? 170  GLU B CG    1 
ATOM   1348 C  CD    . GLU A 1 170 ? 42.497  -20.675 1.233   1.00 81.81  ? 170  GLU B CD    1 
ATOM   1349 O  OE1   . GLU A 1 170 ? 43.134  -19.603 1.145   1.00 85.13  ? 170  GLU B OE1   1 
ATOM   1350 O  OE2   . GLU A 1 170 ? 41.852  -21.003 2.251   1.00 85.05  ? 170  GLU B OE2   1 
ATOM   1351 N  N     . VAL A 1 171 ? 43.796  -23.880 -2.873  1.00 68.81  ? 171  VAL B N     1 
ATOM   1352 C  CA    . VAL A 1 171 ? 43.078  -24.685 -3.857  1.00 66.94  ? 171  VAL B CA    1 
ATOM   1353 C  C     . VAL A 1 171 ? 43.076  -26.171 -3.490  1.00 67.50  ? 171  VAL B C     1 
ATOM   1354 O  O     . VAL A 1 171 ? 42.063  -26.855 -3.629  1.00 66.89  ? 171  VAL B O     1 
ATOM   1355 C  CB    . VAL A 1 171 ? 43.713  -24.519 -5.256  1.00 63.87  ? 171  VAL B CB    1 
ATOM   1356 C  CG1   . VAL A 1 171 ? 42.879  -25.235 -6.306  1.00 62.41  ? 171  VAL B CG1   1 
ATOM   1357 C  CG2   . VAL A 1 171 ? 43.840  -23.041 -5.591  1.00 62.09  ? 171  VAL B CG2   1 
ATOM   1358 N  N     . LYS A 1 172 ? 44.215  -26.662 -3.015  1.00 69.37  ? 172  LYS B N     1 
ATOM   1359 C  CA    . LYS A 1 172 ? 44.352  -28.065 -2.640  1.00 72.41  ? 172  LYS B CA    1 
ATOM   1360 C  C     . LYS A 1 172 ? 43.623  -28.318 -1.325  1.00 73.10  ? 172  LYS B C     1 
ATOM   1361 O  O     . LYS A 1 172 ? 43.045  -29.384 -1.108  1.00 73.72  ? 172  LYS B O     1 
ATOM   1362 C  CB    . LYS A 1 172 ? 45.837  -28.402 -2.527  1.00 73.51  ? 172  LYS B CB    1 
ATOM   1363 C  CG    . LYS A 1 172 ? 46.653  -27.711 -3.617  1.00 78.03  ? 172  LYS B CG    1 
ATOM   1364 C  CD    . LYS A 1 172 ? 48.104  -28.150 -3.648  1.00 81.19  ? 172  LYS B CD    1 
ATOM   1365 C  CE    . LYS A 1 172 ? 48.221  -29.614 -4.036  1.00 83.08  ? 172  LYS B CE    1 
ATOM   1366 N  NZ    . LYS A 1 172 ? 47.490  -29.920 -5.298  1.00 83.84  ? 172  LYS B NZ    1 
ATOM   1367 N  N     . ARG A 1 173 ? 43.657  -27.319 -0.453  1.00 72.71  ? 173  ARG B N     1 
ATOM   1368 C  CA    . ARG A 1 173 ? 42.971  -27.394 0.828   1.00 72.00  ? 173  ARG B CA    1 
ATOM   1369 C  C     . ARG A 1 173 ? 41.476  -27.574 0.537   1.00 68.29  ? 173  ARG B C     1 
ATOM   1370 O  O     . ARG A 1 173 ? 40.813  -28.426 1.126   1.00 69.54  ? 173  ARG B O     1 
ATOM   1371 C  CB    . ARG A 1 173 ? 43.184  -26.091 1.605   1.00 78.53  ? 173  ARG B CB    1 
ATOM   1372 C  CG    . ARG A 1 173 ? 44.215  -26.121 2.732   1.00 86.44  ? 173  ARG B CG    1 
ATOM   1373 C  CD    . ARG A 1 173 ? 44.253  -24.767 3.460   1.00 93.35  ? 173  ARG B CD    1 
ATOM   1374 N  NE    . ARG A 1 173 ? 42.979  -24.051 3.376   1.00 99.02  ? 173  ARG B NE    1 
ATOM   1375 C  CZ    . ARG A 1 173 ? 41.800  -24.576 3.694   1.00 101.46 ? 173  ARG B CZ    1 
ATOM   1376 N  NH1   . ARG A 1 173 ? 41.732  -25.825 4.123   1.00 102.58 ? 173  ARG B NH1   1 
ATOM   1377 N  NH2   . ARG A 1 173 ? 40.689  -23.862 3.562   1.00 102.59 ? 173  ARG B NH2   1 
ATOM   1378 N  N     . LEU A 1 174 ? 40.974  -26.759 -0.394  1.00 63.54  ? 174  LEU B N     1 
ATOM   1379 C  CA    . LEU A 1 174 ? 39.567  -26.744 -0.815  1.00 57.27  ? 174  LEU B CA    1 
ATOM   1380 C  C     . LEU A 1 174 ? 39.115  -27.976 -1.576  1.00 55.90  ? 174  LEU B C     1 
ATOM   1381 O  O     . LEU A 1 174 ? 38.047  -28.526 -1.302  1.00 52.05  ? 174  LEU B O     1 
ATOM   1382 C  CB    . LEU A 1 174 ? 39.294  -25.515 -1.688  1.00 50.61  ? 174  LEU B CB    1 
ATOM   1383 C  CG    . LEU A 1 174 ? 39.352  -24.168 -0.974  1.00 46.72  ? 174  LEU B CG    1 
ATOM   1384 C  CD1   . LEU A 1 174 ? 39.255  -23.023 -1.968  1.00 42.01  ? 174  LEU B CD1   1 
ATOM   1385 C  CD2   . LEU A 1 174 ? 38.218  -24.114 0.030   1.00 43.15  ? 174  LEU B CD2   1 
ATOM   1386 N  N     . ILE A 1 175 ? 39.908  -28.384 -2.560  1.00 53.84  ? 175  ILE B N     1 
ATOM   1387 C  CA    . ILE A 1 175 ? 39.584  -29.568 -3.342  1.00 55.98  ? 175  ILE B CA    1 
ATOM   1388 C  C     . ILE A 1 175 ? 39.262  -30.686 -2.356  1.00 60.25  ? 175  ILE B C     1 
ATOM   1389 O  O     . ILE A 1 175 ? 38.553  -31.636 -2.683  1.00 62.41  ? 175  ILE B O     1 
ATOM   1390 C  CB    . ILE A 1 175 ? 40.778  -29.991 -4.224  1.00 53.19  ? 175  ILE B CB    1 
ATOM   1391 C  CG1   . ILE A 1 175 ? 40.967  -28.980 -5.354  1.00 47.71  ? 175  ILE B CG1   1 
ATOM   1392 C  CG2   . ILE A 1 175 ? 40.558  -31.389 -4.785  1.00 48.19  ? 175  ILE B CG2   1 
ATOM   1393 C  CD1   . ILE A 1 175 ? 42.109  -29.318 -6.279  1.00 44.59  ? 175  ILE B CD1   1 
ATOM   1394 N  N     . ARG A 1 176 ? 39.783  -30.544 -1.139  1.00 68.16  ? 176  ARG B N     1 
ATOM   1395 C  CA    . ARG A 1 176 ? 39.588  -31.520 -0.071  1.00 73.36  ? 176  ARG B CA    1 
ATOM   1396 C  C     . ARG A 1 176 ? 38.485  -31.185 0.936   1.00 76.08  ? 176  ARG B C     1 
ATOM   1397 O  O     . ARG A 1 176 ? 37.722  -32.065 1.338   1.00 76.61  ? 176  ARG B O     1 
ATOM   1398 C  CB    . ARG A 1 176 ? 40.903  -31.725 0.695   1.00 73.51  ? 176  ARG B CB    1 
ATOM   1399 C  CG    . ARG A 1 176 ? 41.788  -32.831 0.146   1.00 78.99  ? 176  ARG B CG    1 
ATOM   1400 C  CD    . ARG A 1 176 ? 43.021  -33.081 1.017   1.00 81.60  ? 176  ARG B CD    1 
ATOM   1401 N  NE    . ARG A 1 176 ? 44.087  -32.100 0.811   1.00 82.76  ? 176  ARG B NE    1 
ATOM   1402 C  CZ    . ARG A 1 176 ? 44.234  -30.979 1.511   1.00 83.74  ? 176  ARG B CZ    1 
ATOM   1403 N  NH1   . ARG A 1 176 ? 43.382  -30.677 2.480   1.00 84.36  ? 176  ARG B NH1   1 
ATOM   1404 N  NH2   . ARG A 1 176 ? 45.246  -30.163 1.246   1.00 84.05  ? 176  ARG B NH2   1 
ATOM   1405 N  N     . GLU A 1 177 ? 38.395  -29.921 1.340   1.00 79.16  ? 177  GLU B N     1 
ATOM   1406 C  CA    . GLU A 1 177 ? 37.410  -29.514 2.342   1.00 83.57  ? 177  GLU B CA    1 
ATOM   1407 C  C     . GLU A 1 177 ? 36.184  -28.745 1.851   1.00 81.32  ? 177  GLU B C     1 
ATOM   1408 O  O     . GLU A 1 177 ? 35.233  -28.550 2.610   1.00 81.43  ? 177  GLU B O     1 
ATOM   1409 C  CB    . GLU A 1 177 ? 38.095  -28.671 3.415   1.00 88.68  ? 177  GLU B CB    1 
ATOM   1410 C  CG    . GLU A 1 177 ? 39.526  -29.065 3.713   1.00 99.07  ? 177  GLU B CG    1 
ATOM   1411 C  CD    . GLU A 1 177 ? 40.127  -28.202 4.795   1.00 105.57 ? 177  GLU B CD    1 
ATOM   1412 O  OE1   . GLU A 1 177 ? 39.894  -26.977 4.758   1.00 110.13 ? 177  GLU B OE1   1 
ATOM   1413 O  OE2   . GLU A 1 177 ? 40.827  -28.740 5.677   1.00 110.29 ? 177  GLU B OE2   1 
ATOM   1414 N  N     . LEU A 1 178 ? 36.197  -28.299 0.599   1.00 79.70  ? 178  LEU B N     1 
ATOM   1415 C  CA    . LEU A 1 178 ? 35.069  -27.532 0.075   1.00 78.48  ? 178  LEU B CA    1 
ATOM   1416 C  C     . LEU A 1 178 ? 33.870  -28.386 -0.292  1.00 73.73  ? 178  LEU B C     1 
ATOM   1417 O  O     . LEU A 1 178 ? 33.973  -29.303 -1.110  1.00 73.47  ? 178  LEU B O     1 
ATOM   1418 C  CB    . LEU A 1 178 ? 35.481  -26.717 -1.157  1.00 77.50  ? 178  LEU B CB    1 
ATOM   1419 C  CG    . LEU A 1 178 ? 34.360  -25.859 -1.764  1.00 76.84  ? 178  LEU B CG    1 
ATOM   1420 C  CD1   . LEU A 1 178 ? 33.854  -24.872 -0.721  1.00 79.43  ? 178  LEU B CD1   1 
ATOM   1421 C  CD2   . LEU A 1 178 ? 34.864  -25.119 -2.995  1.00 79.21  ? 178  LEU B CD2   1 
ATOM   1422 N  N     . ASP A 1 179 ? 32.731  -28.074 0.319   1.00 72.60  ? 179  ASP B N     1 
ATOM   1423 C  CA    . ASP A 1 179 ? 31.496  -28.788 0.037   1.00 72.73  ? 179  ASP B CA    1 
ATOM   1424 C  C     . ASP A 1 179 ? 31.280  -28.654 -1.462  1.00 66.17  ? 179  ASP B C     1 
ATOM   1425 O  O     . ASP A 1 179 ? 31.103  -27.552 -1.976  1.00 66.72  ? 179  ASP B O     1 
ATOM   1426 C  CB    . ASP A 1 179 ? 30.329  -28.142 0.778   1.00 79.67  ? 179  ASP B CB    1 
ATOM   1427 C  CG    . ASP A 1 179 ? 29.032  -28.912 0.611   1.00 88.44  ? 179  ASP B CG    1 
ATOM   1428 O  OD1   . ASP A 1 179 ? 28.853  -29.571 -0.436  1.00 98.12  ? 179  ASP B OD1   1 
ATOM   1429 O  OD2   . ASP A 1 179 ? 28.184  -28.847 1.525   1.00 98.13  ? 179  ASP B OD2   1 
ATOM   1430 N  N     . ILE A 1 180 ? 31.296  -29.779 -2.160  1.00 60.55  ? 180  ILE B N     1 
ATOM   1431 C  CA    . ILE A 1 180 ? 31.130  -29.771 -3.601  1.00 54.81  ? 180  ILE B CA    1 
ATOM   1432 C  C     . ILE A 1 180 ? 29.870  -29.042 -4.055  1.00 52.83  ? 180  ILE B C     1 
ATOM   1433 O  O     . ILE A 1 180 ? 29.817  -28.513 -5.166  1.00 51.66  ? 180  ILE B O     1 
ATOM   1434 C  CB    . ILE A 1 180 ? 31.114  -31.200 -4.145  1.00 52.34  ? 180  ILE B CB    1 
ATOM   1435 C  CG1   . ILE A 1 180 ? 31.472  -31.182 -5.627  1.00 51.10  ? 180  ILE B CG1   1 
ATOM   1436 C  CG2   . ILE A 1 180 ? 29.745  -31.826 -3.924  1.00 50.75  ? 180  ILE B CG2   1 
ATOM   1437 C  CD1   . ILE A 1 180 ? 31.709  -32.550 -6.200  1.00 51.58  ? 180  ILE B CD1   1 
ATOM   1438 N  N     . ALA A 1 181 ? 28.854  -29.011 -3.203  1.00 51.55  ? 181  ALA B N     1 
ATOM   1439 C  CA    . ALA A 1 181 ? 27.626  -28.327 -3.564  1.00 51.19  ? 181  ALA B CA    1 
ATOM   1440 C  C     . ALA A 1 181 ? 27.895  -26.835 -3.721  1.00 50.94  ? 181  ALA B C     1 
ATOM   1441 O  O     . ALA A 1 181 ? 27.075  -26.116 -4.280  1.00 49.84  ? 181  ALA B O     1 
ATOM   1442 C  CB    . ALA A 1 181 ? 26.557  -28.562 -2.508  1.00 53.37  ? 181  ALA B CB    1 
ATOM   1443 N  N     . ASP A 1 182 ? 29.039  -26.366 -3.228  1.00 50.71  ? 182  ASP B N     1 
ATOM   1444 C  CA    . ASP A 1 182 ? 29.373  -24.948 -3.341  1.00 52.41  ? 182  ASP B CA    1 
ATOM   1445 C  C     . ASP A 1 182 ? 30.226  -24.651 -4.570  1.00 50.22  ? 182  ASP B C     1 
ATOM   1446 O  O     . ASP A 1 182 ? 30.767  -23.553 -4.699  1.00 51.99  ? 182  ASP B O     1 
ATOM   1447 C  CB    . ASP A 1 182 ? 30.120  -24.437 -2.100  1.00 56.11  ? 182  ASP B CB    1 
ATOM   1448 C  CG    . ASP A 1 182 ? 29.237  -24.347 -0.863  1.00 58.63  ? 182  ASP B CG    1 
ATOM   1449 O  OD1   . ASP A 1 182 ? 28.002  -24.209 -0.994  1.00 61.45  ? 182  ASP B OD1   1 
ATOM   1450 O  OD2   . ASP A 1 182 ? 29.794  -24.395 0.254   1.00 60.86  ? 182  ASP B OD2   1 
ATOM   1451 N  N     . VAL A 1 183 ? 30.358  -25.631 -5.460  1.00 48.14  ? 183  VAL B N     1 
ATOM   1452 C  CA    . VAL A 1 183 ? 31.137  -25.450 -6.681  1.00 46.32  ? 183  VAL B CA    1 
ATOM   1453 C  C     . VAL A 1 183 ? 30.261  -24.890 -7.792  1.00 42.87  ? 183  VAL B C     1 
ATOM   1454 O  O     . VAL A 1 183 ? 29.182  -25.411 -8.070  1.00 41.06  ? 183  VAL B O     1 
ATOM   1455 C  CB    . VAL A 1 183 ? 31.741  -26.778 -7.188  1.00 45.42  ? 183  VAL B CB    1 
ATOM   1456 C  CG1   . VAL A 1 183 ? 32.404  -26.557 -8.547  1.00 47.32  ? 183  VAL B CG1   1 
ATOM   1457 C  CG2   . VAL A 1 183 ? 32.746  -27.312 -6.187  1.00 46.84  ? 183  VAL B CG2   1 
ATOM   1458 N  N     . PRO A 1 184 ? 30.718  -23.808 -8.438  1.00 40.52  ? 184  PRO B N     1 
ATOM   1459 C  CA    . PRO A 1 184 ? 29.993  -23.160 -9.532  1.00 40.55  ? 184  PRO B CA    1 
ATOM   1460 C  C     . PRO A 1 184 ? 29.524  -24.166 -10.580 1.00 41.15  ? 184  PRO B C     1 
ATOM   1461 O  O     . PRO A 1 184 ? 30.333  -24.859 -11.196 1.00 39.28  ? 184  PRO B O     1 
ATOM   1462 C  CB    . PRO A 1 184 ? 31.025  -22.184 -10.082 1.00 39.48  ? 184  PRO B CB    1 
ATOM   1463 C  CG    . PRO A 1 184 ? 31.706  -21.724 -8.825  1.00 38.65  ? 184  PRO B CG    1 
ATOM   1464 C  CD    . PRO A 1 184 ? 31.906  -23.020 -8.059  1.00 39.57  ? 184  PRO B CD    1 
ATOM   1465 N  N     . GLY A 1 185 ? 28.211  -24.244 -10.772 1.00 42.17  ? 185  GLY B N     1 
ATOM   1466 C  CA    . GLY A 1 185 ? 27.658  -25.163 -11.749 1.00 44.96  ? 185  GLY B CA    1 
ATOM   1467 C  C     . GLY A 1 185 ? 27.033  -26.394 -11.127 1.00 47.73  ? 185  GLY B C     1 
ATOM   1468 O  O     . GLY A 1 185 ? 26.603  -27.307 -11.829 1.00 50.77  ? 185  GLY B O     1 
ATOM   1469 N  N     . ILE A 1 186 ? 26.988  -26.431 -9.803  1.00 50.51  ? 186  ILE B N     1 
ATOM   1470 C  CA    . ILE A 1 186 ? 26.398  -27.568 -9.118  1.00 50.25  ? 186  ILE B CA    1 
ATOM   1471 C  C     . ILE A 1 186 ? 25.246  -27.086 -8.263  1.00 54.40  ? 186  ILE B C     1 
ATOM   1472 O  O     . ILE A 1 186 ? 25.446  -26.393 -7.269  1.00 51.60  ? 186  ILE B O     1 
ATOM   1473 C  CB    . ILE A 1 186 ? 27.426  -28.284 -8.232  1.00 49.43  ? 186  ILE B CB    1 
ATOM   1474 C  CG1   . ILE A 1 186 ? 28.699  -28.549 -9.035  1.00 50.10  ? 186  ILE B CG1   1 
ATOM   1475 C  CG2   . ILE A 1 186 ? 26.859  -29.613 -7.764  1.00 51.53  ? 186  ILE B CG2   1 
ATOM   1476 C  CD1   . ILE A 1 186 ? 28.472  -29.425 -10.247 1.00 47.33  ? 186  ILE B CD1   1 
ATOM   1477 N  N     . GLY A 1 187 ? 24.037  -27.450 -8.671  1.00 56.21  ? 187  GLY B N     1 
ATOM   1478 C  CA    . GLY A 1 187 ? 22.860  -27.043 -7.935  1.00 60.95  ? 187  GLY B CA    1 
ATOM   1479 C  C     . GLY A 1 187 ? 22.326  -28.171 -7.083  1.00 62.33  ? 187  GLY B C     1 
ATOM   1480 O  O     . GLY A 1 187 ? 23.037  -29.125 -6.790  1.00 62.02  ? 187  GLY B O     1 
ATOM   1481 N  N     . ASN A 1 188 ? 21.059  -28.054 -6.702  1.00 64.92  ? 188  ASN B N     1 
ATOM   1482 C  CA    . ASN A 1 188 ? 20.386  -29.038 -5.862  1.00 67.54  ? 188  ASN B CA    1 
ATOM   1483 C  C     . ASN A 1 188 ? 20.212  -30.391 -6.525  1.00 64.55  ? 188  ASN B C     1 
ATOM   1484 O  O     . ASN A 1 188 ? 20.457  -31.424 -5.910  1.00 65.91  ? 188  ASN B O     1 
ATOM   1485 C  CB    . ASN A 1 188 ? 19.014  -28.514 -5.436  1.00 74.67  ? 188  ASN B CB    1 
ATOM   1486 C  CG    . ASN A 1 188 ? 19.101  -27.208 -4.685  1.00 83.94  ? 188  ASN B CG    1 
ATOM   1487 O  OD1   . ASN A 1 188 ? 18.137  -26.774 -4.058  1.00 92.65  ? 188  ASN B OD1   1 
ATOM   1488 N  ND2   . ASN A 1 188 ? 20.262  -26.566 -4.748  1.00 92.11  ? 188  ASN B ND2   1 
ATOM   1489 N  N     . ILE A 1 189 ? 19.773  -30.393 -7.775  1.00 62.46  ? 189  ILE B N     1 
ATOM   1490 C  CA    . ILE A 1 189 ? 19.574  -31.647 -8.478  1.00 59.73  ? 189  ILE B CA    1 
ATOM   1491 C  C     . ILE A 1 189 ? 20.862  -32.455 -8.556  1.00 59.32  ? 189  ILE B C     1 
ATOM   1492 O  O     . ILE A 1 189 ? 20.903  -33.604 -8.119  1.00 58.72  ? 189  ILE B O     1 
ATOM   1493 C  CB    . ILE A 1 189 ? 18.996  -31.400 -9.887  1.00 57.42  ? 189  ILE B CB    1 
ATOM   1494 C  CG1   . ILE A 1 189 ? 17.552  -30.909 -9.742  1.00 54.67  ? 189  ILE B CG1   1 
ATOM   1495 C  CG2   . ILE A 1 189 ? 19.072  -32.668 -10.732 1.00 55.32  ? 189  ILE B CG2   1 
ATOM   1496 C  CD1   . ILE A 1 189 ? 16.730  -31.010 -10.991 1.00 53.97  ? 189  ILE B CD1   1 
ATOM   1497 N  N     . THR A 1 190 ? 21.919  -31.855 -9.093  1.00 58.92  ? 190  THR B N     1 
ATOM   1498 C  CA    . THR A 1 190 ? 23.195  -32.554 -9.201  1.00 60.96  ? 190  THR B CA    1 
ATOM   1499 C  C     . THR A 1 190 ? 23.843  -32.731 -7.832  1.00 60.43  ? 190  THR B C     1 
ATOM   1500 O  O     . THR A 1 190 ? 24.556  -33.704 -7.600  1.00 58.91  ? 190  THR B O     1 
ATOM   1501 C  CB    . THR A 1 190 ? 24.176  -31.815 -10.143 1.00 60.28  ? 190  THR B CB    1 
ATOM   1502 O  OG1   . THR A 1 190 ? 23.682  -31.873 -11.487 1.00 62.29  ? 190  THR B OG1   1 
ATOM   1503 C  CG2   . THR A 1 190 ? 25.557  -32.462 -10.094 1.00 62.58  ? 190  THR B CG2   1 
ATOM   1504 N  N     . ALA A 1 191 ? 23.596  -31.800 -6.918  1.00 61.87  ? 191  ALA B N     1 
ATOM   1505 C  CA    . ALA A 1 191 ? 24.174  -31.921 -5.585  1.00 66.41  ? 191  ALA B CA    1 
ATOM   1506 C  C     . ALA A 1 191 ? 23.670  -33.207 -4.947  1.00 68.81  ? 191  ALA B C     1 
ATOM   1507 O  O     . ALA A 1 191 ? 24.451  -34.002 -4.427  1.00 70.38  ? 191  ALA B O     1 
ATOM   1508 C  CB    . ALA A 1 191 ? 23.784  -30.732 -4.726  1.00 63.39  ? 191  ALA B CB    1 
ATOM   1509 N  N     . GLU A 1 192 ? 22.357  -33.409 -5.004  1.00 75.30  ? 192  GLU B N     1 
ATOM   1510 C  CA    . GLU A 1 192 ? 21.735  -34.594 -4.426  1.00 80.90  ? 192  GLU B CA    1 
ATOM   1511 C  C     . GLU A 1 192 ? 22.310  -35.854 -5.054  1.00 78.39  ? 192  GLU B C     1 
ATOM   1512 O  O     . GLU A 1 192 ? 22.763  -36.754 -4.349  1.00 80.86  ? 192  GLU B O     1 
ATOM   1513 C  CB    . GLU A 1 192 ? 20.216  -34.547 -4.626  1.00 88.09  ? 192  GLU B CB    1 
ATOM   1514 C  CG    . GLU A 1 192 ? 19.434  -35.655 -3.912  1.00 110.29 ? 192  GLU B CG    1 
ATOM   1515 C  CD    . GLU A 1 192 ? 19.788  -35.789 -2.438  1.00 122.10 ? 192  GLU B CD    1 
ATOM   1516 O  OE1   . GLU A 1 192 ? 19.936  -34.752 -1.757  1.00 129.54 ? 192  GLU B OE1   1 
ATOM   1517 O  OE2   . GLU A 1 192 ? 19.904  -36.936 -1.956  1.00 129.65 ? 192  GLU B OE2   1 
ATOM   1518 N  N     . LYS A 1 193 ? 22.304  -35.916 -6.381  1.00 75.07  ? 193  LYS B N     1 
ATOM   1519 C  CA    . LYS A 1 193 ? 22.833  -37.081 -7.076  1.00 73.27  ? 193  LYS B CA    1 
ATOM   1520 C  C     . LYS A 1 193 ? 24.244  -37.424 -6.592  1.00 71.78  ? 193  LYS B C     1 
ATOM   1521 O  O     . LYS A 1 193 ? 24.588  -38.597 -6.449  1.00 69.80  ? 193  LYS B O     1 
ATOM   1522 C  CB    . LYS A 1 193 ? 22.854  -36.831 -8.583  1.00 69.98  ? 193  LYS B CB    1 
ATOM   1523 C  CG    . LYS A 1 193 ? 21.487  -36.624 -9.221  1.00 64.26  ? 193  LYS B CG    1 
ATOM   1524 C  CD    . LYS A 1 193 ? 21.641  -36.610 -10.734 1.00 62.80  ? 193  LYS B CD    1 
ATOM   1525 C  CE    . LYS A 1 193 ? 20.311  -36.670 -11.468 1.00 62.81  ? 193  LYS B CE    1 
ATOM   1526 N  NZ    . LYS A 1 193 ? 20.526  -36.827 -12.937 1.00 62.54  ? 193  LYS B NZ    1 
ATOM   1527 N  N     . LEU A 1 194 ? 25.051  -36.399 -6.336  1.00 71.14  ? 194  LEU B N     1 
ATOM   1528 C  CA    . LEU A 1 194 ? 26.425  -36.593 -5.875  1.00 72.59  ? 194  LEU B CA    1 
ATOM   1529 C  C     . LEU A 1 194 ? 26.511  -36.983 -4.405  1.00 72.93  ? 194  LEU B C     1 
ATOM   1530 O  O     . LEU A 1 194 ? 27.445  -37.664 -3.985  1.00 74.57  ? 194  LEU B O     1 
ATOM   1531 C  CB    . LEU A 1 194 ? 27.238  -35.323 -6.105  1.00 72.56  ? 194  LEU B CB    1 
ATOM   1532 C  CG    . LEU A 1 194 ? 27.482  -34.901 -7.554  1.00 72.63  ? 194  LEU B CG    1 
ATOM   1533 C  CD1   . LEU A 1 194 ? 28.147  -33.537 -7.557  1.00 75.05  ? 194  LEU B CD1   1 
ATOM   1534 C  CD2   . LEU A 1 194 ? 28.350  -35.932 -8.266  1.00 74.41  ? 194  LEU B CD2   1 
ATOM   1535 N  N     . LYS A 1 195 ? 25.540  -36.532 -3.621  1.00 76.08  ? 195  LYS B N     1 
ATOM   1536 C  CA    . LYS A 1 195 ? 25.505  -36.856 -2.204  1.00 78.46  ? 195  LYS B CA    1 
ATOM   1537 C  C     . LYS A 1 195 ? 25.200  -38.345 -2.085  1.00 78.64  ? 195  LYS B C     1 
ATOM   1538 O  O     . LYS A 1 195 ? 25.696  -39.028 -1.190  1.00 78.99  ? 195  LYS B O     1 
ATOM   1539 C  CB    . LYS A 1 195 ? 24.422  -36.034 -1.499  1.00 78.46  ? 195  LYS B CB    1 
ATOM   1540 C  CG    . LYS A 1 195 ? 24.340  -36.280 -0.008  1.00 83.50  ? 195  LYS B CG    1 
ATOM   1541 C  CD    . LYS A 1 195 ? 23.279  -35.414 0.641   1.00 86.32  ? 195  LYS B CD    1 
ATOM   1542 C  CE    . LYS A 1 195 ? 23.205  -35.686 2.131   1.00 88.28  ? 195  LYS B CE    1 
ATOM   1543 N  NZ    . LYS A 1 195 ? 22.169  -34.850 2.791   1.00 89.29  ? 195  LYS B NZ    1 
ATOM   1544 N  N     . LYS A 1 196 ? 24.388  -38.840 -3.014  1.00 79.19  ? 196  LYS B N     1 
ATOM   1545 C  CA    . LYS A 1 196 ? 24.002  -40.246 -3.042  1.00 82.10  ? 196  LYS B CA    1 
ATOM   1546 C  C     . LYS A 1 196 ? 25.163  -41.158 -3.415  1.00 79.27  ? 196  LYS B C     1 
ATOM   1547 O  O     . LYS A 1 196 ? 25.130  -42.359 -3.153  1.00 79.70  ? 196  LYS B O     1 
ATOM   1548 C  CB    . LYS A 1 196 ? 22.844  -40.449 -4.020  1.00 83.90  ? 196  LYS B CB    1 
ATOM   1549 C  CG    . LYS A 1 196 ? 21.565  -40.844 -3.321  1.00 92.89  ? 196  LYS B CG    1 
ATOM   1550 C  CD    . LYS A 1 196 ? 20.332  -40.436 -4.096  1.00 101.68 ? 196  LYS B CD    1 
ATOM   1551 C  CE    . LYS A 1 196 ? 19.104  -40.615 -3.220  1.00 107.70 ? 196  LYS B CE    1 
ATOM   1552 N  NZ    . LYS A 1 196 ? 17.857  -40.093 -3.838  1.00 110.25 ? 196  LYS B NZ    1 
ATOM   1553 N  N     . LEU A 1 197 ? 26.188  -40.579 -4.030  1.00 76.80  ? 197  LEU B N     1 
ATOM   1554 C  CA    . LEU A 1 197 ? 27.365  -41.336 -4.434  1.00 74.54  ? 197  LEU B CA    1 
ATOM   1555 C  C     . LEU A 1 197 ? 28.490  -41.199 -3.413  1.00 69.61  ? 197  LEU B C     1 
ATOM   1556 O  O     . LEU A 1 197 ? 29.580  -41.741 -3.596  1.00 70.92  ? 197  LEU B O     1 
ATOM   1557 C  CB    . LEU A 1 197 ? 27.838  -40.861 -5.809  1.00 76.90  ? 197  LEU B CB    1 
ATOM   1558 C  CG    . LEU A 1 197 ? 26.908  -41.251 -6.959  1.00 77.50  ? 197  LEU B CG    1 
ATOM   1559 C  CD1   . LEU A 1 197 ? 27.319  -40.551 -8.242  1.00 81.30  ? 197  LEU B CD1   1 
ATOM   1560 C  CD2   . LEU A 1 197 ? 26.955  -42.758 -7.129  1.00 82.16  ? 197  LEU B CD2   1 
ATOM   1561 N  N     . GLY A 1 198 ? 28.216  -40.472 -2.333  1.00 67.99  ? 198  GLY B N     1 
ATOM   1562 C  CA    . GLY A 1 198 ? 29.216  -40.284 -1.297  1.00 64.23  ? 198  GLY B CA    1 
ATOM   1563 C  C     . GLY A 1 198 ? 30.189  -39.172 -1.626  1.00 63.42  ? 198  GLY B C     1 
ATOM   1564 O  O     . GLY A 1 198 ? 31.157  -38.938 -0.902  1.00 63.14  ? 198  GLY B O     1 
ATOM   1565 N  N     . ILE A 1 199 ? 29.928  -38.486 -2.731  1.00 62.72  ? 199  ILE B N     1 
ATOM   1566 C  CA    . ILE A 1 199 ? 30.769  -37.389 -3.175  1.00 63.66  ? 199  ILE B CA    1 
ATOM   1567 C  C     . ILE A 1 199 ? 30.329  -36.103 -2.481  1.00 64.69  ? 199  ILE B C     1 
ATOM   1568 O  O     . ILE A 1 199 ? 29.287  -35.529 -2.808  1.00 64.30  ? 199  ILE B O     1 
ATOM   1569 C  CB    . ILE A 1 199 ? 30.678  -37.222 -4.704  1.00 62.67  ? 199  ILE B CB    1 
ATOM   1570 C  CG1   . ILE A 1 199 ? 31.157  -38.512 -5.381  1.00 60.85  ? 199  ILE B CG1   1 
ATOM   1571 C  CG2   . ILE A 1 199 ? 31.496  -36.018 -5.145  1.00 61.31  ? 199  ILE B CG2   1 
ATOM   1572 C  CD1   . ILE A 1 199 ? 30.825  -38.621 -6.858  1.00 59.39  ? 199  ILE B CD1   1 
ATOM   1573 N  N     . ASN A 1 200 ? 31.132  -35.671 -1.511  1.00 65.59  ? 200  ASN B N     1 
ATOM   1574 C  CA    . ASN A 1 200 ? 30.865  -34.464 -0.731  1.00 66.38  ? 200  ASN B CA    1 
ATOM   1575 C  C     . ASN A 1 200 ? 31.970  -33.427 -0.919  1.00 64.73  ? 200  ASN B C     1 
ATOM   1576 O  O     . ASN A 1 200 ? 31.877  -32.307 -0.418  1.00 66.30  ? 200  ASN B O     1 
ATOM   1577 C  CB    . ASN A 1 200 ? 30.749  -34.813 0.759   1.00 68.86  ? 200  ASN B CB    1 
ATOM   1578 C  CG    . ASN A 1 200 ? 29.389  -35.381 1.128   1.00 71.25  ? 200  ASN B CG    1 
ATOM   1579 O  OD1   . ASN A 1 200 ? 28.376  -34.684 1.061   1.00 74.03  ? 200  ASN B OD1   1 
ATOM   1580 N  ND2   . ASN A 1 200 ? 29.361  -36.649 1.523   1.00 74.22  ? 200  ASN B ND2   1 
ATOM   1581 N  N     . LYS A 1 201 ? 33.023  -33.806 -1.632  1.00 63.83  ? 201  LYS B N     1 
ATOM   1582 C  CA    . LYS A 1 201 ? 34.131  -32.895 -1.877  1.00 61.63  ? 201  LYS B CA    1 
ATOM   1583 C  C     . LYS A 1 201 ? 34.648  -33.146 -3.287  1.00 58.60  ? 201  LYS B C     1 
ATOM   1584 O  O     . LYS A 1 201 ? 34.373  -34.190 -3.878  1.00 57.41  ? 201  LYS B O     1 
ATOM   1585 C  CB    . LYS A 1 201 ? 35.252  -33.138 -0.862  1.00 64.26  ? 201  LYS B CB    1 
ATOM   1586 C  CG    . LYS A 1 201 ? 34.805  -33.198 0.597   1.00 68.98  ? 201  LYS B CG    1 
ATOM   1587 C  CD    . LYS A 1 201 ? 34.502  -31.827 1.186   1.00 71.94  ? 201  LYS B CD    1 
ATOM   1588 C  CE    . LYS A 1 201 ? 34.139  -31.946 2.662   1.00 72.87  ? 201  LYS B CE    1 
ATOM   1589 N  NZ    . LYS A 1 201 ? 33.930  -30.623 3.308   1.00 73.87  ? 201  LYS B NZ    1 
ATOM   1590 N  N     . LEU A 1 202 ? 35.391  -32.190 -3.828  1.00 54.75  ? 202  LEU B N     1 
ATOM   1591 C  CA    . LEU A 1 202 ? 35.936  -32.343 -5.168  1.00 51.78  ? 202  LEU B CA    1 
ATOM   1592 C  C     . LEU A 1 202 ? 36.777  -33.597 -5.293  1.00 51.52  ? 202  LEU B C     1 
ATOM   1593 O  O     . LEU A 1 202 ? 36.548  -34.430 -6.168  1.00 50.55  ? 202  LEU B O     1 
ATOM   1594 C  CB    . LEU A 1 202 ? 36.798  -31.140 -5.534  1.00 46.58  ? 202  LEU B CB    1 
ATOM   1595 C  CG    . LEU A 1 202 ? 36.075  -30.040 -6.301  1.00 41.65  ? 202  LEU B CG    1 
ATOM   1596 C  CD1   . LEU A 1 202 ? 36.964  -28.813 -6.387  1.00 38.02  ? 202  LEU B CD1   1 
ATOM   1597 C  CD2   . LEU A 1 202 ? 35.704  -30.551 -7.687  1.00 37.65  ? 202  LEU B CD2   1 
ATOM   1598 N  N     . VAL A 1 203 ? 37.752  -33.720 -4.400  1.00 52.76  ? 203  VAL B N     1 
ATOM   1599 C  CA    . VAL A 1 203 ? 38.676  -34.845 -4.401  1.00 55.91  ? 203  VAL B CA    1 
ATOM   1600 C  C     . VAL A 1 203 ? 37.987  -36.201 -4.486  1.00 54.02  ? 203  VAL B C     1 
ATOM   1601 O  O     . VAL A 1 203 ? 38.614  -37.202 -4.836  1.00 55.74  ? 203  VAL B O     1 
ATOM   1602 C  CB    . VAL A 1 203 ? 39.567  -34.824 -3.141  1.00 54.00  ? 203  VAL B CB    1 
ATOM   1603 C  CG1   . VAL A 1 203 ? 38.915  -35.620 -2.021  1.00 55.08  ? 203  VAL B CG1   1 
ATOM   1604 C  CG2   . VAL A 1 203 ? 40.937  -35.370 -3.474  1.00 55.21  ? 203  VAL B CG2   1 
ATOM   1605 N  N     . ASP A 1 204 ? 36.700  -36.227 -4.166  1.00 55.77  ? 204  ASP B N     1 
ATOM   1606 C  CA    . ASP A 1 204 ? 35.931  -37.461 -4.187  1.00 57.74  ? 204  ASP B CA    1 
ATOM   1607 C  C     . ASP A 1 204 ? 35.592  -37.992 -5.572  1.00 54.82  ? 204  ASP B C     1 
ATOM   1608 O  O     . ASP A 1 204 ? 35.102  -39.113 -5.707  1.00 55.18  ? 204  ASP B O     1 
ATOM   1609 C  CB    . ASP A 1 204 ? 34.642  -37.263 -3.404  1.00 62.05  ? 204  ASP B CB    1 
ATOM   1610 C  CG    . ASP A 1 204 ? 34.701  -37.887 -2.037  1.00 67.42  ? 204  ASP B CG    1 
ATOM   1611 O  OD1   . ASP A 1 204 ? 34.548  -39.123 -1.951  1.00 73.57  ? 204  ASP B OD1   1 
ATOM   1612 O  OD2   . ASP A 1 204 ? 34.913  -37.149 -1.053  1.00 73.07  ? 204  ASP B OD2   1 
ATOM   1613 N  N     . THR A 1 205 ? 35.854  -37.201 -6.601  1.00 53.44  ? 205  THR B N     1 
ATOM   1614 C  CA    . THR A 1 205 ? 35.529  -37.621 -7.955  1.00 54.08  ? 205  THR B CA    1 
ATOM   1615 C  C     . THR A 1 205 ? 36.621  -38.427 -8.658  1.00 56.49  ? 205  THR B C     1 
ATOM   1616 O  O     . THR A 1 205 ? 36.368  -39.047 -9.689  1.00 53.53  ? 205  THR B O     1 
ATOM   1617 C  CB    . THR A 1 205 ? 35.169  -36.401 -8.806  1.00 49.65  ? 205  THR B CB    1 
ATOM   1618 O  OG1   . THR A 1 205 ? 36.192  -35.410 -8.666  1.00 48.23  ? 205  THR B OG1   1 
ATOM   1619 C  CG2   . THR A 1 205 ? 33.844  -35.808 -8.346  1.00 46.81  ? 205  THR B CG2   1 
ATOM   1620 N  N     . LEU A 1 206 ? 37.827  -38.427 -8.101  1.00 59.10  ? 206  LEU B N     1 
ATOM   1621 C  CA    . LEU A 1 206 ? 38.942  -39.161 -8.697  1.00 64.00  ? 206  LEU B CA    1 
ATOM   1622 C  C     . LEU A 1 206 ? 38.915  -40.635 -8.298  1.00 69.06  ? 206  LEU B C     1 
ATOM   1623 O  O     . LEU A 1 206 ? 39.565  -41.469 -8.929  1.00 73.39  ? 206  LEU B O     1 
ATOM   1624 C  CB    . LEU A 1 206 ? 40.269  -38.542 -8.252  1.00 64.09  ? 206  LEU B CB    1 
ATOM   1625 C  CG    . LEU A 1 206 ? 40.320  -37.014 -8.316  1.00 61.98  ? 206  LEU B CG    1 
ATOM   1626 C  CD1   . LEU A 1 206 ? 41.554  -36.488 -7.596  1.00 61.00  ? 206  LEU B CD1   1 
ATOM   1627 C  CD2   . LEU A 1 206 ? 40.299  -36.579 -9.769  1.00 60.63  ? 206  LEU B CD2   1 
ATOM   1628 N  N     . SER A 1 207 ? 38.158  -40.946 -7.249  1.00 76.20  ? 207  SER B N     1 
ATOM   1629 C  CA    . SER A 1 207 ? 38.057  -42.313 -6.745  1.00 79.72  ? 207  SER B CA    1 
ATOM   1630 C  C     . SER A 1 207 ? 36.898  -43.093 -7.358  1.00 81.58  ? 207  SER B C     1 
ATOM   1631 O  O     . SER A 1 207 ? 37.071  -44.237 -7.777  1.00 80.13  ? 207  SER B O     1 
ATOM   1632 C  CB    . SER A 1 207 ? 37.901  -42.303 -5.223  1.00 82.38  ? 207  SER B CB    1 
ATOM   1633 O  OG    . SER A 1 207 ? 36.585  -41.928 -4.855  1.00 90.17  ? 207  SER B OG    1 
ATOM   1634 N  N     . ILE A 1 208 ? 35.715  -42.485 -7.388  1.00 80.31  ? 208  ILE B N     1 
ATOM   1635 C  CA    . ILE A 1 208 ? 34.554  -43.148 -7.968  1.00 81.89  ? 208  ILE B CA    1 
ATOM   1636 C  C     . ILE A 1 208 ? 34.895  -43.518 -9.400  1.00 81.36  ? 208  ILE B C     1 
ATOM   1637 O  O     . ILE A 1 208 ? 35.606  -42.777 -10.080 1.00 81.72  ? 208  ILE B O     1 
ATOM   1638 C  CB    . ILE A 1 208 ? 33.310  -42.228 -7.984  1.00 83.04  ? 208  ILE B CB    1 
ATOM   1639 C  CG1   . ILE A 1 208 ? 32.166  -42.918 -8.732  1.00 78.76  ? 208  ILE B CG1   1 
ATOM   1640 C  CG2   . ILE A 1 208 ? 33.644  -40.902 -8.655  1.00 79.47  ? 208  ILE B CG2   1 
ATOM   1641 C  CD1   . ILE A 1 208 ? 30.851  -42.184 -8.652  1.00 77.37  ? 208  ILE B CD1   1 
ATOM   1642 N  N     . GLU A 1 209 ? 34.409  -44.666 -9.857  1.00 81.42  ? 209  GLU B N     1 
