data_3MEW
# 
_entry.id   3MEW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3MEW         
RCSB  RCSB058458   
WWPDB D_1000058458 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3ME9 . unspecified 
PDB 3MEA . unspecified 
PDB 3MET . unspecified 
PDB 3MEU . unspecified 
PDB 3MEV . unspecified 
# 
_pdbx_database_status.entry_id                        3MEW 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-03-31 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Xu, C.'                               1  
'Bian, C.B.'                           2  
'Lam, R.'                              3  
'Bountra, C.'                          4  
'Arrowsmith, C.H.'                     5  
'Weigelt, J.'                          6  
'Edwards, A.M.'                        7  
'Bochkarev, A.'                        8  
'Min, J.'                              9  
'Structural Genomics Consortium (SGC)' 10 
# 
_citation.id                        primary 
_citation.title                     
'Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            30 
_citation.page_first                2829 
_citation.page_last                 2842 
_citation.year                      2011 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21685874 
_citation.pdbx_database_id_DOI      10.1038/emboj.2011.193 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bian, C.'           1  
primary 'Xu, C.'             2  
primary 'Ruan, J.'           3  
primary 'Lee, K.K.'          4  
primary 'Burke, T.L.'        5  
primary 'Tempel, W.'         6  
primary 'Barsyte, D.'        7  
primary 'Li, J.'             8  
primary 'Wu, M.'             9  
primary 'Zhou, B.O.'         10 
primary 'Fleharty, B.E.'     11 
primary 'Paulson, A.'        12 
primary 'Allali-Hassani, A.' 13 
primary 'Zhou, J.Q.'         14 
primary 'Mer, G.'            15 
primary 'Grant, P.A.'        16 
primary 'Workman, J.L.'      17 
primary 'Zang, J.'           18 
primary 'Min, J.'            19 
# 
_cell.length_a           92.623 
_cell.length_b           41.424 
_cell.length_c           52.324 
_cell.angle_alpha        90.000 
_cell.angle_beta         121.430 
_cell.angle_gamma        90.000 
_cell.entry_id           3MEW 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.entry_id                         3MEW 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                5 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'SAGA-associated factor 29 homolog' 17813.990 1  ? ? 'UNP Residues 115-287' ? 
2 water   nat water                               18.015    84 ? ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Coiled-coil domain-containing protein 101' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;TLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRR
RVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;TLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRR
RVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   THR n 
1 2   LEU n 
1 3   PRO n 
1 4   LEU n 
1 5   TRP n 
1 6   ILE n 
1 7   GLY n 
1 8   LYS n 
1 9   PRO n 
1 10  GLY n 
1 11  ASP n 
1 12  LYS n 
1 13  PRO n 
1 14  PRO n 
1 15  PRO n 
1 16  LEU n 
1 17  CYS n 
1 18  GLY n 
1 19  ALA n 
1 20  ILE n 
1 21  PRO n 
1 22  ALA n 
1 23  SER n 
1 24  GLY n 
1 25  ASP n 
1 26  TYR n 
1 27  VAL n 
1 28  ALA n 
1 29  ARG n 
1 30  PRO n 
1 31  GLY n 
1 32  ASP n 
1 33  LYS n 
1 34  VAL n 
1 35  ALA n 
1 36  ALA n 
1 37  ARG n 
1 38  VAL n 
1 39  LYS n 
1 40  ALA n 
1 41  VAL n 
1 42  ASP n 
1 43  GLY n 
1 44  ASP n 
1 45  GLU n 
1 46  GLN n 
1 47  TRP n 
1 48  ILE n 
1 49  LEU n 
1 50  ALA n 
1 51  GLU n 
1 52  VAL n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  SER n 
1 57  HIS n 
1 58  ALA n 
1 59  THR n 
1 60  ASN n 
1 61  LYS n 
1 62  TYR n 
1 63  GLU n 
1 64  VAL n 
1 65  ASP n 
1 66  ASP n 
1 67  ILE n 
1 68  ASP n 
1 69  GLU n 
1 70  GLU n 
1 71  GLY n 
1 72  LYS n 
1 73  GLU n 
1 74  ARG n 
1 75  HIS n 
1 76  THR n 
1 77  LEU n 
1 78  SER n 
1 79  ARG n 
1 80  ARG n 
1 81  ARG n 
1 82  VAL n 
1 83  ILE n 
1 84  PRO n 
1 85  LEU n 
1 86  PRO n 
1 87  GLN n 
1 88  TRP n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  PRO n 
1 93  GLU n 
1 94  THR n 
1 95  ASP n 
1 96  PRO n 
1 97  GLU n 
1 98  ALA n 
1 99  LEU n 
1 100 PHE n 
1 101 GLN n 
1 102 LYS n 
1 103 GLU n 
1 104 GLN n 
1 105 LEU n 
1 106 VAL n 
1 107 LEU n 
1 108 ALA n 
1 109 LEU n 
1 110 TYR n 
1 111 PRO n 
1 112 GLN n 
1 113 THR n 
1 114 THR n 
1 115 CYS n 
1 116 PHE n 
1 117 TYR n 
1 118 ARG n 
1 119 ALA n 
1 120 LEU n 
1 121 ILE n 
1 122 HIS n 
1 123 ALA n 
1 124 PRO n 
1 125 PRO n 
1 126 GLN n 
1 127 ARG n 
1 128 PRO n 
1 129 GLN n 
1 130 ASP n 
1 131 ASP n 
1 132 TYR n 
1 133 SER n 
1 134 VAL n 
1 135 LEU n 
1 136 PHE n 
1 137 GLU n 
1 138 ASP n 
1 139 THR n 
1 140 SER n 
1 141 TYR n 
1 142 ALA n 
1 143 ASP n 
1 144 GLY n 
1 145 TYR n 
1 146 SER n 
1 147 PRO n 
1 148 PRO n 
1 149 LEU n 
1 150 ASN n 
1 151 VAL n 
1 152 ALA n 
1 153 GLN n 
1 154 ARG n 
1 155 TYR n 
1 156 VAL n 
1 157 VAL n 
1 158 ALA n 
1 159 CYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CCDC101, SGF29' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-V2R-pRARE2' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28-MHL 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SGF29_HUMAN 
_struct_ref.pdbx_db_accession          Q96ES7 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRR
RVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC
;
_struct_ref.pdbx_align_begin           129 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3MEW 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 159 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q96ES7 
_struct_ref_seq.db_align_beg                  129 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  287 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       129 
_struct_ref_seq.pdbx_auth_seq_align_end       287 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3MEW 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.40 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   48.84 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    
'20-28% PEG3350, 0.1M Bis-Tris pH 5.5, vapor diffusion, Sitting drop, temperature 291K, VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2009-11-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-E SUPERBRIGHT' 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     3MEW 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            1.92 
_reflns.d_resolution_low             44.650 
_reflns.number_all                   13104 
_reflns.number_obs                   12062 
_reflns.percent_possible_obs         92.2 
_reflns.pdbx_Rmerge_I_obs            0.0381 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        37.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.92 
_reflns_shell.d_res_low              1.95 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   88.8 
_reflns_shell.Rmerge_I_obs           0.119 
_reflns_shell.meanI_over_sigI_obs    15.4 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        3.8 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3MEW 
_refine.ls_d_res_high                            1.920 
_refine.ls_d_res_low                             44.650 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    92.040 
_refine.ls_number_reflns_obs                     12062 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS
U VALUES: REFINED INDIVIDUALLY
;
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.201 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.235 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 4.900 
_refine.ls_number_reflns_R_free                  587 
_refine.ls_number_reflns_R_work                  11477 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               31.390 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -0.580 
_refine.aniso_B[2][2]                            0.120 
_refine.aniso_B[3][3]                            -1.090 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            -1.480 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.948 
_refine.correlation_coeff_Fo_to_Fc_free          0.933 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.185 
_refine.pdbx_overall_ESU_R_Free                  0.160 
_refine.overall_SU_ML                            0.105 
_refine.overall_SU_B                             3.551 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3ME9' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                66.14 
_refine.B_iso_min                                16.79 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1245 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             84 
_refine_hist.number_atoms_total               1329 
_refine_hist.d_res_high                       1.920 
_refine_hist.d_res_low                        44.650 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' r_bond_refined_d       1281 0.024  0.022  ? ? 
'X-RAY DIFFRACTION' r_angle_refined_deg    1753 2.001  1.976  ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 155  7.993  5.000  ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 60   27.856 24.000 ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 196  15.077 15.000 ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 9    23.103 15.000 ? ? 
'X-RAY DIFFRACTION' r_chiral_restr         189  0.134  0.200  ? ? 
'X-RAY DIFFRACTION' r_gen_planes_refined   1006 0.012  0.022  ? ? 
'X-RAY DIFFRACTION' r_mcbond_it            793  1.371  1.500  ? ? 
'X-RAY DIFFRACTION' r_mcangle_it           1290 2.354  2.000  ? ? 
'X-RAY DIFFRACTION' r_scbond_it            488  3.708  3.000  ? ? 
'X-RAY DIFFRACTION' r_scangle_it           463  6.118  4.500  ? ? 
# 
_refine_ls_shell.d_res_high                       1.920 
_refine_ls_shell.d_res_low                        1.971 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               87.730 
_refine_ls_shell.number_reflns_R_work             811 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.232 
_refine_ls_shell.R_factor_R_free                  0.270 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             40 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                851 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  3MEW 
_struct.title                     'Crystal structure of Novel Tudor domain-containing protein SGF29' 
_struct.pdbx_descriptor           'Crystal structure of Novel Tudor domain-containing protein SGF29' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3MEW 
_struct_keywords.text            
;Structural Genomics Consortium, SGC, Nucleus, Transcription, Transcription regulation, Chromosomal protein, DNA-binding, Nucleosome core
;
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 95  ? LEU A 99  ? ASP A 223 LEU A 227 5 ? 5 
HELX_P HELX_P2 2 ALA A 152 ? ARG A 154 ? ALA A 280 ARG A 282 5 ? 3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 71  ? SER A 78  ? GLY A 199 SER A 206 
A 2 LYS A 61  ? ASP A 68  ? LYS A 189 ASP A 196 
A 3 GLU A 45  ? SER A 56  ? GLU A 173 SER A 184 
A 4 CYS A 115 ? ALA A 123 ? CYS A 243 ALA A 251 
A 5 TYR A 132 ? PHE A 136 ? TYR A 260 PHE A 264 
A 6 LEU A 149 ? VAL A 151 ? LEU A 277 VAL A 279 
B 1 VAL A 82  ? PRO A 84  ? VAL A 210 PRO A 212 
B 2 LYS A 33  ? LYS A 39  ? LYS A 161 LYS A 167 
B 3 GLU A 45  ? SER A 56  ? GLU A 173 SER A 184 
B 4 CYS A 115 ? ALA A 123 ? CYS A 243 ALA A 251 
B 5 LEU A 105 ? LEU A 109 ? LEU A 233 LEU A 237 
B 6 VAL A 156 ? VAL A 157 ? VAL A 284 VAL A 285 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O HIS A 75  ? O HIS A 203 N VAL A 64  ? N VAL A 192 
A 2 3 O GLU A 63  ? O GLU A 191 N VAL A 53  ? N VAL A 181 
A 3 4 N TRP A 47  ? N TRP A 175 O PHE A 116 ? O PHE A 244 
A 4 5 N LEU A 120 ? N LEU A 248 O LEU A 135 ? O LEU A 263 
A 5 6 N VAL A 134 ? N VAL A 262 O LEU A 149 ? O LEU A 277 
B 1 2 O ILE A 83  ? O ILE A 211 N ALA A 35  ? N ALA A 163 
B 2 3 N ALA A 36  ? N ALA A 164 O ILE A 48  ? O ILE A 176 
B 3 4 N TRP A 47  ? N TRP A 175 O PHE A 116 ? O PHE A 244 
B 4 5 O ALA A 119 ? O ALA A 247 N VAL A 106 ? N VAL A 234 
B 5 6 N LEU A 107 ? N LEU A 235 O VAL A 157 ? O VAL A 285 
# 
_atom_sites.entry_id                    3MEW 
_atom_sites.fract_transf_matrix[1][1]   0.010796 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.006598 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.024141 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.022398 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . THR A 1 1   ? -1.981  10.459  -9.854  1.00 40.41 ? 129 THR A N   1 
ATOM   2    C CA  . THR A 1 1   ? -2.015  9.861   -11.229 1.00 41.35 ? 129 THR A CA  1 
ATOM   3    C C   . THR A 1 1   ? -1.083  8.649   -11.238 1.00 39.63 ? 129 THR A C   1 
ATOM   4    O O   . THR A 1 1   ? -0.254  8.543   -10.300 1.00 40.62 ? 129 THR A O   1 
ATOM   5    C CB  . THR A 1 1   ? -1.569  10.857  -12.265 1.00 41.19 ? 129 THR A CB  1 
ATOM   6    O OG1 . THR A 1 1   ? -1.551  10.198  -13.539 1.00 44.53 ? 129 THR A OG1 1 
ATOM   7    C CG2 . THR A 1 1   ? -0.178  11.439  -11.913 1.00 43.24 ? 129 THR A CG2 1 
ATOM   8    N N   . LEU A 1 2   ? -1.235  7.699   -12.180 1.00 36.85 ? 130 LEU A N   1 
ATOM   9    C CA  . LEU A 1 2   ? -0.535  6.406   -11.937 1.00 33.59 ? 130 LEU A CA  1 
ATOM   10   C C   . LEU A 1 2   ? 0.875   6.351   -12.544 1.00 30.56 ? 130 LEU A C   1 
ATOM   11   O O   . LEU A 1 2   ? 1.036   6.724   -13.710 1.00 29.26 ? 130 LEU A O   1 
ATOM   12   C CB  . LEU A 1 2   ? -1.329  5.218   -12.481 1.00 33.58 ? 130 LEU A CB  1 
ATOM   13   C CG  . LEU A 1 2   ? -2.586  4.735   -11.774 1.00 32.97 ? 130 LEU A CG  1 
ATOM   14   C CD1 . LEU A 1 2   ? -2.976  3.457   -12.562 1.00 30.92 ? 130 LEU A CD1 1 
ATOM   15   C CD2 . LEU A 1 2   ? -2.381  4.468   -10.252 1.00 26.67 ? 130 LEU A CD2 1 
ATOM   16   N N   . PRO A 1 3   ? 1.847   5.791   -11.803 1.00 30.55 ? 131 PRO A N   1 
ATOM   17   C CA  . PRO A 1 3   ? 3.188   5.659   -12.409 1.00 30.52 ? 131 PRO A CA  1 
ATOM   18   C C   . PRO A 1 3   ? 3.156   4.543   -13.493 1.00 30.32 ? 131 PRO A C   1 
ATOM   19   O O   . PRO A 1 3   ? 2.421   3.519   -13.304 1.00 28.59 ? 131 PRO A O   1 
ATOM   20   C CB  . PRO A 1 3   ? 4.060   5.154   -11.241 1.00 30.91 ? 131 PRO A CB  1 
ATOM   21   C CG  . PRO A 1 3   ? 3.105   4.468   -10.274 1.00 31.85 ? 131 PRO A CG  1 
ATOM   22   C CD  . PRO A 1 3   ? 1.775   5.197   -10.442 1.00 30.07 ? 131 PRO A CD  1 
ATOM   23   N N   . LEU A 1 4   ? 3.978   4.693   -14.527 1.00 27.88 ? 132 LEU A N   1 
ATOM   24   C CA  . LEU A 1 4   ? 4.309   3.576   -15.428 1.00 28.74 ? 132 LEU A CA  1 
ATOM   25   C C   . LEU A 1 4   ? 4.997   2.453   -14.710 1.00 27.15 ? 132 LEU A C   1 
ATOM   26   O O   . LEU A 1 4   ? 5.968   2.674   -13.964 1.00 26.96 ? 132 LEU A O   1 
ATOM   27   C CB  . LEU A 1 4   ? 5.268   4.039   -16.537 1.00 29.56 ? 132 LEU A CB  1 
ATOM   28   C CG  . LEU A 1 4   ? 4.677   4.826   -17.679 1.00 34.02 ? 132 LEU A CG  1 
ATOM   29   C CD1 . LEU A 1 4   ? 5.872   5.349   -18.529 1.00 35.14 ? 132 LEU A CD1 1 
ATOM   30   C CD2 . LEU A 1 4   ? 3.646   3.988   -18.495 1.00 33.16 ? 132 LEU A CD2 1 
ATOM   31   N N   . TRP A 1 5   ? 4.567   1.233   -14.949 1.00 25.29 ? 133 TRP A N   1 
ATOM   32   C CA  . TRP A 1 5   ? 5.335   0.092   -14.455 1.00 27.01 ? 133 TRP A CA  1 
ATOM   33   C C   . TRP A 1 5   ? 6.601   0.007   -15.305 1.00 27.29 ? 133 TRP A C   1 
ATOM   34   O O   . TRP A 1 5   ? 6.537   0.120   -16.534 1.00 26.70 ? 133 TRP A O   1 
ATOM   35   C CB  . TRP A 1 5   ? 4.568   -1.199  -14.667 1.00 25.21 ? 133 TRP A CB  1 
ATOM   36   C CG  . TRP A 1 5   ? 5.395   -2.513  -14.471 1.00 30.08 ? 133 TRP A CG  1 
ATOM   37   C CD1 . TRP A 1 5   ? 5.699   -3.476  -15.452 1.00 28.79 ? 133 TRP A CD1 1 
ATOM   38   C CD2 . TRP A 1 5   ? 6.045   -2.945  -13.291 1.00 33.07 ? 133 TRP A CD2 1 
ATOM   39   N NE1 . TRP A 1 5   ? 6.470   -4.448  -14.932 1.00 37.06 ? 133 TRP A NE1 1 
ATOM   40   C CE2 . TRP A 1 5   ? 6.713   -4.159  -13.609 1.00 36.19 ? 133 TRP A CE2 1 
ATOM   41   C CE3 . TRP A 1 5   ? 6.163   -2.420  -12.004 1.00 36.59 ? 133 TRP A CE3 1 
ATOM   42   C CZ2 . TRP A 1 5   ? 7.432   -4.870  -12.668 1.00 41.96 ? 133 TRP A CZ2 1 
ATOM   43   C CZ3 . TRP A 1 5   ? 6.883   -3.113  -11.066 1.00 39.75 ? 133 TRP A CZ3 1 
ATOM   44   C CH2 . TRP A 1 5   ? 7.508   -4.330  -11.384 1.00 41.93 ? 133 TRP A CH2 1 
ATOM   45   N N   . ILE A 1 6   ? 7.732   -0.230  -14.652 1.00 29.10 ? 134 ILE A N   1 
ATOM   46   C CA  . ILE A 1 6   ? 9.008   -0.426  -15.378 1.00 30.96 ? 134 ILE A CA  1 
ATOM   47   C C   . ILE A 1 6   ? 9.649   -1.643  -14.773 1.00 31.07 ? 134 ILE A C   1 
ATOM   48   O O   . ILE A 1 6   ? 10.143  -1.610  -13.666 1.00 32.48 ? 134 ILE A O   1 
ATOM   49   C CB  . ILE A 1 6   ? 9.936   0.812   -15.319 1.00 32.41 ? 134 ILE A CB  1 
ATOM   50   C CG1 . ILE A 1 6   ? 9.149   2.094   -15.664 1.00 31.80 ? 134 ILE A CG1 1 
ATOM   51   C CG2 . ILE A 1 6   ? 11.119  0.626   -16.318 1.00 33.43 ? 134 ILE A CG2 1 
ATOM   52   C CD1 . ILE A 1 6   ? 9.945   3.428   -15.455 1.00 41.80 ? 134 ILE A CD1 1 
ATOM   53   N N   . GLY A 1 7   ? 9.533   -2.759  -15.454 1.00 32.56 ? 135 GLY A N   1 
ATOM   54   C CA  . GLY A 1 7   ? 10.073  -3.993  -14.917 1.00 33.94 ? 135 GLY A CA  1 
ATOM   55   C C   . GLY A 1 7   ? 11.526  -4.205  -15.386 1.00 37.03 ? 135 GLY A C   1 
ATOM   56   O O   . GLY A 1 7   ? 11.959  -3.692  -16.443 1.00 34.96 ? 135 GLY A O   1 
ATOM   57   N N   . LYS A 1 8   ? 12.270  -4.966  -14.596 1.00 37.57 ? 136 LYS A N   1 
ATOM   58   C CA  . LYS A 1 8   ? 13.593  -5.406  -15.015 1.00 40.52 ? 136 LYS A CA  1 
