data_3MB3
# 
_entry.id   3MB3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3MB3         
RCSB  RCSB058331   
WWPDB D_1000058331 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3MB4 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        3MB3 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-03-25 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Filippakopoulos, P.'                  1  
'Picaud, S.'                           2  
'Keates, T.'                           3  
'Ugochukwu, E.'                        4  
'von Delft, F.'                        5  
'Arrowsmith, C.H.'                     6  
'Edwards, A.M.'                        7  
'Weigelt, J.'                          8  
'Bountra, C.'                          9  
'Knapp, S.'                            10 
'Structural Genomics Consortium (SGC)' 11 
# 
_citation.id                        primary 
_citation.title                     'Histone recognition and large-scale structural analysis of the human bromodomain family.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            149 
_citation.page_first                214 
_citation.page_last                 231 
_citation.year                      2012 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22464331 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2012.02.013 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Filippakopoulos, P.' 1  
primary 'Picaud, S.'          2  
primary 'Mangos, M.'          3  
primary 'Keates, T.'          4  
primary 'Lambert, J.P.'       5  
primary 'Barsyte-Lovejoy, D.' 6  
primary 'Felletar, I.'        7  
primary 'Volkmer, R.'         8  
primary 'Muller, S.'          9  
primary 'Pawson, T.'          10 
primary 'Gingras, A.C.'       11 
primary 'Arrowsmith, C.H.'    12 
primary 'Knapp, S.'           13 
# 
_cell.length_a           92.090 
_cell.length_b           92.090 
_cell.length_c           76.120 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           3MB3 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              6 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.entry_id                         3MB3 
_symmetry.Int_Tables_number                152 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PH-interacting protein' 16131.264 1  ? ? 'UNP residues 1302-1434' ? 
2 non-polymer syn 1-methylpyrrolidin-2-one 99.131    1  ? ? ?                        ? 
3 water       nat water                    18.015    85 ? ? ?                        ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PHIP, IRS-1 PH domain-binding protein, WD repeat-containing protein 11' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMDHQPRRRLRNRAQSYDIQAWKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFATVRETLEAGNYESPM
ELCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFEEHISSVLSDYKSALRFHKR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMDHQPRRRLRNRAQSYDIQAWKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFATVRETLEAGNYESPM
ELCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFEEHISSVLSDYKSALRFHKR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   ASP n 
1 4   HIS n 
1 5   GLN n 
1 6   PRO n 
1 7   ARG n 
1 8   ARG n 
1 9   ARG n 
1 10  LEU n 
1 11  ARG n 
1 12  ASN n 
1 13  ARG n 
1 14  ALA n 
1 15  GLN n 
1 16  SER n 
1 17  TYR n 
1 18  ASP n 
1 19  ILE n 
1 20  GLN n 
1 21  ALA n 
1 22  TRP n 
1 23  LYS n 
1 24  LYS n 
1 25  GLN n 
1 26  CYS n 
1 27  GLU n 
1 28  GLU n 
1 29  LEU n 
1 30  LEU n 
1 31  ASN n 
1 32  LEU n 
1 33  ILE n 
1 34  PHE n 
1 35  GLN n 
1 36  CYS n 
1 37  GLU n 
1 38  ASP n 
1 39  SER n 
1 40  GLU n 
1 41  PRO n 
1 42  PHE n 
1 43  ARG n 
1 44  GLN n 
1 45  PRO n 
1 46  VAL n 
1 47  ASP n 
1 48  LEU n 
1 49  LEU n 
1 50  GLU n 
1 51  TYR n 
1 52  PRO n 
1 53  ASP n 
1 54  TYR n 
1 55  ARG n 
1 56  ASP n 
1 57  ILE n 
1 58  ILE n 
1 59  ASP n 
1 60  THR n 
1 61  PRO n 
1 62  MET n 
1 63  ASP n 
1 64  PHE n 
1 65  ALA n 
1 66  THR n 
1 67  VAL n 
1 68  ARG n 
1 69  GLU n 
1 70  THR n 
1 71  LEU n 
1 72  GLU n 
1 73  ALA n 
1 74  GLY n 
1 75  ASN n 
1 76  TYR n 
1 77  GLU n 
1 78  SER n 
1 79  PRO n 
1 80  MET n 
1 81  GLU n 
1 82  LEU n 
1 83  CYS n 
1 84  LYS n 
1 85  ASP n 
1 86  VAL n 
1 87  ARG n 
1 88  LEU n 
1 89  ILE n 
1 90  PHE n 
1 91  SER n 
1 92  ASN n 
1 93  SER n 
1 94  LYS n 
1 95  ALA n 
1 96  TYR n 
1 97  THR n 
1 98  PRO n 
1 99  SER n 
1 100 LYS n 
1 101 ARG n 
1 102 SER n 
1 103 ARG n 
1 104 ILE n 
1 105 TYR n 
1 106 SER n 
1 107 MET n 
1 108 SER n 
1 109 LEU n 
1 110 ARG n 
1 111 LEU n 
1 112 SER n 
1 113 ALA n 
1 114 PHE n 
1 115 PHE n 
1 116 GLU n 
1 117 GLU n 
1 118 HIS n 
1 119 ILE n 
1 120 SER n 
1 121 SER n 
1 122 VAL n 
1 123 LEU n 
1 124 SER n 
1 125 ASP n 
1 126 TYR n 
1 127 LYS n 
1 128 SER n 
1 129 ALA n 
1 130 LEU n 
1 131 ARG n 
1 132 PHE n 
1 133 HIS n 
1 134 LYS n 
1 135 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PHIP, WDR11' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-R3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC28-Bsa4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PHIP_HUMAN 
_struct_ref.pdbx_db_accession          Q8WWQ0 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DHQPRRRLRNRAQSYDIQAWKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFATVRETLEAGNYESPMEL
CKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFEEHISSVLSDYKSALRFHKR
;
_struct_ref.pdbx_align_begin           1302 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3MB3 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 135 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8WWQ0 
_struct_ref_seq.db_align_beg                  1302 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1434 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1302 
_struct_ref_seq.pdbx_auth_seq_align_end       1434 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3MB3 SER A 1 ? UNP Q8WWQ0 ? ? 'EXPRESSION TAG' 1300 1 
1 3MB3 MET A 2 ? UNP Q8WWQ0 ? ? 'EXPRESSION TAG' 1301 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                    ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                   ? 'C6 H15 N2 O2 1' 147.195 
MB3 non-polymer         . 1-methylpyrrolidin-2-one ? 'C5 H9 N O'      99.131  
MET 'L-peptide linking' y METHIONINE               ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3MB3 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    '11% PEG3350 4% glycerol,0.1M acetate pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2010-03-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9762 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9762 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04 
# 
_reflns.entry_id                     3MB3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.25 
_reflns.d_resolution_low             39.88 
_reflns.number_all                   18066 
_reflns.number_obs                   18012 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.081 
_reflns.pdbx_Rsym_value              0.081 
_reflns.pdbx_netI_over_sigmaI        9.2 
_reflns.B_iso_Wilson_estimate        41.1 
_reflns.pdbx_redundancy              3.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.25 
_reflns_shell.d_res_low              2.37 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.453 
_reflns_shell.meanI_over_sigI_obs    2.0 
_reflns_shell.pdbx_Rsym_value        0.530 
_reflns_shell.pdbx_redundancy        3.7 
_reflns_shell.number_unique_all      2602 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3MB3 
_refine.ls_d_res_high                            2.250 
_refine.ls_d_res_low                             39.880 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.570 
_refine.ls_number_reflns_obs                     17988 
_refine.ls_number_reflns_all                     18065 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES: WITH TLS ADDED' 
_refine.ls_R_factor_all                          0.208 
_refine.ls_R_factor_obs                          0.208 
_refine.ls_R_factor_R_work                       0.206 
_refine.ls_wR_factor_R_work                      0.209 
_refine.ls_R_factor_R_free                       0.257 
_refine.ls_wR_factor_R_free                      0.255 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  914 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               55.905 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            3.370 
_refine.aniso_B[2][2]                            3.370 
_refine.aniso_B[3][3]                            -5.060 
_refine.aniso_B[1][2]                            1.690 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.951 
_refine.correlation_coeff_Fo_to_Fc_free          0.930 
_refine.overall_SU_R_Cruickshank_DPI             0.134 
_refine.overall_SU_R_free                        0.145 
_refine.pdbx_overall_ESU_R                       0.134 
_refine.pdbx_overall_ESU_R_Free                  0.145 
_refine.overall_SU_ML                            0.127 
_refine.overall_SU_B                             12.537 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'Ensemble of 3HMH, 2NXB, 2OO1, 2OSS, 2OUO, 2RFJ, 3DAI, 3D7C, 3DWY' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.803 
_refine.B_iso_max                                144.07 
_refine.B_iso_min                                25.23 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.50 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        941 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         7 
_refine_hist.number_atoms_solvent             85 
_refine_hist.number_atoms_total               1033 
_refine_hist.d_res_high                       2.250 
_refine_hist.d_res_low                        39.880 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       971  0.016  0.022  ? 'X-RAY DIFFRACTION' ? 
r_bond_other_d         672  0.002  0.020  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    1312 1.573  1.985  ? 'X-RAY DIFFRACTION' ? 
r_angle_other_deg      1629 1.946  3.001  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 115  5.861  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 48   29.072 24.167 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 173  15.678 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 7    13.709 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         142  0.078  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   1066 0.008  0.021  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_other     198  0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            584  4.490  3.000  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_other         226  1.306  3.000  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           948  6.428  5.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            387  11.001 8.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           364  14.065 11.000 ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.250 
_refine_ls_shell.d_res_low                        2.308 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               99.390 
_refine_ls_shell.number_reflns_R_work             1231 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.356 
_refine_ls_shell.R_factor_R_free                  0.375 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             80 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1311 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3MB3 
_struct.title                     
'Crystal Structure of the second bromodomain of Pleckstrin homology domain interacting protein (PHIP)' 
_struct.pdbx_descriptor           'PH-interacting protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3MB3 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;PHIP, Pleckstrin homology domain interacting protein, DCAF14, ndrp, DDB1 and CUL4 associated factor 14, SGC, Structural Genomics Consortium, Bromodomain, Phosphoprotein, WD repeat, SIGNALING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 21  ? CYS A 36  ? ALA A 1320 CYS A 1335 1 ? 16 
HELX_P HELX_P2 2 GLU A 37  ? ARG A 43  ? GLU A 1336 ARG A 1342 5 ? 7  
HELX_P HELX_P3 3 ASP A 53  ? ILE A 58  ? ASP A 1352 ILE A 1357 1 ? 6  
HELX_P HELX_P4 4 ASP A 63  ? ALA A 73  ? ASP A 1362 ALA A 1372 1 ? 11 
HELX_P HELX_P5 5 SER A 78  ? THR A 97  ? SER A 1377 THR A 1396 1 ? 20 
HELX_P HELX_P6 6 SER A 102 ? LEU A 130 ? SER A 1401 LEU A 1429 1 ? 29 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    7 
_struct_site.details              'BINDING SITE FOR RESIDUE MB3 A 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 7 HOH C .  ? HOH A 41   . ? 1_555 ? 
2 AC1 7 HOH C .  ? HOH A 90   . ? 1_555 ? 
3 AC1 7 HOH C .  ? HOH A 151  . ? 1_555 ? 
4 AC1 7 HOH C .  ? HOH A 152  . ? 1_555 ? 
5 AC1 7 PRO A 41 ? PRO A 1340 . ? 1_555 ? 
6 AC1 7 VAL A 46 ? VAL A 1345 . ? 1_555 ? 
7 AC1 7 TYR A 51 ? TYR A 1350 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3MB3 
_atom_sites.fract_transf_matrix[1][1]   0.010859 
_atom_sites.fract_transf_matrix[1][2]   0.006269 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012539 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013137 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . TYR A 1 17  ? -13.618 67.762 0.506   1.00 105.90 ? 1316 TYR A N   1 
ATOM   2    C CA  . TYR A 1 17  ? -13.008 66.415 0.439   1.00 110.64 ? 1316 TYR A CA  1 
ATOM   3    C C   . TYR A 1 17  ? -12.829 65.792 1.847   1.00 114.16 ? 1316 TYR A C   1 
ATOM   4    O O   . TYR A 1 17  ? -12.876 66.477 2.878   1.00 115.35 ? 1316 TYR A O   1 
ATOM   5    C CB  . TYR A 1 17  ? -11.673 66.457 -0.328  1.00 104.40 ? 1316 TYR A CB  1 
ATOM   6    N N   . ASP A 1 18  ? -12.581 64.482 1.835   1.00 112.28 ? 1317 ASP A N   1 
ATOM   7    C CA  . ASP A 1 18  ? -12.715 63.566 2.975   1.00 106.33 ? 1317 ASP A CA  1 
ATOM   8    C C   . ASP A 1 18  ? -11.419 63.497 3.793   1.00 99.46  ? 1317 ASP A C   1 
ATOM   9    O O   . ASP A 1 18  ? -10.338 63.320 3.230   1.00 96.40  ? 1317 ASP A O   1 
ATOM   10   C CB  . ASP A 1 18  ? -13.070 62.179 2.388   1.00 105.15 ? 1317 ASP A CB  1 
ATOM   11   C CG  . ASP A 1 18  ? -13.377 61.121 3.438   1.00 107.97 ? 1317 ASP A CG  1 
ATOM   12   O OD1 . ASP A 1 18  ? -13.897 61.460 4.521   1.00 109.63 ? 1317 ASP A OD1 1 
ATOM   13   O OD2 . ASP A 1 18  ? -13.117 59.926 3.148   1.00 77.10  ? 1317 ASP A OD2 1 
ATOM   14   N N   . ILE A 1 19  ? -11.533 63.618 5.114   1.00 96.70  ? 1318 ILE A N   1 
ATOM   15   C CA  . ILE A 1 19  ? -10.378 63.543 6.033   1.00 91.81  ? 1318 ILE A CA  1 
ATOM   16   C C   . ILE A 1 19  ? -9.798  62.110 6.156   1.00 81.43  ? 1318 ILE A C   1 
ATOM   17   O O   . ILE A 1 19  ? -8.641  61.924 6.545   1.00 62.74  ? 1318 ILE A O   1 
ATOM   18   C CB  . ILE A 1 19  ? -10.767 64.085 7.462   1.00 103.59 ? 1318 ILE A CB  1 
ATOM   19   C CG1 . ILE A 1 19  ? -9.702  65.035 8.027   1.00 110.94 ? 1318 ILE A CG1 1 
ATOM   20   C CG2 . ILE A 1 19  ? -11.033 62.937 8.461   1.00 114.20 ? 1318 ILE A CG2 1 
ATOM   21   C CD1 . ILE A 1 19  ? -10.044 65.566 9.443   1.00 122.40 ? 1318 ILE A CD1 1 
ATOM   22   N N   . GLN A 1 20  ? -10.616 61.107 5.835   1.00 84.17  ? 1319 GLN A N   1 
ATOM   23   C CA  . GLN A 1 20  ? -10.200 59.695 5.842   1.00 80.53  ? 1319 GLN A CA  1 
ATOM   24   C C   . GLN A 1 20  ? -9.645  59.252 4.490   1.00 74.18  ? 1319 GLN A C   1 
ATOM   25   O O   . GLN A 1 20  ? -8.946  58.245 4.403   1.00 78.62  ? 1319 GLN A O   1 
ATOM   26   C CB  . GLN A 1 20  ? -11.403 58.788 6.148   1.00 88.59  ? 1319 GLN A CB  1 
ATOM   27   C CG  . GLN A 1 20  ? -12.173 59.120 7.417   1.00 98.21  ? 1319 GLN A CG  1 
ATOM   28   C CD  . GLN A 1 20  ? -11.600 58.440 8.628   1.00 98.71  ? 1319 GLN A CD  1 
ATOM   29   O OE1 . GLN A 1 20  ? -10.392 58.463 8.860   1.00 75.64  ? 1319 GLN A OE1 1 
ATOM   30   N NE2 . GLN A 1 20  ? -12.467 57.827 9.414   1.00 101.22 ? 1319 GLN A NE2 1 
ATOM   31   N N   . ALA A 1 21  ? -9.970  59.998 3.435   1.00 69.74  ? 1320 ALA A N   1 
ATOM   32   C CA  . ALA A 1 21  ? -9.743  59.566 2.060   1.00 65.12  ? 1320 ALA A CA  1 
ATOM   33   C C   . ALA A 1 21  ? -8.346  59.039 1.814   1.00 55.94  ? 1320 ALA A C   1 
ATOM   34   O O   . ALA A 1 21  ? -8.190  58.170 0.981   1.00 61.06  ? 1320 ALA A O   1 
ATOM   35   C CB  . ALA A 1 21  ? -10.069 60.689 1.060   1.00 59.72  ? 1320 ALA A CB  1 
ATOM   36   N N   . TRP A 1 22  ? -7.349  59.556 2.540   1.00 59.26  ? 1321 TRP A N   1 
ATOM   37   C CA  . TRP A 1 22  ? -5.899  59.176 2.365   1.00 47.45  ? 1321 TRP A CA  1 
ATOM   38   C C   . TRP A 1 22  ? -5.559  57.719 2.632   1.00 46.84  ? 1321 TRP A C   1 
ATOM   39   O O   . TRP A 1 22  ? -4.470  57.215 2.238   1.00 44.32  ? 1321 TRP A O   1 
ATOM   40   C CB  . TRP A 1 22  ? -5.014  60.029 3.274   1.00 48.30  ? 1321 TRP A CB  1 
ATOM   41   C CG  . TRP A 1 22  ? -5.234  59.776 4.745   1.00 57.40  ? 1321 TRP A CG  1 
ATOM   42   C CD1 . TRP A 1 22  ? -6.130  60.401 5.553   1.00 65.24  ? 1321 TRP A CD1 1 
ATOM   43   C CD2 . TRP A 1 22  ? -4.542  58.834 5.570   1.00 59.39  ? 1321 TRP A CD2 1 
ATOM   44   N NE1 . TRP A 1 22  ? -6.061  59.896 6.818   1.00 56.63  ? 1321 TRP A NE1 1 
ATOM   45   C CE2 . TRP A 1 22  ? -5.087  58.933 6.857   1.00 53.00  ? 1321 TRP A CE2 1 
ATOM   46   C CE3 . TRP A 1 22  ? -3.511  57.910 5.341   1.00 52.52  ? 1321 TRP A CE3 1 
ATOM   47   C CZ2 . TRP A 1 22  ? -4.642  58.147 7.915   1.00 49.86  ? 1321 TRP A CZ2 1 
ATOM   48   C CZ3 . TRP A 1 22  ? -3.077  57.129 6.386   1.00 53.40  ? 1321 TRP A CZ3 1 
ATOM   49   C CH2 . TRP A 1 22  ? -3.629  57.260 7.662   1.00 53.49  ? 1321 TRP A CH2 1 
ATOM   50   N N   . LYS A 1 23  ? -6.476  57.049 3.315   1.00 50.11  ? 1322 LYS A N   1 
ATOM   51   C CA  . LYS A 1 23  ? -6.277  55.668 3.669   1.00 54.88  ? 1322 LYS A CA  1 
ATOM   52   C C   . LYS A 1 23  ? -6.364  54.779 2.429   1.00 53.37  ? 1322 LYS A C   1 
ATOM   53   O O   . LYS A 1 23  ? -5.427  54.026 2.152   1.00 45.35  ? 1322 LYS A O   1 
ATOM   54   C CB  . LYS A 1 23  ? -7.254  55.257 4.799   1.00 57.98  ? 1322 LYS A CB  1 
ATOM   55   C CG  . LYS A 1 23  ? -6.917  55.932 6.177   1.00 58.20  ? 1322 LYS A CG  1 
ATOM   56   C CD  . LYS A 1 23  ? -7.980  55.671 7.258   1.00 59.62  ? 1322 LYS A CD  1 
ATOM   57   C CE  . LYS A 1 23  ? -7.609  56.292 8.601   1.00 59.80  ? 1322 LYS A CE  1 
ATOM   58   N NZ  . LYS A 1 23  ? -8.789  56.461 9.537   1.00 49.02  ? 1322 LYS A NZ  1 
ATOM   59   N N   . LYS A 1 24  ? -7.465  54.882 1.684   1.00 61.33  ? 1323 LYS A N   1 
ATOM   60   C CA  . LYS A 1 24  ? -7.610  54.144 0.416   1.00 65.17  ? 1323 LYS A CA  1 
ATOM   61   C C   . LYS A 1 24  ? -6.558  54.579 -0.590  1.00 58.87  ? 1323 LYS A C   1 
ATOM   62   O O   . LYS A 1 24  ? -5.932  53.746 -1.226  1.00 61.50  ? 1323 LYS A O   1 
ATOM   63   C CB  . LYS A 1 24  ? -9.013  54.276 -0.210  1.00 71.89  ? 1323 LYS A CB  1 
ATOM   64   C CG  . LYS A 1 24  ? -9.891  52.973 -0.142  1.00 96.32  ? 1323 LYS A CG  1 
ATOM   65   C CD  . LYS A 1 24  ? -9.309  51.764 -0.932  1.00 95.60  ? 1323 LYS A CD  1 
ATOM   66   N N   . GLN A 1 25  ? -6.353  55.884 -0.722  1.00 56.14  ? 1324 GLN A N   1 
ATOM   67   C CA  . GLN A 1 25  ? -5.327  56.409 -1.625  1.00 46.90  ? 1324 GLN A CA  1 
ATOM   68   C C   . GLN A 1 25  ? -3.981  55.741 -1.399  1.00 47.84  ? 1324 GLN A C   1 
ATOM   69   O O   . GLN A 1 25  ? -3.308  55.372 -2.356  1.00 53.01  ? 1324 GLN A O   1 
ATOM   70   C CB  . GLN A 1 25  ? -5.197  57.915 -1.447  1.00 50.26  ? 1324 GLN A CB  1 
ATOM   71   C CG  . GLN A 1 25  ? -6.456  58.682 -1.895  1.00 53.54  ? 1324 GLN A CG  1 
ATOM   72   C CD  . GLN A 1 25  ? -6.453  60.169 -1.541  1.00 50.61  ? 1324 GLN A CD  1 
ATOM   73   O OE1 . GLN A 1 25  ? -5.545  60.686 -0.871  1.00 65.00  ? 1324 GLN A OE1 1 
ATOM   74   N NE2 . GLN A 1 25  ? -7.487  60.860 -1.985  1.00 63.70  ? 1324 GLN A NE2 1 
ATOM   75   N N   . CYS A 1 26  ? -3.604  55.577 -0.131  1.00 45.18  ? 1325 CYS A N   1 
ATOM   76   C CA  . CYS A 1 26  ? -2.358  54.906 0.231   1.00 39.36  ? 1325 CYS A CA  1 
ATOM   77   C C   . CYS A 1 26  ? -2.454  53.402 0.022   1.00 37.69  ? 1325 CYS A C   1 
ATOM   78   O O   . CYS A 1 26  ? -1.492  52.781 -0.374  1.00 44.76  ? 1325 CYS A O   1 
ATOM   79   C CB  . CYS A 1 26  ? -2.001  55.219 1.686   1.00 40.42  ? 1325 CYS A CB  1 
ATOM   80   S SG  . CYS A 1 26  ? -1.456  56.928 1.970   1.00 46.31  ? 1325 CYS A SG  1 
ATOM   81   N N   . GLU A 1 27  ? -3.610  52.804 0.285   1.00 37.08  ? 1326 GLU A N   1 
ATOM   82   C CA  . GLU A 1 27  ? -3.786  51.384 0.038   1.00 42.57  ? 1326 GLU A CA  1 
ATOM   83   C C   . GLU A 1 27  ? -3.492  51.104 -1.455  1.00 42.42  ? 1326 GLU A C   1 
ATOM   84   O O   . GLU A 1 27  ? -2.681  50.255 -1.787  1.00 46.45  ? 1326 GLU A O   1 
ATOM   85   C CB  . GLU A 1 27  ? -5.210  50.944 0.450   1.00 47.73  ? 1326 GLU A CB  1 
ATOM   86   C CG  . GLU A 1 27  ? -5.468  49.420 0.498   1.00 67.67  ? 1326 GLU A CG  1 
ATOM   87   C CD  . GLU A 1 27  ? -5.105  48.776 1.850   1.00 108.40 ? 1326 GLU A CD  1 
ATOM   88   O OE1 . GLU A 1 27  ? -6.017  48.682 2.722   1.00 109.67 ? 1326 GLU A OE1 1 
ATOM   89   O OE2 . GLU A 1 27  ? -3.911  48.380 2.036   1.00 77.27  ? 1326 GLU A OE2 1 
ATOM   90   N N   . GLU A 1 28  ? -4.125  51.878 -2.332  1.00 39.21  ? 1327 GLU A N   1 
ATOM   91   C CA  . GLU A 1 28  ? -3.945  51.780 -3.775  1.00 40.68  ? 1327 GLU A CA  1 
ATOM   92   C C   . GLU A 1 28  ? -2.515  52.072 -4.243  1.00 41.64  ? 1327 GLU A C   1 
ATOM   93   O O   . GLU A 1 28  ? -1.999  51.374 -5.102  1.00 52.47  ? 1327 GLU A O   1 
ATOM   94   C CB  . GLU A 1 28  ? -4.926  52.712 -4.485  1.00 45.12  ? 1327 GLU A CB  1 
ATOM   95   C CG  . GLU A 1 28  ? -6.415  52.215 -4.381  1.00 73.09  ? 1327 GLU A CG  1 
ATOM   96   C CD  . GLU A 1 28  ? -7.471  53.250 -4.800  1.00 82.28  ? 1327 GLU A CD  1 
ATOM   97   O OE1 . GLU A 1 28  ? -7.101  54.369 -5.225  1.00 84.31  ? 1327 GLU A OE1 1 
ATOM   98   O OE2 . GLU A 1 28  ? -8.681  52.930 -4.694  1.00 80.62  ? 1327 GLU A OE2 1 
ATOM   99   N N   . LEU A 1 29  ? -1.874  53.081 -3.682  1.00 40.38  ? 1328 LEU A N   1 
ATOM   100  C CA  . LEU A 1 29  ? -0.510  53.427 -4.134  1.00 42.58  ? 1328 LEU A CA  1 
ATOM   101  C C   . LEU A 1 29  ? 0.439   52.320 -3.747  1.00 43.95  ? 1328 LEU A C   1 
ATOM   102  O O   . LEU A 1 29  ? 1.303   51.950 -4.538  1.00 49.67  ? 1328 LEU A O   1 
ATOM   103  C CB  . LEU A 1 29  ? -0.050  54.728 -3.538  1.00 33.00  ? 1328 LEU A CB  1 
ATOM   104  C CG  . LEU A 1 29  ? 1.386   55.219 -3.762  1.00 45.57  ? 1328 LEU A CG  1 
ATOM   105  C CD1 . LEU A 1 29  ? 1.739   55.306 -5.223  1.00 33.96  ? 1328 LEU A CD1 1 
ATOM   106  C CD2 . LEU A 1 29  ? 1.526   56.589 -3.097  1.00 33.26  ? 1328 LEU A CD2 1 
ATOM   107  N N   . LEU A 1 30  ? 0.273   51.783 -2.538  1.00 46.21  ? 1329 LEU A N   1 
ATOM   108  C CA  . LEU A 1 30  ? 1.054   50.616 -2.091  1.00 43.62  ? 1329 LEU A CA  1 
ATOM   109  C C   . LEU A 1 30  ? 0.782   49.399 -2.947  1.00 39.62  ? 1329 LEU A C   1 
ATOM   110  O O   . LEU A 1 30  ? 1.698   48.625 -3.231  1.00 39.87  ? 1329 LEU A O   1 
ATOM   111  C CB  . LEU A 1 30  ? 0.779   50.255 -0.607  1.00 42.79  ? 1329 LEU A CB  1 
ATOM   112  C CG  . LEU A 1 30  ? 1.274   51.272 0.441   1.00 46.50  ? 1329 LEU A CG  1 
ATOM   113  C CD1 . LEU A 1 30  ? 0.779   50.904 1.822   1.00 35.73  ? 1329 LEU A CD1 1 
ATOM   114  C CD2 . LEU A 1 30  ? 2.799   51.389 0.407   1.00 32.99  ? 1329 LEU A CD2 1 
ATOM   115  N N   . ASN A 1 31  ? -0.468  49.193 -3.349  1.00 42.76  ? 1330 ASN A N   1 
ATOM   116  C CA  . ASN A 1 31  ? -0.750  48.053 -4.223  1.00 45.78  ? 1330 ASN A CA  1 
ATOM   117  C C   . ASN A 1 31  ? -0.043  48.227 -5.593  1.00 50.17  ? 1330 ASN A C   1 
ATOM   118  O O   . ASN A 1 31  ? 0.410   47.246 -6.218  1.00 47.35  ? 1330 ASN A O   1 
ATOM   119  C CB  . ASN A 1 31  ? -2.256  47.814 -4.368  1.00 54.42  ? 1330 ASN A CB  1 
ATOM   120  C CG  . ASN A 1 31  ? -2.938  47.408 -3.027  1.00 64.70  ? 1330 ASN A CG  1 
ATOM   121  O OD1 . ASN A 1 31  ? -2.288  47.146 -2.008  1.00 74.92  ? 1330 ASN A OD1 1 
ATOM   122  N ND2 . ASN A 1 31  ? -4.260  47.359 -3.048  1.00 77.04  ? 1330 ASN A ND2 1 
ATOM   123  N N   . LEU A 1 32  ? 0.083   49.469 -6.058  1.00 40.40  ? 1331 LEU A N   1 
ATOM   124  C CA  . LEU A 1 32  ? 0.774   49.706 -7.337  1.00 42.48  ? 1331 LEU A CA  1 
ATOM   125  C C   . LEU A 1 32  ? 2.280   49.460 -7.187  1.00 41.98  ? 1331 LEU A C   1 
ATOM   126  O O   . LEU A 1 32  ? 2.941   48.946 -8.093  1.00 40.53  ? 1331 LEU A O   1 
ATOM   127  C CB  . LEU A 1 32  ? 0.519   51.120 -7.866  1.00 40.34  ? 1331 LEU A CB  1 
ATOM   128  C CG  . LEU A 1 32  ? -0.893  51.496 -8.310  1.00 44.18  ? 1331 LEU A CG  1 
ATOM   129  C CD1 . LEU A 1 32  ? -0.893  52.956 -8.649  1.00 32.97  ? 1331 LEU A CD1 1 
ATOM   130  C CD2 . LEU A 1 32  ? -1.364  50.705 -9.490  1.00 39.71  ? 1331 LEU A CD2 1 
ATOM   131  N N   . ILE A 1 33  ? 2.820   49.821 -6.036  1.00 42.85  ? 1332 ILE A N   1 
ATOM   132  C CA  . ILE A 1 33  ? 4.229   49.635 -5.775  1.00 41.09  ? 1332 ILE A CA  1 
ATOM   133  C C   . ILE A 1 33  ? 4.523   48.150 -5.658  1.00 47.24  ? 1332 ILE A C   1 
ATOM   134  O O   . ILE A 1 33  ? 5.463   47.641 -6.254  1.00 43.91  ? 1332 ILE A O   1 
ATOM   135  C CB  . ILE A 1 33  ? 4.639   50.398 -4.509  1.00 51.16  ? 1332 ILE A CB  1 
ATOM   136  C CG1 . ILE A 1 33  ? 4.670   51.919 -4.804  1.00 44.40  ? 1332 ILE A CG1 1 
ATOM   137  C CG2 . ILE A 1 33  ? 5.995   49.911 -3.993  1.00 47.97  ? 1332 ILE A CG2 1 
ATOM   138  C CD1 . ILE A 1 33  ? 4.663   52.757 -3.586  1.00 44.50  ? 1332 ILE A CD1 1 
ATOM   139  N N   . PHE A 1 34  ? 3.691   47.436 -4.929  1.00 45.50  ? 1333 PHE A N   1 
ATOM   140  C CA  . PHE A 1 34  ? 3.925   46.023 -4.771  1.00 53.99  ? 1333 PHE A CA  1 
ATOM   141  C C   . PHE A 1 34  ? 4.013   45.278 -6.138  1.00 53.32  ? 1333 PHE A C   1 
ATOM   142  O O   . PHE A 1 34  ? 4.885   44.412 -6.357  1.00 50.23  ? 1333 PHE A O   1 
ATOM   143  C CB  . PHE A 1 34  ? 2.829   45.400 -3.876  1.00 57.35  ? 1333 PHE A CB  1 