ATOM   1643 C  CA    . GLU A 1 209 ? 34.679  -45.080 -11.225 1.00 80.96  ? 209  GLU B CA    1 
ATOM   1644 C  C     . GLU A 1 209 ? 34.035  -43.983 -12.075 1.00 76.78  ? 209  GLU B C     1 
ATOM   1645 O  O     . GLU A 1 209 ? 32.972  -43.477 -11.720 1.00 77.14  ? 209  GLU B O     1 
ATOM   1646 C  CB    . GLU A 1 209 ? 34.038  -46.442 -11.501 1.00 81.24  ? 209  GLU B CB    1 
ATOM   1647 C  CG    . GLU A 1 209 ? 34.819  -47.304 -12.482 1.00 89.63  ? 209  GLU B CG    1 
ATOM   1648 C  CD    . GLU A 1 209 ? 34.027  -48.503 -12.961 1.00 95.23  ? 209  GLU B CD    1 
ATOM   1649 O  OE1   . GLU A 1 209 ? 32.853  -48.316 -13.341 1.00 99.66  ? 209  GLU B OE1   1 
ATOM   1650 O  OE2   . GLU A 1 209 ? 34.574  -49.625 -12.972 1.00 99.53  ? 209  GLU B OE2   1 
ATOM   1651 N  N     . PHE A 1 210 ? 34.672  -43.607 -13.180 1.00 74.70  ? 210  PHE B N     1 
ATOM   1652 C  CA    . PHE A 1 210 ? 34.157  -42.533 -14.035 1.00 73.23  ? 210  PHE B CA    1 
ATOM   1653 C  C     . PHE A 1 210 ? 32.805  -42.776 -14.690 1.00 73.58  ? 210  PHE B C     1 
ATOM   1654 O  O     . PHE A 1 210 ? 31.861  -42.023 -14.458 1.00 73.33  ? 210  PHE B O     1 
ATOM   1655 C  CB    . PHE A 1 210 ? 35.198  -42.176 -15.116 1.00 69.93  ? 210  PHE B CB    1 
ATOM   1656 C  CG    . PHE A 1 210 ? 34.738  -41.131 -16.129 1.00 66.72  ? 210  PHE B CG    1 
ATOM   1657 C  CD1   . PHE A 1 210 ? 35.675  -40.365 -16.811 1.00 65.47  ? 210  PHE B CD1   1 
ATOM   1658 C  CD2   . PHE A 1 210 ? 33.390  -40.950 -16.444 1.00 64.97  ? 210  PHE B CD2   1 
ATOM   1659 C  CE1   . PHE A 1 210 ? 35.277  -39.445 -17.784 1.00 64.91  ? 210  PHE B CE1   1 
ATOM   1660 C  CE2   . PHE A 1 210 ? 32.985  -40.038 -17.410 1.00 64.10  ? 210  PHE B CE2   1 
ATOM   1661 C  CZ    . PHE A 1 210 ? 33.929  -39.284 -18.082 1.00 64.59  ? 210  PHE B CZ    1 
ATOM   1662 N  N     . ASP A 1 211 ? 32.718  -43.792 -15.537 1.00 74.48  ? 211  ASP B N     1 
ATOM   1663 C  CA    . ASP A 1 211 ? 31.474  -44.065 -16.238 1.00 75.27  ? 211  ASP B CA    1 
ATOM   1664 C  C     . ASP A 1 211 ? 30.231  -44.101 -15.342 1.00 76.64  ? 211  ASP B C     1 
ATOM   1665 O  O     . ASP A 1 211 ? 29.107  -44.001 -15.839 1.00 76.74  ? 211  ASP B O     1 
ATOM   1666 C  CB    . ASP A 1 211 ? 31.629  -45.345 -17.062 1.00 75.34  ? 211  ASP B CB    1 
ATOM   1667 C  CG    . ASP A 1 211 ? 32.454  -45.119 -18.326 1.00 76.48  ? 211  ASP B CG    1 
ATOM   1668 O  OD1   . ASP A 1 211 ? 31.858  -44.803 -19.378 1.00 75.50  ? 211  ASP B OD1   1 
ATOM   1669 O  OD2   . ASP A 1 211 ? 33.697  -45.235 -18.265 1.00 75.59  ? 211  ASP B OD2   1 
ATOM   1670 N  N     . LYS A 1 212 ? 30.429  -44.215 -14.028 1.00 76.24  ? 212  LYS B N     1 
ATOM   1671 C  CA    . LYS A 1 212 ? 29.309  -44.218 -13.084 1.00 75.34  ? 212  LYS B CA    1 
ATOM   1672 C  C     . LYS A 1 212 ? 29.074  -42.803 -12.565 1.00 76.08  ? 212  LYS B C     1 
ATOM   1673 O  O     . LYS A 1 212 ? 28.356  -42.584 -11.591 1.00 75.83  ? 212  LYS B O     1 
ATOM   1674 C  CB    . LYS A 1 212 ? 29.569  -45.170 -11.910 1.00 78.08  ? 212  LYS B CB    1 
ATOM   1675 C  CG    . LYS A 1 212 ? 28.540  -45.058 -10.781 1.00 76.94  ? 212  LYS B CG    1 
ATOM   1676 C  CD    . LYS A 1 212 ? 28.452  -46.326 -9.954  1.00 74.90  ? 212  LYS B CD    1 
ATOM   1677 C  CE    . LYS A 1 212 ? 27.669  -46.106 -8.668  1.00 72.65  ? 212  LYS B CE    1 
ATOM   1678 N  NZ    . LYS A 1 212 ? 28.525  -45.486 -7.620  1.00 71.58  ? 212  LYS B NZ    1 
ATOM   1679 N  N     . LEU A 1 213 ? 29.712  -41.843 -13.218 1.00 73.99  ? 213  LEU B N     1 
ATOM   1680 C  CA    . LEU A 1 213 ? 29.548  -40.445 -12.868 1.00 70.35  ? 213  LEU B CA    1 
ATOM   1681 C  C     . LEU A 1 213 ? 28.865  -39.921 -14.120 1.00 71.59  ? 213  LEU B C     1 
ATOM   1682 O  O     . LEU A 1 213 ? 27.809  -39.290 -14.058 1.00 70.49  ? 213  LEU B O     1 
ATOM   1683 C  CB    . LEU A 1 213 ? 30.911  -39.778 -12.656 1.00 66.60  ? 213  LEU B CB    1 
ATOM   1684 C  CG    . LEU A 1 213 ? 30.915  -38.602 -11.673 1.00 61.53  ? 213  LEU B CG    1 
ATOM   1685 C  CD1   . LEU A 1 213 ? 30.215  -39.023 -10.390 1.00 56.81  ? 213  LEU B CD1   1 
ATOM   1686 C  CD2   . LEU A 1 213 ? 32.339  -38.160 -11.379 1.00 55.91  ? 213  LEU B CD2   1 
ATOM   1687 N  N     . LYS A 1 214 ? 29.472  -40.231 -15.261 1.00 71.83  ? 214  LYS B N     1 
ATOM   1688 C  CA    . LYS A 1 214 ? 28.935  -39.854 -16.562 1.00 71.51  ? 214  LYS B CA    1 
ATOM   1689 C  C     . LYS A 1 214 ? 27.504  -40.358 -16.575 1.00 72.57  ? 214  LYS B C     1 
ATOM   1690 O  O     . LYS A 1 214 ? 26.630  -39.787 -17.223 1.00 73.01  ? 214  LYS B O     1 
ATOM   1691 C  CB    . LYS A 1 214 ? 29.724  -40.555 -17.671 1.00 72.06  ? 214  LYS B CB    1 
ATOM   1692 C  CG    . LYS A 1 214 ? 29.117  -40.472 -19.069 1.00 69.08  ? 214  LYS B CG    1 
ATOM   1693 C  CD    . LYS A 1 214 ? 29.534  -41.693 -19.890 1.00 66.51  ? 214  LYS B CD    1 
ATOM   1694 C  CE    . LYS A 1 214 ? 29.193  -41.571 -21.373 1.00 64.07  ? 214  LYS B CE    1 
ATOM   1695 N  NZ    . LYS A 1 214 ? 30.279  -40.910 -22.152 1.00 63.15  ? 214  LYS B NZ    1 
ATOM   1696 N  N     . GLY A 1 215 ? 27.272  -41.438 -15.841 1.00 73.18  ? 215  GLY B N     1 
ATOM   1697 C  CA    . GLY A 1 215 ? 25.945  -42.009 -15.794 1.00 74.73  ? 215  GLY B CA    1 
ATOM   1698 C  C     . GLY A 1 215 ? 24.932  -41.222 -14.986 1.00 74.95  ? 215  GLY B C     1 
ATOM   1699 O  O     . GLY A 1 215 ? 23.787  -41.080 -15.404 1.00 74.06  ? 215  GLY B O     1 
ATOM   1700 N  N     . MET A 1 216 ? 25.349  -40.682 -13.847 1.00 73.11  ? 216  MET B N     1 
ATOM   1701 C  CA    . MET A 1 216 ? 24.426  -39.963 -12.975 1.00 71.82  ? 216  MET B CA    1 
ATOM   1702 C  C     . MET A 1 216 ? 24.188  -38.466 -13.170 1.00 68.82  ? 216  MET B C     1 
ATOM   1703 O  O     . MET A 1 216 ? 23.045  -38.010 -13.116 1.00 70.16  ? 216  MET B O     1 
ATOM   1704 C  CB    . MET A 1 216 ? 24.821  -40.202 -11.520 1.00 75.90  ? 216  MET B CB    1 
ATOM   1705 C  CG    . MET A 1 216 ? 23.852  -39.590 -10.535 1.00 81.51  ? 216  MET B CG    1 
ATOM   1706 S  SD    . MET A 1 216 ? 23.142  -40.840 -9.460  1.00 86.61  ? 216  MET B SD    1 
ATOM   1707 C  CE    . MET A 1 216 ? 22.478  -42.018 -10.692 1.00 90.86  ? 216  MET B CE    1 
ATOM   1708 N  N     . ILE A 1 217 ? 25.254  -37.700 -13.379 1.00 65.53  ? 217  ILE B N     1 
ATOM   1709 C  CA    . ILE A 1 217 ? 25.128  -36.254 -13.532 1.00 58.58  ? 217  ILE B CA    1 
ATOM   1710 C  C     . ILE A 1 217 ? 25.313  -35.726 -14.951 1.00 60.12  ? 217  ILE B C     1 
ATOM   1711 O  O     . ILE A 1 217 ? 24.995  -34.569 -15.231 1.00 55.51  ? 217  ILE B O     1 
ATOM   1712 C  CB    . ILE A 1 217 ? 26.133  -35.530 -12.619 1.00 55.08  ? 217  ILE B CB    1 
ATOM   1713 C  CG1   . ILE A 1 217 ? 27.559  -35.777 -13.119 1.00 54.70  ? 217  ILE B CG1   1 
ATOM   1714 C  CG2   . ILE A 1 217 ? 25.990  -36.040 -11.194 1.00 56.18  ? 217  ILE B CG2   1 
ATOM   1715 C  CD1   . ILE A 1 217 ? 28.642  -35.283 -12.182 1.00 51.31  ? 217  ILE B CD1   1 
ATOM   1716 N  N     . GLY A 1 218 ? 25.833  -36.562 -15.842 1.00 57.98  ? 218  GLY B N     1 
ATOM   1717 C  CA    . GLY A 1 218 ? 26.046  -36.130 -17.211 1.00 58.94  ? 218  GLY B CA    1 
ATOM   1718 C  C     . GLY A 1 218 ? 27.509  -36.155 -17.598 1.00 58.54  ? 218  GLY B C     1 
ATOM   1719 O  O     . GLY A 1 218 ? 28.381  -35.843 -16.790 1.00 60.40  ? 218  GLY B O     1 
ATOM   1720 N  N     . GLU A 1 219 ? 27.779  -36.529 -18.843 1.00 60.39  ? 219  GLU B N     1 
ATOM   1721 C  CA    . GLU A 1 219 ? 29.144  -36.601 -19.346 1.00 59.08  ? 219  GLU B CA    1 
ATOM   1722 C  C     . GLU A 1 219 ? 29.948  -35.325 -19.092 1.00 58.63  ? 219  GLU B C     1 
ATOM   1723 O  O     . GLU A 1 219 ? 31.052  -35.379 -18.555 1.00 57.95  ? 219  GLU B O     1 
ATOM   1724 C  CB    . GLU A 1 219 ? 29.125  -36.916 -20.846 1.00 58.82  ? 219  GLU B CB    1 
ATOM   1725 C  CG    . GLU A 1 219 ? 30.467  -36.735 -21.535 1.00 63.57  ? 219  GLU B CG    1 
ATOM   1726 C  CD    . GLU A 1 219 ? 30.460  -37.216 -22.972 1.00 65.14  ? 219  GLU B CD    1 
ATOM   1727 O  OE1   . GLU A 1 219 ? 29.716  -36.645 -23.799 1.00 64.56  ? 219  GLU B OE1   1 
ATOM   1728 O  OE2   . GLU A 1 219 ? 31.204  -38.172 -23.273 1.00 65.31  ? 219  GLU B OE2   1 
ATOM   1729 N  N     . ALA A 1 220 ? 29.388  -34.180 -19.470 1.00 56.48  ? 220  ALA B N     1 
ATOM   1730 C  CA    . ALA A 1 220 ? 30.072  -32.899 -19.306 1.00 55.28  ? 220  ALA B CA    1 
ATOM   1731 C  C     . ALA A 1 220 ? 30.376  -32.498 -17.862 1.00 53.94  ? 220  ALA B C     1 
ATOM   1732 O  O     . ALA A 1 220 ? 31.533  -32.250 -17.513 1.00 54.82  ? 220  ALA B O     1 
ATOM   1733 C  CB    . ALA A 1 220 ? 29.267  -31.800 -19.982 1.00 58.15  ? 220  ALA B CB    1 
ATOM   1734 N  N     . LYS A 1 221 ? 29.340  -32.424 -17.032 1.00 51.49  ? 221  LYS B N     1 
ATOM   1735 C  CA    . LYS A 1 221 ? 29.506  -32.032 -15.637 1.00 46.20  ? 221  LYS B CA    1 
ATOM   1736 C  C     . LYS A 1 221 ? 30.445  -32.992 -14.909 1.00 45.04  ? 221  LYS B C     1 
ATOM   1737 O  O     . LYS A 1 221 ? 31.024  -32.645 -13.878 1.00 42.32  ? 221  LYS B O     1 
ATOM   1738 C  CB    . LYS A 1 221 ? 28.138  -31.976 -14.949 1.00 44.33  ? 221  LYS B CB    1 
ATOM   1739 C  CG    . LYS A 1 221 ? 28.042  -30.968 -13.810 1.00 41.24  ? 221  LYS B CG    1 
ATOM   1740 C  CD    . LYS A 1 221 ? 26.629  -30.397 -13.688 1.00 38.02  ? 221  LYS B CD    1 
ATOM   1741 C  CE    . LYS A 1 221 ? 26.370  -29.308 -14.725 1.00 36.33  ? 221  LYS B CE    1 
ATOM   1742 N  NZ    . LYS A 1 221 ? 24.934  -28.911 -14.779 1.00 35.33  ? 221  LYS B NZ    1 
ATOM   1743 N  N     . ALA A 1 222 ? 30.601  -34.195 -15.451 1.00 43.61  ? 222  ALA B N     1 
ATOM   1744 C  CA    . ALA A 1 222 ? 31.497  -35.175 -14.851 1.00 43.62  ? 222  ALA B CA    1 
ATOM   1745 C  C     . ALA A 1 222 ? 32.926  -34.725 -15.145 1.00 43.46  ? 222  ALA B C     1 
ATOM   1746 O  O     . ALA A 1 222 ? 33.745  -34.582 -14.239 1.00 43.31  ? 222  ALA B O     1 
ATOM   1747 C  CB    . ALA A 1 222 ? 31.242  -36.549 -15.444 1.00 48.51  ? 222  ALA B CB    1 
ATOM   1748 N  N     . LYS A 1 223 ? 33.207  -34.492 -16.424 1.00 44.31  ? 223  LYS B N     1 
ATOM   1749 C  CA    . LYS A 1 223 ? 34.521  -34.043 -16.878 1.00 44.48  ? 223  LYS B CA    1 
ATOM   1750 C  C     . LYS A 1 223 ? 34.901  -32.780 -16.118 1.00 43.26  ? 223  LYS B C     1 
ATOM   1751 O  O     . LYS A 1 223 ? 36.054  -32.586 -15.726 1.00 42.68  ? 223  LYS B O     1 
ATOM   1752 C  CB    . LYS A 1 223 ? 34.471  -33.707 -18.368 1.00 45.50  ? 223  LYS B CB    1 
ATOM   1753 C  CG    . LYS A 1 223 ? 33.802  -34.746 -19.246 1.00 50.32  ? 223  LYS B CG    1 
ATOM   1754 C  CD    . LYS A 1 223 ? 34.816  -35.668 -19.887 1.00 54.01  ? 223  LYS B CD    1 
ATOM   1755 C  CE    . LYS A 1 223 ? 34.220  -36.376 -21.097 1.00 56.25  ? 223  LYS B CE    1 
ATOM   1756 N  NZ    . LYS A 1 223 ? 33.857  -35.437 -22.200 1.00 57.24  ? 223  LYS B NZ    1 
ATOM   1757 N  N     . TYR A 1 224 ? 33.906  -31.917 -15.939 1.00 40.79  ? 224  TYR B N     1 
ATOM   1758 C  CA    . TYR A 1 224 ? 34.076  -30.654 -15.243 1.00 38.78  ? 224  TYR B CA    1 
ATOM   1759 C  C     . TYR A 1 224 ? 34.624  -30.871 -13.839 1.00 38.76  ? 224  TYR B C     1 
ATOM   1760 O  O     . TYR A 1 224 ? 35.720  -30.416 -13.520 1.00 39.15  ? 224  TYR B O     1 
ATOM   1761 C  CB    . TYR A 1 224 ? 32.732  -29.919 -15.182 1.00 38.83  ? 224  TYR B CB    1 
ATOM   1762 C  CG    . TYR A 1 224 ? 32.763  -28.610 -14.431 1.00 35.70  ? 224  TYR B CG    1 
ATOM   1763 C  CD1   . TYR A 1 224 ? 33.695  -27.620 -14.746 1.00 34.64  ? 224  TYR B CD1   1 
ATOM   1764 C  CD2   . TYR A 1 224 ? 31.859  -28.361 -13.403 1.00 34.47  ? 224  TYR B CD2   1 
ATOM   1765 C  CE1   . TYR A 1 224 ? 33.724  -26.413 -14.046 1.00 34.93  ? 224  TYR B CE1   1 
ATOM   1766 C  CE2   . TYR A 1 224 ? 31.878  -27.164 -12.702 1.00 34.52  ? 224  TYR B CE2   1 
ATOM   1767 C  CZ    . TYR A 1 224 ? 32.811  -26.197 -13.025 1.00 34.76  ? 224  TYR B CZ    1 
ATOM   1768 O  OH    . TYR A 1 224 ? 32.832  -25.028 -12.304 1.00 35.35  ? 224  TYR B OH    1 
ATOM   1769 N  N     . LEU A 1 225 ? 33.869  -31.583 -13.009 1.00 40.10  ? 225  LEU B N     1 
ATOM   1770 C  CA    . LEU A 1 225 ? 34.286  -31.840 -11.637 1.00 39.18  ? 225  LEU B CA    1 
ATOM   1771 C  C     . LEU A 1 225 ? 35.662  -32.511 -11.506 1.00 40.02  ? 225  LEU B C     1 
ATOM   1772 O  O     . LEU A 1 225 ? 36.474  -32.095 -10.678 1.00 39.26  ? 225  LEU B O     1 
ATOM   1773 C  CB    . LEU A 1 225 ? 33.209  -32.659 -10.905 1.00 35.32  ? 225  LEU B CB    1 
ATOM   1774 C  CG    . LEU A 1 225 ? 31.879  -31.922 -10.675 1.00 34.72  ? 225  LEU B CG    1 
ATOM   1775 C  CD1   . LEU A 1 225 ? 30.901  -32.798 -9.905  1.00 32.34  ? 225  LEU B CD1   1 
ATOM   1776 C  CD2   . LEU A 1 225 ? 32.142  -30.641 -9.899  1.00 33.11  ? 225  LEU B CD2   1 
ATOM   1777 N  N     . ILE A 1 226 ? 35.939  -33.524 -12.324 1.00 40.78  ? 226  ILE B N     1 
ATOM   1778 C  CA    . ILE A 1 226 ? 37.225  -34.223 -12.253 1.00 44.54  ? 226  ILE B CA    1 
ATOM   1779 C  C     . ILE A 1 226 ? 38.423  -33.311 -12.544 1.00 42.69  ? 226  ILE B C     1 
ATOM   1780 O  O     . ILE A 1 226 ? 39.387  -33.284 -11.776 1.00 43.29  ? 226  ILE B O     1 
ATOM   1781 C  CB    . ILE A 1 226 ? 37.290  -35.423 -13.239 1.00 47.30  ? 226  ILE B CB    1 
ATOM   1782 C  CG1   . ILE A 1 226 ? 35.916  -36.079 -13.382 1.00 48.98  ? 226  ILE B CG1   1 
ATOM   1783 C  CG2   . ILE A 1 226 ? 38.253  -36.478 -12.705 1.00 47.74  ? 226  ILE B CG2   1 
ATOM   1784 C  CD1   . ILE A 1 226 ? 35.907  -37.283 -14.311 1.00 51.97  ? 226  ILE B CD1   1 
ATOM   1785 N  N     . SER A 1 227 ? 38.365  -32.572 -13.650 1.00 42.23  ? 227  SER B N     1 
ATOM   1786 C  CA    . SER A 1 227 ? 39.465  -31.682 -14.028 1.00 41.92  ? 227  SER B CA    1 
ATOM   1787 C  C     . SER A 1 227 ? 39.773  -30.741 -12.879 1.00 41.76  ? 227  SER B C     1 
ATOM   1788 O  O     . SER A 1 227 ? 40.926  -30.377 -12.639 1.00 41.46  ? 227  SER B O     1 
ATOM   1789 C  CB    . SER A 1 227 ? 39.099  -30.858 -15.263 1.00 38.94  ? 227  SER B CB    1 
ATOM   1790 O  OG    . SER A 1 227 ? 38.350  -29.709 -14.903 1.00 36.58  ? 227  SER B OG    1 
ATOM   1791 N  N     . LEU A 1 228 ? 38.716  -30.345 -12.178 1.00 43.91  ? 228  LEU B N     1 
ATOM   1792 C  CA    . LEU A 1 228 ? 38.829  -29.456 -11.036 1.00 45.64  ? 228  LEU B CA    1 
ATOM   1793 C  C     . LEU A 1 228 ? 39.506  -30.193 -9.894  1.00 45.30  ? 228  LEU B C     1 
ATOM   1794 O  O     . LEU A 1 228 ? 40.357  -29.635 -9.204  1.00 45.29  ? 228  LEU B O     1 
ATOM   1795 C  CB    . LEU A 1 228 ? 37.441  -28.983 -10.600 1.00 49.66  ? 228  LEU B CB    1 
ATOM   1796 C  CG    . LEU A 1 228 ? 36.880  -27.822 -11.418 1.00 55.66  ? 228  LEU B CG    1 
ATOM   1797 C  CD1   . LEU A 1 228 ? 35.408  -27.619 -11.106 1.00 60.09  ? 228  LEU B CD1   1 
ATOM   1798 C  CD2   . LEU A 1 228 ? 37.681  -26.568 -11.103 1.00 59.65  ? 228  LEU B CD2   1 
ATOM   1799 N  N     . ALA A 1 229 ? 39.133  -31.454 -9.703  1.00 45.12  ? 229  ALA B N     1 
ATOM   1800 C  CA    . ALA A 1 229 ? 39.708  -32.266 -8.637  1.00 46.36  ? 229  ALA B CA    1 
ATOM   1801 C  C     . ALA A 1 229 ? 41.189  -32.557 -8.871  1.00 47.13  ? 229  ALA B C     1 
ATOM   1802 O  O     . ALA A 1 229 ? 41.937  -32.810 -7.929  1.00 45.87  ? 229  ALA B O     1 
ATOM   1803 C  CB    . ALA A 1 229 ? 38.934  -33.570 -8.507  1.00 48.43  ? 229  ALA B CB    1 
ATOM   1804 N  N     . ARG A 1 230 ? 41.605  -32.513 -10.130 1.00 48.50  ? 230  ARG B N     1 
ATOM   1805 C  CA    . ARG A 1 230 ? 42.993  -32.780 -10.499 1.00 50.70  ? 230  ARG B CA    1 
ATOM   1806 C  C     . ARG A 1 230 ? 43.812  -31.507 -10.596 1.00 52.58  ? 230  ARG B C     1 
ATOM   1807 O  O     . ARG A 1 230 ? 44.987  -31.544 -10.969 1.00 53.52  ? 230  ARG B O     1 
ATOM   1808 C  CB    . ARG A 1 230 ? 43.039  -33.472 -11.852 1.00 50.71  ? 230  ARG B CB    1 
ATOM   1809 C  CG    . ARG A 1 230 ? 42.247  -34.737 -11.898 1.00 52.23  ? 230  ARG B CG    1 
ATOM   1810 C  CD    . ARG A 1 230 ? 42.231  -35.294 -13.287 1.00 51.79  ? 230  ARG B CD    1 
ATOM   1811 N  NE    . ARG A 1 230 ? 41.974  -36.724 -13.249 1.00 52.11  ? 230  ARG B NE    1 
ATOM   1812 C  CZ    . ARG A 1 230 ? 41.737  -37.466 -14.321 1.00 52.60  ? 230  ARG B CZ    1 
ATOM   1813 N  NH1   . ARG A 1 230 ? 41.720  -36.908 -15.524 1.00 54.08  ? 230  ARG B NH1   1 
ATOM   1814 N  NH2   . ARG A 1 230 ? 41.524  -38.766 -14.191 1.00 52.24  ? 230  ARG B NH2   1 
ATOM   1815 N  N     . ASP A 1 231 ? 43.187  -30.386 -10.255 1.00 54.44  ? 231  ASP B N     1 
ATOM   1816 C  CA    . ASP A 1 231 ? 43.828  -29.081 -10.349 1.00 55.88  ? 231  ASP B CA    1 
ATOM   1817 C  C     . ASP A 1 231 ? 44.278  -28.912 -11.798 1.00 55.55  ? 231  ASP B C     1 
ATOM   1818 O  O     . ASP A 1 231 ? 45.333  -28.340 -12.078 1.00 56.63  ? 231  ASP B O     1 
ATOM   1819 C  CB    . ASP A 1 231 ? 45.035  -28.963 -9.407  1.00 57.88  ? 231  ASP B CB    1 
ATOM   1820 C  CG    . ASP A 1 231 ? 45.348  -27.517 -9.052  1.00 60.06  ? 231  ASP B CG    1 
ATOM   1821 O  OD1   . ASP A 1 231 ? 44.980  -26.629 -9.848  1.00 62.60  ? 231  ASP B OD1   1 
ATOM   1822 O  OD2   . ASP A 1 231 ? 45.958  -27.264 -7.992  1.00 61.49  ? 231  ASP B OD2   1 
ATOM   1823 N  N     . GLU A 1 232 ? 43.461  -29.425 -12.714 1.00 55.06  ? 232  GLU B N     1 
ATOM   1824 C  CA    . GLU A 1 232 ? 43.735  -29.352 -14.146 1.00 55.51  ? 232  GLU B CA    1 
ATOM   1825 C  C     . GLU A 1 232 ? 42.629  -28.639 -14.899 1.00 56.76  ? 232  GLU B C     1 
ATOM   1826 O  O     . GLU A 1 232 ? 42.361  -28.946 -16.061 1.00 54.56  ? 232  GLU B O     1 
ATOM   1827 C  CB    . GLU A 1 232 ? 43.881  -30.747 -14.730 1.00 52.95  ? 232  GLU B CB    1 
ATOM   1828 C  CG    . GLU A 1 232 ? 45.176  -31.427 -14.407 1.00 52.15  ? 232  GLU B CG    1 
ATOM   1829 C  CD    . GLU A 1 232 ? 45.220  -32.812 -14.984 1.00 52.39  ? 232  GLU B CD    1 
ATOM   1830 O  OE1   . GLU A 1 232 ? 44.564  -33.031 -16.021 1.00 51.96  ? 232  GLU B OE1   1 
ATOM   1831 O  OE2   . GLU A 1 232 ? 45.912  -33.674 -14.412 1.00 52.54  ? 232  GLU B OE2   1 
ATOM   1832 N  N     . TYR A 1 233 ? 41.974  -27.698 -14.232 1.00 58.02  ? 233  TYR B N     1 
ATOM   1833 C  CA    . TYR A 1 233 ? 40.902  -26.953 -14.863 1.00 59.41  ? 233  TYR B CA    1 
ATOM   1834 C  C     . TYR A 1 233 ? 41.426  -25.632 -15.384 1.00 64.30  ? 233  TYR B C     1 
ATOM   1835 O  O     . TYR A 1 233 ? 41.950  -24.816 -14.627 1.00 67.70  ? 233  TYR B O     1 
ATOM   1836 C  CB    . TYR A 1 233 ? 39.766  -26.667 -13.880 1.00 54.51  ? 233  TYR B CB    1 
ATOM   1837 C  CG    . TYR A 1 233 ? 38.735  -25.712 -14.446 1.00 46.26  ? 233  TYR B CG    1 
ATOM   1838 C  CD1   . TYR A 1 233 ? 37.676  -26.175 -15.227 1.00 42.53  ? 233  TYR B CD1   1 
ATOM   1839 C  CD2   . TYR A 1 233 ? 38.862  -24.334 -14.263 1.00 42.17  ? 233  TYR B CD2   1 
ATOM   1840 C  CE1   . TYR A 1 233 ? 36.774  -25.290 -15.812 1.00 39.41  ? 233  TYR B CE1   1 
ATOM   1841 C  CE2   . TYR A 1 233 ? 37.972  -23.443 -14.845 1.00 39.33  ? 233  TYR B CE2   1 
ATOM   1842 C  CZ    . TYR A 1 233 ? 36.931  -23.925 -15.618 1.00 38.83  ? 233  TYR B CZ    1 
ATOM   1843 O  OH    . TYR A 1 233 ? 36.055  -23.040 -16.205 1.00 38.53  ? 233  TYR B OH    1 
ATOM   1844 N  N     . ASN A 1 234 ? 41.285  -25.435 -16.685 1.00 72.81  ? 234  ASN B N     1 
ATOM   1845 C  CA    . ASN A 1 234 ? 41.701  -24.201 -17.314 1.00 79.22  ? 234  ASN B CA    1 
ATOM   1846 C  C     . ASN A 1 234 ? 40.761  -23.917 -18.467 1.00 79.89  ? 234  ASN B C     1 
ATOM   1847 O  O     . ASN A 1 234 ? 40.807  -24.568 -19.510 1.00 79.57  ? 234  ASN B O     1 
ATOM   1848 C  CB    . ASN A 1 234 ? 43.151  -24.286 -17.806 1.00 83.40  ? 234  ASN B CB    1 
ATOM   1849 C  CG    . ASN A 1 234 ? 44.146  -23.743 -16.790 1.00 93.85  ? 234  ASN B CG    1 
ATOM   1850 O  OD1   . ASN A 1 234 ? 45.080  -24.434 -16.389 1.00 99.70  ? 234  ASN B OD1   1 
ATOM   1851 N  ND2   . ASN A 1 234 ? 43.946  -22.497 -16.373 1.00 99.03  ? 234  ASN B ND2   1 
ATOM   1852 N  N     . GLU A 1 235 ? 39.861  -22.975 -18.226 1.00 77.03  ? 235  GLU B N     1 
ATOM   1853 C  CA    . GLU A 1 235 ? 38.909  -22.527 -19.222 1.00 77.10  ? 235  GLU B CA    1 
ATOM   1854 C  C     . GLU A 1 235 ? 39.355  -21.099 -19.426 1.00 68.00  ? 235  GLU B C     1 
ATOM   1855 O  O     . GLU A 1 235 ? 39.384  -20.304 -18.486 1.00 71.90  ? 235  GLU B O     1 
ATOM   1856 C  CB    . GLU A 1 235 ? 37.479  -22.563 -18.688 1.00 83.90  ? 235  GLU B CB    1 
ATOM   1857 C  CG    . GLU A 1 235 ? 36.823  -23.932 -18.742 1.00 92.73  ? 235  GLU B CG    1 
ATOM   1858 C  CD    . GLU A 1 235 ? 36.552  -24.399 -20.152 1.00 99.98  ? 235  GLU B CD    1 
ATOM   1859 O  OE1   . GLU A 1 235 ? 35.854  -23.674 -20.892 1.00 107.00 ? 235  GLU B OE1   1 
ATOM   1860 O  OE2   . GLU A 1 235 ? 37.031  -25.492 -20.518 1.00 106.87 ? 235  GLU B OE2   1 
ATOM   1861 N  N     . PRO A 1 236 ? 39.741  -20.762 -20.655 1.00 60.49  ? 236  PRO B N     1 
ATOM   1862 C  CA    . PRO A 1 236 ? 40.202  -19.418 -20.980 1.00 55.68  ? 236  PRO B CA    1 
ATOM   1863 C  C     . PRO A 1 236 ? 39.131  -18.350 -20.863 1.00 49.59  ? 236  PRO B C     1 
ATOM   1864 O  O     . PRO A 1 236 ? 37.932  -18.618 -20.972 1.00 45.23  ? 236  PRO B O     1 
ATOM   1865 C  CB    . PRO A 1 236 ? 40.708  -19.574 -22.406 1.00 51.01  ? 236  PRO B CB    1 
ATOM   1866 C  CG    . PRO A 1 236 ? 39.747  -20.574 -22.966 1.00 52.62  ? 236  PRO B CG    1 
ATOM   1867 C  CD    . PRO A 1 236 ? 39.685  -21.603 -21.862 1.00 56.91  ? 236  PRO B CD    1 
ATOM   1868 N  N     . ILE A 1 237 ? 39.594  -17.132 -20.632 1.00 45.73  ? 237  ILE B N     1 
ATOM   1869 C  CA    . ILE A 1 237 ? 38.733  -15.976 -20.514 1.00 45.71  ? 237  ILE B CA    1 
ATOM   1870 C  C     . ILE A 1 237 ? 38.436  -15.505 -21.934 1.00 50.01  ? 237  ILE B C     1 
ATOM   1871 O  O     . ILE A 1 237 ? 39.257  -14.823 -22.544 1.00 51.03  ? 237  ILE B O     1 
ATOM   1872 C  CB    . ILE A 1 237 ? 39.464  -14.878 -19.719 1.00 38.17  ? 237  ILE B CB    1 
ATOM   1873 C  CG1   . ILE A 1 237 ? 39.281  -15.113 -18.219 1.00 31.32  ? 237  ILE B CG1   1 
ATOM   1874 C  CG2   . ILE A 1 237 ? 38.981  -13.510 -20.120 1.00 33.05  ? 237  ILE B CG2   1 
ATOM   1875 C  CD1   . ILE A 1 237 ? 40.055  -16.291 -17.686 1.00 26.96  ? 237  ILE B CD1   1 
ATOM   1876 N  N     . ARG A 1 238 ? 37.276  -15.883 -22.468 1.00 57.61  ? 238  ARG B N     1 
ATOM   1877 C  CA    . ARG A 1 238 ? 36.914  -15.493 -23.831 1.00 66.70  ? 238  ARG B CA    1 
ATOM   1878 C  C     . ARG A 1 238 ? 35.767  -14.495 -23.889 1.00 64.30  ? 238  ARG B C     1 
ATOM   1879 O  O     . ARG A 1 238 ? 34.837  -14.553 -23.082 1.00 67.01  ? 238  ARG B O     1 
ATOM   1880 C  CB    . ARG A 1 238 ? 36.535  -16.722 -24.663 1.00 73.12  ? 238  ARG B CB    1 
ATOM   1881 C  CG    . ARG A 1 238 ? 35.284  -17.441 -24.187 1.00 95.26  ? 238  ARG B CG    1 
ATOM   1882 C  CD    . ARG A 1 238 ? 34.766  -18.413 -25.240 1.00 114.07 ? 238  ARG B CD    1 
ATOM   1883 N  NE    . ARG A 1 238 ? 35.837  -19.209 -25.833 1.00 127.84 ? 238  ARG B NE    1 
ATOM   1884 C  CZ    . ARG A 1 238 ? 36.311  -19.030 -27.063 1.00 133.33 ? 238  ARG B CZ    1 
ATOM   1885 N  NH1   . ARG A 1 238 ? 37.290  -19.800 -27.518 1.00 135.67 ? 238  ARG B NH1   1 
ATOM   1886 N  NH2   . ARG A 1 238 ? 35.798  -18.089 -27.845 1.00 135.83 ? 238  ARG B NH2   1 
ATOM   1887 N  N     . THR A 1 239 ? 35.836  -13.588 -24.861 1.00 64.74  ? 239  THR B N     1 
ATOM   1888 C  CA    . THR A 1 239 ? 34.805  -12.573 -25.050 1.00 67.74  ? 239  THR B CA    1 
ATOM   1889 C  C     . THR A 1 239 ? 33.502  -13.331 -25.264 1.00 67.76  ? 239  THR B C     1 
ATOM   1890 O  O     . THR A 1 239 ? 33.467  -14.292 -26.033 1.00 64.84  ? 239  THR B O     1 
ATOM   1891 C  CB    . THR A 1 239 ? 35.084  -11.710 -26.304 1.00 62.10  ? 239  THR B CB    1 
ATOM   1892 O  OG1   . THR A 1 239 ? 36.484  -11.420 -26.391 1.00 60.30  ? 239  THR B OG1   1 
ATOM   1893 C  CG2   . THR A 1 239 ? 34.321  -10.397 -26.225 1.00 59.93  ? 239  THR B CG2   1 
ATOM   1894 N  N     . ARG A 1 240 ? 32.433  -12.918 -24.588 1.00 71.14  ? 240  ARG B N     1 
ATOM   1895 C  CA    . ARG A 1 240 ? 31.162  -13.611 -24.750 1.00 77.40  ? 240  ARG B CA    1 
ATOM   1896 C  C     . ARG A 1 240 ? 30.130  -12.807 -25.525 1.00 81.25  ? 240  ARG B C     1 
ATOM   1897 O  O     . ARG A 1 240 ? 29.732  -11.715 -25.120 1.00 85.76  ? 240  ARG B O     1 
ATOM   1898 C  CB    . ARG A 1 240 ? 30.574  -14.012 -23.395 1.00 76.82  ? 240  ARG B CB    1 
ATOM   1899 C  CG    . ARG A 1 240 ? 29.473  -15.048 -23.552 1.00 77.95  ? 240  ARG B CG    1 
ATOM   1900 C  CD    . ARG A 1 240 ? 28.816  -15.448 -22.246 1.00 80.63  ? 240  ARG B CD    1 
ATOM   1901 N  NE    . ARG A 1 240 ? 29.708  -16.157 -21.333 1.00 83.36  ? 240  ARG B NE    1 
ATOM   1902 C  CZ    . ARG A 1 240 ? 29.308  -16.694 -20.185 1.00 84.86  ? 240  ARG B CZ    1 
ATOM   1903 N  NH1   . ARG A 1 240 ? 28.035  -16.603 -19.822 1.00 85.31  ? 240  ARG B NH1   1 
ATOM   1904 N  NH2   . ARG A 1 240 ? 30.175  -17.310 -19.392 1.00 85.72  ? 240  ARG B NH2   1 
ATOM   1905 N  N     . VAL A 1 241 ? 29.695  -13.377 -26.642 1.00 87.87  ? 241  VAL B N     1 
ATOM   1906 C  CA    . VAL A 1 241 ? 28.709  -12.757 -27.513 1.00 93.39  ? 241  VAL B CA    1 
ATOM   1907 C  C     . VAL A 1 241 ? 27.333  -13.335 -27.191 1.00 89.98  ? 241  VAL B C     1 
ATOM   1908 O  O     . VAL A 1 241 ? 27.104  -14.528 -27.376 1.00 89.58  ? 241  VAL B O     1 
ATOM   1909 C  CB    . VAL A 1 241 ? 29.053  -13.046 -28.994 1.00 96.51  ? 241  VAL B CB    1 
ATOM   1910 C  CG1   . VAL A 1 241 ? 28.064  -12.353 -29.916 1.00 109.30 ? 241  VAL B CG1   1 
ATOM   1911 C  CG2   . VAL A 1 241 ? 30.479  -12.596 -29.289 1.00 109.18 ? 241  VAL B CG2   1 
ATOM   1912 N  N     . ARG A 1 242 ? 26.423  -12.496 -26.703 1.00 83.45  ? 242  ARG B N     1 
ATOM   1913 C  CA    . ARG A 1 242 ? 25.080  -12.955 -26.362 1.00 78.36  ? 242  ARG B CA    1 
ATOM   1914 C  C     . ARG A 1 242 ? 24.528  -13.871 -27.450 1.00 72.76  ? 242  ARG B C     1 
ATOM   1915 O  O     . ARG A 1 242 ? 24.574  -13.540 -28.634 1.00 73.21  ? 242  ARG B O     1 
ATOM   1916 C  CB    . ARG A 1 242 ? 24.143  -11.765 -26.155 1.00 81.67  ? 242  ARG B CB    1 
ATOM   1917 C  CG    . ARG A 1 242 ? 22.757  -12.180 -25.706 1.00 79.43  ? 242  ARG B CG    1 
ATOM   1918 C  CD    . ARG A 1 242 ? 22.044  -11.059 -24.975 1.00 80.82  ? 242  ARG B CD    1 
ATOM   1919 N  NE    . ARG A 1 242 ? 22.814  -10.551 -23.839 1.00 83.54  ? 242  ARG B NE    1 
ATOM   1920 C  CZ    . ARG A 1 242 ? 23.227  -11.288 -22.810 1.00 84.85  ? 242  ARG B CZ    1 
ATOM   1921 N  NH1   . ARG A 1 242 ? 22.952  -12.584 -22.757 1.00 85.54  ? 242  ARG B NH1   1 
ATOM   1922 N  NH2   . ARG A 1 242 ? 23.918  -10.724 -21.827 1.00 85.63  ? 242  ARG B NH2   1 
ATOM   1923 N  N     . LYS A 1 243 ? 23.992  -15.019 -27.046 1.00 67.49  ? 243  LYS B N     1 
ATOM   1924 C  CA    . LYS A 1 243 ? 23.473  -15.984 -28.008 1.00 60.12  ? 243  LYS B CA    1 
ATOM   1925 C  C     . LYS A 1 243 ? 21.952  -16.047 -28.184 1.00 55.34  ? 243  LYS B C     1 
ATOM   1926 O  O     . LYS A 1 243 ? 21.467  -16.577 -29.183 1.00 52.75  ? 243  LYS B O     1 
ATOM   1927 C  CB    . LYS A 1 243 ? 24.035  -17.375 -27.682 1.00 56.48  ? 243  LYS B CB    1 
ATOM   1928 C  CG    . LYS A 1 243 ? 25.564  -17.471 -27.827 1.00 57.21  ? 243  LYS B CG    1 
ATOM   1929 C  CD    . LYS A 1 243 ? 26.024  -18.914 -28.046 1.00 57.60  ? 243  LYS B CD    1 
ATOM   1930 C  CE    . LYS A 1 243 ? 27.491  -19.020 -28.478 1.00 56.43  ? 243  LYS B CE    1 
ATOM   1931 N  NZ    . LYS A 1 243 ? 28.465  -18.718 -27.389 1.00 55.35  ? 243  LYS B NZ    1 
ATOM   1932 N  N     . SER A 1 244 ? 21.199  -15.516 -27.225 1.00 49.98  ? 244  SER B N     1 
ATOM   1933 C  CA    . SER A 1 244 ? 19.739  -15.509 -27.324 1.00 47.60  ? 244  SER B CA    1 
ATOM   1934 C  C     . SER A 1 244 ? 19.196  -14.247 -26.662 1.00 45.82  ? 244  SER B C     1 
ATOM   1935 O  O     . SER A 1 244 ? 19.947  -13.507 -26.026 1.00 47.60  ? 244  SER B O     1 
ATOM   1936 C  CB    . SER A 1 244 ? 19.136  -16.749 -26.650 1.00 47.62  ? 244  SER B CB    1 
ATOM   1937 O  OG    . SER A 1 244 ? 19.106  -16.623 -25.239 1.00 45.56  ? 244  SER B OG    1 
