data_3MGP
# 
_entry.id   3MGP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3MGP         
NDB   NA0501       
RCSB  RCSB058523   
WWPDB D_1000058523 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1KX5 . unspecified 
PDB 3MGQ . unspecified 
PDB 3MGR . unspecified 
PDB 3MGS . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3MGP 
_pdbx_database_status.recvd_initial_deposition_date   2010-04-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mohideen, K.' 1 
'Muhammad, R.' 2 
'Davey, C.A.'  3 
# 
_citation.id                        primary 
_citation.title                     'Perturbations in nucleosome structure from heavy metal association.' 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_volume            38 
_citation.page_first                6301 
_citation.page_last                 6311 
_citation.year                      2010 
_citation.journal_id_ASTM           NARHAD 
_citation.country                   UK 
_citation.journal_id_ISSN           0305-1048 
_citation.journal_id_CSD            0389 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20494975 
_citation.pdbx_database_id_DOI      10.1093/nar/gkq420 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Mohideen, K.' 1 ? 
primary 'Muhammad, R.' 2 ? 
primary 'Davey, C.A.'  3 ? 
# 
_cell.entry_id           3MGP 
_cell.length_a           106.502 
_cell.length_b           109.940 
_cell.length_c           183.352 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3MGP 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone H3.2'    15303.930 2  ? ? ?                    ? 
2 polymer     man 'Histone H4'      11263.231 2  ? ? ?                    ? 
3 polymer     man 'Histone H2A'     12941.095 2  ? ? 'UNP RESIDUES 2-120' ? 
4 polymer     man 'Histone H2B 1.1' 13848.097 2  ? ? ?                    ? 
5 polymer     syn 'DNA (147-MER)'   45368.051 1  ? ? ?                    ? 
6 polymer     syn 'DNA (147-MER)'   45359.035 1  ? ? ?                    ? 
7 non-polymer syn 'CHLORIDE ION'    35.453    4  ? ? ?                    ? 
8 non-polymer syn 'COBALT (II) ION' 58.933    43 ? ? ?                    ? 
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        H2B1.1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
;
C,G ? 
4 'polypeptide(L)'        no no 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DG)(DA)(DA)(DT)(DC)(DC)(DA)(DG)(DC)
(DT)(DG)(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)
(DG)(DC)(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)
(DT)(DG)(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)
(DT)(DA)(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGGAATCCAGC
TGAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DG)(DA)(DT)(DT)(DC)(DC)(DA)(DG)(DC)
(DT)(DG)(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)
(DG)(DC)(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)
(DT)(DG)(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)
(DT)(DA)(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGGATTCCAGC
TGAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
J   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   THR n 
1 4   LYS n 
1 5   GLN n 
1 6   THR n 
1 7   ALA n 
1 8   ARG n 
1 9   LYS n 
1 10  SER n 
1 11  THR n 
1 12  GLY n 
1 13  GLY n 
1 14  LYS n 
1 15  ALA n 
1 16  PRO n 
1 17  ARG n 
1 18  LYS n 
1 19  GLN n 
1 20  LEU n 
1 21  ALA n 
1 22  THR n 
1 23  LYS n 
1 24  ALA n 
1 25  ALA n 
1 26  ARG n 
1 27  LYS n 
1 28  SER n 
1 29  ALA n 
1 30  PRO n 
1 31  ALA n 
1 32  THR n 
1 33  GLY n 
1 34  GLY n 
1 35  VAL n 
1 36  LYS n 
1 37  LYS n 
1 38  PRO n 
1 39  HIS n 
1 40  ARG n 
1 41  TYR n 
1 42  ARG n 
1 43  PRO n 
1 44  GLY n 
1 45  THR n 
1 46  VAL n 
1 47  ALA n 
1 48  LEU n 
1 49  ARG n 
1 50  GLU n 
1 51  ILE n 
1 52  ARG n 
1 53  ARG n 
1 54  TYR n 
1 55  GLN n 
1 56  LYS n 
1 57  SER n 
1 58  THR n 
1 59  GLU n 
1 60  LEU n 
1 61  LEU n 
1 62  ILE n 
1 63  ARG n 
1 64  LYS n 
1 65  LEU n 
1 66  PRO n 
1 67  PHE n 
1 68  GLN n 
1 69  ARG n 
1 70  LEU n 
1 71  VAL n 
1 72  ARG n 
1 73  GLU n 
1 74  ILE n 
1 75  ALA n 
1 76  GLN n 
1 77  ASP n 
1 78  PHE n 
1 79  LYS n 
1 80  THR n 
1 81  ASP n 
1 82  LEU n 
1 83  ARG n 
1 84  PHE n 
1 85  GLN n 
1 86  SER n 
1 87  SER n 
1 88  ALA n 
1 89  VAL n 
1 90  MET n 
1 91  ALA n 
1 92  LEU n 
1 93  GLN n 
1 94  GLU n 
1 95  ALA n 
1 96  SER n 
1 97  GLU n 
1 98  ALA n 
1 99  TYR n 
1 100 LEU n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 PHE n 
1 105 GLU n 
1 106 ASP n 
1 107 THR n 
1 108 ASN n 
1 109 LEU n 
1 110 CYS n 
1 111 ALA n 
1 112 ILE n 
1 113 HIS n 
1 114 ALA n 
1 115 LYS n 
1 116 ARG n 
1 117 VAL n 
1 118 THR n 
1 119 ILE n 
1 120 MET n 
1 121 PRO n 
1 122 LYS n 
1 123 ASP n 
1 124 ILE n 
1 125 GLN n 
1 126 LEU n 
1 127 ALA n 
1 128 ARG n 
1 129 ARG n 
1 130 ILE n 
1 131 ARG n 
1 132 GLY n 
1 133 GLU n 
1 134 ARG n 
1 135 ALA n 
2 1   SER n 
2 2   GLY n 
2 3   ARG n 
2 4   GLY n 
2 5   LYS n 
2 6   GLY n 
2 7   GLY n 
2 8   LYS n 
2 9   GLY n 
2 10  LEU n 
2 11  GLY n 
2 12  LYS n 
2 13  GLY n 
2 14  GLY n 
2 15  ALA n 
2 16  LYS n 
2 17  ARG n 
2 18  HIS n 
2 19  ARG n 
2 20  LYS n 
2 21  VAL n 
2 22  LEU n 
2 23  ARG n 
2 24  ASP n 
2 25  ASN n 
2 26  ILE n 
2 27  GLN n 
2 28  GLY n 
2 29  ILE n 
2 30  THR n 
2 31  LYS n 
2 32  PRO n 
2 33  ALA n 
2 34  ILE n 
2 35  ARG n 
2 36  ARG n 
2 37  LEU n 
2 38  ALA n 
2 39  ARG n 
2 40  ARG n 
2 41  GLY n 
2 42  GLY n 
2 43  VAL n 
2 44  LYS n 
2 45  ARG n 
2 46  ILE n 
2 47  SER n 
2 48  GLY n 
2 49  LEU n 
2 50  ILE n 
2 51  TYR n 
2 52  GLU n 
2 53  GLU n 
2 54  THR n 
2 55  ARG n 
2 56  GLY n 
2 57  VAL n 
2 58  LEU n 
2 59  LYS n 
2 60  VAL n 
2 61  PHE n 
2 62  LEU n 
2 63  GLU n 
2 64  ASN n 
2 65  VAL n 
2 66  ILE n 
2 67  ARG n 
2 68  ASP n 
2 69  ALA n 
2 70  VAL n 
2 71  THR n 
2 72  TYR n 
2 73  THR n 
2 74  GLU n 
2 75  HIS n 
2 76  ALA n 
2 77  LYS n 
2 78  ARG n 
2 79  LYS n 
2 80  THR n 
2 81  VAL n 
2 82  THR n 
2 83  ALA n 
2 84  MET n 
2 85  ASP n 
2 86  VAL n 
2 87  VAL n 
2 88  TYR n 
2 89  ALA n 
2 90  LEU n 
2 91  LYS n 
2 92  ARG n 
2 93  GLN n 
2 94  GLY n 
2 95  ARG n 
2 96  THR n 
2 97  LEU n 
2 98  TYR n 
2 99  GLY n 
2 100 PHE n 
2 101 GLY n 
2 102 GLY n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLN n 
3 7   GLY n 
3 8   GLY n 
3 9   LYS n 
3 10  THR n 
3 11  ARG n 
3 12  ALA n 
3 13  LYS n 
3 14  ALA n 
3 15  LYS n 
3 16  THR n 
3 17  ARG n 
3 18  SER n 
3 19  SER n 
3 20  ARG n 
3 21  ALA n 
3 22  GLY n 
3 23  LEU n 
3 24  GLN n 
3 25  PHE n 
3 26  PRO n 
3 27  VAL n 
3 28  GLY n 
3 29  ARG n 
3 30  VAL n 
3 31  HIS n 
3 32  ARG n 
3 33  LEU n 
3 34  LEU n 
3 35  ARG n 
3 36  LYS n 
3 37  GLY n 
3 38  ASN n 
3 39  TYR n 
3 40  ALA n 
3 41  GLU n 
3 42  ARG n 
3 43  VAL n 
3 44  GLY n 
3 45  ALA n 
3 46  GLY n 
3 47  ALA n 
3 48  PRO n 
3 49  VAL n 
3 50  TYR n 
3 51  LEU n 
3 52  ALA n 
3 53  ALA n 
3 54  VAL n 
3 55  LEU n 
3 56  GLU n 
3 57  TYR n 
3 58  LEU n 
3 59  THR n 
3 60  ALA n 
3 61  GLU n 
3 62  ILE n 
3 63  LEU n 
3 64  GLU n 
3 65  LEU n 
3 66  ALA n 
3 67  GLY n 
3 68  ASN n 
3 69  ALA n 
3 70  ALA n 
3 71  ARG n 
3 72  ASP n 
3 73  ASN n 
3 74  LYS n 
3 75  LYS n 
3 76  THR n 
3 77  ARG n 
3 78  ILE n 
3 79  ILE n 
3 80  PRO n 
3 81  ARG n 
3 82  HIS n 
3 83  LEU n 
3 84  GLN n 
3 85  LEU n 
3 86  ALA n 
3 87  VAL n 
3 88  ARG n 
3 89  ASN n 
3 90  ASP n 
3 91  GLU n 
3 92  GLU n 
3 93  LEU n 
3 94  ASN n 
3 95  LYS n 
3 96  LEU n 
3 97  LEU n 
3 98  GLY n 
3 99  ARG n 
3 100 VAL n 
3 101 THR n 
3 102 ILE n 
3 103 ALA n 
3 104 GLN n 
3 105 GLY n 
3 106 GLY n 
3 107 VAL n 
3 108 LEU n 
3 109 PRO n 
3 110 ASN n 
3 111 ILE n 
3 112 GLN n 
3 113 SER n 
3 114 VAL n 
3 115 LEU n 
3 116 LEU n 
3 117 PRO n 
3 118 LYS n 
3 119 LYS n 
4 1   PRO n 
4 2   GLU n 
4 3   PRO n 
4 4   ALA n 
4 5   LYS n 
4 6   SER n 
4 7   ALA n 
4 8   PRO n 
4 9   ALA n 
4 10  PRO n 
4 11  LYS n 
4 12  LYS n 
4 13  GLY n 
4 14  SER n 
4 15  LYS n 
4 16  LYS n 
4 17  ALA n 
4 18  VAL n 
4 19  THR n 
4 20  LYS n 
4 21  THR n 
4 22  GLN n 
4 23  LYS n 
4 24  LYS n 
4 25  ASP n 
4 26  GLY n 
4 27  LYS n 
4 28  LYS n 
4 29  ARG n 
4 30  ARG n 
4 31  LYS n 
4 32  THR n 
4 33  ARG n 
4 34  LYS n 
4 35  GLU n 
4 36  SER n 
4 37  TYR n 
4 38  ALA n 
4 39  ILE n 
4 40  TYR n 
4 41  VAL n 
4 42  TYR n 
4 43  LYS n 
4 44  VAL n 
4 45  LEU n 
4 46  LYS n 
4 47  GLN n 
4 48  VAL n 
4 49  HIS n 
4 50  PRO n 
4 51  ASP n 
4 52  THR n 
4 53  GLY n 
4 54  ILE n 
4 55  SER n 
4 56  SER n 
4 57  LYS n 
4 58  ALA n 
4 59  MET n 
4 60  SER n 
4 61  ILE n 
4 62  MET n 
4 63  ASN n 
4 64  SER n 
4 65  PHE n 
4 66  VAL n 
4 67  ASN n 
4 68  ASP n 
4 69  VAL n 
4 70  PHE n 
4 71  GLU n 
4 72  ARG n 
4 73  ILE n 
4 74  ALA n 
4 75  GLY n 
4 76  GLU n 
4 77  ALA n 
4 78  SER n 
4 79  ARG n 
4 80  LEU n 
4 81  ALA n 
4 82  HIS n 
4 83  TYR n 
4 84  ASN n 
4 85  LYS n 
4 86  ARG n 
4 87  SER n 
4 88  THR n 
4 89  ILE n 
4 90  THR n 
4 91  SER n 
4 92  ARG n 
4 93  GLU n 
4 94  ILE n 
4 95  GLN n 
4 96  THR n 
4 97  ALA n 
4 98  VAL n 
4 99  ARG n 
4 100 LEU n 
4 101 LEU n 
4 102 LEU n 
4 103 PRO n 
4 104 GLY n 
4 105 GLU n 
4 106 LEU n 
4 107 ALA n 
4 108 LYS n 
4 109 HIS n 
4 110 ALA n 
4 111 VAL n 
4 112 SER n 
4 113 GLU n 
4 114 GLY n 
4 115 THR n 
4 116 LYS n 
4 117 ALA n 
4 118 VAL n 
4 119 THR n 
4 120 LYS n 
4 121 TYR n 
4 122 THR n 
4 123 SER n 
4 124 ALA n 
4 125 LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DA  n 
5 5   DA  n 
5 6   DT  n 
5 7   DA  n 
5 8   DT  n 
5 9   DC  n 
5 10  DC  n 
5 11  DA  n 
5 12  DC  n 
5 13  DC  n 
5 14  DT  n 
5 15  DG  n 
5 16  DC  n 
5 17  DA  n 
5 18  DG  n 
5 19  DA  n 
5 20  DT  n 
5 21  DA  n 
5 22  DC  n 
5 23  DT  n 
5 24  DA  n 
5 25  DC  n 
5 26  DC  n 
5 27  DA  n 
5 28  DA  n 
5 29  DA  n 
5 30  DA  n 
5 31  DG  n 
5 32  DT  n 
5 33  DG  n 
5 34  DT  n 
5 35  DA  n 
5 36  DT  n 
5 37  DT  n 
5 38  DT  n 
5 39  DG  n 
5 40  DG  n 
5 41  DA  n 
5 42  DA  n 
5 43  DA  n 
5 44  DC  n 
5 45  DT  n 
5 46  DG  n 
5 47  DC  n 
5 48  DT  n 
5 49  DC  n 
5 50  DC  n 
5 51  DA  n 
5 52  DT  n 
5 53  DC  n 
5 54  DA  n 
5 55  DA  n 
5 56  DA  n 
5 57  DA  n 
5 58  DG  n 
5 59  DG  n 
5 60  DC  n 
5 61  DA  n 
5 62  DT  n 
5 63  DG  n 
5 64  DT  n 
5 65  DT  n 
5 66  DC  n 
5 67  DA  n 
5 68  DG  n 
5 69  DC  n 
5 70  DT  n 
5 71  DG  n 
5 72  DG  n 
5 73  DA  n 
5 74  DA  n 
5 75  DT  n 
5 76  DC  n 
5 77  DC  n 
5 78  DA  n 
5 79  DG  n 
5 80  DC  n 
5 81  DT  n 
5 82  DG  n 
5 83  DA  n 
5 84  DA  n 
5 85  DC  n 
5 86  DA  n 
5 87  DT  n 
5 88  DG  n 
5 89  DC  n 
5 90  DC  n 
5 91  DT  n 
5 92  DT  n 
5 93  DT  n 
5 94  DT  n 
5 95  DG  n 
5 96  DA  n 
5 97  DT  n 
5 98  DG  n 
5 99  DG  n 
5 100 DA  n 
5 101 DG  n 
5 102 DC  n 
5 103 DA  n 
5 104 DG  n 
5 105 DT  n 
5 106 DT  n 
5 107 DT  n 
5 108 DC  n 
5 109 DC  n 
5 110 DA  n 
5 111 DA  n 
5 112 DA  n 
5 113 DT  n 
5 114 DA  n 
5 115 DC  n 
5 116 DA  n 
5 117 DC  n 
5 118 DT  n 
5 119 DT  n 
5 120 DT  n 
5 121 DT  n 
5 122 DG  n 
5 123 DG  n 
5 124 DT  n 
5 125 DA  n 
5 126 DG  n 
5 127 DT  n 
5 128 DA  n 
5 129 DT  n 
5 130 DC  n 
5 131 DT  n 
5 132 DG  n 
5 133 DC  n 
5 134 DA  n 
5 135 DG  n 
5 136 DG  n 
5 137 DT  n 
5 138 DG  n 
5 139 DG  n 
5 140 DA  n 
5 141 DT  n 
5 142 DA  n 
5 143 DT  n 
5 144 DT  n 
5 145 DG  n 
5 146 DA  n 
5 147 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DA  n 
6 5   DA  n 
6 6   DT  n 
6 7   DA  n 
6 8   DT  n 
6 9   DC  n 
6 10  DC  n 
6 11  DA  n 
6 12  DC  n 
6 13  DC  n 
6 14  DT  n 
6 15  DG  n 
6 16  DC  n 
6 17  DA  n 
6 18  DG  n 
6 19  DA  n 
6 20  DT  n 
6 21  DA  n 
6 22  DC  n 
6 23  DT  n 
6 24  DA  n 
6 25  DC  n 
6 26  DC  n 
6 27  DA  n 
6 28  DA  n 
6 29  DA  n 
6 30  DA  n 
6 31  DG  n 
6 32  DT  n 
6 33  DG  n 
6 34  DT  n 
6 35  DA  n 
6 36  DT  n 
6 37  DT  n 
6 38  DT  n 
6 39  DG  n 
6 40  DG  n 
6 41  DA  n 
6 42  DA  n 
6 43  DA  n 
6 44  DC  n 
6 45  DT  n 
6 46  DG  n 
6 47  DC  n 
6 48  DT  n 
6 49  DC  n 
6 50  DC  n 
6 51  DA  n 
6 52  DT  n 
6 53  DC  n 
6 54  DA  n 
6 55  DA  n 
6 56  DA  n 
6 57  DA  n 
6 58  DG  n 
6 59  DG  n 
6 60  DC  n 
6 61  DA  n 
6 62  DT  n 
6 63  DG  n 
6 64  DT  n 
6 65  DT  n 
6 66  DC  n 
6 67  DA  n 
6 68  DG  n 
6 69  DC  n 
6 70  DT  n 
6 71  DG  n 
6 72  DG  n 
6 73  DA  n 
6 74  DT  n 
6 75  DT  n 
6 76  DC  n 
6 77  DC  n 
6 78  DA  n 
6 79  DG  n 
6 80  DC  n 
6 81  DT  n 
6 82  DG  n 
6 83  DA  n 
6 84  DA  n 
6 85  DC  n 
6 86  DA  n 
6 87  DT  n 
6 88  DG  n 
6 89  DC  n 
6 90  DC  n 
6 91  DT  n 
6 92  DT  n 
6 93  DT  n 
6 94  DT  n 
6 95  DG  n 
6 96  DA  n 
6 97  DT  n 
6 98  DG  n 
6 99  DG  n 
6 100 DA  n 
6 101 DG  n 
6 102 DC  n 
6 103 DA  n 
6 104 DG  n 
6 105 DT  n 
6 106 DT  n 
6 107 DT  n 
6 108 DC  n 
6 109 DC  n 
6 110 DA  n 
6 111 DA  n 
6 112 DA  n 
6 113 DT  n 
6 114 DA  n 
6 115 DC  n 
6 116 DA  n 
6 117 DC  n 
6 118 DT  n 
6 119 DT  n 
6 120 DT  n 
6 121 DT  n 
6 122 DG  n 
6 123 DG  n 
6 124 DT  n 
6 125 DA  n 
6 126 DG  n 
6 127 DT  n 
6 128 DA  n 
6 129 DT  n 
6 130 DC  n 
6 131 DT  n 
6 132 DG  n 
6 133 DC  n 
6 134 DA  n 
6 135 DG  n 
6 136 DG  n 
6 137 DT  n 
6 138 DG  n 
6 139 DG  n 
6 140 DA  n 
6 141 DT  n 
6 142 DA  n 
6 143 DT  n 
6 144 DT  n 
6 145 DG  n 
6 146 DA  n 
6 147 DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'African clawed frog' ? 'Histone 3 or H3'              ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 'BL21 DE3' ? ? ? ? ? ? ? Plasmid ? ? ? pET3D ? ? 
2 1 sample ? ? ? 'African clawed frog' ? 'Histone 4 or H4'              ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 'BL21 DE3' ? ? ? ? ? ? ? Plasmid ? ? ? pET3A ? ? 
3 1 sample ? ? ? 'African clawed frog' ? 'Histone 2A or H2A, LOC494591' ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 'BL21 DE3' ? ? ? ? ? ? ? Plasmid ? ? ? pET3A ? ? 
4 1 sample ? ? ? 'African clawed frog' ? 'Histone 2B or H2B'            ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 'BL21 DE3' ? ? ? ? ? ? ? plasmid ? ? ? pET3A ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
5 1 sample ? ? ? ? ? 'Synthetic Palindromic DNA expressed in pUC18 plasmid using E.coli HB101 cells.' 
6 1 sample ? ? ? ? ? 'Synthetic Palindromic DNA expressed in pUC18 plasmid using E.coli HB101 cells.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP H32_XENLA    P84233 1 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2 ? 
2 UNP H4_XENLA     P62799 2 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2 ? 
3 UNP Q6AZJ8_XENLA Q6AZJ8 3 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
;
2 ? 
4 UNP H2B11_XENLA  P02281 4 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
2 ? 
5 PDB 3MGP         3MGP   5 ? ? ? 
6 PDB 3MGP         3MGP   6 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3MGP A 1 ? 135 ? P84233 2   ? 136 ? 1   135 
2  2 3MGP B 1 ? 102 ? P62799 2   ? 103 ? 1   102 
3  3 3MGP C 1 ? 119 ? Q6AZJ8 2   ? 120 ? 1   119 
4  4 3MGP D 1 ? 125 ? P02281 2   ? 126 ? -2  122 
5  1 3MGP E 1 ? 135 ? P84233 2   ? 136 ? 1   135 
6  2 3MGP F 1 ? 102 ? P62799 2   ? 103 ? 1   102 
7  3 3MGP G 1 ? 119 ? Q6AZJ8 2   ? 120 ? 1   119 
8  4 3MGP H 1 ? 125 ? P02281 2   ? 126 ? -2  122 
9  5 3MGP I 1 ? 147 ? 3MGP   -73 ? 73  ? -73 73  
10 6 3MGP J 1 ? 147 ? 3MGP   -73 ? 73  ? -73 73  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3MGP ALA A 102 ? UNP P84233 GLY 103 'SEE REMARK 999' 102 1 
4 3MGP THR D 32  ? UNP P02281 SER 33  'SEE REMARK 999' 29  2 
5 3MGP ALA E 102 ? UNP P84233 GLY 103 'SEE REMARK 999' 102 3 
8 3MGP THR H 32  ? UNP P02281 SER 33  'SEE REMARK 999' 29  4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CL  non-polymer         . 'CHLORIDE ION'                       ? 'Cl -1'           35.453  
CO  non-polymer         . 'COBALT (II) ION'                    ? 'Co 2'            58.933  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3MGP 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.72 
_exptl_crystal.density_percent_sol   54.75 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    '85mM MnCl2, 60mM KCl, 40mM K-cacodylate, pH 6.0, VAPOR DIFFUSION, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'PSI PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2009-06-22 
_diffrn_detector.details                'Dynamically bendable mirror' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    
;LN2 cooled fixed-exit  
Si(111) monochromator
;
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.6 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.6 
# 
_reflns.entry_id                     3MGP 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             94.49 
_reflns.d_resolution_high            2.44 
_reflns.number_obs                   72231 
_reflns.number_all                   73764 
_reflns.percent_possible_obs         91.6 
_reflns.pdbx_Rmerge_I_obs            0.063 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.0 
_reflns.B_iso_Wilson_estimate        64.0 
_reflns.pdbx_redundancy              4.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.44 
_reflns_shell.d_res_low              2.57 
_reflns_shell.percent_possible_all   59.5 
_reflns_shell.Rmerge_I_obs           0.442 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.0 
_reflns_shell.pdbx_redundancy        2.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      6843 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3MGP 
_refine.ls_number_reflns_obs                     72231 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             52.6 
_refine.ls_d_res_high                            2.44 
_refine.ls_percent_reflns_obs                    91.30 
_refine.ls_R_factor_obs                          0.24022 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.23935 
_refine.ls_R_factor_R_free                       0.28245 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1466 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.940 
_refine.correlation_coeff_Fo_to_Fc_free          0.895 
_refine.B_iso_mean                               83.713 
_refine.aniso_B[1][1]                            1.44 
_refine.aniso_B[2][2]                            -3.08 
_refine.aniso_B[3][3]                            1.64 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1KX5 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.439 
_refine.pdbx_overall_ESU_R_Free                  0.294 
_refine.overall_SU_ML                            0.238 
_refine.overall_SU_B                             10.238 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6160 
_refine_hist.pdbx_number_atoms_nucleic_acid   6021 
_refine_hist.pdbx_number_atoms_ligand         47 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               12228 
_refine_hist.d_res_high                       2.44 
_refine_hist.d_res_low                        52.6 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.010  0.021  ? 12995 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.433  2.545  ? 18802 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.909  5.000  ? 765   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   33.484 21.131 ? 274   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   17.763 15.000 ? 1209  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   20.863 15.000 ? 89    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.074  0.200  ? 2134  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.004  0.020  ? 7660  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.195  0.200  ? 4665  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.302  0.200  ? 7973  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.145  0.200  ? 327   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.184  0.200  ? 22    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.099  0.200  ? 2     'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.777  1.500  ? 3944  'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.375  2.000  ? 6175  'X-RAY DIFFRACTION' ? 
r_scbond_it              1.195  3.000  ? 12249 'X-RAY DIFFRACTION' ? 
r_scangle_it             2.127  4.500  ? 12627 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.440 
_refine_ls_shell.d_res_low                        2.57 
_refine_ls_shell.number_reflns_R_work             2899 
_refine_ls_shell.R_factor_R_work                  0.308 
_refine_ls_shell.percent_reflns_obs               50.60 
_refine_ls_shell.R_factor_R_free                  0.375 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             75 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3MGP 
_struct.title                     'Binding of Cobalt ions to the Nucleosome Core Particle' 
_struct.pdbx_descriptor           'Histone H3.2, Histone H4, Histone H2A, Histone H2B 1.1/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3MGP 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
_struct_keywords.text            'PROTEIN-DNA COMPLEX, STRUCTURAL PROTEIN-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 3 ? 
D  N N 4 ? 
E  N N 1 ? 
F  N N 2 ? 
G  N N 3 ? 
H  N N 4 ? 
I  N N 5 ? 
J  N N 6 ? 
K  N N 7 ? 
L  N N 8 ? 
M  N N 8 ? 
N  N N 8 ? 
O  N N 7 ? 
P  N N 8 ? 
Q  N N 7 ? 
R  N N 7 ? 
S  N N 8 ? 
T  N N 8 ? 
U  N N 8 ? 
V  N N 8 ? 
W  N N 8 ? 
X  N N 8 ? 
Y  N N 8 ? 
Z  N N 8 ? 
AA N N 8 ? 
BA N N 8 ? 
CA N N 8 ? 
DA N N 8 ? 
EA N N 8 ? 
FA N N 8 ? 
GA N N 8 ? 
HA N N 8 ? 
IA N N 8 ? 
JA N N 8 ? 
KA N N 8 ? 
LA N N 8 ? 
MA N N 8 ? 
NA N N 8 ? 
OA N N 8 ? 
PA N N 8 ? 
QA N N 8 ? 
RA N N 8 ? 
SA N N 8 ? 
TA N N 8 ? 
UA N N 8 ? 
VA N N 8 ? 
WA N N 8 ? 
XA N N 8 ? 
YA N N 8 ? 
ZA N N 8 ? 
AB N N 8 ? 
BB N N 8 ? 
CB N N 8 ? 
DB N N 8 ? 
EB N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 44  ? SER A 57  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  2  ARG A 63  ? ASP A 77  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  3  GLN A 85  ? ALA A 114 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  4  MET A 120 ? ARG A 131 ? MET A 120 ARG A 131 1 ? 12 
HELX_P HELX_P5  5  ASN B 25  ? ILE B 29  ? ASN B 25  ILE B 29  5 ? 5  
HELX_P HELX_P6  6  THR B 30  ? GLY B 41  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  7  LEU B 49  ? LYS B 77  ? LEU B 49  LYS B 77  1 ? 29 
HELX_P HELX_P8  8  THR B 82  ? GLN B 93  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  9  PRO C 26  ? GLY C 37  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P10 10 GLY C 46  ? ASN C 73  ? GLY C 46  ASN C 73  1 ? 28 
HELX_P HELX_P11 11 ILE C 79  ? ASP C 90  ? ILE C 79  ASP C 90  1 ? 12 
HELX_P HELX_P12 12 ASP C 90  ? LEU C 97  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P13 13 GLN C 112 ? LEU C 116 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P14 14 TYR D 37  ? HIS D 49  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P15 15 SER D 55  ? ASN D 84  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P16 16 THR D 90  ? LEU D 102 ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P17 17 PRO D 103 ? SER D 123 ? PRO D 100 SER D 120 1 ? 21 
HELX_P HELX_P18 18 GLY E 44  ? SER E 57  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P19 19 ARG E 63  ? ASP E 77  ? ARG E 63  ASP E 77  1 ? 15 
HELX_P HELX_P20 20 GLN E 85  ? ALA E 114 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P21 21 MET E 120 ? ARG E 131 ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P22 22 ASP F 24  ? GLY F 28  ? ASP F 24  GLY F 28  5 ? 5  
HELX_P HELX_P23 23 THR F 30  ? GLY F 41  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P24 24 LEU F 49  ? ALA F 76  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P25 25 THR F 82  ? GLN F 93  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P26 26 THR G 16  ? GLY G 22  ? THR G 16  GLY G 22  1 ? 7  
HELX_P HELX_P27 27 PRO G 26  ? GLY G 37  ? PRO G 26  GLY G 37  1 ? 12 
HELX_P HELX_P28 28 GLY G 46  ? ASN G 73  ? GLY G 46  ASN G 73  1 ? 28 
HELX_P HELX_P29 29 ILE G 79  ? ASN G 89  ? ILE G 79  ASN G 89  1 ? 11 
HELX_P HELX_P30 30 ASP G 90  ? LEU G 97  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P31 31 GLN G 112 ? LEU G 116 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P32 32 TYR H 37  ? HIS H 49  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P33 33 SER H 55  ? ASN H 84  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P34 34 THR H 90  ? LEU H 102 ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P35 35 PRO H 103 ? SER H 123 ? PRO H 100 SER H 120 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? C ASP 90  OD1 ? ? ? 1_555 L  CO .   CO ? ? C ASP 90  C CO 120 1_555 ? ? ? ? ? ? ?               2.315 ? 
metalc2   metalc ? ? D HIS 82  NE2 ? ? ? 1_555 N  CO .   CO ? ? D HIS 79  D CO 124 1_555 ? ? ? ? ? ? ?               2.425 ? 
metalc3   metalc ? ? D GLU 105 OE2 ? ? ? 1_555 M  CO .   CO ? ? D GLU 102 D CO 123 1_555 ? ? ? ? ? ? ?               2.344 ? 
metalc4   metalc ? ? D HIS 109 NE2 ? ? ? 1_555 M  CO .   CO ? ? D HIS 106 D CO 123 1_555 ? ? ? ? ? ? ?               2.493 ? 
metalc5   metalc ? ? E ASP 77  OD1 ? ? ? 1_555 P  CO .   CO ? ? E ASP 77  E CO 136 1_555 ? ? ? ? ? ? ?               2.199 ? 
metalc6   metalc ? ? H HIS 82  NE2 ? ? ? 1_555 S  CO .   CO ? ? H HIS 79  H CO 123 1_555 ? ? ? ? ? ? ?               2.710 ? 
metalc7   metalc ? ? H HIS 109 NE2 ? ? ? 1_555 T  CO .   CO ? ? H HIS 106 H CO 124 1_555 ? ? ? ? ? ? ?               1.893 ? 
metalc8   metalc ? ? I DG  18  N7  ? ? ? 1_555 AA CO .   CO ? ? I DG  -56 I CO 80  1_555 ? ? ? ? ? ? ?               1.926 ? 
metalc9   metalc ? ? I DG  39  N7  ? ? ? 1_555 Y  CO .   CO ? ? I DG  -35 I CO 78  1_555 ? ? ? ? ? ? ?               1.960 ? 
metalc10  metalc ? ? I DG  40  O6  ? ? ? 1_555 Y  CO .   CO ? ? I DG  -34 I CO 78  1_555 ? ? ? ? ? ? ?               2.632 ? 
metalc11  metalc ? ? I DG  68  N7  ? ? ? 1_555 KA CO .   CO ? ? I DG  -6  I CO 94  1_555 ? ? ? ? ? ? ?               2.423 ? 
metalc12  metalc ? ? I DG  71  N7  ? ? ? 1_555 X  CO .   CO ? ? I DG  -3  I CO 77  1_555 ? ? ? ? ? ? ?               2.260 ? 
metalc13  metalc ? ? I DG  98  N7  ? ? ? 1_555 BA CO .   CO ? ? I DG  24  I CO 81  1_555 ? ? ? ? ? ? ?               2.464 ? 
metalc14  metalc ? ? I DG  99  O6  ? ? ? 1_555 BA CO .   CO ? ? I DG  25  I CO 81  1_555 ? ? ? ? ? ? ?               2.414 ? 
metalc15  metalc ? ? I DG  101 N7  ? ? ? 1_555 W  CO .   CO ? ? I DG  27  I CO 76  1_555 ? ? ? ? ? ? ?               2.110 ? 
metalc16  metalc ? ? I DA  103 N7  ? ? ? 1_555 FA CO .   CO ? ? I DA  29  I CO 85  1_555 ? ? ? ? ? ? ?               2.624 ? 
metalc17  metalc ? ? I DG  122 N7  ? ? ? 1_555 V  CO .   CO ? ? I DG  48  I CO 75  1_555 ? ? ? ? ? ? ?               1.900 ? 
metalc18  metalc ? ? I DG  135 N7  ? ? ? 1_555 U  CO .   CO ? ? I DG  61  I CO 74  1_555 ? ? ? ? ? ? ?               2.465 ? 
metalc19  metalc ? ? I DG  138 N7  ? ? ? 1_555 GA CO .   CO ? ? I DG  64  I CO 86  1_555 ? ? ? ? ? ? ?               2.785 ? 
metalc20  metalc ? ? I DG  139 N7  ? ? ? 1_555 CA CO .   CO ? ? I DG  65  I CO 82  1_555 ? ? ? ? ? ? ?               2.564 ? 
metalc21  metalc ? ? J DG  18  N7  ? ? ? 1_555 SA CO .   CO ? ? J DG  -56 J CO 81  1_555 ? ? ? ? ? ? ?               2.626 ? 
metalc22  metalc ? ? J DG  39  N7  ? ? ? 1_555 QA CO .   CO ? ? J DG  -35 J CO 79  1_555 ? ? ? ? ? ? ?               2.487 ? 
metalc23  metalc ? ? J DG  40  O6  ? ? ? 1_555 QA CO .   CO ? ? J DG  -34 J CO 79  1_555 ? ? ? ? ? ? ?               1.995 ? 
metalc24  metalc ? ? J DG  68  N7  ? ? ? 1_555 PA CO .   CO ? ? J DG  -6  J CO 78  1_555 ? ? ? ? ? ? ?               2.336 ? 
metalc25  metalc ? ? J DG  71  N7  ? ? ? 1_555 OA CO .   CO ? ? J DG  -3  J CO 77  1_555 ? ? ? ? ? ? ?               2.724 ? 
metalc26  metalc ? ? J DG  79  N7  ? ? ? 1_555 UA CO .   CO ? ? J DG  5   J CO 83  1_555 ? ? ? ? ? ? ?               2.433 ? 
metalc27  metalc ? ? J DG  98  N7  ? ? ? 1_555 EB CO .   CO ? ? J DG  24  J CO 102 1_555 ? ? ? ? ? ? ?               2.195 ? 
metalc28  metalc ? ? J DG  99  N7  ? ? ? 1_555 BB CO .   CO ? ? J DG  25  J CO 90  1_555 ? ? ? ? ? ? ?               2.776 ? 
metalc29  metalc ? ? J DG  101 N7  ? ? ? 1_555 LA CO .   CO ? ? J DG  27  J CO 74  1_555 ? ? ? ? ? ? ?               2.024 ? 
metalc30  metalc ? ? J DA  103 N7  ? ? ? 1_555 RA CO .   CO ? ? J DA  29  J CO 80  1_555 ? ? ? ? ? ? ?               2.736 ? 
metalc31  metalc ? ? J DG  122 N7  ? ? ? 1_555 NA CO .   CO ? ? J DG  48  J CO 76  1_555 ? ? ? ? ? ? ?               2.213 ? 
metalc32  metalc ? ? J DG  135 N7  ? ? ? 1_555 MA CO .   CO ? ? J DG  61  J CO 75  1_555 ? ? ? ? ? ? ?               2.347 ? 
metalc33  metalc ? ? J DG  145 N7  ? ? ? 1_555 VA CO .   CO ? ? J DG  71  J CO 84  1_555 ? ? ? ? ? ? ?               2.208 ? 
metalc34  metalc ? ? D VAL 48  O   ? ? ? 1_555 P  CO .   CO ? ? D VAL 45  E CO 136 3_555 ? ? ? ? ? ? ?               2.371 ? 
hydrog1   hydrog ? ? I DA  1   N1  ? ? ? 1_555 J  DT 147 N3 ? ? I DA  -73 J DT 73  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog2   hydrog ? ? I DT  2   N3  ? ? ? 1_555 J  DA 146 N1 ? ? I DT  -72 J DA 72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? I DT  2   O4  ? ? ? 1_555 J  DA 146 N6 ? ? I DT  -72 J DA 72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? I DC  3   N3  ? ? ? 1_555 J  DG 145 N1 ? ? I DC  -71 J DG 71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? I DC  3   N4  ? ? ? 1_555 J  DG 145 O6 ? ? I DC  -71 J DG 71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? I DC  3   O2  ? ? ? 1_555 J  DG 145 N2 ? ? I DC  -71 J DG 71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? I DA  4   N1  ? ? ? 1_555 J  DT 144 N3 ? ? I DA  -70 J DT 70  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog8   hydrog ? ? I DA  5   N1  ? ? ? 1_555 J  DT 143 N3 ? ? I DA  -69 J DT 69  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog9   hydrog ? ? I DT  6   N3  ? ? ? 1_555 J  DA 142 N1 ? ? I DT  -68 J DA 68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? I DT  6   O4  ? ? ? 1_555 J  DA 142 N6 ? ? I DT  -68 J DA 68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? I DA  7   N1  ? ? ? 1_555 J  DT 141 N3 ? ? I DA  -67 J DT 67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? I DA  7   N6  ? ? ? 1_555 J  DT 141 O4 ? ? I DA  -67 J DT 67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? I DC  9   O2  ? ? ? 1_555 J  DG 139 N2 ? ? I DC  -65 J DG 65  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog14  hydrog ? ? I DC  10  N3  ? ? ? 1_555 J  DG 138 N1 ? ? I DC  -64 J DG 64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? I DC  10  N4  ? ? ? 1_555 J  DG 138 O6 ? ? I DC  -64 J DG 64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? I DC  10  O2  ? ? ? 1_555 J  DG 138 N2 ? ? I DC  -64 J DG 64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? I DA  11  N1  ? ? ? 1_555 J  DT 137 N3 ? ? I DA  -63 J DT 63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? I DA  11  N6  ? ? ? 1_555 J  DT 137 O4 ? ? I DA  -63 J DT 63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? I DC  12  N4  ? ? ? 1_555 J  DG 136 O6 ? ? I DC  -62 J DG 62  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog20  hydrog ? ? I DC  13  O2  ? ? ? 1_555 J  DG 135 N1 ? ? I DC  -61 J DG 61  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog21  hydrog ? ? I DT  14  N3  ? ? ? 1_555 J  DA 134 N1 ? ? I DT  -60 J DA 60  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog22  hydrog ? ? I DG  15  N1  ? ? ? 1_555 J  DC 133 N3 ? ? I DG  -59 J DC 59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? I DG  15  N2  ? ? ? 1_555 J  DC 133 O2 ? ? I DG  -59 J DC 59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? I DG  15  O6  ? ? ? 1_555 J  DC 133 N4 ? ? I DG  -59 J DC 59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? I DC  16  N3  ? ? ? 1_555 J  DG 132 N1 ? ? I DC  -58 J DG 58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? I DC  16  N4  ? ? ? 1_555 J  DG 132 O6 ? ? I DC  -58 J DG 58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? I DC  16  O2  ? ? ? 1_555 J  DG 132 N2 ? ? I DC  -58 J DG 58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? I DA  17  N1  ? ? ? 1_555 J  DT 131 N3 ? ? I DA  -57 J DT 57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? I DA  17  N6  ? ? ? 1_555 J  DT 131 O4 ? ? I DA  -57 J DT 57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? I DG  18  N1  ? ? ? 1_555 J  DC 130 N3 ? ? I DG  -56 J DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? I DG  18  N2  ? ? ? 1_555 J  DC 130 O2 ? ? I DG  -56 J DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? I DG  18  O6  ? ? ? 1_555 J  DC 130 N4 ? ? I DG  -56 J DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? I DA  19  N1  ? ? ? 1_555 J  DT 129 N3 ? ? I DA  -55 J DT 55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? I DA  19  N6  ? ? ? 1_555 J  DT 129 O4 ? ? I DA  -55 J DT 55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? I DT  20  N3  ? ? ? 1_555 J  DA 128 N1 ? ? I DT  -54 J DA 54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? I DT  20  O4  ? ? ? 1_555 J  DA 128 N6 ? ? I DT  -54 J DA 54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? I DA  21  N1  ? ? ? 1_555 J  DT 127 N3 ? ? I DA  -53 J DT 53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? I DA  21  N6  ? ? ? 1_555 J  DT 127 O4 ? ? I DA  -53 J DT 53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? I DC  22  O2  ? ? ? 1_555 J  DG 126 N1 ? ? I DC  -52 J DG 52  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog40  hydrog ? ? I DT  23  N3  ? ? ? 1_555 J  DA 125 N1 ? ? I DT  -51 J DA 51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? I DT  23  O4  ? ? ? 1_555 J  DA 125 N6 ? ? I DT  -51 J DA 51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? I DA  24  N1  ? ? ? 1_555 J  DT 124 N3 ? ? I DA  -50 J DT 50  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog43  hydrog ? ? I DC  25  N3  ? ? ? 1_555 J  DG 123 N1 ? ? I DC  -49 J DG 49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? I DC  25  N4  ? ? ? 1_555 J  DG 123 O6 ? ? I DC  -49 J DG 49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? I DC  25  O2  ? ? ? 1_555 J  DG 123 N2 ? ? I DC  -49 J DG 49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? I DC  26  N3  ? ? ? 1_555 J  DG 122 N1 ? ? I DC  -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? I DC  26  N4  ? ? ? 1_555 J  DG 122 O6 ? ? I DC  -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? I DC  26  O2  ? ? ? 1_555 J  DG 122 N2 ? ? I DC  -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? I DA  27  N1  ? ? ? 1_555 J  DT 121 N3 ? ? I DA  -47 J DT 47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? I DA  27  N6  ? ? ? 1_555 J  DT 121 O4 ? ? I DA  -47 J DT 47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? I DA  28  N1  ? ? ? 1_555 J  DT 120 N3 ? ? I DA  -46 J DT 46  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog52  hydrog ? ? I DA  29  N1  ? ? ? 1_555 J  DT 119 N3 ? ? I DA  -45 J DT 45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? I DA  29  N6  ? ? ? 1_555 J  DT 119 O4 ? ? I DA  -45 J DT 45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? I DA  30  N1  ? ? ? 1_555 J  DT 118 N3 ? ? I DA  -44 J DT 44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? I DA  30  N6  ? ? ? 1_555 J  DT 118 O4 ? ? I DA  -44 J DT 44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? I DG  31  N2  ? ? ? 1_555 J  DC 117 N3 ? ? I DG  -43 J DC 43  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog57  hydrog ? ? I DT  32  N3  ? ? ? 1_555 J  DA 116 N1 ? ? I DT  -42 J DA 42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? I DT  32  O4  ? ? ? 1_555 J  DA 116 N6 ? ? I DT  -42 J DA 42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? I DG  33  N1  ? ? ? 1_555 J  DA 114 N1 ? ? I DG  -41 J DA 40  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog60  hydrog ? ? I DG  33  O6  ? ? ? 1_555 J  DA 114 N6 ? ? I DG  -41 J DA 40  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog61  hydrog ? ? I DG  33  N1  ? ? ? 1_555 J  DC 115 O2 ? ? I DG  -41 J DC 41  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog62  hydrog ? ? I DA  35  N1  ? ? ? 1_555 J  DT 113 N3 ? ? I DA  -39 J DT 39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? I DA  35  N6  ? ? ? 1_555 J  DT 113 O4 ? ? I DA  -39 J DT 39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? I DT  36  N3  ? ? ? 1_555 J  DA 112 N1 ? ? I DT  -38 J DA 38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? I DT  36  O4  ? ? ? 1_555 J  DA 112 N6 ? ? I DT  -38 J DA 38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? I DT  37  N3  ? ? ? 1_555 J  DA 111 N1 ? ? I DT  -37 J DA 37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? I DT  37  O4  ? ? ? 1_555 J  DA 111 N6 ? ? I DT  -37 J DA 37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? I DT  38  N3  ? ? ? 1_555 J  DA 110 N1 ? ? I DT  -36 J DA 36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? I DT  38  O4  ? ? ? 1_555 J  DA 110 N6 ? ? I DT  -36 J DA 36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? I DG  39  N1  ? ? ? 1_555 J  DC 109 N3 ? ? I DG  -35 J DC 35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? I DG  39  N2  ? ? ? 1_555 J  DC 109 O2 ? ? I DG  -35 J DC 35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? I DG  39  O6  ? ? ? 1_555 J  DC 109 N4 ? ? I DG  -35 J DC 35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? I DG  40  N1  ? ? ? 1_555 J  DC 108 N3 ? ? I DG  -34 J DC 34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? I DG  40  N2  ? ? ? 1_555 J  DC 108 O2 ? ? I DG  -34 J DC 34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? I DG  40  O6  ? ? ? 1_555 J  DC 108 N4 ? ? I DG  -34 J DC 34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? I DA  41  N1  ? ? ? 1_555 J  DT 107 N3 ? ? I DA  -33 J DT 33  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog77  hydrog ? ? I DA  42  N1  ? ? ? 1_555 J  DT 106 N3 ? ? I DA  -32 J DT 32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? I DA  42  N6  ? ? ? 1_555 J  DT 106 O4 ? ? I DA  -32 J DT 32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? I DA  43  N1  ? ? ? 1_555 J  DT 105 N3 ? ? I DA  -31 J DT 31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? I DA  43  N6  ? ? ? 1_555 J  DT 105 O4 ? ? I DA  -31 J DT 31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? I DC  44  O2  ? ? ? 1_555 J  DG 104 N2 ? ? I DC  -30 J DG 30  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog82  hydrog ? ? I DT  45  N3  ? ? ? 1_555 J  DA 103 N1 ? ? I DT  -29 J DA 29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? I DT  45  O4  ? ? ? 1_555 J  DA 103 N6 ? ? I DT  -29 J DA 29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? I DG  46  N1  ? ? ? 1_555 J  DC 102 N3 ? ? I DG  -28 J DC 28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? I DG  46  N2  ? ? ? 1_555 J  DC 102 O2 ? ? I DG  -28 J DC 28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? I DG  46  O6  ? ? ? 1_555 J  DC 102 N4 ? ? I DG  -28 J DC 28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? I DC  47  N3  ? ? ? 1_555 J  DG 101 N1 ? ? I DC  -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? I DC  47  N4  ? ? ? 1_555 J  DG 101 O6 ? ? I DC  -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? I DC  47  O2  ? ? ? 1_555 J  DG 101 N2 ? ? I DC  -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? I DT  48  N3  ? ? ? 1_555 J  DA 100 N1 ? ? I DT  -26 J DA 26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? I DT  48  O4  ? ? ? 1_555 J  DA 100 N6 ? ? I DT  -26 J DA 26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? I DC  49  O2  ? ? ? 1_555 J  DG 99  N2 ? ? I DC  -25 J DG 25  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog93  hydrog ? ? I DC  50  N3  ? ? ? 1_555 J  DG 98  N1 ? ? I DC  -24 J DG 24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? I DC  50  N4  ? ? ? 1_555 J  DG 98  O6 ? ? I DC  -24 J DG 24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? I DC  50  O2  ? ? ? 1_555 J  DG 98  N2 ? ? I DC  -24 J DG 24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? I DA  51  N1  ? ? ? 1_555 J  DT 97  N3 ? ? I DA  -23 J DT 23  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? I DA  51  N6  ? ? ? 1_555 J  DT 97  O4 ? ? I DA  -23 J DT 23  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? I DT  52  N3  ? ? ? 1_555 J  DA 96  N1 ? ? I DT  -22 J DA 22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? I DT  52  O4  ? ? ? 1_555 J  DA 96  N6 ? ? I DT  -22 J DA 22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? I DC  53  N3  ? ? ? 1_555 J  DG 95  N1 ? ? I DC  -21 J DG 21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? I DC  53  N4  ? ? ? 1_555 J  DG 95  O6 ? ? I DC  -21 J DG 21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? I DC  53  O2  ? ? ? 1_555 J  DG 95  N2 ? ? I DC  -21 J DG 21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? I DA  54  N1  ? ? ? 1_555 J  DT 94  N3 ? ? I DA  -20 J DT 20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? I DA  54  N6  ? ? ? 1_555 J  DT 94  O4 ? ? I DA  -20 J DT 20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? I DA  55  N1  ? ? ? 1_555 J  DT 93  N3 ? ? I DA  -19 J DT 19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? I DA  55  N6  ? ? ? 1_555 J  DT 93  O4 ? ? I DA  -19 J DT 19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? I DA  56  N1  ? ? ? 1_555 J  DT 92  N3 ? ? I DA  -18 J DT 18  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog108 hydrog ? ? I DA  57  N1  ? ? ? 1_555 J  DT 91  N3 ? ? I DA  -17 J DT 17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? I DA  57  N6  ? ? ? 1_555 J  DT 91  O4 ? ? I DA  -17 J DT 17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? I DG  58  N1  ? ? ? 1_555 J  DC 90  N3 ? ? I DG  -16 J DC 16  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog111 hydrog ? ? I DG  59  N1  ? ? ? 1_555 J  DC 89  N3 ? ? I DG  -15 J DC 15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? I DG  59  N2  ? ? ? 1_555 J  DC 89  O2 ? ? I DG  -15 J DC 15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? I DG  59  O6  ? ? ? 1_555 J  DC 89  N4 ? ? I DG  -15 J DC 15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? I DC  60  O2  ? ? ? 1_555 J  DG 88  N1 ? ? I DC  -14 J DG 14  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog115 hydrog ? ? I DA  61  N1  ? ? ? 1_555 J  DT 87  N3 ? ? I DA  -13 J DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? I DA  61  N6  ? ? ? 1_555 J  DT 87  O4 ? ? I DA  -13 J DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? I DT  62  N3  ? ? ? 1_555 J  DA 86  N1 ? ? I DT  -12 J DA 12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? I DT  62  O4  ? ? ? 1_555 J  DA 86  N6 ? ? I DT  -12 J DA 12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? I DG  63  N1  ? ? ? 1_555 J  DC 85  N3 ? ? I DG  -11 J DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? I DG  63  N2  ? ? ? 1_555 J  DC 85  O2 ? ? I DG  -11 J DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? I DG  63  O6  ? ? ? 1_555 J  DC 85  N4 ? ? I DG  -11 J DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? I DT  64  N3  ? ? ? 1_555 J  DA 84  N1 ? ? I DT  -10 J DA 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? I DT  64  O4  ? ? ? 1_555 J  DA 84  N6 ? ? I DT  -10 J DA 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? I DT  65  N3  ? ? ? 1_555 J  DA 83  N1 ? ? I DT  -9  J DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? I DT  65  O4  ? ? ? 1_555 J  DA 83  N6 ? ? I DT  -9  J DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? I DC  66  N3  ? ? ? 1_555 J  DG 82  N1 ? ? I DC  -8  J DG 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? I DC  66  N4  ? ? ? 1_555 J  DG 82  O6 ? ? I DC  -8  J DG 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? I DC  66  O2  ? ? ? 1_555 J  DG 82  N2 ? ? I DC  -8  J DG 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? I DA  67  N1  ? ? ? 1_555 J  DT 81  N3 ? ? I DA  -7  J DT 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? I DA  67  N6  ? ? ? 1_555 J  DT 81  O4 ? ? I DA  -7  J DT 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? I DG  68  N1  ? ? ? 1_555 J  DC 80  N3 ? ? I DG  -6  J DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? I DG  68  N2  ? ? ? 1_555 J  DC 80  O2 ? ? I DG  -6  J DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? I DG  68  O6  ? ? ? 1_555 J  DC 80  N4 ? ? I DG  -6  J DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? I DC  69  N3  ? ? ? 1_555 J  DG 79  N1 ? ? I DC  -5  J DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? I DC  69  N4  ? ? ? 1_555 J  DG 79  O6 ? ? I DC  -5  J DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? I DC  69  O2  ? ? ? 1_555 J  DG 79  N2 ? ? I DC  -5  J DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? I DT  70  N3  ? ? ? 1_555 J  DA 78  N1 ? ? I DT  -4  J DA 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? I DT  70  O4  ? ? ? 1_555 J  DA 78  N6 ? ? I DT  -4  J DA 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? I DG  71  N1  ? ? ? 1_555 J  DC 77  N3 ? ? I DG  -3  J DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? I DG  71  N2  ? ? ? 1_555 J  DC 77  O2 ? ? I DG  -3  J DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? I DG  71  O6  ? ? ? 1_555 J  DC 77  N4 ? ? I DG  -3  J DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? I DG  72  N1  ? ? ? 1_555 J  DC 76  N3 ? ? I DG  -2  J DC 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? I DG  72  N2  ? ? ? 1_555 J  DC 76  O2 ? ? I DG  -2  J DC 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? I DG  72  O6  ? ? ? 1_555 J  DC 76  N4 ? ? I DG  -2  J DC 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? I DA  73  N1  ? ? ? 1_555 J  DT 75  N3 ? ? I DA  -1  J DT 1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? I DA  73  N6  ? ? ? 1_555 J  DT 75  O4 ? ? I DA  -1  J DT 1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? I DA  74  N1  ? ? ? 1_555 J  DT 74  N3 ? ? I DA  0   J DT 0   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? I DA  74  N6  ? ? ? 1_555 J  DT 74  O4 ? ? I DA  0   J DT 0   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? I DT  75  N3  ? ? ? 1_555 J  DA 73  N1 ? ? I DT  1   J DA -1  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog150 hydrog ? ? I DC  76  N3  ? ? ? 1_555 J  DG 72  N1 ? ? I DC  2   J DG -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? I DC  76  N4  ? ? ? 1_555 J  DG 72  O6 ? ? I DC  2   J DG -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? I DC  76  O2  ? ? ? 1_555 J  DG 72  N2 ? ? I DC  2   J DG -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? I DC  77  N3  ? ? ? 1_555 J  DG 71  N1 ? ? I DC  3   J DG -3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? I DC  77  N4  ? ? ? 1_555 J  DG 71  O6 ? ? I DC  3   J DG -3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? I DC  77  O2  ? ? ? 1_555 J  DG 71  N2 ? ? I DC  3   J DG -3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? I DA  78  N1  ? ? ? 1_555 J  DT 70  N3 ? ? I DA  4   J DT -4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? I DA  78  N6  ? ? ? 1_555 J  DT 70  O4 ? ? I DA  4   J DT -4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? I DG  79  N1  ? ? ? 1_555 J  DC 69  N3 ? ? I DG  5   J DC -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? I DG  79  N2  ? ? ? 1_555 J  DC 69  O2 ? ? I DG  5   J DC -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? I DG  79  O6  ? ? ? 1_555 J  DC 69  N4 ? ? I DG  5   J DC -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? I DC  80  N3  ? ? ? 1_555 J  DG 68  N1 ? ? I DC  6   J DG -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? I DC  80  N4  ? ? ? 1_555 J  DG 68  O6 ? ? I DC  6   J DG -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? I DC  80  O2  ? ? ? 1_555 J  DG 68  N2 ? ? I DC  6   J DG -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? I DT  81  N3  ? ? ? 1_555 J  DA 67  N1 ? ? I DT  7   J DA -7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? I DT  81  O4  ? ? ? 1_555 J  DA 67  N6 ? ? I DT  7   J DA -7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? I DG  82  N1  ? ? ? 1_555 J  DC 66  N3 ? ? I DG  8   J DC -8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? I DG  82  N2  ? ? ? 1_555 J  DC 66  O2 ? ? I DG  8   J DC -8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? I DG  82  O6  ? ? ? 1_555 J  DC 66  N4 ? ? I DG  8   J DC -8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? I DA  83  N1  ? ? ? 1_555 J  DT 65  N3 ? ? I DA  9   J DT -9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? I DA  83  N6  ? ? ? 1_555 J  DT 65  O4 ? ? I DA  9   J DT -9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? I DA  84  N1  ? ? ? 1_555 J  DT 64  N3 ? ? I DA  10  J DT -10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? I DA  84  N6  ? ? ? 1_555 J  DT 64  O4 ? ? I DA  10  J DT -10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? I DC  85  O2  ? ? ? 1_555 J  DG 63  N2 ? ? I DC  11  J DG -11 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog174 hydrog ? ? I DA  86  N1  ? ? ? 1_555 J  DT 62  N3 ? ? I DA  12  J DT -12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? I DA  86  N6  ? ? ? 1_555 J  DT 62  O4 ? ? I DA  12  J DT -12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? I DT  87  N3  ? ? ? 1_555 J  DA 61  N1 ? ? I DT  13  J DA -13 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog177 hydrog ? ? I DC  90  N3  ? ? ? 1_555 J  DG 59  N1 ? ? I DC  16  J DG -15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? I DC  90  N4  ? ? ? 1_555 J  DG 59  O6 ? ? I DC  16  J DG -15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? I DC  90  O2  ? ? ? 1_555 J  DG 59  N2 ? ? I DC  16  J DG -15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? I DT  91  N3  ? ? ? 1_555 J  DA 57  N1 ? ? I DT  17  J DA -17 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? I DT  91  O4  ? ? ? 1_555 J  DA 57  N6 ? ? I DT  17  J DA -17 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog182 hydrog ? ? I DT  92  N3  ? ? ? 1_555 J  DA 56  N1 ? ? I DT  18  J DA -18 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ? ? I DT  92  O4  ? ? ? 1_555 J  DA 56  N6 ? ? I DT  18  J DA -18 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? I DT  93  N3  ? ? ? 1_555 J  DA 55  N1 ? ? I DT  19  J DA -19 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ? ? I DT  93  O4  ? ? ? 1_555 J  DA 55  N6 ? ? I DT  19  J DA -19 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? I DT  93  O2  ? ? ? 1_555 J  DG 58  N2 ? ? I DT  19  J DG -16 1_555 ? ? ? ? ? ? 'DT-DG MISPAIR' ?     ? 
hydrog187 hydrog ? ? I DT  94  N3  ? ? ? 1_555 J  DA 54  N1 ? ? I DT  20  J DA -20 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog188 hydrog ? ? I DG  95  N1  ? ? ? 1_555 J  DC 53  N3 ? ? I DG  21  J DC -21 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog189 hydrog ? ? I DA  96  N1  ? ? ? 1_555 J  DT 52  N3 ? ? I DA  22  J DT -22 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog190 hydrog ? ? I DA  96  N6  ? ? ? 1_555 J  DT 52  O4 ? ? I DA  22  J DT -22 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog191 hydrog ? ? I DT  97  N3  ? ? ? 1_555 J  DA 51  N1 ? ? I DT  23  J DA -23 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog192 hydrog ? ? I DT  97  O4  ? ? ? 1_555 J  DA 51  N6 ? ? I DT  23  J DA -23 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ? ? I DG  98  N1  ? ? ? 1_555 J  DC 50  N3 ? ? I DG  24  J DC -24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? I DG  98  N2  ? ? ? 1_555 J  DC 50  O2 ? ? I DG  24  J DC -24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog195 hydrog ? ? I DG  98  O6  ? ? ? 1_555 J  DC 50  N4 ? ? I DG  24  J DC -24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog196 hydrog ? ? I DG  99  N1  ? ? ? 1_555 J  DC 49  N3 ? ? I DG  25  J DC -25 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog197 hydrog ? ? I DG  99  N2  ? ? ? 1_555 J  DC 49  O2 ? ? I DG  25  J DC -25 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? I DG  99  O6  ? ? ? 1_555 J  DC 49  N4 ? ? I DG  25  J DC -25 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ? ? I DA  100 N6  ? ? ? 1_555 J  DC 47  N3 ? ? I DA  26  J DC -27 1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog200 hydrog ? ? I DA  100 N1  ? ? ? 1_555 J  DT 48  N3 ? ? I DA  26  J DT -26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog201 hydrog ? ? I DA  100 N6  ? ? ? 1_555 J  DT 48  O4 ? ? I DA  26  J DT -26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog202 hydrog ? ? I DG  101 N1  ? ? ? 1_555 J  DC 47  N3 ? ? I DG  27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog203 hydrog ? ? I DG  101 N2  ? ? ? 1_555 J  DC 47  O2 ? ? I DG  27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ? ? I DG  101 O6  ? ? ? 1_555 J  DC 47  N4 ? ? I DG  27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog205 hydrog ? ? I DC  102 N3  ? ? ? 1_555 J  DG 46  N1 ? ? I DC  28  J DG -28 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog206 hydrog ? ? I DC  102 N4  ? ? ? 1_555 J  DG 46  O6 ? ? I DC  28  J DG -28 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog207 hydrog ? ? I DC  102 O2  ? ? ? 1_555 J  DG 46  N2 ? ? I DC  28  J DG -28 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog208 hydrog ? ? I DA  103 N1  ? ? ? 1_555 J  DT 45  N3 ? ? I DA  29  J DT -29 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog209 hydrog ? ? I DA  103 N6  ? ? ? 1_555 J  DT 45  O4 ? ? I DA  29  J DT -29 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog210 hydrog ? ? I DG  104 N1  ? ? ? 1_555 J  DC 44  N3 ? ? I DG  30  J DC -30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog211 hydrog ? ? I DG  104 N2  ? ? ? 1_555 J  DC 44  O2 ? ? I DG  30  J DC -30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog212 hydrog ? ? I DG  104 O6  ? ? ? 1_555 J  DC 44  N4 ? ? I DG  30  J DC -30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ? ? I DT  105 N3  ? ? ? 1_555 J  DA 43  N1 ? ? I DT  31  J DA -31 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog214 hydrog ? ? I DT  105 O4  ? ? ? 1_555 J  DA 43  N6 ? ? I DT  31  J DA -31 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog215 hydrog ? ? I DT  106 N3  ? ? ? 1_555 J  DA 42  N1 ? ? I DT  32  J DA -32 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog216 hydrog ? ? I DT  106 O4  ? ? ? 1_555 J  DA 42  N6 ? ? I DT  32  J DA -32 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? I DT  107 N3  ? ? ? 1_555 J  DA 41  N1 ? ? I DT  33  J DA -33 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? I DT  107 O4  ? ? ? 1_555 J  DA 41  N6 ? ? I DT  33  J DA -33 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ? ? I DC  108 O2  ? ? ? 1_555 J  DG 40  N2 ? ? I DC  34  J DG -34 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog220 hydrog ? ? I DC  109 N3  ? ? ? 1_555 J  DG 39  N1 ? ? I DC  35  J DG -35 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog221 hydrog ? ? I DC  109 N4  ? ? ? 1_555 J  DG 39  O6 ? ? I DC  35  J DG -35 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ? ? I DC  109 O2  ? ? ? 1_555 J  DG 39  N2 ? ? I DC  35  J DG -35 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog223 hydrog ? ? I DA  110 N1  ? ? ? 1_555 J  DT 38  N3 ? ? I DA  36  J DT -36 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? I DA  110 N6  ? ? ? 1_555 J  DT 38  O4 ? ? I DA  36  J DT -36 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? I DA  111 N1  ? ? ? 1_555 J  DT 37  N3 ? ? I DA  37  J DT -37 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? I DA  111 N6  ? ? ? 1_555 J  DT 37  O4 ? ? I DA  37  J DT -37 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? I DA  112 N1  ? ? ? 1_555 J  DT 36  N3 ? ? I DA  38  J DT -38 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog228 hydrog ? ? I DA  112 N6  ? ? ? 1_555 J  DT 36  O4 ? ? I DA  38  J DT -38 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog229 hydrog ? ? I DA  114 N1  ? ? ? 1_555 J  DT 34  N3 ? ? I DA  40  J DT -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? I DA  114 N6  ? ? ? 1_555 J  DT 34  O4 ? ? I DA  40  J DT -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog231 hydrog ? ? I DC  115 N3  ? ? ? 1_555 J  DG 33  N1 ? ? I DC  41  J DG -41 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ? ? I DC  115 N4  ? ? ? 1_555 J  DG 33  O6 ? ? I DC  41  J DG -41 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? I DC  115 O2  ? ? ? 1_555 J  DG 33  N2 ? ? I DC  41  J DG -41 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ? ? I DC  117 N3  ? ? ? 1_555 J  DG 31  N1 ? ? I DC  43  J DG -43 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog235 hydrog ? ? I DC  117 N4  ? ? ? 1_555 J  DG 31  O6 ? ? I DC  43  J DG -43 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog236 hydrog ? ? I DC  117 O2  ? ? ? 1_555 J  DG 31  N2 ? ? I DC  43  J DG -43 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog237 hydrog ? ? I DT  118 N3  ? ? ? 1_555 J  DA 30  N1 ? ? I DT  44  J DA -44 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog238 hydrog ? ? I DT  118 O4  ? ? ? 1_555 J  DA 30  N6 ? ? I DT  44  J DA -44 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? I DT  119 N3  ? ? ? 1_555 J  DA 29  N1 ? ? I DT  45  J DA -45 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog240 hydrog ? ? I DT  119 O4  ? ? ? 1_555 J  DA 29  N6 ? ? I DT  45  J DA -45 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog241 hydrog ? ? I DT  120 N3  ? ? ? 1_555 J  DA 28  N1 ? ? I DT  46  J DA -46 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog242 hydrog ? ? I DT  120 O4  ? ? ? 1_555 J  DA 28  N6 ? ? I DT  46  J DA -46 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ? ? I DT  121 N3  ? ? ? 1_555 J  DA 27  N1 ? ? I DT  47  J DA -47 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ? ? I DT  121 O4  ? ? ? 1_555 J  DA 27  N6 ? ? I DT  47  J DA -47 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? I DG  122 N1  ? ? ? 1_555 J  DC 26  N3 ? ? I DG  48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ? ? I DG  122 N2  ? ? ? 1_555 J  DC 26  O2 ? ? I DG  48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? I DG  122 O6  ? ? ? 1_555 J  DC 26  N4 ? ? I DG  48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? I DG  123 N1  ? ? ? 1_555 J  DC 25  N3 ? ? I DG  49  J DC -49 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ? ? I DG  123 N2  ? ? ? 1_555 J  DC 25  O2 ? ? I DG  49  J DC -49 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog250 hydrog ? ? I DG  123 O6  ? ? ? 1_555 J  DC 25  N4 ? ? I DG  49  J DC -49 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog251 hydrog ? ? I DT  124 N3  ? ? ? 1_555 J  DA 24  N1 ? ? I DT  50  J DA -50 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog252 hydrog ? ? I DA  125 N1  ? ? ? 1_555 J  DT 23  N3 ? ? I DA  51  J DT -51 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog253 hydrog ? ? I DA  125 N6  ? ? ? 1_555 J  DT 23  O4 ? ? I DA  51  J DT -51 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog254 hydrog ? ? I DG  126 N1  ? ? ? 1_555 J  DC 22  N3 ? ? I DG  52  J DC -52 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog255 hydrog ? ? I DG  126 N2  ? ? ? 1_555 J  DC 22  O2 ? ? I DG  52  J DC -52 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog256 hydrog ? ? I DG  126 O6  ? ? ? 1_555 J  DC 22  N4 ? ? I DG  52  J DC -52 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog257 hydrog ? ? I DT  127 N3  ? ? ? 1_555 J  DA 21  N1 ? ? I DT  53  J DA -53 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog258 hydrog ? ? I DT  127 O4  ? ? ? 1_555 J  DA 21  N6 ? ? I DT  53  J DA -53 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog259 hydrog ? ? I DA  128 N1  ? ? ? 1_555 J  DT 20  N3 ? ? I DA  54  J DT -54 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog260 hydrog ? ? I DA  128 N6  ? ? ? 1_555 J  DT 20  O4 ? ? I DA  54  J DT -54 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog261 hydrog ? ? I DT  129 N3  ? ? ? 1_555 J  DA 19  N1 ? ? I DT  55  J DA -55 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog262 hydrog ? ? I DT  129 O4  ? ? ? 1_555 J  DA 19  N6 ? ? I DT  55  J DA -55 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog263 hydrog ? ? I DC  130 N3  ? ? ? 1_555 J  DG 18  N1 ? ? I DC  56  J DG -56 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog264 hydrog ? ? I DC  130 N4  ? ? ? 1_555 J  DG 18  O6 ? ? I DC  56  J DG -56 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog265 hydrog ? ? I DC  130 O2  ? ? ? 1_555 J  DG 18  N2 ? ? I DC  56  J DG -56 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog266 hydrog ? ? I DT  131 N3  ? ? ? 1_555 J  DA 17  N1 ? ? I DT  57  J DA -57 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog267 hydrog ? ? I DT  131 O4  ? ? ? 1_555 J  DA 17  N6 ? ? I DT  57  J DA -57 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog268 hydrog ? ? I DG  132 N1  ? ? ? 1_555 J  DC 16  N3 ? ? I DG  58  J DC -58 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog269 hydrog ? ? I DG  132 N2  ? ? ? 1_555 J  DC 16  O2 ? ? I DG  58  J DC -58 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog270 hydrog ? ? I DG  132 O6  ? ? ? 1_555 J  DC 16  N4 ? ? I DG  58  J DC -58 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog271 hydrog ? ? I DC  133 N3  ? ? ? 1_555 J  DG 15  N1 ? ? I DC  59  J DG -59 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog272 hydrog ? ? I DC  133 N4  ? ? ? 1_555 J  DG 15  O6 ? ? I DC  59  J DG -59 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog273 hydrog ? ? I DC  133 O2  ? ? ? 1_555 J  DG 15  N2 ? ? I DC  59  J DG -59 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog274 hydrog ? ? I DA  134 N1  ? ? ? 1_555 J  DT 14  N3 ? ? I DA  60  J DT -60 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog275 hydrog ? ? I DA  134 N6  ? ? ? 1_555 J  DT 14  O4 ? ? I DA  60  J DT -60 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog276 hydrog ? ? I DG  135 N1  ? ? ? 1_555 J  DC 13  N3 ? ? I DG  61  J DC -61 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog277 hydrog ? ? I DG  135 N2  ? ? ? 1_555 J  DC 13  O2 ? ? I DG  61  J DC -61 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog278 hydrog ? ? I DG  135 O6  ? ? ? 1_555 J  DC 13  N4 ? ? I DG  61  J DC -61 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog279 hydrog ? ? I DG  136 N1  ? ? ? 1_555 J  DC 12  N3 ? ? I DG  62  J DC -62 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog280 hydrog ? ? I DG  136 N2  ? ? ? 1_555 J  DC 12  O2 ? ? I DG  62  J DC -62 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog281 hydrog ? ? I DG  136 O6  ? ? ? 1_555 J  DC 12  N4 ? ? I DG  62  J DC -62 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog282 hydrog ? ? I DT  137 N3  ? ? ? 1_555 J  DA 11  N1 ? ? I DT  63  J DA -63 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog283 hydrog ? ? I DG  138 N1  ? ? ? 1_555 J  DC 10  N3 ? ? I DG  64  J DC -64 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog284 hydrog ? ? I DG  138 N2  ? ? ? 1_555 J  DC 10  O2 ? ? I DG  64  J DC -64 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog285 hydrog ? ? I DG  138 O6  ? ? ? 1_555 J  DC 10  N4 ? ? I DG  64  J DC -64 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog286 hydrog ? ? I DG  139 N1  ? ? ? 1_555 J  DC 9   N3 ? ? I DG  65  J DC -65 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog287 hydrog ? ? I DG  139 N2  ? ? ? 1_555 J  DC 9   O2 ? ? I DG  65  J DC -65 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog288 hydrog ? ? I DG  139 O6  ? ? ? 1_555 J  DC 9   N4 ? ? I DG  65  J DC -65 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog289 hydrog ? ? I DA  140 N1  ? ? ? 1_555 J  DT 8   N3 ? ? I DA  66  J DT -66 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog290 hydrog ? ? I DA  140 N6  ? ? ? 1_555 J  DT 8   O4 ? ? I DA  66  J DT -66 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog291 hydrog ? ? I DT  141 N3  ? ? ? 1_555 J  DA 7   N1 ? ? I DT  67  J DA -67 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog292 hydrog ? ? I DT  141 O4  ? ? ? 1_555 J  DA 7   N6 ? ? I DT  67  J DA -67 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog293 hydrog ? ? I DA  142 N1  ? ? ? 1_555 J  DT 6   N3 ? ? I DA  68  J DT -68 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog294 hydrog ? ? I DA  142 N6  ? ? ? 1_555 J  DT 6   O4 ? ? I DA  68  J DT -68 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog295 hydrog ? ? I DT  143 N3  ? ? ? 1_555 J  DA 5   N1 ? ? I DT  69  J DA -69 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog296 hydrog ? ? I DT  143 O4  ? ? ? 1_555 J  DA 5   N6 ? ? I DT  69  J DA -69 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog297 hydrog ? ? I DT  144 N3  ? ? ? 1_555 J  DA 4   N1 ? ? I DT  70  J DA -70 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog298 hydrog ? ? I DG  145 N1  ? ? ? 1_555 J  DC 3   O2 ? ? I DG  71  J DC -71 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog299 hydrog ? ? I DA  146 N1  ? ? ? 1_555 J  DT 2   N3 ? ? I DA  72  J DT -72 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog300 hydrog ? ? I DA  146 N6  ? ? ? 1_555 J  DT 2   O4 ? ? I DA  72  J DT -72 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog301 hydrog ? ? I DT  147 N3  ? ? ? 1_555 J  DA 1   N1 ? ? I DT  73  J DA -73 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog302 hydrog ? ? I DT  147 O4  ? ? ? 1_555 J  DA 1   N6 ? ? I DT  73  J DA -73 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
C 1 2 ? parallel 
D 1 2 ? parallel 
E 1 2 ? parallel 
F 1 2 ? parallel 
G 1 2 ? parallel 
H 1 2 ? parallel 
I 1 2 ? parallel 
J 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 83  ? PHE A 84  ? ARG A 83  PHE A 84  
A 2 THR B 80  ? VAL B 81  ? THR B 80  VAL B 81  
B 1 THR A 118 ? ILE A 119 ? THR A 118 ILE A 119 
B 2 ARG B 45  ? ILE B 46  ? ARG B 45  ILE B 46  
C 1 LEU B 97  ? TYR B 98  ? LEU B 97  TYR B 98  
C 2 THR G 101 ? ILE G 102 ? THR G 101 ILE G 102 
D 1 ARG C 42  ? VAL C 43  ? ARG C 42  VAL C 43  
D 2 THR D 88  ? ILE D 89  ? THR D 85  ILE D 86  
E 1 ARG C 77  ? ILE C 78  ? ARG C 77  ILE C 78  
E 2 GLY D 53  ? ILE D 54  ? GLY D 50  ILE D 51  
F 1 VAL C 100 ? ILE C 102 ? VAL C 100 ILE C 102 
F 2 THR F 96  ? TYR F 98  ? THR F 96  TYR F 98  
G 1 ARG E 83  ? PHE E 84  ? ARG E 83  PHE E 84  
G 2 THR F 80  ? VAL F 81  ? THR F 80  VAL F 81  
H 1 THR E 118 ? ILE E 119 ? THR E 118 ILE E 119 
H 2 ARG F 45  ? ILE F 46  ? ARG F 45  ILE F 46  
I 1 ARG G 42  ? VAL G 43  ? ARG G 42  VAL G 43  
I 2 THR H 88  ? ILE H 89  ? THR H 85  ILE H 86  
J 1 ARG G 77  ? ILE G 78  ? ARG G 77  ILE G 78  
J 2 GLY H 53  ? ILE H 54  ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 83  ? N ARG A 83  O VAL B 81  ? O VAL B 81  
B 1 2 N ILE A 119 ? N ILE A 119 O ARG B 45  ? O ARG B 45  
C 1 2 N TYR B 98  ? N TYR B 98  O THR G 101 ? O THR G 101 
D 1 2 N ARG C 42  ? N ARG C 42  O ILE D 89  ? O ILE D 86  
E 1 2 N ILE C 78  ? N ILE C 78  O GLY D 53  ? O GLY D 50  
F 1 2 N THR C 101 ? N THR C 101 O TYR F 98  ? O TYR F 98  
G 1 2 N ARG E 83  ? N ARG E 83  O VAL F 81  ? O VAL F 81  
H 1 2 N ILE E 119 ? N ILE E 119 O ARG F 45  ? O ARG F 45  
I 1 2 N ARG G 42  ? N ARG G 42  O ILE H 89  ? O ILE H 86  
J 1 2 N ILE G 78  ? N ILE G 78  O GLY H 53  ? O GLY H 50  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CO E 136'  
AC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CO J 74'   
AC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CO I 74'   
AC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CO J 75'   
AC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CO I 75'   
AC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CO J 76'   
AC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CO J 77'   
AC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CO I 76'   
AC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CO I 77'   
BC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CO D 123'  
BC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CO J 78'   
BC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CO I 78'   
BC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CO J 79'   
BC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CO H 123'  
BC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CO H 124'  
BC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CO J 80'   
BC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CO J 81'   
BC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CO I 79'   
CC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CO I 80'   
CC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CO J 82'   
CC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CO J 83'   
CC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CO J 84'   
CC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CO J 85'   
CC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CO I 81'   
CC7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CO I 82'   
CC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CO D 124'  
CC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CO C 120'  
DC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CO I 84'   
DC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CO J 88'   
DC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CO J 89'   
DC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CO I 85'   
DC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CO I 86'   
DC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CO I 87'   
DC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CO J 90'   
DC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CO J 91'   
DC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CO I 89'   
EC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CO I 94'   
EC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CO J 102'  
EC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL G 3145' 
EC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL D 3146' 
EC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 3147' 
EC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL E 3148' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 VAL D  48  ? VAL D 45  . ? 3_545 ? 