ATOM   59   C C   . LYS A 1 8   ? 13.506  -6.697  -15.856 1.00 39.95 ? 136 LYS A C   1 
ATOM   60   O O   . LYS A 1 8   ? 12.434  -7.320  -15.933 1.00 38.94 ? 136 LYS A O   1 
ATOM   61   C CB  . LYS A 1 8   ? 14.455  -5.572  -13.759 1.00 41.12 ? 136 LYS A CB  1 
ATOM   62   C CG  . LYS A 1 8   ? 14.877  -4.182  -13.209 1.00 45.49 ? 136 LYS A CG  1 
ATOM   63   C CD  . LYS A 1 8   ? 15.531  -4.281  -11.835 1.00 48.96 ? 136 LYS A CD  1 
ATOM   64   C CE  . LYS A 1 8   ? 15.537  -2.911  -11.123 1.00 51.58 ? 136 LYS A CE  1 
ATOM   65   N NZ  . LYS A 1 8   ? 16.869  -2.237  -11.330 1.00 51.80 ? 136 LYS A NZ  1 
ATOM   66   N N   . PRO A 1 9   ? 14.620  -7.128  -16.465 1.00 40.01 ? 137 PRO A N   1 
ATOM   67   C CA  . PRO A 1 9   ? 14.670  -8.482  -17.101 1.00 39.69 ? 137 PRO A CA  1 
ATOM   68   C C   . PRO A 1 9   ? 14.135  -9.668  -16.241 1.00 39.14 ? 137 PRO A C   1 
ATOM   69   O O   . PRO A 1 9   ? 14.558  -9.893  -15.052 1.00 39.06 ? 137 PRO A O   1 
ATOM   70   C CB  . PRO A 1 9   ? 16.182  -8.643  -17.438 1.00 39.92 ? 137 PRO A CB  1 
ATOM   71   C CG  . PRO A 1 9   ? 16.617  -7.243  -17.717 1.00 40.66 ? 137 PRO A CG  1 
ATOM   72   C CD  . PRO A 1 9   ? 15.906  -6.401  -16.647 1.00 41.96 ? 137 PRO A CD  1 
ATOM   73   N N   . GLY A 1 10  ? 13.212  -10.431 -16.835 1.00 37.87 ? 138 GLY A N   1 
ATOM   74   C CA  . GLY A 1 10  ? 12.605  -11.580 -16.175 1.00 35.63 ? 138 GLY A CA  1 
ATOM   75   C C   . GLY A 1 10  ? 11.469  -11.237 -15.209 1.00 35.50 ? 138 GLY A C   1 
ATOM   76   O O   . GLY A 1 10  ? 10.964  -12.145 -14.557 1.00 35.66 ? 138 GLY A O   1 
ATOM   77   N N   . ASP A 1 11  ? 11.064  -9.951  -15.112 1.00 34.55 ? 139 ASP A N   1 
ATOM   78   C CA  . ASP A 1 11  ? 9.933   -9.535  -14.230 1.00 33.46 ? 139 ASP A CA  1 
ATOM   79   C C   . ASP A 1 11  ? 8.648   -9.561  -15.060 1.00 32.00 ? 139 ASP A C   1 
ATOM   80   O O   . ASP A 1 11  ? 8.559   -8.877  -16.087 1.00 32.04 ? 139 ASP A O   1 
ATOM   81   C CB  . ASP A 1 11  ? 10.074  -8.089  -13.750 1.00 34.65 ? 139 ASP A CB  1 
ATOM   82   C CG  . ASP A 1 11  ? 10.955  -7.924  -12.533 1.00 37.69 ? 139 ASP A CG  1 
ATOM   83   O OD1 . ASP A 1 11  ? 11.259  -8.891  -11.805 1.00 40.02 ? 139 ASP A OD1 1 
ATOM   84   O OD2 . ASP A 1 11  ? 11.370  -6.750  -12.332 1.00 44.40 ? 139 ASP A OD2 1 
ATOM   85   N N   . LYS A 1 12  ? 7.671   -10.326 -14.611 1.00 31.64 ? 140 LYS A N   1 
ATOM   86   C CA  . LYS A 1 12  ? 6.318   -10.314 -15.171 1.00 29.51 ? 140 LYS A CA  1 
ATOM   87   C C   . LYS A 1 12  ? 5.658   -8.973  -14.858 1.00 28.71 ? 140 LYS A C   1 
ATOM   88   O O   . LYS A 1 12  ? 5.884   -8.428  -13.791 1.00 28.08 ? 140 LYS A O   1 
ATOM   89   C CB  . LYS A 1 12  ? 5.459   -11.374 -14.456 1.00 28.28 ? 140 LYS A CB  1 
ATOM   90   C CG  . LYS A 1 12  ? 5.879   -12.795 -14.760 1.00 31.92 ? 140 LYS A CG  1 
ATOM   91   C CD  . LYS A 1 12  ? 4.967   -13.775 -14.044 1.00 30.70 ? 140 LYS A CD  1 
ATOM   92   C CE  . LYS A 1 12  ? 5.568   -15.224 -14.240 1.00 26.59 ? 140 LYS A CE  1 
ATOM   93   N NZ  . LYS A 1 12  ? 4.748   -16.244 -13.465 1.00 27.81 ? 140 LYS A NZ  1 
ATOM   94   N N   . PRO A 1 13  ? 4.796   -8.461  -15.758 1.00 27.45 ? 141 PRO A N   1 
ATOM   95   C CA  . PRO A 1 13  ? 3.975   -7.318  -15.236 1.00 26.41 ? 141 PRO A CA  1 
ATOM   96   C C   . PRO A 1 13  ? 3.214   -7.764  -13.948 1.00 25.57 ? 141 PRO A C   1 
ATOM   97   O O   . PRO A 1 13  ? 2.576   -8.857  -13.918 1.00 24.04 ? 141 PRO A O   1 
ATOM   98   C CB  . PRO A 1 13  ? 2.973   -7.011  -16.388 1.00 25.44 ? 141 PRO A CB  1 
ATOM   99   C CG  . PRO A 1 13  ? 3.498   -7.800  -17.621 1.00 27.34 ? 141 PRO A CG  1 
ATOM   100  C CD  . PRO A 1 13  ? 4.281   -8.988  -17.040 1.00 29.64 ? 141 PRO A CD  1 
ATOM   101  N N   . PRO A 1 14  ? 3.267   -6.945  -12.878 1.00 24.74 ? 142 PRO A N   1 
ATOM   102  C CA  . PRO A 1 14  ? 2.744   -7.541  -11.610 1.00 24.29 ? 142 PRO A CA  1 
ATOM   103  C C   . PRO A 1 14  ? 1.193   -7.420  -11.434 1.00 24.65 ? 142 PRO A C   1 
ATOM   104  O O   . PRO A 1 14  ? 0.530   -6.651  -12.180 1.00 22.58 ? 142 PRO A O   1 
ATOM   105  C CB  . PRO A 1 14  ? 3.485   -6.727  -10.523 1.00 25.05 ? 142 PRO A CB  1 
ATOM   106  C CG  . PRO A 1 14  ? 3.593   -5.249  -11.219 1.00 24.31 ? 142 PRO A CG  1 
ATOM   107  C CD  . PRO A 1 14  ? 3.968   -5.621  -12.688 1.00 22.84 ? 142 PRO A CD  1 
ATOM   108  N N   . PRO A 1 15  ? 0.615   -8.145  -10.444 1.00 24.23 ? 143 PRO A N   1 
ATOM   109  C CA  . PRO A 1 15  ? -0.789  -7.903  -10.113 1.00 23.08 ? 143 PRO A CA  1 
ATOM   110  C C   . PRO A 1 15  ? -1.045  -6.395  -9.945  1.00 23.20 ? 143 PRO A C   1 
ATOM   111  O O   . PRO A 1 15  ? -0.216  -5.688  -9.316  1.00 22.89 ? 143 PRO A O   1 
ATOM   112  C CB  . PRO A 1 15  ? -0.949  -8.601  -8.768  1.00 24.69 ? 143 PRO A CB  1 
ATOM   113  C CG  . PRO A 1 15  ? 0.008   -9.860  -8.935  1.00 24.86 ? 143 PRO A CG  1 
ATOM   114  C CD  . PRO A 1 15  ? 1.234   -9.111  -9.493  1.00 25.36 ? 143 PRO A CD  1 
ATOM   115  N N   . LEU A 1 16  ? -2.084  -5.898  -10.590 1.00 20.94 ? 144 LEU A N   1 
ATOM   116  C CA  . LEU A 1 16  ? -2.488  -4.467  -10.468 1.00 21.77 ? 144 LEU A CA  1 
ATOM   117  C C   . LEU A 1 16  ? -1.631  -3.527  -11.279 1.00 21.09 ? 144 LEU A C   1 
ATOM   118  O O   . LEU A 1 16  ? -1.729  -2.289  -11.177 1.00 22.38 ? 144 LEU A O   1 
ATOM   119  C CB  . LEU A 1 16  ? -2.601  -3.994  -8.995  1.00 21.74 ? 144 LEU A CB  1 
ATOM   120  C CG  . LEU A 1 16  ? -3.515  -4.817  -8.052  1.00 21.14 ? 144 LEU A CG  1 
ATOM   121  C CD1 . LEU A 1 16  ? -3.564  -4.089  -6.684  1.00 26.44 ? 144 LEU A CD1 1 
ATOM   122  C CD2 . LEU A 1 16  ? -4.914  -4.932  -8.698  1.00 17.22 ? 144 LEU A CD2 1 
ATOM   123  N N   . CYS A 1 17  ? -0.864  -4.091  -12.197 1.00 21.71 ? 145 CYS A N   1 
ATOM   124  C CA  . CYS A 1 17  ? -0.337  -3.327  -13.337 1.00 22.64 ? 145 CYS A CA  1 
ATOM   125  C C   . CYS A 1 17  ? -1.313  -3.462  -14.538 1.00 23.23 ? 145 CYS A C   1 
ATOM   126  O O   . CYS A 1 17  ? -1.596  -4.573  -15.037 1.00 23.10 ? 145 CYS A O   1 
ATOM   127  C CB  . CYS A 1 17  ? 1.089   -3.776  -13.703 1.00 23.57 ? 145 CYS A CB  1 
ATOM   128  S SG  . CYS A 1 17  ? 1.634   -3.119  -15.356 1.00 25.68 ? 145 CYS A SG  1 
ATOM   129  N N   . GLY A 1 18  ? -1.967  -2.344  -14.890 1.00 22.21 ? 146 GLY A N   1 
ATOM   130  C CA  . GLY A 1 18  ? -2.931  -2.353  -15.994 1.00 21.52 ? 146 GLY A CA  1 
ATOM   131  C C   . GLY A 1 18  ? -4.008  -3.400  -15.755 1.00 23.42 ? 146 GLY A C   1 
ATOM   132  O O   . GLY A 1 18  ? -4.575  -3.452  -14.680 1.00 23.16 ? 146 GLY A O   1 
ATOM   133  N N   . ALA A 1 19  ? -4.209  -4.274  -16.742 1.00 23.13 ? 147 ALA A N   1 
ATOM   134  C CA  . ALA A 1 19  ? -5.163  -5.418  -16.682 1.00 23.92 ? 147 ALA A CA  1 
ATOM   135  C C   . ALA A 1 19  ? -4.707  -6.673  -15.886 1.00 24.07 ? 147 ALA A C   1 
ATOM   136  O O   . ALA A 1 19  ? -5.491  -7.634  -15.770 1.00 23.26 ? 147 ALA A O   1 
ATOM   137  C CB  . ALA A 1 19  ? -5.510  -5.833  -18.163 1.00 23.72 ? 147 ALA A CB  1 
ATOM   138  N N   . ILE A 1 20  ? -3.515  -6.682  -15.294 1.00 22.19 ? 148 ILE A N   1 
ATOM   139  C CA  . ILE A 1 20  ? -3.102  -7.953  -14.572 1.00 22.13 ? 148 ILE A CA  1 
ATOM   140  C C   . ILE A 1 20  ? -3.915  -8.035  -13.295 1.00 23.99 ? 148 ILE A C   1 
ATOM   141  O O   . ILE A 1 20  ? -3.924  -7.050  -12.531 1.00 25.58 ? 148 ILE A O   1 
ATOM   142  C CB  . ILE A 1 20  ? -1.611  -8.042  -14.287 1.00 20.35 ? 148 ILE A CB  1 
ATOM   143  C CG1 . ILE A 1 20  ? -0.791  -7.824  -15.598 1.00 19.55 ? 148 ILE A CG1 1 
ATOM   144  C CG2 . ILE A 1 20  ? -1.289  -9.427  -13.662 1.00 20.83 ? 148 ILE A CG2 1 
ATOM   145  C CD1 . ILE A 1 20  ? -1.204  -8.767  -16.797 1.00 23.87 ? 148 ILE A CD1 1 
ATOM   146  N N   . PRO A 1 21  ? -4.624  -9.148  -13.064 1.00 24.39 ? 149 PRO A N   1 
ATOM   147  C CA  . PRO A 1 21  ? -5.565  -9.114  -11.943 1.00 25.18 ? 149 PRO A CA  1 
ATOM   148  C C   . PRO A 1 21  ? -4.843  -9.222  -10.597 1.00 25.01 ? 149 PRO A C   1 
ATOM   149  O O   . PRO A 1 21  ? -3.749  -9.717  -10.545 1.00 23.48 ? 149 PRO A O   1 
ATOM   150  C CB  . PRO A 1 21  ? -6.440  -10.354 -12.162 1.00 25.77 ? 149 PRO A CB  1 
ATOM   151  C CG  . PRO A 1 21  ? -5.515  -11.339 -12.892 1.00 27.03 ? 149 PRO A CG  1 
ATOM   152  C CD  . PRO A 1 21  ? -4.811  -10.382 -13.887 1.00 25.65 ? 149 PRO A CD  1 
ATOM   153  N N   . ALA A 1 22  ? -5.491  -8.771  -9.537  1.00 25.64 ? 150 ALA A N   1 
ATOM   154  C CA  . ALA A 1 22  ? -4.993  -8.962  -8.164  1.00 26.04 ? 150 ALA A CA  1 
ATOM   155  C C   . ALA A 1 22  ? -4.914  -10.471 -7.863  1.00 28.78 ? 150 ALA A C   1 
ATOM   156  O O   . ALA A 1 22  ? -5.701  -11.260 -8.416  1.00 25.87 ? 150 ALA A O   1 
ATOM   157  C CB  . ALA A 1 22  ? -5.972  -8.274  -7.179  1.00 28.04 ? 150 ALA A CB  1 
ATOM   158  N N   . SER A 1 23  ? -3.972  -10.871 -7.011  1.00 30.63 ? 151 SER A N   1 
ATOM   159  C CA  . SER A 1 23  ? -3.902  -12.255 -6.430  1.00 34.32 ? 151 SER A CA  1 
ATOM   160  C C   . SER A 1 23  ? -5.169  -12.666 -5.733  1.00 34.53 ? 151 SER A C   1 
ATOM   161  O O   . SER A 1 23  ? -5.899  -11.814 -5.215  1.00 33.45 ? 151 SER A O   1 
ATOM   162  C CB  . SER A 1 23  ? -2.787  -12.270 -5.391  1.00 34.96 ? 151 SER A CB  1 
ATOM   163  O OG  . SER A 1 23  ? -1.726  -11.477 -5.934  1.00 41.85 ? 151 SER A OG  1 
ATOM   164  N N   . GLY A 1 24  ? -5.452  -13.969 -5.673  1.00 34.52 ? 152 GLY A N   1 
ATOM   165  C CA  . GLY A 1 24  ? -6.751  -14.372 -5.101  1.00 36.09 ? 152 GLY A CA  1 
ATOM   166  C C   . GLY A 1 24  ? -6.978  -14.069 -3.629  1.00 36.45 ? 152 GLY A C   1 
ATOM   167  O O   . GLY A 1 24  ? -8.119  -14.000 -3.179  1.00 38.46 ? 152 GLY A O   1 
ATOM   168  N N   . ASP A 1 25  ? -5.890  -13.921 -2.887  1.00 36.56 ? 153 ASP A N   1 
ATOM   169  C CA  . ASP A 1 25  ? -5.908  -13.603 -1.455  1.00 36.21 ? 153 ASP A CA  1 
ATOM   170  C C   . ASP A 1 25  ? -5.683  -12.085 -1.174  1.00 34.39 ? 153 ASP A C   1 
ATOM   171  O O   . ASP A 1 25  ? -5.437  -11.662 -0.034  1.00 32.25 ? 153 ASP A O   1 
ATOM   172  C CB  . ASP A 1 25  ? -4.766  -14.421 -0.775  1.00 39.29 ? 153 ASP A CB  1 
ATOM   173  C CG  . ASP A 1 25  ? -3.327  -14.065 -1.356  1.00 45.00 ? 153 ASP A CG  1 
ATOM   174  O OD1 . ASP A 1 25  ? -3.173  -13.171 -2.209  1.00 49.46 ? 153 ASP A OD1 1 
ATOM   175  O OD2 . ASP A 1 25  ? -2.309  -14.653 -0.926  1.00 50.75 ? 153 ASP A OD2 1 
ATOM   176  N N   . TYR A 1 26  ? -5.777  -11.257 -2.220  1.00 30.30 ? 154 TYR A N   1 
ATOM   177  C CA  . TYR A 1 26  ? -5.299  -9.891  -2.073  1.00 28.63 ? 154 TYR A CA  1 
ATOM   178  C C   . TYR A 1 26  ? -6.234  -9.111  -1.178  1.00 27.37 ? 154 TYR A C   1 
ATOM   179  O O   . TYR A 1 26  ? -7.458  -9.307  -1.233  1.00 25.82 ? 154 TYR A O   1 
ATOM   180  C CB  . TYR A 1 26  ? -5.219  -9.228  -3.442  1.00 27.28 ? 154 TYR A CB  1 
ATOM   181  C CG  . TYR A 1 26  ? -4.808  -7.785  -3.357  1.00 25.62 ? 154 TYR A CG  1 
ATOM   182  C CD1 . TYR A 1 26  ? -3.466  -7.443  -3.250  1.00 27.13 ? 154 TYR A CD1 1 
ATOM   183  C CD2 . TYR A 1 26  ? -5.774  -6.754  -3.431  1.00 26.66 ? 154 TYR A CD2 1 
ATOM   184  C CE1 . TYR A 1 26  ? -3.055  -6.095  -3.192  1.00 27.68 ? 154 TYR A CE1 1 
ATOM   185  C CE2 . TYR A 1 26  ? -5.375  -5.419  -3.351  1.00 22.56 ? 154 TYR A CE2 1 
ATOM   186  C CZ  . TYR A 1 26  ? -4.009  -5.110  -3.241  1.00 24.02 ? 154 TYR A CZ  1 
ATOM   187  O OH  . TYR A 1 26  ? -3.578  -3.790  -3.222  1.00 23.82 ? 154 TYR A OH  1 
ATOM   188  N N   . VAL A 1 27  ? -5.653  -8.214  -0.377  1.00 26.00 ? 155 VAL A N   1 
ATOM   189  C CA  . VAL A 1 27  ? -6.383  -7.300  0.481   1.00 26.26 ? 155 VAL A CA  1 
ATOM   190  C C   . VAL A 1 27  ? -5.844  -5.887  0.302   1.00 25.12 ? 155 VAL A C   1 
ATOM   191  O O   . VAL A 1 27  ? -4.662  -5.632  0.465   1.00 25.62 ? 155 VAL A O   1 
ATOM   192  C CB  . VAL A 1 27  ? -6.256  -7.696  2.006   1.00 27.17 ? 155 VAL A CB  1 
ATOM   193  C CG1 . VAL A 1 27  ? -6.957  -6.693  2.923   1.00 27.77 ? 155 VAL A CG1 1 
ATOM   194  C CG2 . VAL A 1 27  ? -6.775  -9.109  2.202   1.00 28.27 ? 155 VAL A CG2 1 
ATOM   195  N N   . ALA A 1 28  ? -6.743  -4.989  -0.067  1.00 23.57 ? 156 ALA A N   1 
ATOM   196  C CA  . ALA A 1 28  ? -6.391  -3.583  -0.254  1.00 25.55 ? 156 ALA A CA  1 
ATOM   197  C C   . ALA A 1 28  ? -6.129  -2.855  1.093   1.00 25.25 ? 156 ALA A C   1 
ATOM   198  O O   . ALA A 1 28  ? -6.671  -3.233  2.135   1.00 27.77 ? 156 ALA A O   1 
ATOM   199  C CB  . ALA A 1 28  ? -7.502  -2.860  -1.115  1.00 24.72 ? 156 ALA A CB  1 
ATOM   200  N N   . ARG A 1 29  ? -5.257  -1.856  1.064   1.00 24.32 ? 157 ARG A N   1 
ATOM   201  C CA  . ARG A 1 29  ? -4.933  -1.015  2.238   1.00 25.68 ? 157 ARG A CA  1 
ATOM   202  C C   . ARG A 1 29  ? -5.888  0.131   2.472   1.00 25.56 ? 157 ARG A C   1 
ATOM   203  O O   . ARG A 1 29  ? -6.458  0.652   1.500   1.00 25.52 ? 157 ARG A O   1 
ATOM   204  C CB  . ARG A 1 29  ? -3.585  -0.329  2.060   1.00 24.83 ? 157 ARG A CB  1 
ATOM   205  C CG  . ARG A 1 29  ? -2.421  -1.203  2.027   1.00 29.05 ? 157 ARG A CG  1 
ATOM   206  C CD  . ARG A 1 29  ? -1.151  -0.339  2.062   1.00 27.38 ? 157 ARG A CD  1 
ATOM   207  N NE  . ARG A 1 29  ? 0.000   -1.171  1.820   1.00 31.30 ? 157 ARG A NE  1 
ATOM   208  C CZ  . ARG A 1 29  ? 1.227   -0.697  1.579   1.00 29.23 ? 157 ARG A CZ  1 
ATOM   209  N NH1 . ARG A 1 29  ? 1.431   0.612   1.601   1.00 26.24 ? 157 ARG A NH1 1 
ATOM   210  N NH2 . ARG A 1 29  ? 2.233   -1.547  1.343   1.00 32.94 ? 157 ARG A NH2 1 
ATOM   211  N N   . PRO A 1 30  ? -6.051  0.555   3.729   1.00 25.19 ? 158 PRO A N   1 
ATOM   212  C CA  . PRO A 1 30  ? -6.690  1.854   3.915   1.00 26.53 ? 158 PRO A CA  1 
ATOM   213  C C   . PRO A 1 30  ? -6.144  2.915   2.974   1.00 25.58 ? 158 PRO A C   1 
ATOM   214  O O   . PRO A 1 30  ? -4.928  2.992   2.691   1.00 25.96 ? 158 PRO A O   1 
ATOM   215  C CB  . PRO A 1 30  ? -6.409  2.200   5.401   1.00 27.72 ? 158 PRO A CB  1 
ATOM   216  C CG  . PRO A 1 30  ? -6.355  0.814   6.078   1.00 27.81 ? 158 PRO A CG  1 
ATOM   217  C CD  . PRO A 1 30  ? -5.526  0.034   5.000   1.00 28.31 ? 158 PRO A CD  1 
ATOM   218  N N   . GLY A 1 31  ? -7.067  3.713   2.457   1.00 26.74 ? 159 GLY A N   1 
ATOM   219  C CA  . GLY A 1 31  ? -6.743  4.803   1.528   1.00 25.17 ? 159 GLY A CA  1 
ATOM   220  C C   . GLY A 1 31  ? -6.701  4.320   0.069   1.00 25.25 ? 159 GLY A C   1 
ATOM   221  O O   . GLY A 1 31  ? -6.656  5.150   -0.835  1.00 24.19 ? 159 GLY A O   1 
ATOM   222  N N   . ASP A 1 32  ? -6.703  2.995   -0.205  1.00 22.15 ? 160 ASP A N   1 
ATOM   223  C CA  . ASP A 1 32  ? -6.640  2.579   -1.618  1.00 22.46 ? 160 ASP A CA  1 
ATOM   224  C C   . ASP A 1 32  ? -7.972  2.880   -2.285  1.00 22.86 ? 160 ASP A C   1 
ATOM   225  O O   . ASP A 1 32  ? -9.020  2.784   -1.631  1.00 21.83 ? 160 ASP A O   1 
ATOM   226  C CB  . ASP A 1 32  ? -6.426  1.031   -1.755  1.00 21.67 ? 160 ASP A CB  1 
ATOM   227  C CG  . ASP A 1 32  ? -4.998  0.600   -1.479  1.00 22.43 ? 160 ASP A CG  1 
ATOM   228  O OD1 . ASP A 1 32  ? -4.113  1.484   -1.315  1.00 23.55 ? 160 ASP A OD1 1 
ATOM   229  O OD2 . ASP A 1 32  ? -4.752  -0.663  -1.374  1.00 23.46 ? 160 ASP A OD2 1 
ATOM   230  N N   . LYS A 1 33  ? -7.954  3.155   -3.600  1.00 22.78 ? 161 LYS A N   1 
ATOM   231  C CA  . LYS A 1 33  ? -9.209  3.459   -4.283  1.00 23.37 ? 161 LYS A CA  1 
ATOM   232  C C   . LYS A 1 33  ? -9.595  2.182   -4.906  1.00 22.37 ? 161 LYS A C   1 
ATOM   233  O O   . LYS A 1 33  ? -8.711  1.429   -5.372  1.00 21.99 ? 161 LYS A O   1 
ATOM   234  C CB  . LYS A 1 33  ? -9.007  4.527   -5.370  1.00 24.49 ? 161 LYS A CB  1 
ATOM   235  C CG  . LYS A 1 33  ? -8.596  5.859   -4.826  1.00 27.93 ? 161 LYS A CG  1 
ATOM   236  C CD  . LYS A 1 33  ? -9.768  6.477   -4.128  1.00 32.16 ? 161 LYS A CD  1 
ATOM   237  C CE  . LYS A 1 33  ? -9.709  8.002   -4.083  1.00 42.63 ? 161 LYS A CE  1 
ATOM   238  N NZ  . LYS A 1 33  ? -9.713  8.581   -5.511  1.00 45.38 ? 161 LYS A NZ  1 
ATOM   239  N N   . VAL A 1 34  ? -10.890 1.896   -4.901  1.00 20.73 ? 162 VAL A N   1 
ATOM   240  C CA  . VAL A 1 34  ? -11.392 0.647   -5.436  1.00 20.32 ? 162 VAL A CA  1 
ATOM   241  C C   . VAL A 1 34  ? -12.668 0.875   -6.253  1.00 22.11 ? 162 VAL A C   1 
ATOM   242  O O   . VAL A 1 34  ? -13.326 1.919   -6.127  1.00 22.50 ? 162 VAL A O   1 
ATOM   243  C CB  . VAL A 1 34  ? -11.766 -0.367  -4.307  1.00 18.70 ? 162 VAL A CB  1 
ATOM   244  C CG1 . VAL A 1 34  ? -10.519 -0.785  -3.547  1.00 20.82 ? 162 VAL A CG1 1 
ATOM   245  C CG2 . VAL A 1 34  ? -12.886 0.112   -3.399  1.00 18.50 ? 162 VAL A CG2 1 
ATOM   246  N N   . ALA A 1 35  ? -13.069 -0.137  -7.026  1.00 22.30 ? 163 ALA A N   1 
ATOM   247  C CA  . ALA A 1 35  ? -14.460 -0.144  -7.500  1.00 22.52 ? 163 ALA A CA  1 
ATOM   248  C C   . ALA A 1 35  ? -15.286 -0.981  -6.549  1.00 23.14 ? 163 ALA A C   1 
ATOM   249  O O   . ALA A 1 35  ? -14.848 -2.048  -6.165  1.00 22.96 ? 163 ALA A O   1 
ATOM   250  C CB  . ALA A 1 35  ? -14.530 -0.639  -8.970  1.00 24.01 ? 163 ALA A CB  1 
ATOM   251  N N   . ALA A 1 36  ? -16.413 -0.460  -6.060  1.00 22.76 ? 164 ALA A N   1 
ATOM   252  C CA  . ALA A 1 36  ? -17.139 -1.139  -4.950  1.00 23.17 ? 164 ALA A CA  1 
ATOM   253  C C   . ALA A 1 36  ? -18.602 -1.314  -5.413  1.00 24.69 ? 164 ALA A C   1 
ATOM   254  O O   . ALA A 1 36  ? -19.187 -0.366  -5.925  1.00 23.92 ? 164 ALA A O   1 
ATOM   255  C CB  . ALA A 1 36  ? -17.028 -0.295  -3.671  1.00 24.09 ? 164 ALA A CB  1 
ATOM   256  N N   . ARG A 1 37  ? -19.161 -2.519  -5.313  1.00 23.80 ? 165 ARG A N   1 
ATOM   257  C CA  . ARG A 1 37  ? -20.515 -2.758  -5.850  1.00 25.33 ? 165 ARG A CA  1 