ATOM   1938 N  N     . ILE A 1 245 ? 17.895  -14.010 -26.825 1.00 44.87  ? 245  ILE B N     1 
ATOM   1939 C  CA    . ILE A 1 245 ? 17.201  -12.851 -26.255 1.00 41.56  ? 245  ILE B CA    1 
ATOM   1940 C  C     . ILE A 1 245 ? 15.708  -13.086 -26.418 1.00 41.18  ? 245  ILE B C     1 
ATOM   1941 O  O     . ILE A 1 245 ? 15.247  -13.370 -27.523 1.00 39.78  ? 245  ILE B O     1 
ATOM   1942 C  CB    . ILE A 1 245 ? 17.498  -11.551 -27.013 1.00 39.25  ? 245  ILE B CB    1 
ATOM   1943 C  CG1   . ILE A 1 245 ? 18.961  -11.152 -26.867 1.00 40.57  ? 245  ILE B CG1   1 
ATOM   1944 C  CG2   . ILE A 1 245 ? 16.615  -10.441 -26.478 1.00 41.56  ? 245  ILE B CG2   1 
ATOM   1945 C  CD1   . ILE A 1 245 ? 19.323  -9.965  -27.708 1.00 42.70  ? 245  ILE B CD1   1 
ATOM   1946 N  N     . GLY A 1 246 ? 14.943  -12.949 -25.344 1.00 40.06  ? 246  GLY B N     1 
ATOM   1947 C  CA    . GLY A 1 246 ? 13.518  -13.171 -25.469 1.00 41.59  ? 246  GLY B CA    1 
ATOM   1948 C  C     . GLY A 1 246 ? 12.721  -12.477 -24.395 1.00 42.20  ? 246  GLY B C     1 
ATOM   1949 O  O     . GLY A 1 246 ? 13.274  -11.773 -23.555 1.00 42.73  ? 246  GLY B O     1 
ATOM   1950 N  N     . ARG A 1 247 ? 11.412  -12.683 -24.417 1.00 42.52  ? 247  ARG B N     1 
ATOM   1951 C  CA    . ARG A 1 247 ? 10.534  -12.069 -23.440 1.00 42.44  ? 247  ARG B CA    1 
ATOM   1952 C  C     . ARG A 1 247 ? 9.278   -12.906 -23.268 1.00 42.16  ? 247  ARG B C     1 
ATOM   1953 O  O     . ARG A 1 247 ? 8.608   -13.240 -24.243 1.00 42.91  ? 247  ARG B O     1 
ATOM   1954 C  CB    . ARG A 1 247 ? 10.158  -10.656 -23.899 1.00 43.92  ? 247  ARG B CB    1 
ATOM   1955 C  CG    . ARG A 1 247 ? 8.883   -10.112 -23.276 1.00 50.36  ? 247  ARG B CG    1 
ATOM   1956 C  CD    . ARG A 1 247 ? 9.134   -9.199  -22.088 1.00 55.09  ? 247  ARG B CD    1 
ATOM   1957 N  NE    . ARG A 1 247 ? 7.927   -9.109  -21.275 1.00 58.87  ? 247  ARG B NE    1 
ATOM   1958 C  CZ    . ARG A 1 247 ? 7.916   -9.090  -19.947 1.00 59.96  ? 247  ARG B CZ    1 
ATOM   1959 N  NH1   . ARG A 1 247 ? 9.054   -9.142  -19.270 1.00 61.37  ? 247  ARG B NH1   1 
ATOM   1960 N  NH2   . ARG A 1 247 ? 6.763   -9.060  -19.295 1.00 60.02  ? 247  ARG B NH2   1 
ATOM   1961 N  N     . ILE A 1 248 ? 8.966   -13.258 -22.029 1.00 40.72  ? 248  ILE B N     1 
ATOM   1962 C  CA    . ILE A 1 248 ? 7.762   -14.025 -21.762 1.00 38.26  ? 248  ILE B CA    1 
ATOM   1963 C  C     . ILE A 1 248 ? 6.841   -13.170 -20.922 1.00 43.60  ? 248  ILE B C     1 
ATOM   1964 O  O     . ILE A 1 248 ? 7.290   -12.503 -19.991 1.00 42.11  ? 248  ILE B O     1 
ATOM   1965 C  CB    . ILE A 1 248 ? 8.052   -15.320 -20.983 1.00 35.72  ? 248  ILE B CB    1 
ATOM   1966 C  CG1   . ILE A 1 248 ? 7.901   -16.525 -21.907 1.00 32.67  ? 248  ILE B CG1   1 
ATOM   1967 C  CG2   . ILE A 1 248 ? 7.077   -15.465 -19.817 1.00 32.63  ? 248  ILE B CG2   1 
ATOM   1968 C  CD1   . ILE A 1 248 ? 7.899   -17.843 -21.175 1.00 29.41  ? 248  ILE B CD1   1 
ATOM   1969 N  N     . VAL A 1 249 ? 5.554   -13.182 -21.245 1.00 47.59  ? 249  VAL B N     1 
ATOM   1970 C  CA    . VAL A 1 249 ? 4.607   -12.410 -20.466 1.00 51.47  ? 249  VAL B CA    1 
ATOM   1971 C  C     . VAL A 1 249 ? 3.646   -13.367 -19.772 1.00 59.40  ? 249  VAL B C     1 
ATOM   1972 O  O     . VAL A 1 249 ? 3.539   -14.535 -20.142 1.00 59.45  ? 249  VAL B O     1 
ATOM   1973 C  CB    . VAL A 1 249 ? 3.828   -11.400 -21.345 1.00 49.87  ? 249  VAL B CB    1 
ATOM   1974 C  CG1   . VAL A 1 249 ? 4.774   -10.760 -22.350 1.00 48.22  ? 249  VAL B CG1   1 
ATOM   1975 C  CG2   . VAL A 1 249 ? 2.665   -12.077 -22.035 1.00 48.53  ? 249  VAL B CG2   1 
ATOM   1976 N  N     . THR A 1 250 ? 2.959   -12.867 -18.755 1.00 66.25  ? 250  THR B N     1 
ATOM   1977 C  CA    . THR A 1 250 ? 2.027   -13.678 -17.986 1.00 74.86  ? 250  THR B CA    1 
ATOM   1978 C  C     . THR A 1 250 ? 0.589   -13.202 -18.198 1.00 77.70  ? 250  THR B C     1 
ATOM   1979 O  O     . THR A 1 250 ? 0.263   -12.039 -17.955 1.00 79.98  ? 250  THR B O     1 
ATOM   1980 C  CB    . THR A 1 250 ? 2.433   -13.648 -16.484 1.00 76.70  ? 250  THR B CB    1 
ATOM   1981 O  OG1   . THR A 1 250 ? 3.116   -14.865 -16.155 1.00 78.66  ? 250  THR B OG1   1 
ATOM   1982 C  CG2   . THR A 1 250 ? 1.227   -13.458 -15.577 1.00 79.23  ? 250  THR B CG2   1 
ATOM   1983 N  N     . MET A 1 251 ? -0.264  -14.114 -18.661 1.00 81.68  ? 251  MET B N     1 
ATOM   1984 C  CA    . MET A 1 251 ? -1.663  -13.802 -18.949 1.00 83.53  ? 251  MET B CA    1 
ATOM   1985 C  C     . MET A 1 251 ? -2.566  -13.590 -17.743 1.00 82.74  ? 251  MET B C     1 
ATOM   1986 O  O     . MET A 1 251 ? -2.435  -14.261 -16.719 1.00 83.20  ? 251  MET B O     1 
ATOM   1987 C  CB    . MET A 1 251 ? -2.256  -14.884 -19.853 1.00 85.62  ? 251  MET B CB    1 
ATOM   1988 C  CG    . MET A 1 251 ? -1.671  -14.864 -21.253 1.00 89.78  ? 251  MET B CG    1 
ATOM   1989 S  SD    . MET A 1 251 ? -2.048  -16.325 -22.229 1.00 92.74  ? 251  MET B SD    1 
ATOM   1990 C  CE    . MET A 1 251 ? -1.855  -17.603 -21.002 1.00 95.52  ? 251  MET B CE    1 
ATOM   1991 N  N     . LYS A 1 252 ? -3.497  -12.651 -17.893 1.00 82.44  ? 252  LYS B N     1 
ATOM   1992 C  CA    . LYS A 1 252 ? -4.446  -12.299 -16.843 1.00 82.33  ? 252  LYS B CA    1 
ATOM   1993 C  C     . LYS A 1 252 ? -5.281  -13.494 -16.383 1.00 79.88  ? 252  LYS B C     1 
ATOM   1994 O  O     . LYS A 1 252 ? -5.928  -13.437 -15.340 1.00 78.67  ? 252  LYS B O     1 
ATOM   1995 C  CB    . LYS A 1 252 ? -5.370  -11.171 -17.327 1.00 82.35  ? 252  LYS B CB    1 
ATOM   1996 C  CG    . LYS A 1 252 ? -6.216  -10.519 -16.225 1.00 85.22  ? 252  LYS B CG    1 
ATOM   1997 C  CD    . LYS A 1 252 ? -5.357  -9.720  -15.242 1.00 87.67  ? 252  LYS B CD    1 
ATOM   1998 C  CE    . LYS A 1 252 ? -6.111  -9.342  -13.959 1.00 88.68  ? 252  LYS B CE    1 
ATOM   1999 N  NZ    . LYS A 1 252 ? -7.232  -8.377  -14.153 1.00 88.81  ? 252  LYS B NZ    1 
ATOM   2000 N  N     . ARG A 1 253 ? -5.273  -14.570 -17.165 1.00 78.05  ? 253  ARG B N     1 
ATOM   2001 C  CA    . ARG A 1 253 ? -6.013  -15.778 -16.817 1.00 77.38  ? 253  ARG B CA    1 
ATOM   2002 C  C     . ARG A 1 253 ? -5.742  -16.872 -17.845 1.00 71.92  ? 253  ARG B C     1 
ATOM   2003 O  O     . ARG A 1 253 ? -5.632  -16.611 -19.045 1.00 73.52  ? 253  ARG B O     1 
ATOM   2004 C  CB    . ARG A 1 253 ? -7.516  -15.474 -16.696 1.00 78.66  ? 253  ARG B CB    1 
ATOM   2005 C  CG    . ARG A 1 253 ? -8.409  -15.867 -17.866 1.00 84.18  ? 253  ARG B CG    1 
ATOM   2006 C  CD    . ARG A 1 253 ? -9.503  -14.816 -18.031 1.00 91.66  ? 253  ARG B CD    1 
ATOM   2007 N  NE    . ARG A 1 253 ? -10.818 -15.349 -18.388 1.00 98.30  ? 253  ARG B NE    1 
ATOM   2008 C  CZ    . ARG A 1 253 ? -11.068 -16.125 -19.438 1.00 100.95 ? 253  ARG B CZ    1 
ATOM   2009 N  NH1   . ARG A 1 253 ? -10.090 -16.484 -20.255 1.00 102.08 ? 253  ARG B NH1   1 
ATOM   2010 N  NH2   . ARG A 1 253 ? -12.308 -16.529 -19.680 1.00 101.95 ? 253  ARG B NH2   1 
ATOM   2011 N  N     . ASN A 1 254 ? -5.617  -18.096 -17.346 1.00 69.73  ? 254  ASN B N     1 
ATOM   2012 C  CA    . ASN A 1 254 ? -5.322  -19.278 -18.149 1.00 67.71  ? 254  ASN B CA    1 
ATOM   2013 C  C     . ASN A 1 254 ? -6.225  -19.490 -19.365 1.00 63.25  ? 254  ASN B C     1 
ATOM   2014 O  O     . ASN A 1 254 ? -7.324  -18.946 -19.427 1.00 62.02  ? 254  ASN B O     1 
ATOM   2015 C  CB    . ASN A 1 254 ? -5.369  -20.508 -17.240 1.00 68.87  ? 254  ASN B CB    1 
ATOM   2016 C  CG    . ASN A 1 254 ? -4.231  -20.530 -16.232 1.00 73.75  ? 254  ASN B CG    1 
ATOM   2017 O  OD1   . ASN A 1 254 ? -3.888  -19.508 -15.634 1.00 79.14  ? 254  ASN B OD1   1 
ATOM   2018 N  ND2   . ASN A 1 254 ? -3.646  -21.703 -16.035 1.00 79.88  ? 254  ASN B ND2   1 
ATOM   2019 N  N     . SER A 1 255 ? -5.751  -20.273 -20.336 1.00 59.34  ? 255  SER B N     1 
ATOM   2020 C  CA    . SER A 1 255 ? -6.534  -20.564 -21.540 1.00 58.11  ? 255  SER B CA    1 
ATOM   2021 C  C     . SER A 1 255 ? -5.799  -21.396 -22.593 1.00 59.18  ? 255  SER B C     1 
ATOM   2022 O  O     . SER A 1 255 ? -4.584  -21.575 -22.531 1.00 58.87  ? 255  SER B O     1 
ATOM   2023 C  CB    . SER A 1 255 ? -7.014  -19.263 -22.197 1.00 56.27  ? 255  SER B CB    1 
ATOM   2024 O  OG    . SER A 1 255 ? -6.301  -18.979 -23.390 1.00 50.16  ? 255  SER B OG    1 
ATOM   2025 N  N     . ARG A 1 256 ? -6.562  -21.909 -23.555 1.00 62.56  ? 256  ARG B N     1 
ATOM   2026 C  CA    . ARG A 1 256 ? -6.019  -22.699 -24.659 1.00 65.31  ? 256  ARG B CA    1 
ATOM   2027 C  C     . ARG A 1 256 ? -6.559  -22.066 -25.946 1.00 66.81  ? 256  ARG B C     1 
ATOM   2028 O  O     . ARG A 1 256 ? -6.294  -22.532 -27.055 1.00 67.47  ? 256  ARG B O     1 
ATOM   2029 C  CB    . ARG A 1 256 ? -6.468  -24.167 -24.555 1.00 65.17  ? 256  ARG B CB    1 
ATOM   2030 C  CG    . ARG A 1 256 ? -5.817  -24.964 -23.417 1.00 68.42  ? 256  ARG B CG    1 
ATOM   2031 C  CD    . ARG A 1 256 ? -6.223  -26.437 -23.469 1.00 69.17  ? 256  ARG B CD    1 
ATOM   2032 N  NE    . ARG A 1 256 ? -5.903  -27.057 -24.756 1.00 68.72  ? 256  ARG B NE    1 
ATOM   2033 C  CZ    . ARG A 1 256 ? -4.719  -27.572 -25.072 1.00 68.45  ? 256  ARG B CZ    1 
ATOM   2034 N  NH1   . ARG A 1 256 ? -3.729  -27.554 -24.193 1.00 68.73  ? 256  ARG B NH1   1 
ATOM   2035 N  NH2   . ARG A 1 256 ? -4.522  -28.095 -26.275 1.00 67.57  ? 256  ARG B NH2   1 
ATOM   2036 N  N     . ASN A 1 257 ? -7.300  -20.976 -25.759 1.00 67.79  ? 257  ASN B N     1 
ATOM   2037 C  CA    . ASN A 1 257 ? -7.940  -20.205 -26.827 1.00 70.07  ? 257  ASN B CA    1 
ATOM   2038 C  C     . ASN A 1 257 ? -6.960  -19.328 -27.615 1.00 67.17  ? 257  ASN B C     1 
ATOM   2039 O  O     . ASN A 1 257 ? -6.618  -18.226 -27.190 1.00 66.62  ? 257  ASN B O     1 
ATOM   2040 C  CB    . ASN A 1 257 ? -9.026  -19.325 -26.205 1.00 77.09  ? 257  ASN B CB    1 
ATOM   2041 C  CG    . ASN A 1 257 ? -9.934  -18.698 -27.236 1.00 83.09  ? 257  ASN B CG    1 
ATOM   2042 O  OD1   . ASN A 1 257 ? -9.473  -18.126 -28.221 1.00 89.11  ? 257  ASN B OD1   1 
ATOM   2043 N  ND2   . ASN A 1 257 ? -11.238 -18.789 -27.006 1.00 88.82  ? 257  ASN B ND2   1 
ATOM   2044 N  N     . LEU A 1 258 ? -6.544  -19.810 -28.781 1.00 63.04  ? 258  LEU B N     1 
ATOM   2045 C  CA    . LEU A 1 258 ? -5.587  -19.105 -29.636 1.00 60.14  ? 258  LEU B CA    1 
ATOM   2046 C  C     . LEU A 1 258 ? -5.746  -17.589 -29.783 1.00 59.85  ? 258  LEU B C     1 
ATOM   2047 O  O     . LEU A 1 258 ? -4.749  -16.870 -29.856 1.00 58.49  ? 258  LEU B O     1 
ATOM   2048 C  CB    . LEU A 1 258 ? -5.576  -19.728 -31.030 1.00 54.43  ? 258  LEU B CB    1 
ATOM   2049 C  CG    . LEU A 1 258 ? -4.219  -19.567 -31.714 1.00 48.61  ? 258  LEU B CG    1 
ATOM   2050 C  CD1   . LEU A 1 258 ? -3.533  -20.916 -31.733 1.00 46.39  ? 258  LEU B CD1   1 
ATOM   2051 C  CD2   . LEU A 1 258 ? -4.381  -19.033 -33.123 1.00 45.20  ? 258  LEU B CD2   1 
ATOM   2052 N  N     . GLU A 1 259 ? -6.981  -17.103 -29.851 1.00 62.09  ? 259  GLU B N     1 
ATOM   2053 C  CA    . GLU A 1 259 ? -7.214  -15.666 -29.997 1.00 64.26  ? 259  GLU B CA    1 
ATOM   2054 C  C     . GLU A 1 259 ? -7.081  -14.936 -28.669 1.00 65.63  ? 259  GLU B C     1 
ATOM   2055 O  O     . GLU A 1 259 ? -6.921  -13.716 -28.628 1.00 67.65  ? 259  GLU B O     1 
ATOM   2056 C  CB    . GLU A 1 259 ? -8.600  -15.408 -30.587 1.00 65.36  ? 259  GLU B CB    1 
ATOM   2057 C  CG    . GLU A 1 259 ? -8.746  -15.857 -32.029 1.00 69.18  ? 259  GLU B CG    1 
ATOM   2058 C  CD    . GLU A 1 259 ? -7.881  -15.051 -32.975 1.00 70.92  ? 259  GLU B CD    1 
ATOM   2059 O  OE1   . GLU A 1 259 ? -8.067  -13.818 -33.039 1.00 72.11  ? 259  GLU B OE1   1 
ATOM   2060 O  OE2   . GLU A 1 259 ? -7.016  -15.646 -33.652 1.00 71.63  ? 259  GLU B OE2   1 
ATOM   2061 N  N     . GLU A 1 260 ? -7.159  -15.687 -27.579 1.00 66.30  ? 260  GLU B N     1 
ATOM   2062 C  CA    . GLU A 1 260 ? -7.028  -15.097 -26.259 1.00 65.50  ? 260  GLU B CA    1 
ATOM   2063 C  C     . GLU A 1 260 ? -5.548  -15.067 -25.935 1.00 63.69  ? 260  GLU B C     1 
ATOM   2064 O  O     . GLU A 1 260 ? -5.085  -14.275 -25.116 1.00 63.05  ? 260  GLU B O     1 
ATOM   2065 C  CB    . GLU A 1 260 ? -7.749  -15.946 -25.219 1.00 70.80  ? 260  GLU B CB    1 
ATOM   2066 C  CG    . GLU A 1 260 ? -8.687  -15.158 -24.341 1.00 77.30  ? 260  GLU B CG    1 
ATOM   2067 C  CD    . GLU A 1 260 ? -8.969  -15.845 -23.027 1.00 80.33  ? 260  GLU B CD    1 
ATOM   2068 O  OE1   . GLU A 1 260 ? -8.909  -17.092 -22.973 1.00 81.36  ? 260  GLU B OE1   1 
ATOM   2069 O  OE2   . GLU A 1 260 ? -9.261  -15.131 -22.048 1.00 81.62  ? 260  GLU B OE2   1 
ATOM   2070 N  N     . ILE A 1 261 ? -4.808  -15.944 -26.598 1.00 58.40  ? 261  ILE B N     1 
ATOM   2071 C  CA    . ILE A 1 261 ? -3.376  -16.050 -26.384 1.00 52.18  ? 261  ILE B CA    1 
ATOM   2072 C  C     . ILE A 1 261 ? -2.620  -15.052 -27.269 1.00 52.99  ? 261  ILE B C     1 
ATOM   2073 O  O     . ILE A 1 261 ? -1.748  -14.323 -26.796 1.00 51.59  ? 261  ILE B O     1 
ATOM   2074 C  CB    . ILE A 1 261 ? -2.899  -17.489 -26.706 1.00 49.28  ? 261  ILE B CB    1 
ATOM   2075 C  CG1   . ILE A 1 261 ? -3.820  -18.512 -26.021 1.00 43.71  ? 261  ILE B CG1   1 
ATOM   2076 C  CG2   . ILE A 1 261 ? -1.446  -17.663 -26.289 1.00 46.03  ? 261  ILE B CG2   1 
ATOM   2077 C  CD1   . ILE A 1 261 ? -3.255  -19.169 -24.774 1.00 37.95  ? 261  ILE B CD1   1 
ATOM   2078 N  N     . LYS A 1 262 ? -2.990  -15.014 -28.546 1.00 51.58  ? 262  LYS B N     1 
ATOM   2079 C  CA    . LYS A 1 262 ? -2.362  -14.157 -29.555 1.00 50.36  ? 262  LYS B CA    1 
ATOM   2080 C  C     . LYS A 1 262 ? -1.903  -12.745 -29.173 1.00 50.31  ? 262  LYS B C     1 
ATOM   2081 O  O     . LYS A 1 262 ? -0.780  -12.351 -29.490 1.00 49.61  ? 262  LYS B O     1 
ATOM   2082 C  CB    . LYS A 1 262 ? -3.271  -14.055 -30.781 1.00 50.76  ? 262  LYS B CB    1 
ATOM   2083 C  CG    . LYS A 1 262 ? -2.702  -14.674 -32.048 1.00 51.30  ? 262  LYS B CG    1 
ATOM   2084 C  CD    . LYS A 1 262 ? -3.594  -14.321 -33.218 1.00 51.62  ? 262  LYS B CD    1 
ATOM   2085 C  CE    . LYS A 1 262 ? -3.475  -15.316 -34.350 1.00 51.52  ? 262  LYS B CE    1 
ATOM   2086 N  NZ    . LYS A 1 262 ? -4.717  -15.268 -35.169 1.00 51.00  ? 262  LYS B NZ    1 
ATOM   2087 N  N     . PRO A 1 263 ? -2.768  -11.957 -28.516 1.00 50.35  ? 263  PRO B N     1 
ATOM   2088 C  CA    . PRO A 1 263 ? -2.409  -10.590 -28.119 1.00 50.42  ? 263  PRO B CA    1 
ATOM   2089 C  C     . PRO A 1 263 ? -1.163  -10.482 -27.245 1.00 50.50  ? 263  PRO B C     1 
ATOM   2090 O  O     . PRO A 1 263 ? -0.345  -9.578  -27.427 1.00 49.05  ? 263  PRO B O     1 
ATOM   2091 C  CB    . PRO A 1 263 ? -3.661  -10.104 -27.395 1.00 49.27  ? 263  PRO B CB    1 
ATOM   2092 C  CG    . PRO A 1 263 ? -4.750  -10.828 -28.115 1.00 50.13  ? 263  PRO B CG    1 
ATOM   2093 C  CD    . PRO A 1 263 ? -4.186  -12.223 -28.222 1.00 50.03  ? 263  PRO B CD    1 
ATOM   2094 N  N     . TYR A 1 264 ? -1.032  -11.399 -26.290 1.00 49.48  ? 264  TYR B N     1 
ATOM   2095 C  CA    . TYR A 1 264 ? 0.111   -11.418 -25.380 1.00 51.89  ? 264  TYR B CA    1 
ATOM   2096 C  C     . TYR A 1 264 ? 1.369   -11.844 -26.121 1.00 49.54  ? 264  TYR B C     1 
ATOM   2097 O  O     . TYR A 1 264 ? 2.438   -11.267 -25.934 1.00 49.91  ? 264  TYR B O     1 
ATOM   2098 C  CB    . TYR A 1 264 ? -0.142  -12.391 -24.227 1.00 57.43  ? 264  TYR B CB    1 
ATOM   2099 C  CG    . TYR A 1 264 ? -1.247  -11.978 -23.282 1.00 63.36  ? 264  TYR B CG    1 
ATOM   2100 C  CD1   . TYR A 1 264 ? -0.968  -11.282 -22.105 1.00 66.43  ? 264  TYR B CD1   1 
ATOM   2101 C  CD2   . TYR A 1 264 ? -2.575  -12.297 -23.559 1.00 66.57  ? 264  TYR B CD2   1 
ATOM   2102 C  CE1   . TYR A 1 264 ? -1.990  -10.916 -21.224 1.00 70.37  ? 264  TYR B CE1   1 
ATOM   2103 C  CE2   . TYR A 1 264 ? -3.600  -11.937 -22.688 1.00 70.08  ? 264  TYR B CE2   1 
ATOM   2104 C  CZ    . TYR A 1 264 ? -3.304  -11.249 -21.524 1.00 70.98  ? 264  TYR B CZ    1 
ATOM   2105 O  OH    . TYR A 1 264 ? -4.325  -10.907 -20.666 1.00 71.91  ? 264  TYR B OH    1 
ATOM   2106 N  N     . LEU A 1 265 ? 1.235   -12.869 -26.954 1.00 47.39  ? 265  LEU B N     1 
ATOM   2107 C  CA    . LEU A 1 265 ? 2.356   -13.374 -27.730 1.00 44.82  ? 265  LEU B CA    1 
ATOM   2108 C  C     . LEU A 1 265 ? 2.890   -12.277 -28.638 1.00 44.67  ? 265  LEU B C     1 
ATOM   2109 O  O     . LEU A 1 265 ? 4.096   -12.040 -28.702 1.00 44.52  ? 265  LEU B O     1 
ATOM   2110 C  CB    . LEU A 1 265 ? 1.916   -14.562 -28.580 1.00 42.97  ? 265  LEU B CB    1 
ATOM   2111 C  CG    . LEU A 1 265 ? 3.010   -15.116 -29.490 1.00 41.17  ? 265  LEU B CG    1 
ATOM   2112 C  CD1   . LEU A 1 265 ? 3.669   -16.305 -28.813 1.00 39.93  ? 265  LEU B CD1   1 
ATOM   2113 C  CD2   . LEU A 1 265 ? 2.415   -15.521 -30.828 1.00 39.66  ? 265  LEU B CD2   1 
ATOM   2114 N  N     . PHE A 1 266 ? 1.990   -11.614 -29.354 1.00 45.98  ? 266  PHE B N     1 
ATOM   2115 C  CA    . PHE A 1 266 ? 2.410   -10.542 -30.243 1.00 46.16  ? 266  PHE B CA    1 
ATOM   2116 C  C     . PHE A 1 266 ? 3.019   -9.421  -29.414 1.00 47.58  ? 266  PHE B C     1 
ATOM   2117 O  O     . PHE A 1 266 ? 3.905   -8.710  -29.878 1.00 47.85  ? 266  PHE B O     1 
ATOM   2118 C  CB    . PHE A 1 266 ? 1.232   -10.006 -31.070 1.00 45.56  ? 266  PHE B CB    1 
ATOM   2119 C  CG    . PHE A 1 266 ? 0.727   -10.967 -32.114 1.00 47.27  ? 266  PHE B CG    1 
ATOM   2120 C  CD1   . PHE A 1 266 ? 1.564   -11.941 -32.653 1.00 47.07  ? 266  PHE B CD1   1 
ATOM   2121 C  CD2   . PHE A 1 266 ? -0.582  -10.886 -32.572 1.00 47.08  ? 266  PHE B CD2   1 
ATOM   2122 C  CE1   . PHE A 1 266 ? 1.101   -12.819 -33.629 1.00 45.34  ? 266  PHE B CE1   1 
ATOM   2123 C  CE2   . PHE A 1 266 ? -1.055  -11.759 -33.548 1.00 44.87  ? 266  PHE B CE2   1 
ATOM   2124 C  CZ    . PHE A 1 266 ? -0.212  -12.727 -34.078 1.00 44.53  ? 266  PHE B CZ    1 
ATOM   2125 N  N     . ARG A 1 267 ? 2.548   -9.279  -28.178 1.00 46.03  ? 267  ARG B N     1 
ATOM   2126 C  CA    . ARG A 1 267 ? 3.046   -8.246  -27.277 1.00 46.14  ? 267  ARG B CA    1 
ATOM   2127 C  C     . ARG A 1 267 ? 4.465   -8.596  -26.838 1.00 43.49  ? 267  ARG B C     1 
ATOM   2128 O  O     . ARG A 1 267 ? 5.297   -7.715  -26.632 1.00 42.61  ? 267  ARG B O     1 
ATOM   2129 C  CB    . ARG A 1 267 ? 2.125   -8.129  -26.053 1.00 50.90  ? 267  ARG B CB    1 
ATOM   2130 C  CG    . ARG A 1 267 ? 2.152   -6.777  -25.332 1.00 54.79  ? 267  ARG B CG    1 
ATOM   2131 C  CD    . ARG A 1 267 ? 1.134   -6.730  -24.176 1.00 59.39  ? 267  ARG B CD    1 
ATOM   2132 N  NE    . ARG A 1 267 ? -0.264  -6.776  -24.614 1.00 63.24  ? 267  ARG B NE    1 
ATOM   2133 C  CZ    . ARG A 1 267 ? -1.185  -7.594  -24.107 1.00 64.72  ? 267  ARG B CZ    1 
ATOM   2134 N  NH1   . ARG A 1 267 ? -0.864  -8.447  -23.145 1.00 65.58  ? 267  ARG B NH1   1 
ATOM   2135 N  NH2   . ARG A 1 267 ? -2.435  -7.554  -24.554 1.00 65.11  ? 267  ARG B NH2   1 
ATOM   2136 N  N     . ALA A 1 268 ? 4.747   -9.884  -26.695 1.00 39.66  ? 268  ALA B N     1 
ATOM   2137 C  CA    . ALA A 1 268 ? 6.081   -10.286 -26.283 1.00 36.27  ? 268  ALA B CA    1 
ATOM   2138 C  C     . ALA A 1 268 ? 7.047   -10.140 -27.450 1.00 36.30  ? 268  ALA B C     1 
ATOM   2139 O  O     . ALA A 1 268 ? 8.176   -9.689  -27.270 1.00 34.91  ? 268  ALA B O     1 
ATOM   2140 C  CB    . ALA A 1 268 ? 6.071   -11.714 -25.771 1.00 35.61  ? 268  ALA B CB    1 
ATOM   2141 N  N     . ILE A 1 269 ? 6.600   -10.508 -28.650 1.00 38.02  ? 269  ILE B N     1 
ATOM   2142 C  CA    . ILE A 1 269 ? 7.455   -10.388 -29.824 1.00 36.77  ? 269  ILE B CA    1 
ATOM   2143 C  C     . ILE A 1 269 ? 7.931   -8.949  -29.936 1.00 41.76  ? 269  ILE B C     1 
ATOM   2144 O  O     . ILE A 1 269 ? 9.131   -8.690  -30.023 1.00 40.02  ? 269  ILE B O     1 
ATOM   2145 C  CB    . ILE A 1 269 ? 6.724   -10.772 -31.128 1.00 34.90  ? 269  ILE B CB    1 
ATOM   2146 C  CG1   . ILE A 1 269 ? 6.531   -12.285 -31.191 1.00 35.87  ? 269  ILE B CG1   1 
ATOM   2147 C  CG2   . ILE A 1 269 ? 7.539   -10.318 -32.327 1.00 37.96  ? 269  ILE B CG2   1 
ATOM   2148 C  CD1   . ILE A 1 269 ? 5.871   -12.762 -32.470 1.00 31.16  ? 269  ILE B CD1   1 
ATOM   2149 N  N     . GLU A 1 270 ? 6.989   -8.013  -29.932 1.00 43.29  ? 270  GLU B N     1 
ATOM   2150 C  CA    . GLU A 1 270 ? 7.326   -6.599  -30.014 1.00 47.89  ? 270  GLU B CA    1 
ATOM   2151 C  C     . GLU A 1 270 ? 8.454   -6.243  -29.053 1.00 50.47  ? 270  GLU B C     1 
ATOM   2152 O  O     . GLU A 1 270 ? 9.504   -5.754  -29.466 1.00 53.64  ? 270  GLU B O     1 
ATOM   2153 C  CB    . GLU A 1 270 ? 6.101   -5.741  -29.688 1.00 50.76  ? 270  GLU B CB    1 
ATOM   2154 C  CG    . GLU A 1 270 ? 5.102   -5.606  -30.824 1.00 51.76  ? 270  GLU B CG    1 
ATOM   2155 C  CD    . GLU A 1 270 ? 5.752   -5.104  -32.096 1.00 53.04  ? 270  GLU B CD    1 
ATOM   2156 O  OE1   . GLU A 1 270 ? 6.624   -4.218  -32.003 1.00 54.66  ? 270  GLU B OE1   1 
ATOM   2157 O  OE2   . GLU A 1 270 ? 5.391   -5.586  -33.187 1.00 54.44  ? 270  GLU B OE2   1 
ATOM   2158 N  N     . GLU A 1 271 ? 8.233   -6.494  -27.768 1.00 53.42  ? 271  GLU B N     1 
ATOM   2159 C  CA    . GLU A 1 271 ? 9.234   -6.175  -26.758 1.00 52.70  ? 271  GLU B CA    1 
ATOM   2160 C  C     . GLU A 1 271 ? 10.540  -6.895  -27.057 1.00 50.57  ? 271  GLU B C     1 
ATOM   2161 O  O     . GLU A 1 271 ? 11.623  -6.352  -26.833 1.00 49.20  ? 271  GLU B O     1 
ATOM   2162 C  CB    . GLU A 1 271 ? 8.730   -6.554  -25.357 1.00 55.18  ? 271  GLU B CB    1 
ATOM   2163 C  CG    . GLU A 1 271 ? 7.291   -6.120  -25.092 1.00 63.85  ? 271  GLU B CG    1 
ATOM   2164 C  CD    . GLU A 1 271 ? 6.933   -6.045  -23.616 1.00 67.52  ? 271  GLU B CD    1 
ATOM   2165 O  OE1   . GLU A 1 271 ? 7.562   -6.749  -22.799 1.00 69.02  ? 271  GLU B OE1   1 
ATOM   2166 O  OE2   . GLU A 1 271 ? 6.002   -5.285  -23.274 1.00 69.30  ? 271  GLU B OE2   1 
ATOM   2167 N  N     . SER A 1 272 ? 10.435  -8.111  -27.578 1.00 46.65  ? 272  SER B N     1 
ATOM   2168 C  CA    . SER A 1 272 ? 11.614  -8.903  -27.899 1.00 44.38  ? 272  SER B CA    1 
ATOM   2169 C  C     . SER A 1 272 ? 12.478  -8.253  -28.967 1.00 44.67  ? 272  SER B C     1 
ATOM   2170 O  O     . SER A 1 272 ? 13.705  -8.316  -28.904 1.00 44.04  ? 272  SER B O     1 
ATOM   2171 C  CB    . SER A 1 272 ? 11.203  -10.293 -28.376 1.00 44.63  ? 272  SER B CB    1 
ATOM   2172 O  OG    . SER A 1 272 ? 10.498  -10.987 -27.367 1.00 37.82  ? 272  SER B OG    1 
ATOM   2173 N  N     . TYR A 1 273 ? 11.834  -7.635  -29.950 1.00 45.92  ? 273  TYR B N     1 
ATOM   2174 C  CA    . TYR A 1 273 ? 12.547  -6.993  -31.046 1.00 46.86  ? 273  TYR B CA    1 
ATOM   2175 C  C     . TYR A 1 273 ? 13.162  -5.674  -30.651 1.00 48.49  ? 273  TYR B C     1 
ATOM   2176 O  O     . TYR A 1 273 ? 14.131  -5.214  -31.255 1.00 48.47  ? 273  TYR B O     1 
ATOM   2177 C  CB    . TYR A 1 273 ? 11.609  -6.804  -32.228 1.00 44.30  ? 273  TYR B CB    1 
ATOM   2178 C  CG    . TYR A 1 273 ? 11.786  -7.881  -33.255 1.00 44.11  ? 273  TYR B CG    1 
ATOM   2179 C  CD1   . TYR A 1 273 ? 12.688  -7.721  -34.301 1.00 43.38  ? 273  TYR B CD1   1 
ATOM   2180 C  CD2   . TYR A 1 273 ? 11.090  -9.083  -33.158 1.00 44.38  ? 273  TYR B CD2   1 
ATOM   2181 C  CE1   . TYR A 1 273 ? 12.895  -8.731  -35.229 1.00 43.12  ? 273  TYR B CE1   1 
ATOM   2182 C  CE2   . TYR A 1 273 ? 11.288  -10.096 -34.076 1.00 43.71  ? 273  TYR B CE2   1 
ATOM   2183 C  CZ    . TYR A 1 273 ? 12.190  -9.916  -35.108 1.00 43.24  ? 273  TYR B CZ    1 
ATOM   2184 O  OH    . TYR A 1 273 ? 12.382  -10.928 -36.016 1.00 44.29  ? 273  TYR B OH    1 
ATOM   2185 N  N     . TYR A 1 274 ? 12.582  -5.065  -29.632 1.00 52.09  ? 274  TYR B N     1 
ATOM   2186 C  CA    . TYR A 1 274 ? 13.082  -3.812  -29.129 1.00 56.05  ? 274  TYR B CA    1 
ATOM   2187 C  C     . TYR A 1 274 ? 14.452  -4.133  -28.540 1.00 55.21  ? 274  TYR B C     1 
ATOM   2188 O  O     . TYR A 1 274 ? 15.422  -3.411  -28.755 1.00 56.36  ? 274  TYR B O     1 
ATOM   2189 C  CB    . TYR A 1 274 ? 12.126  -3.287  -28.066 1.00 61.07  ? 274  TYR B CB    1 
ATOM   2190 C  CG    . TYR A 1 274 ? 12.519  -1.960  -27.492 1.00 67.38  ? 274  TYR B CG    1 
ATOM   2191 C  CD1   . TYR A 1 274 ? 12.890  -0.903  -28.322 1.00 70.97  ? 274  TYR B CD1   1 
ATOM   2192 C  CD2   . TYR A 1 274 ? 12.494  -1.747  -26.119 1.00 71.00  ? 274  TYR B CD2   1 
ATOM   2193 C  CE1   . TYR A 1 274 ? 13.227  0.332   -27.796 1.00 75.04  ? 274  TYR B CE1   1 
ATOM   2194 C  CE2   . TYR A 1 274 ? 12.828  -0.514  -25.580 1.00 75.21  ? 274  TYR B CE2   1 
ATOM   2195 C  CZ    . TYR A 1 274 ? 13.192  0.520   -26.425 1.00 76.24  ? 274  TYR B CZ    1 
ATOM   2196 O  OH    . TYR A 1 274 ? 13.516  1.749   -25.906 1.00 78.32  ? 274  TYR B OH    1 
ATOM   2197 N  N     . LYS A 1 275 ? 14.527  -5.246  -27.820 1.00 54.47  ? 275  LYS B N     1 
ATOM   2198 C  CA    . LYS A 1 275 ? 15.777  -5.675  -27.207 1.00 54.20  ? 275  LYS B CA    1 
ATOM   2199 C  C     . LYS A 1 275 ? 16.850  -6.013  -28.243 1.00 54.26  ? 275  LYS B C     1 
ATOM   2200 O  O     . LYS A 1 275 ? 17.922  -5.407  -28.247 1.00 54.15  ? 275  LYS B O     1 
ATOM   2201 C  CB    . LYS A 1 275 ? 15.529  -6.890  -26.315 1.00 53.39  ? 275  LYS B CB    1 
ATOM   2202 C  CG    . LYS A 1 275 ? 14.532  -6.640  -25.202 1.00 53.88  ? 275  LYS B CG    1 
ATOM   2203 C  CD    . LYS A 1 275 ? 14.461  -7.844  -24.290 1.00 54.76  ? 275  LYS B CD    1 
ATOM   2204 C  CE    . LYS A 1 275 ? 13.543  -7.605  -23.109 1.00 55.34  ? 275  LYS B CE    1 
ATOM   2205 N  NZ    . LYS A 1 275 ? 13.598  -8.757  -22.172 1.00 56.11  ? 275  LYS B NZ    1 
ATOM   2206 N  N     . LEU A 1 276 ? 16.557  -6.983  -29.109 1.00 55.06  ? 276  LEU B N     1 
ATOM   2207 C  CA    . LEU A 1 276 ? 17.491  -7.411  -30.156 1.00 56.47  ? 276  LEU B CA    1 
ATOM   2208 C  C     . LEU A 1 276 ? 18.336  -6.247  -30.674 1.00 57.65  ? 276  LEU B C     1 
ATOM   2209 O  O     . LEU A 1 276 ? 19.561  -6.339  -30.732 1.00 57.18  ? 276  LEU B O     1 
ATOM   2210 C  CB    . LEU A 1 276 ? 16.730  -8.059  -31.320 1.00 54.06  ? 276  LEU B CB    1 
ATOM   2211 C  CG    . LEU A 1 276 ? 16.195  -9.483  -31.138 1.00 52.40  ? 276  LEU B CG    1 
ATOM   2212 C  CD1   . LEU A 1 276 ? 15.248  -9.820  -32.277 1.00 52.48  ? 276  LEU B CD1   1 
ATOM   2213 C  CD2   . LEU A 1 276 ? 17.350  -10.470 -31.104 1.00 52.03  ? 276  LEU B CD2   1 
ATOM   2214 N  N     . ASP A 1 277 ? 17.670  -5.161  -31.055 1.00 60.82  ? 277  ASP B N     1 
ATOM   2215 C  CA    . ASP A 1 277 ? 18.334  -3.954  -31.541 1.00 65.40  ? 277  ASP B CA    1 
ATOM   2216 C  C     . ASP A 1 277 ? 19.530  -4.192  -32.460 1.00 64.86  ? 277  ASP B C     1 
ATOM   2217 O  O     . ASP A 1 277 ? 20.667  -4.294  -31.998 1.00 67.05  ? 277  ASP B O     1 
ATOM   2218 C  CB    . ASP A 1 277 ? 18.757  -3.099  -30.338 1.00 69.29  ? 277  ASP B CB    1 
ATOM   2219 C  CG    . ASP A 1 277 ? 19.652  -1.938  -30.724 1.00 73.07  ? 277  ASP B CG    1 
ATOM   2220 O  OD1   . ASP A 1 277 ? 19.279  -1.171  -31.636 1.00 78.22  ? 277  ASP B OD1   1 
ATOM   2221 O  OD2   . ASP A 1 277 ? 20.727  -1.788  -30.105 1.00 77.54  ? 277  ASP B OD2   1 
ATOM   2222 N  N     . LYS A 1 278 ? 19.263  -4.270  -33.760 1.00 66.37  ? 278  LYS B N     1 
ATOM   2223 C  CA    . LYS A 1 278 ? 20.301  -4.479  -34.765 1.00 68.05  ? 278  LYS B CA    1 
ATOM   2224 C  C     . LYS A 1 278 ? 20.719  -5.941  -34.916 1.00 65.52  ? 278  LYS B C     1 
ATOM   2225 O  O     . LYS A 1 278 ? 21.322  -6.311  -35.922 1.00 65.57  ? 278  LYS B O     1 
ATOM   2226 C  CB    . LYS A 1 278 ? 21.523  -3.604  -34.456 1.00 68.75  ? 278  LYS B CB    1 
ATOM   2227 C  CG    . LYS A 1 278 ? 21.203  -2.114  -34.362 1.00 76.61  ? 278  LYS B CG    1 
ATOM   2228 C  CD    . LYS A 1 278 ? 20.556  -1.604  -35.642 1.00 83.44  ? 278  LYS B CD    1 
ATOM   2229 C  CE    . LYS A 1 278 ? 20.117  -0.155  -35.517 1.00 87.40  ? 278  LYS B CE    1 
ATOM   2230 N  NZ    . LYS A 1 278 ? 19.400  0.283   -36.747 1.00 89.15  ? 278  LYS B NZ    1 
ATOM   2231 N  N     . ARG A 1 279 ? 20.409  -6.772  -33.925 1.00 63.41  ? 279  ARG B N     1 
ATOM   2232 C  CA    . ARG A 1 279 ? 20.744  -8.192  -34.011 1.00 62.72  ? 279  ARG B CA    1 