2  AC1 2 ASP E  77  ? ASP E 77  . ? 1_555 ? 
3  AC2 1 DG  J  101 ? DG  J 27  . ? 1_555 ? 
4  AC3 1 DG  I  135 ? DG  I 61  . ? 1_555 ? 
5  AC4 2 DG  J  135 ? DG  J 61  . ? 1_555 ? 
6  AC4 2 DG  J  136 ? DG  J 62  . ? 1_555 ? 
7  AC5 2 DT  I  121 ? DT  I 47  . ? 1_555 ? 
8  AC5 2 DG  I  122 ? DG  I 48  . ? 1_555 ? 
9  AC6 1 DG  J  122 ? DG  J 48  . ? 1_555 ? 
10 AC7 1 DG  J  71  ? DG  J -3  . ? 1_555 ? 
11 AC8 1 DG  I  101 ? DG  I 27  . ? 1_555 ? 
12 AC9 1 DG  I  71  ? DG  I -3  . ? 1_555 ? 
13 BC1 3 GLU D  105 ? GLU D 102 . ? 1_555 ? 
14 BC1 3 HIS D  109 ? HIS D 106 . ? 1_555 ? 
15 BC1 3 HIS F  18  ? HIS F 18  . ? 3_555 ? 
16 BC2 1 DG  J  68  ? DG  J -6  . ? 1_555 ? 
17 BC3 2 DG  I  39  ? DG  I -35 . ? 1_555 ? 
18 BC3 2 DG  I  40  ? DG  I -34 . ? 1_555 ? 
19 BC4 2 DG  J  39  ? DG  J -35 . ? 1_555 ? 
20 BC4 2 DG  J  40  ? DG  J -34 . ? 1_555 ? 
21 BC5 1 HIS H  82  ? HIS H 79  . ? 1_555 ? 
22 BC6 2 LYS H  108 ? LYS H 105 . ? 1_555 ? 
23 BC6 2 HIS H  109 ? HIS H 106 . ? 1_555 ? 
24 BC7 1 DA  J  103 ? DA  J 29  . ? 1_555 ? 
25 BC8 1 DG  J  18  ? DG  J -56 . ? 1_555 ? 
26 BC9 4 DG  I  88  ? DG  I 14  . ? 1_555 ? 
27 BC9 4 DC  I  90  ? DC  I 16  . ? 1_555 ? 
28 BC9 4 DC  J  60  ? DC  J -14 . ? 1_555 ? 
29 BC9 4 DG  J  59  ? DG  J -15 . ? 1_555 ? 
30 CC1 1 DG  I  18  ? DG  I -56 . ? 1_555 ? 
31 CC2 1 DG  J  82  ? DG  J 8   . ? 1_555 ? 
32 CC3 1 DG  J  79  ? DG  J 5   . ? 1_555 ? 
33 CC4 1 DG  J  145 ? DG  J 71  . ? 1_555 ? 
34 CC5 1 DG  J  126 ? DG  J 52  . ? 1_555 ? 
35 CC6 2 DG  I  98  ? DG  I 24  . ? 1_555 ? 
36 CC6 2 DG  I  99  ? DG  I 25  . ? 1_555 ? 
37 CC7 2 DG  I  139 ? DG  I 65  . ? 1_555 ? 
38 CC7 2 CO  GA .   ? CO  I 86  . ? 1_555 ? 
39 CC8 1 HIS D  82  ? HIS D 79  . ? 1_555 ? 
40 CC9 1 ASP C  90  ? ASP C 90  . ? 1_555 ? 
41 DC1 3 DC  I  133 ? DC  I 59  . ? 1_555 ? 
42 DC1 3 CO  HA .   ? CO  I 87  . ? 1_555 ? 
43 DC1 3 DG  J  15  ? DG  J -59 . ? 1_555 ? 
44 DC2 1 DG  J  40  ? DG  J -34 . ? 1_555 ? 
45 DC3 2 DG  J  138 ? DG  J 64  . ? 1_555 ? 
46 DC3 2 DG  J  139 ? DG  J 65  . ? 1_555 ? 
47 DC4 1 DA  I  103 ? DA  I 29  . ? 1_555 ? 
48 DC5 2 DG  I  138 ? DG  I 64  . ? 1_555 ? 
49 DC5 2 CO  CA .   ? CO  I 82  . ? 1_555 ? 
50 DC6 1 CO  EA .   ? CO  I 84  . ? 1_555 ? 
51 DC7 1 DG  J  99  ? DG  J 25  . ? 1_555 ? 
52 DC8 1 DA  J  73  ? DA  J -1  . ? 1_555 ? 
53 DC9 1 DG  I  145 ? DG  I 71  . ? 1_555 ? 
54 EC1 1 DG  I  68  ? DG  I -6  . ? 1_555 ? 
55 EC2 2 DT  J  97  ? DT  J 23  . ? 1_555 ? 
56 EC2 2 DG  J  98  ? DG  J 24  . ? 1_555 ? 
57 EC3 5 GLY G  44  ? GLY G 44  . ? 1_555 ? 
58 EC3 5 GLY G  46  ? GLY G 46  . ? 1_555 ? 
59 EC3 5 ALA G  47  ? ALA G 47  . ? 1_555 ? 
60 EC3 5 THR H  90  ? THR H 87  . ? 1_555 ? 
61 EC3 5 SER H  91  ? SER H 88  . ? 1_555 ? 
62 EC4 4 GLY C  46  ? GLY C 46  . ? 1_555 ? 
63 EC4 4 ALA C  47  ? ALA C 47  . ? 1_555 ? 
64 EC4 4 THR D  90  ? THR D 87  . ? 1_555 ? 
65 EC4 4 SER D  91  ? SER D 88  . ? 1_555 ? 
66 EC5 2 PRO A  121 ? PRO A 121 . ? 1_555 ? 
67 EC5 2 LYS A  122 ? LYS A 122 . ? 1_555 ? 
68 EC6 2 PRO E  121 ? PRO E 121 . ? 1_555 ? 
69 EC6 2 LYS E  122 ? LYS E 122 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3MGP 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3MGP 
_atom_sites.fract_transf_matrix[1][1]   0.009390 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009096 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005454 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
CO 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . LYS A  1 37  ? -60.555 -29.691 84.385 1.00 103.57 ? 37   LYS A N     1 
ATOM   2     C  CA    . LYS A  1 37  ? -61.646 -29.749 83.354 1.00 103.53 ? 37   LYS A CA    1 
ATOM   3     C  C     . LYS A  1 37  ? -61.236 -29.162 81.989 1.00 103.29 ? 37   LYS A C     1 
ATOM   4     O  O     . LYS A  1 37  ? -61.718 -29.634 80.954 1.00 103.45 ? 37   LYS A O     1 
ATOM   5     C  CB    . LYS A  1 37  ? -62.959 -29.134 83.877 1.00 103.69 ? 37   LYS A CB    1 
ATOM   6     C  CG    . LYS A  1 37  ? -63.614 -29.944 85.015 1.00 103.72 ? 37   LYS A CG    1 
ATOM   7     C  CD    . LYS A  1 37  ? -65.044 -29.489 85.330 1.00 103.50 ? 37   LYS A CD    1 
ATOM   8     C  CE    . LYS A  1 37  ? -66.071 -30.131 84.402 1.00 103.01 ? 37   LYS A CE    1 
ATOM   9     N  NZ    . LYS A  1 37  ? -66.221 -31.592 84.654 1.00 102.75 ? 37   LYS A NZ    1 
ATOM   10    N  N     . PRO A  1 38  ? -60.366 -28.122 81.976 1.00 102.94 ? 38   PRO A N     1 
ATOM   11    C  CA    . PRO A  1 38  ? -59.685 -27.785 80.704 1.00 102.37 ? 38   PRO A CA    1 
ATOM   12    C  C     . PRO A  1 38  ? -58.599 -28.811 80.309 1.00 101.56 ? 38   PRO A C     1 
ATOM   13    O  O     . PRO A  1 38  ? -58.261 -29.696 81.107 1.00 101.43 ? 38   PRO A O     1 
ATOM   14    C  CB    . PRO A  1 38  ? -59.064 -26.408 80.986 1.00 102.51 ? 38   PRO A CB    1 
ATOM   15    C  CG    . PRO A  1 38  ? -58.886 -26.365 82.480 1.00 102.91 ? 38   PRO A CG    1 
ATOM   16    C  CD    . PRO A  1 38  ? -60.005 -27.187 83.065 1.00 102.88 ? 38   PRO A CD    1 
ATOM   17    N  N     . HIS A  1 39  ? -58.070 -28.683 79.089 1.00 100.55 ? 39   HIS A N     1 
ATOM   18    C  CA    . HIS A  1 39  ? -57.072 -29.620 78.550 1.00 99.45  ? 39   HIS A CA    1 
ATOM   19    C  C     . HIS A  1 39  ? -55.879 -28.893 77.930 1.00 98.23  ? 39   HIS A C     1 
ATOM   20    O  O     . HIS A  1 39  ? -56.051 -28.089 77.004 1.00 98.19  ? 39   HIS A O     1 
ATOM   21    C  CB    . HIS A  1 39  ? -57.715 -30.547 77.505 1.00 99.82  ? 39   HIS A CB    1 
ATOM   22    C  CG    . HIS A  1 39  ? -56.730 -31.405 76.767 1.00 100.73 ? 39   HIS A CG    1 
ATOM   23    N  ND1   . HIS A  1 39  ? -56.206 -31.052 75.541 1.00 100.96 ? 39   HIS A ND1   1 
ATOM   24    C  CD2   . HIS A  1 39  ? -56.169 -32.597 77.086 1.00 101.40 ? 39   HIS A CD2   1 
ATOM   25    C  CE1   . HIS A  1 39  ? -55.368 -31.990 75.136 1.00 101.38 ? 39   HIS A CE1   1 
ATOM   26    N  NE2   . HIS A  1 39  ? -55.329 -32.940 76.054 1.00 101.53 ? 39   HIS A NE2   1 
ATOM   27    N  N     . ARG A  1 40  ? -54.677 -29.185 78.430 1.00 96.56  ? 40   ARG A N     1 
ATOM   28    C  CA    . ARG A  1 40  ? -53.455 -28.562 77.901 1.00 94.93  ? 40   ARG A CA    1 
ATOM   29    C  C     . ARG A  1 40  ? -52.359 -29.544 77.506 1.00 93.64  ? 40   ARG A C     1 
ATOM   30    O  O     . ARG A  1 40  ? -52.064 -30.501 78.236 1.00 93.60  ? 40   ARG A O     1 
ATOM   31    C  CB    . ARG A  1 40  ? -52.886 -27.541 78.882 1.00 94.91  ? 40   ARG A CB    1 
ATOM   32    C  CG    . ARG A  1 40  ? -53.569 -26.204 78.812 1.00 95.13  ? 40   ARG A CG    1 
ATOM   33    C  CD    . ARG A  1 40  ? -52.924 -25.217 79.753 1.00 95.49  ? 40   ARG A CD    1 
ATOM   34    N  NE    . ARG A  1 40  ? -51.697 -24.635 79.210 1.00 95.14  ? 40   ARG A NE    1 
ATOM   35    C  CZ    . ARG A  1 40  ? -51.641 -23.495 78.527 1.00 94.70  ? 40   ARG A CZ    1 
ATOM   36    N  NH1   . ARG A  1 40  ? -52.744 -22.803 78.274 1.00 94.35  ? 40   ARG A NH1   1 
ATOM   37    N  NH2   . ARG A  1 40  ? -50.474 -23.047 78.091 1.00 94.61  ? 40   ARG A NH2   1 
ATOM   38    N  N     . TYR A  1 41  ? -51.758 -29.289 76.345 1.00 91.72  ? 41   TYR A N     1 
ATOM   39    C  CA    . TYR A  1 41  ? -50.573 -30.017 75.916 1.00 89.84  ? 41   TYR A CA    1 
ATOM   40    C  C     . TYR A  1 41  ? -49.320 -29.382 76.525 1.00 88.60  ? 41   TYR A C     1 
ATOM   41    O  O     . TYR A  1 41  ? -49.270 -28.164 76.738 1.00 88.33  ? 41   TYR A O     1 
ATOM   42    C  CB    . TYR A  1 41  ? -50.485 -30.068 74.387 1.00 89.79  ? 41   TYR A CB    1 
ATOM   43    C  CG    . TYR A  1 41  ? -51.481 -31.008 73.743 1.00 89.37  ? 41   TYR A CG    1 
ATOM   44    C  CD1   . TYR A  1 41  ? -52.424 -30.538 72.825 1.00 89.06  ? 41   TYR A CD1   1 
ATOM   45    C  CD2   . TYR A  1 41  ? -51.480 -32.370 74.049 1.00 89.85  ? 41   TYR A CD2   1 
ATOM   46    C  CE1   . TYR A  1 41  ? -53.342 -31.399 72.228 1.00 88.93  ? 41   TYR A CE1   1 
ATOM   47    C  CE2   . TYR A  1 41  ? -52.392 -33.240 73.462 1.00 90.12  ? 41   TYR A CE2   1 
ATOM   48    C  CZ    . TYR A  1 41  ? -53.320 -32.747 72.552 1.00 89.66  ? 41   TYR A CZ    1 
ATOM   49    O  OH    . TYR A  1 41  ? -54.223 -33.614 71.981 1.00 89.45  ? 41   TYR A OH    1 
ATOM   50    N  N     . ARG A  1 42  ? -48.326 -30.215 76.828 1.00 87.02  ? 42   ARG A N     1 
ATOM   51    C  CA    . ARG A  1 42  ? -47.080 -29.742 77.441 1.00 85.69  ? 42   ARG A CA    1 
ATOM   52    C  C     . ARG A  1 42  ? -46.295 -28.861 76.448 1.00 84.11  ? 42   ARG A C     1 
ATOM   53    O  O     . ARG A  1 42  ? -46.473 -28.988 75.229 1.00 84.07  ? 42   ARG A O     1 
ATOM   54    C  CB    . ARG A  1 42  ? -46.220 -30.922 77.943 1.00 85.88  ? 42   ARG A CB    1 
ATOM   55    C  CG    . ARG A  1 42  ? -46.978 -32.011 78.729 1.00 86.95  ? 42   ARG A CG    1 
ATOM   56    C  CD    . ARG A  1 42  ? -46.916 -31.894 80.269 1.00 89.27  ? 42   ARG A CD    1 
ATOM   57    N  NE    . ARG A  1 42  ? -47.316 -30.584 80.808 1.00 92.25  ? 42   ARG A NE    1 
ATOM   58    C  CZ    . ARG A  1 42  ? -48.551 -30.063 80.788 1.00 93.31  ? 42   ARG A CZ    1 
ATOM   59    N  NH1   . ARG A  1 42  ? -49.570 -30.714 80.227 1.00 93.44  ? 42   ARG A NH1   1 
ATOM   60    N  NH2   . ARG A  1 42  ? -48.770 -28.862 81.321 1.00 92.79  ? 42   ARG A NH2   1 
ATOM   61    N  N     . PRO A  1 43  ? -45.461 -27.934 76.961 1.00 82.48  ? 43   PRO A N     1 
ATOM   62    C  CA    . PRO A  1 43  ? -44.569 -27.225 76.050 1.00 81.07  ? 43   PRO A CA    1 
ATOM   63    C  C     . PRO A  1 43  ? -43.713 -28.202 75.251 1.00 79.65  ? 43   PRO A C     1 
ATOM   64    O  O     . PRO A  1 43  ? -43.045 -29.066 75.835 1.00 79.38  ? 43   PRO A O     1 
ATOM   65    C  CB    . PRO A  1 43  ? -43.704 -26.391 76.994 1.00 81.10  ? 43   PRO A CB    1 
ATOM   66    C  CG    . PRO A  1 43  ? -44.561 -26.167 78.174 1.00 81.57  ? 43   PRO A CG    1 
ATOM   67    C  CD    . PRO A  1 43  ? -45.310 -27.454 78.347 1.00 82.31  ? 43   PRO A CD    1 
ATOM   68    N  N     . GLY A  1 44  ? -43.772 -28.080 73.925 1.00 78.11  ? 44   GLY A N     1 
ATOM   69    C  CA    . GLY A  1 44  ? -42.981 -28.919 73.023 1.00 76.09  ? 44   GLY A CA    1 
ATOM   70    C  C     . GLY A  1 44  ? -43.768 -29.948 72.229 1.00 74.68  ? 44   GLY A C     1 
ATOM   71    O  O     . GLY A  1 44  ? -43.314 -30.393 71.178 1.00 74.55  ? 44   GLY A O     1 
ATOM   72    N  N     . THR A  1 45  ? -44.941 -30.328 72.732 1.00 73.33  ? 45   THR A N     1 
ATOM   73    C  CA    . THR A  1 45  ? -45.765 -31.357 72.105 1.00 72.05  ? 45   THR A CA    1 
ATOM   74    C  C     . THR A  1 45  ? -46.340 -30.870 70.776 1.00 71.11  ? 45   THR A C     1 
ATOM   75    O  O     . THR A  1 45  ? -46.350 -31.604 69.780 1.00 71.23  ? 45   THR A O     1 
ATOM   76    C  CB    . THR A  1 45  ? -46.906 -31.823 73.048 1.00 72.40  ? 45   THR A CB    1 
ATOM   77    O  OG1   . THR A  1 45  ? -46.360 -32.170 74.324 1.00 72.16  ? 45   THR A OG1   1 
ATOM   78    C  CG2   . THR A  1 45  ? -47.654 -33.037 72.477 1.00 72.05  ? 45   THR A CG2   1 
ATOM   79    N  N     . VAL A  1 46  ? -46.805 -29.627 70.769 1.00 69.93  ? 46   VAL A N     1 
ATOM   80    C  CA    . VAL A  1 46  ? -47.400 -29.023 69.586 1.00 68.76  ? 46   VAL A CA    1 
ATOM   81    C  C     . VAL A  1 46  ? -46.315 -28.551 68.610 1.00 68.22  ? 46   VAL A C     1 
ATOM   82    O  O     . VAL A  1 46  ? -46.535 -28.544 67.387 1.00 68.04  ? 46   VAL A O     1 
ATOM   83    C  CB    . VAL A  1 46  ? -48.343 -27.872 69.969 1.00 68.76  ? 46   VAL A CB    1 
ATOM   84    C  CG1   . VAL A  1 46  ? -49.222 -27.481 68.784 1.00 68.72  ? 46   VAL A CG1   1 
ATOM   85    C  CG2   . VAL A  1 46  ? -49.211 -28.292 71.150 1.00 68.29  ? 46   VAL A CG2   1 
ATOM   86    N  N     . ALA A  1 47  ? -45.153 -28.173 69.159 1.00 67.06  ? 47   ALA A N     1 
ATOM   87    C  CA    . ALA A  1 47  ? -43.980 -27.805 68.365 1.00 66.00  ? 47   ALA A CA    1 
ATOM   88    C  C     . ALA A  1 47  ? -43.571 -28.974 67.488 1.00 65.48  ? 47   ALA A C     1 
ATOM   89    O  O     . ALA A  1 47  ? -43.500 -28.843 66.263 1.00 65.44  ? 47   ALA A O     1 
ATOM   90    C  CB    . ALA A  1 47  ? -42.841 -27.398 69.257 1.00 65.82  ? 47   ALA A CB    1 
ATOM   91    N  N     . LEU A  1 48  ? -43.318 -30.113 68.129 1.00 64.99  ? 48   LEU A N     1 
ATOM   92    C  CA    . LEU A  1 48  ? -43.026 -31.380 67.453 1.00 64.59  ? 48   LEU A CA    1 
ATOM   93    C  C     . LEU A  1 48  ? -44.069 -31.750 66.390 1.00 64.10  ? 48   LEU A C     1 
ATOM   94    O  O     . LEU A  1 48  ? -43.730 -32.189 65.295 1.00 63.95  ? 48   LEU A O     1 
ATOM   95    C  CB    . LEU A  1 48  ? -42.926 -32.493 68.494 1.00 64.63  ? 48   LEU A CB    1 
ATOM   96    C  CG    . LEU A  1 48  ? -41.589 -33.001 69.035 1.00 65.38  ? 48   LEU A CG    1 
ATOM   97    C  CD1   . LEU A  1 48  ? -40.400 -32.057 68.817 1.00 66.20  ? 48   LEU A CD1   1 
ATOM   98    C  CD2   . LEU A  1 48  ? -41.779 -33.302 70.506 1.00 66.64  ? 48   LEU A CD2   1 
ATOM   99    N  N     . ARG A  1 49  ? -45.335 -31.550 66.729 1.00 63.67  ? 49   ARG A N     1 
ATOM   100   C  CA    . ARG A  1 49  ? -46.457 -31.820 65.839 1.00 63.43  ? 49   ARG A CA    1 
ATOM   101   C  C     . ARG A  1 49  ? -46.413 -30.982 64.559 1.00 63.02  ? 49   ARG A C     1 
ATOM   102   O  O     . ARG A  1 49  ? -46.777 -31.458 63.469 1.00 62.84  ? 49   ARG A O     1 
ATOM   103   C  CB    . ARG A  1 49  ? -47.750 -31.549 66.600 1.00 63.59  ? 49   ARG A CB    1 
ATOM   104   C  CG    . ARG A  1 49  ? -48.990 -32.095 65.966 1.00 64.74  ? 49   ARG A CG    1 
ATOM   105   C  CD    . ARG A  1 49  ? -49.864 -32.695 67.031 1.00 66.70  ? 49   ARG A CD    1 
ATOM   106   N  NE    . ARG A  1 49  ? -50.633 -31.694 67.760 1.00 67.72  ? 49   ARG A NE    1 
ATOM   107   C  CZ    . ARG A  1 49  ? -50.920 -31.778 69.054 1.00 68.40  ? 49   ARG A CZ    1 
ATOM   108   N  NH1   . ARG A  1 49  ? -50.489 -32.808 69.785 1.00 67.43  ? 49   ARG A NH1   1 
ATOM   109   N  NH2   . ARG A  1 49  ? -51.622 -30.810 69.618 1.00 69.57  ? 49   ARG A NH2   1 
ATOM   110   N  N     . GLU A  1 50  ? -45.987 -29.730 64.714 1.00 62.47  ? 50   GLU A N     1 
ATOM   111   C  CA    . GLU A  1 50  ? -45.854 -28.788 63.616 1.00 61.88  ? 50   GLU A CA    1 
ATOM   112   C  C     . GLU A  1 50  ? -44.650 -29.132 62.748 1.00 61.35  ? 50   GLU A C     1 
ATOM   113   O  O     . GLU A  1 50  ? -44.757 -29.169 61.516 1.00 61.30  ? 50   GLU A O     1 
ATOM   114   C  CB    . GLU A  1 50  ? -45.724 -27.372 64.155 1.00 62.12  ? 50   GLU A CB    1 
ATOM   115   C  CG    . GLU A  1 50  ? -46.988 -26.816 64.798 1.00 63.17  ? 50   GLU A CG    1 
ATOM   116   C  CD    . GLU A  1 50  ? -46.739 -25.520 65.548 1.00 65.07  ? 50   GLU A CD    1 
ATOM   117   O  OE1   . GLU A  1 50  ? -45.819 -24.764 65.162 1.00 66.79  ? 50   GLU A OE1   1 
ATOM   118   O  OE2   . GLU A  1 50  ? -47.459 -25.249 66.534 1.00 67.28  ? 50   GLU A OE2   1 
ATOM   119   N  N     . ILE A  1 51  ? -43.510 -29.395 63.386 1.00 60.56  ? 51   ILE A N     1 
ATOM   120   C  CA    . ILE A  1 51  ? -42.319 -29.878 62.673 1.00 59.74  ? 51   ILE A CA    1 
ATOM   121   C  C     . ILE A  1 51  ? -42.693 -31.009 61.735 1.00 59.83  ? 51   ILE A C     1 
ATOM   122   O  O     . ILE A  1 51  ? -42.323 -30.980 60.570 1.00 59.74  ? 51   ILE A O     1 
ATOM   123   C  CB    . ILE A  1 51  ? -41.202 -30.357 63.635 1.00 59.78  ? 51   ILE A CB    1 
ATOM   124   C  CG1   . ILE A  1 51  ? -40.674 -29.191 64.487 1.00 59.03  ? 51   ILE A CG1   1 
ATOM   125   C  CG2   . ILE A  1 51  ? -40.075 -31.004 62.855 1.00 59.22  ? 51   ILE A CG2   1 
ATOM   126   C  CD1   . ILE A  1 51  ? -39.810 -29.616 65.652 1.00 59.10  ? 51   ILE A CD1   1 
ATOM   127   N  N     . ARG A  1 52  ? -43.444 -31.989 62.247 1.00 60.20  ? 52   ARG A N     1 
ATOM   128   C  CA    . ARG A  1 52  ? -43.912 -33.140 61.460 1.00 60.49  ? 52   ARG A CA    1 
ATOM   129   C  C     . ARG A  1 52  ? -44.870 -32.735 60.344 1.00 59.93  ? 52   ARG A C     1 
ATOM   130   O  O     . ARG A  1 52  ? -44.739 -33.203 59.220 1.00 59.99  ? 52   ARG A O     1 
ATOM   131   C  CB    . ARG A  1 52  ? -44.536 -34.223 62.364 1.00 60.53  ? 52   ARG A CB    1 
ATOM   132   C  CG    . ARG A  1 52  ? -43.537 -34.832 63.340 1.00 61.86  ? 52   ARG A CG    1 
ATOM   133   C  CD    . ARG A  1 52  ? -43.953 -36.176 63.937 1.00 62.21  ? 52   ARG A CD    1 
ATOM   134   N  NE    . ARG A  1 52  ? -43.146 -36.454 65.138 1.00 65.81  ? 52   ARG A NE    1 
ATOM   135   C  CZ    . ARG A  1 52  ? -43.591 -36.335 66.395 1.00 66.57  ? 52   ARG A CZ    1 
ATOM   136   N  NH1   . ARG A  1 52  ? -44.860 -35.983 66.633 1.00 66.89  ? 52   ARG A NH1   1 
ATOM   137   N  NH2   . ARG A  1 52  ? -42.774 -36.578 67.417 1.00 64.87  ? 52   ARG A NH2   1 
ATOM   138   N  N     . ARG A  1 53  ? -45.817 -31.859 60.661 1.00 60.09  ? 53   ARG A N     1 
ATOM   139   C  CA    . ARG A  1 53  ? -46.764 -31.318 59.683 1.00 60.45  ? 53   ARG A CA    1 
ATOM   140   C  C     . ARG A  1 53  ? -46.093 -30.547 58.558 1.00 60.30  ? 53   ARG A C     1 
ATOM   141   O  O     . ARG A  1 53  ? -46.385 -30.785 57.384 1.00 60.43  ? 53   ARG A O     1 
ATOM   142   C  CB    . ARG A  1 53  ? -47.771 -30.390 60.364 1.00 60.72  ? 53   ARG A CB    1 
ATOM   143   C  CG    . ARG A  1 53  ? -48.832 -29.862 59.430 1.00 61.75  ? 53   ARG A CG    1 
ATOM   144   C  CD    . ARG A  1 53  ? -49.644 -28.779 60.088 1.00 65.66  ? 53   ARG A CD    1 
ATOM   145   N  NE    . ARG A  1 53  ? -50.557 -28.153 59.134 1.00 68.97  ? 53   ARG A NE    1 
ATOM   146   C  CZ    . ARG A  1 53  ? -51.221 -27.018 59.355 1.00 71.26  ? 53   ARG A CZ    1 
ATOM   147   N  NH1   . ARG A  1 53  ? -51.069 -26.364 60.509 1.00 71.56  ? 53   ARG A NH1   1 
ATOM   148   N  NH2   . ARG A  1 53  ? -52.041 -26.530 58.421 1.00 71.18  ? 53   ARG A NH2   1 
ATOM   149   N  N     . TYR A  1 54  ? -45.208 -29.617 58.920 1.00 60.12  ? 54   TYR A N     1 
ATOM   150   C  CA    . TYR A  1 54  ? -44.559 -28.756 57.932 1.00 59.69  ? 54   TYR A CA    1 
ATOM   151   C  C     . TYR A  1 54  ? -43.451 -29.431 57.137 1.00 59.65  ? 54   TYR A C     1 
ATOM   152   O  O     . TYR A  1 54  ? -43.178 -29.016 56.017 1.00 59.94  ? 54   TYR A O     1 
ATOM   153   C  CB    . TYR A  1 54  ? -44.103 -27.430 58.551 1.00 59.52  ? 54   TYR A CB    1 
ATOM   154   C  CG    . TYR A  1 54  ? -45.267 -26.608 59.000 1.00 58.97  ? 54   TYR A CG    1 
ATOM   155   C  CD1   . TYR A  1 54  ? -45.496 -26.357 60.358 1.00 59.51  ? 54   TYR A CD1   1 
ATOM   156   C  CD2   . TYR A  1 54  ? -46.179 -26.122 58.076 1.00 57.49  ? 54   TYR A CD2   1 
ATOM   157   C  CE1   . TYR A  1 54  ? -46.611 -25.618 60.776 1.00 58.99  ? 54   TYR A CE1   1 
ATOM   158   C  CE2   . TYR A  1 54  ? -47.274 -25.390 58.473 1.00 58.24  ? 54   TYR A CE2   1 
ATOM   159   C  CZ    . TYR A  1 54  ? -47.494 -25.146 59.818 1.00 59.18  ? 54   TYR A CZ    1 
ATOM   160   O  OH    . TYR A  1 54  ? -48.598 -24.406 60.179 1.00 60.29  ? 54   TYR A OH    1 
ATOM   161   N  N     . GLN A  1 55  ? -42.827 -30.467 57.686 1.00 59.54  ? 55   GLN A N     1 
ATOM   162   C  CA    . GLN A  1 55  ? -41.822 -31.211 56.920 1.00 60.02  ? 55   GLN A CA    1 
ATOM   163   C  C     . GLN A  1 55  ? -42.491 -32.167 55.930 1.00 60.47  ? 55   GLN A C     1 
ATOM   164   O  O     . GLN A  1 55  ? -41.889 -32.617 54.958 1.00 60.55  ? 55   GLN A O     1 
ATOM   165   C  CB    . GLN A  1 55  ? -40.834 -31.934 57.843 1.00 59.57  ? 55   GLN A CB    1 
ATOM   166   C  CG    . GLN A  1 55  ? -39.946 -30.993 58.650 1.00 59.37  ? 55   GLN A CG    1 
ATOM   167   C  CD    . GLN A  1 55  ? -38.803 -31.688 59.364 1.00 60.56  ? 55   GLN A CD    1 
ATOM   168   O  OE1   . GLN A  1 55  ? -38.819 -32.902 59.576 1.00 63.07  ? 55   GLN A OE1   1 
ATOM   169   N  NE2   . GLN A  1 55  ? -37.805 -30.916 59.751 1.00 61.53  ? 55   GLN A NE2   1 
ATOM   170   N  N     . LYS A  1 56  ? -43.759 -32.453 56.182 1.00 61.46  ? 56   LYS A N     1 
ATOM   171   C  CA    . LYS A  1 56  ? -44.537 -33.339 55.343 1.00 62.38  ? 56   LYS A CA    1 
ATOM   172   C  C     . LYS A  1 56  ? -45.030 -32.615 54.075 1.00 62.50  ? 56   LYS A C     1 
ATOM   173   O  O     . LYS A  1 56  ? -45.108 -33.211 52.993 1.00 62.52  ? 56   LYS A O     1 
ATOM   174   C  CB    . LYS A  1 56  ? -45.701 -33.899 56.162 1.00 62.81  ? 56   LYS A CB    1 
ATOM   175   C  CG    . LYS A  1 56  ? -46.353 -35.131 55.555 1.00 65.51  ? 56   LYS A CG    1 
ATOM   176   C  CD    . LYS A  1 56  ? -46.397 -36.296 56.533 1.00 69.12  ? 56   LYS A CD    1 
ATOM   177   C  CE    . LYS A  1 56  ? -47.623 -36.244 57.456 1.00 72.10  ? 56   LYS A CE    1 
ATOM   178   N  NZ    . LYS A  1 56  ? -47.870 -37.575 58.126 1.00 72.81  ? 56   LYS A NZ    1 
ATOM   179   N  N     . SER A  1 57  ? -45.348 -31.328 54.216 1.00 62.50  ? 57   SER A N     1 
ATOM   180   C  CA    . SER A  1 57  ? -45.877 -30.538 53.114 1.00 62.51  ? 57   SER A CA    1 
ATOM   181   C  C     . SER A  1 57  ? -44.821 -29.701 52.380 1.00 62.71  ? 57   SER A C     1 
ATOM   182   O  O     . SER A  1 57  ? -43.624 -29.739 52.707 1.00 62.93  ? 57   SER A O     1 
ATOM   183   C  CB    . SER A  1 57  ? -47.032 -29.667 53.596 1.00 62.49  ? 57   SER A CB    1 
ATOM   184   O  OG    . SER A  1 57  ? -46.645 -28.832 54.667 1.00 63.49  ? 57   SER A OG    1 
ATOM   185   N  N     . THR A  1 58  ? -45.283 -28.958 51.372 1.00 62.59  ? 58   THR A N     1 
ATOM   186   C  CA    . THR A  1 58  ? -44.417 -28.211 50.466 1.00 62.10  ? 58   THR A CA    1 
ATOM   187   C  C     . THR A  1 58  ? -44.965 -26.812 50.164 1.00 62.37  ? 58   THR A C     1 
ATOM   188   O  O     . THR A  1 58  ? -44.309 -26.012 49.490 1.00 62.79  ? 58   THR A O     1 
ATOM   189   C  CB    . THR A  1 58  ? -44.185 -28.977 49.148 1.00 61.85  ? 58   THR A CB    1 
ATOM   190   O  OG1   . THR A  1 58  ? -45.414 -29.106 48.444 1.00 61.35  ? 58   THR A OG1   1 
ATOM   191   C  CG2   . THR A  1 58  ? -43.655 -30.354 49.422 1.00 61.43  ? 58   THR A CG2   1 
ATOM   192   N  N     . GLU A  1 59  ? -46.163 -26.524 50.670 1.00 62.41  ? 59   GLU A N     1 
ATOM   193   C  CA    . GLU A  1 59  ? -46.819 -25.221 50.466 1.00 62.37  ? 59   GLU A CA    1 
ATOM   194   C  C     . GLU A  1 59  ? -45.976 -24.073 51.048 1.00 61.74  ? 59   GLU A C     1 
ATOM   195   O  O     . GLU A  1 59  ? -45.284 -24.240 52.059 1.00 61.53  ? 59   GLU A O     1 
ATOM   196   C  CB    . GLU A  1 59  ? -48.273 -25.231 51.007 1.00 62.31  ? 59   GLU A CB    1 
ATOM   197   C  CG    . GLU A  1 59  ? -48.484 -24.937 52.517 1.00 64.97  ? 59   GLU A CG    1 
ATOM   198   C  CD    . GLU A  1 59  ? -48.092 -26.093 53.458 1.00 70.12  ? 59   GLU A CD    1 
ATOM   199   O  OE1   . GLU A  1 59  ? -48.552 -26.100 54.631 1.00 71.37  ? 59   GLU A OE1   1 
ATOM   200   O  OE2   . GLU A  1 59  ? -47.321 -26.993 53.044 1.00 70.82  ? 59   GLU A OE2   1 
ATOM   201   N  N     . LEU A  1 60  ? -46.014 -22.925 50.380 1.00 61.11  ? 60   LEU A N     1 
ATOM   202   C  CA    . LEU A  1 60  ? -45.317 -21.744 50.873 1.00 60.77  ? 60   LEU A CA    1 
ATOM   203   C  C     . LEU A  1 60  ? -45.953 -21.252 52.173 1.00 60.70  ? 60   LEU A C     1 
ATOM   204   O  O     . LEU A  1 60  ? -47.172 -21.295 52.325 1.00 60.75  ? 60   LEU A O     1 
ATOM   205   C  CB    . LEU A  1 60  ? -45.271 -20.641 49.808 1.00 60.53  ? 60   LEU A CB    1 
ATOM   206   C  CG    . LEU A  1 60  ? -44.376 -20.870 48.579 1.00 59.97  ? 60   LEU A CG    1 
ATOM   207   C  CD1   . LEU A  1 60  ? -44.481 -19.700 47.631 1.00 59.14  ? 60   LEU A CD1   1 
ATOM   208   C  CD2   . LEU A  1 60  ? -42.918 -21.149 48.941 1.00 58.09  ? 60   LEU A CD2   1 
ATOM   209   N  N     . LEU A  1 61  ? -45.110 -20.784 53.091 1.00 60.54  ? 61   LEU A N     1 
ATOM   210   C  CA    . LEU A  1 61  ? -45.473 -20.595 54.485 1.00 60.22  ? 61   LEU A CA    1 
ATOM   211   C  C     . LEU A  1 61  ? -45.567 -19.124 54.880 1.00 60.85  ? 61   LEU A C     1 
ATOM   212   O  O     . LEU A  1 61  ? -46.086 -18.792 55.957 1.00 61.29  ? 61   LEU A O     1 
ATOM   213   C  CB    . LEU A  1 61  ? -44.472 -21.328 55.392 1.00 60.00  ? 61   LEU A CB    1 
ATOM   214   C  CG    . LEU A  1 61  ? -44.309 -22.850 55.252 1.00 58.74  ? 61   LEU A CG    1 
ATOM   215   C  CD1   . LEU A  1 61  ? -43.222 -23.368 56.154 1.00 57.52  ? 61   LEU A CD1   1 
ATOM   216   C  CD2   . LEU A  1 61  ? -45.606 -23.588 55.528 1.00 56.86  ? 61   LEU A CD2   1 
ATOM   217   N  N     . ILE A  1 62  ? -45.047 -18.245 54.030 1.00 61.08  ? 62   ILE A N     1 
ATOM   218   C  CA    . ILE A  1 62  ? -45.324 -16.819 54.156 1.00 61.36  ? 62   ILE A CA    1 
ATOM   219   C  C     . ILE A  1 62  ? -46.514 -16.516 53.252 1.00 61.84  ? 62   ILE A C     1 
ATOM   220   O  O     . ILE A  1 62  ? -46.605 -17.054 52.135 1.00 62.12  ? 62   ILE A O     1 
ATOM   221   C  CB    . ILE A  1 62  ? -44.119 -15.938 53.739 1.00 61.39  ? 62   ILE A CB    1 
ATOM   222   C  CG1   . ILE A  1 62  ? -42.848 -16.344 54.481 1.00 60.24  ? 62   ILE A CG1   1 
ATOM   223   C  CG2   . ILE A  1 62  ? -44.414 -14.442 53.961 1.00 61.01  ? 62   ILE A CG2   1 
ATOM   224   C  CD1   . ILE A  1 62  ? -41.606 -15.891 53.770 1.00 59.40  ? 62   ILE A CD1   1 
ATOM   225   N  N     . ARG A  1 63  ? -47.429 -15.678 53.741 1.00 62.28  ? 63   ARG A N     1 
ATOM   226   C  CA    . ARG A  1 63  ? -48.570 -15.198 52.947 1.00 62.75  ? 63   ARG A CA    1 
ATOM   227   C  C     . ARG A  1 63  ? -48.093 -14.316 51.801 1.00 62.77  ? 63   ARG A C     1 
ATOM   228   O  O     . ARG A  1 63  ? -47.165 -13.519 51.963 1.00 62.57  ? 63   ARG A O     1 
ATOM   229   C  CB    . ARG A  1 63  ? -49.561 -14.434 53.822 1.00 62.90  ? 63   ARG A CB    1 
ATOM   230   C  CG    . ARG A  1 63  ? -50.070 -15.231 54.995 1.00 64.61  ? 63   ARG A CG    1 
ATOM   231   C  CD    . ARG A  1 63  ? -50.336 -14.317 56.166 1.00 68.77  ? 63   ARG A CD    1 
ATOM   232   N  NE    . ARG A  1 63  ? -51.759 -14.003 56.337 1.00 71.68  ? 63   ARG A NE    1 
ATOM   233   C  CZ    . ARG A  1 63  ? -52.224 -13.035 57.136 1.00 73.33  ? 63   ARG A CZ    1 
ATOM   234   N  NH1   . ARG A  1 63  ? -51.379 -12.251 57.823 1.00 72.68  ? 63   ARG A NH1   1 
ATOM   235   N  NH2   . ARG A  1 63  ? -53.538 -12.832 57.229 1.00 73.28  ? 63   ARG A NH2   1 
ATOM   236   N  N     . LYS A  1 64  ? -48.739 -14.472 50.650 1.00 63.05  ? 64   LYS A N     1 
ATOM   237   C  CA    . LYS A  1 64  ? -48.253 -13.929 49.379 1.00 63.82  ? 64   LYS A CA    1 
ATOM   238   C  C     . LYS A  1 64  ? -48.129 -12.411 49.310 1.00 63.73  ? 64   LYS A C     1 
ATOM   239   O  O     . LYS A  1 64  ? -47.127 -11.894 48.814 1.00 64.16  ? 64   LYS A O     1 
ATOM   240   C  CB    . LYS A  1 64  ? -49.130 -14.437 48.226 1.00 64.31  ? 64   LYS A CB    1 
ATOM   241   C  CG    . LYS A  1 64  ? -48.842 -15.880 47.833 1.00 66.40  ? 64   LYS A CG    1 
ATOM   242   C  CD    . LYS A  1 64  ? -50.026 -16.513 47.147 1.00 70.99  ? 64   LYS A CD    1 
ATOM   243   C  CE    . LYS A  1 64  ? -49.577 -17.544 46.107 1.00 73.64  ? 64   LYS A CE    1 
ATOM   244   N  NZ    . LYS A  1 64  ? -49.486 -16.923 44.738 1.00 75.05  ? 64   LYS A NZ    1 
ATOM   245   N  N     . LEU A  1 65  ? -49.148 -11.708 49.800 1.00 63.67  ? 65   LEU A N     1 
ATOM   246   C  CA    . LEU A  1 65  ? -49.255 -10.260 49.641 1.00 63.14  ? 65   LEU A CA    1 
ATOM   247   C  C     . LEU A  1 65  ? -48.188 -9.509  50.432 1.00 62.48  ? 65   LEU A C     1 
ATOM   248   O  O     . LEU A  1 65  ? -47.509 -8.664  49.848 1.00 62.86  ? 65   LEU A O     1 
ATOM   249   C  CB    . LEU A  1 65  ? -50.677 -9.755  49.972 1.00 63.36  ? 65   LEU A CB    1 
ATOM   250   C  CG    . LEU A  1 65  ? -50.939 -8.233  50.006 1.00 63.80  ? 65   LEU A CG    1 
ATOM   251   C  CD1   . LEU A  1 65  ? -51.047 -7.621  48.608 1.00 62.53  ? 65   LEU A CD1   1 
ATOM   252   C  CD2   . LEU A  1 65  ? -52.186 -7.901  50.845 1.00 63.70  ? 65   LEU A CD2   1 
ATOM   253   N  N     . PRO A  1 66  ? -48.033 -9.806  51.751 1.00 61.66  ? 66   PRO A N     1 
ATOM   254   C  CA    . PRO A  1 66  ? -46.957 -9.180  52.527 1.00 61.05  ? 66   PRO A CA    1 
ATOM   255   C  C     . PRO A  1 66  ? -45.616 -9.343  51.825 1.00 61.05  ? 66   PRO A C     1 
ATOM   256   O  O     . PRO A  1 66  ? -44.791 -8.416  51.819 1.00 61.41  ? 66   PRO A O     1 
ATOM   257   C  CB    . PRO A  1 66  ? -46.946 -9.990  53.820 1.00 60.84  ? 66   PRO A CB    1 
ATOM   258   C  CG    . PRO A  1 66  ? -48.316 -10.471 53.977 1.00 60.91  ? 66   PRO A CG    1 
ATOM   259   C  CD    . PRO A  1 66  ? -48.837 -10.718 52.590 1.00 61.43  ? 66   PRO A CD    1 
ATOM   260   N  N     . PHE A  1 67  ? -45.421 -10.521 51.229 1.00 60.59  ? 67   PHE A N     1 
ATOM   261   C  CA    . PHE A  1 67  ? -44.205 -10.847 50.534 1.00 59.86  ? 67   PHE A CA    1 
ATOM   262   C  C     . PHE A  1 67  ? -44.077 -10.024 49.271 1.00 60.10  ? 67   PHE A C     1 
ATOM   263   O  O     . PHE A  1 67  ? -42.994 -9.511  48.985 1.00 60.12  ? 67   PHE A O     1 
ATOM   264   C  CB    . PHE A  1 67  ? -44.129 -12.336 50.198 1.00 59.54  ? 67   PHE A CB    1 
ATOM   265   C  CG    . PHE A  1 67  ? -42.750 -12.775 49.801 1.00 58.77  ? 67   PHE A CG    1 
ATOM   266   C  CD1   . PHE A  1 67  ? -41.856 -13.240 50.757 1.00 57.59  ? 67   PHE A CD1   1 
ATOM   267   C  CD2   . PHE A  1 67  ? -42.323 -12.666 48.480 1.00 57.43  ? 67   PHE A CD2   1 
ATOM   268   C  CE1   . PHE A  1 67  ? -40.572 -13.607 50.389 1.00 57.21  ? 67   PHE A CE1   1 
ATOM   269   C  CE2   . PHE A  1 67  ? -41.043 -13.032 48.115 1.00 56.40  ? 67   PHE A CE2   1 
ATOM   270   C  CZ    . PHE A  1 67  ? -40.172 -13.499 49.064 1.00 57.11  ? 67   PHE A CZ    1 
ATOM   271   N  N     . GLN A  1 68  ? -45.182 -9.895  48.528 1.00 60.11  ? 68   GLN A N     1 
ATOM   272   C  CA    . GLN A  1 68  ? -45.220 -9.100  47.288 1.00 60.35  ? 68   GLN A CA    1 
ATOM   273   C  C     . GLN A  1 68  ? -44.906 -7.624  47.580 1.00 59.77  ? 68   GLN A C     1 
ATOM   274   O  O     . GLN A  1 68  ? -44.112 -6.997  46.880 1.00 59.64  ? 68   GLN A O     1 
ATOM   275   C  CB    . GLN A  1 68  ? -46.581 -9.252  46.593 1.00 60.03  ? 68   GLN A CB    1 
ATOM   276   C  CG    . GLN A  1 68  ? -46.520 -9.129  45.075 1.00 61.44  ? 68   GLN A CG    1 
ATOM   277   C  CD    . GLN A  1 68  ? -47.751 -9.700  44.367 1.00 62.03  ? 68   GLN A CD    1 
ATOM   278   O  OE1   . GLN A  1 68  ? -48.877 -9.567  44.859 1.00 65.57  ? 68   GLN A OE1   1 
ATOM   279   N  NE2   . GLN A  1 68  ? -47.544 -10.320 43.195 1.00 62.09  ? 68   GLN A NE2   1 
ATOM   280   N  N     . ARG A  1 69  ? -45.522 -7.095  48.634 1.00 59.76  ? 69   ARG A N     1 
ATOM   281   C  CA    . ARG A  1 69  ? -45.247 -5.749  49.139 1.00 60.08  ? 69   ARG A CA    1 
ATOM   282   C  C     . ARG A  1 69  ? -43.773 -5.517  49.422 1.00 59.65  ? 69   ARG A C     1 
ATOM   283   O  O     . ARG A  1 69  ? -43.178 -4.599  48.873 1.00 59.55  ? 69   ARG A O     1 
ATOM   284   C  CB    . ARG A  1 69  ? -46.049 -5.472  50.415 1.00 60.44  ? 69   ARG A CB    1 
ATOM   285   C  CG    . ARG A  1 69  ? -47.494 -5.043  50.189 1.00 61.79  ? 69   ARG A CG    1 
ATOM   286   C  CD    . ARG A  1 69  ? -47.993 -4.189  51.362 1.00 63.97  ? 69   ARG A CD    1 
ATOM   287   N  NE    . ARG A  1 69  ? -48.055 -4.938  52.618 1.00 64.50  ? 69   ARG A NE    1 
ATOM   288   C  CZ    . ARG A  1 69  ? -49.102 -5.665  53.005 1.00 65.12  ? 69   ARG A CZ    1 
ATOM   289   N  NH1   . ARG A  1 69  ? -50.188 -5.747  52.248 1.00 64.50  ? 69   ARG A NH1   1 
ATOM   290   N  NH2   . ARG A  1 69  ? -49.060 -6.318  54.155 1.00 66.22  ? 69   ARG A NH2   1 
ATOM   291   N  N     . LEU A  1 70  ? -43.194 -6.359  50.276 1.00 59.67  ? 70   LEU A N     1 
ATOM   292   C  CA    . LEU A  1 70  ? -41.778 -6.264  50.652 1.00 59.39  ? 70   LEU A CA    1 
ATOM   293   C  C     . LEU A  1 70  ? -40.844 -6.352  49.443 1.00 59.49  ? 70   LEU A C     1 
ATOM   294   O  O     . LEU A  1 70  ? -39.893 -5.582  49.330 1.00 59.82  ? 70   LEU A O     1 
ATOM   295   C  CB    . LEU A  1 70  ? -41.440 -7.355  51.666 1.00 59.23  ? 70   LEU A CB    1 
ATOM   296   C  CG    . LEU A  1 70  ? -40.016 -7.444  52.197 1.00 58.94  ? 70   LEU A CG    1 
ATOM   297   C  CD1   . LEU A  1 70  ? -39.681 -6.261  53.100 1.00 58.55  ? 70   LEU A CD1   1 
ATOM   298   C  CD2   . LEU A  1 70  ? -39.836 -8.760  52.916 1.00 56.24  ? 70   LEU A CD2   1 
ATOM   299   N  N     . VAL A  1 71  ? -41.121 -7.284  48.537 1.00 59.39  ? 71   VAL A N     1 
ATOM   300   C  CA    . VAL A  1 71  ? -40.354 -7.402  47.289 1.00 59.21  ? 71   VAL A CA    1 
ATOM   301   C  C     . VAL A  1 71  ? -40.334 -6.084  46.495 1.00 59.36  ? 71   VAL A C     1 
ATOM   302   O  O     . VAL A  1 71  ? -39.265 -5.536  46.228 1.00 59.42  ? 71   VAL A O     1 
ATOM   303   C  CB    . VAL A  1 71  ? -40.886 -8.573  46.422 1.00 59.02  ? 71   VAL A CB    1 
ATOM   304   C  CG1   . VAL A  1 71  ? -40.361 -8.494  44.989 1.00 58.43  ? 71   VAL A CG1   1 
ATOM   305   C  CG2   . VAL A  1 71  ? -40.544 -9.900  47.070 1.00 57.87  ? 71   VAL A CG2   1 
ATOM   306   N  N     . ARG A  1 72  ? -41.520 -5.588  46.133 1.00 59.59  ? 72   ARG A N     1 
ATOM   307   C  CA    . ARG A  1 72  ? -41.696 -4.304  45.430 1.00 59.64  ? 72   ARG A CA    1 
ATOM   308   C  C     . ARG A  1 72  ? -41.039 -3.113  46.127 1.00 59.59  ? 72   ARG A C     1 
ATOM   309   O  O     . ARG A  1 72  ? -40.435 -2.271  45.463 1.00 59.68  ? 72   ARG A O     1 
ATOM   310   C  CB    . ARG A  1 72  ? -43.181 -4.025  45.222 1.00 59.70  ? 72   ARG A CB    1 
ATOM   311   C  CG    . ARG A  1 72  ? -43.817 -4.984  44.242 1.00 60.79  ? 72   ARG A CG    1 
ATOM   312   C  CD    . ARG A  1 72  ? -45.287 -4.763  44.115 1.00 60.68  ? 72   ARG A CD    1 
ATOM   313   N  NE    . ARG A  1 72  ? -45.936 -5.974  43.634 1.00 60.58  ? 72   ARG A NE    1 
ATOM   314   C  CZ    . ARG A  1 72  ? -46.185 -6.241  42.356 1.00 59.81  ? 72   ARG A CZ    1 
ATOM   315   N  NH1   . ARG A  1 72  ? -45.850 -5.378  41.416 1.00 59.62  ? 72   ARG A NH1   1 
ATOM   316   N  NH2   . ARG A  1 72  ? -46.771 -7.382  42.023 1.00 59.47  ? 72   ARG A NH2   1 
ATOM   317   N  N     . GLU A  1 73  ? -41.154 -3.063  47.453 1.00 59.48  ? 73   GLU A N     1 
ATOM   318   C  CA    . GLU A  1 73  ? -40.515 -2.040  48.276 1.00 60.21  ? 73   GLU A CA    1 
ATOM   319   C  C     . GLU A  1 73  ? -38.977 -2.053  48.172 1.00 60.16  ? 73   GLU A C     1 
ATOM   320   O  O     . GLU A  1 73  ? -38.350 -0.989  48.062 1.00 60.51  ? 73   GLU A O     1 
ATOM   321   C  CB    . GLU A  1 73  ? -40.949 -2.188  49.737 1.00 60.35  ? 73   GLU A CB    1 
ATOM   322   C  CG    . GLU A  1 73  ? -40.492 -1.057  50.632 1.00 62.96  ? 73   GLU A CG    1 
ATOM   323   C  CD    . GLU A  1 73  ? -40.059 -1.533  52.005 1.00 66.21  ? 73   GLU A CD    1 
ATOM   324   O  OE1   . GLU A  1 73  ? -40.933 -1.795  52.859 1.00 66.57  ? 73   GLU A OE1   1 
ATOM   325   O  OE2   . GLU A  1 73  ? -38.830 -1.642  52.228 1.00 68.50  ? 73   GLU A OE2   1 
ATOM   326   N  N     . ILE A  1 74  ? -38.381 -3.250  48.217 1.00 59.89  ? 74   ILE A N     1 
ATOM   327   C  CA    . ILE A  1 74  ? -36.934 -3.419  48.044 1.00 59.26  ? 74   ILE A CA    1 
ATOM   328   C  C     . ILE A  1 74  ? -36.533 -3.082  46.610 1.00 59.37  ? 74   ILE A C     1 
ATOM   329   O  O     . ILE A  1 74  ? -35.544 -2.397  46.403 1.00 59.22  ? 74   ILE A O     1 
ATOM   330   C  CB    . ILE A  1 74  ? -36.446 -4.848  48.474 1.00 59.28  ? 74   ILE A CB    1 
ATOM   331   C  CG1   . ILE A  1 74  ? -36.416 -4.967  50.000 1.00 58.63  ? 74   ILE A CG1   1 
ATOM   332   C  CG2   . ILE A  1 74  ? -35.058 -5.169  47.914 1.00 58.26  ? 74   ILE A CG2   1 
ATOM   333   C  CD1   . ILE A  1 74  ? -36.479 -6.377  50.513 1.00 58.62  ? 74   ILE A CD1   1 
ATOM   334   N  N     . ALA A  1 75  ? -37.323 -3.529  45.634 1.00 59.96  ? 75   ALA A N     1 
ATOM   335   C  CA    . ALA A  1 75  ? -37.038 -3.266  44.209 1.00 60.92  ? 75   ALA A CA    1 
ATOM   336   C  C     . ALA A  1 75  ? -37.046 -1.778  43.841 1.00 61.79  ? 75   ALA A C     1 
ATOM   337   O  O     . ALA A  1 75  ? -36.196 -1.319  43.073 1.00 61.58  ? 75   ALA A O     1 
ATOM   338   C  CB    . ALA A  1 75  ? -37.994 -4.029  43.326 1.00 60.36  ? 75   ALA A CB    1 
ATOM   339   N  N     . GLN A  1 76  ? -38.015 -1.057  44.413 1.00 63.33  ? 76   GLN A N     1 
ATOM   340   C  CA    . GLN A  1 76  ? -38.217 0.389   44.262 1.00 64.73  ? 76   GLN A CA    1 
ATOM   341   C  C     . GLN A  1 76  ? -36.962 1.226   44.506 1.00 65.00  ? 76   GLN A C     1 
ATOM   342   O  O     . GLN A  1 76  ? -36.784 2.243   43.847 1.00 65.66  ? 76   GLN A O     1 
ATOM   343   C  CB    . GLN A  1 76  ? -39.367 0.849   45.177 1.00 65.16  ? 76   GLN A CB    1 
ATOM   344   C  CG    . GLN A  1 76  ? -39.823 2.315   45.029 1.00 67.11  ? 76   GLN A CG    1 
ATOM   345   C  CD    . GLN A  1 76  ? -40.672 2.586   43.785 1.00 70.26  ? 76   GLN A CD    1 
ATOM   346   O  OE1   . GLN A  1 76  ? -41.184 1.660   43.143 1.00 72.01  ? 76   GLN A OE1   1 
ATOM   347   N  NE2   . GLN A  1 76  ? -40.827 3.868   43.443 1.00 69.90  ? 76   GLN A NE2   1 
ATOM   348   N  N     . ASP A  1 77  ? -36.095 0.797   45.427 1.00 65.39  ? 77   ASP A N     1 
ATOM   349   C  CA    . ASP A  1 77  ? -34.818 1.483   45.687 1.00 65.79  ? 77   ASP A CA    1 
ATOM   350   C  C     . ASP A  1 77  ? -33.757 1.267   44.609 1.00 65.60  ? 77   ASP A C     1 
ATOM   351   O  O     . ASP A  1 77  ? -32.749 1.972   44.599 1.00 65.77  ? 77   ASP A O     1 
ATOM   352   C  CB    . ASP A  1 77  ? -34.232 1.085   47.047 1.00 66.20  ? 77   ASP A CB    1 
ATOM   353   C  CG    . ASP A  1 77  ? -35.219 1.270   48.194 1.00 69.67  ? 77   ASP A CG    1 
ATOM   354   O  OD1   . ASP A  1 77  ? -35.183 0.451   49.147 1.00 72.79  ? 77   ASP A OD1   1 
ATOM   355   O  OD2   . ASP A  1 77  ? -36.038 2.229   48.152 1.00 73.08  ? 77   ASP A OD2   1 
ATOM   356   N  N     . PHE A  1 78  ? -33.959 0.291   43.723 1.00 65.42  ? 78   PHE A N     1 
ATOM   357   C  CA    . PHE A  1 78  ? -33.005 0.019   42.637 1.00 65.22  ? 78   PHE A CA    1 
ATOM   358   C  C     . PHE A  1 78  ? -33.526 0.615   41.337 1.00 65.58  ? 78   PHE A C     1 
ATOM   359   O  O     . PHE A  1 78  ? -32.747 1.032   40.475 1.00 65.59  ? 78   PHE A O     1 
ATOM   360   C  CB    . PHE A  1 78  ? -32.711 -1.501  42.470 1.00 64.90  ? 78   PHE A CB    1 
ATOM   361   C  CG    . PHE A  1 78  ? -32.209 -2.188  43.739 1.00 64.16  ? 78   PHE A CG    1 
ATOM   362   C  CD1   . PHE A  1 78  ? -32.912 -3.259  44.291 1.00 63.20  ? 78   PHE A CD1   1 
ATOM   363   C  CD2   . PHE A  1 78  ? -31.046 -1.751  44.385 1.00 62.80  ? 78   PHE A CD2   1 
ATOM   364   C  CE1   . PHE A  1 78  ? -32.473 -3.883  45.467 1.00 62.21  ? 78   PHE A CE1   1 
ATOM   365   C  CE2   . PHE A  1 78  ? -30.597 -2.369  45.555 1.00 62.09  ? 78   PHE A CE2   1 
ATOM   366   C  CZ    . PHE A  1 78  ? -31.314 -3.434  46.100 1.00 62.53  ? 78   PHE A CZ    1 
ATOM   367   N  N     . LYS A  1 79  ? -34.851 0.638   41.200 1.00 66.06  ? 79   LYS A N     1 
ATOM   368   C  CA    . LYS A  1 79  ? -35.517 1.256   40.052 1.00 66.67  ? 79   LYS A CA    1 
ATOM   369   C  C     . LYS A  1 79  ? -37.002 1.521   40.334 1.00 66.83  ? 79   LYS A C     1 
ATOM   370   O  O     . LYS A  1 79  ? -37.702 0.704   40.936 1.00 67.01  ? 79   LYS A O     1 
ATOM   371   C  CB    . LYS A  1 79  ? -35.352 0.412   38.790 1.00 66.64  ? 79   LYS A CB    1 
ATOM   372   C  CG    . LYS A  1 79  ? -35.425 1.206   37.500 1.00 68.24  ? 79   LYS A CG    1 
ATOM   373   C  CD    . LYS A  1 79  ? -35.771 0.305   36.325 1.00 71.31  ? 79   LYS A CD    1 
ATOM   374   C  CE    . LYS A  1 79  ? -36.018 1.110   35.047 1.00 74.22  ? 79   LYS A CE    1 
ATOM   375   N  NZ    . LYS A  1 79  ? -34.806 1.175   34.159 1.00 74.68  ? 79   LYS A NZ    1 
ATOM   376   N  N     . THR A  1 80  ? -37.471 2.677   39.881 1.00 67.27  ? 80   THR A N     1 
ATOM   377   C  CA    . THR A  1 80  ? -38.839 3.120   40.138 1.00 67.22  ? 80   THR A CA    1 
ATOM   378   C  C     . THR A  1 80  ? -39.765 2.677   39.017 1.00 67.15  ? 80   THR A C     1 
ATOM   379   O  O     . THR A  1 80  ? -39.322 2.448   37.881 1.00 67.00  ? 80   THR A O     1 
ATOM   380   C  CB    . THR A  1 80  ? -38.915 4.663   40.300 1.00 67.24  ? 80   THR A CB    1 
ATOM   381   O  OG1   . THR A  1 80  ? -38.205 5.289   39.226 1.00 67.12  ? 80   THR A OG1   1 
ATOM   382   C  CG2   . THR A  1 80  ? -38.302 5.104   41.626 1.00 66.87  ? 80   THR A CG2   1 
ATOM   383   N  N     . ASP A  1 81  ? -41.048 2.560   39.357 1.00 67.13  ? 81   ASP A N     1 
ATOM   384   C  CA    . ASP A  1 81  ? -42.104 2.179   38.419 1.00 67.18  ? 81   ASP A CA    1 
ATOM   385   C  C     . ASP A  1 81  ? -41.783 0.835   37.746 1.00 66.96  ? 81   ASP A C     1 
ATOM   386   O  O     . ASP A  1 81  ? -41.647 0.727   36.513 1.00 67.20  ? 81   ASP A O     1 
ATOM   387   C  CB    . ASP A  1 81  ? -42.360 3.301   37.402 1.00 67.25  ? 81   ASP A CB    1 
ATOM   388   C  CG    . ASP A  1 81  ? -43.773 3.280   36.835 1.00 68.62  ? 81   ASP A CG    1 
ATOM   389   O  OD1   . ASP A  1 81  ? -44.723 2.812   37.522 1.00 68.54  ? 81   ASP A OD1   1 
ATOM   390   O  OD2   . ASP A  1 81  ? -43.924 3.758   35.685 1.00 70.72  ? 81   ASP A OD2   1 
ATOM   391   N  N     . LEU A  1 82  ? -41.642 -0.187  38.588 1.00 66.30  ? 82   LEU A N     1 
ATOM   392   C  CA    . LEU A  1 82  ? -41.384 -1.543  38.120 1.00 65.36  ? 82   LEU A CA    1 
ATOM   393   C  C     . LEU A  1 82  ? -42.669 -2.325  38.184 1.00 64.87  ? 82   LEU A C     1 
ATOM   394   O  O     . LEU A  1 82  ? -43.512 -2.083  39.041 1.00 64.62  ? 82   LEU A O     1 
ATOM   395   C  CB    . LEU A  1 82  ? -40.300 -2.239  38.963 1.00 64.99  ? 82   LEU A CB    1 
ATOM   396   C  CG    . LEU A  1 82  ? -38.820 -1.957  38.673 1.00 63.78  ? 82   LEU A CG    1 
ATOM   397   C  CD1   . LEU A  1 82  ? -37.948 -2.701  39.665 1.00 61.76  ? 82   LEU A CD1   1 
ATOM   398   C  CD2   . LEU A  1 82  ? -38.417 -2.297  37.242 1.00 61.77  ? 82   LEU A CD2   1 
ATOM   399   N  N     . ARG A  1 83  ? -42.824 -3.244  37.249 1.00 64.52  ? 83   ARG A N     1 
ATOM   400   C  CA    . ARG A  1 83  ? -43.883 -4.225  37.333 1.00 64.56  ? 83   ARG A CA    1 
ATOM   401   C  C     . ARG A  1 83  ? -43.215 -5.580  37.528 1.00 63.85  ? 83   ARG A C     1 
ATOM   402   O  O     . ARG A  1 83  ? -42.013 -5.732  37.279 1.00 64.07  ? 83   ARG A O     1 
ATOM   403   C  CB    . ARG A  1 83  ? -44.756 -4.191  36.073 1.00 64.75  ? 83   ARG A CB    1 
ATOM   404   C  CG    . ARG A  1 83  ? -45.638 -2.941  35.954 1.00 65.35  ? 83   ARG A CG    1 
ATOM   405   C  CD    . ARG A  1 83  ? -46.448 -2.932  34.656 1.00 65.55  ? 83   ARG A CD    1 
ATOM   406   N  NE    . ARG A  1 83  ? -47.872 -2.792  34.956 1.00 69.08  ? 83   ARG A NE    1 
ATOM   407   C  CZ    . ARG A  1 83  ? -48.867 -3.158  34.151 1.00 70.44  ? 83   ARG A CZ    1 
ATOM   408   N  NH1   . ARG A  1 83  ? -48.614 -3.677  32.955 1.00 71.30  ? 83   ARG A NH1   1 
ATOM   409   N  NH2   . ARG A  1 83  ? -50.128 -3.002  34.546 1.00 71.61  ? 83   ARG A NH2   1 
ATOM   410   N  N     . PHE A  1 84  ? -43.986 -6.558  37.981 1.00 63.06  ? 84   PHE A N     1 
ATOM   411   C  CA    . PHE A  1 84  ? -43.459 -7.889  38.251 1.00 62.17  ? 84   PHE A CA    1 
ATOM   412   C  C     . PHE A  1 84  ? -44.325 -8.939  37.573 1.00 61.61  ? 84   PHE A C     1 
ATOM   413   O  O     . PHE A  1 84  ? -45.532 -8.981  37.823 1.00 61.71  ? 84   PHE A O     1 
ATOM   414   C  CB    . PHE A  1 84  ? -43.442 -8.137  39.771 1.00 62.14  ? 84   PHE A CB    1 
ATOM   415   C  CG    . PHE A  1 84  ? -42.193 -7.639  40.461 1.00 62.22  ? 84   PHE A CG    1 
ATOM   416   C  CD1   . PHE A  1 84  ? -42.054 -6.290  40.808 1.00 61.43  ? 84   PHE A CD1   1 
ATOM   417   C  CD2   . PHE A  1 84  ? -41.153 -8.520  40.765 1.00 61.94  ? 84   PHE A CD2   1 
ATOM   418   C  CE1   . PHE A  1 84  ? -40.899 -5.816  41.429 1.00 60.68  ? 84   PHE A CE1   1 
ATOM   419   C  CE2   . PHE A  1 84  ? -39.992 -8.066  41.401 1.00 62.16  ? 84   PHE A CE2   1 
ATOM   420   C  CZ    . PHE A  1 84  ? -39.863 -6.704  41.728 1.00 62.25  ? 84   PHE A CZ    1 
ATOM   421   N  N     . GLN A  1 85  ? -43.737 -9.796  36.731 1.00 60.55  ? 85   GLN A N     1 
ATOM   422   C  CA    . GLN A  1 85  ? -44.449 -11.021 36.339 1.00 59.39  ? 85   GLN A CA    1 
ATOM   423   C  C     . GLN A  1 85  ? -44.862 -11.724 37.621 1.00 58.95  ? 85   GLN A C     1 
ATOM   424   O  O     . GLN A  1 85  ? -44.192 -11.577 38.638 1.00 58.80  ? 85   GLN A O     1 
ATOM   425   C  CB    . GLN A  1 85  ? -43.579 -11.947 35.504 1.00 59.15  ? 85   GLN A CB    1 
ATOM   426   C  CG    . GLN A  1 85  ? -43.350 -11.486 34.093 1.00 58.63  ? 85   GLN A CG    1 
ATOM   427   C  CD    . GLN A  1 85  ? -42.725 -12.551 33.225 1.00 59.59  ? 85   GLN A CD    1 
ATOM   428   O  OE1   . GLN A  1 85  ? -42.088 -13.486 33.714 1.00 60.39  ? 85   GLN A OE1   1 
ATOM   429   N  NE2   . GLN A  1 85  ? -42.895 -12.413 31.919 1.00 61.29  ? 85   GLN A NE2   1 
ATOM   430   N  N     . SER A  1 86  ? -45.965 -12.470 37.598 1.00 58.78  ? 86   SER A N     1 
ATOM   431   C  CA    . SER A  1 86  ? -46.447 -13.121 38.822 1.00 58.22  ? 86   SER A CA    1 
ATOM   432   C  C     . SER A  1 86  ? -45.553 -14.324 39.169 1.00 57.94  ? 86   SER A C     1 
ATOM   433   O  O     . SER A  1 86  ? -45.409 -14.704 40.350 1.00 57.52  ? 86   SER A O     1 
ATOM   434   C  CB    . SER A  1 86  ? -47.918 -13.515 38.691 1.00 58.24  ? 86   SER A CB    1 
ATOM   435   O  OG    . SER A  1 86  ? -48.093 -14.922 38.619 1.00 59.35  ? 86   SER A OG    1 
ATOM   436   N  N     . SER A  1 87  ? -44.941 -14.886 38.123 1.00 57.38  ? 87   SER A N     1 
ATOM   437   C  CA    . SER A  1 87  ? -44.002 -15.996 38.242 1.00 57.10  ? 87   SER A CA    1 
ATOM   438   C  C     . SER A  1 87  ? -42.620 -15.540 38.721 1.00 56.67  ? 87   SER A C     1 
ATOM   439   O  O     . SER A  1 87  ? -41.826 -16.357 39.200 1.00 56.31  ? 87   SER A O     1 
ATOM   440   C  CB    . SER A  1 87  ? -43.878 -16.710 36.907 1.00 56.82  ? 87   SER A CB    1 
ATOM   441   O  OG    . SER A  1 87  ? -43.442 -15.805 35.912 1.00 58.90  ? 87   SER A OG    1 
ATOM   442   N  N     . ALA A  1 88  ? -42.345 -14.238 38.577 1.00 56.28  ? 88   ALA A N     1 
ATOM   443   C  CA    . ALA A  1 88  ? -41.143 -13.607 39.136 1.00 55.45  ? 88   ALA A CA    1 
ATOM   444   C  C     . ALA A  1 88  ? -41.202 -13.520 40.650 1.00 54.94  ? 88   ALA A C     1 
ATOM   445   O  O     . ALA A  1 88  ? -40.194 -13.690 41.314 1.00 54.85  ? 88   ALA A O     1 
ATOM   446   C  CB    . ALA A  1 88  ? -40.928 -12.240 38.536 1.00 55.49  ? 88   ALA A CB    1 
ATOM   447   N  N     . VAL A  1 89  ? -42.390 -13.258 41.189 1.00 55.14  ? 89   VAL A N     1 
ATOM   448   C  CA    . VAL A  1 89  ? -42.593 -13.173 42.639 1.00 54.94  ? 89   VAL A CA    1 
ATOM   449   C  C     . VAL A  1 89  ? -42.698 -14.559 43.276 1.00 55.50  ? 89   VAL A C     1 
ATOM   450   O  O     . VAL A  1 89  ? -42.164 -14.771 44.360 1.00 55.39  ? 89   VAL A O     1 
ATOM   451   C  CB    . VAL A  1 89  ? -43.836 -12.312 43.034 1.00 54.92  ? 89   VAL A CB    1 
ATOM   452   C  CG1   . VAL A  1 89  ? -43.899 -12.119 44.559 1.00 53.72  ? 89   VAL A CG1   1 
ATOM   453   C  CG2   . VAL A  1 89  ? -43.837 -10.963 42.316 1.00 53.58  ? 89   VAL A CG2   1 
ATOM   454   N  N     . MET A  1 90  ? -43.403 -15.488 42.619 1.00 56.42  ? 90   MET A N     1 
ATOM   455   C  CA    . MET A  1 90  ? -43.437 -16.904 43.055 1.00 56.96  ? 90   MET A CA    1 
ATOM   456   C  C     . MET A  1 90  ? -42.011 -17.501 43.186 1.00 55.75  ? 90   MET A C     1 
ATOM   457   O  O     . MET A  1 90  ? -41.711 -18.164 44.169 1.00 55.66  ? 90   MET A O     1 
ATOM   458   C  CB    . MET A  1 90  ? -44.291 -17.764 42.101 1.00 58.92  ? 90   MET A CB    1 
ATOM   459   C  CG    . MET A  1 90  ? -45.826 -17.752 42.303 1.00 61.67  ? 90   MET A CG    1 
ATOM   460   S  SD    . MET A  1 90  ? -46.366 -18.345 43.958 1.00 74.35  ? 90   MET A SD    1 
ATOM   461   C  CE    . MET A  1 90  ? -47.790 -19.369 43.494 1.00 66.54  ? 90   MET A CE    1 
ATOM   462   N  N     . ALA A  1 91  ? -41.142 -17.232 42.205 1.00 54.36  ? 91   ALA A N     1 
ATOM   463   C  CA    . ALA A  1 91  ? -39.750 -17.705 42.198 1.00 53.02  ? 91   ALA A CA    1 
ATOM   464   C  C     . ALA A  1 91  ? -38.925 -17.094 43.326 1.00 52.88  ? 91   ALA A C     1 
ATOM   465   O  O     . ALA A  1 91  ? -38.127 -17.776 43.946 1.00 53.57  ? 91   ALA A O     1 
ATOM   466   C  CB    . ALA A  1 91  ? -39.089 -17.426 40.839 1.00 52.19  ? 91   ALA A CB    1 
ATOM   467   N  N     . LEU A  1 92  ? -39.110 -15.804 43.580 1.00 52.37  ? 92   LEU A N     1 
ATOM   468   C  CA    . LEU A  1 92  ? -38.463 -15.137 44.697 1.00 52.07  ? 92   LEU A CA    1 
ATOM   469   C  C     . LEU A  1 92  ? -38.909 -15.718 46.031 1.00 52.04  ? 92   LEU A C     1 
ATOM   470   O  O     . LEU A  1 92  ? -38.094 -15.822 46.946 1.00 51.91  ? 92   LEU A O     1 
ATOM   471   C  CB    . LEU A  1 92  ? -38.751 -13.626 44.679 1.00 52.05  ? 92   LEU A CB    1 
ATOM   472   C  CG    . LEU A  1 92  ? -37.881 -12.711 43.800 1.00 52.27  ? 92   LEU A CG    1 
ATOM   473   C  CD1   . LEU A  1 92  ? -38.549 -11.355 43.649 1.00 52.25  ? 92   LEU A CD1   1 
ATOM   474   C  CD2   . LEU A  1 92  ? -36.449 -12.556 44.330 1.00 49.40  ? 92   LEU A CD2   1 
ATOM   475   N  N     . GLN A  1 93  ? -40.193 -16.082 46.147 1.00 51.56  ? 93   GLN A N     1 
ATOM   476   C  CA    . GLN A  1 93  ? -40.704 -16.661 47.395 1.00 51.49  ? 93   GLN A CA    1 
ATOM   477   C  C     . GLN A  1 93  ? -40.203 -18.085 47.610 1.00 51.13  ? 93   GLN A C     1 
ATOM   478   O  O     . GLN A  1 93  ? -39.761 -18.421 48.698 1.00 51.32  ? 93   GLN A O     1 
ATOM   479   C  CB    . GLN A  1 93  ? -42.237 -16.577 47.510 1.00 51.43  ? 93   GLN A CB    1 
ATOM   480   C  CG    . GLN A  1 93  ? -42.682 -16.419 48.977 1.00 51.68  ? 93   GLN A CG    1 
ATOM   481   C  CD    . GLN A  1 93  ? -44.178 -16.489 49.184 1.00 51.30  ? 93   GLN A CD    1 
ATOM   482   O  OE1   . GLN A  1 93  ? -44.943 -15.882 48.453 1.00 53.37  ? 93   GLN A OE1   1 
ATOM   483   N  NE2   . GLN A  1 93  ? -44.600 -17.232 50.195 1.00 52.00  ? 93   GLN A NE2   1 
ATOM   484   N  N     . GLU A  1 94  ? -40.257 -18.900 46.558 1.00 50.81  ? 94   GLU A N     1 
ATOM   485   C  CA    . GLU A  1 94  ? -39.698 -20.245 46.560 1.00 50.08  ? 94   GLU A CA    1 
ATOM   486   C  C     . GLU A  1 94  ? -38.242 -20.255 47.019 1.00 49.84  ? 94   GLU A C     1 
ATOM   487   O  O     . GLU A  1 94  ? -37.833 -21.071 47.857 1.00 49.53  ? 94   GLU A O     1 
ATOM   488   C  CB    . GLU A  1 94  ? -39.758 -20.828 45.150 1.00 50.55  ? 94   GLU A CB    1 
ATOM   489   C  CG    . GLU A  1 94  ? -41.125 -21.370 44.682 1.00 51.12  ? 94   GLU A CG    1 
ATOM   490   C  CD    . GLU A  1 94  ? -41.667 -22.518 45.532 1.00 52.15  ? 94   GLU A CD    1 
ATOM   491   O  OE1   . GLU A  1 94  ? -42.915 -22.575 45.666 1.00 54.59  ? 94   GLU A OE1   1 
ATOM   492   O  OE2   . GLU A  1 94  ? -40.868 -23.342 46.056 1.00 48.35  ? 94   GLU A OE2   1 
ATOM   493   N  N     . ALA A  1 95  ? -37.463 -19.343 46.446 1.00 49.19  ? 95   ALA A N     1 
ATOM   494   C  CA    . ALA A  1 95  ? -36.042 -19.266 46.709 1.00 48.39  ? 95   ALA A CA    1 
ATOM   495   C  C     . ALA A  1 95  ? -35.787 -18.767 48.128 1.00 48.05  ? 95   ALA A C     1 
ATOM   496   O  O     . ALA A  1 95  ? -34.879 -19.258 48.808 1.00 48.52  ? 95   ALA A O     1 
ATOM   497   C  CB    . ALA A  1 95  ? -35.370 -18.377 45.679 1.00 47.53  ? 95   ALA A CB    1 
ATOM   498   N  N     . SER A  1 96  ? -36.611 -17.821 48.569 1.00 47.59  ? 96   SER A N     1 
ATOM   499   C  CA    . SER A  1 96  ? -36.451 -17.161 49.865 1.00 47.67  ? 96   SER A CA    1 
ATOM   500   C  C     . SER A  1 96  ? -36.778 -18.065 51.029 1.00 47.06  ? 96   SER A C     1 
ATOM   501   O  O     . SER A  1 96  ? -36.020 -18.129 51.985 1.00 47.32  ? 96   SER A O     1 
ATOM   502   C  CB    . SER A  1 96  ? -37.321 -15.900 49.962 1.00 47.69  ? 96   SER A CB    1 
ATOM   503   O  OG    . SER A  1 96  ? -36.744 -14.827 49.262 1.00 48.49  ? 96   SER A OG    1 
ATOM   504   N  N     . GLU A  1 97  ? -37.925 -18.733 50.956 1.00 46.54  ? 97   GLU A N     1 
ATOM   505   C  CA    . GLU A  1 97  ? -38.289 -19.773 51.930 1.00 46.35  ? 97   GLU A CA    1 
ATOM   506   C  C     . GLU A  1 97  ? -37.351 -21.012 51.912 1.00 46.04  ? 97   GLU A C     1 
ATOM   507   O  O     . GLU A  1 97  ? -37.041 -21.588 52.961 1.00 46.71  ? 97   GLU A O     1 
ATOM   508   C  CB    . GLU A  1 97  ? -39.745 -20.179 51.740 1.00 46.38  ? 97   GLU A CB    1 
ATOM   509   C  CG    . GLU A  1 97  ? -40.728 -19.016 51.679 1.00 47.37  ? 97   GLU A CG    1 
ATOM   510   C  CD    . GLU A  1 97  ? -42.134 -19.444 52.034 1.00 50.70  ? 97   GLU A CD    1 
ATOM   511   O  OE1   . GLU A  1 97  ? -42.334 -20.650 52.290 1.00 53.67  ? 97   GLU A OE1   1 
ATOM   512   O  OE2   . GLU A  1 97  ? -43.046 -18.593 52.064 1.00 50.67  ? 97   GLU A OE2   1 
ATOM   513   N  N     . ALA A  1 98  ? -36.876 -21.421 50.744 1.00 44.90  ? 98   ALA A N     1 
ATOM   514   C  CA    . ALA A  1 98  ? -35.865 -22.475 50.718 1.00 44.71  ? 98   ALA A CA    1 
ATOM   515   C  C     . ALA A  1 98  ? -34.592 -22.071 51.476 1.00 44.89  ? 98   ALA A C     1 
ATOM   516   O  O     . ALA A  1 98  ? -33.991 -22.882 52.161 1.00 45.03  ? 98   ALA A O     1 
ATOM   517   C  CB    . ALA A  1 98  ? -35.540 -22.843 49.307 1.00 44.68  ? 98   ALA A CB    1 
ATOM   518   N  N     . TYR A  1 99  ? -34.196 -20.803 51.340 1.00 44.87  ? 99   TYR A N     1 
ATOM   519   C  CA    . TYR A  1 99  ? -33.042 -20.259 52.000 1.00 44.02  ? 99   TYR A CA    1 
ATOM   520   C  C     . TYR A  1 99  ? -33.298 -20.220 53.501 1.00 44.41  ? 99   TYR A C     1 
ATOM   521   O  O     . TYR A  1 99  ? -32.457 -20.653 54.292 1.00 44.62  ? 99   TYR A O     1 
ATOM   522   C  CB    . TYR A  1 99  ? -32.718 -18.863 51.445 1.00 44.26  ? 99   TYR A CB    1 
ATOM   523   C  CG    . TYR A  1 99  ? -31.656 -18.112 52.246 1.00 44.21  ? 99   TYR A CG    1 
ATOM   524   C  CD1   . TYR A  1 99  ? -30.289 -18.360 52.053 1.00 44.15  ? 99   TYR A CD1   1 
ATOM   525   C  CD2   . TYR A  1 99  ? -32.021 -17.162 53.188 1.00 44.07  ? 99   TYR A CD2   1 
ATOM   526   C  CE1   . TYR A  1 99  ? -29.317 -17.685 52.798 1.00 43.29  ? 99   TYR A CE1   1 
ATOM   527   C  CE2   . TYR A  1 99  ? -31.061 -16.482 53.943 1.00 44.39  ? 99   TYR A CE2   1 
ATOM   528   C  CZ    . TYR A  1 99  ? -29.712 -16.744 53.739 1.00 44.34  ? 99   TYR A CZ    1 
ATOM   529   O  OH    . TYR A  1 99  ? -28.771 -16.062 54.497 1.00 44.51  ? 99   TYR A OH    1 
ATOM   530   N  N     . LEU A  1 100 ? -34.461 -19.722 53.905 1.00 44.19  ? 100  LEU A N     1 
ATOM   531   C  CA    . LEU A  1 100 ? -34.695 -19.544 55.327 1.00 44.55  ? 100  LEU A CA    1 
ATOM   532   C  C     . LEU A  1 100 ? -34.905 -20.882 56.018 1.00 44.28  ? 100  LEU A C     1 
ATOM   533   O  O     . LEU A  1 100 ? -34.432 -21.066 57.129 1.00 44.85  ? 100  LEU A O     1 
ATOM   534   C  CB    . LEU A  1 100 ? -35.839 -18.554 55.613 1.00 44.41  ? 100  LEU A CB    1 
ATOM   535   C  CG    . LEU A  1 100 ? -35.576 -17.066 55.357 1.00 45.59  ? 100  LEU A CG    1 
ATOM   536   C  CD1   . LEU A  1 100 ? -36.854 -16.277 55.471 1.00 45.23  ? 100  LEU A CD1   1 
ATOM   537   C  CD2   . LEU A  1 100 ? -34.513 -16.479 56.285 1.00 45.36  ? 100  LEU A CD2   1 
ATOM   538   N  N     . VAL A  1 101 ? -35.587 -21.815 55.353 1.00 43.85  ? 101  VAL A N     1 
ATOM   539   C  CA    . VAL A  1 101 ? -35.751 -23.183 55.876 1.00 43.66  ? 101  VAL A CA    1 
ATOM   540   C  C     . VAL A  1 101 ? -34.391 -23.852 56.113 1.00 43.12  ? 101  VAL A C     1 
ATOM   541   O  O     . VAL A  1 101 ? -34.173 -24.426 57.177 1.00 43.42  ? 101  VAL A O     1 
ATOM   542   C  CB    . VAL A  1 101 ? -36.684 -24.083 54.980 1.00 43.96  ? 101  VAL A CB    1 
ATOM   543   C  CG1   . VAL A  1 101 ? -36.644 -25.525 55.430 1.00 43.64  ? 101  VAL A CG1   1 
ATOM   544   C  CG2   . VAL A  1 101 ? -38.145 -23.569 54.980 1.00 44.00  ? 101  VAL A CG2   1 
ATOM   545   N  N     . ALA A  1 102 ? -33.469 -23.744 55.155 1.00 42.38  ? 102  ALA A N     1 
ATOM   546   C  CA    . ALA A  1 102 ? -32.150 -24.373 55.303 1.00 41.94  ? 102  ALA A CA    1 
ATOM   547   C  C     . ALA A  1 102 ? -31.265 -23.692 56.319 1.00 42.40  ? 102  ALA A C     1 
ATOM   548   O  O     . ALA A  1 102 ? -30.453 -24.356 56.960 1.00 44.03  ? 102  ALA A O     1 
ATOM   549   C  CB    . ALA A  1 102 ? -31.453 -24.484 53.995 1.00 41.31  ? 102  ALA A CB    1 
ATOM   550   N  N     . LEU A  1 103 ? -31.425 -22.379 56.470 1.00 42.65  ? 103  LEU A N     1 
ATOM   551   C  CA    . LEU A  1 103 ? -30.703 -21.577 57.450 1.00 42.78  ? 103  LEU A CA    1 
ATOM   552   C  C     . LEU A  1 103 ? -31.156 -21.899 58.867 1.00 43.41  ? 103  LEU A C     1 
ATOM   553   O  O     . LEU A  1 103 ? -30.335 -22.002 59.765 1.00 43.75  ? 103  LEU A O     1 
ATOM   554   C  CB    . LEU A  1 103 ? -30.883 -20.056 57.167 1.00 42.97  ? 103  LEU A CB    1 