ATOM   144  C CG  . PHE A 1 34  ? 3.330   44.927 -2.539  1.00 60.64  ? 1333 PHE A CG  1 
ATOM   145  C CD1 . PHE A 1 34  ? 3.975   43.684 -2.420  1.00 76.10  ? 1333 PHE A CD1 1 
ATOM   146  C CD2 . PHE A 1 34  ? 3.143   45.696 -1.401  1.00 70.05  ? 1333 PHE A CD2 1 
ATOM   147  C CE1 . PHE A 1 34  ? 4.460   43.234 -1.193  1.00 66.40  ? 1333 PHE A CE1 1 
ATOM   148  C CE2 . PHE A 1 34  ? 3.608   45.245 -0.172  1.00 77.79  ? 1333 PHE A CE2 1 
ATOM   149  C CZ  . PHE A 1 34  ? 4.276   44.004 -0.076  1.00 70.55  ? 1333 PHE A CZ  1 
ATOM   150  N N   . GLN A 1 35  ? 3.122   45.634 -7.050  1.00 43.68  ? 1334 GLN A N   1 
ATOM   151  C CA  . GLN A 1 35  ? 2.932   44.872 -8.259  1.00 47.59  ? 1334 GLN A CA  1 
ATOM   152  C C   . GLN A 1 35  ? 4.013   45.096 -9.280  1.00 48.08  ? 1334 GLN A C   1 
ATOM   153  O O   . GLN A 1 35  ? 4.184   44.258 -10.153 1.00 55.97  ? 1334 GLN A O   1 
ATOM   154  C CB  . GLN A 1 35  ? 1.584   45.196 -8.882  1.00 50.03  ? 1334 GLN A CB  1 
ATOM   155  C CG  . GLN A 1 35  ? 0.428   44.572 -8.169  1.00 68.07  ? 1334 GLN A CG  1 
ATOM   156  C CD  . GLN A 1 35  ? -0.872  45.287 -8.478  1.00 90.03  ? 1334 GLN A CD  1 
ATOM   157  O OE1 . GLN A 1 35  ? -1.080  45.758 -9.602  1.00 88.99  ? 1334 GLN A OE1 1 
ATOM   158  N NE2 . GLN A 1 35  ? -1.749  45.394 -7.474  1.00 105.33 ? 1334 GLN A NE2 1 
ATOM   159  N N   . CYS A 1 36  ? 4.734   46.210 -9.166  1.00 47.99  ? 1335 CYS A N   1 
ATOM   160  C CA  . CYS A 1 36  ? 5.844   46.507 -10.054 1.00 45.64  ? 1335 CYS A CA  1 
ATOM   161  C C   . CYS A 1 36  ? 7.155   45.884 -9.649  1.00 45.64  ? 1335 CYS A C   1 
ATOM   162  O O   . CYS A 1 36  ? 7.497   45.794 -8.466  1.00 43.20  ? 1335 CYS A O   1 
ATOM   163  C CB  . CYS A 1 36  ? 6.033   48.022 -10.228 1.00 45.40  ? 1335 CYS A CB  1 
ATOM   164  S SG  . CYS A 1 36  ? 6.989   48.948 -9.099  1.00 46.25  ? 1335 CYS A SG  1 
ATOM   165  N N   . GLU A 1 37  ? 7.931   45.537 -10.666 1.00 49.71  ? 1336 GLU A N   1 
ATOM   166  C CA  . GLU A 1 37  ? 9.148   44.739 -10.513 1.00 47.61  ? 1336 GLU A CA  1 
ATOM   167  C C   . GLU A 1 37  ? 10.207  45.475 -9.776  1.00 49.34  ? 1336 GLU A C   1 
ATOM   168  O O   . GLU A 1 37  ? 11.041  44.837 -9.189  1.00 48.34  ? 1336 GLU A O   1 
ATOM   169  C CB  . GLU A 1 37  ? 9.682   44.297 -11.873 1.00 56.36  ? 1336 GLU A CB  1 
ATOM   170  C CG  . GLU A 1 37  ? 8.707   43.339 -12.615 1.00 77.85  ? 1336 GLU A CG  1 
ATOM   171  C CD  . GLU A 1 37  ? 8.907   43.263 -14.145 1.00 94.07  ? 1336 GLU A CD  1 
ATOM   172  O OE1 . GLU A 1 37  ? 10.013  43.581 -14.652 1.00 91.00  ? 1336 GLU A OE1 1 
ATOM   173  O OE2 . GLU A 1 37  ? 7.939   42.870 -14.842 1.00 103.07 ? 1336 GLU A OE2 1 
ATOM   174  N N   . ASP A 1 38  ? 10.174  46.813 -9.768  1.00 43.70  ? 1337 ASP A N   1 
ATOM   175  C CA  . ASP A 1 38  ? 11.162  47.571 -9.030  1.00 42.53  ? 1337 ASP A CA  1 
ATOM   176  C C   . ASP A 1 38  ? 10.979  47.429 -7.505  1.00 41.03  ? 1337 ASP A C   1 
ATOM   177  O O   . ASP A 1 38  ? 11.903  47.702 -6.744  1.00 39.63  ? 1337 ASP A O   1 
ATOM   178  C CB  . ASP A 1 38  ? 11.114  49.054 -9.428  1.00 40.81  ? 1337 ASP A CB  1 
ATOM   179  C CG  . ASP A 1 38  ? 11.770  49.327 -10.753 1.00 46.59  ? 1337 ASP A CG  1 
ATOM   180  O OD1 . ASP A 1 38  ? 12.480  48.456 -11.286 1.00 41.35  ? 1337 ASP A OD1 1 
ATOM   181  O OD2 . ASP A 1 38  ? 11.598  50.449 -11.258 1.00 53.57  ? 1337 ASP A OD2 1 
ATOM   182  N N   . SER A 1 39  ? 9.813   47.010 -7.037  1.00 35.72  ? 1338 SER A N   1 
ATOM   183  C CA  . SER A 1 39  ? 9.642   46.864 -5.602  1.00 37.76  ? 1338 SER A CA  1 
ATOM   184  C C   . SER A 1 39  ? 10.213  45.528 -5.083  1.00 36.49  ? 1338 SER A C   1 
ATOM   185  O O   . SER A 1 39  ? 10.302  45.314 -3.893  1.00 43.42  ? 1338 SER A O   1 
ATOM   186  C CB  . SER A 1 39  ? 8.184   46.917 -5.247  1.00 37.58  ? 1338 SER A CB  1 
ATOM   187  O OG  . SER A 1 39  ? 7.591   45.706 -5.684  1.00 30.57  ? 1338 SER A OG  1 
ATOM   188  N N   . GLU A 1 40  ? 10.611  44.633 -5.953  1.00 38.51  ? 1339 GLU A N   1 
ATOM   189  C CA  . GLU A 1 40  ? 10.944  43.275 -5.496  1.00 50.16  ? 1339 GLU A CA  1 
ATOM   190  C C   . GLU A 1 40  ? 11.868  43.228 -4.273  1.00 46.46  ? 1339 GLU A C   1 
ATOM   191  O O   . GLU A 1 40  ? 11.613  42.486 -3.343  1.00 51.73  ? 1339 GLU A O   1 
ATOM   192  C CB  . GLU A 1 40  ? 11.533  42.428 -6.634  1.00 50.36  ? 1339 GLU A CB  1 
ATOM   193  C CG  . GLU A 1 40  ? 11.237  40.925 -6.575  1.00 69.73  ? 1339 GLU A CG  1 
ATOM   194  C CD  . GLU A 1 40  ? 12.375  40.104 -6.001  1.00 79.86  ? 1339 GLU A CD  1 
ATOM   195  O OE1 . GLU A 1 40  ? 13.375  40.703 -5.556  1.00 67.61  ? 1339 GLU A OE1 1 
ATOM   196  O OE2 . GLU A 1 40  ? 12.259  38.857 -5.996  1.00 91.63  ? 1339 GLU A OE2 1 
ATOM   197  N N   . PRO A 1 41  ? 12.952  44.005 -4.270  1.00 46.13  ? 1340 PRO A N   1 
ATOM   198  C CA  . PRO A 1 41  ? 13.855  43.804 -3.151  1.00 45.27  ? 1340 PRO A CA  1 
ATOM   199  C C   . PRO A 1 41  ? 13.280  44.302 -1.822  1.00 49.41  ? 1340 PRO A C   1 
ATOM   200  O O   . PRO A 1 41  ? 13.740  43.875 -0.761  1.00 56.30  ? 1340 PRO A O   1 
ATOM   201  C CB  . PRO A 1 41  ? 15.098  44.613 -3.560  1.00 46.52  ? 1340 PRO A CB  1 
ATOM   202  C CG  . PRO A 1 41  ? 15.032  44.631 -5.052  1.00 48.45  ? 1340 PRO A CG  1 
ATOM   203  C CD  . PRO A 1 41  ? 13.563  44.847 -5.303  1.00 49.13  ? 1340 PRO A CD  1 
ATOM   204  N N   . PHE A 1 42  ? 12.268  45.165 -1.891  1.00 41.83  ? 1341 PHE A N   1 
ATOM   205  C CA  . PHE A 1 42  ? 11.743  45.885 -0.745  1.00 36.79  ? 1341 PHE A CA  1 
ATOM   206  C C   . PHE A 1 42  ? 10.358  45.373 -0.279  1.00 37.83  ? 1341 PHE A C   1 
ATOM   207  O O   . PHE A 1 42  ? 9.696   46.057 0.460   1.00 39.48  ? 1341 PHE A O   1 
ATOM   208  C CB  . PHE A 1 42  ? 11.635  47.360 -1.126  1.00 33.79  ? 1341 PHE A CB  1 
ATOM   209  C CG  . PHE A 1 42  ? 12.854  47.877 -1.832  1.00 38.38  ? 1341 PHE A CG  1 
ATOM   210  C CD1 . PHE A 1 42  ? 14.045  47.945 -1.181  1.00 36.57  ? 1341 PHE A CD1 1 
ATOM   211  C CD2 . PHE A 1 42  ? 12.804  48.280 -3.161  1.00 36.54  ? 1341 PHE A CD2 1 
ATOM   212  C CE1 . PHE A 1 42  ? 15.200  48.388 -1.836  1.00 40.97  ? 1341 PHE A CE1 1 
ATOM   213  C CE2 . PHE A 1 42  ? 13.934  48.731 -3.807  1.00 57.08  ? 1341 PHE A CE2 1 
ATOM   214  C CZ  . PHE A 1 42  ? 15.135  48.773 -3.149  1.00 45.96  ? 1341 PHE A CZ  1 
ATOM   215  N N   . ARG A 1 43  ? 9.910   44.202 -0.718  1.00 42.12  ? 1342 ARG A N   1 
ATOM   216  C CA  . ARG A 1 43  ? 8.532   43.782 -0.429  1.00 48.42  ? 1342 ARG A CA  1 
ATOM   217  C C   . ARG A 1 43  ? 8.358   43.138 0.914   1.00 50.17  ? 1342 ARG A C   1 
ATOM   218  O O   . ARG A 1 43  ? 7.236   42.969 1.354   1.00 62.44  ? 1342 ARG A O   1 
ATOM   219  C CB  . ARG A 1 43  ? 8.056   42.771 -1.457  1.00 40.45  ? 1342 ARG A CB  1 
ATOM   220  C CG  . ARG A 1 43  ? 7.777   43.404 -2.769  1.00 52.15  ? 1342 ARG A CG  1 
ATOM   221  C CD  . ARG A 1 43  ? 7.494   42.370 -3.837  1.00 46.90  ? 1342 ARG A CD  1 
ATOM   222  N NE  . ARG A 1 43  ? 7.393   43.014 -5.144  1.00 48.44  ? 1342 ARG A NE  1 
ATOM   223  C CZ  . ARG A 1 43  ? 7.439   42.391 -6.313  1.00 56.17  ? 1342 ARG A CZ  1 
ATOM   224  N NH1 . ARG A 1 43  ? 7.575   41.072 -6.368  1.00 42.26  ? 1342 ARG A NH1 1 
ATOM   225  N NH2 . ARG A 1 43  ? 7.355   43.094 -7.440  1.00 51.66  ? 1342 ARG A NH2 1 
ATOM   226  N N   . GLN A 1 44  ? 9.461   42.717 1.519   1.00 43.32  ? 1343 GLN A N   1 
ATOM   227  C CA  . GLN A 1 44  ? 9.435   41.935 2.731   1.00 45.43  ? 1343 GLN A CA  1 
ATOM   228  C C   . GLN A 1 44  ? 10.600  42.362 3.607   1.00 47.58  ? 1343 GLN A C   1 
ATOM   229  O O   . GLN A 1 44  ? 11.582  42.890 3.108   1.00 49.00  ? 1343 GLN A O   1 
ATOM   230  C CB  . GLN A 1 44  ? 9.538   40.438 2.407   1.00 45.64  ? 1343 GLN A CB  1 
ATOM   231  C CG  . GLN A 1 44  ? 8.468   39.888 1.444   1.00 65.99  ? 1343 GLN A CG  1 
ATOM   232  C CD  . GLN A 1 44  ? 7.026   39.910 1.996   1.00 80.20  ? 1343 GLN A CD  1 
ATOM   233  O OE1 . GLN A 1 44  ? 6.815   39.729 3.196   1.00 65.18  ? 1343 GLN A OE1 1 
ATOM   234  N NE2 . GLN A 1 44  ? 6.025   40.107 1.101   1.00 56.91  ? 1343 GLN A NE2 1 
ATOM   235  N N   . PRO A 1 45  ? 10.485  42.143 4.925   1.00 51.31  ? 1344 PRO A N   1 
ATOM   236  C CA  . PRO A 1 45  ? 11.601  42.258 5.845   1.00 54.54  ? 1344 PRO A CA  1 
ATOM   237  C C   . PRO A 1 45  ? 12.813  41.572 5.269   1.00 49.79  ? 1344 PRO A C   1 
ATOM   238  O O   . PRO A 1 45  ? 12.699  40.467 4.785   1.00 55.28  ? 1344 PRO A O   1 
ATOM   239  C CB  . PRO A 1 45  ? 11.148  41.418 7.062   1.00 49.18  ? 1344 PRO A CB  1 
ATOM   240  C CG  . PRO A 1 45  ? 9.712   41.464 7.020   1.00 65.04  ? 1344 PRO A CG  1 
ATOM   241  C CD  . PRO A 1 45  ? 9.317   41.527 5.574   1.00 57.60  ? 1344 PRO A CD  1 
ATOM   242  N N   . VAL A 1 46  ? 13.962  42.217 5.352   1.00 51.55  ? 1345 VAL A N   1 
ATOM   243  C CA  . VAL A 1 46  ? 15.175  41.666 4.806   1.00 48.61  ? 1345 VAL A CA  1 
ATOM   244  C C   . VAL A 1 46  ? 15.524  40.405 5.554   1.00 53.56  ? 1345 VAL A C   1 
ATOM   245  O O   . VAL A 1 46  ? 15.437  40.352 6.769   1.00 62.33  ? 1345 VAL A O   1 
ATOM   246  C CB  . VAL A 1 46  ? 16.341  42.689 4.824   1.00 43.26  ? 1345 VAL A CB  1 
ATOM   247  C CG1 . VAL A 1 46  ? 17.691  41.985 4.831   1.00 54.90  ? 1345 VAL A CG1 1 
ATOM   248  C CG2 . VAL A 1 46  ? 16.230  43.607 3.586   1.00 56.21  ? 1345 VAL A CG2 1 
ATOM   249  N N   . ASP A 1 47  ? 15.905  39.376 4.829   1.00 57.30  ? 1346 ASP A N   1 
ATOM   250  C CA  . ASP A 1 47  ? 16.279  38.108 5.479   1.00 58.33  ? 1346 ASP A CA  1 
ATOM   251  C C   . ASP A 1 47  ? 17.710  38.230 5.989   1.00 57.42  ? 1346 ASP A C   1 
ATOM   252  O O   . ASP A 1 47  ? 18.623  38.406 5.190   1.00 66.72  ? 1346 ASP A O   1 
ATOM   253  C CB  . ASP A 1 47  ? 16.132  36.977 4.459   1.00 63.08  ? 1346 ASP A CB  1 
ATOM   254  C CG  . ASP A 1 47  ? 16.447  35.619 5.030   1.00 69.25  ? 1346 ASP A CG  1 
ATOM   255  O OD1 . ASP A 1 47  ? 17.144  35.542 6.070   1.00 63.86  ? 1346 ASP A OD1 1 
ATOM   256  O OD2 . ASP A 1 47  ? 15.991  34.621 4.436   1.00 93.02  ? 1346 ASP A OD2 1 
ATOM   257  N N   . LEU A 1 48  ? 17.930  38.167 7.303   1.00 56.53  ? 1347 LEU A N   1 
ATOM   258  C CA  . LEU A 1 48  ? 19.306  38.305 7.836   1.00 65.08  ? 1347 LEU A CA  1 
ATOM   259  C C   . LEU A 1 48  ? 20.190  37.101 7.539   1.00 78.67  ? 1347 LEU A C   1 
ATOM   260  O O   . LEU A 1 48  ? 21.415  37.210 7.553   1.00 88.23  ? 1347 LEU A O   1 
ATOM   261  C CB  . LEU A 1 48  ? 19.313  38.591 9.349   1.00 66.97  ? 1347 LEU A CB  1 
ATOM   262  C CG  . LEU A 1 48  ? 18.488  39.807 9.813   1.00 77.93  ? 1347 LEU A CG  1 
ATOM   263  C CD1 . LEU A 1 48  ? 18.925  40.230 11.202  1.00 86.43  ? 1347 LEU A CD1 1 
ATOM   264  C CD2 . LEU A 1 48  ? 18.597  41.004 8.864   1.00 68.20  ? 1347 LEU A CD2 1 
ATOM   265  N N   . LEU A 1 49  ? 19.584  35.945 7.303   1.00 88.62  ? 1348 LEU A N   1 
ATOM   266  C CA  . LEU A 1 49  ? 20.354  34.784 6.878   1.00 96.85  ? 1348 LEU A CA  1 
ATOM   267  C C   . LEU A 1 49  ? 20.983  35.141 5.532   1.00 93.80  ? 1348 LEU A C   1 
ATOM   268  O O   . LEU A 1 49  ? 22.170  34.996 5.349   1.00 95.43  ? 1348 LEU A O   1 
ATOM   269  C CB  . LEU A 1 49  ? 19.486  33.512 6.795   1.00 104.89 ? 1348 LEU A CB  1 
ATOM   270  C CG  . LEU A 1 49  ? 19.329  32.653 8.067   1.00 115.44 ? 1348 LEU A CG  1 
ATOM   271  C CD1 . LEU A 1 49  ? 18.547  33.371 9.217   1.00 97.64  ? 1348 LEU A CD1 1 
ATOM   272  C CD2 . LEU A 1 49  ? 18.690  31.284 7.684   1.00 102.67 ? 1348 LEU A CD2 1 
ATOM   273  N N   . GLU A 1 50  ? 20.198  35.665 4.607   1.00 92.62  ? 1349 GLU A N   1 
ATOM   274  C CA  . GLU A 1 50  ? 20.756  36.103 3.334   1.00 97.73  ? 1349 GLU A CA  1 
ATOM   275  C C   . GLU A 1 50  ? 21.760  37.246 3.515   1.00 94.63  ? 1349 GLU A C   1 
ATOM   276  O O   . GLU A 1 50  ? 22.874  37.182 3.001   1.00 101.56 ? 1349 GLU A O   1 
ATOM   277  C CB  . GLU A 1 50  ? 19.657  36.559 2.371   1.00 99.53  ? 1349 GLU A CB  1 
ATOM   278  C CG  . GLU A 1 50  ? 19.030  35.460 1.520   1.00 111.53 ? 1349 GLU A CG  1 
ATOM   279  C CD  . GLU A 1 50  ? 18.155  36.029 0.391   1.00 132.24 ? 1349 GLU A CD  1 
ATOM   280  O OE1 . GLU A 1 50  ? 17.859  37.268 0.390   1.00 103.40 ? 1349 GLU A OE1 1 
ATOM   281  O OE2 . GLU A 1 50  ? 17.778  35.225 -0.499  1.00 144.07 ? 1349 GLU A OE2 1 
ATOM   282  N N   . TYR A 1 51  ? 21.360  38.283 4.242   1.00 81.88  ? 1350 TYR A N   1 
ATOM   283  C CA  . TYR A 1 51  ? 22.156  39.494 4.365   1.00 79.19  ? 1350 TYR A CA  1 
ATOM   284  C C   . TYR A 1 51  ? 22.590  39.730 5.829   1.00 78.99  ? 1350 TYR A C   1 
ATOM   285  O O   . TYR A 1 51  ? 22.000  40.533 6.539   1.00 71.50  ? 1350 TYR A O   1 
ATOM   286  C CB  . TYR A 1 51  ? 21.326  40.679 3.873   1.00 71.75  ? 1350 TYR A CB  1 
ATOM   287  C CG  . TYR A 1 51  ? 21.079  40.760 2.371   1.00 92.55  ? 1350 TYR A CG  1 
ATOM   288  C CD1 . TYR A 1 51  ? 21.977  41.427 1.545   1.00 98.62  ? 1350 TYR A CD1 1 
ATOM   289  C CD2 . TYR A 1 51  ? 19.932  40.215 1.781   1.00 108.23 ? 1350 TYR A CD2 1 
ATOM   290  C CE1 . TYR A 1 51  ? 21.763  41.542 0.175   1.00 96.85  ? 1350 TYR A CE1 1 
ATOM   291  C CE2 . TYR A 1 51  ? 19.712  40.323 0.393   1.00 114.10 ? 1350 TYR A CE2 1 
ATOM   292  C CZ  . TYR A 1 51  ? 20.641  41.001 -0.399  1.00 104.90 ? 1350 TYR A CZ  1 
ATOM   293  O OH  . TYR A 1 51  ? 20.483  41.164 -1.764  1.00 103.90 ? 1350 TYR A OH  1 
ATOM   294  N N   . PRO A 1 52  ? 23.653  39.069 6.280   1.00 55.73  ? 1351 PRO A N   1 
ATOM   295  C CA  . PRO A 1 52  ? 23.891  38.961 7.716   1.00 57.94  ? 1351 PRO A CA  1 
ATOM   296  C C   . PRO A 1 52  ? 24.480  40.177 8.446   1.00 56.33  ? 1351 PRO A C   1 
ATOM   297  O O   . PRO A 1 52  ? 24.400  40.251 9.689   1.00 54.89  ? 1351 PRO A O   1 
ATOM   298  C CB  . PRO A 1 52  ? 24.847  37.770 7.819   1.00 59.88  ? 1351 PRO A CB  1 
ATOM   299  C CG  . PRO A 1 52  ? 25.388  37.559 6.436   1.00 63.74  ? 1351 PRO A CG  1 
ATOM   300  C CD  . PRO A 1 52  ? 24.784  38.555 5.507   1.00 66.62  ? 1351 PRO A CD  1 
ATOM   301  N N   . ASP A 1 53  ? 25.048  41.103 7.683   1.00 52.19  ? 1352 ASP A N   1 
ATOM   302  C CA  . ASP A 1 53  ? 25.531  42.382 8.195   1.00 47.26  ? 1352 ASP A CA  1 
ATOM   303  C C   . ASP A 1 53  ? 24.500  43.505 8.051   1.00 46.95  ? 1352 ASP A C   1 
ATOM   304  O O   . ASP A 1 53  ? 24.804  44.665 8.302   1.00 43.43  ? 1352 ASP A O   1 
ATOM   305  C CB  . ASP A 1 53  ? 26.833  42.779 7.471   1.00 48.45  ? 1352 ASP A CB  1 
ATOM   306  C CG  . ASP A 1 53  ? 26.647  43.009 5.968   1.00 54.81  ? 1352 ASP A CG  1 
ATOM   307  O OD1 . ASP A 1 53  ? 25.750  42.396 5.356   1.00 59.52  ? 1352 ASP A OD1 1 
ATOM   308  O OD2 . ASP A 1 53  ? 27.426  43.787 5.392   1.00 50.62  ? 1352 ASP A OD2 1 
ATOM   309  N N   . TYR A 1 54  ? 23.274  43.192 7.655   1.00 47.26  ? 1353 TYR A N   1 
ATOM   310  C CA  . TYR A 1 54  ? 22.339  44.262 7.405   1.00 40.00  ? 1353 TYR A CA  1 
ATOM   311  C C   . TYR A 1 54  ? 22.276  45.161 8.613   1.00 39.90  ? 1353 TYR A C   1 
ATOM   312  O O   . TYR A 1 54  ? 22.332  46.387 8.479   1.00 54.18  ? 1353 TYR A O   1 
ATOM   313  C CB  . TYR A 1 54  ? 20.957  43.754 7.018   1.00 45.32  ? 1353 TYR A CB  1 
ATOM   314  C CG  . TYR A 1 54  ? 20.047  44.828 6.414   1.00 40.91  ? 1353 TYR A CG  1 
ATOM   315  C CD1 . TYR A 1 54  ? 20.248  45.286 5.147   1.00 49.31  ? 1353 TYR A CD1 1 
ATOM   316  C CD2 . TYR A 1 54  ? 18.997  45.373 7.132   1.00 44.58  ? 1353 TYR A CD2 1 
ATOM   317  C CE1 . TYR A 1 54  ? 19.429  46.254 4.593   1.00 49.39  ? 1353 TYR A CE1 1 
ATOM   318  C CE2 . TYR A 1 54  ? 18.180  46.361 6.591   1.00 44.56  ? 1353 TYR A CE2 1 
ATOM   319  C CZ  . TYR A 1 54  ? 18.393  46.783 5.310   1.00 49.90  ? 1353 TYR A CZ  1 
ATOM   320  O OH  . TYR A 1 54  ? 17.593  47.744 4.709   1.00 45.45  ? 1353 TYR A OH  1 
ATOM   321  N N   . ARG A 1 55  ? 22.197  44.579 9.796   1.00 43.62  ? 1354 ARG A N   1 
ATOM   322  C CA  . ARG A 1 55  ? 22.068  45.372 11.021  1.00 46.85  ? 1354 ARG A CA  1 
ATOM   323  C C   . ARG A 1 55  ? 23.286  46.135 11.480  1.00 52.19  ? 1354 ARG A C   1 
ATOM   324  O O   . ARG A 1 55  ? 23.170  47.071 12.308  1.00 51.12  ? 1354 ARG A O   1 
ATOM   325  C CB  . ARG A 1 55  ? 21.607  44.506 12.175  1.00 55.64  ? 1354 ARG A CB  1 
ATOM   326  C CG  . ARG A 1 55  ? 20.233  43.907 11.980  1.00 59.23  ? 1354 ARG A CG  1 
ATOM   327  C CD  . ARG A 1 55  ? 19.245  44.948 11.638  1.00 63.63  ? 1354 ARG A CD  1 
ATOM   328  N NE  . ARG A 1 55  ? 18.006  44.657 12.320  1.00 85.51  ? 1354 ARG A NE  1 
ATOM   329  C CZ  . ARG A 1 55  ? 17.613  45.251 13.440  1.00 77.85  ? 1354 ARG A CZ  1 
ATOM   330  N NH1 . ARG A 1 55  ? 18.355  46.205 14.018  1.00 64.42  ? 1354 ARG A NH1 1 
ATOM   331  N NH2 . ARG A 1 55  ? 16.454  44.894 13.972  1.00 90.12  ? 1354 ARG A NH2 1 
ATOM   332  N N   . ASP A 1 56  ? 24.445  45.756 10.967  1.00 54.15  ? 1355 ASP A N   1 
ATOM   333  C CA  . ASP A 1 56  ? 25.649  46.488 11.298  1.00 56.03  ? 1355 ASP A CA  1 
ATOM   334  C C   . ASP A 1 56  ? 25.539  47.841 10.642  1.00 54.76  ? 1355 ASP A C   1 
ATOM   335  O O   . ASP A 1 56  ? 26.092  48.821 11.144  1.00 57.87  ? 1355 ASP A O   1 
ATOM   336  C CB  . ASP A 1 56  ? 26.900  45.783 10.784  1.00 59.33  ? 1355 ASP A CB  1 
ATOM   337  C CG  . ASP A 1 56  ? 27.126  44.408 11.417  1.00 59.62  ? 1355 ASP A CG  1 
ATOM   338  O OD1 . ASP A 1 56  ? 26.665  44.139 12.551  1.00 71.65  ? 1355 ASP A OD1 1 
ATOM   339  O OD2 . ASP A 1 56  ? 27.798  43.590 10.756  1.00 50.56  ? 1355 ASP A OD2 1 
ATOM   340  N N   . ILE A 1 57  ? 24.813  47.881 9.517   1.00 54.47  ? 1356 ILE A N   1 
ATOM   341  C CA  . ILE A 1 57  ? 24.643  49.096 8.722   1.00 48.32  ? 1356 ILE A CA  1 
ATOM   342  C C   . ILE A 1 57  ? 23.293  49.781 9.008   1.00 49.79  ? 1356 ILE A C   1 
ATOM   343  O O   . ILE A 1 57  ? 23.231  51.001 9.071   1.00 51.34  ? 1356 ILE A O   1 
ATOM   344  C CB  . ILE A 1 57  ? 24.772  48.788 7.211   1.00 50.48  ? 1356 ILE A CB  1 
ATOM   345  C CG1 . ILE A 1 57  ? 26.049  47.997 6.921   1.00 47.63  ? 1356 ILE A CG1 1 
ATOM   346  C CG2 . ILE A 1 57  ? 24.759  50.070 6.378   1.00 40.31  ? 1356 ILE A CG2 1 
ATOM   347  C CD1 . ILE A 1 57  ? 27.333  48.732 7.300   1.00 51.61  ? 1356 ILE A CD1 1 
ATOM   348  N N   . ILE A 1 58  ? 22.224  49.017 9.211   1.00 47.95  ? 1357 ILE A N   1 
ATOM   349  C CA  . ILE A 1 58  ? 20.860  49.588 9.267   1.00 49.16  ? 1357 ILE A CA  1 
ATOM   350  C C   . ILE A 1 58  ? 20.232  49.475 10.674  1.00 50.15  ? 1357 ILE A C   1 
ATOM   351  O O   . ILE A 1 58  ? 20.039  48.381 11.182  1.00 54.41  ? 1357 ILE A O   1 
ATOM   352  C CB  . ILE A 1 58  ? 19.963  48.881 8.220   1.00 49.80  ? 1357 ILE A CB  1 
ATOM   353  C CG1 . ILE A 1 58  ? 20.434  49.252 6.813   1.00 52.89  ? 1357 ILE A CG1 1 
ATOM   354  C CG2 . ILE A 1 58  ? 18.488  49.235 8.387   1.00 38.46  ? 1357 ILE A CG2 1 
ATOM   355  C CD1 . ILE A 1 58  ? 20.615  50.695 6.630   1.00 48.36  ? 1357 ILE A CD1 1 
ATOM   356  N N   . ASP A 1 59  ? 19.928  50.614 11.293  1.00 53.66  ? 1358 ASP A N   1 
ATOM   357  C CA  . ASP A 1 59  ? 19.423  50.643 12.670  1.00 55.37  ? 1358 ASP A CA  1 
ATOM   358  C C   . ASP A 1 59  ? 17.974  50.214 12.728  1.00 52.02  ? 1358 ASP A C   1 
ATOM   359  O O   . ASP A 1 59  ? 17.590  49.543 13.675  1.00 52.59  ? 1358 ASP A O   1 
ATOM   360  C CB  . ASP A 1 59  ? 19.527  52.049 13.292  1.00 59.89  ? 1358 ASP A CB  1 
ATOM   361  C CG  . ASP A 1 59  ? 20.964  52.480 13.546  1.00 68.18  ? 1358 ASP A CG  1 
ATOM   362  O OD1 . ASP A 1 59  ? 21.758  51.691 14.090  1.00 66.21  ? 1358 ASP A OD1 1 
ATOM   363  O OD2 . ASP A 1 59  ? 21.295  53.625 13.202  1.00 83.82  ? 1358 ASP A OD2 1 
ATOM   364  N N   . THR A 1 60  ? 17.176  50.609 11.728  1.00 51.00  ? 1359 THR A N   1 
ATOM   365  C CA  . THR A 1 60  ? 15.715  50.376 11.733  1.00 51.07  ? 1359 THR A CA  1 
ATOM   366  C C   . THR A 1 60  ? 15.196  49.893 10.379  1.00 48.79  ? 1359 THR A C   1 
ATOM   367  O O   . THR A 1 60  ? 15.002  50.692 9.470   1.00 48.58  ? 1359 THR A O   1 
ATOM   368  C CB  . THR A 1 60  ? 14.942  51.652 12.102  1.00 49.15  ? 1359 THR A CB  1 
ATOM   369  O OG1 . THR A 1 60  ? 15.588  52.289 13.200  1.00 56.55  ? 1359 THR A OG1 1 
ATOM   370  C CG2 . THR A 1 60  ? 13.451  51.325 12.474  1.00 42.50  ? 1359 THR A CG2 1 
ATOM   371  N N   . PRO A 1 61  ? 14.961  48.576 10.237  1.00 51.15  ? 1360 PRO A N   1 
ATOM   372  C CA  . PRO A 1 61  ? 14.517  48.096 8.926   1.00 46.98  ? 1360 PRO A CA  1 
ATOM   373  C C   . PRO A 1 61  ? 13.097  48.468 8.621   1.00 37.40  ? 1360 PRO A C   1 
ATOM   374  O O   . PRO A 1 61  ? 12.289  48.581 9.534   1.00 45.82  ? 1360 PRO A O   1 
ATOM   375  C CB  . PRO A 1 61  ? 14.625  46.574 9.058   1.00 42.11  ? 1360 PRO A CB  1 
ATOM   376  C CG  . PRO A 1 61  ? 15.607  46.363 10.202  1.00 56.05  ? 1360 PRO A CG  1 
ATOM   377  C CD  . PRO A 1 61  ? 15.288  47.455 11.140  1.00 51.02  ? 1360 PRO A CD  1 
ATOM   378  N N   . MET A 1 62  ? 12.781  48.602 7.338   1.00 35.16  ? 1361 MET A N   1 
ATOM   379  C CA  . MET A 1 62  ? 11.385  48.800 6.923   1.00 35.16  ? 1361 MET A CA  1 
ATOM   380  C C   . MET A 1 62  ? 11.182  48.215 5.533   1.00 37.97  ? 1361 MET A C   1 
ATOM   381  O O   . MET A 1 62  ? 12.135  48.102 4.748   1.00 41.27  ? 1361 MET A O   1 
ATOM   382  C CB  . MET A 1 62  ? 11.027  50.305 6.988   1.00 31.83  ? 1361 MET A CB  1 
ATOM   383  C CG  . MET A 1 62  ? 9.617   50.624 6.687   1.00 40.81  ? 1361 MET A CG  1 
ATOM   384  S SD  . MET A 1 62  ? 8.439   49.749 7.688   1.00 36.77  ? 1361 MET A SD  1 
ATOM   385  C CE  . MET A 1 62  ? 9.076   50.025 9.346   1.00 30.37  ? 1361 MET A CE  1 
ATOM   386  N N   . ASP A 1 63  ? 9.965   47.752 5.273   1.00 37.30  ? 1362 ASP A N   1 
ATOM   387  C CA  . ASP A 1 63  ? 9.652   47.070 4.027   1.00 33.85  ? 1362 ASP A CA  1 
ATOM   388  C C   . ASP A 1 63  ? 8.181   47.227 3.732   1.00 34.17  ? 1362 ASP A C   1 
ATOM   389  O O   . ASP A 1 63  ? 7.421   47.500 4.627   1.00 46.96  ? 1362 ASP A O   1 
ATOM   390  C CB  . ASP A 1 63  ? 9.974   45.604 4.187   1.00 37.39  ? 1362 ASP A CB  1 
ATOM   391  C CG  . ASP A 1 63  ? 9.047   44.932 5.146   1.00 41.41  ? 1362 ASP A CG  1 
ATOM   392  O OD1 . ASP A 1 63  ? 7.999   44.424 4.677   1.00 47.09  ? 1362 ASP A OD1 1 
ATOM   393  O OD2 . ASP A 1 63  ? 9.338   44.965 6.366   1.00 45.28  ? 1362 ASP A OD2 1 
ATOM   394  N N   . PHE A 1 64  ? 7.786   47.103 2.475   1.00 32.92  ? 1363 PHE A N   1 
ATOM   395  C CA  . PHE A 1 64  ? 6.421   47.448 2.064   1.00 33.86  ? 1363 PHE A CA  1 
ATOM   396  C C   . PHE A 1 64  ? 5.363   46.544 2.622   1.00 33.03  ? 1363 PHE A C   1 
ATOM   397  O O   . PHE A 1 64  ? 4.235   46.971 2.742   1.00 34.16  ? 1363 PHE A O   1 
ATOM   398  C CB  . PHE A 1 64  ? 6.298   47.487 0.524   1.00 34.54  ? 1363 PHE A CB  1 
ATOM   399  C CG  . PHE A 1 64  ? 6.860   48.726 -0.055  1.00 39.56  ? 1363 PHE A CG  1 
ATOM   400  C CD1 . PHE A 1 64  ? 8.047   48.721 -0.734  1.00 38.42  ? 1363 PHE A CD1 1 
ATOM   401  C CD2 . PHE A 1 64  ? 6.227   49.914 0.156   1.00 36.56  ? 1363 PHE A CD2 1 
ATOM   402  C CE1 . PHE A 1 64  ? 8.585   49.873 -1.197  1.00 36.66  ? 1363 PHE A CE1 1 
ATOM   403  C CE2 . PHE A 1 64  ? 6.760   51.089 -0.323  1.00 46.52  ? 1363 PHE A CE2 1 
ATOM   404  C CZ  . PHE A 1 64  ? 7.948   51.072 -0.986  1.00 34.24  ? 1363 PHE A CZ  1 
ATOM   405  N N   . ALA A 1 65  ? 5.695   45.293 2.957   1.00 38.82  ? 1364 ALA A N   1 
ATOM   406  C CA  . ALA A 1 65  ? 4.666   44.391 3.540   1.00 43.36  ? 1364 ALA A CA  1 
ATOM   407  C C   . ALA A 1 65  ? 4.330   44.936 4.936   1.00 49.71  ? 1364 ALA A C   1 
ATOM   408  O O   . ALA A 1 65  ? 3.179   44.964 5.341   1.00 45.52  ? 1364 ALA A O   1 
ATOM   409  C CB  . ALA A 1 65  ? 5.162   42.949 3.620   1.00 35.82  ? 1364 ALA A CB  1 
ATOM   410  N N   . THR A 1 66  ? 5.354   45.393 5.651   1.00 38.83  ? 1365 THR A N   1 
ATOM   411  C CA  . THR A 1 66  ? 5.178   45.878 6.994   1.00 40.42  ? 1365 THR A CA  1 
ATOM   412  C C   . THR A 1 66  ? 4.380   47.210 6.916   1.00 40.40  ? 1365 THR A C   1 
ATOM   413  O O   . THR A 1 66  ? 3.489   47.441 7.738   1.00 39.32  ? 1365 THR A O   1 
ATOM   414  C CB  . THR A 1 66  ? 6.550   46.085 7.679   1.00 43.96  ? 1365 THR A CB  1 
ATOM   415  O OG1 . THR A 1 66  ? 7.236   44.826 7.762   1.00 41.71  ? 1365 THR A OG1 1 
ATOM   416  C CG2 . THR A 1 66  ? 6.390   46.675 9.055   1.00 32.32  ? 1365 THR A CG2 1 
ATOM   417  N N   . VAL A 1 67  ? 4.673   48.062 5.934   1.00 36.50  ? 1366 VAL A N   1 
ATOM   418  C CA  . VAL A 1 67  ? 3.942   49.356 5.831   1.00 41.57  ? 1366 VAL A CA  1 
ATOM   419  C C   . VAL A 1 67  ? 2.481   49.036 5.555   1.00 41.40  ? 1366 VAL A C   1 
ATOM   420  O O   . VAL A 1 67  ? 1.578   49.630 6.141   1.00 44.25  ? 1366 VAL A O   1 
ATOM   421  C CB  . VAL A 1 67  ? 4.492   50.285 4.739   1.00 36.46  ? 1366 VAL A CB  1 
ATOM   422  C CG1 . VAL A 1 67  ? 3.584   51.469 4.544   1.00 28.34  ? 1366 VAL A CG1 1 
ATOM   423  C CG2 . VAL A 1 67  ? 5.874   50.754 5.098   1.00 25.23  ? 1366 VAL A CG2 1 
ATOM   424  N N   . ARG A 1 68  ? 2.237   48.035 4.726   1.00 47.54  ? 1367 ARG A N   1 
ATOM   425  C CA  . ARG A 1 68  ? 0.853   47.707 4.395   1.00 52.17  ? 1367 ARG A CA  1 
ATOM   426  C C   . ARG A 1 68  ? 0.094   47.095 5.593   1.00 48.64  ? 1367 ARG A C   1 
ATOM   427  O O   . ARG A 1 68  ? -1.058  47.455 5.853   1.00 51.67  ? 1367 ARG A O   1 
ATOM   428  C CB  . ARG A 1 68  ? 0.767   46.822 3.154   1.00 49.23  ? 1367 ARG A CB  1 
ATOM   429  C CG  . ARG A 1 68  ? -0.683  46.457 2.813   1.00 73.00  ? 1367 ARG A CG  1 
ATOM   430  C CD  . ARG A 1 68  ? -0.853  46.049 1.374   1.00 83.61  ? 1367 ARG A CD  1 
ATOM   431  N NE  . ARG A 1 68  ? -0.038  44.880 1.107   1.00 65.15  ? 1367 ARG A NE  1 
ATOM   432  C CZ  . ARG A 1 68  ? 0.264   44.430 -0.105  1.00 74.41  ? 1367 ARG A CZ  1 
ATOM   433  N NH1 . ARG A 1 68  ? 1.039   43.358 -0.207  1.00 57.81  ? 1367 ARG A NH1 1 
ATOM   434  N NH2 . ARG A 1 68  ? -0.202  45.025 -1.207  1.00 54.78  ? 1367 ARG A NH2 1 