ATOM   2233 C  C     . ARG A 1 279 ? 19.648  -8.883  -34.814 1.00 59.39  ? 279  ARG B C     1 
ATOM   2234 O  O     . ARG A 1 279 ? 18.464  -8.653  -34.574 1.00 60.05  ? 279  ARG B O     1 
ATOM   2235 C  CB    . ARG A 1 279 ? 20.819  -8.812  -32.618 1.00 64.28  ? 279  ARG B CB    1 
ATOM   2236 C  CG    . ARG A 1 279 ? 22.214  -9.225  -32.194 1.00 67.74  ? 279  ARG B CG    1 
ATOM   2237 C  CD    . ARG A 1 279 ? 22.225  -9.552  -30.721 1.00 72.84  ? 279  ARG B CD    1 
ATOM   2238 N  NE    . ARG A 1 279 ? 21.418  -8.581  -29.991 1.00 76.98  ? 279  ARG B NE    1 
ATOM   2239 C  CZ    . ARG A 1 279 ? 21.713  -8.115  -28.784 1.00 78.29  ? 279  ARG B CZ    1 
ATOM   2240 N  NH1   . ARG A 1 279 ? 22.806  -8.526  -28.158 1.00 78.63  ? 279  ARG B NH1   1 
ATOM   2241 N  NH2   . ARG A 1 279 ? 20.909  -7.236  -28.202 1.00 78.97  ? 279  ARG B NH2   1 
ATOM   2242 N  N     . ILE A 1 280 ? 20.036  -9.717  -35.774 1.00 57.22  ? 280  ILE B N     1 
ATOM   2243 C  CA    . ILE A 1 280 ? 19.062  -10.430 -36.596 1.00 55.40  ? 280  ILE B CA    1 
ATOM   2244 C  C     . ILE A 1 280 ? 19.101  -11.905 -36.190 1.00 53.60  ? 280  ILE B C     1 
ATOM   2245 O  O     . ILE A 1 280 ? 20.148  -12.545 -36.263 1.00 53.01  ? 280  ILE B O     1 
ATOM   2246 C  CB    . ILE A 1 280 ? 19.398  -10.332 -38.109 1.00 52.79  ? 280  ILE B CB    1 
ATOM   2247 C  CG1   . ILE A 1 280 ? 20.027  -8.973  -38.441 1.00 53.80  ? 280  ILE B CG1   1 
ATOM   2248 C  CG2   . ILE A 1 280 ? 18.130  -10.514 -38.932 1.00 52.54  ? 280  ILE B CG2   1 
ATOM   2249 C  CD1   . ILE A 1 280 ? 19.110  -7.771  -38.260 1.00 54.25  ? 280  ILE B CD1   1 
ATOM   2250 N  N     . PRO A 1 281 ? 17.964  -12.457 -35.736 1.00 50.98  ? 281  PRO B N     1 
ATOM   2251 C  CA    . PRO A 1 281 ? 17.914  -13.864 -35.326 1.00 52.72  ? 281  PRO B CA    1 
ATOM   2252 C  C     . PRO A 1 281 ? 17.382  -14.774 -36.433 1.00 53.31  ? 281  PRO B C     1 
ATOM   2253 O  O     . PRO A 1 281 ? 16.443  -14.411 -37.138 1.00 56.02  ? 281  PRO B O     1 
ATOM   2254 C  CB    . PRO A 1 281 ? 16.979  -13.821 -34.132 1.00 53.45  ? 281  PRO B CB    1 
ATOM   2255 C  CG    . PRO A 1 281 ? 15.948  -12.844 -34.605 1.00 52.32  ? 281  PRO B CG    1 
ATOM   2256 C  CD    . PRO A 1 281 ? 16.771  -11.735 -35.255 1.00 52.53  ? 281  PRO B CD    1 
ATOM   2257 N  N     . LYS A 1 282 ? 17.976  -15.956 -36.579 1.00 54.82  ? 282  LYS B N     1 
ATOM   2258 C  CA    . LYS A 1 282 ? 17.536  -16.910 -37.594 1.00 53.42  ? 282  LYS B CA    1 
ATOM   2259 C  C     . LYS A 1 282 ? 16.715  -18.021 -36.950 1.00 52.21  ? 282  LYS B C     1 
ATOM   2260 O  O     . LYS A 1 282 ? 16.265  -18.943 -37.631 1.00 51.23  ? 282  LYS B O     1 
ATOM   2261 C  CB    . LYS A 1 282 ? 18.740  -17.525 -38.318 1.00 54.15  ? 282  LYS B CB    1 
ATOM   2262 C  CG    . LYS A 1 282 ? 19.716  -16.498 -38.856 1.00 58.27  ? 282  LYS B CG    1 
ATOM   2263 C  CD    . LYS A 1 282 ? 20.951  -17.134 -39.492 1.00 59.86  ? 282  LYS B CD    1 
ATOM   2264 C  CE    . LYS A 1 282 ? 21.747  -17.973 -38.497 1.00 59.99  ? 282  LYS B CE    1 
ATOM   2265 N  NZ    . LYS A 1 282 ? 23.197  -18.036 -38.844 1.00 58.96  ? 282  LYS B NZ    1 
ATOM   2266 N  N     . ALA A 1 283 ? 16.523  -17.938 -35.637 1.00 47.85  ? 283  ALA B N     1 
ATOM   2267 C  CA    . ALA A 1 283 ? 15.752  -18.952 -34.929 1.00 45.19  ? 283  ALA B CA    1 
ATOM   2268 C  C     . ALA A 1 283 ? 14.818  -18.360 -33.880 1.00 42.93  ? 283  ALA B C     1 
ATOM   2269 O  O     . ALA A 1 283 ? 15.224  -17.538 -33.056 1.00 43.51  ? 283  ALA B O     1 
ATOM   2270 C  CB    . ALA A 1 283 ? 16.686  -19.955 -34.282 1.00 44.11  ? 283  ALA B CB    1 
ATOM   2271 N  N     . ILE A 1 284 ? 13.562  -18.791 -33.915 1.00 41.89  ? 284  ILE B N     1 
ATOM   2272 C  CA    . ILE A 1 284 ? 12.554  -18.311 -32.978 1.00 38.98  ? 284  ILE B CA    1 
ATOM   2273 C  C     . ILE A 1 284 ? 11.969  -19.499 -32.223 1.00 37.59  ? 284  ILE B C     1 
ATOM   2274 O  O     . ILE A 1 284 ? 11.795  -20.578 -32.784 1.00 36.66  ? 284  ILE B O     1 
ATOM   2275 C  CB    . ILE A 1 284 ? 11.430  -17.563 -33.733 1.00 35.35  ? 284  ILE B CB    1 
ATOM   2276 C  CG1   . ILE A 1 284 ? 10.298  -17.184 -32.772 1.00 34.23  ? 284  ILE B CG1   1 
ATOM   2277 C  CG2   . ILE A 1 284 ? 10.939  -18.421 -34.888 1.00 33.95  ? 284  ILE B CG2   1 
ATOM   2278 C  CD1   . ILE A 1 284 ? 9.164   -16.385 -33.414 1.00 33.62  ? 284  ILE B CD1   1 
ATOM   2279 N  N     . HIS A 1 285 ? 11.675  -19.295 -30.944 1.00 37.55  ? 285  HIS B N     1 
ATOM   2280 C  CA    . HIS A 1 285 ? 11.115  -20.345 -30.099 1.00 39.92  ? 285  HIS B CA    1 
ATOM   2281 C  C     . HIS A 1 285 ? 9.932   -19.813 -29.310 1.00 38.32  ? 285  HIS B C     1 
ATOM   2282 O  O     . HIS A 1 285 ? 10.053  -18.787 -28.644 1.00 40.02  ? 285  HIS B O     1 
ATOM   2283 C  CB    . HIS A 1 285 ? 12.177  -20.842 -29.119 1.00 46.65  ? 285  HIS B CB    1 
ATOM   2284 C  CG    . HIS A 1 285 ? 13.207  -21.722 -29.746 1.00 54.59  ? 285  HIS B CG    1 
ATOM   2285 N  ND1   . HIS A 1 285 ? 13.228  -23.088 -29.559 1.00 58.49  ? 285  HIS B ND1   1 
ATOM   2286 C  CD2   . HIS A 1 285 ? 14.224  -21.442 -30.595 1.00 58.77  ? 285  HIS B CD2   1 
ATOM   2287 C  CE1   . HIS A 1 285 ? 14.212  -23.611 -30.266 1.00 62.70  ? 285  HIS B CE1   1 
ATOM   2288 N  NE2   . HIS A 1 285 ? 14.832  -22.635 -30.905 1.00 63.00  ? 285  HIS B NE2   1 
ATOM   2289 N  N     . VAL A 1 286 ? 8.788   -20.491 -29.377 1.00 37.19  ? 286  VAL B N     1 
ATOM   2290 C  CA    . VAL A 1 286 ? 7.631   -20.038 -28.613 1.00 33.93  ? 286  VAL B CA    1 
ATOM   2291 C  C     . VAL A 1 286 ? 7.583   -20.803 -27.297 1.00 35.75  ? 286  VAL B C     1 
ATOM   2292 O  O     . VAL A 1 286 ? 7.638   -22.037 -27.269 1.00 32.89  ? 286  VAL B O     1 
ATOM   2293 C  CB    . VAL A 1 286 ? 6.311   -20.219 -29.390 1.00 32.08  ? 286  VAL B CB    1 
ATOM   2294 C  CG1   . VAL A 1 286 ? 5.145   -19.665 -28.573 1.00 30.60  ? 286  VAL B CG1   1 
ATOM   2295 C  CG2   . VAL A 1 286 ? 6.402   -19.487 -30.717 1.00 31.91  ? 286  VAL B CG2   1 
ATOM   2296 N  N     . VAL A 1 287 ? 7.486   -20.054 -26.205 1.00 36.44  ? 287  VAL B N     1 
ATOM   2297 C  CA    . VAL A 1 287 ? 7.488   -20.638 -24.873 1.00 39.21  ? 287  VAL B CA    1 
ATOM   2298 C  C     . VAL A 1 287 ? 6.237   -20.333 -24.062 1.00 46.29  ? 287  VAL B C     1 
ATOM   2299 O  O     . VAL A 1 287 ? 5.817   -19.183 -23.951 1.00 44.86  ? 287  VAL B O     1 
ATOM   2300 C  CB    . VAL A 1 287 ? 8.709   -20.127 -24.065 1.00 37.53  ? 287  VAL B CB    1 
ATOM   2301 C  CG1   . VAL A 1 287 ? 8.798   -20.853 -22.732 1.00 33.28  ? 287  VAL B CG1   1 
ATOM   2302 C  CG2   . VAL A 1 287 ? 9.994   -20.297 -24.878 1.00 31.86  ? 287  VAL B CG2   1 
ATOM   2303 N  N     . ALA A 1 288 ? 5.651   -21.375 -23.488 1.00 54.85  ? 288  ALA B N     1 
ATOM   2304 C  CA    . ALA A 1 288 ? 4.472   -21.216 -22.658 1.00 64.48  ? 288  ALA B CA    1 
ATOM   2305 C  C     . ALA A 1 288 ? 4.652   -22.079 -21.422 1.00 71.42  ? 288  ALA B C     1 
ATOM   2306 O  O     . ALA A 1 288 ? 5.239   -23.160 -21.483 1.00 74.82  ? 288  ALA B O     1 
ATOM   2307 C  CB    . ALA A 1 288 ? 3.221   -21.632 -23.420 1.00 62.18  ? 288  ALA B CB    1 
ATOM   2308 N  N     . VAL A 1 289 ? 4.167   -21.586 -20.293 1.00 81.13  ? 289  VAL B N     1 
ATOM   2309 C  CA    . VAL A 1 289 ? 4.274   -22.324 -19.051 1.00 93.09  ? 289  VAL B CA    1 
ATOM   2310 C  C     . VAL A 1 289 ? 2.886   -22.711 -18.577 1.00 91.27  ? 289  VAL B C     1 
ATOM   2311 O  O     . VAL A 1 289 ? 2.123   -21.882 -18.081 1.00 93.51  ? 289  VAL B O     1 
ATOM   2312 C  CB    . VAL A 1 289 ? 4.995   -21.494 -17.977 1.00 94.18  ? 289  VAL B CB    1 
ATOM   2313 C  CG1   . VAL A 1 289 ? 4.967   -22.219 -16.648 1.00 102.90 ? 289  VAL B CG1   1 
ATOM   2314 C  CG2   . VAL A 1 289 ? 6.433   -21.252 -18.410 1.00 102.85 ? 289  VAL B CG2   1 
ATOM   2315 N  N     . THR A 1 290 ? 2.568   -23.985 -18.768 1.00 92.66  ? 290  THR B N     1 
ATOM   2316 C  CA    . THR A 1 290 ? 1.285   -24.546 -18.380 1.00 97.53  ? 290  THR B CA    1 
ATOM   2317 C  C     . THR A 1 290 ? 0.924   -24.154 -16.954 1.00 94.96  ? 290  THR B C     1 
ATOM   2318 O  O     . THR A 1 290 ? 1.796   -23.837 -16.149 1.00 94.36  ? 290  THR B O     1 
ATOM   2319 C  CB    . THR A 1 290 ? 1.324   -26.075 -18.465 1.00 93.64  ? 290  THR B CB    1 
ATOM   2320 O  OG1   . THR A 1 290 ? 2.497   -26.554 -17.793 1.00 92.52  ? 290  THR B OG1   1 
ATOM   2321 C  CG2   . THR A 1 290 ? 1.351   -26.529 -19.913 1.00 92.35  ? 290  THR B CG2   1 
ATOM   2322 N  N     . GLU A 1 291 ? -0.373  -24.177 -16.664 1.00 95.06  ? 291  GLU B N     1 
ATOM   2323 C  CA    . GLU A 1 291 ? -0.916  -23.850 -15.348 1.00 95.73  ? 291  GLU B CA    1 
ATOM   2324 C  C     . GLU A 1 291 ? -0.143  -24.525 -14.217 1.00 93.28  ? 291  GLU B C     1 
ATOM   2325 O  O     . GLU A 1 291 ? -0.019  -23.977 -13.119 1.00 96.75  ? 291  GLU B O     1 
ATOM   2326 C  CB    . GLU A 1 291 ? -2.376  -24.291 -15.302 1.00 98.42  ? 291  GLU B CB    1 
ATOM   2327 C  CG    . GLU A 1 291 ? -2.577  -25.682 -15.889 1.00 106.20 ? 291  GLU B CG    1 
ATOM   2328 C  CD    . GLU A 1 291 ? -4.033  -26.050 -16.077 1.00 111.36 ? 291  GLU B CD    1 
ATOM   2329 O  OE1   . GLU A 1 291 ? -4.299  -27.143 -16.620 1.00 116.02 ? 291  GLU B OE1   1 
ATOM   2330 O  OE2   . GLU A 1 291 ? -4.909  -25.253 -15.685 1.00 115.72 ? 291  GLU B OE2   1 
ATOM   2331 N  N     . ASP A 1 292 ? 0.358   -25.726 -14.494 1.00 92.89  ? 292  ASP B N     1 
ATOM   2332 C  CA    . ASP A 1 292 ? 1.120   -26.494 -13.517 1.00 89.02  ? 292  ASP B CA    1 
ATOM   2333 C  C     . ASP A 1 292 ? 2.588   -26.077 -13.511 1.00 89.24  ? 292  ASP B C     1 
ATOM   2334 O  O     . ASP A 1 292 ? 3.406   -26.641 -12.784 1.00 86.47  ? 292  ASP B O     1 
ATOM   2335 C  CB    . ASP A 1 292 ? 0.970   -27.998 -13.792 1.00 86.25  ? 292  ASP B CB    1 
ATOM   2336 C  CG    . ASP A 1 292 ? 1.259   -28.366 -15.236 1.00 88.18  ? 292  ASP B CG    1 
ATOM   2337 O  OD1   . ASP A 1 292 ? 0.754   -27.674 -16.144 1.00 86.27  ? 292  ASP B OD1   1 
ATOM   2338 O  OD2   . ASP A 1 292 ? 1.981   -29.360 -15.463 1.00 85.78  ? 292  ASP B OD2   1 
ATOM   2339 N  N     . LEU A 1 293 ? 2.909   -25.086 -14.337 1.00 85.12  ? 293  LEU B N     1 
ATOM   2340 C  CA    . LEU A 1 293 ? 4.249   -24.513 -14.418 1.00 83.71  ? 293  LEU B CA    1 
ATOM   2341 C  C     . LEU A 1 293 ? 5.363   -25.283 -15.132 1.00 83.53  ? 293  LEU B C     1 
ATOM   2342 O  O     . LEU A 1 293 ? 6.525   -24.885 -15.048 1.00 84.14  ? 293  LEU B O     1 
ATOM   2343 C  CB    . LEU A 1 293 ? 4.708   -24.143 -13.007 1.00 84.81  ? 293  LEU B CB    1 
ATOM   2344 C  CG    . LEU A 1 293 ? 3.592   -23.490 -12.183 1.00 79.04  ? 293  LEU B CG    1 
ATOM   2345 C  CD1   . LEU A 1 293 ? 3.635   -24.028 -10.774 1.00 76.31  ? 293  LEU B CD1   1 
ATOM   2346 C  CD2   . LEU A 1 293 ? 3.718   -21.980 -12.200 1.00 75.14  ? 293  LEU B CD2   1 
ATOM   2347 N  N     . ASP A 1 294 ? 5.041   -26.375 -15.822 1.00 83.95  ? 294  ASP B N     1 
ATOM   2348 C  CA    . ASP A 1 294 ? 6.085   -27.100 -16.550 1.00 83.78  ? 294  ASP B CA    1 
ATOM   2349 C  C     . ASP A 1 294 ? 6.366   -26.194 -17.754 1.00 83.64  ? 294  ASP B C     1 
ATOM   2350 O  O     . ASP A 1 294 ? 5.567   -25.304 -18.051 1.00 82.41  ? 294  ASP B O     1 
ATOM   2351 C  CB    . ASP A 1 294 ? 5.589   -28.485 -16.999 1.00 78.79  ? 294  ASP B CB    1 
ATOM   2352 C  CG    . ASP A 1 294 ? 6.732   -29.477 -17.228 1.00 78.42  ? 294  ASP B CG    1 
ATOM   2353 O  OD1   . ASP A 1 294 ? 7.547   -29.678 -16.301 1.00 77.76  ? 294  ASP B OD1   1 
ATOM   2354 O  OD2   . ASP A 1 294 ? 6.813   -30.064 -18.329 1.00 77.39  ? 294  ASP B OD2   1 
ATOM   2355 N  N     . ILE A 1 295 ? 7.484   -26.396 -18.444 1.00 83.29  ? 295  ILE B N     1 
ATOM   2356 C  CA    . ILE A 1 295 ? 7.811   -25.530 -19.576 1.00 84.58  ? 295  ILE B CA    1 
ATOM   2357 C  C     . ILE A 1 295 ? 7.805   -26.183 -20.954 1.00 82.51  ? 295  ILE B C     1 
ATOM   2358 O  O     . ILE A 1 295 ? 8.686   -26.975 -21.290 1.00 86.05  ? 295  ILE B O     1 
ATOM   2359 C  CB    . ILE A 1 295 ? 9.178   -24.850 -19.364 1.00 91.29  ? 295  ILE B CB    1 
ATOM   2360 C  CG1   . ILE A 1 295 ? 9.150   -24.024 -18.077 1.00 92.66  ? 295  ILE B CG1   1 
ATOM   2361 C  CG2   . ILE A 1 295 ? 9.501   -23.948 -20.548 1.00 91.07  ? 295  ILE B CG2   1 
ATOM   2362 C  CD1   . ILE A 1 295 ? 10.491  -23.438 -17.701 1.00 96.90  ? 295  ILE B CD1   1 
ATOM   2363 N  N     . VAL A 1 296 ? 6.805   -25.820 -21.751 1.00 80.75  ? 296  VAL B N     1 
ATOM   2364 C  CA    . VAL A 1 296 ? 6.658   -26.344 -23.100 1.00 69.01  ? 296  VAL B CA    1 
ATOM   2365 C  C     . VAL A 1 296 ? 7.150   -25.299 -24.090 1.00 70.78  ? 296  VAL B C     1 
ATOM   2366 O  O     . VAL A 1 296 ? 6.858   -24.113 -23.940 1.00 63.74  ? 296  VAL B O     1 
ATOM   2367 C  CB    . VAL A 1 296 ? 5.187   -26.635 -23.429 1.00 70.22  ? 296  VAL B CB    1 
ATOM   2368 C  CG1   . VAL A 1 296 ? 5.100   -27.525 -24.651 1.00 71.92  ? 296  VAL B CG1   1 
ATOM   2369 C  CG2   . VAL A 1 296 ? 4.499   -27.268 -22.237 1.00 71.69  ? 296  VAL B CG2   1 
ATOM   2370 N  N     . SER A 1 297 ? 7.888   -25.731 -25.105 1.00 64.98  ? 297  SER B N     1 
ATOM   2371 C  CA    . SER A 1 297 ? 8.393   -24.792 -26.100 1.00 64.33  ? 297  SER B CA    1 
ATOM   2372 C  C     . SER A 1 297 ? 8.618   -25.472 -27.442 1.00 64.08  ? 297  SER B C     1 
ATOM   2373 O  O     . SER A 1 297 ? 9.206   -26.549 -27.508 1.00 64.82  ? 297  SER B O     1 
ATOM   2374 C  CB    . SER A 1 297 ? 9.719   -24.192 -25.642 1.00 66.17  ? 297  SER B CB    1 
ATOM   2375 O  OG    . SER A 1 297 ? 10.787  -25.075 -25.946 1.00 60.58  ? 297  SER B OG    1 
ATOM   2376 N  N     . ARG A 1 298 ? 8.154   -24.826 -28.509 1.00 64.55  ? 298  ARG B N     1 
ATOM   2377 C  CA    . ARG A 1 298 ? 8.315   -25.337 -29.868 1.00 62.67  ? 298  ARG B CA    1 
ATOM   2378 C  C     . ARG A 1 298 ? 9.111   -24.312 -30.688 1.00 57.78  ? 298  ARG B C     1 
ATOM   2379 O  O     . ARG A 1 298 ? 8.888   -23.107 -30.562 1.00 59.21  ? 298  ARG B O     1 
ATOM   2380 C  CB    . ARG A 1 298 ? 6.939   -25.586 -30.505 1.00 63.58  ? 298  ARG B CB    1 
ATOM   2381 C  CG    . ARG A 1 298 ? 6.138   -26.704 -29.839 1.00 70.21  ? 298  ARG B CG    1 
ATOM   2382 C  CD    . ARG A 1 298 ? 6.811   -28.056 -30.044 1.00 77.74  ? 298  ARG B CD    1 
ATOM   2383 N  NE    . ARG A 1 298 ? 6.224   -29.119 -29.231 1.00 83.21  ? 298  ARG B NE    1 
ATOM   2384 C  CZ    . ARG A 1 298 ? 6.127   -29.080 -27.905 1.00 85.40  ? 298  ARG B CZ    1 
ATOM   2385 N  NH1   . ARG A 1 298 ? 6.574   -28.025 -27.237 1.00 86.81  ? 298  ARG B NH1   1 
ATOM   2386 N  NH2   . ARG A 1 298 ? 5.596   -30.100 -27.243 1.00 86.02  ? 298  ARG B NH2   1 
ATOM   2387 N  N     . GLY A 1 299 ? 10.038  -24.782 -31.520 1.00 57.24  ? 299  GLY B N     1 
ATOM   2388 C  CA    . GLY A 1 299 ? 10.842  -23.859 -32.305 1.00 56.13  ? 299  GLY B CA    1 
ATOM   2389 C  C     . GLY A 1 299 ? 11.085  -24.199 -33.762 1.00 56.54  ? 299  GLY B C     1 
ATOM   2390 O  O     . GLY A 1 299 ? 10.739  -25.277 -34.240 1.00 55.54  ? 299  GLY B O     1 
ATOM   2391 N  N     . ARG A 1 300 ? 11.692  -23.257 -34.472 1.00 55.23  ? 300  ARG B N     1 
ATOM   2392 C  CA    . ARG A 1 300 ? 12.001  -23.415 -35.885 1.00 57.53  ? 300  ARG B CA    1 
ATOM   2393 C  C     . ARG A 1 300 ? 13.196  -22.528 -36.172 1.00 54.70  ? 300  ARG B C     1 
ATOM   2394 O  O     . ARG A 1 300 ? 13.299  -21.428 -35.634 1.00 55.37  ? 300  ARG B O     1 
ATOM   2395 C  CB    . ARG A 1 300 ? 10.804  -22.978 -36.741 1.00 62.94  ? 300  ARG B CB    1 
ATOM   2396 C  CG    . ARG A 1 300 ? 11.139  -22.478 -38.155 1.00 73.37  ? 300  ARG B CG    1 
ATOM   2397 C  CD    . ARG A 1 300 ? 10.855  -23.512 -39.247 1.00 83.68  ? 300  ARG B CD    1 
ATOM   2398 N  NE    . ARG A 1 300 ? 10.596  -22.879 -40.542 1.00 91.62  ? 300  ARG B NE    1 
ATOM   2399 C  CZ    . ARG A 1 300 ? 9.436   -22.948 -41.192 1.00 95.05  ? 300  ARG B CZ    1 
ATOM   2400 N  NH1   . ARG A 1 300 ? 8.423   -23.628 -40.673 1.00 96.80  ? 300  ARG B NH1   1 
ATOM   2401 N  NH2   . ARG A 1 300 ? 9.282   -22.328 -42.355 1.00 96.44  ? 300  ARG B NH2   1 
ATOM   2402 N  N     . THR A 1 301 ? 14.104  -23.016 -37.007 1.00 51.98  ? 301  THR B N     1 
ATOM   2403 C  CA    . THR A 1 301 ? 15.288  -22.254 -37.371 1.00 48.02  ? 301  THR B CA    1 
ATOM   2404 C  C     . THR A 1 301 ? 15.167  -21.943 -38.858 1.00 49.68  ? 301  THR B C     1 
ATOM   2405 O  O     . THR A 1 301 ? 14.778  -22.805 -39.647 1.00 48.51  ? 301  THR B O     1 
ATOM   2406 C  CB    . THR A 1 301 ? 16.587  -23.067 -37.112 1.00 44.39  ? 301  THR B CB    1 
ATOM   2407 O  OG1   . THR A 1 301 ? 16.646  -23.442 -35.728 1.00 40.64  ? 301  THR B OG1   1 
ATOM   2408 C  CG2   . THR A 1 301 ? 17.830  -22.241 -37.469 1.00 38.59  ? 301  THR B CG2   1 
ATOM   2409 N  N     . PHE A 1 302 ? 15.473  -20.705 -39.232 1.00 50.69  ? 302  PHE B N     1 
ATOM   2410 C  CA    . PHE A 1 302 ? 15.405  -20.293 -40.629 1.00 53.95  ? 302  PHE B CA    1 
ATOM   2411 C  C     . PHE A 1 302 ? 16.807  -20.217 -41.206 1.00 59.01  ? 302  PHE B C     1 
ATOM   2412 O  O     . PHE A 1 302 ? 17.792  -20.239 -40.470 1.00 57.50  ? 302  PHE B O     1 
ATOM   2413 C  CB    . PHE A 1 302 ? 14.754  -18.912 -40.768 1.00 54.33  ? 302  PHE B CB    1 
ATOM   2414 C  CG    . PHE A 1 302 ? 13.275  -18.904 -40.522 1.00 55.81  ? 302  PHE B CG    1 
ATOM   2415 C  CD1   . PHE A 1 302 ? 12.768  -18.964 -39.228 1.00 56.02  ? 302  PHE B CD1   1 
ATOM   2416 C  CD2   . PHE A 1 302 ? 12.385  -18.849 -41.589 1.00 55.94  ? 302  PHE B CD2   1 
ATOM   2417 C  CE1   . PHE A 1 302 ? 11.391  -18.969 -39.001 1.00 55.66  ? 302  PHE B CE1   1 
ATOM   2418 C  CE2   . PHE A 1 302 ? 11.009  -18.854 -41.376 1.00 55.92  ? 302  PHE B CE2   1 
ATOM   2419 C  CZ    . PHE A 1 302 ? 10.510  -18.914 -40.078 1.00 55.68  ? 302  PHE B CZ    1 
ATOM   2420 N  N     . PRO A 1 303 ? 16.912  -20.157 -42.540 1.00 59.23  ? 303  PRO B N     1 
ATOM   2421 C  CA    . PRO A 1 303 ? 18.200  -20.065 -43.227 1.00 61.16  ? 303  PRO B CA    1 
ATOM   2422 C  C     . PRO A 1 303 ? 18.479  -18.602 -43.565 1.00 62.03  ? 303  PRO B C     1 
ATOM   2423 O  O     . PRO A 1 303 ? 19.318  -18.296 -44.413 1.00 61.02  ? 303  PRO B O     1 
ATOM   2424 C  CB    . PRO A 1 303 ? 17.979  -20.909 -44.472 1.00 62.48  ? 303  PRO B CB    1 
ATOM   2425 C  CG    . PRO A 1 303 ? 16.567  -20.595 -44.811 1.00 63.16  ? 303  PRO B CG    1 
ATOM   2426 C  CD    . PRO A 1 303 ? 15.872  -20.649 -43.463 1.00 61.84  ? 303  PRO B CD    1 
ATOM   2427 N  N     . HIS A 1 304 ? 17.753  -17.708 -42.900 1.00 60.95  ? 304  HIS B N     1 
ATOM   2428 C  CA    . HIS A 1 304 ? 17.902  -16.274 -43.106 1.00 61.04  ? 304  HIS B CA    1 
ATOM   2429 C  C     . HIS A 1 304 ? 17.398  -15.542 -41.871 1.00 59.29  ? 304  HIS B C     1 
ATOM   2430 O  O     . HIS A 1 304 ? 16.839  -16.156 -40.964 1.00 60.05  ? 304  HIS B O     1 
ATOM   2431 C  CB    . HIS A 1 304 ? 17.089  -15.818 -44.317 1.00 64.47  ? 304  HIS B CB    1 
ATOM   2432 C  CG    . HIS A 1 304 ? 15.628  -16.132 -44.214 1.00 66.79  ? 304  HIS B CG    1 
ATOM   2433 N  ND1   . HIS A 1 304 ? 15.089  -17.321 -44.655 1.00 67.56  ? 304  HIS B ND1   1 
ATOM   2434 C  CD2   . HIS A 1 304 ? 14.598  -15.420 -43.699 1.00 67.81  ? 304  HIS B CD2   1 
ATOM   2435 C  CE1   . HIS A 1 304 ? 13.789  -17.327 -44.418 1.00 67.98  ? 304  HIS B CE1   1 
ATOM   2436 N  NE2   . HIS A 1 304 ? 13.466  -16.185 -43.838 1.00 68.10  ? 304  HIS B NE2   1 
ATOM   2437 N  N     . GLY A 1 305 ? 17.590  -14.229 -41.845 1.00 55.83  ? 305  GLY B N     1 
ATOM   2438 C  CA    . GLY A 1 305 ? 17.138  -13.443 -40.713 1.00 51.26  ? 305  GLY B CA    1 
ATOM   2439 C  C     . GLY A 1 305 ? 15.624  -13.423 -40.601 1.00 47.38  ? 305  GLY B C     1 
ATOM   2440 O  O     . GLY A 1 305 ? 14.915  -13.453 -41.609 1.00 46.07  ? 305  GLY B O     1 
ATOM   2441 N  N     . ILE A 1 306 ? 15.133  -13.368 -39.368 1.00 43.66  ? 306  ILE B N     1 
ATOM   2442 C  CA    . ILE A 1 306 ? 13.702  -13.340 -39.103 1.00 40.18  ? 306  ILE B CA    1 
ATOM   2443 C  C     . ILE A 1 306 ? 13.196  -11.916 -38.951 1.00 40.27  ? 306  ILE B C     1 
ATOM   2444 O  O     . ILE A 1 306 ? 13.622  -11.189 -38.053 1.00 39.72  ? 306  ILE B O     1 
ATOM   2445 C  CB    . ILE A 1 306 ? 13.350  -14.100 -37.807 1.00 37.98  ? 306  ILE B CB    1 
ATOM   2446 C  CG1   . ILE A 1 306 ? 13.752  -15.570 -37.940 1.00 35.98  ? 306  ILE B CG1   1 
ATOM   2447 C  CG2   . ILE A 1 306 ? 11.858  -13.960 -37.509 1.00 36.13  ? 306  ILE B CG2   1 
ATOM   2448 C  CD1   . ILE A 1 306 ? 13.455  -16.403 -36.711 1.00 33.47  ? 306  ILE B CD1   1 
ATOM   2449 N  N     . SER A 1 307 ? 12.294  -11.526 -39.845 1.00 40.12  ? 307  SER B N     1 
ATOM   2450 C  CA    . SER A 1 307 ? 11.694  -10.204 -39.807 1.00 39.54  ? 307  SER B CA    1 
ATOM   2451 C  C     . SER A 1 307 ? 10.423  -10.378 -39.001 1.00 40.54  ? 307  SER B C     1 
ATOM   2452 O  O     . SER A 1 307 ? 9.777   -11.420 -39.073 1.00 39.94  ? 307  SER B O     1 
ATOM   2453 C  CB    . SER A 1 307 ? 11.337  -9.727  -41.214 1.00 39.89  ? 307  SER B CB    1 
ATOM   2454 O  OG    . SER A 1 307 ? 10.191  -10.399 -41.700 1.00 38.64  ? 307  SER B OG    1 
ATOM   2455 N  N     . LYS A 1 308 ? 10.075  -9.353  -38.230 1.00 42.11  ? 308  LYS B N     1 
ATOM   2456 C  CA    . LYS A 1 308 ? 8.878   -9.373  -37.400 1.00 42.79  ? 308  LYS B CA    1 
ATOM   2457 C  C     . LYS A 1 308 ? 7.697   -10.005 -38.098 1.00 43.17  ? 308  LYS B C     1 
ATOM   2458 O  O     . LYS A 1 308 ? 7.056   -10.903 -37.556 1.00 42.98  ? 308  LYS B O     1 
ATOM   2459 C  CB    . LYS A 1 308 ? 8.492   -7.957  -36.977 1.00 42.45  ? 308  LYS B CB    1 
ATOM   2460 C  CG    . LYS A 1 308 ? 9.154   -7.524  -35.696 1.00 43.68  ? 308  LYS B CG    1 
ATOM   2461 C  CD    . LYS A 1 308 ? 8.236   -6.666  -34.845 1.00 43.49  ? 308  LYS B CD    1 
ATOM   2462 C  CE    . LYS A 1 308 ? 8.162   -5.235  -35.336 1.00 43.13  ? 308  LYS B CE    1 
ATOM   2463 N  NZ    . LYS A 1 308 ? 7.995   -4.310  -34.180 1.00 43.14  ? 308  LYS B NZ    1 
ATOM   2464 N  N     . GLU A 1 309 ? 7.399   -9.517  -39.294 1.00 43.75  ? 309  GLU B N     1 
ATOM   2465 C  CA    . GLU A 1 309 ? 6.289   -10.053 -40.050 1.00 46.17  ? 309  GLU B CA    1 
ATOM   2466 C  C     . GLU A 1 309 ? 6.378   -11.571 -39.965 1.00 43.41  ? 309  GLU B C     1 
ATOM   2467 O  O     . GLU A 1 309 ? 5.397   -12.235 -39.638 1.00 44.35  ? 309  GLU B O     1 
ATOM   2468 C  CB    . GLU A 1 309 ? 6.367   -9.581  -41.500 1.00 48.46  ? 309  GLU B CB    1 
ATOM   2469 C  CG    . GLU A 1 309 ? 6.229   -8.068  -41.673 1.00 54.82  ? 309  GLU B CG    1 
ATOM   2470 C  CD    . GLU A 1 309 ? 7.356   -7.267  -41.027 1.00 58.90  ? 309  GLU B CD    1 
ATOM   2471 O  OE1   . GLU A 1 309 ? 8.539   -7.614  -41.231 1.00 62.38  ? 309  GLU B OE1   1 
ATOM   2472 O  OE2   . GLU A 1 309 ? 7.060   -6.273  -40.328 1.00 62.04  ? 309  GLU B OE2   1 
ATOM   2473 N  N     . THR A 1 310 ? 7.570   -12.105 -40.229 1.00 42.26  ? 310  THR B N     1 
ATOM   2474 C  CA    . THR A 1 310 ? 7.812   -13.547 -40.184 1.00 40.78  ? 310  THR B CA    1 
ATOM   2475 C  C     . THR A 1 310 ? 7.602   -14.058 -38.758 1.00 36.67  ? 310  THR B C     1 
ATOM   2476 O  O     . THR A 1 310 ? 6.870   -15.025 -38.520 1.00 34.52  ? 310  THR B O     1 
ATOM   2477 C  CB    . THR A 1 310 ? 9.267   -13.895 -40.621 1.00 40.76  ? 310  THR B CB    1 
ATOM   2478 O  OG1   . THR A 1 310 ? 9.711   -12.990 -41.641 1.00 42.05  ? 310  THR B OG1   1 
ATOM   2479 C  CG2   . THR A 1 310 ? 9.319   -15.307 -41.183 1.00 42.26  ? 310  THR B CG2   1 
ATOM   2480 N  N     . ALA A 1 311 ? 8.265   -13.392 -37.818 1.00 35.71  ? 311  ALA B N     1 
ATOM   2481 C  CA    . ALA A 1 311 ? 8.174   -13.726 -36.407 1.00 35.27  ? 311  ALA B CA    1 
ATOM   2482 C  C     . ALA A 1 311 ? 6.709   -13.799 -36.031 1.00 35.48  ? 311  ALA B C     1 
ATOM   2483 O  O     . ALA A 1 311 ? 6.294   -14.650 -35.249 1.00 34.07  ? 311  ALA B O     1 
ATOM   2484 C  CB    . ALA A 1 311 ? 8.856   -12.660 -35.589 1.00 35.82  ? 311  ALA B CB    1 
ATOM   2485 N  N     . TYR A 1 312 ? 5.924   -12.895 -36.595 1.00 38.04  ? 312  TYR B N     1 
ATOM   2486 C  CA    . TYR A 1 312 ? 4.502   -12.864 -36.319 1.00 43.41  ? 312  TYR B CA    1 
ATOM   2487 C  C     . TYR A 1 312 ? 3.789   -14.104 -36.859 1.00 44.81  ? 312  TYR B C     1 
ATOM   2488 O  O     . TYR A 1 312 ? 3.125   -14.829 -36.115 1.00 46.05  ? 312  TYR B O     1 
ATOM   2489 C  CB    . TYR A 1 312 ? 3.890   -11.609 -36.932 1.00 46.06  ? 312  TYR B CB    1 
ATOM   2490 C  CG    . TYR A 1 312 ? 3.847   -10.411 -36.009 1.00 50.16  ? 312  TYR B CG    1 
ATOM   2491 C  CD1   . TYR A 1 312 ? 2.631   -9.947  -35.515 1.00 52.94  ? 312  TYR B CD1   1 
ATOM   2492 C  CD2   . TYR A 1 312 ? 5.010   -9.724  -35.652 1.00 52.52  ? 312  TYR B CD2   1 
ATOM   2493 C  CE1   . TYR A 1 312 ? 2.564   -8.831  -34.698 1.00 55.09  ? 312  TYR B CE1   1 
ATOM   2494 C  CE2   . TYR A 1 312 ? 4.953   -8.598  -34.828 1.00 54.58  ? 312  TYR B CE2   1 
ATOM   2495 C  CZ    . TYR A 1 312 ? 3.722   -8.161  -34.360 1.00 55.21  ? 312  TYR B CZ    1 
ATOM   2496 O  OH    . TYR A 1 312 ? 3.629   -7.045  -33.565 1.00 55.54  ? 312  TYR B OH    1 
ATOM   2497 N  N     . SER A 1 313 ? 3.943   -14.346 -38.155 1.00 47.60  ? 313  SER B N     1 
ATOM   2498 C  CA    . SER A 1 313 ? 3.296   -15.475 -38.813 1.00 50.14  ? 313  SER B CA    1 
ATOM   2499 C  C     . SER A 1 313 ? 3.743   -16.809 -38.256 1.00 50.34  ? 313  SER B C     1 
ATOM   2500 O  O     . SER A 1 313 ? 2.930   -17.632 -37.838 1.00 50.96  ? 313  SER B O     1 
ATOM   2501 C  CB    . SER A 1 313 ? 3.606   -15.453 -40.306 1.00 49.05  ? 313  SER B CB    1 
ATOM   2502 O  OG    . SER A 1 313 ? 4.082   -14.180 -40.697 1.00 52.84  ? 313  SER B OG    1 
ATOM   2503 N  N     . GLU A 1 314 ? 5.053   -17.010 -38.264 1.00 50.70  ? 314  GLU B N     1 
ATOM   2504 C  CA    . GLU A 1 314 ? 5.642   -18.248 -37.801 1.00 51.24  ? 314  GLU B CA    1 
ATOM   2505 C  C     . GLU A 1 314 ? 5.385   -18.599 -36.340 1.00 50.89  ? 314  GLU B C     1 
ATOM   2506 O  O     . GLU A 1 314 ? 5.185   -19.769 -36.016 1.00 50.13  ? 314  GLU B O     1 
ATOM   2507 C  CB    . GLU A 1 314 ? 7.147   -18.232 -38.054 1.00 53.48  ? 314  GLU B CB    1 
ATOM   2508 C  CG    . GLU A 1 314 ? 7.813   -19.517 -37.623 1.00 58.41  ? 314  GLU B CG    1 
ATOM   2509 C  CD    . GLU A 1 314 ? 7.322   -20.708 -38.420 1.00 61.03  ? 314  GLU B CD    1 
ATOM   2510 O  OE1   . GLU A 1 314 ? 7.154   -21.794 -37.827 1.00 63.36  ? 314  GLU B OE1   1 
ATOM   2511 O  OE2   . GLU A 1 314 ? 7.115   -20.562 -39.644 1.00 63.18  ? 314  GLU B OE2   1 
ATOM   2512 N  N     . SER A 1 315 ? 5.399   -17.599 -35.463 1.00 51.01  ? 315  SER B N     1 
ATOM   2513 C  CA    . SER A 1 315 ? 5.184   -17.826 -34.034 1.00 50.75  ? 315  SER B CA    1 
ATOM   2514 C  C     . SER A 1 315 ? 3.782   -18.341 -33.735 1.00 53.33  ? 315  SER B C     1 
ATOM   2515 O  O     . SER A 1 315 ? 3.552   -18.963 -32.698 1.00 52.37  ? 315  SER B O     1 
ATOM   2516 C  CB    . SER A 1 315 ? 5.401   -16.537 -33.257 1.00 48.89  ? 315  SER B CB    1 
ATOM   2517 O  OG    . SER A 1 315 ? 4.320   -15.658 -33.493 1.00 41.34  ? 315  SER B OG    1 
ATOM   2518 N  N     . VAL A 1 316 ? 2.835   -18.039 -34.619 1.00 57.98  ? 316  VAL B N     1 
ATOM   2519 C  CA    . VAL A 1 316 ? 1.473   -18.516 -34.436 1.00 65.35  ? 316  VAL B CA    1 
ATOM   2520 C  C     . VAL A 1 316 ? 1.488   -19.993 -34.787 1.00 64.07  ? 316  VAL B C     1 
ATOM   2521 O  O     . VAL A 1 316 ? 0.862   -20.809 -34.113 1.00 65.36  ? 316  VAL B O     1 
ATOM   2522 C  CB    . VAL A 1 316 ? 0.473   -17.789 -35.351 1.00 65.17  ? 316  VAL B CB    1 
ATOM   2523 C  CG1   . VAL A 1 316 ? -0.777  -18.639 -35.532 1.00 70.09  ? 316  VAL B CG1   1 
ATOM   2524 C  CG2   . VAL A 1 316 ? 0.094   -16.454 -34.734 1.00 70.09  ? 316  VAL B CG2   1 
ATOM   2525 N  N     . LYS A 1 317 ? 2.201   -20.336 -35.855 1.00 64.01  ? 317  LYS B N     1 
ATOM   2526 C  CA    . LYS A 1 317 ? 2.311   -21.730 -36.255 1.00 64.76  ? 317  LYS B CA    1 
ATOM   2527 C  C     . LYS A 1 317 ? 2.855   -22.479 -35.041 1.00 59.27  ? 317  LYS B C     1 
ATOM   2528 O  O     . LYS A 1 317 ? 2.222   -23.405 -34.538 1.00 60.85  ? 317  LYS B O     1 