ATOM   555   C  CG    . LEU A  1 103 ? -30.207 -19.033 58.117 1.00 41.71  ? 103  LEU A CG    1 
ATOM   556   C  CD1   . LEU A  1 103 ? -28.697 -19.148 58.143 1.00 39.23  ? 103  LEU A CD1   1 
ATOM   557   C  CD2   . LEU A  1 103 ? -30.578 -17.639 57.766 1.00 42.05  ? 103  LEU A CD2   1 
ATOM   558   N  N     . PHE A  1 104 ? -32.459 -22.035 59.082 1.00 44.03  ? 104  PHE A N     1 
ATOM   559   C  CA    . PHE A  1 104 ? -32.937 -22.635 60.335 1.00 45.28  ? 104  PHE A CA    1 
ATOM   560   C  C     . PHE A  1 104 ? -32.388 -24.059 60.597 1.00 46.07  ? 104  PHE A C     1 
ATOM   561   O  O     . PHE A  1 104 ? -32.231 -24.455 61.762 1.00 46.85  ? 104  PHE A O     1 
ATOM   562   C  CB    . PHE A  1 104 ? -34.454 -22.651 60.397 1.00 45.10  ? 104  PHE A CB    1 
ATOM   563   C  CG    . PHE A  1 104 ? -35.076 -21.293 60.525 1.00 44.87  ? 104  PHE A CG    1 
ATOM   564   C  CD1   . PHE A  1 104 ? -35.876 -20.785 59.504 1.00 45.66  ? 104  PHE A CD1   1 
ATOM   565   C  CD2   . PHE A  1 104 ? -34.889 -20.538 61.663 1.00 44.26  ? 104  PHE A CD2   1 
ATOM   566   C  CE1   . PHE A  1 104 ? -36.474 -19.551 59.615 1.00 45.52  ? 104  PHE A CE1   1 
ATOM   567   C  CE2   . PHE A  1 104 ? -35.474 -19.300 61.794 1.00 45.70  ? 104  PHE A CE2   1 
ATOM   568   C  CZ    . PHE A  1 104 ? -36.275 -18.801 60.764 1.00 47.15  ? 104  PHE A CZ    1 
ATOM   569   N  N     . GLU A  1 105 ? -32.097 -24.828 59.542 1.00 46.09  ? 105  GLU A N     1 
ATOM   570   C  CA    . GLU A  1 105 ? -31.483 -26.144 59.755 1.00 46.67  ? 105  GLU A CA    1 
ATOM   571   C  C     . GLU A  1 105 ? -30.117 -25.975 60.384 1.00 46.85  ? 105  GLU A C     1 
ATOM   572   O  O     . GLU A  1 105 ? -29.859 -26.603 61.394 1.00 48.05  ? 105  GLU A O     1 
ATOM   573   C  CB    . GLU A  1 105 ? -31.396 -26.993 58.479 1.00 46.46  ? 105  GLU A CB    1 
ATOM   574   C  CG    . GLU A  1 105 ? -32.685 -27.666 58.069 1.00 46.67  ? 105  GLU A CG    1 
ATOM   575   C  CD    . GLU A  1 105 ? -32.705 -28.069 56.592 1.00 48.82  ? 105  GLU A CD    1 
ATOM   576   O  OE1   . GLU A  1 105 ? -31.614 -28.191 55.997 1.00 52.05  ? 105  GLU A OE1   1 
ATOM   577   O  OE2   . GLU A  1 105 ? -33.801 -28.256 56.015 1.00 47.01  ? 105  GLU A OE2   1 
ATOM   578   N  N     . ASP A  1 106 ? -29.259 -25.121 59.806 1.00 46.91  ? 106  ASP A N     1 
ATOM   579   C  CA    . ASP A  1 106 ? -27.898 -24.857 60.329 1.00 46.49  ? 106  ASP A CA    1 
ATOM   580   C  C     . ASP A  1 106 ? -27.880 -24.182 61.690 1.00 46.92  ? 106  ASP A C     1 
ATOM   581   O  O     . ASP A  1 106 ? -27.024 -24.485 62.515 1.00 47.03  ? 106  ASP A O     1 
ATOM   582   C  CB    . ASP A  1 106 ? -27.107 -23.969 59.386 1.00 46.22  ? 106  ASP A CB    1 
ATOM   583   C  CG    . ASP A  1 106 ? -26.927 -24.574 58.013 1.00 47.39  ? 106  ASP A CG    1 
ATOM   584   O  OD1   . ASP A  1 106 ? -27.097 -25.805 57.849 1.00 48.61  ? 106  ASP A OD1   1 
ATOM   585   O  OD2   . ASP A  1 106 ? -26.618 -23.795 57.082 1.00 47.52  ? 106  ASP A OD2   1 
ATOM   586   N  N     . THR A  1 107 ? -28.794 -23.230 61.888 1.00 47.29  ? 107  THR A N     1 
ATOM   587   C  CA    . THR A  1 107 ? -29.028 -22.543 63.168 1.00 47.46  ? 107  THR A CA    1 
ATOM   588   C  C     . THR A  1 107 ? -29.331 -23.545 64.299 1.00 47.30  ? 107  THR A C     1 
ATOM   589   O  O     . THR A  1 107 ? -28.735 -23.490 65.380 1.00 46.32  ? 107  THR A O     1 
ATOM   590   C  CB    . THR A  1 107 ? -30.213 -21.562 63.000 1.00 48.05  ? 107  THR A CB    1 
ATOM   591   O  OG1   . THR A  1 107 ? -29.908 -20.634 61.958 1.00 48.25  ? 107  THR A OG1   1 
ATOM   592   C  CG2   . THR A  1 107 ? -30.529 -20.818 64.274 1.00 48.03  ? 107  THR A CG2   1 
ATOM   593   N  N     . ASN A  1 108 ? -30.253 -24.469 64.029 1.00 47.38  ? 108  ASN A N     1 
ATOM   594   C  CA    . ASN A  1 108 ? -30.591 -25.521 64.991 1.00 47.32  ? 108  ASN A CA    1 
ATOM   595   C  C     . ASN A  1 108 ? -29.386 -26.378 65.350 1.00 46.85  ? 108  ASN A C     1 
ATOM   596   O  O     . ASN A  1 108 ? -29.155 -26.670 66.525 1.00 47.03  ? 108  ASN A O     1 
ATOM   597   C  CB    . ASN A  1 108 ? -31.745 -26.390 64.486 1.00 47.71  ? 108  ASN A CB    1 
ATOM   598   C  CG    . ASN A  1 108 ? -32.642 -26.854 65.606 1.00 49.01  ? 108  ASN A CG    1 
ATOM   599   O  OD1   . ASN A  1 108 ? -32.646 -26.267 66.686 1.00 52.29  ? 108  ASN A OD1   1 
ATOM   600   N  ND2   . ASN A  1 108 ? -33.400 -27.915 65.368 1.00 49.44  ? 108  ASN A ND2   1 
ATOM   601   N  N     . LEU A  1 109 ? -28.603 -26.758 64.349 1.00 46.05  ? 109  LEU A N     1 
ATOM   602   C  CA    . LEU A  1 109 ? -27.356 -27.437 64.613 1.00 45.96  ? 109  LEU A CA    1 
ATOM   603   C  C     . LEU A  1 109 ? -26.419 -26.655 65.532 1.00 46.28  ? 109  LEU A C     1 
ATOM   604   O  O     . LEU A  1 109 ? -25.821 -27.242 66.442 1.00 46.89  ? 109  LEU A O     1 
ATOM   605   C  CB    . LEU A  1 109 ? -26.638 -27.776 63.315 1.00 46.25  ? 109  LEU A CB    1 
ATOM   606   C  CG    . LEU A  1 109 ? -27.158 -28.965 62.500 1.00 45.97  ? 109  LEU A CG    1 
ATOM   607   C  CD1   . LEU A  1 109 ? -26.376 -29.054 61.201 1.00 44.81  ? 109  LEU A CD1   1 
ATOM   608   C  CD2   . LEU A  1 109 ? -27.019 -30.241 63.312 1.00 44.36  ? 109  LEU A CD2   1 
ATOM   609   N  N     . CYS A  1 110 ? -26.279 -25.348 65.287 1.00 46.33  ? 110  CYS A N     1 
ATOM   610   C  CA    . CYS A  1 110 ? -25.466 -24.451 66.126 1.00 46.12  ? 110  CYS A CA    1 
ATOM   611   C  C     . CYS A  1 110 ? -25.992 -24.311 67.585 1.00 46.03  ? 110  CYS A C     1 
ATOM   612   O  O     . CYS A  1 110 ? -25.209 -24.307 68.525 1.00 45.86  ? 110  CYS A O     1 
ATOM   613   C  CB    . CYS A  1 110 ? -25.331 -23.070 65.456 1.00 45.90  ? 110  CYS A CB    1 
ATOM   614   S  SG    . CYS A  1 110 ? -24.369 -23.040 63.935 1.00 46.50  ? 110  CYS A SG    1 
ATOM   615   N  N     . ALA A  1 111 ? -27.305 -24.182 67.756 1.00 46.32  ? 111  ALA A N     1 
ATOM   616   C  CA    . ALA A  1 111 ? -27.945 -24.267 69.071 1.00 47.17  ? 111  ALA A CA    1 
ATOM   617   C  C     . ALA A  1 111 ? -27.559 -25.554 69.781 1.00 48.30  ? 111  ALA A C     1 
ATOM   618   O  O     . ALA A  1 111 ? -26.995 -25.519 70.874 1.00 48.79  ? 111  ALA A O     1 
ATOM   619   C  CB    . ALA A  1 111 ? -29.461 -24.171 68.943 1.00 46.64  ? 111  ALA A CB    1 
ATOM   620   N  N     . ILE A  1 112 ? -27.841 -26.690 69.141 1.00 49.41  ? 112  ILE A N     1 
ATOM   621   C  CA    . ILE A  1 112 ? -27.529 -28.002 69.702 1.00 50.00  ? 112  ILE A CA    1 
ATOM   622   C  C     . ILE A  1 112 ? -26.041 -28.115 70.049 1.00 50.86  ? 112  ILE A C     1 
ATOM   623   O  O     . ILE A  1 112 ? -25.676 -28.652 71.098 1.00 52.11  ? 112  ILE A O     1 
ATOM   624   C  CB    . ILE A  1 112 ? -28.011 -29.151 68.768 1.00 50.02  ? 112  ILE A CB    1 
ATOM   625   C  CG1   . ILE A  1 112 ? -29.542 -29.228 68.763 1.00 48.61  ? 112  ILE A CG1   1 
ATOM   626   C  CG2   . ILE A  1 112 ? -27.450 -30.513 69.206 1.00 50.63  ? 112  ILE A CG2   1 
ATOM   627   C  CD1   . ILE A  1 112 ? -30.118 -29.765 67.490 1.00 46.48  ? 112  ILE A CD1   1 
ATOM   628   N  N     . HIS A  1 113 ? -25.173 -27.581 69.202 1.00 51.48  ? 113  HIS A N     1 
ATOM   629   C  CA    . HIS A  1 113 ? -23.746 -27.581 69.519 1.00 51.54  ? 113  HIS A CA    1 
ATOM   630   C  C     . HIS A  1 113 ? -23.466 -26.974 70.900 1.00 52.59  ? 113  HIS A C     1 
ATOM   631   O  O     . HIS A  1 113 ? -22.616 -27.484 71.645 1.00 52.95  ? 113  HIS A O     1 
ATOM   632   C  CB    . HIS A  1 113 ? -22.957 -26.840 68.457 1.00 50.46  ? 113  HIS A CB    1 
ATOM   633   C  CG    . HIS A  1 113 ? -21.476 -27.042 68.557 1.00 49.72  ? 113  HIS A CG    1 
ATOM   634   N  ND1   . HIS A  1 113 ? -20.858 -28.221 68.196 1.00 47.68  ? 113  HIS A ND1   1 
ATOM   635   C  CD2   . HIS A  1 113 ? -20.488 -26.210 68.963 1.00 48.53  ? 113  HIS A CD2   1 
ATOM   636   C  CE1   . HIS A  1 113 ? -19.556 -28.104 68.374 1.00 47.29  ? 113  HIS A CE1   1 
ATOM   637   N  NE2   . HIS A  1 113 ? -19.304 -26.892 68.834 1.00 46.60  ? 113  HIS A NE2   1 
ATOM   638   N  N     . ALA A  1 114 ? -24.185 -25.891 71.223 1.00 53.42  ? 114  ALA A N     1 
ATOM   639   C  CA    . ALA A  1 114 ? -24.045 -25.159 72.493 1.00 54.17  ? 114  ALA A CA    1 
ATOM   640   C  C     . ALA A  1 114 ? -24.952 -25.729 73.591 1.00 55.10  ? 114  ALA A C     1 
ATOM   641   O  O     . ALA A  1 114 ? -25.247 -25.050 74.584 1.00 55.26  ? 114  ALA A O     1 
ATOM   642   C  CB    . ALA A  1 114 ? -24.356 -23.704 72.275 1.00 53.77  ? 114  ALA A CB    1 
ATOM   643   N  N     . LYS A  1 115 ? -25.387 -26.977 73.390 1.00 55.97  ? 115  LYS A N     1 
ATOM   644   C  CA    . LYS A  1 115 ? -26.203 -27.745 74.338 1.00 56.45  ? 115  LYS A CA    1 
ATOM   645   C  C     . LYS A  1 115 ? -27.560 -27.118 74.655 1.00 56.13  ? 115  LYS A C     1 
ATOM   646   O  O     . LYS A  1 115 ? -28.096 -27.316 75.746 1.00 56.70  ? 115  LYS A O     1 
ATOM   647   C  CB    . LYS A  1 115 ? -25.418 -28.050 75.621 1.00 57.50  ? 115  LYS A CB    1 
ATOM   648   C  CG    . LYS A  1 115 ? -24.160 -28.923 75.413 1.00 58.68  ? 115  LYS A CG    1 
ATOM   649   C  CD    . LYS A  1 115 ? -23.133 -28.639 76.522 1.00 63.01  ? 115  LYS A CD    1 
ATOM   650   C  CE    . LYS A  1 115 ? -21.859 -29.502 76.389 1.00 63.61  ? 115  LYS A CE    1 
ATOM   651   N  NZ    . LYS A  1 115 ? -21.623 -30.438 77.547 1.00 66.13  ? 115  LYS A NZ    1 
ATOM   652   N  N     . ARG A  1 116 ? -28.114 -26.369 73.701 1.00 55.48  ? 116  ARG A N     1 
ATOM   653   C  CA    . ARG A  1 116 ? -29.443 -25.764 73.848 1.00 54.27  ? 116  ARG A CA    1 
ATOM   654   C  C     . ARG A  1 116 ? -30.439 -26.419 72.903 1.00 54.49  ? 116  ARG A C     1 
ATOM   655   O  O     . ARG A  1 116 ? -30.063 -27.187 72.040 1.00 54.45  ? 116  ARG A O     1 
ATOM   656   C  CB    . ARG A  1 116 ? -29.397 -24.248 73.588 1.00 54.28  ? 116  ARG A CB    1 
ATOM   657   C  CG    . ARG A  1 116 ? -28.822 -23.407 74.731 1.00 52.81  ? 116  ARG A CG    1 
ATOM   658   C  CD    . ARG A  1 116 ? -28.737 -21.940 74.357 1.00 52.54  ? 116  ARG A CD    1 
ATOM   659   N  NE    . ARG A  1 116 ? -27.628 -21.639 73.444 1.00 50.13  ? 116  ARG A NE    1 
ATOM   660   C  CZ    . ARG A  1 116 ? -27.745 -21.449 72.125 1.00 48.39  ? 116  ARG A CZ    1 
ATOM   661   N  NH1   . ARG A  1 116 ? -28.924 -21.525 71.532 1.00 48.29  ? 116  ARG A NH1   1 
ATOM   662   N  NH2   . ARG A  1 116 ? -26.682 -21.174 71.393 1.00 46.40  ? 116  ARG A NH2   1 
ATOM   663   N  N     . VAL A  1 117 ? -31.715 -26.109 73.086 1.00 54.57  ? 117  VAL A N     1 
ATOM   664   C  CA    . VAL A  1 117 ? -32.779 -26.571 72.192 1.00 54.59  ? 117  VAL A CA    1 
ATOM   665   C  C     . VAL A  1 117 ? -33.584 -25.369 71.679 1.00 54.48  ? 117  VAL A C     1 
ATOM   666   O  O     . VAL A  1 117 ? -34.582 -25.529 70.974 1.00 54.26  ? 117  VAL A O     1 
ATOM   667   C  CB    . VAL A  1 117 ? -33.727 -27.637 72.871 1.00 54.70  ? 117  VAL A CB    1 
ATOM   668   C  CG1   . VAL A  1 117 ? -32.964 -28.925 73.224 1.00 54.58  ? 117  VAL A CG1   1 
ATOM   669   C  CG2   . VAL A  1 117 ? -34.428 -27.078 74.089 1.00 54.17  ? 117  VAL A CG2   1 
ATOM   670   N  N     . THR A  1 118 ? -33.123 -24.170 72.053 1.00 54.50  ? 118  THR A N     1 
ATOM   671   C  CA    . THR A  1 118 ? -33.721 -22.890 71.652 1.00 53.94  ? 118  THR A CA    1 
ATOM   672   C  C     . THR A  1 118 ? -32.778 -22.207 70.680 1.00 53.71  ? 118  THR A C     1 
ATOM   673   O  O     . THR A  1 118 ? -31.616 -21.947 71.025 1.00 53.66  ? 118  THR A O     1 
ATOM   674   C  CB    . THR A  1 118 ? -33.911 -21.936 72.861 1.00 53.76  ? 118  THR A CB    1 
ATOM   675   O  OG1   . THR A  1 118 ? -34.402 -22.673 73.982 1.00 54.40  ? 118  THR A OG1   1 
ATOM   676   C  CG2   . THR A  1 118 ? -34.897 -20.810 72.535 1.00 54.08  ? 118  THR A CG2   1 
ATOM   677   N  N     . ILE A  1 119 ? -33.259 -21.922 69.470 1.00 53.15  ? 119  ILE A N     1 
ATOM   678   C  CA    . ILE A  1 119 ? -32.462 -21.134 68.525 1.00 52.26  ? 119  ILE A CA    1 
ATOM   679   C  C     . ILE A  1 119 ? -32.422 -19.657 68.946 1.00 52.98  ? 119  ILE A C     1 
ATOM   680   O  O     . ILE A  1 119 ? -33.439 -19.086 69.370 1.00 52.75  ? 119  ILE A O     1 
ATOM   681   C  CB    . ILE A  1 119 ? -32.921 -21.301 67.052 1.00 52.46  ? 119  ILE A CB    1 
ATOM   682   C  CG1   . ILE A  1 119 ? -34.317 -20.696 66.826 1.00 51.00  ? 119  ILE A CG1   1 
ATOM   683   C  CG2   . ILE A  1 119 ? -32.808 -22.782 66.623 1.00 51.08  ? 119  ILE A CG2   1 
ATOM   684   C  CD1   . ILE A  1 119 ? -34.681 -20.439 65.364 1.00 50.81  ? 119  ILE A CD1   1 
ATOM   685   N  N     . MET A  1 120 ? -31.233 -19.066 68.849 1.00 52.72  ? 120  MET A N     1 
ATOM   686   C  CA    . MET A  1 120 ? -31.000 -17.685 69.218 1.00 53.23  ? 120  MET A CA    1 
ATOM   687   C  C     . MET A  1 120 ? -30.340 -16.938 68.059 1.00 53.08  ? 120  MET A C     1 
ATOM   688   O  O     . MET A  1 120 ? -29.881 -17.564 67.107 1.00 53.12  ? 120  MET A O     1 
ATOM   689   C  CB    . MET A  1 120 ? -30.105 -17.627 70.455 1.00 53.18  ? 120  MET A CB    1 
ATOM   690   C  CG    . MET A  1 120 ? -30.720 -18.274 71.670 1.00 53.80  ? 120  MET A CG    1 
ATOM   691   S  SD    . MET A  1 120 ? -29.761 -18.102 73.181 1.00 55.65  ? 120  MET A SD    1 
ATOM   692   C  CE    . MET A  1 120 ? -30.954 -18.790 74.345 1.00 54.39  ? 120  MET A CE    1 
ATOM   693   N  N     . PRO A  1 121 ? -30.316 -15.588 68.115 1.00 53.25  ? 121  PRO A N     1 
ATOM   694   C  CA    . PRO A  1 121 ? -29.604 -14.793 67.117 1.00 52.65  ? 121  PRO A CA    1 
ATOM   695   C  C     . PRO A  1 121 ? -28.132 -15.161 66.939 1.00 52.18  ? 121  PRO A C     1 
ATOM   696   O  O     . PRO A  1 121 ? -27.620 -15.072 65.832 1.00 51.95  ? 121  PRO A O     1 
ATOM   697   C  CB    . PRO A  1 121 ? -29.746 -13.368 67.661 1.00 52.98  ? 121  PRO A CB    1 
ATOM   698   C  CG    . PRO A  1 121 ? -31.041 -13.389 68.367 1.00 52.57  ? 121  PRO A CG    1 
ATOM   699   C  CD    . PRO A  1 121 ? -31.008 -14.709 69.084 1.00 53.39  ? 121  PRO A CD    1 
ATOM   700   N  N     . LYS A  1 122 ? -27.458 -15.580 68.008 1.00 52.10  ? 122  LYS A N     1 
ATOM   701   C  CA    . LYS A  1 122 ? -26.029 -15.948 67.915 1.00 51.32  ? 122  LYS A CA    1 
ATOM   702   C  C     . LYS A  1 122 ? -25.782 -17.195 67.072 1.00 50.63  ? 122  LYS A C     1 
ATOM   703   O  O     . LYS A  1 122 ? -24.714 -17.353 66.479 1.00 50.71  ? 122  LYS A O     1 
ATOM   704   C  CB    . LYS A  1 122 ? -25.399 -16.105 69.305 1.00 51.34  ? 122  LYS A CB    1 
ATOM   705   C  CG    . LYS A  1 122 ? -26.016 -17.178 70.197 1.00 51.59  ? 122  LYS A CG    1 
ATOM   706   C  CD    . LYS A  1 122 ? -25.222 -17.320 71.470 1.00 53.85  ? 122  LYS A CD    1 
ATOM   707   C  CE    . LYS A  1 122 ? -26.151 -17.409 72.663 1.00 58.04  ? 122  LYS A CE    1 
ATOM   708   N  NZ    . LYS A  1 122 ? -25.415 -17.426 73.973 1.00 60.07  ? 122  LYS A NZ    1 
ATOM   709   N  N     . ASP A  1 123 ? -26.784 -18.072 67.038 1.00 50.18  ? 123  ASP A N     1 
ATOM   710   C  CA    . ASP A  1 123 ? -26.773 -19.320 66.266 1.00 49.03  ? 123  ASP A CA    1 
ATOM   711   C  C     . ASP A  1 123 ? -26.939 -19.026 64.787 1.00 48.67  ? 123  ASP A C     1 
ATOM   712   O  O     . ASP A  1 123 ? -26.228 -19.593 63.957 1.00 48.47  ? 123  ASP A O     1 
ATOM   713   C  CB    . ASP A  1 123 ? -27.909 -20.244 66.749 1.00 48.66  ? 123  ASP A CB    1 
ATOM   714   C  CG    . ASP A  1 123 ? -27.752 -20.658 68.200 1.00 48.26  ? 123  ASP A CG    1 
ATOM   715   O  OD1   . ASP A  1 123 ? -26.618 -20.918 68.637 1.00 49.34  ? 123  ASP A OD1   1 
ATOM   716   O  OD2   . ASP A  1 123 ? -28.753 -20.736 68.919 1.00 46.56  ? 123  ASP A OD2   1 
ATOM   717   N  N     . ILE A  1 124 ? -27.885 -18.143 64.461 1.00 48.84  ? 124  ILE A N     1 
ATOM   718   C  CA    . ILE A  1 124 ? -28.071 -17.656 63.075 1.00 49.25  ? 124  ILE A CA    1 
ATOM   719   C  C     . ILE A  1 124 ? -26.812 -16.941 62.605 1.00 49.46  ? 124  ILE A C     1 
ATOM   720   O  O     . ILE A  1 124 ? -26.391 -17.091 61.456 1.00 50.16  ? 124  ILE A O     1 
ATOM   721   C  CB    . ILE A  1 124 ? -29.283 -16.701 62.930 1.00 49.08  ? 124  ILE A CB    1 
ATOM   722   C  CG1   . ILE A  1 124 ? -30.572 -17.372 63.427 1.00 49.85  ? 124  ILE A CG1   1 
ATOM   723   C  CG2   . ILE A  1 124 ? -29.472 -16.256 61.466 1.00 49.67  ? 124  ILE A CG2   1 
ATOM   724   C  CD1   . ILE A  1 124 ? -31.886 -16.745 62.887 1.00 49.58  ? 124  ILE A CD1   1 
ATOM   725   N  N     . GLN A  1 125 ? -26.196 -16.195 63.516 1.00 49.13  ? 125  GLN A N     1 
ATOM   726   C  CA    . GLN A  1 125 ? -24.994 -15.451 63.224 1.00 49.25  ? 125  GLN A CA    1 
ATOM   727   C  C     . GLN A  1 125 ? -23.790 -16.383 63.035 1.00 48.39  ? 125  GLN A C     1 
ATOM   728   O  O     . GLN A  1 125 ? -22.975 -16.181 62.134 1.00 48.75  ? 125  GLN A O     1 
ATOM   729   C  CB    . GLN A  1 125 ? -24.740 -14.404 64.334 1.00 49.88  ? 125  GLN A CB    1 
ATOM   730   C  CG    . GLN A  1 125 ? -25.766 -13.236 64.380 1.00 50.33  ? 125  GLN A CG    1 
ATOM   731   C  CD    . GLN A  1 125 ? -25.750 -12.438 65.691 1.00 50.18  ? 125  GLN A CD    1 
ATOM   732   O  OE1   . GLN A  1 125 ? -24.749 -12.408 66.400 1.00 53.19  ? 125  GLN A OE1   1 
ATOM   733   N  NE2   . GLN A  1 125 ? -26.868 -11.781 66.004 1.00 50.77  ? 125  GLN A NE2   1 
ATOM   734   N  N     . LEU A  1 126 ? -23.661 -17.398 63.880 1.00 47.42  ? 126  LEU A N     1 
ATOM   735   C  CA    . LEU A  1 126 ? -22.620 -18.412 63.653 1.00 45.93  ? 126  LEU A CA    1 
ATOM   736   C  C     . LEU A  1 126 ? -22.778 -19.104 62.304 1.00 45.56  ? 126  LEU A C     1 
ATOM   737   O  O     . LEU A  1 126 ? -21.808 -19.217 61.558 1.00 45.36  ? 126  LEU A O     1 
ATOM   738   C  CB    . LEU A  1 126 ? -22.557 -19.453 64.769 1.00 45.06  ? 126  LEU A CB    1 
ATOM   739   C  CG    . LEU A  1 126 ? -21.361 -20.418 64.682 1.00 42.95  ? 126  LEU A CG    1 
ATOM   740   C  CD1   . LEU A  1 126 ? -20.025 -19.731 64.713 1.00 41.18  ? 126  LEU A CD1   1 
ATOM   741   C  CD2   . LEU A  1 126 ? -21.439 -21.412 65.780 1.00 39.97  ? 126  LEU A CD2   1 
ATOM   742   N  N     . ALA A  1 127 ? -23.989 -19.551 61.989 1.00 45.01  ? 127  ALA A N     1 
ATOM   743   C  CA    . ALA A  1 127 ? -24.238 -20.158 60.697 1.00 45.07  ? 127  ALA A CA    1 
ATOM   744   C  C     . ALA A  1 127 ? -23.757 -19.278 59.547 1.00 45.22  ? 127  ALA A C     1 
ATOM   745   O  O     . ALA A  1 127 ? -22.886 -19.677 58.792 1.00 45.60  ? 127  ALA A O     1 
ATOM   746   C  CB    . ALA A  1 127 ? -25.699 -20.518 60.538 1.00 45.29  ? 127  ALA A CB    1 
ATOM   747   N  N     . ARG A  1 128 ? -24.293 -18.071 59.437 1.00 45.75  ? 128  ARG A N     1 
ATOM   748   C  CA    . ARG A  1 128 ? -23.946 -17.153 58.351 1.00 46.08  ? 128  ARG A CA    1 
ATOM   749   C  C     . ARG A  1 128 ? -22.457 -16.806 58.271 1.00 46.68  ? 128  ARG A C     1 
ATOM   750   O  O     . ARG A  1 128 ? -21.898 -16.655 57.189 1.00 47.12  ? 128  ARG A O     1 
ATOM   751   C  CB    . ARG A  1 128 ? -24.798 -15.893 58.453 1.00 45.99  ? 128  ARG A CB    1 
ATOM   752   C  CG    . ARG A  1 128 ? -26.282 -16.181 58.334 1.00 45.95  ? 128  ARG A CG    1 
ATOM   753   C  CD    . ARG A  1 128 ? -27.096 -14.924 58.281 1.00 47.02  ? 128  ARG A CD    1 
ATOM   754   N  NE    . ARG A  1 128 ? -26.972 -14.211 57.013 1.00 49.85  ? 128  ARG A NE    1 
ATOM   755   C  CZ    . ARG A  1 128 ? -26.537 -12.951 56.876 1.00 49.29  ? 128  ARG A CZ    1 
ATOM   756   N  NH1   . ARG A  1 128 ? -26.160 -12.235 57.924 1.00 48.28  ? 128  ARG A NH1   1 
ATOM   757   N  NH2   . ARG A  1 128 ? -26.473 -12.409 55.677 1.00 48.68  ? 128  ARG A NH2   1 
ATOM   758   N  N     . ARG A  1 129 ? -21.800 -16.684 59.406 1.00 47.25  ? 129  ARG A N     1 
ATOM   759   C  CA    . ARG A  1 129 ? -20.368 -16.475 59.389 1.00 48.39  ? 129  ARG A CA    1 
ATOM   760   C  C     . ARG A  1 129 ? -19.634 -17.679 58.775 1.00 49.15  ? 129  ARG A C     1 
ATOM   761   O  O     . ARG A  1 129 ? -18.793 -17.509 57.884 1.00 49.74  ? 129  ARG A O     1 
ATOM   762   C  CB    . ARG A  1 129 ? -19.885 -16.086 60.796 1.00 48.35  ? 129  ARG A CB    1 
ATOM   763   C  CG    . ARG A  1 129 ? -18.402 -16.176 61.068 1.00 51.11  ? 129  ARG A CG    1 
ATOM   764   C  CD    . ARG A  1 129 ? -17.509 -15.428 60.083 1.00 54.04  ? 129  ARG A CD    1 
ATOM   765   N  NE    . ARG A  1 129 ? -16.101 -15.765 60.313 1.00 57.24  ? 129  ARG A NE    1 
ATOM   766   C  CZ    . ARG A  1 129 ? -15.481 -16.862 59.853 1.00 58.59  ? 129  ARG A CZ    1 
ATOM   767   N  NH1   . ARG A  1 129 ? -16.126 -17.750 59.104 1.00 57.62  ? 129  ARG A NH1   1 
ATOM   768   N  NH2   . ARG A  1 129 ? -14.198 -17.070 60.144 1.00 58.05  ? 129  ARG A NH2   1 
ATOM   769   N  N     . ILE A  1 130 ? -19.969 -18.893 59.216 1.00 50.08  ? 130  ILE A N     1 
ATOM   770   C  CA    . ILE A  1 130 ? -19.305 -20.108 58.708 1.00 50.66  ? 130  ILE A CA    1 
ATOM   771   C  C     . ILE A  1 130 ? -19.707 -20.399 57.264 1.00 51.65  ? 130  ILE A C     1 
ATOM   772   O  O     . ILE A  1 130 ? -18.885 -20.858 56.483 1.00 51.85  ? 130  ILE A O     1 
ATOM   773   C  CB    . ILE A  1 130 ? -19.563 -21.341 59.602 1.00 50.42  ? 130  ILE A CB    1 
ATOM   774   C  CG1   . ILE A  1 130 ? -19.033 -21.099 61.007 1.00 49.81  ? 130  ILE A CG1   1 
ATOM   775   C  CG2   . ILE A  1 130 ? -18.893 -22.583 59.033 1.00 49.47  ? 130  ILE A CG2   1 
ATOM   776   C  CD1   . ILE A  1 130 ? -19.521 -22.139 61.972 1.00 52.13  ? 130  ILE A CD1   1 
ATOM   777   N  N     . ARG A  1 131 ? -20.968 -20.127 56.922 1.00 52.67  ? 131  ARG A N     1 
ATOM   778   C  CA    . ARG A  1 131 ? -21.449 -20.176 55.543 1.00 53.64  ? 131  ARG A CA    1 
ATOM   779   C  C     . ARG A  1 131 ? -20.743 -19.179 54.604 1.00 55.43  ? 131  ARG A C     1 
ATOM   780   O  O     . ARG A  1 131 ? -20.884 -19.263 53.382 1.00 55.10  ? 131  ARG A O     1 
ATOM   781   C  CB    . ARG A  1 131 ? -22.947 -19.894 55.511 1.00 53.16  ? 131  ARG A CB    1 
ATOM   782   C  CG    . ARG A  1 131 ? -23.875 -21.077 55.728 1.00 51.10  ? 131  ARG A CG    1 
ATOM   783   C  CD    . ARG A  1 131 ? -25.296 -20.532 55.785 1.00 50.77  ? 131  ARG A CD    1 
ATOM   784   N  NE    . ARG A  1 131 ? -26.337 -21.543 55.684 1.00 49.32  ? 131  ARG A NE    1 
ATOM   785   C  CZ    . ARG A  1 131 ? -27.452 -21.391 54.978 1.00 51.08  ? 131  ARG A CZ    1 
ATOM   786   N  NH1   . ARG A  1 131 ? -27.667 -20.269 54.308 1.00 50.88  ? 131  ARG A NH1   1 
ATOM   787   N  NH2   . ARG A  1 131 ? -28.357 -22.362 54.930 1.00 51.29  ? 131  ARG A NH2   1 
ATOM   788   N  N     . GLY A  1 132 ? -20.008 -18.223 55.172 1.00 57.67  ? 132  GLY A N     1 
ATOM   789   C  CA    . GLY A  1 132 ? -19.320 -17.207 54.379 1.00 60.29  ? 132  GLY A CA    1 
ATOM   790   C  C     . GLY A  1 132 ? -20.208 -16.066 53.910 1.00 62.37  ? 132  GLY A C     1 
ATOM   791   O  O     . GLY A  1 132 ? -19.859 -15.360 52.961 1.00 63.21  ? 132  GLY A O     1 
ATOM   792   N  N     . GLU A  1 133 ? -21.351 -15.878 54.570 1.00 63.86  ? 133  GLU A N     1 
ATOM   793   C  CA    . GLU A  1 133 ? -22.261 -14.761 54.283 1.00 65.68  ? 133  GLU A CA    1 
ATOM   794   C  C     . GLU A  1 133 ? -21.941 -13.519 55.115 1.00 67.81  ? 133  GLU A C     1 
ATOM   795   O  O     . GLU A  1 133 ? -22.064 -12.402 54.624 1.00 68.62  ? 133  GLU A O     1 
ATOM   796   C  CB    . GLU A  1 133 ? -23.715 -15.169 54.523 1.00 65.09  ? 133  GLU A CB    1 
ATOM   797   C  CG    . GLU A  1 133 ? -24.269 -16.120 53.494 1.00 63.11  ? 133  GLU A CG    1 
ATOM   798   C  CD    . GLU A  1 133 ? -25.560 -16.778 53.923 1.00 59.52  ? 133  GLU A CD    1 
ATOM   799   O  OE1   . GLU A  1 133 ? -26.382 -16.146 54.614 1.00 58.84  ? 133  GLU A OE1   1 
ATOM   800   O  OE2   . GLU A  1 133 ? -25.756 -17.943 53.553 1.00 59.11  ? 133  GLU A OE2   1 
ATOM   801   N  N     . ARG A  1 134 ? -21.575 -13.718 56.382 1.00 70.15  ? 134  ARG A N     1 
ATOM   802   C  CA    . ARG A  1 134 ? -21.015 -12.651 57.211 1.00 72.54  ? 134  ARG A CA    1 
ATOM   803   C  C     . ARG A  1 134 ? -19.501 -12.524 57.018 1.00 73.53  ? 134  ARG A C     1 
ATOM   804   O  O     . ARG A  1 134 ? -18.939 -11.443 57.252 1.00 74.21  ? 134  ARG A O     1 
ATOM   805   C  CB    . ARG A  1 134 ? -21.311 -12.866 58.703 1.00 72.72  ? 134  ARG A CB    1 
ATOM   806   C  CG    . ARG A  1 134 ? -22.762 -13.134 59.052 1.00 74.71  ? 134  ARG A CG    1 
ATOM   807   C  CD    . ARG A  1 134 ? -23.147 -12.657 60.455 1.00 78.62  ? 134  ARG A CD    1 
ATOM   808   N  NE    . ARG A  1 134 ? -22.328 -13.215 61.531 1.00 82.04  ? 134  ARG A NE    1 
ATOM   809   C  CZ    . ARG A  1 134 ? -21.215 -12.654 62.019 1.00 85.02  ? 134  ARG A CZ    1 
ATOM   810   N  NH1   . ARG A  1 134 ? -20.748 -11.510 61.512 1.00 85.35  ? 134  ARG A NH1   1 
ATOM   811   N  NH2   . ARG A  1 134 ? -20.548 -13.248 63.012 1.00 85.59  ? 134  ARG A NH2   1 
ATOM   812   N  N     . ALA A  1 135 ? -18.845 -13.620 56.613 1.00 74.61  ? 135  ALA A N     1 
ATOM   813   C  CA    . ALA A  1 135 ? -17.387 -13.627 56.353 1.00 75.68  ? 135  ALA A CA    1 
ATOM   814   C  C     . ALA A  1 135 ? -16.981 -12.963 55.006 1.00 76.53  ? 135  ALA A C     1 
ATOM   815   O  O     . ALA A  1 135 ? -17.781 -12.878 54.055 1.00 77.29  ? 135  ALA A O     1 
ATOM   816   C  CB    . ALA A  1 135 ? -16.834 -15.041 56.439 1.00 75.45  ? 135  ALA A CB    1 
ATOM   817   O  OXT   . ALA A  1 135 ? -15.839 -12.488 54.817 1.00 76.71  ? 135  ALA A OXT   1 
ATOM   818   N  N     . ASP B  2 24  ? -43.184 -0.954  58.645 1.00 79.26  ? 24   ASP B N     1 
ATOM   819   C  CA    . ASP B  2 24  ? -44.047 -2.012  58.038 1.00 79.36  ? 24   ASP B CA    1 
ATOM   820   C  C     . ASP B  2 24  ? -43.455 -2.586  56.744 1.00 78.94  ? 24   ASP B C     1 
ATOM   821   O  O     . ASP B  2 24  ? -42.393 -2.139  56.274 1.00 78.99  ? 24   ASP B O     1 
ATOM   822   C  CB    . ASP B  2 24  ? -45.473 -1.490  57.789 1.00 79.62  ? 24   ASP B CB    1 
ATOM   823   C  CG    . ASP B  2 24  ? -46.271 -1.328  59.072 1.00 80.64  ? 24   ASP B CG    1 
ATOM   824   O  OD1   . ASP B  2 24  ? -45.944 -0.405  59.856 1.00 82.03  ? 24   ASP B OD1   1 
ATOM   825   O  OD2   . ASP B  2 24  ? -47.227 -2.114  59.290 1.00 80.87  ? 24   ASP B OD2   1 
ATOM   826   N  N     . ASN B  2 25  ? -44.180 -3.555  56.176 1.00 78.13  ? 25   ASN B N     1 
ATOM   827   C  CA    . ASN B  2 25  ? -43.748 -4.399  55.039 1.00 77.31  ? 25   ASN B CA    1 
ATOM   828   C  C     . ASN B  2 25  ? -42.885 -5.551  55.531 1.00 76.49  ? 25   ASN B C     1 
ATOM   829   O  O     . ASN B  2 25  ? -43.350 -6.690  55.550 1.00 76.36  ? 25   ASN B O     1 
ATOM   830   C  CB    . ASN B  2 25  ? -43.076 -3.611  53.900 1.00 77.26  ? 25   ASN B CB    1 
ATOM   831   C  CG    . ASN B  2 25  ? -44.081 -2.889  53.006 1.00 77.49  ? 25   ASN B CG    1 
ATOM   832   O  OD1   . ASN B  2 25  ? -45.225 -3.323  52.841 1.00 77.39  ? 25   ASN B OD1   1 
ATOM   833   N  ND2   . ASN B  2 25  ? -43.647 -1.785  52.415 1.00 77.61  ? 25   ASN B ND2   1 
ATOM   834   N  N     . ILE B  2 26  ? -41.659 -5.247  55.965 1.00 75.58  ? 26   ILE B N     1 
ATOM   835   C  CA    . ILE B  2 26  ? -40.817 -6.237  56.644 1.00 74.86  ? 26   ILE B CA    1 
ATOM   836   C  C     . ILE B  2 26  ? -41.540 -6.846  57.850 1.00 74.28  ? 26   ILE B C     1 
ATOM   837   O  O     . ILE B  2 26  ? -41.312 -8.006  58.197 1.00 74.31  ? 26   ILE B O     1 
ATOM   838   C  CB    . ILE B  2 26  ? -39.417 -5.667  57.052 1.00 75.03  ? 26   ILE B CB    1 
ATOM   839   C  CG1   . ILE B  2 26  ? -38.419 -6.795  57.361 1.00 74.60  ? 26   ILE B CG1   1 
ATOM   840   C  CG2   . ILE B  2 26  ? -39.519 -4.727  58.254 1.00 74.69  ? 26   ILE B CG2   1 
ATOM   841   C  CD1   . ILE B  2 26  ? -38.233 -7.818  56.246 1.00 74.73  ? 26   ILE B CD1   1 
ATOM   842   N  N     . GLN B  2 27  ? -42.431 -6.063  58.458 1.00 73.37  ? 27   GLN B N     1 
ATOM   843   C  CA    . GLN B  2 27  ? -43.185 -6.493  59.633 1.00 72.26  ? 27   GLN B CA    1 
ATOM   844   C  C     . GLN B  2 27  ? -44.418 -7.314  59.252 1.00 71.37  ? 27   GLN B C     1 
ATOM   845   O  O     . GLN B  2 27  ? -44.993 -8.016  60.087 1.00 71.43  ? 27   GLN B O     1 
ATOM   846   C  CB    . GLN B  2 27  ? -43.552 -5.282  60.480 1.00 72.25  ? 27   GLN B CB    1 
ATOM   847   C  CG    . GLN B  2 27  ? -42.331 -4.514  60.988 1.00 73.06  ? 27   GLN B CG    1 
ATOM   848   C  CD    . GLN B  2 27  ? -41.542 -5.285  62.035 1.00 74.05  ? 27   GLN B CD    1 
ATOM   849   O  OE1   . GLN B  2 27  ? -42.119 -5.901  62.936 1.00 74.80  ? 27   GLN B OE1   1 
ATOM   850   N  NE2   . GLN B  2 27  ? -40.216 -5.252  61.926 1.00 74.11  ? 27   GLN B NE2   1 
ATOM   851   N  N     . GLY B  2 28  ? -44.801 -7.239  57.980 1.00 70.40  ? 28   GLY B N     1 
ATOM   852   C  CA    . GLY B  2 28  ? -45.843 -8.103  57.416 1.00 69.42  ? 28   GLY B CA    1 
ATOM   853   C  C     . GLY B  2 28  ? -45.400 -9.553  57.243 1.00 68.67  ? 28   GLY B C     1 
ATOM   854   O  O     . GLY B  2 28  ? -46.232 -10.441 57.010 1.00 68.82  ? 28   GLY B O     1 
ATOM   855   N  N     . ILE B  2 29  ? -44.083 -9.773  57.321 1.00 67.56  ? 29   ILE B N     1 
ATOM   856   C  CA    . ILE B  2 29  ? -43.478 -11.091 57.514 1.00 66.17  ? 29   ILE B CA    1 
ATOM   857   C  C     . ILE B  2 29  ? -43.681 -11.428 58.991 1.00 65.65  ? 29   ILE B C     1 
ATOM   858   O  O     . ILE B  2 29  ? -42.864 -11.079 59.841 1.00 65.27  ? 29   ILE B O     1 
ATOM   859   C  CB    . ILE B  2 29  ? -41.957 -11.087 57.136 1.00 65.92  ? 29   ILE B CB    1 
ATOM   860   C  CG1   . ILE B  2 29  ? -41.730 -10.548 55.714 1.00 64.45  ? 29   ILE B CG1   1 
ATOM   861   C  CG2   . ILE B  2 29  ? -41.304 -12.472 57.339 1.00 66.27  ? 29   ILE B CG2   1 
ATOM   862   C  CD1   . ILE B  2 29  ? -42.337 -11.361 54.592 1.00 61.56  ? 29   ILE B CD1   1 
ATOM   863   N  N     . THR B  2 30  ? -44.790 -12.095 59.285 1.00 65.23  ? 30   THR B N     1 
ATOM   864   C  CA    . THR B  2 30  ? -45.271 -12.216 60.656 1.00 65.11  ? 30   THR B CA    1 
ATOM   865   C  C     . THR B  2 30  ? -44.513 -13.237 61.500 1.00 65.30  ? 30   THR B C     1 
ATOM   866   O  O     . THR B  2 30  ? -43.873 -14.141 60.973 1.00 65.63  ? 30   THR B O     1 
ATOM   867   C  CB    . THR B  2 30  ? -46.828 -12.420 60.719 1.00 64.87  ? 30   THR B CB    1 
ATOM   868   O  OG1   . THR B  2 30  ? -47.229 -13.546 59.927 1.00 64.98  ? 30   THR B OG1   1 
ATOM   869   C  CG2   . THR B  2 30  ? -47.545 -11.188 60.195 1.00 64.75  ? 30   THR B CG2   1 
ATOM   870   N  N     . LYS B  2 31  ? -44.572 -13.070 62.817 1.00 65.34  ? 31   LYS B N     1 
ATOM   871   C  CA    . LYS B  2 31  ? -44.084 -14.075 63.758 1.00 64.98  ? 31   LYS B CA    1 
ATOM   872   C  C     . LYS B  2 31  ? -44.585 -15.523 63.507 1.00 64.73  ? 31   LYS B C     1 
ATOM   873   O  O     . LYS B  2 31  ? -43.795 -16.472 63.605 1.00 65.01  ? 31   LYS B O     1 
ATOM   874   C  CB    . LYS B  2 31  ? -44.356 -13.608 65.199 1.00 65.36  ? 31   LYS B CB    1 
ATOM   875   C  CG    . LYS B  2 31  ? -44.788 -14.701 66.167 1.00 66.14  ? 31   LYS B CG    1 
ATOM   876   C  CD    . LYS B  2 31  ? -44.406 -14.389 67.598 1.00 67.48  ? 31   LYS B CD    1 
ATOM   877   C  CE    . LYS B  2 31  ? -44.530 -15.652 68.447 1.00 69.01  ? 31   LYS B CE    1 
ATOM   878   N  NZ    . LYS B  2 31  ? -44.078 -15.441 69.859 1.00 70.67  ? 31   LYS B NZ    1 
ATOM   879   N  N     . PRO B  2 32  ? -45.891 -15.717 63.203 1.00 64.41  ? 32   PRO B N     1 
ATOM   880   C  CA    . PRO B  2 32  ? -46.305 -17.109 62.941 1.00 63.80  ? 32   PRO B CA    1 
ATOM   881   C  C     . PRO B  2 32  ? -45.777 -17.711 61.635 1.00 63.31  ? 32   PRO B C     1 
ATOM   882   O  O     . PRO B  2 32  ? -45.631 -18.930 61.548 1.00 63.40  ? 32   PRO B O     1 
ATOM   883   C  CB    . PRO B  2 32  ? -47.839 -17.026 62.900 1.00 63.88  ? 32   PRO B CB    1 
ATOM   884   C  CG    . PRO B  2 32  ? -48.191 -15.667 63.443 1.00 63.85  ? 32   PRO B CG    1 
ATOM   885   C  CD    . PRO B  2 32  ? -47.039 -14.791 63.131 1.00 64.15  ? 32   PRO B CD    1 
ATOM   886   N  N     . ALA B  2 33  ? -45.508 -16.864 60.640 1.00 62.72  ? 33   ALA B N     1 
ATOM   887   C  CA    . ALA B  2 33  ? -44.939 -17.287 59.351 1.00 62.12  ? 33   ALA B CA    1 
ATOM   888   C  C     . ALA B  2 33  ? -43.479 -17.695 59.485 1.00 61.72  ? 33   ALA B C     1 
ATOM   889   O  O     . ALA B  2 33  ? -43.055 -18.702 58.902 1.00 61.77  ? 33   ALA B O     1 
ATOM   890   C  CB    . ALA B  2 33  ? -45.069 -16.190 58.334 1.00 62.08  ? 33   ALA B CB    1 
ATOM   891   N  N     . ILE B  2 34  ? -42.721 -16.902 60.246 1.00 61.31  ? 34   ILE B N     1 
ATOM   892   C  CA    . ILE B  2 34  ? -41.324 -17.195 60.590 1.00 60.67  ? 34   ILE B CA    1 
ATOM   893   C  C     . ILE B  2 34  ? -41.243 -18.463 61.444 1.00 61.15  ? 34   ILE B C     1 
ATOM   894   O  O     . ILE B  2 34  ? -40.311 -19.247 61.307 1.00 61.41  ? 34   ILE B O     1 
ATOM   895   C  CB    . ILE B  2 34  ? -40.643 -15.995 61.330 1.00 61.04  ? 34   ILE B CB    1 
ATOM   896   C  CG1   . ILE B  2 34  ? -40.491 -14.778 60.394 1.00 60.18  ? 34   ILE B CG1   1 
ATOM   897   C  CG2   . ILE B  2 34  ? -39.297 -16.406 61.949 1.00 60.09  ? 34   ILE B CG2   1 
ATOM   898   C  CD1   . ILE B  2 34  ? -40.143 -13.480 61.090 1.00 59.10  ? 34   ILE B CD1   1 
ATOM   899   N  N     . ARG B  2 35  ? -42.222 -18.667 62.321 1.00 61.16  ? 35   ARG B N     1 
ATOM   900   C  CA    . ARG B  2 35  ? -42.246 -19.860 63.156 1.00 61.29  ? 35   ARG B CA    1 
ATOM   901   C  C     . ARG B  2 35  ? -42.523 -21.117 62.333 1.00 60.41  ? 35   ARG B C     1 
ATOM   902   O  O     . ARG B  2 35  ? -41.930 -22.170 62.610 1.00 60.71  ? 35   ARG B O     1 
ATOM   903   C  CB    . ARG B  2 35  ? -43.245 -19.714 64.307 1.00 61.50  ? 35   ARG B CB    1 
ATOM   904   C  CG    . ARG B  2 35  ? -43.768 -21.046 64.844 1.00 63.22  ? 35   ARG B CG    1 
ATOM   905   C  CD    . ARG B  2 35  ? -44.835 -20.880 65.902 1.00 63.16  ? 35   ARG B CD    1 
ATOM   906   N  NE    . ARG B  2 35  ? -44.246 -20.921 67.237 1.00 68.21  ? 35   ARG B NE    1 
ATOM   907   C  CZ    . ARG B  2 35  ? -43.667 -19.887 67.843 1.00 69.77  ? 35   ARG B CZ    1 
ATOM   908   N  NH1   . ARG B  2 35  ? -43.598 -18.704 67.231 1.00 70.49  ? 35   ARG B NH1   1 
ATOM   909   N  NH2   . ARG B  2 35  ? -43.163 -20.039 69.067 1.00 69.36  ? 35   ARG B NH2   1 
ATOM   910   N  N     . ARG B  2 36  ? -43.407 -21.010 61.332 1.00 59.24  ? 36   ARG B N     1 
ATOM   911   C  CA    . ARG B  2 36  ? -43.680 -22.112 60.388 1.00 57.85  ? 36   ARG B CA    1 
ATOM   912   C  C     . ARG B  2 36  ? -42.469 -22.509 59.553 1.00 56.80  ? 36   ARG B C     1 
ATOM   913   O  O     . ARG B  2 36  ? -42.281 -23.686 59.253 1.00 57.11  ? 36   ARG B O     1 
ATOM   914   C  CB    . ARG B  2 36  ? -44.815 -21.762 59.433 1.00 57.93  ? 36   ARG B CB    1 
ATOM   915   C  CG    . ARG B  2 36  ? -46.194 -21.791 60.034 1.00 58.92  ? 36   ARG B CG    1 
ATOM   916   C  CD    . ARG B  2 36  ? -47.270 -21.767 58.924 1.00 60.40  ? 36   ARG B CD    1 
ATOM   917   N  NE    . ARG B  2 36  ? -47.294 -20.514 58.181 1.00 60.04  ? 36   ARG B NE    1 
ATOM   918   C  CZ    . ARG B  2 36  ? -47.928 -19.419 58.589 1.00 61.87  ? 36   ARG B CZ    1 
ATOM   919   N  NH1   . ARG B  2 36  ? -48.597 -19.427 59.738 1.00 61.15  ? 36   ARG B NH1   1 
ATOM   920   N  NH2   . ARG B  2 36  ? -47.891 -18.309 57.851 1.00 61.96  ? 36   ARG B NH2   1 
ATOM   921   N  N     . LEU B  2 37  ? -41.672 -21.522 59.151 1.00 55.66  ? 37   LEU B N     1 
ATOM   922   C  CA    . LEU B  2 37  ? -40.436 -21.762 58.406 1.00 54.07  ? 37   LEU B CA    1 
ATOM   923   C  C     . LEU B  2 37  ? -39.453 -22.490 59.277 1.00 53.25  ? 37   LEU B C     1 
ATOM   924   O  O     . LEU B  2 37  ? -38.795 -23.413 58.818 1.00 53.24  ? 37   LEU B O     1 
ATOM   925   C  CB    . LEU B  2 37  ? -39.799 -20.449 57.932 1.00 54.16  ? 37   LEU B CB    1 
ATOM   926   C  CG    . LEU B  2 37  ? -40.448 -19.694 56.777 1.00 53.74  ? 37   LEU B CG    1 
ATOM   927   C  CD1   . LEU B  2 37  ? -39.851 -18.302 56.675 1.00 54.14  ? 37   LEU B CD1   1 
ATOM   928   C  CD2   . LEU B  2 37  ? -40.302 -20.436 55.477 1.00 52.30  ? 37   LEU B CD2   1 
ATOM   929   N  N     . ALA B  2 38  ? -39.352 -22.062 60.534 1.00 52.50  ? 38   ALA B N     1 
ATOM   930   C  CA    . ALA B  2 38  ? -38.491 -22.717 61.527 1.00 51.86  ? 38   ALA B CA    1 
ATOM   931   C  C     . ALA B  2 38  ? -38.882 -24.182 61.713 1.00 51.45  ? 38   ALA B C     1 
ATOM   932   O  O     . ALA B  2 38  ? -38.021 -25.052 61.718 1.00 51.95  ? 38   ALA B O     1 
ATOM   933   C  CB    . ALA B  2 38  ? -38.542 -21.972 62.859 1.00 51.28  ? 38   ALA B CB    1 
ATOM   934   N  N     . ARG B  2 39  ? -40.183 -24.437 61.832 1.00 50.96  ? 39   ARG B N     1 
ATOM   935   C  CA    . ARG B  2 39  ? -40.734 -25.780 62.013 1.00 50.44  ? 39   ARG B CA    1 
ATOM   936   C  C     . ARG B  2 39  ? -40.333 -26.708 60.874 1.00 50.18  ? 39   ARG B C     1 
ATOM   937   O  O     . ARG B  2 39  ? -39.746 -27.757 61.118 1.00 50.03  ? 39   ARG B O     1 
ATOM   938   C  CB    . ARG B  2 39  ? -42.262 -25.725 62.166 1.00 50.45  ? 39   ARG B CB    1 
ATOM   939   C  CG    . ARG B  2 39  ? -42.768 -25.022 63.425 1.00 51.26  ? 39   ARG B CG    1 
ATOM   940   C  CD    . ARG B  2 39  ? -42.371 -25.789 64.680 1.00 55.10  ? 39   ARG B CD    1 
ATOM   941   N  NE    . ARG B  2 39  ? -43.034 -25.309 65.894 1.00 57.00  ? 39   ARG B NE    1 
ATOM   942   C  CZ    . ARG B  2 39  ? -42.448 -24.552 66.816 1.00 59.84  ? 39   ARG B CZ    1 
ATOM   943   N  NH1   . ARG B  2 39  ? -41.182 -24.170 66.673 1.00 60.85  ? 39   ARG B NH1   1 
ATOM   944   N  NH2   . ARG B  2 39  ? -43.125 -24.169 67.887 1.00 61.46  ? 39   ARG B NH2   1 
ATOM   945   N  N     . ARG B  2 40  ? -40.638 -26.326 59.632 1.00 49.68  ? 40   ARG B N     1 
ATOM   946   C  CA    . ARG B  2 40  ? -40.097 -27.032 58.465 1.00 49.22  ? 40   ARG B CA    1 
ATOM   947   C  C     . ARG B  2 40  ? -38.561 -27.205 58.525 1.00 48.72  ? 40   ARG B C     1 
ATOM   948   O  O     . ARG B  2 40  ? -38.036 -28.222 58.079 1.00 48.58  ? 40   ARG B O     1 
ATOM   949   C  CB    . ARG B  2 40  ? -40.539 -26.354 57.162 1.00 49.36  ? 40   ARG B CB    1 
ATOM   950   C  CG    . ARG B  2 40  ? -40.118 -27.085 55.876 1.00 49.91  ? 40   ARG B CG    1 
ATOM   951   C  CD    . ARG B  2 40  ? -40.801 -26.518 54.625 1.00 49.50  ? 40   ARG B CD    1 
ATOM   952   N  NE    . ARG B  2 40  ? -42.197 -26.929 54.584 1.00 51.29  ? 40   ARG B NE    1 
ATOM   953   C  CZ    . ARG B  2 40  ? -43.168 -26.325 53.900 1.00 51.35  ? 40   ARG B CZ    1 
ATOM   954   N  NH1   . ARG B  2 40  ? -42.927 -25.240 53.177 1.00 50.80  ? 40   ARG B NH1   1 
ATOM   955   N  NH2   . ARG B  2 40  ? -44.399 -26.816 53.957 1.00 51.98  ? 40   ARG B NH2   1 
ATOM   956   N  N     . GLY B  2 41  ? -37.847 -26.235 59.102 1.00 48.40  ? 41   GLY B N     1 
ATOM   957   C  CA    . GLY B  2 41  ? -36.396 -26.362 59.312 1.00 48.37  ? 41   GLY B CA    1 
ATOM   958   C  C     . GLY B  2 41  ? -35.997 -27.278 60.467 1.00 48.73  ? 41   GLY B C     1 
ATOM   959   O  O     . GLY B  2 41  ? -34.795 -27.488 60.733 1.00 47.90  ? 41   GLY B O     1 
ATOM   960   N  N     . GLY B  2 42  ? -37.010 -27.817 61.154 1.00 49.10  ? 42   GLY B N     1 
ATOM   961   C  CA    . GLY B  2 42  ? -36.830 -28.753 62.258 1.00 50.12  ? 42   GLY B CA    1 
ATOM   962   C  C     . GLY B  2 42  ? -36.656 -28.142 63.634 1.00 51.04  ? 42   GLY B C     1 
ATOM   963   O  O     . GLY B  2 42  ? -36.182 -28.818 64.543 1.00 51.59  ? 42   GLY B O     1 
ATOM   964   N  N     . VAL B  2 43  ? -37.056 -26.880 63.796 1.00 51.99  ? 43   VAL B N     1 
ATOM   965   C  CA    . VAL B  2 43  ? -36.839 -26.111 65.027 1.00 52.81  ? 43   VAL B CA    1 
ATOM   966   C  C     . VAL B  2 43  ? -37.975 -26.291 66.045 1.00 54.04  ? 43   VAL B C     1 
ATOM   967   O  O     . VAL B  2 43  ? -39.153 -26.170 65.690 1.00 54.39  ? 43   VAL B O     1 
ATOM   968   C  CB    . VAL B  2 43  ? -36.641 -24.585 64.723 1.00 52.67  ? 43   VAL B CB    1 
ATOM   969   C  CG1   . VAL B  2 43  ? -36.453 -23.790 66.000 1.00 51.95  ? 43   VAL B CG1   1 
ATOM   970   C  CG2   . VAL B  2 43  ? -35.451 -24.354 63.802 1.00 51.26  ? 43   VAL B CG2   1 
ATOM   971   N  N     . LYS B  2 44  ? -37.605 -26.546 67.309 1.00 55.01  ? 44   LYS B N     1 
ATOM   972   C  CA    . LYS B  2 44  ? -38.558 -26.809 68.402 1.00 55.76  ? 44   LYS B CA    1 
ATOM   973   C  C     . LYS B  2 44  ? -38.883 -25.585 69.269 1.00 56.17  ? 44   LYS B C     1 
ATOM   974   O  O     . LYS B  2 44  ? -40.045 -25.288 69.547 1.00 56.71  ? 44   LYS B O     1 
ATOM   975   C  CB    . LYS B  2 44  ? -38.018 -27.920 69.297 1.00 55.78  ? 44   LYS B CB    1 
ATOM   976   C  CG    . LYS B  2 44  ? -39.037 -28.503 70.251 1.00 57.02  ? 44   LYS B CG    1 
ATOM   977   C  CD    . LYS B  2 44  ? -38.366 -29.424 71.268 1.00 60.00  ? 44   LYS B CD    1 
ATOM   978   C  CE    . LYS B  2 44  ? -39.405 -30.133 72.155 1.00 61.96  ? 44   LYS B CE    1 
ATOM   979   N  NZ    . LYS B  2 44  ? -38.820 -31.231 72.990 1.00 60.82  ? 44   LYS B NZ    1 
ATOM   980   N  N     . ARG B  2 45  ? -37.842 -24.891 69.710 1.00 56.48  ? 45   ARG B N     1 
ATOM   981   C  CA    . ARG B  2 45  ? -37.976 -23.767 70.606 1.00 56.41  ? 45   ARG B CA    1 
ATOM   982   C  C     . ARG B  2 45  ? -37.236 -22.571 70.000 1.00 56.41  ? 45   ARG B C     1 
ATOM   983   O  O     . ARG B  2 45  ? -36.150 -22.715 69.440 1.00 56.00  ? 45   ARG B O     1 
ATOM   984   C  CB    . ARG B  2 45  ? -37.411 -24.151 71.962 1.00 56.42  ? 45   ARG B CB    1 
ATOM   985   C  CG    . ARG B  2 45  ? -37.923 -23.321 73.095 1.00 58.14  ? 45   ARG B CG    1 
ATOM   986   C  CD    . ARG B  2 45  ? -37.702 -24.038 74.409 1.00 60.63  ? 45   ARG B CD    1 
ATOM   987   N  NE    . ARG B  2 45  ? -38.227 -23.277 75.536 1.00 61.94  ? 45   ARG B NE    1 
ATOM   988   C  CZ    . ARG B  2 45  ? -37.540 -22.360 76.209 1.00 63.47  ? 45   ARG B CZ    1 
ATOM   989   N  NH1   . ARG B  2 45  ? -36.290 -22.071 75.877 1.00 63.85  ? 45   ARG B NH1   1 
ATOM   990   N  NH2   . ARG B  2 45  ? -38.113 -21.720 77.218 1.00 64.86  ? 45   ARG B NH2   1 
ATOM   991   N  N     . ILE B  2 46  ? -37.847 -21.395 70.118 1.00 56.82  ? 46   ILE B N     1 
ATOM   992   C  CA    . ILE B  2 46  ? -37.459 -20.197 69.364 1.00 56.73  ? 46   ILE B CA    1 
ATOM   993   C  C     . ILE B  2 46  ? -37.350 -18.971 70.281 1.00 56.89  ? 46   ILE B C     1 
ATOM   994   O  O     . ILE B  2 46  ? -38.343 -18.539 70.833 1.00 57.23  ? 46   ILE B O     1 
ATOM   995   C  CB    . ILE B  2 46  ? -38.499 -19.895 68.237 1.00 56.64  ? 46   ILE B CB    1 
ATOM   996   C  CG1   . ILE B  2 46  ? -38.671 -21.105 67.307 1.00 56.36  ? 46   ILE B CG1   1 
ATOM   997   C  CG2   . ILE B  2 46  ? -38.104 -18.653 67.450 1.00 56.72  ? 46   ILE B CG2   1 
ATOM   998   C  CD1   . ILE B  2 46  ? -39.807 -20.989 66.298 1.00 55.88  ? 46   ILE B CD1   1 
ATOM   999   N  N     . SER B  2 47  ? -36.146 -18.419 70.427 1.00 57.09  ? 47   SER B N     1 
ATOM   1000  C  CA    . SER B  2 47  ? -35.911 -17.178 71.175 1.00 56.97  ? 47   SER B CA    1 
ATOM   1001  C  C     . SER B  2 47  ? -36.699 -15.992 70.607 1.00 57.35  ? 47   SER B C     1 
ATOM   1002  O  O     . SER B  2 47  ? -36.860 -15.861 69.387 1.00 57.53  ? 47   SER B O     1 
ATOM   1003  C  CB    . SER B  2 47  ? -34.412 -16.882 71.222 1.00 56.66  ? 47   SER B CB    1 
ATOM   1004  O  OG    . SER B  2 47  ? -34.133 -15.508 71.408 1.00 57.15  ? 47   SER B OG    1 
ATOM   1005  N  N     . GLY B  2 48  ? -37.200 -15.138 71.501 1.00 57.93  ? 48   GLY B N     1 
ATOM   1006  C  CA    . GLY B  2 48  ? -38.026 -13.979 71.132 1.00 57.89  ? 48   GLY B CA    1 
ATOM   1007  C  C     . GLY B  2 48  ? -37.344 -13.046 70.147 1.00 58.80  ? 48   GLY B C     1 
ATOM   1008  O  O     . GLY B  2 48  ? -38.007 -12.434 69.294 1.00 59.41  ? 48   GLY B O     1 
ATOM   1009  N  N     . LEU B  2 49  ? -36.014 -12.954 70.240 1.00 58.55  ? 49   LEU B N     1 
ATOM   1010  C  CA    . LEU B  2 49  ? -35.229 -12.034 69.414 1.00 58.29  ? 49   LEU B CA    1 
ATOM   1011  C  C     . LEU B  2 49  ? -35.008 -12.515 67.971 1.00 58.28  ? 49   LEU B C     1 
ATOM   1012  O  O     . LEU B  2 49  ? -34.532 -11.762 67.112 1.00 58.60  ? 49   LEU B O     1 
ATOM   1013  C  CB    . LEU B  2 49  ? -33.896 -11.751 70.093 1.00 58.37  ? 49   LEU B CB    1 
ATOM   1014  C  CG    . LEU B  2 49  ? -33.976 -11.186 71.519 1.00 58.76  ? 49   LEU B CG    1 
ATOM   1015  C  CD1   . LEU B  2 49  ? -32.673 -11.445 72.275 1.00 58.48  ? 49   LEU B CD1   1 
ATOM   1016  C  CD2   . LEU B  2 49  ? -34.314 -9.691  71.482 1.00 58.77  ? 49   LEU B CD2   1 
ATOM   1017  N  N     . ILE B  2 50  ? -35.384 -13.766 67.719 1.00 58.21  ? 50   ILE B N     1 
ATOM   1018  C  CA    . ILE B  2 50  ? -35.220 -14.427 66.431 1.00 57.48  ? 50   ILE B CA    1 
ATOM   1019  C  C     . ILE B  2 50  ? -36.023 -13.794 65.299 1.00 57.49  ? 50   ILE B C     1 
ATOM   1020  O  O     . ILE B  2 50  ? -35.538 -13.719 64.175 1.00 57.83  ? 50   ILE B O     1 
ATOM   1021  C  CB    . ILE B  2 50  ? -35.565 -15.939 66.545 1.00 57.54  ? 50   ILE B CB    1 
ATOM   1022  C  CG1   . ILE B  2 50  ? -34.410 -16.703 67.189 1.00 56.98  ? 50   ILE B CG1   1 
ATOM   1023  C  CG2   . ILE B  2 50  ? -35.924 -16.539 65.183 1.00 56.83  ? 50   ILE B CG2   1 
ATOM   1024  C  CD1   . ILE B  2 50  ? -33.200 -16.831 66.299 1.00 58.25  ? 50   ILE B CD1   1 
ATOM   1025  N  N     . TYR B  2 51  ? -37.237 -13.336 65.593 1.00 57.04  ? 51   TYR B N     1 
ATOM   1026  C  CA    . TYR B  2 51  ? -38.145 -12.885 64.546 1.00 56.99  ? 51   TYR B CA    1 
ATOM   1027  C  C     . TYR B  2 51  ? -37.595 -11.667 63.853 1.00 57.37  ? 51   TYR B C     1 
ATOM   1028  O  O     . TYR B  2 51  ? -37.611 -11.588 62.622 1.00 57.24  ? 51   TYR B O     1 
ATOM   1029  C  CB    . TYR B  2 51  ? -39.562 -12.665 65.089 1.00 56.58  ? 51   TYR B CB    1 
ATOM   1030  C  CG    . TYR B  2 51  ? -40.059 -13.879 65.836 1.00 55.90  ? 51   TYR B CG    1 
ATOM   1031  C  CD1   . TYR B  2 51  ? -40.545 -14.988 65.151 1.00 55.15  ? 51   TYR B CD1   1 
ATOM   1032  C  CD2   . TYR B  2 51  ? -39.991 -13.935 67.237 1.00 54.56  ? 51   TYR B CD2   1 
ATOM   1033  C  CE1   . TYR B  2 51  ? -40.970 -16.115 65.843 1.00 56.72  ? 51   TYR B CE1   1 
ATOM   1034  C  CE2   . TYR B  2 51  ? -40.406 -15.039 67.933 1.00 53.40  ? 51   TYR B CE2   1 
ATOM   1035  C  CZ    . TYR B  2 51  ? -40.899 -16.137 67.245 1.00 56.38  ? 51   TYR B CZ    1 
ATOM   1036  O  OH    . TYR B  2 51  ? -41.320 -17.261 67.948 1.00 56.08  ? 51   TYR B OH    1 
ATOM   1037  N  N     . GLU B  2 52  ? -37.070 -10.740 64.649 1.00 57.74  ? 52   GLU B N     1 
ATOM   1038  C  CA    . GLU B  2 52  ? -36.398 -9.570  64.107 1.00 58.55  ? 52   GLU B CA    1 
ATOM   1039  C  C     . GLU B  2 52  ? -35.089 -9.918  63.388 1.00 58.01  ? 52   GLU B C     1 
ATOM   1040  O  O     . GLU B  2 52  ? -34.800 -9.336  62.353 1.00 58.41  ? 52   GLU B O     1 
ATOM   1041  C  CB    . GLU B  2 52  ? -36.192 -8.491  65.185 1.00 59.06  ? 52   GLU B CB    1 
ATOM   1042  C  CG    . GLU B  2 52  ? -37.451 -7.641  65.476 1.00 61.31  ? 52   GLU B CG    1 
ATOM   1043  C  CD    . GLU B  2 52  ? -37.930 -6.838  64.266 1.00 63.30  ? 52   GLU B CD    1 
ATOM   1044  O  OE1   . GLU B  2 52  ? -39.095 -7.015  63.832 1.00 64.51  ? 52   GLU B OE1   1 
ATOM   1045  O  OE2   . GLU B  2 52  ? -37.139 -6.033  63.740 1.00 63.97  ? 52   GLU B OE2   1 
ATOM   1046  N  N     . GLU B  2 53  ? -34.314 -10.866 63.923 1.00 57.88  ? 53   GLU B N     1 
ATOM   1047  C  CA    . GLU B  2 53  ? -33.084 -11.331 63.248 1.00 57.35  ? 53   GLU B CA    1 
ATOM   1048  C  C     . GLU B  2 53  ? -33.397 -11.984 61.894 1.00 56.70  ? 53   GLU B C     1 
ATOM   1049  O  O     . GLU B  2 53  ? -32.682 -11.748 60.911 1.00 56.34  ? 53   GLU B O     1 
ATOM   1050  C  CB    . GLU B  2 53  ? -32.260 -12.274 64.140 1.00 57.49  ? 53   GLU B CB    1 
ATOM   1051  C  CG    . GLU B  2 53  ? -30.861 -12.639 63.602 1.00 58.35  ? 53   GLU B CG    1 
ATOM   1052  C  CD    . GLU B  2 53  ? -29.752 -11.621 63.957 1.00 60.42  ? 53   GLU B CD    1 
ATOM   1053  O  OE1   . GLU B  2 53  ? -29.964 -10.747 64.829 1.00 60.02  ? 53   GLU B OE1   1 
ATOM   1054  O  OE2   . GLU B  2 53  ? -28.645 -11.708 63.367 1.00 60.46  ? 53   GLU B OE2   1 
ATOM   1055  N  N     . THR B  2 54  ? -34.482 -12.761 61.847 1.00 55.96  ? 54   THR B N     1 
ATOM   1056  C  CA    . THR B  2 54  ? -34.902 -13.472 60.632 1.00 55.57  ? 54   THR B CA    1 
ATOM   1057  C  C     . THR B  2 54  ? -35.279 -12.487 59.530 1.00 55.03  ? 54   THR B C     1 
ATOM   1058  O  O     . THR B  2 54  ? -34.965 -12.703 58.360 1.00 55.16  ? 54   THR B O     1 
ATOM   1059  C  CB    . THR B  2 54  ? -36.071 -14.484 60.901 1.00 55.45  ? 54   THR B CB    1 
ATOM   1060  O  OG1   . THR B  2 54  ? -35.710 -15.379 61.954 1.00 56.00  ? 54   THR B OG1   1 
ATOM   1061  C  CG2   . THR B  2 54  ? -36.384 -15.322 59.669 1.00 55.90  ? 54   THR B CG2   1 
ATOM   1062  N  N     . ARG B  2 55  ? -35.942 -11.406 59.924 1.00 54.64  ? 55   ARG B N     1 
ATOM   1063  C  CA    . ARG B  2 55  ? -36.341 -10.321 59.015 1.00 53.88  ? 55   ARG B CA    1 
ATOM   1064  C  C     . ARG B  2 55  ? -35.183 -9.621  58.323 1.00 53.47  ? 55   ARG B C     1 
ATOM   1065  O  O     . ARG B  2 55  ? -35.229 -9.410  57.117 1.00 53.64  ? 55   ARG B O     1 
ATOM   1066  C  CB    . ARG B  2 55  ? -37.192 -9.295  59.754 1.00 53.98  ? 55   ARG B CB    1 
ATOM   1067  C  CG    . ARG B  2 55  ? -38.627 -9.721  59.873 1.00 52.99  ? 55   ARG B CG    1 
ATOM   1068  C  CD    . ARG B  2 55  ? -39.472 -8.768  60.683 1.00 51.80  ? 55   ARG B CD    1 
ATOM   1069  N  NE    . ARG B  2 55  ? -40.738 -9.431  61.015 1.00 51.43  ? 55   ARG B NE    1 
ATOM   1070  C  CZ    . ARG B  2 55  ? -41.135 -9.731  62.243 1.00 49.00  ? 55   ARG B CZ    1 
ATOM   1071  N  NH1   . ARG B  2 55  ? -40.401 -9.386  63.285 1.00 49.43  ? 55   ARG B NH1   1 
ATOM   1072  N  NH2   . ARG B  2 55  ? -42.281 -10.360 62.428 1.00 49.58  ? 55   ARG B NH2   1 
ATOM   1073  N  N     . GLY B  2 56  ? -34.158 -9.249  59.079 1.00 52.87  ? 56   GLY B N     1 
ATOM   1074  C  CA    . GLY B  2 56  ? -32.998 -8.582  58.495 1.00 52.07  ? 56   GLY B CA    1 
ATOM   1075  C  C     . GLY B  2 56  ? -32.250 -9.465  57.516 1.00 51.81  ? 56   GLY B C     1 
ATOM   1076  O  O     . GLY B  2 56  ? -31.867 -9.013  56.427 1.00 52.53  ? 56   GLY B O     1 
ATOM   1077  N  N     . VAL B  2 57  ? -32.027 -10.716 57.925 1.00 50.66  ? 57   VAL B N     1 
ATOM   1078  C  CA    . VAL B  2 57  ? -31.460 -11.777 57.093 1.00 49.47  ? 57   VAL B CA    1 
ATOM   1079  C  C     . VAL B  2 57  ? -32.240 -11.892 55.775 1.00 48.90  ? 57   VAL B C     1 
ATOM   1080  O  O     . VAL B  2 57  ? -31.641 -11.931 54.709 1.00 48.95  ? 57   VAL B O     1 
ATOM   1081  C  CB    . VAL B  2 57  ? -31.424 -13.152 57.892 1.00 49.74  ? 57   VAL B CB    1 
ATOM   1082  C  CG1   . VAL B  2 57  ? -31.485 -14.355 56.988 1.00 49.38  ? 57   VAL B CG1   1 
ATOM   1083  C  CG2   . VAL B  2 57  ? -30.217 -13.239 58.829 1.00 48.50  ? 57   VAL B CG2   1 
ATOM   1084  N  N     . LEU B  2 58  ? -33.570 -11.920 55.851 1.00 48.27  ? 58   LEU B N     1 
ATOM   1085  C  CA    . LEU B  2 58  ? -34.416 -11.999 54.656 1.00 47.82  ? 58   LEU B CA    1 
ATOM   1086  C  C     . LEU B  2 58  ? -34.324 -10.748 53.804 1.00 48.23  ? 58   LEU B C     1 
ATOM   1087  O  O     . LEU B  2 58  ? -34.272 -10.846 52.561 1.00 48.68  ? 58   LEU B O     1 
ATOM   1088  C  CB    . LEU B  2 58  ? -35.874 -12.272 55.017 1.00 47.54  ? 58   LEU B CB    1 
ATOM   1089  C  CG    . LEU B  2 58  ? -36.861 -12.371 53.834 1.00 48.20  ? 58   LEU B CG    1 
ATOM   1090  C  CD1   . LEU B  2 58  ? -36.488 -13.487 52.819 1.00 46.79  ? 58   LEU B CD1   1 
ATOM   1091  C  CD2   . LEU B  2 58  ? -38.301 -12.539 54.329 1.00 47.11  ? 58   LEU B CD2   1 
ATOM   1092  N  N     . LYS B  2 59  ? -34.316 -9.578  54.460 1.00 47.89  ? 59   LYS B N     1 
ATOM   1093  C  CA    . LYS B  2 59  ? -34.084 -8.311  53.773 1.00 47.56  ? 59   LYS B CA    1 
ATOM   1094  C  C     . LYS B  2 59  ? -32.777 -8.348  52.968 1.00 46.80  ? 59   LYS B C     1 
ATOM   1095  O  O     . LYS B  2 59  ? -32.784 -8.038  51.770 1.00 46.61  ? 59   LYS B O     1 
ATOM   1096  C  CB    . LYS B  2 59  ? -34.107 -7.121  54.744 1.00 48.25  ? 59   LYS B CB    1 
ATOM   1097  C  CG    . LYS B  2 59  ? -34.068 -5.748  54.047 1.00 50.56  ? 59   LYS B CG    1 
ATOM   1098  C  CD    . LYS B  2 59  ? -34.810 -4.623  54.815 1.00 55.42  ? 59   LYS B CD    1 
ATOM   1099  C  CE    . LYS B  2 59  ? -33.880 -3.730  55.670 1.00 58.00  ? 59   LYS B CE    1 
ATOM   1100  N  NZ    . LYS B  2 59  ? -32.910 -2.912  54.869 1.00 58.08  ? 59   LYS B NZ    1 
ATOM   1101  N  N     . VAL B  2 60  ? -31.668 -8.724  53.611 1.00 45.63  ? 60   VAL B N     1 
ATOM   1102  C  CA    . VAL B  2 60  ? -30.374 -8.798  52.913 1.00 44.75  ? 60   VAL B CA    1 
ATOM   1103  C  C     . VAL B  2 60  ? -30.430 -9.789  51.748 1.00 44.50  ? 60   VAL B C     1 
ATOM   1104  O  O     . VAL B  2 60  ? -29.873 -9.518  50.695 1.00 44.72  ? 60   VAL B O     1 
ATOM   1105  C  CB    . VAL B  2 60  ? -29.208 -9.177  53.848 1.00 44.70  ? 60   VAL B CB    1 
ATOM   1106  C  CG1   . VAL B  2 60  ? -28.037 -9.621  53.044 1.00 43.58  ? 60   VAL B CG1   1 
ATOM   1107  C  CG2   . VAL B  2 60  ? -28.798 -8.012  54.739 1.00 44.83  ? 60   VAL B CG2   1 
ATOM   1108  N  N     . PHE B  2 61  ? -31.099 -10.931 51.943 1.00 44.26  ? 61   PHE B N     1 
ATOM   1109  C  CA    . PHE B  2 61  ? -31.289 -11.931 50.882 1.00 43.95  ? 61   PHE B CA    1 
ATOM   1110  C  C     . PHE B  2 61  ? -32.021 -11.345 49.660 1.00 44.30  ? 61   PHE B C     1 
ATOM   1111  O  O     . PHE B  2 61  ? -31.512 -11.400 48.554 1.00 45.04  ? 61   PHE B O     1 
ATOM   1112  C  CB    . PHE B  2 61  ? -32.000 -13.208 51.416 1.00 43.05  ? 61   PHE B CB    1 
ATOM   1113  C  CG    . PHE B  2 61  ? -32.166 -14.291 50.375 1.00 42.30  ? 61   PHE B CG    1 
ATOM   1114  C  CD1   . PHE B  2 61  ? -31.124 -15.188 50.102 1.00 40.44  ? 61   PHE B CD1   1 
ATOM   1115  C  CD2   . PHE B  2 61  ? -33.342 -14.387 49.618 1.00 41.11  ? 61   PHE B CD2   1 
ATOM   1116  C  CE1   . PHE B  2 61  ? -31.266 -16.186 49.102 1.00 38.90  ? 61   PHE B CE1   1 
ATOM   1117  C  CE2   . PHE B  2 61  ? -33.471 -15.373 48.619 1.00 40.91  ? 61   PHE B CE2   1 
ATOM   1118  C  CZ    . PHE B  2 61  ? -32.435 -16.273 48.368 1.00 38.39  ? 61   PHE B CZ    1 
ATOM   1119  N  N     . LEU B  2 62  ? -33.207 -10.787 49.860 1.00 45.60  ? 62   LEU B N     1 
ATOM   1120  C  CA    . LEU B  2 62  ? -33.952 -10.152 48.757 1.00 47.11  ? 62   LEU B CA    1 
ATOM   1121  C  C     . LEU B  2 62  ? -33.241 -8.933  48.140 1.00 47.92  ? 62   LEU B C     1 
ATOM   1122  O  O     . LEU B  2 62  ? -33.263 -8.766  46.903 1.00 48.50  ? 62   LEU B O     1 
ATOM   1123  C  CB    . LEU B  2 62  ? -35.391 -9.807  49.172 1.00 47.30  ? 62   LEU B CB    1 
ATOM   1124  C  CG    . LEU B  2 62  ? -36.334 -10.978 49.500 1.00 48.06  ? 62   LEU B CG    1 
ATOM   1125  C  CD1   . LEU B  2 62  ? -37.549 -10.487 50.273 1.00 48.33  ? 62   LEU B CD1   1 
ATOM   1126  C  CD2   . LEU B  2 62  ? -36.769 -11.733 48.243 1.00 47.23  ? 62   LEU B CD2   1 
ATOM   1127  N  N     . GLU B  2 63  ? -32.594 -8.100  48.963 1.00 48.07  ? 63   GLU B N     1 
ATOM   1128  C  CA    . GLU B  2 63  ? -31.757 -7.010  48.418 1.00 49.16  ? 63   GLU B CA    1 
ATOM   1129  C  C     . GLU B  2 63  ? -30.760 -7.553  47.423 1.00 48.98  ? 63   GLU B C     1 
ATOM   1130  O  O     . GLU B  2 63  ? -30.671 -7.044  46.315 1.00 49.03  ? 63   GLU B O     1 
ATOM   1131  C  CB    . GLU B  2 63  ? -31.010 -6.219  49.504 1.00 48.76  ? 63   GLU B CB    1 
ATOM   1132  C  CG    . GLU B  2 63  ? -31.926 -5.511  50.478 1.00 51.07  ? 63   GLU B CG    1 
ATOM   1133  C  CD    . GLU B  2 63  ? -31.193 -4.755  51.555 1.00 51.50  ? 63   GLU B CD    1 
ATOM   1134  O  OE1   . GLU B  2 63  ? -30.213 -5.269  52.120 1.00 54.54  ? 63   GLU B OE1   1 
ATOM   1135  O  OE2   . GLU B  2 63  ? -31.607 -3.624  51.844 1.00 56.83  ? 63   GLU B OE2   1 
ATOM   1136  N  N     . ASN B  2 64  ? -30.018 -8.597  47.809 1.00 49.84  ? 64   ASN B N     1 
ATOM   1137  C  CA    . ASN B  2 64  ? -28.951 -9.137  46.942 1.00 49.91  ? 64   ASN B CA    1 
ATOM   1138  C  C     . ASN B  2 64  ? -29.435 -9.704  45.646 1.00 49.44  ? 64   ASN B C     1 
ATOM   1139  O  O     . ASN B  2 64  ? -28.823 -9.463  44.626 1.00 49.89  ? 64   ASN B O     1 
ATOM   1140  C  CB    . ASN B  2 64  ? -28.110 -10.185 47.645 1.00 50.17  ? 64   ASN B CB    1 
ATOM   1141  C  CG    . ASN B  2 64  ? -27.153 -9.594  48.608 1.00 51.30  ? 64   ASN B CG    1 
ATOM   1142  O  OD1   . ASN B  2 64  ? -26.186 -8.947  48.220 1.00 55.82  ? 64   ASN B OD1   1 
ATOM   1143  N  ND2   . ASN B  2 64  ? -27.398 -9.811  49.883 1.00 52.62  ? 64   ASN B ND2   1 