ATOM   258  C C   . ARG A 1 37  ? -21.513 -2.556  -4.705  1.00 26.02 ? 165 ARG A C   1 
ATOM   259  O O   . ARG A 1 37  ? -21.514 -3.332  -3.758  1.00 26.75 ? 165 ARG A O   1 
ATOM   260  C CB  . ARG A 1 37  ? -20.662 -4.176  -6.500  1.00 23.84 ? 165 ARG A CB  1 
ATOM   261  C CG  . ARG A 1 37  ? -21.956 -4.238  -7.413  1.00 29.91 ? 165 ARG A CG  1 
ATOM   262  C CD  . ARG A 1 37  ? -22.216 -5.607  -8.004  1.00 37.63 ? 165 ARG A CD  1 
ATOM   263  N NE  . ARG A 1 37  ? -22.613 -6.490  -6.920  1.00 51.09 ? 165 ARG A NE  1 
ATOM   264  C CZ  . ARG A 1 37  ? -23.012 -7.753  -7.065  1.00 56.78 ? 165 ARG A CZ  1 
ATOM   265  N NH1 . ARG A 1 37  ? -23.094 -8.323  -8.270  1.00 61.41 ? 165 ARG A NH1 1 
ATOM   266  N NH2 . ARG A 1 37  ? -23.320 -8.444  -5.989  1.00 59.27 ? 165 ARG A NH2 1 
ATOM   267  N N   . VAL A 1 38  ? -22.327 -1.499  -4.753  1.00 26.68 ? 166 VAL A N   1 
ATOM   268  C CA  . VAL A 1 38  ? -23.182 -1.145  -3.651  1.00 28.48 ? 166 VAL A CA  1 
ATOM   269  C C   . VAL A 1 38  ? -24.653 -1.193  -4.114  1.00 32.82 ? 166 VAL A C   1 
ATOM   270  O O   . VAL A 1 38  ? -24.944 -1.231  -5.302  1.00 30.23 ? 166 VAL A O   1 
ATOM   271  C CB  . VAL A 1 38  ? -22.859 0.257   -3.075  1.00 29.58 ? 166 VAL A CB  1 
ATOM   272  C CG1 . VAL A 1 38  ? -21.397 0.275   -2.489  1.00 27.27 ? 166 VAL A CG1 1 
ATOM   273  C CG2 . VAL A 1 38  ? -23.046 1.361   -4.164  1.00 29.11 ? 166 VAL A CG2 1 
ATOM   274  N N   . LYS A 1 39  ? -25.579 -1.219  -3.166  1.00 37.29 ? 167 LYS A N   1 
ATOM   275  C CA  . LYS A 1 39  ? -26.981 -1.205  -3.577  1.00 42.08 ? 167 LYS A CA  1 
ATOM   276  C C   . LYS A 1 39  ? -27.285 0.234   -3.948  1.00 44.39 ? 167 LYS A C   1 
ATOM   277  O O   . LYS A 1 39  ? -26.903 1.171   -3.220  1.00 43.78 ? 167 LYS A O   1 
ATOM   278  C CB  . LYS A 1 39  ? -27.920 -1.642  -2.472  1.00 42.94 ? 167 LYS A CB  1 
ATOM   279  C CG  . LYS A 1 39  ? -28.912 -2.797  -2.915  1.00 50.06 ? 167 LYS A CG  1 
ATOM   280  C CD  . LYS A 1 39  ? -29.803 -2.458  -4.097  1.00 55.85 ? 167 LYS A CD  1 
ATOM   281  C CE  . LYS A 1 39  ? -30.789 -3.587  -4.463  1.00 60.37 ? 167 LYS A CE  1 
ATOM   282  N NZ  . LYS A 1 39  ? -31.313 -4.243  -3.222  1.00 65.58 ? 167 LYS A NZ  1 
ATOM   283  N N   . ALA A 1 40  ? -27.945 0.392   -5.091  1.00 46.42 ? 168 ALA A N   1 
ATOM   284  C CA  . ALA A 1 40  ? -28.453 1.693   -5.490  1.00 48.99 ? 168 ALA A CA  1 
ATOM   285  C C   . ALA A 1 40  ? -29.986 1.779   -5.302  1.00 50.26 ? 168 ALA A C   1 
ATOM   286  O O   . ALA A 1 40  ? -30.560 1.159   -4.378  1.00 50.52 ? 168 ALA A O   1 
ATOM   287  C CB  . ALA A 1 40  ? -28.055 1.949   -6.927  1.00 49.82 ? 168 ALA A CB  1 
ATOM   288  N N   . VAL A 1 41  ? -30.641 2.534   -6.188  1.00 51.41 ? 169 VAL A N   1 
ATOM   289  C CA  . VAL A 1 41  ? -32.069 2.888   -6.056  1.00 52.03 ? 169 VAL A CA  1 
ATOM   290  C C   . VAL A 1 41  ? -33.060 1.747   -6.341  1.00 52.22 ? 169 VAL A C   1 
ATOM   291  O O   . VAL A 1 41  ? -32.862 0.985   -7.288  1.00 52.90 ? 169 VAL A O   1 
ATOM   292  C CB  . VAL A 1 41  ? -32.366 4.153   -6.917  1.00 52.22 ? 169 VAL A CB  1 
ATOM   293  C CG1 . VAL A 1 41  ? -33.855 4.424   -7.019  1.00 52.45 ? 169 VAL A CG1 1 
ATOM   294  C CG2 . VAL A 1 41  ? -31.630 5.355   -6.325  1.00 51.56 ? 169 VAL A CG2 1 
ATOM   295  N N   . ASP A 1 44  ? -31.653 -1.756  -7.491  1.00 52.00 ? 172 ASP A N   1 
ATOM   296  C CA  . ASP A 1 44  ? -30.557 -1.915  -8.479  1.00 51.66 ? 172 ASP A CA  1 
ATOM   297  C C   . ASP A 1 44  ? -29.184 -1.993  -7.782  1.00 50.11 ? 172 ASP A C   1 
ATOM   298  O O   . ASP A 1 44  ? -29.043 -1.578  -6.631  1.00 50.46 ? 172 ASP A O   1 
ATOM   299  C CB  . ASP A 1 44  ? -30.552 -0.765  -9.519  1.00 52.78 ? 172 ASP A CB  1 
ATOM   300  C CG  . ASP A 1 44  ? -31.847 -0.712  -10.382 1.00 56.49 ? 172 ASP A CG  1 
ATOM   301  O OD1 . ASP A 1 44  ? -31.945 -1.439  -11.402 1.00 59.46 ? 172 ASP A OD1 1 
ATOM   302  O OD2 . ASP A 1 44  ? -32.760 0.079   -10.036 1.00 59.16 ? 172 ASP A OD2 1 
ATOM   303  N N   . GLU A 1 45  ? -28.189 -2.553  -8.455  1.00 48.40 ? 173 GLU A N   1 
ATOM   304  C CA  . GLU A 1 45  ? -26.824 -2.491  -7.925  1.00 46.88 ? 173 GLU A CA  1 
ATOM   305  C C   . GLU A 1 45  ? -25.887 -1.667  -8.851  1.00 44.50 ? 173 GLU A C   1 
ATOM   306  O O   . GLU A 1 45  ? -26.111 -1.585  -10.072 1.00 45.25 ? 173 GLU A O   1 
ATOM   307  C CB  . GLU A 1 45  ? -26.310 -3.890  -7.593  1.00 48.12 ? 173 GLU A CB  1 
ATOM   308  C CG  . GLU A 1 45  ? -26.881 -4.436  -6.253  1.00 50.17 ? 173 GLU A CG  1 
ATOM   309  C CD  . GLU A 1 45  ? -26.287 -5.781  -5.847  1.00 56.21 ? 173 GLU A CD  1 
ATOM   310  O OE1 . GLU A 1 45  ? -25.045 -5.893  -5.859  1.00 57.87 ? 173 GLU A OE1 1 
ATOM   311  O OE2 . GLU A 1 45  ? -27.061 -6.713  -5.502  1.00 58.02 ? 173 GLU A OE2 1 
ATOM   312  N N   . GLN A 1 46  ? -24.883 -1.014  -8.263  1.00 39.98 ? 174 GLN A N   1 
ATOM   313  C CA  . GLN A 1 46  ? -24.063 -0.053  -8.984  1.00 34.27 ? 174 GLN A CA  1 
ATOM   314  C C   . GLN A 1 46  ? -22.615 -0.185  -8.520  1.00 31.42 ? 174 GLN A C   1 
ATOM   315  O O   . GLN A 1 46  ? -22.349 -0.196  -7.299  1.00 28.48 ? 174 GLN A O   1 
ATOM   316  C CB  . GLN A 1 46  ? -24.579 1.348   -8.665  1.00 34.19 ? 174 GLN A CB  1 
ATOM   317  C CG  . GLN A 1 46  ? -23.832 2.503   -9.299  1.00 38.62 ? 174 GLN A CG  1 
ATOM   318  C CD  . GLN A 1 46  ? -23.818 2.491   -10.840 1.00 43.57 ? 174 GLN A CD  1 
ATOM   319  O OE1 . GLN A 1 46  ? -24.880 2.502   -11.492 1.00 46.19 ? 174 GLN A OE1 1 
ATOM   320  N NE2 . GLN A 1 46  ? -22.609 2.488   -11.428 1.00 40.83 ? 174 GLN A NE2 1 
ATOM   321  N N   . TRP A 1 47  ? -21.688 -0.270  -9.477  1.00 28.18 ? 175 TRP A N   1 
ATOM   322  C CA  . TRP A 1 47  ? -20.258 -0.077  -9.151  1.00 25.65 ? 175 TRP A CA  1 
ATOM   323  C C   . TRP A 1 47  ? -19.872 1.378   -8.984  1.00 24.97 ? 175 TRP A C   1 
ATOM   324  O O   . TRP A 1 47  ? -20.168 2.225   -9.869  1.00 23.83 ? 175 TRP A O   1 
ATOM   325  C CB  . TRP A 1 47  ? -19.387 -0.746  -10.203 1.00 26.15 ? 175 TRP A CB  1 
ATOM   326  C CG  . TRP A 1 47  ? -19.490 -2.222  -10.222 1.00 26.25 ? 175 TRP A CG  1 
ATOM   327  C CD1 . TRP A 1 47  ? -20.308 -2.997  -11.030 1.00 29.63 ? 175 TRP A CD1 1 
ATOM   328  C CD2 . TRP A 1 47  ? -18.682 -3.164  -9.452  1.00 26.10 ? 175 TRP A CD2 1 
ATOM   329  N NE1 . TRP A 1 47  ? -20.070 -4.339  -10.769 1.00 28.51 ? 175 TRP A NE1 1 
ATOM   330  C CE2 . TRP A 1 47  ? -19.102 -4.464  -9.802  1.00 27.96 ? 175 TRP A CE2 1 
ATOM   331  C CE3 . TRP A 1 47  ? -17.683 -3.017  -8.482  1.00 23.88 ? 175 TRP A CE3 1 
ATOM   332  C CZ2 . TRP A 1 47  ? -18.553 -5.637  -9.199  1.00 27.34 ? 175 TRP A CZ2 1 
ATOM   333  C CZ3 . TRP A 1 47  ? -17.131 -4.153  -7.912  1.00 22.69 ? 175 TRP A CZ3 1 
ATOM   334  C CH2 . TRP A 1 47  ? -17.583 -5.453  -8.256  1.00 24.38 ? 175 TRP A CH2 1 
ATOM   335  N N   . ILE A 1 48  ? -19.291 1.701   -7.820  1.00 22.11 ? 176 ILE A N   1 
ATOM   336  C CA  . ILE A 1 48  ? -18.883 3.069   -7.547  1.00 23.31 ? 176 ILE A CA  1 
ATOM   337  C C   . ILE A 1 48  ? -17.411 3.146   -7.216  1.00 23.18 ? 176 ILE A C   1 
ATOM   338  O O   . ILE A 1 48  ? -16.799 2.173   -6.754  1.00 22.38 ? 176 ILE A O   1 
ATOM   339  C CB  . ILE A 1 48  ? -19.669 3.731   -6.359  1.00 24.98 ? 176 ILE A CB  1 
ATOM   340  C CG1 . ILE A 1 48  ? -19.374 3.037   -5.008  1.00 25.72 ? 176 ILE A CG1 1 
ATOM   341  C CG2 . ILE A 1 48  ? -21.193 3.838   -6.671  1.00 22.78 ? 176 ILE A CG2 1 
ATOM   342  C CD1 . ILE A 1 48  ? -19.779 3.874   -3.864  1.00 30.45 ? 176 ILE A CD1 1 
ATOM   343  N N   . LEU A 1 49  ? -16.832 4.295   -7.483  1.00 22.15 ? 177 LEU A N   1 
ATOM   344  C CA  . LEU A 1 49  ? -15.522 4.626   -6.971  1.00 23.13 ? 177 LEU A CA  1 
ATOM   345  C C   . LEU A 1 49  ? -15.591 4.842   -5.443  1.00 23.72 ? 177 LEU A C   1 
ATOM   346  O O   . LEU A 1 49  ? -16.414 5.617   -4.917  1.00 22.63 ? 177 LEU A O   1 
ATOM   347  C CB  . LEU A 1 49  ? -14.984 5.854   -7.693  1.00 22.21 ? 177 LEU A CB  1 
ATOM   348  C CG  . LEU A 1 49  ? -13.554 6.307   -7.401  1.00 25.76 ? 177 LEU A CG  1 
ATOM   349  C CD1 . LEU A 1 49  ? -12.604 5.185   -7.869  1.00 23.51 ? 177 LEU A CD1 1 
ATOM   350  C CD2 . LEU A 1 49  ? -13.130 7.674   -8.018  1.00 25.47 ? 177 LEU A CD2 1 
ATOM   351  N N   . ALA A 1 50  ? -14.708 4.143   -4.725  1.00 23.75 ? 178 ALA A N   1 
ATOM   352  C CA  . ALA A 1 50  ? -14.685 4.172   -3.295  1.00 23.65 ? 178 ALA A CA  1 
ATOM   353  C C   . ALA A 1 50  ? -13.285 4.114   -2.693  1.00 23.92 ? 178 ALA A C   1 
ATOM   354  O O   . ALA A 1 50  ? -12.286 3.786   -3.377  1.00 23.88 ? 178 ALA A O   1 
ATOM   355  C CB  . ALA A 1 50  ? -15.625 3.034   -2.728  1.00 24.24 ? 178 ALA A CB  1 
ATOM   356  N N   . GLU A 1 51  ? -13.188 4.442   -1.409  1.00 22.74 ? 179 GLU A N   1 
ATOM   357  C CA  . GLU A 1 51  ? -11.888 4.418   -0.747  1.00 24.14 ? 179 GLU A CA  1 
ATOM   358  C C   . GLU A 1 51  ? -11.938 3.447   0.394   1.00 24.04 ? 179 GLU A C   1 
ATOM   359  O O   . GLU A 1 51  ? -12.875 3.491   1.193   1.00 24.86 ? 179 GLU A O   1 
ATOM   360  C CB  . GLU A 1 51  ? -11.527 5.793   -0.146  1.00 25.53 ? 179 GLU A CB  1 
ATOM   361  C CG  . GLU A 1 51  ? -10.054 5.884   0.113   1.00 29.39 ? 179 GLU A CG  1 
ATOM   362  C CD  . GLU A 1 51  ? -9.666  7.329   0.526   1.00 37.67 ? 179 GLU A CD  1 
ATOM   363  O OE1 . GLU A 1 51  ? -9.677  8.222   -0.354  1.00 39.02 ? 179 GLU A OE1 1 
ATOM   364  O OE2 . GLU A 1 51  ? -9.377  7.518   1.719   1.00 37.63 ? 179 GLU A OE2 1 
ATOM   365  N N   . VAL A 1 52  ? -10.945 2.578   0.474   1.00 24.43 ? 180 VAL A N   1 
ATOM   366  C CA  . VAL A 1 52  ? -10.917 1.563   1.534   1.00 23.81 ? 180 VAL A CA  1 
ATOM   367  C C   . VAL A 1 52  ? -10.671 2.294   2.884   1.00 26.44 ? 180 VAL A C   1 
ATOM   368  O O   . VAL A 1 52  ? -9.754  3.163   3.001   1.00 24.44 ? 180 VAL A O   1 
ATOM   369  C CB  . VAL A 1 52  ? -9.818  0.504   1.276   1.00 24.79 ? 180 VAL A CB  1 
ATOM   370  C CG1 . VAL A 1 52  ? -9.614  -0.415  2.490   1.00 23.33 ? 180 VAL A CG1 1 
ATOM   371  C CG2 . VAL A 1 52  ? -10.134 -0.385  0.084   1.00 23.33 ? 180 VAL A CG2 1 
ATOM   372  N N   . VAL A 1 53  ? -11.493 1.948   3.880   1.00 26.37 ? 181 VAL A N   1 
ATOM   373  C CA  . VAL A 1 53  ? -11.292 2.332   5.282   1.00 26.87 ? 181 VAL A CA  1 
ATOM   374  C C   . VAL A 1 53  ? -10.620 1.207   6.038   1.00 27.18 ? 181 VAL A C   1 
ATOM   375  O O   . VAL A 1 53  ? -9.586  1.435   6.689   1.00 26.34 ? 181 VAL A O   1 
ATOM   376  C CB  . VAL A 1 53  ? -12.638 2.731   5.921   1.00 27.84 ? 181 VAL A CB  1 
ATOM   377  C CG1 . VAL A 1 53  ? -12.485 3.065   7.467   1.00 30.30 ? 181 VAL A CG1 1 
ATOM   378  C CG2 . VAL A 1 53  ? -13.255 3.917   5.137   1.00 24.55 ? 181 VAL A CG2 1 
ATOM   379  N N   . SER A 1 54  ? -11.122 -0.022  5.931   1.00 26.50 ? 182 SER A N   1 
ATOM   380  C CA  . SER A 1 54  ? -10.473 -1.152  6.625   1.00 27.34 ? 182 SER A CA  1 
ATOM   381  C C   . SER A 1 54  ? -10.942 -2.452  6.037   1.00 27.35 ? 182 SER A C   1 
ATOM   382  O O   . SER A 1 54  ? -11.855 -2.485  5.234   1.00 27.51 ? 182 SER A O   1 
ATOM   383  C CB  . SER A 1 54  ? -10.780 -1.161  8.131   1.00 28.13 ? 182 SER A CB  1 
ATOM   384  O OG  . SER A 1 54  ? -12.198 -1.142  8.386   1.00 30.43 ? 182 SER A OG  1 
ATOM   385  N N   . TYR A 1 55  ? -10.260 -3.509  6.407   1.00 27.78 ? 183 TYR A N   1 
ATOM   386  C CA  . TYR A 1 55  ? -10.665 -4.873  6.111   1.00 28.55 ? 183 TYR A CA  1 
ATOM   387  C C   . TYR A 1 55  ? -10.638 -5.721  7.370   1.00 29.46 ? 183 TYR A C   1 
ATOM   388  O O   . TYR A 1 55  ? -9.693  -5.626  8.184   1.00 30.17 ? 183 TYR A O   1 
ATOM   389  C CB  . TYR A 1 55  ? -9.700  -5.474  5.072   1.00 25.80 ? 183 TYR A CB  1 
ATOM   390  C CG  . TYR A 1 55  ? -9.996  -6.886  4.649   1.00 26.99 ? 183 TYR A CG  1 
ATOM   391  C CD1 . TYR A 1 55  ? -11.007 -7.160  3.698   1.00 30.06 ? 183 TYR A CD1 1 
ATOM   392  C CD2 . TYR A 1 55  ? -9.256  -7.943  5.127   1.00 31.23 ? 183 TYR A CD2 1 
ATOM   393  C CE1 . TYR A 1 55  ? -11.261 -8.430  3.283   1.00 24.66 ? 183 TYR A CE1 1 
ATOM   394  C CE2 . TYR A 1 55  ? -9.512  -9.248  4.697   1.00 28.51 ? 183 TYR A CE2 1 
ATOM   395  C CZ  . TYR A 1 55  ? -10.511 -9.453  3.761   1.00 27.20 ? 183 TYR A CZ  1 
ATOM   396  O OH  . TYR A 1 55  ? -10.785 -10.708 3.322   1.00 30.51 ? 183 TYR A OH  1 
ATOM   397  N N   . SER A 1 56  ? -11.648 -6.577  7.517   1.00 30.89 ? 184 SER A N   1 
ATOM   398  C CA  . SER A 1 56  ? -11.660 -7.542  8.615   1.00 31.71 ? 184 SER A CA  1 
ATOM   399  C C   . SER A 1 56  ? -11.390 -8.959  8.087   1.00 32.44 ? 184 SER A C   1 
ATOM   400  O O   . SER A 1 56  ? -12.144 -9.483  7.269   1.00 32.35 ? 184 SER A O   1 
ATOM   401  C CB  . SER A 1 56  ? -13.006 -7.488  9.382   1.00 31.47 ? 184 SER A CB  1 
ATOM   402  O OG  . SER A 1 56  ? -13.162 -8.767  10.001  1.00 32.03 ? 184 SER A OG  1 
ATOM   403  N N   . HIS A 1 57  ? -10.278 -9.582  8.479   1.00 33.40 ? 185 HIS A N   1 
ATOM   404  C CA  . HIS A 1 57  ? -10.061 -10.969 8.088   1.00 35.53 ? 185 HIS A CA  1 
ATOM   405  C C   . HIS A 1 57  ? -11.086 -11.918 8.722   1.00 35.65 ? 185 HIS A C   1 
ATOM   406  O O   . HIS A 1 57  ? -11.288 -13.033 8.230   1.00 37.79 ? 185 HIS A O   1 
ATOM   407  C CB  . HIS A 1 57  ? -8.611  -11.442 8.396   1.00 35.69 ? 185 HIS A CB  1 
ATOM   408  C CG  . HIS A 1 57  ? -7.562  -10.853 7.495   1.00 38.02 ? 185 HIS A CG  1 
ATOM   409  N ND1 . HIS A 1 57  ? -7.069  -9.571  7.653   1.00 37.66 ? 185 HIS A ND1 1 
ATOM   410  C CD2 . HIS A 1 57  ? -6.884  -11.392 6.444   1.00 38.44 ? 185 HIS A CD2 1 
ATOM   411  C CE1 . HIS A 1 57  ? -6.133  -9.343  6.743   1.00 36.64 ? 185 HIS A CE1 1 
ATOM   412  N NE2 . HIS A 1 57  ? -6.014  -10.426 5.986   1.00 38.55 ? 185 HIS A NE2 1 
ATOM   413  N N   . ALA A 1 58  ? -11.749 -11.517 9.794   1.00 35.96 ? 186 ALA A N   1 
ATOM   414  C CA  . ALA A 1 58  ? -12.712 -12.424 10.440  1.00 35.63 ? 186 ALA A CA  1 
ATOM   415  C C   . ALA A 1 58  ? -13.971 -12.652 9.567   1.00 36.50 ? 186 ALA A C   1 
ATOM   416  O O   . ALA A 1 58  ? -14.463 -13.799 9.422   1.00 36.54 ? 186 ALA A O   1 
ATOM   417  C CB  . ALA A 1 58  ? -13.128 -11.869 11.755  1.00 35.27 ? 186 ALA A CB  1 
ATOM   418  N N   . THR A 1 59  ? -14.494 -11.540 9.019   1.00 33.85 ? 187 THR A N   1 
ATOM   419  C CA  . THR A 1 59  ? -15.664 -11.537 8.154   1.00 33.10 ? 187 THR A CA  1 
ATOM   420  C C   . THR A 1 59  ? -15.376 -11.450 6.622   1.00 33.37 ? 187 THR A C   1 
ATOM   421  O O   . THR A 1 59  ? -16.319 -11.612 5.837   1.00 33.62 ? 187 THR A O   1 
ATOM   422  C CB  . THR A 1 59  ? -16.618 -10.392 8.512   1.00 31.91 ? 187 THR A CB  1 
ATOM   423  O OG1 . THR A 1 59  ? -15.952 -9.184  8.221   1.00 29.31 ? 187 THR A OG1 1 
ATOM   424  C CG2 . THR A 1 59  ? -16.976 -10.337 10.026  1.00 32.55 ? 187 THR A CG2 1 
ATOM   425  N N   . ASN A 1 60  ? -14.119 -11.243 6.200   1.00 32.08 ? 188 ASN A N   1 
ATOM   426  C CA  . ASN A 1 60  ? -13.760 -11.031 4.765   1.00 34.00 ? 188 ASN A CA  1 
ATOM   427  C C   . ASN A 1 60  ? -14.559 -9.864  4.160   1.00 32.49 ? 188 ASN A C   1 
ATOM   428  O O   . ASN A 1 60  ? -15.003 -9.916  3.003   1.00 34.45 ? 188 ASN A O   1 
ATOM   429  C CB  . ASN A 1 60  ? -13.782 -12.342 3.884   1.00 34.93 ? 188 ASN A CB  1 
ATOM   430  C CG  . ASN A 1 60  ? -12.503 -13.255 4.083   1.00 40.13 ? 188 ASN A CG  1 
ATOM   431  O OD1 . ASN A 1 60  ? -11.624 -12.990 4.929   1.00 43.88 ? 188 ASN A OD1 1 
ATOM   432  N ND2 . ASN A 1 60  ? -12.420 -14.338 3.287   1.00 43.84 ? 188 ASN A ND2 1 
ATOM   433  N N   . LYS A 1 61  ? -14.769 -8.839  4.986   1.00 30.56 ? 189 LYS A N   1 
ATOM   434  C CA  . LYS A 1 61  ? -15.481 -7.622  4.562   1.00 29.44 ? 189 LYS A CA  1 
ATOM   435  C C   . LYS A 1 61  ? -14.640 -6.349  4.702   1.00 26.84 ? 189 LYS A C   1 
ATOM   436  O O   . LYS A 1 61  ? -13.905 -6.140  5.656   1.00 25.68 ? 189 LYS A O   1 
ATOM   437  C CB  . LYS A 1 61  ? -16.776 -7.453  5.350   1.00 28.90 ? 189 LYS A CB  1 
ATOM   438  C CG  . LYS A 1 61  ? -17.791 -8.643  5.075   1.00 30.73 ? 189 LYS A CG  1 
ATOM   439  C CD  . LYS A 1 61  ? -19.166 -8.225  5.433   1.00 38.29 ? 189 LYS A CD  1 
ATOM   440  C CE  . LYS A 1 61  ? -20.213 -9.354  5.206   1.00 38.76 ? 189 LYS A CE  1 
ATOM   441  N NZ  . LYS A 1 61  ? -21.328 -8.839  6.013   1.00 41.94 ? 189 LYS A NZ  1 
ATOM   442  N N   . TYR A 1 62  ? -14.786 -5.496  3.722   1.00 25.23 ? 190 TYR A N   1 
ATOM   443  C CA  . TYR A 1 62  ? -14.245 -4.181  3.796   1.00 24.32 ? 190 TYR A CA  1 
ATOM   444  C C   . TYR A 1 62  ? -15.220 -3.226  4.352   1.00 24.65 ? 190 TYR A C   1 
ATOM   445  O O   . TYR A 1 62  ? -16.467 -3.368  4.129   1.00 26.08 ? 190 TYR A O   1 
ATOM   446  C CB  . TYR A 1 62  ? -13.926 -3.694  2.378   1.00 23.95 ? 190 TYR A CB  1 
ATOM   447  C CG  . TYR A 1 62  ? -12.733 -4.351  1.719   1.00 22.99 ? 190 TYR A CG  1 
ATOM   448  C CD1 . TYR A 1 62  ? -11.437 -3.896  1.959   1.00 26.88 ? 190 TYR A CD1 1 
ATOM   449  C CD2 . TYR A 1 62  ? -12.908 -5.361  0.754   1.00 22.58 ? 190 TYR A CD2 1 
ATOM   450  C CE1 . TYR A 1 62  ? -10.334 -4.504  1.324   1.00 26.88 ? 190 TYR A CE1 1 
ATOM   451  C CE2 . TYR A 1 62  ? -11.843 -5.932  0.109   1.00 20.67 ? 190 TYR A CE2 1 
ATOM   452  C CZ  . TYR A 1 62  ? -10.559 -5.511  0.408   1.00 23.64 ? 190 TYR A CZ  1 
ATOM   453  O OH  . TYR A 1 62  ? -9.489  -6.066  -0.266  1.00 25.97 ? 190 TYR A OH  1 
ATOM   454  N N   . GLU A 1 63  ? -14.677 -2.166  4.946   1.00 25.38 ? 191 GLU A N   1 
ATOM   455  C CA  . GLU A 1 63  ? -15.405 -0.941  5.094   1.00 26.43 ? 191 GLU A CA  1 
ATOM   456  C C   . GLU A 1 63  ? -14.863 -0.007  4.025   1.00 27.42 ? 191 GLU A C   1 
ATOM   457  O O   . GLU A 1 63  ? -13.627 0.162   3.908   1.00 26.71 ? 191 GLU A O   1 