ATOM   2529 C  CB    . LYS A 1 317 ? 3.256   -21.864 -37.453 1.00 69.90  ? 317  LYS B CB    1 
ATOM   2530 C  CG    . LYS A 1 317 ? 2.648   -21.372 -38.764 1.00 79.50  ? 317  LYS B CG    1 
ATOM   2531 C  CD    . LYS A 1 317 ? 3.711   -21.107 -39.818 1.00 90.24  ? 317  LYS B CD    1 
ATOM   2532 C  CE    . LYS A 1 317 ? 3.092   -20.545 -41.092 1.00 97.91  ? 317  LYS B CE    1 
ATOM   2533 N  NZ    . LYS A 1 317 ? 4.110   -19.911 -41.975 1.00 101.72 ? 317  LYS B NZ    1 
ATOM   2534 N  N     . LEU A 1 318 ? 4.018   -22.053 -34.557 1.00 54.76  ? 318  LEU B N     1 
ATOM   2535 C  CA    . LEU A 1 318 ? 4.623   -22.680 -33.389 1.00 48.49  ? 318  LEU B CA    1 
ATOM   2536 C  C     . LEU A 1 318 ? 3.614   -22.772 -32.240 1.00 47.51  ? 318  LEU B C     1 
ATOM   2537 O  O     . LEU A 1 318 ? 3.261   -23.875 -31.825 1.00 44.70  ? 318  LEU B O     1 
ATOM   2538 C  CB    . LEU A 1 318 ? 5.857   -21.893 -32.939 1.00 42.07  ? 318  LEU B CB    1 
ATOM   2539 C  CG    . LEU A 1 318 ? 7.017   -21.759 -33.932 1.00 38.85  ? 318  LEU B CG    1 
ATOM   2540 C  CD1   . LEU A 1 318 ? 8.035   -20.773 -33.383 1.00 35.96  ? 318  LEU B CD1   1 
ATOM   2541 C  CD2   . LEU A 1 318 ? 7.659   -23.119 -34.183 1.00 34.06  ? 318  LEU B CD2   1 
ATOM   2542 N  N     . LEU A 1 319 ? 3.141   -21.634 -31.728 1.00 46.00  ? 319  LEU B N     1 
ATOM   2543 C  CA    . LEU A 1 319 ? 2.171   -21.670 -30.627 1.00 47.39  ? 319  LEU B CA    1 
ATOM   2544 C  C     . LEU A 1 319 ? 1.139   -22.765 -30.852 1.00 49.60  ? 319  LEU B C     1 
ATOM   2545 O  O     . LEU A 1 319 ? 0.851   -23.546 -29.948 1.00 51.14  ? 319  LEU B O     1 
ATOM   2546 C  CB    . LEU A 1 319 ? 1.457   -20.318 -30.450 1.00 46.93  ? 319  LEU B CB    1 
ATOM   2547 C  CG    . LEU A 1 319 ? 0.176   -20.255 -29.591 1.00 43.69  ? 319  LEU B CG    1 
ATOM   2548 C  CD1   . LEU A 1 319 ? 0.235   -21.231 -28.431 1.00 42.46  ? 319  LEU B CD1   1 
ATOM   2549 C  CD2   . LEU A 1 319 ? -0.009  -18.844 -29.061 1.00 42.56  ? 319  LEU B CD2   1 
ATOM   2550 N  N     . GLN A 1 320 ? 0.588   -22.821 -32.060 1.00 52.87  ? 320  GLN B N     1 
ATOM   2551 C  CA    . GLN A 1 320 ? -0.404  -23.835 -32.392 1.00 54.89  ? 320  GLN B CA    1 
ATOM   2552 C  C     . GLN A 1 320 ? 0.126   -25.236 -32.127 1.00 55.31  ? 320  GLN B C     1 
ATOM   2553 O  O     . GLN A 1 320 ? -0.541  -26.050 -31.492 1.00 54.93  ? 320  GLN B O     1 
ATOM   2554 C  CB    . GLN A 1 320 ? -0.815  -23.727 -33.859 1.00 54.39  ? 320  GLN B CB    1 
ATOM   2555 C  CG    . GLN A 1 320 ? -1.806  -22.628 -34.150 1.00 58.19  ? 320  GLN B CG    1 
ATOM   2556 C  CD    . GLN A 1 320 ? -2.408  -22.766 -35.527 1.00 60.53  ? 320  GLN B CD    1 
ATOM   2557 O  OE1   . GLN A 1 320 ? -1.708  -22.672 -36.534 1.00 61.88  ? 320  GLN B OE1   1 
ATOM   2558 N  NE2   . GLN A 1 320 ? -3.714  -23.001 -35.582 1.00 61.39  ? 320  GLN B NE2   1 
ATOM   2559 N  N     . LYS A 1 321 ? 1.327   -25.513 -32.620 1.00 55.56  ? 321  LYS B N     1 
ATOM   2560 C  CA    . LYS A 1 321 ? 1.941   -26.818 -32.434 1.00 57.68  ? 321  LYS B CA    1 
ATOM   2561 C  C     . LYS A 1 321 ? 1.911   -27.189 -30.954 1.00 58.49  ? 321  LYS B C     1 
ATOM   2562 O  O     . LYS A 1 321 ? 1.740   -28.359 -30.603 1.00 58.85  ? 321  LYS B O     1 
ATOM   2563 C  CB    . LYS A 1 321 ? 3.382   -26.796 -32.937 1.00 58.81  ? 321  LYS B CB    1 
ATOM   2564 C  CG    . LYS A 1 321 ? 3.845   -28.118 -33.520 1.00 59.85  ? 321  LYS B CG    1 
ATOM   2565 C  CD    . LYS A 1 321 ? 5.300   -28.055 -33.953 1.00 62.76  ? 321  LYS B CD    1 
ATOM   2566 C  CE    . LYS A 1 321 ? 5.539   -26.985 -35.010 1.00 64.64  ? 321  LYS B CE    1 
ATOM   2567 N  NZ    . LYS A 1 321 ? 6.930   -27.043 -35.545 1.00 65.89  ? 321  LYS B NZ    1 
ATOM   2568 N  N     . ILE A 1 322 ? 2.083   -26.191 -30.092 1.00 59.09  ? 322  ILE B N     1 
ATOM   2569 C  CA    . ILE A 1 322 ? 2.057   -26.414 -28.651 1.00 58.55  ? 322  ILE B CA    1 
ATOM   2570 C  C     . ILE A 1 322 ? 0.656   -26.856 -28.252 1.00 63.73  ? 322  ILE B C     1 
ATOM   2571 O  O     . ILE A 1 322 ? 0.468   -27.907 -27.642 1.00 62.17  ? 322  ILE B O     1 
ATOM   2572 C  CB    . ILE A 1 322 ? 2.388   -25.126 -27.867 1.00 56.01  ? 322  ILE B CB    1 
ATOM   2573 C  CG1   . ILE A 1 322 ? 3.862   -24.765 -28.049 1.00 54.66  ? 322  ILE B CG1   1 
ATOM   2574 C  CG2   . ILE A 1 322 ? 2.051   -25.312 -26.392 1.00 55.38  ? 322  ILE B CG2   1 
ATOM   2575 C  CD1   . ILE A 1 322 ? 4.239   -23.418 -27.457 1.00 50.68  ? 322  ILE B CD1   1 
ATOM   2576 N  N     . LEU A 1 323 ? -0.326  -26.033 -28.600 1.00 68.20  ? 323  LEU B N     1 
ATOM   2577 C  CA    . LEU A 1 323 ? -1.717  -26.318 -28.284 1.00 74.59  ? 323  LEU B CA    1 
ATOM   2578 C  C     . LEU A 1 323 ? -2.145  -27.684 -28.825 1.00 82.91  ? 323  LEU B C     1 
ATOM   2579 O  O     . LEU A 1 323 ? -2.882  -28.417 -28.168 1.00 83.94  ? 323  LEU B O     1 
ATOM   2580 C  CB    . LEU A 1 323 ? -2.609  -25.219 -28.867 1.00 69.68  ? 323  LEU B CB    1 
ATOM   2581 C  CG    . LEU A 1 323 ? -3.402  -24.259 -27.967 1.00 65.18  ? 323  LEU B CG    1 
ATOM   2582 C  CD1   . LEU A 1 323 ? -2.993  -24.367 -26.506 1.00 60.16  ? 323  LEU B CD1   1 
ATOM   2583 C  CD2   . LEU A 1 323 ? -3.183  -22.847 -28.481 1.00 60.25  ? 323  LEU B CD2   1 
ATOM   2584 N  N     . GLU A 1 324 ? -1.672  -28.020 -30.023 1.00 89.97  ? 324  GLU B N     1 
ATOM   2585 C  CA    . GLU A 1 324 ? -2.007  -29.292 -30.661 1.00 95.27  ? 324  GLU B CA    1 
ATOM   2586 C  C     . GLU A 1 324 ? -1.356  -30.480 -29.965 1.00 95.57  ? 324  GLU B C     1 
ATOM   2587 O  O     . GLU A 1 324 ? -1.938  -31.564 -29.901 1.00 99.22  ? 324  GLU B O     1 
ATOM   2588 C  CB    . GLU A 1 324 ? -1.562  -29.294 -32.131 1.00 104.70 ? 324  GLU B CB    1 
ATOM   2589 C  CG    . GLU A 1 324 ? -2.350  -28.381 -33.057 1.00 117.62 ? 324  GLU B CG    1 
ATOM   2590 C  CD    . GLU A 1 324 ? -1.784  -28.357 -34.468 1.00 123.86 ? 324  GLU B CD    1 
ATOM   2591 O  OE1   . GLU A 1 324 ? -2.371  -27.678 -35.336 1.00 127.93 ? 324  GLU B OE1   1 
ATOM   2592 O  OE2   . GLU A 1 324 ? -0.750  -29.014 -34.712 1.00 127.68 ? 324  GLU B OE2   1 
ATOM   2593 N  N     . GLU A 1 325 ? -0.151  -30.271 -29.443 1.00 94.65  ? 325  GLU B N     1 
ATOM   2594 C  CA    . GLU A 1 325 ? 0.601   -31.338 -28.793 1.00 89.44  ? 325  GLU B CA    1 
ATOM   2595 C  C     . GLU A 1 325 ? 0.649   -31.342 -27.262 1.00 88.68  ? 325  GLU B C     1 
ATOM   2596 O  O     . GLU A 1 325 ? 1.405   -32.111 -26.667 1.00 85.31  ? 325  GLU B O     1 
ATOM   2597 C  CB    . GLU A 1 325 ? 2.018   -31.358 -29.373 1.00 87.29  ? 325  GLU B CB    1 
ATOM   2598 C  CG    . GLU A 1 325 ? 2.035   -31.804 -30.830 1.00 77.60  ? 325  GLU B CG    1 
ATOM   2599 C  CD    . GLU A 1 325 ? 3.314   -31.451 -31.562 1.00 71.25  ? 325  GLU B CD    1 
ATOM   2600 O  OE1   . GLU A 1 325 ? 4.406   -31.683 -31.008 1.00 65.72  ? 325  GLU B OE1   1 
ATOM   2601 O  OE2   . GLU A 1 325 ? 3.221   -30.951 -32.704 1.00 65.77  ? 325  GLU B OE2   1 
ATOM   2602 N  N     . ASP A 1 326 ? -0.155  -30.494 -26.628 1.00 86.94  ? 326  ASP B N     1 
ATOM   2603 C  CA    . ASP A 1 326 ? -0.218  -30.438 -25.167 1.00 87.98  ? 326  ASP B CA    1 
ATOM   2604 C  C     . ASP A 1 326 ? -1.642  -30.028 -24.815 1.00 84.87  ? 326  ASP B C     1 
ATOM   2605 O  O     . ASP A 1 326 ? -2.145  -29.030 -25.325 1.00 85.69  ? 326  ASP B O     1 
ATOM   2606 C  CB    . ASP A 1 326 ? 0.788   -29.422 -24.615 1.00 90.17  ? 326  ASP B CB    1 
ATOM   2607 C  CG    . ASP A 1 326 ? 1.018   -29.579 -23.120 1.00 90.61  ? 326  ASP B CG    1 
ATOM   2608 O  OD1   . ASP A 1 326 ? 0.059   -29.399 -22.341 1.00 93.05  ? 326  ASP B OD1   1 
ATOM   2609 O  OD2   . ASP A 1 326 ? 2.161   -29.887 -22.723 1.00 92.59  ? 326  ASP B OD2   1 
ATOM   2610 N  N     . GLU A 1 327 ? -2.291  -30.799 -23.948 1.00 83.95  ? 327  GLU B N     1 
ATOM   2611 C  CA    . GLU A 1 327 ? -3.678  -30.529 -23.579 1.00 84.25  ? 327  GLU B CA    1 
ATOM   2612 C  C     . GLU A 1 327 ? -3.890  -29.624 -22.366 1.00 79.35  ? 327  GLU B C     1 
ATOM   2613 O  O     . GLU A 1 327 ? -5.027  -29.340 -21.997 1.00 79.55  ? 327  GLU B O     1 
ATOM   2614 C  CB    . GLU A 1 327 ? -4.421  -31.857 -23.361 1.00 82.89  ? 327  GLU B CB    1 
ATOM   2615 C  CG    . GLU A 1 327 ? -4.045  -32.610 -22.084 1.00 92.99  ? 327  GLU B CG    1 
ATOM   2616 C  CD    . GLU A 1 327 ? -4.766  -33.947 -21.942 1.00 100.63 ? 327  GLU B CD    1 
ATOM   2617 O  OE1   . GLU A 1 327 ? -5.986  -34.004 -22.207 1.00 106.98 ? 327  GLU B OE1   1 
ATOM   2618 O  OE2   . GLU A 1 327 ? -4.115  -34.939 -21.552 1.00 107.22 ? 327  GLU B OE2   1 
ATOM   2619 N  N     . ARG A 1 328 ? -2.804  -29.159 -21.760 1.00 78.30  ? 328  ARG B N     1 
ATOM   2620 C  CA    . ARG A 1 328 ? -2.899  -28.301 -20.584 1.00 77.33  ? 328  ARG B CA    1 
ATOM   2621 C  C     . ARG A 1 328 ? -3.219  -26.845 -20.893 1.00 74.99  ? 328  ARG B C     1 
ATOM   2622 O  O     . ARG A 1 328 ? -3.092  -26.392 -22.029 1.00 76.02  ? 328  ARG B O     1 
ATOM   2623 C  CB    . ARG A 1 328 ? -1.596  -28.363 -19.787 1.00 76.07  ? 328  ARG B CB    1 
ATOM   2624 C  CG    . ARG A 1 328 ? -1.397  -29.649 -19.007 1.00 78.95  ? 328  ARG B CG    1 
ATOM   2625 C  CD    . ARG A 1 328 ? 0.015   -29.731 -18.452 1.00 82.75  ? 328  ARG B CD    1 
ATOM   2626 N  NE    . ARG A 1 328 ? 0.990   -30.014 -19.501 1.00 86.27  ? 328  ARG B NE    1 
ATOM   2627 C  CZ    . ARG A 1 328 ? 2.305   -30.053 -19.312 1.00 87.76  ? 328  ARG B CZ    1 
ATOM   2628 N  NH1   . ARG A 1 328 ? 2.814   -29.822 -18.111 1.00 87.59  ? 328  ARG B NH1   1 
ATOM   2629 N  NH2   . ARG A 1 328 ? 3.112   -30.334 -20.325 1.00 88.28  ? 328  ARG B NH2   1 
ATOM   2630 N  N     . LYS A 1 329 ? -3.639  -26.117 -19.864 1.00 73.99  ? 329  LYS B N     1 
ATOM   2631 C  CA    . LYS A 1 329 ? -3.958  -24.702 -20.005 1.00 72.67  ? 329  LYS B CA    1 
ATOM   2632 C  C     . LYS A 1 329 ? -2.690  -23.870 -19.933 1.00 73.02  ? 329  LYS B C     1 
ATOM   2633 O  O     . LYS A 1 329 ? -1.705  -24.272 -19.316 1.00 71.69  ? 329  LYS B O     1 
ATOM   2634 C  CB    . LYS A 1 329 ? -4.917  -24.249 -18.908 1.00 74.05  ? 329  LYS B CB    1 
ATOM   2635 C  CG    . LYS A 1 329 ? -6.367  -24.507 -19.228 1.00 78.74  ? 329  LYS B CG    1 
ATOM   2636 C  CD    . LYS A 1 329 ? -7.252  -23.858 -18.198 1.00 79.88  ? 329  LYS B CD    1 
ATOM   2637 C  CE    . LYS A 1 329 ? -8.702  -23.958 -18.605 1.00 80.14  ? 329  LYS B CE    1 
ATOM   2638 N  NZ    . LYS A 1 329 ? -9.565  -23.375 -17.554 1.00 80.24  ? 329  LYS B NZ    1 
ATOM   2639 N  N     . ILE A 1 330 ? -2.730  -22.701 -20.560 1.00 70.33  ? 330  ILE B N     1 
ATOM   2640 C  CA    . ILE A 1 330 ? -1.585  -21.804 -20.590 1.00 66.95  ? 330  ILE B CA    1 
ATOM   2641 C  C     . ILE A 1 330 ? -1.815  -20.599 -19.678 1.00 71.50  ? 330  ILE B C     1 
ATOM   2642 O  O     . ILE A 1 330 ? -2.917  -20.054 -19.634 1.00 70.33  ? 330  ILE B O     1 
ATOM   2643 C  CB    . ILE A 1 330 ? -1.342  -21.286 -22.024 1.00 64.35  ? 330  ILE B CB    1 
ATOM   2644 C  CG1   . ILE A 1 330 ? -1.608  -22.409 -23.033 1.00 58.53  ? 330  ILE B CG1   1 
ATOM   2645 C  CG2   . ILE A 1 330 ? 0.080   -20.752 -22.150 1.00 61.83  ? 330  ILE B CG2   1 
ATOM   2646 C  CD1   . ILE A 1 330 ? -0.383  -22.895 -23.781 1.00 52.35  ? 330  ILE B CD1   1 
ATOM   2647 N  N     . ARG A 1 331 ? -0.778  -20.197 -18.945 1.00 74.24  ? 331  ARG B N     1 
ATOM   2648 C  CA    . ARG A 1 331 ? -0.858  -19.033 -18.061 1.00 76.68  ? 331  ARG B CA    1 
ATOM   2649 C  C     . ARG A 1 331 ? 0.213   -18.046 -18.508 1.00 76.10  ? 331  ARG B C     1 
ATOM   2650 O  O     . ARG A 1 331 ? 0.011   -16.833 -18.481 1.00 77.45  ? 331  ARG B O     1 
ATOM   2651 C  CB    . ARG A 1 331 ? -0.623  -19.416 -16.586 1.00 81.20  ? 331  ARG B CB    1 
ATOM   2652 C  CG    . ARG A 1 331 ? 0.833   -19.700 -16.199 1.00 88.54  ? 331  ARG B CG    1 
ATOM   2653 C  CD    . ARG A 1 331 ? 0.976   -20.094 -14.721 1.00 93.58  ? 331  ARG B CD    1 
ATOM   2654 N  NE    . ARG A 1 331 ? 1.198   -18.957 -13.826 1.00 97.99  ? 331  ARG B NE    1 
ATOM   2655 C  CZ    . ARG A 1 331 ? 0.512   -18.742 -12.707 1.00 100.12 ? 331  ARG B CZ    1 
ATOM   2656 N  NH1   . ARG A 1 331 ? -0.449  -19.580 -12.346 1.00 101.36 ? 331  ARG B NH1   1 
ATOM   2657 N  NH2   . ARG A 1 331 ? 0.795   -17.698 -11.941 1.00 100.77 ? 331  ARG B NH2   1 
ATOM   2658 N  N     . ARG A 1 332 ? 1.353   -18.581 -18.928 1.00 73.83  ? 332  ARG B N     1 
ATOM   2659 C  CA    . ARG A 1 332 ? 2.457   -17.752 -19.385 1.00 70.12  ? 332  ARG B CA    1 
ATOM   2660 C  C     . ARG A 1 332 ? 2.697   -17.977 -20.876 1.00 65.63  ? 332  ARG B C     1 
ATOM   2661 O  O     . ARG A 1 332 ? 2.577   -19.098 -21.369 1.00 64.90  ? 332  ARG B O     1 
ATOM   2662 C  CB    . ARG A 1 332 ? 3.731   -18.079 -18.593 1.00 75.97  ? 332  ARG B CB    1 
ATOM   2663 C  CG    . ARG A 1 332 ? 3.595   -17.927 -17.075 1.00 81.72  ? 332  ARG B CG    1 
ATOM   2664 C  CD    . ARG A 1 332 ? 4.953   -17.992 -16.383 1.00 86.08  ? 332  ARG B CD    1 
ATOM   2665 N  NE    . ARG A 1 332 ? 5.799   -16.885 -16.811 1.00 90.03  ? 332  ARG B NE    1 
ATOM   2666 C  CZ    . ARG A 1 332 ? 7.096   -16.764 -16.544 1.00 91.47  ? 332  ARG B CZ    1 
ATOM   2667 N  NH1   . ARG A 1 332 ? 7.732   -17.688 -15.833 1.00 91.93  ? 332  ARG B NH1   1 
ATOM   2668 N  NH2   . ARG A 1 332 ? 7.757   -15.714 -17.008 1.00 92.46  ? 332  ARG B NH2   1 
ATOM   2669 N  N     . ILE A 1 333 ? 3.019   -16.906 -21.594 1.00 58.28  ? 333  ILE B N     1 
ATOM   2670 C  CA    . ILE A 1 333 ? 3.284   -17.009 -23.023 1.00 48.94  ? 333  ILE B CA    1 
ATOM   2671 C  C     . ILE A 1 333 ? 4.401   -16.057 -23.439 1.00 49.56  ? 333  ILE B C     1 
ATOM   2672 O  O     . ILE A 1 333 ? 4.433   -14.902 -23.016 1.00 46.38  ? 333  ILE B O     1 
ATOM   2673 C  CB    . ILE A 1 333 ? 2.018   -16.710 -23.864 1.00 45.79  ? 333  ILE B CB    1 
ATOM   2674 C  CG1   . ILE A 1 333 ? 2.229   -17.219 -25.291 1.00 42.05  ? 333  ILE B CG1   1 
ATOM   2675 C  CG2   . ILE A 1 333 ? 1.722   -15.213 -23.882 1.00 43.90  ? 333  ILE B CG2   1 
ATOM   2676 C  CD1   . ILE A 1 333 ? 2.453   -18.718 -25.369 1.00 35.80  ? 333  ILE B CD1   1 
ATOM   2677 N  N     . GLY A 1 334 ? 5.320   -16.550 -24.266 1.00 46.99  ? 334  GLY B N     1 
ATOM   2678 C  CA    . GLY A 1 334 ? 6.428   -15.721 -24.708 1.00 45.14  ? 334  GLY B CA    1 
ATOM   2679 C  C     . GLY A 1 334 ? 7.161   -16.234 -25.934 1.00 44.16  ? 334  GLY B C     1 
ATOM   2680 O  O     . GLY A 1 334 ? 6.705   -17.158 -26.610 1.00 44.39  ? 334  GLY B O     1 
ATOM   2681 N  N     . VAL A 1 335 ? 8.315   -15.640 -26.214 1.00 44.65  ? 335  VAL B N     1 
ATOM   2682 C  CA    . VAL A 1 335 ? 9.100   -16.025 -27.376 1.00 42.17  ? 335  VAL B CA    1 
ATOM   2683 C  C     . VAL A 1 335 ? 10.583  -15.921 -27.046 1.00 44.01  ? 335  VAL B C     1 
ATOM   2684 O  O     . VAL A 1 335 ? 10.951  -15.451 -25.970 1.00 42.92  ? 335  VAL B O     1 
ATOM   2685 C  CB    . VAL A 1 335 ? 8.782   -15.089 -28.558 1.00 40.77  ? 335  VAL B CB    1 
ATOM   2686 C  CG1   . VAL A 1 335 ? 9.242   -13.678 -28.226 1.00 39.60  ? 335  VAL B CG1   1 
ATOM   2687 C  CG2   . VAL A 1 335 ? 9.436   -15.590 -29.830 1.00 39.99  ? 335  VAL B CG2   1 
ATOM   2688 N  N     . ARG A 1 336 ? 11.428  -16.361 -27.974 1.00 45.18  ? 336  ARG B N     1 
ATOM   2689 C  CA    . ARG A 1 336 ? 12.873  -16.298 -27.790 1.00 47.90  ? 336  ARG B CA    1 
ATOM   2690 C  C     . ARG A 1 336 ? 13.607  -16.376 -29.133 1.00 47.82  ? 336  ARG B C     1 
ATOM   2691 O  O     . ARG A 1 336 ? 13.290  -17.206 -29.986 1.00 48.77  ? 336  ARG B O     1 
ATOM   2692 C  CB    . ARG A 1 336 ? 13.329  -17.407 -26.831 1.00 50.69  ? 336  ARG B CB    1 
ATOM   2693 C  CG    . ARG A 1 336 ? 14.826  -17.459 -26.617 1.00 56.74  ? 336  ARG B CG    1 
ATOM   2694 C  CD    . ARG A 1 336 ? 15.204  -18.036 -25.262 1.00 61.45  ? 336  ARG B CD    1 
ATOM   2695 N  NE    . ARG A 1 336 ? 15.894  -17.031 -24.463 1.00 65.76  ? 336  ARG B NE    1 
ATOM   2696 C  CZ    . ARG A 1 336 ? 15.299  -16.185 -23.630 1.00 67.57  ? 336  ARG B CZ    1 
ATOM   2697 N  NH1   . ARG A 1 336 ? 13.986  -16.212 -23.457 1.00 68.00  ? 336  ARG B NH1   1 
ATOM   2698 N  NH2   . ARG A 1 336 ? 16.027  -15.294 -22.986 1.00 67.95  ? 336  ARG B NH2   1 
ATOM   2699 N  N     . PHE A 1 337 ? 14.587  -15.497 -29.319 1.00 47.83  ? 337  PHE B N     1 
ATOM   2700 C  CA    . PHE A 1 337 ? 15.338  -15.443 -30.568 1.00 47.95  ? 337  PHE B CA    1 
ATOM   2701 C  C     . PHE A 1 337 ? 16.788  -15.892 -30.418 1.00 46.75  ? 337  PHE B C     1 
ATOM   2702 O  O     . PHE A 1 337 ? 17.509  -15.417 -29.538 1.00 45.82  ? 337  PHE B O     1 
ATOM   2703 C  CB    . PHE A 1 337 ? 15.248  -14.023 -31.123 1.00 47.44  ? 337  PHE B CB    1 
ATOM   2704 C  CG    . PHE A 1 337 ? 13.847  -13.620 -31.474 1.00 49.14  ? 337  PHE B CG    1 
ATOM   2705 C  CD1   . PHE A 1 337 ? 13.280  -14.035 -32.674 1.00 50.17  ? 337  PHE B CD1   1 
ATOM   2706 C  CD2   . PHE A 1 337 ? 13.063  -12.901 -30.576 1.00 50.01  ? 337  PHE B CD2   1 
ATOM   2707 C  CE1   . PHE A 1 337 ? 11.952  -13.747 -32.975 1.00 51.42  ? 337  PHE B CE1   1 
ATOM   2708 C  CE2   . PHE A 1 337 ? 11.731  -12.608 -30.867 1.00 51.54  ? 337  PHE B CE2   1 
ATOM   2709 C  CZ    . PHE A 1 337 ? 11.175  -13.032 -32.069 1.00 51.88  ? 337  PHE B CZ    1 
ATOM   2710 N  N     . SER A 1 338 ? 17.201  -16.818 -31.286 1.00 47.53  ? 338  SER B N     1 
ATOM   2711 C  CA    . SER A 1 338 ? 18.552  -17.376 -31.262 1.00 48.26  ? 338  SER B CA    1 
ATOM   2712 C  C     . SER A 1 338 ? 19.223  -17.260 -32.618 1.00 48.43  ? 338  SER B C     1 
ATOM   2713 O  O     . SER A 1 338 ? 18.694  -16.646 -33.544 1.00 48.38  ? 338  SER B O     1 
ATOM   2714 C  CB    . SER A 1 338 ? 18.511  -18.862 -30.910 1.00 45.91  ? 338  SER B CB    1 
ATOM   2715 O  OG    . SER A 1 338 ? 17.404  -19.163 -30.086 1.00 48.79  ? 338  SER B OG    1 
ATOM   2716 N  N     . LYS A 1 339 ? 20.387  -17.894 -32.716 1.00 49.99  ? 339  LYS B N     1 
ATOM   2717 C  CA    . LYS A 1 339 ? 21.174  -17.932 -33.939 1.00 51.86  ? 339  LYS B CA    1 
ATOM   2718 C  C     . LYS A 1 339 ? 21.246  -16.563 -34.607 1.00 51.17  ? 339  LYS B C     1 
ATOM   2719 O  O     . LYS A 1 339 ? 20.827  -16.412 -35.753 1.00 51.34  ? 339  LYS B O     1 
ATOM   2720 C  CB    . LYS A 1 339 ? 20.560  -18.939 -34.921 1.00 53.63  ? 339  LYS B CB    1 
ATOM   2721 C  CG    . LYS A 1 339 ? 19.847  -20.140 -34.279 1.00 59.01  ? 339  LYS B CG    1 
ATOM   2722 C  CD    . LYS A 1 339 ? 20.796  -21.181 -33.696 1.00 63.39  ? 339  LYS B CD    1 
ATOM   2723 C  CE    . LYS A 1 339 ? 20.046  -22.247 -32.876 1.00 66.81  ? 339  LYS B CE    1 
ATOM   2724 N  NZ    . LYS A 1 339 ? 19.086  -23.098 -33.643 1.00 68.52  ? 339  LYS B NZ    1 
ATOM   2725 N  N     . PHE A 1 340 ? 21.768  -15.564 -33.902 1.00 51.52  ? 340  PHE B N     1 
ATOM   2726 C  CA    . PHE A 1 340 ? 21.873  -14.232 -34.483 1.00 52.26  ? 340  PHE B CA    1 
ATOM   2727 C  C     . PHE A 1 340 ? 22.770  -14.307 -35.715 1.00 53.21  ? 340  PHE B C     1 
ATOM   2728 O  O     . PHE A 1 340 ? 23.252  -15.383 -36.060 1.00 52.88  ? 340  PHE B O     1 
ATOM   2729 C  CB    . PHE A 1 340 ? 22.429  -13.253 -33.453 1.00 50.05  ? 340  PHE B CB    1 
ATOM   2730 C  CG    . PHE A 1 340 ? 21.613  -13.184 -32.195 1.00 48.89  ? 340  PHE B CG    1 
ATOM   2731 C  CD1   . PHE A 1 340 ? 20.222  -13.184 -32.253 1.00 48.58  ? 340  PHE B CD1   1 
ATOM   2732 C  CD2   . PHE A 1 340 ? 22.230  -13.096 -30.954 1.00 48.33  ? 340  PHE B CD2   1 
ATOM   2733 C  CE1   . PHE A 1 340 ? 19.460  -13.095 -31.095 1.00 47.97  ? 340  PHE B CE1   1 
ATOM   2734 C  CE2   . PHE A 1 340 ? 21.474  -13.006 -29.788 1.00 48.05  ? 340  PHE B CE2   1 
ATOM   2735 C  CZ    . PHE A 1 340 ? 20.086  -13.006 -29.860 1.00 47.64  ? 340  PHE B CZ    1 
ATOM   2736 N  N     . ILE A 1 341 ? 23.003  -13.184 -36.386 1.00 55.03  ? 341  ILE B N     1 
ATOM   2737 C  CA    . ILE A 1 341 ? 23.825  -13.223 -37.591 1.00 57.36  ? 341  ILE B CA    1 
ATOM   2738 C  C     . ILE A 1 341 ? 25.324  -13.009 -37.380 1.00 57.48  ? 341  ILE B C     1 
ATOM   2739 O  O     . ILE A 1 341 ? 25.706  -11.947 -36.849 1.00 58.14  ? 341  ILE B O     1 
ATOM   2740 C  CB    . ILE A 1 341 ? 23.279  -12.230 -38.660 1.00 59.44  ? 341  ILE B CB    1 
ATOM   2741 C  CG1   . ILE A 1 341 ? 22.662  -13.028 -39.811 1.00 61.39  ? 341  ILE B CG1   1 
ATOM   2742 C  CG2   . ILE A 1 341 ? 24.389  -11.342 -39.210 1.00 60.51  ? 341  ILE B CG2   1 
ATOM   2743 C  CD1   . ILE A 1 341 ? 21.243  -12.641 -40.164 1.00 63.69  ? 341  ILE B CD1   1 
ATOM   2744 O  "O5'" . DG  B 2 1   ? 32.207  -48.222 -31.952 1.00 74.88  ? 1    DG  P "O5'" 1 
ATOM   2745 C  "C5'" . DG  B 2 1   ? 31.504  -47.657 -33.052 1.00 73.49  ? 1    DG  P "C5'" 1 
ATOM   2746 C  "C4'" . DG  B 2 1   ? 32.176  -46.426 -33.594 1.00 72.72  ? 1    DG  P "C4'" 1 
ATOM   2747 O  "O4'" . DG  B 2 1   ? 31.648  -46.068 -34.879 1.00 72.64  ? 1    DG  P "O4'" 1 
ATOM   2748 C  "C3'" . DG  B 2 1   ? 31.902  -45.238 -32.706 1.00 72.54  ? 1    DG  P "C3'" 1 
ATOM   2749 O  "O3'" . DG  B 2 1   ? 33.067  -44.443 -32.721 1.00 72.31  ? 1    DG  P "O3'" 1 
ATOM   2750 C  "C2'" . DG  B 2 1   ? 30.731  -44.527 -33.363 1.00 72.76  ? 1    DG  P "C2'" 1 
ATOM   2751 C  "C1'" . DG  B 2 1   ? 30.969  -44.821 -34.824 1.00 72.62  ? 1    DG  P "C1'" 1 
ATOM   2752 N  N9    . DG  B 2 1   ? 29.752  -44.959 -35.610 1.00 72.38  ? 1    DG  P N9    1 
ATOM   2753 C  C8    . DG  B 2 1   ? 28.667  -45.742 -35.310 1.00 72.38  ? 1    DG  P C8    1 
ATOM   2754 N  N7    . DG  B 2 1   ? 27.714  -45.660 -36.192 1.00 72.16  ? 1    DG  P N7    1 
ATOM   2755 C  C5    . DG  B 2 1   ? 28.203  -44.778 -37.142 1.00 72.06  ? 1    DG  P C5    1 
ATOM   2756 C  C6    . DG  B 2 1   ? 27.618  -44.312 -38.329 1.00 71.93  ? 1    DG  P C6    1 
ATOM   2757 O  O6    . DG  B 2 1   ? 26.518  -44.593 -38.795 1.00 72.26  ? 1    DG  P O6    1 
ATOM   2758 N  N1    . DG  B 2 1   ? 28.453  -43.429 -39.001 1.00 72.13  ? 1    DG  P N1    1 
ATOM   2759 C  C2    . DG  B 2 1   ? 29.699  -43.045 -38.577 1.00 72.48  ? 1    DG  P C2    1 
ATOM   2760 N  N2    . DG  B 2 1   ? 30.353  -42.179 -39.368 1.00 73.32  ? 1    DG  P N2    1 
ATOM   2761 N  N3    . DG  B 2 1   ? 30.261  -43.477 -37.463 1.00 72.58  ? 1    DG  P N3    1 
ATOM   2762 C  C4    . DG  B 2 1   ? 29.460  -44.337 -36.799 1.00 72.26  ? 1    DG  P C4    1 
ATOM   2763 P  P     . DG  B 2 2   ? 33.148  -43.173 -31.734 1.00 71.58  ? 2    DG  P P     1 
ATOM   2764 O  OP1   . DG  B 2 2   ? 34.586  -43.105 -31.344 1.00 72.45  ? 2    DG  P OP1   1 
ATOM   2765 O  OP2   . DG  B 2 2   ? 32.090  -43.433 -30.686 1.00 71.80  ? 2    DG  P OP2   1 
ATOM   2766 O  "O5'" . DG  B 2 2   ? 32.704  -41.937 -32.658 1.00 73.47  ? 2    DG  P "O5'" 1 
ATOM   2767 C  "C5'" . DG  B 2 2   ? 32.429  -42.229 -34.038 1.00 74.73  ? 2    DG  P "C5'" 1 
ATOM   2768 C  "C4'" . DG  B 2 2   ? 32.287  -40.943 -34.806 1.00 75.43  ? 2    DG  P "C4'" 1 
ATOM   2769 O  "O4'" . DG  B 2 2   ? 31.152  -41.050 -35.695 1.00 75.24  ? 2    DG  P "O4'" 1 
ATOM   2770 C  "C3'" . DG  B 2 2   ? 31.979  -39.764 -33.891 1.00 76.54  ? 2    DG  P "C3'" 1 
ATOM   2771 O  "O3'" . DG  B 2 2   ? 32.522  -38.588 -34.475 1.00 79.22  ? 2    DG  P "O3'" 1 
ATOM   2772 C  "C2'" . DG  B 2 2   ? 30.463  -39.702 -33.892 1.00 75.51  ? 2    DG  P "C2'" 1 
ATOM   2773 C  "C1'" . DG  B 2 2   ? 30.127  -40.142 -35.306 1.00 74.45  ? 2    DG  P "C1'" 1 
ATOM   2774 N  N9    . DG  B 2 2   ? 28.848  -40.835 -35.429 1.00 72.78  ? 2    DG  P N9    1 
ATOM   2775 C  C8    . DG  B 2 2   ? 28.278  -41.691 -34.515 1.00 71.76  ? 2    DG  P C8    1 
ATOM   2776 N  N7    . DG  B 2 2   ? 27.121  -42.152 -34.896 1.00 71.06  ? 2    DG  P N7    1 
ATOM   2777 C  C5    . DG  B 2 2   ? 26.914  -41.575 -36.141 1.00 71.32  ? 2    DG  P C5    1 
ATOM   2778 C  C6    . DG  B 2 2   ? 25.843  -41.710 -37.032 1.00 71.00  ? 2    DG  P C6    1 
ATOM   2779 O  O6    . DG  B 2 2   ? 24.824  -42.390 -36.903 1.00 71.15  ? 2    DG  P O6    1 
ATOM   2780 N  N1    . DG  B 2 2   ? 26.038  -40.952 -38.181 1.00 70.59  ? 2    DG  P N1    1 
ATOM   2781 C  C2    . DG  B 2 2   ? 27.130  -40.163 -38.435 1.00 70.32  ? 2    DG  P C2    1 
ATOM   2782 N  N2    . DG  B 2 2   ? 27.143  -39.505 -39.593 1.00 69.98  ? 2    DG  P N2    1 
ATOM   2783 N  N3    . DG  B 2 2   ? 28.140  -40.029 -37.610 1.00 70.80  ? 2    DG  P N3    1 
ATOM   2784 C  C4    . DG  B 2 2   ? 27.970  -40.760 -36.486 1.00 71.79  ? 2    DG  P C4    1 
ATOM   2785 P  P     . DG  B 2 3   ? 32.747  -37.273 -33.586 1.00 80.89  ? 3    DG  P P     1 
ATOM   2786 O  OP1   . DG  B 2 3   ? 34.137  -37.313 -33.054 1.00 80.73  ? 3    DG  P OP1   1 
ATOM   2787 O  OP2   . DG  B 2 3   ? 31.601  -37.148 -32.645 1.00 82.36  ? 3    DG  P OP2   1 
ATOM   2788 O  "O5'" . DG  B 2 3   ? 32.636  -36.094 -34.652 1.00 80.72  ? 3    DG  P "O5'" 1 
ATOM   2789 C  "C5'" . DG  B 2 3   ? 32.929  -36.313 -36.037 1.00 81.59  ? 3    DG  P "C5'" 1 
ATOM   2790 C  "C4'" . DG  B 2 3   ? 32.106  -35.382 -36.898 1.00 82.06  ? 3    DG  P "C4'" 1 
ATOM   2791 O  "O4'" . DG  B 2 3   ? 30.828  -35.966 -37.241 1.00 81.90  ? 3    DG  P "O4'" 1 
ATOM   2792 C  "C3'" . DG  B 2 3   ? 31.790  -34.047 -36.235 1.00 82.71  ? 3    DG  P "C3'" 1 
ATOM   2793 O  "O3'" . DG  B 2 3   ? 31.761  -33.015 -37.219 1.00 84.13  ? 3    DG  P "O3'" 1 
ATOM   2794 C  "C2'" . DG  B 2 3   ? 30.404  -34.274 -35.659 1.00 82.26  ? 3    DG  P "C2'" 1 
ATOM   2795 C  "C1'" . DG  B 2 3   ? 29.772  -35.179 -36.708 1.00 81.10  ? 3    DG  P "C1'" 1 
ATOM   2796 N  N9    . DG  B 2 3   ? 28.764  -36.097 -36.191 1.00 79.67  ? 3    DG  P N9    1 
ATOM   2797 C  C8    . DG  B 2 3   ? 28.866  -36.895 -35.076 1.00 79.22  ? 3    DG  P C8    1 
ATOM   2798 N  N7    . DG  B 2 3   ? 27.797  -37.607 -34.856 1.00 78.44  ? 3    DG  P N7    1 
ATOM   2799 C  C5    . DG  B 2 3   ? 26.937  -37.268 -35.893 1.00 78.49  ? 3    DG  P C5    1 
ATOM   2800 C  C6    . DG  B 2 3   ? 25.631  -37.722 -36.182 1.00 78.11  ? 3    DG  P C6    1 
ATOM   2801 O  O6    . DG  B 2 3   ? 24.950  -38.542 -35.561 1.00 77.83  ? 3    DG  P O6    1 
ATOM   2802 N  N1    . DG  B 2 3   ? 25.121  -37.119 -37.326 1.00 77.70  ? 3    DG  P N1    1 
ATOM   2803 C  C2    . DG  B 2 3   ? 25.784  -36.197 -38.095 1.00 77.78  ? 3    DG  P C2    1 
ATOM   2804 N  N2    . DG  B 2 3   ? 25.120  -35.730 -39.163 1.00 77.66  ? 3    DG  P N2    1 
ATOM   2805 N  N3    . DG  B 2 3   ? 27.005  -35.764 -37.838 1.00 78.22  ? 3    DG  P N3    1 
ATOM   2806 C  C4    . DG  B 2 3   ? 27.519  -36.338 -36.727 1.00 78.80  ? 3    DG  P C4    1 
ATOM   2807 P  P     . DG  B 2 4   ? 31.610  -31.487 -36.754 1.00 84.48  ? 4    DG  P P     1 
ATOM   2808 O  OP1   . DG  B 2 4   ? 32.349  -30.662 -37.739 1.00 84.84  ? 4    DG  P OP1   1 
ATOM   2809 O  OP2   . DG  B 2 4   ? 31.936  -31.399 -35.313 1.00 84.65  ? 4    DG  P OP2   1 
ATOM   2810 O  "O5'" . DG  B 2 4   ? 30.053  -31.178 -36.926 1.00 84.82  ? 4    DG  P "O5'" 1 
ATOM   2811 C  "C5'" . DG  B 2 4   ? 29.523  -30.907 -38.225 1.00 85.45  ? 4    DG  P "C5'" 1 
ATOM   2812 C  "C4'" . DG  B 2 4   ? 28.015  -30.882 -38.183 1.00 86.51  ? 4    DG  P "C4'" 1 
ATOM   2813 O  "O4'" . DG  B 2 4   ? 27.513  -32.085 -37.560 1.00 86.75  ? 4    DG  P "O4'" 1 
ATOM   2814 C  "C3'" . DG  B 2 4   ? 27.416  -29.735 -37.366 1.00 87.31  ? 4    DG  P "C3'" 1 
ATOM   2815 O  "O3'" . DG  B 2 4   ? 26.180  -29.346 -37.946 1.00 88.70  ? 4    DG  P "O3'" 1 
ATOM   2816 C  "C2'" . DG  B 2 4   ? 27.046  -30.401 -36.064 1.00 86.95  ? 4    DG  P "C2'" 1 
ATOM   2817 C  "C1'" . DG  B 2 4   ? 26.515  -31.688 -36.641 1.00 86.14  ? 4    DG  P "C1'" 1 
ATOM   2818 N  N9    . DG  B 2 4   ? 26.340  -32.728 -35.650 1.00 84.95  ? 4    DG  P N9    1 
ATOM   2819 C  C8    . DG  B 2 4   ? 27.212  -33.070 -34.640 1.00 84.52  ? 4    DG  P C8    1 
ATOM   2820 N  N7    . DG  B 2 4   ? 26.761  -34.018 -33.868 1.00 83.95  ? 4    DG  P N7    1 
ATOM   2821 C  C5    . DG  B 2 4   ? 25.529  -34.342 -34.420 1.00 83.65  ? 4    DG  P C5    1 
ATOM   2822 C  C6    . DG  B 2 4   ? 24.596  -35.304 -34.036 1.00 83.31  ? 4    DG  P C6    1 
ATOM   2823 O  O6    . DG  B 2 4   ? 24.670  -36.103 -33.110 1.00 83.34  ? 4    DG  P O6    1 