ATOM   1144  N  N     . VAL B  2 65  ? -30.525 -10.468 45.695 1.00 49.66  ? 65   VAL B N     1 
ATOM   1145  C  CA    . VAL B  2 65  ? -31.064 -11.136 44.503 1.00 49.46  ? 65   VAL B CA    1 
ATOM   1146  C  C     . VAL B  2 65  ? -31.826 -10.188 43.580 1.00 49.25  ? 65   VAL B C     1 
ATOM   1147  O  O     . VAL B  2 65  ? -31.574 -10.180 42.385 1.00 49.63  ? 65   VAL B O     1 
ATOM   1148  C  CB    . VAL B  2 65  ? -31.934 -12.393 44.864 1.00 49.68  ? 65   VAL B CB    1 
ATOM   1149  C  CG1   . VAL B  2 65  ? -32.475 -13.056 43.598 1.00 48.12  ? 65   VAL B CG1   1 
ATOM   1150  C  CG2   . VAL B  2 65  ? -31.107 -13.387 45.639 1.00 50.08  ? 65   VAL B CG2   1 
ATOM   1151  N  N     . ILE B  2 66  ? -32.756 -9.410  44.144 1.00 49.23  ? 66   ILE B N     1 
ATOM   1152  C  CA    . ILE B  2 66  ? -33.489 -8.355  43.428 1.00 48.90  ? 66   ILE B CA    1 
ATOM   1153  C  C     . ILE B  2 66  ? -32.568 -7.339  42.731 1.00 49.39  ? 66   ILE B C     1 
ATOM   1154  O  O     . ILE B  2 66  ? -32.801 -6.995  41.569 1.00 49.32  ? 66   ILE B O     1 
ATOM   1155  C  CB    . ILE B  2 66  ? -34.497 -7.643  44.368 1.00 49.32  ? 66   ILE B CB    1 
ATOM   1156  C  CG1   . ILE B  2 66  ? -35.590 -8.631  44.831 1.00 49.16  ? 66   ILE B CG1   1 
ATOM   1157  C  CG2   . ILE B  2 66  ? -35.096 -6.383  43.722 1.00 48.34  ? 66   ILE B CG2   1 
ATOM   1158  C  CD1   . ILE B  2 66  ? -36.625 -8.033  45.739 1.00 49.02  ? 66   ILE B CD1   1 
ATOM   1159  N  N     . ARG B  2 67  ? -31.529 -6.865  43.429 1.00 49.41  ? 67   ARG B N     1 
ATOM   1160  C  CA    . ARG B  2 67  ? -30.555 -5.955  42.831 1.00 50.19  ? 67   ARG B CA    1 
ATOM   1161  C  C     . ARG B  2 67  ? -30.113 -6.504  41.493 1.00 50.15  ? 67   ARG B C     1 
ATOM   1162  O  O     . ARG B  2 67  ? -30.138 -5.809  40.491 1.00 50.77  ? 67   ARG B O     1 
ATOM   1163  C  CB    . ARG B  2 67  ? -29.343 -5.755  43.756 1.00 49.71  ? 67   ARG B CB    1 
ATOM   1164  C  CG    . ARG B  2 67  ? -28.160 -5.001  43.133 1.00 50.99  ? 67   ARG B CG    1 
ATOM   1165  C  CD    . ARG B  2 67  ? -26.950 -4.898  44.098 1.00 52.16  ? 67   ARG B CD    1 
ATOM   1166  N  NE    . ARG B  2 67  ? -27.295 -4.097  45.286 1.00 58.89  ? 67   ARG B NE    1 
ATOM   1167  C  CZ    . ARG B  2 67  ? -27.367 -4.544  46.546 1.00 59.88  ? 67   ARG B CZ    1 
ATOM   1168  N  NH1   . ARG B  2 67  ? -27.079 -5.807  46.851 1.00 60.74  ? 67   ARG B NH1   1 
ATOM   1169  N  NH2   . ARG B  2 67  ? -27.712 -3.708  47.515 1.00 60.74  ? 67   ARG B NH2   1 
ATOM   1170  N  N     . ASP B  2 68  ? -29.726 -7.776  41.497 1.00 50.75  ? 68   ASP B N     1 
ATOM   1171  C  CA    . ASP B  2 68  ? -29.183 -8.473  40.337 1.00 50.27  ? 68   ASP B CA    1 
ATOM   1172  C  C     . ASP B  2 68  ? -30.258 -8.720  39.285 1.00 50.34  ? 68   ASP B C     1 
ATOM   1173  O  O     . ASP B  2 68  ? -29.980 -8.636  38.092 1.00 50.41  ? 68   ASP B O     1 
ATOM   1174  C  CB    . ASP B  2 68  ? -28.581 -9.814  40.792 1.00 50.46  ? 68   ASP B CB    1 
ATOM   1175  C  CG    . ASP B  2 68  ? -27.091 -9.743  41.094 1.00 50.33  ? 68   ASP B CG    1 
ATOM   1176  O  OD1   . ASP B  2 68  ? -26.510 -8.639  41.182 1.00 52.03  ? 68   ASP B OD1   1 
ATOM   1177  O  OD2   . ASP B  2 68  ? -26.482 -10.827 41.243 1.00 49.00  ? 68   ASP B OD2   1 
ATOM   1178  N  N     . ALA B  2 69  ? -31.473 -9.055  39.731 1.00 50.13  ? 69   ALA B N     1 
ATOM   1179  C  CA    . ALA B  2 69  ? -32.627 -9.268  38.833 1.00 50.10  ? 69   ALA B CA    1 
ATOM   1180  C  C     . ALA B  2 69  ? -32.977 -7.996  38.094 1.00 50.14  ? 69   ALA B C     1 
ATOM   1181  O  O     . ALA B  2 69  ? -33.106 -8.007  36.878 1.00 50.45  ? 69   ALA B O     1 
ATOM   1182  C  CB    . ALA B  2 69  ? -33.853 -9.784  39.613 1.00 49.66  ? 69   ALA B CB    1 
ATOM   1183  N  N     . VAL B  2 70  ? -33.107 -6.893  38.839 1.00 50.71  ? 70   VAL B N     1 
ATOM   1184  C  CA    . VAL B  2 70  ? -33.379 -5.563  38.274 1.00 50.19  ? 70   VAL B CA    1 
ATOM   1185  C  C     . VAL B  2 70  ? -32.284 -5.051  37.329 1.00 50.57  ? 70   VAL B C     1 
ATOM   1186  O  O     . VAL B  2 70  ? -32.565 -4.269  36.432 1.00 52.01  ? 70   VAL B O     1 
ATOM   1187  C  CB    . VAL B  2 70  ? -33.685 -4.546  39.388 1.00 50.28  ? 70   VAL B CB    1 
ATOM   1188  C  CG1   . VAL B  2 70  ? -33.730 -3.119  38.843 1.00 50.06  ? 70   VAL B CG1   1 
ATOM   1189  C  CG2   . VAL B  2 70  ? -35.016 -4.906  40.073 1.00 49.58  ? 70   VAL B CG2   1 
ATOM   1190  N  N     . THR B  2 71  ? -31.048 -5.490  37.520 1.00 50.05  ? 71   THR B N     1 
ATOM   1191  C  CA    . THR B  2 71  ? -29.963 -5.175  36.610 1.00 49.52  ? 71   THR B CA    1 
ATOM   1192  C  C     . THR B  2 71  ? -30.121 -5.929  35.310 1.00 50.49  ? 71   THR B C     1 
ATOM   1193  O  O     . THR B  2 71  ? -29.638 -5.486  34.271 1.00 51.31  ? 71   THR B O     1 
ATOM   1194  C  CB    . THR B  2 71  ? -28.618 -5.521  37.260 1.00 49.39  ? 71   THR B CB    1 
ATOM   1195  O  OG1   . THR B  2 71  ? -28.555 -4.883  38.531 1.00 48.72  ? 71   THR B OG1   1 
ATOM   1196  C  CG2   . THR B  2 71  ? -27.438 -5.061  36.432 1.00 46.99  ? 71   THR B CG2   1 
ATOM   1197  N  N     . TYR B  2 72  ? -30.773 -7.089  35.366 1.00 51.16  ? 72   TYR B N     1 
ATOM   1198  C  CA    . TYR B  2 72  ? -31.130 -7.838  34.156 1.00 51.51  ? 72   TYR B CA    1 
ATOM   1199  C  C     . TYR B  2 72  ? -32.298 -7.184  33.426 1.00 51.95  ? 72   TYR B C     1 
ATOM   1200  O  O     . TYR B  2 72  ? -32.332 -7.173  32.209 1.00 52.12  ? 72   TYR B O     1 
ATOM   1201  C  CB    . TYR B  2 72  ? -31.482 -9.308  34.477 1.00 50.79  ? 72   TYR B CB    1 
ATOM   1202  C  CG    . TYR B  2 72  ? -30.277 -10.187 34.704 1.00 49.56  ? 72   TYR B CG    1 
ATOM   1203  C  CD1   . TYR B  2 72  ? -30.095 -10.862 35.911 1.00 48.58  ? 72   TYR B CD1   1 
ATOM   1204  C  CD2   . TYR B  2 72  ? -29.318 -10.336 33.715 1.00 48.84  ? 72   TYR B CD2   1 
ATOM   1205  C  CE1   . TYR B  2 72  ? -28.988 -11.650 36.122 1.00 47.52  ? 72   TYR B CE1   1 
ATOM   1206  C  CE2   . TYR B  2 72  ? -28.217 -11.131 33.912 1.00 49.60  ? 72   TYR B CE2   1 
ATOM   1207  C  CZ    . TYR B  2 72  ? -28.056 -11.779 35.118 1.00 48.47  ? 72   TYR B CZ    1 
ATOM   1208  O  OH    . TYR B  2 72  ? -26.948 -12.546 35.294 1.00 48.49  ? 72   TYR B OH    1 
ATOM   1209  N  N     . THR B  2 73  ? -33.261 -6.669  34.180 1.00 53.00  ? 73   THR B N     1 
ATOM   1210  C  CA    . THR B  2 73  ? -34.402 -5.957  33.603 1.00 54.13  ? 73   THR B CA    1 
ATOM   1211  C  C     . THR B  2 73  ? -33.943 -4.729  32.831 1.00 54.94  ? 73   THR B C     1 
ATOM   1212  O  O     . THR B  2 73  ? -34.188 -4.650  31.633 1.00 55.51  ? 73   THR B O     1 
ATOM   1213  C  CB    . THR B  2 73  ? -35.399 -5.532  34.671 1.00 53.88  ? 73   THR B CB    1 
ATOM   1214  O  OG1   . THR B  2 73  ? -35.689 -6.650  35.510 1.00 54.07  ? 73   THR B OG1   1 
ATOM   1215  C  CG2   . THR B  2 73  ? -36.675 -5.068  34.022 1.00 54.69  ? 73   THR B CG2   1 
ATOM   1216  N  N     . GLU B  2 74  ? -33.264 -3.800  33.514 1.00 55.48  ? 74   GLU B N     1 
ATOM   1217  C  CA    . GLU B  2 74  ? -32.659 -2.613  32.887 1.00 56.66  ? 74   GLU B CA    1 
ATOM   1218  C  C     . GLU B  2 74  ? -31.889 -2.921  31.581 1.00 56.35  ? 74   GLU B C     1 
ATOM   1219  O  O     . GLU B  2 74  ? -32.091 -2.250  30.562 1.00 56.50  ? 74   GLU B O     1 
ATOM   1220  C  CB    . GLU B  2 74  ? -31.760 -1.848  33.882 1.00 56.43  ? 74   GLU B CB    1 
ATOM   1221  C  CG    . GLU B  2 74  ? -32.520 -1.209  35.068 1.00 58.51  ? 74   GLU B CG    1 
ATOM   1222  C  CD    . GLU B  2 74  ? -31.617 -0.466  36.070 1.00 59.29  ? 74   GLU B CD    1 
ATOM   1223  O  OE1   . GLU B  2 74  ? -30.733 -1.100  36.705 1.00 62.87  ? 74   GLU B OE1   1 
ATOM   1224  O  OE2   . GLU B  2 74  ? -31.810 0.761   36.240 1.00 63.01  ? 74   GLU B OE2   1 
ATOM   1225  N  N     . HIS B  2 75  ? -31.016 -3.928  31.601 1.00 56.01  ? 75   HIS B N     1 
ATOM   1226  C  CA    . HIS B  2 75  ? -30.331 -4.336  30.373 1.00 55.56  ? 75   HIS B CA    1 
ATOM   1227  C  C     . HIS B  2 75  ? -31.287 -4.696  29.222 1.00 56.32  ? 75   HIS B C     1 
ATOM   1228  O  O     . HIS B  2 75  ? -31.062 -4.322  28.072 1.00 56.03  ? 75   HIS B O     1 
ATOM   1229  C  CB    . HIS B  2 75  ? -29.378 -5.494  30.623 1.00 54.82  ? 75   HIS B CB    1 
ATOM   1230  C  CG    . HIS B  2 75  ? -28.345 -5.640  29.556 1.00 51.81  ? 75   HIS B CG    1 
ATOM   1231  N  ND1   . HIS B  2 75  ? -27.135 -4.985  29.607 1.00 48.26  ? 75   HIS B ND1   1 
ATOM   1232  C  CD2   . HIS B  2 75  ? -28.353 -6.337  28.394 1.00 48.81  ? 75   HIS B CD2   1 
ATOM   1233  C  CE1   . HIS B  2 75  ? -26.433 -5.289  28.527 1.00 48.60  ? 75   HIS B CE1   1 
ATOM   1234  N  NE2   . HIS B  2 75  ? -27.152 -6.102  27.772 1.00 46.16  ? 75   HIS B NE2   1 
ATOM   1235  N  N     . ALA B  2 76  ? -32.350 -5.426  29.539 1.00 57.19  ? 76   ALA B N     1 
ATOM   1236  C  CA    . ALA B  2 76  ? -33.304 -5.861  28.529 1.00 58.28  ? 76   ALA B CA    1 
ATOM   1237  C  C     . ALA B  2 76  ? -34.215 -4.714  28.072 1.00 59.10  ? 76   ALA B C     1 
ATOM   1238  O  O     . ALA B  2 76  ? -35.014 -4.876  27.137 1.00 59.66  ? 76   ALA B O     1 
ATOM   1239  C  CB    . ALA B  2 76  ? -34.119 -7.030  29.047 1.00 57.89  ? 76   ALA B CB    1 
ATOM   1240  N  N     . LYS B  2 77  ? -34.071 -3.556  28.721 1.00 59.94  ? 77   LYS B N     1 
ATOM   1241  C  CA    . LYS B  2 77  ? -34.851 -2.354  28.404 1.00 60.46  ? 77   LYS B CA    1 
ATOM   1242  C  C     . LYS B  2 77  ? -36.328 -2.648  28.672 1.00 60.33  ? 77   LYS B C     1 
ATOM   1243  O  O     . LYS B  2 77  ? -37.197 -2.310  27.867 1.00 60.73  ? 77   LYS B O     1 
ATOM   1244  C  CB    . LYS B  2 77  ? -34.649 -1.909  26.943 1.00 60.66  ? 77   LYS B CB    1 
ATOM   1245  C  CG    . LYS B  2 77  ? -33.235 -1.495  26.526 1.00 62.02  ? 77   LYS B CG    1 
ATOM   1246  C  CD    . LYS B  2 77  ? -32.984 -1.981  25.077 1.00 64.49  ? 77   LYS B CD    1 
ATOM   1247  C  CE    . LYS B  2 77  ? -32.191 -0.991  24.194 1.00 66.37  ? 77   LYS B CE    1 
ATOM   1248  N  NZ    . LYS B  2 77  ? -30.736 -0.858  24.537 1.00 66.77  ? 77   LYS B NZ    1 
ATOM   1249  N  N     . ARG B  2 78  ? -36.593 -3.304  29.798 1.00 60.15  ? 78   ARG B N     1 
ATOM   1250  C  CA    . ARG B  2 78  ? -37.950 -3.629  30.214 1.00 59.83  ? 78   ARG B CA    1 
ATOM   1251  C  C     . ARG B  2 78  ? -38.310 -2.845  31.479 1.00 60.14  ? 78   ARG B C     1 
ATOM   1252  O  O     . ARG B  2 78  ? -37.446 -2.208  32.081 1.00 60.09  ? 78   ARG B O     1 
ATOM   1253  C  CB    . ARG B  2 78  ? -38.101 -5.153  30.418 1.00 59.81  ? 78   ARG B CB    1 
ATOM   1254  C  CG    . ARG B  2 78  ? -38.157 -5.962  29.119 1.00 58.59  ? 78   ARG B CG    1 
ATOM   1255  C  CD    . ARG B  2 78  ? -38.387 -7.466  29.351 1.00 59.02  ? 78   ARG B CD    1 
ATOM   1256  N  NE    . ARG B  2 78  ? -37.163 -8.172  29.708 1.00 55.64  ? 78   ARG B NE    1 
ATOM   1257  C  CZ    . ARG B  2 78  ? -36.780 -8.427  30.957 1.00 55.78  ? 78   ARG B CZ    1 
ATOM   1258  N  NH1   . ARG B  2 78  ? -37.534 -8.059  31.993 1.00 55.30  ? 78   ARG B NH1   1 
ATOM   1259  N  NH2   . ARG B  2 78  ? -35.642 -9.059  31.172 1.00 54.69  ? 78   ARG B NH2   1 
ATOM   1260  N  N     . LYS B  2 79  ? -39.588 -2.882  31.850 1.00 60.60  ? 79   LYS B N     1 
ATOM   1261  C  CA    . LYS B  2 79  ? -40.148 -2.175  33.009 1.00 61.20  ? 79   LYS B CA    1 
ATOM   1262  C  C     . LYS B  2 79  ? -40.780 -3.222  33.914 1.00 60.98  ? 79   LYS B C     1 
ATOM   1263  O  O     . LYS B  2 79  ? -41.356 -2.914  34.963 1.00 61.42  ? 79   LYS B O     1 
ATOM   1264  C  CB    . LYS B  2 79  ? -41.222 -1.177  32.538 1.00 61.94  ? 79   LYS B CB    1 
ATOM   1265  C  CG    . LYS B  2 79  ? -40.652 0.101   31.926 1.00 64.37  ? 79   LYS B CG    1 
ATOM   1266  C  CD    . LYS B  2 79  ? -41.242 0.421   30.539 1.00 69.37  ? 79   LYS B CD    1 
ATOM   1267  C  CE    . LYS B  2 79  ? -40.236 1.269   29.715 1.00 71.61  ? 79   LYS B CE    1 
ATOM   1268  N  NZ    . LYS B  2 79  ? -40.886 2.226   28.757 1.00 72.94  ? 79   LYS B NZ    1 
ATOM   1269  N  N     . THR B  2 80  ? -40.650 -4.474  33.486 1.00 60.69  ? 80   THR B N     1 
ATOM   1270  C  CA    . THR B  2 80  ? -41.247 -5.629  34.141 1.00 59.88  ? 80   THR B CA    1 
ATOM   1271  C  C     . THR B  2 80  ? -40.141 -6.619  34.441 1.00 59.08  ? 80   THR B C     1 
ATOM   1272  O  O     . THR B  2 80  ? -39.418 -7.055  33.529 1.00 59.18  ? 80   THR B O     1 
ATOM   1273  C  CB    . THR B  2 80  ? -42.274 -6.312  33.207 1.00 60.06  ? 80   THR B CB    1 
ATOM   1274  O  OG1   . THR B  2 80  ? -43.110 -5.314  32.609 1.00 61.34  ? 80   THR B OG1   1 
ATOM   1275  C  CG2   . THR B  2 80  ? -43.132 -7.318  33.956 1.00 59.30  ? 80   THR B CG2   1 
ATOM   1276  N  N     . VAL B  2 81  ? -39.999 -6.954  35.723 1.00 58.13  ? 81   VAL B N     1 
ATOM   1277  C  CA    . VAL B  2 81  ? -39.109 -8.034  36.150 1.00 56.41  ? 81   VAL B CA    1 
ATOM   1278  C  C     . VAL B  2 81  ? -39.728 -9.363  35.738 1.00 55.52  ? 81   VAL B C     1 
ATOM   1279  O  O     . VAL B  2 81  ? -40.872 -9.672  36.093 1.00 55.03  ? 81   VAL B O     1 
ATOM   1280  C  CB    . VAL B  2 81  ? -38.866 -7.998  37.660 1.00 56.39  ? 81   VAL B CB    1 
ATOM   1281  C  CG1   . VAL B  2 81  ? -37.832 -9.047  38.067 1.00 56.08  ? 81   VAL B CG1   1 
ATOM   1282  C  CG2   . VAL B  2 81  ? -38.395 -6.606  38.076 1.00 56.33  ? 81   VAL B CG2   1 
ATOM   1283  N  N     . THR B  2 82  ? -38.984 -10.135 34.953 1.00 54.93  ? 82   THR B N     1 
ATOM   1284  C  CA    . THR B  2 82  ? -39.453 -11.468 34.555 1.00 53.97  ? 82   THR B CA    1 
ATOM   1285  C  C     . THR B  2 82  ? -38.910 -12.570 35.480 1.00 53.86  ? 82   THR B C     1 
ATOM   1286  O  O     . THR B  2 82  ? -37.860 -12.422 36.103 1.00 53.60  ? 82   THR B O     1 
ATOM   1287  C  CB    . THR B  2 82  ? -39.186 -11.768 33.049 1.00 53.75  ? 82   THR B CB    1 
ATOM   1288  O  OG1   . THR B  2 82  ? -37.789 -11.802 32.786 1.00 52.50  ? 82   THR B OG1   1 
ATOM   1289  C  CG2   . THR B  2 82  ? -39.812 -10.687 32.157 1.00 54.34  ? 82   THR B CG2   1 
ATOM   1290  N  N     . ALA B  2 83  ? -39.661 -13.658 35.592 1.00 53.92  ? 83   ALA B N     1 
ATOM   1291  C  CA    . ALA B  2 83  ? -39.191 -14.879 36.226 1.00 53.58  ? 83   ALA B CA    1 
ATOM   1292  C  C     . ALA B  2 83  ? -37.761 -15.211 35.828 1.00 53.22  ? 83   ALA B C     1 
ATOM   1293  O  O     . ALA B  2 83  ? -36.978 -15.605 36.677 1.00 54.08  ? 83   ALA B O     1 
ATOM   1294  C  CB    . ALA B  2 83  ? -40.117 -16.041 35.892 1.00 53.82  ? 83   ALA B CB    1 
ATOM   1295  N  N     . MET B  2 84  ? -37.420 -15.049 34.554 1.00 52.46  ? 84   MET B N     1 
ATOM   1296  C  CA    . MET B  2 84  ? -36.083 -15.357 34.060 1.00 51.87  ? 84   MET B CA    1 
ATOM   1297  C  C     . MET B  2 84  ? -35.025 -14.419 34.596 1.00 51.88  ? 84   MET B C     1 
ATOM   1298  O  O     . MET B  2 84  ? -33.882 -14.850 34.775 1.00 52.25  ? 84   MET B O     1 
ATOM   1299  C  CB    . MET B  2 84  ? -36.017 -15.326 32.530 1.00 52.16  ? 84   MET B CB    1 
ATOM   1300  C  CG    . MET B  2 84  ? -36.686 -16.480 31.817 1.00 52.96  ? 84   MET B CG    1 
ATOM   1301  S  SD    . MET B  2 84  ? -36.288 -18.121 32.455 1.00 57.38  ? 84   MET B SD    1 
ATOM   1302  C  CE    . MET B  2 84  ? -34.510 -18.213 32.236 1.00 53.49  ? 84   MET B CE    1 
ATOM   1303  N  N     . ASP B  2 85  ? -35.374 -13.142 34.816 1.00 51.35  ? 85   ASP B N     1 
ATOM   1304  C  CA    . ASP B  2 85  ? -34.437 -12.191 35.437 1.00 50.93  ? 85   ASP B CA    1 
ATOM   1305  C  C     . ASP B  2 85  ? -34.074 -12.696 36.820 1.00 50.66  ? 85   ASP B C     1 
ATOM   1306  O  O     . ASP B  2 85  ? -32.910 -12.622 37.230 1.00 51.11  ? 85   ASP B O     1 
ATOM   1307  C  CB    . ASP B  2 85  ? -35.011 -10.765 35.584 1.00 50.93  ? 85   ASP B CB    1 
ATOM   1308  C  CG    . ASP B  2 85  ? -35.285 -10.073 34.252 1.00 50.74  ? 85   ASP B CG    1 
ATOM   1309  O  OD1   . ASP B  2 85  ? -34.642 -10.374 33.228 1.00 50.21  ? 85   ASP B OD1   1 
ATOM   1310  O  OD2   . ASP B  2 85  ? -36.155 -9.189  34.245 1.00 51.74  ? 85   ASP B OD2   1 
ATOM   1311  N  N     . VAL B  2 86  ? -35.084 -13.181 37.533 1.00 49.79  ? 86   VAL B N     1 
ATOM   1312  C  CA    . VAL B  2 86  ? -34.924 -13.726 38.881 1.00 50.11  ? 86   VAL B CA    1 
ATOM   1313  C  C     . VAL B  2 86  ? -34.067 -14.990 38.871 1.00 50.49  ? 86   VAL B C     1 
ATOM   1314  O  O     . VAL B  2 86  ? -33.096 -15.097 39.626 1.00 51.37  ? 86   VAL B O     1 
ATOM   1315  C  CB    . VAL B  2 86  ? -36.295 -14.032 39.519 1.00 49.90  ? 86   VAL B CB    1 
ATOM   1316  C  CG1   . VAL B  2 86  ? -36.127 -14.806 40.790 1.00 50.31  ? 86   VAL B CG1   1 
ATOM   1317  C  CG2   . VAL B  2 86  ? -37.073 -12.734 39.770 1.00 49.29  ? 86   VAL B CG2   1 
ATOM   1318  N  N     . VAL B  2 87  ? -34.413 -15.921 37.983 1.00 50.12  ? 87   VAL B N     1 
ATOM   1319  C  CA    . VAL B  2 87  ? -33.752 -17.200 37.852 1.00 49.46  ? 87   VAL B CA    1 
ATOM   1320  C  C     . VAL B  2 87  ? -32.271 -17.014 37.537 1.00 49.35  ? 87   VAL B C     1 
ATOM   1321  O  O     . VAL B  2 87  ? -31.410 -17.729 38.069 1.00 49.67  ? 87   VAL B O     1 
ATOM   1322  C  CB    . VAL B  2 87  ? -34.504 -18.080 36.793 1.00 49.89  ? 87   VAL B CB    1 
ATOM   1323  C  CG1   . VAL B  2 87  ? -33.700 -19.320 36.373 1.00 49.31  ? 87   VAL B CG1   1 
ATOM   1324  C  CG2   . VAL B  2 87  ? -35.857 -18.503 37.327 1.00 48.14  ? 87   VAL B CG2   1 
ATOM   1325  N  N     . TYR B  2 88  ? -31.976 -16.035 36.693 1.00 49.21  ? 88   TYR B N     1 
ATOM   1326  C  CA    . TYR B  2 88  ? -30.599 -15.710 36.313 1.00 48.21  ? 88   TYR B CA    1 
ATOM   1327  C  C     . TYR B  2 88  ? -29.821 -15.075 37.462 1.00 47.60  ? 88   TYR B C     1 
ATOM   1328  O  O     . TYR B  2 88  ? -28.608 -15.289 37.622 1.00 47.45  ? 88   TYR B O     1 
ATOM   1329  C  CB    . TYR B  2 88  ? -30.624 -14.761 35.128 1.00 49.02  ? 88   TYR B CB    1 
ATOM   1330  C  CG    . TYR B  2 88  ? -31.084 -15.380 33.824 1.00 50.37  ? 88   TYR B CG    1 
ATOM   1331  C  CD1   . TYR B  2 88  ? -31.661 -14.595 32.836 1.00 51.03  ? 88   TYR B CD1   1 
ATOM   1332  C  CD2   . TYR B  2 88  ? -30.945 -16.752 33.580 1.00 51.74  ? 88   TYR B CD2   1 
ATOM   1333  C  CE1   . TYR B  2 88  ? -32.078 -15.140 31.630 1.00 51.30  ? 88   TYR B CE1   1 
ATOM   1334  C  CE2   . TYR B  2 88  ? -31.359 -17.316 32.384 1.00 51.59  ? 88   TYR B CE2   1 
ATOM   1335  C  CZ    . TYR B  2 88  ? -31.911 -16.496 31.403 1.00 52.56  ? 88   TYR B CZ    1 
ATOM   1336  O  OH    . TYR B  2 88  ? -32.312 -17.034 30.194 1.00 53.60  ? 88   TYR B OH    1 
ATOM   1337  N  N     . ALA B  2 89  ? -30.527 -14.298 38.272 1.00 46.80  ? 89   ALA B N     1 
ATOM   1338  C  CA    . ALA B  2 89  ? -29.912 -13.616 39.389 1.00 46.34  ? 89   ALA B CA    1 
ATOM   1339  C  C     . ALA B  2 89  ? -29.584 -14.639 40.446 1.00 45.46  ? 89   ALA B C     1 
ATOM   1340  O  O     . ALA B  2 89  ? -28.476 -14.645 40.952 1.00 45.75  ? 89   ALA B O     1 
ATOM   1341  C  CB    . ALA B  2 89  ? -30.824 -12.519 39.942 1.00 46.36  ? 89   ALA B CB    1 
ATOM   1342  N  N     . LEU B  2 90  ? -30.548 -15.505 40.760 1.00 44.68  ? 90   LEU B N     1 
ATOM   1343  C  CA    . LEU B  2 90  ? -30.332 -16.672 41.641 1.00 43.53  ? 90   LEU B CA    1 
ATOM   1344  C  C     . LEU B  2 90  ? -29.218 -17.623 41.167 1.00 43.31  ? 90   LEU B C     1 
ATOM   1345  O  O     . LEU B  2 90  ? -28.387 -18.067 41.953 1.00 42.89  ? 90   LEU B O     1 
ATOM   1346  C  CB    . LEU B  2 90  ? -31.631 -17.435 41.818 1.00 43.00  ? 90   LEU B CB    1 
ATOM   1347  C  CG    . LEU B  2 90  ? -32.729 -16.785 42.669 1.00 43.24  ? 90   LEU B CG    1 
ATOM   1348  C  CD1   . LEU B  2 90  ? -34.065 -17.469 42.389 1.00 42.75  ? 90   LEU B CD1   1 
ATOM   1349  C  CD2   . LEU B  2 90  ? -32.416 -16.841 44.172 1.00 41.03  ? 90   LEU B CD2   1 
ATOM   1350  N  N     . LYS B  2 91  ? -29.171 -17.931 39.884 1.00 43.43  ? 91   LYS B N     1 
ATOM   1351  C  CA    . LYS B  2 91  ? -28.054 -18.731 39.397 1.00 44.49  ? 91   LYS B CA    1 
ATOM   1352  C  C     . LYS B  2 91  ? -26.714 -18.144 39.820 1.00 44.87  ? 91   LYS B C     1 
ATOM   1353  O  O     . LYS B  2 91  ? -25.905 -18.842 40.416 1.00 45.80  ? 91   LYS B O     1 
ATOM   1354  C  CB    . LYS B  2 91  ? -28.115 -18.920 37.889 1.00 44.75  ? 91   LYS B CB    1 
ATOM   1355  C  CG    . LYS B  2 91  ? -27.117 -19.932 37.388 1.00 47.05  ? 91   LYS B CG    1 
ATOM   1356  C  CD    . LYS B  2 91  ? -27.566 -20.596 36.098 1.00 50.58  ? 91   LYS B CD    1 
ATOM   1357  C  CE    . LYS B  2 91  ? -26.764 -21.892 35.886 1.00 53.37  ? 91   LYS B CE    1 
ATOM   1358  N  NZ    . LYS B  2 91  ? -27.105 -22.678 34.640 1.00 56.74  ? 91   LYS B NZ    1 
ATOM   1359  N  N     . ARG B  2 92  ? -26.497 -16.854 39.553 1.00 45.67  ? 92   ARG B N     1 
ATOM   1360  C  CA    . ARG B  2 92  ? -25.222 -16.196 39.842 1.00 45.45  ? 92   ARG B CA    1 
ATOM   1361  C  C     . ARG B  2 92  ? -24.990 -15.891 41.314 1.00 46.40  ? 92   ARG B C     1 
ATOM   1362  O  O     . ARG B  2 92  ? -23.861 -15.609 41.689 1.00 46.65  ? 92   ARG B O     1 
ATOM   1363  C  CB    . ARG B  2 92  ? -24.999 -14.948 38.964 1.00 45.66  ? 92   ARG B CB    1 
ATOM   1364  C  CG    . ARG B  2 92  ? -26.010 -13.797 39.152 1.00 44.92  ? 92   ARG B CG    1 
ATOM   1365  C  CD    . ARG B  2 92  ? -25.644 -12.529 38.347 1.00 44.14  ? 92   ARG B CD    1 
ATOM   1366  N  NE    . ARG B  2 92  ? -24.195 -12.312 38.337 1.00 43.48  ? 92   ARG B NE    1 
ATOM   1367  C  CZ    . ARG B  2 92  ? -23.509 -11.873 39.384 1.00 43.38  ? 92   ARG B CZ    1 
ATOM   1368  N  NH1   . ARG B  2 92  ? -24.138 -11.588 40.518 1.00 41.60  ? 92   ARG B NH1   1 
ATOM   1369  N  NH2   . ARG B  2 92  ? -22.197 -11.748 39.307 1.00 44.13  ? 92   ARG B NH2   1 
ATOM   1370  N  N     . GLN B  2 93  ? -26.035 -15.955 42.143 1.00 47.33  ? 93   GLN B N     1 
ATOM   1371  C  CA    . GLN B  2 93  ? -25.851 -15.962 43.609 1.00 48.44  ? 93   GLN B CA    1 
ATOM   1372  C  C     . GLN B  2 93  ? -25.467 -17.359 44.127 1.00 48.25  ? 93   GLN B C     1 
ATOM   1373  O  O     . GLN B  2 93  ? -25.296 -17.541 45.338 1.00 48.63  ? 93   GLN B O     1 
ATOM   1374  C  CB    . GLN B  2 93  ? -27.107 -15.492 44.369 1.00 48.77  ? 93   GLN B CB    1 
ATOM   1375  C  CG    . GLN B  2 93  ? -27.613 -14.050 44.095 1.00 52.23  ? 93   GLN B CG    1 
ATOM   1376  C  CD    . GLN B  2 93  ? -26.539 -12.984 44.236 1.00 55.82  ? 93   GLN B CD    1 
ATOM   1377  O  OE1   . GLN B  2 93  ? -26.345 -12.179 43.330 1.00 58.70  ? 93   GLN B OE1   1 
ATOM   1378  N  NE2   . GLN B  2 93  ? -25.827 -12.983 45.358 1.00 55.15  ? 93   GLN B NE2   1 
ATOM   1379  N  N     . GLY B  2 94  ? -25.345 -18.329 43.218 1.00 47.98  ? 94   GLY B N     1 
ATOM   1380  C  CA    . GLY B  2 94  ? -25.095 -19.728 43.559 1.00 47.78  ? 94   GLY B CA    1 
ATOM   1381  C  C     . GLY B  2 94  ? -26.288 -20.385 44.248 1.00 48.18  ? 94   GLY B C     1 
ATOM   1382  O  O     . GLY B  2 94  ? -26.132 -21.216 45.149 1.00 47.93  ? 94   GLY B O     1 
ATOM   1383  N  N     . ARG B  2 95  ? -27.483 -19.990 43.819 1.00 48.00  ? 95   ARG B N     1 
ATOM   1384  C  CA    . ARG B  2 95  ? -28.731 -20.454 44.391 1.00 47.51  ? 95   ARG B CA    1 
ATOM   1385  C  C     . ARG B  2 95  ? -29.723 -20.802 43.289 1.00 47.07  ? 95   ARG B C     1 
ATOM   1386  O  O     . ARG B  2 95  ? -30.913 -20.516 43.412 1.00 46.47  ? 95   ARG B O     1 
ATOM   1387  C  CB    . ARG B  2 95  ? -29.314 -19.392 45.342 1.00 48.11  ? 95   ARG B CB    1 
ATOM   1388  C  CG    . ARG B  2 95  ? -28.403 -19.098 46.527 1.00 49.22  ? 95   ARG B CG    1 
ATOM   1389  C  CD    . ARG B  2 95  ? -29.146 -18.893 47.787 1.00 51.14  ? 95   ARG B CD    1 
ATOM   1390  N  NE    . ARG B  2 95  ? -30.098 -19.987 48.045 1.00 54.74  ? 95   ARG B NE    1 
ATOM   1391  C  CZ    . ARG B  2 95  ? -29.969 -20.898 49.015 1.00 53.89  ? 95   ARG B CZ    1 
ATOM   1392  N  NH1   . ARG B  2 95  ? -28.921 -20.867 49.835 1.00 53.92  ? 95   ARG B NH1   1 
ATOM   1393  N  NH2   . ARG B  2 95  ? -30.904 -21.825 49.181 1.00 52.19  ? 95   ARG B NH2   1 
ATOM   1394  N  N     . THR B  2 96  ? -29.196 -21.408 42.215 1.00 46.66  ? 96   THR B N     1 
ATOM   1395  C  CA    . THR B  2 96  ? -29.951 -22.081 41.141 1.00 46.11  ? 96   THR B CA    1 
ATOM   1396  C  C     . THR B  2 96  ? -31.306 -22.642 41.589 1.00 46.57  ? 96   THR B C     1 
ATOM   1397  O  O     . THR B  2 96  ? -31.370 -23.348 42.587 1.00 46.97  ? 96   THR B O     1 
ATOM   1398  C  CB    . THR B  2 96  ? -29.112 -23.220 40.550 1.00 45.96  ? 96   THR B CB    1 
ATOM   1399  O  OG1   . THR B  2 96  ? -27.828 -22.704 40.176 1.00 46.18  ? 96   THR B OG1   1 
ATOM   1400  C  CG2   . THR B  2 96  ? -29.772 -23.841 39.343 1.00 43.97  ? 96   THR B CG2   1 
ATOM   1401  N  N     . LEU B  2 97  ? -32.374 -22.285 40.863 1.00 46.23  ? 97   LEU B N     1 
ATOM   1402  C  CA    . LEU B  2 97  ? -33.723 -22.748 41.138 1.00 45.84  ? 97   LEU B CA    1 
ATOM   1403  C  C     . LEU B  2 97  ? -34.354 -23.362 39.871 1.00 46.26  ? 97   LEU B C     1 
ATOM   1404  O  O     . LEU B  2 97  ? -34.262 -22.798 38.767 1.00 45.12  ? 97   LEU B O     1 
ATOM   1405  C  CB    . LEU B  2 97  ? -34.583 -21.594 41.681 1.00 45.83  ? 97   LEU B CB    1 
ATOM   1406  C  CG    . LEU B  2 97  ? -36.101 -21.730 41.941 1.00 46.34  ? 97   LEU B CG    1 
ATOM   1407  C  CD1   . LEU B  2 97  ? -36.448 -22.353 43.296 1.00 45.15  ? 97   LEU B CD1   1 
ATOM   1408  C  CD2   . LEU B  2 97  ? -36.786 -20.366 41.838 1.00 45.44  ? 97   LEU B CD2   1 
ATOM   1409  N  N     . TYR B  2 98  ? -34.997 -24.520 40.060 1.00 46.22  ? 98   TYR B N     1 
ATOM   1410  C  CA    . TYR B  2 98  ? -35.637 -25.254 38.992 1.00 46.48  ? 98   TYR B CA    1 
ATOM   1411  C  C     . TYR B  2 98  ? -37.125 -25.017 39.102 1.00 47.64  ? 98   TYR B C     1 
ATOM   1412  O  O     . TYR B  2 98  ? -37.662 -24.965 40.221 1.00 47.03  ? 98   TYR B O     1 
ATOM   1413  C  CB    . TYR B  2 98  ? -35.367 -26.765 39.115 1.00 45.71  ? 98   TYR B CB    1 
ATOM   1414  C  CG    . TYR B  2 98  ? -33.970 -27.258 38.775 1.00 44.29  ? 98   TYR B CG    1 
ATOM   1415  C  CD1   . TYR B  2 98  ? -32.970 -26.391 38.287 1.00 44.24  ? 98   TYR B CD1   1 
ATOM   1416  C  CD2   . TYR B  2 98  ? -33.657 -28.611 38.912 1.00 41.70  ? 98   TYR B CD2   1 
ATOM   1417  C  CE1   . TYR B  2 98  ? -31.687 -26.866 37.959 1.00 43.16  ? 98   TYR B CE1   1 
ATOM   1418  C  CE2   . TYR B  2 98  ? -32.397 -29.095 38.577 1.00 42.15  ? 98   TYR B CE2   1 
ATOM   1419  C  CZ    . TYR B  2 98  ? -31.418 -28.221 38.099 1.00 43.38  ? 98   TYR B CZ    1 
ATOM   1420  O  OH    . TYR B  2 98  ? -30.181 -28.721 37.785 1.00 43.20  ? 98   TYR B OH    1 
ATOM   1421  N  N     . GLY B  2 99  ? -37.785 -24.876 37.942 1.00 48.87  ? 99   GLY B N     1 
ATOM   1422  C  CA    . GLY B  2 99  ? -39.240 -24.730 37.888 1.00 50.95  ? 99   GLY B CA    1 
ATOM   1423  C  C     . GLY B  2 99  ? -39.817 -23.471 37.258 1.00 52.67  ? 99   GLY B C     1 
ATOM   1424  O  O     . GLY B  2 99  ? -41.027 -23.314 37.199 1.00 53.18  ? 99   GLY B O     1 
ATOM   1425  N  N     . PHE B  2 100 ? -38.974 -22.558 36.796 1.00 54.36  ? 100  PHE B N     1 
ATOM   1426  C  CA    . PHE B  2 100 ? -39.466 -21.314 36.194 1.00 55.59  ? 100  PHE B CA    1 
ATOM   1427  C  C     . PHE B  2 100 ? -38.690 -20.963 34.909 1.00 57.12  ? 100  PHE B C     1 
ATOM   1428  O  O     . PHE B  2 100 ? -38.756 -19.824 34.450 1.00 57.52  ? 100  PHE B O     1 
ATOM   1429  C  CB    . PHE B  2 100 ? -39.398 -20.137 37.199 1.00 54.82  ? 100  PHE B CB    1 
ATOM   1430  C  CG    . PHE B  2 100 ? -40.170 -20.363 38.496 1.00 53.80  ? 100  PHE B CG    1 
ATOM   1431  C  CD1   . PHE B  2 100 ? -39.574 -20.998 39.586 1.00 52.30  ? 100  PHE B CD1   1 
ATOM   1432  C  CD2   . PHE B  2 100 ? -41.480 -19.909 38.637 1.00 52.39  ? 100  PHE B CD2   1 
ATOM   1433  C  CE1   . PHE B  2 100 ? -40.286 -21.206 40.783 1.00 50.11  ? 100  PHE B CE1   1 
ATOM   1434  C  CE2   . PHE B  2 100 ? -42.191 -20.109 39.828 1.00 51.93  ? 100  PHE B CE2   1 
ATOM   1435  C  CZ    . PHE B  2 100 ? -41.591 -20.761 40.901 1.00 50.92  ? 100  PHE B CZ    1 
ATOM   1436  N  N     . GLY B  2 101 ? -37.966 -21.932 34.335 1.00 58.86  ? 101  GLY B N     1 
ATOM   1437  C  CA    . GLY B  2 101 ? -37.050 -21.685 33.208 1.00 61.31  ? 101  GLY B CA    1 
ATOM   1438  C  C     . GLY B  2 101 ? -37.733 -21.748 31.834 1.00 64.01  ? 101  GLY B C     1 
ATOM   1439  O  O     . GLY B  2 101 ? -37.105 -22.132 30.820 1.00 64.04  ? 101  GLY B O     1 
ATOM   1440  N  N     . GLY B  2 102 ? -39.020 -21.366 31.788 1.00 65.62  ? 102  GLY B N     1 
ATOM   1441  C  CA    . GLY B  2 102 ? -39.816 -21.378 30.538 1.00 66.99  ? 102  GLY B CA    1 
ATOM   1442  C  C     . GLY B  2 102 ? -39.410 -20.377 29.444 1.00 67.87  ? 102  GLY B C     1 
ATOM   1443  O  O     . GLY B  2 102 ? -38.212 -20.118 29.197 1.00 68.18  ? 102  GLY B O     1 
ATOM   1444  O  OXT   . GLY B  2 102 ? -40.281 -19.808 28.753 1.00 67.96  ? 102  GLY B OXT   1 
ATOM   1445  N  N     . LYS C  3 15  ? -0.858  5.422   16.028 1.00 69.93  ? 15   LYS C N     1 
ATOM   1446  C  CA    . LYS C  3 15  ? -1.711  5.840   17.181 1.00 69.85  ? 15   LYS C CA    1 
ATOM   1447  C  C     . LYS C  3 15  ? -2.490  4.647   17.799 1.00 69.28  ? 15   LYS C C     1 
ATOM   1448  O  O     . LYS C  3 15  ? -3.533  4.236   17.281 1.00 69.23  ? 15   LYS C O     1 
ATOM   1449  C  CB    . LYS C  3 15  ? -2.652  6.975   16.732 1.00 70.06  ? 15   LYS C CB    1 
ATOM   1450  C  CG    . LYS C  3 15  ? -3.360  7.751   17.861 1.00 71.49  ? 15   LYS C CG    1 
ATOM   1451  C  CD    . LYS C  3 15  ? -2.618  9.026   18.312 1.00 73.58  ? 15   LYS C CD    1 
ATOM   1452  C  CE    . LYS C  3 15  ? -1.298  8.715   19.051 1.00 75.76  ? 15   LYS C CE    1 
ATOM   1453  N  NZ    . LYS C  3 15  ? -1.223  9.332   20.420 1.00 76.77  ? 15   LYS C NZ    1 
ATOM   1454  N  N     . THR C  3 16  ? -1.978  4.089   18.900 1.00 68.50  ? 16   THR C N     1 
ATOM   1455  C  CA    . THR C  3 16  ? -2.644  2.952   19.577 1.00 67.45  ? 16   THR C CA    1 
ATOM   1456  C  C     . THR C  3 16  ? -4.023  3.340   20.100 1.00 66.77  ? 16   THR C C     1 
ATOM   1457  O  O     . THR C  3 16  ? -4.259  4.509   20.432 1.00 66.77  ? 16   THR C O     1 
ATOM   1458  C  CB    . THR C  3 16  ? -1.850  2.413   20.787 1.00 67.41  ? 16   THR C CB    1 
ATOM   1459  O  OG1   . THR C  3 16  ? -1.873  3.378   21.846 1.00 67.32  ? 16   THR C OG1   1 
ATOM   1460  C  CG2   . THR C  3 16  ? -0.411  2.061   20.417 1.00 67.55  ? 16   THR C CG2   1 
ATOM   1461  N  N     . ARG C  3 17  ? -4.922  2.358   20.192 1.00 65.53  ? 17   ARG C N     1 
ATOM   1462  C  CA    . ARG C  3 17  ? -6.274  2.595   20.713 1.00 64.22  ? 17   ARG C CA    1 
ATOM   1463  C  C     . ARG C  3 17  ? -6.232  2.801   22.218 1.00 63.32  ? 17   ARG C C     1 
ATOM   1464  O  O     . ARG C  3 17  ? -7.186  3.287   22.829 1.00 62.94  ? 17   ARG C O     1 
ATOM   1465  C  CB    . ARG C  3 17  ? -7.188  1.432   20.372 1.00 64.19  ? 17   ARG C CB    1 
ATOM   1466  C  CG    . ARG C  3 17  ? -7.408  1.251   18.904 1.00 64.48  ? 17   ARG C CG    1 
ATOM   1467  C  CD    . ARG C  3 17  ? -8.599  0.363   18.653 1.00 64.82  ? 17   ARG C CD    1 
ATOM   1468  N  NE    . ARG C  3 17  ? -8.246  -1.047  18.756 1.00 63.95  ? 17   ARG C NE    1 
ATOM   1469  C  CZ    . ARG C  3 17  ? -9.130  -2.032  18.876 1.00 63.97  ? 17   ARG C CZ    1 
ATOM   1470  N  NH1   . ARG C  3 17  ? -10.438 -1.778  18.912 1.00 63.48  ? 17   ARG C NH1   1 
ATOM   1471  N  NH2   . ARG C  3 17  ? -8.696  -3.276  18.957 1.00 63.93  ? 17   ARG C NH2   1 
ATOM   1472  N  N     . SER C  3 18  ? -5.110  2.405   22.803 1.00 62.50  ? 18   SER C N     1 
ATOM   1473  C  CA    . SER C  3 18  ? -4.804  2.696   24.189 1.00 62.11  ? 18   SER C CA    1 
ATOM   1474  C  C     . SER C  3 18  ? -4.596  4.198   24.392 1.00 61.96  ? 18   SER C C     1 
ATOM   1475  O  O     . SER C  3 18  ? -5.361  4.824   25.114 1.00 61.78  ? 18   SER C O     1 
ATOM   1476  C  CB    . SER C  3 18  ? -3.578  1.897   24.637 1.00 61.61  ? 18   SER C CB    1 
ATOM   1477  O  OG    . SER C  3 18  ? -3.959  0.591   25.000 1.00 60.70  ? 18   SER C OG    1 
ATOM   1478  N  N     . SER C  3 19  ? -3.574  4.768   23.744 1.00 61.98  ? 19   SER C N     1 
ATOM   1479  C  CA    . SER C  3 19  ? -3.327  6.222   23.803 1.00 62.04  ? 19   SER C CA    1 
ATOM   1480  C  C     . SER C  3 19  ? -4.597  7.010   23.468 1.00 61.21  ? 19   SER C C     1 
ATOM   1481  O  O     . SER C  3 19  ? -4.927  7.984   24.142 1.00 61.39  ? 19   SER C O     1 
ATOM   1482  C  CB    . SER C  3 19  ? -2.177  6.630   22.879 1.00 61.92  ? 19   SER C CB    1 
ATOM   1483  O  OG    . SER C  3 19  ? -2.526  6.382   21.527 1.00 63.52  ? 19   SER C OG    1 
ATOM   1484  N  N     . ARG C  3 20  ? -5.318  6.526   22.459 1.00 60.32  ? 20   ARG C N     1 
ATOM   1485  C  CA    . ARG C  3 20  ? -6.564  7.096   21.976 1.00 59.74  ? 20   ARG C CA    1 
ATOM   1486  C  C     . ARG C  3 20  ? -7.737  7.070   22.972 1.00 59.28  ? 20   ARG C C     1 
ATOM   1487  O  O     . ARG C  3 20  ? -8.738  7.784   22.785 1.00 59.74  ? 20   ARG C O     1 
ATOM   1488  C  CB    . ARG C  3 20  ? -6.926  6.368   20.682 1.00 60.13  ? 20   ARG C CB    1 
ATOM   1489  C  CG    . ARG C  3 20  ? -8.146  6.874   19.928 1.00 62.85  ? 20   ARG C CG    1 
ATOM   1490  C  CD    . ARG C  3 20  ? -7.973  6.676   18.427 1.00 66.94  ? 20   ARG C CD    1 
ATOM   1491  N  NE    . ARG C  3 20  ? -7.514  5.328   18.108 1.00 70.08  ? 20   ARG C NE    1 
ATOM   1492  C  CZ    . ARG C  3 20  ? -6.576  5.046   17.207 1.00 72.90  ? 20   ARG C CZ    1 
ATOM   1493  N  NH1   . ARG C  3 20  ? -5.979  6.027   16.525 1.00 74.69  ? 20   ARG C NH1   1 
ATOM   1494  N  NH2   . ARG C  3 20  ? -6.227  3.781   16.988 1.00 73.05  ? 20   ARG C NH2   1 
ATOM   1495  N  N     . ALA C  3 21  ? -7.636  6.247   24.019 1.00 58.53  ? 21   ALA C N     1 
ATOM   1496  C  CA    . ALA C  3 21  ? -8.694  6.149   25.044 1.00 57.31  ? 21   ALA C CA    1 
ATOM   1497  C  C     . ALA C  3 21  ? -8.181  6.602   26.395 1.00 56.53  ? 21   ALA C C     1 
ATOM   1498  O  O     . ALA C  3 21  ? -8.945  6.728   27.346 1.00 56.27  ? 21   ALA C O     1 
ATOM   1499  C  CB    . ALA C  3 21  ? -9.259  4.723   25.122 1.00 57.78  ? 21   ALA C CB    1 
ATOM   1500  N  N     . GLY C  3 22  ? -6.876  6.851   26.460 1.00 55.97  ? 22   GLY C N     1 
ATOM   1501  C  CA    . GLY C  3 22  ? -6.242  7.420   27.644 1.00 55.45  ? 22   GLY C CA    1 
ATOM   1502  C  C     . GLY C  3 22  ? -5.842  6.354   28.631 1.00 55.22  ? 22   GLY C C     1 
ATOM   1503  O  O     . GLY C  3 22  ? -5.934  6.563   29.850 1.00 54.64  ? 22   GLY C O     1 
ATOM   1504  N  N     . LEU C  3 23  ? -5.365  5.225   28.088 1.00 55.01  ? 23   LEU C N     1 
ATOM   1505  C  CA    . LEU C  3 23  ? -5.194  3.993   28.847 1.00 54.46  ? 23   LEU C CA    1 
ATOM   1506  C  C     . LEU C  3 23  ? -3.801  3.431   28.753 1.00 54.94  ? 23   LEU C C     1 
ATOM   1507  O  O     . LEU C  3 23  ? -3.185  3.458   27.692 1.00 55.05  ? 23   LEU C O     1 
ATOM   1508  C  CB    . LEU C  3 23  ? -6.217  2.939   28.412 1.00 54.26  ? 23   LEU C CB    1 
ATOM   1509  C  CG    . LEU C  3 23  ? -7.714  3.187   28.647 1.00 52.58  ? 23   LEU C CG    1 
ATOM   1510  C  CD1   . LEU C  3 23  ? -8.473  1.953   28.276 1.00 52.91  ? 23   LEU C CD1   1 
ATOM   1511  C  CD2   . LEU C  3 23  ? -8.026  3.560   30.080 1.00 51.60  ? 23   LEU C CD2   1 
ATOM   1512  N  N     . GLN C  3 24  ? -3.316  2.936   29.895 1.00 55.62  ? 24   GLN C N     1 
ATOM   1513  C  CA    . GLN C  3 24  ? -2.014  2.274   30.019 1.00 55.93  ? 24   GLN C CA    1 
ATOM   1514  C  C     . GLN C  3 24  ? -2.115  0.797   29.667 1.00 56.04  ? 24   GLN C C     1 
ATOM   1515  O  O     . GLN C  3 24  ? -1.130  0.203   29.241 1.00 56.64  ? 24   GLN C O     1 
ATOM   1516  C  CB    . GLN C  3 24  ? -1.484  2.378   31.463 1.00 56.24  ? 24   GLN C CB    1 
ATOM   1517  C  CG    . GLN C  3 24  ? -1.191  3.781   31.983 1.00 55.92  ? 24   GLN C CG    1 
ATOM   1518  C  CD    . GLN C  3 24  ? -0.332  4.580   31.036 1.00 55.85  ? 24   GLN C CD    1 
ATOM   1519  O  OE1   . GLN C  3 24  ? 0.719   4.106   30.567 1.00 55.12  ? 24   GLN C OE1   1 
ATOM   1520  N  NE2   . GLN C  3 24  ? -0.776  5.805   30.734 1.00 54.19  ? 24   GLN C NE2   1 
ATOM   1521  N  N     . PHE C  3 25  ? -3.298  0.215   29.893 1.00 55.85  ? 25   PHE C N     1 
ATOM   1522  C  CA    . PHE C  3 25  ? -3.603  -1.183  29.591 1.00 55.44  ? 25   PHE C CA    1 
ATOM   1523  C  C     . PHE C  3 25  ? -3.906  -1.322  28.094 1.00 55.92  ? 25   PHE C C     1 
ATOM   1524  O  O     . PHE C  3 25  ? -4.355  -0.346  27.479 1.00 56.25  ? 25   PHE C O     1 
ATOM   1525  C  CB    . PHE C  3 25  ? -4.773  -1.665  30.467 1.00 54.93  ? 25   PHE C CB    1 
ATOM   1526  C  CG    . PHE C  3 25  ? -4.342  -2.387  31.734 1.00 54.37  ? 25   PHE C CG    1 
ATOM   1527  C  CD1   . PHE C  3 25  ? -3.490  -1.781  32.651 1.00 51.25  ? 25   PHE C CD1   1 
ATOM   1528  C  CD2   . PHE C  3 25  ? -4.797  -3.687  32.007 1.00 55.04  ? 25   PHE C CD2   1 
ATOM   1529  C  CE1   . PHE C  3 25  ? -3.092  -2.437  33.807 1.00 51.39  ? 25   PHE C CE1   1 
ATOM   1530  C  CE2   . PHE C  3 25  ? -4.393  -4.364  33.184 1.00 53.46  ? 25   PHE C CE2   1 
ATOM   1531  C  CZ    . PHE C  3 25  ? -3.542  -3.736  34.077 1.00 51.69  ? 25   PHE C CZ    1 
ATOM   1532  N  N     . PRO C  3 26  ? -3.649  -2.521  27.497 1.00 56.08  ? 26   PRO C N     1 
ATOM   1533  C  CA    . PRO C  3 26  ? -3.662  -2.716  26.034 1.00 55.71  ? 26   PRO C CA    1 
ATOM   1534  C  C     . PRO C  3 26  ? -5.022  -3.072  25.457 1.00 55.89  ? 26   PRO C C     1 
ATOM   1535  O  O     . PRO C  3 26  ? -5.529  -4.176  25.676 1.00 56.14  ? 26   PRO C O     1 
ATOM   1536  C  CB    . PRO C  3 26  ? -2.694  -3.879  25.825 1.00 55.83  ? 26   PRO C CB    1 
ATOM   1537  C  CG    . PRO C  3 26  ? -2.740  -4.663  27.108 1.00 56.72  ? 26   PRO C CG    1 
ATOM   1538  C  CD    . PRO C  3 26  ? -3.313  -3.776  28.202 1.00 56.38  ? 26   PRO C CD    1 
ATOM   1539  N  N     . VAL C  3 27  ? -5.599  -2.134  24.713 1.00 55.52  ? 27   VAL C N     1 
ATOM   1540  C  CA    . VAL C  3 27  ? -6.898  -2.320  24.072 1.00 54.84  ? 27   VAL C CA    1 
ATOM   1541  C  C     . VAL C  3 27  ? -6.805  -3.331  22.919 1.00 54.98  ? 27   VAL C C     1 
ATOM   1542  O  O     . VAL C  3 27  ? -7.735  -4.097  22.683 1.00 55.56  ? 27   VAL C O     1 
ATOM   1543  C  CB    . VAL C  3 27  ? -7.492  -0.954  23.631 1.00 54.35  ? 27   VAL C CB    1 
ATOM   1544  C  CG1   . VAL C  3 27  ? -8.787  -1.126  22.916 1.00 54.30  ? 27   VAL C CG1   1 
ATOM   1545  C  CG2   . VAL C  3 27  ? -7.703  -0.049  24.845 1.00 53.07  ? 27   VAL C CG2   1 
ATOM   1546  N  N     . GLY C  3 28  ? -5.672  -3.350  22.220 1.00 54.88  ? 28   GLY C N     1 
ATOM   1547  C  CA    . GLY C  3 28  ? -5.473  -4.293  21.131 1.00 54.16  ? 28   GLY C CA    1 
ATOM   1548  C  C     . GLY C  3 28  ? -5.499  -5.731  21.621 1.00 53.86  ? 28   GLY C C     1 
ATOM   1549  O  O     . GLY C  3 28  ? -6.140  -6.573  21.007 1.00 53.93  ? 28   GLY C O     1 
ATOM   1550  N  N     . ARG C  3 29  ? -4.794  -5.994  22.726 1.00 53.28  ? 29   ARG C N     1 
ATOM   1551  C  CA    . ARG C  3 29  ? -4.716  -7.316  23.347 1.00 52.57  ? 29   ARG C CA    1 
ATOM   1552  C  C     . ARG C  3 29  ? -6.053  -7.811  23.904 1.00 53.54  ? 29   ARG C C     1 
ATOM   1553  O  O     . ARG C  3 29  ? -6.403  -8.979  23.739 1.00 54.04  ? 29   ARG C O     1 
ATOM   1554  C  CB    . ARG C  3 29  ? -3.651  -7.344  24.446 1.00 52.07  ? 29   ARG C CB    1 
ATOM   1555  C  CG    . ARG C  3 29  ? -3.529  -8.693  25.149 1.00 50.23  ? 29   ARG C CG    1 
ATOM   1556  C  CD    . ARG C  3 29  ? -2.417  -8.716  26.192 1.00 50.92  ? 29   ARG C CD    1 
ATOM   1557  N  NE    . ARG C  3 29  ? -1.082  -8.658  25.603 1.00 48.11  ? 29   ARG C NE    1 
ATOM   1558  C  CZ    . ARG C  3 29  ? 0.058   -8.724  26.295 1.00 48.86  ? 29   ARG C CZ    1 
ATOM   1559  N  NH1   . ARG C  3 29  ? 0.046   -8.864  27.617 1.00 48.30  ? 29   ARG C NH1   1 
ATOM   1560  N  NH2   . ARG C  3 29  ? 1.226   -8.657  25.662 1.00 47.75  ? 29   ARG C NH2   1 
ATOM   1561  N  N     . VAL C  3 30  ? -6.773  -6.921  24.577 1.00 54.08  ? 30   VAL C N     1 
ATOM   1562  C  CA    . VAL C  3 30  ? -8.057  -7.208  25.205 1.00 54.01  ? 30   VAL C CA    1 
ATOM   1563  C  C     . VAL C  3 30  ? -9.136  -7.483  24.123 1.00 55.69  ? 30   VAL C C     1 
ATOM   1564  O  O     . VAL C  3 30  ? -9.949  -8.402  24.281 1.00 56.61  ? 30   VAL C O     1 
ATOM   1565  C  CB    . VAL C  3 30  ? -8.455  -6.047  26.182 1.00 53.46  ? 30   VAL C CB    1 
ATOM   1566  C  CG1   . VAL C  3 30  ? -9.892  -6.159  26.673 1.00 51.77  ? 30   VAL C CG1   1 
ATOM   1567  C  CG2   . VAL C  3 30  ? -7.489  -5.972  27.350 1.00 51.28  ? 30   VAL C CG2   1 
ATOM   1568  N  N     . HIS C  3 31  ? -9.143  -6.709  23.036 1.00 56.40  ? 31   HIS C N     1 
ATOM   1569  C  CA    . HIS C  3 31  ? -9.988  -7.027  21.872 1.00 57.40  ? 31   HIS C CA    1 
ATOM   1570  C  C     . HIS C  3 31  ? -9.659  -8.423  21.336 1.00 57.67  ? 31   HIS C C     1 
ATOM   1571  O  O     . HIS C  3 31  ? -10.544 -9.154  20.886 1.00 57.94  ? 31   HIS C O     1 
ATOM   1572  C  CB    . HIS C  3 31  ? -9.779  -6.024  20.730 1.00 57.39  ? 31   HIS C CB    1 
ATOM   1573  C  CG    . HIS C  3 31  ? -10.996 -5.813  19.877 1.00 57.88  ? 31   HIS C CG    1 
ATOM   1574  N  ND1   . HIS C  3 31  ? -12.167 -6.519  20.057 1.00 58.90  ? 31   HIS C ND1   1 
ATOM   1575  C  CD2   . HIS C  3 31  ? -11.224 -4.973  18.837 1.00 56.95  ? 31   HIS C CD2   1 
ATOM   1576  C  CE1   . HIS C  3 31  ? -13.064 -6.118  19.171 1.00 57.64  ? 31   HIS C CE1   1 
ATOM   1577  N  NE2   . HIS C  3 31  ? -12.515 -5.185  18.415 1.00 55.92  ? 31   HIS C NE2   1 
ATOM   1578  N  N     . ARG C  3 32  ? -8.377  -8.771  21.388 1.00 57.27  ? 32   ARG C N     1 
ATOM   1579  C  CA    . ARG C  3 32  ? -7.882  -10.006 20.820 1.00 57.16  ? 32   ARG C CA    1 
ATOM   1580  C  C     . ARG C  3 32  ? -8.335  -11.172 21.697 1.00 57.15  ? 32   ARG C C     1 
ATOM   1581  O  O     . ARG C  3 32  ? -9.002  -12.083 21.220 1.00 57.32  ? 32   ARG C O     1 
ATOM   1582  C  CB    . ARG C  3 32  ? -6.360  -9.946  20.718 1.00 56.99  ? 32   ARG C CB    1 
ATOM   1583  C  CG    . ARG C  3 32  ? -5.766  -10.740 19.585 1.00 56.61  ? 32   ARG C CG    1 
ATOM   1584  C  CD    . ARG C  3 32  ? -4.240  -10.710 19.633 1.00 55.98  ? 32   ARG C CD    1 
ATOM   1585  N  NE    . ARG C  3 32  ? -3.690  -11.489 20.749 1.00 55.77  ? 32   ARG C NE    1 
ATOM   1586  C  CZ    . ARG C  3 32  ? -2.821  -11.011 21.637 1.00 56.69  ? 32   ARG C CZ    1 
ATOM   1587  N  NH1   . ARG C  3 32  ? -2.385  -9.764  21.551 1.00 55.60  ? 32   ARG C NH1   1 
ATOM   1588  N  NH2   . ARG C  3 32  ? -2.376  -11.778 22.614 1.00 57.06  ? 32   ARG C NH2   1 
ATOM   1589  N  N     . LEU C  3 33  ? -7.994  -11.101 22.985 1.00 57.11  ? 33   LEU C N     1 
ATOM   1590  C  CA    . LEU C  3 33  ? -8.353  -12.090 23.987 1.00 56.47  ? 33   LEU C CA    1 
ATOM   1591  C  C     . LEU C  3 33  ? -9.855  -12.306 24.105 1.00 56.59  ? 33   LEU C C     1 
ATOM   1592  O  O     . LEU C  3 33  ? -10.283 -13.361 24.534 1.00 57.25  ? 33   LEU C O     1 
ATOM   1593  C  CB    . LEU C  3 33  ? -7.762  -11.707 25.348 1.00 56.23  ? 33   LEU C CB    1 
ATOM   1594  C  CG    . LEU C  3 33  ? -6.238  -11.602 25.470 1.00 55.73  ? 33   LEU C CG    1 
ATOM   1595  C  CD1   . LEU C  3 33  ? -5.805  -11.238 26.884 1.00 55.87  ? 33   LEU C CD1   1 
ATOM   1596  C  CD2   . LEU C  3 33  ? -5.533  -12.868 25.045 1.00 54.48  ? 33   LEU C CD2   1 
ATOM   1597  N  N     . LEU C  3 34  ? -10.648 -11.316 23.716 1.00 57.38  ? 34   LEU C N     1 
ATOM   1598  C  CA    . LEU C  3 34  ? -12.105 -11.431 23.727 1.00 58.27  ? 34   LEU C CA    1 
ATOM   1599  C  C     . LEU C  3 34  ? -12.654 -12.251 22.558 1.00 59.32  ? 34   LEU C C     1 
ATOM   1600  O  O     . LEU C  3 34  ? -13.675 -12.941 22.675 1.00 59.45  ? 34   LEU C O     1 
ATOM   1601  C  CB    . LEU C  3 34  ? -12.748 -10.049 23.738 1.00 57.75  ? 34   LEU C CB    1 
ATOM   1602  C  CG    . LEU C  3 34  ? -12.929 -9.334  25.087 1.00 57.69  ? 34   LEU C CG    1 
ATOM   1603  C  CD1   . LEU C  3 34  ? -13.617 -7.956  24.884 1.00 55.68  ? 34   LEU C CD1   1 
ATOM   1604  C  CD2   . LEU C  3 34  ? -13.706 -10.182 26.085 1.00 55.34  ? 34   LEU C CD2   1 
ATOM   1605  N  N     . ARG C  3 35  ? -11.974 -12.148 21.421 1.00 60.79  ? 35   ARG C N     1 
ATOM   1606  C  CA    . ARG C  3 35  ? -12.285 -12.942 20.243 1.00 61.62  ? 35   ARG C CA    1 
ATOM   1607  C  C     . ARG C  3 35  ? -11.853 -14.397 20.436 1.00 62.23  ? 35   ARG C C     1 
ATOM   1608  O  O     . ARG C  3 35  ? -12.645 -15.315 20.235 1.00 62.56  ? 35   ARG C O     1 
ATOM   1609  C  CB    . ARG C  3 35  ? -11.618 -12.332 19.017 1.00 61.42  ? 35   ARG C CB    1 
ATOM   1610  C  CG    . ARG C  3 35  ? -12.152 -10.976 18.668 1.00 61.81  ? 35   ARG C CG    1 
ATOM   1611  C  CD    . ARG C  3 35  ? -11.659 -10.560 17.296 1.00 63.85  ? 35   ARG C CD    1 
ATOM   1612  N  NE    . ARG C  3 35  ? -12.006 -9.180  16.963 1.00 65.43  ? 35   ARG C NE    1 
ATOM   1613  C  CZ    . ARG C  3 35  ? -13.228 -8.761  16.631 1.00 67.58  ? 35   ARG C CZ    1 
ATOM   1614  N  NH1   . ARG C  3 35  ? -14.262 -9.608  16.609 1.00 68.79  ? 35   ARG C NH1   1 
ATOM   1615  N  NH2   . ARG C  3 35  ? -13.426 -7.479  16.334 1.00 68.08  ? 35   ARG C NH2   1 
ATOM   1616  N  N     . LYS C  3 36  ? -10.604 -14.587 20.854 1.00 62.95  ? 36   LYS C N     1 
ATOM   1617  C  CA    . LYS C  3 36  ? -10.023 -15.900 21.107 1.00 63.80  ? 36   LYS C CA    1 
ATOM   1618  C  C     . LYS C  3 36  ? -10.845 -16.763 22.080 1.00 63.53  ? 36   LYS C C     1 
ATOM   1619  O  O     . LYS C  3 36  ? -10.862 -18.002 21.969 1.00 64.01  ? 36   LYS C O     1 
ATOM   1620  C  CB    . LYS C  3 36  ? -8.616  -15.715 21.668 1.00 63.72  ? 36   LYS C CB    1 
ATOM   1621  C  CG    . LYS C  3 36  ? -7.778  -16.995 21.764 1.00 65.72  ? 36   LYS C CG    1 
ATOM   1622  C  CD    . LYS C  3 36  ? -6.613  -16.848 22.753 1.00 65.47  ? 36   LYS C CD    1 
ATOM   1623  C  CE    . LYS C  3 36  ? -7.111  -16.940 24.199 1.00 67.38  ? 36   LYS C CE    1 
ATOM   1624  N  NZ    . LYS C  3 36  ? -5.969  -17.022 25.146 1.00 68.86  ? 36   LYS C NZ    1 
ATOM   1625  N  N     . GLY C  3 37  ? -11.520 -16.109 23.026 1.00 62.92  ? 37   GLY C N     1 
ATOM   1626  C  CA    . GLY C  3 37  ? -12.167 -16.799 24.138 1.00 61.24  ? 37   GLY C CA    1 
ATOM   1627  C  C     . GLY C  3 37  ? -13.594 -17.235 23.912 1.00 60.58  ? 37   GLY C C     1 
ATOM   1628  O  O     . GLY C  3 37  ? -14.219 -17.743 24.842 1.00 60.78  ? 37   GLY C O     1 
ATOM   1629  N  N     . ASN C  3 38  ? -14.112 -17.039 22.696 1.00 59.90  ? 38   ASN C N     1 
ATOM   1630  C  CA    . ASN C  3 38  ? -15.470 -17.482 22.311 1.00 59.19  ? 38   ASN C CA    1 
ATOM   1631  C  C     . ASN C  3 38  ? -16.510 -17.089 23.332 1.00 57.93  ? 38   ASN C C     1 
ATOM   1632  O  O     . ASN C  3 38  ? -17.095 -17.959 23.993 1.00 58.15  ? 38   ASN C O     1 
ATOM   1633  C  CB    . ASN C  3 38  ? -15.558 -19.013 22.142 1.00 59.92  ? 38   ASN C CB    1 
ATOM   1634  C  CG    . ASN C  3 38  ? -14.569 -19.562 21.138 1.00 62.47  ? 38   ASN C CG    1 
ATOM   1635  O  OD1   . ASN C  3 38  ? -13.817 -20.496 21.452 1.00 65.39  ? 38   ASN C OD1   1 
ATOM   1636  N  ND2   . ASN C  3 38  ? -14.553 -18.993 19.925 1.00 63.57  ? 38   ASN C ND2   1 
ATOM   1637  N  N     . TYR C  3 39  ? -16.732 -15.791 23.495 1.00 56.27  ? 39   TYR C N     1 
ATOM   1638  C  CA    . TYR C  3 39  ? -17.731 -15.331 24.454 1.00 54.44  ? 39   TYR C CA    1 
ATOM   1639  C  C     . TYR C  3 39  ? -19.034 -14.999 23.747 1.00 54.99  ? 39   TYR C C     1 
ATOM   1640  O  O     . TYR C  3 39  ? -20.130 -15.157 24.314 1.00 55.16  ? 39   TYR C O     1 
ATOM   1641  C  CB    . TYR C  3 39  ? -17.194 -14.155 25.261 1.00 52.86  ? 39   TYR C CB    1 
ATOM   1642  C  CG    . TYR C  3 39  ? -15.961 -14.480 26.103 1.00 49.85  ? 39   TYR C CG    1 
ATOM   1643  C  CD1   . TYR C  3 39  ? -14.691 -14.091 25.692 1.00 47.30  ? 39   TYR C CD1   1 
ATOM   1644  C  CD2   . TYR C  3 39  ? -16.080 -15.149 27.321 1.00 44.96  ? 39   TYR C CD2   1 
ATOM   1645  C  CE1   . TYR C  3 39  ? -13.555 -14.378 26.467 1.00 46.32  ? 39   TYR C CE1   1 
ATOM   1646  C  CE2   . TYR C  3 39  ? -14.955 -15.432 28.102 1.00 44.79  ? 39   TYR C CE2   1 
ATOM   1647  C  CZ    . TYR C  3 39  ? -13.702 -15.049 27.667 1.00 46.52  ? 39   TYR C CZ    1 
ATOM   1648  O  OH    . TYR C  3 39  ? -12.599 -15.340 28.435 1.00 48.33  ? 39   TYR C OH    1 
ATOM   1649  N  N     . ALA C  3 40  ? -18.904 -14.564 22.496 1.00 55.47  ? 40   ALA C N     1 
ATOM   1650  C  CA    . ALA C  3 40  ? -20.041 -14.306 21.617 1.00 56.32  ? 40   ALA C CA    1 
ATOM   1651  C  C     . ALA C  3 40  ? -19.583 -14.354 20.160 1.00 57.06  ? 40   ALA C C     1 
ATOM   1652  O  O     . ALA C  3 40  ? -18.391 -14.500 19.880 1.00 57.19  ? 40   ALA C O     1 
ATOM   1653  C  CB    . ALA C  3 40  ? -20.682 -12.970 21.945 1.00 55.68  ? 40   ALA C CB    1 
ATOM   1654  N  N     . GLU C  3 41  ? -20.520 -14.252 19.229 1.00 58.31  ? 41   GLU C N     1 
ATOM   1655  C  CA    . GLU C  3 41  ? -20.160 -14.294 17.806 1.00 59.84  ? 41   GLU C CA    1 
ATOM   1656  C  C     . GLU C  3 41  ? -19.400 -13.033 17.364 1.00 59.88  ? 41   GLU C C     1 
ATOM   1657  O  O     . GLU C  3 41  ? -18.390 -13.138 16.679 1.00 60.36  ? 41   GLU C O     1 
ATOM   1658  C  CB    . GLU C  3 41  ? -21.385 -14.585 16.919 1.00 60.02  ? 41   GLU C CB    1 
ATOM   1659  C  CG    . GLU C  3 41  ? -21.180 -15.733 15.902 1.00 63.45  ? 41   GLU C CG    1 
ATOM   1660  C  CD    . GLU C  3 41  ? -20.814 -17.104 16.543 1.00 68.34  ? 41   GLU C CD    1 
ATOM   1661  O  OE1   . GLU C  3 41  ? -19.778 -17.695 16.138 1.00 69.20  ? 41   GLU C OE1   1 
ATOM   1662  O  OE2   . GLU C  3 41  ? -21.550 -17.594 17.449 1.00 69.76  ? 41   GLU C OE2   1 
ATOM   1663  N  N     . ARG C  3 42  ? -19.864 -11.856 17.783 1.00 59.93  ? 42   ARG C N     1 
ATOM   1664  C  CA    . ARG C  3 42  ? -19.211 -10.582 17.440 1.00 59.91  ? 42   ARG C CA    1 
ATOM   1665  C  C     . ARG C  3 42  ? -18.765 -9.822  18.698 1.00 59.42  ? 42   ARG C C     1 
ATOM   1666  O  O     . ARG C  3 42  ? -19.435 -9.879  19.729 1.00 59.53  ? 42   ARG C O     1 
ATOM   1667  C  CB    . ARG C  3 42  ? -20.158 -9.697  16.599 1.00 60.34  ? 42   ARG C CB    1 
ATOM   1668  C  CG    . ARG C  3 42  ? -20.503 -10.255 15.205 1.00 61.73  ? 42   ARG C CG    1 
ATOM   1669  C  CD    . ARG C  3 42  ? -21.913 -9.880  14.763 1.00 65.52  ? 42   ARG C CD    1 
ATOM   1670  N  NE    . ARG C  3 42  ? -21.949 -8.795  13.775 1.00 69.17  ? 42   ARG C NE    1 
ATOM   1671  C  CZ    . ARG C  3 42  ? -22.009 -8.961  12.447 1.00 71.07  ? 42   ARG C CZ    1 
ATOM   1672  N  NH1   . ARG C  3 42  ? -22.047 -10.175 11.904 1.00 71.11  ? 42   ARG C NH1   1 
ATOM   1673  N  NH2   . ARG C  3 42  ? -22.039 -7.899  11.647 1.00 71.90  ? 42   ARG C NH2   1 
ATOM   1674  N  N     . VAL C  3 43  ? -17.639 -9.117  18.600 1.00 58.85  ? 43   VAL C N     1 
ATOM   1675  C  CA    . VAL C  3 43  ? -17.153 -8.217  19.664 1.00 58.35  ? 43   VAL C CA    1 
ATOM   1676  C  C     . VAL C  3 43  ? -17.097 -6.754  19.188 1.00 58.33  ? 43   VAL C C     1 
ATOM   1677  O  O     . VAL C  3 43  ? -16.240 -6.383  18.365 1.00 58.46  ? 43   VAL C O     1 
ATOM   1678  C  CB    . VAL C  3 43  ? -15.749 -8.642  20.201 1.00 58.31  ? 43   VAL C CB    1 
ATOM   1679  C  CG1   . VAL C  3 43  ? -15.331 -7.791  21.400 1.00 56.72  ? 43   VAL C CG1   1 
ATOM   1680  C  CG2   . VAL C  3 43  ? -15.745 -10.116 20.565 1.00 57.49  ? 43   VAL C CG2   1 
ATOM   1681  N  N     . GLY C  3 44  ? -18.008 -5.936  19.711 1.00 57.91  ? 44   GLY C N     1 
ATOM   1682  C  CA    . GLY C  3 44  ? -18.035 -4.492  19.431 1.00 57.57  ? 44   GLY C CA    1 
ATOM   1683  C  C     . GLY C  3 44  ? -16.781 -3.721  19.829 1.00 57.40  ? 44   GLY C C     1 
ATOM   1684  O  O     . GLY C  3 44  ? -16.079 -4.091  20.780 1.00 57.28  ? 44   GLY C O     1 
ATOM   1685  N  N     . ALA C  3 45  ? -16.525 -2.631  19.108 1.00 57.10  ? 45   ALA C N     1 
ATOM   1686  C  CA    . ALA C  3 45  ? -15.297 -1.820  19.242 1.00 56.94  ? 45   ALA C CA    1 
ATOM   1687  C  C     . ALA C  3 45  ? -15.058 -1.168  20.617 1.00 56.64  ? 45   ALA C C     1 
ATOM   1688  O  O     . ALA C  3 45  ? -13.911 -1.043  21.047 1.00 56.83  ? 45   ALA C O     1 
ATOM   1689  C  CB    . ALA C  3 45  ? -15.268 -0.751  18.159 1.00 57.10  ? 45   ALA C CB    1 
ATOM   1690  N  N     . GLY C  3 46  ? -16.131 -0.744  21.281 1.00 55.95  ? 46   GLY C N     1 
ATOM   1691  C  CA    . GLY C  3 46  ? -16.038 -0.153  22.618 1.00 55.54  ? 46   GLY C CA    1 
ATOM   1692  C  C     . GLY C  3 46  ? -15.785 -1.106  23.783 1.00 55.14  ? 46   GLY C C     1 
ATOM   1693  O  O     . GLY C  3 46  ? -15.077 -0.751  24.733 1.00 55.73  ? 46   GLY C O     1 
ATOM   1694  N  N     . ALA C  3 47  ? -16.354 -2.314  23.706 1.00 54.27  ? 47   ALA C N     1 
ATOM   1695  C  CA    . ALA C  3 47  ? -16.185 -3.378  24.712 1.00 52.52  ? 47   ALA C CA    1 
ATOM   1696  C  C     . ALA C  3 47  ? -14.757 -3.620  25.220 1.00 51.26  ? 47   ALA C C     1 
ATOM   1697  O  O     . ALA C  3 47  ? -14.540 -3.630  26.428 1.00 50.81  ? 47   ALA C O     1 
ATOM   1698  C  CB    . ALA C  3 47  ? -16.814 -4.690  24.215 1.00 53.35  ? 47   ALA C CB    1 
ATOM   1699  N  N     . PRO C  3 48  ? -13.777 -3.810  24.313 1.00 50.53  ? 48   PRO C N     1 
ATOM   1700  C  CA    . PRO C  3 48  ? -12.390 -3.946  24.807 1.00 49.74  ? 48   PRO C CA    1 
ATOM   1701  C  C     . PRO C  3 48  ? -11.814 -2.681  25.432 1.00 49.89  ? 48   PRO C C     1 
ATOM   1702  O  O     . PRO C  3 48  ? -10.926 -2.776  26.287 1.00 50.98  ? 48   PRO C O     1 
ATOM   1703  C  CB    . PRO C  3 48  ? -11.590 -4.302  23.560 1.00 49.73  ? 48   PRO C CB    1 
ATOM   1704  C  CG    . PRO C  3 48  ? -12.449 -3.949  22.407 1.00 50.14  ? 48   PRO C CG    1 
ATOM   1705  C  CD    . PRO C  3 48  ? -13.869 -3.938  22.849 1.00 49.98  ? 48   PRO C CD    1 
ATOM   1706  N  N     . VAL C  3 49  ? -12.294 -1.510  24.998 1.00 49.16  ? 49   VAL C N     1 
ATOM   1707  C  CA    . VAL C  3 49  ? -11.867 -0.223  25.542 1.00 48.03  ? 49   VAL C CA    1 
ATOM   1708  C  C     . VAL C  3 49  ? -12.396 -0.099  26.961 1.00 47.99  ? 49   VAL C C     1 
ATOM   1709  O  O     . VAL C  3 49  ? -11.641 0.162   27.906 1.00 47.97  ? 49   VAL C O     1 
ATOM   1710  C  CB    . VAL C  3 49  ? -12.359 0.973   24.639 1.00 48.75  ? 49   VAL C CB    1 
ATOM   1711  C  CG1   . VAL C  3 49  ? -12.214 2.298   25.349 1.00 47.67  ? 49   VAL C CG1   1 
ATOM   1712  C  CG2   . VAL C  3 49  ? -11.629 0.985   23.249 1.00 46.65  ? 49   VAL C CG2   1 
ATOM   1713  N  N     . TYR C  3 50  ? -13.700 -0.298  27.114 1.00 47.41  ? 50   TYR C N     1 
ATOM   1714  C  CA    . TYR C  3 50  ? -14.320 -0.315  28.430 1.00 47.50  ? 50   TYR C CA    1 
ATOM   1715  C  C     . TYR C  3 50  ? -13.692 -1.342  29.389 1.00 47.96  ? 50   TYR C C     1 
ATOM   1716  O  O     . TYR C  3 50  ? -13.577 -1.080  30.592 1.00 49.33  ? 50   TYR C O     1 
ATOM   1717  C  CB    . TYR C  3 50  ? -15.796 -0.611  28.269 1.00 47.27  ? 50   TYR C CB    1 
ATOM   1718  C  CG    . TYR C  3 50  ? -16.682 -0.197  29.417 1.00 46.77  ? 50   TYR C CG    1 
ATOM   1719  C  CD1   . TYR C  3 50  ? -17.754 0.663   29.202 1.00 44.41  ? 50   TYR C CD1   1 
ATOM   1720  C  CD2   . TYR C  3 50  ? -16.485 -0.697  30.714 1.00 46.04  ? 50   TYR C CD2   1 
ATOM   1721  C  CE1   . TYR C  3 50  ? -18.605 1.034   30.241 1.00 42.83  ? 50   TYR C CE1   1 
ATOM   1722  C  CE2   . TYR C  3 50  ? -17.335 -0.330  31.760 1.00 44.77  ? 50   TYR C CE2   1 
ATOM   1723  C  CZ    . TYR C  3 50  ? -18.387 0.537   31.508 1.00 45.66  ? 50   TYR C CZ    1 
ATOM   1724  O  OH    . TYR C  3 50  ? -19.246 0.899   32.527 1.00 48.92  ? 50   TYR C OH    1 
ATOM   1725  N  N     . LEU C  3 51  ? -13.274 -2.497  28.867 1.00 47.21  ? 51   LEU C N     1 
ATOM   1726  C  CA    . LEU C  3 51  ? -12.790 -3.572  29.718 1.00 46.57  ? 51   LEU C CA    1 
ATOM   1727  C  C     . LEU C  3 51  ? -11.363 -3.331  30.168 1.00 46.22  ? 51   LEU C C     1 
ATOM   1728  O  O     . LEU C  3 51  ? -11.033 -3.564  31.337 1.00 46.98  ? 51   LEU C O     1 
ATOM   1729  C  CB    . LEU C  3 51  ? -12.962 -4.959  29.050 1.00 46.34  ? 51   LEU C CB    1 
ATOM   1730  C  CG    . LEU C  3 51  ? -12.459 -6.222  29.792 1.00 46.66  ? 51   LEU C CG    1 
ATOM   1731  C  CD1   . LEU C  3 51  ? -13.161 -6.469  31.127 1.00 43.57  ? 51   LEU C CD1   1 
ATOM   1732  C  CD2   . LEU C  3 51  ? -12.558 -7.459  28.901 1.00 46.57  ? 51   LEU C CD2   1 
ATOM   1733  N  N     . ALA C  3 52  ? -10.514 -2.868  29.255 1.00 45.91  ? 52   ALA C N     1 