ATOM   458  C CB  . GLU A 1 63  ? -15.232 -0.289  6.484   1.00 28.45 ? 191 GLU A CB  1 
ATOM   459  C CG  . GLU A 1 63  ? -15.566 -1.188  7.636   1.00 33.49 ? 191 GLU A CG  1 
ATOM   460  C CD  . GLU A 1 63  ? -17.051 -1.528  7.663   1.00 43.47 ? 191 GLU A CD  1 
ATOM   461  O OE1 . GLU A 1 63  ? -17.884 -0.629  7.420   1.00 48.74 ? 191 GLU A OE1 1 
ATOM   462  O OE2 . GLU A 1 63  ? -17.385 -2.686  7.947   1.00 47.43 ? 191 GLU A OE2 1 
ATOM   463  N N   . VAL A 1 64  ? -15.767 0.611   3.256   1.00 26.85 ? 192 VAL A N   1 
ATOM   464  C CA  . VAL A 1 64  ? -15.325 1.570   2.228   1.00 26.96 ? 192 VAL A CA  1 
ATOM   465  C C   . VAL A 1 64  ? -16.125 2.847   2.275   1.00 27.13 ? 192 VAL A C   1 
ATOM   466  O O   . VAL A 1 64  ? -17.315 2.831   2.623   1.00 30.02 ? 192 VAL A O   1 
ATOM   467  C CB  . VAL A 1 64  ? -15.366 0.999   0.785   1.00 25.82 ? 192 VAL A CB  1 
ATOM   468  C CG1 . VAL A 1 64  ? -14.644 -0.342  0.683   1.00 25.74 ? 192 VAL A CG1 1 
ATOM   469  C CG2 . VAL A 1 64  ? -16.847 0.872   0.261   1.00 25.89 ? 192 VAL A CG2 1 
ATOM   470  N N   . ASP A 1 65  ? -15.478 3.961   1.942   1.00 27.09 ? 193 ASP A N   1 
ATOM   471  C CA  . ASP A 1 65  ? -16.193 5.231   1.833   1.00 28.80 ? 193 ASP A CA  1 
ATOM   472  C C   . ASP A 1 65  ? -16.447 5.630   0.366   1.00 29.94 ? 193 ASP A C   1 
ATOM   473  O O   . ASP A 1 65  ? -15.518 5.675   -0.467  1.00 29.64 ? 193 ASP A O   1 
ATOM   474  C CB  . ASP A 1 65  ? -15.410 6.352   2.558   1.00 29.47 ? 193 ASP A CB  1 
ATOM   475  C CG  . ASP A 1 65  ? -15.661 6.359   4.083   1.00 32.30 ? 193 ASP A CG  1 
ATOM   476  O OD1 . ASP A 1 65  ? -16.735 5.865   4.541   1.00 32.26 ? 193 ASP A OD1 1 
ATOM   477  O OD2 . ASP A 1 65  ? -14.736 6.796   4.809   1.00 31.35 ? 193 ASP A OD2 1 
ATOM   478  N N   . ASP A 1 66  ? -17.701 5.883   0.037   1.00 31.82 ? 194 ASP A N   1 
ATOM   479  C CA  . ASP A 1 66  ? -18.039 6.560   -1.209  1.00 35.68 ? 194 ASP A CA  1 
ATOM   480  C C   . ASP A 1 66  ? -17.505 7.994   -1.146  1.00 39.21 ? 194 ASP A C   1 
ATOM   481  O O   . ASP A 1 66  ? -17.837 8.739   -0.248  1.00 42.36 ? 194 ASP A O   1 
ATOM   482  C CB  . ASP A 1 66  ? -19.558 6.518   -1.322  1.00 36.57 ? 194 ASP A CB  1 
ATOM   483  C CG  . ASP A 1 66  ? -20.132 7.302   -2.489  1.00 38.59 ? 194 ASP A CG  1 
ATOM   484  O OD1 . ASP A 1 66  ? -19.420 7.987   -3.245  1.00 38.36 ? 194 ASP A OD1 1 
ATOM   485  O OD2 . ASP A 1 66  ? -21.375 7.222   -2.616  1.00 39.20 ? 194 ASP A OD2 1 
ATOM   486  N N   . ILE A 1 67  ? -16.742 8.395   -2.144  1.00 42.57 ? 195 ILE A N   1 
ATOM   487  C CA  . ILE A 1 67  ? -16.050 9.676   -2.104  1.00 45.89 ? 195 ILE A CA  1 
ATOM   488  C C   . ILE A 1 67  ? -16.775 10.790  -2.852  1.00 46.49 ? 195 ILE A C   1 
ATOM   489  O O   . ILE A 1 67  ? -16.557 10.994  -3.998  1.00 47.74 ? 195 ILE A O   1 
ATOM   490  C CB  . ILE A 1 67  ? -14.622 9.480   -2.670  1.00 46.14 ? 195 ILE A CB  1 
ATOM   491  C CG1 . ILE A 1 67  ? -14.652 8.486   -3.847  1.00 45.69 ? 195 ILE A CG1 1 
ATOM   492  C CG2 . ILE A 1 67  ? -13.668 9.000   -1.557  1.00 48.62 ? 195 ILE A CG2 1 
ATOM   493  C CD1 . ILE A 1 67  ? -15.018 9.180   -5.213  1.00 37.70 ? 195 ILE A CD1 1 
ATOM   494  N N   . ASP A 1 68  ? -17.648 11.527  -2.196  1.00 49.84 ? 196 ASP A N   1 
ATOM   495  C CA  . ASP A 1 68  ? -18.515 12.446  -2.919  1.00 51.29 ? 196 ASP A CA  1 
ATOM   496  C C   . ASP A 1 68  ? -18.123 13.857  -2.492  1.00 51.97 ? 196 ASP A C   1 
ATOM   497  O O   . ASP A 1 68  ? -17.550 14.048  -1.426  1.00 50.95 ? 196 ASP A O   1 
ATOM   498  C CB  . ASP A 1 68  ? -19.980 12.096  -2.589  1.00 52.78 ? 196 ASP A CB  1 
ATOM   499  C CG  . ASP A 1 68  ? -20.943 12.397  -3.746  1.00 56.87 ? 196 ASP A CG  1 
ATOM   500  O OD1 . ASP A 1 68  ? -20.906 13.543  -4.253  1.00 61.14 ? 196 ASP A OD1 1 
ATOM   501  O OD2 . ASP A 1 68  ? -21.730 11.494  -4.154  1.00 57.97 ? 196 ASP A OD2 1 
ATOM   502  N N   . GLU A 1 69  ? -18.403 14.857  -3.322  1.00 52.94 ? 197 GLU A N   1 
ATOM   503  C CA  . GLU A 1 69  ? -17.983 16.213  -2.987  1.00 54.15 ? 197 GLU A CA  1 
ATOM   504  C C   . GLU A 1 69  ? -18.757 16.825  -1.817  1.00 53.76 ? 197 GLU A C   1 
ATOM   505  O O   . GLU A 1 69  ? -18.401 17.913  -1.352  1.00 54.81 ? 197 GLU A O   1 
ATOM   506  C CB  . GLU A 1 69  ? -17.963 17.150  -4.213  1.00 55.28 ? 197 GLU A CB  1 
ATOM   507  C CG  . GLU A 1 69  ? -17.136 18.442  -3.965  1.00 58.98 ? 197 GLU A CG  1 
ATOM   508  C CD  . GLU A 1 69  ? -15.955 18.656  -4.944  1.00 63.23 ? 197 GLU A CD  1 
ATOM   509  O OE1 . GLU A 1 69  ? -15.040 17.786  -5.025  1.00 62.66 ? 197 GLU A OE1 1 
ATOM   510  O OE2 . GLU A 1 69  ? -15.929 19.732  -5.596  1.00 64.11 ? 197 GLU A OE2 1 
ATOM   511  N N   . GLU A 1 70  ? -19.785 16.134  -1.315  1.00 52.87 ? 198 GLU A N   1 
ATOM   512  C CA  . GLU A 1 70  ? -20.475 16.614  -0.108  1.00 51.70 ? 198 GLU A CA  1 
ATOM   513  C C   . GLU A 1 70  ? -20.081 15.880  1.193   1.00 51.68 ? 198 GLU A C   1 
ATOM   514  O O   . GLU A 1 70  ? -20.492 16.260  2.305   1.00 51.63 ? 198 GLU A O   1 
ATOM   515  C CB  . GLU A 1 70  ? -22.001 16.659  -0.296  1.00 51.15 ? 198 GLU A CB  1 
ATOM   516  C CG  . GLU A 1 70  ? -22.540 17.777  -1.249  1.00 49.63 ? 198 GLU A CG  1 
ATOM   517  C CD  . GLU A 1 70  ? -22.294 19.236  -0.798  1.00 42.62 ? 198 GLU A CD  1 
ATOM   518  O OE1 . GLU A 1 70  ? -21.913 19.543  0.346   1.00 43.42 ? 198 GLU A OE1 1 
ATOM   519  O OE2 . GLU A 1 70  ? -22.414 20.096  -1.650  1.00 45.23 ? 198 GLU A OE2 1 
ATOM   520  N N   . GLY A 1 71  ? -19.280 14.835  1.059   1.00 50.58 ? 199 GLY A N   1 
ATOM   521  C CA  . GLY A 1 71  ? -18.874 14.054  2.215   1.00 50.55 ? 199 GLY A CA  1 
ATOM   522  C C   . GLY A 1 71  ? -18.939 12.603  1.798   1.00 49.83 ? 199 GLY A C   1 
ATOM   523  O O   . GLY A 1 71  ? -19.330 12.275  0.648   1.00 49.64 ? 199 GLY A O   1 
ATOM   524  N N   . LYS A 1 72  ? -18.588 11.729  2.732   1.00 48.20 ? 200 LYS A N   1 
ATOM   525  C CA  . LYS A 1 72  ? -18.570 10.329  2.415   1.00 47.00 ? 200 LYS A CA  1 
ATOM   526  C C   . LYS A 1 72  ? -19.643 9.500   3.116   1.00 46.04 ? 200 LYS A C   1 
ATOM   527  O O   . LYS A 1 72  ? -20.052 9.764   4.260   1.00 46.06 ? 200 LYS A O   1 
ATOM   528  C CB  . LYS A 1 72  ? -17.182 9.764   2.670   1.00 48.10 ? 200 LYS A CB  1 
ATOM   529  C CG  . LYS A 1 72  ? -16.670 10.055  4.034   1.00 50.36 ? 200 LYS A CG  1 
ATOM   530  C CD  . LYS A 1 72  ? -15.190 10.419  3.996   1.00 55.38 ? 200 LYS A CD  1 
ATOM   531  C CE  . LYS A 1 72  ? -14.656 10.659  5.427   1.00 60.21 ? 200 LYS A CE  1 
ATOM   532  N NZ  . LYS A 1 72  ? -15.653 11.397  6.304   1.00 60.35 ? 200 LYS A NZ  1 
ATOM   533  N N   . GLU A 1 73  ? -20.083 8.474   2.413   1.00 42.25 ? 201 GLU A N   1 
ATOM   534  C CA  . GLU A 1 73  ? -21.012 7.547   2.956   1.00 39.79 ? 201 GLU A CA  1 
ATOM   535  C C   . GLU A 1 73  ? -20.328 6.176   3.046   1.00 36.85 ? 201 GLU A C   1 
ATOM   536  O O   . GLU A 1 73  ? -19.681 5.736   2.103   1.00 33.82 ? 201 GLU A O   1 
ATOM   537  C CB  . GLU A 1 73  ? -22.153 7.554   1.992   1.00 41.35 ? 201 GLU A CB  1 
ATOM   538  C CG  . GLU A 1 73  ? -23.183 6.553   2.170   1.00 46.25 ? 201 GLU A CG  1 
ATOM   539  C CD  . GLU A 1 73  ? -24.110 6.574   0.949   1.00 57.31 ? 201 GLU A CD  1 
ATOM   540  O OE1 . GLU A 1 73  ? -24.124 7.603   0.196   1.00 60.28 ? 201 GLU A OE1 1 
ATOM   541  O OE2 . GLU A 1 73  ? -24.841 5.565   0.758   1.00 61.56 ? 201 GLU A OE2 1 
ATOM   542  N N   . ARG A 1 74  ? -20.428 5.549   4.208   1.00 35.00 ? 202 ARG A N   1 
ATOM   543  C CA  . ARG A 1 74  ? -19.751 4.293   4.482   1.00 34.49 ? 202 ARG A CA  1 
ATOM   544  C C   . ARG A 1 74  ? -20.513 3.081   4.023   1.00 34.45 ? 202 ARG A C   1 
ATOM   545  O O   . ARG A 1 74  ? -21.693 2.992   4.299   1.00 36.20 ? 202 ARG A O   1 
ATOM   546  C CB  . ARG A 1 74  ? -19.526 4.171   5.995   1.00 35.48 ? 202 ARG A CB  1 
ATOM   547  C CG  . ARG A 1 74  ? -18.962 2.844   6.491   1.00 38.15 ? 202 ARG A CG  1 
ATOM   548  C CD  . ARG A 1 74  ? -17.502 2.698   6.197   1.00 40.54 ? 202 ARG A CD  1 
ATOM   549  N NE  . ARG A 1 74  ? -16.777 3.948   6.412   1.00 42.62 ? 202 ARG A NE  1 
ATOM   550  C CZ  . ARG A 1 74  ? -16.196 4.292   7.552   1.00 43.51 ? 202 ARG A CZ  1 
ATOM   551  N NH1 . ARG A 1 74  ? -16.251 3.456   8.572   1.00 45.94 ? 202 ARG A NH1 1 
ATOM   552  N NH2 . ARG A 1 74  ? -15.538 5.460   7.651   1.00 42.01 ? 202 ARG A NH2 1 
ATOM   553  N N   . HIS A 1 75  ? -19.856 2.097   3.408   1.00 32.69 ? 203 HIS A N   1 
ATOM   554  C CA  . HIS A 1 75  ? -20.477 0.801   3.130   1.00 31.48 ? 203 HIS A CA  1 
ATOM   555  C C   . HIS A 1 75  ? -19.622 -0.314  3.690   1.00 31.51 ? 203 HIS A C   1 
ATOM   556  O O   . HIS A 1 75  ? -18.389 -0.197  3.746   1.00 29.57 ? 203 HIS A O   1 
ATOM   557  C CB  . HIS A 1 75  ? -20.675 0.573   1.621   1.00 30.84 ? 203 HIS A CB  1 
ATOM   558  C CG  . HIS A 1 75  ? -21.540 1.609   0.970   1.00 33.14 ? 203 HIS A CG  1 
ATOM   559  N ND1 . HIS A 1 75  ? -21.081 2.876   0.654   1.00 35.34 ? 203 HIS A ND1 1 
ATOM   560  C CD2 . HIS A 1 75  ? -22.842 1.573   0.589   1.00 31.08 ? 203 HIS A CD2 1 
ATOM   561  C CE1 . HIS A 1 75  ? -22.074 3.586   0.135   1.00 35.51 ? 203 HIS A CE1 1 
ATOM   562  N NE2 . HIS A 1 75  ? -23.152 2.812   0.076   1.00 36.90 ? 203 HIS A NE2 1 
ATOM   563  N N   . THR A 1 76  ? -20.268 -1.408  4.069   1.00 30.12 ? 204 THR A N   1 
ATOM   564  C CA  . THR A 1 76  ? -19.560 -2.614  4.513   1.00 31.15 ? 204 THR A CA  1 
ATOM   565  C C   . THR A 1 76  ? -19.860 -3.641  3.450   1.00 30.91 ? 204 THR A C   1 
ATOM   566  O O   . THR A 1 76  ? -21.033 -3.847  3.186   1.00 31.83 ? 204 THR A O   1 
ATOM   567  C CB  . THR A 1 76  ? -20.162 -3.091  5.844   1.00 32.29 ? 204 THR A CB  1 
ATOM   568  O OG1 . THR A 1 76  ? -19.988 -2.073  6.830   1.00 34.86 ? 204 THR A OG1 1 
ATOM   569  C CG2 . THR A 1 76  ? -19.536 -4.391  6.301   1.00 32.99 ? 204 THR A CG2 1 
ATOM   570  N N   . LEU A 1 77  ? -18.825 -4.234  2.824   1.00 28.82 ? 205 LEU A N   1 
ATOM   571  C CA  . LEU A 1 77  ? -18.959 -5.090  1.627   1.00 28.71 ? 205 LEU A CA  1 
ATOM   572  C C   . LEU A 1 77  ? -18.078 -6.319  1.651   1.00 28.19 ? 205 LEU A C   1 
ATOM   573  O O   . LEU A 1 77  ? -16.890 -6.197  1.933   1.00 27.27 ? 205 LEU A O   1 
ATOM   574  C CB  . LEU A 1 77  ? -18.531 -4.314  0.369   1.00 28.20 ? 205 LEU A CB  1 
ATOM   575  C CG  . LEU A 1 77  ? -19.255 -3.027  0.040   1.00 30.97 ? 205 LEU A CG  1 
ATOM   576  C CD1 . LEU A 1 77  ? -18.563 -2.351  -1.117  1.00 28.96 ? 205 LEU A CD1 1 
ATOM   577  C CD2 . LEU A 1 77  ? -20.774 -3.305  -0.281  1.00 30.02 ? 205 LEU A CD2 1 
ATOM   578  N N   . SER A 1 78  ? -18.592 -7.484  1.226   1.00 29.66 ? 206 SER A N   1 
ATOM   579  C CA  . SER A 1 78  ? -17.700 -8.617  1.005   1.00 29.59 ? 206 SER A CA  1 
ATOM   580  C C   . SER A 1 78  ? -16.630 -8.243  -0.003  1.00 30.63 ? 206 SER A C   1 
ATOM   581  O O   . SER A 1 78  ? -16.853 -7.449  -0.974  1.00 28.47 ? 206 SER A O   1 
ATOM   582  C CB  . SER A 1 78  ? -18.367 -9.874  0.447   1.00 31.78 ? 206 SER A CB  1 
ATOM   583  O OG  . SER A 1 78  ? -19.163 -9.558  -0.699  1.00 37.07 ? 206 SER A OG  1 
ATOM   584  N N   . ARG A 1 79  ? -15.513 -8.962  0.143   1.00 30.31 ? 207 ARG A N   1 
ATOM   585  C CA  . ARG A 1 79  ? -14.382 -8.837  -0.743  1.00 31.70 ? 207 ARG A CA  1 
ATOM   586  C C   . ARG A 1 79  ? -14.818 -9.132  -2.163  1.00 32.16 ? 207 ARG A C   1 
ATOM   587  O O   . ARG A 1 79  ? -14.189 -8.619  -3.062  1.00 32.71 ? 207 ARG A O   1 
ATOM   588  C CB  . ARG A 1 79  ? -13.235 -9.797  -0.311  1.00 32.57 ? 207 ARG A CB  1 
ATOM   589  C CG  . ARG A 1 79  ? -13.597 -11.344 -0.394  1.00 36.26 ? 207 ARG A CG  1 
ATOM   590  C CD  . ARG A 1 79  ? -12.295 -12.231 -0.554  1.00 45.68 ? 207 ARG A CD  1 
ATOM   591  N NE  . ARG A 1 79  ? -11.260 -11.443 0.053   1.00 48.32 ? 207 ARG A NE  1 
ATOM   592  C CZ  . ARG A 1 79  ? -10.103 -11.064 -0.453  1.00 45.03 ? 207 ARG A CZ  1 
ATOM   593  N NH1 . ARG A 1 79  ? -9.618  -11.499 -1.617  1.00 45.53 ? 207 ARG A NH1 1 
ATOM   594  N NH2 . ARG A 1 79  ? -9.415  -10.250 0.291   1.00 46.74 ? 207 ARG A NH2 1 
ATOM   595  N N   . ARG A 1 80  ? -15.897 -9.901  -2.375  1.00 31.16 ? 208 ARG A N   1 
ATOM   596  C CA  . ARG A 1 80  ? -16.351 -10.221 -3.729  1.00 33.15 ? 208 ARG A CA  1 
ATOM   597  C C   . ARG A 1 80  ? -17.006 -9.007  -4.445  1.00 32.31 ? 208 ARG A C   1 
ATOM   598  O O   . ARG A 1 80  ? -17.220 -9.017  -5.678  1.00 33.19 ? 208 ARG A O   1 
ATOM   599  C CB  . ARG A 1 80  ? -17.299 -11.451 -3.746  1.00 35.80 ? 208 ARG A CB  1 
ATOM   600  C CG  . ARG A 1 80  ? -16.546 -12.816 -3.579  1.00 42.19 ? 208 ARG A CG  1 
ATOM   601  C CD  . ARG A 1 80  ? -17.430 -13.900 -3.054  1.00 50.39 ? 208 ARG A CD  1 
ATOM   602  N NE  . ARG A 1 80  ? -18.598 -13.208 -2.552  1.00 59.65 ? 208 ARG A NE  1 
ATOM   603  C CZ  . ARG A 1 80  ? -19.838 -13.672 -2.579  1.00 64.26 ? 208 ARG A CZ  1 
ATOM   604  N NH1 . ARG A 1 80  ? -20.118 -14.905 -3.038  1.00 66.14 ? 208 ARG A NH1 1 
ATOM   605  N NH2 . ARG A 1 80  ? -20.806 -12.880 -2.122  1.00 65.16 ? 208 ARG A NH2 1 
ATOM   606  N N   . ARG A 1 81  ? -17.258 -7.926  -3.706  1.00 29.99 ? 209 ARG A N   1 
ATOM   607  C CA  . ARG A 1 81  ? -17.857 -6.766  -4.316  1.00 27.09 ? 209 ARG A CA  1 
ATOM   608  C C   . ARG A 1 81  ? -16.900 -5.605  -4.417  1.00 25.32 ? 209 ARG A C   1 
ATOM   609  O O   . ARG A 1 81  ? -17.343 -4.465  -4.507  1.00 24.30 ? 209 ARG A O   1 
ATOM   610  C CB  . ARG A 1 81  ? -19.116 -6.383  -3.561  1.00 27.31 ? 209 ARG A CB  1 
ATOM   611  C CG  . ARG A 1 81  ? -20.208 -7.477  -3.762  1.00 30.86 ? 209 ARG A CG  1 
ATOM   612  C CD  . ARG A 1 81  ? -21.123 -7.479  -2.640  1.00 43.64 ? 209 ARG A CD  1 
ATOM   613  N NE  . ARG A 1 81  ? -22.091 -6.508  -3.023  1.00 52.34 ? 209 ARG A NE  1 
ATOM   614  C CZ  . ARG A 1 81  ? -23.290 -6.377  -2.503  1.00 57.23 ? 209 ARG A CZ  1 
ATOM   615  N NH1 . ARG A 1 81  ? -23.702 -7.160  -1.483  1.00 58.75 ? 209 ARG A NH1 1 
ATOM   616  N NH2 . ARG A 1 81  ? -24.046 -5.413  -3.017  1.00 58.67 ? 209 ARG A NH2 1 
ATOM   617  N N   . VAL A 1 82  ? -15.613 -5.897  -4.330  1.00 23.96 ? 210 VAL A N   1 
ATOM   618  C CA  . VAL A 1 82  ? -14.567 -4.848  -4.257  1.00 22.81 ? 210 VAL A CA  1 
ATOM   619  C C   . VAL A 1 82  ? -13.510 -5.248  -5.248  1.00 23.63 ? 210 VAL A C   1 
ATOM   620  O O   . VAL A 1 82  ? -12.987 -6.380  -5.166  1.00 24.62 ? 210 VAL A O   1 
ATOM   621  C CB  . VAL A 1 82  ? -13.942 -4.706  -2.796  1.00 21.74 ? 210 VAL A CB  1 
ATOM   622  C CG1 . VAL A 1 82  ? -12.736 -3.732  -2.835  1.00 22.24 ? 210 VAL A CG1 1 
ATOM   623  C CG2 . VAL A 1 82  ? -14.952 -4.117  -1.834  1.00 21.53 ? 210 VAL A CG2 1 
ATOM   624  N N   . ILE A 1 83  ? -13.245 -4.368  -6.236  1.00 22.95 ? 211 ILE A N   1 
ATOM   625  C CA  . ILE A 1 83  ? -12.184 -4.584  -7.231  1.00 21.48 ? 211 ILE A CA  1 
ATOM   626  C C   . ILE A 1 83  ? -11.143 -3.508  -6.996  1.00 22.09 ? 211 ILE A C   1 
ATOM   627  O O   . ILE A 1 83  ? -11.480 -2.320  -7.115  1.00 22.44 ? 211 ILE A O   1 
ATOM   628  C CB  . ILE A 1 83  ? -12.714 -4.537  -8.686  1.00 22.11 ? 211 ILE A CB  1 
ATOM   629  C CG1 . ILE A 1 83  ? -13.889 -5.531  -8.886  1.00 25.14 ? 211 ILE A CG1 1 
ATOM   630  C CG2 . ILE A 1 83  ? -11.537 -4.755  -9.761  1.00 20.27 ? 211 ILE A CG2 1 
ATOM   631  C CD1 . ILE A 1 83  ? -14.490 -5.426  -10.288 1.00 25.92 ? 211 ILE A CD1 1 
ATOM   632  N N   . PRO A 1 84  ? -9.907  -3.893  -6.604  1.00 22.63 ? 212 PRO A N   1 
ATOM   633  C CA  . PRO A 1 84  ? -8.848  -2.855  -6.442  1.00 22.64 ? 212 PRO A CA  1 
ATOM   634  C C   . PRO A 1 84  ? -8.558  -2.230  -7.793  1.00 23.29 ? 212 PRO A C   1 
ATOM   635  O O   . PRO A 1 84  ? -8.474  -2.952  -8.802  1.00 21.95 ? 212 PRO A O   1 
ATOM   636  C CB  . PRO A 1 84  ? -7.596  -3.623  -6.015  1.00 25.37 ? 212 PRO A CB  1 
ATOM   637  C CG  . PRO A 1 84  ? -7.982  -5.162  -5.957  1.00 22.51 ? 212 PRO A CG  1 
ATOM   638  C CD  . PRO A 1 84  ? -9.394  -5.304  -6.495  1.00 25.79 ? 212 PRO A CD  1 
ATOM   639  N N   . LEU A 1 85  ? -8.405  -0.911  -7.854  1.00 21.04 ? 213 LEU A N   1 
ATOM   640  C CA  . LEU A 1 85  ? -7.903  -0.322  -9.092  1.00 20.94 ? 213 LEU A CA  1 
ATOM   641  C C   . LEU A 1 85  ? -6.433  -0.640  -9.368  1.00 21.09 ? 213 LEU A C   1 
ATOM   642  O O   . LEU A 1 85  ? -5.678  -0.954  -8.434  1.00 22.35 ? 213 LEU A O   1 
ATOM   643  C CB  . LEU A 1 85  ? -8.077  1.229   -9.061  1.00 19.72 ? 213 LEU A CB  1 
ATOM   644  C CG  . LEU A 1 85  ? -9.558  1.647   -8.764  1.00 23.15 ? 213 LEU A CG  1 
ATOM   645  C CD1 . LEU A 1 85  ? -9.605  3.171   -8.966  1.00 20.96 ? 213 LEU A CD1 1 
ATOM   646  C CD2 . LEU A 1 85  ? -10.549 0.927   -9.687  1.00 24.21 ? 213 LEU A CD2 1 
ATOM   647  N N   . PRO A 1 86  ? -5.991  -0.473  -10.631 1.00 20.88 ? 214 PRO A N   1 
ATOM   648  C CA  . PRO A 1 86  ? -4.541  -0.599  -10.886 1.00 20.96 ? 214 PRO A CA  1 
ATOM   649  C C   . PRO A 1 86  ? -3.704  0.382   -10.079 1.00 22.60 ? 214 PRO A C   1 
ATOM   650  O O   . PRO A 1 86  ? -4.142  1.507   -9.798  1.00 23.32 ? 214 PRO A O   1 
ATOM   651  C CB  . PRO A 1 86  ? -4.393  -0.338  -12.408 1.00 20.50 ? 214 PRO A CB  1 
ATOM   652  C CG  . PRO A 1 86  ? -5.784  -0.558  -12.983 1.00 20.61 ? 214 PRO A CG  1 
ATOM   653  C CD  . PRO A 1 86  ? -6.729  -0.107  -11.870 1.00 21.93 ? 214 PRO A CD  1 
ATOM   654  N N   . GLN A 1 87  ? -2.538  -0.091  -9.649  1.00 23.10 ? 215 GLN A N   1 
ATOM   655  C CA  . GLN A 1 87  ? -1.541  0.723   -8.978  1.00 23.97 ? 215 GLN A CA  1 
ATOM   656  C C   . GLN A 1 87  ? -0.436  1.171   -9.935  1.00 24.62 ? 215 GLN A C   1 