ATOM   2824 N  N1    . DG  B 2 4   ? 23.475  -35.292 -34.865 1.00 82.88  ? 4    DG  P N1    1 
ATOM   2825 C  C2    . DG  B 2 4   ? 23.281  -34.453 -35.930 1.00 83.00  ? 4    DG  P C2    1 
ATOM   2826 N  N2    . DG  B 2 4   ? 22.125  -34.597 -36.596 1.00 82.78  ? 4    DG  P N2    1 
ATOM   2827 N  N3    . DG  B 2 4   ? 24.154  -33.545 -36.309 1.00 83.57  ? 4    DG  P N3    1 
ATOM   2828 C  C4    . DG  B 2 4   ? 25.254  -33.552 -35.518 1.00 83.94  ? 4    DG  P C4    1 
ATOM   2829 P  P     . DG  B 2 5   ? 25.484  -27.990 -37.467 1.00 89.50  ? 5    DG  P P     1 
ATOM   2830 O  OP1   . DG  B 2 5   ? 25.810  -27.062 -38.574 1.00 89.42  ? 5    DG  P OP1   1 
ATOM   2831 O  OP2   . DG  B 2 5   ? 25.902  -27.691 -36.072 1.00 89.40  ? 5    DG  P OP2   1 
ATOM   2832 O  "O5'" . DG  B 2 5   ? 23.929  -28.345 -37.460 1.00 88.75  ? 5    DG  P "O5'" 1 
ATOM   2833 C  "C5'" . DG  B 2 5   ? 23.056  -27.949 -36.398 1.00 87.75  ? 5    DG  P "C5'" 1 
ATOM   2834 C  "C4'" . DG  B 2 5   ? 21.881  -28.895 -36.283 1.00 87.26  ? 5    DG  P "C4'" 1 
ATOM   2835 O  "O4'" . DG  B 2 5   ? 22.328  -30.188 -35.788 1.00 87.01  ? 5    DG  P "O4'" 1 
ATOM   2836 C  "C3'" . DG  B 2 5   ? 20.792  -28.428 -35.309 1.00 87.17  ? 5    DG  P "C3'" 1 
ATOM   2837 O  "O3'" . DG  B 2 5   ? 19.476  -28.665 -35.828 1.00 86.84  ? 5    DG  P "O3'" 1 
ATOM   2838 C  "C2'" . DG  B 2 5   ? 20.998  -29.318 -34.105 1.00 87.13  ? 5    DG  P "C2'" 1 
ATOM   2839 C  "C1'" . DG  B 2 5   ? 21.441  -30.601 -34.756 1.00 86.97  ? 5    DG  P "C1'" 1 
ATOM   2840 N  N9    . DG  B 2 5   ? 22.142  -31.484 -33.830 1.00 86.95  ? 5    DG  P N9    1 
ATOM   2841 C  C8    . DG  B 2 5   ? 23.454  -31.415 -33.433 1.00 86.35  ? 5    DG  P C8    1 
ATOM   2842 N  N7    . DG  B 2 5   ? 23.777  -32.335 -32.567 1.00 86.23  ? 5    DG  P N7    1 
ATOM   2843 C  C5    . DG  B 2 5   ? 22.609  -33.060 -32.383 1.00 86.67  ? 5    DG  P C5    1 
ATOM   2844 C  C6    . DG  B 2 5   ? 22.345  -34.183 -31.561 1.00 86.85  ? 5    DG  P C6    1 
ATOM   2845 O  O6    . DG  B 2 5   ? 23.118  -34.786 -30.807 1.00 87.27  ? 5    DG  P O6    1 
ATOM   2846 N  N1    . DG  B 2 5   ? 21.023  -34.598 -31.677 1.00 86.70  ? 5    DG  P N1    1 
ATOM   2847 C  C2    . DG  B 2 5   ? 20.079  -34.011 -32.484 1.00 86.96  ? 5    DG  P C2    1 
ATOM   2848 N  N2    . DG  B 2 5   ? 18.860  -34.544 -32.466 1.00 86.51  ? 5    DG  P N2    1 
ATOM   2849 N  N3    . DG  B 2 5   ? 20.314  -32.971 -33.255 1.00 87.01  ? 5    DG  P N3    1 
ATOM   2850 C  C4    . DG  B 2 5   ? 21.591  -32.549 -33.157 1.00 86.95  ? 5    DG  P C4    1 
ATOM   2851 P  P     . DA  B 2 6   ? 18.386  -27.479 -35.812 1.00 86.49  ? 6    DA  P P     1 
ATOM   2852 O  OP1   . DA  B 2 6   ? 17.957  -27.323 -37.222 1.00 86.36  ? 6    DA  P OP1   1 
ATOM   2853 O  OP2   . DA  B 2 6   ? 18.989  -26.326 -35.087 1.00 86.45  ? 6    DA  P OP2   1 
ATOM   2854 O  "O5'" . DA  B 2 6   ? 17.146  -28.055 -34.980 1.00 85.51  ? 6    DA  P "O5'" 1 
ATOM   2855 C  "C5'" . DA  B 2 6   ? 15.838  -27.426 -34.919 1.00 84.74  ? 6    DA  P "C5'" 1 
ATOM   2856 C  "C4'" . DA  B 2 6   ? 14.817  -28.388 -34.338 1.00 84.78  ? 6    DA  P "C4'" 1 
ATOM   2857 O  "O4'" . DA  B 2 6   ? 15.543  -29.523 -33.829 1.00 84.74  ? 6    DA  P "O4'" 1 
ATOM   2858 C  "C3'" . DA  B 2 6   ? 14.014  -27.868 -33.140 1.00 85.14  ? 6    DA  P "C3'" 1 
ATOM   2859 O  "O3'" . DA  B 2 6   ? 12.789  -28.621 -32.929 1.00 85.48  ? 6    DA  P "O3'" 1 
ATOM   2860 C  "C2'" . DA  B 2 6   ? 14.973  -28.120 -31.996 1.00 84.77  ? 6    DA  P "C2'" 1 
ATOM   2861 C  "C1'" . DA  B 2 6   ? 15.652  -29.412 -32.421 1.00 84.05  ? 6    DA  P "C1'" 1 
ATOM   2862 N  N9    . DA  B 2 6   ? 17.066  -29.541 -32.076 1.00 83.37  ? 6    DA  P N9    1 
ATOM   2863 C  C8    . DA  B 2 6   ? 18.139  -28.835 -32.541 1.00 82.89  ? 6    DA  P C8    1 
ATOM   2864 N  N7    . DA  B 2 6   ? 19.284  -29.234 -32.049 1.00 82.04  ? 6    DA  P N7    1 
ATOM   2865 C  C5    . DA  B 2 6   ? 18.936  -30.277 -31.201 1.00 82.53  ? 6    DA  P C5    1 
ATOM   2866 C  C6    . DA  B 2 6   ? 19.689  -31.135 -30.384 1.00 82.40  ? 6    DA  P C6    1 
ATOM   2867 N  N6    . DA  B 2 6   ? 21.021  -31.097 -30.291 1.00 81.73  ? 6    DA  P N6    1 
ATOM   2868 N  N1    . DA  B 2 6   ? 19.018  -32.053 -29.657 1.00 82.56  ? 6    DA  P N1    1 
ATOM   2869 C  C2    . DA  B 2 6   ? 17.683  -32.103 -29.753 1.00 82.73  ? 6    DA  P C2    1 
ATOM   2870 N  N3    . DA  B 2 6   ? 16.869  -31.364 -30.485 1.00 82.87  ? 6    DA  P N3    1 
ATOM   2871 C  C4    . DA  B 2 6   ? 17.567  -30.463 -31.197 1.00 82.92  ? 6    DA  P C4    1 
ATOM   2872 P  P     . DA  B 2 7   ? 11.701  -28.113 -31.837 1.00 86.24  ? 7    DA  P P     1 
ATOM   2873 O  OP1   . DA  B 2 7   ? 10.455  -27.751 -32.553 1.00 86.26  ? 7    DA  P OP1   1 
ATOM   2874 O  OP2   . DA  B 2 7   ? 12.353  -27.120 -30.948 1.00 86.16  ? 7    DA  P OP2   1 
ATOM   2875 O  "O5'" . DA  B 2 7   ? 11.339  -29.364 -30.916 1.00 84.27  ? 7    DA  P "O5'" 1 
ATOM   2876 C  "C5'" . DA  B 2 7   ? 10.670  -29.094 -29.672 1.00 81.81  ? 7    DA  P "C5'" 1 
ATOM   2877 C  "C4'" . DA  B 2 7   ? 11.202  -29.943 -28.540 1.00 81.22  ? 7    DA  P "C4'" 1 
ATOM   2878 O  "O4'" . DA  B 2 7   ? 12.605  -30.225 -28.767 1.00 80.86  ? 7    DA  P "O4'" 1 
ATOM   2879 C  "C3'" . DA  B 2 7   ? 11.101  -29.299 -27.150 1.00 81.07  ? 7    DA  P "C3'" 1 
ATOM   2880 O  "O3'" . DA  B 2 7   ? 10.649  -30.250 -26.169 1.00 81.24  ? 7    DA  P "O3'" 1 
ATOM   2881 C  "C2'" . DA  B 2 7   ? 12.528  -28.851 -26.867 1.00 80.55  ? 7    DA  P "C2'" 1 
ATOM   2882 C  "C1'" . DA  B 2 7   ? 13.354  -29.886 -27.617 1.00 80.41  ? 7    DA  P "C1'" 1 
ATOM   2883 N  N9    . DA  B 2 7   ? 14.700  -29.482 -28.041 1.00 80.55  ? 7    DA  P N9    1 
ATOM   2884 C  C8    . DA  B 2 7   ? 15.107  -28.595 -29.010 1.00 80.65  ? 7    DA  P C8    1 
ATOM   2885 N  N7    . DA  B 2 7   ? 16.414  -28.487 -29.113 1.00 80.04  ? 7    DA  P N7    1 
ATOM   2886 C  C5    . DA  B 2 7   ? 16.896  -29.358 -28.144 1.00 79.67  ? 7    DA  P C5    1 
ATOM   2887 C  C6    . DA  B 2 7   ? 18.200  -29.705 -27.735 1.00 79.16  ? 7    DA  P C6    1 
ATOM   2888 N  N6    . DA  B 2 7   ? 19.312  -29.185 -28.263 1.00 78.56  ? 7    DA  P N6    1 
ATOM   2889 N  N1    . DA  B 2 7   ? 18.323  -30.617 -26.746 1.00 79.62  ? 7    DA  P N1    1 
ATOM   2890 C  C2    . DA  B 2 7   ? 17.214  -31.131 -26.204 1.00 80.23  ? 7    DA  P C2    1 
ATOM   2891 N  N3    . DA  B 2 7   ? 15.944  -30.881 -26.495 1.00 80.19  ? 7    DA  P N3    1 
ATOM   2892 C  C4    . DA  B 2 7   ? 15.852  -29.977 -27.484 1.00 80.08  ? 7    DA  P C4    1 
ATOM   2893 P  P     . DG  B 2 8   ? 9.690   -29.783 -24.954 1.00 81.49  ? 8    DG  P P     1 
ATOM   2894 O  OP1   . DG  B 2 8   ? 8.279   -30.079 -25.309 1.00 81.35  ? 8    DG  P OP1   1 
ATOM   2895 O  OP2   . DG  B 2 8   ? 10.074  -28.415 -24.523 1.00 81.54  ? 8    DG  P OP2   1 
ATOM   2896 O  "O5'" . DG  B 2 8   ? 10.065  -30.765 -23.764 1.00 81.86  ? 8    DG  P "O5'" 1 
ATOM   2897 C  "C5'" . DG  B 2 8   ? 11.183  -31.634 -23.878 1.00 82.25  ? 8    DG  P "C5'" 1 
ATOM   2898 C  "C4'" . DG  B 2 8   ? 11.915  -31.759 -22.563 1.00 81.99  ? 8    DG  P "C4'" 1 
ATOM   2899 O  "O4'" . DG  B 2 8   ? 13.281  -31.322 -22.732 1.00 81.80  ? 8    DG  P "O4'" 1 
ATOM   2900 C  "C3'" . DG  B 2 8   ? 11.363  -30.970 -21.378 1.00 81.55  ? 8    DG  P "C3'" 1 
ATOM   2901 O  "O3'" . DG  B 2 8   ? 11.510  -31.805 -20.219 1.00 81.94  ? 8    DG  P "O3'" 1 
ATOM   2902 C  "C2'" . DG  B 2 8   ? 12.220  -29.711 -21.373 1.00 81.36  ? 8    DG  P "C2'" 1 
ATOM   2903 C  "C1'" . DG  B 2 8   ? 13.564  -30.216 -21.888 1.00 81.67  ? 8    DG  P "C1'" 1 
ATOM   2904 N  N9    . DG  B 2 8   ? 14.364  -29.279 -22.674 1.00 82.44  ? 8    DG  P N9    1 
ATOM   2905 C  C8    . DG  B 2 8   ? 13.922  -28.234 -23.453 1.00 82.93  ? 8    DG  P C8    1 
ATOM   2906 N  N7    . DG  B 2 8   ? 14.888  -27.620 -24.081 1.00 83.20  ? 8    DG  P N7    1 
ATOM   2907 C  C5    . DG  B 2 8   ? 16.037  -28.292 -23.685 1.00 83.03  ? 8    DG  P C5    1 
ATOM   2908 C  C6    . DG  B 2 8   ? 17.393  -28.091 -24.042 1.00 82.94  ? 8    DG  P C6    1 
ATOM   2909 O  O6    . DG  B 2 8   ? 17.874  -27.257 -24.823 1.00 82.97  ? 8    DG  P O6    1 
ATOM   2910 N  N1    . DG  B 2 8   ? 18.229  -28.993 -23.392 1.00 82.77  ? 8    DG  P N1    1 
ATOM   2911 C  C2    . DG  B 2 8   ? 17.817  -29.965 -22.516 1.00 83.20  ? 8    DG  P C2    1 
ATOM   2912 N  N2    . DG  B 2 8   ? 18.764  -30.734 -21.972 1.00 82.91  ? 8    DG  P N2    1 
ATOM   2913 N  N3    . DG  B 2 8   ? 16.562  -30.171 -22.190 1.00 83.19  ? 8    DG  P N3    1 
ATOM   2914 C  C4    . DG  B 2 8   ? 15.731  -29.306 -22.804 1.00 82.99  ? 8    DG  P C4    1 
ATOM   2915 P  P     . DG  B 2 9   ? 11.533  -31.223 -18.722 1.00 82.49  ? 9    DG  P P     1 
ATOM   2916 O  OP1   . DG  B 2 9   ? 10.607  -32.030 -17.891 1.00 83.07  ? 9    DG  P OP1   1 
ATOM   2917 O  OP2   . DG  B 2 9   ? 11.417  -29.745 -18.717 1.00 83.00  ? 9    DG  P OP2   1 
ATOM   2918 O  "O5'" . DG  B 2 9   ? 12.993  -31.628 -18.262 1.00 81.44  ? 9    DG  P "O5'" 1 
ATOM   2919 C  "C5'" . DG  B 2 9   ? 13.715  -30.928 -17.277 1.00 81.20  ? 9    DG  P "C5'" 1 
ATOM   2920 C  "C4'" . DG  B 2 9   ? 15.156  -31.321 -17.469 1.00 79.69  ? 9    DG  P "C4'" 1 
ATOM   2921 O  "O4'" . DG  B 2 9   ? 15.656  -30.741 -18.698 1.00 80.04  ? 9    DG  P "O4'" 1 
ATOM   2922 C  "C3'" . DG  B 2 9   ? 16.091  -30.853 -16.366 1.00 78.59  ? 9    DG  P "C3'" 1 
ATOM   2923 O  "O3'" . DG  B 2 9   ? 17.068  -31.869 -16.167 1.00 76.46  ? 9    DG  P "O3'" 1 
ATOM   2924 C  "C2'" . DG  B 2 9   ? 16.712  -29.598 -16.944 1.00 79.22  ? 9    DG  P "C2'" 1 
ATOM   2925 C  "C1'" . DG  B 2 9   ? 16.764  -29.896 -18.425 1.00 79.83  ? 9    DG  P "C1'" 1 
ATOM   2926 N  N9    . DG  B 2 9   ? 16.660  -28.714 -19.277 1.00 79.72  ? 9    DG  P N9    1 
ATOM   2927 C  C8    . DG  B 2 9   ? 15.522  -28.165 -19.822 1.00 79.95  ? 9    DG  P C8    1 
ATOM   2928 N  N7    . DG  B 2 9   ? 15.765  -27.128 -20.578 1.00 79.74  ? 9    DG  P N7    1 
ATOM   2929 C  C5    . DG  B 2 9   ? 17.143  -26.980 -20.523 1.00 79.24  ? 9    DG  P C5    1 
ATOM   2930 C  C6    . DG  B 2 9   ? 17.991  -26.037 -21.154 1.00 79.00  ? 9    DG  P C6    1 
ATOM   2931 O  O6    . DG  B 2 9   ? 17.690  -25.130 -21.939 1.00 78.83  ? 9    DG  P O6    1 
ATOM   2932 N  N1    . DG  B 2 9   ? 19.320  -26.236 -20.801 1.00 78.24  ? 9    DG  P N1    1 
ATOM   2933 C  C2    . DG  B 2 9   ? 19.776  -27.221 -19.960 1.00 77.99  ? 9    DG  P C2    1 
ATOM   2934 N  N2    . DG  B 2 9   ? 21.081  -27.248 -19.720 1.00 77.29  ? 9    DG  P N2    1 
ATOM   2935 N  N3    . DG  B 2 9   ? 19.002  -28.115 -19.388 1.00 78.97  ? 9    DG  P N3    1 
ATOM   2936 C  C4    . DG  B 2 9   ? 17.706  -27.938 -19.709 1.00 79.35  ? 9    DG  P C4    1 
ATOM   2937 P  P     . DA  B 2 10  ? 17.380  -32.412 -14.691 1.00 74.53  ? 10   DA  P P     1 
ATOM   2938 O  OP1   . DA  B 2 10  ? 17.259  -33.889 -14.750 1.00 75.12  ? 10   DA  P OP1   1 
ATOM   2939 O  OP2   . DA  B 2 10  ? 16.583  -31.625 -13.713 1.00 74.15  ? 10   DA  P OP2   1 
ATOM   2940 O  "O5'" . DA  B 2 10  ? 18.915  -32.055 -14.501 1.00 74.07  ? 10   DA  P "O5'" 1 
ATOM   2941 C  "C5'" . DA  B 2 10  ? 19.489  -31.130 -15.418 1.00 72.88  ? 10   DA  P "C5'" 1 
ATOM   2942 C  "C4'" . DA  B 2 10  ? 20.351  -30.106 -14.719 1.00 71.83  ? 10   DA  P "C4'" 1 
ATOM   2943 O  "O4'" . DA  B 2 10  ? 20.192  -28.857 -15.432 1.00 71.42  ? 10   DA  P "O4'" 1 
ATOM   2944 C  "C3'" . DA  B 2 10  ? 19.962  -29.795 -13.276 1.00 71.23  ? 10   DA  P "C3'" 1 
ATOM   2945 O  "O3'" . DA  B 2 10  ? 21.156  -29.466 -12.548 1.00 69.94  ? 10   DA  P "O3'" 1 
ATOM   2946 C  "C2'" . DA  B 2 10  ? 19.023  -28.612 -13.417 1.00 70.99  ? 10   DA  P "C2'" 1 
ATOM   2947 C  "C1'" . DA  B 2 10  ? 19.628  -27.861 -14.584 1.00 71.79  ? 10   DA  P "C1'" 1 
ATOM   2948 N  N9    . DA  B 2 10  ? 18.669  -27.100 -15.383 1.00 73.41  ? 10   DA  P N9    1 
ATOM   2949 C  C8    . DA  B 2 10  ? 17.305  -27.234 -15.449 1.00 74.13  ? 10   DA  P C8    1 
ATOM   2950 N  N7    . DA  B 2 10  ? 16.741  -26.462 -16.342 1.00 74.59  ? 10   DA  P N7    1 
ATOM   2951 C  C5    . DA  B 2 10  ? 17.801  -25.751 -16.881 1.00 74.46  ? 10   DA  P C5    1 
ATOM   2952 C  C6    . DA  B 2 10  ? 17.869  -24.780 -17.887 1.00 73.91  ? 10   DA  P C6    1 
ATOM   2953 N  N6    . DA  B 2 10  ? 16.809  -24.364 -18.584 1.00 73.55  ? 10   DA  P N6    1 
ATOM   2954 N  N1    . DA  B 2 10  ? 19.078  -24.253 -18.168 1.00 73.98  ? 10   DA  P N1    1 
ATOM   2955 C  C2    . DA  B 2 10  ? 20.143  -24.692 -17.489 1.00 74.55  ? 10   DA  P C2    1 
ATOM   2956 N  N3    . DA  B 2 10  ? 20.210  -25.612 -16.536 1.00 75.06  ? 10   DA  P N3    1 
ATOM   2957 C  C4    . DA  B 2 10  ? 18.990  -26.111 -16.278 1.00 74.62  ? 10   DA  P C4    1 
ATOM   2958 P  P     . DA  B 2 11  ? 21.122  -28.446 -11.304 1.00 68.13  ? 11   DA  P P     1 
ATOM   2959 O  OP1   . DA  B 2 11  ? 22.132  -28.900 -10.317 1.00 67.59  ? 11   DA  P OP1   1 
ATOM   2960 O  OP2   . DA  B 2 11  ? 19.714  -28.279 -10.868 1.00 68.31  ? 11   DA  P OP2   1 
ATOM   2961 O  "O5'" . DA  B 2 11  ? 21.621  -27.079 -11.947 1.00 68.48  ? 11   DA  P "O5'" 1 
ATOM   2962 C  "C5'" . DA  B 2 11  ? 22.850  -27.060 -12.663 1.00 69.57  ? 11   DA  P "C5'" 1 
ATOM   2963 C  "C4'" . DA  B 2 11  ? 23.436  -25.680 -12.627 1.00 70.27  ? 11   DA  P "C4'" 1 
ATOM   2964 O  "O4'" . DA  B 2 11  ? 22.702  -24.709 -13.388 1.00 70.00  ? 11   DA  P "O4'" 1 
ATOM   2965 C  "C3'" . DA  B 2 11  ? 23.400  -25.183 -11.213 1.00 70.88  ? 11   DA  P "C3'" 1 
ATOM   2966 O  "O3'" . DA  B 2 11  ? 24.591  -24.400 -11.053 1.00 72.31  ? 11   DA  P "O3'" 1 
ATOM   2967 C  "C2'" . DA  B 2 11  ? 22.191  -24.258 -11.168 1.00 70.69  ? 11   DA  P "C2'" 1 
ATOM   2968 C  "C1'" . DA  B 2 11  ? 22.142  -23.702 -12.562 1.00 70.38  ? 11   DA  P "C1'" 1 
ATOM   2969 N  N9    . DA  B 2 11  ? 20.789  -23.449 -13.052 1.00 71.63  ? 11   DA  P N9    1 
ATOM   2970 C  C8    . DA  B 2 11  ? 19.601  -23.884 -12.511 1.00 71.91  ? 11   DA  P C8    1 
ATOM   2971 N  N7    . DA  B 2 11  ? 18.544  -23.489 -13.170 1.00 72.69  ? 11   DA  P N7    1 
ATOM   2972 C  C5    . DA  B 2 11  ? 19.064  -22.752 -14.222 1.00 73.40  ? 11   DA  P C5    1 
ATOM   2973 C  C6    . DA  B 2 11  ? 18.451  -22.069 -15.283 1.00 74.22  ? 11   DA  P C6    1 
ATOM   2974 N  N6    . DA  B 2 11  ? 17.132  -22.020 -15.469 1.00 74.38  ? 11   DA  P N6    1 
ATOM   2975 N  N1    . DA  B 2 11  ? 19.250  -21.429 -16.162 1.00 75.30  ? 11   DA  P N1    1 
ATOM   2976 C  C2    . DA  B 2 11  ? 20.579  -21.479 -15.980 1.00 74.98  ? 11   DA  P C2    1 
ATOM   2977 N  N3    . DA  B 2 11  ? 21.275  -22.092 -15.023 1.00 74.28  ? 11   DA  P N3    1 
ATOM   2978 C  C4    . DA  B 2 11  ? 20.448  -22.718 -14.164 1.00 73.08  ? 11   DA  P C4    1 
ATOM   2979 P  P     . DA  B 2 12  ? 24.619  -23.209 -9.942  1.00 72.70  ? 12   DA  P P     1 
ATOM   2980 O  OP1   . DA  B 2 12  ? 26.064  -23.264 -9.578  1.00 73.11  ? 12   DA  P OP1   1 
ATOM   2981 O  OP2   . DA  B 2 12  ? 23.518  -23.659 -8.937  1.00 72.90  ? 12   DA  P OP2   1 
ATOM   2982 O  "O5'" . DA  B 2 12  ? 24.115  -21.929 -10.789 1.00 70.88  ? 12   DA  P "O5'" 1 
ATOM   2983 C  "C5'" . DA  B 2 12  ? 24.735  -21.732 -12.078 1.00 70.79  ? 12   DA  P "C5'" 1 
ATOM   2984 C  "C4'" . DA  B 2 12  ? 24.845  -20.232 -12.286 1.00 71.26  ? 12   DA  P "C4'" 1 
ATOM   2985 O  "O4'" . DA  B 2 12  ? 23.638  -19.796 -12.989 1.00 71.01  ? 12   DA  P "O4'" 1 
ATOM   2986 C  "C3'" . DA  B 2 12  ? 24.923  -19.389 -10.977 1.00 71.85  ? 12   DA  P "C3'" 1 
ATOM   2987 O  "O3'" . DA  B 2 12  ? 25.662  -18.189 -11.071 1.00 73.21  ? 12   DA  P "O3'" 1 
ATOM   2988 C  "C2'" . DA  B 2 12  ? 23.465  -19.082 -10.743 1.00 71.02  ? 12   DA  P "C2'" 1 
ATOM   2989 C  "C1'" . DA  B 2 12  ? 22.926  -18.889 -12.164 1.00 70.51  ? 12   DA  P "C1'" 1 
ATOM   2990 N  N9    . DA  B 2 12  ? 21.502  -19.194 -12.300 1.00 70.40  ? 12   DA  P N9    1 
ATOM   2991 C  C8    . DA  B 2 12  ? 20.743  -20.039 -11.519 1.00 70.21  ? 12   DA  P C8    1 
ATOM   2992 N  N7    . DA  B 2 12  ? 19.488  -20.109 -11.881 1.00 70.57  ? 12   DA  P N7    1 
ATOM   2993 C  C5    . DA  B 2 12  ? 19.410  -19.263 -12.977 1.00 70.83  ? 12   DA  P C5    1 
ATOM   2994 C  C6    . DA  B 2 12  ? 18.340  -18.899 -13.811 1.00 70.63  ? 12   DA  P C6    1 
ATOM   2995 N  N6    . DA  B 2 12  ? 17.095  -19.362 -13.665 1.00 70.49  ? 12   DA  P N6    1 
ATOM   2996 N  N1    . DA  B 2 12  ? 18.593  -18.030 -14.810 1.00 70.15  ? 12   DA  P N1    1 
ATOM   2997 C  C2    . DA  B 2 12  ? 19.837  -17.560 -14.955 1.00 69.76  ? 12   DA  P C2    1 
ATOM   2998 N  N3    . DA  B 2 12  ? 20.926  -17.824 -14.239 1.00 70.19  ? 12   DA  P N3    1 
ATOM   2999 C  C4    . DA  B 2 12  ? 20.643  -18.692 -13.250 1.00 70.47  ? 12   DA  P C4    1 
ATOM   3000 P  P     . DG  B 2 13  ? 25.901  -17.255 -9.819  1.00 74.21  ? 13   DG  P P     1 
ATOM   3001 O  OP1   . DG  B 2 13  ? 27.282  -17.305 -9.387  1.00 74.08  ? 13   DG  P OP1   1 
ATOM   3002 O  OP2   . DG  B 2 13  ? 24.889  -17.216 -8.831  1.00 73.95  ? 13   DG  P OP2   1 
ATOM   3003 P  P     . DG  C 3 4   ? 4.030   -21.427 -6.866  1.00 87.77  ? 3    DG  T P     1 
ATOM   3004 O  OP1   . DG  C 3 4   ? 3.111   -20.280 -6.693  1.00 87.56  ? 3    DG  T OP1   1 
ATOM   3005 O  OP2   . DG  C 3 4   ? 3.796   -22.682 -6.116  1.00 87.61  ? 3    DG  T OP2   1 
ATOM   3006 O  "O5'" . DG  C 3 4   ? 4.122   -21.791 -8.421  1.00 87.48  ? 3    DG  T "O5'" 1 
ATOM   3007 C  "C5'" . DG  C 3 4   ? 4.727   -20.879 -9.331  1.00 88.14  ? 3    DG  T "C5'" 1 
ATOM   3008 C  "C4'" . DG  C 3 4   ? 4.913   -19.518 -8.686  1.00 87.99  ? 3    DG  T "C4'" 1 
ATOM   3009 O  "O4'" . DG  C 3 4   ? 5.455   -19.688 -7.351  1.00 87.99  ? 3    DG  T "O4'" 1 
ATOM   3010 C  "C3'" . DG  C 3 4   ? 5.886   -18.594 -9.408  1.00 87.70  ? 3    DG  T "C3'" 1 
ATOM   3011 O  "O3'" . DG  C 3 4   ? 5.509   -17.238 -9.207  1.00 87.75  ? 3    DG  T "O3'" 1 
ATOM   3012 C  "C2'" . DG  C 3 4   ? 7.209   -18.915 -8.721  1.00 87.88  ? 3    DG  T "C2'" 1 
ATOM   3013 C  "C1'" . DG  C 3 4   ? 6.725   -19.152 -7.256  1.00 88.97  ? 3    DG  T "C1'" 1 
ATOM   3014 N  N9    . DG  C 3 4   ? 7.374   -20.424 -6.718  1.00 90.19  ? 3    DG  T N9    1 
ATOM   3015 C  C8    . DG  C 3 4   ? 8.684   -20.619 -6.914  1.00 92.05  ? 3    DG  T C8    1 
ATOM   3016 N  N7    . DG  C 3 4   ? 9.238   -21.350 -6.125  1.00 92.46  ? 3    DG  T N7    1 
ATOM   3017 C  C5    . DG  C 3 4   ? 8.231   -21.938 -5.331  1.00 90.76  ? 3    DG  T C5    1 
ATOM   3018 C  C6    . DG  C 3 4   ? 8.326   -22.900 -4.274  1.00 89.92  ? 3    DG  T C6    1 
ATOM   3019 O  O6    . DG  C 3 4   ? 9.375   -23.440 -3.876  1.00 90.78  ? 3    DG  T O6    1 
ATOM   3020 N  N1    . DG  C 3 4   ? 7.093   -23.282 -3.680  1.00 89.06  ? 3    DG  T N1    1 
ATOM   3021 C  C2    . DG  C 3 4   ? 5.908   -22.743 -4.028  1.00 88.74  ? 3    DG  T C2    1 
ATOM   3022 N  N2    . DG  C 3 4   ? 4.833   -23.142 -3.285  1.00 89.99  ? 3    DG  T N2    1 
ATOM   3023 N  N3    . DG  C 3 4   ? 5.780   -21.810 -5.030  1.00 89.43  ? 3    DG  T N3    1 
ATOM   3024 C  C4    . DG  C 3 4   ? 7.002   -21.402 -5.654  1.00 90.14  ? 3    DG  T C4    1 
ATOM   3025 P  P     . DG  C 3 5   ? 5.485   -16.223 -10.443 1.00 88.15  ? 4    DG  T P     1 
ATOM   3026 O  OP1   . DG  C 3 5   ? 4.184   -15.518 -10.429 1.00 86.77  ? 4    DG  T OP1   1 
ATOM   3027 O  OP2   . DG  C 3 5   ? 5.908   -16.967 -11.651 1.00 87.69  ? 4    DG  T OP2   1 
ATOM   3028 O  "O5'" . DG  C 3 5   ? 6.703   -15.285 -10.105 1.00 89.15  ? 4    DG  T "O5'" 1 
ATOM   3029 C  "C5'" . DG  C 3 5   ? 7.876   -15.790 -9.478  1.00 88.42  ? 4    DG  T "C5'" 1 
ATOM   3030 C  "C4'" . DG  C 3 5   ? 9.091   -15.589 -10.366 1.00 86.36  ? 4    DG  T "C4'" 1 
ATOM   3031 O  "O4'" . DG  C 3 5   ? 10.264  -16.133 -9.708  1.00 86.54  ? 4    DG  T "O4'" 1 
ATOM   3032 C  "C3'" . DG  C 3 5   ? 8.885   -16.356 -11.687 1.00 85.22  ? 4    DG  T "C3'" 1 
ATOM   3033 O  "O3'" . DG  C 3 5   ? 9.530   -15.654 -12.741 1.00 82.34  ? 4    DG  T "O3'" 1 
ATOM   3034 C  "C2'" . DG  C 3 5   ? 9.651   -17.643 -11.410 1.00 83.80  ? 4    DG  T "C2'" 1 
ATOM   3035 C  "C1'" . DG  C 3 5   ? 10.729  -17.270 -10.430 1.00 85.32  ? 4    DG  T "C1'" 1 
ATOM   3036 N  N9    . DG  C 3 5   ? 11.198  -18.454 -9.447  1.00 85.12  ? 4    DG  T N9    1 
ATOM   3037 C  C8    . DG  C 3 5   ? 10.655  -19.761 -9.014  1.00 88.24  ? 4    DG  T C8    1 
ATOM   3038 N  N7    . DG  C 3 5   ? 11.345  -20.190 -7.892  1.00 88.81  ? 4    DG  T N7    1 
ATOM   3039 C  C5    . DG  C 3 5   ? 12.339  -19.272 -7.815  1.00 84.92  ? 4    DG  T C5    1 
ATOM   3040 C  C6    . DG  C 3 5   ? 13.315  -19.246 -6.928  1.00 82.31  ? 4    DG  T C6    1 
ATOM   3041 O  O6    . DG  C 3 5   ? 13.539  -20.052 -6.063  1.00 81.19  ? 4    DG  T O6    1 
ATOM   3042 N  N1    . DG  C 3 5   ? 14.179  -18.170 -7.126  1.00 80.93  ? 4    DG  T N1    1 
ATOM   3043 C  C2    . DG  C 3 5   ? 14.015  -17.196 -8.096  1.00 80.39  ? 4    DG  T C2    1 
ATOM   3044 N  N2    . DG  C 3 5   ? 14.909  -16.258 -8.128  1.00 79.98  ? 4    DG  T N2    1 
ATOM   3045 N  N3    . DG  C 3 5   ? 13.054  -17.197 -8.936  1.00 81.43  ? 4    DG  T N3    1 
ATOM   3046 C  C4    . DG  C 3 5   ? 12.222  -18.231 -8.749  1.00 83.87  ? 4    DG  T C4    1 
ATOM   3047 O  OP1   . DC  C 3 6   ? 9.553   -13.289 -13.527 1.00 80.63  ? 5    DC  T OP1   1 
ATOM   3048 O  OP2   . DC  C 3 6   ? 7.344   -14.499 -13.054 1.00 78.88  ? 5    DC  T OP2   1 
ATOM   3049 O  "O5'" . DC  C 3 6   ? 8.717   -15.102 -15.044 1.00 77.53  ? 5    DC  T "O5'" 1 
ATOM   3050 C  "C5'" . DC  C 3 6   ? 9.911   -15.037 -15.775 1.00 71.75  ? 5    DC  T "C5'" 1 
ATOM   3051 C  "C4'" . DC  C 3 6   ? 10.585  -13.596 -15.914 1.00 69.06  ? 5    DC  T "C4'" 1 
ATOM   3052 O  "O4'" . DC  C 3 6   ? 11.587  -13.486 -14.875 1.00 68.17  ? 5    DC  T "O4'" 1 
ATOM   3053 C  "C3'" . DC  C 3 6   ? 11.319  -13.549 -17.240 1.00 68.48  ? 5    DC  T "C3'" 1 
ATOM   3054 O  "O3'" . DC  C 3 6   ? 11.428  -12.212 -17.698 1.00 67.81  ? 5    DC  T "O3'" 1 
ATOM   3055 C  "C2'" . DC  C 3 6   ? 12.702  -14.014 -16.859 1.00 68.00  ? 5    DC  T "C2'" 1 
ATOM   3056 C  "C1'" . DC  C 3 6   ? 12.881  -13.538 -15.429 1.00 68.19  ? 5    DC  T "C1'" 1 
ATOM   3057 N  N1    . DC  C 3 6   ? 13.727  -14.381 -14.548 1.00 68.56  ? 5    DC  T N1    1 
ATOM   3058 C  C2    . DC  C 3 6   ? 13.193  -15.546 -13.972 1.00 68.97  ? 5    DC  T C2    1 
ATOM   3059 O  O2    . DC  C 3 6   ? 12.030  -15.858 -14.228 1.00 68.99  ? 5    DC  T O2    1 
ATOM   3060 N  N3    . DC  C 3 6   ? 13.962  -16.305 -13.163 1.00 69.92  ? 5    DC  T N3    1 
ATOM   3061 C  C4    . DC  C 3 6   ? 15.225  -15.952 -12.925 1.00 70.74  ? 5    DC  T C4    1 
ATOM   3062 N  N4    . DC  C 3 6   ? 15.955  -16.739 -12.134 1.00 70.73  ? 5    DC  T N4    1 
ATOM   3063 C  C5    . DC  C 3 6   ? 15.799  -14.775 -13.493 1.00 70.30  ? 5    DC  T C5    1 
ATOM   3064 C  C6    . DC  C 3 6   ? 15.021  -14.026 -14.290 1.00 69.25  ? 5    DC  T C6    1 
ATOM   3065 P  P     . DT  C 3 7   ? 11.899  -11.912 -19.207 1.00 67.24  ? 6    DT  T P     1 
ATOM   3066 O  OP1   . DT  C 3 7   ? 11.822  -10.442 -19.424 1.00 65.53  ? 6    DT  T OP1   1 
ATOM   3067 O  OP2   . DT  C 3 7   ? 11.141  -12.830 -20.100 1.00 66.68  ? 6    DT  T OP2   1 
ATOM   3068 O  "O5'" . DT  C 3 7   ? 13.434  -12.352 -19.210 1.00 66.44  ? 6    DT  T "O5'" 1 
ATOM   3069 C  "C5'" . DT  C 3 7   ? 14.382  -11.649 -18.396 1.00 64.53  ? 6    DT  T "C5'" 1 
ATOM   3070 C  "C4'" . DT  C 3 7   ? 15.794  -12.072 -18.722 1.00 63.29  ? 6    DT  T "C4'" 1 
ATOM   3071 O  "O4'" . DT  C 3 7   ? 16.282  -13.021 -17.751 1.00 63.49  ? 6    DT  T "O4'" 1 
ATOM   3072 C  "C3'" . DT  C 3 7   ? 15.938  -12.743 -20.077 1.00 63.89  ? 6    DT  T "C3'" 1 
ATOM   3073 O  "O3'" . DT  C 3 7   ? 17.208  -12.426 -20.625 1.00 66.99  ? 6    DT  T "O3'" 1 
ATOM   3074 C  "C2'" . DT  C 3 7   ? 15.873  -14.218 -19.732 1.00 63.50  ? 6    DT  T "C2'" 1 
ATOM   3075 C  "C1'" . DT  C 3 7   ? 16.562  -14.262 -18.375 1.00 63.09  ? 6    DT  T "C1'" 1 
ATOM   3076 N  N1    . DT  C 3 7   ? 16.095  -15.335 -17.470 1.00 63.13  ? 6    DT  T N1    1 
ATOM   3077 C  C2    . DT  C 3 7   ? 17.004  -16.088 -16.775 1.00 62.68  ? 6    DT  T C2    1 
ATOM   3078 O  O2    . DT  C 3 7   ? 18.220  -15.932 -16.870 1.00 61.87  ? 6    DT  T O2    1 
ATOM   3079 N  N3    . DT  C 3 7   ? 16.433  -17.051 -15.962 1.00 61.98  ? 6    DT  T N3    1 
ATOM   3080 C  C4    . DT  C 3 7   ? 15.100  -17.334 -15.793 1.00 61.57  ? 6    DT  T C4    1 
ATOM   3081 O  O4    . DT  C 3 7   ? 14.756  -18.223 -15.016 1.00 60.39  ? 6    DT  T O4    1 
ATOM   3082 C  C5    . DT  C 3 7   ? 14.214  -16.525 -16.567 1.00 62.03  ? 6    DT  T C5    1 
ATOM   3083 C  C7    . DT  C 3 7   ? 12.743  -16.790 -16.487 1.00 62.52  ? 6    DT  T C7    1 
ATOM   3084 C  C6    . DT  C 3 7   ? 14.749  -15.569 -17.343 1.00 62.21  ? 6    DT  T C6    1 
ATOM   3085 P  P     . DT  C 3 8   ? 17.412  -12.430 -22.216 1.00 69.31  ? 7    DT  T P     1 
ATOM   3086 O  OP1   . DT  C 3 8   ? 17.684  -11.024 -22.607 1.00 69.01  ? 7    DT  T OP1   1 
ATOM   3087 O  OP2   . DT  C 3 8   ? 16.258  -13.115 -22.836 1.00 70.58  ? 7    DT  T OP2   1 
ATOM   3088 O  "O5'" . DT  C 3 8   ? 18.721  -13.323 -22.411 1.00 70.02  ? 7    DT  T "O5'" 1 
ATOM   3089 C  "C5'" . DT  C 3 8   ? 19.835  -13.127 -21.528 1.00 71.68  ? 7    DT  T "C5'" 1 
ATOM   3090 C  "C4'" . DT  C 3 8   ? 20.634  -14.380 -21.226 1.00 72.67  ? 7    DT  T "C4'" 1 
ATOM   3091 O  "O4'" . DT  C 3 8   ? 20.029  -15.198 -20.183 1.00 72.25  ? 7    DT  T "O4'" 1 
ATOM   3092 C  "C3'" . DT  C 3 8   ? 20.955  -15.325 -22.395 1.00 73.29  ? 7    DT  T "C3'" 1 
ATOM   3093 O  "O3'" . DT  C 3 8   ? 22.365  -15.630 -22.389 1.00 74.51  ? 7    DT  T "O3'" 1 
ATOM   3094 C  "C2'" . DT  C 3 8   ? 20.168  -16.576 -22.040 1.00 72.88  ? 7    DT  T "C2'" 1 
ATOM   3095 C  "C1'" . DT  C 3 8   ? 20.254  -16.556 -20.526 1.00 72.08  ? 7    DT  T "C1'" 1 
ATOM   3096 N  N1    . DT  C 3 8   ? 19.272  -17.424 -19.824 1.00 71.30  ? 7    DT  T N1    1 
ATOM   3097 C  C2    . DT  C 3 8   ? 19.747  -18.370 -18.929 1.00 70.79  ? 7    DT  T C2    1 
ATOM   3098 O  O2    . DT  C 3 8   ? 20.929  -18.487 -18.628 1.00 69.89  ? 7    DT  T O2    1 
ATOM   3099 N  N3    . DT  C 3 8   ? 18.775  -19.182 -18.392 1.00 70.01  ? 7    DT  T N3    1 
ATOM   3100 C  C4    . DT  C 3 8   ? 17.417  -19.149 -18.651 1.00 69.52  ? 7    DT  T C4    1 
ATOM   3101 O  O4    . DT  C 3 8   ? 16.673  -19.968 -18.115 1.00 68.04  ? 7    DT  T O4    1 
ATOM   3102 C  C5    . DT  C 3 8   ? 16.990  -18.119 -19.571 1.00 69.86  ? 7    DT  T C5    1 
ATOM   3103 C  C7    . DT  C 3 8   ? 15.538  -18.002 -19.910 1.00 69.76  ? 7    DT  T C7    1 
ATOM   3104 C  C6    . DT  C 3 8   ? 17.923  -17.313 -20.093 1.00 70.47  ? 7    DT  T C6    1 
ATOM   3105 P  P     . DT  C 3 9   ? 23.120  -16.268 -23.673 1.00 74.60  ? 8    DT  T P     1 
ATOM   3106 O  OP1   . DT  C 3 9   ? 24.573  -16.179 -23.375 1.00 74.89  ? 8    DT  T OP1   1 
ATOM   3107 O  OP2   . DT  C 3 9   ? 22.603  -15.732 -24.952 1.00 75.31  ? 8    DT  T OP2   1 
ATOM   3108 O  "O5'" . DT  C 3 9   ? 22.769  -17.817 -23.628 1.00 74.61  ? 8    DT  T "O5'" 1 
ATOM   3109 C  "C5'" . DT  C 3 9   ? 22.473  -18.442 -22.395 1.00 75.00  ? 8    DT  T "C5'" 1 
ATOM   3110 C  "C4'" . DT  C 3 9   ? 23.722  -18.790 -21.620 1.00 74.48  ? 8    DT  T "C4'" 1 
ATOM   3111 O  "O4'" . DT  C 3 9   ? 23.322  -19.253 -20.310 1.00 73.54  ? 8    DT  T "O4'" 1 
ATOM   3112 C  "C3'" . DT  C 3 9   ? 24.562  -19.908 -22.227 1.00 74.51  ? 8    DT  T "C3'" 1 
ATOM   3113 O  "O3'" . DT  C 3 9   ? 25.951  -19.570 -22.140 1.00 75.26  ? 8    DT  T "O3'" 1 
ATOM   3114 C  "C2'" . DT  C 3 9   ? 24.157  -21.151 -21.445 1.00 73.54  ? 8    DT  T "C2'" 1 
ATOM   3115 C  "C1'" . DT  C 3 9   ? 23.302  -20.674 -20.274 1.00 72.14  ? 8    DT  T "C1'" 1 
ATOM   3116 N  N1    . DT  C 3 9   ? 21.868  -21.099 -20.368 1.00 69.45  ? 8    DT  T N1    1 
ATOM   3117 C  C2    . DT  C 3 9   ? 21.386  -22.127 -19.582 1.00 68.14  ? 8    DT  T C2    1 
ATOM   3118 O  O2    . DT  C 3 9   ? 22.078  -22.773 -18.814 1.00 69.12  ? 8    DT  T O2    1 