ATOM   1734  C  CA    . ALA C  3 52  ? -9.147  -2.470  29.619 1.00 45.61  ? 52   ALA C CA    1 
ATOM   1735  C  C     . ALA C  3 52  ? -9.115  -1.335  30.673 1.00 45.44  ? 52   ALA C C     1 
ATOM   1736  O  O     . ALA C  3 52  ? -8.194  -1.263  31.510 1.00 45.79  ? 52   ALA C O     1 
ATOM   1737  C  CB    . ALA C  3 52  ? -8.360  -2.100  28.378 1.00 45.30  ? 52   ALA C CB    1 
ATOM   1738  N  N     . ALA C  3 53  ? -10.136 -0.478  30.650 1.00 44.93  ? 53   ALA C N     1 
ATOM   1739  C  CA    . ALA C  3 53  ? -10.263 0.616   31.603 1.00 44.53  ? 53   ALA C CA    1 
ATOM   1740  C  C     . ALA C  3 53  ? -10.619 0.094   32.979 1.00 44.51  ? 53   ALA C C     1 
ATOM   1741  O  O     . ALA C  3 53  ? -9.971  0.452   33.963 1.00 44.55  ? 53   ALA C O     1 
ATOM   1742  C  CB    . ALA C  3 53  ? -11.316 1.625   31.125 1.00 44.92  ? 53   ALA C CB    1 
ATOM   1743  N  N     . VAL C  3 54  ? -11.665 -0.737  33.051 1.00 44.21  ? 54   VAL C N     1 
ATOM   1744  C  CA    . VAL C  3 54  ? -12.024 -1.440  34.303 1.00 43.68  ? 54   VAL C CA    1 
ATOM   1745  C  C     . VAL C  3 54  ? -10.835 -2.191  34.919 1.00 43.25  ? 54   VAL C C     1 
ATOM   1746  O  O     . VAL C  3 54  ? -10.537 -2.067  36.116 1.00 41.73  ? 54   VAL C O     1 
ATOM   1747  C  CB    . VAL C  3 54  ? -13.213 -2.405  34.077 1.00 44.28  ? 54   VAL C CB    1 
ATOM   1748  C  CG1   . VAL C  3 54  ? -13.419 -3.313  35.284 1.00 43.76  ? 54   VAL C CG1   1 
ATOM   1749  C  CG2   . VAL C  3 54  ? -14.506 -1.603  33.737 1.00 43.45  ? 54   VAL C CG2   1 
ATOM   1750  N  N     . LEU C  3 55  ? -10.140 -2.945  34.076 1.00 43.42  ? 55   LEU C N     1 
ATOM   1751  C  CA    . LEU C  3 55  ? -9.014  -3.756  34.528 1.00 43.73  ? 55   LEU C CA    1 
ATOM   1752  C  C     . LEU C  3 55  ? -7.878  -2.905  35.105 1.00 43.66  ? 55   LEU C C     1 
ATOM   1753  O  O     . LEU C  3 55  ? -7.282  -3.256  36.139 1.00 43.54  ? 55   LEU C O     1 
ATOM   1754  C  CB    . LEU C  3 55  ? -8.537  -4.676  33.394 1.00 43.91  ? 55   LEU C CB    1 
ATOM   1755  C  CG    . LEU C  3 55  ? -9.514  -5.790  32.926 1.00 44.45  ? 55   LEU C CG    1 
ATOM   1756  C  CD1   . LEU C  3 55  ? -8.954  -6.550  31.738 1.00 43.26  ? 55   LEU C CD1   1 
ATOM   1757  C  CD2   . LEU C  3 55  ? -9.887  -6.764  34.039 1.00 42.90  ? 55   LEU C CD2   1 
ATOM   1758  N  N     . GLU C  3 56  ? -7.617  -1.763  34.456 1.00 44.11  ? 56   GLU C N     1 
ATOM   1759  C  CA    . GLU C  3 56  ? -6.593  -0.786  34.896 1.00 43.19  ? 56   GLU C CA    1 
ATOM   1760  C  C     . GLU C  3 56  ? -7.048  -0.076  36.142 1.00 42.31  ? 56   GLU C C     1 
ATOM   1761  O  O     . GLU C  3 56  ? -6.270  0.128   37.077 1.00 41.46  ? 56   GLU C O     1 
ATOM   1762  C  CB    . GLU C  3 56  ? -6.369  0.241   33.813 1.00 43.86  ? 56   GLU C CB    1 
ATOM   1763  C  CG    . GLU C  3 56  ? -5.175  1.144   34.048 1.00 46.04  ? 56   GLU C CG    1 
ATOM   1764  C  CD    . GLU C  3 56  ? -5.019  2.136   32.926 1.00 50.58  ? 56   GLU C CD    1 
ATOM   1765  O  OE1   . GLU C  3 56  ? -4.776  1.669   31.779 1.00 49.86  ? 56   GLU C OE1   1 
ATOM   1766  O  OE2   . GLU C  3 56  ? -5.158  3.370   33.199 1.00 52.22  ? 56   GLU C OE2   1 
ATOM   1767  N  N     . TYR C  3 57  ? -8.319  0.304   36.158 1.00 41.74  ? 57   TYR C N     1 
ATOM   1768  C  CA    . TYR C  3 57  ? -8.885  0.864   37.362 1.00 42.37  ? 57   TYR C CA    1 
ATOM   1769  C  C     . TYR C  3 57  ? -8.615  -0.039  38.570 1.00 42.66  ? 57   TYR C C     1 
ATOM   1770  O  O     . TYR C  3 57  ? -8.110  0.434   39.578 1.00 43.79  ? 57   TYR C O     1 
ATOM   1771  C  CB    . TYR C  3 57  ? -10.383 1.182   37.210 1.00 42.78  ? 57   TYR C CB    1 
ATOM   1772  C  CG    . TYR C  3 57  ? -11.034 1.430   38.547 1.00 43.84  ? 57   TYR C CG    1 
ATOM   1773  C  CD1   . TYR C  3 57  ? -10.639 2.507   39.354 1.00 47.42  ? 57   TYR C CD1   1 
ATOM   1774  C  CD2   . TYR C  3 57  ? -12.015 0.580   39.028 1.00 43.60  ? 57   TYR C CD2   1 
ATOM   1775  C  CE1   . TYR C  3 57  ? -11.231 2.723   40.603 1.00 46.47  ? 57   TYR C CE1   1 
ATOM   1776  C  CE2   . TYR C  3 57  ? -12.601 0.780   40.275 1.00 43.89  ? 57   TYR C CE2   1 
ATOM   1777  C  CZ    . TYR C  3 57  ? -12.210 1.843   41.053 1.00 44.82  ? 57   TYR C CZ    1 
ATOM   1778  O  OH    . TYR C  3 57  ? -12.794 2.034   42.290 1.00 45.64  ? 57   TYR C OH    1 
ATOM   1779  N  N     . LEU C  3 58  ? -8.919  -1.340  38.458 1.00 42.58  ? 58   LEU C N     1 
ATOM   1780  C  CA    . LEU C  3 58  ? -8.804  -2.290  39.582 1.00 41.50  ? 58   LEU C CA    1 
ATOM   1781  C  C     . LEU C  3 58  ? -7.364  -2.602  40.014 1.00 41.55  ? 58   LEU C C     1 
ATOM   1782  O  O     . LEU C  3 58  ? -7.070  -2.640  41.206 1.00 41.59  ? 58   LEU C O     1 
ATOM   1783  C  CB    . LEU C  3 58  ? -9.552  -3.576  39.251 1.00 41.98  ? 58   LEU C CB    1 
ATOM   1784  C  CG    . LEU C  3 58  ? -11.071 -3.478  39.093 1.00 40.67  ? 58   LEU C CG    1 
ATOM   1785  C  CD1   . LEU C  3 58  ? -11.546 -4.739  38.427 1.00 38.51  ? 58   LEU C CD1   1 
ATOM   1786  C  CD2   . LEU C  3 58  ? -11.781 -3.257  40.415 1.00 39.80  ? 58   LEU C CD2   1 
ATOM   1787  N  N     . THR C  3 59  ? -6.482  -2.857  39.051 1.00 41.08  ? 59   THR C N     1 
ATOM   1788  C  CA    . THR C  3 59  ? -5.046  -2.883  39.290 1.00 41.15  ? 59   THR C CA    1 
ATOM   1789  C  C     . THR C  3 59  ? -4.579  -1.641  40.077 1.00 42.30  ? 59   THR C C     1 
ATOM   1790  O  O     . THR C  3 59  ? -3.852  -1.762  41.088 1.00 43.04  ? 59   THR C O     1 
ATOM   1791  C  CB    . THR C  3 59  ? -4.302  -2.936  37.925 1.00 41.45  ? 59   THR C CB    1 
ATOM   1792  O  OG1   . THR C  3 59  ? -4.947  -3.886  37.068 1.00 39.23  ? 59   THR C OG1   1 
ATOM   1793  C  CG2   . THR C  3 59  ? -2.844  -3.305  38.072 1.00 40.89  ? 59   THR C CG2   1 
ATOM   1794  N  N     . ALA C  3 60  ? -4.989  -0.444  39.629 1.00 42.15  ? 60   ALA C N     1 
ATOM   1795  C  CA    . ALA C  3 60  ? -4.536  0.807   40.272 1.00 41.92  ? 60   ALA C CA    1 
ATOM   1796  C  C     . ALA C  3 60  ? -4.981  0.875   41.722 1.00 41.81  ? 60   ALA C C     1 
ATOM   1797  O  O     . ALA C  3 60  ? -4.199  1.232   42.607 1.00 41.54  ? 60   ALA C O     1 
ATOM   1798  C  CB    . ALA C  3 60  ? -5.019  2.057   39.484 1.00 41.67  ? 60   ALA C CB    1 
ATOM   1799  N  N     . GLU C  3 61  ? -6.245  0.524   41.942 1.00 42.37  ? 61   GLU C N     1 
ATOM   1800  C  CA    . GLU C  3 61  ? -6.843  0.387   43.269 1.00 43.54  ? 61   GLU C CA    1 
ATOM   1801  C  C     . GLU C  3 61  ? -6.081  -0.561  44.209 1.00 43.38  ? 61   GLU C C     1 
ATOM   1802  O  O     . GLU C  3 61  ? -5.809  -0.228  45.371 1.00 44.13  ? 61   GLU C O     1 
ATOM   1803  C  CB    . GLU C  3 61  ? -8.277  -0.090  43.096 1.00 44.30  ? 61   GLU C CB    1 
ATOM   1804  C  CG    . GLU C  3 61  ? -9.132  0.062   44.339 1.00 49.84  ? 61   GLU C CG    1 
ATOM   1805  C  CD    . GLU C  3 61  ? -9.361  1.532   44.775 1.00 55.16  ? 61   GLU C CD    1 
ATOM   1806  O  OE1   . GLU C  3 61  ? -9.446  2.448   43.898 1.00 55.07  ? 61   GLU C OE1   1 
ATOM   1807  O  OE2   . GLU C  3 61  ? -9.484  1.742   46.014 1.00 57.11  ? 61   GLU C OE2   1 
ATOM   1808  N  N     . ILE C  3 62  ? -5.714  -1.745  43.716 1.00 42.75  ? 62   ILE C N     1 
ATOM   1809  C  CA    . ILE C  3 62  ? -4.995  -2.708  44.559 1.00 41.98  ? 62   ILE C CA    1 
ATOM   1810  C  C     . ILE C  3 62  ? -3.520  -2.318  44.756 1.00 40.45  ? 62   ILE C C     1 
ATOM   1811  O  O     . ILE C  3 62  ? -3.007  -2.433  45.854 1.00 39.87  ? 62   ILE C O     1 
ATOM   1812  C  CB    . ILE C  3 62  ? -5.246  -4.208  44.093 1.00 41.90  ? 62   ILE C CB    1 
ATOM   1813  C  CG1   . ILE C  3 62  ? -4.503  -5.230  44.925 1.00 41.53  ? 62   ILE C CG1   1 
ATOM   1814  C  CG2   . ILE C  3 62  ? -4.834  -4.429  42.669 1.00 43.71  ? 62   ILE C CG2   1 
ATOM   1815  C  CD1   . ILE C  3 62  ? -5.163  -6.626  44.781 1.00 43.28  ? 62   ILE C CD1   1 
ATOM   1816  N  N     . LEU C  3 63  ? -2.851  -1.828  43.715 1.00 40.16  ? 63   LEU C N     1 
ATOM   1817  C  CA    . LEU C  3 63  ? -1.480  -1.312  43.886 1.00 40.48  ? 63   LEU C CA    1 
ATOM   1818  C  C     . LEU C  3 63  ? -1.350  -0.131  44.860 1.00 40.93  ? 63   LEU C C     1 
ATOM   1819  O  O     . LEU C  3 63  ? -0.341  -0.017  45.589 1.00 40.75  ? 63   LEU C O     1 
ATOM   1820  C  CB    . LEU C  3 63  ? -0.813  -1.005  42.546 1.00 40.21  ? 63   LEU C CB    1 
ATOM   1821  C  CG    . LEU C  3 63  ? -0.586  -2.241  41.660 1.00 41.28  ? 63   LEU C CG    1 
ATOM   1822  C  CD1   . LEU C  3 63  ? -0.216  -1.842  40.246 1.00 41.78  ? 63   LEU C CD1   1 
ATOM   1823  C  CD2   . LEU C  3 63  ? 0.459   -3.203  42.265 1.00 37.88  ? 63   LEU C CD2   1 
ATOM   1824  N  N     . GLU C  3 64  ? -2.372  0.732   44.876 1.00 41.24  ? 64   GLU C N     1 
ATOM   1825  C  CA    . GLU C  3 64  ? -2.457  1.811   45.837 1.00 41.71  ? 64   GLU C CA    1 
ATOM   1826  C  C     . GLU C  3 64  ? -2.386  1.256   47.243 1.00 41.71  ? 64   GLU C C     1 
ATOM   1827  O  O     . GLU C  3 64  ? -1.460  1.562   47.989 1.00 43.31  ? 64   GLU C O     1 
ATOM   1828  C  CB    . GLU C  3 64  ? -3.743  2.629   45.620 1.00 41.92  ? 64   GLU C CB    1 
ATOM   1829  C  CG    . GLU C  3 64  ? -3.827  3.931   46.436 1.00 44.66  ? 64   GLU C CG    1 
ATOM   1830  C  CD    . GLU C  3 64  ? -2.720  4.918   46.116 1.00 46.63  ? 64   GLU C CD    1 
ATOM   1831  O  OE1   . GLU C  3 64  ? -2.186  5.580   47.014 1.00 50.28  ? 64   GLU C OE1   1 
ATOM   1832  O  OE2   . GLU C  3 64  ? -2.350  5.009   44.951 1.00 50.94  ? 64   GLU C OE2   1 
ATOM   1833  N  N     . LEU C  3 65  ? -3.348  0.412   47.597 1.00 41.66  ? 65   LEU C N     1 
ATOM   1834  C  CA    . LEU C  3 65  ? -3.471  -0.146  48.955 1.00 40.73  ? 65   LEU C CA    1 
ATOM   1835  C  C     . LEU C  3 65  ? -2.288  -0.986  49.431 1.00 41.54  ? 65   LEU C C     1 
ATOM   1836  O  O     . LEU C  3 65  ? -1.928  -0.965  50.632 1.00 41.67  ? 65   LEU C O     1 
ATOM   1837  C  CB    . LEU C  3 65  ? -4.744  -0.953  49.032 1.00 40.39  ? 65   LEU C CB    1 
ATOM   1838  C  CG    . LEU C  3 65  ? -6.026  -0.103  48.935 1.00 39.28  ? 65   LEU C CG    1 
ATOM   1839  C  CD1   . LEU C  3 65  ? -7.241  -1.027  48.867 1.00 32.53  ? 65   LEU C CD1   1 
ATOM   1840  C  CD2   . LEU C  3 65  ? -6.104  0.911   50.126 1.00 31.87  ? 65   LEU C CD2   1 
ATOM   1841  N  N     . ALA C  3 66  ? -1.683  -1.685  48.467 1.00 41.67  ? 66   ALA C N     1 
ATOM   1842  C  CA    . ALA C  3 66  ? -0.567  -2.598  48.642 1.00 41.90  ? 66   ALA C CA    1 
ATOM   1843  C  C     . ALA C  3 66  ? 0.734   -1.846  48.864 1.00 42.35  ? 66   ALA C C     1 
ATOM   1844  O  O     . ALA C  3 66  ? 1.502   -2.165  49.799 1.00 42.72  ? 66   ALA C O     1 
ATOM   1845  C  CB    . ALA C  3 66  ? -0.464  -3.497  47.405 1.00 41.53  ? 66   ALA C CB    1 
ATOM   1846  N  N     . GLY C  3 67  ? 0.995   -0.867  47.982 1.00 42.48  ? 67   GLY C N     1 
ATOM   1847  C  CA    . GLY C  3 67  ? 2.010   0.160   48.208 1.00 41.55  ? 67   GLY C CA    1 
ATOM   1848  C  C     . GLY C  3 67  ? 1.954   0.742   49.611 1.00 41.62  ? 67   GLY C C     1 
ATOM   1849  O  O     . GLY C  3 67  ? 2.981   0.900   50.266 1.00 40.99  ? 67   GLY C O     1 
ATOM   1850  N  N     . ASN C  3 68  ? 0.764   1.084   50.081 1.00 42.29  ? 68   ASN C N     1 
ATOM   1851  C  CA    . ASN C  3 68  ? 0.666   1.619   51.428 1.00 43.70  ? 68   ASN C CA    1 
ATOM   1852  C  C     . ASN C  3 68  ? 1.079   0.615   52.464 1.00 44.42  ? 68   ASN C C     1 
ATOM   1853  O  O     . ASN C  3 68  ? 1.848   0.943   53.370 1.00 45.06  ? 68   ASN C O     1 
ATOM   1854  C  CB    . ASN C  3 68  ? -0.730  2.166   51.738 1.00 44.38  ? 68   ASN C CB    1 
ATOM   1855  C  CG    . ASN C  3 68  ? -1.116  3.354   50.846 1.00 46.00  ? 68   ASN C CG    1 
ATOM   1856  O  OD1   . ASN C  3 68  ? -0.249  4.054   50.279 1.00 44.14  ? 68   ASN C OD1   1 
ATOM   1857  N  ND2   . ASN C  3 68  ? -2.424  3.581   50.719 1.00 44.64  ? 68   ASN C ND2   1 
ATOM   1858  N  N     . ALA C  3 69  ? 0.582   -0.622  52.317 1.00 45.45  ? 69   ALA C N     1 
ATOM   1859  C  CA    . ALA C  3 69  ? 0.948   -1.735  53.203 1.00 45.30  ? 69   ALA C CA    1 
ATOM   1860  C  C     . ALA C  3 69  ? 2.447   -2.004  53.178 1.00 45.27  ? 69   ALA C C     1 
ATOM   1861  O  O     . ALA C  3 69  ? 3.063   -2.196  54.227 1.00 45.17  ? 69   ALA C O     1 
ATOM   1862  C  CB    . ALA C  3 69  ? 0.111   -3.011  52.890 1.00 45.14  ? 69   ALA C CB    1 
ATOM   1863  N  N     . ALA C  3 70  ? 3.037   -1.990  51.990 1.00 46.38  ? 70   ALA C N     1 
ATOM   1864  C  CA    . ALA C  3 70  ? 4.498   -1.999  51.868 1.00 48.55  ? 70   ALA C CA    1 
ATOM   1865  C  C     . ALA C  3 70  ? 5.103   -0.930  52.779 1.00 50.69  ? 70   ALA C C     1 
ATOM   1866  O  O     . ALA C  3 70  ? 5.883   -1.255  53.681 1.00 51.47  ? 70   ALA C O     1 
ATOM   1867  C  CB    . ALA C  3 70  ? 4.908   -1.758  50.426 1.00 48.24  ? 70   ALA C CB    1 
ATOM   1868  N  N     . ARG C  3 71  ? 4.698   0.333   52.563 1.00 52.66  ? 71   ARG C N     1 
ATOM   1869  C  CA    . ARG C  3 71  ? 5.159   1.490   53.332 1.00 54.66  ? 71   ARG C CA    1 
ATOM   1870  C  C     . ARG C  3 71  ? 4.973   1.363   54.838 1.00 55.52  ? 71   ARG C C     1 
ATOM   1871  O  O     . ARG C  3 71  ? 5.912   1.613   55.580 1.00 55.70  ? 71   ARG C O     1 
ATOM   1872  C  CB    . ARG C  3 71  ? 4.480   2.770   52.842 1.00 55.48  ? 71   ARG C CB    1 
ATOM   1873  C  CG    . ARG C  3 71  ? 5.155   4.053   53.310 1.00 57.66  ? 71   ARG C CG    1 
ATOM   1874  C  CD    . ARG C  3 71  ? 4.152   5.187   53.497 1.00 63.56  ? 71   ARG C CD    1 
ATOM   1875  N  NE    . ARG C  3 71  ? 3.035   4.874   54.412 1.00 66.27  ? 71   ARG C NE    1 
ATOM   1876  C  CZ    . ARG C  3 71  ? 1.775   4.650   54.016 1.00 68.94  ? 71   ARG C CZ    1 
ATOM   1877  N  NH1   . ARG C  3 71  ? 1.455   4.682   52.714 1.00 69.24  ? 71   ARG C NH1   1 
ATOM   1878  N  NH2   . ARG C  3 71  ? 0.827   4.390   54.916 1.00 67.82  ? 71   ARG C NH2   1 
ATOM   1879  N  N     . ASP C  3 72  ? 3.778   0.981   55.288 1.00 56.79  ? 72   ASP C N     1 
ATOM   1880  C  CA    . ASP C  3 72  ? 3.534   0.707   56.707 1.00 58.76  ? 72   ASP C CA    1 
ATOM   1881  C  C     . ASP C  3 72  ? 4.540   -0.294  57.345 1.00 59.63  ? 72   ASP C C     1 
ATOM   1882  O  O     . ASP C  3 72  ? 4.788   -0.237  58.551 1.00 60.05  ? 72   ASP C O     1 
ATOM   1883  C  CB    . ASP C  3 72  ? 2.107   0.189   56.922 1.00 59.03  ? 72   ASP C CB    1 
ATOM   1884  C  CG    . ASP C  3 72  ? 1.028   1.220   56.587 1.00 61.84  ? 72   ASP C CG    1 
ATOM   1885  O  OD1   . ASP C  3 72  ? 1.301   2.447   56.649 1.00 64.10  ? 72   ASP C OD1   1 
ATOM   1886  O  OD2   . ASP C  3 72  ? -0.117  0.798   56.281 1.00 63.37  ? 72   ASP C OD2   1 
ATOM   1887  N  N     . ASN C  3 73  ? 5.102   -1.209  56.552 1.00 60.42  ? 73   ASN C N     1 
ATOM   1888  C  CA    . ASN C  3 73  ? 6.088   -2.183  57.059 1.00 61.23  ? 73   ASN C CA    1 
ATOM   1889  C  C     . ASN C  3 73  ? 7.511   -1.808  56.669 1.00 61.25  ? 73   ASN C C     1 
ATOM   1890  O  O     . ASN C  3 73  ? 8.375   -2.660  56.595 1.00 61.89  ? 73   ASN C O     1 
ATOM   1891  C  CB    . ASN C  3 73  ? 5.781   -3.608  56.562 1.00 61.51  ? 73   ASN C CB    1 
ATOM   1892  C  CG    . ASN C  3 73  ? 4.491   -4.168  57.138 1.00 63.58  ? 73   ASN C CG    1 
ATOM   1893  O  OD1   . ASN C  3 73  ? 4.480   -4.707  58.251 1.00 65.95  ? 73   ASN C OD1   1 
ATOM   1894  N  ND2   . ASN C  3 73  ? 3.390   -4.040  56.385 1.00 64.39  ? 73   ASN C ND2   1 
ATOM   1895  N  N     . LYS C  3 74  ? 7.751   -0.530  56.412 1.00 61.21  ? 74   LYS C N     1 
ATOM   1896  C  CA    . LYS C  3 74  ? 9.081   -0.037  56.043 1.00 60.83  ? 74   LYS C CA    1 
ATOM   1897  C  C     . LYS C  3 74  ? 9.706   -0.702  54.814 1.00 59.95  ? 74   LYS C C     1 
ATOM   1898  O  O     . LYS C  3 74  ? 10.916  -0.918  54.783 1.00 60.16  ? 74   LYS C O     1 
ATOM   1899  C  CB    . LYS C  3 74  ? 10.019  -0.133  57.245 1.00 61.30  ? 74   LYS C CB    1 
ATOM   1900  C  CG    . LYS C  3 74  ? 9.697   0.876   58.328 1.00 63.20  ? 74   LYS C CG    1 
ATOM   1901  C  CD    . LYS C  3 74  ? 9.610   0.220   59.696 1.00 66.52  ? 74   LYS C CD    1 
ATOM   1902  C  CE    . LYS C  3 74  ? 8.343   0.673   60.440 1.00 68.16  ? 74   LYS C CE    1 
ATOM   1903  N  NZ    . LYS C  3 74  ? 8.185   2.165   60.478 1.00 69.48  ? 74   LYS C NZ    1 
ATOM   1904  N  N     . LYS C  3 75  ? 8.896   -1.015  53.802 1.00 58.64  ? 75   LYS C N     1 
ATOM   1905  C  CA    . LYS C  3 75  ? 9.412   -1.692  52.607 1.00 57.81  ? 75   LYS C CA    1 
ATOM   1906  C  C     . LYS C  3 75  ? 9.119   -0.875  51.379 1.00 57.00  ? 75   LYS C C     1 
ATOM   1907  O  O     . LYS C  3 75  ? 8.075   -0.228  51.299 1.00 57.63  ? 75   LYS C O     1 
ATOM   1908  C  CB    . LYS C  3 75  ? 8.792   -3.100  52.409 1.00 57.98  ? 75   LYS C CB    1 
ATOM   1909  C  CG    . LYS C  3 75  ? 8.726   -3.997  53.628 1.00 57.63  ? 75   LYS C CG    1 
ATOM   1910  C  CD    . LYS C  3 75  ? 10.116  -4.431  54.100 1.00 59.09  ? 75   LYS C CD    1 
ATOM   1911  C  CE    . LYS C  3 75  ? 10.033  -5.270  55.368 1.00 59.29  ? 75   LYS C CE    1 
ATOM   1912  N  NZ    . LYS C  3 75  ? 9.361   -6.577  55.025 1.00 63.27  ? 75   LYS C NZ    1 
ATOM   1913  N  N     . THR C  3 76  ? 10.019  -0.942  50.407 1.00 55.60  ? 76   THR C N     1 
ATOM   1914  C  CA    . THR C  3 76  ? 9.854   -0.236  49.152 1.00 54.37  ? 76   THR C CA    1 
ATOM   1915  C  C     . THR C  3 76  ? 9.522   -1.234  48.048 1.00 53.43  ? 76   THR C C     1 
ATOM   1916  O  O     . THR C  3 76  ? 9.330   -0.851  46.889 1.00 53.41  ? 76   THR C O     1 
ATOM   1917  C  CB    . THR C  3 76  ? 11.134  0.618   48.781 1.00 54.93  ? 76   THR C CB    1 
ATOM   1918  O  OG1   . THR C  3 76  ? 12.041  -0.147  47.964 1.00 55.57  ? 76   THR C OG1   1 
ATOM   1919  C  CG2   . THR C  3 76  ? 11.869  1.130   50.044 1.00 54.55  ? 76   THR C CG2   1 
ATOM   1920  N  N     . ARG C  3 77  ? 9.474   -2.522  48.397 1.00 52.11  ? 77   ARG C N     1 
ATOM   1921  C  CA    . ARG C  3 77  ? 9.076   -3.559  47.432 1.00 50.47  ? 77   ARG C CA    1 
ATOM   1922  C  C     . ARG C  3 77  ? 7.795   -4.279  47.841 1.00 49.03  ? 77   ARG C C     1 
ATOM   1923  O  O     . ARG C  3 77  ? 7.751   -4.898  48.900 1.00 49.73  ? 77   ARG C O     1 
ATOM   1924  C  CB    . ARG C  3 77  ? 10.202  -4.556  47.231 1.00 50.49  ? 77   ARG C CB    1 
ATOM   1925  C  CG    . ARG C  3 77  ? 9.972   -5.413  46.034 1.00 52.02  ? 77   ARG C CG    1 
ATOM   1926  C  CD    . ARG C  3 77  ? 11.066  -6.407  45.838 1.00 53.81  ? 77   ARG C CD    1 
ATOM   1927  N  NE    . ARG C  3 77  ? 12.208  -5.805  45.166 1.00 55.47  ? 77   ARG C NE    1 
ATOM   1928  C  CZ    . ARG C  3 77  ? 13.437  -5.790  45.669 1.00 57.23  ? 77   ARG C CZ    1 
ATOM   1929  N  NH1   . ARG C  3 77  ? 13.668  -6.343  46.855 1.00 58.35  ? 77   ARG C NH1   1 
ATOM   1930  N  NH2   . ARG C  3 77  ? 14.430  -5.225  44.987 1.00 57.19  ? 77   ARG C NH2   1 
ATOM   1931  N  N     . ILE C  3 78  ? 6.750   -4.170  47.022 1.00 47.37  ? 78   ILE C N     1 
ATOM   1932  C  CA    . ILE C  3 78  ? 5.498   -4.920  47.238 1.00 45.72  ? 78   ILE C CA    1 
ATOM   1933  C  C     . ILE C  3 78  ? 5.737   -6.451  47.049 1.00 45.58  ? 78   ILE C C     1 
ATOM   1934  O  O     . ILE C  3 78  ? 6.147   -6.907  45.964 1.00 45.46  ? 78   ILE C O     1 
ATOM   1935  C  CB    . ILE C  3 78  ? 4.344   -4.477  46.278 1.00 45.51  ? 78   ILE C CB    1 
ATOM   1936  C  CG1   . ILE C  3 78  ? 4.023   -2.996  46.403 1.00 44.43  ? 78   ILE C CG1   1 
ATOM   1937  C  CG2   . ILE C  3 78  ? 3.064   -5.274  46.530 1.00 44.90  ? 78   ILE C CG2   1 
ATOM   1938  C  CD1   . ILE C  3 78  ? 2.944   -2.541  45.425 1.00 44.02  ? 78   ILE C CD1   1 
ATOM   1939  N  N     . ILE C  3 79  ? 5.482   -7.211  48.118 1.00 44.57  ? 79   ILE C N     1 
ATOM   1940  C  CA    . ILE C  3 79  ? 5.460   -8.681  48.105 1.00 42.76  ? 79   ILE C CA    1 
ATOM   1941  C  C     . ILE C  3 79  ? 4.010   -9.147  48.323 1.00 42.49  ? 79   ILE C C     1 
ATOM   1942  O  O     . ILE C  3 79  ? 3.139   -8.302  48.548 1.00 42.65  ? 79   ILE C O     1 
ATOM   1943  C  CB    . ILE C  3 79  ? 6.438   -9.291  49.160 1.00 42.62  ? 79   ILE C CB    1 
ATOM   1944  C  CG1   . ILE C  3 79  ? 5.979   -9.017  50.590 1.00 41.09  ? 79   ILE C CG1   1 
ATOM   1945  C  CG2   . ILE C  3 79  ? 7.855   -8.826  48.892 1.00 42.23  ? 79   ILE C CG2   1 
ATOM   1946  C  CD1   . ILE C  3 79  ? 6.966   -9.441  51.631 1.00 41.16  ? 79   ILE C CD1   1 
ATOM   1947  N  N     . PRO C  3 80  ? 3.726   -10.473 48.184 1.00 41.36  ? 80   PRO C N     1 
ATOM   1948  C  CA    . PRO C  3 80  ? 2.358   -11.009 48.399 1.00 39.99  ? 80   PRO C CA    1 
ATOM   1949  C  C     . PRO C  3 80  ? 1.698   -10.727 49.765 1.00 38.64  ? 80   PRO C C     1 
ATOM   1950  O  O     . PRO C  3 80  ? 0.479   -10.625 49.849 1.00 39.55  ? 80   PRO C O     1 
ATOM   1951  C  CB    . PRO C  3 80  ? 2.531   -12.524 48.139 1.00 40.15  ? 80   PRO C CB    1 
ATOM   1952  C  CG    . PRO C  3 80  ? 3.694   -12.607 47.178 1.00 40.59  ? 80   PRO C CG    1 
ATOM   1953  C  CD    . PRO C  3 80  ? 4.643   -11.526 47.697 1.00 41.27  ? 80   PRO C CD    1 
ATOM   1954  N  N     . ARG C  3 81  ? 2.472   -10.595 50.818 1.00 37.37  ? 81   ARG C N     1 
ATOM   1955  C  CA    . ARG C  3 81  ? 1.931   -10.200 52.114 1.00 36.78  ? 81   ARG C CA    1 
ATOM   1956  C  C     . ARG C  3 81  ? 1.156   -8.889  51.995 1.00 37.35  ? 81   ARG C C     1 
ATOM   1957  O  O     . ARG C  3 81  ? 0.023   -8.785  52.503 1.00 37.57  ? 81   ARG C O     1 
ATOM   1958  C  CB    . ARG C  3 81  ? 3.055   -10.094 53.136 1.00 36.10  ? 81   ARG C CB    1 
ATOM   1959  C  CG    . ARG C  3 81  ? 2.633   -9.651  54.511 1.00 36.49  ? 81   ARG C CG    1 
ATOM   1960  C  CD    . ARG C  3 81  ? 1.503   -10.473 55.041 1.00 36.97  ? 81   ARG C CD    1 
ATOM   1961  N  NE    . ARG C  3 81  ? 1.293   -10.332 56.483 1.00 36.00  ? 81   ARG C NE    1 
ATOM   1962  C  CZ    . ARG C  3 81  ? 0.256   -10.870 57.114 1.00 37.73  ? 81   ARG C CZ    1 
ATOM   1963  N  NH1   . ARG C  3 81  ? -0.638  -11.566 56.418 1.00 41.24  ? 81   ARG C NH1   1 
ATOM   1964  N  NH2   . ARG C  3 81  ? 0.087   -10.710 58.420 1.00 36.89  ? 81   ARG C NH2   1 
ATOM   1965  N  N     . HIS C  3 82  ? 1.764   -7.916  51.287 1.00 37.41  ? 82   HIS C N     1 
ATOM   1966  C  CA    . HIS C  3 82  ? 1.198   -6.582  51.016 1.00 36.17  ? 82   HIS C CA    1 
ATOM   1967  C  C     . HIS C  3 82  ? -0.083  -6.623  50.225 1.00 36.98  ? 82   HIS C C     1 
ATOM   1968  O  O     . HIS C  3 82  ? -1.090  -6.008  50.630 1.00 37.53  ? 82   HIS C O     1 
ATOM   1969  C  CB    . HIS C  3 82  ? 2.230   -5.684  50.324 1.00 35.51  ? 82   HIS C CB    1 
ATOM   1970  C  CG    . HIS C  3 82  ? 3.525   -5.597  51.062 1.00 30.88  ? 82   HIS C CG    1 
ATOM   1971  N  ND1   . HIS C  3 82  ? 4.745   -5.530  50.422 1.00 30.48  ? 82   HIS C ND1   1 
ATOM   1972  C  CD2   . HIS C  3 82  ? 3.791   -5.601  52.389 1.00 28.35  ? 82   HIS C CD2   1 
ATOM   1973  C  CE1   . HIS C  3 82  ? 5.712   -5.507  51.324 1.00 28.95  ? 82   HIS C CE1   1 
ATOM   1974  N  NE2   . HIS C  3 82  ? 5.159   -5.571  52.527 1.00 30.12  ? 82   HIS C NE2   1 
ATOM   1975  N  N     . LEU C  3 83  ? -0.069  -7.337  49.098 1.00 37.11  ? 83   LEU C N     1 
ATOM   1976  C  CA    . LEU C  3 83  ? -1.323  -7.615  48.360 1.00 36.97  ? 83   LEU C CA    1 
ATOM   1977  C  C     . LEU C  3 83  ? -2.417  -8.213  49.269 1.00 38.19  ? 83   LEU C C     1 
ATOM   1978  O  O     . LEU C  3 83  ? -3.615  -7.825  49.177 1.00 39.14  ? 83   LEU C O     1 
ATOM   1979  C  CB    . LEU C  3 83  ? -1.060  -8.503  47.152 1.00 36.60  ? 83   LEU C CB    1 
ATOM   1980  C  CG    . LEU C  3 83  ? 0.026   -8.034  46.165 1.00 36.77  ? 83   LEU C CG    1 
ATOM   1981  C  CD1   . LEU C  3 83  ? 0.374   -9.077  45.107 1.00 33.56  ? 83   LEU C CD1   1 
ATOM   1982  C  CD2   . LEU C  3 83  ? -0.399  -6.719  45.481 1.00 39.30  ? 83   LEU C CD2   1 
ATOM   1983  N  N     . GLN C  3 84  ? -2.024  -9.104  50.183 1.00 37.81  ? 84   GLN C N     1 
ATOM   1984  C  CA    . GLN C  3 84  ? -3.011  -9.760  51.047 1.00 37.94  ? 84   GLN C CA    1 
ATOM   1985  C  C     . GLN C  3 84  ? -3.590  -8.804  52.102 1.00 38.23  ? 84   GLN C C     1 
ATOM   1986  O  O     . GLN C  3 84  ? -4.820  -8.656  52.216 1.00 39.47  ? 84   GLN C O     1 
ATOM   1987  C  CB    . GLN C  3 84  ? -2.415  -11.061 51.680 1.00 38.19  ? 84   GLN C CB    1 
ATOM   1988  C  CG    . GLN C  3 84  ? -3.216  -11.653 52.831 1.00 35.79  ? 84   GLN C CG    1 
ATOM   1989  C  CD    . GLN C  3 84  ? -4.362  -12.555 52.364 1.00 35.48  ? 84   GLN C CD    1 
ATOM   1990  O  OE1   . GLN C  3 84  ? -4.925  -12.382 51.273 1.00 35.94  ? 84   GLN C OE1   1 
ATOM   1991  N  NE2   . GLN C  3 84  ? -4.709  -13.524 53.200 1.00 29.07  ? 84   GLN C NE2   1 
ATOM   1992  N  N     . LEU C  3 85  ? -2.732  -8.186  52.914 1.00 38.19  ? 85   LEU C N     1 
ATOM   1993  C  CA    . LEU C  3 85  ? -3.155  -7.011  53.729 1.00 37.89  ? 85   LEU C CA    1 
ATOM   1994  C  C     . LEU C  3 85  ? -4.018  -5.986  52.989 1.00 37.08  ? 85   LEU C C     1 
ATOM   1995  O  O     . LEU C  3 85  ? -5.025  -5.542  53.508 1.00 36.83  ? 85   LEU C O     1 
ATOM   1996  C  CB    . LEU C  3 85  ? -1.957  -6.284  54.304 1.00 37.74  ? 85   LEU C CB    1 
ATOM   1997  C  CG    . LEU C  3 85  ? -1.038  -7.014  55.283 1.00 38.44  ? 85   LEU C CG    1 
ATOM   1998  C  CD1   . LEU C  3 85  ? 0.052   -6.075  55.653 1.00 32.63  ? 85   LEU C CD1   1 
ATOM   1999  C  CD2   . LEU C  3 85  ? -1.816  -7.518  56.531 1.00 38.10  ? 85   LEU C CD2   1 
ATOM   2000  N  N     . ALA C  3 86  ? -3.616  -5.596  51.794 1.00 37.45  ? 86   ALA C N     1 
ATOM   2001  C  CA    . ALA C  3 86  ? -4.427  -4.682  50.972 1.00 37.97  ? 86   ALA C CA    1 
ATOM   2002  C  C     . ALA C  3 86  ? -5.858  -5.156  50.783 1.00 38.48  ? 86   ALA C C     1 
ATOM   2003  O  O     . ALA C  3 86  ? -6.797  -4.458  51.127 1.00 39.02  ? 86   ALA C O     1 
ATOM   2004  C  CB    . ALA C  3 86  ? -3.795  -4.489  49.643 1.00 38.64  ? 86   ALA C CB    1 
ATOM   2005  N  N     . VAL C  3 87  ? -6.004  -6.369  50.233 1.00 39.92  ? 87   VAL C N     1 
ATOM   2006  C  CA    . VAL C  3 87  ? -7.288  -7.002  49.896 1.00 38.53  ? 87   VAL C CA    1 
ATOM   2007  C  C     . VAL C  3 87  ? -8.102  -7.318  51.131 1.00 38.62  ? 87   VAL C C     1 
ATOM   2008  O  O     . VAL C  3 87  ? -9.296  -7.077  51.161 1.00 38.65  ? 87   VAL C O     1 
ATOM   2009  C  CB    . VAL C  3 87  ? -7.057  -8.272  49.035 1.00 38.73  ? 87   VAL C CB    1 
ATOM   2010  C  CG1   . VAL C  3 87  ? -8.362  -9.030  48.716 1.00 38.08  ? 87   VAL C CG1   1 
ATOM   2011  C  CG2   . VAL C  3 87  ? -6.414  -7.885  47.741 1.00 39.26  ? 87   VAL C CG2   1 
ATOM   2012  N  N     . ARG C  3 88  ? -7.484  -7.861  52.164 1.00 39.65  ? 88   ARG C N     1 
ATOM   2013  C  CA    . ARG C  3 88  ? -8.307  -8.344  53.284 1.00 40.25  ? 88   ARG C CA    1 
ATOM   2014  C  C     . ARG C  3 88  ? -8.756  -7.213  54.171 1.00 40.66  ? 88   ARG C C     1 
ATOM   2015  O  O     . ARG C  3 88  ? -9.751  -7.329  54.878 1.00 41.93  ? 88   ARG C O     1 
ATOM   2016  C  CB    . ARG C  3 88  ? -7.645  -9.499  54.076 1.00 39.76  ? 88   ARG C CB    1 
ATOM   2017  C  CG    . ARG C  3 88  ? -7.266  -10.775 53.236 1.00 38.32  ? 88   ARG C CG    1 
ATOM   2018  C  CD    . ARG C  3 88  ? -8.439  -11.399 52.446 1.00 34.00  ? 88   ARG C CD    1 
ATOM   2019  N  NE    . ARG C  3 88  ? -8.017  -12.151 51.240 1.00 30.47  ? 88   ARG C NE    1 
ATOM   2020  C  CZ    . ARG C  3 88  ? -8.878  -12.567 50.296 1.00 30.24  ? 88   ARG C CZ    1 
ATOM   2021  N  NH1   . ARG C  3 88  ? -10.178 -12.320 50.409 1.00 30.52  ? 88   ARG C NH1   1 
ATOM   2022  N  NH2   . ARG C  3 88  ? -8.465  -13.249 49.242 1.00 28.07  ? 88   ARG C NH2   1 
ATOM   2023  N  N     . ASN C  3 89  ? -8.032  -6.105  54.112 1.00 41.85  ? 89   ASN C N     1 
ATOM   2024  C  CA    . ASN C  3 89  ? -8.353  -4.908  54.892 1.00 42.92  ? 89   ASN C CA    1 
ATOM   2025  C  C     . ASN C  3 89  ? -9.369  -3.992  54.215 1.00 44.09  ? 89   ASN C C     1 
ATOM   2026  O  O     . ASN C  3 89  ? -9.876  -3.076  54.846 1.00 44.24  ? 89   ASN C O     1 
ATOM   2027  C  CB    . ASN C  3 89  ? -7.096  -4.123  55.185 1.00 42.77  ? 89   ASN C CB    1 
ATOM   2028  C  CG    . ASN C  3 89  ? -6.274  -4.721  56.304 1.00 42.00  ? 89   ASN C CG    1 
ATOM   2029  O  OD1   . ASN C  3 89  ? -6.768  -4.999  57.400 1.00 41.07  ? 89   ASN C OD1   1 
ATOM   2030  N  ND2   . ASN C  3 89  ? -4.999  -4.882  56.043 1.00 42.71  ? 89   ASN C ND2   1 
ATOM   2031  N  N     . ASP C  3 90  ? -9.661  -4.262  52.941 1.00 45.35  ? 90   ASP C N     1 
ATOM   2032  C  CA    . ASP C  3 90  ? -10.615 -3.511  52.156 1.00 46.42  ? 90   ASP C CA    1 
ATOM   2033  C  C     . ASP C  3 90  ? -11.851 -4.323  51.910 1.00 47.24  ? 90   ASP C C     1 
ATOM   2034  O  O     . ASP C  3 90  ? -11.843 -5.229  51.084 1.00 48.15  ? 90   ASP C O     1 
ATOM   2035  C  CB    . ASP C  3 90  ? -10.019 -3.152  50.806 1.00 46.84  ? 90   ASP C CB    1 
ATOM   2036  C  CG    . ASP C  3 90  ? -10.853 -2.126  50.069 1.00 48.95  ? 90   ASP C CG    1 
ATOM   2037  O  OD1   . ASP C  3 90  ? -10.799 -0.934  50.451 1.00 53.18  ? 90   ASP C OD1   1 
ATOM   2038  O  OD2   . ASP C  3 90  ? -11.556 -2.491  49.102 1.00 51.17  ? 90   ASP C OD2   1 
ATOM   2039  N  N     . GLU C  3 91  ? -12.924 -3.975  52.607 1.00 47.92  ? 91   GLU C N     1 
ATOM   2040  C  CA    . GLU C  3 91  ? -14.218 -4.617  52.487 1.00 48.07  ? 91   GLU C CA    1 
ATOM   2041  C  C     . GLU C  3 91  ? -14.597 -5.031  51.068 1.00 47.62  ? 91   GLU C C     1 
ATOM   2042  O  O     . GLU C  3 91  ? -15.152 -6.117  50.849 1.00 47.75  ? 91   GLU C O     1 
ATOM   2043  C  CB    . GLU C  3 91  ? -15.263 -3.648  53.013 1.00 49.12  ? 91   GLU C CB    1 
ATOM   2044  C  CG    . GLU C  3 91  ? -16.177 -4.197  54.074 1.00 52.23  ? 91   GLU C CG    1 
ATOM   2045  C  CD    . GLU C  3 91  ? -17.503 -3.462  54.119 1.00 58.32  ? 91   GLU C CD    1 
ATOM   2046  O  OE1   . GLU C  3 91  ? -17.830 -2.933  55.209 1.00 61.37  ? 91   GLU C OE1   1 
ATOM   2047  O  OE2   . GLU C  3 91  ? -18.218 -3.412  53.077 1.00 58.84  ? 91   GLU C OE2   1 
ATOM   2048  N  N     . GLU C  3 92  ? -14.289 -4.187  50.088 1.00 47.09  ? 92   GLU C N     1 
ATOM   2049  C  CA    . GLU C  3 92  ? -14.755 -4.456  48.720 1.00 46.61  ? 92   GLU C CA    1 
ATOM   2050  C  C     . GLU C  3 92  ? -13.895 -5.396  47.884 1.00 45.67  ? 92   GLU C C     1 
ATOM   2051  O  O     . GLU C  3 92  ? -14.422 -6.227  47.136 1.00 45.98  ? 92   GLU C O     1 
ATOM   2052  C  CB    . GLU C  3 92  ? -15.099 -3.165  47.977 1.00 46.58  ? 92   GLU C CB    1 
ATOM   2053  C  CG    . GLU C  3 92  ? -16.427 -2.618  48.449 1.00 48.79  ? 92   GLU C CG    1 
ATOM   2054  C  CD    . GLU C  3 92  ? -16.933 -1.481  47.625 1.00 53.44  ? 92   GLU C CD    1 
ATOM   2055  O  OE1   . GLU C  3 92  ? -16.191 -1.003  46.728 1.00 55.56  ? 92   GLU C OE1   1 
ATOM   2056  O  OE2   . GLU C  3 92  ? -18.088 -1.066  47.878 1.00 55.78  ? 92   GLU C OE2   1 
ATOM   2057  N  N     . LEU C  3 93  ? -12.584 -5.237  47.989 1.00 44.94  ? 93   LEU C N     1 
ATOM   2058  C  CA    . LEU C  3 93  ? -11.672 -6.133  47.326 1.00 44.67  ? 93   LEU C CA    1 
ATOM   2059  C  C     . LEU C  3 93  ? -11.702 -7.507  48.019 1.00 44.75  ? 93   LEU C C     1 
ATOM   2060  O  O     . LEU C  3 93  ? -11.523 -8.537  47.367 1.00 44.39  ? 93   LEU C O     1 
ATOM   2061  C  CB    . LEU C  3 93  ? -10.252 -5.556  47.290 1.00 43.59  ? 93   LEU C CB    1 
ATOM   2062  C  CG    . LEU C  3 93  ? -9.910  -4.391  46.356 1.00 42.98  ? 93   LEU C CG    1 
ATOM   2063  C  CD1   . LEU C  3 93  ? -8.565  -3.800  46.747 1.00 38.56  ? 93   LEU C CD1   1 
ATOM   2064  C  CD2   . LEU C  3 93  ? -9.981  -4.734  44.822 1.00 40.01  ? 93   LEU C CD2   1 
ATOM   2065  N  N     . ASN C  3 94  ? -11.941 -7.503  49.334 1.00 45.04  ? 94   ASN C N     1 
ATOM   2066  C  CA    . ASN C  3 94  ? -12.092 -8.731  50.084 1.00 45.35  ? 94   ASN C CA    1 
ATOM   2067  C  C     . ASN C  3 94  ? -13.288 -9.573  49.652 1.00 45.95  ? 94   ASN C C     1 
ATOM   2068  O  O     . ASN C  3 94  ? -13.166 -10.785 49.512 1.00 47.66  ? 94   ASN C O     1 
ATOM   2069  C  CB    . ASN C  3 94  ? -12.139 -8.498  51.583 1.00 44.66  ? 94   ASN C CB    1 
ATOM   2070  C  CG    . ASN C  3 94  ? -12.238 -9.816  52.356 1.00 44.75  ? 94   ASN C CG    1 
ATOM   2071  O  OD1   . ASN C  3 94  ? -11.574 -10.796 52.019 1.00 46.20  ? 94   ASN C OD1   1 
ATOM   2072  N  ND2   . ASN C  3 94  ? -13.092 -9.856  53.344 1.00 41.65  ? 94   ASN C ND2   1 
ATOM   2073  N  N     . LYS C  3 95  ? -14.433 -8.940  49.462 1.00 46.08  ? 95   LYS C N     1 
ATOM   2074  C  CA    . LYS C  3 95  ? -15.605 -9.585  48.913 1.00 46.54  ? 95   LYS C CA    1 
ATOM   2075  C  C     . LYS C  3 95  ? -15.343 -10.040 47.484 1.00 46.21  ? 95   LYS C C     1 
ATOM   2076  O  O     . LYS C  3 95  ? -15.580 -11.201 47.164 1.00 47.95  ? 95   LYS C O     1 
ATOM   2077  C  CB    . LYS C  3 95  ? -16.803 -8.633  48.962 1.00 47.23  ? 95   LYS C CB    1 
ATOM   2078  C  CG    . LYS C  3 95  ? -18.110 -9.153  48.366 1.00 47.50  ? 95   LYS C CG    1 
ATOM   2079  C  CD    . LYS C  3 95  ? -19.216 -8.097  48.574 1.00 48.64  ? 95   LYS C CD    1 
ATOM   2080  C  CE    . LYS C  3 95  ? -20.507 -8.384  47.757 1.00 52.35  ? 95   LYS C CE    1 
ATOM   2081  N  NZ    . LYS C  3 95  ? -20.436 -8.130  46.247 1.00 54.30  ? 95   LYS C NZ    1 
ATOM   2082  N  N     . LEU C  3 96  ? -14.858 -9.153  46.620 1.00 44.53  ? 96   LEU C N     1 
ATOM   2083  C  CA    . LEU C  3 96  ? -14.626 -9.506  45.213 1.00 43.32  ? 96   LEU C CA    1 
ATOM   2084  C  C     . LEU C  3 96  ? -13.707 -10.714 45.111 1.00 43.33  ? 96   LEU C C     1 
ATOM   2085  O  O     . LEU C  3 96  ? -13.877 -11.550 44.214 1.00 44.09  ? 96   LEU C O     1 
ATOM   2086  C  CB    . LEU C  3 96  ? -14.041 -8.316  44.416 1.00 42.88  ? 96   LEU C CB    1 
ATOM   2087  C  CG    . LEU C  3 96  ? -13.445 -8.529  43.006 1.00 43.38  ? 96   LEU C CG    1 
ATOM   2088  C  CD1   . LEU C  3 96  ? -14.500 -8.891  41.959 1.00 39.63  ? 96   LEU C CD1   1 
ATOM   2089  C  CD2   . LEU C  3 96  ? -12.612 -7.350  42.523 1.00 42.11  ? 96   LEU C CD2   1 
ATOM   2090  N  N     . LEU C  3 97  ? -12.726 -10.784 46.012 1.00 42.86  ? 97   LEU C N     1 
ATOM   2091  C  CA    . LEU C  3 97  ? -11.761 -11.887 46.042 1.00 42.66  ? 97   LEU C CA    1 
ATOM   2092  C  C     . LEU C  3 97  ? -12.000 -12.809 47.250 1.00 42.83  ? 97   LEU C C     1 
ATOM   2093  O  O     . LEU C  3 97  ? -11.060 -13.214 47.944 1.00 42.66  ? 97   LEU C O     1 
ATOM   2094  C  CB    . LEU C  3 97  ? -10.343 -11.345 46.055 1.00 41.76  ? 97   LEU C CB    1 
ATOM   2095  C  CG    . LEU C  3 97  ? -9.887  -10.542 44.848 1.00 41.98  ? 97   LEU C CG    1 
ATOM   2096  C  CD1   . LEU C  3 97  ? -8.430  -10.193 44.955 1.00 41.38  ? 97   LEU C CD1   1 
ATOM   2097  C  CD2   . LEU C  3 97  ? -10.133 -11.302 43.568 1.00 43.40  ? 97   LEU C CD2   1 
ATOM   2098  N  N     . GLY C  3 98  ? -13.272 -13.094 47.522 1.00 42.66  ? 98   GLY C N     1 
ATOM   2099  C  CA    . GLY C  3 98  ? -13.633 -13.824 48.721 1.00 42.34  ? 98   GLY C CA    1 
ATOM   2100  C  C     . GLY C  3 98  ? -13.444 -15.335 48.595 1.00 42.11  ? 98   GLY C C     1 
ATOM   2101  O  O     . GLY C  3 98  ? -13.455 -16.041 49.595 1.00 42.13  ? 98   GLY C O     1 
ATOM   2102  N  N     . ARG C  3 99  ? -13.298 -15.812 47.360 1.00 41.58  ? 99   ARG C N     1 
ATOM   2103  C  CA    . ARG C  3 99  ? -13.040 -17.212 47.048 1.00 41.03  ? 99   ARG C CA    1 
ATOM   2104  C  C     . ARG C  3 99  ? -11.683 -17.362 46.359 1.00 40.22  ? 99   ARG C C     1 
ATOM   2105  O  O     . ARG C  3 99  ? -11.495 -18.256 45.560 1.00 41.04  ? 99   ARG C O     1 
ATOM   2106  C  CB    . ARG C  3 99  ? -14.122 -17.775 46.118 1.00 40.89  ? 99   ARG C CB    1 
ATOM   2107  C  CG    . ARG C  3 99  ? -15.541 -17.791 46.651 1.00 43.74  ? 99   ARG C CG    1 
ATOM   2108  C  CD    . ARG C  3 99  ? -15.642 -18.219 48.108 1.00 50.03  ? 99   ARG C CD    1 
ATOM   2109  N  NE    . ARG C  3 99  ? -17.046 -18.285 48.536 1.00 58.10  ? 99   ARG C NE    1 
ATOM   2110  C  CZ    . ARG C  3 99  ? -17.485 -18.196 49.801 1.00 60.94  ? 99   ARG C CZ    1 
ATOM   2111  N  NH1   . ARG C  3 99  ? -16.638 -18.042 50.832 1.00 60.29  ? 99   ARG C NH1   1 
ATOM   2112  N  NH2   . ARG C  3 99  ? -18.794 -18.269 50.032 1.00 61.63  ? 99   ARG C NH2   1 
ATOM   2113  N  N     . VAL C  3 100 ? -10.744 -16.481 46.657 1.00 39.11  ? 100  VAL C N     1 
ATOM   2114  C  CA    . VAL C  3 100 ? -9.439  -16.531 46.037 1.00 37.82  ? 100  VAL C CA    1 
ATOM   2115  C  C     . VAL C  3 100 ? -8.423  -16.648 47.153 1.00 37.69  ? 100  VAL C C     1 
ATOM   2116  O  O     . VAL C  3 100 ? -8.681  -16.207 48.286 1.00 37.16  ? 100  VAL C O     1 
ATOM   2117  C  CB    . VAL C  3 100 ? -9.145  -15.267 45.165 1.00 38.08  ? 100  VAL C CB    1 
ATOM   2118  C  CG1   . VAL C  3 100 ? -7.735  -15.314 44.619 1.00 37.65  ? 100  VAL C CG1   1 
ATOM   2119  C  CG2   . VAL C  3 100 ? -10.154 -15.155 44.013 1.00 37.15  ? 100  VAL C CG2   1 
ATOM   2120  N  N     . THR C  3 101 ? -7.281  -17.256 46.820 1.00 37.12  ? 101  THR C N     1 
ATOM   2121  C  CA    . THR C  3 101 ? -6.171  -17.450 47.731 1.00 37.12  ? 101  THR C CA    1 
ATOM   2122  C  C     . THR C  3 101 ? -4.924  -16.852 47.117 1.00 37.04  ? 101  THR C C     1 
ATOM   2123  O  O     . THR C  3 101 ? -4.550  -17.165 45.985 1.00 36.66  ? 101  THR C O     1 
ATOM   2124  C  CB    . THR C  3 101 ? -5.937  -18.951 48.057 1.00 37.51  ? 101  THR C CB    1 
ATOM   2125  O  OG1   . THR C  3 101 ? -7.161  -19.534 48.535 1.00 39.14  ? 101  THR C OG1   1 
ATOM   2126  C  CG2   . THR C  3 101 ? -4.867  -19.131 49.116 1.00 37.40  ? 101  THR C CG2   1 
ATOM   2127  N  N     . ILE C  3 102 ? -4.299  -15.968 47.885 1.00 36.90  ? 102  ILE C N     1 
ATOM   2128  C  CA    . ILE C  3 102 ? -3.078  -15.332 47.491 1.00 37.06  ? 102  ILE C CA    1 
ATOM   2129  C  C     . ILE C  3 102 ? -1.973  -16.123 48.148 1.00 37.42  ? 102  ILE C C     1 
ATOM   2130  O  O     . ILE C  3 102 ? -1.822  -16.086 49.361 1.00 38.15  ? 102  ILE C O     1 
ATOM   2131  C  CB    . ILE C  3 102 ? -3.046  -13.814 47.932 1.00 36.70  ? 102  ILE C CB    1 
ATOM   2132  C  CG1   . ILE C  3 102 ? -4.147  -13.031 47.213 1.00 37.52  ? 102  ILE C CG1   1 
ATOM   2133  C  CG2   . ILE C  3 102 ? -1.652  -13.211 47.762 1.00 34.45  ? 102  ILE C CG2   1 
ATOM   2134  C  CD1   . ILE C  3 102 ? -4.295  -11.545 47.591 1.00 37.53  ? 102  ILE C CD1   1 
ATOM   2135  N  N     . ALA C  3 103 ? -1.203  -16.830 47.339 1.00 38.63  ? 103  ALA C N     1 
ATOM   2136  C  CA    . ALA C  3 103 ? -0.067  -17.601 47.808 1.00 40.24  ? 103  ALA C CA    1 
ATOM   2137  C  C     . ALA C  3 103 ? 0.850   -16.692 48.572 1.00 41.42  ? 103  ALA C C     1 
ATOM   2138  O  O     . ALA C  3 103 ? 1.078   -15.583 48.139 1.00 43.04  ? 103  ALA C O     1 
ATOM   2139  C  CB    . ALA C  3 103 ? 0.681   -18.208 46.624 1.00 40.03  ? 103  ALA C CB    1 
ATOM   2140  N  N     . GLN C  3 104 ? 1.384   -17.168 49.698 1.00 42.77  ? 104  GLN C N     1 
ATOM   2141  C  CA    . GLN C  3 104 ? 2.412   -16.467 50.484 1.00 42.99  ? 104  GLN C CA    1 
ATOM   2142  C  C     . GLN C  3 104 ? 1.899   -15.141 51.071 1.00 43.36  ? 104  GLN C C     1 
ATOM   2143  O  O     . GLN C  3 104 ? 2.673   -14.213 51.354 1.00 43.80  ? 104  GLN C O     1 
ATOM   2144  C  CB    . GLN C  3 104 ? 3.718   -16.309 49.683 1.00 43.31  ? 104  GLN C CB    1 
ATOM   2145  C  CG    . GLN C  3 104 ? 4.696   -17.520 49.755 1.00 45.34  ? 104  GLN C CG    1 
ATOM   2146  C  CD    . GLN C  3 104 ? 5.052   -17.917 51.205 1.00 47.66  ? 104  GLN C CD    1 
ATOM   2147  O  OE1   . GLN C  3 104 ? 5.777   -17.199 51.896 1.00 50.25  ? 104  GLN C OE1   1 
ATOM   2148  N  NE2   . GLN C  3 104 ? 4.515   -19.041 51.668 1.00 45.42  ? 104  GLN C NE2   1 
ATOM   2149  N  N     . GLY C  3 105 ? 0.589   -15.095 51.301 1.00 42.57  ? 105  GLY C N     1 
ATOM   2150  C  CA    . GLY C  3 105 ? -0.063  -13.924 51.817 1.00 42.65  ? 105  GLY C CA    1 
ATOM   2151  C  C     . GLY C  3 105 ? -0.342  -13.888 53.306 1.00 42.54  ? 105  GLY C C     1 
ATOM   2152  O  O     . GLY C  3 105 ? -0.391  -12.793 53.917 1.00 43.36  ? 105  GLY C O     1 
ATOM   2153  N  N     . GLY C  3 106 ? -0.569  -15.061 53.887 1.00 41.57  ? 106  GLY C N     1 
ATOM   2154  C  CA    . GLY C  3 106 ? -0.685  -15.215 55.325 1.00 40.24  ? 106  GLY C CA    1 
ATOM   2155  C  C     . GLY C  3 106 ? -2.081  -14.818 55.643 1.00 40.52  ? 106  GLY C C     1 
ATOM   2156  O  O     . GLY C  3 106 ? -2.909  -14.660 54.741 1.00 39.85  ? 106  GLY C O     1 
ATOM   2157  N  N     . VAL C  3 107 ? -2.354  -14.666 56.928 1.00 41.02  ? 107  VAL C N     1 
ATOM   2158  C  CA    . VAL C  3 107 ? -3.651  -14.144 57.366 1.00 41.62  ? 107  VAL C CA    1 
ATOM   2159  C  C     . VAL C  3 107 ? -3.501  -12.743 57.983 1.00 42.62  ? 107  VAL C C     1 
ATOM   2160  O  O     . VAL C  3 107 ? -2.384  -12.245 58.128 1.00 42.24  ? 107  VAL C O     1 
ATOM   2161  C  CB    . VAL C  3 107 ? -4.319  -15.103 58.385 1.00 40.97  ? 107  VAL C CB    1 
ATOM   2162  C  CG1   . VAL C  3 107 ? -4.635  -16.459 57.698 1.00 40.29  ? 107  VAL C CG1   1 
ATOM   2163  C  CG2   . VAL C  3 107 ? -3.465  -15.250 59.634 1.00 38.88  ? 107  VAL C CG2   1 
ATOM   2164  N  N     . LEU C  3 108 ? -4.622  -12.142 58.362 1.00 43.89  ? 108  LEU C N     1 
ATOM   2165  C  CA    . LEU C  3 108 ? -4.601  -10.949 59.187 1.00 45.74  ? 108  LEU C CA    1 
ATOM   2166  C  C     . LEU C  3 108 ? -4.425  -11.304 60.645 1.00 47.57  ? 108  LEU C C     1 
ATOM   2167  O  O     . LEU C  3 108 ? -5.116  -12.193 61.151 1.00 48.04  ? 108  LEU C O     1 
ATOM   2168  C  CB    . LEU C  3 108 ? -5.906  -10.158 59.041 1.00 45.22  ? 108  LEU C CB    1 
ATOM   2169  C  CG    . LEU C  3 108 ? -6.227  -9.464  57.712 1.00 43.44  ? 108  LEU C CG    1 
ATOM   2170  C  CD1   . LEU C  3 108 ? -7.541  -8.723  57.868 1.00 40.39  ? 108  LEU C CD1   1 
ATOM   2171  C  CD2   . LEU C  3 108 ? -5.115  -8.536  57.268 1.00 39.27  ? 108  LEU C CD2   1 
ATOM   2172  N  N     . PRO C  3 109 ? -3.514  -10.596 61.346 1.00 49.49  ? 109  PRO C N     1 
ATOM   2173  C  CA    . PRO C  3 109 ? -3.450  -10.727 62.803 1.00 50.05  ? 109  PRO C CA    1 
ATOM   2174  C  C     . PRO C  3 109 ? -4.800  -10.484 63.452 1.00 50.81  ? 109  PRO C C     1 
ATOM   2175  O  O     . PRO C  3 109 ? -5.301  -9.379  63.420 1.00 51.32  ? 109  PRO C O     1 
ATOM   2176  C  CB    . PRO C  3 109 ? -2.457  -9.637  63.194 1.00 50.22  ? 109  PRO C CB    1 
ATOM   2177  C  CG    . PRO C  3 109 ? -1.518  -9.585  62.021 1.00 49.94  ? 109  PRO C CG    1 
ATOM   2178  C  CD    . PRO C  3 109 ? -2.464  -9.685  60.844 1.00 49.69  ? 109  PRO C CD    1 
ATOM   2179  N  N     . ASN C  3 110 ? -5.387  -11.524 64.022 1.00 51.94  ? 110  ASN C N     1 
ATOM   2180  C  CA    . ASN C  3 110 ? -6.667  -11.411 64.707 1.00 53.07  ? 110  ASN C CA    1 
ATOM   2181  C  C     . ASN C  3 110 ? -6.835  -12.553 65.699 1.00 53.88  ? 110  ASN C C     1 
ATOM   2182  O  O     . ASN C  3 110 ? -6.827  -13.732 65.307 1.00 54.34  ? 110  ASN C O     1 
ATOM   2183  C  CB    . ASN C  3 110 ? -7.810  -11.391 63.690 1.00 53.03  ? 110  ASN C CB    1 
ATOM   2184  C  CG    . ASN C  3 110 ? -9.185  -11.473 64.330 1.00 55.22  ? 110  ASN C CG    1 
ATOM   2185  O  OD1   . ASN C  3 110 ? -9.359  -11.235 65.539 1.00 57.40  ? 110  ASN C OD1   1 
ATOM   2186  N  ND2   . ASN C  3 110 ? -10.184 -11.806 63.514 1.00 54.11  ? 110  ASN C ND2   1 
ATOM   2187  N  N     . ILE C  3 111 ? -6.967  -12.177 66.979 1.00 54.53  ? 111  ILE C N     1 
ATOM   2188  C  CA    . ILE C  3 111 ? -7.160  -13.081 68.119 1.00 54.76  ? 111  ILE C CA    1 
ATOM   2189  C  C     . ILE C  3 111 ? -8.506  -12.767 68.775 1.00 55.68  ? 111  ILE C C     1 
ATOM   2190  O  O     . ILE C  3 111 ? -8.799  -11.622 69.097 1.00 56.16  ? 111  ILE C O     1 
ATOM   2191  C  CB    . ILE C  3 111 ? -6.043  -12.921 69.200 1.00 54.68  ? 111  ILE C CB    1 
ATOM   2192  C  CG1   . ILE C  3 111 ? -4.640  -12.864 68.565 1.00 54.39  ? 111  ILE C CG1   1 
ATOM   2193  C  CG2   . ILE C  3 111 ? -6.158  -14.034 70.272 1.00 54.37  ? 111  ILE C CG2   1 
ATOM   2194  C  CD1   . ILE C  3 111 ? -3.484  -12.825 69.576 1.00 54.12  ? 111  ILE C CD1   1 
ATOM   2195  N  N     . GLN C  3 112 ? -9.319  -13.791 68.981 1.00 56.69  ? 112  GLN C N     1 
ATOM   2196  C  CA    . GLN C  3 112 ? -10.655 -13.624 69.527 1.00 57.42  ? 112  GLN C CA    1 
ATOM   2197  C  C     . GLN C  3 112 ? -10.593 -13.203 70.982 1.00 58.25  ? 112  GLN C C     1 
ATOM   2198  O  O     . GLN C  3 112 ? -9.737  -13.676 71.725 1.00 58.33  ? 112  GLN C O     1 
ATOM   2199  C  CB    . GLN C  3 112 ? -11.431 -14.933 69.375 1.00 57.71  ? 112  GLN C CB    1 
ATOM   2200  C  CG    . GLN C  3 112 ? -11.616 -15.354 67.913 1.00 57.46  ? 112  GLN C CG    1 
ATOM   2201  C  CD    . GLN C  3 112 ? -12.684 -14.546 67.203 1.00 59.06  ? 112  GLN C CD    1 
ATOM   2202  O  OE1   . GLN C  3 112 ? -13.796 -14.343 67.736 1.00 59.54  ? 112  GLN C OE1   1 
ATOM   2203  N  NE2   . GLN C  3 112 ? -12.361 -14.074 65.991 1.00 57.44  ? 112  GLN C NE2   1 
ATOM   2204  N  N     . SER C  3 113 ? -11.513 -12.321 71.377 1.00 59.36  ? 113  SER C N     1 
ATOM   2205  C  CA    . SER C  3 113 ? -11.493 -11.656 72.688 1.00 60.41  ? 113  SER C CA    1 
ATOM   2206  C  C     . SER C  3 113 ? -11.307 -12.593 73.856 1.00 61.20  ? 113  SER C C     1 
ATOM   2207  O  O     . SER C  3 113 ? -10.353 -12.453 74.621 1.00 61.49  ? 113  SER C O     1 
ATOM   2208  C  CB    . SER C  3 113 ? -12.768 -10.846 72.898 1.00 60.31  ? 113  SER C CB    1 
ATOM   2209  O  OG    . SER C  3 113 ? -12.624 -9.578  72.309 1.00 60.67  ? 113  SER C OG    1 
ATOM   2210  N  N     . VAL C  3 114 ? -12.226 -13.553 73.968 1.00 62.25  ? 114  VAL C N     1 
ATOM   2211  C  CA    . VAL C  3 114 ? -12.242 -14.568 75.029 1.00 62.97  ? 114  VAL C CA    1 
ATOM   2212  C  C     . VAL C  3 114 ? -10.885 -15.261 75.234 1.00 63.63  ? 114  VAL C C     1 
ATOM   2213  O  O     . VAL C  3 114 ? -10.631 -15.820 76.298 1.00 64.01  ? 114  VAL C O     1 
ATOM   2214  C  CB    . VAL C  3 114 ? -13.366 -15.638 74.775 1.00 63.02  ? 114  VAL C CB    1 
ATOM   2215  C  CG1   . VAL C  3 114 ? -14.699 -14.963 74.390 1.00 63.41  ? 114  VAL C CG1   1 
ATOM   2216  C  CG2   . VAL C  3 114 ? -12.958 -16.644 73.686 1.00 62.48  ? 114  VAL C CG2   1 
ATOM   2217  N  N     . LEU C  3 115 ? -10.024 -15.212 74.215 1.00 64.33  ? 115  LEU C N     1 
ATOM   2218  C  CA    . LEU C  3 115 ? -8.754  -15.936 74.226 1.00 65.07  ? 115  LEU C CA    1 
ATOM   2219  C  C     . LEU C  3 115 ? -7.638  -15.161 74.916 1.00 66.33  ? 115  LEU C C     1 
ATOM   2220  O  O     . LEU C  3 115 ? -6.600  -15.724 75.257 1.00 66.31  ? 115  LEU C O     1 
ATOM   2221  C  CB    . LEU C  3 115 ? -8.341  -16.352 72.801 1.00 64.52  ? 115  LEU C CB    1 
ATOM   2222  C  CG    . LEU C  3 115 ? -9.218  -17.331 71.992 1.00 62.92  ? 115  LEU C CG    1 
ATOM   2223  C  CD1   . LEU C  3 115 ? -8.393  -17.917 70.866 1.00 60.12  ? 115  LEU C CD1   1 
ATOM   2224  C  CD2   . LEU C  3 115 ? -9.846  -18.452 72.843 1.00 60.32  ? 115  LEU C CD2   1 
ATOM   2225  N  N     . LEU C  3 116 ? -7.862  -13.864 75.108 1.00 68.30  ? 116  LEU C N     1 
ATOM   2226  C  CA    . LEU C  3 116 ? -6.967  -13.012 75.889 1.00 69.94  ? 116  LEU C CA    1 
ATOM   2227  C  C     . LEU C  3 116 ? -7.173  -13.287 77.377 1.00 71.09  ? 116  LEU C C     1 
ATOM   2228  O  O     . LEU C  3 116 ? -8.298  -13.543 77.808 1.00 71.11  ? 116  LEU C O     1 
ATOM   2229  C  CB    . LEU C  3 116 ? -7.231  -11.531 75.587 1.00 69.90  ? 116  LEU C CB    1 
ATOM   2230  C  CG    . LEU C  3 116 ? -7.207  -11.059 74.126 1.00 69.93  ? 116  LEU C CG    1 
ATOM   2231  C  CD1   . LEU C  3 116 ? -7.793  -9.658  74.014 1.00 68.67  ? 116  LEU C CD1   1 
ATOM   2232  C  CD2   . LEU C  3 116 ? -5.802  -11.124 73.525 1.00 68.99  ? 116  LEU C CD2   1 
ATOM   2233  N  N     . PRO C  3 117 ? -6.088  -13.223 78.168 1.00 72.55  ? 117  PRO C N     1 
ATOM   2234  C  CA    . PRO C  3 117 ? -6.188  -13.436 79.617 1.00 73.80  ? 117  PRO C CA    1 
ATOM   2235  C  C     . PRO C  3 117 ? -6.807  -12.228 80.333 1.00 75.21  ? 117  PRO C C     1 
ATOM   2236  O  O     . PRO C  3 117 ? -6.896  -11.143 79.742 1.00 75.28  ? 117  PRO C O     1 
ATOM   2237  C  CB    . PRO C  3 117 ? -4.724  -13.583 80.038 1.00 73.77  ? 117  PRO C CB    1 
ATOM   2238  C  CG    . PRO C  3 117 ? -3.974  -12.737 79.052 1.00 73.01  ? 117  PRO C CG    1 
ATOM   2239  C  CD    . PRO C  3 117 ? -4.703  -12.922 77.748 1.00 72.57  ? 117  PRO C CD    1 
ATOM   2240  N  N     . LYS C  3 118 ? -7.236  -12.426 81.583 1.00 76.65  ? 118  LYS C N     1 
ATOM   2241  C  CA    . LYS C  3 118 ? -7.621  -11.319 82.481 1.00 78.18  ? 118  LYS C CA    1 
ATOM   2242  C  C     . LYS C  3 118 ? -7.382  -11.632 83.961 1.00 78.67  ? 118  LYS C C     1 
ATOM   2243  O  O     . LYS C  3 118 ? -6.229  -11.848 84.383 1.00 79.40  ? 118  LYS C O     1 
ATOM   2244  C  CB    . LYS C  3 118 ? -9.079  -10.870 82.260 1.00 78.56  ? 118  LYS C CB    1 
ATOM   2245  C  CG    . LYS C  3 118 ? -9.231  -9.512  81.527 1.00 79.93  ? 118  LYS C CG    1 
ATOM   2246  C  CD    . LYS C  3 118 ? -9.282  -8.294  82.485 1.00 81.61  ? 118  LYS C CD    1 
ATOM   2247  C  CE    . LYS C  3 118 ? -7.890  -7.805  82.958 1.00 82.39  ? 118  LYS C CE    1 
ATOM   2248  N  NZ    . LYS C  3 118 ? -7.004  -7.265  81.874 1.00 82.01  ? 118  LYS C NZ    1 
ATOM   2249  N  N     . GLY D  4 26  ? 21.016  -16.283 21.384 1.00 112.58 ? 23   GLY D N     1 
ATOM   2250  C  CA    . GLY D  4 26  ? 19.526  -16.206 21.358 1.00 112.61 ? 23   GLY D CA    1 
ATOM   2251  C  C     . GLY D  4 26  ? 18.846  -17.341 20.607 1.00 112.67 ? 23   GLY D C     1 
ATOM   2252  O  O     . GLY D  4 26  ? 19.473  -18.013 19.781 1.00 112.71 ? 23   GLY D O     1 
ATOM   2253  N  N     . LYS D  4 27  ? 17.561  -17.548 20.914 1.00 112.62 ? 24   LYS D N     1 
ATOM   2254  C  CA    . LYS D  4 27  ? 16.662  -18.499 20.217 1.00 112.43 ? 24   LYS D CA    1 
ATOM   2255  C  C     . LYS D  4 27  ? 17.091  -19.980 20.227 1.00 111.99 ? 24   LYS D C     1 
ATOM   2256  O  O     . LYS D  4 27  ? 18.024  -20.379 19.519 1.00 112.07 ? 24   LYS D O     1 
ATOM   2257  C  CB    . LYS D  4 27  ? 16.343  -18.022 18.781 1.00 112.68 ? 24   LYS D CB    1 
ATOM   2258  C  CG    . LYS D  4 27  ? 15.187  -17.014 18.676 1.00 113.24 ? 24   LYS D CG    1 
ATOM   2259  C  CD    . LYS D  4 27  ? 15.548  -15.652 19.265 1.00 113.78 ? 24   LYS D CD    1 
ATOM   2260  C  CE    . LYS D  4 27  ? 14.342  -15.012 19.933 1.00 114.12 ? 24   LYS D CE    1 
ATOM   2261  N  NZ    . LYS D  4 27  ? 14.753  -14.038 20.986 1.00 114.56 ? 24   LYS D NZ    1 
ATOM   2262  N  N     . LYS D  4 28  ? 16.391  -20.782 21.031 1.00 111.29 ? 25   LYS D N     1 
ATOM   2263  C  CA    . LYS D  4 28  ? 16.618  -22.234 21.095 1.00 110.43 ? 25   LYS D CA    1 
ATOM   2264  C  C     . LYS D  4 28  ? 15.383  -22.987 20.582 1.00 109.64 ? 25   LYS D C     1 
ATOM   2265  O  O     . LYS D  4 28  ? 14.434  -23.241 21.336 1.00 109.50 ? 25   LYS D O     1 
ATOM   2266  C  CB    . LYS D  4 28  ? 16.995  -22.675 22.518 1.00 110.52 ? 25   LYS D CB    1 
ATOM   2267  C  CG    . LYS D  4 28  ? 18.459  -22.412 22.918 1.00 110.76 ? 25   LYS D CG    1 
ATOM   2268  C  CD    . LYS D  4 28  ? 18.743  -20.945 23.300 1.00 111.10 ? 25   LYS D CD    1 
ATOM   2269  C  CE    . LYS D  4 28  ? 17.794  -20.422 24.385 1.00 110.99 ? 25   LYS D CE    1 
ATOM   2270  N  NZ    . LYS D  4 28  ? 17.849  -21.229 25.637 1.00 110.95 ? 25   LYS D NZ    1 
ATOM   2271  N  N     . ARG D  4 29  ? 15.415  -23.326 19.290 1.00 108.66 ? 26   ARG D N     1 
ATOM   2272  C  CA    . ARG D  4 29  ? 14.253  -23.841 18.534 1.00 107.56 ? 26   ARG D CA    1 
ATOM   2273  C  C     . ARG D  4 29  ? 13.005  -22.930 18.637 1.00 106.76 ? 26   ARG D C     1 
ATOM   2274  O  O     . ARG D  4 29  ? 11.930  -23.288 18.153 1.00 106.68 ? 26   ARG D O     1 
ATOM   2275  C  CB    . ARG D  4 29  ? 13.942  -25.311 18.889 1.00 107.63 ? 26   ARG D CB    1 
ATOM   2276  C  CG    . ARG D  4 29  ? 13.062  -26.043 17.864 1.00 107.45 ? 26   ARG D CG    1 
ATOM   2277  C  CD    . ARG D  4 29  ? 13.422  -27.526 17.721 1.00 107.36 ? 26   ARG D CD    1 
ATOM   2278  N  NE    . ARG D  4 29  ? 12.656  -28.413 18.598 1.00 106.65 ? 26   ARG D NE    1 
ATOM   2279  C  CZ    . ARG D  4 29  ? 12.638  -29.742 18.493 1.00 106.74 ? 26   ARG D CZ    1 
ATOM   2280  N  NH1   . ARG D  4 29  ? 13.343  -30.355 17.548 1.00 106.94 ? 26   ARG D NH1   1 
ATOM   2281  N  NH2   . ARG D  4 29  ? 11.913  -30.466 19.333 1.00 106.54 ? 26   ARG D NH2   1 
ATOM   2282  N  N     . ARG D  4 30  ? 13.176  -21.754 19.252 1.00 105.52 ? 27   ARG D N     1 
ATOM   2283  C  CA    . ARG D  4 30  ? 12.118  -20.741 19.430 1.00 104.33 ? 27   ARG D CA    1 
ATOM   2284  C  C     . ARG D  4 30  ? 10.955  -21.164 20.347 1.00 102.88 ? 27   ARG D C     1 
ATOM   2285  O  O     . ARG D  4 30  ? 9.977   -21.774 19.904 1.00 102.74 ? 27   ARG D O     1 
ATOM   2286  C  CB    . ARG D  4 30  ? 11.610  -20.211 18.071 1.00 104.79 ? 27   ARG D CB    1 
ATOM   2287  C  CG    . ARG D  4 30  ? 10.655  -19.013 18.160 1.00 106.26 ? 27   ARG D CG    1 
ATOM   2288  C  CD    . ARG D  4 30  ? 11.265  -17.865 18.971 1.00 108.67 ? 27   ARG D CD    1 
ATOM   2289  N  NE    . ARG D  4 30  ? 10.245  -17.082 19.672 1.00 110.19 ? 27   ARG D NE    1 
ATOM   2290  C  CZ    . ARG D  4 30  ? 10.395  -16.561 20.889 1.00 110.85 ? 27   ARG D CZ    1 
ATOM   2291  N  NH1   . ARG D  4 30  ? 11.523  -16.748 21.572 1.00 111.00 ? 27   ARG D NH1   1 
ATOM   2292  N  NH2   . ARG D  4 30  ? 9.404   -15.865 21.435 1.00 111.04 ? 27   ARG D NH2   1 
ATOM   2293  N  N     . LYS D  4 31  ? 11.083  -20.815 21.627 1.00 101.17 ? 28   LYS D N     1 
ATOM   2294  C  CA    . LYS D  4 31  ? 10.045  -21.030 22.640 1.00 99.37  ? 28   LYS D CA    1 
ATOM   2295  C  C     . LYS D  4 31  ? 8.835   -20.128 22.370 1.00 97.89  ? 28   LYS D C     1 
ATOM   2296  O  O     . LYS D  4 31  ? 8.988   -18.912 22.253 1.00 97.88  ? 28   LYS D O     1 
ATOM   2297  C  CB    . LYS D  4 31  ? 10.623  -20.737 24.032 1.00 99.50  ? 28   LYS D CB    1 
ATOM   2298  C  CG    . LYS D  4 31  ? 9.595   -20.662 25.153 1.00 99.90  ? 28   LYS D CG    1 
ATOM   2299  C  CD    . LYS D  4 31  ? 10.045  -19.719 26.267 1.00 100.05 ? 28   LYS D CD    1 
ATOM   2300  C  CE    . LYS D  4 31  ? 8.972   -19.570 27.346 1.00 100.08 ? 28   LYS D CE    1 
ATOM   2301  N  NZ    . LYS D  4 31  ? 7.685   -19.018 26.817 1.00 99.59  ? 28   LYS D NZ    1 
ATOM   2302  N  N     . THR D  4 32  ? 7.643   -20.719 22.270 1.00 95.90  ? 29   THR D N     1 
ATOM   2303  C  CA    . THR D  4 32  ? 6.424   -19.940 22.009 1.00 93.95  ? 29   THR D CA    1 
ATOM   2304  C  C     . THR D  4 32  ? 6.185   -18.933 23.133 1.00 92.52  ? 29   THR D C     1 
ATOM   2305  O  O     . THR D  4 32  ? 6.330   -19.264 24.318 1.00 92.49  ? 29   THR D O     1 
ATOM   2306  C  CB    . THR D  4 32  ? 5.160   -20.824 21.792 1.00 94.16  ? 29   THR D CB    1 
ATOM   2307  O  OG1   . THR D  4 32  ? 4.936   -21.650 22.938 1.00 93.54  ? 29   THR D OG1   1 
ATOM   2308  C  CG2   . THR D  4 32  ? 5.300   -21.696 20.537 1.00 93.86  ? 29   THR D CG2   1 
ATOM   2309  N  N     . ARG D  4 33  ? 5.823   -17.710 22.750 1.00 90.52  ? 30   ARG D N     1 
ATOM   2310  C  CA    . ARG D  4 33  ? 5.833   -16.567 23.675 1.00 88.49  ? 30   ARG D CA    1 
ATOM   2311  C  C     . ARG D  4 33  ? 4.723   -16.549 24.738 1.00 86.41  ? 30   ARG D C     1 
ATOM   2312  O  O     . ARG D  4 33  ? 3.538   -16.706 24.442 1.00 85.95  ? 30   ARG D O     1 
ATOM   2313  C  CB    . ARG D  4 33  ? 5.963   -15.217 22.925 1.00 88.95  ? 30   ARG D CB    1 
ATOM   2314  C  CG    . ARG D  4 33  ? 5.275   -15.125 21.553 1.00 90.28  ? 30   ARG D CG    1 
ATOM   2315  C  CD    . ARG D  4 33  ? 3.903   -14.448 21.634 1.00 93.05  ? 30   ARG D CD    1 
ATOM   2316  N  NE    . ARG D  4 33  ? 3.998   -12.986 21.712 1.00 94.32  ? 30   ARG D NE    1 
ATOM   2317  C  CZ    . ARG D  4 33  ? 2.973   -12.169 21.964 1.00 95.55  ? 30   ARG D CZ    1 
ATOM   2318  N  NH1   . ARG D  4 33  ? 1.752   -12.655 22.173 1.00 95.52  ? 30   ARG D NH1   1 
ATOM   2319  N  NH2   . ARG D  4 33  ? 3.167   -10.856 22.013 1.00 95.82  ? 30   ARG D NH2   1 
ATOM   2320  N  N     . LYS D  4 34  ? 5.154   -16.379 25.983 1.00 83.97  ? 31   LYS D N     1 
ATOM   2321  C  CA    . LYS D  4 34  ? 4.274   -16.342 27.141 1.00 81.67  ? 31   LYS D CA    1 
ATOM   2322  C  C     . LYS D  4 34  ? 4.025   -14.881 27.523 1.00 79.64  ? 31   LYS D C     1 