ATOM   435  N N   . GLU A 1 69  ? 0.739   46.197 6.327   1.00 47.97  ? 1368 GLU A N   1 
ATOM   436  C CA  . GLU A 1 69  ? 0.159   45.673 7.553   1.00 48.71  ? 1368 GLU A CA  1 
ATOM   437  C C   . GLU A 1 69  ? -0.212  46.798 8.531   1.00 51.49  ? 1368 GLU A C   1 
ATOM   438  O O   . GLU A 1 69  ? -1.287  46.772 9.126   1.00 54.56  ? 1368 GLU A O   1 
ATOM   439  C CB  . GLU A 1 69  ? 1.103   44.718 8.246   1.00 54.01  ? 1368 GLU A CB  1 
ATOM   440  C CG  . GLU A 1 69  ? 1.247   43.354 7.605   1.00 78.75  ? 1368 GLU A CG  1 
ATOM   441  C CD  . GLU A 1 69  ? 2.153   42.413 8.427   1.00 108.14 ? 1368 GLU A CD  1 
ATOM   442  O OE1 . GLU A 1 69  ? 1.845   42.148 9.615   1.00 116.70 ? 1368 GLU A OE1 1 
ATOM   443  O OE2 . GLU A 1 69  ? 3.174   41.938 7.879   1.00 98.36  ? 1368 GLU A OE2 1 
ATOM   444  N N   . THR A 1 70  ? 0.674   47.776 8.688   1.00 42.55  ? 1369 THR A N   1 
ATOM   445  C CA  . THR A 1 70  ? 0.462   48.855 9.646   1.00 40.64  ? 1369 THR A CA  1 
ATOM   446  C C   . THR A 1 70  ? -0.758  49.700 9.275   1.00 35.11  ? 1369 THR A C   1 
ATOM   447  O O   . THR A 1 70  ? -1.598  49.998 10.118  1.00 44.24  ? 1369 THR A O   1 
ATOM   448  C CB  . THR A 1 70  ? 1.706   49.727 9.713   1.00 40.98  ? 1369 THR A CB  1 
ATOM   449  O OG1 . THR A 1 70  ? 2.829   48.907 10.043  1.00 39.77  ? 1369 THR A OG1 1 
ATOM   450  C CG2 . THR A 1 70  ? 1.546   50.782 10.762  1.00 31.71  ? 1369 THR A CG2 1 
ATOM   451  N N   . LEU A 1 71  ? -0.864  50.025 7.993   1.00 37.16  ? 1370 LEU A N   1 
ATOM   452  C CA  . LEU A 1 71  ? -2.024  50.703 7.409   1.00 38.17  ? 1370 LEU A CA  1 
ATOM   453  C C   . LEU A 1 71  ? -3.336  49.935 7.572   1.00 43.89  ? 1370 LEU A C   1 
ATOM   454  O O   . LEU A 1 71  ? -4.351  50.494 7.990   1.00 46.81  ? 1370 LEU A O   1 
ATOM   455  C CB  . LEU A 1 71  ? -1.788  50.945 5.917   1.00 29.88  ? 1370 LEU A CB  1 
ATOM   456  C CG  . LEU A 1 71  ? -2.865  51.774 5.212   1.00 43.91  ? 1370 LEU A CG  1 
ATOM   457  C CD1 . LEU A 1 71  ? -2.980  53.163 5.821   1.00 40.99  ? 1370 LEU A CD1 1 
ATOM   458  C CD2 . LEU A 1 71  ? -2.569  51.913 3.715   1.00 39.49  ? 1370 LEU A CD2 1 
ATOM   459  N N   . GLU A 1 72  ? -3.321  48.660 7.221   1.00 39.76  ? 1371 GLU A N   1 
ATOM   460  C CA  . GLU A 1 72  ? -4.513  47.831 7.390   1.00 48.67  ? 1371 GLU A CA  1 
ATOM   461  C C   . GLU A 1 72  ? -4.936  47.723 8.839   1.00 49.22  ? 1371 GLU A C   1 
ATOM   462  O O   . GLU A 1 72  ? -6.119  47.754 9.117   1.00 49.50  ? 1371 GLU A O   1 
ATOM   463  C CB  . GLU A 1 72  ? -4.288  46.422 6.823   1.00 44.22  ? 1371 GLU A CB  1 
ATOM   464  C CG  . GLU A 1 72  ? -4.436  46.381 5.292   1.00 60.10  ? 1371 GLU A CG  1 
ATOM   465  C CD  . GLU A 1 72  ? -3.966  45.062 4.670   1.00 87.37  ? 1371 GLU A CD  1 
ATOM   466  O OE1 . GLU A 1 72  ? -3.573  45.094 3.473   1.00 69.03  ? 1371 GLU A OE1 1 
ATOM   467  O OE2 . GLU A 1 72  ? -3.992  44.014 5.379   1.00 79.15  ? 1371 GLU A OE2 1 
ATOM   468  N N   . ALA A 1 73  ? -3.968  47.589 9.750   1.00 50.11  ? 1372 ALA A N   1 
ATOM   469  C CA  . ALA A 1 73  ? -4.243  47.544 11.193  1.00 50.18  ? 1372 ALA A CA  1 
ATOM   470  C C   . ALA A 1 73  ? -4.801  48.857 11.759  1.00 47.13  ? 1372 ALA A C   1 
ATOM   471  O O   . ALA A 1 73  ? -5.273  48.877 12.881  1.00 63.35  ? 1372 ALA A O   1 
ATOM   472  C CB  . ALA A 1 73  ? -2.988  47.139 11.963  1.00 42.88  ? 1372 ALA A CB  1 
ATOM   473  N N   . GLY A 1 74  ? -4.754  49.921 10.969  1.00 47.60  ? 1373 GLY A N   1 
ATOM   474  C CA  . GLY A 1 74  ? -5.167  51.258 11.367  1.00 50.55  ? 1373 GLY A CA  1 
ATOM   475  C C   . GLY A 1 74  ? -4.159  52.005 12.237  1.00 47.92  ? 1373 GLY A C   1 
ATOM   476  O O   . GLY A 1 74  ? -4.523  52.906 12.954  1.00 52.76  ? 1373 GLY A O   1 
ATOM   477  N N   . ASN A 1 75  ? -2.893  51.646 12.147  1.00 40.66  ? 1374 ASN A N   1 
ATOM   478  C CA  . ASN A 1 75  ? -1.894  52.106 13.094  1.00 41.95  ? 1374 ASN A CA  1 
ATOM   479  C C   . ASN A 1 75  ? -1.123  53.299 12.581  1.00 42.90  ? 1374 ASN A C   1 
ATOM   480  O O   . ASN A 1 75  ? -0.155  53.689 13.203  1.00 44.78  ? 1374 ASN A O   1 
ATOM   481  C CB  . ASN A 1 75  ? -0.914  50.968 13.469  1.00 40.36  ? 1374 ASN A CB  1 
ATOM   482  C CG  . ASN A 1 75  ? -1.492  50.020 14.543  1.00 42.04  ? 1374 ASN A CG  1 
ATOM   483  O OD1 . ASN A 1 75  ? -2.428  50.360 15.238  1.00 54.72  ? 1374 ASN A OD1 1 
ATOM   484  N ND2 . ASN A 1 75  ? -0.925  48.854 14.670  1.00 38.66  ? 1374 ASN A ND2 1 
ATOM   485  N N   . TYR A 1 76  ? -1.565  53.873 11.465  1.00 38.95  ? 1375 TYR A N   1 
ATOM   486  C CA  . TYR A 1 76  ? -1.107  55.176 11.026  1.00 32.22  ? 1375 TYR A CA  1 
ATOM   487  C C   . TYR A 1 76  ? -2.107  56.269 11.378  1.00 41.29  ? 1375 TYR A C   1 
ATOM   488  O O   . TYR A 1 76  ? -3.237  56.274 10.888  1.00 42.03  ? 1375 TYR A O   1 
ATOM   489  C CB  . TYR A 1 76  ? -0.836  55.202 9.538   1.00 35.66  ? 1375 TYR A CB  1 
ATOM   490  C CG  . TYR A 1 76  ? 0.425   54.460 9.120   1.00 37.26  ? 1375 TYR A CG  1 
ATOM   491  C CD1 . TYR A 1 76  ? 1.658   54.738 9.704   1.00 28.05  ? 1375 TYR A CD1 1 
ATOM   492  C CD2 . TYR A 1 76  ? 0.369   53.454 8.168   1.00 38.10  ? 1375 TYR A CD2 1 
ATOM   493  C CE1 . TYR A 1 76  ? 2.813   54.023 9.322   1.00 41.38  ? 1375 TYR A CE1 1 
ATOM   494  C CE2 . TYR A 1 76  ? 1.509   52.738 7.787   1.00 36.85  ? 1375 TYR A CE2 1 
ATOM   495  C CZ  . TYR A 1 76  ? 2.698   53.026 8.363   1.00 39.53  ? 1375 TYR A CZ  1 
ATOM   496  O OH  . TYR A 1 76  ? 3.755   52.309 7.943   1.00 30.56  ? 1375 TYR A OH  1 
ATOM   497  N N   . GLU A 1 77  ? -1.693  57.199 12.236  1.00 40.35  ? 1376 GLU A N   1 
ATOM   498  C CA  . GLU A 1 77  ? -2.607  58.223 12.690  1.00 43.24  ? 1376 GLU A CA  1 
ATOM   499  C C   . GLU A 1 77  ? -2.816  59.278 11.616  1.00 39.97  ? 1376 GLU A C   1 
ATOM   500  O O   . GLU A 1 77  ? -3.852  59.927 11.605  1.00 47.37  ? 1376 GLU A O   1 
ATOM   501  C CB  . GLU A 1 77  ? -2.124  58.841 13.990  1.00 42.36  ? 1376 GLU A CB  1 
ATOM   502  C CG  . GLU A 1 77  ? -3.114  59.831 14.633  1.00 50.06  ? 1376 GLU A CG  1 
ATOM   503  C CD  . GLU A 1 77  ? -2.915  61.292 14.224  1.00 46.43  ? 1376 GLU A CD  1 
ATOM   504  O OE1 . GLU A 1 77  ? -3.719  62.162 14.692  1.00 47.68  ? 1376 GLU A OE1 1 
ATOM   505  O OE2 . GLU A 1 77  ? -1.964  61.558 13.441  1.00 41.12  ? 1376 GLU A OE2 1 
ATOM   506  N N   . SER A 1 78  ? -1.832  59.435 10.730  1.00 37.24  ? 1377 SER A N   1 
ATOM   507  C CA  . SER A 1 78  ? -1.909  60.363 9.584   1.00 38.52  ? 1377 SER A CA  1 
ATOM   508  C C   . SER A 1 78  ? -1.035  59.882 8.455   1.00 38.53  ? 1377 SER A C   1 
ATOM   509  O O   . SER A 1 78  ? -0.063  59.148 8.679   1.00 45.63  ? 1377 SER A O   1 
ATOM   510  C CB  . SER A 1 78  ? -1.448  61.777 9.979   1.00 45.52  ? 1377 SER A CB  1 
ATOM   511  O OG  . SER A 1 78  ? -0.043  61.795 10.152  1.00 51.29  ? 1377 SER A OG  1 
ATOM   512  N N   . PRO A 1 79  ? -1.320  60.360 7.237   1.00 39.96  ? 1378 PRO A N   1 
ATOM   513  C CA  . PRO A 1 79  ? -0.481  59.913 6.179   1.00 36.48  ? 1378 PRO A CA  1 
ATOM   514  C C   . PRO A 1 79  ? 0.975   60.324 6.323   1.00 42.56  ? 1378 PRO A C   1 
ATOM   515  O O   . PRO A 1 79  ? 1.802   59.643 5.731   1.00 36.70  ? 1378 PRO A O   1 
ATOM   516  C CB  . PRO A 1 79  ? -1.116  60.504 4.920   1.00 42.71  ? 1378 PRO A CB  1 
ATOM   517  C CG  . PRO A 1 79  ? -2.178  61.479 5.384   1.00 53.31  ? 1378 PRO A CG  1 
ATOM   518  C CD  . PRO A 1 79  ? -2.163  61.514 6.844   1.00 47.35  ? 1378 PRO A CD  1 
ATOM   519  N N   . MET A 1 80  ? 1.313   61.379 7.079   1.00 35.68  ? 1379 MET A N   1 
ATOM   520  C CA  . MET A 1 80  ? 2.733   61.679 7.275   1.00 38.04  ? 1379 MET A CA  1 
ATOM   521  C C   . MET A 1 80  ? 3.479   60.521 7.936   1.00 44.75  ? 1379 MET A C   1 
ATOM   522  O O   . MET A 1 80  ? 4.646   60.321 7.642   1.00 54.76  ? 1379 MET A O   1 
ATOM   523  C CB  . MET A 1 80  ? 2.964   62.954 8.089   1.00 37.35  ? 1379 MET A CB  1 
ATOM   524  C CG  . MET A 1 80  ? 2.439   64.245 7.409   1.00 43.20  ? 1379 MET A CG  1 
ATOM   525  S SD  . MET A 1 80  ? 0.622   64.377 7.511   1.00 61.44  ? 1379 MET A SD  1 
ATOM   526  C CE  . MET A 1 80  ? 0.473   64.929 9.274   1.00 49.87  ? 1379 MET A CE  1 
ATOM   527  N N   . GLU A 1 81  ? 2.814   59.774 8.816   1.00 40.82  ? 1380 GLU A N   1 
ATOM   528  C CA  . GLU A 1 81  ? 3.448   58.636 9.499   1.00 46.46  ? 1380 GLU A CA  1 
ATOM   529  C C   . GLU A 1 81  ? 3.795   57.525 8.517   1.00 36.50  ? 1380 GLU A C   1 
ATOM   530  O O   . GLU A 1 81  ? 4.874   56.931 8.591   1.00 45.58  ? 1380 GLU A O   1 
ATOM   531  C CB  . GLU A 1 81  ? 2.538   58.107 10.621  1.00 54.79  ? 1380 GLU A CB  1 
ATOM   532  C CG  . GLU A 1 81  ? 2.154   59.174 11.637  1.00 40.34  ? 1380 GLU A CG  1 
ATOM   533  C CD  . GLU A 1 81  ? 3.402   59.784 12.188  1.00 67.90  ? 1380 GLU A CD  1 
ATOM   534  O OE1 . GLU A 1 81  ? 4.192   59.019 12.811  1.00 57.26  ? 1380 GLU A OE1 1 
ATOM   535  O OE2 . GLU A 1 81  ? 3.622   60.991 11.952  1.00 42.32  ? 1380 GLU A OE2 1 
ATOM   536  N N   . LEU A 1 82  ? 2.879   57.249 7.594   1.00 36.24  ? 1381 LEU A N   1 
ATOM   537  C CA  . LEU A 1 82  ? 3.113   56.280 6.537   1.00 41.64  ? 1381 LEU A CA  1 
ATOM   538  C C   . LEU A 1 82  ? 4.290   56.721 5.704   1.00 41.25  ? 1381 LEU A C   1 
ATOM   539  O O   . LEU A 1 82  ? 5.175   55.947 5.376   1.00 35.75  ? 1381 LEU A O   1 
ATOM   540  C CB  . LEU A 1 82  ? 1.884   56.133 5.669   1.00 39.98  ? 1381 LEU A CB  1 
ATOM   541  C CG  . LEU A 1 82  ? 1.984   55.057 4.580   1.00 43.01  ? 1381 LEU A CG  1 
ATOM   542  C CD1 . LEU A 1 82  ? 0.686   54.303 4.453   1.00 35.37  ? 1381 LEU A CD1 1 
ATOM   543  C CD2 . LEU A 1 82  ? 2.361   55.674 3.230   1.00 34.74  ? 1381 LEU A CD2 1 
ATOM   544  N N   . CYS A 1 83  ? 4.323   58.000 5.400   1.00 35.36  ? 1382 CYS A N   1 
ATOM   545  C CA  . CYS A 1 83  ? 5.387   58.553 4.581   1.00 36.24  ? 1382 CYS A CA  1 
ATOM   546  C C   . CYS A 1 83  ? 6.728   58.371 5.184   1.00 29.12  ? 1382 CYS A C   1 
ATOM   547  O O   . CYS A 1 83  ? 7.645   58.151 4.460   1.00 42.46  ? 1382 CYS A O   1 
ATOM   548  C CB  . CYS A 1 83  ? 5.215   60.017 4.429   1.00 42.43  ? 1382 CYS A CB  1 
ATOM   549  S SG  A CYS A 1 83  ? 4.246   60.386 3.077   0.50 39.70  ? 1382 CYS A SG  1 
ATOM   550  S SG  B CYS A 1 83  ? 5.799   60.660 2.881   0.50 45.41  ? 1382 CYS A SG  1 
ATOM   551  N N   . LYS A 1 84  ? 6.841   58.550 6.502   1.00 35.22  ? 1383 LYS A N   1 
ATOM   552  C CA  . LYS A 1 84  ? 8.123   58.396 7.197   1.00 44.77  ? 1383 LYS A CA  1 
ATOM   553  C C   . LYS A 1 84  ? 8.594   56.950 7.049   1.00 39.40  ? 1383 LYS A C   1 
ATOM   554  O O   . LYS A 1 84  ? 9.755   56.678 6.752   1.00 40.85  ? 1383 LYS A O   1 
ATOM   555  C CB  . LYS A 1 84  ? 7.972   58.715 8.688   1.00 45.15  ? 1383 LYS A CB  1 
ATOM   556  C CG  . LYS A 1 84  ? 7.710   60.137 9.062   1.00 53.38  ? 1383 LYS A CG  1 
ATOM   557  C CD  . LYS A 1 84  ? 7.546   60.225 10.601  1.00 57.31  ? 1383 LYS A CD  1 
ATOM   558  C CE  . LYS A 1 84  ? 7.018   61.583 11.051  1.00 61.13  ? 1383 LYS A CE  1 
ATOM   559  N NZ  . LYS A 1 84  ? 6.637   61.592 12.541  1.00 54.24  ? 1383 LYS A NZ  1 
ATOM   560  N N   . ASP A 1 85  ? 7.672   56.017 7.240   1.00 38.23  ? 1384 ASP A N   1 
ATOM   561  C CA  . ASP A 1 85  ? 7.993   54.614 7.024   1.00 36.36  ? 1384 ASP A CA  1 
ATOM   562  C C   . ASP A 1 85  ? 8.455   54.314 5.578   1.00 40.74  ? 1384 ASP A C   1 
ATOM   563  O O   . ASP A 1 85  ? 9.538   53.766 5.375   1.00 42.33  ? 1384 ASP A O   1 
ATOM   564  C CB  . ASP A 1 85  ? 6.807   53.736 7.456   1.00 43.06  ? 1384 ASP A CB  1 
ATOM   565  C CG  . ASP A 1 85  ? 6.801   53.495 8.957   1.00 56.35  ? 1384 ASP A CG  1 
ATOM   566  O OD1 . ASP A 1 85  ? 7.748   54.013 9.603   1.00 44.84  ? 1384 ASP A OD1 1 
ATOM   567  O OD2 . ASP A 1 85  ? 5.872   52.815 9.477   1.00 43.78  ? 1384 ASP A OD2 1 
ATOM   568  N N   . VAL A 1 86  ? 7.678   54.729 4.579   1.00 39.72  ? 1385 VAL A N   1 
ATOM   569  C CA  . VAL A 1 86  ? 8.033   54.478 3.181   1.00 33.73  ? 1385 VAL A CA  1 
ATOM   570  C C   . VAL A 1 86  ? 9.373   55.135 2.863   1.00 37.19  ? 1385 VAL A C   1 
ATOM   571  O O   . VAL A 1 86  ? 10.175  54.574 2.135   1.00 32.48  ? 1385 VAL A O   1 
ATOM   572  C CB  . VAL A 1 86  ? 6.952   54.916 2.181   1.00 34.68  ? 1385 VAL A CB  1 
ATOM   573  C CG1 . VAL A 1 86  ? 7.444   54.785 0.747   1.00 28.77  ? 1385 VAL A CG1 1 
ATOM   574  C CG2 . VAL A 1 86  ? 5.634   54.119 2.398   1.00 30.48  ? 1385 VAL A CG2 1 
ATOM   575  N N   . ARG A 1 87  ? 9.645   56.306 3.415   1.00 33.72  ? 1386 ARG A N   1 
ATOM   576  C CA  . ARG A 1 87  ? 10.890  56.976 3.032   1.00 37.28  ? 1386 ARG A CA  1 
ATOM   577  C C   . ARG A 1 87  ? 12.109  56.338 3.690   1.00 42.94  ? 1386 ARG A C   1 
ATOM   578  O O   . ARG A 1 87  ? 13.243  56.489 3.222   1.00 46.96  ? 1386 ARG A O   1 
ATOM   579  C CB  . ARG A 1 87  ? 10.843  58.444 3.430   1.00 35.50  ? 1386 ARG A CB  1 
ATOM   580  C CG  . ARG A 1 87  ? 10.158  59.286 2.434   1.00 43.12  ? 1386 ARG A CG  1 
ATOM   581  C CD  . ARG A 1 87  ? 9.740   60.594 3.025   1.00 41.32  ? 1386 ARG A CD  1 
ATOM   582  N NE  . ARG A 1 87  ? 9.110   61.376 1.991   1.00 55.21  ? 1386 ARG A NE  1 
ATOM   583  C CZ  . ARG A 1 87  ? 8.449   62.508 2.183   1.00 67.05  ? 1386 ARG A CZ  1 
ATOM   584  N NH1 . ARG A 1 87  ? 8.274   63.006 3.405   1.00 48.34  ? 1386 ARG A NH1 1 
ATOM   585  N NH2 . ARG A 1 87  ? 7.938   63.130 1.131   1.00 58.87  ? 1386 ARG A NH2 1 
ATOM   586  N N   . LEU A 1 88  ? 11.864  55.691 4.820   1.00 41.27  ? 1387 LEU A N   1 
ATOM   587  C CA  . LEU A 1 88  ? 12.870  54.898 5.493   1.00 44.09  ? 1387 LEU A CA  1 
ATOM   588  C C   . LEU A 1 88  ? 13.309  53.680 4.665   1.00 46.11  ? 1387 LEU A C   1 
ATOM   589  O O   . LEU A 1 88  ? 14.457  53.215 4.758   1.00 44.99  ? 1387 LEU A O   1 
ATOM   590  C CB  . LEU A 1 88  ? 12.297  54.445 6.832   1.00 43.50  ? 1387 LEU A CB  1 
ATOM   591  C CG  . LEU A 1 88  ? 13.239  53.826 7.834   1.00 43.73  ? 1387 LEU A CG  1 
ATOM   592  C CD1 . LEU A 1 88  ? 14.470  54.737 8.088   1.00 44.71  ? 1387 LEU A CD1 1 
ATOM   593  C CD2 . LEU A 1 88  ? 12.444  53.564 9.098   1.00 33.10  ? 1387 LEU A CD2 1 
ATOM   594  N N   . ILE A 1 89  ? 12.398  53.153 3.854   1.00 46.84  ? 1388 ILE A N   1 
ATOM   595  C CA  . ILE A 1 89  ? 12.725  51.997 3.029   1.00 42.52  ? 1388 ILE A CA  1 
ATOM   596  C C   . ILE A 1 89  ? 13.791  52.469 2.093   1.00 41.10  ? 1388 ILE A C   1 
ATOM   597  O O   . ILE A 1 89  ? 14.748  51.792 1.859   1.00 37.25  ? 1388 ILE A O   1 
ATOM   598  C CB  . ILE A 1 89  ? 11.536  51.517 2.210   1.00 42.74  ? 1388 ILE A CB  1 
ATOM   599  C CG1 . ILE A 1 89  ? 10.455  50.995 3.151   1.00 35.69  ? 1388 ILE A CG1 1 
ATOM   600  C CG2 . ILE A 1 89  ? 11.977  50.468 1.222   1.00 35.53  ? 1388 ILE A CG2 1 
ATOM   601  C CD1 . ILE A 1 89  ? 9.251   50.344 2.480   1.00 28.74  ? 1388 ILE A CD1 1 
ATOM   602  N N   . PHE A 1 90  ? 13.644  53.682 1.606   1.00 42.46  ? 1389 PHE A N   1 
ATOM   603  C CA  . PHE A 1 90  ? 14.556  54.192 0.579   1.00 43.37  ? 1389 PHE A CA  1 
ATOM   604  C C   . PHE A 1 90  ? 15.848  54.686 1.136   1.00 44.95  ? 1389 PHE A C   1 
ATOM   605  O O   . PHE A 1 90  ? 16.880  54.463 0.525   1.00 53.35  ? 1389 PHE A O   1 
ATOM   606  C CB  . PHE A 1 90  ? 13.861  55.278 -0.282  1.00 44.25  ? 1389 PHE A CB  1 
ATOM   607  C CG  . PHE A 1 90  ? 12.623  54.762 -1.008  1.00 34.69  ? 1389 PHE A CG  1 
ATOM   608  C CD1 . PHE A 1 90  ? 12.652  53.546 -1.687  1.00 40.63  ? 1389 PHE A CD1 1 
ATOM   609  C CD2 . PHE A 1 90  ? 11.416  55.445 -0.951  1.00 49.08  ? 1389 PHE A CD2 1 
ATOM   610  C CE1 . PHE A 1 90  ? 11.542  53.079 -2.325  1.00 33.82  ? 1389 PHE A CE1 1 
ATOM   611  C CE2 . PHE A 1 90  ? 10.295  54.956 -1.567  1.00 39.64  ? 1389 PHE A CE2 1 
ATOM   612  C CZ  . PHE A 1 90  ? 10.353  53.788 -2.262  1.00 37.31  ? 1389 PHE A CZ  1 
ATOM   613  N N   . SER A 1 91  ? 15.813  55.344 2.291   1.00 49.74  ? 1390 SER A N   1 
ATOM   614  C CA  . SER A 1 91  ? 17.053  55.784 2.951   1.00 47.90  ? 1390 SER A CA  1 
ATOM   615  C C   . SER A 1 91  ? 17.863  54.570 3.429   1.00 47.15  ? 1390 SER A C   1 
ATOM   616  O O   . SER A 1 91  ? 19.101  54.569 3.368   1.00 44.32  ? 1390 SER A O   1 
ATOM   617  C CB  . SER A 1 91  ? 16.784  56.736 4.119   1.00 47.93  ? 1390 SER A CB  1 
ATOM   618  O OG  . SER A 1 91  ? 15.967  56.124 5.114   1.00 55.01  ? 1390 SER A OG  1 
ATOM   619  N N   . ASN A 1 92  ? 17.175  53.541 3.902   1.00 42.43  ? 1391 ASN A N   1 
ATOM   620  C CA  . ASN A 1 92  ? 17.855  52.293 4.232   1.00 40.07  ? 1391 ASN A CA  1 
ATOM   621  C C   . ASN A 1 92  ? 18.566  51.772 2.993   1.00 44.19  ? 1391 ASN A C   1 
ATOM   622  O O   . ASN A 1 92  ? 19.783  51.512 3.005   1.00 41.52  ? 1391 ASN A O   1 
ATOM   623  C CB  . ASN A 1 92  ? 16.873  51.252 4.773   1.00 41.33  ? 1391 ASN A CB  1 
ATOM   624  C CG  . ASN A 1 92  ? 16.516  51.496 6.209   1.00 43.38  ? 1391 ASN A CG  1 
ATOM   625  O OD1 . ASN A 1 92  ? 17.071  52.392 6.844   1.00 39.83  ? 1391 ASN A OD1 1 
ATOM   626  N ND2 . ASN A 1 92  ? 15.602  50.674 6.754   1.00 34.17  ? 1391 ASN A ND2 1 
ATOM   627  N N   . SER A 1 93  ? 17.826  51.642 1.903   1.00 42.42  ? 1392 SER A N   1 
ATOM   628  C CA  . SER A 1 93  ? 18.449  51.129 0.699   1.00 42.80  ? 1392 SER A CA  1 
ATOM   629  C C   . SER A 1 93  ? 19.667  51.957 0.275   1.00 45.10  ? 1392 SER A C   1 
ATOM   630  O O   . SER A 1 93  ? 20.715  51.405 -0.083  1.00 47.83  ? 1392 SER A O   1 
ATOM   631  C CB  . SER A 1 93  ? 17.460  51.063 -0.447  1.00 40.38  ? 1392 SER A CB  1 
ATOM   632  O OG  . SER A 1 93  ? 18.107  50.608 -1.600  1.00 37.28  ? 1392 SER A OG  1 
ATOM   633  N N   . LYS A 1 94  ? 19.549  53.274 0.309   1.00 39.33  ? 1393 LYS A N   1 
ATOM   634  C CA  . LYS A 1 94  ? 20.685  54.130 -0.130  1.00 48.24  ? 1393 LYS A CA  1 
ATOM   635  C C   . LYS A 1 94  ? 21.877  53.984 0.809   1.00 45.18  ? 1393 LYS A C   1 
ATOM   636  O O   . LYS A 1 94  ? 23.013  54.166 0.406   1.00 56.92  ? 1393 LYS A O   1 
ATOM   637  C CB  . LYS A 1 94  ? 20.245  55.597 -0.210  1.00 43.06  ? 1393 LYS A CB  1 
ATOM   638  C CG  . LYS A 1 94  ? 21.208  56.586 -0.888  1.00 77.84  ? 1393 LYS A CG  1 
ATOM   639  C CD  . LYS A 1 94  ? 20.756  58.053 -0.583  1.00 91.00  ? 1393 LYS A CD  1 
ATOM   640  C CE  . LYS A 1 94  ? 21.431  59.118 -1.441  1.00 86.34  ? 1393 LYS A CE  1 
ATOM   641  N NZ  . LYS A 1 94  ? 21.206  60.461 -0.836  1.00 81.04  ? 1393 LYS A NZ  1 
ATOM   642  N N   . ALA A 1 95  ? 21.613  53.686 2.082   1.00 44.99  ? 1394 ALA A N   1 
ATOM   643  C CA  . ALA A 1 95  ? 22.683  53.517 3.056   1.00 41.80  ? 1394 ALA A CA  1 
ATOM   644  C C   . ALA A 1 95  ? 23.300  52.161 2.900   1.00 45.19  ? 1394 ALA A C   1 
ATOM   645  O O   . ALA A 1 95  ? 24.510  52.059 3.003   1.00 44.30  ? 1394 ALA A O   1 
ATOM   646  C CB  . ALA A 1 95  ? 22.210  53.728 4.506   1.00 42.13  ? 1394 ALA A CB  1 
ATOM   647  N N   . TYR A 1 96  ? 22.494  51.130 2.643   1.00 38.76  ? 1395 TYR A N   1 
ATOM   648  C CA  . TYR A 1 96  ? 23.047  49.798 2.512   1.00 39.42  ? 1395 TYR A CA  1 
ATOM   649  C C   . TYR A 1 96  ? 23.622  49.482 1.114   1.00 45.12  ? 1395 TYR A C   1 
ATOM   650  O O   . TYR A 1 96  ? 24.529  48.646 0.955   1.00 42.41  ? 1395 TYR A O   1 
ATOM   651  C CB  . TYR A 1 96  ? 21.999  48.767 2.923   1.00 35.86  ? 1395 TYR A CB  1 
ATOM   652  C CG  . TYR A 1 96  ? 22.588  47.391 3.037   1.00 41.09  ? 1395 TYR A CG  1 
ATOM   653  C CD1 . TYR A 1 96  ? 22.447  46.480 2.012   1.00 42.32  ? 1395 TYR A CD1 1 
ATOM   654  C CD2 . TYR A 1 96  ? 23.349  47.026 4.135   1.00 37.38  ? 1395 TYR A CD2 1 
ATOM   655  C CE1 . TYR A 1 96  ? 23.021  45.231 2.094   1.00 50.13  ? 1395 TYR A CE1 1 
ATOM   656  C CE2 . TYR A 1 96  ? 23.940  45.800 4.203   1.00 44.97  ? 1395 TYR A CE2 1 
ATOM   657  C CZ  . TYR A 1 96  ? 23.757  44.903 3.182   1.00 43.07  ? 1395 TYR A CZ  1 
ATOM   658  O OH  . TYR A 1 96  ? 24.325  43.677 3.240   1.00 49.17  ? 1395 TYR A OH  1 
ATOM   659  N N   . THR A 1 97  ? 23.091  50.138 0.100   1.00 47.63  ? 1396 THR A N   1 
ATOM   660  C CA  . THR A 1 97  ? 23.493  49.888 -1.280  1.00 44.80  ? 1396 THR A CA  1 
ATOM   661  C C   . THR A 1 97  ? 23.780  51.268 -1.872  1.00 50.39  ? 1396 THR A C   1 
ATOM   662  O O   . THR A 1 97  ? 22.931  51.836 -2.552  1.00 50.83  ? 1396 THR A O   1 
ATOM   663  C CB  . THR A 1 97  ? 22.385  49.174 -2.091  1.00 47.94  ? 1396 THR A CB  1 
ATOM   664  O OG1 . THR A 1 97  ? 21.947  47.985 -1.408  1.00 44.78  ? 1396 THR A OG1 1 
ATOM   665  C CG2 . THR A 1 97  ? 22.883  48.815 -3.497  1.00 47.65  ? 1396 THR A CG2 1 
ATOM   666  N N   . PRO A 1 98  ? 24.953  51.842 -1.554  1.00 46.55  ? 1397 PRO A N   1 
ATOM   667  C CA  . PRO A 1 98  ? 25.223  53.246 -1.955  1.00 53.14  ? 1397 PRO A CA  1 
ATOM   668  C C   . PRO A 1 98  ? 25.715  53.455 -3.378  1.00 54.40  ? 1397 PRO A C   1 
ATOM   669  O O   . PRO A 1 98  ? 25.725  54.600 -3.824  1.00 56.20  ? 1397 PRO A O   1 
ATOM   670  C CB  . PRO A 1 98  ? 26.319  53.703 -0.969  1.00 46.39  ? 1397 PRO A CB  1 
ATOM   671  C CG  . PRO A 1 98  ? 27.046  52.419 -0.598  1.00 53.84  ? 1397 PRO A CG  1 
ATOM   672  C CD  . PRO A 1 98  ? 25.967  51.314 -0.629  1.00 48.74  ? 1397 PRO A CD  1 
ATOM   673  N N   . SER A 1 99  ? 26.137  52.388 -4.068  1.00 53.61  ? 1398 SER A N   1 
ATOM   674  C CA  . SER A 1 99  ? 26.824  52.517 -5.371  1.00 56.27  ? 1398 SER A CA  1 
ATOM   675  C C   . SER A 1 99  ? 25.850  52.816 -6.507  1.00 55.18  ? 1398 SER A C   1 
ATOM   676  O O   . SER A 1 99  ? 24.825  52.153 -6.628  1.00 48.61  ? 1398 SER A O   1 
ATOM   677  C CB  . SER A 1 99  ? 27.595  51.233 -5.710  1.00 62.23  ? 1398 SER A CB  1 
ATOM   678  O OG  . SER A 1 99  ? 28.425  51.382 -6.862  1.00 56.20  ? 1398 SER A OG  1 
ATOM   679  N N   . LYS A 1 100 ? 26.180  53.805 -7.336  1.00 54.51  ? 1399 LYS A N   1 
ATOM   680  C CA  . LYS A 1 100 ? 25.357  54.131 -8.493  1.00 56.57  ? 1399 LYS A CA  1 
ATOM   681  C C   . LYS A 1 100 ? 25.414  52.988 -9.510  1.00 56.46  ? 1399 LYS A C   1 
ATOM   682  O O   . LYS A 1 100 ? 24.481  52.786 -10.278 1.00 59.84  ? 1399 LYS A O   1 
ATOM   683  C CB  . LYS A 1 100 ? 25.785  55.460 -9.138  1.00 55.18  ? 1399 LYS A CB  1 
ATOM   684  C CG  . LYS A 1 100 ? 25.893  56.585 -8.139  1.00 67.82  ? 1399 LYS A CG  1 
ATOM   685  C CD  . LYS A 1 100 ? 25.596  57.975 -8.708  1.00 88.54  ? 1399 LYS A CD  1 
ATOM   686  C CE  . LYS A 1 100 ? 25.616  59.025 -7.565  1.00 101.32 ? 1399 LYS A CE  1 
ATOM   687  N NZ  . LYS A 1 100 ? 25.794  60.434 -8.029  1.00 89.51  ? 1399 LYS A NZ  1 
ATOM   688  N N   . ARG A 1 101 ? 26.507  52.236 -9.506  1.00 53.64  ? 1400 ARG A N   1 
ATOM   689  C CA  . ARG A 1 101 ? 26.646  51.080 -10.381 1.00 54.32  ? 1400 ARG A CA  1 
ATOM   690  C C   . ARG A 1 101 ? 25.604  50.019 -10.107 1.00 49.55  ? 1400 ARG A C   1 
ATOM   691  O O   . ARG A 1 101 ? 25.301  49.244 -10.984 1.00 52.79  ? 1400 ARG A O   1 
ATOM   692  C CB  . ARG A 1 101 ? 28.050  50.466 -10.255 1.00 59.86  ? 1400 ARG A CB  1 
ATOM   693  C CG  . ARG A 1 101 ? 29.156  51.350 -10.861 1.00 75.39  ? 1400 ARG A CG  1 
ATOM   694  C CD  . ARG A 1 101 ? 30.572  51.076 -10.310 1.00 96.08  ? 1400 ARG A CD  1 
ATOM   695  N NE  . ARG A 1 101 ? 31.118  49.742 -10.607 1.00 107.75 ? 1400 ARG A NE  1 
ATOM   696  C CZ  . ARG A 1 101 ? 31.442  49.277 -11.822 1.00 118.52 ? 1400 ARG A CZ  1 
ATOM   697  N NH1 . ARG A 1 101 ? 31.240  50.019 -12.919 1.00 106.88 ? 1400 ARG A NH1 1 
ATOM   698  N NH2 . ARG A 1 101 ? 31.956  48.042 -11.949 1.00 91.63  ? 1400 ARG A NH2 1 
ATOM   699  N N   . SER A 1 102 ? 25.059  49.969 -8.904  1.00 49.02  ? 1401 SER A N   1 
ATOM   700  C CA  . SER A 1 102 ? 24.173  48.863 -8.533  1.00 47.89  ? 1401 SER A CA  1 
ATOM   701  C C   . SER A 1 102 ? 22.784  49.017 -9.096  1.00 50.65  ? 1401 SER A C   1 
ATOM   702  O O   . SER A 1 102 ? 22.168  50.085 -8.991  1.00 54.53  ? 1401 SER A O   1 
ATOM   703  C CB  . SER A 1 102 ? 23.998  48.762 -7.030  1.00 43.96  ? 1401 SER A CB  1 
ATOM   704  O OG  . SER A 1 102 ? 23.081  47.712 -6.732  1.00 45.76  ? 1401 SER A OG  1 
ATOM   705  N N   . ARG A 1 103 ? 22.263  47.929 -9.634  1.00 49.08  ? 1402 ARG A N   1 
ATOM   706  C CA  . ARG A 1 103 ? 20.916  47.942 -10.194 1.00 50.09  ? 1402 ARG A CA  1 
ATOM   707  C C   . ARG A 1 103 ? 19.891  48.167 -9.134  1.00 47.28  ? 1402 ARG A C   1 
ATOM   708  O O   . ARG A 1 103 ? 18.840  48.731 -9.424  1.00 61.40  ? 1402 ARG A O   1 
ATOM   709  C CB  . ARG A 1 103 ? 20.612  46.653 -10.952 1.00 49.57  ? 1402 ARG A CB  1 
ATOM   710  C CG  . ARG A 1 103 ? 20.626  45.433 -10.101 1.00 61.44  ? 1402 ARG A CG  1 
ATOM   711  C CD  . ARG A 1 103 ? 20.334  44.236 -10.905 1.00 52.99  ? 1402 ARG A CD  1 
ATOM   712  N NE  . ARG A 1 103 ? 21.443  43.926 -11.781 1.00 61.81  ? 1402 ARG A NE  1 
ATOM   713  C CZ  . ARG A 1 103 ? 21.527  42.813 -12.500 1.00 78.84  ? 1402 ARG A CZ  1 
ATOM   714  N NH1 . ARG A 1 103 ? 20.556  41.899 -12.448 1.00 87.26  ? 1402 ARG A NH1 1 
ATOM   715  N NH2 . ARG A 1 103 ? 22.590  42.614 -13.265 1.00 60.33  ? 1402 ARG A NH2 1 
ATOM   716  N N   . ILE A 1 104 ? 20.194  47.750 -7.900  1.00 47.68  ? 1403 ILE A N   1 
ATOM   717  C CA  . ILE A 1 104 ? 19.270  47.968 -6.780  1.00 41.38  ? 1403 ILE A CA  1 
ATOM   718  C C   . ILE A 1 104 ? 19.168  49.469 -6.467  1.00 41.94  ? 1403 ILE A C   1 
ATOM   719  O O   . ILE A 1 104 ? 18.094  49.986 -6.209  1.00 44.19  ? 1403 ILE A O   1 
ATOM   720  C CB  . ILE A 1 104 ? 19.670  47.168 -5.529  1.00 51.84  ? 1403 ILE A CB  1 
ATOM   721  C CG1 . ILE A 1 104 ? 19.767  45.647 -5.829  1.00 49.47  ? 1403 ILE A CG1 1 
ATOM   722  C CG2 . ILE A 1 104 ? 18.690  47.421 -4.407  1.00 43.30  ? 1403 ILE A CG2 1 
ATOM   723  C CD1 . ILE A 1 104 ? 18.483  45.010 -6.222  1.00 43.99  ? 1403 ILE A CD1 1 
ATOM   724  N N   . TYR A 1 105 ? 20.275  50.189 -6.546  1.00 43.11  ? 1404 TYR A N   1 
ATOM   725  C CA  . TYR A 1 105 ? 20.248  51.642 -6.358  1.00 44.57  ? 1404 TYR A CA  1 
ATOM   726  C C   . TYR A 1 105 ? 19.243  52.276 -7.306  1.00 47.72  ? 1404 TYR A C   1 