ATOM   3119 N  N3    . DT  C 3 9   ? 20.041  -22.376 -19.738 1.00 65.84  ? 8    DT  T N3    1 
ATOM   3120 C  C4    . DT  C 3 9   ? 19.154  -21.730 -20.581 1.00 65.16  ? 8    DT  T C4    1 
ATOM   3121 O  O4    . DT  C 3 9   ? 17.969  -22.062 -20.600 1.00 62.96  ? 8    DT  T O4    1 
ATOM   3122 C  C5    . DT  C 3 9   ? 19.731  -20.690 -21.389 1.00 66.14  ? 8    DT  T C5    1 
ATOM   3123 C  C7    . DT  C 3 9   ? 18.862  -19.943 -22.352 1.00 66.29  ? 8    DT  T C7    1 
ATOM   3124 C  C6    . DT  C 3 9   ? 21.032  -20.436 -21.242 1.00 68.03  ? 8    DT  T C6    1 
ATOM   3125 P  P     . DC  C 3 10  ? 27.091  -20.701 -22.197 1.00 75.95  ? 9    DC  T P     1 
ATOM   3126 O  OP1   . DC  C 3 10  ? 27.109  -21.328 -20.849 1.00 75.52  ? 9    DC  T OP1   1 
ATOM   3127 O  OP2   . DC  C 3 10  ? 28.330  -20.099 -22.760 1.00 76.02  ? 9    DC  T OP2   1 
ATOM   3128 O  "O5'" . DC  C 3 10  ? 26.536  -21.767 -23.242 1.00 74.50  ? 9    DC  T "O5'" 1 
ATOM   3129 C  "C5'" . DC  C 3 10  ? 27.218  -22.988 -23.489 1.00 74.05  ? 9    DC  T "C5'" 1 
ATOM   3130 C  "C4'" . DC  C 3 10  ? 27.149  -23.869 -22.264 1.00 71.54  ? 9    DC  T "C4'" 1 
ATOM   3131 O  "O4'" . DC  C 3 10  ? 25.887  -23.690 -21.576 1.00 70.21  ? 9    DC  T "O4'" 1 
ATOM   3132 C  "C3'" . DC  C 3 10  ? 27.245  -25.354 -22.576 1.00 71.60  ? 9    DC  T "C3'" 1 
ATOM   3133 O  "O3'" . DC  C 3 10  ? 27.910  -26.030 -21.498 1.00 73.52  ? 9    DC  T "O3'" 1 
ATOM   3134 C  "C2'" . DC  C 3 10  ? 25.784  -25.760 -22.670 1.00 69.76  ? 9    DC  T "C2'" 1 
ATOM   3135 C  "C1'" . DC  C 3 10  ? 25.136  -24.895 -21.606 1.00 67.61  ? 9    DC  T "C1'" 1 
ATOM   3136 N  N1    . DC  C 3 10  ? 23.731  -24.547 -21.894 1.00 63.90  ? 9    DC  T N1    1 
ATOM   3137 C  C2    . DC  C 3 10  ? 22.715  -25.254 -21.246 1.00 61.20  ? 9    DC  T C2    1 
ATOM   3138 O  O2    . DC  C 3 10  ? 23.022  -26.151 -20.453 1.00 60.08  ? 9    DC  T O2    1 
ATOM   3139 N  N3    . DC  C 3 10  ? 21.424  -24.939 -21.503 1.00 59.38  ? 9    DC  T N3    1 
ATOM   3140 C  C4    . DC  C 3 10  ? 21.133  -23.962 -22.364 1.00 59.20  ? 9    DC  T C4    1 
ATOM   3141 N  N4    . DC  C 3 10  ? 19.853  -23.688 -22.596 1.00 57.68  ? 9    DC  T N4    1 
ATOM   3142 C  C5    . DC  C 3 10  ? 22.147  -23.222 -23.032 1.00 60.51  ? 9    DC  T C5    1 
ATOM   3143 C  C6    . DC  C 3 10  ? 23.420  -23.550 -22.778 1.00 62.64  ? 9    DC  T C6    1 
ATOM   3144 P  P     . DC  C 3 11  ? 28.902  -27.261 -21.817 1.00 75.39  ? 10   DC  T P     1 
ATOM   3145 O  OP1   . DC  C 3 11  ? 29.875  -27.339 -20.694 1.00 75.19  ? 10   DC  T OP1   1 
ATOM   3146 O  OP2   . DC  C 3 11  ? 29.405  -27.095 -23.211 1.00 75.36  ? 10   DC  T OP2   1 
ATOM   3147 O  "O5'" . DC  C 3 11  ? 27.965  -28.556 -21.769 1.00 75.30  ? 10   DC  T "O5'" 1 
ATOM   3148 C  "C5'" . DC  C 3 11  ? 26.604  -28.450 -22.166 1.00 75.72  ? 10   DC  T "C5'" 1 
ATOM   3149 C  "C4'" . DC  C 3 11  ? 25.699  -29.325 -21.334 1.00 74.99  ? 10   DC  T "C4'" 1 
ATOM   3150 O  "O4'" . DC  C 3 11  ? 24.360  -28.772 -21.325 1.00 74.13  ? 10   DC  T "O4'" 1 
ATOM   3151 C  "C3'" . DC  C 3 11  ? 25.561  -30.731 -21.887 1.00 75.21  ? 10   DC  T "C3'" 1 
ATOM   3152 O  "O3'" . DC  C 3 11  ? 25.305  -31.636 -20.821 1.00 76.05  ? 10   DC  T "O3'" 1 
ATOM   3153 C  "C2'" . DC  C 3 11  ? 24.335  -30.609 -22.768 1.00 74.36  ? 10   DC  T "C2'" 1 
ATOM   3154 C  "C1'" . DC  C 3 11  ? 23.470  -29.601 -22.046 1.00 72.69  ? 10   DC  T "C1'" 1 
ATOM   3155 N  N1    . DC  C 3 11  ? 22.676  -28.732 -22.936 1.00 70.78  ? 10   DC  T N1    1 
ATOM   3156 C  C2    . DC  C 3 11  ? 21.298  -28.924 -23.009 1.00 70.34  ? 10   DC  T C2    1 
ATOM   3157 O  O2    . DC  C 3 11  ? 20.789  -29.816 -22.332 1.00 69.23  ? 10   DC  T O2    1 
ATOM   3158 N  N3    . DC  C 3 11  ? 20.558  -28.128 -23.817 1.00 70.02  ? 10   DC  T N3    1 
ATOM   3159 C  C4    . DC  C 3 11  ? 21.149  -27.170 -24.533 1.00 69.92  ? 10   DC  T C4    1 
ATOM   3160 N  N4    . DC  C 3 11  ? 20.388  -26.405 -25.317 1.00 70.23  ? 10   DC  T N4    1 
ATOM   3161 C  C5    . DC  C 3 11  ? 22.554  -26.952 -24.479 1.00 69.84  ? 10   DC  T C5    1 
ATOM   3162 C  C6    . DC  C 3 11  ? 23.274  -27.748 -23.675 1.00 70.24  ? 10   DC  T C6    1 
ATOM   3163 P  P     . DT  C 3 12  ? 25.790  -33.162 -20.937 1.00 76.13  ? 11   DT  T P     1 
ATOM   3164 O  OP1   . DT  C 3 12  ? 26.400  -33.555 -19.633 1.00 76.53  ? 11   DT  T OP1   1 
ATOM   3165 O  OP2   . DT  C 3 12  ? 26.554  -33.343 -22.207 1.00 75.94  ? 11   DT  T OP2   1 
ATOM   3166 O  "O5'" . DT  C 3 12  ? 24.408  -33.944 -21.068 1.00 75.28  ? 11   DT  T "O5'" 1 
ATOM   3167 C  "C5'" . DT  C 3 12  ? 23.255  -33.612 -20.231 1.00 75.73  ? 11   DT  T "C5'" 1 
ATOM   3168 C  "C4'" . DT  C 3 12  ? 22.114  -34.532 -20.604 1.00 75.92  ? 11   DT  T "C4'" 1 
ATOM   3169 O  "O4'" . DT  C 3 12  ? 21.266  -33.924 -21.593 1.00 75.22  ? 11   DT  T "O4'" 1 
ATOM   3170 C  "C3'" . DT  C 3 12  ? 22.636  -35.790 -21.308 1.00 76.86  ? 11   DT  T "C3'" 1 
ATOM   3171 O  "O3'" . DT  C 3 12  ? 21.474  -36.577 -21.554 1.00 79.66  ? 11   DT  T "O3'" 1 
ATOM   3172 C  "C2'" . DT  C 3 12  ? 22.951  -35.273 -22.702 1.00 75.91  ? 11   DT  T "C2'" 1 
ATOM   3173 C  "C1'" . DT  C 3 12  ? 21.647  -34.457 -22.873 1.00 74.29  ? 11   DT  T "C1'" 1 
ATOM   3174 N  N1    . DT  C 3 12  ? 21.707  -33.361 -23.791 1.00 72.55  ? 11   DT  T N1    1 
ATOM   3175 C  C2    . DT  C 3 12  ? 20.529  -32.798 -24.222 1.00 71.35  ? 11   DT  T C2    1 
ATOM   3176 O  O2    . DT  C 3 12  ? 19.414  -33.188 -23.856 1.00 70.49  ? 11   DT  T O2    1 
ATOM   3177 N  N3    . DT  C 3 12  ? 20.705  -31.758 -25.096 1.00 70.62  ? 11   DT  T N3    1 
ATOM   3178 C  C4    . DT  C 3 12  ? 21.901  -31.254 -25.565 1.00 70.28  ? 11   DT  T C4    1 
ATOM   3179 O  O4    . DT  C 3 12  ? 21.895  -30.311 -26.346 1.00 69.11  ? 11   DT  T O4    1 
ATOM   3180 C  C5    . DT  C 3 12  ? 23.088  -31.908 -25.069 1.00 70.69  ? 11   DT  T C5    1 
ATOM   3181 C  C7    . DT  C 3 12  ? 24.429  -31.441 -25.536 1.00 70.51  ? 11   DT  T C7    1 
ATOM   3182 C  C6    . DT  C 3 12  ? 22.930  -32.910 -24.211 1.00 71.80  ? 11   DT  T C6    1 
ATOM   3183 P  P     . DT  C 3 13  ? 21.310  -38.090 -21.099 1.00 81.57  ? 12   DT  T P     1 
ATOM   3184 O  OP1   . DT  C 3 13  ? 20.735  -38.001 -19.733 1.00 82.00  ? 12   DT  T OP1   1 
ATOM   3185 O  OP2   . DT  C 3 13  ? 22.601  -38.749 -21.361 1.00 81.20  ? 12   DT  T OP2   1 
ATOM   3186 O  "O5'" . DT  C 3 13  ? 20.197  -38.646 -22.101 1.00 80.71  ? 12   DT  T "O5'" 1 
ATOM   3187 C  "C5'" . DT  C 3 13  ? 20.244  -38.313 -23.484 1.00 80.99  ? 12   DT  T "C5'" 1 
ATOM   3188 C  "C4'" . DT  C 3 13  ? 18.847  -38.146 -24.036 1.00 81.26  ? 12   DT  T "C4'" 1 
ATOM   3189 O  "O4'" . DT  C 3 13  ? 18.719  -36.827 -24.619 1.00 80.44  ? 12   DT  T "O4'" 1 
ATOM   3190 C  "C3'" . DT  C 3 13  ? 18.526  -39.123 -25.158 1.00 82.25  ? 12   DT  T "C3'" 1 
ATOM   3191 O  "O3'" . DT  C 3 13  ? 17.126  -39.403 -25.180 1.00 83.81  ? 12   DT  T "O3'" 1 
ATOM   3192 C  "C2'" . DT  C 3 13  ? 18.917  -38.343 -26.396 1.00 81.37  ? 12   DT  T "C2'" 1 
ATOM   3193 C  "C1'" . DT  C 3 13  ? 18.565  -36.913 -26.029 1.00 79.45  ? 12   DT  T "C1'" 1 
ATOM   3194 N  N1    . DT  C 3 13  ? 19.441  -35.890 -26.637 1.00 77.32  ? 12   DT  T N1    1 
ATOM   3195 C  C2    . DT  C 3 13  ? 18.892  -34.937 -27.467 1.00 76.57  ? 12   DT  T C2    1 
ATOM   3196 O  O2    . DT  C 3 13  ? 17.692  -34.886 -27.738 1.00 76.43  ? 12   DT  T O2    1 
ATOM   3197 N  N3    . DT  C 3 13  ? 19.804  -34.037 -27.973 1.00 75.66  ? 12   DT  T N3    1 
ATOM   3198 C  C4    . DT  C 3 13  ? 21.159  -33.992 -27.747 1.00 75.20  ? 12   DT  T C4    1 
ATOM   3199 O  O4    . DT  C 3 13  ? 21.834  -33.114 -28.287 1.00 74.52  ? 12   DT  T O4    1 
ATOM   3200 C  C5    . DT  C 3 13  ? 21.666  -35.020 -26.867 1.00 75.33  ? 12   DT  T C5    1 
ATOM   3201 C  C7    . DT  C 3 13  ? 23.128  -35.058 -26.566 1.00 74.74  ? 12   DT  T C7    1 
ATOM   3202 C  C6    . DT  C 3 13  ? 20.794  -35.903 -26.360 1.00 76.11  ? 12   DT  T C6    1 
ATOM   3203 P  P     . DC  C 3 14  ? 16.587  -40.760 -25.846 1.00 84.76  ? 13   DC  T P     1 
ATOM   3204 O  OP1   . DC  C 3 14  ? 15.593  -41.355 -24.911 1.00 85.34  ? 13   DC  T OP1   1 
ATOM   3205 O  OP2   . DC  C 3 14  ? 17.750  -41.567 -26.288 1.00 84.99  ? 13   DC  T OP2   1 
ATOM   3206 O  "O5'" . DC  C 3 14  ? 15.834  -40.261 -27.155 1.00 82.72  ? 13   DC  T "O5'" 1 
ATOM   3207 C  "C5'" . DC  C 3 14  ? 15.033  -39.079 -27.173 1.00 81.27  ? 13   DC  T "C5'" 1 
ATOM   3208 C  "C4'" . DC  C 3 14  ? 14.783  -38.670 -28.607 1.00 79.87  ? 13   DC  T "C4'" 1 
ATOM   3209 O  "O4'" . DC  C 3 14  ? 15.786  -37.723 -29.037 1.00 78.86  ? 13   DC  T "O4'" 1 
ATOM   3210 C  "C3'" . DC  C 3 14  ? 14.765  -39.769 -29.668 1.00 78.91  ? 13   DC  T "C3'" 1 
ATOM   3211 O  "O3'" . DC  C 3 14  ? 13.814  -39.415 -30.719 1.00 79.35  ? 13   DC  T "O3'" 1 
ATOM   3212 C  "C2'" . DC  C 3 14  ? 16.213  -39.748 -30.157 1.00 77.81  ? 13   DC  T "C2'" 1 
ATOM   3213 C  "C1'" . DC  C 3 14  ? 16.490  -38.249 -30.152 1.00 76.35  ? 13   DC  T "C1'" 1 
ATOM   3214 N  N1    . DC  C 3 14  ? 17.902  -37.879 -30.008 1.00 73.82  ? 13   DC  T N1    1 
ATOM   3215 C  C2    . DC  C 3 14  ? 18.366  -36.752 -30.666 1.00 71.86  ? 13   DC  T C2    1 
ATOM   3216 O  O2    . DC  C 3 14  ? 17.570  -36.086 -31.346 1.00 69.98  ? 13   DC  T O2    1 
ATOM   3217 N  N3    . DC  C 3 14  ? 19.670  -36.411 -30.547 1.00 70.53  ? 13   DC  T N3    1 
ATOM   3218 C  C4    . DC  C 3 14  ? 20.489  -37.155 -29.802 1.00 70.59  ? 13   DC  T C4    1 
ATOM   3219 N  N4    . DC  C 3 14  ? 21.769  -36.791 -29.714 1.00 69.51  ? 13   DC  T N4    1 
ATOM   3220 C  C5    . DC  C 3 14  ? 20.035  -38.306 -29.116 1.00 71.24  ? 13   DC  T C5    1 
ATOM   3221 C  C6    . DC  C 3 14  ? 18.748  -38.629 -29.245 1.00 72.76  ? 13   DC  T C6    1 
ATOM   3222 P  P     . DC  C 3 15  ? 13.919  -40.225 -32.119 1.00 79.57  ? 14   DC  T P     1 
ATOM   3223 O  OP1   . DC  C 3 15  ? 12.645  -40.253 -32.916 1.00 80.20  ? 14   DC  T OP1   1 
ATOM   3224 O  OP2   . DC  C 3 15  ? 14.592  -41.507 -31.779 1.00 79.72  ? 14   DC  T OP2   1 
ATOM   3225 O  "O5'" . DC  C 3 15  ? 14.908  -39.367 -33.028 1.00 78.48  ? 14   DC  T "O5'" 1 
ATOM   3226 C  "C5'" . DC  C 3 15  ? 15.221  -39.941 -34.316 1.00 77.43  ? 14   DC  T "C5'" 1 
ATOM   3227 C  "C4'" . DC  C 3 15  ? 15.562  -38.906 -35.359 1.00 76.98  ? 14   DC  T "C4'" 1 
ATOM   3228 O  "O4'" . DC  C 3 15  ? 16.315  -37.835 -34.738 1.00 76.56  ? 14   DC  T "O4'" 1 
ATOM   3229 C  "C3'" . DC  C 3 15  ? 16.418  -39.433 -36.501 1.00 77.37  ? 14   DC  T "C3'" 1 
ATOM   3230 O  "O3'" . DC  C 3 15  ? 15.546  -39.812 -37.543 1.00 78.28  ? 14   DC  T "O3'" 1 
ATOM   3231 C  "C2'" . DC  C 3 15  ? 17.464  -38.351 -36.738 1.00 76.74  ? 14   DC  T "C2'" 1 
ATOM   3232 C  "C1'" . DC  C 3 15  ? 17.405  -37.414 -35.547 1.00 75.97  ? 14   DC  T "C1'" 1 
ATOM   3233 N  N1    . DC  C 3 15  ? 18.638  -37.608 -34.762 1.00 74.82  ? 14   DC  T N1    1 
ATOM   3234 C  C2    . DC  C 3 15  ? 19.814  -36.889 -35.095 1.00 74.18  ? 14   DC  T C2    1 
ATOM   3235 O  O2    . DC  C 3 15  ? 19.806  -36.108 -36.069 1.00 73.59  ? 14   DC  T O2    1 
ATOM   3236 N  N3    . DC  C 3 15  ? 20.924  -37.080 -34.340 1.00 74.11  ? 14   DC  T N3    1 
ATOM   3237 C  C4    . DC  C 3 15  ? 20.894  -37.932 -33.306 1.00 73.89  ? 14   DC  T C4    1 
ATOM   3238 N  N4    . DC  C 3 15  ? 21.999  -38.084 -32.584 1.00 73.01  ? 14   DC  T N4    1 
ATOM   3239 C  C5    . DC  C 3 15  ? 19.725  -38.671 -32.964 1.00 73.77  ? 14   DC  T C5    1 
ATOM   3240 C  C6    . DC  C 3 15  ? 18.640  -38.488 -33.713 1.00 74.28  ? 14   DC  T C6    1 
ATOM   3241 P  P     . DC  C 3 16  ? 15.486  -39.121 -38.977 1.00 78.79  ? 15   DC  T P     1 
ATOM   3242 O  OP1   . DC  C 3 16  ? 14.225  -38.347 -39.137 1.00 78.72  ? 15   DC  T OP1   1 
ATOM   3243 O  OP2   . DC  C 3 16  ? 15.790  -40.247 -39.863 1.00 79.23  ? 15   DC  T OP2   1 
ATOM   3244 O  "O5'" . DC  C 3 16  ? 16.680  -38.089 -39.021 1.00 77.33  ? 15   DC  T "O5'" 1 
ATOM   3245 C  "C5'" . DC  C 3 16  ? 16.411  -36.786 -39.559 1.00 76.24  ? 15   DC  T "C5'" 1 
ATOM   3246 C  "C4'" . DC  C 3 16  ? 17.538  -36.397 -40.477 1.00 75.51  ? 15   DC  T "C4'" 1 
ATOM   3247 O  "O4'" . DC  C 3 16  ? 18.764  -36.323 -39.719 1.00 74.42  ? 15   DC  T "O4'" 1 
ATOM   3248 C  "C3'" . DC  C 3 16  ? 17.753  -37.500 -41.486 1.00 75.71  ? 15   DC  T "C3'" 1 
ATOM   3249 O  "O3'" . DC  C 3 16  ? 17.729  -36.976 -42.797 1.00 77.60  ? 15   DC  T "O3'" 1 
ATOM   3250 C  "C2'" . DC  C 3 16  ? 19.063  -38.171 -41.085 1.00 74.14  ? 15   DC  T "C2'" 1 
ATOM   3251 C  "C1'" . DC  C 3 16  ? 19.781  -37.139 -40.273 1.00 73.08  ? 15   DC  T "C1'" 1 
ATOM   3252 N  N1    . DC  C 3 16  ? 20.511  -37.738 -39.149 1.00 71.18  ? 15   DC  T N1    1 
ATOM   3253 C  C2    . DC  C 3 16  ? 21.844  -37.397 -38.948 1.00 70.11  ? 15   DC  T C2    1 
ATOM   3254 O  O2    . DC  C 3 16  ? 22.406  -36.617 -39.740 1.00 70.01  ? 15   DC  T O2    1 
ATOM   3255 N  N3    . DC  C 3 16  ? 22.491  -37.926 -37.894 1.00 68.64  ? 15   DC  T N3    1 
ATOM   3256 C  C4    . DC  C 3 16  ? 21.852  -38.758 -37.056 1.00 68.02  ? 15   DC  T C4    1 
ATOM   3257 N  N4    . DC  C 3 16  ? 22.528  -39.252 -36.028 1.00 66.43  ? 15   DC  T N4    1 
ATOM   3258 C  C5    . DC  C 3 16  ? 20.498  -39.121 -37.242 1.00 68.52  ? 15   DC  T C5    1 
ATOM   3259 C  C6    . DC  C 3 16  ? 19.876  -38.605 -38.296 1.00 69.81  ? 15   DC  T C6    1 
ATOM   3260 P  P     . DC  C 3 17  ? 18.438  -37.884 -43.910 1.00 79.65  ? 16   DC  T P     1 
ATOM   3261 O  OP1   . DC  C 3 17  ? 18.292  -37.176 -45.205 1.00 79.79  ? 16   DC  T OP1   1 
ATOM   3262 O  OP2   . DC  C 3 17  ? 17.950  -39.295 -43.689 1.00 80.46  ? 16   DC  T OP2   1 
ATOM   3263 O  "O5'" . DC  C 3 17  ? 19.950  -37.881 -43.447 1.00 80.39  ? 16   DC  T "O5'" 1 
ATOM   3264 C  "C5'" . DC  C 3 17  ? 20.682  -36.759 -43.789 1.00 82.03  ? 16   DC  T "C5'" 1 
ATOM   3265 C  "C4'" . DC  C 3 17  ? 22.084  -37.295 -43.798 1.00 82.89  ? 16   DC  T "C4'" 1 
ATOM   3266 O  "O4'" . DC  C 3 17  ? 22.329  -37.857 -42.475 1.00 83.29  ? 16   DC  T "O4'" 1 
ATOM   3267 C  "C3'" . DC  C 3 17  ? 22.582  -38.319 -44.837 1.00 83.29  ? 16   DC  T "C3'" 1 
ATOM   3268 O  "O3'" . DC  C 3 17  ? 23.923  -37.923 -45.274 1.00 84.01  ? 16   DC  T "O3'" 1 
ATOM   3269 C  "C2'" . DC  C 3 17  ? 22.734  -39.580 -43.992 1.00 83.19  ? 16   DC  T "C2'" 1 
ATOM   3270 C  "C1'" . DC  C 3 17  ? 23.181  -38.964 -42.656 1.00 82.95  ? 16   DC  T "C1'" 1 
ATOM   3271 N  N1    . DC  C 3 17  ? 23.095  -39.835 -41.473 1.00 82.07  ? 16   DC  T N1    1 
ATOM   3272 C  C2    . DC  C 3 17  ? 24.186  -39.893 -40.582 1.00 81.58  ? 16   DC  T C2    1 
ATOM   3273 O  O2    . DC  C 3 17  ? 25.193  -39.200 -40.802 1.00 81.40  ? 16   DC  T O2    1 
ATOM   3274 N  N3    . DC  C 3 17  ? 24.102  -40.711 -39.509 1.00 80.84  ? 16   DC  T N3    1 
ATOM   3275 C  C4    . DC  C 3 17  ? 22.998  -41.441 -39.306 1.00 80.52  ? 16   DC  T C4    1 
ATOM   3276 N  N4    . DC  C 3 17  ? 22.942  -42.234 -38.242 1.00 80.19  ? 16   DC  T N4    1 
ATOM   3277 C  C5    . DC  C 3 17  ? 21.890  -41.393 -40.187 1.00 80.50  ? 16   DC  T C5    1 
ATOM   3278 C  C6    . DC  C 3 17  ? 21.975  -40.585 -41.245 1.00 81.42  ? 16   DC  T C6    1 
ATOM   3279 P  P     . DC  C 3 18  ? 24.313  -38.082 -46.843 1.00 84.56  ? 17   DC  T P     1 
ATOM   3280 O  OP1   . DC  C 3 18  ? 24.723  -36.711 -47.268 1.00 84.96  ? 17   DC  T OP1   1 
ATOM   3281 O  OP2   . DC  C 3 18  ? 23.333  -38.914 -47.645 1.00 84.56  ? 17   DC  T OP2   1 
ATOM   3282 O  "O5'" . DC  C 3 18  ? 25.654  -38.916 -46.747 1.00 83.83  ? 17   DC  T "O5'" 1 
ATOM   3283 C  "C5'" . DC  C 3 18  ? 27.018  -38.366 -46.830 1.00 83.40  ? 17   DC  T "C5'" 1 
ATOM   3284 C  "C4'" . DC  C 3 18  ? 27.752  -38.711 -45.554 1.00 83.21  ? 17   DC  T "C4'" 1 
ATOM   3285 O  "O4'" . DC  C 3 18  ? 26.852  -39.349 -44.625 1.00 83.26  ? 17   DC  T "O4'" 1 
ATOM   3286 C  "C3'" . DC  C 3 18  ? 28.975  -39.625 -45.632 1.00 83.15  ? 17   DC  T "C3'" 1 
ATOM   3287 O  "O3'" . DC  C 3 18  ? 30.154  -38.981 -45.978 1.00 83.29  ? 17   DC  T "O3'" 1 
ATOM   3288 C  "C2'" . DC  C 3 18  ? 28.960  -40.357 -44.306 1.00 82.71  ? 17   DC  T "C2'" 1 
ATOM   3289 C  "C1'" . DC  C 3 18  ? 27.698  -39.827 -43.603 1.00 82.55  ? 17   DC  T "C1'" 1 
ATOM   3290 N  N1    . DC  C 3 18  ? 27.012  -40.904 -42.873 1.00 81.68  ? 17   DC  T N1    1 
ATOM   3291 C  C2    . DC  C 3 18  ? 27.700  -41.486 -41.806 1.00 81.26  ? 17   DC  T C2    1 
ATOM   3292 O  O2    . DC  C 3 18  ? 28.848  -41.089 -41.527 1.00 80.95  ? 17   DC  T O2    1 
ATOM   3293 N  N3    . DC  C 3 18  ? 27.113  -42.469 -41.107 1.00 81.01  ? 17   DC  T N3    1 
ATOM   3294 C  C4    . DC  C 3 18  ? 25.885  -42.887 -41.429 1.00 80.61  ? 17   DC  T C4    1 
ATOM   3295 N  N4    . DC  C 3 18  ? 25.343  -43.860 -40.707 1.00 80.49  ? 17   DC  T N4    1 
ATOM   3296 C  C5    . DC  C 3 18  ? 25.156  -42.324 -42.509 1.00 80.90  ? 17   DC  T C5    1 
ATOM   3297 C  C6    . DC  C 3 18  ? 25.751  -41.341 -43.206 1.00 81.43  ? 17   DC  T C6    1 
HETATM 3298 N  N1    . CTP D 4 .   ? 19.357  -12.331 -9.712  1.00 51.48  ? 2001 CTP B N1    1 
HETATM 3299 C  C2    . CTP D 4 .   ? 17.995  -12.546 -10.032 1.00 51.14  ? 2001 CTP B C2    1 
HETATM 3300 N  N3    . CTP D 4 .   ? 17.345  -13.661 -9.617  1.00 50.49  ? 2001 CTP B N3    1 
HETATM 3301 C  C4    . CTP D 4 .   ? 17.982  -14.642 -8.915  1.00 49.37  ? 2001 CTP B C4    1 
HETATM 3302 C  C5    . CTP D 4 .   ? 19.381  -14.550 -8.523  1.00 49.78  ? 2001 CTP B C5    1 
HETATM 3303 C  C6    . CTP D 4 .   ? 20.013  -13.356 -8.978  1.00 50.63  ? 2001 CTP B C6    1 
HETATM 3304 O  O2    . CTP D 4 .   ? 17.286  -11.685 -10.695 1.00 51.05  ? 2001 CTP B O2    1 
HETATM 3305 N  N4    . CTP D 4 .   ? 17.220  -15.677 -8.592  1.00 48.78  ? 2001 CTP B N4    1 
HETATM 3306 C  "C1'" . CTP D 4 .   ? 20.008  -11.070 -10.198 1.00 53.30  ? 2001 CTP B "C1'" 1 
HETATM 3307 C  "C2'" . CTP D 4 .   ? 20.119  -9.897  -9.233  1.00 54.27  ? 2001 CTP B "C2'" 1 
HETATM 3308 C  "C3'" . CTP D 4 .   ? 21.588  -9.488  -9.276  1.00 54.69  ? 2001 CTP B "C3'" 1 
HETATM 3309 C  "C4'" . CTP D 4 .   ? 22.335  -10.505 -10.209 1.00 54.87  ? 2001 CTP B "C4'" 1 
HETATM 3310 O  "O4'" . CTP D 4 .   ? 21.312  -11.435 -10.631 1.00 54.53  ? 2001 CTP B "O4'" 1 
HETATM 3311 O  "O3'" . CTP D 4 .   ? 21.847  -8.205  -9.891  1.00 56.22  ? 2001 CTP B "O3'" 1 
HETATM 3312 C  "C5'" . CTP D 4 .   ? 23.366  -11.027 -9.254  1.00 56.56  ? 2001 CTP B "C5'" 1 
HETATM 3313 O  "O5'" . CTP D 4 .   ? 23.198  -12.368 -8.836  1.00 59.13  ? 2001 CTP B "O5'" 1 
HETATM 3314 P  PA    . CTP D 4 .   ? 23.179  -12.722 -7.315  1.00 60.43  ? 2001 CTP B PA    1 
HETATM 3315 O  O1A   . CTP D 4 .   ? 24.671  -12.831 -6.872  1.00 59.10  ? 2001 CTP B O1A   1 
HETATM 3316 O  O2A   . CTP D 4 .   ? 22.441  -14.051 -7.215  1.00 60.27  ? 2001 CTP B O2A   1 
HETATM 3317 O  O3A   . CTP D 4 .   ? 22.323  -11.648 -6.560  1.00 61.54  ? 2001 CTP B O3A   1 
HETATM 3318 P  PB    . CTP D 4 .   ? 22.981  -10.564 -5.647  1.00 61.63  ? 2001 CTP B PB    1 
HETATM 3319 O  O1B   . CTP D 4 .   ? 21.774  -9.671  -5.188  1.00 62.94  ? 2001 CTP B O1B   1 
HETATM 3320 O  O2B   . CTP D 4 .   ? 24.047  -9.775  -6.473  1.00 62.34  ? 2001 CTP B O2B   1 
HETATM 3321 O  O3B   . CTP D 4 .   ? 23.537  -11.191 -4.315  1.00 65.29  ? 2001 CTP B O3B   1 
HETATM 3322 P  PG    . CTP D 4 .   ? 25.032  -11.141 -3.829  1.00 68.01  ? 2001 CTP B PG    1 
HETATM 3323 O  O1G   . CTP D 4 .   ? 25.828  -12.003 -4.846  1.00 68.49  ? 2001 CTP B O1G   1 
HETATM 3324 O  O2G   . CTP D 4 .   ? 25.023  -11.813 -2.429  1.00 67.81  ? 2001 CTP B O2G   1 
HETATM 3325 O  O3G   . CTP D 4 .   ? 25.639  -9.716  -3.822  1.00 68.18  ? 2001 CTP B O3G   1 
HETATM 3326 CA CA    . CA  E 5 .   ? 25.934  -13.033 -9.842  1.00 68.76  ? 353  CA  B CA    1 
HETATM 3327 CA CA    . CA  F 5 .   ? 26.333  -10.231 -7.463  1.00 35.66  ? 354  CA  B CA    1 
HETATM 3328 CA CA    . CA  G 5 .   ? 24.765  -24.842 -5.018  1.00 74.28  ? 355  CA  B CA    1 
HETATM 3329 CA CA    . CA  H 5 .   ? 27.464  -20.001 -6.634  1.00 73.21  ? 356  CA  B CA    1 
HETATM 3330 C  C1    . GOL I 6 .   ? 27.719  -25.742 -15.399 1.00 57.57  ? 357  GOL B C1    1 
HETATM 3331 O  O1    . GOL I 6 .   ? 27.291  -24.430 -14.997 1.00 57.43  ? 357  GOL B O1    1 
HETATM 3332 C  C2    . GOL I 6 .   ? 28.953  -25.656 -16.133 1.00 57.61  ? 357  GOL B C2    1 
HETATM 3333 O  O2    . GOL I 6 .   ? 29.943  -24.924 -15.419 1.00 57.14  ? 357  GOL B O2    1 
HETATM 3334 C  C3    . GOL I 6 .   ? 29.374  -27.139 -16.473 1.00 57.27  ? 357  GOL B C3    1 
HETATM 3335 O  O3    . GOL I 6 .   ? 30.580  -27.338 -17.191 1.00 57.21  ? 357  GOL B O3    1 
HETATM 3336 C  C1    . GOL J 6 .   ? 27.721  -36.732 -29.089 1.00 57.43  ? 14   GOL P C1    1 
HETATM 3337 O  O1    . GOL J 6 .   ? 28.974  -36.784 -28.301 1.00 57.52  ? 14   GOL P O1    1 
HETATM 3338 C  C2    . GOL J 6 .   ? 28.053  -37.686 -30.220 1.00 57.46  ? 14   GOL P C2    1 
HETATM 3339 O  O2    . GOL J 6 .   ? 29.260  -38.369 -30.166 1.00 57.66  ? 14   GOL P O2    1 
HETATM 3340 C  C3    . GOL J 6 .   ? 26.926  -38.289 -31.192 1.00 57.06  ? 14   GOL P C3    1 
HETATM 3341 O  O3    . GOL J 6 .   ? 27.611  -39.398 -31.856 1.00 56.47  ? 14   GOL P O3    1 
HETATM 3342 C  C1    . GOL K 6 .   ? 13.620  -34.782 -30.059 1.00 57.78  ? 15   GOL P C1    1 
HETATM 3343 O  O1    . GOL K 6 .   ? 14.887  -33.957 -30.216 1.00 57.20  ? 15   GOL P O1    1 
HETATM 3344 C  C2    . GOL K 6 .   ? 13.386  -34.688 -28.612 1.00 57.85  ? 15   GOL P C2    1 
HETATM 3345 O  O2    . GOL K 6 .   ? 14.087  -33.706 -27.843 1.00 58.03  ? 15   GOL P O2    1 
HETATM 3346 C  C3    . GOL K 6 .   ? 11.930  -35.139 -28.029 1.00 57.69  ? 15   GOL P C3    1 
HETATM 3347 O  O3    . GOL K 6 .   ? 11.853  -34.626 -26.652 1.00 59.16  ? 15   GOL P O3    1 
HETATM 3348 PT PT1   . CPT L 7 .   ? 10.965  -21.837 -6.946  1.00 99.51  ? 1004 CPT T PT1   1 
HETATM 3349 N  N1    . CPT L 7 .   ? 12.716  -22.415 -7.623  1.00 91.42  ? 1004 CPT T N1    1 
HETATM 3350 N  N2    . CPT L 7 .   ? 10.824  -23.504 -5.970  1.00 90.12  ? 1004 CPT T N2    1 
HETATM 3351 O  O     . HOH M 8 .   ? 32.987  -11.024 -23.037 1.00 51.57  ? 358  HOH B O     1 
HETATM 3352 O  O     . HOH M 8 .   ? 21.796  -20.736 -40.531 1.00 53.50  ? 359  HOH B O     1 
HETATM 3353 O  O     . HOH M 8 .   ? 43.043  -26.575 -19.711 1.00 54.35  ? 360  HOH B O     1 
HETATM 3354 O  O     . HOH M 8 .   ? 38.359  -45.516 -9.625  1.00 57.87  ? 361  HOH B O     1 
HETATM 3355 O  O     . HOH M 8 .   ? 5.541   -28.017 -12.252 1.00 49.88  ? 362  HOH B O     1 
HETATM 3356 O  O     . HOH M 8 .   ? -4.345  -36.003 -19.151 1.00 59.49  ? 363  HOH B O     1 
HETATM 3357 O  O     . HOH M 8 .   ? 49.343  -25.096 5.476   1.00 56.64  ? 364  HOH B O     1 
HETATM 3358 O  O     . HOH M 8 .   ? 52.388  -3.118  -2.840  1.00 53.66  ? 365  HOH B O     1 
HETATM 3359 O  O     . HOH M 8 .   ? -3.886  -16.803 -4.881  1.00 59.04  ? 366  HOH B O     1 
HETATM 3360 O  O     . HOH M 8 .   ? 45.515  1.743   -13.732 1.00 53.30  ? 367  HOH B O     1 
HETATM 3361 O  O     . HOH M 8 .   ? 15.250  -19.092 -2.783  1.00 55.78  ? 368  HOH B O     1 
HETATM 3362 O  O     . HOH M 8 .   ? 3.995   -31.536 -24.291 1.00 53.69  ? 369  HOH B O     1 
HETATM 3363 O  O     . HOH M 8 .   ? 5.713   -24.234 -42.007 1.00 60.09  ? 370  HOH B O     1 
HETATM 3364 O  O     . HOH M 8 .   ? 6.754   -31.596 -31.884 1.00 53.55  ? 371  HOH B O     1 
HETATM 3365 O  O     . HOH M 8 .   ? -4.212  -16.888 -10.188 1.00 56.23  ? 372  HOH B O     1 
HETATM 3366 O  O     . HOH M 8 .   ? 37.466  -10.422 1.307   1.00 54.90  ? 373  HOH B O     1 
HETATM 3367 O  O     . HOH M 8 .   ? 27.793  -4.699  -20.670 1.00 54.36  ? 374  HOH B O     1 
HETATM 3368 O  O     . HOH M 8 .   ? 53.156  -21.819 -6.997  1.00 56.42  ? 375  HOH B O     1 
HETATM 3369 O  O     . HOH M 8 .   ? 56.721  -8.966  -3.851  1.00 51.24  ? 376  HOH B O     1 
HETATM 3370 O  O     . HOH M 8 .   ? 23.655  -15.324 -8.617  1.00 51.04  ? 377  HOH B O     1 
HETATM 3371 O  O     . HOH M 8 .   ? 23.212  -13.319 -12.031 1.00 56.21  ? 378  HOH B O     1 
HETATM 3372 O  O     . HOH M 8 .   ? 14.732  -13.133 -10.908 1.00 54.44  ? 379  HOH B O     1 
HETATM 3373 O  O     . HOH M 8 .   ? 31.237  -15.859 4.310   1.00 58.76  ? 380  HOH B O     1 
HETATM 3374 O  O     . HOH M 8 .   ? 43.473  1.605   -1.630  1.00 57.91  ? 381  HOH B O     1 
HETATM 3375 O  O     . HOH M 8 .   ? 53.913  -5.828  -13.235 1.00 54.93  ? 382  HOH B O     1 
HETATM 3376 O  O     . HOH M 8 .   ? 31.916  -29.537 5.158   1.00 57.81  ? 383  HOH B O     1 
HETATM 3377 O  O     . HOH M 8 .   ? 2.809   -12.028 -42.493 1.00 54.15  ? 384  HOH B O     1 
HETATM 3378 O  O     . HOH M 8 .   ? 4.657   1.167   5.330   1.00 57.54  ? 385  HOH B O     1 
HETATM 3379 O  O     . HOH M 8 .   ? 24.357  -42.251 -5.792  1.00 52.05  ? 386  HOH B O     1 
HETATM 3380 O  O     . HOH M 8 .   ? 30.869  8.018   -13.442 1.00 55.79  ? 387  HOH B O     1 
HETATM 3381 O  O     . HOH M 8 .   ? 47.604  -15.287 -25.161 1.00 57.39  ? 388  HOH B O     1 
HETATM 3382 O  O     . HOH M 8 .   ? 18.667  -12.622 -2.039  1.00 59.13  ? 389  HOH B O     1 
HETATM 3383 O  O     . HOH M 8 .   ? 42.972  -2.114  -22.572 1.00 51.58  ? 390  HOH B O     1 
HETATM 3384 O  O     . HOH N 8 .   ? 20.559  -25.908 -36.990 1.00 53.57  ? 19   HOH P O     1 
HETATM 3385 O  O     . HOH N 8 .   ? 22.910  -28.526 -39.415 1.00 58.37  ? 28   HOH P O     1 
HETATM 3386 O  O     . HOH N 8 .   ? 30.904  -33.731 -31.795 1.00 49.64  ? 35   HOH P O     1 
HETATM 3387 O  O     . HOH O 8 .   ? 16.748  -33.646 -21.800 1.00 54.30  ? 18   HOH T O     1 
HETATM 3388 O  O     . HOH O 8 .   ? 12.350  -13.973 -10.444 1.00 54.82  ? 22   HOH T O     1 
HETATM 3389 O  O     . HOH O 8 .   ? 25.922  -26.766 -18.747 1.00 46.60  ? 29   HOH T O     1 
HETATM 3390 O  O     . HOH O 8 .   ? 17.652  -41.608 -23.096 1.00 54.89  ? 31   HOH T O     1 
HETATM 3391 O  O     . HOH O 8 .   ? 27.115  -16.091 -24.834 1.00 41.27  ? 39   HOH T O     1 
HETATM 3392 O  O     . HOH O 8 .   ? 3.337   -16.686 -7.803  1.00 58.57  ? 40   HOH T O     1 
HETATM 3393 O  O     . HOH O 8 .   ? 14.550  -44.415 -24.194 1.00 59.50  ? 48   HOH T O     1 
HETATM 3394 O  O     . HOH O 8 .   ? 18.130  -17.512 -11.210 1.00 56.87  ? 57   HOH T O     1 
HETATM 3395 O  O     . HOH O 8 .   ? 24.426  -24.061 -18.611 1.00 57.24  ? 58   HOH T O     1 
HETATM 3396 O  O     . HOH O 8 .   ? 9.366   -26.452 -7.085  1.00 56.96  ? 84   HOH T O     1 
HETATM 3397 O  O     . HOH O 8 .   ? 8.272   -26.881 -3.921  1.00 51.52  ? 93   HOH T O     1 
HETATM 3398 O  O     . HOH O 8 .   ? 22.079  -38.831 -17.625 1.00 59.49  ? 94   HOH T O     1 
HETATM 3399 O  O     . HOH O 8 .   ? 31.753  -21.540 -20.515 1.00 55.67  ? 391  HOH T O     1 
HETATM 3400 O  O     . HOH O 8 .   ? 30.761  -24.399 -19.327 1.00 56.04  ? 392  HOH T O     1 
HETATM 3401 O  O     . HOH O 8 .   ? 26.439  -32.826 -17.127 1.00 56.27  ? 393  HOH T O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET B . n 
A 1 2   ILE 2   2   2   ILE ILE B . n 
A 1 3   VAL 3   3   3   VAL VAL B . n 
A 1 4   LEU 4   4   4   LEU LEU B . n 
A 1 5   PHE 5   5   5   PHE PHE B . n 
A 1 6   VAL 6   6   6   VAL VAL B . n 
A 1 7   ASP 7   7   7   ASP ASP B . n 
A 1 8   PHE 8   8   8   PHE PHE B . n 
A 1 9   ASP 9   9   9   ASP ASP B . n 
A 1 10  TYR 10  10  10  TYR TYR B . n 
A 1 11  PHE 11  11  11  PHE PHE B . n 
A 1 12  TYR 12  12  12  TYR TYR B . n 
A 1 13  ALA 13  13  13  ALA ALA B . n 
A 1 14  GLN 14  14  14  GLN GLN B . n 
A 1 15  VAL 15  15  15  VAL VAL B . n 
A 1 16  GLU 16  16  16  GLU GLU B . n 
A 1 17  GLU 17  17  17  GLU GLU B . n 
A 1 18  VAL 18  18  18  VAL VAL B . n 
A 1 19  LEU 19  19  19  LEU LEU B . n 
A 1 20  ASN 20  20  20  ASN ASN B . n 
A 1 21  PRO 21  21  21  PRO PRO B . n 
A 1 22  SER 22  22  22  SER SER B . n 
A 1 23  LEU 23  23  23  LEU LEU B . n 
A 1 24  LYS 24  24  24  LYS LYS B . n 
A 1 25  GLY 25  25  25  GLY GLY B . n 
A 1 26  LYS 26  26  26  LYS LYS B . n 
A 1 27  PRO 27  27  27  PRO PRO B . n 
A 1 28  VAL 28  28  28  VAL VAL B . n 
A 1 29  VAL 29  29  29  VAL VAL B . n 