ATOM   2323  O  O     . LYS D  4 34  ? 4.833   -14.246 28.208 1.00 79.47  ? 31   LYS D O     1 
ATOM   2324  C  CB    . LYS D  4 34  ? 4.894   -17.131 28.312 1.00 82.00  ? 31   LYS D CB    1 
ATOM   2325  C  CG    . LYS D  4 34  ? 3.965   -17.353 29.509 1.00 83.14  ? 31   LYS D CG    1 
ATOM   2326  C  CD    . LYS D  4 34  ? 3.046   -18.581 29.327 1.00 84.08  ? 31   LYS D CD    1 
ATOM   2327  C  CE    . LYS D  4 34  ? 1.601   -18.242 29.683 1.00 83.13  ? 31   LYS D CE    1 
ATOM   2328  N  NZ    . LYS D  4 34  ? 1.007   -17.331 28.661 1.00 82.23  ? 31   LYS D NZ    1 
ATOM   2329  N  N     . GLU D  4 35  ? 2.896   -14.360 27.062 1.00 76.96  ? 32   GLU D N     1 
ATOM   2330  C  CA    . GLU D  4 35  ? 2.526   -12.979 27.298 1.00 74.37  ? 32   GLU D CA    1 
ATOM   2331  C  C     . GLU D  4 35  ? 1.818   -12.776 28.635 1.00 72.35  ? 32   GLU D C     1 
ATOM   2332  O  O     . GLU D  4 35  ? 0.987   -13.595 29.043 1.00 72.22  ? 32   GLU D O     1 
ATOM   2333  C  CB    . GLU D  4 35  ? 1.632   -12.484 26.162 1.00 74.68  ? 32   GLU D CB    1 
ATOM   2334  C  CG    . GLU D  4 35  ? 0.298   -13.198 26.081 1.00 74.43  ? 32   GLU D CG    1 
ATOM   2335  C  CD    . GLU D  4 35  ? -0.611  -12.630 25.015 1.00 75.03  ? 32   GLU D CD    1 
ATOM   2336  O  OE1   . GLU D  4 35  ? -0.099  -12.014 24.048 1.00 74.32  ? 32   GLU D OE1   1 
ATOM   2337  O  OE2   . GLU D  4 35  ? -1.846  -12.812 25.146 1.00 75.43  ? 32   GLU D OE2   1 
ATOM   2338  N  N     . SER D  4 36  ? 2.150   -11.677 29.311 1.00 69.49  ? 33   SER D N     1 
ATOM   2339  C  CA    . SER D  4 36  ? 1.402   -11.256 30.492 1.00 66.68  ? 33   SER D CA    1 
ATOM   2340  C  C     . SER D  4 36  ? 1.153   -9.749  30.548 1.00 64.63  ? 33   SER D C     1 
ATOM   2341  O  O     . SER D  4 36  ? 1.517   -9.009  29.637 1.00 64.23  ? 33   SER D O     1 
ATOM   2342  C  CB    . SER D  4 36  ? 2.071   -11.752 31.774 1.00 66.76  ? 33   SER D CB    1 
ATOM   2343  O  OG    . SER D  4 36  ? 3.308   -11.129 31.988 1.00 66.69  ? 33   SER D OG    1 
ATOM   2344  N  N     . TYR D  4 37  ? 0.509   -9.322  31.628 1.00 62.02  ? 34   TYR D N     1 
ATOM   2345  C  CA    . TYR D  4 37  ? 0.165   -7.925  31.877 1.00 59.35  ? 34   TYR D CA    1 
ATOM   2346  C  C     . TYR D  4 37  ? 1.208   -7.161  32.688 1.00 58.18  ? 34   TYR D C     1 
ATOM   2347  O  O     . TYR D  4 37  ? 0.962   -6.030  33.066 1.00 58.01  ? 34   TYR D O     1 
ATOM   2348  C  CB    . TYR D  4 37  ? -1.142  -7.857  32.648 1.00 58.41  ? 34   TYR D CB    1 
ATOM   2349  C  CG    . TYR D  4 37  ? -2.340  -8.309  31.883 1.00 57.13  ? 34   TYR D CG    1 
ATOM   2350  C  CD1   . TYR D  4 37  ? -2.912  -9.551  32.134 1.00 55.36  ? 34   TYR D CD1   1 
ATOM   2351  C  CD2   . TYR D  4 37  ? -2.932  -7.478  30.923 1.00 55.31  ? 34   TYR D CD2   1 
ATOM   2352  C  CE1   . TYR D  4 37  ? -4.032  -9.968  31.434 1.00 56.01  ? 34   TYR D CE1   1 
ATOM   2353  C  CE2   . TYR D  4 37  ? -4.053  -7.884  30.216 1.00 55.58  ? 34   TYR D CE2   1 
ATOM   2354  C  CZ    . TYR D  4 37  ? -4.599  -9.132  30.482 1.00 56.39  ? 34   TYR D CZ    1 
ATOM   2355  O  OH    . TYR D  4 37  ? -5.713  -9.547  29.803 1.00 57.59  ? 34   TYR D OH    1 
ATOM   2356  N  N     . ALA D  4 38  ? 2.359   -7.776  32.947 1.00 57.02  ? 35   ALA D N     1 
ATOM   2357  C  CA    . ALA D  4 38  ? 3.342   -7.247  33.893 1.00 56.07  ? 35   ALA D CA    1 
ATOM   2358  C  C     . ALA D  4 38  ? 3.866   -5.826  33.611 1.00 55.33  ? 35   ALA D C     1 
ATOM   2359  O  O     . ALA D  4 38  ? 3.989   -5.009  34.536 1.00 55.03  ? 35   ALA D O     1 
ATOM   2360  C  CB    . ALA D  4 38  ? 4.508   -8.244  34.084 1.00 55.84  ? 35   ALA D CB    1 
ATOM   2361  N  N     . ILE D  4 39  ? 4.165   -5.526  32.350 1.00 54.67  ? 36   ILE D N     1 
ATOM   2362  C  CA    . ILE D  4 39  ? 4.686   -4.206  31.990 1.00 53.91  ? 36   ILE D CA    1 
ATOM   2363  C  C     . ILE D  4 39  ? 3.612   -3.112  32.156 1.00 53.52  ? 36   ILE D C     1 
ATOM   2364  O  O     . ILE D  4 39  ? 3.932   -1.960  32.462 1.00 53.26  ? 36   ILE D O     1 
ATOM   2365  C  CB    . ILE D  4 39  ? 5.368   -4.171  30.576 1.00 54.24  ? 36   ILE D CB    1 
ATOM   2366  C  CG1   . ILE D  4 39  ? 4.388   -4.473  29.449 1.00 53.31  ? 36   ILE D CG1   1 
ATOM   2367  C  CG2   . ILE D  4 39  ? 6.578   -5.119  30.514 1.00 53.61  ? 36   ILE D CG2   1 
ATOM   2368  C  CD1   . ILE D  4 39  ? 5.017   -4.278  28.075 1.00 54.42  ? 36   ILE D CD1   1 
ATOM   2369  N  N     . TYR D  4 40  ? 2.351   -3.499  31.989 1.00 52.48  ? 37   TYR D N     1 
ATOM   2370  C  CA    . TYR D  4 40  ? 1.224   -2.615  32.231 1.00 52.46  ? 37   TYR D CA    1 
ATOM   2371  C  C     . TYR D  4 40  ? 0.887   -2.475  33.710 1.00 51.69  ? 37   TYR D C     1 
ATOM   2372  O  O     . TYR D  4 40  ? 0.492   -1.406  34.150 1.00 51.75  ? 37   TYR D O     1 
ATOM   2373  C  CB    . TYR D  4 40  ? -0.012  -3.090  31.472 1.00 53.10  ? 37   TYR D CB    1 
ATOM   2374  C  CG    . TYR D  4 40  ? 0.285   -3.447  30.052 1.00 54.37  ? 37   TYR D CG    1 
ATOM   2375  C  CD1   . TYR D  4 40  ? 0.304   -4.788  29.641 1.00 55.73  ? 37   TYR D CD1   1 
ATOM   2376  C  CD2   . TYR D  4 40  ? 0.578   -2.456  29.111 1.00 54.16  ? 37   TYR D CD2   1 
ATOM   2377  C  CE1   . TYR D  4 40  ? 0.589   -5.131  28.327 1.00 56.10  ? 37   TYR D CE1   1 
ATOM   2378  C  CE2   . TYR D  4 40  ? 0.874   -2.782  27.793 1.00 55.63  ? 37   TYR D CE2   1 
ATOM   2379  C  CZ    . TYR D  4 40  ? 0.872   -4.122  27.408 1.00 56.98  ? 37   TYR D CZ    1 
ATOM   2380  O  OH    . TYR D  4 40  ? 1.152   -4.451  26.097 1.00 58.56  ? 37   TYR D OH    1 
ATOM   2381  N  N     . VAL D  4 41  ? 1.016   -3.556  34.469 1.00 50.74  ? 38   VAL D N     1 
ATOM   2382  C  CA    . VAL D  4 41  ? 0.813   -3.496  35.909 1.00 49.76  ? 38   VAL D CA    1 
ATOM   2383  C  C     . VAL D  4 41  ? 1.902   -2.588  36.484 1.00 50.03  ? 38   VAL D C     1 
ATOM   2384  O  O     . VAL D  4 41  ? 1.650   -1.791  37.381 1.00 49.46  ? 38   VAL D O     1 
ATOM   2385  C  CB    . VAL D  4 41  ? 0.788   -4.919  36.566 1.00 49.12  ? 38   VAL D CB    1 
ATOM   2386  C  CG1   . VAL D  4 41  ? 0.860   -4.841  38.068 1.00 46.92  ? 38   VAL D CG1   1 
ATOM   2387  C  CG2   . VAL D  4 41  ? -0.460  -5.718  36.121 1.00 47.40  ? 38   VAL D CG2   1 
ATOM   2388  N  N     . TYR D  4 42  ? 3.100   -2.719  35.928 1.00 50.78  ? 39   TYR D N     1 
ATOM   2389  C  CA    . TYR D  4 42  ? 4.266   -1.910  36.295 1.00 51.60  ? 39   TYR D CA    1 
ATOM   2390  C  C     . TYR D  4 42  ? 4.121   -0.398  35.979 1.00 51.16  ? 39   TYR D C     1 
ATOM   2391  O  O     . TYR D  4 42  ? 4.440   0.428   36.812 1.00 51.34  ? 39   TYR D O     1 
ATOM   2392  C  CB    . TYR D  4 42  ? 5.517   -2.513  35.647 1.00 52.46  ? 39   TYR D CB    1 
ATOM   2393  C  CG    . TYR D  4 42  ? 6.799   -1.967  36.180 1.00 54.80  ? 39   TYR D CG    1 
ATOM   2394  C  CD1   . TYR D  4 42  ? 7.196   -2.213  37.500 1.00 56.49  ? 39   TYR D CD1   1 
ATOM   2395  C  CD2   . TYR D  4 42  ? 7.632   -1.202  35.364 1.00 57.05  ? 39   TYR D CD2   1 
ATOM   2396  C  CE1   . TYR D  4 42  ? 8.391   -1.682  38.002 1.00 58.31  ? 39   TYR D CE1   1 
ATOM   2397  C  CE2   . TYR D  4 42  ? 8.832   -0.672  35.843 1.00 58.07  ? 39   TYR D CE2   1 
ATOM   2398  C  CZ    . TYR D  4 42  ? 9.211   -0.911  37.162 1.00 57.65  ? 39   TYR D CZ    1 
ATOM   2399  O  OH    . TYR D  4 42  ? 10.408  -0.386  37.619 1.00 56.28  ? 39   TYR D OH    1 
ATOM   2400  N  N     . LYS D  4 43  ? 3.626   -0.050  34.792 1.00 50.82  ? 40   LYS D N     1 
ATOM   2401  C  CA    . LYS D  4 43  ? 3.289   1.341   34.448 1.00 50.43  ? 40   LYS D CA    1 
ATOM   2402  C  C     . LYS D  4 43  ? 2.384   1.967   35.497 1.00 49.74  ? 40   LYS D C     1 
ATOM   2403  O  O     . LYS D  4 43  ? 2.672   3.042   36.039 1.00 50.35  ? 40   LYS D O     1 
ATOM   2404  C  CB    . LYS D  4 43  ? 2.580   1.426   33.086 1.00 49.90  ? 40   LYS D CB    1 
ATOM   2405  C  CG    . LYS D  4 43  ? 3.475   1.209   31.895 1.00 50.26  ? 40   LYS D CG    1 
ATOM   2406  C  CD    . LYS D  4 43  ? 2.679   1.088   30.579 1.00 51.45  ? 40   LYS D CD    1 
ATOM   2407  C  CE    . LYS D  4 43  ? 3.637   0.965   29.373 1.00 54.83  ? 40   LYS D CE    1 
ATOM   2408  N  NZ    . LYS D  4 43  ? 2.973   0.580   28.080 1.00 57.11  ? 40   LYS D NZ    1 
ATOM   2409  N  N     . VAL D  4 44  ? 1.274   1.289   35.752 1.00 48.56  ? 41   VAL D N     1 
ATOM   2410  C  CA    . VAL D  4 44  ? 0.272   1.720   36.712 1.00 47.31  ? 41   VAL D CA    1 
ATOM   2411  C  C     . VAL D  4 44  ? 0.861   1.782   38.126 1.00 47.89  ? 41   VAL D C     1 
ATOM   2412  O  O     . VAL D  4 44  ? 0.520   2.671   38.922 1.00 49.11  ? 41   VAL D O     1 
ATOM   2413  C  CB    . VAL D  4 44  ? -0.983  0.808   36.628 1.00 46.58  ? 41   VAL D CB    1 
ATOM   2414  C  CG1   . VAL D  4 44  ? -2.056  1.260   37.566 1.00 44.08  ? 41   VAL D CG1   1 
ATOM   2415  C  CG2   . VAL D  4 44  ? -1.518  0.782   35.198 1.00 44.69  ? 41   VAL D CG2   1 
ATOM   2416  N  N     . LEU D  4 45  ? 1.772   0.871   38.440 1.00 47.56  ? 42   LEU D N     1 
ATOM   2417  C  CA    . LEU D  4 45  ? 2.427   0.900   39.746 1.00 47.53  ? 42   LEU D CA    1 
ATOM   2418  C  C     . LEU D  4 45  ? 3.242   2.192   39.908 1.00 48.29  ? 42   LEU D C     1 
ATOM   2419  O  O     . LEU D  4 45  ? 3.355   2.739   41.011 1.00 48.99  ? 42   LEU D O     1 
ATOM   2420  C  CB    . LEU D  4 45  ? 3.342   -0.308  39.915 1.00 46.85  ? 42   LEU D CB    1 
ATOM   2421  C  CG    . LEU D  4 45  ? 4.268   -0.340  41.125 1.00 44.78  ? 42   LEU D CG    1 
ATOM   2422  C  CD1   . LEU D  4 45  ? 3.507   -0.264  42.440 1.00 43.45  ? 42   LEU D CD1   1 
ATOM   2423  C  CD2   . LEU D  4 45  ? 5.113   -1.573  41.032 1.00 43.87  ? 42   LEU D CD2   1 
ATOM   2424  N  N     . LYS D  4 46  ? 3.816   2.655   38.799 1.00 48.23  ? 43   LYS D N     1 
ATOM   2425  C  CA    . LYS D  4 46  ? 4.723   3.796   38.812 1.00 47.81  ? 43   LYS D CA    1 
ATOM   2426  C  C     . LYS D  4 46  ? 3.950   5.074   38.964 1.00 47.25  ? 43   LYS D C     1 
ATOM   2427  O  O     . LYS D  4 46  ? 4.398   5.971   39.666 1.00 48.36  ? 43   LYS D O     1 
ATOM   2428  C  CB    . LYS D  4 46  ? 5.589   3.812   37.558 1.00 47.74  ? 43   LYS D CB    1 
ATOM   2429  C  CG    . LYS D  4 46  ? 6.538   2.601   37.464 1.00 47.97  ? 43   LYS D CG    1 
ATOM   2430  C  CD    . LYS D  4 46  ? 7.801   2.731   38.318 1.00 47.58  ? 43   LYS D CD    1 
ATOM   2431  C  CE    . LYS D  4 46  ? 7.588   2.353   39.775 1.00 49.31  ? 43   LYS D CE    1 
ATOM   2432  N  NZ    . LYS D  4 46  ? 8.879   1.956   40.424 1.00 47.80  ? 43   LYS D NZ    1 
ATOM   2433  N  N     . GLN D  4 47  ? 2.769   5.120   38.352 1.00 45.94  ? 44   GLN D N     1 
ATOM   2434  C  CA    . GLN D  4 47  ? 1.825   6.198   38.521 1.00 44.65  ? 44   GLN D CA    1 
ATOM   2435  C  C     . GLN D  4 47  ? 1.385   6.452   39.958 1.00 44.64  ? 44   GLN D C     1 
ATOM   2436  O  O     . GLN D  4 47  ? 1.317   7.622   40.394 1.00 45.11  ? 44   GLN D O     1 
ATOM   2437  C  CB    . GLN D  4 47  ? 0.593   5.960   37.659 1.00 44.66  ? 44   GLN D CB    1 
ATOM   2438  C  CG    . GLN D  4 47  ? 0.849   6.057   36.166 1.00 44.83  ? 44   GLN D CG    1 
ATOM   2439  C  CD    . GLN D  4 47  ? -0.410  5.850   35.350 1.00 47.46  ? 44   GLN D CD    1 
ATOM   2440  O  OE1   . GLN D  4 47  ? -1.218  4.929   35.621 1.00 47.60  ? 44   GLN D OE1   1 
ATOM   2441  N  NE2   . GLN D  4 47  ? -0.592  6.694   34.334 1.00 46.13  ? 44   GLN D NE2   1 
ATOM   2442  N  N     . VAL D  4 48  ? 1.077   5.377   40.685 1.00 44.21  ? 45   VAL D N     1 
ATOM   2443  C  CA    . VAL D  4 48  ? 0.541   5.464   42.042 1.00 43.32  ? 45   VAL D CA    1 
ATOM   2444  C  C     . VAL D  4 48  ? 1.597   5.467   43.131 1.00 44.26  ? 45   VAL D C     1 
ATOM   2445  O  O     . VAL D  4 48  ? 1.423   6.099   44.165 1.00 44.51  ? 45   VAL D O     1 
ATOM   2446  C  CB    . VAL D  4 48  ? -0.528  4.377   42.343 1.00 43.41  ? 45   VAL D CB    1 
ATOM   2447  C  CG1   . VAL D  4 48  ? -1.669  4.471   41.349 1.00 41.42  ? 45   VAL D CG1   1 
ATOM   2448  C  CG2   . VAL D  4 48  ? 0.091   2.947   42.388 1.00 42.75  ? 45   VAL D CG2   1 
ATOM   2449  N  N     . HIS D  4 49  ? 2.689   4.749   42.926 1.00 45.59  ? 46   HIS D N     1 
ATOM   2450  C  CA    . HIS D  4 49  ? 3.746   4.711   43.921 1.00 46.10  ? 46   HIS D CA    1 
ATOM   2451  C  C     . HIS D  4 49  ? 5.057   4.703   43.160 1.00 47.16  ? 46   HIS D C     1 
ATOM   2452  O  O     . HIS D  4 49  ? 5.604   3.638   42.883 1.00 47.57  ? 46   HIS D O     1 
ATOM   2453  C  CB    . HIS D  4 49  ? 3.609   3.502   44.842 1.00 46.40  ? 46   HIS D CB    1 
ATOM   2454  C  CG    . HIS D  4 49  ? 2.459   3.583   45.804 1.00 44.83  ? 46   HIS D CG    1 
ATOM   2455  N  ND1   . HIS D  4 49  ? 2.552   4.213   47.021 1.00 46.17  ? 46   HIS D ND1   1 
ATOM   2456  C  CD2   . HIS D  4 49  ? 1.209   3.077   45.745 1.00 45.83  ? 46   HIS D CD2   1 
ATOM   2457  C  CE1   . HIS D  4 49  ? 1.405   4.115   47.666 1.00 44.84  ? 46   HIS D CE1   1 
ATOM   2458  N  NE2   . HIS D  4 49  ? 0.567   3.439   46.907 1.00 46.25  ? 46   HIS D NE2   1 
ATOM   2459  N  N     . PRO D  4 50  ? 5.543   5.911   42.780 1.00 47.68  ? 47   PRO D N     1 
ATOM   2460  C  CA    . PRO D  4 50  ? 6.676   6.126   41.865 1.00 47.18  ? 47   PRO D CA    1 
ATOM   2461  C  C     . PRO D  4 50  ? 7.984   5.555   42.382 1.00 47.64  ? 47   PRO D C     1 
ATOM   2462  O  O     . PRO D  4 50  ? 8.861   5.211   41.576 1.00 46.84  ? 47   PRO D O     1 
ATOM   2463  C  CB    . PRO D  4 50  ? 6.763   7.656   41.756 1.00 47.18  ? 47   PRO D CB    1 
ATOM   2464  C  CG    . PRO D  4 50  ? 5.404   8.172   42.204 1.00 47.45  ? 47   PRO D CG    1 
ATOM   2465  C  CD    . PRO D  4 50  ? 4.957   7.187   43.248 1.00 47.55  ? 47   PRO D CD    1 
ATOM   2466  N  N     . ASP D  4 51  ? 8.113   5.462   43.705 1.00 48.18  ? 48   ASP D N     1 
ATOM   2467  C  CA    . ASP D  4 51  ? 9.328   4.927   44.341 1.00 49.87  ? 48   ASP D CA    1 
ATOM   2468  C  C     . ASP D  4 51  ? 9.218   3.471   44.839 1.00 49.95  ? 48   ASP D C     1 
ATOM   2469  O  O     . ASP D  4 51  ? 10.154  2.973   45.454 1.00 50.49  ? 48   ASP D O     1 
ATOM   2470  C  CB    . ASP D  4 51  ? 9.746   5.797   45.547 1.00 50.55  ? 48   ASP D CB    1 
ATOM   2471  C  CG    . ASP D  4 51  ? 10.171  7.203   45.156 1.00 53.01  ? 48   ASP D CG    1 
ATOM   2472  O  OD1   . ASP D  4 51  ? 10.645  7.439   44.011 1.00 54.24  ? 48   ASP D OD1   1 
ATOM   2473  O  OD2   . ASP D  4 51  ? 10.019  8.081   46.030 1.00 56.80  ? 48   ASP D OD2   1 
ATOM   2474  N  N     . THR D  4 52  ? 8.078   2.820   44.602 1.00 49.93  ? 49   THR D N     1 
ATOM   2475  C  CA    . THR D  4 52  ? 7.825   1.448   45.049 1.00 49.30  ? 49   THR D CA    1 
ATOM   2476  C  C     . THR D  4 52  ? 8.115   0.420   43.937 1.00 48.99  ? 49   THR D C     1 
ATOM   2477  O  O     . THR D  4 52  ? 7.931   0.697   42.741 1.00 49.21  ? 49   THR D O     1 
ATOM   2478  C  CB    . THR D  4 52  ? 6.357   1.302   45.603 1.00 49.72  ? 49   THR D CB    1 
ATOM   2479  O  OG1   . THR D  4 52  ? 6.146   2.238   46.666 1.00 48.60  ? 49   THR D OG1   1 
ATOM   2480  C  CG2   . THR D  4 52  ? 6.083   -0.100  46.159 1.00 49.46  ? 49   THR D CG2   1 
ATOM   2481  N  N     . GLY D  4 53  ? 8.603   -0.747  44.339 1.00 48.28  ? 50   GLY D N     1 
ATOM   2482  C  CA    . GLY D  4 53  ? 8.779   -1.876  43.425 1.00 48.66  ? 50   GLY D CA    1 
ATOM   2483  C  C     . GLY D  4 53  ? 7.801   -3.035  43.661 1.00 48.61  ? 50   GLY D C     1 
ATOM   2484  O  O     . GLY D  4 53  ? 6.902   -2.976  44.510 1.00 49.03  ? 50   GLY D O     1 
ATOM   2485  N  N     . ILE D  4 54  ? 7.961   -4.095  42.891 1.00 48.43  ? 51   ILE D N     1 
ATOM   2486  C  CA    . ILE D  4 54  ? 7.114   -5.266  43.046 1.00 47.64  ? 51   ILE D CA    1 
ATOM   2487  C  C     . ILE D  4 54  ? 7.977   -6.510  42.824 1.00 48.51  ? 51   ILE D C     1 
ATOM   2488  O  O     . ILE D  4 54  ? 8.732   -6.573  41.841 1.00 48.37  ? 51   ILE D O     1 
ATOM   2489  C  CB    . ILE D  4 54  ? 5.868   -5.202  42.088 1.00 47.84  ? 51   ILE D CB    1 
ATOM   2490  C  CG1   . ILE D  4 54  ? 4.755   -6.180  42.543 1.00 45.69  ? 51   ILE D CG1   1 
ATOM   2491  C  CG2   . ILE D  4 54  ? 6.292   -5.301  40.610 1.00 45.42  ? 51   ILE D CG2   1 
ATOM   2492  C  CD1   . ILE D  4 54  ? 3.412   -6.027  41.819 1.00 45.88  ? 51   ILE D CD1   1 
ATOM   2493  N  N     . SER D  4 55  ? 7.889   -7.471  43.750 1.00 48.21  ? 52   SER D N     1 
ATOM   2494  C  CA    . SER D  4 55  ? 8.548   -8.784  43.572 1.00 48.52  ? 52   SER D CA    1 
ATOM   2495  C  C     . SER D  4 55  ? 7.909   -9.538  42.411 1.00 48.76  ? 52   SER D C     1 
ATOM   2496  O  O     . SER D  4 55  ? 6.782   -9.226  42.000 1.00 48.96  ? 52   SER D O     1 
ATOM   2497  C  CB    . SER D  4 55  ? 8.430   -9.615  44.832 1.00 48.06  ? 52   SER D CB    1 
ATOM   2498  O  OG    . SER D  4 55  ? 7.125   -10.163 44.884 1.00 50.19  ? 52   SER D OG    1 
ATOM   2499  N  N     . SER D  4 56  ? 8.628   -10.512 41.858 1.00 49.26  ? 53   SER D N     1 
ATOM   2500  C  CA    . SER D  4 56  ? 8.089   -11.332 40.768 1.00 49.86  ? 53   SER D CA    1 
ATOM   2501  C  C     . SER D  4 56  ? 6.923   -12.189 41.259 1.00 49.34  ? 53   SER D C     1 
ATOM   2502  O  O     . SER D  4 56  ? 5.961   -12.420 40.519 1.00 49.43  ? 53   SER D O     1 
ATOM   2503  C  CB    . SER D  4 56  ? 9.163   -12.215 40.171 1.00 50.02  ? 53   SER D CB    1 
ATOM   2504  O  OG    . SER D  4 56  ? 9.785   -12.899 41.236 1.00 52.59  ? 53   SER D OG    1 
ATOM   2505  N  N     . LYS D  4 57  ? 6.991   -12.641 42.505 1.00 48.75  ? 54   LYS D N     1 
ATOM   2506  C  CA    . LYS D  4 57  ? 5.855   -13.339 43.084 1.00 48.87  ? 54   LYS D CA    1 
ATOM   2507  C  C     . LYS D  4 57  ? 4.617   -12.459 43.167 1.00 48.25  ? 54   LYS D C     1 
ATOM   2508  O  O     . LYS D  4 57  ? 3.536   -12.882 42.759 1.00 49.21  ? 54   LYS D O     1 
ATOM   2509  C  CB    . LYS D  4 57  ? 6.202   -13.930 44.437 1.00 49.55  ? 54   LYS D CB    1 
ATOM   2510  C  CG    . LYS D  4 57  ? 6.867   -15.284 44.331 1.00 53.22  ? 54   LYS D CG    1 
ATOM   2511  C  CD    . LYS D  4 57  ? 7.500   -15.729 45.657 1.00 57.67  ? 54   LYS D CD    1 
ATOM   2512  C  CE    . LYS D  4 57  ? 8.338   -17.010 45.414 1.00 58.86  ? 54   LYS D CE    1 
ATOM   2513  N  NZ    . LYS D  4 57  ? 9.472   -17.112 46.388 1.00 60.13  ? 54   LYS D NZ    1 
ATOM   2514  N  N     . ALA D  4 58  ? 4.770   -11.227 43.658 1.00 47.16  ? 55   ALA D N     1 
ATOM   2515  C  CA    . ALA D  4 58  ? 3.668   -10.260 43.654 1.00 45.26  ? 55   ALA D CA    1 
ATOM   2516  C  C     . ALA D  4 58  ? 3.184   -9.938  42.265 1.00 43.93  ? 55   ALA D C     1 
ATOM   2517  O  O     . ALA D  4 58  ? 1.996   -9.847  42.040 1.00 44.01  ? 55   ALA D O     1 
ATOM   2518  C  CB    . ALA D  4 58  ? 4.055   -9.014  44.367 1.00 45.50  ? 55   ALA D CB    1 
ATOM   2519  N  N     . MET D  4 59  ? 4.093   -9.769  41.322 1.00 43.35  ? 56   MET D N     1 
ATOM   2520  C  CA    . MET D  4 59  ? 3.689   -9.548  39.945 1.00 43.52  ? 56   MET D CA    1 
ATOM   2521  C  C     . MET D  4 59  ? 2.940   -10.757 39.384 1.00 43.50  ? 56   MET D C     1 
ATOM   2522  O  O     . MET D  4 59  ? 2.024   -10.614 38.547 1.00 44.32  ? 56   MET D O     1 
ATOM   2523  C  CB    . MET D  4 59  ? 4.869   -9.172  39.071 1.00 43.65  ? 56   MET D CB    1 
ATOM   2524  C  CG    . MET D  4 59  ? 4.478   -8.875  37.633 1.00 45.92  ? 56   MET D CG    1 
ATOM   2525  S  SD    . MET D  4 59  ? 3.378   -7.428  37.475 1.00 50.69  ? 56   MET D SD    1 
ATOM   2526  C  CE    . MET D  4 59  ? 4.583   -6.115  37.586 1.00 48.53  ? 56   MET D CE    1 
ATOM   2527  N  N     . SER D  4 60  ? 3.281   -11.944 39.876 1.00 42.95  ? 57   SER D N     1 
ATOM   2528  C  CA    . SER D  4 60  ? 2.536   -13.139 39.499 1.00 42.11  ? 57   SER D CA    1 
ATOM   2529  C  C     . SER D  4 60  ? 1.104   -13.158 40.043 1.00 41.47  ? 57   SER D C     1 
ATOM   2530  O  O     . SER D  4 60  ? 0.168   -13.350 39.255 1.00 41.27  ? 57   SER D O     1 
ATOM   2531  C  CB    . SER D  4 60  ? 3.312   -14.390 39.850 1.00 42.73  ? 57   SER D CB    1 
ATOM   2532  O  OG    . SER D  4 60  ? 3.049   -15.378 38.868 1.00 44.90  ? 57   SER D OG    1 
ATOM   2533  N  N     . ILE D  4 61  ? 0.915   -12.927 41.350 1.00 40.51  ? 58   ILE D N     1 
ATOM   2534  C  CA    . ILE D  4 61  ? -0.428  -12.621 41.887 1.00 40.72  ? 58   ILE D CA    1 
ATOM   2535  C  C     . ILE D  4 61  ? -1.187  -11.549 41.089 1.00 41.60  ? 58   ILE D C     1 
ATOM   2536  O  O     . ILE D  4 61  ? -2.405  -11.678 40.887 1.00 41.99  ? 58   ILE D O     1 
ATOM   2537  C  CB    . ILE D  4 61  ? -0.410  -12.035 43.329 1.00 40.95  ? 58   ILE D CB    1 
ATOM   2538  C  CG1   . ILE D  4 61  ? 0.388   -12.878 44.338 1.00 39.81  ? 58   ILE D CG1   1 
ATOM   2539  C  CG2   . ILE D  4 61  ? -1.829  -11.668 43.773 1.00 39.46  ? 58   ILE D CG2   1 
ATOM   2540  C  CD1   . ILE D  4 61  ? 0.280   -14.322 44.159 1.00 37.83  ? 58   ILE D CD1   1 
ATOM   2541  N  N     . MET D  4 62  ? -0.477  -10.494 40.643 1.00 41.59  ? 59   MET D N     1 
ATOM   2542  C  CA    . MET D  4 62  ? -1.137  -9.377  39.950 1.00 41.83  ? 59   MET D CA    1 
ATOM   2543  C  C     . MET D  4 62  ? -1.546  -9.760  38.563 1.00 41.47  ? 59   MET D C     1 
ATOM   2544  O  O     . MET D  4 62  ? -2.622  -9.379  38.090 1.00 40.66  ? 59   MET D O     1 
ATOM   2545  C  CB    . MET D  4 62  ? -0.274  -8.079  39.900 1.00 41.69  ? 59   MET D CB    1 
ATOM   2546  C  CG    . MET D  4 62  ? -0.178  -7.301  41.198 1.00 40.54  ? 59   MET D CG    1 
ATOM   2547  S  SD    . MET D  4 62  ? -1.783  -6.879  41.881 1.00 43.40  ? 59   MET D SD    1 
ATOM   2548  C  CE    . MET D  4 62  ? -2.614  -6.210  40.454 1.00 40.09  ? 59   MET D CE    1 
ATOM   2549  N  N     . ASN D  4 63  ? -0.659  -10.469 37.881 1.00 42.56  ? 60   ASN D N     1 
ATOM   2550  C  CA    . ASN D  4 63  ? -1.037  -11.016 36.580 1.00 43.94  ? 60   ASN D CA    1 
ATOM   2551  C  C     . ASN D  4 63  ? -2.203  -12.045 36.655 1.00 43.63  ? 60   ASN D C     1 
ATOM   2552  O  O     . ASN D  4 63  ? -3.057  -12.076 35.763 1.00 43.53  ? 60   ASN D O     1 
ATOM   2553  C  CB    . ASN D  4 63  ? 0.172   -11.558 35.833 1.00 44.15  ? 60   ASN D CB    1 
ATOM   2554  C  CG    . ASN D  4 63  ? -0.185  -12.018 34.444 1.00 46.54  ? 60   ASN D CG    1 
ATOM   2555  O  OD1   . ASN D  4 63  ? -0.806  -11.280 33.680 1.00 46.87  ? 60   ASN D OD1   1 
ATOM   2556  N  ND2   . ASN D  4 63  ? 0.171   -13.260 34.114 1.00 47.86  ? 60   ASN D ND2   1 
ATOM   2557  N  N     . SER D  4 64  ? -2.249  -12.849 37.730 1.00 44.15  ? 61   SER D N     1 
ATOM   2558  C  CA    . SER D  4 64  ? -3.353  -13.813 37.944 1.00 44.62  ? 61   SER D CA    1 
ATOM   2559  C  C     . SER D  4 64  ? -4.664  -13.060 38.146 1.00 44.79  ? 61   SER D C     1 
ATOM   2560  O  O     . SER D  4 64  ? -5.710  -13.434 37.568 1.00 45.08  ? 61   SER D O     1 
ATOM   2561  C  CB    . SER D  4 64  ? -3.113  -14.719 39.174 1.00 44.70  ? 61   SER D CB    1 
ATOM   2562  O  OG    . SER D  4 64  ? -2.162  -15.765 38.945 1.00 46.55  ? 61   SER D OG    1 
ATOM   2563  N  N     . PHE D  4 65  ? -4.598  -12.011 38.981 1.00 44.27  ? 62   PHE D N     1 
ATOM   2564  C  CA    . PHE D  4 65  ? -5.756  -11.164 39.313 1.00 43.50  ? 62   PHE D CA    1 
ATOM   2565  C  C     . PHE D  4 65  ? -6.402  -10.559 38.065 1.00 42.90  ? 62   PHE D C     1 
ATOM   2566  O  O     . PHE D  4 65  ? -7.625  -10.591 37.937 1.00 42.60  ? 62   PHE D O     1 
ATOM   2567  C  CB    . PHE D  4 65  ? -5.392  -10.130 40.415 1.00 43.21  ? 62   PHE D CB    1 
ATOM   2568  C  CG    . PHE D  4 65  ? -6.320  -8.949  40.490 1.00 44.23  ? 62   PHE D CG    1 
ATOM   2569  C  CD1   . PHE D  4 65  ? -7.610  -9.076  41.007 1.00 45.09  ? 62   PHE D CD1   1 
ATOM   2570  C  CD2   . PHE D  4 65  ? -5.905  -7.687  40.032 1.00 44.77  ? 62   PHE D CD2   1 
ATOM   2571  C  CE1   . PHE D  4 65  ? -8.481  -7.978  41.050 1.00 42.74  ? 62   PHE D CE1   1 
ATOM   2572  C  CE2   . PHE D  4 65  ? -6.772  -6.591  40.060 1.00 43.58  ? 62   PHE D CE2   1 
ATOM   2573  C  CZ    . PHE D  4 65  ? -8.056  -6.741  40.570 1.00 44.14  ? 62   PHE D CZ    1 
ATOM   2574  N  N     . VAL D  4 66  ? -5.599  -10.051 37.124 1.00 43.33  ? 63   VAL D N     1 
ATOM   2575  C  CA    . VAL D  4 66  ? -6.144  -9.327  35.937 1.00 43.18  ? 63   VAL D CA    1 
ATOM   2576  C  C     . VAL D  4 66  ? -6.770  -10.356 35.020 1.00 43.30  ? 63   VAL D C     1 
ATOM   2577  O  O     . VAL D  4 66  ? -7.869  -10.160 34.509 1.00 43.60  ? 63   VAL D O     1 
ATOM   2578  C  CB    . VAL D  4 66  ? -5.057  -8.476  35.130 1.00 43.89  ? 63   VAL D CB    1 
ATOM   2579  C  CG1   . VAL D  4 66  ? -5.689  -7.668  34.009 1.00 42.16  ? 63   VAL D CG1   1 
ATOM   2580  C  CG2   . VAL D  4 66  ? -4.210  -7.537  36.035 1.00 43.49  ? 63   VAL D CG2   1 
ATOM   2581  N  N     . ASN D  4 67  ? -6.055  -11.463 34.808 1.00 43.90  ? 64   ASN D N     1 
ATOM   2582  C  CA    . ASN D  4 67  ? -6.588  -12.624 34.080 1.00 43.12  ? 64   ASN D CA    1 
ATOM   2583  C  C     . ASN D  4 67  ? -7.879  -13.142 34.709 1.00 42.26  ? 64   ASN D C     1 
ATOM   2584  O  O     . ASN D  4 67  ? -8.884  -13.299 34.027 1.00 42.88  ? 64   ASN D O     1 
ATOM   2585  C  CB    . ASN D  4 67  ? -5.517  -13.715 33.983 1.00 43.79  ? 64   ASN D CB    1 
ATOM   2586  C  CG    . ASN D  4 67  ? -4.519  -13.470 32.846 1.00 44.85  ? 64   ASN D CG    1 
ATOM   2587  O  OD1   . ASN D  4 67  ? -4.916  -13.216 31.709 1.00 46.71  ? 64   ASN D OD1   1 
ATOM   2588  N  ND2   . ASN D  4 67  ? -3.221  -13.560 33.148 1.00 46.15  ? 64   ASN D ND2   1 
ATOM   2589  N  N     . ASP D  4 68  ? -7.874  -13.380 36.012 1.00 41.64  ? 65   ASP D N     1 
ATOM   2590  C  CA    . ASP D  4 68  ? -9.112  -13.705 36.733 1.00 41.87  ? 65   ASP D CA    1 
ATOM   2591  C  C     . ASP D  4 68  ? -10.274 -12.762 36.374 1.00 42.49  ? 65   ASP D C     1 
ATOM   2592  O  O     . ASP D  4 68  ? -11.220 -13.156 35.703 1.00 43.53  ? 65   ASP D O     1 
ATOM   2593  C  CB    . ASP D  4 68  ? -8.838  -13.663 38.233 1.00 41.75  ? 65   ASP D CB    1 
ATOM   2594  C  CG    . ASP D  4 68  ? -9.875  -14.402 39.052 1.00 43.37  ? 65   ASP D CG    1 
ATOM   2595  O  OD1   . ASP D  4 68  ? -10.655 -15.195 38.478 1.00 48.12  ? 65   ASP D OD1   1 
ATOM   2596  O  OD2   . ASP D  4 68  ? -9.909  -14.189 40.284 1.00 41.38  ? 65   ASP D OD2   1 
ATOM   2597  N  N     . VAL D  4 69  ? -10.204 -11.505 36.816 1.00 43.09  ? 66   VAL D N     1 
ATOM   2598  C  CA    . VAL D  4 69  ? -11.252 -10.503 36.543 1.00 42.21  ? 66   VAL D CA    1 
ATOM   2599  C  C     . VAL D  4 69  ? -11.611 -10.371 35.033 1.00 42.06  ? 66   VAL D C     1 
ATOM   2600  O  O     . VAL D  4 69  ? -12.784 -10.327 34.664 1.00 41.83  ? 66   VAL D O     1 
ATOM   2601  C  CB    . VAL D  4 69  ? -10.937 -9.131  37.295 1.00 43.04  ? 66   VAL D CB    1 
ATOM   2602  C  CG1   . VAL D  4 69  ? -12.036 -8.067  37.059 1.00 42.26  ? 66   VAL D CG1   1 
ATOM   2603  C  CG2   . VAL D  4 69  ? -10.744 -9.378  38.831 1.00 40.43  ? 66   VAL D CG2   1 
ATOM   2604  N  N     . PHE D  4 70  ? -10.629 -10.345 34.151 1.00 42.49  ? 67   PHE D N     1 
ATOM   2605  C  CA    . PHE D  4 70  ? -10.950 -10.475 32.724 1.00 43.55  ? 67   PHE D CA    1 
ATOM   2606  C  C     . PHE D  4 70  ? -11.963 -11.612 32.441 1.00 44.27  ? 67   PHE D C     1 
ATOM   2607  O  O     . PHE D  4 70  ? -12.991 -11.368 31.815 1.00 44.54  ? 67   PHE D O     1 
ATOM   2608  C  CB    . PHE D  4 70  ? -9.679  -10.612 31.858 1.00 43.62  ? 67   PHE D CB    1 
ATOM   2609  C  CG    . PHE D  4 70  ? -9.966  -10.764 30.373 1.00 44.62  ? 67   PHE D CG    1 
ATOM   2610  C  CD1   . PHE D  4 70  ? -9.782  -9.704  29.499 1.00 45.76  ? 67   PHE D CD1   1 
ATOM   2611  C  CD2   . PHE D  4 70  ? -10.441 -11.967 29.853 1.00 46.44  ? 67   PHE D CD2   1 
ATOM   2612  C  CE1   . PHE D  4 70  ? -10.070 -9.827  28.130 1.00 44.54  ? 67   PHE D CE1   1 
ATOM   2613  C  CE2   . PHE D  4 70  ? -10.731 -12.098 28.479 1.00 47.06  ? 67   PHE D CE2   1 
ATOM   2614  C  CZ    . PHE D  4 70  ? -10.549 -11.019 27.629 1.00 44.71  ? 67   PHE D CZ    1 
ATOM   2615  N  N     . GLU D  4 71  ? -11.690 -12.845 32.907 1.00 45.23  ? 68   GLU D N     1 
ATOM   2616  C  CA    . GLU D  4 71  ? -12.593 -13.984 32.651 1.00 45.43  ? 68   GLU D CA    1 
ATOM   2617  C  C     . GLU D  4 71  ? -13.969 -13.833 33.276 1.00 44.64  ? 68   GLU D C     1 
ATOM   2618  O  O     . GLU D  4 71  ? -14.982 -14.099 32.623 1.00 44.33  ? 68   GLU D O     1 
ATOM   2619  C  CB    . GLU D  4 71  ? -11.993 -15.294 33.127 1.00 46.73  ? 68   GLU D CB    1 
ATOM   2620  C  CG    . GLU D  4 71  ? -10.810 -15.862 32.330 1.00 51.49  ? 68   GLU D CG    1 
ATOM   2621  C  CD    . GLU D  4 71  ? -9.952  -16.766 33.230 1.00 59.09  ? 68   GLU D CD    1 
ATOM   2622  O  OE1   . GLU D  4 71  ? -8.756  -16.991 32.897 1.00 60.62  ? 68   GLU D OE1   1 
ATOM   2623  O  OE2   . GLU D  4 71  ? -10.477 -17.222 34.299 1.00 60.98  ? 68   GLU D OE2   1 
ATOM   2624  N  N     . ARG D  4 72  ? -14.023 -13.410 34.534 1.00 43.84  ? 69   ARG D N     1 
ATOM   2625  C  CA    . ARG D  4 72  ? -15.323 -13.182 35.179 1.00 44.08  ? 69   ARG D CA    1 
ATOM   2626  C  C     . ARG D  4 72  ? -16.241 -12.170 34.487 1.00 44.58  ? 69   ARG D C     1 
ATOM   2627  O  O     . ARG D  4 72  ? -17.457 -12.363 34.457 1.00 45.69  ? 69   ARG D O     1 
ATOM   2628  C  CB    . ARG D  4 72  ? -15.149 -12.756 36.624 1.00 43.87  ? 69   ARG D CB    1 
ATOM   2629  C  CG    . ARG D  4 72  ? -14.416 -13.726 37.490 1.00 43.52  ? 69   ARG D CG    1 
ATOM   2630  C  CD    . ARG D  4 72  ? -14.768 -13.422 38.932 1.00 43.80  ? 69   ARG D CD    1 
ATOM   2631  N  NE    . ARG D  4 72  ? -13.600 -13.430 39.785 1.00 43.23  ? 69   ARG D NE    1 
ATOM   2632  C  CZ    . ARG D  4 72  ? -13.622 -13.158 41.075 1.00 44.94  ? 69   ARG D CZ    1 
ATOM   2633  N  NH1   . ARG D  4 72  ? -14.761 -12.866 41.675 1.00 44.32  ? 69   ARG D NH1   1 
ATOM   2634  N  NH2   . ARG D  4 72  ? -12.490 -13.185 41.773 1.00 48.41  ? 69   ARG D NH2   1 
ATOM   2635  N  N     . ILE D  4 73  ? -15.682 -11.089 33.947 1.00 44.76  ? 70   ILE D N     1 
ATOM   2636  C  CA    . ILE D  4 73  ? -16.486 -10.071 33.244 1.00 44.72  ? 70   ILE D CA    1 
ATOM   2637  C  C     . ILE D  4 73  ? -16.842 -10.539 31.839 1.00 45.63  ? 70   ILE D C     1 
ATOM   2638  O  O     . ILE D  4 73  ? -18.003 -10.450 31.437 1.00 45.69  ? 70   ILE D O     1 
ATOM   2639  C  CB    . ILE D  4 73  ? -15.787 -8.652  33.216 1.00 44.42  ? 70   ILE D CB    1 
ATOM   2640  C  CG1   . ILE D  4 73  ? -15.886 -7.986  34.585 1.00 43.46  ? 70   ILE D CG1   1 
ATOM   2641  C  CG2   . ILE D  4 73  ? -16.405 -7.750  32.148 1.00 43.08  ? 70   ILE D CG2   1 
ATOM   2642  C  CD1   . ILE D  4 73  ? -14.857 -6.918  34.835 1.00 46.46  ? 70   ILE D CD1   1 
ATOM   2643  N  N     . ALA D  4 74  ? -15.849 -11.024 31.085 1.00 46.49  ? 71   ALA D N     1 
ATOM   2644  C  CA    . ALA D  4 74  ? -16.122 -11.589 29.751 1.00 47.22  ? 71   ALA D CA    1 
ATOM   2645  C  C     . ALA D  4 74  ? -17.224 -12.671 29.762 1.00 47.92  ? 71   ALA D C     1 
ATOM   2646  O  O     . ALA D  4 74  ? -18.016 -12.762 28.813 1.00 48.41  ? 71   ALA D O     1 
ATOM   2647  C  CB    . ALA D  4 74  ? -14.856 -12.088 29.110 1.00 46.96  ? 71   ALA D CB    1 
ATOM   2648  N  N     . GLY D  4 75  ? -17.313 -13.433 30.857 1.00 48.53  ? 72   GLY D N     1 
ATOM   2649  C  CA    . GLY D  4 75  ? -18.343 -14.463 31.032 1.00 49.05  ? 72   GLY D CA    1 
ATOM   2650  C  C     . GLY D  4 75  ? -19.718 -13.999 31.483 1.00 49.88  ? 72   GLY D C     1 
ATOM   2651  O  O     . GLY D  4 75  ? -20.728 -14.534 31.042 1.00 49.56  ? 72   GLY D O     1 
ATOM   2652  N  N     . GLU D  4 76  ? -19.785 -13.016 32.380 1.00 51.22  ? 73   GLU D N     1 
ATOM   2653  C  CA    . GLU D  4 76  ? -21.074 -12.354 32.645 1.00 52.01  ? 73   GLU D CA    1 
ATOM   2654  C  C     . GLU D  4 76  ? -21.568 -11.694 31.357 1.00 52.18  ? 73   GLU D C     1 
ATOM   2655  O  O     . GLU D  4 76  ? -22.754 -11.796 31.023 1.00 52.50  ? 73   GLU D O     1 
ATOM   2656  C  CB    . GLU D  4 76  ? -20.993 -11.309 33.753 1.00 52.29  ? 73   GLU D CB    1 
ATOM   2657  C  CG    . GLU D  4 76  ? -20.398 -11.770 35.088 1.00 55.86  ? 73   GLU D CG    1 
ATOM   2658  C  CD    . GLU D  4 76  ? -21.372 -12.556 35.975 1.00 60.12  ? 73   GLU D CD    1 
ATOM   2659  O  OE1   . GLU D  4 76  ? -22.592 -12.603 35.667 1.00 61.08  ? 73   GLU D OE1   1 
ATOM   2660  O  OE2   . GLU D  4 76  ? -20.898 -13.137 36.989 1.00 60.54  ? 73   GLU D OE2   1 
ATOM   2661  N  N     . ALA D  4 77  ? -20.666 -11.022 30.635 1.00 51.83  ? 74   ALA D N     1 
ATOM   2662  C  CA    . ALA D  4 77  ? -21.004 -10.451 29.329 1.00 51.98  ? 74   ALA D CA    1 
ATOM   2663  C  C     . ALA D  4 77  ? -21.557 -11.502 28.373 1.00 51.96  ? 74   ALA D C     1 
ATOM   2664  O  O     . ALA D  4 77  ? -22.662 -11.349 27.868 1.00 52.24  ? 74   ALA D O     1 
ATOM   2665  C  CB    . ALA D  4 77  ? -19.791 -9.737  28.715 1.00 52.09  ? 74   ALA D CB    1 
ATOM   2666  N  N     . SER D  4 78  ? -20.770 -12.556 28.134 1.00 52.11  ? 75   SER D N     1 
ATOM   2667  C  CA    . SER D  4 78  ? -21.183 -13.759 27.387 1.00 51.94  ? 75   SER D CA    1 
ATOM   2668  C  C     . SER D  4 78  ? -22.591 -14.235 27.697 1.00 51.44  ? 75   SER D C     1 
ATOM   2669  O  O     . SER D  4 78  ? -23.427 -14.332 26.803 1.00 51.80  ? 75   SER D O     1 
ATOM   2670  C  CB    . SER D  4 78  ? -20.211 -14.900 27.667 1.00 52.04  ? 75   SER D CB    1 
ATOM   2671  O  OG    . SER D  4 78  ? -20.543 -16.043 26.901 1.00 53.10  ? 75   SER D OG    1 
ATOM   2672  N  N     . ARG D  4 79  ? -22.831 -14.552 28.963 1.00 51.42  ? 76   ARG D N     1 
ATOM   2673  C  CA    . ARG D  4 79  ? -24.161 -14.905 29.463 1.00 51.39  ? 76   ARG D CA    1 
ATOM   2674  C  C     . ARG D  4 79  ? -25.247 -13.881 29.137 1.00 52.11  ? 76   ARG D C     1 
ATOM   2675  O  O     . ARG D  4 79  ? -26.212 -14.220 28.464 1.00 52.42  ? 76   ARG D O     1 
ATOM   2676  C  CB    . ARG D  4 79  ? -24.109 -15.169 30.964 1.00 51.11  ? 76   ARG D CB    1 
ATOM   2677  C  CG    . ARG D  4 79  ? -23.820 -16.618 31.326 1.00 49.91  ? 76   ARG D CG    1 
ATOM   2678  C  CD    . ARG D  4 79  ? -23.252 -16.740 32.738 1.00 48.39  ? 76   ARG D CD    1 
ATOM   2679  N  NE    . ARG D  4 79  ? -21.866 -17.185 32.652 1.00 48.96  ? 76   ARG D NE    1 
ATOM   2680  C  CZ    . ARG D  4 79  ? -20.903 -16.870 33.513 1.00 47.25  ? 76   ARG D CZ    1 
ATOM   2681  N  NH1   . ARG D  4 79  ? -21.145 -16.096 34.559 1.00 44.24  ? 76   ARG D NH1   1 
ATOM   2682  N  NH2   . ARG D  4 79  ? -19.677 -17.318 33.302 1.00 48.90  ? 76   ARG D NH2   1 
ATOM   2683  N  N     . LEU D  4 80  ? -25.096 -12.641 29.610 1.00 52.98  ? 77   LEU D N     1 
ATOM   2684  C  CA    . LEU D  4 80  ? -26.001 -11.532 29.244 1.00 53.94  ? 77   LEU D CA    1 
ATOM   2685  C  C     . LEU D  4 80  ? -26.440 -11.493 27.776 1.00 54.65  ? 77   LEU D C     1 
ATOM   2686  O  O     . LEU D  4 80  ? -27.632 -11.445 27.483 1.00 54.30  ? 77   LEU D O     1 
ATOM   2687  C  CB    . LEU D  4 80  ? -25.364 -10.188 29.566 1.00 53.70  ? 77   LEU D CB    1 
ATOM   2688  C  CG    . LEU D  4 80  ? -25.882 -9.382  30.740 1.00 54.32  ? 77   LEU D CG    1 
ATOM   2689  C  CD1   . LEU D  4 80  ? -25.009 -8.160  30.841 1.00 53.75  ? 77   LEU D CD1   1 
ATOM   2690  C  CD2   . LEU D  4 80  ? -27.361 -9.019  30.597 1.00 52.92  ? 77   LEU D CD2   1 
ATOM   2691  N  N     . ALA D  4 81  ? -25.464 -11.469 26.871 1.00 55.75  ? 78   ALA D N     1 
ATOM   2692  C  CA    . ALA D  4 81  ? -25.732 -11.471 25.445 1.00 57.48  ? 78   ALA D CA    1 
ATOM   2693  C  C     . ALA D  4 81  ? -26.693 -12.614 25.091 1.00 58.78  ? 78   ALA D C     1 
ATOM   2694  O  O     . ALA D  4 81  ? -27.718 -12.416 24.422 1.00 59.19  ? 78   ALA D O     1 
ATOM   2695  C  CB    . ALA D  4 81  ? -24.408 -11.583 24.660 1.00 56.97  ? 78   ALA D CB    1 
ATOM   2696  N  N     . HIS D  4 82  ? -26.365 -13.806 25.575 1.00 60.31  ? 79   HIS D N     1 
ATOM   2697  C  CA    . HIS D  4 82  ? -27.157 -14.985 25.304 1.00 61.50  ? 79   HIS D CA    1 
ATOM   2698  C  C     . HIS D  4 82  ? -28.564 -14.831 25.822 1.00 61.60  ? 79   HIS D C     1 
ATOM   2699  O  O     . HIS D  4 82  ? -29.511 -15.042 25.085 1.00 62.16  ? 79   HIS D O     1 
ATOM   2700  C  CB    . HIS D  4 82  ? -26.522 -16.225 25.919 1.00 62.01  ? 79   HIS D CB    1 
ATOM   2701  C  CG    . HIS D  4 82  ? -27.197 -17.492 25.506 1.00 65.17  ? 79   HIS D CG    1 
ATOM   2702  N  ND1   . HIS D  4 82  ? -26.713 -18.298 24.495 1.00 67.84  ? 79   HIS D ND1   1 
ATOM   2703  C  CD2   . HIS D  4 82  ? -28.345 -18.069 25.934 1.00 67.01  ? 79   HIS D CD2   1 
ATOM   2704  C  CE1   . HIS D  4 82  ? -27.522 -19.330 24.338 1.00 68.41  ? 79   HIS D CE1   1 
ATOM   2705  N  NE2   . HIS D  4 82  ? -28.520 -19.214 25.197 1.00 68.51  ? 79   HIS D NE2   1 
ATOM   2706  N  N     . TYR D  4 83  ? -28.697 -14.472 27.090 1.00 62.12  ? 80   TYR D N     1 
ATOM   2707  C  CA    . TYR D  4 83  ? -30.004 -14.269 27.711 1.00 62.99  ? 80   TYR D CA    1 
ATOM   2708  C  C     . TYR D  4 83  ? -30.923 -13.356 26.910 1.00 63.01  ? 80   TYR D C     1 
ATOM   2709  O  O     . TYR D  4 83  ? -32.134 -13.494 26.980 1.00 62.97  ? 80   TYR D O     1 
ATOM   2710  C  CB    . TYR D  4 83  ? -29.845 -13.714 29.130 1.00 63.56  ? 80   TYR D CB    1 
ATOM   2711  C  CG    . TYR D  4 83  ? -29.147 -14.647 30.108 1.00 65.40  ? 80   TYR D CG    1 
ATOM   2712  C  CD1   . TYR D  4 83  ? -28.708 -14.176 31.350 1.00 65.80  ? 80   TYR D CD1   1 
ATOM   2713  C  CD2   . TYR D  4 83  ? -28.916 -16.003 29.796 1.00 66.59  ? 80   TYR D CD2   1 
ATOM   2714  C  CE1   . TYR D  4 83  ? -28.088 -15.017 32.266 1.00 64.99  ? 80   TYR D CE1   1 
ATOM   2715  C  CE2   . TYR D  4 83  ? -28.277 -16.852 30.706 1.00 66.28  ? 80   TYR D CE2   1 
ATOM   2716  C  CZ    . TYR D  4 83  ? -27.872 -16.346 31.943 1.00 65.77  ? 80   TYR D CZ    1 
ATOM   2717  O  OH    . TYR D  4 83  ? -27.241 -17.162 32.856 1.00 65.63  ? 80   TYR D OH    1 
ATOM   2718  N  N     . ASN D  4 84  ? -30.336 -12.442 26.136 1.00 63.75  ? 81   ASN D N     1 
ATOM   2719  C  CA    . ASN D  4 84  ? -31.082 -11.425 25.377 1.00 64.17  ? 81   ASN D CA    1 
ATOM   2720  C  C     . ASN D  4 84  ? -31.060 -11.639 23.860 1.00 64.44  ? 81   ASN D C     1 
ATOM   2721  O  O     . ASN D  4 84  ? -31.374 -10.725 23.095 1.00 65.07  ? 81   ASN D O     1 
ATOM   2722  C  CB    . ASN D  4 84  ? -30.538 -10.021 25.700 1.00 63.96  ? 81   ASN D CB    1 
ATOM   2723  C  CG    . ASN D  4 84  ? -30.832 -9.591  27.119 1.00 64.15  ? 81   ASN D CG    1 
ATOM   2724  O  OD1   . ASN D  4 84  ? -31.928 -9.112  27.423 1.00 64.67  ? 81   ASN D OD1   1 
ATOM   2725  N  ND2   . ASN D  4 84  ? -29.850 -9.752  28.002 1.00 63.73  ? 81   ASN D ND2   1 
ATOM   2726  N  N     . LYS D  4 85  ? -30.679 -12.836 23.428 1.00 64.58  ? 82   LYS D N     1 
ATOM   2727  C  CA    . LYS D  4 85  ? -30.572 -13.187 21.995 1.00 64.57  ? 82   LYS D CA    1 
ATOM   2728  C  C     . LYS D  4 85  ? -29.711 -12.212 21.174 1.00 64.18  ? 82   LYS D C     1 
ATOM   2729  O  O     . LYS D  4 85  ? -30.075 -11.837 20.061 1.00 64.15  ? 82   LYS D O     1 
ATOM   2730  C  CB    . LYS D  4 85  ? -31.954 -13.365 21.353 1.00 64.70  ? 82   LYS D CB    1 
ATOM   2731  C  CG    . LYS D  4 85  ? -32.875 -14.332 22.088 1.00 66.18  ? 82   LYS D CG    1 
ATOM   2732  C  CD    . LYS D  4 85  ? -33.967 -13.602 22.864 1.00 68.69  ? 82   LYS D CD    1 
ATOM   2733  C  CE    . LYS D  4 85  ? -34.708 -14.549 23.822 1.00 70.85  ? 82   LYS D CE    1 
ATOM   2734  N  NZ    . LYS D  4 85  ? -34.914 -15.922 23.248 1.00 71.38  ? 82   LYS D NZ    1 
ATOM   2735  N  N     . ARG D  4 86  ? -28.576 -11.810 21.741 1.00 63.59  ? 83   ARG D N     1 
ATOM   2736  C  CA    . ARG D  4 86  ? -27.652 -10.904 21.084 1.00 63.18  ? 83   ARG D CA    1 
ATOM   2737  C  C     . ARG D  4 86  ? -26.395 -11.667 20.741 1.00 62.50  ? 83   ARG D C     1 
ATOM   2738  O  O     . ARG D  4 86  ? -25.841 -12.370 21.589 1.00 63.08  ? 83   ARG D O     1 
ATOM   2739  C  CB    . ARG D  4 86  ? -27.277 -9.732  22.007 1.00 63.65  ? 83   ARG D CB    1 
ATOM   2740  C  CG    . ARG D  4 86  ? -28.437 -8.870  22.489 1.00 65.18  ? 83   ARG D CG    1 
ATOM   2741  C  CD    . ARG D  4 86  ? -28.722 -7.714  21.541 1.00 68.61  ? 83   ARG D CD    1 
ATOM   2742  N  NE    . ARG D  4 86  ? -30.126 -7.315  21.619 1.00 70.23  ? 83   ARG D NE    1 
ATOM   2743  C  CZ    . ARG D  4 86  ? -31.064 -7.708  20.762 1.00 71.35  ? 83   ARG D CZ    1 
ATOM   2744  N  NH1   . ARG D  4 86  ? -30.757 -8.505  19.737 1.00 72.60  ? 83   ARG D NH1   1 
ATOM   2745  N  NH2   . ARG D  4 86  ? -32.313 -7.300  20.927 1.00 71.43  ? 83   ARG D NH2   1 
ATOM   2746  N  N     . SER D  4 87  ? -25.931 -11.519 19.507 1.00 61.36  ? 84   SER D N     1 
ATOM   2747  C  CA    . SER D  4 87  ? -24.681 -12.124 19.093 1.00 59.98  ? 84   SER D CA    1 
ATOM   2748  C  C     . SER D  4 87  ? -23.458 -11.214 19.281 1.00 59.16  ? 84   SER D C     1 
ATOM   2749  O  O     . SER D  4 87  ? -22.337 -11.604 18.952 1.00 58.63  ? 84   SER D O     1 
ATOM   2750  C  CB    . SER D  4 87  ? -24.797 -12.621 17.645 1.00 60.71  ? 84   SER D CB    1 
ATOM   2751  O  OG    . SER D  4 87  ? -25.033 -11.570 16.727 1.00 60.04  ? 84   SER D OG    1 
ATOM   2752  N  N     . THR D  4 88  ? -23.664 -10.008 19.817 1.00 58.44  ? 85   THR D N     1 
ATOM   2753  C  CA    . THR D  4 88  ? -22.550 -9.052  20.019 1.00 57.67  ? 85   THR D CA    1 
ATOM   2754  C  C     . THR D  4 88  ? -22.325 -8.708  21.498 1.00 56.85  ? 85   THR D C     1 
ATOM   2755  O  O     . THR D  4 88  ? -23.282 -8.454  22.244 1.00 56.59  ? 85   THR D O     1 
ATOM   2756  C  CB    . THR D  4 88  ? -22.729 -7.714  19.203 1.00 57.63  ? 85   THR D CB    1 
ATOM   2757  O  OG1   . THR D  4 88  ? -23.268 -7.980  17.908 1.00 58.24  ? 85   THR D OG1   1 
ATOM   2758  C  CG2   . THR D  4 88  ? -21.397 -6.998  19.009 1.00 57.92  ? 85   THR D CG2   1 
ATOM   2759  N  N     . ILE D  4 89  ? -21.062 -8.716  21.922 1.00 55.86  ? 86   ILE D N     1 
ATOM   2760  C  CA    . ILE D  4 89  ? -20.706 -8.117  23.203 1.00 55.04  ? 86   ILE D CA    1 
ATOM   2761  C  C     . ILE D  4 89  ? -20.258 -6.692  22.900 1.00 54.80  ? 86   ILE D C     1 
ATOM   2762  O  O     . ILE D  4 89  ? -19.248 -6.482  22.227 1.00 54.42  ? 86   ILE D O     1 
ATOM   2763  C  CB    . ILE D  4 89  ? -19.582 -8.866  23.953 1.00 54.67  ? 86   ILE D CB    1 
ATOM   2764  C  CG1   . ILE D  4 89  ? -20.036 -10.247 24.422 1.00 54.50  ? 86   ILE D CG1   1 
ATOM   2765  C  CG2   . ILE D  4 89  ? -19.137 -8.078  25.167 1.00 53.79  ? 86   ILE D CG2   1 
ATOM   2766  C  CD1   . ILE D  4 89  ? -18.863 -11.130 24.840 1.00 51.79  ? 86   ILE D CD1   1 
ATOM   2767  N  N     . THR D  4 90  ? -21.034 -5.727  23.384 1.00 54.48  ? 87   THR D N     1 
ATOM   2768  C  CA    . THR D  4 90  ? -20.700 -4.316  23.271 1.00 54.39  ? 87   THR D CA    1 
ATOM   2769  C  C     . THR D  4 90  ? -20.309 -3.786  24.659 1.00 54.76  ? 87   THR D C     1 
ATOM   2770  O  O     . THR D  4 90  ? -20.429 -4.493  25.667 1.00 55.30  ? 87   THR D O     1 
ATOM   2771  C  CB    . THR D  4 90  ? -21.896 -3.490  22.709 1.00 54.40  ? 87   THR D CB    1 
ATOM   2772  O  OG1   . THR D  4 90  ? -22.882 -3.296  23.735 1.00 54.85  ? 87   THR D OG1   1 
ATOM   2773  C  CG2   . THR D  4 90  ? -22.550 -4.177  21.509 1.00 53.61  ? 87   THR D CG2   1 
ATOM   2774  N  N     . SER D  4 91  ? -19.868 -2.535  24.718 1.00 54.62  ? 88   SER D N     1 
ATOM   2775  C  CA    . SER D  4 91  ? -19.487 -1.897  25.973 1.00 54.12  ? 88   SER D CA    1 
ATOM   2776  C  C     . SER D  4 91  ? -20.659 -1.899  26.946 1.00 54.02  ? 88   SER D C     1 
ATOM   2777  O  O     . SER D  4 91  ? -20.480 -1.786  28.173 1.00 54.10  ? 88   SER D O     1 
ATOM   2778  C  CB    . SER D  4 91  ? -18.990 -0.460  25.714 1.00 54.52  ? 88   SER D CB    1 
ATOM   2779  O  OG    . SER D  4 91  ? -20.028 0.372   25.219 1.00 53.75  ? 88   SER D OG    1 
ATOM   2780  N  N     . ARG D  4 92  ? -21.862 -2.023  26.396 1.00 53.41  ? 89   ARG D N     1 
ATOM   2781  C  CA    . ARG D  4 92  ? -23.067 -2.060  27.219 1.00 53.05  ? 89   ARG D CA    1 
ATOM   2782  C  C     . ARG D  4 92  ? -23.229 -3.417  27.936 1.00 52.48  ? 89   ARG D C     1 
ATOM   2783  O  O     . ARG D  4 92  ? -23.800 -3.499  29.027 1.00 52.65  ? 89   ARG D O     1 
ATOM   2784  C  CB    . ARG D  4 92  ? -24.291 -1.741  26.374 1.00 52.84  ? 89   ARG D CB    1 
ATOM   2785  C  CG    . ARG D  4 92  ? -25.485 -1.465  27.222 1.00 54.57  ? 89   ARG D CG    1 
ATOM   2786  C  CD    . ARG D  4 92  ? -26.697 -1.124  26.415 1.00 56.48  ? 89   ARG D CD    1 
ATOM   2787  N  NE    . ARG D  4 92  ? -27.839 -0.987  27.307 1.00 58.51  ? 89   ARG D NE    1 
ATOM   2788  C  CZ    . ARG D  4 92  ? -28.789 -1.901  27.448 1.00 58.96  ? 89   ARG D CZ    1 
ATOM   2789  N  NH1   . ARG D  4 92  ? -28.748 -3.017  26.730 1.00 59.10  ? 89   ARG D NH1   1 
ATOM   2790  N  NH2   . ARG D  4 92  ? -29.794 -1.682  28.286 1.00 59.30  ? 89   ARG D NH2   1 
ATOM   2791  N  N     . GLU D  4 93  ? -22.740 -4.479  27.295 1.00 51.53  ? 90   GLU D N     1 
ATOM   2792  C  CA    . GLU D  4 93  ? -22.637 -5.779  27.929 1.00 50.02  ? 90   GLU D CA    1 
ATOM   2793  C  C     . GLU D  4 93  ? -21.533 -5.734  28.992 1.00 49.36  ? 90   GLU D C     1 
ATOM   2794  O  O     . GLU D  4 93  ? -21.782 -6.137  30.117 1.00 49.30  ? 90   GLU D O     1 
ATOM   2795  C  CB    . GLU D  4 93  ? -22.418 -6.887  26.893 1.00 49.88  ? 90   GLU D CB    1 
ATOM   2796  C  CG    . GLU D  4 93  ? -23.706 -7.361  26.176 1.00 49.57  ? 90   GLU D CG    1 
ATOM   2797  C  CD    . GLU D  4 93  ? -24.419 -6.253  25.416 1.00 49.74  ? 90   GLU D CD    1 
ATOM   2798  O  OE1   . GLU D  4 93  ? -23.775 -5.604  24.578 1.00 50.70  ? 90   GLU D OE1   1 
ATOM   2799  O  OE2   . GLU D  4 93  ? -25.618 -6.011  25.659 1.00 49.39  ? 90   GLU D OE2   1 
ATOM   2800  N  N     . ILE D  4 94  ? -20.346 -5.205  28.676 1.00 48.16  ? 91   ILE D N     1 
ATOM   2801  C  CA    . ILE D  4 94  ? -19.283 -5.096  29.709 1.00 48.19  ? 91   ILE D CA    1 
ATOM   2802  C  C     . ILE D  4 94  ? -19.760 -4.335  30.949 1.00 48.66  ? 91   ILE D C     1 
ATOM   2803  O  O     . ILE D  4 94  ? -19.424 -4.686  32.072 1.00 48.61  ? 91   ILE D O     1 
ATOM   2804  C  CB    . ILE D  4 94  ? -17.968 -4.421  29.211 1.00 47.64  ? 91   ILE D CB    1 
ATOM   2805  C  CG1   . ILE D  4 94  ? -17.424 -5.075  27.919 1.00 47.35  ? 91   ILE D CG1   1 
ATOM   2806  C  CG2   . ILE D  4 94  ? -16.915 -4.363  30.352 1.00 46.59  ? 91   ILE D CG2   1 
ATOM   2807  C  CD1   . ILE D  4 94  ? -17.056 -6.586  28.024 1.00 45.53  ? 91   ILE D CD1   1 
ATOM   2808  N  N     . GLN D  4 95  ? -20.554 -3.293  30.721 1.00 49.55  ? 92   GLN D N     1 
ATOM   2809  C  CA    . GLN D  4 95  ? -20.978 -2.381  31.772 1.00 49.69  ? 92   GLN D CA    1 
ATOM   2810  C  C     . GLN D  4 95  ? -21.889 -3.072  32.773 1.00 49.13  ? 92   GLN D C     1 
ATOM   2811  O  O     . GLN D  4 95  ? -21.654 -2.991  33.985 1.00 49.20  ? 92   GLN D O     1 
ATOM   2812  C  CB    . GLN D  4 95  ? -21.651 -1.131  31.172 1.00 50.28  ? 92   GLN D CB    1 
ATOM   2813  C  CG    . GLN D  4 95  ? -22.342 -0.249  32.227 1.00 53.18  ? 92   GLN D CG    1 
ATOM   2814  C  CD    . GLN D  4 95  ? -22.452 1.203   31.842 1.00 56.14  ? 92   GLN D CD    1 
ATOM   2815  O  OE1   . GLN D  4 95  ? -23.558 1.740   31.767 1.00 57.69  ? 92   GLN D OE1   1 
ATOM   2816  N  NE2   . GLN D  4 95  ? -21.317 1.857   31.620 1.00 54.08  ? 92   GLN D NE2   1 
ATOM   2817  N  N     . THR D  4 96  ? -22.924 -3.742  32.272 1.00 48.60  ? 93   THR D N     1 
ATOM   2818  C  CA    . THR D  4 96  ? -23.790 -4.552  33.127 1.00 48.72  ? 93   THR D CA    1 
ATOM   2819  C  C     . THR D  4 96  ? -23.050 -5.678  33.866 1.00 47.92  ? 93   THR D C     1 
ATOM   2820  O  O     . THR D  4 96  ? -23.325 -5.931  35.035 1.00 47.50  ? 93   THR D O     1 
ATOM   2821  C  CB    . THR D  4 96  ? -24.957 -5.137  32.340 1.00 49.18  ? 93   THR D CB    1 
ATOM   2822  O  OG1   . THR D  4 96  ? -25.531 -4.105  31.527 1.00 50.88  ? 93   THR D OG1   1 
ATOM   2823  C  CG2   . THR D  4 96  ? -26.034 -5.703  33.295 1.00 49.05  ? 93   THR D CG2   1 
ATOM   2824  N  N     . ALA D  4 97  ? -22.114 -6.330  33.180 1.00 47.30  ? 94   ALA D N     1 
ATOM   2825  C  CA    . ALA D  4 97  ? -21.291 -7.388  33.756 1.00 47.24  ? 94   ALA D CA    1 
ATOM   2826  C  C     . ALA D  4 97  ? -20.501 -6.869  34.940 1.00 47.58  ? 94   ALA D C     1 
ATOM   2827  O  O     . ALA D  4 97  ? -20.278 -7.589  35.916 1.00 47.40  ? 94   ALA D O     1 
ATOM   2828  C  CB    . ALA D  4 97  ? -20.340 -7.925  32.718 1.00 47.68  ? 94   ALA D CB    1 
ATOM   2829  N  N     . VAL D  4 98  ? -20.077 -5.607  34.837 1.00 47.80  ? 95   VAL D N     1 
ATOM   2830  C  CA    . VAL D  4 98  ? -19.277 -4.950  35.863 1.00 47.88  ? 95   VAL D CA    1 
ATOM   2831  C  C     . VAL D  4 98  ? -20.169 -4.643  37.071 1.00 47.81  ? 95   VAL D C     1 
ATOM   2832  O  O     . VAL D  4 98  ? -19.747 -4.765  38.207 1.00 47.97  ? 95   VAL D O     1 
ATOM   2833  C  CB    . VAL D  4 98  ? -18.598 -3.696  35.281 1.00 48.26  ? 95   VAL D CB    1 
ATOM   2834  C  CG1   . VAL D  4 98  ? -17.893 -2.879  36.354 1.00 48.74  ? 95   VAL D CG1   1 
ATOM   2835  C  CG2   . VAL D  4 98  ? -17.627 -4.090  34.167 1.00 46.87  ? 95   VAL D CG2   1 
ATOM   2836  N  N     . ARG D  4 99  ? -21.423 -4.315  36.805 1.00 47.94  ? 96   ARG D N     1 
ATOM   2837  C  CA    . ARG D  4 99  ? -22.404 -4.012  37.845 1.00 48.73  ? 96   ARG D CA    1 
ATOM   2838  C  C     . ARG D  4 99  ? -22.911 -5.261  38.557 1.00 47.18  ? 96   ARG D C     1 
ATOM   2839  O  O     . ARG D  4 99  ? -23.173 -5.227  39.755 1.00 47.51  ? 96   ARG D O     1 
ATOM   2840  C  CB    . ARG D  4 99  ? -23.575 -3.193  37.264 1.00 48.90  ? 96   ARG D CB    1 
ATOM   2841  C  CG    . ARG D  4 99  ? -23.223 -1.716  36.993 1.00 50.81  ? 96   ARG D CG    1 
ATOM   2842  C  CD    . ARG D  4 99  ? -24.340 -1.008  36.201 1.00 52.47  ? 96   ARG D CD    1 
ATOM   2843  N  NE    . ARG D  4 99  ? -24.217 0.457   36.254 1.00 58.83  ? 96   ARG D NE    1 
ATOM   2844  C  CZ    . ARG D  4 99  ? -24.790 1.314   35.396 1.00 61.07  ? 96   ARG D CZ    1 
ATOM   2845  N  NH1   . ARG D  4 99  ? -25.539 0.878   34.376 1.00 59.51  ? 96   ARG D NH1   1 
ATOM   2846  N  NH2   . ARG D  4 99  ? -24.601 2.628   35.559 1.00 62.67  ? 96   ARG D NH2   1 
ATOM   2847  N  N     . LEU D  4 100 ? -23.043 -6.359  37.814 1.00 46.23  ? 97   LEU D N     1 
ATOM   2848  C  CA    . LEU D  4 100 ? -23.294 -7.693  38.397 1.00 44.38  ? 97   LEU D CA    1 
ATOM   2849  C  C     . LEU D  4 100 ? -22.108 -8.196  39.203 1.00 44.49  ? 97   LEU D C     1 
ATOM   2850  O  O     . LEU D  4 100 ? -22.284 -8.630  40.331 1.00 44.67  ? 97   LEU D O     1 
ATOM   2851  C  CB    . LEU D  4 100 ? -23.672 -8.719  37.328 1.00 43.10  ? 97   LEU D CB    1 
ATOM   2852  C  CG    . LEU D  4 100 ? -24.964 -8.456  36.546 1.00 40.48  ? 97   LEU D CG    1 
ATOM   2853  C  CD1   . LEU D  4 100 ? -24.979 -9.268  35.299 1.00 36.24  ? 97   LEU D CD1   1 
ATOM   2854  C  CD2   . LEU D  4 100 ? -26.223 -8.675  37.369 1.00 38.66  ? 97   LEU D CD2   1 
ATOM   2855  N  N     . LEU D  4 101 ? -20.906 -8.088  38.650 1.00 44.45  ? 98   LEU D N     1 
ATOM   2856  C  CA    . LEU D  4 101 ? -19.715 -8.606  39.308 1.00 45.09  ? 98   LEU D CA    1 
ATOM   2857  C  C     . LEU D  4 101 ? -19.156 -7.836  40.518 1.00 45.47  ? 98   LEU D C     1 
ATOM   2858  O  O     . LEU D  4 101 ? -18.847 -8.438  41.534 1.00 46.36  ? 98   LEU D O     1 
ATOM   2859  C  CB    . LEU D  4 101 ? -18.613 -8.859  38.281 1.00 44.90  ? 98   LEU D CB    1 
ATOM   2860  C  CG    . LEU D  4 101 ? -17.484 -9.782  38.779 1.00 45.75  ? 98   LEU D CG    1 
ATOM   2861  C  CD1   . LEU D  4 101 ? -17.911 -11.266 38.738 1.00 43.91  ? 98   LEU D CD1   1 
ATOM   2862  C  CD2   . LEU D  4 101 ? -16.165 -9.541  38.024 1.00 42.13  ? 98   LEU D CD2   1 
ATOM   2863  N  N     . LEU D  4 102 ? -19.015 -6.516  40.414 1.00 46.46  ? 99   LEU D N     1 
ATOM   2864  C  CA    . LEU D  4 102 ? -18.318 -5.727  41.432 1.00 46.04  ? 99   LEU D CA    1 
ATOM   2865  C  C     . LEU D  4 102 ? -19.255 -5.236  42.529 1.00 47.08  ? 99   LEU D C     1 
ATOM   2866  O  O     . LEU D  4 102 ? -20.449 -5.098  42.298 1.00 47.53  ? 99   LEU D O     1 
ATOM   2867  C  CB    . LEU D  4 102 ? -17.577 -4.561  40.779 1.00 45.81  ? 99   LEU D CB    1 
ATOM   2868  C  CG    . LEU D  4 102 ? -16.510 -4.824  39.706 1.00 44.40  ? 99   LEU D CG    1 
ATOM   2869  C  CD1   . LEU D  4 102 ? -15.663 -3.605  39.566 1.00 44.20  ? 99   LEU D CD1   1 
ATOM   2870  C  CD2   . LEU D  4 102 ? -15.612 -5.985  40.042 1.00 42.46  ? 99   LEU D CD2   1 
ATOM   2871  N  N     . PRO D  4 103 ? -18.735 -5.026  43.752 1.00 48.02  ? 100  PRO D N     1 
ATOM   2872  C  CA    . PRO D  4 103 ? -19.582 -4.443  44.791 1.00 48.69  ? 100  PRO D CA    1 
ATOM   2873  C  C     . PRO D  4 103 ? -19.561 -2.907  44.870 1.00 49.85  ? 100  PRO D C     1 
ATOM   2874  O  O     . PRO D  4 103 ? -18.565 -2.261  44.486 1.00 49.74  ? 100  PRO D O     1 
ATOM   2875  C  CB    . PRO D  4 103 ? -19.020 -5.046  46.083 1.00 48.39  ? 100  PRO D CB    1 
ATOM   2876  C  CG    . PRO D  4 103 ? -17.600 -5.445  45.759 1.00 48.22  ? 100  PRO D CG    1 
ATOM   2877  C  CD    . PRO D  4 103 ? -17.401 -5.384  44.267 1.00 48.04  ? 100  PRO D CD    1 
ATOM   2878  N  N     . GLY D  4 104 ? -20.673 -2.354  45.364 1.00 50.45  ? 101  GLY D N     1 
ATOM   2879  C  CA    . GLY D  4 104 ? -20.775 -0.958  45.797 1.00 51.14  ? 101  GLY D CA    1 
ATOM   2880  C  C     . GLY D  4 104 ? -19.972 0.057   45.025 1.00 51.76  ? 101  GLY D C     1 
ATOM   2881  O  O     . GLY D  4 104 ? -20.277 0.341   43.855 1.00 52.31  ? 101  GLY D O     1 
ATOM   2882  N  N     . GLU D  4 105 ? -18.952 0.593   45.694 1.00 51.93  ? 102  GLU D N     1 
ATOM   2883  C  CA    . GLU D  4 105 ? -18.049 1.601   45.145 1.00 52.58  ? 102  GLU D CA    1 
ATOM   2884  C  C     . GLU D  4 105 ? -17.172 1.148   43.998 1.00 52.56  ? 102  GLU D C     1 
ATOM   2885  O  O     . GLU D  4 105 ? -16.808 1.961   43.171 1.00 53.86  ? 102  GLU D O     1 
ATOM   2886  C  CB    . GLU D  4 105 ? -17.114 2.142   46.225 1.00 52.33  ? 102  GLU D CB    1 
ATOM   2887  C  CG    . GLU D  4 105 ? -17.734 3.188   47.099 1.00 55.75  ? 102  GLU D CG    1 
ATOM   2888  C  CD    . GLU D  4 105 ? -18.344 4.318   46.290 1.00 57.41  ? 102  GLU D CD    1 
ATOM   2889  O  OE1   . GLU D  4 105 ? -19.569 4.551   46.435 1.00 57.42  ? 102  GLU D OE1   1 
ATOM   2890  O  OE2   . GLU D  4 105 ? -17.601 4.937   45.489 1.00 57.79  ? 102  GLU D OE2   1 
ATOM   2891  N  N     . LEU D  4 106 ? -16.761 -0.115  43.983 1.00 52.39  ? 103  LEU D N     1 
ATOM   2892  C  CA    . LEU D  4 106 ? -15.914 -0.602  42.903 1.00 51.54  ? 103  LEU D CA    1 
ATOM   2893  C  C     . LEU D  4 106 ? -16.672 -0.559  41.592 1.00 51.49  ? 103  LEU D C     1 
ATOM   2894  O  O     . LEU D  4 106 ? -16.129 -0.126  40.588 1.00 51.33  ? 103  LEU D O     1 
ATOM   2895  C  CB    . LEU D  4 106 ? -15.389 -2.016  43.192 1.00 51.47  ? 103  LEU D CB    1 
ATOM   2896  C  CG    . LEU D  4 106 ? -14.247 -2.177  44.209 1.00 50.57  ? 103  LEU D CG    1 
ATOM   2897  C  CD1   . LEU D  4 106 ? -13.733 -3.600  44.214 1.00 47.27  ? 103  LEU D CD1   1 
ATOM   2898  C  CD2   . LEU D  4 106 ? -13.104 -1.187  43.975 1.00 48.61  ? 103  LEU D CD2   1 
ATOM   2899  N  N     . ALA D  4 107 ? -17.934 -0.984  41.613 1.00 51.91  ? 104  ALA D N     1 
ATOM   2900  C  CA    . ALA D  4 107 ? -18.787 -0.906  40.431 1.00 52.49  ? 104  ALA D CA    1 
ATOM   2901  C  C     . ALA D  4 107 ? -19.000 0.544   39.964 1.00 52.99  ? 104  ALA D C     1 
ATOM   2902  O  O     . ALA D  4 107 ? -18.705 0.863   38.806 1.00 53.31  ? 104  ALA D O     1 
ATOM   2903  C  CB    . ALA D  4 107 ? -20.090 -1.621  40.651 1.00 52.00  ? 104  ALA D CB    1 
ATOM   2904  N  N     . LYS D  4 108 ? -19.448 1.433   40.858 1.00 53.64  ? 105  LYS D N     1 
ATOM   2905  C  CA    . LYS D  4 108 ? -19.609 2.875   40.505 1.00 53.61  ? 105  LYS D CA    1 
ATOM   2906  C  C     . LYS D  4 108 ? -18.366 3.515   39.878 1.00 53.30  ? 105  LYS D C     1 
ATOM   2907  O  O     . LYS D  4 108 ? -18.426 4.098   38.799 1.00 53.54  ? 105  LYS D O     1 
ATOM   2908  C  CB    . LYS D  4 108 ? -20.075 3.692   41.706 1.00 53.71  ? 105  LYS D CB    1 
ATOM   2909  C  CG    . LYS D  4 108 ? -21.542 3.483   42.035 1.00 55.47  ? 105  LYS D CG    1 
ATOM   2910  C  CD    . LYS D  4 108 ? -21.950 4.229   43.292 1.00 60.43  ? 105  LYS D CD    1 
ATOM   2911  C  CE    . LYS D  4 108 ? -22.773 3.322   44.227 1.00 63.12  ? 105  LYS D CE    1 
ATOM   2912  N  NZ    . LYS D  4 108 ? -23.952 2.660   43.540 1.00 63.83  ? 105  LYS D NZ    1 