ATOM   727  O O   . TYR A 1 105 ? 18.407  53.050 -6.860  1.00 56.34  ? 1404 TYR A O   1 
ATOM   728  C CB  . TYR A 1 105 ? 21.646  52.232 -6.602  1.00 48.23  ? 1404 TYR A CB  1 
ATOM   729  C CG  . TYR A 1 105 ? 21.818  53.738 -6.450  1.00 50.30  ? 1404 TYR A CG  1 
ATOM   730  C CD1 . TYR A 1 105 ? 21.532  54.619 -7.502  1.00 51.83  ? 1404 TYR A CD1 1 
ATOM   731  C CD2 . TYR A 1 105 ? 22.354  54.278 -5.279  1.00 52.93  ? 1404 TYR A CD2 1 
ATOM   732  C CE1 . TYR A 1 105 ? 21.737  56.028 -7.355  1.00 65.97  ? 1404 TYR A CE1 1 
ATOM   733  C CE2 . TYR A 1 105 ? 22.575  55.658 -5.128  1.00 57.52  ? 1404 TYR A CE2 1 
ATOM   734  C CZ  . TYR A 1 105 ? 22.263  56.524 -6.163  1.00 66.59  ? 1404 TYR A CZ  1 
ATOM   735  O OH  . TYR A 1 105 ? 22.494  57.862 -5.975  1.00 76.53  ? 1404 TYR A OH  1 
ATOM   736  N N   . SER A 1 106 ? 19.331  51.949 -8.602  1.00 47.96  ? 1405 SER A N   1 
ATOM   737  C CA  . SER A 1 106 ? 18.448  52.541 -9.626  1.00 46.70  ? 1405 SER A CA  1 
ATOM   738  C C   . SER A 1 106 ? 16.997  52.211 -9.374  1.00 47.59  ? 1405 SER A C   1 
ATOM   739  O O   . SER A 1 106 ? 16.133  53.090 -9.537  1.00 48.58  ? 1405 SER A O   1 
ATOM   740  C CB  . SER A 1 106 ? 18.784  52.061 -11.049 1.00 45.56  ? 1405 SER A CB  1 
ATOM   741  O OG  . SER A 1 106 ? 20.171  51.910 -11.250 1.00 61.64  ? 1405 SER A OG  1 
ATOM   742  N N   . MET A 1 107 ? 16.729  50.942 -9.037  1.00 40.76  ? 1406 MET A N   1 
ATOM   743  C CA  . MET A 1 107 ? 15.355  50.487 -8.763  1.00 38.31  ? 1406 MET A CA  1 
ATOM   744  C C   . MET A 1 107 ? 14.737  51.302 -7.626  1.00 35.65  ? 1406 MET A C   1 
ATOM   745  O O   . MET A 1 107 ? 13.592  51.767 -7.687  1.00 46.43  ? 1406 MET A O   1 
ATOM   746  C CB  . MET A 1 107 ? 15.309  49.001 -8.359  1.00 30.67  ? 1406 MET A CB  1 
ATOM   747  C CG  . MET A 1 107 ? 15.748  47.992 -9.371  1.00 51.02  ? 1406 MET A CG  1 
ATOM   748  S SD  . MET A 1 107 ? 15.624  46.287 -8.749  1.00 56.44  ? 1406 MET A SD  1 
ATOM   749  C CE  A MET A 1 107 ? 14.063  46.431 -7.926  0.50 36.01  ? 1406 MET A CE  1 
ATOM   750  C CE  B MET A 1 107 ? 16.407  45.372 -10.074 0.50 79.30  ? 1406 MET A CE  1 
ATOM   751  N N   . SER A 1 108 ? 15.503  51.451 -6.575  1.00 32.76  ? 1407 SER A N   1 
ATOM   752  C CA  . SER A 1 108 ? 15.096  52.207 -5.435  1.00 39.66  ? 1407 SER A CA  1 
ATOM   753  C C   . SER A 1 108 ? 14.818  53.666 -5.808  1.00 38.87  ? 1407 SER A C   1 
ATOM   754  O O   . SER A 1 108 ? 13.844  54.259 -5.339  1.00 40.20  ? 1407 SER A O   1 
ATOM   755  C CB  . SER A 1 108 ? 16.187  52.122 -4.356  1.00 43.72  ? 1407 SER A CB  1 
ATOM   756  O OG  . SER A 1 108 ? 15.913  53.006 -3.274  1.00 59.47  ? 1407 SER A OG  1 
ATOM   757  N N   . LEU A 1 109 ? 15.684  54.266 -6.610  1.00 42.48  ? 1408 LEU A N   1 
ATOM   758  C CA  . LEU A 1 109 ? 15.460  55.653 -7.010  1.00 49.48  ? 1408 LEU A CA  1 
ATOM   759  C C   . LEU A 1 109 ? 14.184  55.783 -7.821  1.00 42.70  ? 1408 LEU A C   1 
ATOM   760  O O   . LEU A 1 109 ? 13.438  56.724 -7.628  1.00 44.67  ? 1408 LEU A O   1 
ATOM   761  C CB  . LEU A 1 109 ? 16.656  56.240 -7.776  1.00 51.41  ? 1408 LEU A CB  1 
ATOM   762  C CG  . LEU A 1 109 ? 17.713  57.004 -6.960  1.00 68.51  ? 1408 LEU A CG  1 
ATOM   763  C CD1 . LEU A 1 109 ? 18.701  57.714 -7.892  1.00 56.09  ? 1408 LEU A CD1 1 
ATOM   764  C CD2 . LEU A 1 109 ? 17.092  58.013 -5.969  1.00 77.64  ? 1408 LEU A CD2 1 
ATOM   765  N N   . ARG A 1 110 ? 13.921  54.832 -8.714  1.00 46.89  ? 1409 ARG A N   1 
ATOM   766  C CA  . ARG A 1 110 ? 12.755  54.925 -9.591  1.00 45.48  ? 1409 ARG A CA  1 
ATOM   767  C C   . ARG A 1 110 ? 11.510  54.813 -8.784  1.00 42.35  ? 1409 ARG A C   1 
ATOM   768  O O   . ARG A 1 110 ? 10.549  55.553 -8.981  1.00 51.00  ? 1409 ARG A O   1 
ATOM   769  C CB  . ARG A 1 110 ? 12.752  53.826 -10.648 1.00 45.92  ? 1409 ARG A CB  1 
ATOM   770  C CG  . ARG A 1 110 ? 13.692  54.115 -11.761 1.00 44.12  ? 1409 ARG A CG  1 
ATOM   771  C CD  . ARG A 1 110 ? 13.581  53.140 -12.935 1.00 44.63  ? 1409 ARG A CD  1 
ATOM   772  N NE  . ARG A 1 110 ? 13.817  51.765 -12.520 1.00 42.12  ? 1409 ARG A NE  1 
ATOM   773  C CZ  . ARG A 1 110 ? 14.976  51.134 -12.607 1.00 46.28  ? 1409 ARG A CZ  1 
ATOM   774  N NH1 . ARG A 1 110 ? 15.067  49.873 -12.201 1.00 49.19  ? 1409 ARG A NH1 1 
ATOM   775  N NH2 . ARG A 1 110 ? 16.039  51.746 -13.094 1.00 56.93  ? 1409 ARG A NH2 1 
ATOM   776  N N   . LEU A 1 111 ? 11.525  53.857 -7.882  1.00 43.03  ? 1410 LEU A N   1 
ATOM   777  C CA  . LEU A 1 111 ? 10.353  53.586 -7.056  1.00 44.94  ? 1410 LEU A CA  1 
ATOM   778  C C   . LEU A 1 111 ? 10.130  54.727 -6.097  1.00 42.06  ? 1410 LEU A C   1 
ATOM   779  O O   . LEU A 1 111 ? 8.990   55.072 -5.791  1.00 40.97  ? 1410 LEU A O   1 
ATOM   780  C CB  . LEU A 1 111 ? 10.568  52.301 -6.297  1.00 38.78  ? 1410 LEU A CB  1 
ATOM   781  C CG  . LEU A 1 111 ? 9.398   51.560 -5.698  1.00 45.53  ? 1410 LEU A CG  1 
ATOM   782  C CD1 . LEU A 1 111 ? 8.454   51.091 -6.758  1.00 42.23  ? 1410 LEU A CD1 1 
ATOM   783  C CD2 . LEU A 1 111 ? 10.020  50.407 -4.945  1.00 36.53  ? 1410 LEU A CD2 1 
ATOM   784  N N   . SER A 1 112 ? 11.217  55.323 -5.608  1.00 39.05  ? 1411 SER A N   1 
ATOM   785  C CA  . SER A 1 112 ? 11.087  56.489 -4.735  1.00 40.99  ? 1411 SER A CA  1 
ATOM   786  C C   . SER A 1 112 ? 10.446  57.622 -5.486  1.00 39.75  ? 1411 SER A C   1 
ATOM   787  O O   . SER A 1 112 ? 9.488   58.196 -4.993  1.00 43.08  ? 1411 SER A O   1 
ATOM   788  C CB  . SER A 1 112 ? 12.426  56.958 -4.189  1.00 46.00  ? 1411 SER A CB  1 
ATOM   789  O OG  . SER A 1 112 ? 12.236  58.149 -3.435  1.00 42.20  ? 1411 SER A OG  1 
ATOM   790  N N   . ALA A 1 113 ? 10.961  57.911 -6.688  1.00 38.56  ? 1412 ALA A N   1 
ATOM   791  C CA  . ALA A 1 113 ? 10.443  59.021 -7.521  1.00 45.14  ? 1412 ALA A CA  1 
ATOM   792  C C   . ALA A 1 113 ? 8.957   58.852 -7.736  1.00 44.30  ? 1412 ALA A C   1 
ATOM   793  O O   . ALA A 1 113 ? 8.206   59.810 -7.679  1.00 43.96  ? 1412 ALA A O   1 
ATOM   794  C CB  . ALA A 1 113 ? 11.190  59.123 -8.867  1.00 37.55  ? 1412 ALA A CB  1 
ATOM   795  N N   . PHE A 1 114 ? 8.551   57.611 -7.945  1.00 38.12  ? 1413 PHE A N   1 
ATOM   796  C CA  . PHE A 1 114 ? 7.164   57.248 -8.185  1.00 41.17  ? 1413 PHE A CA  1 
ATOM   797  C C   . PHE A 1 114 ? 6.334   57.432 -6.951  1.00 40.41  ? 1413 PHE A C   1 
ATOM   798  O O   . PHE A 1 114 ? 5.266   58.015 -7.003  1.00 40.82  ? 1413 PHE A O   1 
ATOM   799  C CB  . PHE A 1 114 ? 7.099   55.753 -8.551  1.00 44.81  ? 1413 PHE A CB  1 
ATOM   800  C CG  . PHE A 1 114 ? 5.734   55.279 -8.942  1.00 31.23  ? 1413 PHE A CG  1 
ATOM   801  C CD1 . PHE A 1 114 ? 5.223   55.579 -10.190 1.00 40.17  ? 1413 PHE A CD1 1 
ATOM   802  C CD2 . PHE A 1 114 ? 4.968   54.531 -8.069  1.00 41.94  ? 1413 PHE A CD2 1 
ATOM   803  C CE1 . PHE A 1 114 ? 3.946   55.137 -10.563 1.00 41.32  ? 1413 PHE A CE1 1 
ATOM   804  C CE2 . PHE A 1 114 ? 3.698   54.092 -8.428  1.00 29.15  ? 1413 PHE A CE2 1 
ATOM   805  C CZ  . PHE A 1 114 ? 3.202   54.387 -9.689  1.00 35.06  ? 1413 PHE A CZ  1 
ATOM   806  N N   . PHE A 1 115 ? 6.793   56.863 -5.845  1.00 38.38  ? 1414 PHE A N   1 
ATOM   807  C CA  . PHE A 1 115 ? 6.176   57.153 -4.573  1.00 32.90  ? 1414 PHE A CA  1 
ATOM   808  C C   . PHE A 1 115 ? 5.972   58.663 -4.345  1.00 39.37  ? 1414 PHE A C   1 
ATOM   809  O O   . PHE A 1 115 ? 4.862   59.134 -4.084  1.00 43.51  ? 1414 PHE A O   1 
ATOM   810  C CB  . PHE A 1 115 ? 6.989   56.562 -3.439  1.00 36.33  ? 1414 PHE A CB  1 
ATOM   811  C CG  . PHE A 1 115 ? 6.375   56.847 -2.096  1.00 35.99  ? 1414 PHE A CG  1 
ATOM   812  C CD1 . PHE A 1 115 ? 5.216   56.214 -1.721  1.00 40.94  ? 1414 PHE A CD1 1 
ATOM   813  C CD2 . PHE A 1 115 ? 6.885   57.820 -1.280  1.00 41.83  ? 1414 PHE A CD2 1 
ATOM   814  C CE1 . PHE A 1 115 ? 4.616   56.511 -0.529  1.00 39.87  ? 1414 PHE A CE1 1 
ATOM   815  C CE2 . PHE A 1 115 ? 6.280   58.117 -0.096  1.00 37.07  ? 1414 PHE A CE2 1 
ATOM   816  C CZ  . PHE A 1 115 ? 5.154   57.460 0.276   1.00 49.01  ? 1414 PHE A CZ  1 
ATOM   817  N N   . GLU A 1 116 ? 7.041   59.436 -4.446  1.00 36.73  ? 1415 GLU A N   1 
ATOM   818  C CA  . GLU A 1 116 ? 6.938   60.844 -4.107  1.00 38.20  ? 1415 GLU A CA  1 
ATOM   819  C C   . GLU A 1 116 ? 5.990   61.559 -5.038  1.00 37.90  ? 1415 GLU A C   1 
ATOM   820  O O   . GLU A 1 116 ? 5.316   62.466 -4.602  1.00 51.70  ? 1415 GLU A O   1 
ATOM   821  C CB  . GLU A 1 116 ? 8.304   61.528 -4.167  1.00 41.02  ? 1415 GLU A CB  1 
ATOM   822  C CG  . GLU A 1 116 ? 9.340   60.967 -3.196  1.00 47.50  ? 1415 GLU A CG  1 
ATOM   823  C CD  . GLU A 1 116 ? 8.996   61.237 -1.740  1.00 54.15  ? 1415 GLU A CD  1 
ATOM   824  O OE1 . GLU A 1 116 ? 8.231   62.185 -1.439  1.00 51.81  ? 1415 GLU A OE1 1 
ATOM   825  O OE2 . GLU A 1 116 ? 9.495   60.479 -0.895  1.00 44.56  ? 1415 GLU A OE2 1 
ATOM   826  N N   . GLU A 1 117 ? 5.961   61.191 -6.319  1.00 54.79  ? 1416 GLU A N   1 
ATOM   827  C CA  . GLU A 1 117 ? 5.026   61.791 -7.276  1.00 59.76  ? 1416 GLU A CA  1 
ATOM   828  C C   . GLU A 1 117 ? 3.589   61.641 -6.821  1.00 50.81  ? 1416 GLU A C   1 
ATOM   829  O O   . GLU A 1 117 ? 2.789   62.519 -7.053  1.00 63.82  ? 1416 GLU A O   1 
ATOM   830  C CB  . GLU A 1 117 ? 5.087   61.133 -8.667  1.00 62.57  ? 1416 GLU A CB  1 
ATOM   831  C CG  . GLU A 1 117 ? 6.153   61.561 -9.603  1.00 89.00  ? 1416 GLU A CG  1 
ATOM   832  C CD  . GLU A 1 117 ? 6.185   60.690 -10.883 1.00 108.10 ? 1416 GLU A CD  1 
ATOM   833  O OE1 . GLU A 1 117 ? 7.243   60.685 -11.556 1.00 97.05  ? 1416 GLU A OE1 1 
ATOM   834  O OE2 . GLU A 1 117 ? 5.162   60.015 -11.205 1.00 98.74  ? 1416 GLU A OE2 1 
ATOM   835  N N   . HIS A 1 118 ? 3.234   60.516 -6.216  1.00 49.40  ? 1417 HIS A N   1 
ATOM   836  C CA  . HIS A 1 118 ? 1.846   60.269 -5.918  1.00 46.05  ? 1417 HIS A CA  1 
ATOM   837  C C   . HIS A 1 118 ? 1.527   60.667 -4.493  1.00 49.95  ? 1417 HIS A C   1 
ATOM   838  O O   . HIS A 1 118 ? 0.403   61.040 -4.201  1.00 44.99  ? 1417 HIS A O   1 
ATOM   839  C CB  . HIS A 1 118 ? 1.429   58.804 -6.264  1.00 50.34  ? 1417 HIS A CB  1 
ATOM   840  C CG  . HIS A 1 118 ? 1.427   58.524 -7.737  1.00 42.96  ? 1417 HIS A CG  1 
ATOM   841  N ND1 . HIS A 1 118 ? 2.535   58.035 -8.393  1.00 56.16  ? 1417 HIS A ND1 1 
ATOM   842  C CD2 . HIS A 1 118 ? 0.526   58.819 -8.699  1.00 55.42  ? 1417 HIS A CD2 1 
ATOM   843  C CE1 . HIS A 1 118 ? 2.294   57.985 -9.689  1.00 68.02  ? 1417 HIS A CE1 1 
ATOM   844  N NE2 . HIS A 1 118 ? 1.082   58.459 -9.903  1.00 64.99  ? 1417 HIS A NE2 1 
ATOM   845  N N   . ILE A 1 119 ? 2.491   60.627 -3.598  1.00 45.45  ? 1418 ILE A N   1 
ATOM   846  C CA  . ILE A 1 119 ? 2.154   60.969 -2.221  1.00 48.21  ? 1418 ILE A CA  1 
ATOM   847  C C   . ILE A 1 119 ? 1.919   62.486 -1.995  1.00 53.35  ? 1418 ILE A C   1 
ATOM   848  O O   . ILE A 1 119 ? 1.036   62.858 -1.230  1.00 63.25  ? 1418 ILE A O   1 
ATOM   849  C CB  . ILE A 1 119 ? 3.167   60.398 -1.259  1.00 47.12  ? 1418 ILE A CB  1 
ATOM   850  C CG1 . ILE A 1 119 ? 2.546   60.210 0.139   1.00 50.35  ? 1418 ILE A CG1 1 
ATOM   851  C CG2 . ILE A 1 119 ? 4.446   61.254 -1.220  1.00 34.56  ? 1418 ILE A CG2 1 
ATOM   852  C CD1 . ILE A 1 119 ? 1.382   59.223 0.224   1.00 44.80  ? 1418 ILE A CD1 1 
ATOM   853  N N   . SER A 1 120 ? 2.659   63.345 -2.687  1.00 54.20  ? 1419 SER A N   1 
ATOM   854  C CA  . SER A 1 120 ? 2.355   64.795 -2.754  1.00 60.89  ? 1419 SER A CA  1 
ATOM   855  C C   . SER A 1 120 ? 0.888   65.130 -2.681  1.00 54.74  ? 1419 SER A C   1 
ATOM   856  O O   . SER A 1 120 ? 0.469   65.888 -1.828  1.00 61.69  ? 1419 SER A O   1 
ATOM   857  C CB  . SER A 1 120 ? 2.860   65.425 -4.045  1.00 58.28  ? 1419 SER A CB  1 
ATOM   858  O OG  . SER A 1 120 ? 4.221   65.156 -4.228  1.00 83.55  ? 1419 SER A OG  1 
ATOM   859  N N   . SER A 1 121 ? 0.125   64.586 -3.608  1.00 55.26  ? 1420 SER A N   1 
ATOM   860  C CA  . SER A 1 121 ? -1.281  64.924 -3.737  1.00 58.09  ? 1420 SER A CA  1 
ATOM   861  C C   . SER A 1 121 ? -2.041  64.395 -2.568  1.00 56.06  ? 1420 SER A C   1 
ATOM   862  O O   . SER A 1 121 ? -3.072  64.960 -2.172  1.00 72.54  ? 1420 SER A O   1 
ATOM   863  C CB  . SER A 1 121 ? -1.851  64.322 -5.022  1.00 58.55  ? 1420 SER A CB  1 
ATOM   864  O OG  . SER A 1 121 ? -0.859  64.371 -6.038  1.00 73.03  ? 1420 SER A OG  1 
ATOM   865  N N   . VAL A 1 122 ? -1.570  63.274 -2.038  1.00 48.40  ? 1421 VAL A N   1 
ATOM   866  C CA  . VAL A 1 122 ? -2.275  62.615 -0.993  1.00 52.83  ? 1421 VAL A CA  1 
ATOM   867  C C   . VAL A 1 122 ? -2.159  63.503 0.217   1.00 54.97  ? 1421 VAL A C   1 
ATOM   868  O O   . VAL A 1 122 ? -3.116  63.668 0.972   1.00 52.50  ? 1421 VAL A O   1 
ATOM   869  C CB  . VAL A 1 122 ? -1.714  61.212 -0.671  1.00 52.70  ? 1421 VAL A CB  1 
ATOM   870  C CG1 . VAL A 1 122 ? -2.416  60.654 0.549   1.00 51.97  ? 1421 VAL A CG1 1 
ATOM   871  C CG2 . VAL A 1 122 ? -1.958  60.273 -1.811  1.00 54.11  ? 1421 VAL A CG2 1 
ATOM   872  N N   . LEU A 1 123 ? -0.971  64.058 0.401   1.00 48.73  ? 1422 LEU A N   1 
ATOM   873  C CA  . LEU A 1 123 ? -0.709  64.918 1.533   1.00 50.91  ? 1422 LEU A CA  1 
ATOM   874  C C   . LEU A 1 123 ? -1.373  66.289 1.348   1.00 50.10  ? 1422 LEU A C   1 
ATOM   875  O O   . LEU A 1 123 ? -1.979  66.784 2.278   1.00 56.05  ? 1422 LEU A O   1 
ATOM   876  C CB  . LEU A 1 123 ? 0.795   65.096 1.734   1.00 41.23  ? 1422 LEU A CB  1 
ATOM   877  C CG  . LEU A 1 123 ? 1.598   63.889 2.149   1.00 42.59  ? 1422 LEU A CG  1 
ATOM   878  C CD1 . LEU A 1 123 ? 3.084   64.270 2.107   1.00 32.64  ? 1422 LEU A CD1 1 
ATOM   879  C CD2 . LEU A 1 123 ? 1.204   63.423 3.563   1.00 44.19  ? 1422 LEU A CD2 1 
ATOM   880  N N   . SER A 1 124 ? -1.220  66.892 0.178   1.00 52.80  ? 1423 SER A N   1 
ATOM   881  C CA  . SER A 1 124 ? -1.829  68.195 -0.126  1.00 57.76  ? 1423 SER A CA  1 
ATOM   882  C C   . SER A 1 124 ? -3.328  68.131 0.074   1.00 61.14  ? 1423 SER A C   1 
ATOM   883  O O   . SER A 1 124 ? -3.907  69.073 0.614   1.00 74.10  ? 1423 SER A O   1 
ATOM   884  C CB  . SER A 1 124 ? -1.461  68.677 -1.535  1.00 64.52  ? 1423 SER A CB  1 
ATOM   885  O OG  A SER A 1 124 ? -0.064  68.487 -1.521  0.50 71.47  ? 1423 SER A OG  1 
ATOM   886  O OG  B SER A 1 124 ? -2.678  69.120 -2.135  0.50 61.05  ? 1423 SER A OG  1 
ATOM   887  N N   . ASP A 1 125 ? -3.954  67.025 -0.319  1.00 61.06  ? 1424 ASP A N   1 
ATOM   888  C CA  . ASP A 1 125 ? -5.409  66.879 -0.165  1.00 68.70  ? 1424 ASP A CA  1 
ATOM   889  C C   . ASP A 1 125 ? -5.786  66.673 1.285   1.00 71.60  ? 1424 ASP A C   1 
ATOM   890  O O   . ASP A 1 125 ? -6.893  67.036 1.685   1.00 77.54  ? 1424 ASP A O   1 
ATOM   891  C CB  . ASP A 1 125 ? -5.953  65.701 -0.965  1.00 73.52  ? 1424 ASP A CB  1 
ATOM   892  C CG  . ASP A 1 125 ? -5.908  65.928 -2.465  1.00 83.86  ? 1424 ASP A CG  1 
ATOM   893  O OD1 . ASP A 1 125 ? -5.394  66.966 -2.951  1.00 78.20  ? 1424 ASP A OD1 1 
ATOM   894  O OD2 . ASP A 1 125 ? -6.401  65.031 -3.163  1.00 73.04  ? 1424 ASP A OD2 1 
ATOM   895  N N   . TYR A 1 126 ? -4.877  66.063 2.052   1.00 65.36  ? 1425 TYR A N   1 
ATOM   896  C CA  . TYR A 1 126 ? -5.074  65.878 3.486   1.00 62.14  ? 1425 TYR A CA  1 
ATOM   897  C C   . TYR A 1 126 ? -4.991  67.212 4.231   1.00 67.07  ? 1425 TYR A C   1 
ATOM   898  O O   . TYR A 1 126 ? -5.947  67.566 4.935   1.00 69.08  ? 1425 TYR A O   1 
ATOM   899  C CB  . TYR A 1 126 ? -4.077  64.885 4.043   1.00 56.62  ? 1425 TYR A CB  1 
ATOM   900  C CG  . TYR A 1 126 ? -4.103  64.737 5.554   1.00 54.86  ? 1425 TYR A CG  1 
ATOM   901  C CD1 . TYR A 1 126 ? -5.166  64.117 6.205   1.00 65.23  ? 1425 TYR A CD1 1 
ATOM   902  C CD2 . TYR A 1 126 ? -3.036  65.187 6.328   1.00 55.65  ? 1425 TYR A CD2 1 
ATOM   903  C CE1 . TYR A 1 126 ? -5.187  63.992 7.602   1.00 65.03  ? 1425 TYR A CE1 1 
ATOM   904  C CE2 . TYR A 1 126 ? -3.029  65.040 7.717   1.00 56.42  ? 1425 TYR A CE2 1 
ATOM   905  C CZ  . TYR A 1 126 ? -4.109  64.459 8.354   1.00 73.86  ? 1425 TYR A CZ  1 
ATOM   906  O OH  . TYR A 1 126 ? -4.080  64.335 9.740   1.00 76.00  ? 1425 TYR A OH  1 
ATOM   907  N N   . LYS A 1 127 ? -3.882  67.949 4.048   1.00 61.77  ? 1426 LYS A N   1 
ATOM   908  C CA  . LYS A 1 127 ? -3.661  69.265 4.693   1.00 65.42  ? 1426 LYS A CA  1 
ATOM   909  C C   . LYS A 1 127 ? -4.808  70.213 4.439   1.00 70.82  ? 1426 LYS A C   1 
ATOM   910  O O   . LYS A 1 127 ? -5.232  70.921 5.339   1.00 79.42  ? 1426 LYS A O   1 
ATOM   911  C CB  . LYS A 1 127 ? -2.384  69.985 4.217   1.00 60.38  ? 1426 LYS A CB  1 
ATOM   912  C CG  . LYS A 1 127 ? -1.049  69.263 4.477   1.00 81.93  ? 1426 LYS A CG  1 
ATOM   913  C CD  . LYS A 1 127 ? -0.533  69.353 5.909   1.00 94.31  ? 1426 LYS A CD  1 
ATOM   914  C CE  . LYS A 1 127 ? 0.821   68.639 6.020   1.00 93.28  ? 1426 LYS A CE  1 
ATOM   915  N NZ  . LYS A 1 127 ? 1.351   68.674 7.396   1.00 89.74  ? 1426 LYS A NZ  1 
ATOM   916  N N   . SER A 1 128 ? -5.293  70.249 3.212   1.00 74.76  ? 1427 SER A N   1 
ATOM   917  C CA  . SER A 1 128 ? -6.361  71.163 2.888   1.00 84.37  ? 1427 SER A CA  1 
ATOM   918  C C   . SER A 1 128 ? -7.720  70.619 3.359   1.00 87.82  ? 1427 SER A C   1 
ATOM   919  O O   . SER A 1 128 ? -8.601  71.413 3.723   1.00 100.40 ? 1427 SER A O   1 
ATOM   920  C CB  . SER A 1 128 ? -6.350  71.542 1.393   1.00 89.88  ? 1427 SER A CB  1 
ATOM   921  O OG  . SER A 1 128 ? -6.955  70.547 0.607   1.00 100.23 ? 1427 SER A OG  1 
ATOM   922  N N   . ALA A 1 129 ? -7.896  69.296 3.389   1.00 82.45  ? 1428 ALA A N   1 
ATOM   923  C CA  . ALA A 1 129 ? -9.126  68.714 3.958   1.00 90.82  ? 1428 ALA A CA  1 
ATOM   924  C C   . ALA A 1 129 ? -9.222  69.035 5.450   1.00 93.12  ? 1428 ALA A C   1 
ATOM   925  O O   . ALA A 1 129 ? -10.330 69.162 5.989   1.00 100.95 ? 1428 ALA A O   1 
ATOM   926  C CB  . ALA A 1 129 ? -9.205  67.216 3.731   1.00 93.73  ? 1428 ALA A CB  1 
ATOM   927  N N   . LEU A 1 130 ? -8.065  69.204 6.097   1.00 83.98  ? 1429 LEU A N   1 
ATOM   928  C CA  . LEU A 1 130 ? -7.997  69.767 7.445   1.00 86.68  ? 1429 LEU A CA  1 
ATOM   929  C C   . LEU A 1 130 ? -8.456  71.248 7.563   1.00 95.19  ? 1429 LEU A C   1 
ATOM   930  O O   . LEU A 1 130 ? -8.487  71.783 8.667   1.00 100.69 ? 1429 LEU A O   1 
ATOM   931  C CB  . LEU A 1 130 ? -6.582  69.638 8.017   1.00 81.27  ? 1429 LEU A CB  1 
ATOM   932  C CG  . LEU A 1 130 ? -5.942  68.261 8.234   1.00 90.71  ? 1429 LEU A CG  1 
ATOM   933  C CD1 . LEU A 1 130 ? -4.775  68.344 9.268   1.00 78.24  ? 1429 LEU A CD1 1 
ATOM   934  C CD2 . LEU A 1 130 ? -6.976  67.193 8.632   1.00 81.27  ? 1429 LEU A CD2 1 
ATOM   935  N N   . ARG A 1 131 ? -8.801  71.904 6.457   1.00 96.98  ? 1430 ARG A N   1 
ATOM   936  C CA  . ARG A 1 131 ? -9.383  73.242 6.496   1.00 105.52 ? 1430 ARG A CA  1 
ATOM   937  C C   . ARG A 1 131 ? -10.750 73.238 5.765   1.00 116.59 ? 1430 ARG A C   1 
ATOM   938  O O   . ARG A 1 131 ? -10.837 73.678 4.617   1.00 125.72 ? 1430 ARG A O   1 
ATOM   939  C CB  . ARG A 1 131 ? -8.395  74.241 5.858   1.00 99.31  ? 1430 ARG A CB  1 
ATOM   940  N N   . PHE A 1 132 ? -11.815 72.727 6.396   1.00 122.31 ? 1431 PHE A N   1 
ATOM   941  C CA  . PHE A 1 132 ? -13.179 72.878 5.816   1.00 134.72 ? 1431 PHE A CA  1 
ATOM   942  C C   . PHE A 1 132 ? -14.299 72.833 6.870   1.00 144.07 ? 1431 PHE A C   1 
ATOM   943  O O   . PHE A 1 132 ? -14.197 72.119 7.875   1.00 142.41 ? 1431 PHE A O   1 
ATOM   944  C CB  . PHE A 1 132 ? -13.436 71.846 4.703   1.00 129.40 ? 1431 PHE A CB  1 
HETATM 945  C CAA . MB3 B 2 .   ? 19.900  44.541 -1.809  1.00 91.51  ? 1    MB3 A CAA 1 
HETATM 946  O OAB . MB3 B 2 .   ? 18.783  46.402 0.397   1.00 86.62  ? 1    MB3 A OAB 1 
HETATM 947  C CAC . MB3 B 2 .   ? 16.646  43.608 -0.074  1.00 62.47  ? 1    MB3 A CAC 1 
HETATM 948  C CAD . MB3 B 2 .   ? 17.159  44.697 0.870   1.00 68.01  ? 1    MB3 A CAD 1 
HETATM 949  C CAE . MB3 B 2 .   ? 17.919  43.176 -0.783  1.00 93.65  ? 1    MB3 A CAE 1 
HETATM 950  C CAF . MB3 B 2 .   ? 18.335  45.283 0.118   1.00 78.09  ? 1    MB3 A CAF 1 
HETATM 951  N NAG . MB3 B 2 .   ? 18.752  44.400 -0.819  1.00 103.80 ? 1    MB3 A NAG 1 
HETATM 952  O O   . HOH C 3 .   ? 0.650   56.661 13.583  1.00 55.52  ? 2    HOH A O   1 
HETATM 953  O O   . HOH C 3 .   ? -3.573  53.574 9.651   1.00 49.52  ? 3    HOH A O   1 
HETATM 954  O O   . HOH C 3 .   ? 26.209  49.412 -3.124  1.00 47.12  ? 4    HOH A O   1 
HETATM 955  O O   . HOH C 3 .   ? 5.095   63.442 5.902   1.00 48.46  ? 5    HOH A O   1 
HETATM 956  O O   . HOH C 3 .   ? 20.133  52.044 -2.882  1.00 42.02  ? 6    HOH A O   1 
HETATM 957  O O   . HOH C 3 .   ? 11.766  58.335 7.152   1.00 37.52  ? 8    HOH A O   1 
HETATM 958  O O   . HOH C 3 .   ? 11.117  58.640 -0.992  1.00 55.58  ? 9    HOH A O   1 
HETATM 959  O O   . HOH C 3 .   ? 12.875  60.228 -4.809  1.00 54.99  ? 10   HOH A O   1 
HETATM 960  O O   . HOH C 3 .   ? 4.169   41.927 -6.178  1.00 62.91  ? 11   HOH A O   1 
HETATM 961  O O   . HOH C 3 .   ? 17.611  55.071 6.809   1.00 46.69  ? 12   HOH A O   1 
HETATM 962  O O   . HOH C 3 .   ? 2.162   48.694 -10.606 1.00 48.61  ? 14   HOH A O   1 
HETATM 963  O O   . HOH C 3 .   ? -5.519  62.656 0.885   1.00 47.14  ? 15   HOH A O   1 
HETATM 964  O O   . HOH C 3 .   ? 17.533  52.643 9.822   1.00 42.92  ? 16   HOH A O   1 
HETATM 965  O O   . HOH C 3 .   ? -5.596  46.577 -0.851  1.00 58.59  ? 17   HOH A O   1 
HETATM 966  O O   . HOH C 3 .   ? 14.363  58.092 6.106   1.00 51.73  ? 18   HOH A O   1 
HETATM 967  O O   . HOH C 3 .   ? -9.809  56.238 2.932   1.00 57.02  ? 21   HOH A O   1 
HETATM 968  O O   . HOH C 3 .   ? 2.306   67.630 -0.869  1.00 58.84  ? 22   HOH A O   1 
HETATM 969  O O   . HOH C 3 .   ? 6.005   40.208 6.379   1.00 54.95  ? 23   HOH A O   1 
HETATM 970  O O   . HOH C 3 .   ? 11.734  45.613 7.299   1.00 59.12  ? 24   HOH A O   1 
HETATM 971  O O   . HOH C 3 .   ? 14.958  48.008 5.308   1.00 55.50  ? 25   HOH A O   1 
HETATM 972  O O   . HOH C 3 .   ? 13.564  44.531 2.296   1.00 43.48  ? 27   HOH A O   1 
HETATM 973  O O   . HOH C 3 .   ? 11.554  41.400 -0.140  1.00 55.00  ? 28   HOH A O   1 
HETATM 974  O O   . HOH C 3 .   ? 15.227  49.243 2.331   1.00 37.93  ? 29   HOH A O   1 
HETATM 975  O O   . HOH C 3 .   ? -4.701  63.009 -3.050  1.00 76.28  ? 30   HOH A O   1 
HETATM 976  O O   . HOH C 3 .   ? -6.150  52.940 8.121   1.00 51.48  ? 31   HOH A O   1 
HETATM 977  O O   . HOH C 3 .   ? 19.003  54.564 -4.040  1.00 51.54  ? 32   HOH A O   1 
HETATM 978  O O   . HOH C 3 .   ? 10.932  60.900 6.905   1.00 47.48  ? 33   HOH A O   1 
HETATM 979  O O   . HOH C 3 .   ? 13.372  47.154 2.334   1.00 38.17  ? 34   HOH A O   1 
HETATM 980  O O   . HOH C 3 .   ? 20.558  56.893 3.506   1.00 47.98  ? 35   HOH A O   1 
HETATM 981  O O   . HOH C 3 .   ? 6.612   64.167 12.749  1.00 64.93  ? 36   HOH A O   1 
HETATM 982  O O   . HOH C 3 .   ? -7.766  60.558 9.339   1.00 72.44  ? 37   HOH A O   1 
HETATM 983  O O   . HOH C 3 .   ? 13.926  58.717 1.715   1.00 45.29  ? 38   HOH A O   1 
HETATM 984  O O   . HOH C 3 .   ? -2.144  65.729 11.250  1.00 68.69  ? 39   HOH A O   1 
HETATM 985  O O   . HOH C 3 .   ? 11.766  62.197 -5.653  1.00 65.13  ? 40   HOH A O   1 
HETATM 986  O O   . HOH C 3 .   ? 22.505  45.398 -2.695  1.00 52.72  ? 41   HOH A O   1 
HETATM 987  O O   . HOH C 3 .   ? -5.295  53.194 -7.870  1.00 63.26  ? 42   HOH A O   1 
HETATM 988  O O   . HOH C 3 .   ? 9.873   62.500 -7.574  1.00 52.04  ? 43   HOH A O   1 
HETATM 989  O O   . HOH C 3 .   ? -1.968  59.738 -5.419  1.00 68.12  ? 44   HOH A O   1 
HETATM 990  O O   . HOH C 3 .   ? 16.288  57.830 -2.171  1.00 49.52  ? 45   HOH A O   1 
HETATM 991  O O   . HOH C 3 .   ? -4.247  61.093 -5.115  1.00 70.51  ? 46   HOH A O   1 
HETATM 992  O O   . HOH C 3 .   ? 17.729  48.626 -12.158 1.00 48.17  ? 47   HOH A O   1 
HETATM 993  O O   . HOH C 3 .   ? 14.615  60.284 4.170   1.00 57.28  ? 48   HOH A O   1 
HETATM 994  O O   . HOH C 3 .   ? 13.921  45.068 6.067   1.00 56.37  ? 49   HOH A O   1 
HETATM 995  O O   . HOH C 3 .   ? 9.518   55.997 -11.867 1.00 53.62  ? 50   HOH A O   1 
HETATM 996  O O   . HOH C 3 .   ? 1.000   43.333 4.281   1.00 62.62  ? 52   HOH A O   1 
HETATM 997  O O   . HOH C 3 .   ? 20.231  53.578 9.950   1.00 53.01  ? 53   HOH A O   1 
HETATM 998  O O   . HOH C 3 .   ? 14.374  59.061 -6.680  1.00 49.95  ? 54   HOH A O   1 
HETATM 999  O O   . HOH C 3 .   ? -3.159  56.811 -5.310  1.00 58.45  ? 55   HOH A O   1 
HETATM 1000 O O   . HOH C 3 .   ? 5.830   42.496 7.478   1.00 51.16  ? 58   HOH A O   1 
HETATM 1001 O O   . HOH C 3 .   ? -6.096  55.965 11.664  1.00 67.77  ? 59   HOH A O   1 
HETATM 1002 O O   . HOH C 3 .   ? 5.810   55.981 11.461  1.00 59.12  ? 60   HOH A O   1 
HETATM 1003 O O   . HOH C 3 .   ? 22.624  41.959 10.490  1.00 54.36  ? 62   HOH A O   1 
HETATM 1004 O O   . HOH C 3 .   ? -5.396  61.880 10.762  1.00 67.99  ? 64   HOH A O   1 
HETATM 1005 O O   . HOH C 3 .   ? 8.281   58.003 -12.114 1.00 70.58  ? 65   HOH A O   1 
HETATM 1006 O O   . HOH C 3 .   ? -4.069  50.571 -6.948  1.00 59.02  ? 66   HOH A O   1 
HETATM 1007 O O   . HOH C 3 .   ? 8.412   52.790 12.553  1.00 57.96  ? 67   HOH A O   1 
HETATM 1008 O O   . HOH C 3 .   ? 11.685  57.702 9.959   1.00 52.74  ? 70   HOH A O   1 
HETATM 1009 O O   . HOH C 3 .   ? 16.683  58.401 0.735   1.00 53.32  ? 73   HOH A O   1 
HETATM 1010 O O   . HOH C 3 .   ? 5.369   53.232 12.717  1.00 69.29  ? 74   HOH A O   1 
HETATM 1011 O O   . HOH C 3 .   ? 2.032   42.032 -11.396 1.00 62.24  ? 75   HOH A O   1 
HETATM 1012 O O   . HOH C 3 .   ? 0.483   44.764 -12.139 1.00 75.23  ? 76   HOH A O   1 
HETATM 1013 O O   . HOH C 3 .   ? -4.058  51.238 -11.486 1.00 57.44  ? 77   HOH A O   1 
HETATM 1014 O O   . HOH C 3 .   ? -11.852 57.017 0.959   1.00 73.65  ? 80   HOH A O   1 
HETATM 1015 O O   . HOH C 3 .   ? 17.671  41.891 -3.257  1.00 76.55  ? 90   HOH A O   1 
HETATM 1016 O O   . HOH C 3 .   ? 16.282  40.433 1.857   1.00 67.91  ? 99   HOH A O   1 
HETATM 1017 O O   . HOH C 3 .   ? 18.803  58.987 2.174   1.00 58.25  ? 101  HOH A O   1 