A 1 30  VAL 30  30  30  VAL VAL B . n 
A 1 31  CYS 31  31  31  CYS CYS B . n 
A 1 32  VAL 32  32  32  VAL VAL B . n 
A 1 33  PHE 33  33  33  PHE PHE B . n 
A 1 34  SER 34  34  34  SER SER B . n 
A 1 35  GLY 35  35  35  GLY GLY B . n 
A 1 36  ARG 36  36  36  ARG ARG B . n 
A 1 37  PHE 37  37  37  PHE PHE B . n 
A 1 38  GLU 38  38  38  GLU GLU B . n 
A 1 39  ASP 39  39  39  ASP ASP B . n 
A 1 40  SER 40  40  40  SER SER B . n 
A 1 41  GLY 41  41  41  GLY GLY B . n 
A 1 42  ALA 42  42  42  ALA ALA B . n 
A 1 43  VAL 43  43  43  VAL VAL B . n 
A 1 44  ALA 44  44  44  ALA ALA B . n 
A 1 45  THR 45  45  45  THR THR B . n 
A 1 46  ALA 46  46  46  ALA ALA B . n 
A 1 47  ASN 47  47  47  ASN ASN B . n 
A 1 48  TYR 48  48  48  TYR TYR B . n 
A 1 49  GLU 49  49  49  GLU GLU B . n 
A 1 50  ALA 50  50  50  ALA ALA B . n 
A 1 51  ARG 51  51  51  ARG ARG B . n 
A 1 52  LYS 52  52  52  LYS LYS B . n 
A 1 53  PHE 53  53  53  PHE PHE B . n 
A 1 54  GLY 54  54  54  GLY GLY B . n 
A 1 55  VAL 55  55  55  VAL VAL B . n 
A 1 56  LYS 56  56  56  LYS LYS B . n 
A 1 57  ALA 57  57  57  ALA ALA B . n 
A 1 58  GLY 58  58  58  GLY GLY B . n 
A 1 59  ILE 59  59  59  ILE ILE B . n 
A 1 60  PRO 60  60  60  PRO PRO B . n 
A 1 61  ILE 61  61  61  ILE ILE B . n 
A 1 62  VAL 62  62  62  VAL VAL B . n 
A 1 63  GLU 63  63  63  GLU GLU B . n 
A 1 64  ALA 64  64  64  ALA ALA B . n 
A 1 65  LYS 65  65  65  LYS LYS B . n 
A 1 66  LYS 66  66  66  LYS LYS B . n 
A 1 67  ILE 67  67  67  ILE ILE B . n 
A 1 68  LEU 68  68  68  LEU LEU B . n 
A 1 69  PRO 69  69  69  PRO PRO B . n 
A 1 70  ASN 70  70  70  ASN ASN B . n 
A 1 71  ALA 71  71  71  ALA ALA B . n 
A 1 72  VAL 72  72  72  VAL VAL B . n 
A 1 73  TYR 73  73  73  TYR TYR B . n 
A 1 74  LEU 74  74  74  LEU LEU B . n 
A 1 75  PRO 75  75  75  PRO PRO B . n 
A 1 76  MET 76  76  76  MET MET B . n 
A 1 77  ARG 77  77  77  ARG ARG B . n 
A 1 78  LYS 78  78  78  LYS LYS B . n 
A 1 79  GLU 79  79  79  GLU GLU B . n 
A 1 80  VAL 80  80  80  VAL VAL B . n 
A 1 81  TYR 81  81  81  TYR TYR B . n 
A 1 82  GLN 82  82  82  GLN GLN B . n 
A 1 83  GLN 83  83  83  GLN GLN B . n 
A 1 84  VAL 84  84  84  VAL VAL B . n 
A 1 85  SER 85  85  85  SER SER B . n 
A 1 86  SER 86  86  86  SER SER B . n 
A 1 87  ARG 87  87  87  ARG ARG B . n 
A 1 88  ILE 88  88  88  ILE ILE B . n 
A 1 89  MET 89  89  89  MET MET B . n 
A 1 90  ASN 90  90  90  ASN ASN B . n 
A 1 91  LEU 91  91  91  LEU LEU B . n 
A 1 92  LEU 92  92  92  LEU LEU B . n 
A 1 93  ARG 93  93  93  ARG ARG B . n 
A 1 94  GLU 94  94  94  GLU GLU B . n 
A 1 95  TYR 95  95  95  TYR TYR B . n 
A 1 96  SER 96  96  96  SER SER B . n 
A 1 97  GLU 97  97  97  GLU GLU B . n 
A 1 98  LYS 98  98  98  LYS LYS B . n 
A 1 99  ILE 99  99  99  ILE ILE B . n 
A 1 100 GLU 100 100 100 GLU GLU B . n 
A 1 101 ILE 101 101 101 ILE ILE B . n 
A 1 102 ALA 102 102 102 ALA ALA B . n 
A 1 103 SER 103 103 103 SER SER B . n 
A 1 104 ILE 104 104 104 ILE ILE B . n 
A 1 105 ASP 105 105 105 ASP ASP B . n 
A 1 106 GLU 106 106 106 GLU GLU B . n 
A 1 107 ALA 107 107 107 ALA ALA B . n 
A 1 108 TYR 108 108 108 TYR TYR B . n 
A 1 109 LEU 109 109 109 LEU LEU B . n 
A 1 110 ASP 110 110 110 ASP ASP B . n 
A 1 111 ILE 111 111 111 ILE ILE B . n 
A 1 112 SER 112 112 112 SER SER B . n 
A 1 113 ASP 113 113 113 ASP ASP B . n 
A 1 114 LYS 114 114 114 LYS LYS B . n 
A 1 115 VAL 115 115 115 VAL VAL B . n 
A 1 116 ARG 116 116 116 ARG ARG B . n 
A 1 117 ASP 117 117 117 ASP ASP B . n 
A 1 118 TYR 118 118 118 TYR TYR B . n 
A 1 119 ARG 119 119 119 ARG ARG B . n 
A 1 120 GLU 120 120 120 GLU GLU B . n 
A 1 121 ALA 121 121 121 ALA ALA B . n 
A 1 122 TYR 122 122 122 TYR TYR B . n 
A 1 123 ASN 123 123 123 ASN ASN B . n 
A 1 124 LEU 124 124 124 LEU LEU B . n 
A 1 125 GLY 125 125 125 GLY GLY B . n 
A 1 126 LEU 126 126 126 LEU LEU B . n 
A 1 127 GLU 127 127 127 GLU GLU B . n 
A 1 128 ILE 128 128 128 ILE ILE B . n 
A 1 129 LYS 129 129 129 LYS LYS B . n 
A 1 130 ASN 130 130 130 ASN ASN B . n 
A 1 131 LYS 131 131 131 LYS LYS B . n 
A 1 132 ILE 132 132 132 ILE ILE B . n 
A 1 133 LEU 133 133 133 LEU LEU B . n 
A 1 134 GLU 134 134 134 GLU GLU B . n 
A 1 135 LYS 135 135 135 LYS LYS B . n 
A 1 136 GLU 136 136 136 GLU GLU B . n 
A 1 137 LYS 137 137 137 LYS LYS B . n 
A 1 138 ILE 138 138 138 ILE ILE B . n 
A 1 139 THR 139 139 139 THR THR B . n 
A 1 140 VAL 140 140 140 VAL VAL B . n 
A 1 141 THR 141 141 141 THR THR B . n 
A 1 142 VAL 142 142 142 VAL VAL B . n 
A 1 143 GLY 143 143 143 GLY GLY B . n 
A 1 144 ILE 144 144 144 ILE ILE B . n 
A 1 145 SER 145 145 145 SER SER B . n 
A 1 146 LYS 146 146 146 LYS LYS B . n 
A 1 147 ASN 147 147 147 ASN ASN B . n 
A 1 148 LYS 148 148 148 LYS LYS B . n 
A 1 149 VAL 149 149 149 VAL VAL B . n 
A 1 150 PHE 150 150 150 PHE PHE B . n 
A 1 151 ALA 151 151 151 ALA ALA B . n 
A 1 152 LYS 152 152 152 LYS LYS B . n 
A 1 153 ILE 153 153 153 ILE ILE B . n 
A 1 154 ALA 154 154 154 ALA ALA B . n 
A 1 155 ALA 155 155 155 ALA ALA B . n 
A 1 156 ASP 156 156 156 ASP ASP B . n 
A 1 157 MET 157 157 157 MET MET B . n 
A 1 158 ALA 158 158 158 ALA ALA B . n 
A 1 159 LYS 159 159 159 LYS LYS B . n 
A 1 160 PRO 160 160 160 PRO PRO B . n 
A 1 161 ASN 161 161 161 ASN ASN B . n 
A 1 162 GLY 162 162 162 GLY GLY B . n 
A 1 163 ILE 163 163 163 ILE ILE B . n 
A 1 164 LYS 164 164 164 LYS LYS B . n 
A 1 165 VAL 165 165 165 VAL VAL B . n 
A 1 166 ILE 166 166 166 ILE ILE B . n 
A 1 167 ASP 167 167 167 ASP ASP B . n 
A 1 168 ASP 168 168 168 ASP ASP B . n 
A 1 169 GLU 169 169 169 GLU GLU B . n 
A 1 170 GLU 170 170 170 GLU GLU B . n 
A 1 171 VAL 171 171 171 VAL VAL B . n 
A 1 172 LYS 172 172 172 LYS LYS B . n 
A 1 173 ARG 173 173 173 ARG ARG B . n 
A 1 174 LEU 174 174 174 LEU LEU B . n 
A 1 175 ILE 175 175 175 ILE ILE B . n 
A 1 176 ARG 176 176 176 ARG ARG B . n 
A 1 177 GLU 177 177 177 GLU GLU B . n 
A 1 178 LEU 178 178 178 LEU LEU B . n 
A 1 179 ASP 179 179 179 ASP ASP B . n 
A 1 180 ILE 180 180 180 ILE ILE B . n 
A 1 181 ALA 181 181 181 ALA ALA B . n 
A 1 182 ASP 182 182 182 ASP ASP B . n 
A 1 183 VAL 183 183 183 VAL VAL B . n 
A 1 184 PRO 184 184 184 PRO PRO B . n 
A 1 185 GLY 185 185 185 GLY GLY B . n 
A 1 186 ILE 186 186 186 ILE ILE B . n 
A 1 187 GLY 187 187 187 GLY GLY B . n 
A 1 188 ASN 188 188 188 ASN ASN B . n 
A 1 189 ILE 189 189 189 ILE ILE B . n 
A 1 190 THR 190 190 190 THR THR B . n 
A 1 191 ALA 191 191 191 ALA ALA B . n 
A 1 192 GLU 192 192 192 GLU GLU B . n 
A 1 193 LYS 193 193 193 LYS LYS B . n 
A 1 194 LEU 194 194 194 LEU LEU B . n 
A 1 195 LYS 195 195 195 LYS LYS B . n 
A 1 196 LYS 196 196 196 LYS LYS B . n 
A 1 197 LEU 197 197 197 LEU LEU B . n 
A 1 198 GLY 198 198 198 GLY GLY B . n 
A 1 199 ILE 199 199 199 ILE ILE B . n 
A 1 200 ASN 200 200 200 ASN ASN B . n 
A 1 201 LYS 201 201 201 LYS LYS B . n 
A 1 202 LEU 202 202 202 LEU LEU B . n 
A 1 203 VAL 203 203 203 VAL VAL B . n 
A 1 204 ASP 204 204 204 ASP ASP B . n 
A 1 205 THR 205 205 205 THR THR B . n 
A 1 206 LEU 206 206 206 LEU LEU B . n 
A 1 207 SER 207 207 207 SER SER B . n 
A 1 208 ILE 208 208 208 ILE ILE B . n 
A 1 209 GLU 209 209 209 GLU GLU B . n 
A 1 210 PHE 210 210 210 PHE PHE B . n 
A 1 211 ASP 211 211 211 ASP ASP B . n 
A 1 212 LYS 212 212 212 LYS LYS B . n 
A 1 213 LEU 213 213 213 LEU LEU B . n 
A 1 214 LYS 214 214 214 LYS LYS B . n 
A 1 215 GLY 215 215 215 GLY GLY B . n 
A 1 216 MET 216 216 216 MET MET B . n 
A 1 217 ILE 217 217 217 ILE ILE B . n 
A 1 218 GLY 218 218 218 GLY GLY B . n 
A 1 219 GLU 219 219 219 GLU GLU B . n 
A 1 220 ALA 220 220 220 ALA ALA B . n 
A 1 221 LYS 221 221 221 LYS LYS B . n 
A 1 222 ALA 222 222 222 ALA ALA B . n 
A 1 223 LYS 223 223 223 LYS LYS B . n 
A 1 224 TYR 224 224 224 TYR TYR B . n 
A 1 225 LEU 225 225 225 LEU LEU B . n 
A 1 226 ILE 226 226 226 ILE ILE B . n 
A 1 227 SER 227 227 227 SER SER B . n 
A 1 228 LEU 228 228 228 LEU LEU B . n 
A 1 229 ALA 229 229 229 ALA ALA B . n 
A 1 230 ARG 230 230 230 ARG ARG B . n 
A 1 231 ASP 231 231 231 ASP ASP B . n 
A 1 232 GLU 232 232 232 GLU GLU B . n 
A 1 233 TYR 233 233 233 TYR TYR B . n 
A 1 234 ASN 234 234 234 ASN ASN B . n 
A 1 235 GLU 235 235 235 GLU GLU B . n 
A 1 236 PRO 236 236 236 PRO PRO B . n 
A 1 237 ILE 237 237 237 ILE ILE B . n 
A 1 238 ARG 238 238 238 ARG ARG B . n 
A 1 239 THR 239 239 239 THR THR B . n 
A 1 240 ARG 240 240 240 ARG ARG B . n 
A 1 241 VAL 241 241 241 VAL VAL B . n 
A 1 242 ARG 242 242 242 ARG ARG B . n 
A 1 243 LYS 243 243 243 LYS LYS B . n 
A 1 244 SER 244 244 244 SER SER B . n 
A 1 245 ILE 245 245 245 ILE ILE B . n 
A 1 246 GLY 246 246 246 GLY GLY B . n 
A 1 247 ARG 247 247 247 ARG ARG B . n 
A 1 248 ILE 248 248 248 ILE ILE B . n 
A 1 249 VAL 249 249 249 VAL VAL B . n 
A 1 250 THR 250 250 250 THR THR B . n 
A 1 251 MET 251 251 251 MET MET B . n 
A 1 252 LYS 252 252 252 LYS LYS B . n 
A 1 253 ARG 253 253 253 ARG ARG B . n 
A 1 254 ASN 254 254 254 ASN ASN B . n 
A 1 255 SER 255 255 255 SER SER B . n 
A 1 256 ARG 256 256 256 ARG ARG B . n 
A 1 257 ASN 257 257 257 ASN ASN B . n 
A 1 258 LEU 258 258 258 LEU LEU B . n 
A 1 259 GLU 259 259 259 GLU GLU B . n 
A 1 260 GLU 260 260 260 GLU GLU B . n 
A 1 261 ILE 261 261 261 ILE ILE B . n 
A 1 262 LYS 262 262 262 LYS LYS B . n 
A 1 263 PRO 263 263 263 PRO PRO B . n 
A 1 264 TYR 264 264 264 TYR TYR B . n 
A 1 265 LEU 265 265 265 LEU LEU B . n 
A 1 266 PHE 266 266 266 PHE PHE B . n 
A 1 267 ARG 267 267 267 ARG ARG B . n 
A 1 268 ALA 268 268 268 ALA ALA B . n 
A 1 269 ILE 269 269 269 ILE ILE B . n 
A 1 270 GLU 270 270 270 GLU GLU B . n 
A 1 271 GLU 271 271 271 GLU GLU B . n 
A 1 272 SER 272 272 272 SER SER B . n 
A 1 273 TYR 273 273 273 TYR TYR B . n 
A 1 274 TYR 274 274 274 TYR TYR B . n 
A 1 275 LYS 275 275 275 LYS LYS B . n 
A 1 276 LEU 276 276 276 LEU LEU B . n 
A 1 277 ASP 277 277 277 ASP ASP B . n 
A 1 278 LYS 278 278 278 LYS LYS B . n 
A 1 279 ARG 279 279 279 ARG ARG B . n 
A 1 280 ILE 280 280 280 ILE ILE B . n 
A 1 281 PRO 281 281 281 PRO PRO B . n 
A 1 282 LYS 282 282 282 LYS LYS B . n 
A 1 283 ALA 283 283 283 ALA ALA B . n 
A 1 284 ILE 284 284 284 ILE ILE B . n 
A 1 285 HIS 285 285 285 HIS HIS B . n 
A 1 286 VAL 286 286 286 VAL VAL B . n 
A 1 287 VAL 287 287 287 VAL VAL B . n 
A 1 288 ALA 288 288 288 ALA ALA B . n 
A 1 289 VAL 289 289 289 VAL VAL B . n 
A 1 290 THR 290 290 290 THR THR B . n 
A 1 291 GLU 291 291 291 GLU GLU B . n 
A 1 292 ASP 292 292 292 ASP ASP B . n 
A 1 293 LEU 293 293 293 LEU LEU B . n 
A 1 294 ASP 294 294 294 ASP ASP B . n 
A 1 295 ILE 295 295 295 ILE ILE B . n 
A 1 296 VAL 296 296 296 VAL VAL B . n 
A 1 297 SER 297 297 297 SER SER B . n 
A 1 298 ARG 298 298 298 ARG ARG B . n 
A 1 299 GLY 299 299 299 GLY GLY B . n 
A 1 300 ARG 300 300 300 ARG ARG B . n 
A 1 301 THR 301 301 301 THR THR B . n 
A 1 302 PHE 302 302 302 PHE PHE B . n 
A 1 303 PRO 303 303 303 PRO PRO B . n 
A 1 304 HIS 304 304 304 HIS HIS B . n 
A 1 305 GLY 305 305 305 GLY GLY B . n 
A 1 306 ILE 306 306 306 ILE ILE B . n 
A 1 307 SER 307 307 307 SER SER B . n 
A 1 308 LYS 308 308 308 LYS LYS B . n 
A 1 309 GLU 309 309 309 GLU GLU B . n 
A 1 310 THR 310 310 310 THR THR B . n 
A 1 311 ALA 311 311 311 ALA ALA B . n 
A 1 312 TYR 312 312 312 TYR TYR B . n 
A 1 313 SER 313 313 313 SER SER B . n 
A 1 314 GLU 314 314 314 GLU GLU B . n 
A 1 315 SER 315 315 315 SER SER B . n 
A 1 316 VAL 316 316 316 VAL VAL B . n 
A 1 317 LYS 317 317 317 LYS LYS B . n 
A 1 318 LEU 318 318 318 LEU LEU B . n 
A 1 319 LEU 319 319 319 LEU LEU B . n 
A 1 320 GLN 320 320 320 GLN GLN B . n 
A 1 321 LYS 321 321 321 LYS LYS B . n 
A 1 322 ILE 322 322 322 ILE ILE B . n 
A 1 323 LEU 323 323 323 LEU LEU B . n 
A 1 324 GLU 324 324 324 GLU GLU B . n 
A 1 325 GLU 325 325 325 GLU GLU B . n 
A 1 326 ASP 326 326 326 ASP ASP B . n 
A 1 327 GLU 327 327 327 GLU GLU B . n 
A 1 328 ARG 328 328 328 ARG ARG B . n 
A 1 329 LYS 329 329 329 LYS LYS B . n 
A 1 330 ILE 330 330 330 ILE ILE B . n 
A 1 331 ARG 331 331 331 ARG ARG B . n 
A 1 332 ARG 332 332 332 ARG ARG B . n 
A 1 333 ILE 333 333 333 ILE ILE B . n 
A 1 334 GLY 334 334 334 GLY GLY B . n 
A 1 335 VAL 335 335 335 VAL VAL B . n 
A 1 336 ARG 336 336 336 ARG ARG B . n 
A 1 337 PHE 337 337 337 PHE PHE B . n 
A 1 338 SER 338 338 338 SER SER B . n 
A 1 339 LYS 339 339 339 LYS LYS B . n 
A 1 340 PHE 340 340 340 PHE PHE B . n 
A 1 341 ILE 341 341 341 ILE ILE B . n 
A 1 342 GLU 342 342 ?   ?   ?   B . n 
A 1 343 ALA 343 343 ?   ?   ?   B . n 
A 1 344 ILE 344 344 ?   ?   ?   B . n 
A 1 345 GLY 345 345 ?   ?   ?   B . n 
A 1 346 LEU 346 346 ?   ?   ?   B . n 
A 1 347 ASP 347 347 ?   ?   ?   B . n 
A 1 348 LYS 348 348 ?   ?   ?   B . n 
A 1 349 PHE 349 349 ?   ?   ?   B . n 
A 1 350 PHE 350 350 ?   ?   ?   B . n 
A 1 351 ASP 351 351 ?   ?   ?   B . n 
A 1 352 THR 352 352 ?   ?   ?   B . n 
B 2 1   DG  1   1   1   DG  DG  P . n 
B 2 2   DG  2   2   2   DG  DG  P . n 
B 2 3   DG  3   3   3   DG  DG  P . n 
B 2 4   DG  4   4   4   DG  DG  P . n 
B 2 5   DG  5   5   5   DG  DG  P . n 
B 2 6   DA  6   6   6   DA  DA  P . n 
B 2 7   DA  7   7   7   DA  DA  P . n 
B 2 8   DG  8   8   8   DG  DG  P . n 
B 2 9   DG  9   9   9   DG  DG  P . n 
B 2 10  DA  10  10  10  DA  DA  P . n 
B 2 11  DA  11  11  11  DA  DA  P . n 
B 2 12  DA  12  12  12  DA  DA  P . n 
B 2 13  DG  13  13  13  DG  DG  P . n 
C 3 1   DT  1   0   ?   ?   ?   T . n 
C 3 2   DC  2   1   ?   ?   ?   T . n 
C 3 3   DT  3   2   ?   ?   ?   T . n 
C 3 4   DG  4   3   3   DG  DG  T . n 
C 3 5   DG  5   4   4   DG  DG  T . n 
C 3 6   DC  6   5   5   DC  DC  T . n 
C 3 7   DT  7   6   6   DT  DT  T . n 
C 3 8   DT  8   7   7   DT  DT  T . n 
C 3 9   DT  9   8   8   DT  DT  T . n 
C 3 10  DC  10  9   9   DC  DC  T . n 
C 3 11  DC  11  10  10  DC  DC  T . n 
C 3 12  DT  12  11  11  DT  DT  T . n 
C 3 13  DT  13  12  12  DT  DT  T . n 
C 3 14  DC  14  13  13  DC  DC  T . n 
C 3 15  DC  15  14  14  DC  DC  T . n 
C 3 16  DC  16  15  15  DC  DC  T . n 
C 3 17  DC  17  16  16  DC  DC  T . n 
C 3 18  DC  18  17  17  DC  DC  T . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 CTP 1  2001 2001 CTP CTP B . 
E 5 CA  1  353  353  CA  CA  B . 
F 5 CA  1  354  354  CA  CA  B . 
G 5 CA  1  355  355  CA  CA  B . 
H 5 CA  1  356  356  CA  CA  B . 
I 6 GOL 1  357  357  GOL GOL B . 
J 6 GOL 1  14   14   GOL GOL P . 
K 6 GOL 1  15   15   GOL GOL P . 
L 7 CPT 1  1004 1004 CPT CPT T . 
M 8 HOH 1  358  358  HOH HOH B . 
M 8 HOH 2  359  359  HOH HOH B . 
M 8 HOH 3  360  360  HOH HOH B . 
M 8 HOH 4  361  361  HOH HOH B . 
M 8 HOH 5  362  362  HOH HOH B . 
M 8 HOH 6  363  363  HOH HOH B . 
M 8 HOH 7  364  364  HOH HOH B . 
M 8 HOH 8  365  365  HOH HOH B . 
M 8 HOH 9  366  366  HOH HOH B . 
M 8 HOH 10 367  367  HOH HOH B . 
M 8 HOH 11 368  368  HOH HOH B . 
M 8 HOH 12 369  369  HOH HOH B . 
M 8 HOH 13 370  370  HOH HOH B . 
M 8 HOH 14 371  371  HOH HOH B . 
M 8 HOH 15 372  372  HOH HOH B . 
M 8 HOH 16 373  373  HOH HOH B . 
M 8 HOH 17 374  374  HOH HOH B . 
M 8 HOH 18 375  375  HOH HOH B . 
M 8 HOH 19 376  376  HOH HOH B . 
M 8 HOH 20 377  377  HOH HOH B . 
M 8 HOH 21 378  378  HOH HOH B . 
M 8 HOH 22 379  379  HOH HOH B . 
M 8 HOH 23 380  380  HOH HOH B . 
M 8 HOH 24 381  381  HOH HOH B . 
M 8 HOH 25 382  382  HOH HOH B . 
M 8 HOH 26 383  383  HOH HOH B . 
M 8 HOH 27 384  384  HOH HOH B . 
M 8 HOH 28 385  385  HOH HOH B . 
M 8 HOH 29 386  386  HOH HOH B . 
M 8 HOH 30 387  387  HOH HOH B . 
M 8 HOH 31 388  388  HOH HOH B . 
M 8 HOH 32 389  389  HOH HOH B . 
M 8 HOH 33 390  390  HOH HOH B . 
N 8 HOH 1  19   19   HOH HOH P . 
N 8 HOH 2  28   28   HOH HOH P . 
N 8 HOH 3  35   35   HOH HOH P . 
O 8 HOH 1  18   18   HOH HOH T . 
O 8 HOH 2  22   22   HOH HOH T . 
O 8 HOH 3  29   29   HOH HOH T . 
O 8 HOH 4  31   31   HOH HOH T . 
O 8 HOH 5  39   39   HOH HOH T . 
O 8 HOH 6  40   40   HOH HOH T . 
O 8 HOH 7  48   48   HOH HOH T . 
O 8 HOH 8  57   57   HOH HOH T . 
O 8 HOH 9  58   58   HOH HOH T . 
O 8 HOH 10 84   84   HOH HOH T . 
O 8 HOH 11 93   93   HOH HOH T . 
O 8 HOH 12 94   94   HOH HOH T . 
O 8 HOH 13 391  391  HOH HOH T . 
O 8 HOH 14 392  392  HOH HOH T . 
O 8 HOH 15 393  393  HOH HOH T . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5760  ? 
1 MORE         -89   ? 
1 'SSA (A^2)'  20120 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  N7    ? C DG  5   ? T DG  4    ? 1_555 PT1 ? L CPT . ? T CPT 1004 ? 1_555 N1    ? L CPT .   ? T CPT 1004 ? 1_555 84.7  ? 
2  N7    ? C DG  5   ? T DG  4    ? 1_555 PT1 ? L CPT . ? T CPT 1004 ? 1_555 N2    ? L CPT .   ? T CPT 1004 ? 1_555 172.8 ? 
3  N1    ? L CPT .   ? T CPT 1004 ? 1_555 PT1 ? L CPT . ? T CPT 1004 ? 1_555 N2    ? L CPT .   ? T CPT 1004 ? 1_555 89.2  ? 
4  N7    ? C DG  5   ? T DG  4    ? 1_555 PT1 ? L CPT . ? T CPT 1004 ? 1_555 N7    ? C DG  4   ? T DG  3    ? 1_555 99.5  ? 
5  N1    ? L CPT .   ? T CPT 1004 ? 1_555 PT1 ? L CPT . ? T CPT 1004 ? 1_555 N7    ? C DG  4   ? T DG  3    ? 1_555 175.0 ? 
6  N2    ? L CPT .   ? T CPT 1004 ? 1_555 PT1 ? L CPT . ? T CPT 1004 ? 1_555 N7    ? C DG  4   ? T DG  3    ? 1_555 86.5  ? 
7  OD1   ? A ASP 7   ? B ASP 7    ? 1_555 CA  ? F CA  . ? B CA  354  ? 1_555 O     ? A PHE 8   ? B PHE 8    ? 1_555 83.4  ? 
8  OD1   ? A ASP 7   ? B ASP 7    ? 1_555 CA  ? F CA  . ? B CA  354  ? 1_555 O2B   ? D CTP .   ? B CTP 2001 ? 1_555 153.1 ? 
9  O     ? A PHE 8   ? B PHE 8    ? 1_555 CA  ? F CA  . ? B CA  354  ? 1_555 O2B   ? D CTP .   ? B CTP 2001 ? 1_555 92.5  ? 
10 OD1   ? A ASP 7   ? B ASP 7    ? 1_555 CA  ? F CA  . ? B CA  354  ? 1_555 OD2   ? A ASP 105 ? B ASP 105  ? 1_555 116.0 ? 
11 O     ? A PHE 8   ? B PHE 8    ? 1_555 CA  ? F CA  . ? B CA  354  ? 1_555 OD2   ? A ASP 105 ? B ASP 105  ? 1_555 82.4  ? 
12 O2B   ? D CTP .   ? B CTP 2001 ? 1_555 CA  ? F CA  . ? B CA  354  ? 1_555 OD2   ? A ASP 105 ? B ASP 105  ? 1_555 89.5  ? 
13 OD1   ? A ASP 7   ? B ASP 7    ? 1_555 CA  ? F CA  . ? B CA  354  ? 1_555 O1A   ? D CTP .   ? B CTP 2001 ? 1_555 109.6 ? 
14 O     ? A PHE 8   ? B PHE 8    ? 1_555 CA  ? F CA  . ? B CA  354  ? 1_555 O1A   ? D CTP .   ? B CTP 2001 ? 1_555 155.3 ? 
15 O2B   ? D CTP .   ? B CTP 2001 ? 1_555 CA  ? F CA  . ? B CA  354  ? 1_555 O1A   ? D CTP .   ? B CTP 2001 ? 1_555 66.3  ? 
16 OD2   ? A ASP 105 ? B ASP 105  ? 1_555 CA  ? F CA  . ? B CA  354  ? 1_555 O1A   ? D CTP .   ? B CTP 2001 ? 1_555 108.6 ? 
17 O     ? A ALA 181 ? B ALA 181  ? 1_555 CA  ? G CA  . ? B CA  355  ? 1_555 O     ? A ILE 186 ? B ILE 186  ? 1_555 75.8  ? 
18 OE2   ? A GLU 106 ? B GLU 106  ? 1_555 CA  ? E CA  . ? B CA  353  ? 1_555 "O5'" ? D CTP .   ? B CTP 2001 ? 1_555 161.5 ? 
19 OE2   ? A GLU 106 ? B GLU 106  ? 1_555 CA  ? E CA  . ? B CA  353  ? 1_555 OD1   ? A ASP 105 ? B ASP 105  ? 1_555 108.6 ? 
20 "O5'" ? D CTP .   ? B CTP 2001 ? 1_555 CA  ? E CA  . ? B CA  353  ? 1_555 OD1   ? A ASP 105 ? B ASP 105  ? 1_555 89.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-06-16 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .     ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com      'data reduction'  http://www.hkl-xray.com/ 
?          ? 
2 SCALEPACK   .     ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com      'data scaling'    http://www.hkl-xray.com/ 
?          ? 
3 CNS         .     ?               package 'Axel T. Brunger'    axel.brunger@yale.edu refinement        http://cns-online.org/ 
Fortran_77 ? 
4 PDB_EXTRACT 3.100 'Jan. 22, 2010' package PDB                  help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++        ? 
5 HKL-2000    .     ?               ?       ?                    ?                     'data collection' ? ?          ? 
6 CNS         .     ?               ?       ?                    ?                     phasing           ? ?          ? 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 C2    T DG 3 ? ? N3    T DG 3 ? ? 1.375 1.323 0.052  0.008 N 
2  1 N3    T DG 3 ? ? C4    T DG 3 ? ? 1.431 1.350 0.081  0.007 N 
3  1 N7    T DG 3 ? ? C8    T DG 3 ? ? 1.210 1.305 -0.095 0.006 N 
4  1 N9    T DG 3 ? ? C4    T DG 3 ? ? 1.492 1.375 0.117  0.008 N 
5  1 "C1'" T DG 4 ? ? N9    T DG 4 ? ? 1.609 1.488 0.121  0.013 N 
6  1 C5    T DG 4 ? ? C6    T DG 4 ? ? 1.319 1.419 -0.100 0.010 N 
7  1 N7    T DG 4 ? ? C8    T DG 4 ? ? 1.385 1.305 0.080  0.006 N 
8  1 C8    T DG 4 ? ? N9    T DG 4 ? ? 1.480 1.374 0.106  0.007 N 
9  1 N9    T DG 4 ? ? C4    T DG 4 ? ? 1.259 1.375 -0.116 0.008 N 
10 1 "C5'" T DC 5 ? ? "C4'" T DC 5 ? ? 1.597 1.512 0.085  0.007 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O3'" P DA 12 ? ? P     P DG 13 ? ? OP2   P DG 13 ? ? 117.48 110.50 6.98   1.10 Y 
2  1 "O4'" T DG 3  ? ? "C1'" T DG 3  ? ? N9    T DG 3  ? ? 95.27  108.00 -12.73 0.70 N 
3  1 C2    T DG 3  ? ? N3    T DG 3  ? ? C4    T DG 3  ? ? 115.57 111.90 3.67   0.50 N 
4  1 N3    T DG 3  ? ? C4    T DG 3  ? ? C5    T DG 3  ? ? 123.22 128.60 -5.38  0.50 N 
5  1 C5    T DG 3  ? ? C6    T DG 3  ? ? N1    T DG 3  ? ? 115.56 111.50 4.06   0.50 N 
6  1 N7    T DG 3  ? ? C8    T DG 3  ? ? N9    T DG 3  ? ? 116.14 113.10 3.04   0.50 N 
7  1 N9    T DG 3  ? ? C4    T DG 3  ? ? C5    T DG 3  ? ? 101.51 105.40 -3.89  0.40 N 
8  1 N3    T DG 3  ? ? C4    T DG 3  ? ? N9    T DG 3  ? ? 135.27 126.00 9.27   0.60 N 
9  1 C8    T DG 3  ? ? N9    T DG 3  ? ? "C1'" T DG 3  ? ? 119.07 127.00 -7.93  1.30 N 
10 1 "O4'" T DG 4  ? ? "C1'" T DG 4  ? ? N9    T DG 4  ? ? 111.89 108.30 3.59   0.30 N 
11 1 C4    T DG 4  ? ? C5    T DG 4  ? ? N7    T DG 4  ? ? 113.80 110.80 3.00   0.40 N 
12 1 N7    T DG 4  ? ? C8    T DG 4  ? ? N9    T DG 4  ? ? 109.13 113.10 -3.97  0.50 N 
13 1 C6    T DG 4  ? ? C5    T DG 4  ? ? N7    T DG 4  ? ? 126.46 130.40 -3.94  0.60 N 
14 1 C8    T DG 4  ? ? N9    T DG 4  ? ? "C1'" T DG 4  ? ? 136.20 127.00 9.20   1.30 N 
15 1 C4    T DG 4  ? ? N9    T DG 4  ? ? "C1'" T DG 4  ? ? 116.45 126.50 -10.05 1.30 N 
16 1 "C3'" T DT 11 ? ? "C2'" T DT 11 ? ? "C1'" T DT 11 ? ? 96.09  102.40 -6.31  0.80 N 
17 1 "O5'" T DC 16 ? ? "C5'" T DC 16 ? ? "C4'" T DC 16 ? ? 101.90 109.40 -7.50  0.80 N 
18 1 "C1'" T DC 17 ? ? "O4'" T DC 17 ? ? "C4'" T DC 17 ? ? 104.03 110.10 -6.07  1.00 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR B 10  ? ? 16.53   45.98   
2  1 PHE B 11  ? ? -29.71  -78.81  
3  1 VAL B 15  ? ? -55.93  -2.33   
4  1 ASN B 20  ? ? -164.77 70.79   
5  1 PHE B 37  ? ? 156.49  159.22  
6  1 ASN B 47  ? ? -46.33  167.95  
7  1 LYS B 52  ? ? -48.71  -19.91  
8  1 SER B 96  ? ? 170.68  141.58  
9  1 ASP B 105 ? ? -151.75 35.59   
10 1 ILE B 111 ? ? -105.52 46.97   
11 1 ASP B 113 ? ? -142.15 17.72   
12 1 SER B 145 ? ? -173.16 -168.19 
13 1 ASN B 161 ? ? 35.82   57.80   
14 1 ILE B 166 ? ? -115.72 76.83   
15 1 VAL B 203 ? ? -49.44  -18.64  
16 1 ASP B 211 ? ? -48.97  -16.12  
17 1 ARG B 253 ? ? -176.14 140.87  
18 1 SER B 255 ? ? 175.82  166.41  
19 1 ASP B 277 ? ? 40.32   89.81   
20 1 LYS B 278 ? ? 81.25   -18.17  
21 1 THR B 290 ? ? -48.27  156.38  
22 1 PHE B 340 ? ? -61.13  -179.41 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DG T 3 ? ? 0.121 'SIDE CHAIN' 
2 1 DG T 4 ? ? 0.078 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 P DG  13   ? "O5'" ? B DG  13 "O5'" 
2  1 Y 1 P DG  13   ? "C5'" ? B DG  13 "C5'" 
3  1 Y 1 P DG  13   ? "C4'" ? B DG  13 "C4'" 
4  1 Y 1 P DG  13   ? "O4'" ? B DG  13 "O4'" 
5  1 Y 1 P DG  13   ? "C3'" ? B DG  13 "C3'" 
6  1 Y 1 P DG  13   ? "O3'" ? B DG  13 "O3'" 
7  1 Y 1 P DG  13   ? "C2'" ? B DG  13 "C2'" 
8  1 Y 1 P DG  13   ? "C1'" ? B DG  13 "C1'" 
9  1 Y 1 P DG  13   ? N9    ? B DG  13 N9    
10 1 Y 1 P DG  13   ? C8    ? B DG  13 C8    
11 1 Y 1 P DG  13   ? N7    ? B DG  13 N7    
12 1 Y 1 P DG  13   ? C5    ? B DG  13 C5    
13 1 Y 1 P DG  13   ? C6    ? B DG  13 C6    
14 1 Y 1 P DG  13   ? O6    ? B DG  13 O6    
15 1 Y 1 P DG  13   ? N1    ? B DG  13 N1    
16 1 Y 1 P DG  13   ? C2    ? B DG  13 C2    
17 1 Y 1 P DG  13   ? N2    ? B DG  13 N2    
18 1 Y 1 P DG  13   ? N3    ? B DG  13 N3    
19 1 Y 1 P DG  13   ? C4    ? B DG  13 C4    
20 1 Y 1 T DC  5    ? P     ? C DC  6  P     
21 1 N 1 B CTP 2001 ? "O2'" ? D CTP 1  "O2'" 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B GLU 342 ? A GLU 342 
2  1 Y 1 B ALA 343 ? A ALA 343 
3  1 Y 1 B ILE 344 ? A ILE 344 
4  1 Y 1 B GLY 345 ? A GLY 345 
5  1 Y 1 B LEU 346 ? A LEU 346 
6  1 Y 1 B ASP 347 ? A ASP 347 
7  1 Y 1 B LYS 348 ? A LYS 348 
8  1 Y 1 B PHE 349 ? A PHE 349 
9  1 Y 1 B PHE 350 ? A PHE 350 
10 1 Y 1 B ASP 351 ? A ASP 351 
11 1 Y 1 B THR 352 ? A THR 352 
12 1 Y 1 T DT  0   ? C DT  1   
13 1 Y 1 T DC  1   ? C DC  2   
14 1 Y 1 T DT  2   ? C DT  3   
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3M9M 'double helix'        
3M9M 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 1  1_555 C DC 18 1_555 -0.213 -0.472 0.089  8.238  -2.096 -8.563 1  P_DG1:DC17_T P 1  ? T 17 ? 19 1 
1 B DG 2  1_555 C DC 17 1_555 -0.081 -0.719 -0.247 6.862  -1.539 -1.927 2  P_DG2:DC16_T P 2  ? T 16 ? 19 1 
1 B DG 3  1_555 C DC 16 1_555 -0.095 -0.289 0.109  5.401  2.118  -6.630 3  P_DG3:DC15_T P 3  ? T 15 ? 19 1 
1 B DG 4  1_555 C DC 15 1_555 -0.025 0.199  0.179  9.203  -1.861 4.130  4  P_DG4:DC14_T P 4  ? T 14 ? 19 1 
1 B DG 5  1_555 C DC 14 1_555 0.515  -0.451 -0.137 -2.562 -3.930 3.314  5  P_DG5:DC13_T P 5  ? T 13 ? 19 1 
1 B DA 6  1_555 C DT 13 1_555 0.378  -0.192 -0.037 -2.255 4.770  4.622  6  P_DA6:DT12_T P 6  ? T 12 ? 20 1 
1 B DA 7  1_555 C DT 12 1_555 0.450  0.186  -0.569 -6.373 4.671  4.747  7  P_DA7:DT11_T P 7  ? T 11 ? 20 1 
1 B DG 8  1_555 C DC 11 1_555 -0.736 -0.611 0.009  13.127 -0.609 4.871  8  P_DG8:DC10_T P 8  ? T 10 ? 19 1 
1 B DG 9  1_555 C DC 10 1_555 0.392  -0.399 -0.317 -7.983 1.121  2.747  9  P_DG9:DC9_T  P 9  ? T 9  ? 19 1 
1 B DA 10 1_555 C DT 9  1_555 0.149  -0.180 0.095  4.216  -2.952 14.017 10 P_DA10:DT8_T P 10 ? T 8  ? 20 1 
1 B DA 11 1_555 C DT 8  1_555 0.613  0.283  0.091  14.384 -7.636 2.023  11 P_DA11:DT7_T P 11 ? T 7  ? 20 1 
1 B DA 12 1_555 C DT 7  1_555 -0.547 -0.378 0.026  14.359 1.783  6.226  12 P_DA12:DT6_T P 12 ? T 6  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 1  1_555 C DC 18 1_555 B DG 2  1_555 C DC 17 1_555 0.742  -0.727 3.433 4.948  -1.316 30.752 -1.085 -0.370 3.534 -2.459 
-9.250 31.165 1  PP_DG1DG2:DC16DC17_TT P 1  ? T 17 ? P 2  ? T 16 ? 
1 B DG 2  1_555 C DC 17 1_555 B DG 3  1_555 C DC 16 1_555 -1.346 0.005  3.562 -6.754 0.681  31.581 -0.129 1.064  3.761 1.233  
12.234 32.284 2  PP_DG2DG3:DC15DC16_TT P 2  ? T 16 ? P 3  ? T 15 ? 
1 B DG 3  1_555 C DC 16 1_555 B DG 4  1_555 C DC 15 1_555 1.098  -0.379 3.257 2.279  3.577  32.848 -1.269 -1.542 3.266 6.293  
-4.008 33.113 3  PP_DG3DG4:DC14DC15_TT P 3  ? T 15 ? P 4  ? T 14 ? 
1 B DG 4  1_555 C DC 15 1_555 B DG 5  1_555 C DC 14 1_555 0.241  -1.555 3.487 2.859  13.574 34.870 -4.180 -0.004 2.727 21.622 
-4.554 37.448 4  PP_DG4DG5:DC13DC14_TT P 4  ? T 14 ? P 5  ? T 13 ? 
1 B DG 5  1_555 C DC 14 1_555 B DA 6  1_555 C DT 13 1_555 -1.094 1.009  3.331 -2.462 6.878  45.523 0.670  1.176  3.491 8.821  
3.157  46.074 5  PP_DG5DA6:DT12DC13_TT P 5  ? T 13 ? P 6  ? T 12 ? 
1 B DA 6  1_555 C DT 13 1_555 B DA 7  1_555 C DT 12 1_555 -0.625 -0.268 3.368 0.528  8.720  35.151 -1.682 1.083  3.203 14.169 
-0.858 36.187 6  PP_DA6DA7:DT11DT12_TT P 6  ? T 12 ? P 7  ? T 11 ? 
1 B DA 7  1_555 C DT 12 1_555 B DG 8  1_555 C DC 11 1_555 -0.136 0.498  3.276 -0.121 -3.956 35.633 1.373  0.204  3.205 -6.439 
0.196  35.845 7  PP_DA7DG8:DC10DT11_TT P 7  ? T 11 ? P 8  ? T 10 ? 
1 B DG 8  1_555 C DC 11 1_555 B DG 9  1_555 C DC 10 1_555 -0.244 -0.872 3.998 -1.846 0.079  38.133 -1.346 0.088  4.004 0.121  
2.824  38.176 8  PP_DG8DG9:DC9DC10_TT  P 8  ? T 10 ? P 9  ? T 9  ? 
1 B DG 9  1_555 C DC 10 1_555 B DA 10 1_555 C DT 9  1_555 0.089  0.536  2.976 -0.814 8.549  31.723 -0.418 -0.288 3.011 15.292 
1.455  32.836 9  PP_DG9DA10:DT8DC9_TT  P 9  ? T 9  ? P 10 ? T 8  ? 
1 B DA 10 1_555 C DT 9  1_555 B DA 11 1_555 C DT 8  1_555 -0.525 -0.529 3.357 4.238  -4.966 35.267 -0.127 1.478  3.316 -8.110 
-6.922 35.847 10 PP_DA10DA11:DT7DT8_TT P 10 ? T 8  ? P 11 ? T 7  ? 
1 B DA 11 1_555 C DT 8  1_555 B DA 12 1_555 C DT 7  1_555 0.482  -0.700 3.405 -0.476 3.463  23.538 -2.864 -1.330 3.259 8.429  
1.159  23.792 11 PP_DA11DA12:DT6DT7_TT P 11 ? T 7  ? P 12 ? T 6  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 "CYTIDINE-5'-TRIPHOSPHATE" CTP 
5 'CALCIUM ION'              CA  
6 GLYCEROL                   GOL 
7 Cisplatin                  CPT 
8 water                      HOH 
#