ATOM   657  O O   . GLN A 1 87  ? 0.386   2.050   -9.603  1.00 24.03 ? 215 GLN A O   1 
ATOM   658  C CB  . GLN A 1 87  ? -0.996  -0.087  -7.789  1.00 25.08 ? 215 GLN A CB  1 
ATOM   659  C CG  . GLN A 1 87  ? -2.120  -0.371  -6.774  1.00 25.63 ? 215 GLN A CG  1 
ATOM   660  C CD  . GLN A 1 87  ? -1.573  -1.094  -5.548  1.00 30.54 ? 215 GLN A CD  1 
ATOM   661  O OE1 . GLN A 1 87  ? -0.355  -1.325  -5.437  1.00 31.80 ? 215 GLN A OE1 1 
ATOM   662  N NE2 . GLN A 1 87  ? -2.453  -1.368  -4.586  1.00 33.85 ? 215 GLN A NE2 1 
ATOM   663  N N   . TRP A 1 88  ? -0.362  0.565   -11.126 1.00 23.81 ? 216 TRP A N   1 
ATOM   664  C CA  . TRP A 1 88  ? 0.517   1.120   -12.161 1.00 25.04 ? 216 TRP A CA  1 
ATOM   665  C C   . TRP A 1 88  ? -0.187  1.102   -13.513 1.00 26.10 ? 216 TRP A C   1 
ATOM   666  O O   . TRP A 1 88  ? -1.028  0.199   -13.769 1.00 25.61 ? 216 TRP A O   1 
ATOM   667  C CB  . TRP A 1 88  ? 1.793   0.287   -12.379 1.00 26.45 ? 216 TRP A CB  1 
ATOM   668  C CG  . TRP A 1 88  ? 2.762   0.042   -11.229 1.00 27.61 ? 216 TRP A CG  1 
ATOM   669  C CD1 . TRP A 1 88  ? 3.911   0.710   -10.971 1.00 27.24 ? 216 TRP A CD1 1 
ATOM   670  C CD2 . TRP A 1 88  ? 2.709   -1.056  -10.312 1.00 25.56 ? 216 TRP A CD2 1 
ATOM   671  N NE1 . TRP A 1 88  ? 4.555   0.176   -9.863  1.00 25.53 ? 216 TRP A NE1 1 
ATOM   672  C CE2 . TRP A 1 88  ? 3.839   -0.927  -9.447  1.00 27.47 ? 216 TRP A CE2 1 
ATOM   673  C CE3 . TRP A 1 88  ? 1.783   -2.100  -10.100 1.00 26.99 ? 216 TRP A CE3 1 
ATOM   674  C CZ2 . TRP A 1 88  ? 4.106   -1.829  -8.410  1.00 28.94 ? 216 TRP A CZ2 1 
ATOM   675  C CZ3 . TRP A 1 88  ? 2.027   -3.018  -9.059  1.00 31.01 ? 216 TRP A CZ3 1 
ATOM   676  C CH2 . TRP A 1 88  ? 3.205   -2.871  -8.215  1.00 31.80 ? 216 TRP A CH2 1 
ATOM   677  N N   . LYS A 1 89  ? 0.195   2.039   -14.405 1.00 25.25 ? 217 LYS A N   1 
ATOM   678  C CA  . LYS A 1 89  ? -0.181  1.961   -15.819 1.00 26.09 ? 217 LYS A CA  1 
ATOM   679  C C   . LYS A 1 89  ? 0.717   0.890   -16.455 1.00 26.43 ? 217 LYS A C   1 
ATOM   680  O O   . LYS A 1 89  ? 1.911   0.803   -16.160 1.00 28.10 ? 217 LYS A O   1 
ATOM   681  C CB  . LYS A 1 89  ? 0.177   3.262   -16.567 1.00 25.46 ? 217 LYS A CB  1 
ATOM   682  C CG  . LYS A 1 89  ? -0.511  4.548   -16.114 1.00 28.28 ? 217 LYS A CG  1 
ATOM   683  C CD  . LYS A 1 89  ? 0.165   5.666   -16.909 1.00 29.39 ? 217 LYS A CD  1 
ATOM   684  C CE  . LYS A 1 89  ? -0.764  6.850   -17.127 1.00 38.61 ? 217 LYS A CE  1 
ATOM   685  N NZ  . LYS A 1 89  ? 0.100   7.988   -17.630 1.00 43.23 ? 217 LYS A NZ  1 
ATOM   686  N N   . ALA A 1 90  ? 0.156   0.106   -17.357 1.00 25.87 ? 218 ALA A N   1 
ATOM   687  C CA  . ALA A 1 90  ? 0.953   -0.693  -18.263 1.00 25.07 ? 218 ALA A CA  1 
ATOM   688  C C   . ALA A 1 90  ? 1.500   0.180   -19.386 1.00 24.98 ? 218 ALA A C   1 
ATOM   689  O O   . ALA A 1 90  ? 0.709   0.858   -20.100 1.00 25.35 ? 218 ALA A O   1 
ATOM   690  C CB  . ALA A 1 90  ? 0.101   -1.817  -18.878 1.00 23.32 ? 218 ALA A CB  1 
ATOM   691  N N   . ASN A 1 91  ? 2.806   0.102   -19.651 1.00 24.10 ? 219 ASN A N   1 
ATOM   692  C CA  . ASN A 1 91  ? 3.324   0.855   -20.756 1.00 26.19 ? 219 ASN A CA  1 
ATOM   693  C C   . ASN A 1 91  ? 3.081   0.122   -22.079 1.00 26.75 ? 219 ASN A C   1 
ATOM   694  O O   . ASN A 1 91  ? 3.585   -1.024  -22.226 1.00 27.25 ? 219 ASN A O   1 
ATOM   695  C CB  . ASN A 1 91  ? 4.817   1.114   -20.524 1.00 26.73 ? 219 ASN A CB  1 
ATOM   696  C CG  . ASN A 1 91  ? 5.438   2.009   -21.607 1.00 30.86 ? 219 ASN A CG  1 
ATOM   697  O OD1 . ASN A 1 91  ? 4.857   2.257   -22.702 1.00 28.33 ? 219 ASN A OD1 1 
ATOM   698  N ND2 . ASN A 1 91  ? 6.616   2.579   -21.256 1.00 29.40 ? 219 ASN A ND2 1 
ATOM   699  N N   . PRO A 1 92  ? 2.260   0.710   -23.007 1.00 27.77 ? 220 PRO A N   1 
ATOM   700  C CA  . PRO A 1 92  ? 1.995   0.072   -24.314 1.00 29.39 ? 220 PRO A CA  1 
ATOM   701  C C   . PRO A 1 92  ? 3.283   -0.161  -25.095 1.00 31.37 ? 220 PRO A C   1 
ATOM   702  O O   . PRO A 1 92  ? 3.399   -1.183  -25.785 1.00 31.39 ? 220 PRO A O   1 
ATOM   703  C CB  . PRO A 1 92  ? 1.144   1.061   -25.065 1.00 29.42 ? 220 PRO A CB  1 
ATOM   704  C CG  . PRO A 1 92  ? 0.801   2.148   -24.121 1.00 30.63 ? 220 PRO A CG  1 
ATOM   705  C CD  . PRO A 1 92  ? 1.672   2.044   -22.910 1.00 28.68 ? 220 PRO A CD  1 
ATOM   706  N N   . GLU A 1 93  ? 4.276   0.706   -24.913 1.00 31.71 ? 221 GLU A N   1 
ATOM   707  C CA  . GLU A 1 93  ? 5.581   0.494   -25.586 1.00 33.54 ? 221 GLU A CA  1 
ATOM   708  C C   . GLU A 1 93  ? 6.437   -0.666  -25.020 1.00 34.35 ? 221 GLU A C   1 
ATOM   709  O O   . GLU A 1 93  ? 7.270   -1.213  -25.758 1.00 35.25 ? 221 GLU A O   1 
ATOM   710  C CB  . GLU A 1 93  ? 6.332   1.834   -25.747 1.00 34.32 ? 221 GLU A CB  1 
ATOM   711  C CG  . GLU A 1 93  ? 5.555   2.800   -26.741 1.00 36.85 ? 221 GLU A CG  1 
ATOM   712  C CD  . GLU A 1 93  ? 6.037   4.267   -26.730 1.00 41.52 ? 221 GLU A CD  1 
ATOM   713  O OE1 . GLU A 1 93  ? 6.985   4.608   -25.977 1.00 44.91 ? 221 GLU A OE1 1 
ATOM   714  O OE2 . GLU A 1 93  ? 5.451   5.100   -27.466 1.00 40.96 ? 221 GLU A OE2 1 
ATOM   715  N N   . THR A 1 94  ? 6.232   -1.098  -23.753 1.00 32.12 ? 222 THR A N   1 
ATOM   716  C CA  . THR A 1 94  ? 7.054   -2.200  -23.220 1.00 31.46 ? 222 THR A CA  1 
ATOM   717  C C   . THR A 1 94  ? 6.251   -3.421  -22.748 1.00 30.74 ? 222 THR A C   1 
ATOM   718  O O   . THR A 1 94  ? 6.714   -4.558  -22.851 1.00 31.60 ? 222 THR A O   1 
ATOM   719  C CB  . THR A 1 94  ? 7.940   -1.735  -22.045 1.00 32.14 ? 222 THR A CB  1 
ATOM   720  O OG1 . THR A 1 94  ? 7.085   -1.318  -20.938 1.00 31.91 ? 222 THR A OG1 1 
ATOM   721  C CG2 . THR A 1 94  ? 8.873   -0.556  -22.474 1.00 33.36 ? 222 THR A CG2 1 
ATOM   722  N N   . ASP A 1 95  ? 5.059   -3.203  -22.190 1.00 29.21 ? 223 ASP A N   1 
ATOM   723  C CA  . ASP A 1 95  ? 4.210   -4.308  -21.654 1.00 28.97 ? 223 ASP A CA  1 
ATOM   724  C C   . ASP A 1 95  ? 2.794   -4.304  -22.198 1.00 27.62 ? 223 ASP A C   1 
ATOM   725  O O   . ASP A 1 95  ? 1.833   -4.324  -21.411 1.00 26.05 ? 223 ASP A O   1 
ATOM   726  C CB  . ASP A 1 95  ? 4.180   -4.201  -20.123 1.00 29.04 ? 223 ASP A CB  1 
ATOM   727  C CG  . ASP A 1 95  ? 5.594   -4.249  -19.530 1.00 31.50 ? 223 ASP A CG  1 
ATOM   728  O OD1 . ASP A 1 95  ? 6.145   -5.361  -19.424 1.00 30.03 ? 223 ASP A OD1 1 
ATOM   729  O OD2 . ASP A 1 95  ? 6.181   -3.183  -19.241 1.00 29.10 ? 223 ASP A OD2 1 
ATOM   730  N N   . PRO A 1 96  ? 2.662   -4.329  -23.553 1.00 27.02 ? 224 PRO A N   1 
ATOM   731  C CA  . PRO A 1 96  ? 1.401   -4.143  -24.255 1.00 26.14 ? 224 PRO A CA  1 
ATOM   732  C C   . PRO A 1 96  ? 0.368   -5.208  -23.909 1.00 26.53 ? 224 PRO A C   1 
ATOM   733  O O   . PRO A 1 96  ? -0.859  -4.976  -24.005 1.00 25.43 ? 224 PRO A O   1 
ATOM   734  C CB  . PRO A 1 96  ? 1.806   -4.219  -25.750 1.00 28.48 ? 224 PRO A CB  1 
ATOM   735  C CG  . PRO A 1 96  ? 3.043   -5.024  -25.790 1.00 28.68 ? 224 PRO A CG  1 
ATOM   736  C CD  . PRO A 1 96  ? 3.763   -4.667  -24.487 1.00 27.84 ? 224 PRO A CD  1 
ATOM   737  N N   . GLU A 1 97  ? 0.870   -6.368  -23.476 1.00 27.31 ? 225 GLU A N   1 
ATOM   738  C CA  . GLU A 1 97  ? 0.033   -7.530  -23.213 1.00 26.77 ? 225 GLU A CA  1 
ATOM   739  C C   . GLU A 1 97  ? -0.732  -7.374  -21.939 1.00 25.70 ? 225 GLU A C   1 
ATOM   740  O O   . GLU A 1 97  ? -1.690  -8.104  -21.689 1.00 28.30 ? 225 GLU A O   1 
ATOM   741  C CB  . GLU A 1 97  ? 0.914   -8.820  -23.188 1.00 26.57 ? 225 GLU A CB  1 
ATOM   742  C CG  . GLU A 1 97  ? 1.746   -9.085  -21.852 1.00 27.23 ? 225 GLU A CG  1 
ATOM   743  C CD  . GLU A 1 97  ? 3.134   -8.390  -21.842 1.00 31.08 ? 225 GLU A CD  1 
ATOM   744  O OE1 . GLU A 1 97  ? 3.415   -7.530  -22.737 1.00 29.65 ? 225 GLU A OE1 1 
ATOM   745  O OE2 . GLU A 1 97  ? 3.919   -8.680  -20.894 1.00 31.12 ? 225 GLU A OE2 1 
ATOM   746  N N   . ALA A 1 98  ? -0.319  -6.410  -21.128 1.00 24.76 ? 226 ALA A N   1 
ATOM   747  C CA  . ALA A 1 98  ? -0.929  -6.092  -19.837 1.00 25.72 ? 226 ALA A CA  1 
ATOM   748  C C   . ALA A 1 98  ? -2.018  -4.975  -19.987 1.00 25.84 ? 226 ALA A C   1 
ATOM   749  O O   . ALA A 1 98  ? -2.463  -4.415  -19.000 1.00 26.34 ? 226 ALA A O   1 
ATOM   750  C CB  . ALA A 1 98  ? 0.163   -5.654  -18.861 1.00 26.18 ? 226 ALA A CB  1 
ATOM   751  N N   . LEU A 1 99  ? -2.402  -4.651  -21.230 1.00 24.75 ? 227 LEU A N   1 
ATOM   752  C CA  . LEU A 1 99  ? -3.538  -3.727  -21.507 1.00 23.56 ? 227 LEU A CA  1 
ATOM   753  C C   . LEU A 1 99  ? -4.766  -4.523  -21.926 1.00 24.56 ? 227 LEU A C   1 
ATOM   754  O O   . LEU A 1 99  ? -4.600  -5.530  -22.601 1.00 26.05 ? 227 LEU A O   1 
ATOM   755  C CB  . LEU A 1 99  ? -3.200  -2.785  -22.676 1.00 22.74 ? 227 LEU A CB  1 
ATOM   756  C CG  . LEU A 1 99  ? -2.061  -1.783  -22.377 1.00 22.03 ? 227 LEU A CG  1 
ATOM   757  C CD1 . LEU A 1 99  ? -1.606  -1.020  -23.627 1.00 24.71 ? 227 LEU A CD1 1 
ATOM   758  C CD2 . LEU A 1 99  ? -2.480  -0.836  -21.263 1.00 21.07 ? 227 LEU A CD2 1 
ATOM   759  N N   . PHE A 1 100 ? -5.975  -4.063  -21.591 1.00 24.16 ? 228 PHE A N   1 
ATOM   760  C CA  . PHE A 1 100 ? -7.177  -4.702  -22.137 1.00 24.92 ? 228 PHE A CA  1 
ATOM   761  C C   . PHE A 1 100 ? -7.199  -4.427  -23.659 1.00 25.13 ? 228 PHE A C   1 
ATOM   762  O O   . PHE A 1 100 ? -6.711  -3.359  -24.133 1.00 24.78 ? 228 PHE A O   1 
ATOM   763  C CB  . PHE A 1 100 ? -8.474  -4.204  -21.519 1.00 23.96 ? 228 PHE A CB  1 
ATOM   764  C CG  . PHE A 1 100 ? -8.608  -4.505  -20.057 1.00 26.06 ? 228 PHE A CG  1 
ATOM   765  C CD1 . PHE A 1 100 ? -9.013  -5.773  -19.637 1.00 25.64 ? 228 PHE A CD1 1 
ATOM   766  C CD2 . PHE A 1 100 ? -8.347  -3.513  -19.100 1.00 22.46 ? 228 PHE A CD2 1 
ATOM   767  C CE1 . PHE A 1 100 ? -9.134  -6.075  -18.268 1.00 26.87 ? 228 PHE A CE1 1 
ATOM   768  C CE2 . PHE A 1 100 ? -8.502  -3.764  -17.746 1.00 24.19 ? 228 PHE A CE2 1 
ATOM   769  C CZ  . PHE A 1 100 ? -8.889  -5.069  -17.301 1.00 22.79 ? 228 PHE A CZ  1 
ATOM   770  N N   . GLN A 1 101 ? -7.688  -5.414  -24.419 1.00 23.70 ? 229 GLN A N   1 
ATOM   771  C CA  . GLN A 1 101 ? -7.654  -5.351  -25.877 1.00 24.33 ? 229 GLN A CA  1 
ATOM   772  C C   . GLN A 1 101 ? -9.045  -4.973  -26.464 1.00 25.32 ? 229 GLN A C   1 
ATOM   773  O O   . GLN A 1 101 ? -10.095 -5.106  -25.803 1.00 23.46 ? 229 GLN A O   1 
ATOM   774  C CB  . GLN A 1 101 ? -7.024  -6.668  -26.497 1.00 25.71 ? 229 GLN A CB  1 
ATOM   775  C CG  . GLN A 1 101 ? -5.585  -7.058  -25.978 1.00 25.83 ? 229 GLN A CG  1 
ATOM   776  C CD  . GLN A 1 101 ? -4.460  -5.856  -26.014 1.00 38.31 ? 229 GLN A CD  1 
ATOM   777  O OE1 . GLN A 1 101 ? -4.510  -4.990  -26.919 1.00 46.07 ? 229 GLN A OE1 1 
ATOM   778  N NE2 . GLN A 1 101 ? -3.432  -5.878  -25.077 1.00 27.01 ? 229 GLN A NE2 1 
ATOM   779  N N   . LYS A 1 102 ? -9.039  -4.442  -27.696 1.00 25.56 ? 230 LYS A N   1 
ATOM   780  C CA  . LYS A 1 102 ? -10.252 -4.089  -28.390 1.00 27.06 ? 230 LYS A CA  1 
ATOM   781  C C   . LYS A 1 102 ? -11.332 -5.157  -28.207 1.00 28.02 ? 230 LYS A C   1 
ATOM   782  O O   . LYS A 1 102 ? -11.057 -6.376  -28.303 1.00 25.97 ? 230 LYS A O   1 
ATOM   783  C CB  . LYS A 1 102 ? -9.953  -3.898  -29.884 1.00 29.05 ? 230 LYS A CB  1 
ATOM   784  C CG  . LYS A 1 102 ? -11.150 -3.603  -30.714 1.00 36.30 ? 230 LYS A CG  1 
ATOM   785  C CD  . LYS A 1 102 ? -10.890 -3.920  -32.211 1.00 44.56 ? 230 LYS A CD  1 
ATOM   786  C CE  . LYS A 1 102 ? -12.063 -3.482  -33.084 1.00 48.98 ? 230 LYS A CE  1 
ATOM   787  N NZ  . LYS A 1 102 ? -12.138 -1.940  -33.202 1.00 50.59 ? 230 LYS A NZ  1 
ATOM   788  N N   . GLU A 1 103 ? -12.560 -4.683  -27.942 1.00 26.97 ? 231 GLU A N   1 
ATOM   789  C CA  . GLU A 1 103 ? -13.715 -5.513  -27.764 1.00 28.31 ? 231 GLU A CA  1 
ATOM   790  C C   . GLU A 1 103 ? -13.847 -6.242  -26.418 1.00 28.06 ? 231 GLU A C   1 
ATOM   791  O O   . GLU A 1 103 ? -14.954 -6.736  -26.093 1.00 29.80 ? 231 GLU A O   1 
ATOM   792  C CB  . GLU A 1 103 ? -13.991 -6.450  -28.999 1.00 28.60 ? 231 GLU A CB  1 
ATOM   793  C CG  . GLU A 1 103 ? -15.435 -6.829  -29.109 1.00 37.19 ? 231 GLU A CG  1 
ATOM   794  C CD  . GLU A 1 103 ? -15.757 -7.681  -30.321 1.00 43.65 ? 231 GLU A CD  1 
ATOM   795  O OE1 . GLU A 1 103 ? -14.914 -7.798  -31.255 1.00 47.12 ? 231 GLU A OE1 1 
ATOM   796  O OE2 . GLU A 1 103 ? -16.888 -8.207  -30.310 1.00 48.48 ? 231 GLU A OE2 1 
ATOM   797  N N   . GLN A 1 104 ? -12.828 -6.243  -25.578 1.00 26.05 ? 232 GLN A N   1 
ATOM   798  C CA  . GLN A 1 104 ? -13.031 -6.805  -24.203 1.00 26.67 ? 232 GLN A CA  1 
ATOM   799  C C   . GLN A 1 104 ? -14.014 -6.015  -23.375 1.00 27.18 ? 232 GLN A C   1 
ATOM   800  O O   . GLN A 1 104 ? -14.014 -4.766  -23.402 1.00 25.81 ? 232 GLN A O   1 
ATOM   801  C CB  . GLN A 1 104 ? -11.749 -6.922  -23.450 1.00 26.04 ? 232 GLN A CB  1 
ATOM   802  C CG  . GLN A 1 104 ? -10.772 -7.887  -24.244 1.00 29.20 ? 232 GLN A CG  1 
ATOM   803  C CD  . GLN A 1 104 ? -9.357  -8.041  -23.633 1.00 29.64 ? 232 GLN A CD  1 
ATOM   804  O OE1 . GLN A 1 104 ? -9.006  -7.450  -22.606 1.00 34.34 ? 232 GLN A OE1 1 
ATOM   805  N NE2 . GLN A 1 104 ? -8.531  -8.821  -24.310 1.00 34.23 ? 232 GLN A NE2 1 
ATOM   806  N N   . LEU A 1 105 ? -14.843 -6.760  -22.648 1.00 24.04 ? 233 LEU A N   1 
ATOM   807  C CA  . LEU A 1 105 ? -15.791 -6.210  -21.705 1.00 26.12 ? 233 LEU A CA  1 
ATOM   808  C C   . LEU A 1 105 ? -15.040 -5.789  -20.454 1.00 25.45 ? 233 LEU A C   1 
ATOM   809  O O   . LEU A 1 105 ? -14.140 -6.547  -19.993 1.00 25.25 ? 233 LEU A O   1 
ATOM   810  C CB  . LEU A 1 105 ? -16.849 -7.294  -21.386 1.00 24.82 ? 233 LEU A CB  1 
ATOM   811  C CG  . LEU A 1 105 ? -17.740 -6.885  -20.211 1.00 27.67 ? 233 LEU A CG  1 
ATOM   812  C CD1 . LEU A 1 105 ? -18.650 -5.724  -20.629 1.00 27.82 ? 233 LEU A CD1 1 
ATOM   813  C CD2 . LEU A 1 105 ? -18.573 -8.141  -19.725 1.00 29.04 ? 233 LEU A CD2 1 
ATOM   814  N N   . VAL A 1 106 ? -15.286 -4.541  -20.012 1.00 23.21 ? 234 VAL A N   1 
ATOM   815  C CA  . VAL A 1 106 ? -14.715 -4.026  -18.771 1.00 22.09 ? 234 VAL A CA  1 
ATOM   816  C C   . VAL A 1 106 ? -15.718 -3.234  -17.987 1.00 21.55 ? 234 VAL A C   1 
ATOM   817  O O   . VAL A 1 106 ? -16.842 -2.979  -18.445 1.00 23.39 ? 234 VAL A O   1 
ATOM   818  C CB  . VAL A 1 106 ? -13.534 -3.057  -19.059 1.00 20.86 ? 234 VAL A CB  1 
ATOM   819  C CG1 . VAL A 1 106 ? -12.386 -3.796  -19.689 1.00 24.90 ? 234 VAL A CG1 1 
ATOM   820  C CG2 . VAL A 1 106 ? -13.984 -1.865  -20.017 1.00 19.00 ? 234 VAL A CG2 1 
ATOM   821  N N   . LEU A 1 107 ? -15.292 -2.773  -16.821 1.00 22.69 ? 235 LEU A N   1 
ATOM   822  C CA  . LEU A 1 107 ? -16.047 -1.812  -16.047 1.00 22.72 ? 235 LEU A CA  1 
ATOM   823  C C   . LEU A 1 107 ? -15.161 -0.532  -16.138 1.00 22.56 ? 235 LEU A C   1 
ATOM   824  O O   . LEU A 1 107 ? -13.952 -0.651  -15.956 1.00 21.39 ? 235 LEU A O   1 
ATOM   825  C CB  . LEU A 1 107 ? -16.185 -2.297  -14.583 1.00 23.27 ? 235 LEU A CB  1 
ATOM   826  C CG  . LEU A 1 107 ? -17.328 -3.289  -14.291 1.00 26.20 ? 235 LEU A CG  1 
ATOM   827  C CD1 . LEU A 1 107 ? -17.116 -3.797  -12.923 1.00 27.64 ? 235 LEU A CD1 1 
ATOM   828  C CD2 . LEU A 1 107 ? -18.669 -2.548  -14.384 1.00 28.01 ? 235 LEU A CD2 1 
ATOM   829  N N   . ALA A 1 108 ? -15.746 0.639   -16.387 1.00 22.06 ? 236 ALA A N   1 
ATOM   830  C CA  . ALA A 1 108 ? -14.969 1.877   -16.642 1.00 21.87 ? 236 ALA A CA  1 
ATOM   831  C C   . ALA A 1 108 ? -15.685 3.046   -16.028 1.00 22.53 ? 236 ALA A C   1 
ATOM   832  O O   . ALA A 1 108 ? -16.909 3.093   -16.049 1.00 23.56 ? 236 ALA A O   1 
ATOM   833  C CB  . ALA A 1 108 ? -14.775 2.127   -18.150 1.00 23.22 ? 236 ALA A CB  1 
ATOM   834  N N   . LEU A 1 109 ? -14.893 4.007   -15.526 1.00 22.12 ? 237 LEU A N   1 
ATOM   835  C CA  . LEU A 1 109 ? -15.446 5.149   -14.858 1.00 23.72 ? 237 LEU A CA  1 
ATOM   836  C C   . LEU A 1 109 ? -16.029 6.045   -15.909 1.00 22.54 ? 237 LEU A C   1 
ATOM   837  O O   . LEU A 1 109 ? -15.330 6.424   -16.858 1.00 21.04 ? 237 LEU A O   1 
ATOM   838  C CB  . LEU A 1 109 ? -14.348 5.876   -14.040 1.00 23.07 ? 237 LEU A CB  1 
ATOM   839  C CG  . LEU A 1 109 ? -14.874 6.867   -12.986 1.00 26.70 ? 237 LEU A CG  1 
ATOM   840  C CD1 . LEU A 1 109 ? -15.634 6.270   -11.777 1.00 23.37 ? 237 LEU A CD1 1 
ATOM   841  C CD2 . LEU A 1 109 ? -13.810 7.894   -12.496 1.00 27.70 ? 237 LEU A CD2 1 
ATOM   842  N N   . TYR A 1 110 ? -17.295 6.393   -15.742 1.00 22.82 ? 238 TYR A N   1 
ATOM   843  C CA  . TYR A 1 110 ? -17.945 7.272   -16.703 1.00 24.72 ? 238 TYR A CA  1 
ATOM   844  C C   . TYR A 1 110 ? -17.507 8.730   -16.535 1.00 25.08 ? 238 TYR A C   1 
ATOM   845  O O   . TYR A 1 110 ? -17.407 9.212   -15.426 1.00 24.52 ? 238 TYR A O   1 
ATOM   846  C CB  . TYR A 1 110 ? -19.455 7.202   -16.559 1.00 25.91 ? 238 TYR A CB  1 
ATOM   847  C CG  . TYR A 1 110 ? -20.177 7.784   -17.784 1.00 25.27 ? 238 TYR A CG  1 
ATOM   848  C CD1 . TYR A 1 110 ? -20.295 7.030   -18.920 1.00 24.07 ? 238 TYR A CD1 1 
ATOM   849  C CD2 . TYR A 1 110 ? -20.716 9.088   -17.784 1.00 28.22 ? 238 TYR A CD2 1 
ATOM   850  C CE1 . TYR A 1 110 ? -20.963 7.470   -20.063 1.00 27.39 ? 238 TYR A CE1 1 
ATOM   851  C CE2 . TYR A 1 110 ? -21.418 9.588   -18.978 1.00 29.07 ? 238 TYR A CE2 1 
ATOM   852  C CZ  . TYR A 1 110 ? -21.507 8.741   -20.108 1.00 28.88 ? 238 TYR A CZ  1 
ATOM   853  O OH  . TYR A 1 110 ? -22.135 9.073   -21.324 1.00 29.85 ? 238 TYR A OH  1 
ATOM   854  N N   . PRO A 1 111 ? -17.240 9.429   -17.652 1.00 26.89 ? 239 PRO A N   1 
ATOM   855  C CA  . PRO A 1 111 ? -16.685 10.790  -17.505 1.00 28.25 ? 239 PRO A CA  1 
ATOM   856  C C   . PRO A 1 111 ? -17.505 11.693  -16.567 1.00 28.56 ? 239 PRO A C   1 