HETATM 1018 O O   . HOH C 3 .   ? 18.868  49.972 -14.041 1.00 66.74  ? 102  HOH A O   1 
HETATM 1019 O O   . HOH C 3 .   ? -8.280  53.555 10.130  1.00 73.53  ? 104  HOH A O   1 
HETATM 1020 O O   . HOH C 3 .   ? -13.615 62.562 7.384   1.00 78.53  ? 105  HOH A O   1 
HETATM 1021 O O   . HOH C 3 .   ? 13.116  62.543 5.217   1.00 58.94  ? 106  HOH A O   1 
HETATM 1022 O O   . HOH C 3 .   ? -5.453  49.011 -5.580  1.00 60.37  ? 110  HOH A O   1 
HETATM 1023 O O   . HOH C 3 .   ? 24.843  57.223 -2.838  1.00 66.12  ? 111  HOH A O   1 
HETATM 1024 O O   . HOH C 3 .   ? 16.755  55.272 -2.633  1.00 53.25  ? 123  HOH A O   1 
HETATM 1025 O O   . HOH C 3 .   ? 25.137  46.620 -0.633  1.00 54.98  ? 124  HOH A O   1 
HETATM 1026 O O   . HOH C 3 .   ? 9.493   55.907 10.319  1.00 65.46  ? 150  HOH A O   1 
HETATM 1027 O O   . HOH C 3 .   ? 17.638  48.254 2.332   1.00 41.67  ? 151  HOH A O   1 
HETATM 1028 O O   . HOH C 3 .   ? 19.348  48.436 -0.797  1.00 44.47  ? 152  HOH A O   1 
HETATM 1029 O O   . HOH C 3 .   ? 2.157   62.858 11.681  1.00 54.63  ? 153  HOH A O   1 
HETATM 1030 O O   . HOH C 3 .   ? 26.828  48.035 2.817   1.00 42.41  ? 155  HOH A O   1 
HETATM 1031 O O   . HOH C 3 .   ? -1.220  56.974 -7.128  1.00 63.58  ? 156  HOH A O   1 
HETATM 1032 O O   . HOH C 3 .   ? 27.522  45.722 3.616   1.00 54.83  ? 157  HOH A O   1 
HETATM 1033 O O   . HOH C 3 .   ? 12.280  44.648 -14.227 1.00 67.17  ? 159  HOH A O   1 
HETATM 1034 O O   . HOH C 3 .   ? 2.063   42.276 1.985   1.00 65.56  ? 160  HOH A O   1 
HETATM 1035 O O   . HOH C 3 .   ? 7.589   38.008 7.273   1.00 30.00  ? 161  HOH A O   1 
HETATM 1036 O O   . HOH C 3 .   ? 9.305   48.284 -12.246 1.00 44.96  ? 1435 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . TYR A 17  ? 1.1062 1.5556 1.3616 0.7297  -0.0070 -0.0125 1316 TYR A N   
2    C CA  . TYR A 17  ? 1.1533 1.6338 1.4165 0.6432  0.0016  -0.0013 1316 TYR A CA  
3    C C   . TYR A 17  ? 1.1837 1.7020 1.4518 0.6139  0.0445  -0.0198 1316 TYR A C   
4    O O   . TYR A 17  ? 1.2149 1.7077 1.4599 0.6526  0.0679  -0.0433 1316 TYR A O   
5    C CB  . TYR A 17  ? 1.1428 1.4900 1.3336 0.5981  -0.0197 0.0153  1316 TYR A CB  
6    N N   . ASP A 18  ? 1.1341 1.7056 1.4263 0.5441  0.0523  -0.0085 1317 ASP A N   
7    C CA  . ASP A 18  ? 1.0248 1.6724 1.3429 0.5076  0.0883  -0.0157 1317 ASP A CA  
8    C C   . ASP A 18  ? 0.9971 1.5380 1.2437 0.4734  0.1054  -0.0219 1317 ASP A C   
9    O O   . ASP A 18  ? 1.0046 1.4518 1.2061 0.4367  0.0883  -0.0109 1317 ASP A O   
10   C CB  . ASP A 18  ? 0.9594 1.7006 1.3351 0.4473  0.0802  0.0033  1317 ASP A CB  
11   C CG  . ASP A 18  ? 0.9537 1.7844 1.3641 0.4039  0.1134  0.0034  1317 ASP A CG  
12   O OD1 . ASP A 18  ? 0.9523 1.8387 1.3743 0.4335  0.1438  -0.0111 1317 ASP A OD1 
13   O OD2 . ASP A 18  ? 0.5529 1.3985 0.9779 0.3395  0.1084  0.0187  1317 ASP A OD2 
14   N N   . ILE A 19  ? 0.9575 1.5220 1.1947 0.4849  0.1390  -0.0398 1318 ILE A N   
15   C CA  . ILE A 19  ? 0.9462 1.4250 1.1172 0.4537  0.1559  -0.0468 1318 ILE A CA  
16   C C   . ILE A 19  ? 0.8051 1.3043 0.9843 0.3780  0.1612  -0.0266 1318 ILE A C   
17   O O   . ILE A 19  ? 0.6133 1.0313 0.7389 0.3452  0.1635  -0.0249 1318 ILE A O   
18   C CB  . ILE A 19  ? 1.0899 1.5995 1.2462 0.4902  0.1914  -0.0742 1318 ILE A CB  
19   C CG1 . ILE A 19  ? 1.2580 1.6309 1.3263 0.5033  0.1924  -0.0940 1318 ILE A CG1 
20   C CG2 . ILE A 19  ? 1.1809 1.7924 1.3657 0.4454  0.2232  -0.0672 1318 ILE A CG2 
21   C CD1 . ILE A 19  ? 1.4022 1.8010 1.4474 0.5385  0.2269  -0.1260 1318 ILE A CD1 
22   N N   . GLN A 20  ? 0.7812 1.3888 1.0281 0.3514  0.1616  -0.0115 1319 GLN A N   
23   C CA  . GLN A 20  ? 0.7258 1.3488 0.9849 0.2818  0.1627  0.0084  1319 GLN A CA  
24   C C   . GLN A 20  ? 0.6634 1.2342 0.9205 0.2531  0.1291  0.0218  1319 GLN A C   
25   O O   . GLN A 20  ? 0.7326 1.2744 0.9801 0.2018  0.1253  0.0338  1319 GLN A O   
26   C CB  . GLN A 20  ? 0.7564 1.5206 1.0889 0.2600  0.1787  0.0181  1319 GLN A CB  
27   C CG  . GLN A 20  ? 0.8448 1.6948 1.1918 0.2870  0.2152  0.0056  1319 GLN A CG  
28   C CD  . GLN A 20  ? 0.8665 1.7049 1.1790 0.2451  0.2416  0.0131  1319 GLN A CD  
29   O OE1 . GLN A 20  ? 0.6312 1.3619 0.8810 0.2292  0.2367  0.0136  1319 GLN A OE1 
30   N NE2 . GLN A 20  ? 0.8455 1.8012 1.1992 0.2255  0.2690  0.0209  1319 GLN A NE2 
31   N N   . ALA A 21  ? 0.6084 1.1682 0.8729 0.2885  0.1043  0.0195  1320 ALA A N   
32   C CA  . ALA A 21  ? 0.5539 1.0945 0.8257 0.2645  0.0727  0.0314  1320 ALA A CA  
33   C C   . ALA A 21  ? 0.4861 0.9313 0.7078 0.2212  0.0652  0.0369  1320 ALA A C   
34   O O   . ALA A 21  ? 0.5439 0.9956 0.7803 0.1851  0.0486  0.0449  1320 ALA A O   
35   C CB  . ALA A 21  ? 0.4951 1.0133 0.7604 0.3143  0.0465  0.0301  1320 ALA A CB  
36   N N   . TRP A 22  ? 0.5751 0.9372 0.7391 0.2256  0.0771  0.0305  1321 TRP A N   
37   C CA  . TRP A 22  ? 0.4711 0.7455 0.5862 0.1892  0.0704  0.0347  1321 TRP A CA  
38   C C   . TRP A 22  ? 0.4505 0.7458 0.5832 0.1384  0.0768  0.0437  1321 TRP A C   
39   O O   . TRP A 22  ? 0.4466 0.6850 0.5520 0.1102  0.0670  0.0471  1321 TRP A O   
40   C CB  . TRP A 22  ? 0.5272 0.7252 0.5826 0.2028  0.0831  0.0251  1321 TRP A CB  
41   C CG  . TRP A 22  ? 0.6298 0.8638 0.6873 0.2006  0.1125  0.0196  1321 TRP A CG  
42   C CD1 . TRP A 22  ? 0.7100 0.9897 0.7788 0.2376  0.1315  0.0071  1321 TRP A CD1 
43   C CD2 . TRP A 22  ? 0.6604 0.8903 0.7056 0.1611  0.1257  0.0269  1321 TRP A CD2 
44   N NE1 . TRP A 22  ? 0.5932 0.9027 0.6557 0.2199  0.1572  0.0064  1321 TRP A NE1 
45   C CE2 . TRP A 22  ? 0.5633 0.8398 0.6103 0.1724  0.1527  0.0207  1321 TRP A CE2 
46   C CE3 . TRP A 22  ? 0.5900 0.7831 0.6223 0.1202  0.1167  0.0381  1321 TRP A CE3 
47   C CZ2 . TRP A 22  ? 0.5256 0.8106 0.5582 0.1408  0.1694  0.0294  1321 TRP A CZ2 
48   C CZ3 . TRP A 22  ? 0.6027 0.8011 0.6249 0.0934  0.1318  0.0461  1321 TRP A CZ3 
49   C CH2 . TRP A 22  ? 0.5901 0.8320 0.6100 0.1021  0.1571  0.0436  1321 TRP A CH2 
50   N N   . LYS A 23  ? 0.4500 0.8264 0.6273 0.1275  0.0934  0.0480  1322 LYS A N   
51   C CA  . LYS A 23  ? 0.5004 0.8915 0.6933 0.0792  0.0993  0.0597  1322 LYS A CA  
52   C C   . LYS A 23  ? 0.4700 0.8676 0.6900 0.0501  0.0751  0.0638  1322 LYS A C   
53   O O   . LYS A 23  ? 0.3939 0.7360 0.5929 0.0216  0.0665  0.0664  1322 LYS A O   
54   C CB  . LYS A 23  ? 0.4992 0.9763 0.7275 0.0712  0.1255  0.0662  1322 LYS A CB  
55   C CG  . LYS A 23  ? 0.5210 0.9815 0.7086 0.0919  0.1517  0.0602  1322 LYS A CG  
56   C CD  . LYS A 23  ? 0.4950 1.0546 0.7156 0.0890  0.1806  0.0649  1322 LYS A CD  
57   C CE  . LYS A 23  ? 0.5185 1.0617 0.6916 0.1078  0.2062  0.0561  1322 LYS A CE  
58   N NZ  . LYS A 23  ? 0.3359 0.9874 0.5389 0.1233  0.2367  0.0521  1322 LYS A NZ  
59   N N   . LYS A 24  ? 0.5329 0.9994 0.7980 0.0596  0.0633  0.0624  1323 LYS A N   
60   C CA  . LYS A 24  ? 0.5714 1.0467 0.8580 0.0336  0.0372  0.0621  1323 LYS A CA  
61   C C   . LYS A 24  ? 0.5343 0.9291 0.7734 0.0428  0.0174  0.0556  1323 LYS A C   
62   O O   . LYS A 24  ? 0.5829 0.9424 0.8112 0.0131  0.0048  0.0528  1323 LYS A O   
63   C CB  . LYS A 24  ? 0.6045 1.1786 0.9482 0.0438  0.0252  0.0618  1323 LYS A CB  
64   C CG  . LYS A 24  ? 0.8694 1.5204 1.2696 -0.0051 0.0252  0.0685  1323 LYS A CG  
65   C CD  . LYS A 24  ? 0.8808 1.4806 1.2708 -0.0532 0.0054  0.0658  1323 LYS A CD  
66   N N   . GLN A 25  ? 0.5202 0.8841 0.7285 0.0836  0.0151  0.0527  1324 GLN A N   
67   C CA  . GLN A 25  ? 0.4446 0.7340 0.6032 0.0893  -0.0015 0.0502  1324 GLN A CA  
68   C C   . GLN A 25  ? 0.4892 0.7149 0.6133 0.0597  0.0040  0.0484  1324 GLN A C   
69   O O   . GLN A 25  ? 0.5702 0.7670 0.6765 0.0435  -0.0109 0.0446  1324 GLN A O   
70   C CB  . GLN A 25  ? 0.5124 0.7615 0.6356 0.1324  -0.0002 0.0501  1324 GLN A CB  
71   C CG  . GLN A 25  ? 0.5253 0.8297 0.6792 0.1718  -0.0119 0.0522  1324 GLN A CG  
72   C CD  . GLN A 25  ? 0.5153 0.7721 0.6354 0.2205  -0.0093 0.0506  1324 GLN A CD  
73   O OE1 . GLN A 25  ? 0.7381 0.9211 0.8104 0.2221  0.0026  0.0463  1324 GLN A OE1 
74   N NE2 . GLN A 25  ? 0.6589 0.9573 0.8039 0.2611  -0.0224 0.0531  1324 GLN A NE2 
75   N N   . CYS A 26  ? 0.4636 0.6741 0.5787 0.0545  0.0255  0.0505  1325 CYS A N   
76   C CA  . CYS A 26  ? 0.4164 0.5751 0.5038 0.0303  0.0304  0.0508  1325 CYS A CA  
77   C C   . CYS A 26  ? 0.3801 0.5550 0.4970 -0.0044 0.0255  0.0523  1325 CYS A C   
78   O O   . CYS A 26  ? 0.4893 0.6229 0.5883 -0.0199 0.0182  0.0480  1325 CYS A O   
79   C CB  . CYS A 26  ? 0.4422 0.5848 0.5088 0.0365  0.0522  0.0542  1325 CYS A CB  
80   S SG  . CYS A 26  ? 0.5516 0.6421 0.5659 0.0704  0.0555  0.0472  1325 CYS A SG  
81   N N   . GLU A 27  ? 0.3373 0.5719 0.4994 -0.0174 0.0292  0.0577  1326 GLU A N   
82   C CA  . GLU A 27  ? 0.3961 0.6371 0.5843 -0.0549 0.0217  0.0591  1326 GLU A CA  
83   C C   . GLU A 27  ? 0.4024 0.6245 0.5847 -0.0613 -0.0028 0.0446  1326 GLU A C   
84   O O   . GLU A 27  ? 0.4738 0.6497 0.6413 -0.0787 -0.0099 0.0376  1326 GLU A O   
85   C CB  . GLU A 27  ? 0.4175 0.7377 0.6581 -0.0716 0.0282  0.0681  1326 GLU A CB  
86   C CG  . GLU A 27  ? 0.6615 0.9818 0.9276 -0.1191 0.0232  0.0743  1326 GLU A CG  
87   C CD  . GLU A 27  ? 1.1894 1.4847 1.4446 -0.1379 0.0424  0.0926  1326 GLU A CD  
88   O OE1 . GLU A 27  ? 1.1758 1.5328 1.4584 -0.1505 0.0594  0.1075  1326 GLU A OE1 
89   O OE2 . GLU A 27  ? 0.8321 1.0525 1.0513 -0.1391 0.0403  0.0930  1326 GLU A OE2 
90   N N   . GLU A 28  ? 0.3472 0.6052 0.5373 -0.0431 -0.0156 0.0399  1327 GLU A N   
91   C CA  . GLU A 28  ? 0.3720 0.6225 0.5510 -0.0469 -0.0390 0.0271  1327 GLU A CA  
92   C C   . GLU A 28  ? 0.4233 0.6081 0.5504 -0.0391 -0.0411 0.0198  1327 GLU A C   
93   O O   . GLU A 28  ? 0.5710 0.7359 0.6865 -0.0546 -0.0532 0.0060  1327 GLU A O   
94   C CB  . GLU A 28  ? 0.4051 0.7101 0.5991 -0.0237 -0.0526 0.0294  1327 GLU A CB  
95   C CG  . GLU A 28  ? 0.7098 1.1018 0.9652 -0.0378 -0.0568 0.0326  1327 GLU A CG  
96   C CD  . GLU A 28  ? 0.7963 1.2551 1.0747 -0.0045 -0.0676 0.0380  1327 GLU A CD  
97   O OE1 . GLU A 28  ? 0.8441 1.2721 1.0872 0.0298  -0.0741 0.0407  1327 GLU A OE1 
98   O OE2 . GLU A 28  ? 0.7288 1.2725 1.0618 -0.0134 -0.0704 0.0408  1327 GLU A OE2 
99   N N   . LEU A 29  ? 0.4279 0.5822 0.5240 -0.0169 -0.0293 0.0271  1328 LEU A N   
100  C CA  . LEU A 29  ? 0.4885 0.5915 0.5379 -0.0138 -0.0310 0.0219  1328 LEU A CA  
101  C C   . LEU A 29  ? 0.5172 0.5893 0.5632 -0.0323 -0.0245 0.0152  1328 LEU A C   
102  O O   . LEU A 29  ? 0.6029 0.6551 0.6292 -0.0384 -0.0317 0.0029  1328 LEU A O   
103  C CB  . LEU A 29  ? 0.3875 0.4616 0.4045 0.0077  -0.0210 0.0312  1328 LEU A CB  
104  C CG  . LEU A 29  ? 0.5781 0.6049 0.5481 0.0059  -0.0197 0.0296  1328 LEU A CG  
105  C CD1 . LEU A 29  ? 0.4379 0.4654 0.3869 0.0004  -0.0356 0.0240  1328 LEU A CD1 
106  C CD2 . LEU A 29  ? 0.4419 0.4390 0.3828 0.0246  -0.0123 0.0387  1328 LEU A CD2 
107  N N   . LEU A 30  ? 0.5402 0.6110 0.6045 -0.0394 -0.0112 0.0237  1329 LEU A N   
108  C CA  . LEU A 30  ? 0.5180 0.5566 0.5824 -0.0549 -0.0080 0.0214  1329 LEU A CA  
109  C C   . LEU A 30  ? 0.4616 0.4984 0.5451 -0.0746 -0.0227 0.0073  1329 LEU A C   
110  O O   . LEU A 30  ? 0.4808 0.4818 0.5523 -0.0781 -0.0270 -0.0044 1329 LEU A O   
111  C CB  . LEU A 30  ? 0.5029 0.5425 0.5805 -0.0616 0.0074  0.0386  1329 LEU A CB  
112  C CG  . LEU A 30  ? 0.5614 0.5926 0.6124 -0.0445 0.0228  0.0484  1329 LEU A CG  
113  C CD1 . LEU A 30  ? 0.4162 0.4617 0.4794 -0.0528 0.0382  0.0649  1329 LEU A CD1 
114  C CD2 . LEU A 30  ? 0.4149 0.4065 0.4319 -0.0391 0.0214  0.0435  1329 LEU A CD2 
115  N N   . ASN A 31  ? 0.4781 0.5544 0.5920 -0.0870 -0.0313 0.0065  1330 ASN A N   
116  C CA  . ASN A 31  ? 0.5134 0.5843 0.6415 -0.1099 -0.0481 -0.0106 1330 ASN A CA  
117  C C   . ASN A 31  ? 0.5828 0.6424 0.6809 -0.1007 -0.0613 -0.0333 1330 ASN A C   
118  O O   . ASN A 31  ? 0.5593 0.5894 0.6503 -0.1112 -0.0709 -0.0545 1330 ASN A O   
119  C CB  . ASN A 31  ? 0.5908 0.7167 0.7600 -0.1302 -0.0563 -0.0067 1330 ASN A CB  
120  C CG  . ASN A 31  ? 0.7052 0.8480 0.9049 -0.1471 -0.0412 0.0153  1330 ASN A CG  
121  O OD1 . ASN A 31  ? 0.8515 0.9565 1.0385 -0.1461 -0.0271 0.0276  1330 ASN A OD1 
122  N ND2 . ASN A 31  ? 0.8265 1.0342 1.0665 -0.1636 -0.0447 0.0212  1330 ASN A ND2 
123  N N   . LEU A 32  ? 0.4595 0.5393 0.5360 -0.0809 -0.0614 -0.0292 1331 LEU A N   
124  C CA  . LEU A 32  ? 0.4986 0.5740 0.5413 -0.0752 -0.0718 -0.0463 1331 LEU A CA  
125  C C   . LEU A 32  ? 0.5146 0.5503 0.5301 -0.0680 -0.0616 -0.0548 1331 LEU A C   
126  O O   . LEU A 32  ? 0.5049 0.5326 0.5024 -0.0696 -0.0677 -0.0774 1331 LEU A O   
127  C CB  . LEU A 32  ? 0.4698 0.5708 0.4922 -0.0585 -0.0762 -0.0340 1331 LEU A CB  
128  C CG  . LEU A 32  ? 0.4938 0.6447 0.5402 -0.0574 -0.0911 -0.0272 1331 LEU A CG  
129  C CD1 . LEU A 32  ? 0.3595 0.5151 0.3780 -0.0341 -0.0943 -0.0110 1331 LEU A CD1 
130  C CD2 . LEU A 32  ? 0.4269 0.6030 0.4788 -0.0760 -0.1120 -0.0474 1331 LEU A CD2 
131  N N   . ILE A 33  ? 0.5326 0.5498 0.5456 -0.0592 -0.0461 -0.0385 1332 ILE A N   
132  C CA  . ILE A 33  ? 0.5257 0.5166 0.5188 -0.0516 -0.0375 -0.0438 1332 ILE A CA  
133  C C   . ILE A 33  ? 0.6078 0.5702 0.6167 -0.0574 -0.0410 -0.0590 1332 ILE A C   
134  O O   . ILE A 33  ? 0.5737 0.5252 0.5693 -0.0502 -0.0429 -0.0795 1332 ILE A O   
135  C CB  . ILE A 33  ? 0.6586 0.6401 0.6448 -0.0433 -0.0230 -0.0223 1332 ILE A CB  
136  C CG1 . ILE A 33  ? 0.5785 0.5712 0.5372 -0.0356 -0.0215 -0.0124 1332 ILE A CG1 
137  C CG2 . ILE A 33  ? 0.6282 0.5889 0.6054 -0.0377 -0.0163 -0.0258 1332 ILE A CG2 
138  C CD1 . ILE A 33  ? 0.5855 0.5673 0.5378 -0.0288 -0.0099 0.0053  1332 ILE A CD1 
139  N N   . PHE A 34  ? 0.5806 0.5308 0.6172 -0.0703 -0.0422 -0.0494 1333 PHE A N   
140  C CA  . PHE A 34  ? 0.6983 0.6067 0.7462 -0.0774 -0.0480 -0.0603 1333 PHE A CA  
141  C C   . PHE A 34  ? 0.6955 0.5941 0.7362 -0.0808 -0.0628 -0.0952 1333 PHE A C   
142  O O   . PHE A 34  ? 0.6712 0.5333 0.7037 -0.0701 -0.0657 -0.1153 1333 PHE A O   
143  C CB  . PHE A 34  ? 0.7340 0.6337 0.8113 -0.1000 -0.0484 -0.0411 1333 PHE A CB  
144  C CG  . PHE A 34  ? 0.7867 0.6519 0.8653 -0.0977 -0.0392 -0.0196 1333 PHE A CG  
145  C CD1 . PHE A 34  ? 1.0025 0.8095 1.0793 -0.0963 -0.0470 -0.0269 1333 PHE A CD1 
146  C CD2 . PHE A 34  ? 0.8984 0.7863 0.9769 -0.0952 -0.0245 0.0073  1333 PHE A CD2 
147  C CE1 . PHE A 34  ? 0.8912 0.6653 0.9661 -0.0923 -0.0417 -0.0031 1333 PHE A CE1 
148  C CE2 . PHE A 34  ? 1.0070 0.8667 1.0816 -0.0945 -0.0176 0.0284  1333 PHE A CE2 
149  C CZ  . PHE A 34  ? 0.9348 0.7379 1.0077 -0.0933 -0.0272 0.0253  1333 PHE A CZ  
150  N N   . GLN A 35  ? 0.5612 0.4949 0.6033 -0.0927 -0.0729 -0.1035 1334 GLN A N   
151  C CA  . GLN A 35  ? 0.6151 0.5425 0.6504 -0.1026 -0.0891 -0.1366 1334 GLN A CA  
152  C C   . GLN A 35  ? 0.6299 0.5659 0.6307 -0.0836 -0.0877 -0.1621 1334 GLN A C   
153  O O   . GLN A 35  ? 0.7391 0.6584 0.7288 -0.0856 -0.0980 -0.1960 1334 GLN A O   
154  C CB  . GLN A 35  ? 0.6265 0.5990 0.6752 -0.1228 -0.1027 -0.1354 1334 GLN A CB  
155  C CG  . GLN A 35  ? 0.8430 0.8133 0.9299 -0.1500 -0.1077 -0.1214 1334 GLN A CG  
156  C CD  . GLN A 35  ? 1.0915 1.1296 1.1996 -0.1616 -0.1161 -0.1094 1334 GLN A CD  
157  O OE1 . GLN A 35  ? 1.0716 1.1452 1.1643 -0.1583 -0.1289 -0.1229 1334 GLN A OE1 
158  N NE2 . GLN A 35  ? 1.2653 1.3279 1.4086 -0.1733 -0.1088 -0.0830 1334 GLN A NE2 
159  N N   . CYS A 36  ? 0.6261 0.5886 0.6086 -0.0675 -0.0749 -0.1469 1335 CYS A N   
160  C CA  . CYS A 36  ? 0.6008 0.5824 0.5508 -0.0530 -0.0700 -0.1661 1335 CYS A CA  
161  C C   . CYS A 36  ? 0.6087 0.5672 0.5579 -0.0331 -0.0597 -0.1784 1335 CYS A C   
162  O O   . CYS A 36  ? 0.5800 0.5160 0.5454 -0.0261 -0.0521 -0.1585 1335 CYS A O   
163  C CB  . CYS A 36  ? 0.5925 0.6127 0.5197 -0.0506 -0.0629 -0.1429 1335 CYS A CB  
164  S SG  . CYS A 36  ? 0.6056 0.6232 0.5282 -0.0399 -0.0450 -0.1148 1335 CYS A SG  
165  N N   . GLU A 37  ? 0.6626 0.6356 0.5904 -0.0218 -0.0592 -0.2112 1336 GLU A N   
166  C CA  . GLU A 37  ? 0.6405 0.5978 0.5707 0.0032  -0.0520 -0.2328 1336 GLU A CA  
167  C C   . GLU A 37  ? 0.6532 0.6370 0.5843 0.0160  -0.0367 -0.2103 1336 GLU A C   
168  O O   . GLU A 37  ? 0.6414 0.6086 0.5865 0.0372  -0.0328 -0.2156 1336 GLU A O   
169  C CB  . GLU A 37  ? 0.7519 0.7324 0.6568 0.0141  -0.0528 -0.2770 1336 GLU A CB  
170  C CG  . GLU A 37  ? 1.0371 0.9822 0.9386 0.0011  -0.0712 -0.3083 1336 GLU A CG  
171  C CD  . GLU A 37  ? 1.2420 1.2254 1.1067 0.0026  -0.0736 -0.3493 1336 GLU A CD  
172  O OE1 . GLU A 37  ? 1.1941 1.2247 1.0387 0.0211  -0.0585 -0.3631 1336 GLU A OE1 
173  O OE2 . GLU A 37  ? 1.3631 1.3347 1.2184 -0.0170 -0.0907 -0.3682 1336 GLU A OE2 
174  N N   . ASP A 38  ? 0.5743 0.5956 0.4902 0.0031  -0.0299 -0.1844 1337 ASP A N   
175  C CA  . ASP A 38  ? 0.5523 0.5967 0.4669 0.0086  -0.0171 -0.1632 1337 ASP A CA  
176  C C   . ASP A 38  ? 0.5375 0.5448 0.4763 0.0107  -0.0170 -0.1368 1337 ASP A C   
177  O O   . ASP A 38  ? 0.5144 0.5347 0.4566 0.0189  -0.0093 -0.1246 1337 ASP A O   
178  C CB  . ASP A 38  ? 0.5283 0.6076 0.4146 -0.0095 -0.0125 -0.1421 1337 ASP A CB  
179  C CG  . ASP A 38  ? 0.5949 0.7239 0.4515 -0.0120 -0.0077 -0.1610 1337 ASP A CG  
180  O OD1 . ASP A 38  ? 0.5212 0.6694 0.3805 0.0042  -0.0038 -0.1930 1337 ASP A OD1 
181  O OD2 . ASP A 38  ? 0.6861 0.8353 0.5140 -0.0296 -0.0074 -0.1430 1337 ASP A OD2 
182  N N   . SER A 39  ? 0.4780 0.4463 0.4326 0.0011  -0.0253 -0.1273 1338 SER A N   
183  C CA  . SER A 39  ? 0.5076 0.4469 0.4800 0.0011  -0.0233 -0.1013 1338 SER A CA  
184  C C   . SER A 39  ? 0.4984 0.4000 0.4881 0.0188  -0.0277 -0.1102 1338 SER A C   
185  O O   . SER A 39  ? 0.5900 0.4695 0.5900 0.0213  -0.0268 -0.0876 1338 SER A O   
186  C CB  . SER A 39  ? 0.5072 0.4289 0.4918 -0.0175 -0.0283 -0.0855 1338 SER A CB  
187  O OG  . SER A 39  ? 0.4241 0.3148 0.4227 -0.0229 -0.0399 -0.1040 1338 SER A OG  
188  N N   . GLU A 40  ? 0.5273 0.4187 0.5169 0.0331  -0.0334 -0.1428 1339 GLU A N   
189  C CA  . GLU A 40  ? 0.6879 0.5252 0.6928 0.0518  -0.0417 -0.1515 1339 GLU A CA  
190  C C   . GLU A 40  ? 0.6384 0.4742 0.6527 0.0705  -0.0381 -0.1280 1339 GLU A C   
191  O O   . GLU A 40  ? 0.7185 0.5030 0.7437 0.0714  -0.0454 -0.1096 1339 GLU A O   
192  C CB  . GLU A 40  ? 0.6941 0.5255 0.6935 0.0745  -0.0462 -0.1965 1339 GLU A CB  
193  C CG  . GLU A 40  ? 0.9636 0.7133 0.9724 0.0835  -0.0614 -0.2140 1339 GLU A CG  
194  C CD  . GLU A 40  ? 1.0977 0.8191 1.1173 0.1235  -0.0641 -0.2181 1339 GLU A CD  
195  O OE1 . GLU A 40  ? 0.9232 0.6980 0.9476 0.1420  -0.0541 -0.2050 1339 GLU A OE1 
196  O OE2 . GLU A 40  ? 1.2714 0.9154 1.2947 0.1361  -0.0781 -0.2339 1339 GLU A OE2 
197  N N   . PRO A 41  ? 0.6165 0.5107 0.6253 0.0828  -0.0282 -0.1270 1340 PRO A N   
198  C CA  . PRO A 41  ? 0.6016 0.4973 0.6212 0.1020  -0.0290 -0.1079 1340 PRO A CA  
199  C C   . PRO A 41  ? 0.6599 0.5402 0.6772 0.0815  -0.0279 -0.0679 1340 PRO A C   
200  O O   . PRO A 41  ? 0.7502 0.6144 0.7742 0.0941  -0.0329 -0.0480 1340 PRO A O   
201  C CB  . PRO A 41  ? 0.5925 0.5671 0.6077 0.1124  -0.0185 -0.1178 1340 PRO A CB  
202  C CG  . PRO A 41  ? 0.6126 0.6109 0.6172 0.1120  -0.0143 -0.1523 1340 PRO A CG  
203  C CD  . PRO A 41  ? 0.6376 0.5977 0.6314 0.0824  -0.0183 -0.1453 1340 PRO A CD  
204  N N   . PHE A 42  ? 0.5653 0.4519 0.5721 0.0530  -0.0223 -0.0571 1341 PHE A N   
205  C CA  . PHE A 42  ? 0.5037 0.3899 0.5039 0.0352  -0.0171 -0.0252 1341 PHE A CA  
206  C C   . PHE A 42  ? 0.5283 0.3721 0.5369 0.0167  -0.0202 -0.0100 1341 PHE A C   
207  O O   . PHE A 42  ? 0.5481 0.4006 0.5511 0.0012  -0.0131 0.0108  1341 PHE A O   
208  C CB  . PHE A 42  ? 0.4582 0.3855 0.4399 0.0202  -0.0077 -0.0245 1341 PHE A CB  
209  C CG  . PHE A 42  ? 0.5040 0.4776 0.4766 0.0285  -0.0040 -0.0401 1341 PHE A CG  
210  C CD1 . PHE A 42  ? 0.4716 0.4719 0.4460 0.0395  -0.0032 -0.0339 1341 PHE A CD1 
211  C CD2 . PHE A 42  ? 0.4762 0.4738 0.4382 0.0231  -0.0018 -0.0598 1341 PHE A CD2 
212  C CE1 . PHE A 42  ? 0.5102 0.5658 0.4807 0.0438  0.0012  -0.0479 1341 PHE A CE1 
213  C CE2 . PHE A 42  ? 0.7227 0.7704 0.6754 0.0266  0.0036  -0.0719 1341 PHE A CE2 
214  C CZ  . PHE A 42  ? 0.5692 0.6484 0.5286 0.0363  0.0059  -0.0665 1341 PHE A CZ  
215  N N   . ARG A 43  ? 0.5926 0.3936 0.6140 0.0166  -0.0302 -0.0219 1342 ARG A N   
216  C CA  . ARG A 43  ? 0.6788 0.4508 0.7102 -0.0092 -0.0328 -0.0083 1342 ARG A CA  
217  C C   . ARG A 43  ? 0.7117 0.4482 0.7461 -0.0157 -0.0343 0.0237  1342 ARG A C   
218  O O   . ARG A 43  ? 0.8675 0.5951 0.9097 -0.0416 -0.0324 0.0412  1342 ARG A O   
219  C CB  . ARG A 43  ? 0.5868 0.3223 0.6276 -0.0148 -0.0452 -0.0345 1342 ARG A CB  
220  C CG  . ARG A 43  ? 0.7241 0.4979 0.7595 -0.0187 -0.0446 -0.0614 1342 ARG A CG  
221  C CD  . ARG A 43  ? 0.6681 0.4070 0.7066 -0.0218 -0.0584 -0.0939 1342 ARG A CD  
222  N NE  . ARG A 43  ? 0.6769 0.4600 0.7034 -0.0228 -0.0582 -0.1201 1342 ARG A NE  
223  C CZ  . ARG A 43  ? 0.7813 0.5527 0.8001 -0.0197 -0.0678 -0.1570 1342 ARG A CZ  
224  N NH1 . ARG A 43  ? 0.6249 0.3328 0.6480 -0.0138 -0.0792 -0.1760 1342 ARG A NH1 
225  N NH2 . ARG A 43  ? 0.7136 0.5331 0.7161 -0.0222 -0.0670 -0.1753 1342 ARG A NH2 
226  N N   . GLN A 44  ? 0.6321 0.3524 0.6614 0.0073  -0.0388 0.0319  1343 GLN A N   
227  C CA  . GLN A 44  ? 0.6734 0.3519 0.7008 0.0043  -0.0444 0.0642  1343 GLN A CA  
228  C C   . GLN A 44  ? 0.6955 0.4014 0.7108 0.0262  -0.0430 0.0796  1343 GLN A C   
229  O O   . GLN A 44  ? 0.7008 0.4455 0.7154 0.0472  -0.0416 0.0599  1343 GLN A O   
230  C CB  . GLN A 44  ? 0.6988 0.3013 0.7339 0.0134  -0.0619 0.0564  1343 GLN A CB  
231  C CG  . GLN A 44  ? 0.9637 0.5341 1.0093 -0.0109 -0.0675 0.0354  1343 GLN A CG  
232  C CD  . GLN A 44  ? 1.1414 0.7123 1.1933 -0.0554 -0.0622 0.0620  1343 GLN A CD  
233  O OE1 . GLN A 44  ? 0.9570 0.5163 1.0031 -0.0682 -0.0591 0.0996  1343 GLN A OE1 
234  N NE2 . GLN A 44  ? 0.8356 0.4270 0.8996 -0.0792 -0.0614 0.0425  1343 GLN A NE2 
235  N N   . PRO A 45  ? 0.7512 0.4428 0.7556 0.0182  -0.0436 0.1161  1344 PRO A N   
236  C CA  . PRO A 45  ? 0.7903 0.4995 0.7824 0.0390  -0.0484 0.1337  1344 PRO A CA  
237  C C   . PRO A 45  ? 0.7299 0.4271 0.7348 0.0775  -0.0628 0.1146  1344 PRO A C   
238  O O   . PRO A 45  ? 0.8156 0.4535 0.8310 0.0882  -0.0745 0.1058  1344 PRO A O   
239  C CB  . PRO A 45  ? 0.7418 0.4045 0.7223 0.0260  -0.0548 0.1753  1344 PRO A CB  
240  C CG  . PRO A 45  ? 0.9446 0.5985 0.9280 -0.0104 -0.0438 0.1818  1344 PRO A CG  
241  C CD  . PRO A 45  ? 0.8438 0.4974 0.8474 -0.0119 -0.0430 0.1437  1344 PRO A CD  
242  N N   . VAL A 46  ? 0.7335 0.4878 0.7374 0.0978  -0.0623 0.1074  1345 VAL A N   
243  C CA  . VAL A 46  ? 0.6874 0.4513 0.7083 0.1379  -0.0734 0.0871  1345 VAL A CA  
244  C C   . VAL A 46  ? 0.7689 0.4741 0.7917 0.1629  -0.0931 0.1112  1345 VAL A C   
245  O O   . VAL A 46  ? 0.8886 0.5844 0.8952 0.1538  -0.0981 0.1491  1345 VAL A O   
246  C CB  . VAL A 46  ? 0.5899 0.4417 0.6119 0.1482  -0.0684 0.0780  1345 VAL A CB  
247  C CG1 . VAL A 46  ? 0.7239 0.5963 0.7657 0.1936  -0.0831 0.0719  1345 VAL A CG1 
248  C CG2 . VAL A 46  ? 0.7389 0.6339 0.7629 0.1344  -0.0533 0.0449  1345 VAL A CG2 
249  N N   . ASP A 47  ? 0.8255 0.4870 0.8645 0.1955  -0.1051 0.0894  1346 ASP A N   
250  C CA  . ASP A 47  ? 0.8619 0.4529 0.9014 0.2255  -0.1274 0.1123  1346 ASP A CA  
251  C C   . ASP A 47  ? 0.8264 0.4788 0.8763 0.2669  -0.1375 0.1191  1346 ASP A C   
252  O O   . ASP A 47  ? 0.9180 0.6271 0.9896 0.2981  -0.1350 0.0846  1346 ASP A O   
253  C CB  . ASP A 47  ? 0.9441 0.4575 0.9950 0.2476  -0.1374 0.0806  1346 ASP A CB  
254  C CG  . ASP A 47  ? 1.0542 0.4744 1.1025 0.2800  -0.1628 0.1025  1346 ASP A CG  
255  O OD1 . ASP A 47  ? 0.9821 0.4176 1.0265 0.3006  -0.1746 0.1372  1346 ASP A OD1 
256  O OD2 . ASP A 47  ? 1.3864 0.7137 1.4340 0.2842  -0.1729 0.0855  1346 ASP A OD2 
257  N N   . LEU A 48  ? 0.8204 0.4724 0.8550 0.2661  -0.1487 0.1631  1347 LEU A N   
258  C CA  . LEU A 48  ? 0.9018 0.6230 0.9479 0.3043  -0.1615 0.1713  1347 LEU A CA  
259  C C   . LEU A 48  ? 1.0781 0.7629 1.1478 0.3669  -0.1837 0.1616  1347 LEU A C   
260  O O   . LEU A 48  ? 1.1664 0.9265 1.2593 0.4071  -0.1919 0.1526  1347 LEU A O   
261  C CB  . LEU A 48  ? 0.9299 0.6661 0.9483 0.2859  -0.1696 0.2211  1347 LEU A CB  
262  C CG  . LEU A 48  ? 1.0654 0.8388 1.0567 0.2296  -0.1480 0.2302  1347 LEU A CG  
263  C CD1 . LEU A 48  ? 1.1669 0.9844 1.1326 0.2221  -0.1569 0.2671  1347 LEU A CD1 
264  C CD2 . LEU A 48  ? 0.9139 0.7598 0.9173 0.2136  -0.1268 0.1893  1347 LEU A CD2 
265  N N   . LEU A 49  ? 1.2443 0.8140 1.3086 0.3760  -0.1949 0.1636  1348 LEU A N   
266  C CA  . LEU A 49  ? 1.3583 0.8783 1.4431 0.4399  -0.2157 0.1462  1348 LEU A CA  
267  C C   . LEU A 49  ? 1.2852 0.8783 1.4005 0.4663  -0.2006 0.0856  1348 LEU A C   
268  O O   . LEU A 49  ? 1.2760 0.9306 1.4191 0.5198  -0.2080 0.0684  1348 LEU A O   
269  C CB  . LEU A 49  ? 1.5166 0.8846 1.5841 0.4368  -0.2304 0.1558  1348 LEU A CB  
270  C CG  . LEU A 49  ? 1.6888 0.9667 1.7307 0.4390  -0.2562 0.2168  1348 LEU A CG  
271  C CD1 . LEU A 49  ? 1.4652 0.7690 1.4756 0.3762  -0.2461 0.2676  1348 LEU A CD1 
272  C CD2 . LEU A 49  ? 1.5837 0.7034 1.6136 0.4444  -0.2734 0.2143  1348 LEU A CD2 
273  N N   . GLU A 50  ? 1.2702 0.8684 1.3802 0.4277  -0.1788 0.0550  1349 GLU A N   
274  C CA  . GLU A 50  ? 1.3019 0.9776 1.4337 0.4455  -0.1624 0.0011  1349 GLU A CA  
275  C C   . GLU A 50  ? 1.2100 1.0274 1.3581 0.4464  -0.1515 0.0014  1349 GLU A C   
276  O O   . GLU A 50  ? 1.2633 1.1551 1.4402 0.4909  -0.1510 -0.0267 1349 GLU A O   
277  C CB  . GLU A 50  ? 1.3350 0.9941 1.4525 0.3980  -0.1429 -0.0251 1349 GLU A CB  
278  C CG  . GLU A 50  ? 1.5242 1.0769 1.6363 0.4082  -0.1504 -0.0558 1349 GLU A CG  
279  C CD  . GLU A 50  ? 1.7850 1.3524 1.8871 0.3670  -0.1315 -0.0889 1349 GLU A CD  
280  O OE1 . GLU A 50  ? 1.3961 1.0398 1.4926 0.3268  -0.1137 -0.0798 1349 GLU A OE1 
281  O OE2 . GLU A 50  ? 1.9589 1.4581 2.0567 0.3764  -0.1366 -0.1247 1349 GLU A OE2 