ATOM   2913  N  N     . HIS D  4 109 ? -17.232 3.396   40.544 1.00 53.18  ? 106  HIS D N     1 
ATOM   2914  C  CA    . HIS D  4 109 ? -16.004 3.935   40.002 1.00 53.44  ? 106  HIS D CA    1 
ATOM   2915  C  C     . HIS D  4 109 ? -15.534 3.292   38.712 1.00 53.23  ? 106  HIS D C     1 
ATOM   2916  O  O     . HIS D  4 109 ? -14.979 3.984   37.849 1.00 53.17  ? 106  HIS D O     1 
ATOM   2917  C  CB    . HIS D  4 109 ? -14.897 3.839   41.024 1.00 54.15  ? 106  HIS D CB    1 
ATOM   2918  C  CG    . HIS D  4 109 ? -14.950 4.903   42.066 1.00 57.13  ? 106  HIS D CG    1 
ATOM   2919  N  ND1   . HIS D  4 109 ? -14.703 6.229   41.784 1.00 60.17  ? 106  HIS D ND1   1 
ATOM   2920  C  CD2   . HIS D  4 109 ? -15.207 4.841   43.391 1.00 60.50  ? 106  HIS D CD2   1 
ATOM   2921  C  CE1   . HIS D  4 109 ? -14.803 6.938   42.892 1.00 61.37  ? 106  HIS D CE1   1 
ATOM   2922  N  NE2   . HIS D  4 109 ? -15.099 6.118   43.884 1.00 62.54  ? 106  HIS D NE2   1 
ATOM   2923  N  N     . ALA D  4 110 ? -15.729 1.977   38.578 1.00 52.97  ? 107  ALA D N     1 
ATOM   2924  C  CA    . ALA D  4 110 ? -15.278 1.263   37.374 1.00 52.68  ? 107  ALA D CA    1 
ATOM   2925  C  C     . ALA D  4 110 ? -16.137 1.613   36.170 1.00 52.13  ? 107  ALA D C     1 
ATOM   2926  O  O     . ALA D  4 110 ? -15.628 1.770   35.065 1.00 52.27  ? 107  ALA D O     1 
ATOM   2927  C  CB    . ALA D  4 110 ? -15.214 -0.275  37.602 1.00 52.79  ? 107  ALA D CB    1 
ATOM   2928  N  N     . VAL D  4 111 ? -17.437 1.738   36.403 1.00 52.21  ? 108  VAL D N     1 
ATOM   2929  C  CA    . VAL D  4 111 ? -18.398 2.169   35.382 1.00 52.53  ? 108  VAL D CA    1 
ATOM   2930  C  C     . VAL D  4 111 ? -18.043 3.533   34.802 1.00 53.14  ? 108  VAL D C     1 
ATOM   2931  O  O     . VAL D  4 111 ? -18.011 3.704   33.580 1.00 53.36  ? 108  VAL D O     1 
ATOM   2932  C  CB    . VAL D  4 111 ? -19.841 2.176   35.932 1.00 52.47  ? 108  VAL D CB    1 
ATOM   2933  C  CG1   . VAL D  4 111 ? -20.794 2.938   35.004 1.00 51.94  ? 108  VAL D CG1   1 
ATOM   2934  C  CG2   . VAL D  4 111 ? -20.320 0.750   36.124 1.00 51.29  ? 108  VAL D CG2   1 
ATOM   2935  N  N     . SER D  4 112 ? -17.745 4.496   35.668 1.00 53.68  ? 109  SER D N     1 
ATOM   2936  C  CA    . SER D  4 112 ? -17.364 5.826   35.186 1.00 53.98  ? 109  SER D CA    1 
ATOM   2937  C  C     . SER D  4 112 ? -16.012 5.857   34.455 1.00 54.19  ? 109  SER D C     1 
ATOM   2938  O  O     . SER D  4 112 ? -15.875 6.564   33.450 1.00 54.57  ? 109  SER D O     1 
ATOM   2939  C  CB    . SER D  4 112 ? -17.457 6.890   36.292 1.00 53.76  ? 109  SER D CB    1 
ATOM   2940  O  OG    . SER D  4 112 ? -16.422 6.749   37.242 1.00 54.15  ? 109  SER D OG    1 
ATOM   2941  N  N     . GLU D  4 113 ? -15.025 5.099   34.929 1.00 54.30  ? 110  GLU D N     1 
ATOM   2942  C  CA    . GLU D  4 113 ? -13.729 5.041   34.229 1.00 54.71  ? 110  GLU D CA    1 
ATOM   2943  C  C     . GLU D  4 113 ? -13.849 4.422   32.846 1.00 54.80  ? 110  GLU D C     1 
ATOM   2944  O  O     . GLU D  4 113 ? -13.081 4.755   31.937 1.00 54.92  ? 110  GLU D O     1 
ATOM   2945  C  CB    . GLU D  4 113 ? -12.703 4.256   35.026 1.00 54.59  ? 110  GLU D CB    1 
ATOM   2946  C  CG    . GLU D  4 113 ? -12.303 4.911   36.329 1.00 57.55  ? 110  GLU D CG    1 
ATOM   2947  C  CD    . GLU D  4 113 ? -10.948 5.580   36.259 1.00 60.25  ? 110  GLU D CD    1 
ATOM   2948  O  OE1   . GLU D  4 113 ? -10.803 6.562   35.491 1.00 60.83  ? 110  GLU D OE1   1 
ATOM   2949  O  OE2   . GLU D  4 113 ? -10.028 5.119   36.982 1.00 61.81  ? 110  GLU D OE2   1 
ATOM   2950  N  N     . GLY D  4 114 ? -14.798 3.498   32.704 1.00 54.95  ? 111  GLY D N     1 
ATOM   2951  C  CA    . GLY D  4 114 ? -14.978 2.766   31.469 1.00 54.82  ? 111  GLY D CA    1 
ATOM   2952  C  C     . GLY D  4 114 ? -15.834 3.550   30.506 1.00 54.75  ? 111  GLY D C     1 
ATOM   2953  O  O     . GLY D  4 114 ? -15.563 3.565   29.312 1.00 53.98  ? 111  GLY D O     1 
ATOM   2954  N  N     . THR D  4 115 ? -16.888 4.167   31.029 1.00 55.59  ? 112  THR D N     1 
ATOM   2955  C  CA    . THR D  4 115 ? -17.631 5.195   30.292 1.00 57.39  ? 112  THR D CA    1 
ATOM   2956  C  C     . THR D  4 115 ? -16.706 6.321   29.803 1.00 58.00  ? 112  THR D C     1 
ATOM   2957  O  O     . THR D  4 115 ? -16.726 6.682   28.629 1.00 58.07  ? 112  THR D O     1 
ATOM   2958  C  CB    . THR D  4 115 ? -18.720 5.833   31.135 1.00 57.17  ? 112  THR D CB    1 
ATOM   2959  O  OG1   . THR D  4 115 ? -19.555 4.810   31.681 1.00 57.41  ? 112  THR D OG1   1 
ATOM   2960  C  CG2   . THR D  4 115 ? -19.561 6.748   30.257 1.00 58.05  ? 112  THR D CG2   1 
ATOM   2961  N  N     . LYS D  4 116 ? -15.885 6.839   30.711 1.00 58.89  ? 113  LYS D N     1 
ATOM   2962  C  CA    . LYS D  4 116 ? -14.865 7.816   30.371 1.00 60.16  ? 113  LYS D CA    1 
ATOM   2963  C  C     . LYS D  4 116 ? -14.063 7.371   29.157 1.00 60.32  ? 113  LYS D C     1 
ATOM   2964  O  O     . LYS D  4 116 ? -13.960 8.107   28.179 1.00 60.76  ? 113  LYS D O     1 
ATOM   2965  C  CB    . LYS D  4 116 ? -13.934 8.058   31.563 1.00 60.36  ? 113  LYS D CB    1 
ATOM   2966  C  CG    . LYS D  4 116 ? -13.074 9.285   31.441 1.00 62.80  ? 113  LYS D CG    1 
ATOM   2967  C  CD    . LYS D  4 116 ? -11.661 9.035   31.956 1.00 68.42  ? 113  LYS D CD    1 
ATOM   2968  C  CE    . LYS D  4 116 ? -11.560 9.115   33.480 1.00 71.44  ? 113  LYS D CE    1 
ATOM   2969  N  NZ    . LYS D  4 116 ? -11.793 10.500  33.992 1.00 73.91  ? 113  LYS D NZ    1 
ATOM   2970  N  N     . ALA D  4 117 ? -13.519 6.162   29.211 1.00 60.56  ? 114  ALA D N     1 
ATOM   2971  C  CA    . ALA D  4 117 ? -12.622 5.684   28.178 1.00 60.86  ? 114  ALA D CA    1 
ATOM   2972  C  C     . ALA D  4 117 ? -13.327 5.501   26.836 1.00 61.44  ? 114  ALA D C     1 
ATOM   2973  O  O     . ALA D  4 117 ? -12.716 5.652   25.795 1.00 62.10  ? 114  ALA D O     1 
ATOM   2974  C  CB    . ALA D  4 117 ? -11.968 4.411   28.617 1.00 60.77  ? 114  ALA D CB    1 
ATOM   2975  N  N     . VAL D  4 118 ? -14.613 5.183   26.851 1.00 62.31  ? 115  VAL D N     1 
ATOM   2976  C  CA    . VAL D  4 118 ? -15.346 4.967   25.603 1.00 62.81  ? 115  VAL D CA    1 
ATOM   2977  C  C     . VAL D  4 118 ? -15.771 6.296   24.972 1.00 63.30  ? 115  VAL D C     1 
ATOM   2978  O  O     . VAL D  4 118 ? -15.685 6.446   23.757 1.00 63.25  ? 115  VAL D O     1 
ATOM   2979  C  CB    . VAL D  4 118 ? -16.535 3.973   25.778 1.00 62.74  ? 115  VAL D CB    1 
ATOM   2980  C  CG1   . VAL D  4 118 ? -17.340 3.837   24.493 1.00 62.43  ? 115  VAL D CG1   1 
ATOM   2981  C  CG2   . VAL D  4 118 ? -16.008 2.613   26.175 1.00 62.95  ? 115  VAL D CG2   1 
ATOM   2982  N  N     . THR D  4 119 ? -16.226 7.244   25.796 1.00 63.98  ? 116  THR D N     1 
ATOM   2983  C  CA    . THR D  4 119 ? -16.432 8.626   25.358 1.00 64.81  ? 116  THR D CA    1 
ATOM   2984  C  C     . THR D  4 119 ? -15.166 9.179   24.691 1.00 65.29  ? 116  THR D C     1 
ATOM   2985  O  O     . THR D  4 119 ? -15.170 9.489   23.503 1.00 65.47  ? 116  THR D O     1 
ATOM   2986  C  CB    . THR D  4 119 ? -16.845 9.563   26.515 1.00 64.87  ? 116  THR D CB    1 
ATOM   2987  O  OG1   . THR D  4 119 ? -17.921 8.993   27.272 1.00 65.50  ? 116  THR D OG1   1 
ATOM   2988  C  CG2   . THR D  4 119 ? -17.341 10.854  25.952 1.00 65.87  ? 116  THR D CG2   1 
ATOM   2989  N  N     . LYS D  4 120 ? -14.082 9.270   25.454 1.00 66.23  ? 117  LYS D N     1 
ATOM   2990  C  CA    . LYS D  4 120 ? -12.786 9.716   24.937 1.00 67.09  ? 117  LYS D CA    1 
ATOM   2991  C  C     . LYS D  4 120 ? -12.322 8.964   23.678 1.00 68.21  ? 117  LYS D C     1 
ATOM   2992  O  O     . LYS D  4 120 ? -11.743 9.569   22.780 1.00 68.63  ? 117  LYS D O     1 
ATOM   2993  C  CB    . LYS D  4 120 ? -11.720 9.668   26.046 1.00 66.71  ? 117  LYS D CB    1 
ATOM   2994  C  CG    . LYS D  4 120 ? -10.291 9.970   25.606 1.00 66.04  ? 117  LYS D CG    1 
ATOM   2995  C  CD    . LYS D  4 120 ? -9.439  10.397  26.793 1.00 66.88  ? 117  LYS D CD    1 
ATOM   2996  C  CE    . LYS D  4 120 ? -7.936  10.202  26.540 1.00 68.88  ? 117  LYS D CE    1 
ATOM   2997  N  NZ    . LYS D  4 120 ? -7.224  11.311  25.799 1.00 70.42  ? 117  LYS D NZ    1 
ATOM   2998  N  N     . TYR D  4 121 ? -12.563 7.659   23.607 1.00 69.42  ? 118  TYR D N     1 
ATOM   2999  C  CA    . TYR D  4 121 ? -12.116 6.879   22.451 1.00 70.71  ? 118  TYR D CA    1 
ATOM   3000  C  C     . TYR D  4 121 ? -12.903 7.209   21.175 1.00 72.24  ? 118  TYR D C     1 
ATOM   3001  O  O     . TYR D  4 121 ? -12.318 7.310   20.094 1.00 72.16  ? 118  TYR D O     1 
ATOM   3002  C  CB    . TYR D  4 121 ? -12.162 5.374   22.752 1.00 70.23  ? 118  TYR D CB    1 
ATOM   3003  C  CG    . TYR D  4 121 ? -11.961 4.467   21.547 1.00 69.07  ? 118  TYR D CG    1 
ATOM   3004  C  CD1   . TYR D  4 121 ? -10.684 4.097   21.129 1.00 67.70  ? 118  TYR D CD1   1 
ATOM   3005  C  CD2   . TYR D  4 121 ? -13.059 3.962   20.843 1.00 68.35  ? 118  TYR D CD2   1 
ATOM   3006  C  CE1   . TYR D  4 121 ? -10.500 3.260   20.030 1.00 67.98  ? 118  TYR D CE1   1 
ATOM   3007  C  CE2   . TYR D  4 121 ? -12.892 3.130   19.743 1.00 67.92  ? 118  TYR D CE2   1 
ATOM   3008  C  CZ    . TYR D  4 121 ? -11.614 2.785   19.340 1.00 68.96  ? 118  TYR D CZ    1 
ATOM   3009  O  OH    . TYR D  4 121 ? -11.457 1.962   18.247 1.00 69.82  ? 118  TYR D OH    1 
ATOM   3010  N  N     . THR D  4 122 ? -14.221 7.365   21.304 1.00 74.28  ? 119  THR D N     1 
ATOM   3011  C  CA    . THR D  4 122 ? -15.086 7.574   20.138 1.00 76.46  ? 119  THR D CA    1 
ATOM   3012  C  C     . THR D  4 122 ? -14.957 8.983   19.569 1.00 78.06  ? 119  THR D C     1 
ATOM   3013  O  O     . THR D  4 122 ? -14.950 9.153   18.344 1.00 78.45  ? 119  THR D O     1 
ATOM   3014  C  CB    . THR D  4 122 ? -16.581 7.227   20.398 1.00 76.37  ? 119  THR D CB    1 
ATOM   3015  O  OG1   . THR D  4 122 ? -17.087 8.010   21.484 1.00 76.61  ? 119  THR D OG1   1 
ATOM   3016  C  CG2   . THR D  4 122 ? -16.749 5.747   20.714 1.00 76.36  ? 119  THR D CG2   1 
ATOM   3017  N  N     . SER D  4 123 ? -14.857 9.987   20.441 1.00 79.72  ? 120  SER D N     1 
ATOM   3018  C  CA    . SER D  4 123 ? -14.490 11.326  19.982 1.00 81.49  ? 120  SER D CA    1 
ATOM   3019  C  C     . SER D  4 123 ? -12.965 11.406  19.848 1.00 82.62  ? 120  SER D C     1 
ATOM   3020  O  O     . SER D  4 123 ? -12.262 11.870  20.758 1.00 82.89  ? 120  SER D O     1 
ATOM   3021  C  CB    . SER D  4 123 ? -15.067 12.432  20.880 1.00 81.44  ? 120  SER D CB    1 
ATOM   3022  O  OG    . SER D  4 123 ? -14.440 12.473  22.150 1.00 82.03  ? 120  SER D OG    1 
ATOM   3023  N  N     . ALA D  4 124 ? -12.478 10.904  18.712 1.00 84.01  ? 121  ALA D N     1 
ATOM   3024  C  CA    . ALA D  4 124 ? -11.058 10.921  18.338 1.00 85.58  ? 121  ALA D CA    1 
ATOM   3025  C  C     . ALA D  4 124 ? -10.849 10.370  16.909 1.00 86.77  ? 121  ALA D C     1 
ATOM   3026  O  O     . ALA D  4 124 ? -10.140 9.363   16.725 1.00 86.88  ? 121  ALA D O     1 
ATOM   3027  C  CB    . ALA D  4 124 ? -10.201 10.140  19.359 1.00 85.19  ? 121  ALA D CB    1 
ATOM   3028  N  N     . LYS D  4 125 ? -11.481 11.031  15.923 1.00 88.01  ? 122  LYS D N     1 
ATOM   3029  C  CA    . LYS D  4 125 ? -11.313 10.759  14.463 1.00 89.31  ? 122  LYS D CA    1 
ATOM   3030  C  C     . LYS D  4 125 ? -12.170 11.652  13.524 1.00 89.71  ? 122  LYS D C     1 
ATOM   3031  O  O     . LYS D  4 125 ? -13.378 11.856  13.729 1.00 89.98  ? 122  LYS D O     1 
ATOM   3032  C  CB    . LYS D  4 125 ? -11.503 9.266   14.103 1.00 89.43  ? 122  LYS D CB    1 
ATOM   3033  C  CG    . LYS D  4 125 ? -10.231 8.597   13.562 1.00 89.76  ? 122  LYS D CG    1 
ATOM   3034  C  CD    . LYS D  4 125 ? -10.442 7.118   13.210 1.00 89.75  ? 122  LYS D CD    1 
ATOM   3035  C  CE    . LYS D  4 125 ? -9.276  6.588   12.361 1.00 90.04  ? 122  LYS D CE    1 
ATOM   3036  N  NZ    . LYS D  4 125 ? -9.048  5.126   12.530 1.00 89.39  ? 122  LYS D NZ    1 
ATOM   3037  O  OXT   . LYS D  4 125 ? -11.679 12.182  12.513 1.00 89.78  ? 122  LYS D OXT   1 
ATOM   3038  N  N     . LYS E  1 37  ? 13.731  -22.199 92.362 1.00 95.50  ? 37   LYS E N     1 
ATOM   3039  C  CA    . LYS E  1 37  ? 13.137  -21.034 91.635 1.00 95.47  ? 37   LYS E CA    1 
ATOM   3040  C  C     . LYS E  1 37  ? 13.278  -21.094 90.089 1.00 94.98  ? 37   LYS E C     1 
ATOM   3041  O  O     . LYS E  1 37  ? 13.651  -20.087 89.461 1.00 95.25  ? 37   LYS E O     1 
ATOM   3042  C  CB    . LYS E  1 37  ? 13.722  -19.720 92.186 1.00 95.67  ? 37   LYS E CB    1 
ATOM   3043  C  CG    . LYS E  1 37  ? 13.085  -19.228 93.489 1.00 96.45  ? 37   LYS E CG    1 
ATOM   3044  C  CD    . LYS E  1 37  ? 11.789  -18.446 93.227 1.00 97.07  ? 37   LYS E CD    1 
ATOM   3045  C  CE    . LYS E  1 37  ? 11.342  -17.675 94.465 1.00 97.46  ? 37   LYS E CE    1 
ATOM   3046  N  NZ    . LYS E  1 37  ? 10.353  -16.602 94.143 1.00 96.80  ? 37   LYS E NZ    1 
ATOM   3047  N  N     . PRO E  1 38  ? 12.979  -22.265 89.469 1.00 94.20  ? 38   PRO E N     1 
ATOM   3048  C  CA    . PRO E  1 38  ? 12.964  -22.330 87.995 1.00 93.34  ? 38   PRO E CA    1 
ATOM   3049  C  C     . PRO E  1 38  ? 11.718  -21.662 87.395 1.00 92.32  ? 38   PRO E C     1 
ATOM   3050  O  O     . PRO E  1 38  ? 10.667  -21.588 88.045 1.00 92.48  ? 38   PRO E O     1 
ATOM   3051  C  CB    . PRO E  1 38  ? 12.958  -23.840 87.699 1.00 93.38  ? 38   PRO E CB    1 
ATOM   3052  C  CG    . PRO E  1 38  ? 13.193  -24.522 89.030 1.00 93.95  ? 38   PRO E CG    1 
ATOM   3053  C  CD    . PRO E  1 38  ? 12.663  -23.577 90.058 1.00 94.17  ? 38   PRO E CD    1 
ATOM   3054  N  N     . HIS E  1 39  ? 11.838  -21.186 86.161 1.00 90.78  ? 39   HIS E N     1 
ATOM   3055  C  CA    . HIS E  1 39  ? 10.798  -20.357 85.554 1.00 89.31  ? 39   HIS E CA    1 
ATOM   3056  C  C     . HIS E  1 39  ? 9.784   -21.164 84.733 1.00 87.76  ? 39   HIS E C     1 
ATOM   3057  O  O     . HIS E  1 39  ? 10.159  -22.120 84.032 1.00 87.63  ? 39   HIS E O     1 
ATOM   3058  C  CB    . HIS E  1 39  ? 11.455  -19.263 84.704 1.00 89.66  ? 39   HIS E CB    1 
ATOM   3059  C  CG    . HIS E  1 39  ? 10.505  -18.517 83.821 1.00 90.75  ? 39   HIS E CG    1 
ATOM   3060  N  ND1   . HIS E  1 39  ? 10.243  -18.899 82.522 1.00 91.60  ? 39   HIS E ND1   1 
ATOM   3061  C  CD2   . HIS E  1 39  ? 9.765   -17.405 84.046 1.00 91.97  ? 39   HIS E CD2   1 
ATOM   3062  C  CE1   . HIS E  1 39  ? 9.376   -18.058 81.988 1.00 92.05  ? 39   HIS E CE1   1 
ATOM   3063  N  NE2   . HIS E  1 39  ? 9.070   -17.143 82.891 1.00 92.31  ? 39   HIS E NE2   1 
ATOM   3064  N  N     . ARG E  1 40  ? 8.508   -20.770 84.834 1.00 85.51  ? 40   ARG E N     1 
ATOM   3065  C  CA    . ARG E  1 40  ? 7.423   -21.356 84.031 1.00 83.32  ? 40   ARG E CA    1 
ATOM   3066  C  C     . ARG E  1 40  ? 6.342   -20.360 83.612 1.00 81.55  ? 40   ARG E C     1 
ATOM   3067  O  O     . ARG E  1 40  ? 5.689   -19.742 84.461 1.00 81.09  ? 40   ARG E O     1 
ATOM   3068  C  CB    . ARG E  1 40  ? 6.766   -22.535 84.760 1.00 83.50  ? 40   ARG E CB    1 
ATOM   3069  C  CG    . ARG E  1 40  ? 7.429   -23.870 84.498 1.00 83.74  ? 40   ARG E CG    1 
ATOM   3070  C  CD    . ARG E  1 40  ? 6.620   -25.019 85.069 1.00 84.63  ? 40   ARG E CD    1 
ATOM   3071  N  NE    . ARG E  1 40  ? 5.705   -25.606 84.091 1.00 84.74  ? 40   ARG E NE    1 
ATOM   3072  C  CZ    . ARG E  1 40  ? 6.032   -26.567 83.226 1.00 84.46  ? 40   ARG E CZ    1 
ATOM   3073  N  NH1   . ARG E  1 40  ? 7.266   -27.065 83.193 1.00 84.14  ? 40   ARG E NH1   1 
ATOM   3074  N  NH2   . ARG E  1 40  ? 5.117   -27.035 82.389 1.00 83.84  ? 40   ARG E NH2   1 
ATOM   3075  N  N     . TYR E  1 41  ? 6.151   -20.218 82.299 1.00 79.33  ? 41   TYR E N     1 
ATOM   3076  C  CA    . TYR E  1 41  ? 4.967   -19.527 81.786 1.00 77.27  ? 41   TYR E CA    1 
ATOM   3077  C  C     . TYR E  1 41  ? 3.760   -20.406 82.044 1.00 76.06  ? 41   TYR E C     1 
ATOM   3078  O  O     . TYR E  1 41  ? 3.840   -21.635 81.991 1.00 76.12  ? 41   TYR E O     1 
ATOM   3079  C  CB    . TYR E  1 41  ? 5.074   -19.186 80.295 1.00 76.92  ? 41   TYR E CB    1 
ATOM   3080  C  CG    . TYR E  1 41  ? 6.149   -18.182 79.995 1.00 76.22  ? 41   TYR E CG    1 
ATOM   3081  C  CD1   . TYR E  1 41  ? 7.263   -18.536 79.244 1.00 75.70  ? 41   TYR E CD1   1 
ATOM   3082  C  CD2   . TYR E  1 41  ? 6.069   -16.883 80.487 1.00 75.97  ? 41   TYR E CD2   1 
ATOM   3083  C  CE1   . TYR E  1 41  ? 8.263   -17.623 78.981 1.00 76.05  ? 41   TYR E CE1   1 
ATOM   3084  C  CE2   . TYR E  1 41  ? 7.064   -15.960 80.235 1.00 75.66  ? 41   TYR E CE2   1 
ATOM   3085  C  CZ    . TYR E  1 41  ? 8.158   -16.334 79.481 1.00 76.14  ? 41   TYR E CZ    1 
ATOM   3086  O  OH    . TYR E  1 41  ? 9.154   -15.421 79.230 1.00 76.51  ? 41   TYR E OH    1 
ATOM   3087  N  N     . ARG E  1 42  ? 2.646   -19.764 82.348 1.00 74.32  ? 42   ARG E N     1 
ATOM   3088  C  CA    . ARG E  1 42  ? 1.430   -20.471 82.683 1.00 72.56  ? 42   ARG E CA    1 
ATOM   3089  C  C     . ARG E  1 42  ? 0.740   -21.013 81.427 1.00 70.82  ? 42   ARG E C     1 
ATOM   3090  O  O     . ARG E  1 42  ? 0.983   -20.518 80.317 1.00 70.67  ? 42   ARG E O     1 
ATOM   3091  C  CB    . ARG E  1 42  ? 0.544   -19.553 83.515 1.00 72.72  ? 42   ARG E CB    1 
ATOM   3092  C  CG    . ARG E  1 42  ? 1.108   -19.380 84.940 1.00 74.72  ? 42   ARG E CG    1 
ATOM   3093  C  CD    . ARG E  1 42  ? 0.513   -18.190 85.670 1.00 77.57  ? 42   ARG E CD    1 
ATOM   3094  N  NE    . ARG E  1 42  ? -0.940  -18.155 85.530 1.00 79.54  ? 42   ARG E NE    1 
ATOM   3095  C  CZ    . ARG E  1 42  ? -1.687  -17.066 85.683 1.00 80.88  ? 42   ARG E CZ    1 
ATOM   3096  N  NH1   . ARG E  1 42  ? -1.124  -15.897 85.987 1.00 81.49  ? 42   ARG E NH1   1 
ATOM   3097  N  NH2   . ARG E  1 42  ? -3.003  -17.152 85.528 1.00 80.66  ? 42   ARG E NH2   1 
ATOM   3098  N  N     . PRO E  1 43  ? -0.082  -22.071 81.578 1.00 69.06  ? 43   PRO E N     1 
ATOM   3099  C  CA    . PRO E  1 43  ? -0.763  -22.582 80.393 1.00 67.45  ? 43   PRO E CA    1 
ATOM   3100  C  C     . PRO E  1 43  ? -1.544  -21.497 79.647 1.00 65.94  ? 43   PRO E C     1 
ATOM   3101  O  O     . PRO E  1 43  ? -2.467  -20.890 80.201 1.00 65.81  ? 43   PRO E O     1 
ATOM   3102  C  CB    . PRO E  1 43  ? -1.703  -23.646 80.966 1.00 67.31  ? 43   PRO E CB    1 
ATOM   3103  C  CG    . PRO E  1 43  ? -1.032  -24.104 82.192 1.00 67.76  ? 43   PRO E CG    1 
ATOM   3104  C  CD    . PRO E  1 43  ? -0.414  -22.866 82.775 1.00 68.77  ? 43   PRO E CD    1 
ATOM   3105  N  N     . GLY E  1 44  ? -1.143  -21.251 78.403 1.00 64.25  ? 44   GLY E N     1 
ATOM   3106  C  CA    . GLY E  1 44  ? -1.858  -20.345 77.512 1.00 62.04  ? 44   GLY E CA    1 
ATOM   3107  C  C     . GLY E  1 44  ? -1.024  -19.180 77.028 1.00 60.75  ? 44   GLY E C     1 
ATOM   3108  O  O     . GLY E  1 44  ? -1.392  -18.514 76.068 1.00 61.06  ? 44   GLY E O     1 
ATOM   3109  N  N     . THR E  1 45  ? 0.100   -18.934 77.698 1.00 59.18  ? 45   THR E N     1 
ATOM   3110  C  CA    . THR E  1 45  ? 0.931   -17.772 77.431 1.00 57.22  ? 45   THR E CA    1 
ATOM   3111  C  C     . THR E  1 45  ? 1.788   -17.998 76.198 1.00 56.27  ? 45   THR E C     1 
ATOM   3112  O  O     . THR E  1 45  ? 1.979   -17.073 75.407 1.00 56.57  ? 45   THR E O     1 
ATOM   3113  C  CB    . THR E  1 45  ? 1.804   -17.376 78.677 1.00 57.27  ? 45   THR E CB    1 
ATOM   3114  O  OG1   . THR E  1 45  ? 0.951   -17.135 79.800 1.00 56.92  ? 45   THR E OG1   1 
ATOM   3115  C  CG2   . THR E  1 45  ? 2.589   -16.112 78.429 1.00 56.46  ? 45   THR E CG2   1 
ATOM   3116  N  N     . VAL E  1 46  ? 2.300   -19.217 76.030 1.00 54.69  ? 46   VAL E N     1 
ATOM   3117  C  CA    . VAL E  1 46  ? 3.100   -19.543 74.852 1.00 52.96  ? 46   VAL E CA    1 
ATOM   3118  C  C     . VAL E  1 46  ? 2.180   -19.786 73.654 1.00 52.77  ? 46   VAL E C     1 
ATOM   3119  O  O     . VAL E  1 46  ? 2.557   -19.506 72.507 1.00 52.91  ? 46   VAL E O     1 
ATOM   3120  C  CB    . VAL E  1 46  ? 4.044   -20.729 75.099 1.00 52.74  ? 46   VAL E CB    1 
ATOM   3121  C  CG1   . VAL E  1 46  ? 4.976   -20.943 73.917 1.00 51.79  ? 46   VAL E CG1   1 
ATOM   3122  C  CG2   . VAL E  1 46  ? 4.856   -20.482 76.352 1.00 52.31  ? 46   VAL E CG2   1 
ATOM   3123  N  N     . ALA E  1 47  ? 0.972   -20.282 73.929 1.00 51.45  ? 47   ALA E N     1 
ATOM   3124  C  CA    . ALA E  1 47  ? -0.029  -20.493 72.902 1.00 50.93  ? 47   ALA E CA    1 
ATOM   3125  C  C     . ALA E  1 47  ? -0.342  -19.162 72.217 1.00 50.24  ? 47   ALA E C     1 
ATOM   3126  O  O     . ALA E  1 47  ? -0.153  -19.026 71.004 1.00 50.17  ? 47   ALA E O     1 
ATOM   3127  C  CB    . ALA E  1 47  ? -1.294  -21.146 73.498 1.00 50.69  ? 47   ALA E CB    1 
ATOM   3128  N  N     . LEU E  1 48  ? -0.763  -18.176 73.008 1.00 50.14  ? 48   LEU E N     1 
ATOM   3129  C  CA    . LEU E  1 48  ? -1.030  -16.791 72.538 1.00 49.78  ? 48   LEU E CA    1 
ATOM   3130  C  C     . LEU E  1 48  ? 0.162   -16.161 71.835 1.00 49.15  ? 48   LEU E C     1 
ATOM   3131  O  O     . LEU E  1 48  ? 0.014   -15.476 70.834 1.00 48.50  ? 48   LEU E O     1 
ATOM   3132  C  CB    . LEU E  1 48  ? -1.435  -15.901 73.701 1.00 49.43  ? 48   LEU E CB    1 
ATOM   3133  C  CG    . LEU E  1 48  ? -2.826  -16.095 74.278 1.00 51.49  ? 48   LEU E CG    1 
ATOM   3134  C  CD1   . LEU E  1 48  ? -2.878  -15.484 75.692 1.00 51.19  ? 48   LEU E CD1   1 
ATOM   3135  C  CD2   . LEU E  1 48  ? -3.940  -15.524 73.354 1.00 50.64  ? 48   LEU E CD2   1 
ATOM   3136  N  N     . ARG E  1 49  ? 1.341   -16.409 72.378 1.00 49.16  ? 49   ARG E N     1 
ATOM   3137  C  CA    . ARG E  1 49  ? 2.569   -15.935 71.794 1.00 50.19  ? 49   ARG E CA    1 
ATOM   3138  C  C     . ARG E  1 49  ? 2.809   -16.530 70.417 1.00 50.07  ? 49   ARG E C     1 
ATOM   3139  O  O     . ARG E  1 49  ? 3.258   -15.834 69.501 1.00 50.89  ? 49   ARG E O     1 
ATOM   3140  C  CB    . ARG E  1 49  ? 3.728   -16.273 72.718 1.00 50.14  ? 49   ARG E CB    1 
ATOM   3141  C  CG    . ARG E  1 49  ? 5.085   -15.751 72.207 1.00 52.03  ? 49   ARG E CG    1 
ATOM   3142  C  CD    . ARG E  1 49  ? 6.230   -16.121 73.155 1.00 51.60  ? 49   ARG E CD    1 
ATOM   3143  N  NE    . ARG E  1 49  ? 5.852   -15.965 74.560 1.00 53.55  ? 49   ARG E NE    1 
ATOM   3144  C  CZ    . ARG E  1 49  ? 6.454   -16.602 75.555 1.00 56.29  ? 49   ARG E CZ    1 
ATOM   3145  N  NH1   . ARG E  1 49  ? 7.468   -17.427 75.294 1.00 56.92  ? 49   ARG E NH1   1 
ATOM   3146  N  NH2   . ARG E  1 49  ? 6.041   -16.420 76.809 1.00 56.65  ? 49   ARG E NH2   1 
ATOM   3147  N  N     . GLU E  1 50  ? 2.520   -17.827 70.289 1.00 49.96  ? 50   GLU E N     1 
ATOM   3148  C  CA    . GLU E  1 50  ? 2.635   -18.567 69.022 1.00 49.41  ? 50   GLU E CA    1 
ATOM   3149  C  C     . GLU E  1 50  ? 1.619   -18.089 67.961 1.00 47.60  ? 50   GLU E C     1 
ATOM   3150  O  O     . GLU E  1 50  ? 1.983   -17.922 66.799 1.00 46.71  ? 50   GLU E O     1 
ATOM   3151  C  CB    . GLU E  1 50  ? 2.511   -20.076 69.269 1.00 48.98  ? 50   GLU E CB    1 
ATOM   3152  C  CG    . GLU E  1 50  ? 3.710   -20.705 69.939 1.00 50.22  ? 50   GLU E CG    1 
ATOM   3153  C  CD    . GLU E  1 50  ? 3.617   -22.230 70.030 1.00 52.59  ? 50   GLU E CD    1 
ATOM   3154  O  OE1   . GLU E  1 50  ? 4.683   -22.863 70.193 1.00 56.88  ? 50   GLU E OE1   1 
ATOM   3155  O  OE2   . GLU E  1 50  ? 2.495   -22.808 69.931 1.00 57.91  ? 50   GLU E OE2   1 
ATOM   3156  N  N     . ILE E  1 51  ? 0.368   -17.872 68.367 1.00 46.13  ? 51   ILE E N     1 
ATOM   3157  C  CA    . ILE E  1 51  ? -0.614  -17.193 67.515 1.00 45.66  ? 51   ILE E CA    1 
ATOM   3158  C  C     . ILE E  1 51  ? -0.054  -15.890 66.891 1.00 46.78  ? 51   ILE E C     1 
ATOM   3159  O  O     . ILE E  1 51  ? -0.051  -15.728 65.659 1.00 47.09  ? 51   ILE E O     1 
ATOM   3160  C  CB    . ILE E  1 51  ? -1.917  -16.864 68.274 1.00 45.55  ? 51   ILE E CB    1 
ATOM   3161  C  CG1   . ILE E  1 51  ? -2.558  -18.140 68.848 1.00 43.93  ? 51   ILE E CG1   1 
ATOM   3162  C  CG2   . ILE E  1 51  ? -2.867  -16.064 67.375 1.00 44.51  ? 51   ILE E CG2   1 
ATOM   3163  C  CD1   . ILE E  1 51  ? -3.790  -17.891 69.708 1.00 44.37  ? 51   ILE E CD1   1 
ATOM   3164  N  N     . ARG E  1 52  ? 0.429   -14.972 67.728 1.00 47.25  ? 52   ARG E N     1 
ATOM   3165  C  CA    . ARG E  1 52  ? 1.042   -13.743 67.235 1.00 48.23  ? 52   ARG E CA    1 
ATOM   3166  C  C     . ARG E  1 52  ? 2.173   -14.013 66.261 1.00 48.11  ? 52   ARG E C     1 
ATOM   3167  O  O     . ARG E  1 52  ? 2.255   -13.392 65.214 1.00 48.87  ? 52   ARG E O     1 
ATOM   3168  C  CB    . ARG E  1 52  ? 1.535   -12.871 68.388 1.00 48.78  ? 52   ARG E CB    1 
ATOM   3169  C  CG    . ARG E  1 52  ? 0.393   -12.379 69.279 1.00 51.12  ? 52   ARG E CG    1 
ATOM   3170  C  CD    . ARG E  1 52  ? 0.871   -11.563 70.462 1.00 52.69  ? 52   ARG E CD    1 
ATOM   3171  N  NE    . ARG E  1 52  ? -0.151  -11.561 71.508 1.00 54.68  ? 52   ARG E NE    1 
ATOM   3172  C  CZ    . ARG E  1 52  ? 0.021   -12.089 72.720 1.00 57.16  ? 52   ARG E CZ    1 
ATOM   3173  N  NH1   . ARG E  1 52  ? 1.203   -12.642 73.067 1.00 55.97  ? 52   ARG E NH1   1 
ATOM   3174  N  NH2   . ARG E  1 52  ? -0.978  -12.035 73.601 1.00 57.04  ? 52   ARG E NH2   1 
ATOM   3175  N  N     . ARG E  1 53  ? 3.035   -14.956 66.594 1.00 48.26  ? 53   ARG E N     1 
ATOM   3176  C  CA    . ARG E  1 53  ? 4.149   -15.290 65.721 1.00 48.29  ? 53   ARG E CA    1 
ATOM   3177  C  C     . ARG E  1 53  ? 3.681   -15.756 64.347 1.00 47.94  ? 53   ARG E C     1 
ATOM   3178  O  O     . ARG E  1 53  ? 4.142   -15.254 63.321 1.00 49.06  ? 53   ARG E O     1 
ATOM   3179  C  CB    . ARG E  1 53  ? 5.011   -16.361 66.366 1.00 48.51  ? 53   ARG E CB    1 
ATOM   3180  C  CG    . ARG E  1 53  ? 6.103   -16.809 65.458 1.00 50.09  ? 53   ARG E CG    1 
ATOM   3181  C  CD    . ARG E  1 53  ? 6.889   -17.961 66.013 1.00 52.27  ? 53   ARG E CD    1 
ATOM   3182  N  NE    . ARG E  1 53  ? 7.789   -18.441 64.967 1.00 53.87  ? 53   ARG E NE    1 
ATOM   3183  C  CZ    . ARG E  1 53  ? 8.738   -19.348 65.156 1.00 55.42  ? 53   ARG E CZ    1 
ATOM   3184  N  NH1   . ARG E  1 53  ? 8.929   -19.882 66.363 1.00 55.72  ? 53   ARG E NH1   1 
ATOM   3185  N  NH2   . ARG E  1 53  ? 9.506   -19.707 64.138 1.00 56.62  ? 53   ARG E NH2   1 
ATOM   3186  N  N     . TYR E  1 54  ? 2.753   -16.708 64.338 1.00 47.03  ? 54   TYR E N     1 
ATOM   3187  C  CA    . TYR E  1 54  ? 2.263   -17.311 63.102 1.00 45.87  ? 54   TYR E CA    1 
ATOM   3188  C  C     . TYR E  1 54  ? 1.271   -16.451 62.316 1.00 46.24  ? 54   TYR E C     1 
ATOM   3189  O  O     . TYR E  1 54  ? 1.267   -16.494 61.092 1.00 46.23  ? 54   TYR E O     1 
ATOM   3190  C  CB    . TYR E  1 54  ? 1.765   -18.751 63.352 1.00 44.15  ? 54   TYR E CB    1 
ATOM   3191  C  CG    . TYR E  1 54  ? 2.911   -19.631 63.762 1.00 41.50  ? 54   TYR E CG    1 
ATOM   3192  C  CD1   . TYR E  1 54  ? 2.922   -20.294 65.002 1.00 40.18  ? 54   TYR E CD1   1 
ATOM   3193  C  CD2   . TYR E  1 54  ? 4.030   -19.747 62.943 1.00 36.86  ? 54   TYR E CD2   1 
ATOM   3194  C  CE1   . TYR E  1 54  ? 4.027   -21.066 65.394 1.00 38.78  ? 54   TYR E CE1   1 
ATOM   3195  C  CE2   . TYR E  1 54  ? 5.123   -20.497 63.322 1.00 35.95  ? 54   TYR E CE2   1 
ATOM   3196  C  CZ    . TYR E  1 54  ? 5.124   -21.149 64.537 1.00 39.02  ? 54   TYR E CZ    1 
ATOM   3197  O  OH    . TYR E  1 54  ? 6.216   -21.914 64.876 1.00 42.39  ? 54   TYR E OH    1 
ATOM   3198  N  N     . GLN E  1 55  ? 0.441   -15.668 62.996 1.00 47.26  ? 55   GLN E N     1 
ATOM   3199  C  CA    . GLN E  1 55  ? -0.408  -14.703 62.266 1.00 48.43  ? 55   GLN E CA    1 
ATOM   3200  C  C     . GLN E  1 55  ? 0.401   -13.610 61.549 1.00 49.14  ? 55   GLN E C     1 
ATOM   3201  O  O     . GLN E  1 55  ? -0.056  -13.045 60.562 1.00 50.11  ? 55   GLN E O     1 
ATOM   3202  C  CB    . GLN E  1 55  ? -1.525  -14.149 63.145 1.00 47.44  ? 55   GLN E CB    1 
ATOM   3203  C  CG    . GLN E  1 55  ? -2.759  -15.018 63.029 1.00 48.73  ? 55   GLN E CG    1 
ATOM   3204  C  CD    . GLN E  1 55  ? -3.804  -14.765 64.076 1.00 48.52  ? 55   GLN E CD    1 
ATOM   3205  O  OE1   . GLN E  1 55  ? -3.821  -13.718 64.700 1.00 51.29  ? 55   GLN E OE1   1 
ATOM   3206  N  NE2   . GLN E  1 55  ? -4.708  -15.718 64.256 1.00 47.41  ? 55   GLN E NE2   1 
ATOM   3207  N  N     . LYS E  1 56  ? 1.625   -13.393 62.026 1.00 49.80  ? 56   LYS E N     1 
ATOM   3208  C  CA    . LYS E  1 56  ? 2.565   -12.388 61.557 1.00 50.81  ? 56   LYS E CA    1 
ATOM   3209  C  C     . LYS E  1 56  ? 3.366   -12.817 60.321 1.00 50.47  ? 56   LYS E C     1 
ATOM   3210  O  O     . LYS E  1 56  ? 3.892   -11.970 59.581 1.00 50.74  ? 56   LYS E O     1 
ATOM   3211  C  CB    . LYS E  1 56  ? 3.545   -12.109 62.709 1.00 50.95  ? 56   LYS E CB    1 
ATOM   3212  C  CG    . LYS E  1 56  ? 4.089   -10.704 62.811 1.00 52.62  ? 56   LYS E CG    1 
ATOM   3213  C  CD    . LYS E  1 56  ? 4.997   -10.544 64.051 1.00 53.28  ? 56   LYS E CD    1 
ATOM   3214  C  CE    . LYS E  1 56  ? 5.784   -9.217  63.970 1.00 59.27  ? 56   LYS E CE    1 
ATOM   3215  N  NZ    . LYS E  1 56  ? 7.182   -9.275  64.555 1.00 61.82  ? 56   LYS E NZ    1 
ATOM   3216  N  N     . SER E  1 57  ? 3.513   -14.121 60.109 1.00 50.39  ? 57   SER E N     1 
ATOM   3217  C  CA    . SER E  1 57  ? 4.290   -14.597 58.959 1.00 50.02  ? 57   SER E CA    1 
ATOM   3218  C  C     . SER E  1 57  ? 3.441   -15.246 57.873 1.00 49.16  ? 57   SER E C     1 
ATOM   3219  O  O     . SER E  1 57  ? 2.226   -15.446 58.036 1.00 48.52  ? 57   SER E O     1 
ATOM   3220  C  CB    . SER E  1 57  ? 5.451   -15.490 59.390 1.00 50.27  ? 57   SER E CB    1 
ATOM   3221  O  OG    . SER E  1 57  ? 5.001   -16.570 60.196 1.00 53.17  ? 57   SER E OG    1 
ATOM   3222  N  N     . THR E  1 58  ? 4.095   -15.527 56.745 1.00 48.67  ? 58   THR E N     1 
ATOM   3223  C  CA    . THR E  1 58  ? 3.455   -16.155 55.588 1.00 48.08  ? 58   THR E CA    1 
ATOM   3224  C  C     . THR E  1 58  ? 4.113   -17.487 55.134 1.00 48.19  ? 58   THR E C     1 
ATOM   3225  O  O     . THR E  1 58  ? 3.649   -18.109 54.161 1.00 48.56  ? 58   THR E O     1 
ATOM   3226  C  CB    . THR E  1 58  ? 3.464   -15.189 54.396 1.00 48.15  ? 58   THR E CB    1 
ATOM   3227  O  OG1   . THR E  1 58  ? 4.797   -15.076 53.891 1.00 47.02  ? 58   THR E OG1   1 
ATOM   3228  C  CG2   . THR E  1 58  ? 2.963   -13.816 54.797 1.00 47.91  ? 58   THR E CG2   1 
ATOM   3229  N  N     . GLU E  1 59  ? 5.191   -17.900 55.815 1.00 47.68  ? 59   GLU E N     1 
ATOM   3230  C  CA    . GLU E  1 59  ? 5.938   -19.129 55.508 1.00 47.31  ? 59   GLU E CA    1 
ATOM   3231  C  C     . GLU E  1 59  ? 5.000   -20.340 55.603 1.00 47.20  ? 59   GLU E C     1 
ATOM   3232  O  O     . GLU E  1 59  ? 4.091   -20.355 56.440 1.00 46.91  ? 59   GLU E O     1 
ATOM   3233  C  CB    . GLU E  1 59  ? 7.084   -19.298 56.501 1.00 47.04  ? 59   GLU E CB    1 
ATOM   3234  C  CG    . GLU E  1 59  ? 6.652   -20.043 57.745 1.00 49.09  ? 59   GLU E CG    1 
ATOM   3235  C  CD    . GLU E  1 59  ? 7.184   -19.476 59.034 1.00 52.85  ? 59   GLU E CD    1 
ATOM   3236  O  OE1   . GLU E  1 59  ? 8.372   -19.698 59.297 1.00 53.96  ? 59   GLU E OE1   1 
ATOM   3237  O  OE2   . GLU E  1 59  ? 6.413   -18.825 59.795 1.00 55.62  ? 59   GLU E OE2   1 
ATOM   3238  N  N     . LEU E  1 60  ? 5.193   -21.336 54.738 1.00 46.98  ? 60   LEU E N     1 
ATOM   3239  C  CA    . LEU E  1 60  ? 4.413   -22.568 54.843 1.00 46.72  ? 60   LEU E CA    1 
ATOM   3240  C  C     . LEU E  1 60  ? 4.790   -23.304 56.132 1.00 46.61  ? 60   LEU E C     1 
ATOM   3241  O  O     . LEU E  1 60  ? 5.951   -23.319 56.533 1.00 47.15  ? 60   LEU E O     1 
ATOM   3242  C  CB    . LEU E  1 60  ? 4.626   -23.434 53.614 1.00 46.78  ? 60   LEU E CB    1 
ATOM   3243  C  CG    . LEU E  1 60  ? 3.536   -23.545 52.537 1.00 46.98  ? 60   LEU E CG    1 
ATOM   3244  C  CD1   . LEU E  1 60  ? 2.492   -22.431 52.570 1.00 47.53  ? 60   LEU E CD1   1 
ATOM   3245  C  CD2   . LEU E  1 60  ? 4.163   -23.684 51.171 1.00 44.13  ? 60   LEU E CD2   1 
ATOM   3246  N  N     . LEU E  1 61  ? 3.803   -23.886 56.796 1.00 46.38  ? 61   LEU E N     1 
ATOM   3247  C  CA    . LEU E  1 61  ? 3.990   -24.430 58.141 1.00 45.92  ? 61   LEU E CA    1 
ATOM   3248  C  C     . LEU E  1 61  ? 4.195   -25.973 58.252 1.00 46.32  ? 61   LEU E C     1 
ATOM   3249  O  O     . LEU E  1 61  ? 4.648   -26.466 59.279 1.00 46.25  ? 61   LEU E O     1 
ATOM   3250  C  CB    . LEU E  1 61  ? 2.861   -23.924 59.051 1.00 45.23  ? 61   LEU E CB    1 
ATOM   3251  C  CG    . LEU E  1 61  ? 2.775   -22.398 59.264 1.00 43.13  ? 61   LEU E CG    1 
ATOM   3252  C  CD1   . LEU E  1 61  ? 1.549   -22.021 60.070 1.00 39.23  ? 61   LEU E CD1   1 
ATOM   3253  C  CD2   . LEU E  1 61  ? 4.032   -21.832 59.918 1.00 40.45  ? 61   LEU E CD2   1 
ATOM   3254  N  N     . ILE E  1 62  ? 3.864   -26.713 57.192 1.00 46.49  ? 62   ILE E N     1 
ATOM   3255  C  CA    . ILE E  1 62  ? 4.209   -28.119 57.063 1.00 46.59  ? 62   ILE E CA    1 
ATOM   3256  C  C     . ILE E  1 62  ? 5.536   -28.170 56.310 1.00 46.94  ? 62   ILE E C     1 
ATOM   3257  O  O     . ILE E  1 62  ? 5.750   -27.365 55.405 1.00 46.12  ? 62   ILE E O     1 
ATOM   3258  C  CB    . ILE E  1 62  ? 3.137   -28.920 56.233 1.00 46.54  ? 62   ILE E CB    1 
ATOM   3259  C  CG1   . ILE E  1 62  ? 1.764   -28.961 56.917 1.00 46.98  ? 62   ILE E CG1   1 
ATOM   3260  C  CG2   . ILE E  1 62  ? 3.593   -30.353 55.968 1.00 47.02  ? 62   ILE E CG2   1 
ATOM   3261  C  CD1   . ILE E  1 62  ? 0.641   -29.394 55.988 1.00 46.43  ? 62   ILE E CD1   1 
ATOM   3262  N  N     . ARG E  1 63  ? 6.393   -29.145 56.655 1.00 47.71  ? 63   ARG E N     1 
ATOM   3263  C  CA    . ARG E  1 63  ? 7.715   -29.325 56.027 1.00 48.33  ? 63   ARG E CA    1 
ATOM   3264  C  C     . ARG E  1 63  ? 7.529   -29.852 54.609 1.00 47.20  ? 63   ARG E C     1 
ATOM   3265  O  O     . ARG E  1 63  ? 6.565   -30.561 54.342 1.00 47.93  ? 63   ARG E O     1 
ATOM   3266  C  CB    . ARG E  1 63  ? 8.593   -30.288 56.852 1.00 49.90  ? 63   ARG E CB    1 
ATOM   3267  C  CG    . ARG E  1 63  ? 8.647   -30.064 58.406 1.00 53.17  ? 63   ARG E CG    1 
ATOM   3268  C  CD    . ARG E  1 63  ? 9.875   -29.218 58.837 1.00 60.49  ? 63   ARG E CD    1 
ATOM   3269  N  NE    . ARG E  1 63  ? 9.504   -27.865 59.316 1.00 65.41  ? 63   ARG E NE    1 
ATOM   3270  C  CZ    . ARG E  1 63  ? 9.719   -26.709 58.665 1.00 66.65  ? 63   ARG E CZ    1 
ATOM   3271  N  NH1   . ARG E  1 63  ? 10.326  -26.691 57.473 1.00 67.52  ? 63   ARG E NH1   1 
ATOM   3272  N  NH2   . ARG E  1 63  ? 9.326   -25.557 59.212 1.00 65.31  ? 63   ARG E NH2   1 
ATOM   3273  N  N     . LYS E  1 64  ? 8.437   -29.496 53.710 1.00 46.12  ? 64   LYS E N     1 
ATOM   3274  C  CA    . LYS E  1 64  ? 8.250   -29.716 52.278 1.00 45.96  ? 64   LYS E CA    1 
ATOM   3275  C  C     . LYS E  1 64  ? 8.224   -31.182 51.875 1.00 45.64  ? 64   LYS E C     1 
ATOM   3276  O  O     . LYS E  1 64  ? 7.333   -31.610 51.145 1.00 45.86  ? 64   LYS E O     1 
ATOM   3277  C  CB    . LYS E  1 64  ? 9.349   -29.038 51.442 1.00 45.98  ? 64   LYS E CB    1 
ATOM   3278  C  CG    . LYS E  1 64  ? 9.391   -27.522 51.370 1.00 48.54  ? 64   LYS E CG    1 
ATOM   3279  C  CD    . LYS E  1 64  ? 8.031   -26.832 51.276 1.00 51.69  ? 64   LYS E CD    1 
ATOM   3280  C  CE    . LYS E  1 64  ? 8.075   -25.488 52.027 1.00 54.39  ? 64   LYS E CE    1 
ATOM   3281  N  NZ    . LYS E  1 64  ? 8.790   -24.421 51.265 1.00 53.35  ? 64   LYS E NZ    1 
ATOM   3282  N  N     . LEU E  1 65  ? 9.239   -31.941 52.308 1.00 45.46  ? 65   LEU E N     1 
ATOM   3283  C  CA    . LEU E  1 65  ? 9.375   -33.336 51.913 1.00 44.28  ? 65   LEU E CA    1 
ATOM   3284  C  C     . LEU E  1 65  ? 8.220   -34.210 52.413 1.00 43.45  ? 65   LEU E C     1 
ATOM   3285  O  O     . LEU E  1 65  ? 7.588   -34.889 51.613 1.00 43.68  ? 65   LEU E O     1 
ATOM   3286  C  CB    . LEU E  1 65  ? 10.717  -33.886 52.344 1.00 44.62  ? 65   LEU E CB    1 
ATOM   3287  C  CG    . LEU E  1 65  ? 11.055  -35.286 51.836 1.00 44.18  ? 65   LEU E CG    1 
ATOM   3288  C  CD1   . LEU E  1 65  ? 10.989  -35.377 50.293 1.00 42.75  ? 65   LEU E CD1   1 
ATOM   3289  C  CD2   . LEU E  1 65  ? 12.425  -35.605 52.346 1.00 43.03  ? 65   LEU E CD2   1 
ATOM   3290  N  N     . PRO E  1 66  ? 7.926   -34.177 53.726 1.00 42.33  ? 66   PRO E N     1 
ATOM   3291  C  CA    . PRO E  1 66  ? 6.766   -34.912 54.212 1.00 41.67  ? 66   PRO E CA    1 
ATOM   3292  C  C     . PRO E  1 66  ? 5.514   -34.698 53.375 1.00 41.49  ? 66   PRO E C     1 
ATOM   3293  O  O     . PRO E  1 66  ? 4.780   -35.642 53.119 1.00 42.53  ? 66   PRO E O     1 
ATOM   3294  C  CB    . PRO E  1 66  ? 6.552   -34.335 55.617 1.00 42.12  ? 66   PRO E CB    1 
ATOM   3295  C  CG    . PRO E  1 66  ? 7.903   -33.910 56.062 1.00 42.15  ? 66   PRO E CG    1 
ATOM   3296  C  CD    . PRO E  1 66  ? 8.652   -33.490 54.812 1.00 41.86  ? 66   PRO E CD    1 
ATOM   3297  N  N     . PHE E  1 67  ? 5.257   -33.450 52.984 1.00 41.40  ? 67   PHE E N     1 
ATOM   3298  C  CA    . PHE E  1 67  ? 4.057   -33.072 52.241 1.00 39.43  ? 67   PHE E CA    1 
ATOM   3299  C  C     . PHE E  1 67  ? 4.098   -33.575 50.803 1.00 39.72  ? 67   PHE E C     1 
ATOM   3300  O  O     . PHE E  1 67  ? 3.090   -34.037 50.276 1.00 39.82  ? 67   PHE E O     1 
ATOM   3301  C  CB    . PHE E  1 67  ? 3.850   -31.534 52.236 1.00 37.53  ? 67   PHE E CB    1 
ATOM   3302  C  CG    . PHE E  1 67  ? 2.585   -31.111 51.525 1.00 33.19  ? 67   PHE E CG    1 
ATOM   3303  C  CD1   . PHE E  1 67  ? 1.390   -31.011 52.213 1.00 28.77  ? 67   PHE E CD1   1 
ATOM   3304  C  CD2   . PHE E  1 67  ? 2.580   -30.891 50.148 1.00 30.71  ? 67   PHE E CD2   1 
ATOM   3305  C  CE1   . PHE E  1 67  ? 0.227   -30.647 51.544 1.00 26.80  ? 67   PHE E CE1   1 
ATOM   3306  C  CE2   . PHE E  1 67  ? 1.413   -30.548 49.477 1.00 27.11  ? 67   PHE E CE2   1 
ATOM   3307  C  CZ    . PHE E  1 67  ? 0.247   -30.426 50.169 1.00 26.85  ? 67   PHE E CZ    1 
ATOM   3308  N  N     . GLN E  1 68  ? 5.244   -33.406 50.161 1.00 40.20  ? 68   GLN E N     1 
ATOM   3309  C  CA    . GLN E  1 68  ? 5.483   -33.923 48.830 1.00 42.00  ? 68   GLN E CA    1 
ATOM   3310  C  C     . GLN E  1 68  ? 5.287   -35.449 48.770 1.00 41.52  ? 68   GLN E C     1 
ATOM   3311  O  O     . GLN E  1 68  ? 4.745   -35.967 47.792 1.00 41.03  ? 68   GLN E O     1 
ATOM   3312  C  CB    . GLN E  1 68  ? 6.900   -33.575 48.411 1.00 41.65  ? 68   GLN E CB    1 
ATOM   3313  C  CG    . GLN E  1 68  ? 7.143   -33.629 46.926 1.00 43.98  ? 68   GLN E CG    1 
ATOM   3314  C  CD    . GLN E  1 68  ? 8.581   -33.239 46.559 1.00 46.18  ? 68   GLN E CD    1 
ATOM   3315  O  OE1   . GLN E  1 68  ? 8.804   -32.413 45.663 1.00 54.27  ? 68   GLN E OE1   1 
ATOM   3316  N  NE2   . GLN E  1 68  ? 9.559   -33.833 47.242 1.00 50.13  ? 68   GLN E NE2   1 
ATOM   3317  N  N     . ARG E  1 69  ? 5.712   -36.159 49.815 1.00 41.37  ? 69   ARG E N     1 
ATOM   3318  C  CA    . ARG E  1 69  ? 5.546   -37.617 49.853 1.00 42.18  ? 69   ARG E CA    1 
ATOM   3319  C  C     . ARG E  1 69  ? 4.095   -38.026 49.949 1.00 42.38  ? 69   ARG E C     1 
ATOM   3320  O  O     . ARG E  1 69  ? 3.711   -39.051 49.396 1.00 43.10  ? 69   ARG E O     1 
ATOM   3321  C  CB    . ARG E  1 69  ? 6.309   -38.245 51.014 1.00 41.87  ? 69   ARG E CB    1 
ATOM   3322  C  CG    . ARG E  1 69  ? 7.808   -38.347 50.814 1.00 41.83  ? 69   ARG E CG    1 
ATOM   3323  C  CD    . ARG E  1 69  ? 8.443   -39.246 51.908 1.00 43.00  ? 69   ARG E CD    1 
ATOM   3324  N  NE    . ARG E  1 69  ? 7.952   -38.978 53.272 1.00 44.12  ? 69   ARG E NE    1 
ATOM   3325  C  CZ    . ARG E  1 69  ? 8.668   -38.389 54.225 1.00 45.04  ? 69   ARG E CZ    1 
ATOM   3326  N  NH1   . ARG E  1 69  ? 9.905   -37.978 53.967 1.00 43.98  ? 69   ARG E NH1   1 
ATOM   3327  N  NH2   . ARG E  1 69  ? 8.136   -38.201 55.434 1.00 45.70  ? 69   ARG E NH2   1 
ATOM   3328  N  N     . LEU E  1 70  ? 3.300   -37.235 50.667 1.00 41.96  ? 70   LEU E N     1 
ATOM   3329  C  CA    . LEU E  1 70  ? 1.881   -37.500 50.843 1.00 42.23  ? 70   LEU E CA    1 
ATOM   3330  C  C     . LEU E  1 70  ? 1.077   -37.244 49.557 1.00 42.65  ? 70   LEU E C     1 
ATOM   3331  O  O     . LEU E  1 70  ? 0.073   -37.897 49.287 1.00 43.71  ? 70   LEU E O     1 
ATOM   3332  C  CB    . LEU E  1 70  ? 1.345   -36.645 52.000 1.00 42.19  ? 70   LEU E CB    1 
ATOM   3333  C  CG    . LEU E  1 70  ? -0.166  -36.664 52.203 1.00 43.11  ? 70   LEU E CG    1 
ATOM   3334  C  CD1   . LEU E  1 70  ? -0.727  -38.107 52.486 1.00 41.26  ? 70   LEU E CD1   1 
ATOM   3335  C  CD2   . LEU E  1 70  ? -0.570  -35.655 53.263 1.00 41.86  ? 70   LEU E CD2   1 
ATOM   3336  N  N     . VAL E  1 71  ? 1.531   -36.277 48.775 1.00 42.47  ? 71   VAL E N     1 
ATOM   3337  C  CA    . VAL E  1 71  ? 0.945   -35.930 47.494 1.00 41.12  ? 71   VAL E CA    1 
ATOM   3338  C  C     . VAL E  1 71  ? 1.203   -37.055 46.508 1.00 40.87  ? 71   VAL E C     1 
ATOM   3339  O  O     . VAL E  1 71  ? 0.282   -37.523 45.822 1.00 39.72  ? 71   VAL E O     1 
ATOM   3340  C  CB    . VAL E  1 71  ? 1.549   -34.592 46.976 1.00 41.27  ? 71   VAL E CB    1 
ATOM   3341  C  CG1   . VAL E  1 71  ? 1.287   -34.374 45.462 1.00 39.36  ? 71   VAL E CG1   1 
ATOM   3342  C  CG2   . VAL E  1 71  ? 1.018   -33.449 47.801 1.00 39.35  ? 71   VAL E CG2   1 
ATOM   3343  N  N     . ARG E  1 72  ? 2.472   -37.451 46.432 1.00 40.86  ? 72   ARG E N     1 
ATOM   3344  C  CA    . ARG E  1 72  ? 2.928   -38.542 45.580 1.00 41.32  ? 72   ARG E CA    1 
ATOM   3345  C  C     . ARG E  1 72  ? 2.233   -39.883 45.901 1.00 41.18  ? 72   ARG E C     1 
ATOM   3346  O  O     . ARG E  1 72  ? 1.847   -40.610 44.990 1.00 41.12  ? 72   ARG E O     1 
ATOM   3347  C  CB    . ARG E  1 72  ? 4.428   -38.684 45.674 1.00 41.45  ? 72   ARG E CB    1 
ATOM   3348  C  CG    . ARG E  1 72  ? 5.162   -37.568 45.008 1.00 45.30  ? 72   ARG E CG    1 
ATOM   3349  C  CD    . ARG E  1 72  ? 6.646   -37.804 45.054 1.00 50.44  ? 72   ARG E CD    1 
ATOM   3350  N  NE    . ARG E  1 72  ? 7.398   -36.689 44.473 1.00 55.69  ? 72   ARG E NE    1 
ATOM   3351  C  CZ    . ARG E  1 72  ? 7.460   -36.400 43.169 1.00 57.71  ? 72   ARG E CZ    1 
ATOM   3352  N  NH1   . ARG E  1 72  ? 6.801   -37.122 42.264 1.00 57.90  ? 72   ARG E NH1   1 
ATOM   3353  N  NH2   . ARG E  1 72  ? 8.189   -35.374 42.765 1.00 58.60  ? 72   ARG E NH2   1 
ATOM   3354  N  N     . GLU E  1 73  ? 2.042   -40.167 47.185 1.00 40.84  ? 73   GLU E N     1 
ATOM   3355  C  CA    . GLU E  1 73  ? 1.267   -41.317 47.620 1.00 40.54  ? 73   GLU E CA    1 
ATOM   3356  C  C     . GLU E  1 73  ? -0.178  -41.270 47.188 1.00 41.01  ? 73   GLU E C     1 
ATOM   3357  O  O     . GLU E  1 73  ? -0.637  -42.183 46.542 1.00 42.66  ? 73   GLU E O     1 
ATOM   3358  C  CB    . GLU E  1 73  ? 1.357   -41.490 49.133 1.00 39.99  ? 73   GLU E CB    1 
ATOM   3359  C  CG    . GLU E  1 73  ? 0.618   -42.728 49.656 1.00 38.54  ? 73   GLU E CG    1 
ATOM   3360  C  CD    . GLU E  1 73  ? 0.529   -42.737 51.163 1.00 37.32  ? 73   GLU E CD    1 
ATOM   3361  O  OE1   . GLU E  1 73  ? 1.559   -42.526 51.814 1.00 36.39  ? 73   GLU E OE1   1 
ATOM   3362  O  OE2   . GLU E  1 73  ? -0.572  -42.942 51.707 1.00 38.03  ? 73   GLU E OE2   1 
ATOM   3363  N  N     . ILE E  1 74  ? -0.911  -40.226 47.563 1.00 41.65  ? 74   ILE E N     1 
ATOM   3364  C  CA    . ILE E  1 74  ? -2.314  -40.101 47.183 1.00 41.32  ? 74   ILE E CA    1 
ATOM   3365  C  C     . ILE E  1 74  ? -2.504  -40.113 45.671 1.00 41.93  ? 74   ILE E C     1 
ATOM   3366  O  O     . ILE E  1 74  ? -3.422  -40.765 45.176 1.00 43.35  ? 74   ILE E O     1 
ATOM   3367  C  CB    . ILE E  1 74  ? -2.976  -38.827 47.806 1.00 42.02  ? 74   ILE E CB    1 
ATOM   3368  C  CG1   . ILE E  1 74  ? -3.191  -39.025 49.316 1.00 41.12  ? 74   ILE E CG1   1 
ATOM   3369  C  CG2   . ILE E  1 74  ? -4.300  -38.474 47.093 1.00 40.18  ? 74   ILE E CG2   1 
ATOM   3370  C  CD1   . ILE E  1 74  ? -3.521  -37.737 50.087 1.00 39.73  ? 74   ILE E CD1   1 
ATOM   3371  N  N     . ALA E  1 75  ? -1.665  -39.394 44.935 1.00 41.99  ? 75   ALA E N     1 
ATOM   3372  C  CA    . ALA E  1 75  ? -1.768  -39.365 43.470 1.00 43.20  ? 75   ALA E CA    1 
ATOM   3373  C  C     . ALA E  1 75  ? -1.443  -40.712 42.822 1.00 43.91  ? 75   ALA E C     1 
ATOM   3374  O  O     . ALA E  1 75  ? -1.915  -41.024 41.726 1.00 43.83  ? 75   ALA E O     1 
ATOM   3375  C  CB    . ALA E  1 75  ? -0.861  -38.282 42.891 1.00 42.88  ? 75   ALA E CB    1 
ATOM   3376  N  N     . GLN E  1 76  ? -0.605  -41.490 43.502 1.00 44.65  ? 76   GLN E N     1 
ATOM   3377  C  CA    . GLN E  1 76  ? -0.173  -42.785 43.010 1.00 45.25  ? 76   GLN E CA    1 
ATOM   3378  C  C     . GLN E  1 76  ? -1.262  -43.832 43.146 1.00 45.38  ? 76   GLN E C     1 
ATOM   3379  O  O     . GLN E  1 76  ? -1.362  -44.709 42.288 1.00 46.26  ? 76   GLN E O     1 
ATOM   3380  C  CB    . GLN E  1 76  ? 1.048   -43.236 43.766 1.00 45.50  ? 76   GLN E CB    1 
ATOM   3381  C  CG    . GLN E  1 76  ? 1.573   -44.549 43.328 1.00 46.87  ? 76   GLN E CG    1 
ATOM   3382  C  CD    . GLN E  1 76  ? 2.811   -44.895 44.066 1.00 48.24  ? 76   GLN E CD    1 
ATOM   3383  O  OE1   . GLN E  1 76  ? 2.827   -44.942 45.301 1.00 50.10  ? 76   GLN E OE1   1 
ATOM   3384  N  NE2   . GLN E  1 76  ? 3.871   -45.134 43.326 1.00 48.68  ? 76   GLN E NE2   1 
ATOM   3385  N  N     . ASP E  1 77  ? -2.052  -43.761 44.219 1.00 44.55  ? 77   ASP E N     1 
ATOM   3386  C  CA    . ASP E  1 77  ? -3.268  -44.552 44.305 1.00 44.52  ? 77   ASP E CA    1 
ATOM   3387  C  C     . ASP E  1 77  ? -4.313  -44.232 43.206 1.00 44.94  ? 77   ASP E C     1 
ATOM   3388  O  O     . ASP E  1 77  ? -5.196  -45.039 42.973 1.00 45.75  ? 77   ASP E O     1 
ATOM   3389  C  CB    . ASP E  1 77  ? -3.896  -44.498 45.704 1.00 43.56  ? 77   ASP E CB    1 
ATOM   3390  C  CG    . ASP E  1 77  ? -2.981  -45.089 46.807 1.00 45.83  ? 77   ASP E CG    1 
ATOM   3391  O  OD1   . ASP E  1 77  ? -2.181  -46.038 46.570 1.00 46.60  ? 77   ASP E OD1   1 
ATOM   3392  O  OD2   . ASP E  1 77  ? -3.087  -44.627 47.959 1.00 45.32  ? 77   ASP E OD2   1 
ATOM   3393  N  N     . PHE E  1 78  ? -4.216  -43.087 42.527 1.00 45.80  ? 78   PHE E N     1 
ATOM   3394  C  CA    . PHE E  1 78  ? -5.149  -42.725 41.439 1.00 46.11  ? 78   PHE E CA    1 
ATOM   3395  C  C     . PHE E  1 78  ? -4.573  -43.107 40.080 1.00 46.16  ? 78   PHE E C     1 
ATOM   3396  O  O     . PHE E  1 78  ? -5.313  -43.426 39.167 1.00 45.46  ? 78   PHE E O     1 
ATOM   3397  C  CB    . PHE E  1 78  ? -5.449  -41.201 41.393 1.00 46.76  ? 78   PHE E CB    1 
ATOM   3398  C  CG    . PHE E  1 78  ? -6.579  -40.753 42.293 1.00 48.59  ? 78   PHE E CG    1 
ATOM   3399  C  CD1   . PHE E  1 78  ? -6.395  -39.669 43.180 1.00 49.42  ? 78   PHE E CD1   1 
ATOM   3400  C  CD2   . PHE E  1 78  ? -7.827  -41.383 42.255 1.00 50.29  ? 78   PHE E CD2   1 
ATOM   3401  C  CE1   . PHE E  1 78  ? -7.415  -39.237 44.035 1.00 48.69  ? 78   PHE E CE1   1 
ATOM   3402  C  CE2   . PHE E  1 78  ? -8.877  -40.956 43.112 1.00 51.30  ? 78   PHE E CE2   1 
ATOM   3403  C  CZ    . PHE E  1 78  ? -8.665  -39.876 44.005 1.00 49.53  ? 78   PHE E CZ    1 
ATOM   3404  N  N     . LYS E  1 79  ? -3.257  -43.019 39.933 1.00 47.00  ? 79   LYS E N     1 
ATOM   3405  C  CA    . LYS E  1 79  ? -2.606  -43.340 38.669 1.00 48.97  ? 79   LYS E CA    1 
ATOM   3406  C  C     . LYS E  1 79  ? -1.087  -43.458 38.856 1.00 49.83  ? 79   LYS E C     1 
ATOM   3407  O  O     . LYS E  1 79  ? -0.451  -42.598 39.464 1.00 51.25  ? 79   LYS E O     1 
ATOM   3408  C  CB    . LYS E  1 79  ? -3.042  -42.346 37.562 1.00 49.17  ? 79   LYS E CB    1 
ATOM   3409  C  CG    . LYS E  1 79  ? -2.104  -42.125 36.372 1.00 50.90  ? 79   LYS E CG    1 
ATOM   3410  C  CD    . LYS E  1 79  ? -1.888  -43.361 35.502 1.00 53.94  ? 79   LYS E CD    1 
ATOM   3411  C  CE    . LYS E  1 79  ? -2.058  -43.060 34.020 1.00 55.03  ? 79   LYS E CE    1 
ATOM   3412  N  NZ    . LYS E  1 79  ? -3.486  -42.756 33.699 1.00 55.58  ? 79   LYS E NZ    1 
ATOM   3413  N  N     . THR E  1 80  ? -0.516  -44.551 38.364 1.00 50.58  ? 80   THR E N     1 
ATOM   3414  C  CA    . THR E  1 80  ? 0.887   -44.884 38.615 1.00 50.85  ? 80   THR E CA    1 
ATOM   3415  C  C     . THR E  1 80  ? 1.769   -44.165 37.593 1.00 51.34  ? 80   THR E C     1 
ATOM   3416  O  O     . THR E  1 80  ? 1.281   -43.690 36.573 1.00 51.59  ? 80   THR E O     1 
ATOM   3417  C  CB    . THR E  1 80  ? 1.131   -46.435 38.555 1.00 50.72  ? 80   THR E CB    1 
ATOM   3418  O  OG1   . THR E  1 80  ? 0.295   -47.006 37.547 1.00 52.06  ? 80   THR E OG1   1 
ATOM   3419  C  CG2   . THR E  1 80  ? 0.814   -47.132 39.894 1.00 49.65  ? 80   THR E CG2   1 
ATOM   3420  N  N     . ASP E  1 81  ? 3.067   -44.083 37.869 1.00 52.15  ? 81   ASP E N     1 
ATOM   3421  C  CA    . ASP E  1 81  ? 4.031   -43.494 36.921 1.00 53.29  ? 81   ASP E CA    1 
ATOM   3422  C  C     . ASP E  1 81  ? 3.773   -41.986 36.611 1.00 52.70  ? 81   ASP E C     1 
ATOM   3423  O  O     . ASP E  1 81  ? 4.042   -41.511 35.500 1.00 52.73  ? 81   ASP E O     1 
ATOM   3424  C  CB    . ASP E  1 81  ? 4.121   -44.339 35.620 1.00 54.24  ? 81   ASP E CB    1 
ATOM   3425  C  CG    . ASP E  1 81  ? 4.198   -45.859 35.889 1.00 58.03  ? 81   ASP E CG    1 
ATOM   3426  O  OD1   . ASP E  1 81  ? 3.267   -46.583 35.427 1.00 61.13  ? 81   ASP E OD1   1 
ATOM   3427  O  OD2   . ASP E  1 81  ? 5.164   -46.322 36.577 1.00 59.96  ? 81   ASP E OD2   1 
ATOM   3428  N  N     . LEU E  1 82  ? 3.262   -41.250 37.605 1.00 52.06  ? 82   LEU E N     1 
ATOM   3429  C  CA    . LEU E  1 82  ? 3.055   -39.792 37.499 1.00 50.84  ? 82   LEU E CA    1 
ATOM   3430  C  C     . LEU E  1 82  ? 4.298   -39.056 37.941 1.00 50.79  ? 82   LEU E C     1 
ATOM   3431  O  O     . LEU E  1 82  ? 4.967   -39.479 38.868 1.00 50.26  ? 82   LEU E O     1 
ATOM   3432  C  CB    . LEU E  1 82  ? 1.872   -39.318 38.356 1.00 50.26  ? 82   LEU E CB    1 
ATOM   3433  C  CG    . LEU E  1 82  ? 0.447   -39.652 37.916 1.00 47.74  ? 82   LEU E CG    1 
ATOM   3434  C  CD1   . LEU E  1 82  ? -0.516  -39.247 39.003 1.00 44.27  ? 82   LEU E CD1   1 
ATOM   3435  C  CD2   . LEU E  1 82  ? 0.101   -39.001 36.583 1.00 45.31  ? 82   LEU E CD2   1 
ATOM   3436  N  N     . ARG E  1 83  ? 4.607   -37.967 37.246 1.00 50.90  ? 83   ARG E N     1 
ATOM   3437  C  CA    . ARG E  1 83  ? 5.642   -37.024 37.669 1.00 51.05  ? 83   ARG E CA    1 
ATOM   3438  C  C     . ARG E  1 83  ? 4.999   -35.672 38.000 1.00 50.45  ? 83   ARG E C     1 
ATOM   3439  O  O     . ARG E  1 83  ? 3.896   -35.372 37.541 1.00 50.60  ? 83   ARG E O     1 
ATOM   3440  C  CB    . ARG E  1 83  ? 6.696   -36.870 36.575 1.00 51.39  ? 83   ARG E CB    1 
ATOM   3441  C  CG    . ARG E  1 83  ? 7.446   -38.140 36.304 1.00 53.32  ? 83   ARG E CG    1 
ATOM   3442  C  CD    . ARG E  1 83  ? 7.845   -38.260 34.853 1.00 54.66  ? 83   ARG E CD    1 
ATOM   3443  N  NE    . ARG E  1 83  ? 9.018   -37.451 34.569 1.00 59.15  ? 83   ARG E NE    1 
ATOM   3444  C  CZ    . ARG E  1 83  ? 10.276  -37.782 34.854 1.00 60.54  ? 83   ARG E CZ    1 
ATOM   3445  N  NH1   . ARG E  1 83  ? 10.563  -38.935 35.445 1.00 61.96  ? 83   ARG E NH1   1 
ATOM   3446  N  NH2   . ARG E  1 83  ? 11.260  -36.944 34.537 1.00 61.91  ? 83   ARG E NH2   1 
ATOM   3447  N  N     . PHE E  1 84  ? 5.687   -34.867 38.800 1.00 49.90  ? 84   PHE E N     1 
ATOM   3448  C  CA    . PHE E  1 84  ? 5.153   -33.583 39.269 1.00 49.08  ? 84   PHE E CA    1 
ATOM   3449  C  C     . PHE E  1 84  ? 6.102   -32.445 39.006 1.00 48.47  ? 84   PHE E C     1 
ATOM   3450  O  O     . PHE E  1 84  ? 7.271   -32.536 39.353 1.00 48.76  ? 84   PHE E O     1 
ATOM   3451  C  CB    . PHE E  1 84  ? 4.912   -33.645 40.773 1.00 48.84  ? 84   PHE E CB    1 
ATOM   3452  C  CG    . PHE E  1 84  ? 3.618   -34.320 41.163 1.00 49.66  ? 84   PHE E CG    1 
ATOM   3453  C  CD1   . PHE E  1 84  ? 3.508   -35.734 41.163 1.00 49.96  ? 84   PHE E CD1   1 
ATOM   3454  C  CD2   . PHE E  1 84  ? 2.526   -33.558 41.579 1.00 46.31  ? 84   PHE E CD2   1 
ATOM   3455  C  CE1   . PHE E  1 84  ? 2.316   -36.356 41.558 1.00 48.70  ? 84   PHE E CE1   1 
ATOM   3456  C  CE2   . PHE E  1 84  ? 1.335   -34.163 41.971 1.00 46.87  ? 84   PHE E CE2   1 
ATOM   3457  C  CZ    . PHE E  1 84  ? 1.213   -35.558 41.949 1.00 49.09  ? 84   PHE E CZ    1 
ATOM   3458  N  N     . GLN E  1 85  ? 5.613   -31.359 38.410 1.00 48.32  ? 85   GLN E N     1 
ATOM   3459  C  CA    . GLN E  1 85  ? 6.394   -30.106 38.385 1.00 47.33  ? 85   GLN E CA    1 
ATOM   3460  C  C     . GLN E  1 85  ? 6.541   -29.648 39.821 1.00 46.76  ? 85   GLN E C     1 
ATOM   3461  O  O     . GLN E  1 85  ? 5.588   -29.708 40.580 1.00 46.57  ? 85   GLN E O     1 
ATOM   3462  C  CB    . GLN E  1 85  ? 5.681   -29.030 37.578 1.00 47.38  ? 85   GLN E CB    1 
ATOM   3463  C  CG    . GLN E  1 85  ? 5.763   -29.187 36.060 1.00 47.89  ? 85   GLN E CG    1 
ATOM   3464  C  CD    . GLN E  1 85  ? 5.011   -28.084 35.344 1.00 47.82  ? 85   GLN E CD    1 
ATOM   3465  O  OE1   . GLN E  1 85  ? 4.224   -27.371 35.956 1.00 48.79  ? 85   GLN E OE1   1 
ATOM   3466  N  NE2   . GLN E  1 85  ? 5.231   -27.951 34.041 1.00 49.23  ? 85   GLN E NE2   1 
ATOM   3467  N  N     . SER E  1 86  ? 7.722   -29.199 40.218 1.00 46.59  ? 86   SER E N     1 
ATOM   3468  C  CA    . SER E  1 86  ? 7.911   -28.801 41.624 1.00 46.90  ? 86   SER E CA    1 
ATOM   3469  C  C     . SER E  1 86  ? 6.882   -27.778 42.123 1.00 46.82  ? 86   SER E C     1 
ATOM   3470  O  O     . SER E  1 86  ? 6.580   -27.736 43.328 1.00 47.39  ? 86   SER E O     1 
ATOM   3471  C  CB    . SER E  1 86  ? 9.331   -28.315 41.897 1.00 46.84  ? 86   SER E CB    1 
ATOM   3472  O  OG    . SER E  1 86  ? 9.828   -27.560 40.813 1.00 47.40  ? 86   SER E OG    1 
ATOM   3473  N  N     . SER E  1 87  ? 6.328   -26.987 41.201 1.00 45.79  ? 87   SER E N     1 
ATOM   3474  C  CA    . SER E  1 87  ? 5.400   -25.917 41.559 1.00 45.41  ? 87   SER E CA    1 
ATOM   3475  C  C     . SER E  1 87  ? 3.953   -26.386 41.519 1.00 45.36  ? 87   SER E C     1 
ATOM   3476  O  O     . SER E  1 87  ? 3.050   -25.664 41.958 1.00 45.96  ? 87   SER E O     1 
ATOM   3477  C  CB    . SER E  1 87  ? 5.565   -24.742 40.626 1.00 45.12  ? 87   SER E CB    1 
ATOM   3478  O  OG    . SER E  1 87  ? 4.987   -25.054 39.377 1.00 47.53  ? 87   SER E OG    1 
ATOM   3479  N  N     . ALA E  1 88  ? 3.727   -27.597 41.011 1.00 44.31  ? 88   ALA E N     1 
ATOM   3480  C  CA    . ALA E  1 88  ? 2.435   -28.226 41.147 1.00 43.08  ? 88   ALA E CA    1 
ATOM   3481  C  C     . ALA E  1 88  ? 2.297   -28.647 42.600 1.00 42.84  ? 88   ALA E C     1 
ATOM   3482  O  O     . ALA E  1 88  ? 1.223   -28.564 43.199 1.00 42.79  ? 88   ALA E O     1 
ATOM   3483  C  CB    . ALA E  1 88  ? 2.327   -29.387 40.232 1.00 43.22  ? 88   ALA E CB    1 
ATOM   3484  N  N     . VAL E  1 89  ? 3.410   -29.047 43.187 1.00 42.58  ? 89   VAL E N     1 
ATOM   3485  C  CA    . VAL E  1 89  ? 3.417   -29.506 44.559 1.00 42.57  ? 89   VAL E CA    1 
ATOM   3486  C  C     . VAL E  1 89  ? 3.353   -28.358 45.526 1.00 43.32  ? 89   VAL E C     1 
ATOM   3487  O  O     . VAL E  1 89  ? 2.756   -28.480 46.585 1.00 43.84  ? 89   VAL E O     1 
ATOM   3488  C  CB    . VAL E  1 89  ? 4.656   -30.393 44.860 1.00 42.43  ? 89   VAL E CB    1 
ATOM   3489  C  CG1   . VAL E  1 89  ? 4.546   -31.058 46.231 1.00 39.15  ? 89   VAL E CG1   1 
ATOM   3490  C  CG2   . VAL E  1 89  ? 4.840   -31.415 43.753 1.00 41.84  ? 89   VAL E CG2   1 
ATOM   3491  N  N     . MET E  1 90  ? 3.996   -27.246 45.177 1.00 44.72  ? 90   MET E N     1 
ATOM   3492  C  CA    . MET E  1 90  ? 3.957   -26.029 46.002 1.00 44.96  ? 90   MET E CA    1 
ATOM   3493  C  C     . MET E  1 90  ? 2.583   -25.365 45.952 1.00 43.56  ? 90   MET E C     1 
ATOM   3494  O  O     . MET E  1 90  ? 2.102   -24.846 46.978 1.00 43.65  ? 90   MET E O     1 
ATOM   3495  C  CB    . MET E  1 90  ? 5.059   -25.055 45.581 1.00 46.42  ? 90   MET E CB    1 
ATOM   3496  C  CG    . MET E  1 90  ? 6.491   -25.449 45.997 1.00 51.29  ? 90   MET E CG    1 
ATOM   3497  S  SD    . MET E  1 90  ? 6.741   -25.719 47.804 1.00 64.27  ? 90   MET E SD    1 
ATOM   3498  C  CE    . MET E  1 90  ? 6.470   -24.061 48.477 1.00 62.54  ? 90   MET E CE    1 
ATOM   3499  N  N     . ALA E  1 91  ? 1.947   -25.394 44.775 1.00 41.85  ? 91   ALA E N     1 
ATOM   3500  C  CA    . ALA E  1 91  ? 0.530   -25.006 44.630 1.00 40.43  ? 91   ALA E CA    1 
ATOM   3501  C  C     . ALA E  1 91  ? -0.425  -25.796 45.528 1.00 40.37  ? 91   ALA E C     1 