ATOM   857  O O   . PRO A 1 111 ? -18.716 11.753  -16.708 1.00 28.25 ? 239 PRO A O   1 
ATOM   858  C CB  . PRO A 1 111 ? -16.717 11.326  -18.960 1.00 28.56 ? 239 PRO A CB  1 
ATOM   859  C CG  . PRO A 1 111 ? -16.345 10.082  -19.793 1.00 28.83 ? 239 PRO A CG  1 
ATOM   860  C CD  . PRO A 1 111 ? -17.228 8.964   -19.063 1.00 24.60 ? 239 PRO A CD  1 
ATOM   861  N N   . GLN A 1 112 ? -16.819 12.341  -15.603 1.00 31.36 ? 240 GLN A N   1 
ATOM   862  C CA  . GLN A 1 112 ? -17.425 13.303  -14.649 1.00 32.26 ? 240 GLN A CA  1 
ATOM   863  C C   . GLN A 1 112 ? -18.364 12.676  -13.657 1.00 33.33 ? 240 GLN A C   1 
ATOM   864  O O   . GLN A 1 112 ? -19.252 13.342  -13.105 1.00 33.43 ? 240 GLN A O   1 
ATOM   865  C CB  . GLN A 1 112 ? -18.106 14.463  -15.399 1.00 32.90 ? 240 GLN A CB  1 
ATOM   866  C CG  . GLN A 1 112 ? -17.047 15.336  -15.985 1.00 36.61 ? 240 GLN A CG  1 
ATOM   867  C CD  . GLN A 1 112 ? -17.492 16.783  -16.133 1.00 41.71 ? 240 GLN A CD  1 
ATOM   868  O OE1 . GLN A 1 112 ? -18.590 17.152  -15.713 1.00 43.60 ? 240 GLN A OE1 1 
ATOM   869  N NE2 . GLN A 1 112 ? -16.674 17.586  -16.819 1.00 40.46 ? 240 GLN A NE2 1 
ATOM   870  N N   . THR A 1 113 ? -18.196 11.367  -13.445 1.00 31.05 ? 241 THR A N   1 
ATOM   871  C CA  . THR A 1 113 ? -18.956 10.679  -12.436 1.00 29.18 ? 241 THR A CA  1 
ATOM   872  C C   . THR A 1 113 ? -17.993 9.996   -11.487 1.00 29.13 ? 241 THR A C   1 
ATOM   873  O O   . THR A 1 113 ? -16.775 9.881   -11.764 1.00 27.88 ? 241 THR A O   1 
ATOM   874  C CB  . THR A 1 113 ? -19.906 9.564   -12.983 1.00 28.89 ? 241 THR A CB  1 
ATOM   875  O OG1 . THR A 1 113 ? -19.148 8.395   -13.378 1.00 29.04 ? 241 THR A OG1 1 
ATOM   876  C CG2 . THR A 1 113 ? -20.839 10.062  -14.094 1.00 28.72 ? 241 THR A CG2 1 
ATOM   877  N N   . THR A 1 114 ? -18.533 9.492   -10.389 1.00 25.69 ? 242 THR A N   1 
ATOM   878  C CA  . THR A 1 114 ? -17.731 8.543   -9.602  1.00 27.09 ? 242 THR A CA  1 
ATOM   879  C C   . THR A 1 114 ? -18.351 7.152   -9.724  1.00 26.52 ? 242 THR A C   1 
ATOM   880  O O   . THR A 1 114 ? -18.287 6.339   -8.773  1.00 28.18 ? 242 THR A O   1 
ATOM   881  C CB  . THR A 1 114 ? -17.615 8.977   -8.136  1.00 25.26 ? 242 THR A CB  1 
ATOM   882  O OG1 . THR A 1 114 ? -18.942 9.018   -7.579  1.00 25.80 ? 242 THR A OG1 1 
ATOM   883  C CG2 . THR A 1 114 ? -16.995 10.328  -8.042  1.00 30.10 ? 242 THR A CG2 1 
ATOM   884  N N   . CYS A 1 115 ? -18.917 6.862   -10.894 1.00 25.38 ? 243 CYS A N   1 
ATOM   885  C CA  . CYS A 1 115 ? -19.493 5.555   -11.152 1.00 26.62 ? 243 CYS A CA  1 
ATOM   886  C C   . CYS A 1 115 ? -18.867 4.807   -12.312 1.00 25.48 ? 243 CYS A C   1 
ATOM   887  O O   . CYS A 1 115 ? -18.534 5.385   -13.355 1.00 23.45 ? 243 CYS A O   1 
ATOM   888  C CB  . CYS A 1 115 ? -20.957 5.634   -11.449 1.00 28.50 ? 243 CYS A CB  1 
ATOM   889  S SG  . CYS A 1 115 ? -21.982 6.266   -10.072 1.00 36.30 ? 243 CYS A SG  1 
ATOM   890  N N   . PHE A 1 116 ? -18.823 3.485   -12.126 1.00 23.88 ? 244 PHE A N   1 
ATOM   891  C CA  . PHE A 1 116 ? -18.362 2.520   -13.138 1.00 22.58 ? 244 PHE A CA  1 
ATOM   892  C C   . PHE A 1 116 ? -19.484 1.864   -13.878 1.00 23.48 ? 244 PHE A C   1 
ATOM   893  O O   . PHE A 1 116 ? -20.501 1.478   -13.282 1.00 24.83 ? 244 PHE A O   1 
ATOM   894  C CB  . PHE A 1 116 ? -17.520 1.414   -12.481 1.00 22.02 ? 244 PHE A CB  1 
ATOM   895  C CG  . PHE A 1 116 ? -16.187 1.873   -11.984 1.00 20.51 ? 244 PHE A CG  1 
ATOM   896  C CD1 . PHE A 1 116 ? -15.047 1.844   -12.789 1.00 19.74 ? 244 PHE A CD1 1 
ATOM   897  C CD2 . PHE A 1 116 ? -16.065 2.306   -10.679 1.00 23.97 ? 244 PHE A CD2 1 
ATOM   898  C CE1 . PHE A 1 116 ? -13.843 2.277   -12.308 1.00 20.41 ? 244 PHE A CE1 1 
ATOM   899  C CE2 . PHE A 1 116 ? -14.855 2.740   -10.185 1.00 22.02 ? 244 PHE A CE2 1 
ATOM   900  C CZ  . PHE A 1 116 ? -13.700 2.688   -11.023 1.00 21.46 ? 244 PHE A CZ  1 
ATOM   901  N N   . TYR A 1 117 ? -19.312 1.662   -15.181 1.00 22.67 ? 245 TYR A N   1 
ATOM   902  C CA  . TYR A 1 117 ? -20.344 0.984   -15.944 1.00 23.19 ? 245 TYR A CA  1 
ATOM   903  C C   . TYR A 1 117 ? -19.693 0.099   -16.905 1.00 23.16 ? 245 TYR A C   1 
ATOM   904  O O   . TYR A 1 117 ? -18.486 0.307   -17.249 1.00 22.78 ? 245 TYR A O   1 
ATOM   905  C CB  . TYR A 1 117 ? -21.206 1.984   -16.790 1.00 24.85 ? 245 TYR A CB  1 
ATOM   906  C CG  . TYR A 1 117 ? -21.947 2.985   -15.965 1.00 26.29 ? 245 TYR A CG  1 
ATOM   907  C CD1 . TYR A 1 117 ? -23.212 2.662   -15.398 1.00 29.76 ? 245 TYR A CD1 1 
ATOM   908  C CD2 . TYR A 1 117 ? -21.451 4.249   -15.785 1.00 27.22 ? 245 TYR A CD2 1 
ATOM   909  C CE1 . TYR A 1 117 ? -23.893 3.569   -14.663 1.00 29.89 ? 245 TYR A CE1 1 
ATOM   910  C CE2 . TYR A 1 117 ? -22.153 5.182   -15.025 1.00 29.20 ? 245 TYR A CE2 1 
ATOM   911  C CZ  . TYR A 1 117 ? -23.376 4.831   -14.475 1.00 26.09 ? 245 TYR A CZ  1 
ATOM   912  O OH  . TYR A 1 117 ? -24.083 5.769   -13.720 1.00 31.97 ? 245 TYR A OH  1 
ATOM   913  N N   . ARG A 1 118 ? -20.455 -0.903  -17.363 1.00 22.68 ? 246 ARG A N   1 
ATOM   914  C CA  . ARG A 1 118 ? -19.998 -1.811  -18.453 1.00 22.16 ? 246 ARG A CA  1 
ATOM   915  C C   . ARG A 1 118 ? -19.645 -1.120  -19.773 1.00 22.79 ? 246 ARG A C   1 
ATOM   916  O O   . ARG A 1 118 ? -20.422 -0.286  -20.319 1.00 23.92 ? 246 ARG A O   1 
ATOM   917  C CB  . ARG A 1 118 ? -21.064 -2.860  -18.720 1.00 23.52 ? 246 ARG A CB  1 
ATOM   918  C CG  . ARG A 1 118 ? -21.244 -3.787  -17.498 1.00 28.68 ? 246 ARG A CG  1 
ATOM   919  C CD  . ARG A 1 118 ? -22.549 -4.519  -17.606 1.00 38.33 ? 246 ARG A CD  1 
ATOM   920  N NE  . ARG A 1 118 ? -22.498 -5.405  -18.734 1.00 36.42 ? 246 ARG A NE  1 
ATOM   921  C CZ  . ARG A 1 118 ? -22.176 -6.695  -18.641 1.00 44.00 ? 246 ARG A CZ  1 
ATOM   922  N NH1 . ARG A 1 118 ? -21.874 -7.234  -17.453 1.00 40.43 ? 246 ARG A NH1 1 
ATOM   923  N NH2 . ARG A 1 118 ? -22.152 -7.436  -19.736 1.00 41.31 ? 246 ARG A NH2 1 
ATOM   924  N N   . ALA A 1 119 ? -18.499 -1.470  -20.324 1.00 22.31 ? 247 ALA A N   1 
ATOM   925  C CA  . ALA A 1 119 ? -18.107 -0.914  -21.610 1.00 23.77 ? 247 ALA A CA  1 
ATOM   926  C C   . ALA A 1 119 ? -17.287 -1.930  -22.356 1.00 24.13 ? 247 ALA A C   1 
ATOM   927  O O   . ALA A 1 119 ? -16.709 -2.804  -21.704 1.00 24.86 ? 247 ALA A O   1 
ATOM   928  C CB  . ALA A 1 119 ? -17.209 0.320   -21.374 1.00 22.44 ? 247 ALA A CB  1 
ATOM   929  N N   . LEU A 1 120 ? -17.133 -1.725  -23.671 1.00 24.39 ? 248 LEU A N   1 
ATOM   930  C CA  . LEU A 1 120 ? -16.193 -2.460  -24.510 1.00 25.38 ? 248 LEU A CA  1 
ATOM   931  C C   . LEU A 1 120 ? -15.020 -1.564  -24.874 1.00 25.36 ? 248 LEU A C   1 
ATOM   932  O O   . LEU A 1 120 ? -15.190 -0.379  -25.201 1.00 25.75 ? 248 LEU A O   1 
ATOM   933  C CB  . LEU A 1 120 ? -16.866 -2.913  -25.784 1.00 26.26 ? 248 LEU A CB  1 
ATOM   934  C CG  . LEU A 1 120 ? -17.988 -3.965  -25.657 1.00 31.07 ? 248 LEU A CG  1 
ATOM   935  C CD1 . LEU A 1 120 ? -18.526 -4.386  -27.063 1.00 33.70 ? 248 LEU A CD1 1 
ATOM   936  C CD2 . LEU A 1 120 ? -17.553 -5.191  -24.825 1.00 29.64 ? 248 LEU A CD2 1 
ATOM   937  N N   . ILE A 1 121 ? -13.828 -2.144  -24.847 1.00 25.83 ? 249 ILE A N   1 
ATOM   938  C CA  . ILE A 1 121 ? -12.645 -1.465  -25.314 1.00 25.97 ? 249 ILE A CA  1 
ATOM   939  C C   . ILE A 1 121 ? -12.801 -1.080  -26.809 1.00 26.83 ? 249 ILE A C   1 
ATOM   940  O O   . ILE A 1 121 ? -13.066 -1.928  -27.701 1.00 25.84 ? 249 ILE A O   1 
ATOM   941  C CB  . ILE A 1 121 ? -11.326 -2.233  -25.004 1.00 25.34 ? 249 ILE A CB  1 
ATOM   942  C CG1 . ILE A 1 121 ? -11.212 -2.575  -23.487 1.00 26.70 ? 249 ILE A CG1 1 
ATOM   943  C CG2 . ILE A 1 121 ? -10.091 -1.507  -25.577 1.00 27.01 ? 249 ILE A CG2 1 
ATOM   944  C CD1 . ILE A 1 121 ? -11.232 -1.330  -22.476 1.00 24.97 ? 249 ILE A CD1 1 
ATOM   945  N N   . HIS A 1 122 ? -12.697 0.225   -27.073 1.00 26.65 ? 250 HIS A N   1 
ATOM   946  C CA  . HIS A 1 122 ? -12.623 0.691   -28.496 1.00 26.94 ? 250 HIS A CA  1 
ATOM   947  C C   . HIS A 1 122 ? -11.171 0.705   -28.971 1.00 27.72 ? 250 HIS A C   1 
ATOM   948  O O   . HIS A 1 122 ? -10.789 0.113   -30.049 1.00 27.66 ? 250 HIS A O   1 
ATOM   949  C CB  . HIS A 1 122 ? -13.314 2.098   -28.640 1.00 27.17 ? 250 HIS A CB  1 
ATOM   950  C CG  . HIS A 1 122 ? -13.166 2.695   -30.010 1.00 27.88 ? 250 HIS A CG  1 
ATOM   951  N ND1 . HIS A 1 122 ? -13.817 2.172   -31.109 1.00 33.17 ? 250 HIS A ND1 1 
ATOM   952  C CD2 . HIS A 1 122 ? -12.412 3.725   -30.472 1.00 28.85 ? 250 HIS A CD2 1 
ATOM   953  C CE1 . HIS A 1 122 ? -13.499 2.879   -32.184 1.00 34.81 ? 250 HIS A CE1 1 
ATOM   954  N NE2 . HIS A 1 122 ? -12.633 3.809   -31.825 1.00 32.34 ? 250 HIS A NE2 1 
ATOM   955  N N   . ALA A 1 123 ? -10.303 1.320   -28.148 1.00 27.36 ? 251 ALA A N   1 
ATOM   956  C CA  . ALA A 1 123 ? -8.911  1.336   -28.447 1.00 27.94 ? 251 ALA A CA  1 
ATOM   957  C C   . ALA A 1 123 ? -8.069  1.389   -27.157 1.00 28.51 ? 251 ALA A C   1 
ATOM   958  O O   . ALA A 1 123 ? -8.327  2.198   -26.271 1.00 27.68 ? 251 ALA A O   1 
ATOM   959  C CB  . ALA A 1 123 ? -8.580  2.561   -29.405 1.00 28.42 ? 251 ALA A CB  1 
ATOM   960  N N   . PRO A 1 124 ? -7.089  0.488   -27.032 1.00 28.57 ? 252 PRO A N   1 
ATOM   961  C CA  . PRO A 1 124 ? -6.175  0.629   -25.884 1.00 27.82 ? 252 PRO A CA  1 
ATOM   962  C C   . PRO A 1 124 ? -5.214  1.816   -26.107 1.00 27.36 ? 252 PRO A C   1 
ATOM   963  O O   . PRO A 1 124 ? -5.075  2.276   -27.229 1.00 27.34 ? 252 PRO A O   1 
ATOM   964  C CB  . PRO A 1 124 ? -5.374  -0.669  -25.898 1.00 26.69 ? 252 PRO A CB  1 
ATOM   965  C CG  . PRO A 1 124 ? -5.416  -1.095  -27.371 1.00 29.96 ? 252 PRO A CG  1 
ATOM   966  C CD  . PRO A 1 124 ? -6.758  -0.691  -27.877 1.00 29.54 ? 252 PRO A CD  1 
ATOM   967  N N   . PRO A 1 125 ? -4.576  2.289   -25.034 1.00 26.82 ? 253 PRO A N   1 
ATOM   968  C CA  . PRO A 1 125 ? -3.526  3.319   -25.170 1.00 27.57 ? 253 PRO A CA  1 
ATOM   969  C C   . PRO A 1 125 ? -2.451  2.860   -26.087 1.00 28.67 ? 253 PRO A C   1 
ATOM   970  O O   . PRO A 1 125 ? -2.015  1.699   -26.010 1.00 27.02 ? 253 PRO A O   1 
ATOM   971  C CB  . PRO A 1 125 ? -2.985  3.500   -23.748 1.00 27.19 ? 253 PRO A CB  1 
ATOM   972  C CG  . PRO A 1 125 ? -3.637  2.425   -22.882 1.00 28.40 ? 253 PRO A CG  1 
ATOM   973  C CD  . PRO A 1 125 ? -4.803  1.878   -23.635 1.00 23.59 ? 253 PRO A CD  1 
ATOM   974  N N   . GLN A 1 126 ? -2.032  3.761   -26.971 1.00 29.79 ? 254 GLN A N   1 
ATOM   975  C CA  . GLN A 1 126 ? -0.954  3.448   -27.900 1.00 33.41 ? 254 GLN A CA  1 
ATOM   976  C C   . GLN A 1 126 ? 0.395   3.938   -27.357 1.00 32.47 ? 254 GLN A C   1 
ATOM   977  O O   . GLN A 1 126 ? 1.421   3.345   -27.620 1.00 31.60 ? 254 GLN A O   1 
ATOM   978  C CB  . GLN A 1 126 ? -1.266  4.047   -29.300 1.00 35.54 ? 254 GLN A CB  1 
ATOM   979  C CG  . GLN A 1 126 ? -2.112  3.132   -30.223 1.00 44.28 ? 254 GLN A CG  1 
ATOM   980  C CD  . GLN A 1 126 ? -1.636  1.652   -30.270 1.00 55.58 ? 254 GLN A CD  1 
ATOM   981  O OE1 . GLN A 1 126 ? -0.453  1.364   -30.579 1.00 61.55 ? 254 GLN A OE1 1 
ATOM   982  N NE2 . GLN A 1 126 ? -2.555  0.709   -29.979 1.00 57.46 ? 254 GLN A NE2 1 
ATOM   983  N N   . ARG A 1 127 ? 0.371   5.018   -26.570 1.00 32.62 ? 255 ARG A N   1 
ATOM   984  C CA  . ARG A 1 127 ? 1.584   5.611   -26.034 1.00 33.58 ? 255 ARG A CA  1 
ATOM   985  C C   . ARG A 1 127 ? 1.398   5.777   -24.545 1.00 32.48 ? 255 ARG A C   1 
ATOM   986  O O   . ARG A 1 127 ? 0.261   5.694   -24.060 1.00 31.40 ? 255 ARG A O   1 
ATOM   987  C CB  . ARG A 1 127 ? 1.917   6.935   -26.757 1.00 34.98 ? 255 ARG A CB  1 
ATOM   988  C CG  . ARG A 1 127 ? 2.338   6.688   -28.238 1.00 43.09 ? 255 ARG A CG  1 
ATOM   989  C CD  . ARG A 1 127 ? 2.116   7.956   -29.023 1.00 53.78 ? 255 ARG A CD  1 
ATOM   990  N NE  . ARG A 1 127 ? 0.782   8.486   -28.693 1.00 58.85 ? 255 ARG A NE  1 
ATOM   991  C CZ  . ARG A 1 127 ? 0.495   9.783   -28.460 1.00 62.12 ? 255 ARG A CZ  1 
ATOM   992  N NH1 . ARG A 1 127 ? -0.758  10.136  -28.172 1.00 55.51 ? 255 ARG A NH1 1 
ATOM   993  N NH2 . ARG A 1 127 ? 1.447   10.736  -28.523 1.00 62.94 ? 255 ARG A NH2 1 
ATOM   994  N N   . PRO A 1 128 ? 2.514   5.907   -23.792 1.00 32.16 ? 256 PRO A N   1 
ATOM   995  C CA  . PRO A 1 128 ? 2.397   5.827   -22.366 1.00 32.18 ? 256 PRO A CA  1 
ATOM   996  C C   . PRO A 1 128 ? 1.442   6.813   -21.709 1.00 30.91 ? 256 PRO A C   1 
ATOM   997  O O   . PRO A 1 128 ? 0.898   6.495   -20.687 1.00 29.38 ? 256 PRO A O   1 
ATOM   998  C CB  . PRO A 1 128 ? 3.860   6.050   -21.861 1.00 32.45 ? 256 PRO A CB  1 
ATOM   999  C CG  . PRO A 1 128 ? 4.726   6.080   -23.083 1.00 34.29 ? 256 PRO A CG  1 
ATOM   1000 C CD  . PRO A 1 128 ? 3.882   5.532   -24.209 1.00 33.51 ? 256 PRO A CD  1 
ATOM   1001 N N   . GLN A 1 129 ? 1.217   7.978   -22.289 1.00 30.68 ? 257 GLN A N   1 
ATOM   1002 C CA  . GLN A 1 129 ? 0.357   8.964   -21.637 1.00 32.04 ? 257 GLN A CA  1 
ATOM   1003 C C   . GLN A 1 129 ? -1.125  8.850   -22.064 1.00 31.40 ? 257 GLN A C   1 
ATOM   1004 O O   . GLN A 1 129 ? -1.994  9.630   -21.559 1.00 28.34 ? 257 GLN A O   1 
ATOM   1005 C CB  . GLN A 1 129 ? 0.915   10.386  -21.896 1.00 33.73 ? 257 GLN A CB  1 
ATOM   1006 C CG  . GLN A 1 129 ? 1.092   10.783  -23.446 1.00 41.59 ? 257 GLN A CG  1 
ATOM   1007 C CD  . GLN A 1 129 ? 2.212   10.061  -24.334 1.00 46.95 ? 257 GLN A CD  1 
ATOM   1008 O OE1 . GLN A 1 129 ? 2.937   9.175   -23.873 1.00 48.69 ? 257 GLN A OE1 1 
ATOM   1009 N NE2 . GLN A 1 129 ? 2.347   10.514  -25.627 1.00 47.29 ? 257 GLN A NE2 1 
ATOM   1010 N N   . ASP A 1 130 ? -1.403  7.885   -22.963 1.00 29.34 ? 258 ASP A N   1 
ATOM   1011 C CA  . ASP A 1 130 ? -2.730  7.777   -23.579 1.00 29.18 ? 258 ASP A CA  1 
ATOM   1012 C C   . ASP A 1 130 ? -3.786  7.145   -22.663 1.00 27.77 ? 258 ASP A C   1 
ATOM   1013 O O   . ASP A 1 130 ? -3.458  6.326   -21.817 1.00 27.16 ? 258 ASP A O   1 
ATOM   1014 C CB  . ASP A 1 130 ? -2.662  6.965   -24.855 1.00 27.17 ? 258 ASP A CB  1 
ATOM   1015 C CG  . ASP A 1 130 ? -1.993  7.723   -26.016 1.00 32.84 ? 258 ASP A CG  1 
ATOM   1016 O OD1 . ASP A 1 130 ? -1.826  8.987   -25.954 1.00 32.56 ? 258 ASP A OD1 1 
ATOM   1017 O OD2 . ASP A 1 130 ? -1.588  7.021   -26.955 1.00 32.82 ? 258 ASP A OD2 1 
ATOM   1018 N N   . ASP A 1 131 ? -5.042  7.516   -22.876 1.00 26.63 ? 259 ASP A N   1 
ATOM   1019 C CA  . ASP A 1 131 ? -6.161  6.863   -22.234 1.00 26.22 ? 259 ASP A CA  1 
ATOM   1020 C C   . ASP A 1 131 ? -6.598  5.654   -23.059 1.00 24.90 ? 259 ASP A C   1 
ATOM   1021 O O   . ASP A 1 131 ? -6.202  5.502   -24.239 1.00 25.69 ? 259 ASP A O   1 
ATOM   1022 C CB  . ASP A 1 131 ? -7.331  7.833   -22.156 1.00 27.94 ? 259 ASP A CB  1 
ATOM   1023 C CG  . ASP A 1 131 ? -7.271  8.770   -20.943 1.00 31.47 ? 259 ASP A CG  1 
ATOM   1024 O OD1 . ASP A 1 131 ? -6.246  8.839   -20.235 1.00 30.69 ? 259 ASP A OD1 1 
ATOM   1025 O OD2 . ASP A 1 131 ? -8.316  9.421   -20.693 1.00 36.91 ? 259 ASP A OD2 1 
ATOM   1026 N N   . TYR A 1 132 ? -7.421  4.777   -22.465 1.00 23.75 ? 260 TYR A N   1 
ATOM   1027 C CA  . TYR A 1 132 ? -8.275  3.901   -23.285 1.00 22.69 ? 260 TYR A CA  1 
ATOM   1028 C C   . TYR A 1 132 ? -9.343  4.738   -23.943 1.00 24.15 ? 260 TYR A C   1 
ATOM   1029 O O   . TYR A 1 132 ? -9.716  5.810   -23.434 1.00 24.23 ? 260 TYR A O   1 
ATOM   1030 C CB  . TYR A 1 132 ? -9.032  2.923   -22.408 1.00 23.08 ? 260 TYR A CB  1 
ATOM   1031 C CG  . TYR A 1 132 ? -8.168  1.815   -21.900 1.00 20.38 ? 260 TYR A CG  1 
ATOM   1032 C CD1 . TYR A 1 132 ? -8.007  0.660   -22.667 1.00 22.39 ? 260 TYR A CD1 1 
ATOM   1033 C CD2 . TYR A 1 132 ? -7.561  1.878   -20.633 1.00 22.07 ? 260 TYR A CD2 1 
ATOM   1034 C CE1 . TYR A 1 132 ? -7.240  -0.411  -22.251 1.00 20.79 ? 260 TYR A CE1 1 
ATOM   1035 C CE2 . TYR A 1 132 ? -6.772  0.771   -20.181 1.00 23.83 ? 260 TYR A CE2 1 
ATOM   1036 C CZ  . TYR A 1 132 ? -6.621  -0.351  -21.000 1.00 20.22 ? 260 TYR A CZ  1 
ATOM   1037 O OH  . TYR A 1 132 ? -5.838  -1.457  -20.572 1.00 22.17 ? 260 TYR A OH  1 
ATOM   1038 N N   . SER A 1 133 ? -9.848  4.228   -25.062 1.00 23.20 ? 261 SER A N   1 
ATOM   1039 C CA  . SER A 1 133 ? -11.050 4.698   -25.662 1.00 24.70 ? 261 SER A CA  1 
ATOM   1040 C C   . SER A 1 133 ? -12.057 3.548   -25.476 1.00 22.89 ? 261 SER A C   1 
ATOM   1041 O O   . SER A 1 133 ? -11.731 2.411   -25.751 1.00 23.96 ? 261 SER A O   1 
ATOM   1042 C CB  . SER A 1 133 ? -10.767 4.938   -27.196 1.00 25.20 ? 261 SER A CB  1 
ATOM   1043 O OG  . SER A 1 133 ? -11.968 5.416   -27.735 1.00 34.05 ? 261 SER A OG  1 
ATOM   1044 N N   . VAL A 1 134 ? -13.262 3.824   -24.994 1.00 22.06 ? 262 VAL A N   1 
ATOM   1045 C CA  . VAL A 1 134 ? -14.212 2.738   -24.800 1.00 22.25 ? 262 VAL A CA  1 
ATOM   1046 C C   . VAL A 1 134 ? -15.609 3.078   -25.313 1.00 23.74 ? 262 VAL A C   1 
ATOM   1047 O O   . VAL A 1 134 ? -15.949 4.276   -25.482 1.00 24.79 ? 262 VAL A O   1 
ATOM   1048 C CB  . VAL A 1 134 ? -14.302 2.282   -23.272 1.00 21.33 ? 262 VAL A CB  1 
ATOM   1049 C CG1 . VAL A 1 134 ? -12.853 2.123   -22.681 1.00 22.48 ? 262 VAL A CG1 1 
ATOM   1050 C CG2 . VAL A 1 134 ? -15.148 3.251   -22.412 1.00 21.89 ? 262 VAL A CG2 1 
ATOM   1051 N N   . LEU A 1 135 ? -16.415 2.037   -25.533 1.00 22.91 ? 263 LEU A N   1 
ATOM   1052 C CA  . LEU A 1 135 ? -17.831 2.220   -25.848 1.00 25.18 ? 263 LEU A CA  1 
ATOM   1053 C C   . LEU A 1 135 ? -18.662 1.745   -24.674 1.00 26.39 ? 263 LEU A C   1 
ATOM   1054 O O   . LEU A 1 135 ? -18.718 0.516   -24.387 1.00 27.10 ? 263 LEU A O   1 
ATOM   1055 C CB  . LEU A 1 135 ? -18.258 1.444   -27.118 1.00 25.40 ? 263 LEU A CB  1 