282  N N   . TYR A 51  ? 1.0420 0.8975 1.1714 0.3966  -0.1426 0.0316  1350 TYR A N   
283  C CA  . TYR A 51  ? 0.9639 0.9432 1.1017 0.3833  -0.1316 0.0303  1350 TYR A CA  
284  C C   . TYR A 51  ? 0.9548 0.9621 1.0841 0.3799  -0.1466 0.0755  1350 TYR A C   
285  O O   . TYR A 51  ? 0.8682 0.8783 0.9699 0.3333  -0.1400 0.1001  1350 TYR A O   
286  C CB  . TYR A 51  ? 0.8693 0.8700 0.9865 0.3255  -0.1082 0.0210  1350 TYR A CB  
287  C CG  . TYR A 51  ? 1.1287 1.1360 1.2516 0.3237  -0.0923 -0.0237 1350 TYR A CG  
288  C CD1 . TYR A 51  ? 1.1664 1.2757 1.3051 0.3299  -0.0792 -0.0524 1350 TYR A CD1 
289  C CD2 . TYR A 51  ? 1.3612 1.2795 1.4712 0.3105  -0.0904 -0.0358 1350 TYR A CD2 
290  C CE1 . TYR A 51  ? 1.1401 1.2619 1.2777 0.3258  -0.0641 -0.0912 1350 TYR A CE1 
291  C CE2 . TYR A 51  ? 1.4314 1.3619 1.5419 0.3072  -0.0775 -0.0774 1350 TYR A CE2 
292  C CZ  . TYR A 51  ? 1.2768 1.3096 1.3991 0.3158  -0.0639 -0.1042 1350 TYR A CZ  
293  O OH  . TYR A 51  ? 1.2586 1.3132 1.3760 0.3111  -0.0503 -0.1430 1350 TYR A OH  
294  N N   . PRO A 52  ? 0.8242 0.7357 0.5575 0.2332  0.0131  0.0735  1351 PRO A N   
295  C CA  . PRO A 52  ? 0.8501 0.7870 0.5644 0.2583  0.0164  0.0903  1351 PRO A CA  
296  C C   . PRO A 52  ? 0.8072 0.8129 0.5201 0.2550  0.0004  0.0768  1351 PRO A C   
297  O O   . PRO A 52  ? 0.7864 0.8158 0.4832 0.2734  0.0016  0.0867  1351 PRO A O   
298  C CB  . PRO A 52  ? 0.8790 0.8172 0.5788 0.2969  0.0243  0.1053  1351 PRO A CB  
299  C CG  . PRO A 52  ? 0.9256 0.8577 0.6383 0.2893  0.0194  0.0892  1351 PRO A CG  
300  C CD  . PRO A 52  ? 0.9566 0.8851 0.6895 0.2495  0.0101  0.0680  1351 PRO A CD  
301  N N   . ASP A 53  ? 0.7377 0.7758 0.4694 0.2331  -0.0130 0.0543  1352 ASP A N   
302  C CA  . ASP A 53  ? 0.6519 0.7487 0.3948 0.2209  -0.0279 0.0350  1352 ASP A CA  
303  C C   . ASP A 53  ? 0.6493 0.7268 0.4075 0.1858  -0.0313 0.0233  1352 ASP A C   
304  O O   . ASP A 53  ? 0.5864 0.7024 0.3613 0.1699  -0.0427 0.0040  1352 ASP A O   
305  C CB  . ASP A 53  ? 0.6444 0.7900 0.4063 0.2166  -0.0376 0.0192  1352 ASP A CB  
306  C CG  . ASP A 53  ? 0.7281 0.8456 0.5085 0.1912  -0.0350 0.0140  1352 ASP A CG  
307  O OD1 . ASP A 53  ? 0.8090 0.8697 0.5826 0.1875  -0.0257 0.0230  1352 ASP A OD1 
308  O OD2 . ASP A 53  ? 0.6543 0.8110 0.4580 0.1765  -0.0415 0.0006  1352 ASP A OD2 
309  N N   . TYR A 54  ? 0.6734 0.6927 0.4293 0.1738  -0.0214 0.0329  1353 TYR A N   
310  C CA  . TYR A 54  ? 0.5820 0.5859 0.3518 0.1432  -0.0246 0.0220  1353 TYR A CA  
311  C C   . TYR A 54  ? 0.5698 0.6085 0.3377 0.1433  -0.0328 0.0125  1353 TYR A C   
312  O O   . TYR A 54  ? 0.7379 0.7950 0.5253 0.1211  -0.0419 -0.0064 1353 TYR A O   
313  C CB  . TYR A 54  ? 0.6698 0.6148 0.4371 0.1336  -0.0133 0.0326  1353 TYR A CB  
314  C CG  . TYR A 54  ? 0.6138 0.5441 0.3963 0.1034  -0.0167 0.0209  1353 TYR A CG  
315  C CD1 . TYR A 54  ? 0.7153 0.6452 0.5129 0.0874  -0.0196 0.0115  1353 TYR A CD1 
316  C CD2 . TYR A 54  ? 0.6647 0.5846 0.4444 0.0949  -0.0156 0.0214  1353 TYR A CD2 
317  C CE1 . TYR A 54  ? 0.7166 0.6342 0.5256 0.0649  -0.0208 0.0044  1353 TYR A CE1 
318  C CE2 . TYR A 54  ? 0.6646 0.5718 0.4566 0.0710  -0.0181 0.0117  1353 TYR A CE2 
319  C CZ  . TYR A 54  ? 0.7283 0.6331 0.5346 0.0567  -0.0202 0.0042  1353 TYR A CZ  
320  O OH  . TYR A 54  ? 0.6723 0.5653 0.4890 0.0374  -0.0208 -0.0018 1353 TYR A OH  
321  N N   . ARG A 55  ? 0.6206 0.6704 0.3662 0.1702  -0.0291 0.0251  1354 ARG A N   
322  C CA  . ARG A 55  ? 0.6507 0.7388 0.3904 0.1758  -0.0376 0.0140  1354 ARG A CA  
323  C C   . ARG A 55  ? 0.6914 0.8487 0.4428 0.1802  -0.0544 -0.0113 1354 ARG A C   
324  O O   . ARG A 55  ? 0.6653 0.8557 0.4213 0.1770  -0.0651 -0.0316 1354 ARG A O   
325  C CB  . ARG A 55  ? 0.7728 0.8587 0.4826 0.2084  -0.0266 0.0382  1354 ARG A CB  
326  C CG  . ARG A 55  ? 0.8408 0.8633 0.5463 0.2008  -0.0091 0.0607  1354 ARG A CG  
327  C CD  . ARG A 55  ? 0.8976 0.9013 0.6185 0.1686  -0.0136 0.0456  1354 ARG A CD  
328  N NE  . ARG A 55  ? 1.1868 1.1660 0.8961 0.1739  -0.0006 0.0639  1354 ARG A NE  
329  C CZ  . ARG A 55  ? 1.0841 1.0930 0.7807 0.1844  -0.0039 0.0607  1354 ARG A CZ  
330  N NH1 . ARG A 55  ? 0.8960 0.9598 0.5919 0.1894  -0.0218 0.0350  1354 ARG A NH1 
331  N NH2 . ARG A 55  ? 1.2501 1.2360 0.9378 0.1895  0.0109  0.0814  1354 ARG A NH2 
332  N N   . ASP A 56  ? 0.7053 0.8879 0.4642 0.1877  -0.0574 -0.0135 1355 ASP A N   
333  C CA  . ASP A 56  ? 0.6989 0.9520 0.4777 0.1881  -0.0733 -0.0406 1355 ASP A CA  
334  C C   . ASP A 56  ? 0.6717 0.9203 0.4887 0.1471  -0.0797 -0.0644 1355 ASP A C   
335  O O   . ASP A 56  ? 0.6865 0.9839 0.5282 0.1378  -0.0930 -0.0935 1355 ASP A O   
336  C CB  . ASP A 56  ? 0.7301 1.0125 0.5116 0.2041  -0.0735 -0.0364 1355 ASP A CB  
337  C CG  . ASP A 56  ? 0.7449 1.0310 0.4891 0.2492  -0.0652 -0.0106 1355 ASP A CG  
338  O OD1 . ASP A 56  ? 0.9034 1.1974 0.6215 0.2740  -0.0628 -0.0004 1355 ASP A OD1 
339  O OD2 . ASP A 56  ? 0.6327 0.9146 0.3737 0.2622  -0.0598 0.0008  1355 ASP A OD2 
340  N N   . ILE A 57  ? 0.6851 0.8755 0.5087 0.1242  -0.0696 -0.0524 1356 ILE A N   
341  C CA  . ILE A 57  ? 0.6001 0.7778 0.4577 0.0884  -0.0708 -0.0667 1356 ILE A CA  
342  C C   . ILE A 57  ? 0.6328 0.7719 0.4868 0.0737  -0.0689 -0.0686 1356 ILE A C   
343  O O   . ILE A 57  ? 0.6413 0.7873 0.5219 0.0522  -0.0742 -0.0885 1356 ILE A O   
344  C CB  . ILE A 57  ? 0.6342 0.7832 0.5006 0.0769  -0.0610 -0.0525 1356 ILE A CB  
345  C CG1 . ILE A 57  ? 0.5858 0.7718 0.4519 0.0955  -0.0618 -0.0488 1356 ILE A CG1 
346  C CG2 . ILE A 57  ? 0.4953 0.6384 0.3979 0.0445  -0.0592 -0.0625 1356 ILE A CG2 
347  C CD1 . ILE A 57  ? 0.6028 0.8572 0.5008 0.0906  -0.0725 -0.0717 1356 ILE A CD1 
348  N N   . ILE A 58  ? 0.6326 0.7320 0.4570 0.0854  -0.0605 -0.0488 1357 ILE A N   
349  C CA  . ILE A 58  ? 0.6618 0.7225 0.4835 0.0709  -0.0567 -0.0477 1357 ILE A CA  
350  C C   . ILE A 58  ? 0.6783 0.7503 0.4767 0.0899  -0.0585 -0.0473 1357 ILE A C   
351  O O   . ILE A 58  ? 0.7423 0.8099 0.5150 0.1141  -0.0511 -0.0270 1357 ILE A O   
352  C CB  . ILE A 58  ? 0.6905 0.6977 0.5039 0.0648  -0.0441 -0.0269 1357 ILE A CB  
353  C CG1 . ILE A 58  ? 0.7244 0.7254 0.5596 0.0470  -0.0425 -0.0293 1357 ILE A CG1 
354  C CG2 . ILE A 58  ? 0.5605 0.5332 0.3676 0.0554  -0.0394 -0.0233 1357 ILE A CG2 
355  C CD1 . ILE A 58  ? 0.6538 0.6666 0.5168 0.0250  -0.0470 -0.0456 1357 ILE A CD1 
356  N N   . ASP A 59  ? 0.7144 0.8013 0.5231 0.0807  -0.0671 -0.0689 1358 ASP A N   
357  C CA  . ASP A 59  ? 0.7360 0.8452 0.5225 0.1017  -0.0706 -0.0726 1358 ASP A CA  
358  C C   . ASP A 59  ? 0.7150 0.7799 0.4815 0.1036  -0.0574 -0.0495 1358 ASP A C   
359  O O   . ASP A 59  ? 0.7274 0.8029 0.4677 0.1291  -0.0516 -0.0341 1358 ASP A O   
360  C CB  . ASP A 59  ? 0.7765 0.9158 0.5832 0.0914  -0.0851 -0.1089 1358 ASP A CB  
361  C CG  . ASP A 59  ? 0.8540 1.0509 0.6853 0.0919  -0.0998 -0.1379 1358 ASP A CG  
362  O OD1 . ASP A 59  ? 0.8201 1.0602 0.6354 0.1185  -0.1034 -0.1340 1358 ASP A OD1 
363  O OD2 . ASP A 59  ? 1.0384 1.2384 0.9079 0.0659  -0.1066 -0.1646 1358 ASP A OD2 
364  N N   . THR A 60  ? 0.7125 0.7324 0.4926 0.0784  -0.0517 -0.0464 1359 THR A N   
365  C CA  . THR A 60  ? 0.7297 0.7127 0.4979 0.0761  -0.0407 -0.0299 1359 THR A CA  
366  C C   . THR A 60  ? 0.7126 0.6510 0.4899 0.0593  -0.0309 -0.0157 1359 THR A C   
367  O O   . THR A 60  ? 0.7096 0.6322 0.5039 0.0389  -0.0331 -0.0250 1359 THR A O   
368  C CB  . THR A 60  ? 0.7034 0.6861 0.4780 0.0655  -0.0465 -0.0483 1359 THR A CB  
369  O OG1 . THR A 60  ? 0.7820 0.8110 0.5555 0.0781  -0.0594 -0.0719 1359 THR A OG1 
370  C CG2 . THR A 60  ? 0.6320 0.5923 0.3903 0.0709  -0.0352 -0.0308 1359 THR A CG2 
371  N N   . PRO A 61  ? 0.7525 0.6712 0.5196 0.0697  -0.0193 0.0062  1360 PRO A N   
372  C CA  . PRO A 61  ? 0.7079 0.5904 0.4865 0.0550  -0.0126 0.0125  1360 PRO A CA  
373  C C   . PRO A 61  ? 0.5929 0.4513 0.3769 0.0409  -0.0079 0.0129  1360 PRO A C   
374  O O   . PRO A 61  ? 0.7015 0.5624 0.4769 0.0466  -0.0040 0.0180  1360 PRO A O   
375  C CB  . PRO A 61  ? 0.6541 0.5215 0.4244 0.0713  -0.0010 0.0326  1360 PRO A CB  
376  C CG  . PRO A 61  ? 0.8242 0.7275 0.5779 0.0963  -0.0039 0.0369  1360 PRO A CG  
377  C CD  . PRO A 61  ? 0.7533 0.6837 0.5015 0.0967  -0.0118 0.0247  1360 PRO A CD  
378  N N   . MET A 62  ? 0.5664 0.4061 0.3633 0.0256  -0.0078 0.0083  1361 MET A N   
379  C CA  . MET A 62  ? 0.5707 0.3915 0.3734 0.0146  -0.0033 0.0083  1361 MET A CA  
380  C C   . MET A 62  ? 0.6080 0.4125 0.4221 0.0070  -0.0011 0.0063  1361 MET A C   
381  O O   . MET A 62  ? 0.6472 0.4567 0.4640 0.0079  -0.0048 0.0026  1361 MET A O   
382  C CB  . MET A 62  ? 0.5252 0.3540 0.3301 0.0062  -0.0099 -0.0032 1361 MET A CB  
383  C CG  . MET A 62  ? 0.6419 0.4585 0.4501 -0.0009 -0.0061 -0.0032 1361 MET A CG  
384  S SD  . MET A 62  ? 0.5937 0.4061 0.3973 0.0053  0.0045  0.0094  1361 MET A SD  
385  C CE  . MET A 62  ? 0.5107 0.3469 0.2960 0.0227  0.0021  0.0120  1361 MET A CE  
386  N N   . ASP A 63  ? 0.6018 0.3914 0.4239 0.0013  0.0051  0.0075  1362 ASP A N   
387  C CA  . ASP A 63  ? 0.5572 0.3362 0.3925 -0.0039 0.0060  0.0001  1362 ASP A CA  
388  C C   . ASP A 63  ? 0.5583 0.3349 0.4049 -0.0133 0.0085  -0.0056 1362 ASP A C   
389  O O   . ASP A 63  ? 0.7206 0.4979 0.5656 -0.0146 0.0129  0.0006  1362 ASP A O   
390  C CB  . ASP A 63  ? 0.6059 0.3676 0.4472 0.0024  0.0139  0.0064  1362 ASP A CB  
391  C CG  . ASP A 63  ? 0.6590 0.4062 0.5079 0.0020  0.0265  0.0186  1362 ASP A CG  
392  O OD1 . ASP A 63  ? 0.7278 0.4633 0.5979 -0.0084 0.0318  0.0119  1362 ASP A OD1 
393  O OD2 . ASP A 63  ? 0.7110 0.4633 0.5461 0.0128  0.0314  0.0341  1362 ASP A OD2 
394  N N   . PHE A 64  ? 0.5378 0.3179 0.3950 -0.0175 0.0049  -0.0189 1363 PHE A N   
395  C CA  . PHE A 64  ? 0.5435 0.3321 0.4109 -0.0243 0.0045  -0.0278 1363 PHE A CA  
396  C C   . PHE A 64  ? 0.5294 0.3084 0.4170 -0.0318 0.0137  -0.0273 1363 PHE A C   
397  O O   . PHE A 64  ? 0.5378 0.3277 0.4324 -0.0369 0.0149  -0.0302 1363 PHE A O   
398  C CB  . PHE A 64  ? 0.5450 0.3493 0.4178 -0.0222 -0.0026 -0.0444 1363 PHE A CB  
399  C CG  . PHE A 64  ? 0.6095 0.4279 0.4657 -0.0154 -0.0077 -0.0404 1363 PHE A CG  
400  C CD1 . PHE A 64  ? 0.5955 0.4191 0.4449 -0.0084 -0.0102 -0.0391 1363 PHE A CD1 
401  C CD2 . PHE A 64  ? 0.5716 0.3966 0.4210 -0.0153 -0.0076 -0.0357 1363 PHE A CD2 
402  C CE1 . PHE A 64  ? 0.5729 0.4074 0.4126 -0.0036 -0.0109 -0.0313 1363 PHE A CE1 
403  C CE2 . PHE A 64  ? 0.6991 0.5306 0.5379 -0.0095 -0.0086 -0.0289 1363 PHE A CE2 
404  C CZ  . PHE A 64  ? 0.5431 0.3790 0.3788 -0.0047 -0.0093 -0.0256 1363 PHE A CZ  
405  N N   . ALA A 65  ? 0.6055 0.3641 0.5053 -0.0320 0.0220  -0.0224 1364 ALA A N   
406  C CA  . ALA A 65  ? 0.6584 0.4042 0.5848 -0.0410 0.0356  -0.0181 1364 ALA A CA  
407  C C   . ALA A 65  ? 0.7420 0.4921 0.6544 -0.0369 0.0435  0.0034  1364 ALA A C   
408  O O   . ALA A 65  ? 0.6818 0.4386 0.6091 -0.0441 0.0511  0.0061  1364 ALA A O   
409  C CB  . ALA A 65  ? 0.5668 0.2832 0.5108 -0.0400 0.0461  -0.0139 1364 ALA A CB  
410  N N   . THR A 66  ? 0.6131 0.3648 0.4975 -0.0241 0.0409  0.0162  1365 THR A N   
411  C CA  . THR A 66  ? 0.6354 0.3969 0.5035 -0.0155 0.0465  0.0330  1365 THR A CA  
412  C C   . THR A 66  ? 0.6308 0.4124 0.4918 -0.0194 0.0381  0.0229  1365 THR A C   
413  O O   . THR A 66  ? 0.6138 0.4051 0.4749 -0.0179 0.0452  0.0311  1365 THR A O   
414  C CB  . THR A 66  ? 0.6872 0.4538 0.5291 0.0004  0.0420  0.0416  1365 THR A CB  
415  O OG1 . THR A 66  ? 0.6632 0.4115 0.5100 0.0078  0.0512  0.0531  1365 THR A OG1 
416  C CG2 . THR A 66  ? 0.5399 0.3252 0.3628 0.0129  0.0448  0.0532  1365 THR A CG2 
417  N N   . VAL A 67  ? 0.5811 0.3691 0.4366 -0.0222 0.0251  0.0075  1366 VAL A N   
418  C CA  . VAL A 67  ? 0.6426 0.4453 0.4912 -0.0228 0.0190  0.0003  1366 VAL A CA  
419  C C   . VAL A 67  ? 0.6310 0.4419 0.4999 -0.0306 0.0247  -0.0039 1366 VAL A C   
420  O O   . VAL A 67  ? 0.6638 0.4872 0.5301 -0.0286 0.0273  -0.0013 1366 VAL A O   
421  C CB  . VAL A 67  ? 0.5791 0.3849 0.4210 -0.0224 0.0083  -0.0103 1366 VAL A CB  
422  C CG1 . VAL A 67  ? 0.4741 0.2904 0.3121 -0.0209 0.0055  -0.0152 1366 VAL A CG1 
423  C CG2 . VAL A 67  ? 0.4424 0.2451 0.2709 -0.0174 0.0035  -0.0077 1366 VAL A CG2 
424  N N   . ARG A 68  ? 0.7025 0.5091 0.5947 -0.0393 0.0268  -0.0123 1367 ARG A N   
425  C CA  . ARG A 68  ? 0.7474 0.5681 0.6664 -0.0488 0.0310  -0.0218 1367 ARG A CA  
426  C C   . ARG A 68  ? 0.6983 0.5168 0.6329 -0.0531 0.0474  -0.0058 1367 ARG A C   
427  O O   . ARG A 68  ? 0.7267 0.5654 0.6710 -0.0560 0.0510  -0.0066 1367 ARG A O   
428  C CB  . ARG A 68  ? 0.7013 0.5229 0.6461 -0.0571 0.0272  -0.0421 1367 ARG A CB  
429  C CG  . ARG A 68  ? 0.9835 0.8269 0.9631 -0.0686 0.0302  -0.0575 1367 ARG A CG  
430  C CD  . ARG A 68  ? 1.1057 0.9661 1.1046 -0.0716 0.0195  -0.0870 1367 ARG A CD  
431  N NE  . ARG A 68  ? 0.8759 0.7099 0.8894 -0.0759 0.0221  -0.0925 1367 ARG A NE  
432  C CZ  . ARG A 68  ? 0.9872 0.8299 1.0100 -0.0738 0.0118  -0.1177 1367 ARG A CZ  
433  N NH1 . ARG A 68  ? 0.7824 0.5966 0.8174 -0.0760 0.0157  -0.1211 1367 ARG A NH1 
434  N NH2 . ARG A 68  ? 0.7269 0.6087 0.7458 -0.0663 -0.0016 -0.1393 1367 ARG A NH2 
435  N N   . GLU A 69  ? 0.6965 0.4933 0.6327 -0.0509 0.0586  0.0111  1368 GLU A N   
436  C CA  . GLU A 69  ? 0.7030 0.4985 0.6491 -0.0498 0.0776  0.0337  1368 GLU A CA  
437  C C   . GLU A 69  ? 0.7397 0.5581 0.6586 -0.0373 0.0763  0.0433  1368 GLU A C   
438  O O   . GLU A 69  ? 0.7688 0.6031 0.7009 -0.0391 0.0879  0.0522  1368 GLU A O   
439  C CB  . GLU A 69  ? 0.7800 0.5506 0.7214 -0.0411 0.0898  0.0551  1368 GLU A CB  
440  C CG  . GLU A 69  ? 1.0912 0.8334 1.0674 -0.0524 0.0987  0.0511  1368 GLU A CG  
441  C CD  . GLU A 69  ? 1.4746 1.1906 1.4435 -0.0386 0.1143  0.0783  1368 GLU A CD  
442  O OE1 . GLU A 69  ? 1.5832 1.3007 1.5499 -0.0290 0.1332  0.1074  1368 GLU A OE1 
443  O OE2 . GLU A 69  ? 1.3587 1.0556 1.3228 -0.0344 0.1084  0.0719  1368 GLU A OE2 
444  N N   . THR A 70  ? 0.6369 0.4582 0.5214 -0.0248 0.0628  0.0396  1369 THR A N   
445  C CA  . THR A 70  ? 0.6147 0.4554 0.4738 -0.0111 0.0599  0.0436  1369 THR A CA  
446  C C   . THR A 70  ? 0.5364 0.3959 0.4018 -0.0153 0.0559  0.0317  1369 THR A C   
447  O O   . THR A 70  ? 0.6467 0.5253 0.5090 -0.0083 0.0633  0.0396  1369 THR A O   
448  C CB  . THR A 70  ? 0.6293 0.4673 0.4604 -0.0012 0.0451  0.0351  1369 THR A CB  
449  O OG1 . THR A 70  ? 0.6195 0.4465 0.4450 0.0047  0.0483  0.0456  1369 THR A OG1 
450  C CG2 . THR A 70  ? 0.5130 0.3702 0.3214 0.0135  0.0414  0.0340  1369 THR A CG2 
451  N N   . LEU A 71  ? 0.5601 0.4179 0.4339 -0.0238 0.0453  0.0139  1370 LEU A N   
452  C CA  . LEU A 71  ? 0.5632 0.4418 0.4450 -0.0257 0.0414  0.0019  1370 LEU A CA  
453  C C   . LEU A 71  ? 0.6186 0.5163 0.5326 -0.0356 0.0540  0.0047  1370 LEU A C   
454  O O   . LEU A 71  ? 0.6476 0.5693 0.5617 -0.0306 0.0571  0.0057  1370 LEU A O   
455  C CB  . LEU A 71  ? 0.4574 0.3347 0.3429 -0.0296 0.0296  -0.0150 1370 LEU A CB  
456  C CG  . LEU A 71  ? 0.6260 0.5287 0.5137 -0.0252 0.0241  -0.0268 1370 LEU A CG  
457  C CD1 . LEU A 71  ? 0.5975 0.5011 0.4586 -0.0103 0.0213  -0.0226 1370 LEU A CD1 
458  C CD2 . LEU A 71  ? 0.5682 0.4751 0.4569 -0.0239 0.0140  -0.0406 1370 LEU A CD2 
459  N N   . GLU A 72  ? 0.5593 0.4469 0.5045 -0.0499 0.0619  0.0044  1371 GLU A N   
460  C CA  . GLU A 72  ? 0.6530 0.5565 0.6395 -0.0635 0.0766  0.0063  1371 GLU A CA  
461  C C   . GLU A 72  ? 0.6585 0.5692 0.6421 -0.0566 0.0946  0.0328  1371 GLU A C   
462  O O   . GLU A 72  ? 0.6458 0.5841 0.6506 -0.0608 0.1036  0.0348  1371 GLU A O   
463  C CB  . GLU A 72  ? 0.5906 0.4736 0.6159 -0.0809 0.0837  0.0003  1371 GLU A CB  
464  C CG  . GLU A 72  ? 0.7821 0.6768 0.8245 -0.0892 0.0677  -0.0324 1371 GLU A CG  
465  C CD  . GLU A 72  ? 1.1245 0.9949 1.1999 -0.1028 0.0710  -0.0440 1371 GLU A CD  
466  O OE1 . GLU A 72  ? 0.8916 0.7665 0.9648 -0.1017 0.0552  -0.0685 1371 GLU A OE1 
467  O OE2 . GLU A 72  ? 1.0191 0.8661 1.1220 -0.1123 0.0905  -0.0277 1371 GLU A OE2 
468  N N   . ALA A 73  ? 0.6850 0.5766 0.6421 -0.0437 0.0999  0.0531  1372 ALA A N   
469  C CA  . ALA A 73  ? 0.6854 0.5898 0.6312 -0.0296 0.1167  0.0802  1372 ALA A CA  
470  C C   . ALA A 73  ? 0.6461 0.5810 0.5633 -0.0133 0.1091  0.0762  1372 ALA A C   
471  O O   . ALA A 73  ? 0.8471 0.8025 0.7572 -0.0003 0.1227  0.0955  1372 ALA A O   
472  C CB  . ALA A 73  ? 0.6084 0.4926 0.5282 -0.0143 0.1211  0.0993  1372 ALA A CB  
473  N N   . GLY A 74  ? 0.6564 0.5938 0.5584 -0.0121 0.0890  0.0525  1373 GLY A N   
474  C CA  . GLY A 74  ? 0.6959 0.6536 0.5709 0.0043  0.0801  0.0448  1373 GLY A CA  
475  C C   . GLY A 74  ? 0.6781 0.6290 0.5136 0.0241  0.0720  0.0458  1373 GLY A C   
476  O O   . GLY A 74  ? 0.7401 0.7094 0.5552 0.0407  0.0692  0.0425  1373 GLY A O   
477  N N   . ASN A 75  ? 0.5968 0.5242 0.4236 0.0229  0.0672  0.0467  1374 ASN A N   
478  C CA  . ASN A 75  ? 0.6230 0.5518 0.4191 0.0411  0.0610  0.0470  1374 ASN A CA  
479  C C   . ASN A 75  ? 0.6444 0.5598 0.4255 0.0422  0.0415  0.0235  1374 ASN A C   
480  O O   . ASN A 75  ? 0.6741 0.5905 0.4368 0.0533  0.0338  0.0172  1374 ASN A O   
481  C CB  . ASN A 75  ? 0.6067 0.5242 0.4025 0.0430  0.0691  0.0641  1374 ASN A CB  
482  C CG  . ASN A 75  ? 0.6206 0.5553 0.4212 0.0535  0.0921  0.0939  1374 ASN A CG  
483  O OD1 . ASN A 75  ? 0.7736 0.7350 0.5702 0.0637  0.0997  0.1004  1374 ASN A OD1 
484  N ND2 . ASN A 75  ? 0.5801 0.4995 0.3893 0.0529  0.1046  0.1136  1374 ASN A ND2 
485  N N   . TYR A 76  ? 0.5941 0.5002 0.3855 0.0320  0.0349  0.0109  1375 TYR A N   
486  C CA  . TYR A 76  ? 0.5168 0.4101 0.2973 0.0352  0.0213  -0.0071 1375 TYR A CA  
487  C C   . TYR A 76  ? 0.6301 0.5367 0.4018 0.0478  0.0199  -0.0152 1375 TYR A C   
488  O O   . TYR A 76  ? 0.6322 0.5505 0.4139 0.0460  0.0245  -0.0130 1375 TYR A O   
489  C CB  . TYR A 76  ? 0.5622 0.4369 0.3555 0.0219  0.0165  -0.0123 1375 TYR A CB  
490  C CG  . TYR A 76  ? 0.5864 0.4450 0.3841 0.0127  0.0143  -0.0097 1375 TYR A CG  
491  C CD1 . TYR A 76  ? 0.4756 0.3279 0.2621 0.0173  0.0082  -0.0138 1375 TYR A CD1 
492  C CD2 . TYR A 76  ? 0.5928 0.4469 0.4077 0.0008  0.0176  -0.0058 1375 TYR A CD2 
493  C CE1 . TYR A 76  ? 0.6464 0.4885 0.4371 0.0108  0.0065  -0.0108 1375 TYR A CE1 
494  C CE2 . TYR A 76  ? 0.5806 0.4208 0.3986 -0.0049 0.0160  -0.0038 1375 TYR A CE2 
495  C CZ  . TYR A 76  ? 0.6208 0.4554 0.4258 0.0005  0.0110  -0.0046 1375 TYR A CZ  
496  O OH  . TYR A 76  ? 0.5091 0.3341 0.3177 -0.0036 0.0097  -0.0023 1375 TYR A OH  
497  N N   . GLU A 77  ? 0.6237 0.5312 0.3781 0.0619  0.0129  -0.0275 1376 GLU A N   
498  C CA  . GLU A 77  ? 0.6596 0.5789 0.4043 0.0772  0.0118  -0.0370 1376 GLU A CA  
499  C C   . GLU A 77  ? 0.6241 0.5203 0.3739 0.0750  0.0067  -0.0470 1376 GLU A C   
500  O O   . GLU A 77  ? 0.7160 0.6216 0.4621 0.0863  0.0086  -0.0498 1376 GLU A O   
501  C CB  . GLU A 77  ? 0.6507 0.5814 0.3770 0.0952  0.0053  -0.0513 1376 GLU A CB  
502  C CG  . GLU A 77  ? 0.7470 0.6937 0.4611 0.1153  0.0045  -0.0628 1376 GLU A CG  
503  C CD  . GLU A 77  ? 0.7105 0.6276 0.4260 0.1187  -0.0051 -0.0862 1376 GLU A CD  
504  O OE1 . GLU A 77  ? 0.7267 0.6522 0.4325 0.1369  -0.0060 -0.0975 1376 GLU A OE1 
505  O OE2 . GLU A 77  ? 0.6497 0.5349 0.3774 0.1041  -0.0101 -0.0917 1376 GLU A OE2 
506  N N   . SER A 78  ? 0.5961 0.4647 0.3539 0.0631  0.0020  -0.0500 1377 SER A N   
507  C CA  . SER A 78  ? 0.6181 0.4636 0.3816 0.0625  0.0009  -0.0529 1377 SER A CA  
508  C C   . SER A 78  ? 0.6198 0.4497 0.3945 0.0476  0.0005  -0.0460 1377 SER A C   
509  O O   . SER A 78  ? 0.7092 0.5375 0.4870 0.0378  -0.0015 -0.0448 1377 SER A O   
510  C CB  . SER A 78  ? 0.7158 0.5372 0.4763 0.0714  -0.0039 -0.0698 1377 SER A CB  
511  O OG  . SER A 78  ? 0.7915 0.5975 0.5598 0.0609  -0.0094 -0.0784 1377 SER A OG  
512  N N   . PRO A 79  ? 0.6396 0.4600 0.4185 0.0494  0.0029  -0.0411 1378 PRO A N   
513  C CA  . PRO A 79  ? 0.5959 0.4069 0.3832 0.0386  0.0030  -0.0345 1378 PRO A CA  
514  C C   . PRO A 79  ? 0.6790 0.4656 0.4723 0.0307  0.0003  -0.0390 1378 PRO A C   
515  O O   . PRO A 79  ? 0.6029 0.3887 0.4026 0.0208  0.0000  -0.0338 1378 PRO A O   
516  C CB  . PRO A 79  ? 0.6747 0.4862 0.4615 0.0488  0.0070  -0.0273 1378 PRO A CB  
517  C CG  . PRO A 79  ? 0.8112 0.6246 0.5895 0.0654  0.0091  -0.0308 1378 PRO A CG  
518  C CD  . PRO A 79  ? 0.7370 0.5512 0.5109 0.0650  0.0058  -0.0415 1378 PRO A CD  
519  N N   . MET A 80  ? 0.5971 0.3669 0.3916 0.0347  -0.0016 -0.0510 1379 MET A N   
520  C CA  . MET A 80  ? 0.6280 0.3818 0.4355 0.0243  -0.0050 -0.0596 1379 MET A CA  
521  C C   . MET A 80  ? 0.7072 0.4808 0.5122 0.0168  -0.0108 -0.0621 1379 MET A C   
522  O O   . MET A 80  ? 0.8318 0.6009 0.6477 0.0067  -0.0125 -0.0625 1379 MET A O   
523  C CB  . MET A 80  ? 0.6226 0.3585 0.4380 0.0285  -0.0078 -0.0795 1379 MET A CB  
524  C CG  . MET A 80  ? 0.7044 0.4100 0.5267 0.0368  0.0007  -0.0755 1379 MET A CG  
525  S SD  . MET A 80  ? 0.9381 0.6586 0.7377 0.0583  0.0035  -0.0697 1379 MET A SD  
526  C CE  . MET A 80  ? 0.7912 0.5181 0.5854 0.0676  -0.0057 -0.0993 1379 MET A CE  
527  N N   . GLU A 81  ? 0.6544 0.4509 0.4457 0.0235  -0.0120 -0.0614 1380 GLU A N   
528  C CA  . GLU A 81  ? 0.7212 0.5360 0.5080 0.0213  -0.0144 -0.0588 1380 GLU A CA  
529  C C   . GLU A 81  ? 0.5937 0.4065 0.3865 0.0110  -0.0107 -0.0441 1380 GLU A C   
530  O O   . GLU A 81  ? 0.7070 0.5221 0.5026 0.0064  -0.0132 -0.0434 1380 GLU A O   
531  C CB  . GLU A 81  ? 0.8234 0.6627 0.5955 0.0335  -0.0117 -0.0552 1380 GLU A CB  
532  C CG  . GLU A 81  ? 0.6409 0.4877 0.4040 0.0478  -0.0164 -0.0724 1380 GLU A CG  
533  C CD  . GLU A 81  ? 0.9888 0.8343 0.7569 0.0477  -0.0265 -0.0936 1380 GLU A CD  
534  O OE1 . GLU A 81  ? 0.8490 0.7147 0.6119 0.0502  -0.0297 -0.0930 1380 GLU A OE1 
535  O OE2 . GLU A 81  ? 0.6675 0.4922 0.4480 0.0449  -0.0303 -0.1105 1380 GLU A OE2 
536  N N   . LEU A 82  ? 0.5898 0.4019 0.3852 0.0093  -0.0055 -0.0351 1381 LEU A N   
537  C CA  . LEU A 82  ? 0.6557 0.4675 0.4587 0.0012  -0.0033 -0.0268 1381 LEU A CA  
538  C C   . LEU A 82  ? 0.6531 0.4516 0.4626 -0.0037 -0.0056 -0.0275 1381 LEU A C   
539  O O   . LEU A 82  ? 0.5817 0.3811 0.3952 -0.0090 -0.0065 -0.0246 1381 LEU A O   
540  C CB  . LEU A 82  ? 0.6304 0.4512 0.4372 0.0027  0.0001  -0.0237 1381 LEU A CB  
541  C CG  . LEU A 82  ? 0.6637 0.4900 0.4805 -0.0039 0.0008  -0.0214 1381 LEU A CG  
542  C CD1 . LEU A 82  ? 0.5572 0.4024 0.3842 -0.0058 0.0042  -0.0231 1381 LEU A CD1 
543  C CD2 . LEU A 82  ? 0.5599 0.3831 0.3767 -0.0004 -0.0005 -0.0208 1381 LEU A CD2 
544  N N   . CYS A 83  ? 0.5817 0.3674 0.3942 -0.0010 -0.0048 -0.0304 1382 CYS A N   
545  C CA  . CYS A 83  ? 0.5934 0.3663 0.4170 -0.0059 -0.0030 -0.0275 1382 CYS A CA  
546  C C   . CYS A 83  ? 0.5000 0.2742 0.3318 -0.0138 -0.0076 -0.0347 1382 CYS A C   
547  O O   . CYS A 83  ? 0.6661 0.4405 0.5066 -0.0192 -0.0061 -0.0294 1382 CYS A O   
548  C CB  . CYS A 83  ? 0.6761 0.4296 0.5064 -0.0019 0.0014  -0.0286 1382 CYS A CB  
549  S SG  A CYS A 83  ? 0.6435 0.3967 0.4679 0.0101  0.0097  -0.0134 1382 CYS A SG  
550  S SG  B CYS A 83  ? 0.7142 0.4547 0.5563 -0.0012 0.0119  -0.0121 1382 CYS A SG  
551  N N   . LYS A 84  ? 0.5763 0.3563 0.4054 -0.0121 -0.0135 -0.0480 1383 LYS A N   
552  C CA  . LYS A 84  ? 0.6911 0.4820 0.5278 -0.0165 -0.0199 -0.0588 1383 LYS A CA  
553  C C   . LYS A 84  ? 0.6210 0.4259 0.4501 -0.0162 -0.0202 -0.0485 1383 LYS A C   
554  O O   . LYS A 84  ? 0.6343 0.4451 0.4726 -0.0211 -0.0220 -0.0487 1383 LYS A O   
555  C CB  . LYS A 84  ? 0.6937 0.4984 0.5232 -0.0082 -0.0273 -0.0764 1383 LYS A CB  
556  C CG  . LYS A 84  ? 0.7988 0.5903 0.6388 -0.0074 -0.0292 -0.0941 1383 LYS A CG  
557  C CD  . LYS A 84  ? 0.8447 0.6604 0.6725 0.0055  -0.0383 -0.1138 1383 LYS A CD  
558  C CE  . LYS A 84  ? 0.8951 0.6972 0.7300 0.0102  -0.0406 -0.1345 1383 LYS A CE  
559  N NZ  . LYS A 84  ? 0.8039 0.6365 0.6204 0.0286  -0.0494 -0.1531 1383 LYS A NZ  
560  N N   . ASP A 85  ? 0.6092 0.4186 0.4244 -0.0102 -0.0171 -0.0392 1384 ASP A N   
561  C CA  . ASP A 85  ? 0.5850 0.3998 0.3967 -0.0098 -0.0148 -0.0288 1384 ASP A CA  
562  C C   . ASP A 85  ? 0.6398 0.4476 0.4604 -0.0162 -0.0128 -0.0232 1384 ASP A C   
563  O O   . ASP A 85  ? 0.6571 0.4701 0.4809 -0.0169 -0.0143 -0.0219 1384 ASP A O   
564  C CB  . ASP A 85  ? 0.6716 0.4889 0.4754 -0.0050 -0.0087 -0.0198 1384 ASP A CB  
565  C CG  . ASP A 85  ? 0.8389 0.6713 0.6305 0.0063  -0.0084 -0.0187 1384 ASP A CG  
566  O OD1 . ASP A 85  ? 0.6902 0.5344 0.4788 0.0110  -0.0158 -0.0292 1384 ASP A OD1 
567  O OD2 . ASP A 85  ? 0.6798 0.5164 0.4670 0.0112  -0.0004 -0.0078 1384 ASP A OD2 
568  N N   . VAL A 86  ? 0.6283 0.4293 0.4516 -0.0175 -0.0095 -0.0205 1385 VAL A N   
569  C CA  . VAL A 86  ? 0.5505 0.3523 0.3789 -0.0185 -0.0075 -0.0156 1385 VAL A CA  
570  C C   . VAL A 86  ? 0.5910 0.3928 0.4291 -0.0221 -0.0074 -0.0147 1385 VAL A C   
571  O O   . VAL A 86  ? 0.5279 0.3368 0.3691 -0.0218 -0.0068 -0.0109 1385 VAL A O   
572  C CB  . VAL A 86  ? 0.5624 0.3655 0.3895 -0.0139 -0.0043 -0.0130 1385 VAL A CB  
573  C CG1 . VAL A 86  ? 0.4841 0.2954 0.3136 -0.0099 -0.0022 -0.0080 1385 VAL A CG1 
574  C CG2 . VAL A 86  ? 0.5076 0.3177 0.3325 -0.0128 -0.0044 -0.0167 1385 VAL A CG2 
575  N N   . ARG A 87  ? 0.5465 0.3415 0.3930 -0.0258 -0.0076 -0.0198 1386 ARG A N   
576  C CA  . ARG A 87  ? 0.5852 0.3808 0.4503 -0.0326 -0.0051 -0.0192 1386 ARG A CA  
577  C C   . ARG A 87  ? 0.6496 0.4622 0.5196 -0.0356 -0.0115 -0.0267 1386 ARG A C   
578  O O   . ARG A 87  ? 0.6921 0.5139 0.5782 -0.0409 -0.0095 -0.0250 1386 ARG A O   
579  C CB  . ARG A 87  ? 0.5624 0.3428 0.4434 -0.0378 -0.0024 -0.0260 1386 ARG A CB  
580  C CG  . ARG A 87  ? 0.6639 0.4277 0.5468 -0.0334 0.0080  -0.0127 1386 ARG A CG  
581  C CD  . ARG A 87  ? 0.6445 0.3868 0.5386 -0.0349 0.0106  -0.0209 1386 ARG A CD  
582  N NE  . ARG A 87  ? 0.8258 0.5517 0.7201 -0.0265 0.0233  -0.0033 1386 ARG A NE  