ATOM   1056 C CG  . LEU A 1 135 ? -17.351 1.579   -28.358 1.00 24.76 ? 263 LEU A CG  1 
ATOM   1057 C CD1 . LEU A 1 135 ? -17.735 0.634   -29.553 1.00 33.36 ? 263 LEU A CD1 1 
ATOM   1058 C CD2 . LEU A 1 135 ? -17.315 3.056   -28.804 1.00 25.66 ? 263 LEU A CD2 1 
ATOM   1059 N N   . PHE A 1 136 ? -19.292 2.690   -23.984 1.00 26.15 ? 264 PHE A N   1 
ATOM   1060 C CA  . PHE A 1 136 ? -20.077 2.310   -22.808 1.00 26.18 ? 264 PHE A CA  1 
ATOM   1061 C C   . PHE A 1 136 ? -21.398 1.724   -23.253 1.00 28.18 ? 264 PHE A C   1 
ATOM   1062 O O   . PHE A 1 136 ? -22.000 2.218   -24.240 1.00 26.34 ? 264 PHE A O   1 
ATOM   1063 C CB  . PHE A 1 136 ? -20.392 3.533   -21.945 1.00 26.75 ? 264 PHE A CB  1 
ATOM   1064 C CG  . PHE A 1 136 ? -19.264 3.962   -21.055 1.00 25.27 ? 264 PHE A CG  1 
ATOM   1065 C CD1 . PHE A 1 136 ? -19.130 3.428   -19.768 1.00 24.44 ? 264 PHE A CD1 1 
ATOM   1066 C CD2 . PHE A 1 136 ? -18.351 4.922   -21.492 1.00 24.76 ? 264 PHE A CD2 1 
ATOM   1067 C CE1 . PHE A 1 136 ? -18.103 3.850   -18.914 1.00 21.31 ? 264 PHE A CE1 1 
ATOM   1068 C CE2 . PHE A 1 136 ? -17.299 5.333   -20.641 1.00 22.59 ? 264 PHE A CE2 1 
ATOM   1069 C CZ  . PHE A 1 136 ? -17.186 4.785   -19.357 1.00 20.84 ? 264 PHE A CZ  1 
ATOM   1070 N N   . GLU A 1 137 ? -21.884 0.712   -22.528 1.00 29.42 ? 265 GLU A N   1 
ATOM   1071 C CA  . GLU A 1 137 ? -23.250 0.213   -22.752 1.00 31.08 ? 265 GLU A CA  1 
ATOM   1072 C C   . GLU A 1 137 ? -24.210 1.340   -22.394 1.00 31.62 ? 265 GLU A C   1 
ATOM   1073 O O   . GLU A 1 137 ? -24.081 1.981   -21.360 1.00 32.95 ? 265 GLU A O   1 
ATOM   1074 C CB  . GLU A 1 137 ? -23.552 -1.032  -21.912 1.00 31.30 ? 265 GLU A CB  1 
ATOM   1075 C CG  . GLU A 1 137 ? -22.915 -2.298  -22.453 1.00 30.41 ? 265 GLU A CG  1 
ATOM   1076 C CD  . GLU A 1 137 ? -23.275 -3.518  -21.569 1.00 30.59 ? 265 GLU A CD  1 
ATOM   1077 O OE1 . GLU A 1 137 ? -24.164 -3.393  -20.704 1.00 33.50 ? 265 GLU A OE1 1 
ATOM   1078 O OE2 . GLU A 1 137 ? -22.637 -4.527  -21.700 1.00 29.29 ? 265 GLU A OE2 1 
ATOM   1079 N N   . ASP A 1 138 ? -25.156 1.641   -23.293 1.00 33.09 ? 266 ASP A N   1 
ATOM   1080 C CA  . ASP A 1 138 ? -26.084 2.742   -23.045 1.00 32.20 ? 266 ASP A CA  1 
ATOM   1081 C C   . ASP A 1 138 ? -27.356 2.456   -23.857 1.00 33.52 ? 266 ASP A C   1 
ATOM   1082 O O   . ASP A 1 138 ? -27.383 2.589   -25.072 1.00 31.25 ? 266 ASP A O   1 
ATOM   1083 C CB  . ASP A 1 138 ? -25.464 4.107   -23.439 1.00 33.11 ? 266 ASP A CB  1 
ATOM   1084 C CG  . ASP A 1 138 ? -26.281 5.298   -22.889 1.00 34.67 ? 266 ASP A CG  1 
ATOM   1085 O OD1 . ASP A 1 138 ? -27.454 5.117   -22.515 1.00 37.15 ? 266 ASP A OD1 1 
ATOM   1086 O OD2 . ASP A 1 138 ? -25.751 6.408   -22.747 1.00 37.31 ? 266 ASP A OD2 1 
ATOM   1087 N N   . THR A 1 139 ? -28.399 2.042   -23.159 1.00 34.60 ? 267 THR A N   1 
ATOM   1088 C CA  . THR A 1 139 ? -29.634 1.621   -23.781 1.00 37.70 ? 267 THR A CA  1 
ATOM   1089 C C   . THR A 1 139 ? -30.407 2.851   -24.304 1.00 38.05 ? 267 THR A C   1 
ATOM   1090 O O   . THR A 1 139 ? -31.453 2.707   -24.881 1.00 40.32 ? 267 THR A O   1 
ATOM   1091 C CB  . THR A 1 139 ? -30.489 0.810   -22.743 1.00 37.02 ? 267 THR A CB  1 
ATOM   1092 O OG1 . THR A 1 139 ? -30.671 1.637   -21.580 1.00 41.82 ? 267 THR A OG1 1 
ATOM   1093 C CG2 . THR A 1 139 ? -29.764 -0.443  -22.332 1.00 40.03 ? 267 THR A CG2 1 
ATOM   1094 N N   . SER A 1 140 ? -29.889 4.064   -24.132 1.00 39.11 ? 268 SER A N   1 
ATOM   1095 C CA  . SER A 1 140 ? -30.561 5.238   -24.697 1.00 38.68 ? 268 SER A CA  1 
ATOM   1096 C C   . SER A 1 140 ? -30.354 5.333   -26.259 1.00 37.69 ? 268 SER A C   1 
ATOM   1097 O O   . SER A 1 140 ? -31.084 6.067   -26.959 1.00 36.70 ? 268 SER A O   1 
ATOM   1098 C CB  . SER A 1 140 ? -30.119 6.488   -23.960 1.00 39.01 ? 268 SER A CB  1 
ATOM   1099 O OG  . SER A 1 140 ? -29.083 7.120   -24.668 1.00 42.79 ? 268 SER A OG  1 
ATOM   1100 N N   . TYR A 1 141 ? -29.390 4.578   -26.794 1.00 35.06 ? 269 TYR A N   1 
ATOM   1101 C CA  . TYR A 1 141 ? -29.100 4.561   -28.203 1.00 35.34 ? 269 TYR A CA  1 
ATOM   1102 C C   . TYR A 1 141 ? -29.509 3.225   -28.787 1.00 36.94 ? 269 TYR A C   1 
ATOM   1103 O O   . TYR A 1 141 ? -29.420 2.185   -28.121 1.00 36.96 ? 269 TYR A O   1 
ATOM   1104 C CB  . TYR A 1 141 ? -27.603 4.831   -28.479 1.00 35.08 ? 269 TYR A CB  1 
ATOM   1105 C CG  . TYR A 1 141 ? -27.106 6.065   -27.760 1.00 31.74 ? 269 TYR A CG  1 
ATOM   1106 C CD1 . TYR A 1 141 ? -27.770 7.308   -27.892 1.00 29.71 ? 269 TYR A CD1 1 
ATOM   1107 C CD2 . TYR A 1 141 ? -26.025 5.972   -26.840 1.00 29.33 ? 269 TYR A CD2 1 
ATOM   1108 C CE1 . TYR A 1 141 ? -27.277 8.469   -27.178 1.00 30.77 ? 269 TYR A CE1 1 
ATOM   1109 C CE2 . TYR A 1 141 ? -25.531 7.092   -26.162 1.00 30.99 ? 269 TYR A CE2 1 
ATOM   1110 C CZ  . TYR A 1 141 ? -26.164 8.355   -26.322 1.00 31.96 ? 269 TYR A CZ  1 
ATOM   1111 O OH  . TYR A 1 141 ? -25.660 9.459   -25.571 1.00 30.89 ? 269 TYR A OH  1 
ATOM   1112 N N   . ALA A 1 142 ? -29.935 3.288   -30.043 1.00 37.61 ? 270 ALA A N   1 
ATOM   1113 C CA  . ALA A 1 142 ? -30.512 2.183   -30.769 1.00 38.17 ? 270 ALA A CA  1 
ATOM   1114 C C   . ALA A 1 142 ? -29.515 1.022   -30.747 1.00 38.83 ? 270 ALA A C   1 
ATOM   1115 O O   . ALA A 1 142 ? -29.889 -0.113  -30.396 1.00 39.95 ? 270 ALA A O   1 
ATOM   1116 C CB  . ALA A 1 142 ? -30.823 2.644   -32.241 1.00 37.80 ? 270 ALA A CB  1 
ATOM   1117 N N   . ASP A 1 143 ? -28.245 1.309   -31.067 1.00 38.07 ? 271 ASP A N   1 
ATOM   1118 C CA  . ASP A 1 143 ? -27.257 0.267   -31.142 1.00 37.37 ? 271 ASP A CA  1 
ATOM   1119 C C   . ASP A 1 143 ? -26.691 -0.074  -29.775 1.00 36.99 ? 271 ASP A C   1 
ATOM   1120 O O   . ASP A 1 143 ? -25.813 -0.938  -29.656 1.00 37.77 ? 271 ASP A O   1 
ATOM   1121 C CB  . ASP A 1 143 ? -26.184 0.612   -32.152 1.00 37.18 ? 271 ASP A CB  1 
ATOM   1122 C CG  . ASP A 1 143 ? -25.134 1.580   -31.605 1.00 38.68 ? 271 ASP A CG  1 
ATOM   1123 O OD1 . ASP A 1 143 ? -25.241 2.090   -30.451 1.00 34.51 ? 271 ASP A OD1 1 
ATOM   1124 O OD2 . ASP A 1 143 ? -24.179 1.778   -32.364 1.00 37.73 ? 271 ASP A OD2 1 
ATOM   1125 N N   . GLY A 1 144 ? -27.216 0.581   -28.745 1.00 36.13 ? 272 GLY A N   1 
ATOM   1126 C CA  . GLY A 1 144 ? -26.845 0.292   -27.361 1.00 34.45 ? 272 GLY A CA  1 
ATOM   1127 C C   . GLY A 1 144 ? -25.448 0.694   -26.823 1.00 32.72 ? 272 GLY A C   1 
ATOM   1128 O O   . GLY A 1 144 ? -25.105 0.278   -25.694 1.00 31.22 ? 272 GLY A O   1 
ATOM   1129 N N   . TYR A 1 145 ? -24.699 1.527   -27.560 1.00 31.06 ? 273 TYR A N   1 
ATOM   1130 C CA  . TYR A 1 145 ? -23.321 1.938   -27.184 1.00 29.52 ? 273 TYR A CA  1 
ATOM   1131 C C   . TYR A 1 145 ? -23.073 3.437   -27.349 1.00 29.53 ? 273 TYR A C   1 
ATOM   1132 O O   . TYR A 1 145 ? -23.560 4.057   -28.315 1.00 27.87 ? 273 TYR A O   1 
ATOM   1133 C CB  . TYR A 1 145 ? -22.253 1.204   -27.963 1.00 30.08 ? 273 TYR A CB  1 
ATOM   1134 C CG  . TYR A 1 145 ? -22.174 -0.214  -27.529 1.00 34.11 ? 273 TYR A CG  1 
ATOM   1135 C CD1 . TYR A 1 145 ? -21.419 -0.565  -26.397 1.00 35.58 ? 273 TYR A CD1 1 
ATOM   1136 C CD2 . TYR A 1 145 ? -22.931 -1.190  -28.161 1.00 35.88 ? 273 TYR A CD2 1 
ATOM   1137 C CE1 . TYR A 1 145 ? -21.403 -1.838  -25.938 1.00 37.88 ? 273 TYR A CE1 1 
ATOM   1138 C CE2 . TYR A 1 145 ? -22.909 -2.513  -27.707 1.00 39.98 ? 273 TYR A CE2 1 
ATOM   1139 C CZ  . TYR A 1 145 ? -22.136 -2.812  -26.611 1.00 40.24 ? 273 TYR A CZ  1 
ATOM   1140 O OH  . TYR A 1 145 ? -22.092 -4.091  -26.120 1.00 42.35 ? 273 TYR A OH  1 
ATOM   1141 N N   . SER A 1 146 ? -22.322 4.012   -26.384 1.00 26.92 ? 274 SER A N   1 
ATOM   1142 C CA  . SER A 1 146 ? -21.904 5.388   -26.495 1.00 25.37 ? 274 SER A CA  1 
ATOM   1143 C C   . SER A 1 146 ? -20.928 5.483   -27.672 1.00 24.44 ? 274 SER A C   1 
ATOM   1144 O O   . SER A 1 146 ? -20.377 4.485   -28.166 1.00 25.53 ? 274 SER A O   1 
ATOM   1145 C CB  . SER A 1 146 ? -21.267 5.867   -25.169 1.00 22.79 ? 274 SER A CB  1 
ATOM   1146 O OG  . SER A 1 146 ? -19.957 5.298   -25.086 1.00 24.02 ? 274 SER A OG  1 
ATOM   1147 N N   . PRO A 1 147 ? -20.683 6.706   -28.140 1.00 24.84 ? 275 PRO A N   1 
ATOM   1148 C CA  . PRO A 1 147 ? -19.517 6.917   -28.951 1.00 24.57 ? 275 PRO A CA  1 
ATOM   1149 C C   . PRO A 1 147 ? -18.236 6.651   -28.128 1.00 23.12 ? 275 PRO A C   1 
ATOM   1150 O O   . PRO A 1 147 ? -18.368 6.475   -26.923 1.00 23.55 ? 275 PRO A O   1 
ATOM   1151 C CB  . PRO A 1 147 ? -19.681 8.384   -29.422 1.00 24.42 ? 275 PRO A CB  1 
ATOM   1152 C CG  . PRO A 1 147 ? -20.679 9.020   -28.588 1.00 26.36 ? 275 PRO A CG  1 
ATOM   1153 C CD  . PRO A 1 147 ? -21.365 7.949   -27.752 1.00 24.81 ? 275 PRO A CD  1 
ATOM   1154 N N   . PRO A 1 148 ? -17.032 6.562   -28.777 1.00 25.10 ? 276 PRO A N   1 
ATOM   1155 C CA  . PRO A 1 148 ? -15.776 6.352   -28.073 1.00 24.71 ? 276 PRO A CA  1 
ATOM   1156 C C   . PRO A 1 148 ? -15.531 7.459   -27.030 1.00 24.89 ? 276 PRO A C   1 
ATOM   1157 O O   . PRO A 1 148 ? -15.628 8.666   -27.349 1.00 24.19 ? 276 PRO A O   1 
ATOM   1158 C CB  . PRO A 1 148 ? -14.725 6.440   -29.192 1.00 26.63 ? 276 PRO A CB  1 
ATOM   1159 C CG  . PRO A 1 148 ? -15.471 6.042   -30.419 1.00 26.96 ? 276 PRO A CG  1 
ATOM   1160 C CD  . PRO A 1 148 ? -16.763 6.773   -30.216 1.00 24.61 ? 276 PRO A CD  1 
ATOM   1161 N N   . LEU A 1 149 ? -15.316 7.057   -25.784 1.00 22.23 ? 277 LEU A N   1 
ATOM   1162 C CA  . LEU A 1 149 ? -15.048 8.041   -24.732 1.00 22.67 ? 277 LEU A CA  1 
ATOM   1163 C C   . LEU A 1 149 ? -13.742 7.592   -24.068 1.00 23.87 ? 277 LEU A C   1 
ATOM   1164 O O   . LEU A 1 149 ? -13.504 6.374   -23.900 1.00 23.03 ? 277 LEU A O   1 
ATOM   1165 C CB  . LEU A 1 149 ? -16.202 8.110   -23.701 1.00 20.94 ? 277 LEU A CB  1 
ATOM   1166 C CG  . LEU A 1 149 ? -17.609 8.465   -24.161 1.00 23.28 ? 277 LEU A CG  1 
ATOM   1167 C CD1 . LEU A 1 149 ? -18.597 8.389   -23.025 1.00 24.32 ? 277 LEU A CD1 1 
ATOM   1168 C CD2 . LEU A 1 149 ? -17.652 9.924   -24.764 1.00 24.26 ? 277 LEU A CD2 1 
ATOM   1169 N N   . ASN A 1 150 ? -12.919 8.571   -23.702 1.00 22.13 ? 278 ASN A N   1 
ATOM   1170 C CA  . ASN A 1 150 ? -11.661 8.331   -22.998 1.00 24.83 ? 278 ASN A CA  1 
ATOM   1171 C C   . ASN A 1 150 ? -11.796 7.953   -21.515 1.00 23.28 ? 278 ASN A C   1 
ATOM   1172 O O   . ASN A 1 150 ? -12.561 8.573   -20.768 1.00 24.05 ? 278 ASN A O   1 
ATOM   1173 C CB  . ASN A 1 150 ? -10.790 9.600   -23.071 1.00 24.58 ? 278 ASN A CB  1 
ATOM   1174 C CG  . ASN A 1 150 ? -10.078 9.740   -24.353 1.00 30.80 ? 278 ASN A CG  1 
ATOM   1175 O OD1 . ASN A 1 150 ? -10.110 8.838   -25.218 1.00 31.11 ? 278 ASN A OD1 1 
ATOM   1176 N ND2 . ASN A 1 150 ? -9.387  10.901  -24.514 1.00 33.89 ? 278 ASN A ND2 1 
ATOM   1177 N N   . VAL A 1 151 ? -11.067 6.922   -21.088 1.00 23.19 ? 279 VAL A N   1 
ATOM   1178 C CA  . VAL A 1 151 ? -11.005 6.531   -19.663 1.00 22.21 ? 279 VAL A CA  1 
ATOM   1179 C C   . VAL A 1 151 ? -9.558  6.199   -19.370 1.00 23.55 ? 279 VAL A C   1 
ATOM   1180 O O   . VAL A 1 151 ? -8.958  5.467   -20.123 1.00 23.64 ? 279 VAL A O   1 
ATOM   1181 C CB  . VAL A 1 151 ? -11.855 5.295   -19.372 1.00 22.79 ? 279 VAL A CB  1 
ATOM   1182 C CG1 . VAL A 1 151 ? -11.924 5.022   -17.819 1.00 21.78 ? 279 VAL A CG1 1 
ATOM   1183 C CG2 . VAL A 1 151 ? -13.300 5.622   -19.761 1.00 21.71 ? 279 VAL A CG2 1 
ATOM   1184 N N   . ALA A 1 152 ? -8.995  6.727   -18.267 1.00 22.57 ? 280 ALA A N   1 
ATOM   1185 C CA  . ALA A 1 152 ? -7.579  6.496   -17.979 1.00 22.17 ? 280 ALA A CA  1 
ATOM   1186 C C   . ALA A 1 152 ? -7.390  5.061   -17.508 1.00 21.79 ? 280 ALA A C   1 
ATOM   1187 O O   . ALA A 1 152 ? -8.352  4.436   -16.965 1.00 21.52 ? 280 ALA A O   1 
ATOM   1188 C CB  . ALA A 1 152 ? -7.095  7.448   -16.877 1.00 21.65 ? 280 ALA A CB  1 
ATOM   1189 N N   . GLN A 1 153 ? -6.157  4.567   -17.618 1.00 21.91 ? 281 GLN A N   1 
ATOM   1190 C CA  . GLN A 1 153 ? -5.816  3.199   -17.104 1.00 20.61 ? 281 GLN A CA  1 
ATOM   1191 C C   . GLN A 1 153 ? -6.208  2.970   -15.665 1.00 22.00 ? 281 GLN A C   1 
ATOM   1192 O O   . GLN A 1 153 ? -6.678  1.888   -15.309 1.00 20.04 ? 281 GLN A O   1 
ATOM   1193 C CB  . GLN A 1 153 ? -4.347  2.910   -17.203 1.00 20.46 ? 281 GLN A CB  1 
ATOM   1194 C CG  . GLN A 1 153 ? -3.853  2.880   -18.646 1.00 21.08 ? 281 GLN A CG  1 
ATOM   1195 C CD  . GLN A 1 153 ? -2.650  2.004   -18.821 1.00 21.46 ? 281 GLN A CD  1 
ATOM   1196 O OE1 . GLN A 1 153 ? -1.676  2.378   -19.544 1.00 27.34 ? 281 GLN A OE1 1 
ATOM   1197 N NE2 . GLN A 1 153 ? -2.641  0.853   -18.157 1.00 16.79 ? 281 GLN A NE2 1 
ATOM   1198 N N   . ARG A 1 154 ? -6.056  4.010   -14.826 1.00 21.29 ? 282 ARG A N   1 
ATOM   1199 C CA  . ARG A 1 154 ? -6.525  3.909   -13.447 1.00 22.84 ? 282 ARG A CA  1 
ATOM   1200 C C   . ARG A 1 154 ? -7.947  3.466   -13.268 1.00 21.11 ? 282 ARG A C   1 
ATOM   1201 O O   . ARG A 1 154 ? -8.270  2.844   -12.254 1.00 22.17 ? 282 ARG A O   1 
ATOM   1202 C CB  . ARG A 1 154 ? -6.306  5.253   -12.711 1.00 24.05 ? 282 ARG A CB  1 
ATOM   1203 C CG  . ARG A 1 154 ? -6.110  4.938   -11.220 1.00 29.38 ? 282 ARG A CG  1 
ATOM   1204 C CD  . ARG A 1 154 ? -6.074  6.184   -10.412 1.00 37.26 ? 282 ARG A CD  1 
ATOM   1205 N NE  . ARG A 1 154 ? -5.870  5.873   -8.987  1.00 43.77 ? 282 ARG A NE  1 
ATOM   1206 C CZ  . ARG A 1 154 ? -5.776  6.832   -8.060  1.00 48.60 ? 282 ARG A CZ  1 
ATOM   1207 N NH1 . ARG A 1 154 ? -5.580  6.530   -6.765  1.00 44.64 ? 282 ARG A NH1 1 
ATOM   1208 N NH2 . ARG A 1 154 ? -5.891  8.114   -8.454  1.00 48.03 ? 282 ARG A NH2 1 
ATOM   1209 N N   . TYR A 1 155 ? -8.818  3.717   -14.248 1.00 20.78 ? 283 TYR A N   1 
ATOM   1210 C CA  . TYR A 1 155 ? -10.240 3.582   -13.991 1.00 19.29 ? 283 TYR A CA  1 
ATOM   1211 C C   . TYR A 1 155 ? -10.893 2.606   -14.956 1.00 19.35 ? 283 TYR A C   1 
ATOM   1212 O O   . TYR A 1 155 ? -12.065 2.725   -15.197 1.00 19.59 ? 283 TYR A O   1 
ATOM   1213 C CB  . TYR A 1 155 ? -10.916 4.980   -14.162 1.00 18.00 ? 283 TYR A CB  1 
ATOM   1214 C CG  . TYR A 1 155 ? -10.481 5.884   -13.063 1.00 18.41 ? 283 TYR A CG  1 
ATOM   1215 C CD1 . TYR A 1 155 ? -10.570 5.469   -11.719 1.00 25.08 ? 283 TYR A CD1 1 
ATOM   1216 C CD2 . TYR A 1 155 ? -10.009 7.174   -13.335 1.00 23.80 ? 283 TYR A CD2 1 
ATOM   1217 C CE1 . TYR A 1 155 ? -10.117 6.316   -10.665 1.00 26.13 ? 283 TYR A CE1 1 
ATOM   1218 C CE2 . TYR A 1 155 ? -9.595  8.000   -12.298 1.00 29.98 ? 283 TYR A CE2 1 
ATOM   1219 C CZ  . TYR A 1 155 ? -9.648  7.569   -10.979 1.00 30.58 ? 283 TYR A CZ  1 
ATOM   1220 O OH  . TYR A 1 155 ? -9.239  8.429   -9.935  1.00 33.42 ? 283 TYR A OH  1 
ATOM   1221 N N   . VAL A 1 156 ? -10.122 1.626   -15.406 1.00 20.23 ? 284 VAL A N   1 
ATOM   1222 C CA  . VAL A 1 156 ? -10.638 0.556   -16.228 1.00 19.31 ? 284 VAL A CA  1 
ATOM   1223 C C   . VAL A 1 156 ? -10.228 -0.773  -15.541 1.00 18.96 ? 284 VAL A C   1 
ATOM   1224 O O   . VAL A 1 156 ? -8.996  -1.073  -15.373 1.00 18.62 ? 284 VAL A O   1 
ATOM   1225 C CB  . VAL A 1 156 ? -10.068 0.615   -17.645 1.00 20.37 ? 284 VAL A CB  1 
ATOM   1226 C CG1 . VAL A 1 156 ? -10.573 -0.618  -18.437 1.00 22.72 ? 284 VAL A CG1 1 
ATOM   1227 C CG2 . VAL A 1 156 ? -10.498 1.928   -18.426 1.00 20.77 ? 284 VAL A CG2 1 
ATOM   1228 N N   . VAL A 1 157 ? -11.258 -1.538  -15.151 1.00 19.68 ? 285 VAL A N   1 
ATOM   1229 C CA  . VAL A 1 157 ? -11.018 -2.793  -14.446 1.00 21.94 ? 285 VAL A CA  1 
ATOM   1230 C C   . VAL A 1 157 ? -11.809 -3.908  -15.082 1.00 23.13 ? 285 VAL A C   1 
ATOM   1231 O O   . VAL A 1 157 ? -12.614 -3.672  -15.945 1.00 24.35 ? 285 VAL A O   1 
ATOM   1232 C CB  . VAL A 1 157 ? -11.272 -2.658  -12.927 1.00 22.46 ? 285 VAL A CB  1 
ATOM   1233 C CG1 . VAL A 1 157 ? -10.272 -1.606  -12.273 1.00 20.28 ? 285 VAL A CG1 1 
ATOM   1234 C CG2 . VAL A 1 157 ? -12.749 -2.346  -12.570 1.00 18.79 ? 285 VAL A CG2 1 
ATOM   1235 N N   . ALA A 1 158 ? -11.460 -5.140  -14.749 1.00 24.54 ? 286 ALA A N   1 
ATOM   1236 C CA  . ALA A 1 158 ? -12.171 -6.297  -15.239 1.00 25.77 ? 286 ALA A CA  1 
ATOM   1237 C C   . ALA A 1 158 ? -13.568 -6.325  -14.663 1.00 26.41 ? 286 ALA A C   1 
ATOM   1238 O O   . ALA A 1 158 ? -13.823 -5.774  -13.608 1.00 27.42 ? 286 ALA A O   1 
ATOM   1239 C CB  . ALA A 1 158 ? -11.343 -7.622  -14.905 1.00 25.79 ? 286 ALA A CB  1 
ATOM   1240 N N   . CYS A 1 159 ? -14.514 -6.852  -15.435 1.00 29.09 ? 287 CYS A N   1 
ATOM   1241 C CA  . CYS A 1 159 ? -15.921 -6.782  -15.105 1.00 31.31 ? 287 CYS A CA  1 
ATOM   1242 C C   . CYS A 1 159 ? -16.272 -8.052  -14.284 1.00 33.89 ? 287 CYS A C   1 
ATOM   1243 O O   . CYS A 1 159 ? -16.356 -9.149  -14.858 1.00 37.39 ? 287 CYS A O   1 
ATOM   1244 C CB  . CYS A 1 159 ? -16.749 -6.576  -16.414 1.00 30.80 ? 287 CYS A CB  1 
ATOM   1245 S SG  . CYS A 1 159 ? -18.564 -6.533  -16.074 1.00 35.59 ? 287 CYS A SG  1 
HETATM 1246 O O   . HOH B 2 .   ? -3.972  6.238   -15.221 1.00 19.85 ? 1   HOH A O   1 
HETATM 1247 O O   . HOH B 2 .   ? -14.959 -2.965  -34.703 1.00 50.75 ? 2   HOH A O   1 
HETATM 1248 O O   . HOH B 2 .   ? -5.572  -2.107  -3.605  1.00 25.38 ? 3   HOH A O   1 
HETATM 1249 O O   . HOH B 2 .   ? -22.392 -0.509  -12.507 1.00 31.71 ? 4   HOH A O   1 
HETATM 1250 O O   . HOH B 2 .   ? -7.728  -4.847  -10.877 1.00 24.12 ? 5   HOH A O   1 
HETATM 1251 O O   . HOH B 2 .   ? -6.542  -0.353  -16.598 1.00 21.73 ? 6   HOH A O   1 
HETATM 1252 O O   . HOH B 2 .   ? -5.446  -4.704  -12.377 1.00 21.49 ? 7   HOH A O   1 
HETATM 1253 O O   . HOH B 2 .   ? 2.337   -11.012 -12.462 1.00 28.08 ? 8   HOH A O   1 
HETATM 1254 O O   . HOH B 2 .   ? -5.407  -0.630  -5.699  1.00 26.08 ? 9   HOH A O   1 