583  C CZ  . ARG A 87  ? 0.9819 0.6841 0.8813 -0.0218 0.0291  -0.0041 1386 ARG A CZ  
584  N NH1 . ARG A 87  ? 0.7464 0.4391 0.6512 -0.0256 0.0218  -0.0257 1386 ARG A NH1 
585  N NH2 . ARG A 87  ? 0.8830 0.5736 0.7801 -0.0097 0.0426  0.0168  1386 ARG A NH2 
586  N N   . LEU A 88  ? 0.6303 0.4505 0.4871 -0.0304 -0.0179 -0.0338 1387 LEU A N   
587  C CA  . LEU A 88  ? 0.6601 0.5003 0.5148 -0.0266 -0.0236 -0.0381 1387 LEU A CA  
588  C C   . LEU A 88  ? 0.6863 0.5300 0.5354 -0.0223 -0.0208 -0.0267 1387 LEU A C   
589  O O   . LEU A 88  ? 0.6651 0.5260 0.5181 -0.0197 -0.0236 -0.0279 1387 LEU A O   
590  C CB  . LEU A 88  ? 0.6559 0.5033 0.4934 -0.0165 -0.0275 -0.0421 1387 LEU A CB  
591  C CG  . LEU A 88  ? 0.6521 0.5258 0.4835 -0.0063 -0.0334 -0.0470 1387 LEU A CG  
592  C CD1 . LEU A 88  ? 0.6501 0.5456 0.5031 -0.0129 -0.0414 -0.0661 1387 LEU A CD1 
593  C CD2 . LEU A 88  ? 0.5213 0.4025 0.3336 0.0070  -0.0340 -0.0468 1387 LEU A CD2 
594  N N   . ILE A 89  ? 0.7027 0.5330 0.5439 -0.0203 -0.0161 -0.0183 1388 ILE A N   
595  C CA  . ILE A 89  ? 0.6484 0.4806 0.4862 -0.0153 -0.0143 -0.0127 1388 ILE A CA  
596  C C   . ILE A 89  ? 0.6226 0.4667 0.4722 -0.0178 -0.0129 -0.0105 1388 ILE A C   
597  O O   . ILE A 89  ? 0.5696 0.4258 0.4200 -0.0131 -0.0138 -0.0093 1388 ILE A O   
598  C CB  . ILE A 89  ? 0.6562 0.4779 0.4899 -0.0139 -0.0111 -0.0109 1388 ILE A CB  
599  C CG1 . ILE A 89  ? 0.5720 0.3840 0.4000 -0.0134 -0.0098 -0.0111 1388 ILE A CG1 
600  C CG2 . ILE A 89  ? 0.5633 0.3891 0.3973 -0.0082 -0.0106 -0.0109 1388 ILE A CG2 
601  C CD1 . ILE A 89  ? 0.4849 0.2908 0.3162 -0.0143 -0.0070 -0.0135 1388 ILE A CD1 
602  N N   . PHE A 90  ? 0.6375 0.4782 0.4975 -0.0239 -0.0089 -0.0082 1389 PHE A N   
603  C CA  . PHE A 90  ? 0.6406 0.4924 0.5147 -0.0257 -0.0029 -0.0006 1389 PHE A CA  
604  C C   . PHE A 90  ? 0.6489 0.5152 0.5437 -0.0341 -0.0042 -0.0057 1389 PHE A C   
605  O O   . PHE A 90  ? 0.7459 0.6307 0.6502 -0.0331 -0.0012 -0.0007 1389 PHE A O   
606  C CB  . PHE A 90  ? 0.6538 0.4951 0.5324 -0.0258 0.0060  0.0093  1389 PHE A CB  
607  C CG  . PHE A 90  ? 0.5398 0.3785 0.3996 -0.0149 0.0059  0.0117  1389 PHE A CG  
608  C CD1 . PHE A 90  ? 0.6143 0.4657 0.4637 -0.0058 0.0027  0.0091  1389 PHE A CD1 
609  C CD2 . PHE A 90  ? 0.7279 0.5541 0.5826 -0.0132 0.0079  0.0125  1389 PHE A CD2 
610  C CE1 . PHE A 90  ? 0.5307 0.3850 0.3693 0.0025  0.0011  0.0050  1389 PHE A CE1 
611  C CE2 . PHE A 90  ? 0.6108 0.4427 0.4523 -0.0035 0.0064  0.0109  1389 PHE A CE2 
612  C CZ  . PHE A 90  ? 0.5784 0.4256 0.4136 0.0033  0.0026  0.0057  1389 PHE A CZ  
613  N N   . SER A 91  ? 0.7077 0.5707 0.6112 -0.0415 -0.0091 -0.0182 1390 SER A N   
614  C CA  . SER A 91  ? 0.6693 0.5538 0.5969 -0.0498 -0.0132 -0.0307 1390 SER A CA  
615  C C   . SER A 91  ? 0.6550 0.5655 0.5710 -0.0395 -0.0210 -0.0344 1390 SER A C   
616  O O   . SER A 91  ? 0.6039 0.5417 0.5382 -0.0423 -0.0222 -0.0383 1390 SER A O   
617  C CB  . SER A 91  ? 0.6673 0.5471 0.6065 -0.0572 -0.0191 -0.0496 1390 SER A CB  
618  O OG  . SER A 91  ? 0.7667 0.6446 0.6784 -0.0459 -0.0269 -0.0553 1390 SER A OG  
619  N N   . ASN A 92  ? 0.6072 0.5097 0.4952 -0.0270 -0.0247 -0.0318 1391 ASN A N   
620  C CA  . ASN A 92  ? 0.5758 0.4958 0.4506 -0.0132 -0.0284 -0.0298 1391 ASN A CA  
621  C C   . ASN A 92  ? 0.6243 0.5516 0.5031 -0.0103 -0.0236 -0.0205 1391 ASN A C   
622  O O   . ASN A 92  ? 0.5780 0.5337 0.4657 -0.0063 -0.0258 -0.0227 1391 ASN A O   
623  C CB  . ASN A 92  ? 0.6066 0.5082 0.4556 -0.0011 -0.0278 -0.0233 1391 ASN A CB  
624  C CG  . ASN A 92  ? 0.6328 0.5417 0.4736 0.0038  -0.0327 -0.0307 1391 ASN A CG  
625  O OD1 . ASN A 92  ? 0.5763 0.5068 0.4300 -0.0004 -0.0394 -0.0457 1391 ASN A OD1 
626  N ND2 . ASN A 92  ? 0.5276 0.4215 0.3491 0.0140  -0.0288 -0.0213 1391 ASN A ND2 
627  N N   . SER A 93  ? 0.6103 0.5182 0.4830 -0.0103 -0.0174 -0.0116 1392 SER A N   
628  C CA  . SER A 93  ? 0.6111 0.5306 0.4845 -0.0035 -0.0133 -0.0045 1392 SER A CA  
629  C C   . SER A 93  ? 0.6227 0.5696 0.5214 -0.0110 -0.0092 -0.0021 1392 SER A C   
630  O O   . SER A 93  ? 0.6478 0.6196 0.5498 -0.0033 -0.0091 -0.0002 1392 SER A O   
631  C CB  . SER A 93  ? 0.5885 0.4924 0.4533 -0.0006 -0.0083 0.0011  1392 SER A CB  
632  O OG  . SER A 93  ? 0.5436 0.4650 0.4077 0.0092  -0.0049 0.0059  1392 SER A OG  
633  N N   . LYS A 94  ? 0.5440 0.4864 0.4638 -0.0258 -0.0046 -0.0019 1393 LYS A N   
634  C CA  . LYS A 94  ? 0.6378 0.6039 0.5911 -0.0365 0.0030  0.0020  1393 LYS A CA  
635  C C   . LYS A 94  ? 0.5824 0.5811 0.5529 -0.0398 -0.0053 -0.0128 1393 LYS A C   
636  O O   . LYS A 94  ? 0.7127 0.7420 0.7080 -0.0439 -0.0007 -0.0105 1393 LYS A O   
637  C CB  . LYS A 94  ? 0.5706 0.5171 0.5480 -0.0523 0.0120  0.0050  1393 LYS A CB  
638  C CG  . LYS A 94  ? 0.9925 0.9542 1.0108 -0.0651 0.0265  0.0156  1393 LYS A CG  
639  C CD  . LYS A 94  ? 1.1588 1.0925 1.2061 -0.0823 0.0346  0.0133  1393 LYS A CD  
640  C CE  . LYS A 94  ? 1.0847 1.0207 1.1749 -0.0944 0.0559  0.0318  1393 LYS A CE  
641  N NZ  . LYS A 94  ? 1.0147 0.9225 1.1416 -0.1138 0.0614  0.0214  1393 LYS A NZ  
642  N N   . ALA A 95  ? 0.5846 0.5822 0.5427 -0.0364 -0.0172 -0.0279 1394 ALA A N   
643  C CA  . ALA A 95  ? 0.5273 0.5635 0.4974 -0.0343 -0.0271 -0.0442 1394 ALA A CA  
644  C C   . ALA A 95  ? 0.5710 0.6265 0.5194 -0.0136 -0.0298 -0.0375 1394 ALA A C   
645  O O   . ALA A 95  ? 0.5404 0.6369 0.5057 -0.0113 -0.0327 -0.0435 1394 ALA A O   
646  C CB  . ALA A 95  ? 0.5340 0.5702 0.4963 -0.0326 -0.0384 -0.0626 1394 ALA A CB  
647  N N   . TYR A 96  ? 0.5102 0.5373 0.4250 0.0011  -0.0283 -0.0264 1395 TYR A N   
648  C CA  . TYR A 96  ? 0.5214 0.5594 0.4169 0.0223  -0.0296 -0.0207 1395 TYR A CA  
649  C C   . TYR A 96  ? 0.5887 0.6366 0.4888 0.0267  -0.0225 -0.0111 1395 TYR A C   
650  O O   . TYR A 96  ? 0.5483 0.6198 0.4430 0.0428  -0.0237 -0.0096 1395 TYR A O   
651  C CB  . TYR A 96  ? 0.4984 0.5008 0.3631 0.0357  -0.0296 -0.0150 1395 TYR A CB  
652  C CG  . TYR A 96  ? 0.5685 0.5769 0.4157 0.0593  -0.0297 -0.0095 1395 TYR A CG  
653  C CD1 . TYR A 96  ? 0.5937 0.5829 0.4314 0.0688  -0.0246 -0.0033 1395 TYR A CD1 
654  C CD2 . TYR A 96  ? 0.5140 0.5513 0.3550 0.0749  -0.0351 -0.0120 1395 TYR A CD2 
655  C CE1 . TYR A 96  ? 0.6967 0.6871 0.5207 0.0916  -0.0235 0.0008  1395 TYR A CE1 
656  C CE2 . TYR A 96  ? 0.6138 0.6560 0.4389 0.0997  -0.0334 -0.0044 1395 TYR A CE2 
657  C CZ  . TYR A 96  ? 0.6016 0.6161 0.4189 0.1072  -0.0269 0.0024  1395 TYR A CZ  
658  O OH  . TYR A 96  ? 0.6839 0.6974 0.4868 0.1329  -0.0241 0.0092  1395 TYR A OH  
659  N N   . THR A 97  ? 0.6229 0.6558 0.5307 0.0160  -0.0146 -0.0038 1396 THR A N   
660  C CA  . THR A 97  ? 0.5828 0.6283 0.4909 0.0240  -0.0069 0.0063  1396 THR A CA  
661  C C   . THR A 97  ? 0.6389 0.6977 0.5779 0.0065  0.0034  0.0145  1396 THR A C   
662  O O   . THR A 97  ? 0.6522 0.6900 0.5889 0.0024  0.0107  0.0235  1396 THR A O   
663  C CB  . THR A 97  ? 0.6412 0.6563 0.5239 0.0350  -0.0055 0.0092  1396 THR A CB  
664  O OG1 . THR A 97  ? 0.6157 0.6082 0.4774 0.0465  -0.0121 0.0022  1396 THR A OG1 
665  C CG2 . THR A 97  ? 0.6312 0.6683 0.5107 0.0493  0.0004  0.0159  1396 THR A CG2 
666  N N   . PRO A 98  ? 0.5677 0.6619 0.5389 -0.0037 0.0049  0.0114  1397 PRO A N   
667  C CA  . PRO A 98  ? 0.6358 0.7367 0.6465 -0.0246 0.0176  0.0192  1397 PRO A CA  
668  C C   . PRO A 98  ? 0.6414 0.7626 0.6629 -0.0194 0.0343  0.0412  1397 PRO A C   
669  O O   . PRO A 98  ? 0.6555 0.7729 0.7070 -0.0341 0.0493  0.0544  1397 PRO A O   
670  C CB  . PRO A 98  ? 0.5262 0.6622 0.5741 -0.0391 0.0118  0.0020  1397 PRO A CB  
671  C CG  . PRO A 98  ? 0.6176 0.7840 0.6439 -0.0180 0.0004  -0.0054 1397 PRO A CG  
672  C CD  . PRO A 98  ? 0.5826 0.7103 0.5590 0.0019  -0.0052 -0.0017 1397 PRO A CD  
673  N N   . SER A 99  ? 0.6317 0.7745 0.6305 0.0028  0.0331  0.0460  1398 SER A N   
674  C CA  . SER A 99  ? 0.6509 0.8268 0.6600 0.0122  0.0487  0.0663  1398 SER A CA  
675  C C   . SER A 99  ? 0.6499 0.8064 0.6402 0.0224  0.0598  0.0842  1398 SER A C   
676  O O   . SER A 99  ? 0.5872 0.7177 0.5420 0.0355  0.0506  0.0764  1398 SER A O   
677  C CB  . SER A 99  ? 0.7227 0.9305 0.7110 0.0367  0.0423  0.0620  1398 SER A CB  
678  O OG  . SER A 99  ? 0.6280 0.8780 0.6291 0.0468  0.0575  0.0807  1398 SER A OG  
679  N N   . LYS A 100 ? 0.6273 0.8000 0.6437 0.0176  0.0807  0.1085  1399 LYS A N   
680  C CA  . LYS A 100 ? 0.6625 0.8274 0.6595 0.0335  0.0934  0.1294  1399 LYS A CA  
681  C C   . LYS A 100 ? 0.6637 0.8574 0.6239 0.0665  0.0892  0.1288  1399 LYS A C   
682  O O   . LYS A 100 ? 0.7188 0.9060 0.6488 0.0858  0.0888  0.1315  1399 LYS A O   
683  C CB  . LYS A 100 ? 0.6281 0.8047 0.6637 0.0239  0.1210  0.1612  1399 LYS A CB  
684  C CG  . LYS A 100 ? 0.7820 0.9316 0.8633 -0.0101 0.1255  0.1568  1399 LYS A CG  
685  C CD  . LYS A 100 ? 1.0410 1.1717 1.1512 -0.0182 0.1526  0.1875  1399 LYS A CD  
686  C CE  . LYS A 100 ? 1.1986 1.2953 1.3557 -0.0533 0.1530  0.1732  1399 LYS A CE  
687  N NZ  . LYS A 100 ? 1.0377 1.1195 1.2438 -0.0676 0.1842  0.2031  1399 LYS A NZ  
688  N N   . ARG A 101 ? 0.6154 0.8438 0.5787 0.0745  0.0850  0.1224  1400 ARG A N   
689  C CA  . ARG A 101 ? 0.6263 0.8811 0.5563 0.1068  0.0793  0.1164  1400 ARG A CA  
690  C C   . ARG A 101 ? 0.5896 0.8096 0.4833 0.1174  0.0592  0.0898  1400 ARG A C   
691  O O   . ARG A 101 ? 0.6355 0.8682 0.5019 0.1435  0.0549  0.0820  1400 ARG A O   
692  C CB  . ARG A 101 ? 0.6788 0.9749 0.6207 0.1130  0.0778  0.1126  1400 ARG A CB  
693  C CG  . ARG A 101 ? 0.8469 1.1913 0.8261 0.1083  0.1008  0.1408  1400 ARG A CG  
694  C CD  . ARG A 101 ? 1.0863 1.4705 1.0937 0.1016  0.0989  0.1348  1400 ARG A CD  
695  N NE  . ARG A 101 ? 1.2346 1.6464 1.2127 0.1318  0.0877  0.1213  1400 ARG A NE  
696  C CZ  . ARG A 101 ? 1.3646 1.8151 1.3233 0.1628  0.0955  0.1315  1400 ARG A CZ  
697  N NH1 . ARG A 101 ? 1.2097 1.6798 1.1715 0.1708  0.1156  0.1587  1400 ARG A NH1 
698  N NH2 . ARG A 101 ? 1.0256 1.4959 0.9598 0.1896  0.0836  0.1146  1400 ARG A NH2 
699  N N   . SER A 102 ? 0.5959 0.7748 0.4917 0.0980  0.0475  0.0746  1401 SER A N   
700  C CA  . SER A 102 ? 0.6018 0.7476 0.4702 0.1060  0.0309  0.0509  1401 SER A CA  
701  C C   . SER A 102 ? 0.6493 0.7746 0.5005 0.1109  0.0298  0.0478  1401 SER A C   
702  O O   . SER A 102 ? 0.7000 0.8112 0.5604 0.0971  0.0368  0.0598  1401 SER A O   
703  C CB  . SER A 102 ? 0.5608 0.6733 0.4360 0.0866  0.0210  0.0393  1401 SER A CB  
704  O OG  . SER A 102 ? 0.6024 0.6812 0.4551 0.0940  0.0095  0.0213  1401 SER A OG  
705  N N   . ARG A 103 ? 0.6378 0.7608 0.4662 0.1305  0.0201  0.0287  1402 ARG A N   
706  C CA  . ARG A 103 ? 0.6591 0.7709 0.4731 0.1369  0.0163  0.0194  1402 ARG A CA  
707  C C   . ARG A 103 ? 0.6369 0.7042 0.4554 0.1147  0.0106  0.0127  1402 ARG A C   
708  O O   . ARG A 103 ? 0.8192 0.8802 0.6334 0.1133  0.0118  0.0141  1402 ARG A O   
709  C CB  . ARG A 103 ? 0.6554 0.7765 0.4512 0.1609  0.0055  -0.0072 1402 ARG A CB  
710  C CG  . ARG A 103 ? 0.8170 0.9036 0.6138 0.1561  -0.0054 -0.0289 1402 ARG A CG  
711  C CD  . ARG A 103 ? 0.7116 0.8042 0.4974 0.1784  -0.0146 -0.0575 1402 ARG A CD  
712  N NE  . ARG A 103 ? 0.8118 0.9471 0.5893 0.2036  -0.0118 -0.0557 1402 ARG A NE  
713  C CZ  . ARG A 103 ? 1.0270 1.1733 0.7952 0.2276  -0.0198 -0.0825 1402 ARG A CZ  
714  N NH1 . ARG A 103 ? 1.1431 1.2580 0.9141 0.2268  -0.0307 -0.1145 1402 ARG A NH1 
715  N NH2 . ARG A 103 ? 0.7810 0.9706 0.5403 0.2523  -0.0163 -0.0786 1402 ARG A NH2 
716  N N   . ILE A 104 ? 0.6481 0.6891 0.4742 0.1002  0.0051  0.0067  1403 ILE A N   
717  C CA  . ILE A 104 ? 0.5800 0.5824 0.4098 0.0808  0.0008  0.0022  1403 ILE A CA  
718  C C   . ILE A 104 ? 0.5831 0.5839 0.4266 0.0640  0.0092  0.0198  1403 ILE A C   
719  O O   . ILE A 104 ? 0.6189 0.5990 0.4611 0.0556  0.0088  0.0191  1403 ILE A O   
720  C CB  . ILE A 104 ? 0.7190 0.6999 0.5507 0.0749  -0.0051 -0.0050 1403 ILE A CB  
721  C CG1 . ILE A 104 ? 0.6947 0.6687 0.5162 0.0925  -0.0108 -0.0213 1403 ILE A CG1 
722  C CG2 . ILE A 104 ? 0.6213 0.5687 0.4551 0.0584  -0.0079 -0.0073 1403 ILE A CG2 
723  C CD1 . ILE A 104 ? 0.6338 0.5864 0.4511 0.0947  -0.0154 -0.0390 1403 ILE A CD1 
724  N N   . TYR A 105 ? 0.5848 0.6082 0.4449 0.0596  0.0181  0.0350  1404 TYR A N   
725  C CA  . TYR A 105 ? 0.5980 0.6171 0.4784 0.0434  0.0287  0.0509  1404 TYR A CA  
726  C C   . TYR A 105 ? 0.6417 0.6589 0.5123 0.0523  0.0364  0.0618  1404 TYR A C   
727  O O   . TYR A 105 ? 0.7580 0.7503 0.6323 0.0414  0.0380  0.0640  1404 TYR A O   
728  C CB  . TYR A 105 ? 0.6253 0.6756 0.5316 0.0389  0.0402  0.0660  1404 TYR A CB  
729  C CG  . TYR A 105 ? 0.6426 0.6874 0.5808 0.0199  0.0545  0.0822  1404 TYR A CG  
730  C CD1 . TYR A 105 ? 0.6589 0.7088 0.6016 0.0269  0.0722  0.1064  1404 TYR A CD1 
731  C CD2 . TYR A 105 ? 0.6687 0.7064 0.6356 -0.0029 0.0515  0.0731  1404 TYR A CD2 
732  C CE1 . TYR A 105 ? 0.8301 0.8681 0.8084 0.0087  0.0890  0.1234  1404 TYR A CE1 
733  C CE2 . TYR A 105 ? 0.7170 0.7472 0.7213 -0.0224 0.0650  0.0834  1404 TYR A CE2 
734  C CZ  . TYR A 105 ? 0.8308 0.8568 0.8422 -0.0177 0.0848  0.1096  1404 TYR A CZ  
735  O OH  . TYR A 105 ? 0.9476 0.9593 1.0008 -0.0377 0.1005  0.1203  1404 TYR A OH  
736  N N   . SER A 106 ? 0.6393 0.6869 0.4960 0.0755  0.0410  0.0680  1405 SER A N   
737  C CA  . SER A 106 ? 0.6242 0.6820 0.4682 0.0913  0.0491  0.0801  1405 SER A CA  
738  C C   . SER A 106 ? 0.6481 0.6839 0.4762 0.0917  0.0369  0.0611  1405 SER A C   
739  O O   . SER A 106 ? 0.6640 0.6917 0.4899 0.0929  0.0431  0.0716  1405 SER A O   
740  C CB  . SER A 106 ? 0.6000 0.7039 0.4270 0.1221  0.0532  0.0849  1405 SER A CB  
741  O OG  . SER A 106 ? 0.7910 0.9209 0.6299 0.1245  0.0605  0.0952  1405 SER A OG  
742  N N   . MET A 107 ? 0.5673 0.5948 0.3865 0.0923  0.0214  0.0344  1406 MET A N   
743  C CA  . MET A 107 ? 0.5453 0.5540 0.3563 0.0900  0.0104  0.0139  1406 MET A CA  
744  C C   . MET A 107 ? 0.5198 0.4943 0.3403 0.0685  0.0119  0.0197  1406 MET A C   
745  O O   . MET A 107 ? 0.6600 0.6285 0.4757 0.0693  0.0115  0.0185  1406 MET A O   
746  C CB  . MET A 107 ? 0.4532 0.4488 0.2631 0.0888  -0.0024 -0.0125 1406 MET A CB  
747  C CG  . MET A 107 ? 0.7046 0.7278 0.5059 0.1104  -0.0072 -0.0277 1406 MET A CG  
748  S SD  . MET A 107 ? 0.7813 0.7747 0.5883 0.1063  -0.0189 -0.0576 1406 MET A SD  
749  C CE  A MET A 107 ? 0.5303 0.4917 0.3460 0.0867  -0.0224 -0.0661 1406 MET A CE  
750  C CE  B MET A 107 ? 1.0616 1.0925 0.8589 0.1357  -0.0228 -0.0737 1406 MET A CE  
751  N N   . SER A 108 ? 0.4849 0.4414 0.3183 0.0515  0.0126  0.0237  1407 SER A N   
752  C CA  . SER A 108 ? 0.5783 0.5072 0.4211 0.0332  0.0131  0.0260  1407 SER A CA  
753  C C   . SER A 108 ? 0.5665 0.4938 0.4163 0.0323  0.0253  0.0448  1407 SER A C   
754  O O   . SER A 108 ? 0.5903 0.4979 0.4390 0.0267  0.0249  0.0437  1407 SER A O   
755  C CB  . SER A 108 ? 0.6274 0.5502 0.4835 0.0198  0.0110  0.0246  1407 SER A CB  
756  O OG  . SER A 108 ? 0.8301 0.7326 0.6970 0.0039  0.0112  0.0246  1407 SER A OG  
757  N N   . LEU A 109 ? 0.6028 0.5495 0.4616 0.0385  0.0380  0.0639  1408 LEU A N   
758  C CA  . LEU A 109 ? 0.6901 0.6308 0.5590 0.0394  0.0540  0.0865  1408 LEU A CA  
759  C C   . LEU A 109 ? 0.6092 0.5573 0.4559 0.0595  0.0549  0.0899  1408 LEU A C   
760  O O   . LEU A 109 ? 0.6397 0.5686 0.4886 0.0581  0.0611  0.0986  1408 LEU A O   
761  C CB  . LEU A 109 ? 0.7013 0.6634 0.5884 0.0430  0.0718  0.1111  1408 LEU A CB  
762  C CG  . LEU A 109 ? 0.9097 0.8588 0.8345 0.0180  0.0793  0.1155  1408 LEU A CG  
763  C CD1 . LEU A 109 ? 0.7373 0.7083 0.6853 0.0221  0.1021  0.1451  1408 LEU A CD1 
764  C CD2 . LEU A 109 ? 1.0332 0.9430 0.9736 0.0000  0.0799  0.1104  1408 LEU A CD2 
765  N N   . ARG A 110 ? 0.6589 0.6373 0.4853 0.0798  0.0476  0.0800  1409 ARG A N   
766  C CA  . ARG A 110 ? 0.6410 0.6395 0.4474 0.1026  0.0469  0.0795  1409 ARG A CA  
767  C C   . ARG A 110 ? 0.6098 0.5857 0.4134 0.0922  0.0356  0.0609  1409 ARG A C   
768  O O   . ARG A 110 ? 0.7218 0.6975 0.5185 0.1015  0.0398  0.0684  1409 ARG A O   
769  C CB  . ARG A 110 ? 0.6383 0.6789 0.4273 0.1258  0.0380  0.0636  1409 ARG A CB  
770  C CG  . ARG A 110 ? 0.6051 0.6814 0.3895 0.1473  0.0521  0.0869  1409 ARG A CG  
771  C CD  . ARG A 110 ? 0.6021 0.7281 0.3655 0.1772  0.0429  0.0690  1409 ARG A CD  
772  N NE  . ARG A 110 ? 0.5716 0.6904 0.3383 0.1670  0.0252  0.0353  1409 ARG A NE  
773  C CZ  . ARG A 110 ? 0.6203 0.7476 0.3906 0.1678  0.0251  0.0335  1409 ARG A CZ  
774  N NH1 . ARG A 110 ? 0.6603 0.7753 0.4334 0.1608  0.0101  0.0032  1409 ARG A NH1 
775  N NH2 . ARG A 110 ? 0.7472 0.8951 0.5206 0.1762  0.0415  0.0628  1409 ARG A NH2 
776  N N   . LEU A 111 ? 0.6223 0.5813 0.4312 0.0751  0.0225  0.0383  1410 LEU A N   
777  C CA  . LEU A 111 ? 0.6526 0.5931 0.4615 0.0645  0.0128  0.0208  1410 LEU A CA  
778  C C   . LEU A 111 ? 0.6237 0.5336 0.4406 0.0508  0.0192  0.0329  1410 LEU A C   
779  O O   . LEU A 111 ? 0.6134 0.5165 0.4265 0.0513  0.0172  0.0286  1410 LEU A O   
780  C CB  . LEU A 111 ? 0.5771 0.5046 0.3918 0.0513  0.0020  0.0003  1410 LEU A CB  
781  C CG  . LEU A 111 ? 0.6650 0.5821 0.4827 0.0434  -0.0069 -0.0199 1410 LEU A CG  
782  C CD1 . LEU A 111 ? 0.6143 0.5622 0.4280 0.0585  -0.0129 -0.0370 1410 LEU A CD1 
783  C CD2 . LEU A 111 ? 0.5544 0.4538 0.3796 0.0325  -0.0113 -0.0297 1410 LEU A CD2 
784  N N   . SER A 112 ? 0.5862 0.4804 0.4171 0.0388  0.0266  0.0452  1411 SER A N   
785  C CA  . SER A 112 ? 0.6163 0.4819 0.4592 0.0263  0.0325  0.0524  1411 SER A CA  
786  C C   . SER A 112 ? 0.6019 0.4672 0.4411 0.0410  0.0452  0.0714  1411 SER A C   
787  O O   . SER A 112 ? 0.6506 0.4993 0.4869 0.0406  0.0447  0.0689  1411 SER A O   
788  C CB  . SER A 112 ? 0.6756 0.5308 0.5411 0.0106  0.0380  0.0579  1411 SER A CB  
789  O OG  . SER A 112 ? 0.6315 0.4595 0.5123 -0.0002 0.0435  0.0603  1411 SER A OG  
790  N N   . ALA A 113 ? 0.5804 0.4667 0.4179 0.0572  0.0576  0.0918  1412 ALA A N   
791  C CA  . ALA A 113 ? 0.6647 0.5532 0.4971 0.0772  0.0741  0.1172  1412 ALA A CA  
792  C C   . ALA A 113 ? 0.6571 0.5590 0.4672 0.0939  0.0656  0.1069  1412 ALA A C   
793  O O   . ALA A 113 ? 0.6583 0.5458 0.4659 0.1023  0.0737  0.1185  1412 ALA A O   
794  C CB  . ALA A 113 ? 0.5592 0.4792 0.3881 0.0980  0.0891  0.1423  1412 ALA A CB  
795  N N   . PHE A 114 ? 0.5738 0.5031 0.3713 0.0978  0.0493  0.0831  1413 PHE A N   
796  C CA  . PHE A 114 ? 0.6100 0.5616 0.3927 0.1111  0.0388  0.0666  1413 PHE A CA  
797  C C   . PHE A 114 ? 0.6078 0.5306 0.3969 0.0937  0.0325  0.0543  1413 PHE A C   
798  O O   . PHE A 114 ? 0.6140 0.5415 0.3953 0.1056  0.0340  0.0566  1413 PHE A O   
799  C CB  . PHE A 114 ? 0.6471 0.6288 0.4264 0.1120  0.0228  0.0384  1413 PHE A CB  
800  C CG  . PHE A 114 ? 0.4669 0.4809 0.2386 0.1247  0.0114  0.0162  1413 PHE A CG  
801  C CD1 . PHE A 114 ? 0.5703 0.6307 0.3252 0.1572  0.0135  0.0209  1413 PHE A CD1 
802  C CD2 . PHE A 114 ? 0.6023 0.6054 0.3856 0.1057  -0.0004 -0.0088 1413 PHE A CD2 
803  C CE1 . PHE A 114 ? 0.5730 0.6722 0.3245 0.1694  0.0010  -0.0045 1413 PHE A CE1 
804  C CE2 . PHE A 114 ? 0.4289 0.4658 0.2129 0.1146  -0.0104 -0.0317 1413 PHE A CE2 
805  C CZ  . PHE A 114 ? 0.4920 0.5791 0.2610 0.1460  -0.0110 -0.0321 1413 PHE A CZ  
806  N N   . PHE A 115 ? 0.5861 0.4846 0.3874 0.0688  0.0252  0.0409  1414 PHE A N   
807  C CA  . PHE A 115 ? 0.5237 0.3956 0.3305 0.0541  0.0216  0.0329  1414 PHE A CA  
808  C C   . PHE A 115 ? 0.6130 0.4609 0.4217 0.0586  0.0336  0.0504  1414 PHE A C   
809  O O   . PHE A 115 ? 0.6681 0.5143 0.4705 0.0659  0.0331  0.0482  1414 PHE A O   
810  C CB  . PHE A 115 ? 0.5704 0.4215 0.3882 0.0319  0.0159  0.0231  1414 PHE A CB  
811  C CG  . PHE A 115 ? 0.5721 0.4023 0.3927 0.0207  0.0125  0.0151  1414 PHE A CG  
812  C CD1 . PHE A 115 ? 0.6330 0.4727 0.4497 0.0204  0.0059  0.0024  1414 PHE A CD1 
813  C CD2 . PHE A 115 ? 0.6516 0.4567 0.4810 0.0122  0.0168  0.0194  1414 PHE A CD2 
814  C CE1 . PHE A 115 ? 0.6238 0.4498 0.4411 0.0139  0.0044  -0.0023 1414 PHE A CE1 
815  C CE2 . PHE A 115 ? 0.5957 0.3876 0.4248 0.0067  0.0131  0.0102  1414 PHE A CE2 
816  C CZ  . PHE A 115 ? 0.7460 0.5491 0.5669 0.0087  0.0074  0.0012  1414 PHE A CZ  
817  N N   . GLU A 116 ? 0.5817 0.4109 0.4028 0.0544  0.0453  0.0672  1415 GLU A N   
818  C CA  . GLU A 116 ? 0.6075 0.4052 0.4385 0.0549  0.0578  0.0806  1415 GLU A CA  
819  C C   . GLU A 116 ? 0.6053 0.4134 0.4213 0.0825  0.0681  0.0987  1415 GLU A C   
820  O O   . GLU A 116 ? 0.7874 0.5729 0.6040 0.0871  0.0733  0.1021  1415 GLU A O   
821  C CB  . GLU A 116 ? 0.6417 0.4192 0.4974 0.0436  0.0711  0.0952  1415 GLU A CB  
822  C CG  . GLU A 116 ? 0.7200 0.4918 0.5926 0.0185  0.0610  0.0769  1415 GLU A CG  
823  C CD  . GLU A 116 ? 0.8097 0.5590 0.6885 0.0044  0.0514  0.0557  1415 GLU A CD  
824  O OE1 . GLU A 116 ? 0.7870 0.5147 0.6665 0.0097  0.0563  0.0570  1415 GLU A OE1 
825  O OE2 . GLU A 116 ? 0.6852 0.4411 0.5665 -0.0087 0.0392  0.0381  1415 GLU A OE2 
826  N N   . GLU A 117 ? 0.6091 0.9786 0.4939 -0.1352 0.1751  0.1081  1416 GLU A N   
827  C CA  . GLU A 117 ? 0.7305 1.0527 0.4871 -0.1102 0.1956  0.1860  1416 GLU A CA  
828  C C   . GLU A 117 ? 0.6246 0.9675 0.3382 -0.0808 0.1194  0.1949  1416 GLU A C   
829  O O   . GLU A 117 ? 0.8181 1.1280 0.4785 -0.0465 0.1178  0.2448  1416 GLU A O   
830  C CB  . GLU A 117 ? 0.8078 1.1388 0.4306 -0.0868 0.2185  0.2033  1416 GLU A CB  
831  C CG  . GLU A 117 ? 1.1701 1.4441 0.7673 -0.0948 0.3328  0.2317  1416 GLU A CG  
832  C CD  . GLU A 117 ? 1.4665 1.7439 0.8969 -0.0535 0.3425  0.2376  1416 GLU A CD  
833  O OE1 . GLU A 117 ? 1.3391 1.5839 0.7641 -0.0640 0.4470  0.2439  1416 GLU A OE1 
834  O OE2 . GLU A 117 ? 1.3709 1.6883 0.6921 -0.0118 0.2498  0.2232  1416 GLU A OE2 
835  N N   . HIS A 118 ? 0.5845 0.9729 0.3194 -0.0888 0.0697  0.1446  1417 HIS A N   
836  C CA  . HIS A 118 ? 0.5326 0.9537 0.2630 -0.0755 0.0252  0.1402  1417 HIS A CA  
837  C C   . HIS A 118 ? 0.5759 0.9543 0.3673 -0.0727 0.0217  0.1376  1417 HIS A C   
838  O O   . HIS A 118 ? 0.5005 0.8976 0.3110 -0.0556 0.0075  0.1516  1417 HIS A O   
839  C CB  . HIS A 118 ? 0.5761 1.0460 0.2905 -0.0936 0.0021  0.0844  1417 HIS A CB  
840  C CG  . HIS A 118 ? 0.4955 1.0119 0.1249 -0.0755 -0.0138 0.0792  1417 HIS A CG  
841  N ND1 . HIS A 118 ? 0.6908 1.1832 0.2595 -0.0794 0.0168  0.0729  1417 HIS A ND1 
842  C CD2 . HIS A 118 ? 0.6516 1.2294 0.2248 -0.0306 -0.0591 0.0799  1417 HIS A CD2 
843  C CE1 . HIS A 118 ? 0.8699 1.3867 0.3278 -0.0411 0.0001  0.0758  1417 HIS A CE1 
844  N NE2 . HIS A 118 ? 0.8169 1.3858 0.2665 -0.0035 -0.0553 0.0765  1417 HIS A NE2 
845  N N   . ILE A 119 ? 0.5267 0.8539 0.3462 -0.0747 0.0295  0.1111  1418 ILE A N   
846  C CA  . ILE A 119 ? 0.5783 0.8434 0.4099 -0.0485 0.0199  0.1033  1418 ILE A CA  
847  C C   . ILE A 119 ? 0.6423 0.8776 0.5071 -0.0359 0.0232  0.1398  1418 ILE A C   
848  O O   . ILE A 119 ? 0.7816 0.9838 0.6379 -0.0085 0.0193  0.1540  1418 ILE A O   
849  C CB  . ILE A 119 ? 0.5873 0.8001 0.4028 -0.0198 0.0044  0.0469  1418 ILE A CB  
850  C CG1 . ILE A 119 ? 0.6864 0.7968 0.4297 0.0328  0.0042  0.0403  1418 ILE A CG1 
851  C CG2 . ILE A 119 ? 0.3895 0.6263 0.2971 -0.0238 -0.0087 0.0101  1418 ILE A CG2 
852  C CD1 . ILE A 119 ? 0.6461 0.7190 0.3370 0.0219  0.0523  0.0573  1418 ILE A CD1 
853  N N   . SER A 120 ? 0.6446 0.8732 0.5412 -0.0555 0.0488  0.1566  1419 SER A N   
854  C CA  . SER A 120 ? 0.7499 0.9131 0.6503 -0.0448 0.0753  0.2034  1419 SER A CA  
855  C C   . SER A 120 ? 0.6886 0.8553 0.5357 0.0009  0.0564  0.2491  1419 SER A C   
856  O O   . SER A 120 ? 0.7923 0.9021 0.6493 0.0271  0.0527  0.2555  1419 SER A O   
857  C CB  . SER A 120 ? 0.7382 0.8658 0.6102 -0.0618 0.1413  0.2493  1419 SER A CB  
858  O OG  . SER A 120 ? 1.0233 1.1689 0.9822 -0.1112 0.1788  0.2010  1419 SER A OG  
859  N N   . SER A 121 ? 0.6843 0.9294 0.4857 0.0173  0.0397  0.2673  1420 SER A N   
860  C CA  . SER A 121 ? 0.7081 1.0035 0.4954 0.0710  0.0115  0.2899  1420 SER A CA  
861  C C   . SER A 121 ? 0.6462 0.9759 0.5080 0.0655  0.0028  0.2529  1420 SER A C   
862  O O   . SER A 121 ? 0.8389 1.1888 0.7283 0.1084  -0.0021 0.2654  1420 SER A O   
863  C CB  . SER A 121 ? 0.6926 1.0954 0.4363 0.0964  -0.0255 0.2811  1420 SER A CB  
864  O OG  . SER A 121 ? 0.9264 1.2735 0.5747 0.0918  0.0046  0.3074  1420 SER A OG  
865  N N   . VAL A 122 ? 0.5451 0.8681 0.4254 0.0235  0.0134  0.2090  1421 VAL A N   
866  C CA  . VAL A 122 ? 0.5945 0.9049 0.5075 0.0223  0.0386  0.1814  1421 VAL A CA  
867  C C   . VAL A 122 ? 0.6700 0.8685 0.5499 0.0635  0.0515  0.1984  1421 VAL A C   
868  O O   . VAL A 122 ? 0.6377 0.8212 0.5356 0.0920  0.0807  0.2033  1421 VAL A O   
869  C CB  . VAL A 122 ? 0.6181 0.8842 0.5000 -0.0103 0.0631  0.1401  1421 VAL A CB  
870  C CG1 . VAL A 122 ? 0.6416 0.8224 0.5103 0.0028  0.1262  0.1276  1421 VAL A CG1 
871  C CG2 . VAL A 122 ? 0.5897 0.9577 0.5084 -0.0532 0.0526  0.1096  1421 VAL A CG2 
872  N N   . LEU A 123 ? 0.6262 0.7522 0.4731 0.0661  0.0333  0.1939  1422 LEU A N   
873  C CA  . LEU A 123 ? 0.6989 0.7181 0.5173 0.1075  0.0278  0.1843  1422 LEU A CA  
874  C C   . LEU A 123 ? 0.6896 0.6909 0.5228 0.1327  0.0339  0.2299  1422 LEU A C   
875  O O   . LEU A 123 ? 0.7946 0.7334 0.6015 0.1802  0.0433  0.2342  1422 LEU A O   
876  C CB  . LEU A 123 ? 0.5840 0.5653 0.4172 0.0961  -0.0027 0.1314  1422 LEU A CB  
877  C CG  . LEU A 123 ? 0.6158 0.5929 0.4094 0.1091  -0.0241 0.0747  1422 LEU A CG  
878  C CD1 . LEU A 123 ? 0.4536 0.4551 0.3311 0.0950  -0.0634 0.0033  1422 LEU A CD1 
879  C CD2 . LEU A 123 ? 0.7178 0.5780 0.3831 0.1905  -0.0223 0.0561  1422 LEU A CD2 
880  N N   . SER A 124 ? 0.7112 0.7388 0.5561 0.1155  0.0377  0.2665  1423 SER A N   
881  C CA  . SER A 124 ? 0.8015 0.7760 0.6170 0.1602  0.0518  0.3194  1423 SER A CA  
882  C C   . SER A 124 ? 0.8150 0.8673 0.6407 0.2175  0.0420  0.3359  1423 SER A C   
883  O O   . SER A 124 ? 1.0070 0.9957 0.8125 0.2727  0.0513  0.3574  1423 SER A O   
884  C CB  . SER A 124 ? 0.9098 0.8644 0.6773 0.1552  0.0762  0.3668  1423 SER A CB  
885  O OG  A SER A 124 ? 0.9944 0.9113 0.8095 0.0859  0.0994  0.3282  1423 SER A OG  
886  O OG  B SER A 124 ? 0.8739 0.8647 0.5807 0.2356  0.0611  0.4151  1423 SER A OG  
887  N N   . ASP A 125 ? 0.7492 0.9425 0.6280 0.2019  0.0288  0.3126  1424 ASP A N   
888  C CA  . ASP A 125 ? 0.7803 1.0916 0.7381 0.2424  0.0276  0.2999  1424 ASP A CA  
889  C C   . ASP A 125 ? 0.8297 1.0798 0.8110 0.2467  0.0789  0.2818  1424 ASP A C   
890  O O   . ASP A 125 ? 0.8679 1.1680 0.9100 0.2941  0.1008  0.2817  1424 ASP A O   
891  C CB  . ASP A 125 ? 0.7521 1.2378 0.8034 0.2078  0.0062  0.2506  1424 ASP A CB  
892  C CG  . ASP A 125 ? 0.8757 1.4356 0.8748 0.2430  -0.0545 0.2621  1424 ASP A CG  
893  O OD1 . ASP A 125 ? 0.8837 1.3326 0.7549 0.2908  -0.0576 0.3236  1424 ASP A OD1 
894  O OD2 . ASP A 125 ? 0.6621 1.3749 0.7382 0.2266  -0.0905 0.2036  1424 ASP A OD2 
895  N N   . TYR A 126 ? 0.8080 0.9474 0.7277 0.2134  0.1004  0.2628  1425 TYR A N   
896  C CA  . TYR A 126 ? 0.8253 0.8466 0.6891 0.2464  0.1542  0.2518  1425 TYR A CA  
897  C C   . TYR A 126 ? 0.9514 0.8533 0.7435 0.3125  0.1422  0.2705  1425 TYR A C   
898  O O   . TYR A 126 ? 0.9840 0.8634 0.7771 0.3654  0.1879  0.2819  1425 TYR A O   
899  C CB  . TYR A 126 ? 0.8212 0.7397 0.5904 0.2301  0.1629  0.2216  1425 TYR A CB  
900  C CG  . TYR A 126 ? 0.9042 0.6461 0.5339 0.3011  0.2127  0.2131  1425 TYR A CG  
901  C CD1 . TYR A 126 ? 1.0523 0.7517 0.6744 0.3171  0.3216  0.2234  1425 TYR A CD1 
902  C CD2 . TYR A 126 ? 1.0002 0.6113 0.5028 0.3591  0.1566  0.1832  1425 TYR A CD2 
903  C CE1 . TYR A 126 ? 1.1812 0.6724 0.6171 0.4051  0.3868  0.2269  1425 TYR A CE1 
904  C CE2 . TYR A 126 ? 1.1312 0.5602 0.4520 0.4569  0.1877  0.1683  1425 TYR A CE2 
905  C CZ  . TYR A 126 ? 1.3992 0.7484 0.6586 0.4874  0.3092  0.2015  1425 TYR A CZ  
906  O OH  . TYR A 126 ? 1.5804 0.7045 0.6026 0.6070  0.3560  0.1967  1425 TYR A OH  
907  N N   . LYS A 127 ? 0.9225 0.7512 0.6730 0.3045  0.0924  0.2648  1426 LYS A N   
908  C CA  . LYS A 127 ? 1.0301 0.7279 0.7273 0.3528  0.0792  0.2632  1426 LYS A CA  
909  C C   . LYS A 127 ? 1.0865 0.8028 0.8013 0.4042  0.1005  0.3134  1426 LYS A C   
910  O O   . LYS A 127 ? 1.2461 0.8645 0.9070 0.4683  0.1172  0.3138  1426 LYS A O   
911  C CB  . LYS A 127 ? 0.9779 0.6196 0.6964 0.3081  0.0453  0.2394  1426 LYS A CB  
912  C CG  . LYS A 127 ? 1.2455 0.8881 0.9793 0.2693  0.0072  0.1654  1426 LYS A CG  
913  C CD  . LYS A 127 ? 1.4630 0.9971 1.1231 0.3319  -0.0352 0.0857  1426 LYS A CD  
914  C CE  . LYS A 127 ? 1.4269 0.9981 1.1191 0.3134  -0.0923 -0.0026 1426 LYS A CE  
915  N NZ  . LYS A 127 ? 1.4466 0.9215 1.0413 0.4070  -0.1600 -0.0992 1426 LYS A NZ  
916  N N   . SER A 128 ? 1.0779 0.9134 0.8489 0.3951  0.0925  0.3496  1427 SER A N   
917  C CA  . SER A 128 ? 1.1900 1.0521 0.9635 0.4727  0.0963  0.3900  1427 SER A CA  
918  C C   . SER A 128 ? 1.1555 1.1565 1.0247 0.5109  0.1250  0.3724  1427 SER A C   
919  O O   . SER A 128 ? 1.3159 1.3104 1.1883 0.5927  0.1413  0.3881  1427 SER A O   
920  C CB  . SER A 128 ? 1.2521 1.1609 1.0019 0.4878  0.0688  0.4309  1427 SER A CB  
921  O OG  . SER A 128 ? 1.2867 1.4002 1.1211 0.4779  0.0388  0.4093  1427 SER A OG  
922  N N   . ALA A 129 ? 1.0202 1.1347 0.9778 0.4512  0.1469  0.3347  1428 ALA A N   
923  C CA  . ALA A 129 ? 1.0471 1.2726 1.1308 0.4640  0.2133  0.3044  1428 ALA A CA  
924  C C   . ALA A 129 ? 1.1672 1.2177 1.1530 0.5125  0.2866  0.3142  1428 ALA A C   
925  O O   . ALA A 129 ? 1.2224 1.3248 1.2883 0.5588  0.3553  0.3073  1428 ALA A O   
926  C CB  . ALA A 129 ? 1.0139 1.3435 1.2036 0.3767  0.2490  0.2576  1428 ALA A CB  
927  N N   . LEU A 130 ? 1.1737 1.0260 0.9910 0.5131  0.2681  0.3189  1429 LEU A N   
928  C CA  . LEU A 130 ? 1.3210 0.9796 0.9925 0.5889  0.3032  0.3193  1429 LEU A CA  
929  C C   . LEU A 130 ? 1.4540 1.0620 1.1008 0.6679  0.2850  0.3432  1429 LEU A C   
930  O O   . LEU A 130 ? 1.6192 1.0654 1.1412 0.7400  0.3115  0.3370  1429 LEU A O   
931  C CB  . LEU A 130 ? 1.3599 0.8514 0.8765 0.5853  0.2527  0.2870  1429 LEU A CB  
932  C CG  . LEU A 130 ? 1.5074 0.9718 0.9674 0.5505  0.2680  0.2607  1429 LEU A CG  
933  C CD1 . LEU A 130 ? 1.4767 0.7522 0.7438 0.6158  0.2130  0.2090  1429 LEU A CD1 
934  C CD2 . LEU A 130 ? 1.3765 0.8545 0.8568 0.5503  0.3952  0.2761  1429 LEU A CD2 
935  N N   . ARG A 131 ? 1.4120 1.1301 1.1424 0.6721  0.2415  0.3695  1430 ARG A N   
936  C CA  . ARG A 131 ? 1.5514 1.2122 1.2455 0.7643  0.2369  0.3987  1430 ARG A CA  
937  C C   . ARG A 131 ? 1.5643 1.4531 1.4122 0.8165  0.2418  0.4067  1430 ARG A C   
938  O O   . ARG A 131 ? 1.6527 1.6127 1.5111 0.8431  0.1827  0.4289  1430 ARG A O   
939  C CB  . ARG A 131 ? 1.5504 1.0699 1.1528 0.7516  0.1834  0.4203  1430 ARG A CB  
940  N N   . PHE A 132 ? 1.5572 1.5631 1.5268 0.8400  0.3153  0.3792  1431 PHE A N   
941  C CA  . PHE A 132 ? 1.5668 1.8217 1.7302 0.9068  0.3113  0.3567  1431 PHE A CA  
942  C C   . PHE A 132 ? 1.6314 1.9382 1.9043 0.9587  0.4240  0.3309  1431 PHE A C   
943  O O   . PHE A 132 ? 1.6527 1.8598 1.8983 0.9120  0.5304  0.3225  1431 PHE A O   
944  C CB  . PHE A 132 ? 1.3486 1.8639 1.7038 0.8373  0.2663  0.3062  1431 PHE A CB  
952  O O   . HOH C .   ? 0.8199 0.7314 0.5582 0.0695  0.0039  -0.0333 2    HOH A O   
953  O O   . HOH C .   ? 0.5040 0.8215 0.5559 -0.0097 0.1829  0.1070  3    HOH A O   
954  O O   . HOH C .   ? 0.5738 0.7108 0.5058 0.0454  0.0051  0.0209  4    HOH A O   
955  O O   . HOH C .   ? 0.7624 0.4599 0.6188 0.0043  0.0050  -0.0588 5    HOH A O   
956  O O   . HOH C .   ? 0.5744 0.5463 0.4759 0.0037  0.0103  0.0249  6    HOH A O   
957  O O   . HOH C .   ? 0.5756 0.3944 0.4553 -0.0359 -0.0291 -0.0765 8    HOH A O   
958  O O   . HOH C .   ? 0.8130 0.6033 0.6953 -0.0185 0.0282  0.0302  9    HOH A O   
959  O O   . HOH C .   ? 0.7874 0.6041 0.6977 0.0079  0.0789  0.1048  10   HOH A O   
960  O O   . HOH C .   ? 0.8572 0.6186 0.9143 -0.0980 -0.0879 -0.1340 11   HOH A O   
961  O O   . HOH C .   ? 0.6426 0.5813 0.5499 -0.0312 -0.0442 -0.0762 12   HOH A O   
962  O O   . HOH C .   ? 0.5993 0.6737 0.5739 -0.0843 -0.0990 -0.1129 14   HOH A O   
963  O O   . HOH C .   ? 0.5563 0.6608 0.5737 0.2876  0.0286  0.0272  15   HOH A O   
964  O O   . HOH C .   ? 0.5999 0.5937 0.4370 0.0263  -0.0574 -0.0735 16   HOH A O   
965  O O   . HOH C .   ? 0.5555 0.8208 0.8495 -0.2050 -0.0152 0.0619  17   HOH A O   
966  O O   . HOH C .   ? 0.7340 0.5780 0.6534 -0.0525 -0.0277 -0.0749 18   HOH A O   
967  O O   . HOH C .   ? 0.3971 1.0363 0.7328 0.1291  0.0968  0.0558  21   HOH A O   
968  O O   . HOH C .   ? 0.7715 0.7175 0.7464 -0.0156 0.0929  0.1945  22   HOH A O   
969  O O   . HOH C .   ? 0.8230 0.4222 0.8423 -0.1084 -0.0351 0.1957  23   HOH A O   
970  O O   . HOH C .   ? 0.8197 0.6634 0.7632 0.0112  -0.0157 0.1445  24   HOH A O   
971  O O   . HOH C .   ? 0.8163 0.6658 0.6265 0.0253  -0.0135 0.0023  25   HOH A O   
972  O O   . HOH C .   ? 0.5956 0.4521 0.6040 0.0732  -0.0320 0.0282  27   HOH A O   
973  O O   . HOH C .   ? 0.7856 0.4808 0.8232 0.0717  -0.0565 -0.0290 28   HOH A O   
974  O O   . HOH C .   ? 0.4886 0.5145 0.4379 0.0253  -0.0035 0.0255  29   HOH A O   
975  O O   . HOH C .   ? 0.9656 0.9961 0.9363 0.2615  -0.0492 0.0668  30   HOH A O   
976  O O   . HOH C .   ? 0.4388 0.9003 0.6170 -0.0210 0.1769  0.1100  31   HOH A O   
977  O O   . HOH C .   ? 0.6947 0.6453 0.6182 -0.0083 0.0343  0.0524  32   HOH A O   
978  O O   . HOH C .   ? 0.7069 0.4798 0.6172 -0.0447 -0.0207 -0.0898 33   HOH A O   
979  O O   . HOH C .   ? 0.5142 0.4455 0.4904 0.0373  -0.0111 0.0315  34   HOH A O   
980  O O   . HOH C .   ? 0.6162 0.5765 0.6303 -0.0762 -0.0171 -0.0595 35   HOH A O   
981  O O   . HOH C .   ? 0.9404 0.7317 0.7949 0.0250  -0.0542 -0.1994 36   HOH A O   
982  O O   . HOH C .   ? 0.7412 1.1928 0.8181 0.2742  0.2217  -0.0225 37   HOH A O   
983  O O   . HOH C .   ? 0.6623 0.4648 0.5937 -0.0545 0.0110  -0.0098 38   HOH A O   
984  O O   . HOH C .   ? 1.0288 0.7960 0.7849 0.1139  -0.0090 -0.1206 39   HOH A O   
985  O O   . HOH C .   ? 0.9253 0.7106 0.8385 0.0295  0.1077  0.1419  40   HOH A O   
986  O O   . HOH C .   ? 0.7262 0.7165 0.5601 0.0882  -0.0130 -0.0043 41   HOH A O   
987  O O   . HOH C .   ? 0.6328 0.9734 0.7970 -0.0189 -0.1136 0.0135  42   HOH A O   
988  O O   . HOH C .   ? 0.7660 0.5845 0.6268 0.0885  0.1207  0.1755  43   HOH A O   
989  O O   . HOH C .   ? 0.6973 1.3102 0.5808 -0.0598 -0.0554 0.0715  44   HOH A O   
990  O O   . HOH C .   ? 0.6926 0.5498 0.6391 -0.0394 0.0408  0.0458  45   HOH A O   
991  O O   . HOH C .   ? 0.6278 1.3959 0.6551 0.0170  -0.1036 0.0685  46   HOH A O   
992  O O   . HOH C .   ? 0.6395 0.7704 0.4203 0.1656  0.0120  0.0046  47   HOH A O   
993  O O   . HOH C .   ? 0.8008 0.6008 0.7745 -0.0747 -0.0028 -0.0579 48   HOH A O   
994  O O   . HOH C .   ? 0.7682 0.6359 0.7375 0.0581  -0.0349 0.1118  49   HOH A O   
995  O O   . HOH C .   ? 0.7374 0.8079 0.4920 0.1747  0.0507  0.0885  50   HOH A O   
996  O O   . HOH C .   ? 0.8701 0.6258 0.8831 -0.0762 0.0644  -0.0227 52   HOH A O   
997  O O   . HOH C .   ? 0.6840 0.7569 0.5732 0.0163  -0.0751 -0.1133 53   HOH A O   
998  O O   . HOH C .   ? 0.7054 0.5845 0.6079 0.0280  0.0875  0.1262  54   HOH A O   
999  O O   . HOH C .   ? 0.6642 0.8380 0.7186 0.0679  -0.0604 0.0467  55   HOH A O   
1000 O O   . HOH C .   ? 0.7403 0.4646 0.7389 -0.1048 -0.0014 0.2044  58   HOH A O   
1001 O O   . HOH C .   ? 0.6743 1.1683 0.7323 0.0755  0.2512  0.0658  59   HOH A O   
1002 O O   . HOH C .   ? 0.8710 0.7333 0.6420 0.0298  -0.0194 -0.0500 60   HOH A O   
1003 O O   . HOH C .   ? 0.7783 0.8027 0.4842 0.2328  -0.0049 0.0727  62   HOH A O   
1004 O O   . HOH C .   ? 0.9820 0.8792 0.7221 0.1099  0.0087  -0.0598 64   HOH A O   
1005 O O   . HOH C .   ? 0.9591 1.0193 0.7032 0.1985  0.0727  0.1283  65   HOH A O   
1006 O O   . HOH C .   ? 0.6024 0.8671 0.7728 -0.0830 -0.0936 -0.0099 66   HOH A O   
1007 O O   . HOH C .   ? 0.8495 0.7498 0.6025 0.0518  -0.0145 -0.0193 67   HOH A O   
1008 O O   . HOH C .   ? 0.7617 0.6303 0.6118 -0.0112 -0.0472 -0.1035 70   HOH A O   
1009 O O   . HOH C .   ? 0.7356 0.5813 0.7090 -0.0664 0.0192  -0.0003 73   HOH A O   
1010 O O   . HOH C .   ? 0.9975 0.8862 0.7487 0.0496  0.0012  -0.0068 74   HOH A O   
1011 O O   . HOH C .   ? 0.8260 0.7012 0.8377 -0.1474 -0.1439 -0.2485 75   HOH A O   
1012 O O   . HOH C .   ? 0.9366 0.9705 0.9510 -0.1515 -0.1490 -0.2008 76   HOH A O   
1013 O O   . HOH C .   ? 0.5933 0.9072 0.6818 -0.0809 -0.1660 -0.0453 77   HOH A O   
1014 O O   . HOH C .   ? 0.5299 1.3108 0.9574 0.1812  0.0546  0.0524  80   HOH A O   
1015 O O   . HOH C .   ? 0.9595 0.9237 1.0252 0.2243  -0.0368 -0.1578 90   HOH A O   
1016 O O   . HOH C .   ? 0.9204 0.6789 0.9809 0.2029  -0.0795 -0.0066 99   HOH A O   
1017 O O   . HOH C .   ? 0.7658 0.6493 0.7980 -0.0912 0.0092  -0.0347 101  HOH A O   
1018 O O   . HOH C .   ? 0.8511 1.0622 0.6223 0.2032  0.0409  0.0548  102  HOH A O   
1019 O O   . HOH C .   ? 0.6406 1.2959 0.8571 -0.0003 0.2377  0.1104  104  HOH A O   
1020 O O   . HOH C .   ? 0.5922 1.4532 0.9384 0.4876  0.2166  -0.0562 105  HOH A O   
1021 O O   . HOH C .   ? 0.8332 0.5817 0.8243 -0.0768 -0.0004 -0.0826 106  HOH A O   
1022 O O   . HOH C .   ? 0.5779 0.8900 0.8258 -0.1305 -0.0829 -0.0005 110  HOH A O   
1023 O O   . HOH C .   ? 0.7793 0.8398 0.8928 -0.0800 0.0616  0.0483  111  HOH A O   
1024 O O   . HOH C .   ? 0.7401 0.6343 0.6486 -0.0195 0.0246  0.0368  123  HOH A O   
1025 O O   . HOH C .   ? 0.7167 0.7891 0.5832 0.0794  -0.0186 0.0000  124  HOH A O   
1026 O O   . HOH C .   ? 0.9406 0.8032 0.7434 0.0093  -0.0341 -0.0664 150  HOH A O   
1027 O O   . HOH C .   ? 0.6204 0.5091 0.4536 0.0233  -0.0185 -0.0053 151  HOH A O   
1028 O O   . HOH C .   ? 0.4846 0.7139 0.4908 0.0806  -0.0002 -0.0491 152  HOH A O   
1029 O O   . HOH C .   ? 0.8330 0.6272 0.6153 0.0576  -0.0262 -0.1221 153  HOH A O   
1030 O O   . HOH C .   ? 0.5157 0.6764 0.4190 0.0676  -0.0390 -0.0259 155  HOH A O   
1031 O O   . HOH C .   ? 0.7804 0.8838 0.7514 0.0436  -0.0787 0.0435  156  HOH A O   
1032 O O   . HOH C .   ? 0.6858 0.8558 0.5417 0.1223  -0.0421 -0.0155 157  HOH A O   
1033 O O   . HOH C .   ? 0.8635 0.9825 0.7060 0.0512  -0.0228 -0.3440 159  HOH A O   
1034 O O   . HOH C .   ? 0.8692 0.6431 0.9786 -0.1665 -0.0234 0.0887  160  HOH A O   
1036 O O   . HOH C .   ? 0.5869 0.6813 0.4398 -0.0260 -0.0391 -0.1919 1435 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1300 ?    ?   ?   A . n 
A 1 2   MET 2   1301 ?    ?   ?   A . n 
A 1 3   ASP 3   1302 ?    ?   ?   A . n 
A 1 4   HIS 4   1303 ?    ?   ?   A . n 
A 1 5   GLN 5   1304 ?    ?   ?   A . n 
A 1 6   PRO 6   1305 ?    ?   ?   A . n 
A 1 7   ARG 7   1306 ?    ?   ?   A . n 
A 1 8   ARG 8   1307 ?    ?   ?   A . n 
A 1 9   ARG 9   1308 ?    ?   ?   A . n 
A 1 10  LEU 10  1309 ?    ?   ?   A . n 
A 1 11  ARG 11  1310 ?    ?   ?   A . n 
A 1 12  ASN 12  1311 ?    ?   ?   A . n 
A 1 13  ARG 13  1312 ?    ?   ?   A . n 
A 1 14  ALA 14  1313 ?    ?   ?   A . n 
A 1 15  GLN 15  1314 ?    ?   ?   A . n 
A 1 16  SER 16  1315 ?    ?   ?   A . n 
A 1 17  TYR 17  1316 1316 TYR TYR A . n 
A 1 18  ASP 18  1317 1317 ASP ASP A . n 
A 1 19  ILE 19  1318 1318 ILE ILE A . n 
A 1 20  GLN 20  1319 1319 GLN GLN A . n 
A 1 21  ALA 21  1320 1320 ALA ALA A . n 
A 1 22  TRP 22  1321 1321 TRP TRP A . n 
A 1 23  LYS 23  1322 1322 LYS LYS A . n 
A 1 24  LYS 24  1323 1323 LYS LYS A . n 
A 1 25  GLN 25  1324 1324 GLN GLN A . n 
A 1 26  CYS 26  1325 1325 CYS CYS A . n 
A 1 27  GLU 27  1326 1326 GLU GLU A . n 
A 1 28  GLU 28  1327 1327 GLU GLU A . n 
A 1 29  LEU 29  1328 1328 LEU LEU A . n 
A 1 30  LEU 30  1329 1329 LEU LEU A . n 
A 1 31  ASN 31  1330 1330 ASN ASN A . n 
A 1 32  LEU 32  1331 1331 LEU LEU A . n 
A 1 33  ILE 33  1332 1332 ILE ILE A . n 
A 1 34  PHE 34  1333 1333 PHE PHE A . n 
A 1 35  GLN 35  1334 1334 GLN GLN A . n 
A 1 36  CYS 36  1335 1335 CYS CYS A . n 
A 1 37  GLU 37  1336 1336 GLU GLU A . n 
A 1 38  ASP 38  1337 1337 ASP ASP A . n 
A 1 39  SER 39  1338 1338 SER SER A . n 
A 1 40  GLU 40  1339 1339 GLU GLU A . n 
A 1 41  PRO 41  1340 1340 PRO PRO A . n 
A 1 42  PHE 42  1341 1341 PHE PHE A . n 
A 1 43  ARG 43  1342 1342 ARG ARG A . n 
A 1 44  GLN 44  1343 1343 GLN GLN A . n 
A 1 45  PRO 45  1344 1344 PRO PRO A . n 
A 1 46  VAL 46  1345 1345 VAL VAL A . n 
A 1 47  ASP 47  1346 1346 ASP ASP A . n 
A 1 48  LEU 48  1347 1347 LEU LEU A . n 
A 1 49  LEU 49  1348 1348 LEU LEU A . n 
A 1 50  GLU 50  1349 1349 GLU GLU A . n 
A 1 51  TYR 51  1350 1350 TYR TYR A . n 
A 1 52  PRO 52  1351 1351 PRO PRO A . n 
A 1 53  ASP 53  1352 1352 ASP ASP A . n 
A 1 54  TYR 54  1353 1353 TYR TYR A . n 
A 1 55  ARG 55  1354 1354 ARG ARG A . n 
A 1 56  ASP 56  1355 1355 ASP ASP A . n 
A 1 57  ILE 57  1356 1356 ILE ILE A . n 
A 1 58  ILE 58  1357 1357 ILE ILE A . n 
A 1 59  ASP 59  1358 1358 ASP ASP A . n 
A 1 60  THR 60  1359 1359 THR THR A . n 
A 1 61  PRO 61  1360 1360 PRO PRO A . n 
A 1 62  MET 62  1361 1361 MET MET A . n 
A 1 63  ASP 63  1362 1362 ASP ASP A . n 
A 1 64  PHE 64  1363 1363 PHE PHE A . n 
A 1 65  ALA 65  1364 1364 ALA ALA A . n 
A 1 66  THR 66  1365 1365 THR THR A . n 
A 1 67  VAL 67  1366 1366 VAL VAL A . n 
A 1 68  ARG 68  1367 1367 ARG ARG A . n 
A 1 69  GLU 69  1368 1368 GLU GLU A . n 
A 1 70  THR 70  1369 1369 THR THR A . n 
A 1 71  LEU 71  1370 1370 LEU LEU A . n 
A 1 72  GLU 72  1371 1371 GLU GLU A . n 
A 1 73  ALA 73  1372 1372 ALA ALA A . n 
A 1 74  GLY 74  1373 1373 GLY GLY A . n 
A 1 75  ASN 75  1374 1374 ASN ASN A . n 
A 1 76  TYR 76  1375 1375 TYR TYR A . n 
A 1 77  GLU 77  1376 1376 GLU GLU A . n 
A 1 78  SER 78  1377 1377 SER SER A . n 
A 1 79  PRO 79  1378 1378 PRO PRO A . n 
A 1 80  MET 80  1379 1379 MET MET A . n 
A 1 81  GLU 81  1380 1380 GLU GLU A . n 
A 1 82  LEU 82  1381 1381 LEU LEU A . n 
A 1 83  CYS 83  1382 1382 CYS CYS A . n 
A 1 84  LYS 84  1383 1383 LYS LYS A . n 
A 1 85  ASP 85  1384 1384 ASP ASP A . n 
A 1 86  VAL 86  1385 1385 VAL VAL A . n 
A 1 87  ARG 87  1386 1386 ARG ARG A . n 
A 1 88  LEU 88  1387 1387 LEU LEU A . n 
A 1 89  ILE 89  1388 1388 ILE ILE A . n 
A 1 90  PHE 90  1389 1389 PHE PHE A . n 
A 1 91  SER 91  1390 1390 SER SER A . n 
A 1 92  ASN 92  1391 1391 ASN ASN A . n 
A 1 93  SER 93  1392 1392 SER SER A . n 
A 1 94  LYS 94  1393 1393 LYS LYS A . n 
A 1 95  ALA 95  1394 1394 ALA ALA A . n 
A 1 96  TYR 96  1395 1395 TYR TYR A . n 
A 1 97  THR 97  1396 1396 THR THR A . n 
A 1 98  PRO 98  1397 1397 PRO PRO A . n 
A 1 99  SER 99  1398 1398 SER SER A . n 
A 1 100 LYS 100 1399 1399 LYS LYS A . n 
A 1 101 ARG 101 1400 1400 ARG ARG A . n 
A 1 102 SER 102 1401 1401 SER SER A . n 
A 1 103 ARG 103 1402 1402 ARG ARG A . n 
A 1 104 ILE 104 1403 1403 ILE ILE A . n 
A 1 105 TYR 105 1404 1404 TYR TYR A . n 
A 1 106 SER 106 1405 1405 SER SER A . n 
A 1 107 MET 107 1406 1406 MET MET A . n 
A 1 108 SER 108 1407 1407 SER SER A . n 
A 1 109 LEU 109 1408 1408 LEU LEU A . n 
A 1 110 ARG 110 1409 1409 ARG ARG A . n 
A 1 111 LEU 111 1410 1410 LEU LEU A . n 
A 1 112 SER 112 1411 1411 SER SER A . n 
A 1 113 ALA 113 1412 1412 ALA ALA A . n 
A 1 114 PHE 114 1413 1413 PHE PHE A . n 
A 1 115 PHE 115 1414 1414 PHE PHE A . n 
A 1 116 GLU 116 1415 1415 GLU GLU A . n 
A 1 117 GLU 117 1416 1416 GLU GLU A . n 
A 1 118 HIS 118 1417 1417 HIS HIS A . n 
A 1 119 ILE 119 1418 1418 ILE ILE A . n 
A 1 120 SER 120 1419 1419 SER SER A . n 
A 1 121 SER 121 1420 1420 SER SER A . n 
A 1 122 VAL 122 1421 1421 VAL VAL A . n 
A 1 123 LEU 123 1422 1422 LEU LEU A . n 
A 1 124 SER 124 1423 1423 SER SER A . n 
A 1 125 ASP 125 1424 1424 ASP ASP A . n 
A 1 126 TYR 126 1425 1425 TYR TYR A . n 
A 1 127 LYS 127 1426 1426 LYS LYS A . n 
A 1 128 SER 128 1427 1427 SER SER A . n 
A 1 129 ALA 129 1428 1428 ALA ALA A . n 
A 1 130 LEU 130 1429 1429 LEU LEU A . n 
A 1 131 ARG 131 1430 1430 ARG ARG A . n 
A 1 132 PHE 132 1431 1431 PHE PHE A . n 
A 1 133 HIS 133 1432 ?    ?   ?   A . n 
A 1 134 LYS 134 1433 ?    ?   ?   A . n 
A 1 135 ARG 135 1434 ?    ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-04-14 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2012-04-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 4.0280  48.6087 -0.5033 0.1679 0.1067 0.2025 -0.0591 0.0009  0.0254  5.3359  3.0736  7.5811  
0.6182   1.1776  0.0520  0.1154  0.0624  -0.1778 0.1014  -0.8573 0.4697  0.0077 0.5043  -0.4725 
'X-RAY DIFFRACTION' 2 ? refined 12.5930 52.1035 2.0354  0.2054 0.0368 0.0459 -0.0158 -0.0119 -0.0102 5.7598  1.7049  3.3627  
-2.6526  -1.1736 0.5896  0.0317  -0.0249 -0.0068 -0.0133 0.1551  -0.1317 0.0602 0.0087  0.2690  
'X-RAY DIFFRACTION' 3 ? refined -2.3376 65.6881 0.5259  0.3777 0.4957 0.2407 0.1243  0.0401  0.2510  12.6561 27.2923 20.1553 
-14.1840 -8.5820 12.1527 -0.3808 0.5669  -0.1860 1.4046  0.8955  0.6056  0.4266 -1.2340 -1.3823 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 1316 A 1350 ? . . . . ? 
'X-RAY DIFFRACTION' 2 2 A 1351 A 1415 ? . . . . ? 
'X-RAY DIFFRACTION' 3 3 A 1416 A 1431 ? . . . . ? 
# 
_pdbx_phasing_MR.entry_id                     3MB3 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     51.420 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.500 
_pdbx_phasing_MR.d_res_low_rotation           39.880 
_pdbx_phasing_MR.d_res_high_translation       2.500 
_pdbx_phasing_MR.d_res_low_translation        39.880 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   mr 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 SCALA        .     ?                          other   'Phil R. Evans'      pre@mrc-lmb.cam.ac.uk       'data scaling'    
http://www.ccp4.ac.uk/dist/html/scala.html   Fortran_77 ? 
2 PHASER       2.1.4 'Wed Jun 24 14:00:05 2009' program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/  ?          ? 
3 REFMAC       .     ?                          program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
4 PDB_EXTRACT  3.100 'Jan. 22, 2010'            package PDB                  help@deposit.rcsb.org       'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
5 CrystalClear .     ?                          ?       ?                    ?                           'data collection' ? ? ? 
6 MOSFLM       .     ?                          ?       ?                    ?                           'data reduction'  ? ? ? 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             1382 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            SG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             1382 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            A 
_pdbx_validate_rmsd_bond.bond_value                1.704 
_pdbx_validate_rmsd_bond.bond_target_value         1.812 
_pdbx_validate_rmsd_bond.bond_deviation            -0.108 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.016 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_1              1335 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_2              1335 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             SG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_3              1335 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                121.15 
_pdbx_validate_rmsd_angle.angle_target_value         114.20 
_pdbx_validate_rmsd_angle.angle_deviation            6.95 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.10 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A TYR 1316 ? CG  ? A TYR 17  CG  
2  1 Y 1 A TYR 1316 ? CD1 ? A TYR 17  CD1 
3  1 Y 1 A TYR 1316 ? CD2 ? A TYR 17  CD2 
4  1 Y 1 A TYR 1316 ? CE1 ? A TYR 17  CE1 
5  1 Y 1 A TYR 1316 ? CE2 ? A TYR 17  CE2 
6  1 Y 1 A TYR 1316 ? CZ  ? A TYR 17  CZ  
7  1 Y 1 A TYR 1316 ? OH  ? A TYR 17  OH  
8  1 Y 1 A LYS 1323 ? CE  ? A LYS 24  CE  
9  1 Y 1 A LYS 1323 ? NZ  ? A LYS 24  NZ  
10 1 Y 1 A ARG 1430 ? CG  ? A ARG 131 CG  
11 1 Y 1 A ARG 1430 ? CD  ? A ARG 131 CD  
12 1 Y 1 A ARG 1430 ? NE  ? A ARG 131 NE  
13 1 Y 1 A ARG 1430 ? CZ  ? A ARG 131 CZ  
14 1 Y 1 A ARG 1430 ? NH1 ? A ARG 131 NH1 
15 1 Y 1 A ARG 1430 ? NH2 ? A ARG 131 NH2 
16 1 Y 1 A PHE 1431 ? CG  ? A PHE 132 CG  
17 1 Y 1 A PHE 1431 ? CD1 ? A PHE 132 CD1 
18 1 Y 1 A PHE 1431 ? CD2 ? A PHE 132 CD2 
19 1 Y 1 A PHE 1431 ? CE1 ? A PHE 132 CE1 
20 1 Y 1 A PHE 1431 ? CE2 ? A PHE 132 CE2 
21 1 Y 1 A PHE 1431 ? CZ  ? A PHE 132 CZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 1300 ? A SER 1   
2  1 Y 1 A MET 1301 ? A MET 2   
3  1 Y 1 A ASP 1302 ? A ASP 3   
4  1 Y 1 A HIS 1303 ? A HIS 4   
5  1 Y 1 A GLN 1304 ? A GLN 5   
6  1 Y 1 A PRO 1305 ? A PRO 6   
7  1 Y 1 A ARG 1306 ? A ARG 7   
8  1 Y 1 A ARG 1307 ? A ARG 8   
9  1 Y 1 A ARG 1308 ? A ARG 9   
10 1 Y 1 A LEU 1309 ? A LEU 10  
11 1 Y 1 A ARG 1310 ? A ARG 11  
12 1 Y 1 A ASN 1311 ? A ASN 12  
13 1 Y 1 A ARG 1312 ? A ARG 13  
14 1 Y 1 A ALA 1313 ? A ALA 14  
15 1 Y 1 A GLN 1314 ? A GLN 15  
16 1 Y 1 A SER 1315 ? A SER 16  
17 1 Y 1 A HIS 1432 ? A HIS 133 
18 1 Y 1 A LYS 1433 ? A LYS 134 
19 1 Y 1 A ARG 1434 ? A ARG 135 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 1-methylpyrrolidin-2-one MB3 
3 water                    HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MB3 1  1    1   MB3 MB3 A . 
C 3 HOH 1  2    2   HOH HOH A . 
C 3 HOH 2  3    3   HOH HOH A . 
C 3 HOH 3  4    4   HOH HOH A . 
C 3 HOH 4  5    5   HOH HOH A . 
C 3 HOH 5  6    6   HOH HOH A . 
C 3 HOH 6  8    8   HOH HOH A . 
C 3 HOH 7  9    9   HOH HOH A . 
C 3 HOH 8  10   10  HOH HOH A . 
C 3 HOH 9  11   11  HOH HOH A . 
C 3 HOH 10 12   12  HOH HOH A . 
C 3 HOH 11 14   14  HOH HOH A . 
C 3 HOH 12 15   15  HOH HOH A . 
C 3 HOH 13 16   16  HOH HOH A . 
C 3 HOH 14 17   17  HOH HOH A . 
C 3 HOH 15 18   18  HOH HOH A . 
C 3 HOH 16 21   21  HOH HOH A . 
C 3 HOH 17 22   22  HOH HOH A . 
C 3 HOH 18 23   23  HOH HOH A . 
C 3 HOH 19 24   24  HOH HOH A . 
C 3 HOH 20 25   25  HOH HOH A . 
C 3 HOH 21 27   27  HOH HOH A . 
C 3 HOH 22 28   28  HOH HOH A . 
C 3 HOH 23 29   29  HOH HOH A . 
C 3 HOH 24 30   30  HOH HOH A . 
C 3 HOH 25 31   31  HOH HOH A . 
C 3 HOH 26 32   32  HOH HOH A . 
C 3 HOH 27 33   33  HOH HOH A . 
C 3 HOH 28 34   34  HOH HOH A . 
C 3 HOH 29 35   35  HOH HOH A . 
C 3 HOH 30 36   36  HOH HOH A . 
C 3 HOH 31 37   37  HOH HOH A . 
C 3 HOH 32 38   38  HOH HOH A . 
C 3 HOH 33 39   39  HOH HOH A . 
C 3 HOH 34 40   40  HOH HOH A . 
C 3 HOH 35 41   41  HOH HOH A . 
C 3 HOH 36 42   42  HOH HOH A . 
C 3 HOH 37 43   43  HOH HOH A . 
C 3 HOH 38 44   44  HOH HOH A . 
C 3 HOH 39 45   45  HOH HOH A . 
C 3 HOH 40 46   46  HOH HOH A . 
C 3 HOH 41 47   47  HOH HOH A . 
C 3 HOH 42 48   48  HOH HOH A . 
C 3 HOH 43 49   49  HOH HOH A . 
C 3 HOH 44 50   50  HOH HOH A . 
C 3 HOH 45 52   52  HOH HOH A . 
C 3 HOH 46 53   53  HOH HOH A . 
C 3 HOH 47 54   54  HOH HOH A . 
C 3 HOH 48 55   55  HOH HOH A . 
C 3 HOH 49 58   58  HOH HOH A . 
C 3 HOH 50 59   59  HOH HOH A . 
C 3 HOH 51 60   60  HOH HOH A . 
C 3 HOH 52 62   62  HOH HOH A . 
C 3 HOH 53 64   64  HOH HOH A . 
C 3 HOH 54 65   65  HOH HOH A . 
C 3 HOH 55 66   66  HOH HOH A . 
C 3 HOH 56 67   67  HOH HOH A . 
C 3 HOH 57 70   70  HOH HOH A . 
C 3 HOH 58 73   73  HOH HOH A . 
C 3 HOH 59 74   74  HOH HOH A . 
C 3 HOH 60 75   75  HOH HOH A . 
C 3 HOH 61 76   76  HOH HOH A . 
C 3 HOH 62 77   77  HOH HOH A . 
C 3 HOH 63 80   80  HOH HOH A . 
C 3 HOH 64 90   90  HOH HOH A . 
C 3 HOH 65 99   99  HOH HOH A . 
C 3 HOH 66 101  101 HOH HOH A . 
C 3 HOH 67 102  102 HOH HOH A . 
C 3 HOH 68 104  104 HOH HOH A . 
C 3 HOH 69 105  105 HOH HOH A . 
C 3 HOH 70 106  106 HOH HOH A . 
C 3 HOH 71 110  110 HOH HOH A . 
C 3 HOH 72 111  111 HOH HOH A . 
C 3 HOH 73 123  123 HOH HOH A . 
C 3 HOH 74 124  124 HOH HOH A . 
C 3 HOH 75 150  150 HOH HOH A . 
C 3 HOH 76 151  151 HOH HOH A . 
C 3 HOH 77 152  152 HOH HOH A . 
C 3 HOH 78 153  153 HOH HOH A . 
C 3 HOH 79 155  155 HOH HOH A . 
C 3 HOH 80 156  156 HOH HOH A . 
C 3 HOH 81 157  157 HOH HOH A . 
C 3 HOH 82 159  159 HOH HOH A . 
C 3 HOH 83 160  160 HOH HOH A . 
C 3 HOH 84 161  161 HOH HOH A . 
C 3 HOH 85 1435 1   HOH HOH A . 
#