HETATM 1255 O O   . HOH B 2 .   ? -21.516 9.853   -9.947  1.00 32.78 ? 10  HOH A O   1 
HETATM 1256 O O   . HOH B 2 .   ? -8.832  -5.285  -13.393 1.00 23.66 ? 11  HOH A O   1 
HETATM 1257 O O   . HOH B 2 .   ? -7.886  -7.747  -14.286 1.00 26.08 ? 12  HOH A O   1 
HETATM 1258 O O   . HOH B 2 .   ? -8.018  -7.457  -9.884  1.00 21.24 ? 13  HOH A O   1 
HETATM 1259 O O   . HOH B 2 .   ? 4.566   -1.285  -18.167 1.00 23.38 ? 14  HOH A O   1 
HETATM 1260 O O   . HOH B 2 .   ? -4.535  -0.980  -18.334 1.00 25.67 ? 15  HOH A O   1 
HETATM 1261 O O   . HOH B 2 .   ? -21.120 3.927   -30.658 1.00 28.57 ? 16  HOH A O   1 
HETATM 1262 O O   . HOH B 2 .   ? -4.932  3.153   -7.791  1.00 29.65 ? 17  HOH A O   1 
HETATM 1263 O O   . HOH B 2 .   ? -7.413  -3.144  -14.520 1.00 23.99 ? 18  HOH A O   1 
HETATM 1264 O O   . HOH B 2 .   ? -1.613  5.121   -20.511 1.00 28.75 ? 19  HOH A O   1 
HETATM 1265 O O   . HOH B 2 .   ? -2.746  -8.572  0.271   1.00 27.33 ? 20  HOH A O   1 
HETATM 1266 O O   . HOH B 2 .   ? -7.631  -2.765  7.465   1.00 29.40 ? 21  HOH A O   1 
HETATM 1267 O O   . HOH B 2 .   ? -11.576 -8.232  -3.576  1.00 31.71 ? 22  HOH A O   1 
HETATM 1268 O O   . HOH B 2 .   ? -13.965 10.874  -27.141 1.00 26.13 ? 24  HOH A O   1 
HETATM 1269 O O   . HOH B 2 .   ? -13.192 11.341  -24.621 1.00 32.03 ? 25  HOH A O   1 
HETATM 1270 O O   . HOH B 2 .   ? -22.069 6.849   6.352   1.00 39.36 ? 26  HOH A O   1 
HETATM 1271 O O   . HOH B 2 .   ? -10.724 8.633   -16.740 1.00 28.68 ? 27  HOH A O   1 
HETATM 1272 O O   . HOH B 2 .   ? 2.072   -0.378  -6.070  1.00 35.51 ? 28  HOH A O   1 
HETATM 1273 O O   . HOH B 2 .   ? -6.387  -4.054  -28.929 1.00 26.53 ? 29  HOH A O   1 
HETATM 1274 O O   . HOH B 2 .   ? -9.758  -10.395 -26.419 1.00 30.09 ? 30  HOH A O   1 
HETATM 1275 O O   . HOH B 2 .   ? -4.147  6.312   -18.903 1.00 29.75 ? 31  HOH A O   1 
HETATM 1276 O O   . HOH B 2 .   ? 11.086  -4.718  -10.798 1.00 39.31 ? 32  HOH A O   1 
HETATM 1277 O O   . HOH B 2 .   ? -23.153 -1.139  -16.419 1.00 31.65 ? 33  HOH A O   1 
HETATM 1278 O O   . HOH B 2 .   ? -4.014  12.049  -7.650  1.00 38.18 ? 34  HOH A O   1 
HETATM 1279 O O   . HOH B 2 .   ? 8.297   -11.955 -12.008 1.00 26.80 ? 35  HOH A O   1 
HETATM 1280 O O   . HOH B 2 .   ? -9.918  5.689   4.024   1.00 30.08 ? 36  HOH A O   1 
HETATM 1281 O O   . HOH B 2 .   ? -13.423 -8.118  -17.857 1.00 27.16 ? 37  HOH A O   1 
HETATM 1282 O O   . HOH B 2 .   ? -5.860  9.220   -24.974 1.00 28.60 ? 38  HOH A O   1 
HETATM 1283 O O   . HOH B 2 .   ? -19.710 5.418   -32.482 1.00 33.25 ? 39  HOH A O   1 
HETATM 1284 O O   . HOH B 2 .   ? -30.681 6.121   -30.956 1.00 32.91 ? 40  HOH A O   1 
HETATM 1285 O O   . HOH B 2 .   ? -5.447  -2.536  -30.622 1.00 43.19 ? 41  HOH A O   1 
HETATM 1286 O O   . HOH B 2 .   ? -21.422 -7.489  1.249   1.00 40.52 ? 42  HOH A O   1 
HETATM 1287 O O   . HOH B 2 .   ? -0.026  3.706   -7.494  1.00 29.45 ? 43  HOH A O   1 
HETATM 1288 O O   . HOH B 2 .   ? -27.424 3.890   -32.134 1.00 32.71 ? 44  HOH A O   1 
HETATM 1289 O O   . HOH B 2 .   ? -2.506  -9.309  6.215   1.00 47.55 ? 45  HOH A O   1 
HETATM 1290 O O   . HOH B 2 .   ? -4.164  -8.068  -22.098 1.00 34.30 ? 46  HOH A O   1 
HETATM 1291 O O   . HOH B 2 .   ? -0.391  -3.998  1.976   1.00 31.59 ? 48  HOH A O   1 
HETATM 1292 O O   . HOH B 2 .   ? -17.468 7.677   6.476   1.00 42.55 ? 49  HOH A O   1 
HETATM 1293 O O   . HOH B 2 .   ? -5.790  1.987   -5.459  1.00 31.63 ? 50  HOH A O   1 
HETATM 1294 O O   . HOH B 2 .   ? 4.497   -10.892 -10.527 1.00 25.91 ? 51  HOH A O   1 
HETATM 1295 O O   . HOH B 2 .   ? -19.300 8.104   -32.833 1.00 29.16 ? 52  HOH A O   1 
HETATM 1296 O O   . HOH B 2 .   ? -21.695 10.150  -7.163  1.00 48.16 ? 53  HOH A O   1 
HETATM 1297 O O   . HOH B 2 .   ? -26.165 -1.888  -24.582 1.00 45.40 ? 54  HOH A O   1 
HETATM 1298 O O   . HOH B 2 .   ? -14.979 -8.898  -7.184  1.00 48.82 ? 55  HOH A O   1 
HETATM 1299 O O   . HOH B 2 .   ? -6.638  -12.701 2.108   1.00 45.68 ? 56  HOH A O   1 
HETATM 1300 O O   . HOH B 2 .   ? -20.336 -9.767  9.037   1.00 55.80 ? 57  HOH A O   1 
HETATM 1301 O O   . HOH B 2 .   ? -22.991 7.587   -23.050 1.00 31.29 ? 58  HOH A O   1 
HETATM 1302 O O   . HOH B 2 .   ? -21.533 1.622   -31.774 1.00 32.41 ? 59  HOH A O   1 
HETATM 1303 O O   . HOH B 2 .   ? 7.839   0.897   -19.061 1.00 38.56 ? 60  HOH A O   1 
HETATM 1304 O O   . HOH B 2 .   ? -21.648 -10.629 -1.595  1.00 51.97 ? 61  HOH A O   1 
HETATM 1305 O O   . HOH B 2 .   ? -13.132 11.276  -20.945 1.00 27.63 ? 62  HOH A O   1 
HETATM 1306 O O   . HOH B 2 .   ? -1.850  -10.804 -2.108  1.00 44.75 ? 63  HOH A O   1 
HETATM 1307 O O   . HOH B 2 .   ? -21.023 -4.886  -24.097 1.00 37.07 ? 65  HOH A O   1 
HETATM 1308 O O   . HOH B 2 .   ? -26.742 8.861   -22.089 1.00 48.41 ? 67  HOH A O   1 
HETATM 1309 O O   . HOH B 2 .   ? -15.057 -4.945  8.089   1.00 40.35 ? 68  HOH A O   1 
HETATM 1310 O O   . HOH B 2 .   ? 7.670   4.326   -12.729 1.00 53.28 ? 69  HOH A O   1 
HETATM 1311 O O   . HOH B 2 .   ? -11.506 -8.987  -27.609 1.00 35.62 ? 72  HOH A O   1 
HETATM 1312 O O   . HOH B 2 .   ? -6.631  4.924   -26.866 1.00 41.34 ? 73  HOH A O   1 
HETATM 1313 O O   . HOH B 2 .   ? -1.049  8.034   -30.432 1.00 50.06 ? 75  HOH A O   1 
HETATM 1314 O O   . HOH B 2 .   ? -8.955  -7.412  -29.936 1.00 33.88 ? 76  HOH A O   1 
HETATM 1315 O O   . HOH B 2 .   ? -16.804 -6.930  9.224   1.00 42.87 ? 78  HOH A O   1 
HETATM 1316 O O   . HOH B 2 .   ? 7.958   -9.166  -19.019 1.00 40.20 ? 79  HOH A O   1 
HETATM 1317 O O   . HOH B 2 .   ? 8.023   4.139   -23.446 1.00 34.33 ? 81  HOH A O   1 
HETATM 1318 O O   . HOH B 2 .   ? -3.419  3.311   0.517   1.00 31.73 ? 82  HOH A O   1 
HETATM 1319 O O   . HOH B 2 .   ? 1.292   -6.075  -7.193  1.00 31.83 ? 83  HOH A O   1 
HETATM 1320 O O   . HOH B 2 .   ? 3.922   -11.185 -19.689 1.00 31.53 ? 85  HOH A O   1 
HETATM 1321 O O   . HOH B 2 .   ? -24.772 10.231  -20.527 1.00 57.15 ? 86  HOH A O   1 
HETATM 1322 O O   . HOH B 2 .   ? -4.677  -16.219 -7.377  1.00 49.97 ? 87  HOH A O   1 
HETATM 1323 O O   . HOH B 2 .   ? -6.246  -3.328  4.890   1.00 37.63 ? 88  HOH A O   1 
HETATM 1324 O O   . HOH B 2 .   ? -22.542 -6.690  3.275   1.00 54.38 ? 90  HOH A O   1 
HETATM 1325 O O   . HOH B 2 .   ? -13.758 -10.237 -26.226 1.00 32.74 ? 126 HOH A O   1 
HETATM 1326 O O   . HOH B 2 .   ? -3.744  -4.087  4.718   1.00 33.28 ? 127 HOH A O   1 
HETATM 1327 O O   . HOH B 2 .   ? -4.890  5.558   -3.449  1.00 53.53 ? 128 HOH A O   1 
HETATM 1328 O O   . HOH B 2 .   ? -11.665 -10.516 -30.093 1.00 34.95 ? 288 HOH A O   1 
HETATM 1329 O O   . HOH B 2 .   ? -4.081  -6.531  6.831   1.00 47.82 ? 289 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   THR 1   129 129 THR THR A . n 
A 1 2   LEU 2   130 130 LEU LEU A . n 
A 1 3   PRO 3   131 131 PRO PRO A . n 
A 1 4   LEU 4   132 132 LEU LEU A . n 
A 1 5   TRP 5   133 133 TRP TRP A . n 
A 1 6   ILE 6   134 134 ILE ILE A . n 
A 1 7   GLY 7   135 135 GLY GLY A . n 
A 1 8   LYS 8   136 136 LYS LYS A . n 
A 1 9   PRO 9   137 137 PRO PRO A . n 
A 1 10  GLY 10  138 138 GLY GLY A . n 
A 1 11  ASP 11  139 139 ASP ASP A . n 
A 1 12  LYS 12  140 140 LYS LYS A . n 
A 1 13  PRO 13  141 141 PRO PRO A . n 
A 1 14  PRO 14  142 142 PRO PRO A . n 
A 1 15  PRO 15  143 143 PRO PRO A . n 
A 1 16  LEU 16  144 144 LEU LEU A . n 
A 1 17  CYS 17  145 145 CYS CYS A . n 
A 1 18  GLY 18  146 146 GLY GLY A . n 
A 1 19  ALA 19  147 147 ALA ALA A . n 
A 1 20  ILE 20  148 148 ILE ILE A . n 
A 1 21  PRO 21  149 149 PRO PRO A . n 
A 1 22  ALA 22  150 150 ALA ALA A . n 
A 1 23  SER 23  151 151 SER SER A . n 
A 1 24  GLY 24  152 152 GLY GLY A . n 
A 1 25  ASP 25  153 153 ASP ASP A . n 
A 1 26  TYR 26  154 154 TYR TYR A . n 
A 1 27  VAL 27  155 155 VAL VAL A . n 
A 1 28  ALA 28  156 156 ALA ALA A . n 
A 1 29  ARG 29  157 157 ARG ARG A . n 
A 1 30  PRO 30  158 158 PRO PRO A . n 
A 1 31  GLY 31  159 159 GLY GLY A . n 
A 1 32  ASP 32  160 160 ASP ASP A . n 
A 1 33  LYS 33  161 161 LYS LYS A . n 
A 1 34  VAL 34  162 162 VAL VAL A . n 
A 1 35  ALA 35  163 163 ALA ALA A . n 
A 1 36  ALA 36  164 164 ALA ALA A . n 
A 1 37  ARG 37  165 165 ARG ARG A . n 
A 1 38  VAL 38  166 166 VAL VAL A . n 
A 1 39  LYS 39  167 167 LYS LYS A . n 
A 1 40  ALA 40  168 168 ALA ALA A . n 
A 1 41  VAL 41  169 169 VAL VAL A . n 
A 1 42  ASP 42  170 ?   ?   ?   A . n 
A 1 43  GLY 43  171 ?   ?   ?   A . n 
A 1 44  ASP 44  172 172 ASP ASP A . n 
A 1 45  GLU 45  173 173 GLU GLU A . n 
A 1 46  GLN 46  174 174 GLN GLN A . n 
A 1 47  TRP 47  175 175 TRP TRP A . n 
A 1 48  ILE 48  176 176 ILE ILE A . n 
A 1 49  LEU 49  177 177 LEU LEU A . n 
A 1 50  ALA 50  178 178 ALA ALA A . n 
A 1 51  GLU 51  179 179 GLU GLU A . n 
A 1 52  VAL 52  180 180 VAL VAL A . n 
A 1 53  VAL 53  181 181 VAL VAL A . n 
A 1 54  SER 54  182 182 SER SER A . n 
A 1 55  TYR 55  183 183 TYR TYR A . n 
A 1 56  SER 56  184 184 SER SER A . n 
A 1 57  HIS 57  185 185 HIS HIS A . n 
A 1 58  ALA 58  186 186 ALA ALA A . n 
A 1 59  THR 59  187 187 THR THR A . n 
A 1 60  ASN 60  188 188 ASN ASN A . n 
A 1 61  LYS 61  189 189 LYS LYS A . n 
A 1 62  TYR 62  190 190 TYR TYR A . n 
A 1 63  GLU 63  191 191 GLU GLU A . n 
A 1 64  VAL 64  192 192 VAL VAL A . n 
A 1 65  ASP 65  193 193 ASP ASP A . n 
A 1 66  ASP 66  194 194 ASP ASP A . n 
A 1 67  ILE 67  195 195 ILE ILE A . n 
A 1 68  ASP 68  196 196 ASP ASP A . n 
A 1 69  GLU 69  197 197 GLU GLU A . n 
A 1 70  GLU 70  198 198 GLU GLU A . n 
A 1 71  GLY 71  199 199 GLY GLY A . n 
A 1 72  LYS 72  200 200 LYS LYS A . n 
A 1 73  GLU 73  201 201 GLU GLU A . n 
A 1 74  ARG 74  202 202 ARG ARG A . n 
A 1 75  HIS 75  203 203 HIS HIS A . n 
A 1 76  THR 76  204 204 THR THR A . n 
A 1 77  LEU 77  205 205 LEU LEU A . n 
A 1 78  SER 78  206 206 SER SER A . n 
A 1 79  ARG 79  207 207 ARG ARG A . n 
A 1 80  ARG 80  208 208 ARG ARG A . n 
A 1 81  ARG 81  209 209 ARG ARG A . n 
A 1 82  VAL 82  210 210 VAL VAL A . n 
A 1 83  ILE 83  211 211 ILE ILE A . n 
A 1 84  PRO 84  212 212 PRO PRO A . n 
A 1 85  LEU 85  213 213 LEU LEU A . n 
A 1 86  PRO 86  214 214 PRO PRO A . n 
A 1 87  GLN 87  215 215 GLN GLN A . n 
A 1 88  TRP 88  216 216 TRP TRP A . n 
A 1 89  LYS 89  217 217 LYS LYS A . n 
A 1 90  ALA 90  218 218 ALA ALA A . n 
A 1 91  ASN 91  219 219 ASN ASN A . n 
A 1 92  PRO 92  220 220 PRO PRO A . n 
A 1 93  GLU 93  221 221 GLU GLU A . n 
A 1 94  THR 94  222 222 THR THR A . n 
A 1 95  ASP 95  223 223 ASP ASP A . n 
A 1 96  PRO 96  224 224 PRO PRO A . n 
A 1 97  GLU 97  225 225 GLU GLU A . n 
A 1 98  ALA 98  226 226 ALA ALA A . n 
A 1 99  LEU 99  227 227 LEU LEU A . n 
A 1 100 PHE 100 228 228 PHE PHE A . n 
A 1 101 GLN 101 229 229 GLN GLN A . n 
A 1 102 LYS 102 230 230 LYS LYS A . n 
A 1 103 GLU 103 231 231 GLU GLU A . n 
A 1 104 GLN 104 232 232 GLN GLN A . n 
A 1 105 LEU 105 233 233 LEU LEU A . n 
A 1 106 VAL 106 234 234 VAL VAL A . n 
A 1 107 LEU 107 235 235 LEU LEU A . n 
A 1 108 ALA 108 236 236 ALA ALA A . n 
A 1 109 LEU 109 237 237 LEU LEU A . n 
A 1 110 TYR 110 238 238 TYR TYR A . n 
A 1 111 PRO 111 239 239 PRO PRO A . n 
A 1 112 GLN 112 240 240 GLN GLN A . n 
A 1 113 THR 113 241 241 THR THR A . n 
A 1 114 THR 114 242 242 THR THR A . n 
A 1 115 CYS 115 243 243 CYS CYS A . n 
A 1 116 PHE 116 244 244 PHE PHE A . n 
A 1 117 TYR 117 245 245 TYR TYR A . n 
A 1 118 ARG 118 246 246 ARG ARG A . n 
A 1 119 ALA 119 247 247 ALA ALA A . n 
A 1 120 LEU 120 248 248 LEU LEU A . n 
A 1 121 ILE 121 249 249 ILE ILE A . n 
A 1 122 HIS 122 250 250 HIS HIS A . n 
A 1 123 ALA 123 251 251 ALA ALA A . n 
A 1 124 PRO 124 252 252 PRO PRO A . n 
A 1 125 PRO 125 253 253 PRO PRO A . n 
A 1 126 GLN 126 254 254 GLN GLN A . n 
A 1 127 ARG 127 255 255 ARG ARG A . n 
A 1 128 PRO 128 256 256 PRO PRO A . n 
A 1 129 GLN 129 257 257 GLN GLN A . n 
A 1 130 ASP 130 258 258 ASP ASP A . n 
A 1 131 ASP 131 259 259 ASP ASP A . n 
A 1 132 TYR 132 260 260 TYR TYR A . n 
A 1 133 SER 133 261 261 SER SER A . n 
A 1 134 VAL 134 262 262 VAL VAL A . n 
A 1 135 LEU 135 263 263 LEU LEU A . n 
A 1 136 PHE 136 264 264 PHE PHE A . n 
A 1 137 GLU 137 265 265 GLU GLU A . n 
A 1 138 ASP 138 266 266 ASP ASP A . n 
A 1 139 THR 139 267 267 THR THR A . n 
A 1 140 SER 140 268 268 SER SER A . n 
A 1 141 TYR 141 269 269 TYR TYR A . n 
A 1 142 ALA 142 270 270 ALA ALA A . n 
A 1 143 ASP 143 271 271 ASP ASP A . n 
A 1 144 GLY 144 272 272 GLY GLY A . n 
A 1 145 TYR 145 273 273 TYR TYR A . n 
A 1 146 SER 146 274 274 SER SER A . n 
A 1 147 PRO 147 275 275 PRO PRO A . n 
A 1 148 PRO 148 276 276 PRO PRO A . n 
A 1 149 LEU 149 277 277 LEU LEU A . n 
A 1 150 ASN 150 278 278 ASN ASN A . n 
A 1 151 VAL 151 279 279 VAL VAL A . n 
A 1 152 ALA 152 280 280 ALA ALA A . n 
A 1 153 GLN 153 281 281 GLN GLN A . n 
A 1 154 ARG 154 282 282 ARG ARG A . n 
A 1 155 TYR 155 283 283 TYR TYR A . n 
A 1 156 VAL 156 284 284 VAL VAL A . n 
A 1 157 VAL 157 285 285 VAL VAL A . n 
A 1 158 ALA 158 286 286 ALA ALA A . n 
A 1 159 CYS 159 287 287 CYS CYS A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-04-28 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2011-08-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 REFMAC      5.5.0102 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
2 PDB_EXTRACT 3.100    'Jan. 22, 2010' package PDB                  help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
3 HKL-2000    .        ?               ?       ?                    ?                     'data reduction'  ? ?          ? 
4 HKL-2000    .        ?               ?       ?                    ?                     'data scaling'    ? ?          ? 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    GLU 
_pdbx_validate_symm_contact.auth_seq_id_1     198 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    NH2 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    ARG 
_pdbx_validate_symm_contact.auth_seq_id_2     209 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_455 
_pdbx_validate_symm_contact.dist              2.14 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CG 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLN 
_pdbx_validate_rmsd_bond.auth_seq_id_1             229 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLN 
_pdbx_validate_rmsd_bond.auth_seq_id_2             229 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.647 
_pdbx_validate_rmsd_bond.bond_target_value         1.506 
_pdbx_validate_rmsd_bond.bond_deviation            0.141 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.023 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 207 ? ? CZ A ARG 207 ? ? NH1 A ARG 207 ? ? 124.07 120.30 3.77  0.50 N 
2 1 NE A ARG 207 ? ? CZ A ARG 207 ? ? NH2 A ARG 207 ? ? 115.14 120.30 -5.16 0.50 N 
3 1 NE A ARG 209 ? ? CZ A ARG 209 ? ? NH2 A ARG 209 ? ? 116.02 120.30 -4.28 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 168 ? ? -105.01 -146.81 
2 1 GLU A 231 ? ? 76.87   -10.01  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASP 170 ? A ASP 42 
2 1 Y 1 A GLY 171 ? A GLY 43 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  1   1   HOH HOH A . 
B 2 HOH 2  2   2   HOH HOH A . 
B 2 HOH 3  3   3   HOH HOH A . 
B 2 HOH 4  4   4   HOH HOH A . 
B 2 HOH 5  5   5   HOH HOH A . 
B 2 HOH 6  6   6   HOH HOH A . 
B 2 HOH 7  7   7   HOH HOH A . 
B 2 HOH 8  8   8   HOH HOH A . 
B 2 HOH 9  9   9   HOH HOH A . 
B 2 HOH 10 10  10  HOH HOH A . 
B 2 HOH 11 11  11  HOH HOH A . 
B 2 HOH 12 12  12  HOH HOH A . 
B 2 HOH 13 13  13  HOH HOH A . 
B 2 HOH 14 14  14  HOH HOH A . 
B 2 HOH 15 15  15  HOH HOH A . 
B 2 HOH 16 16  16  HOH HOH A . 
B 2 HOH 17 17  17  HOH HOH A . 
B 2 HOH 18 18  18  HOH HOH A . 
B 2 HOH 19 19  19  HOH HOH A . 
B 2 HOH 20 20  20  HOH HOH A . 
B 2 HOH 21 21  21  HOH HOH A . 
B 2 HOH 22 22  22  HOH HOH A . 
B 2 HOH 23 24  24  HOH HOH A . 
B 2 HOH 24 25  25  HOH HOH A . 
B 2 HOH 25 26  26  HOH HOH A . 
B 2 HOH 26 27  27  HOH HOH A . 
B 2 HOH 27 28  28  HOH HOH A . 
B 2 HOH 28 29  29  HOH HOH A . 
B 2 HOH 29 30  30  HOH HOH A . 
B 2 HOH 30 31  31  HOH HOH A . 
B 2 HOH 31 32  32  HOH HOH A . 
B 2 HOH 32 33  33  HOH HOH A . 
B 2 HOH 33 34  34  HOH HOH A . 
B 2 HOH 34 35  35  HOH HOH A . 
B 2 HOH 35 36  36  HOH HOH A . 
B 2 HOH 36 37  37  HOH HOH A . 
B 2 HOH 37 38  38  HOH HOH A . 
B 2 HOH 38 39  39  HOH HOH A . 
B 2 HOH 39 40  40  HOH HOH A . 
B 2 HOH 40 41  41  HOH HOH A . 
B 2 HOH 41 42  42  HOH HOH A . 
B 2 HOH 42 43  43  HOH HOH A . 
B 2 HOH 43 44  44  HOH HOH A . 
B 2 HOH 44 45  45  HOH HOH A . 
B 2 HOH 45 46  46  HOH HOH A . 
B 2 HOH 46 48  48  HOH HOH A . 
B 2 HOH 47 49  49  HOH HOH A . 
B 2 HOH 48 50  50  HOH HOH A . 
B 2 HOH 49 51  51  HOH HOH A . 
B 2 HOH 50 52  52  HOH HOH A . 
B 2 HOH 51 53  53  HOH HOH A . 
B 2 HOH 52 54  54  HOH HOH A . 
B 2 HOH 53 55  55  HOH HOH A . 
B 2 HOH 54 56  56  HOH HOH A . 
B 2 HOH 55 57  57  HOH HOH A . 
B 2 HOH 56 58  58  HOH HOH A . 
B 2 HOH 57 59  59  HOH HOH A . 
B 2 HOH 58 60  60  HOH HOH A . 
B 2 HOH 59 61  61  HOH HOH A . 
B 2 HOH 60 62  62  HOH HOH A . 
B 2 HOH 61 63  63  HOH HOH A . 
B 2 HOH 62 65  65  HOH HOH A . 
B 2 HOH 63 67  67  HOH HOH A . 
B 2 HOH 64 68  68  HOH HOH A . 
B 2 HOH 65 69  69  HOH HOH A . 
B 2 HOH 66 72  72  HOH HOH A . 
B 2 HOH 67 73  73  HOH HOH A . 
B 2 HOH 68 75  75  HOH HOH A . 
B 2 HOH 69 76  76  HOH HOH A . 
B 2 HOH 70 78  78  HOH HOH A . 
B 2 HOH 71 79  79  HOH HOH A . 
B 2 HOH 72 81  81  HOH HOH A . 
B 2 HOH 73 82  82  HOH HOH A . 
B 2 HOH 74 83  83  HOH HOH A . 
B 2 HOH 75 85  85  HOH HOH A . 
B 2 HOH 76 86  86  HOH HOH A . 
B 2 HOH 77 87  87  HOH HOH A . 
B 2 HOH 78 88  88  HOH HOH A . 
B 2 HOH 79 90  90  HOH HOH A . 
B 2 HOH 80 126 126 HOH HOH A . 
B 2 HOH 81 127 127 HOH HOH A . 
B 2 HOH 82 128 128 HOH HOH A . 
B 2 HOH 83 288 129 HOH HOH A . 
B 2 HOH 84 289 130 HOH HOH A . 
#