ATOM   3502  O  O     . ALA E  1 91  ? -1.420  -25.255 46.015 1.00 41.59  ? 91   ALA E O     1 
ATOM   3503  C  CB    . ALA E  1 91  ? 0.078   -25.111 43.179 1.00 39.40  ? 91   ALA E CB    1 
ATOM   3504  N  N     . LEU E  1 92  ? -0.152  -27.084 45.720 1.00 39.56  ? 92   LEU E N     1 
ATOM   3505  C  CA    . LEU E  1 92  ? -1.038  -27.951 46.468 1.00 38.09  ? 92   LEU E CA    1 
ATOM   3506  C  C     . LEU E  1 92  ? -0.780  -27.632 47.910 1.00 38.19  ? 92   LEU E C     1 
ATOM   3507  O  O     . LEU E  1 92  ? -1.714  -27.616 48.722 1.00 39.34  ? 92   LEU E O     1 
ATOM   3508  C  CB    . LEU E  1 92  ? -0.735  -29.438 46.175 1.00 38.20  ? 92   LEU E CB    1 
ATOM   3509  C  CG    . LEU E  1 92  ? -1.261  -30.063 44.872 1.00 36.57  ? 92   LEU E CG    1 
ATOM   3510  C  CD1   . LEU E  1 92  ? -0.458  -31.290 44.412 1.00 35.65  ? 92   LEU E CD1   1 
ATOM   3511  C  CD2   . LEU E  1 92  ? -2.762  -30.365 44.956 1.00 36.71  ? 92   LEU E CD2   1 
ATOM   3512  N  N     . GLN E  1 93  ? 0.477   -27.345 48.248 1.00 36.77  ? 93   GLN E N     1 
ATOM   3513  C  CA    . GLN E  1 93  ? 0.765   -27.002 49.622 1.00 36.70  ? 93   GLN E CA    1 
ATOM   3514  C  C     . GLN E  1 93  ? 0.141   -25.697 50.028 1.00 37.45  ? 93   GLN E C     1 
ATOM   3515  O  O     . GLN E  1 93  ? -0.488  -25.630 51.086 1.00 38.38  ? 93   GLN E O     1 
ATOM   3516  C  CB    . GLN E  1 93  ? 2.253   -27.029 49.954 1.00 35.68  ? 93   GLN E CB    1 
ATOM   3517  C  CG    . GLN E  1 93  ? 2.437   -27.162 51.460 1.00 34.11  ? 93   GLN E CG    1 
ATOM   3518  C  CD    . GLN E  1 93  ? 3.855   -27.437 51.865 1.00 32.21  ? 93   GLN E CD    1 
ATOM   3519  O  OE1   . GLN E  1 93  ? 4.731   -27.687 51.029 1.00 31.60  ? 93   GLN E OE1   1 
ATOM   3520  N  NE2   . GLN E  1 93  ? 4.102   -27.375 53.149 1.00 30.48  ? 93   GLN E NE2   1 
ATOM   3521  N  N     . GLU E  1 94  ? 0.318   -24.657 49.196 1.00 38.26  ? 94   GLU E N     1 
ATOM   3522  C  CA    . GLU E  1 94  ? -0.282  -23.336 49.441 1.00 37.64  ? 94   GLU E CA    1 
ATOM   3523  C  C     . GLU E  1 94  ? -1.782  -23.461 49.614 1.00 37.21  ? 94   GLU E C     1 
ATOM   3524  O  O     . GLU E  1 94  ? -2.347  -22.997 50.594 1.00 37.85  ? 94   GLU E O     1 
ATOM   3525  C  CB    . GLU E  1 94  ? 0.014   -22.379 48.282 1.00 38.29  ? 94   GLU E CB    1 
ATOM   3526  C  CG    . GLU E  1 94  ? 1.453   -21.803 48.166 1.00 38.45  ? 94   GLU E CG    1 
ATOM   3527  C  CD    . GLU E  1 94  ? 1.860   -20.838 49.285 1.00 41.46  ? 94   GLU E CD    1 
ATOM   3528  O  OE1   . GLU E  1 94  ? 0.987   -20.205 49.949 1.00 41.95  ? 94   GLU E OE1   1 
ATOM   3529  O  OE2   . GLU E  1 94  ? 3.093   -20.714 49.495 1.00 43.00  ? 94   GLU E OE2   1 
ATOM   3530  N  N     . ALA E  1 95  ? -2.437  -24.098 48.656 1.00 36.86  ? 95   ALA E N     1 
ATOM   3531  C  CA    . ALA E  1 95  ? -3.877  -24.339 48.742 1.00 36.28  ? 95   ALA E CA    1 
ATOM   3532  C  C     . ALA E  1 95  ? -4.303  -25.136 49.991 1.00 36.80  ? 95   ALA E C     1 
ATOM   3533  O  O     . ALA E  1 95  ? -5.361  -24.845 50.587 1.00 37.49  ? 95   ALA E O     1 
ATOM   3534  C  CB    . ALA E  1 95  ? -4.322  -25.045 47.507 1.00 35.74  ? 95   ALA E CB    1 
ATOM   3535  N  N     . SER E  1 96  ? -3.504  -26.148 50.364 1.00 36.21  ? 96   SER E N     1 
ATOM   3536  C  CA    . SER E  1 96  ? -3.825  -27.050 51.477 1.00 36.35  ? 96   SER E CA    1 
ATOM   3537  C  C     . SER E  1 96  ? -3.683  -26.355 52.808 1.00 36.11  ? 96   SER E C     1 
ATOM   3538  O  O     . SER E  1 96  ? -4.574  -26.488 53.653 1.00 35.48  ? 96   SER E O     1 
ATOM   3539  C  CB    . SER E  1 96  ? -2.968  -28.371 51.461 1.00 36.93  ? 96   SER E CB    1 
ATOM   3540  O  OG    . SER E  1 96  ? -3.125  -29.148 50.256 1.00 36.51  ? 96   SER E OG    1 
ATOM   3541  N  N     . GLU E  1 97  ? -2.563  -25.644 53.016 1.00 36.03  ? 97   GLU E N     1 
ATOM   3542  C  CA    . GLU E  1 97  ? -2.386  -24.826 54.251 1.00 37.34  ? 97   GLU E CA    1 
ATOM   3543  C  C     . GLU E  1 97  ? -3.363  -23.654 54.390 1.00 37.08  ? 97   GLU E C     1 
ATOM   3544  O  O     . GLU E  1 97  ? -3.816  -23.342 55.512 1.00 38.42  ? 97   GLU E O     1 
ATOM   3545  C  CB    . GLU E  1 97  ? -0.934  -24.369 54.470 1.00 37.29  ? 97   GLU E CB    1 
ATOM   3546  C  CG    . GLU E  1 97  ? 0.123   -25.467 54.277 1.00 37.90  ? 97   GLU E CG    1 
ATOM   3547  C  CD    . GLU E  1 97  ? 1.440   -25.164 54.991 1.00 38.99  ? 97   GLU E CD    1 
ATOM   3548  O  OE1   . GLU E  1 97  ? 1.542   -24.125 55.673 1.00 41.42  ? 97   GLU E OE1   1 
ATOM   3549  O  OE2   . GLU E  1 97  ? 2.393   -25.964 54.865 1.00 40.42  ? 97   GLU E OE2   1 
ATOM   3550  N  N     . ALA E  1 98  ? -3.722  -23.023 53.281 1.00 36.30  ? 98   ALA E N     1 
ATOM   3551  C  CA    . ALA E  1 98  ? -4.782  -21.996 53.312 1.00 36.62  ? 98   ALA E CA    1 
ATOM   3552  C  C     . ALA E  1 98  ? -6.145  -22.554 53.651 1.00 37.02  ? 98   ALA E C     1 
ATOM   3553  O  O     . ALA E  1 98  ? -6.926  -21.907 54.380 1.00 38.36  ? 98   ALA E O     1 
ATOM   3554  C  CB    . ALA E  1 98  ? -4.844  -21.226 52.010 1.00 36.05  ? 98   ALA E CB    1 
ATOM   3555  N  N     . TYR E  1 99  ? -6.480  -23.736 53.116 1.00 37.09  ? 99   TYR E N     1 
ATOM   3556  C  CA    . TYR E  1 99  ? -7.763  -24.376 53.482 1.00 35.56  ? 99   TYR E CA    1 
ATOM   3557  C  C     . TYR E  1 99  ? -7.754  -24.763 54.972 1.00 35.26  ? 99   TYR E C     1 
ATOM   3558  O  O     . TYR E  1 99  ? -8.730  -24.553 55.705 1.00 35.10  ? 99   TYR E O     1 
ATOM   3559  C  CB    . TYR E  1 99  ? -8.066  -25.544 52.564 1.00 36.01  ? 99   TYR E CB    1 
ATOM   3560  C  CG    . TYR E  1 99  ? -9.144  -26.488 53.061 1.00 36.49  ? 99   TYR E CG    1 
ATOM   3561  C  CD1   . TYR E  1 99  ? -10.472 -26.262 52.768 1.00 36.12  ? 99   TYR E CD1   1 
ATOM   3562  C  CD2   . TYR E  1 99  ? -8.818  -27.616 53.815 1.00 37.88  ? 99   TYR E CD2   1 
ATOM   3563  C  CE1   . TYR E  1 99  ? -11.464 -27.103 53.245 1.00 38.97  ? 99   TYR E CE1   1 
ATOM   3564  C  CE2   . TYR E  1 99  ? -9.802  -28.482 54.296 1.00 37.49  ? 99   TYR E CE2   1 
ATOM   3565  C  CZ    . TYR E  1 99  ? -11.120 -28.226 54.008 1.00 38.26  ? 99   TYR E CZ    1 
ATOM   3566  O  OH    . TYR E  1 99  ? -12.108 -29.087 54.454 1.00 35.73  ? 99   TYR E OH    1 
ATOM   3567  N  N     . LEU E  1 100 ? -6.619  -25.251 55.451 1.00 35.16  ? 100  LEU E N     1 
ATOM   3568  C  CA    . LEU E  1 100 ? -6.567  -25.721 56.832 1.00 35.39  ? 100  LEU E CA    1 
ATOM   3569  C  C     . LEU E  1 100 ? -6.664  -24.615 57.872 1.00 35.27  ? 100  LEU E C     1 
ATOM   3570  O  O     . LEU E  1 100 ? -7.537  -24.677 58.733 1.00 36.10  ? 100  LEU E O     1 
ATOM   3571  C  CB    . LEU E  1 100 ? -5.390  -26.680 57.072 1.00 35.26  ? 100  LEU E CB    1 
ATOM   3572  C  CG    . LEU E  1 100 ? -5.471  -28.131 56.533 1.00 34.91  ? 100  LEU E CG    1 
ATOM   3573  C  CD1   . LEU E  1 100 ? -4.126  -28.821 56.670 1.00 32.09  ? 100  LEU E CD1   1 
ATOM   3574  C  CD2   . LEU E  1 100 ? -6.568  -28.977 57.193 1.00 33.78  ? 100  LEU E CD2   1 
ATOM   3575  N  N     . VAL E  1 101 ? -5.783  -23.606 57.783 1.00 34.98  ? 101  VAL E N     1 
ATOM   3576  C  CA    . VAL E  1 101 ? -5.924  -22.300 58.510 1.00 33.69  ? 101  VAL E CA    1 
ATOM   3577  C  C     . VAL E  1 101 ? -7.351  -21.739 58.533 1.00 32.90  ? 101  VAL E C     1 
ATOM   3578  O  O     . VAL E  1 101 ? -7.887  -21.476 59.601 1.00 33.03  ? 101  VAL E O     1 
ATOM   3579  C  CB    . VAL E  1 101 ? -4.924  -21.207 57.965 1.00 34.08  ? 101  VAL E CB    1 
ATOM   3580  C  CG1   . VAL E  1 101 ? -5.183  -19.888 58.601 1.00 34.52  ? 101  VAL E CG1   1 
ATOM   3581  C  CG2   . VAL E  1 101 ? -3.462  -21.605 58.215 1.00 33.54  ? 101  VAL E CG2   1 
ATOM   3582  N  N     . ALA E  1 102 ? -7.986  -21.562 57.376 1.00 32.95  ? 102  ALA E N     1 
ATOM   3583  C  CA    . ALA E  1 102 ? -9.374  -21.063 57.375 1.00 33.55  ? 102  ALA E CA    1 
ATOM   3584  C  C     . ALA E  1 102 ? -10.330 -21.951 58.152 1.00 35.22  ? 102  ALA E C     1 
ATOM   3585  O  O     . ALA E  1 102 ? -11.148 -21.452 58.923 1.00 38.52  ? 102  ALA E O     1 
ATOM   3586  C  CB    . ALA E  1 102 ? -9.870  -20.842 55.998 1.00 31.71  ? 102  ALA E CB    1 
ATOM   3587  N  N     . LEU E  1 103 ? -10.236 -23.265 57.975 1.00 35.91  ? 103  LEU E N     1 
ATOM   3588  C  CA    . LEU E  1 103 ? -11.043 -24.226 58.724 1.00 35.12  ? 103  LEU E CA    1 
ATOM   3589  C  C     . LEU E  1 103 ? -10.854 -24.139 60.217 1.00 35.35  ? 103  LEU E C     1 
ATOM   3590  O  O     . LEU E  1 103 ? -11.834 -24.085 60.942 1.00 35.54  ? 103  LEU E O     1 
ATOM   3591  C  CB    . LEU E  1 103 ? -10.792 -25.664 58.220 1.00 35.09  ? 103  LEU E CB    1 
ATOM   3592  C  CG    . LEU E  1 103 ? -11.586 -26.819 58.831 1.00 33.59  ? 103  LEU E CG    1 
ATOM   3593  C  CD1   . LEU E  1 103 ? -13.082 -26.739 58.532 1.00 32.58  ? 103  LEU E CD1   1 
ATOM   3594  C  CD2   . LEU E  1 103 ? -11.033 -28.037 58.270 1.00 33.78  ? 103  LEU E CD2   1 
ATOM   3595  N  N     . PHE E  1 104 ? -9.621  -24.114 60.713 1.00 36.81  ? 104  PHE E N     1 
ATOM   3596  C  CA    . PHE E  1 104 ? -9.435  -23.837 62.182 1.00 37.81  ? 104  PHE E CA    1 
ATOM   3597  C  C     . PHE E  1 104 ? -10.063 -22.542 62.691 1.00 38.76  ? 104  PHE E C     1 
ATOM   3598  O  O     . PHE E  1 104 ? -10.513 -22.502 63.847 1.00 39.43  ? 104  PHE E O     1 
ATOM   3599  C  CB    . PHE E  1 104 ? -7.989  -23.850 62.602 1.00 37.28  ? 104  PHE E CB    1 
ATOM   3600  C  CG    . PHE E  1 104 ? -7.340  -25.195 62.484 1.00 38.20  ? 104  PHE E CG    1 
ATOM   3601  C  CD1   . PHE E  1 104 ? -6.372  -25.433 61.514 1.00 38.72  ? 104  PHE E CD1   1 
ATOM   3602  C  CD2   . PHE E  1 104 ? -7.687  -26.228 63.349 1.00 37.62  ? 104  PHE E CD2   1 
ATOM   3603  C  CE1   . PHE E  1 104 ? -5.751  -26.708 61.419 1.00 38.99  ? 104  PHE E CE1   1 
ATOM   3604  C  CE2   . PHE E  1 104 ? -7.079  -27.480 63.258 1.00 37.00  ? 104  PHE E CE2   1 
ATOM   3605  C  CZ    . PHE E  1 104 ? -6.106  -27.714 62.279 1.00 37.13  ? 104  PHE E CZ    1 
ATOM   3606  N  N     . GLU E  1 105 ? -10.088 -21.482 61.862 1.00 38.95  ? 105  GLU E N     1 
ATOM   3607  C  CA    . GLU E  1 105 ? -10.755 -20.236 62.273 1.00 39.13  ? 105  GLU E CA    1 
ATOM   3608  C  C     . GLU E  1 105 ? -12.198 -20.542 62.508 1.00 38.97  ? 105  GLU E C     1 
ATOM   3609  O  O     . GLU E  1 105 ? -12.694 -20.339 63.616 1.00 39.75  ? 105  GLU E O     1 
ATOM   3610  C  CB    . GLU E  1 105 ? -10.609 -19.092 61.258 1.00 39.06  ? 105  GLU E CB    1 
ATOM   3611  C  CG    . GLU E  1 105 ? -9.192  -18.661 61.042 1.00 39.72  ? 105  GLU E CG    1 
ATOM   3612  C  CD    . GLU E  1 105 ? -9.006  -17.830 59.799 1.00 42.25  ? 105  GLU E CD    1 
ATOM   3613  O  OE1   . GLU E  1 105 ? -10.000 -17.627 59.081 1.00 44.79  ? 105  GLU E OE1   1 
ATOM   3614  O  OE2   . GLU E  1 105 ? -7.861  -17.387 59.532 1.00 44.09  ? 105  GLU E OE2   1 
ATOM   3615  N  N     . ASP E  1 106 ? -12.874 -21.076 61.488 1.00 39.11  ? 106  ASP E N     1 
ATOM   3616  C  CA    . ASP E  1 106 ? -14.256 -21.577 61.665 1.00 38.54  ? 106  ASP E CA    1 
ATOM   3617  C  C     . ASP E  1 106 ? -14.429 -22.497 62.886 1.00 37.77  ? 106  ASP E C     1 
ATOM   3618  O  O     . ASP E  1 106 ? -15.388 -22.349 63.639 1.00 36.84  ? 106  ASP E O     1 
ATOM   3619  C  CB    . ASP E  1 106 ? -14.738 -22.259 60.393 1.00 38.39  ? 106  ASP E CB    1 
ATOM   3620  C  CG    . ASP E  1 106 ? -14.885 -21.286 59.222 1.00 41.76  ? 106  ASP E CG    1 
ATOM   3621  O  OD1   . ASP E  1 106 ? -14.524 -20.093 59.392 1.00 45.49  ? 106  ASP E OD1   1 
ATOM   3622  O  OD2   . ASP E  1 106 ? -15.380 -21.702 58.129 1.00 42.86  ? 106  ASP E OD2   1 
ATOM   3623  N  N     . THR E  1 107 ? -13.483 -23.430 63.069 1.00 38.56  ? 107  THR E N     1 
ATOM   3624  C  CA    . THR E  1 107 ? -13.479 -24.432 64.168 1.00 39.48  ? 107  THR E CA    1 
ATOM   3625  C  C     . THR E  1 107 ? -13.412 -23.753 65.536 1.00 39.76  ? 107  THR E C     1 
ATOM   3626  O  O     . THR E  1 107 ? -14.227 -24.046 66.416 1.00 39.34  ? 107  THR E O     1 
ATOM   3627  C  CB    . THR E  1 107 ? -12.279 -25.430 64.035 1.00 39.57  ? 107  THR E CB    1 
ATOM   3628  O  OG1   . THR E  1 107 ? -12.356 -26.131 62.799 1.00 40.21  ? 107  THR E OG1   1 
ATOM   3629  C  CG2   . THR E  1 107 ? -12.246 -26.441 65.156 1.00 40.34  ? 107  THR E CG2   1 
ATOM   3630  N  N     . ASN E  1 108 ? -12.433 -22.854 65.694 1.00 40.62  ? 108  ASN E N     1 
ATOM   3631  C  CA    . ASN E  1 108 ? -12.299 -21.966 66.874 1.00 41.76  ? 108  ASN E CA    1 
ATOM   3632  C  C     . ASN E  1 108 ? -13.575 -21.224 67.222 1.00 42.12  ? 108  ASN E C     1 
ATOM   3633  O  O     . ASN E  1 108 ? -13.935 -21.054 68.389 1.00 42.89  ? 108  ASN E O     1 
ATOM   3634  C  CB    . ASN E  1 108 ? -11.203 -20.946 66.616 1.00 41.96  ? 108  ASN E CB    1 
ATOM   3635  C  CG    . ASN E  1 108 ? -10.509 -20.493 67.882 1.00 44.33  ? 108  ASN E CG    1 
ATOM   3636  O  OD1   . ASN E  1 108 ? -10.607 -21.133 68.936 1.00 48.42  ? 108  ASN E OD1   1 
ATOM   3637  N  ND2   . ASN E  1 108 ? -9.784  -19.385 67.783 1.00 44.40  ? 108  ASN E ND2   1 
ATOM   3638  N  N     . LEU E  1 109 ? -14.271 -20.799 66.189 1.00 42.58  ? 109  LEU E N     1 
ATOM   3639  C  CA    . LEU E  1 109 ? -15.480 -20.035 66.321 1.00 42.98  ? 109  LEU E CA    1 
ATOM   3640  C  C     . LEU E  1 109 ? -16.634 -20.921 66.808 1.00 43.15  ? 109  LEU E C     1 
ATOM   3641  O  O     . LEU E  1 109 ? -17.521 -20.469 67.522 1.00 43.94  ? 109  LEU E O     1 
ATOM   3642  C  CB    . LEU E  1 109 ? -15.767 -19.410 64.948 1.00 43.13  ? 109  LEU E CB    1 
ATOM   3643  C  CG    . LEU E  1 109 ? -16.043 -17.907 64.794 1.00 43.34  ? 109  LEU E CG    1 
ATOM   3644  C  CD1   . LEU E  1 109 ? -15.085 -17.037 65.584 1.00 39.69  ? 109  LEU E CD1   1 
ATOM   3645  C  CD2   . LEU E  1 109 ? -16.029 -17.561 63.309 1.00 42.34  ? 109  LEU E CD2   1 
ATOM   3646  N  N     . CYS E  1 110 ? -16.609 -22.194 66.427 1.00 43.88  ? 110  CYS E N     1 
ATOM   3647  C  CA    . CYS E  1 110 ? -17.548 -23.227 66.954 1.00 43.08  ? 110  CYS E CA    1 
ATOM   3648  C  C     . CYS E  1 110 ? -17.235 -23.657 68.398 1.00 43.29  ? 110  CYS E C     1 
ATOM   3649  O  O     . CYS E  1 110 ? -18.150 -23.894 69.167 1.00 43.50  ? 110  CYS E O     1 
ATOM   3650  C  CB    . CYS E  1 110 ? -17.581 -24.453 66.033 1.00 42.78  ? 110  CYS E CB    1 
ATOM   3651  S  SG    . CYS E  1 110 ? -18.352 -24.220 64.409 1.00 42.13  ? 110  CYS E SG    1 
ATOM   3652  N  N     . ALA E  1 111 ? -15.962 -23.794 68.764 1.00 43.48  ? 111  ALA E N     1 
ATOM   3653  C  CA    . ALA E  1 111 ? -15.608 -23.989 70.168 1.00 44.61  ? 111  ALA E CA    1 
ATOM   3654  C  C     . ALA E  1 111 ? -16.187 -22.874 71.034 1.00 45.85  ? 111  ALA E C     1 
ATOM   3655  O  O     . ALA E  1 111 ? -16.986 -23.143 71.920 1.00 46.92  ? 111  ALA E O     1 
ATOM   3656  C  CB    . ALA E  1 111 ? -14.099 -24.085 70.348 1.00 44.42  ? 111  ALA E CB    1 
ATOM   3657  N  N     . ILE E  1 112 ? -15.797 -21.621 70.752 1.00 47.10  ? 112  ILE E N     1 
ATOM   3658  C  CA    . ILE E  1 112 ? -16.280 -20.390 71.431 1.00 46.68  ? 112  ILE E CA    1 
ATOM   3659  C  C     . ILE E  1 112 ? -17.798 -20.289 71.530 1.00 47.82  ? 112  ILE E C     1 
ATOM   3660  O  O     . ILE E  1 112 ? -18.320 -19.809 72.535 1.00 48.95  ? 112  ILE E O     1 
ATOM   3661  C  CB    . ILE E  1 112 ? -15.693 -19.110 70.747 1.00 46.30  ? 112  ILE E CB    1 
ATOM   3662  C  CG1   . ILE E  1 112 ? -14.193 -19.000 70.987 1.00 46.34  ? 112  ILE E CG1   1 
ATOM   3663  C  CG2   . ILE E  1 112 ? -16.321 -17.854 71.263 1.00 45.99  ? 112  ILE E CG2   1 
ATOM   3664  C  CD1   . ILE E  1 112 ? -13.448 -18.251 69.908 1.00 46.49  ? 112  ILE E CD1   1 
ATOM   3665  N  N     . HIS E  1 113 ? -18.519 -20.723 70.494 1.00 48.81  ? 113  HIS E N     1 
ATOM   3666  C  CA    . HIS E  1 113 ? -19.988 -20.788 70.542 1.00 49.33  ? 113  HIS E CA    1 
ATOM   3667  C  C     . HIS E  1 113 ? -20.479 -21.703 71.659 1.00 50.28  ? 113  HIS E C     1 
ATOM   3668  O  O     . HIS E  1 113 ? -21.548 -21.487 72.242 1.00 50.90  ? 113  HIS E O     1 
ATOM   3669  C  CB    . HIS E  1 113 ? -20.534 -21.312 69.220 1.00 48.92  ? 113  HIS E CB    1 
ATOM   3670  C  CG    . HIS E  1 113 ? -22.024 -21.208 69.092 1.00 49.04  ? 113  HIS E CG    1 
ATOM   3671  N  ND1   . HIS E  1 113 ? -22.684 -19.998 69.018 1.00 48.92  ? 113  HIS E ND1   1 
ATOM   3672  C  CD2   . HIS E  1 113 ? -22.982 -22.163 68.999 1.00 49.81  ? 113  HIS E CD2   1 
ATOM   3673  C  CE1   . HIS E  1 113 ? -23.983 -20.211 68.894 1.00 48.63  ? 113  HIS E CE1   1 
ATOM   3674  N  NE2   . HIS E  1 113 ? -24.191 -21.516 68.879 1.00 49.87  ? 113  HIS E NE2   1 
ATOM   3675  N  N     . ALA E  1 114 ? -19.695 -22.744 71.922 1.00 51.28  ? 114  ALA E N     1 
ATOM   3676  C  CA    . ALA E  1 114 ? -20.007 -23.763 72.915 1.00 51.84  ? 114  ALA E CA    1 
ATOM   3677  C  C     . ALA E  1 114 ? -19.431 -23.358 74.256 1.00 52.73  ? 114  ALA E C     1 
ATOM   3678  O  O     . ALA E  1 114 ? -19.442 -24.146 75.200 1.00 53.77  ? 114  ALA E O     1 
ATOM   3679  C  CB    . ALA E  1 114 ? -19.429 -25.086 72.484 1.00 51.52  ? 114  ALA E CB    1 
ATOM   3680  N  N     . LYS E  1 115 ? -18.939 -22.116 74.331 1.00 53.28  ? 115  LYS E N     1 
ATOM   3681  C  CA    . LYS E  1 115 ? -18.346 -21.539 75.538 1.00 52.90  ? 115  LYS E CA    1 
ATOM   3682  C  C     . LYS E  1 115 ? -17.070 -22.265 75.954 1.00 52.51  ? 115  LYS E C     1 
ATOM   3683  O  O     . LYS E  1 115 ? -16.751 -22.321 77.141 1.00 52.74  ? 115  LYS E O     1 
ATOM   3684  C  CB    . LYS E  1 115 ? -19.357 -21.488 76.686 1.00 53.48  ? 115  LYS E CB    1 
ATOM   3685  C  CG    . LYS E  1 115 ? -20.408 -20.361 76.591 1.00 55.98  ? 115  LYS E CG    1 
ATOM   3686  C  CD    . LYS E  1 115 ? -21.778 -20.887 77.025 1.00 60.88  ? 115  LYS E CD    1 
ATOM   3687  C  CE    . LYS E  1 115 ? -22.602 -19.869 77.833 1.00 63.71  ? 115  LYS E CE    1 
ATOM   3688  N  NZ    . LYS E  1 115 ? -22.952 -18.629 77.081 1.00 63.71  ? 115  LYS E NZ    1 
ATOM   3689  N  N     . ARG E  1 116 ? -16.339 -22.797 74.968 1.00 51.54  ? 116  ARG E N     1 
ATOM   3690  C  CA    . ARG E  1 116 ? -15.029 -23.428 75.188 1.00 50.14  ? 116  ARG E CA    1 
ATOM   3691  C  C     . ARG E  1 116 ? -13.909 -22.620 74.538 1.00 49.90  ? 116  ARG E C     1 
ATOM   3692  O  O     . ARG E  1 116 ? -14.154 -21.614 73.885 1.00 50.40  ? 116  ARG E O     1 
ATOM   3693  C  CB    . ARG E  1 116 ? -15.008 -24.864 74.639 1.00 50.17  ? 116  ARG E CB    1 
ATOM   3694  C  CG    . ARG E  1 116 ? -15.834 -25.890 75.447 1.00 49.42  ? 116  ARG E CG    1 
ATOM   3695  C  CD    . ARG E  1 116 ? -15.805 -27.264 74.784 1.00 48.25  ? 116  ARG E CD    1 
ATOM   3696  N  NE    . ARG E  1 116 ? -16.672 -27.380 73.587 1.00 45.38  ? 116  ARG E NE    1 
ATOM   3697  C  CZ    . ARG E  1 116 ? -16.254 -27.380 72.317 1.00 41.23  ? 116  ARG E CZ    1 
ATOM   3698  N  NH1   . ARG E  1 116 ? -14.974 -27.242 72.018 1.00 40.68  ? 116  ARG E NH1   1 
ATOM   3699  N  NH2   . ARG E  1 116 ? -17.127 -27.515 71.340 1.00 38.98  ? 116  ARG E NH2   1 
ATOM   3700  N  N     . VAL E  1 117 ? -12.677 -23.071 74.728 1.00 49.14  ? 117  VAL E N     1 
ATOM   3701  C  CA    . VAL E  1 117 ? -11.500 -22.477 74.106 1.00 48.55  ? 117  VAL E CA    1 
ATOM   3702  C  C     . VAL E  1 117 ? -10.659 -23.607 73.499 1.00 47.95  ? 117  VAL E C     1 
ATOM   3703  O  O     . VAL E  1 117 ? -9.611  -23.386 72.923 1.00 47.45  ? 117  VAL E O     1 
ATOM   3704  C  CB    . VAL E  1 117 ? -10.646 -21.609 75.124 1.00 48.84  ? 117  VAL E CB    1 
ATOM   3705  C  CG1   . VAL E  1 117 ? -11.518 -20.627 75.882 1.00 49.11  ? 117  VAL E CG1   1 
ATOM   3706  C  CG2   . VAL E  1 117 ? -9.864  -22.467 76.110 1.00 48.40  ? 117  VAL E CG2   1 
ATOM   3707  N  N     . THR E  1 118 ? -11.137 -24.833 73.665 1.00 47.84  ? 118  THR E N     1 
ATOM   3708  C  CA    . THR E  1 118 ? -10.450 -26.012 73.181 1.00 47.13  ? 118  THR E CA    1 
ATOM   3709  C  C     . THR E  1 118 ? -11.151 -26.496 71.952 1.00 46.91  ? 118  THR E C     1 
ATOM   3710  O  O     . THR E  1 118 ? -12.358 -26.815 71.983 1.00 47.06  ? 118  THR E O     1 
ATOM   3711  C  CB    . THR E  1 118 ? -10.499 -27.094 74.216 1.00 46.92  ? 118  THR E CB    1 
ATOM   3712  O  OG1   . THR E  1 118 ? -10.102 -26.525 75.470 1.00 49.12  ? 118  THR E OG1   1 
ATOM   3713  C  CG2   . THR E  1 118 ? -9.569  -28.244 73.847 1.00 47.34  ? 118  THR E CG2   1 
ATOM   3714  N  N     . ILE E  1 119 ? -10.423 -26.523 70.848 1.00 46.19  ? 119  ILE E N     1 
ATOM   3715  C  CA    . ILE E  1 119 ? -11.026 -27.043 69.635 1.00 46.16  ? 119  ILE E CA    1 
ATOM   3716  C  C     . ILE E  1 119 ? -11.126 -28.580 69.723 1.00 46.74  ? 119  ILE E C     1 
ATOM   3717  O  O     . ILE E  1 119 ? -10.162 -29.273 70.093 1.00 47.02  ? 119  ILE E O     1 
ATOM   3718  C  CB    . ILE E  1 119 ? -10.333 -26.533 68.339 1.00 45.58  ? 119  ILE E CB    1 
ATOM   3719  C  CG1   . ILE E  1 119 ? -8.842  -26.862 68.325 1.00 43.85  ? 119  ILE E CG1   1 
ATOM   3720  C  CG2   . ILE E  1 119 ? -10.548 -25.048 68.202 1.00 45.95  ? 119  ILE E CG2   1 
ATOM   3721  C  CD1   . ILE E  1 119 ? -8.239  -26.945 66.948 1.00 41.82  ? 119  ILE E CD1   1 
ATOM   3722  N  N     . MET E  1 120 ? -12.306 -29.096 69.400 1.00 46.76  ? 120  MET E N     1 
ATOM   3723  C  CA    . MET E  1 120 ? -12.562 -30.525 69.445 1.00 46.90  ? 120  MET E CA    1 
ATOM   3724  C  C     . MET E  1 120 ? -13.006 -31.013 68.081 1.00 46.51  ? 120  MET E C     1 
ATOM   3725  O  O     . MET E  1 120 ? -13.449 -30.207 67.265 1.00 47.02  ? 120  MET E O     1 
ATOM   3726  C  CB    . MET E  1 120 ? -13.604 -30.825 70.521 1.00 46.55  ? 120  MET E CB    1 
ATOM   3727  C  CG    . MET E  1 120 ? -13.041 -30.568 71.904 1.00 46.78  ? 120  MET E CG    1 
ATOM   3728  S  SD    . MET E  1 120 ? -14.289 -30.602 73.176 1.00 48.79  ? 120  MET E SD    1 
ATOM   3729  C  CE    . MET E  1 120 ? -14.545 -32.364 73.424 1.00 48.89  ? 120  MET E CE    1 
ATOM   3730  N  N     . PRO E  1 121 ? -12.838 -32.329 67.799 1.00 46.25  ? 121  PRO E N     1 
ATOM   3731  C  CA    . PRO E  1 121 ? -13.311 -32.921 66.554 1.00 45.29  ? 121  PRO E CA    1 
ATOM   3732  C  C     . PRO E  1 121 ? -14.725 -32.506 66.163 1.00 44.76  ? 121  PRO E C     1 
ATOM   3733  O  O     . PRO E  1 121 ? -15.003 -32.313 64.971 1.00 45.07  ? 121  PRO E O     1 
ATOM   3734  C  CB    . PRO E  1 121 ? -13.238 -34.423 66.854 1.00 45.23  ? 121  PRO E CB    1 
ATOM   3735  C  CG    . PRO E  1 121 ? -12.060 -34.528 67.678 1.00 45.40  ? 121  PRO E CG    1 
ATOM   3736  C  CD    . PRO E  1 121 ? -12.122 -33.341 68.609 1.00 45.91  ? 121  PRO E CD    1 
ATOM   3737  N  N     . LYS E  1 122 ? -15.609 -32.355 67.139 1.00 44.32  ? 122  LYS E N     1 
ATOM   3738  C  CA    . LYS E  1 122 ? -16.994 -31.989 66.836 1.00 44.20  ? 122  LYS E CA    1 
ATOM   3739  C  C     . LYS E  1 122 ? -17.187 -30.534 66.391 1.00 43.69  ? 122  LYS E C     1 
ATOM   3740  O  O     . LYS E  1 122 ? -18.196 -30.215 65.786 1.00 44.47  ? 122  LYS E O     1 
ATOM   3741  C  CB    . LYS E  1 122 ? -17.941 -32.340 67.995 1.00 44.34  ? 122  LYS E CB    1 
ATOM   3742  C  CG    . LYS E  1 122 ? -17.706 -31.572 69.282 1.00 45.58  ? 122  LYS E CG    1 
ATOM   3743  C  CD    . LYS E  1 122 ? -18.985 -31.487 70.052 1.00 46.86  ? 122  LYS E CD    1 
ATOM   3744  C  CE    . LYS E  1 122 ? -18.692 -31.076 71.475 1.00 50.00  ? 122  LYS E CE    1 
ATOM   3745  N  NZ    . LYS E  1 122 ? -18.667 -32.253 72.377 1.00 51.93  ? 122  LYS E NZ    1 
ATOM   3746  N  N     . ASP E  1 123 ? -16.244 -29.658 66.724 1.00 43.09  ? 123  ASP E N     1 
ATOM   3747  C  CA    . ASP E  1 123 ? -16.229 -28.285 66.216 1.00 42.26  ? 123  ASP E CA    1 
ATOM   3748  C  C     . ASP E  1 123 ? -15.866 -28.302 64.739 1.00 42.33  ? 123  ASP E C     1 
ATOM   3749  O  O     . ASP E  1 123 ? -16.447 -27.569 63.959 1.00 42.60  ? 123  ASP E O     1 
ATOM   3750  C  CB    . ASP E  1 123 ? -15.236 -27.405 66.991 1.00 41.25  ? 123  ASP E CB    1 
ATOM   3751  C  CG    . ASP E  1 123 ? -15.519 -27.366 68.490 1.00 40.93  ? 123  ASP E CG    1 
ATOM   3752  O  OD1   . ASP E  1 123 ? -16.694 -27.275 68.887 1.00 41.48  ? 123  ASP E OD1   1 
ATOM   3753  O  OD2   . ASP E  1 123 ? -14.570 -27.431 69.285 1.00 36.96  ? 123  ASP E OD2   1 
ATOM   3754  N  N     . ILE E  1 124 ? -14.905 -29.138 64.356 1.00 42.99  ? 124  ILE E N     1 
ATOM   3755  C  CA    . ILE E  1 124 ? -14.486 -29.238 62.954 1.00 43.27  ? 124  ILE E CA    1 
ATOM   3756  C  C     . ILE E  1 124 ? -15.660 -29.758 62.125 1.00 44.74  ? 124  ILE E C     1 
ATOM   3757  O  O     . ILE E  1 124 ? -15.939 -29.234 61.049 1.00 45.35  ? 124  ILE E O     1 
ATOM   3758  C  CB    . ILE E  1 124 ? -13.302 -30.197 62.775 1.00 42.81  ? 124  ILE E CB    1 
ATOM   3759  C  CG1   . ILE E  1 124 ? -12.045 -29.703 63.512 1.00 43.50  ? 124  ILE E CG1   1 
ATOM   3760  C  CG2   . ILE E  1 124 ? -13.002 -30.405 61.320 1.00 43.14  ? 124  ILE E CG2   1 
ATOM   3761  C  CD1   . ILE E  1 124 ? -10.771 -30.495 63.168 1.00 42.74  ? 124  ILE E CD1   1 
ATOM   3762  N  N     . GLN E  1 125 ? -16.335 -30.789 62.641 1.00 45.30  ? 125  GLN E N     1 
ATOM   3763  C  CA    . GLN E  1 125 ? -17.444 -31.424 61.972 1.00 45.56  ? 125  GLN E CA    1 
ATOM   3764  C  C     . GLN E  1 125 ? -18.610 -30.454 61.803 1.00 45.26  ? 125  GLN E C     1 
ATOM   3765  O  O     . GLN E  1 125 ? -19.291 -30.480 60.779 1.00 45.97  ? 125  GLN E O     1 
ATOM   3766  C  CB    . GLN E  1 125 ? -17.877 -32.689 62.747 1.00 46.42  ? 125  GLN E CB    1 
ATOM   3767  C  CG    . GLN E  1 125 ? -16.862 -33.874 62.730 1.00 45.99  ? 125  GLN E CG    1 
ATOM   3768  C  CD    . GLN E  1 125 ? -16.953 -34.757 63.980 1.00 46.97  ? 125  GLN E CD    1 
ATOM   3769  O  OE1   . GLN E  1 125 ? -15.999 -35.453 64.325 1.00 47.60  ? 125  GLN E OE1   1 
ATOM   3770  N  NE2   . GLN E  1 125 ? -18.103 -34.722 64.669 1.00 49.23  ? 125  GLN E NE2   1 
ATOM   3771  N  N     . LEU E  1 126 ? -18.841 -29.587 62.785 1.00 44.53  ? 126  LEU E N     1 
ATOM   3772  C  CA    . LEU E  1 126 ? -19.883 -28.556 62.646 1.00 43.75  ? 126  LEU E CA    1 
ATOM   3773  C  C     . LEU E  1 126 ? -19.522 -27.536 61.583 1.00 43.41  ? 126  LEU E C     1 
ATOM   3774  O  O     . LEU E  1 126 ? -20.343 -27.226 60.724 1.00 43.60  ? 126  LEU E O     1 
ATOM   3775  C  CB    . LEU E  1 126 ? -20.199 -27.868 63.973 1.00 43.66  ? 126  LEU E CB    1 
ATOM   3776  C  CG    . LEU E  1 126 ? -21.427 -26.936 63.934 1.00 44.19  ? 126  LEU E CG    1 
ATOM   3777  C  CD1   . LEU E  1 126 ? -22.669 -27.652 63.474 1.00 44.88  ? 126  LEU E CD1   1 
ATOM   3778  C  CD2   . LEU E  1 126 ? -21.692 -26.309 65.285 1.00 43.76  ? 126  LEU E CD2   1 
ATOM   3779  N  N     . ALA E  1 127 ? -18.288 -27.037 61.636 1.00 42.81  ? 127  ALA E N     1 
ATOM   3780  C  CA    . ALA E  1 127 ? -17.738 -26.187 60.592 1.00 43.03  ? 127  ALA E CA    1 
ATOM   3781  C  C     . ALA E  1 127 ? -17.983 -26.756 59.192 1.00 43.50  ? 127  ALA E C     1 
ATOM   3782  O  O     . ALA E  1 127 ? -18.500 -26.049 58.326 1.00 43.25  ? 127  ALA E O     1 
ATOM   3783  C  CB    . ALA E  1 127 ? -16.238 -25.945 60.822 1.00 42.76  ? 127  ALA E CB    1 
ATOM   3784  N  N     . ARG E  1 128 ? -17.628 -28.034 58.992 1.00 43.84  ? 128  ARG E N     1 
ATOM   3785  C  CA    . ARG E  1 128 ? -17.703 -28.698 57.692 1.00 44.00  ? 128  ARG E CA    1 
ATOM   3786  C  C     . ARG E  1 128 ? -19.130 -28.989 57.231 1.00 44.52  ? 128  ARG E C     1 
ATOM   3787  O  O     . ARG E  1 128 ? -19.384 -29.023 56.049 1.00 43.77  ? 128  ARG E O     1 
ATOM   3788  C  CB    . ARG E  1 128 ? -16.860 -29.954 57.699 1.00 43.53  ? 128  ARG E CB    1 
ATOM   3789  C  CG    . ARG E  1 128 ? -15.403 -29.649 57.818 1.00 45.24  ? 128  ARG E CG    1 
ATOM   3790  C  CD    . ARG E  1 128 ? -14.511 -30.833 57.581 1.00 47.19  ? 128  ARG E CD    1 
ATOM   3791  N  NE    . ARG E  1 128 ? -14.352 -31.157 56.169 1.00 49.82  ? 128  ARG E NE    1 
ATOM   3792  C  CZ    . ARG E  1 128 ? -14.804 -32.277 55.593 1.00 53.10  ? 128  ARG E CZ    1 
ATOM   3793  N  NH1   . ARG E  1 128 ? -15.464 -33.190 56.305 1.00 52.67  ? 128  ARG E NH1   1 
ATOM   3794  N  NH2   . ARG E  1 128 ? -14.604 -32.487 54.292 1.00 54.21  ? 128  ARG E NH2   1 
ATOM   3795  N  N     . ARG E  1 129 ? -20.043 -29.206 58.170 1.00 45.98  ? 129  ARG E N     1 
ATOM   3796  C  CA    . ARG E  1 129 ? -21.457 -29.403 57.871 1.00 48.23  ? 129  ARG E CA    1 
ATOM   3797  C  C     . ARG E  1 129 ? -22.125 -28.105 57.378 1.00 49.29  ? 129  ARG E C     1 
ATOM   3798  O  O     . ARG E  1 129 ? -22.741 -28.090 56.307 1.00 49.65  ? 129  ARG E O     1 
ATOM   3799  C  CB    . ARG E  1 129 ? -22.187 -29.982 59.089 1.00 48.38  ? 129  ARG E CB    1 
ATOM   3800  C  CG    . ARG E  1 129 ? -23.663 -30.330 58.851 1.00 51.41  ? 129  ARG E CG    1 
ATOM   3801  C  CD    . ARG E  1 129 ? -24.086 -31.567 59.674 1.00 56.60  ? 129  ARG E CD    1 
ATOM   3802  N  NE    . ARG E  1 129 ? -25.500 -31.949 59.487 1.00 58.48  ? 129  ARG E NE    1 
ATOM   3803  C  CZ    . ARG E  1 129 ? -26.244 -32.593 60.396 1.00 59.20  ? 129  ARG E CZ    1 
ATOM   3804  N  NH1   . ARG E  1 129 ? -25.728 -32.938 61.580 1.00 58.09  ? 129  ARG E NH1   1 
ATOM   3805  N  NH2   . ARG E  1 129 ? -27.523 -32.877 60.128 1.00 58.87  ? 129  ARG E NH2   1 
ATOM   3806  N  N     . ILE E  1 130 ? -21.986 -27.019 58.141 1.00 50.23  ? 130  ILE E N     1 
ATOM   3807  C  CA    . ILE E  1 130 ? -22.479 -25.713 57.707 1.00 51.23  ? 130  ILE E CA    1 
ATOM   3808  C  C     . ILE E  1 130 ? -21.806 -25.229 56.419 1.00 52.20  ? 130  ILE E C     1 
ATOM   3809  O  O     . ILE E  1 130 ? -22.492 -24.742 55.510 1.00 52.71  ? 130  ILE E O     1 
ATOM   3810  C  CB    . ILE E  1 130 ? -22.353 -24.664 58.804 1.00 51.48  ? 130  ILE E CB    1 
ATOM   3811  C  CG1   . ILE E  1 130 ? -23.042 -25.168 60.074 1.00 51.80  ? 130  ILE E CG1   1 
ATOM   3812  C  CG2   . ILE E  1 130 ? -22.976 -23.347 58.357 1.00 50.74  ? 130  ILE E CG2   1 
ATOM   3813  C  CD1   . ILE E  1 130 ? -22.535 -24.475 61.305 1.00 54.79  ? 130  ILE E CD1   1 
ATOM   3814  N  N     . ARG E  1 131 ? -20.480 -25.376 56.345 1.00 52.69  ? 131  ARG E N     1 
ATOM   3815  C  CA    . ARG E  1 131 ? -19.706 -25.125 55.123 1.00 52.96  ? 131  ARG E CA    1 
ATOM   3816  C  C     . ARG E  1 131 ? -20.227 -25.884 53.903 1.00 54.29  ? 131  ARG E C     1 
ATOM   3817  O  O     . ARG E  1 131 ? -19.948 -25.495 52.782 1.00 54.82  ? 131  ARG E O     1 
ATOM   3818  C  CB    . ARG E  1 131 ? -18.246 -25.519 55.319 1.00 51.93  ? 131  ARG E CB    1 
ATOM   3819  C  CG    . ARG E  1 131 ? -17.336 -24.430 55.730 1.00 49.17  ? 131  ARG E CG    1 
ATOM   3820  C  CD    . ARG E  1 131 ? -16.006 -25.031 56.160 1.00 45.27  ? 131  ARG E CD    1 
ATOM   3821  N  NE    . ARG E  1 131 ? -15.015 -24.022 56.515 1.00 41.19  ? 131  ARG E NE    1 
ATOM   3822  C  CZ    . ARG E  1 131 ? -13.835 -23.902 55.906 1.00 43.37  ? 131  ARG E CZ    1 
ATOM   3823  N  NH1   . ARG E  1 131 ? -13.484 -24.738 54.945 1.00 43.27  ? 131  ARG E NH1   1 
ATOM   3824  N  NH2   . ARG E  1 131 ? -12.985 -22.951 56.261 1.00 45.24  ? 131  ARG E NH2   1 
ATOM   3825  N  N     . GLY E  1 132 ? -20.960 -26.972 54.110 1.00 55.73  ? 132  GLY E N     1 
ATOM   3826  C  CA    . GLY E  1 132 ? -21.450 -27.760 52.988 1.00 57.63  ? 132  GLY E CA    1 
ATOM   3827  C  C     . GLY E  1 132 ? -20.460 -28.793 52.493 1.00 59.59  ? 132  GLY E C     1 
ATOM   3828  O  O     . GLY E  1 132 ? -20.619 -29.331 51.394 1.00 59.88  ? 132  GLY E O     1 
ATOM   3829  N  N     . GLU E  1 133 ? -19.428 -29.060 53.295 1.00 61.20  ? 133  GLU E N     1 
ATOM   3830  C  CA    . GLU E  1 133 ? -18.527 -30.198 53.090 1.00 63.02  ? 133  GLU E CA    1 
ATOM   3831  C  C     . GLU E  1 133 ? -19.096 -31.494 53.738 1.00 64.96  ? 133  GLU E C     1 
ATOM   3832  O  O     . GLU E  1 133 ? -18.457 -32.554 53.722 1.00 65.07  ? 133  GLU E O     1 
ATOM   3833  C  CB    . GLU E  1 133 ? -17.137 -29.874 53.648 1.00 62.48  ? 133  GLU E CB    1 
ATOM   3834  C  CG    . GLU E  1 133 ? -16.434 -28.728 52.948 1.00 61.89  ? 133  GLU E CG    1 
ATOM   3835  C  CD    . GLU E  1 133 ? -15.315 -28.112 53.774 1.00 60.91  ? 133  GLU E CD    1 
ATOM   3836  O  OE1   . GLU E  1 133 ? -14.463 -28.838 54.318 1.00 60.60  ? 133  GLU E OE1   1 
ATOM   3837  O  OE2   . GLU E  1 133 ? -15.277 -26.880 53.875 1.00 62.03  ? 133  GLU E OE2   1 
ATOM   3838  N  N     . ARG E  1 134 ? -20.291 -31.386 54.325 1.00 67.28  ? 134  ARG E N     1 
ATOM   3839  C  CA    . ARG E  1 134 ? -21.001 -32.534 54.889 1.00 69.47  ? 134  ARG E CA    1 
ATOM   3840  C  C     . ARG E  1 134 ? -22.534 -32.501 54.680 1.00 70.67  ? 134  ARG E C     1 
ATOM   3841  O  O     . ARG E  1 134 ? -23.164 -33.577 54.605 1.00 71.02  ? 134  ARG E O     1 
ATOM   3842  C  CB    . ARG E  1 134 ? -20.636 -32.773 56.378 1.00 69.66  ? 134  ARG E CB    1 
ATOM   3843  C  CG    . ARG E  1 134 ? -19.277 -33.478 56.627 1.00 71.16  ? 134  ARG E CG    1 
ATOM   3844  C  CD    . ARG E  1 134 ? -19.218 -34.909 56.017 1.00 73.46  ? 134  ARG E CD    1 
ATOM   3845  N  NE    . ARG E  1 134 ? -18.050 -35.104 55.144 1.00 75.84  ? 134  ARG E NE    1 
ATOM   3846  C  CZ    . ARG E  1 134 ? -16.993 -35.883 55.412 1.00 76.23  ? 134  ARG E CZ    1 
ATOM   3847  N  NH1   . ARG E  1 134 ? -16.918 -36.584 56.544 1.00 76.48  ? 134  ARG E NH1   1 
ATOM   3848  N  NH2   . ARG E  1 134 ? -15.996 -35.965 54.534 1.00 74.83  ? 134  ARG E NH2   1 
ATOM   3849  N  N     . ALA E  1 135 ? -23.131 -31.300 54.588 1.00 71.83  ? 135  ALA E N     1 
ATOM   3850  C  CA    . ALA E  1 135 ? -24.611 -31.168 54.421 1.00 73.03  ? 135  ALA E CA    1 
ATOM   3851  C  C     . ALA E  1 135 ? -25.139 -29.752 54.152 1.00 73.66  ? 135  ALA E C     1 
ATOM   3852  O  O     . ALA E  1 135 ? -24.388 -28.767 54.118 1.00 74.15  ? 135  ALA E O     1 
ATOM   3853  C  CB    . ALA E  1 135 ? -25.388 -31.802 55.633 1.00 73.16  ? 135  ALA E CB    1 
ATOM   3854  O  OXT   . ALA E  1 135 ? -26.361 -29.567 53.979 1.00 73.97  ? 135  ALA E OXT   1 
ATOM   3855  N  N     . LYS F  2 16  ? 18.435  -51.920 38.183 1.00 99.57  ? 16   LYS F N     1 
ATOM   3856  C  CA    . LYS F  2 16  ? 18.814  -50.638 38.858 1.00 99.64  ? 16   LYS F CA    1 
ATOM   3857  C  C     . LYS F  2 16  ? 17.584  -49.886 39.380 1.00 99.21  ? 16   LYS F C     1 
ATOM   3858  O  O     . LYS F  2 16  ? 17.628  -49.274 40.461 1.00 99.17  ? 16   LYS F O     1 
ATOM   3859  C  CB    . LYS F  2 16  ? 19.621  -49.736 37.908 1.00 99.67  ? 16   LYS F CB    1 
ATOM   3860  C  CG    . LYS F  2 16  ? 20.453  -48.678 38.626 1.00 100.04 ? 16   LYS F CG    1 
ATOM   3861  C  CD    . LYS F  2 16  ? 21.042  -47.648 37.668 1.00 99.92  ? 16   LYS F CD    1 
ATOM   3862  C  CE    . LYS F  2 16  ? 21.812  -46.575 38.445 1.00 99.83  ? 16   LYS F CE    1 
ATOM   3863  N  NZ    . LYS F  2 16  ? 22.387  -45.520 37.568 1.00 98.87  ? 16   LYS F NZ    1 
ATOM   3864  N  N     . ARG F  2 17  ? 16.499  -49.952 38.603 1.00 98.59  ? 17   ARG F N     1 
ATOM   3865  C  CA    . ARG F  2 17  ? 15.255  -49.215 38.878 1.00 97.98  ? 17   ARG F CA    1 
ATOM   3866  C  C     . ARG F  2 17  ? 14.834  -49.188 40.356 1.00 96.86  ? 17   ARG F C     1 
ATOM   3867  O  O     . ARG F  2 17  ? 14.579  -50.230 40.970 1.00 96.81  ? 17   ARG F O     1 
ATOM   3868  C  CB    . ARG F  2 17  ? 14.119  -49.691 37.953 1.00 98.31  ? 17   ARG F CB    1 
ATOM   3869  C  CG    . ARG F  2 17  ? 13.960  -48.909 36.626 1.00 99.45  ? 17   ARG F CG    1 
ATOM   3870  C  CD    . ARG F  2 17  ? 15.221  -48.146 36.168 1.00 101.62 ? 17   ARG F CD    1 
ATOM   3871  N  NE    . ARG F  2 17  ? 15.262  -46.778 36.709 1.00 103.72 ? 17   ARG F NE    1 
ATOM   3872  C  CZ    . ARG F  2 17  ? 16.243  -46.263 37.458 1.00 104.17 ? 17   ARG F CZ    1 
ATOM   3873  N  NH1   . ARG F  2 17  ? 17.317  -46.986 37.767 1.00 104.38 ? 17   ARG F NH1   1 
ATOM   3874  N  NH2   . ARG F  2 17  ? 16.155  -45.007 37.892 1.00 103.72 ? 17   ARG F NH2   1 
ATOM   3875  N  N     . HIS F  2 18  ? 14.798  -47.974 40.906 1.00 95.35  ? 18   HIS F N     1 
ATOM   3876  C  CA    . HIS F  2 18  ? 14.507  -47.736 42.320 1.00 93.69  ? 18   HIS F CA    1 
ATOM   3877  C  C     . HIS F  2 18  ? 13.049  -48.095 42.650 1.00 91.71  ? 18   HIS F C     1 
ATOM   3878  O  O     . HIS F  2 18  ? 12.739  -49.264 42.880 1.00 91.81  ? 18   HIS F O     1 
ATOM   3879  C  CB    . HIS F  2 18  ? 14.865  -46.278 42.695 1.00 94.21  ? 18   HIS F CB    1 
ATOM   3880  C  CG    . HIS F  2 18  ? 14.346  -45.833 44.035 1.00 96.18  ? 18   HIS F CG    1 
ATOM   3881  N  ND1   . HIS F  2 18  ? 14.572  -46.537 45.202 1.00 97.53  ? 18   HIS F ND1   1 
ATOM   3882  C  CD2   . HIS F  2 18  ? 13.620  -44.744 44.389 1.00 96.81  ? 18   HIS F CD2   1 
ATOM   3883  C  CE1   . HIS F  2 18  ? 14.002  -45.904 46.213 1.00 97.79  ? 18   HIS F CE1   1 
ATOM   3884  N  NE2   . HIS F  2 18  ? 13.417  -44.814 45.747 1.00 97.37  ? 18   HIS F NE2   1 
ATOM   3885  N  N     . ARG F  2 19  ? 12.172  -47.091 42.641 1.00 88.97  ? 19   ARG F N     1 
ATOM   3886  C  CA    . ARG F  2 19  ? 10.756  -47.222 43.015 1.00 86.05  ? 19   ARG F CA    1 
ATOM   3887  C  C     . ARG F  2 19  ? 10.528  -47.870 44.387 1.00 83.36  ? 19   ARG F C     1 
ATOM   3888  O  O     . ARG F  2 19  ? 10.479  -49.104 44.511 1.00 83.37  ? 19   ARG F O     1 
ATOM   3889  C  CB    . ARG F  2 19  ? 9.950   -47.928 41.916 1.00 86.40  ? 19   ARG F CB    1 
ATOM   3890  C  CG    . ARG F  2 19  ? 8.548   -47.386 41.788 1.00 87.37  ? 19   ARG F CG    1 
ATOM   3891  C  CD    . ARG F  2 19  ? 8.264   -47.003 40.351 1.00 90.43  ? 19   ARG F CD    1 
ATOM   3892  N  NE    . ARG F  2 19  ? 7.754   -45.632 40.252 1.00 92.32  ? 19   ARG F NE    1 
ATOM   3893  C  CZ    . ARG F  2 19  ? 7.367   -45.044 39.121 1.00 93.61  ? 19   ARG F CZ    1 
ATOM   3894  N  NH1   . ARG F  2 19  ? 7.414   -45.702 37.964 1.00 93.65  ? 19   ARG F NH1   1 
ATOM   3895  N  NH2   . ARG F  2 19  ? 6.925   -43.790 39.145 1.00 94.47  ? 19   ARG F NH2   1 
ATOM   3896  N  N     . LYS F  2 20  ? 10.397  -47.033 45.413 1.00 79.49  ? 20   LYS F N     1 
ATOM   3897  C  CA    . LYS F  2 20  ? 10.075  -47.536 46.740 1.00 75.76  ? 20   LYS F CA    1 
ATOM   3898  C  C     . LYS F  2 20  ? 8.591   -47.331 47.044 1.00 72.62  ? 20   LYS F C     1 
ATOM   3899  O  O     . LYS F  2 20  ? 7.918   -46.496 46.440 1.00 72.37  ? 20   LYS F O     1 
ATOM   3900  C  CB    . LYS F  2 20  ? 10.985  -46.935 47.827 1.00 76.42  ? 20   LYS F CB    1 
ATOM   3901  C  CG    . LYS F  2 20  ? 11.155  -47.818 49.098 1.00 77.05  ? 20   LYS F CG    1 
ATOM   3902  C  CD    . LYS F  2 20  ? 10.145  -47.433 50.184 1.00 78.31  ? 20   LYS F CD    1 
ATOM   3903  C  CE    . LYS F  2 20  ? 10.013  -48.474 51.283 1.00 78.12  ? 20   LYS F CE    1 
ATOM   3904  N  NZ    . LYS F  2 20  ? 8.723   -48.322 52.058 1.00 78.55  ? 20   LYS F NZ    1 
ATOM   3905  N  N     . VAL F  2 21  ? 8.098   -48.132 47.975 1.00 68.46  ? 21   VAL F N     1 
ATOM   3906  C  CA    . VAL F  2 21  ? 6.701   -48.194 48.314 1.00 64.39  ? 21   VAL F CA    1 
ATOM   3907  C  C     . VAL F  2 21  ? 6.367   -47.019 49.227 1.00 61.68  ? 21   VAL F C     1 
ATOM   3908  O  O     . VAL F  2 21  ? 7.054   -46.771 50.221 1.00 61.23  ? 21   VAL F O     1 
ATOM   3909  C  CB    . VAL F  2 21  ? 6.363   -49.573 48.964 1.00 64.22  ? 21   VAL F CB    1 
ATOM   3910  C  CG1   . VAL F  2 21  ? 4.975   -49.598 49.552 1.00 63.95  ? 21   VAL F CG1   1 
ATOM   3911  C  CG2   . VAL F  2 21  ? 6.512   -50.666 47.947 1.00 63.32  ? 21   VAL F CG2   1 
ATOM   3912  N  N     . LEU F  2 22  ? 5.306   -46.300 48.862 1.00 58.18  ? 22   LEU F N     1 
ATOM   3913  C  CA    . LEU F  2 22  ? 4.828   -45.180 49.636 1.00 54.46  ? 22   LEU F CA    1 
ATOM   3914  C  C     . LEU F  2 22  ? 3.642   -45.593 50.472 1.00 52.38  ? 22   LEU F C     1 
ATOM   3915  O  O     . LEU F  2 22  ? 2.634   -46.049 49.939 1.00 51.48  ? 22   LEU F O     1 
ATOM   3916  C  CB    . LEU F  2 22  ? 4.481   -44.006 48.710 1.00 54.63  ? 22   LEU F CB    1 
ATOM   3917  C  CG    . LEU F  2 22  ? 5.706   -43.319 48.083 1.00 54.24  ? 22   LEU F CG    1 
ATOM   3918  C  CD1   . LEU F  2 22  ? 5.343   -42.548 46.843 1.00 53.50  ? 22   LEU F CD1   1 
ATOM   3919  C  CD2   . LEU F  2 22  ? 6.392   -42.426 49.100 1.00 55.35  ? 22   LEU F CD2   1 
ATOM   3920  N  N     . ARG F  2 23  ? 3.767   -45.431 51.789 1.00 50.26  ? 23   ARG F N     1 
ATOM   3921  C  CA    . ARG F  2 23  ? 2.678   -45.758 52.703 1.00 48.75  ? 23   ARG F CA    1 
ATOM   3922  C  C     . ARG F  2 23  ? 2.781   -45.018 54.041 1.00 48.79  ? 23   ARG F C     1 
ATOM   3923  O  O     . ARG F  2 23  ? 3.881   -44.680 54.486 1.00 48.99  ? 23   ARG F O     1 
ATOM   3924  C  CB    . ARG F  2 23  ? 2.594   -47.278 52.921 1.00 49.17  ? 23   ARG F CB    1 
ATOM   3925  C  CG    . ARG F  2 23  ? 3.898   -47.923 53.293 1.00 47.18  ? 23   ARG F CG    1 
ATOM   3926  C  CD    . ARG F  2 23  ? 3.859   -49.443 53.364 1.00 47.67  ? 23   ARG F CD    1 
ATOM   3927  N  NE    . ARG F  2 23  ? 5.030   -49.860 54.146 1.00 46.06  ? 23   ARG F NE    1 
ATOM   3928  C  CZ    . ARG F  2 23  ? 4.999   -50.331 55.391 1.00 42.58  ? 23   ARG F CZ    1 
ATOM   3929  N  NH1   . ARG F  2 23  ? 3.858   -50.550 56.024 1.00 40.23  ? 23   ARG F NH1   1 
ATOM   3930  N  NH2   . ARG F  2 23  ? 6.128   -50.615 55.984 1.00 43.56  ? 23   ARG F NH2   1 
ATOM   3931  N  N     . ASP F  2 24  ? 1.629   -44.772 54.674 1.00 48.05  ? 24   ASP F N     1 
ATOM   3932  C  CA    . ASP F  2 24  ? 1.540   -44.056 55.960 1.00 47.77  ? 24   ASP F CA    1 
ATOM   3933  C  C     . ASP F  2 24  ? 2.087   -42.591 55.964 1.00 47.21  ? 24   ASP F C     1 
ATOM   3934  O  O     . ASP F  2 24  ? 2.305   -42.007 57.030 1.00 46.68  ? 24   ASP F O     1 
ATOM   3935  C  CB    . ASP F  2 24  ? 2.235   -44.857 57.056 1.00 47.46  ? 24   ASP F CB    1 
ATOM   3936  C  CG    . ASP F  2 24  ? 1.570   -44.690 58.402 1.00 48.33  ? 24   ASP F CG    1 
ATOM   3937  O  OD1   . ASP F  2 24  ? 0.318   -44.570 58.429 1.00 49.91  ? 24   ASP F OD1   1 
ATOM   3938  O  OD2   . ASP F  2 24  ? 2.292   -44.704 59.431 1.00 48.18  ? 24   ASP F OD2   1 
ATOM   3939  N  N     . ASN F  2 25  ? 2.305   -42.017 54.782 1.00 46.55  ? 25   ASN F N     1 
ATOM   3940  C  CA    . ASN F  2 25  ? 2.830   -40.642 54.655 1.00 46.07  ? 25   ASN F CA    1 
ATOM   3941  C  C     . ASN F  2 25  ? 1.975   -39.533 55.276 1.00 46.23  ? 25   ASN F C     1 
ATOM   3942  O  O     . ASN F  2 25  ? 2.499   -38.464 55.555 1.00 46.63  ? 25   ASN F O     1 
ATOM   3943  C  CB    . ASN F  2 25  ? 3.126   -40.305 53.200 1.00 44.99  ? 25   ASN F CB    1 
ATOM   3944  C  CG    . ASN F  2 25  ? 4.231   -41.138 52.639 1.00 43.39  ? 25   ASN F CG    1 
ATOM   3945  O  OD1   . ASN F  2 25  ? 5.379   -40.998 53.037 1.00 40.60  ? 25   ASN F OD1   1 
ATOM   3946  N  ND2   . ASN F  2 25  ? 3.895   -42.030 51.705 1.00 42.87  ? 25   ASN F ND2   1 
ATOM   3947  N  N     . ILE F  2 26  ? 0.689   -39.797 55.504 1.00 46.80  ? 26   ILE F N     1 
ATOM   3948  C  CA    . ILE F  2 26  ? -0.185  -38.900 56.274 1.00 48.06  ? 26   ILE F CA    1 
ATOM   3949  C  C     . ILE F  2 26  ? 0.299   -38.598 57.701 1.00 49.02  ? 26   ILE F C     1 
ATOM   3950  O  O     . ILE F  2 26  ? -0.233  -37.675 58.362 1.00 49.96  ? 26   ILE F O     1 
ATOM   3951  C  CB    . ILE F  2 26  ? -1.657  -39.434 56.369 1.00 48.28  ? 26   ILE F CB    1 
ATOM   3952  C  CG1   . ILE F  2 26  ? -2.625  -38.334 56.850 1.00 48.67  ? 26   ILE F CG1   1 
ATOM   3953  C  CG2   . ILE F  2 26  ? -1.762  -40.622 57.325 1.00 46.32  ? 26   ILE F CG2   1 
ATOM   3954  C  CD1   . ILE F  2 26  ? -2.856  -37.189 55.883 1.00 49.56  ? 26   ILE F CD1   1 
ATOM   3955  N  N     . GLN F  2 27  ? 1.261   -39.382 58.188 1.00 48.97  ? 27   GLN F N     1 
ATOM   3956  C  CA    . GLN F  2 27  ? 1.767   -39.238 59.557 1.00 49.32  ? 27   GLN F CA    1 
ATOM   3957  C  C     . GLN F  2 27  ? 3.036   -38.412 59.518 1.00 49.38  ? 27   GLN F C     1 
ATOM   3958  O  O     . GLN F  2 27  ? 3.644   -38.128 60.559 1.00 50.07  ? 27   GLN F O     1 
ATOM   3959  C  CB    . GLN F  2 27  ? 2.008   -40.609 60.231 1.00 49.65  ? 27   GLN F CB    1 
ATOM   3960  C  CG    . GLN F  2 27  ? 0.740   -41.478 60.345 1.00 49.55  ? 27   GLN F CG    1 
ATOM   3961  C  CD    . GLN F  2 27  ? -0.203  -41.046 61.468 1.00 49.50  ? 27   GLN F CD    1 
ATOM   3962  O  OE1   . GLN F  2 27  ? 0.238   -40.751 62.573 1.00 51.82  ? 27   GLN F OE1   1 
ATOM   3963  N  NE2   . GLN F  2 27  ? -1.502  -41.020 61.188 1.00 47.04  ? 27   GLN F NE2   1 
ATOM   3964  N  N     . GLY F  2 28  ? 3.433   -38.041 58.303 1.00 49.13  ? 28   GLY F N     1 
ATOM   3965  C  CA    . GLY F  2 28  ? 4.460   -37.044 58.087 1.00 48.62  ? 28   GLY F CA    1 
ATOM   3966  C  C     . GLY F  2 28  ? 3.888   -35.668 58.368 1.00 48.77  ? 28   GLY F C     1 
ATOM   3967  O  O     . GLY F  2 28  ? 4.628   -34.706 58.542 1.00 49.89  ? 28   GLY F O     1 
ATOM   3968  N  N     . ILE F  2 29  ? 2.561   -35.569 58.398 1.00 48.02  ? 29   ILE F N     1 
ATOM   3969  C  CA    . ILE F  2 29  ? 1.865   -34.358 58.819 1.00 47.02  ? 29   ILE F CA    1 
ATOM   3970  C  C     . ILE F  2 29  ? 1.875   -34.408 60.348 1.00 47.18  ? 29   ILE F C     1 
ATOM   3971  O  O     . ILE F  2 29  ? 0.924   -34.876 60.991 1.00 47.31  ? 29   ILE F O     1 
ATOM   3972  C  CB    . ILE F  2 29  ? 0.421   -34.300 58.214 1.00 46.59  ? 29   ILE F CB    1 
ATOM   3973  C  CG1   . ILE F  2 29  ? 0.425   -34.622 56.703 1.00 45.37  ? 29   ILE F CG1   1 
ATOM   3974  C  CG2   . ILE F  2 29  ? -0.255  -32.984 58.492 1.00 47.41  ? 29   ILE F CG2   1 
ATOM   3975  C  CD1   . ILE F  2 29  ? 1.338   -33.770 55.798 1.00 37.14  ? 29   ILE F CD1   1 
ATOM   3976  N  N     . THR F  2 30  ? 2.986   -33.941 60.914 1.00 47.13  ? 30   THR F N     1 
ATOM   3977  C  CA    . THR F  2 30  ? 3.279   -34.056 62.334 1.00 47.31  ? 30   THR F CA    1 
ATOM   3978  C  C     . THR F  2 30  ? 2.359   -33.244 63.235 1.00 47.76  ? 30   THR F C     1 
ATOM   3979  O  O     . THR F  2 30  ? 1.648   -32.365 62.783 1.00 48.04  ? 30   THR F O     1 
ATOM   3980  C  CB    . THR F  2 30  ? 4.780   -33.772 62.634 1.00 47.20  ? 30   THR F CB    1 
ATOM   3981  O  OG1   . THR F  2 30  ? 5.073   -32.392 62.401 1.00 49.22  ? 30   THR F OG1   1 
ATOM   3982  C  CG2   . THR F  2 30  ? 5.697   -34.613 61.724 1.00 45.64  ? 30   THR F CG2   1 
ATOM   3983  N  N     . LYS F  2 31  ? 2.351   -33.588 64.517 1.00 48.60  ? 31   LYS F N     1 
ATOM   3984  C  CA    . LYS F  2 31  ? 1.603   -32.876 65.547 1.00 49.28  ? 31   LYS F CA    1 
ATOM   3985  C  C     . LYS F  2 31  ? 2.058   -31.396 65.716 1.00 48.97  ? 31   LYS F C     1 
ATOM   3986  O  O     . LYS F  2 31  ? 1.210   -30.513 65.854 1.00 49.46  ? 31   LYS F O     1 
ATOM   3987  C  CB    . LYS F  2 31  ? 1.689   -33.658 66.866 1.00 48.84  ? 31   LYS F CB    1 
ATOM   3988  C  CG    . LYS F  2 31  ? 0.906   -33.079 68.013 1.00 51.37  ? 31   LYS F CG    1 
ATOM   3989  C  CD    . LYS F  2 31  ? 1.319   -33.657 69.377 1.00 51.09  ? 31   LYS F CD    1 
ATOM   3990  C  CE    . LYS F  2 31  ? 0.687   -32.782 70.503 1.00 56.41  ? 31   LYS F CE    1 
ATOM   3991  N  NZ    . LYS F  2 31  ? 1.100   -33.059 71.949 1.00 56.36  ? 31   LYS F NZ    1 
ATOM   3992  N  N     . PRO F  2 32  ? 3.386   -31.121 65.709 1.00 48.54  ? 32   PRO F N     1 
ATOM   3993  C  CA    . PRO F  2 32  ? 3.823   -29.722 65.712 1.00 47.97  ? 32   PRO F CA    1 
ATOM   3994  C  C     . PRO F  2 32  ? 3.366   -28.888 64.487 1.00 47.95  ? 32   PRO F C     1 
ATOM   3995  O  O     . PRO F  2 32  ? 3.124   -27.675 64.642 1.00 48.24  ? 32   PRO F O     1 
ATOM   3996  C  CB    . PRO F  2 32  ? 5.352   -29.823 65.716 1.00 48.16  ? 32   PRO F CB    1 
ATOM   3997  C  CG    . PRO F  2 32  ? 5.683   -31.215 66.121 1.00 48.25  ? 32   PRO F CG    1 
ATOM   3998  C  CD    . PRO F  2 32  ? 4.536   -32.056 65.717 1.00 48.62  ? 32   PRO F CD    1 
ATOM   3999  N  N     . ALA F  2 33  ? 3.273   -29.508 63.300 1.00 46.14  ? 33   ALA F N     1 
ATOM   4000  C  CA    . ALA F  2 33  ? 2.843   -28.816 62.084 1.00 45.02  ? 33   ALA F CA    1 
ATOM   4001  C  C     . ALA F  2 33  ? 1.351   -28.466 62.107 1.00 44.78  ? 33   ALA F C     1 
ATOM   4002  O  O     . ALA F  2 33  ? 0.945   -27.402 61.638 1.00 44.98  ? 33   ALA F O     1 
ATOM   4003  C  CB    . ALA F  2 33  ? 3.172   -29.627 60.854 1.00 44.57  ? 33   ALA F CB    1 
ATOM   4004  N  N     . ILE F  2 34  ? 0.532   -29.369 62.635 1.00 44.39  ? 34   ILE F N     1 
ATOM   4005  C  CA    . ILE F  2 34  ? -0.901  -29.113 62.814 1.00 43.46  ? 34   ILE F CA    1 
ATOM   4006  C  C     . ILE F  2 34  ? -1.121  -28.008 63.855 1.00 44.01  ? 34   ILE F C     1 
ATOM   4007  O  O     . ILE F  2 34  ? -2.021  -27.200 63.709 1.00 44.66  ? 34   ILE F O     1 
ATOM   4008  C  CB    . ILE F  2 34  ? -1.677  -30.425 63.205 1.00 43.12  ? 34   ILE F CB    1 
ATOM   4009  C  CG1   . ILE F  2 34  ? -1.608  -31.453 62.066 1.00 42.78  ? 34   ILE F CG1   1 
ATOM   4010  C  CG2   . ILE F  2 34  ? -3.124  -30.133 63.634 1.00 40.99  ? 34   ILE F CG2   1 
ATOM   4011  C  CD1   . ILE F  2 34  ? -1.999  -32.882 62.444 1.00 41.79  ? 34   ILE F CD1   1 
ATOM   4012  N  N     . ARG F  2 35  ? -0.301  -27.991 64.906 1.00 44.45  ? 35   ARG F N     1 
ATOM   4013  C  CA    . ARG F  2 35  ? -0.361  -26.982 65.969 1.00 45.00  ? 35   ARG F CA    1 
ATOM   4014  C  C     . ARG F  2 35  ? -0.073  -25.572 65.416 1.00 43.86  ? 35   ARG F C     1 
ATOM   4015  O  O     . ARG F  2 35  ? -0.725  -24.609 65.791 1.00 44.39  ? 35   ARG F O     1 
ATOM   4016  C  CB    . ARG F  2 35  ? 0.654   -27.336 67.054 1.00 45.12  ? 35   ARG F CB    1 
ATOM   4017  C  CG    . ARG F  2 35  ? 0.370   -26.741 68.412 1.00 47.47  ? 35   ARG F CG    1 
ATOM   4018  C  CD    . ARG F  2 35  ? 1.361   -27.195 69.495 1.00 47.98  ? 35   ARG F CD    1 
ATOM   4019  N  NE    . ARG F  2 35  ? 1.543   -28.659 69.566 1.00 55.69  ? 35   ARG F NE    1 
ATOM   4020  C  CZ    . ARG F  2 35  ? 2.736   -29.290 69.560 1.00 57.27  ? 35   ARG F CZ    1 
ATOM   4021  N  NH1   . ARG F  2 35  ? 3.893   -28.624 69.486 1.00 56.45  ? 35   ARG F NH1   1 
ATOM   4022  N  NH2   . ARG F  2 35  ? 2.782   -30.609 69.633 1.00 58.52  ? 35   ARG F NH2   1 
ATOM   4023  N  N     . ARG F  2 36  ? 0.888   -25.484 64.508 1.00 42.58  ? 36   ARG F N     1 
ATOM   4024  C  CA    . ARG F  2 36  ? 1.266   -24.255 63.847 1.00 41.57  ? 36   ARG F CA    1 
ATOM   4025  C  C     . ARG F  2 36  ? 0.175   -23.704 62.962 1.00 41.56  ? 36   ARG F C     1 
ATOM   4026  O  O     . ARG F  2 36  ? -0.028  -22.488 62.928 1.00 42.05  ? 36   ARG F O     1 
ATOM   4027  C  CB    . ARG F  2 36  ? 2.529   -24.455 63.009 1.00 41.30  ? 36   ARG F CB    1 
ATOM   4028  C  CG    . ARG F  2 36  ? 3.795   -24.542 63.829 1.00 41.07  ? 36   ARG F CG    1 
ATOM   4029  C  CD    . ARG F  2 36  ? 5.033   -24.394 62.965 1.00 42.46  ? 36   ARG F CD    1 
ATOM   4030  N  NE    . ARG F  2 36  ? 5.273   -25.498 62.030 1.00 44.43  ? 36   ARG F NE    1 
ATOM   4031  C  CZ    . ARG F  2 36  ? 5.926   -26.631 62.328 1.00 46.27  ? 36   ARG F CZ    1 
ATOM   4032  N  NH1   . ARG F  2 36  ? 6.386   -26.835 63.569 1.00 44.60  ? 36   ARG F NH1   1 
ATOM   4033  N  NH2   . ARG F  2 36  ? 6.121   -27.569 61.379 1.00 43.72  ? 36   ARG F NH2   1 
ATOM   4034  N  N     . LEU F  2 37  ? -0.500  -24.580 62.223 1.00 41.08  ? 37   LEU F N     1 
ATOM   4035  C  CA    . LEU F  2 37  ? -1.636  -24.192 61.406 1.00 40.99  ? 37   LEU F CA    1 
ATOM   4036  C  C     . LEU F  2 37  ? -2.795  -23.714 62.268 1.00 41.52  ? 37   LEU F C     1 
ATOM   4037  O  O     . LEU F  2 37  ? -3.517  -22.798 61.884 1.00 42.09  ? 37   LEU F O     1 
ATOM   4038  C  CB    . LEU F  2 37  ? -2.100  -25.345 60.519 1.00 40.67  ? 37   LEU F CB    1 
ATOM   4039  C  CG    . LEU F  2 37  ? -1.121  -25.808 59.448 1.00 39.98  ? 37   LEU F CG    1 
ATOM   4040  C  CD1   . LEU F  2 37  ? -1.277  -27.321 59.145 1.00 40.73  ? 37   LEU F CD1   1 
ATOM   4041  C  CD2   . LEU F  2 37  ? -1.291  -24.993 58.225 1.00 37.27  ? 37   LEU F CD2   1 
ATOM   4042  N  N     . ALA F  2 38  ? -2.971  -24.332 63.433 1.00 41.74  ? 38   ALA F N     1 
ATOM   4043  C  CA    . ALA F  2 38  ? -4.031  -23.942 64.349 1.00 41.88  ? 38   ALA F CA    1 
ATOM   4044  C  C     . ALA F  2 38  ? -3.760  -22.528 64.885 1.00 42.06  ? 38   ALA F C     1 
ATOM   4045  O  O     . ALA F  2 38  ? -4.687  -21.738 65.001 1.00 43.34  ? 38   ALA F O     1 
ATOM   4046  C  CB    . ALA F  2 38  ? -4.165  -24.957 65.483 1.00 41.41  ? 38   ALA F CB    1 
ATOM   4047  N  N     . ARG F  2 39  ? -2.487  -22.232 65.182 1.00 41.58  ? 39   ARG F N     1 
ATOM   4048  C  CA    . ARG F  2 39  ? -1.996  -20.911 65.607 1.00 40.32  ? 39   ARG F CA    1 
ATOM   4049  C  C     . ARG F  2 39  ? -2.282  -19.796 64.589 1.00 40.02  ? 39   ARG F C     1 
ATOM   4050  O  O     . ARG F  2 39  ? -2.922  -18.820 64.917 1.00 40.22  ? 39   ARG F O     1 
ATOM   4051  C  CB    . ARG F  2 39  ? -0.487  -20.963 65.831 1.00 40.02  ? 39   ARG F CB    1 
ATOM   4052  C  CG    . ARG F  2 39  ? 0.003   -21.809 66.984 1.00 40.80  ? 39   ARG F CG    1 
ATOM   4053  C  CD    . ARG F  2 39  ? -0.888  -21.733 68.230 1.00 41.04  ? 39   ARG F CD    1 
ATOM   4054  N  NE    . ARG F  2 39  ? -0.255  -22.482 69.305 1.00 45.82  ? 39   ARG F NE    1 
ATOM   4055  C  CZ    . ARG F  2 39  ? -0.901  -23.113 70.280 1.00 47.29  ? 39   ARG F CZ    1 
ATOM   4056  N  NH1   . ARG F  2 39  ? -2.228  -23.104 70.341 1.00 47.67  ? 39   ARG F NH1   1 
ATOM   4057  N  NH2   . ARG F  2 39  ? -0.207  -23.759 71.193 1.00 47.78  ? 39   ARG F NH2   1 
ATOM   4058  N  N     . ARG F  2 40  ? -1.785  -19.944 63.363 1.00 39.20  ? 40   ARG F N     1 
ATOM   4059  C  CA    . ARG F  2 40  ? -2.177  -19.080 62.260 1.00 38.03  ? 40   ARG F CA    1 
ATOM   4060  C  C     . ARG F  2 40  ? -3.690  -18.907 62.172 1.00 38.42  ? 40   ARG F C     1 
ATOM   4061  O  O     . ARG F  2 40  ? -4.143  -17.829 61.860 1.00 40.08  ? 40   ARG F O     1 
ATOM   4062  C  CB    . ARG F  2 40  ? -1.568  -19.551 60.922 1.00 38.03  ? 40   ARG F CB    1 
ATOM   4063  C  CG    . ARG F  2 40  ? -1.662  -18.540 59.747 1.00 36.84  ? 40   ARG F CG    1 
ATOM   4064  C  CD    . ARG F  2 40  ? -0.651  -18.850 58.618 1.00 35.00  ? 40   ARG F CD    1 
ATOM   4065  N  NE    . ARG F  2 40  ? 0.702   -18.530 59.071 1.00 33.51  ? 40   ARG F NE    1 
ATOM   4066  C  CZ    . ARG F  2 40  ? 1.828   -18.797 58.416 1.00 31.42  ? 40   ARG F CZ    1 
ATOM   4067  N  NH1   . ARG F  2 40  ? 1.811   -19.404 57.259 1.00 28.51  ? 40   ARG F NH1   1 
ATOM   4068  N  NH2   . ARG F  2 40  ? 2.992   -18.433 58.929 1.00 34.15  ? 40   ARG F NH2   1 
ATOM   4069  N  N     . GLY F  2 41  ? -4.469  -19.942 62.483 1.00 38.55  ? 41   GLY F N     1 
ATOM   4070  C  CA    . GLY F  2 41  ? -5.936  -19.869 62.450 1.00 37.21  ? 41   GLY F CA    1 
ATOM   4071  C  C     . GLY F  2 41  ? -6.495  -19.350 63.757 1.00 37.47  ? 41   GLY F C     1 
ATOM   4072  O  O     . GLY F  2 41  ? -7.718  -19.281 63.962 1.00 36.91  ? 41   GLY F O     1 
ATOM   4073  N  N     . GLY F  2 42  ? -5.592  -18.985 64.653 1.00 37.88  ? 42   GLY F N     1 
ATOM   4074  C  CA    . GLY F  2 42  ? -5.958  -18.302 65.894 1.00 39.47  ? 42   GLY F CA    1 
ATOM   4075  C  C     . GLY F  2 42  ? -6.405  -19.153 67.068 1.00 39.90  ? 42   GLY F C     1 
ATOM   4076  O  O     . GLY F  2 42  ? -7.038  -18.644 67.989 1.00 40.04  ? 42   GLY F O     1 
ATOM   4077  N  N     . VAL F  2 43  ? -6.041  -20.436 67.042 1.00 40.55  ? 43   VAL F N     1 
ATOM   4078  C  CA    . VAL F  2 43  ? -6.470  -21.407 68.038 1.00 40.59  ? 43   VAL F CA    1 
ATOM   4079  C  C     . VAL F  2 43  ? -5.505  -21.411 69.220 1.00 41.62  ? 43   VAL F C     1 
ATOM   4080  O  O     . VAL F  2 43  ? -4.292  -21.433 69.047 1.00 41.64  ? 43   VAL F O     1 
ATOM   4081  C  CB    . VAL F  2 43  ? -6.621  -22.835 67.431 1.00 40.16  ? 43   VAL F CB    1 
ATOM   4082  C  CG1   . VAL F  2 43  ? -6.950  -23.824 68.501 1.00 37.76  ? 43   VAL F CG1   1 
ATOM   4083  C  CG2   . VAL F  2 43  ? -7.677  -22.860 66.329 1.00 39.82  ? 43   VAL F CG2   1 
ATOM   4084  N  N     . LYS F  2 44  ? -6.066  -21.396 70.424 1.00 42.78  ? 44   LYS F N     1 
ATOM   4085  C  CA    . LYS F  2 44  ? -5.265  -21.283 71.634 1.00 44.53  ? 44   LYS F CA    1 
ATOM   4086  C  C     . LYS F  2 44  ? -5.055  -22.629 72.322 1.00 44.83  ? 44   LYS F C     1 
ATOM   4087  O  O     . LYS F  2 44  ? -4.010  -22.864 72.903 1.00 45.00  ? 44   LYS F O     1 
ATOM   4088  C  CB    . LYS F  2 44  ? -5.927  -20.299 72.601 1.00 44.68  ? 44   LYS F CB    1 
ATOM   4089  C  CG    . LYS F  2 44  ? -5.027  -19.820 73.719 1.00 46.99  ? 44   LYS F CG    1 
ATOM   4090  C  CD    . LYS F  2 44  ? -5.855  -19.263 74.879 1.00 49.75  ? 44   LYS F CD    1 
ATOM   4091  C  CE    . LYS F  2 44  ? -4.936  -18.780 75.993 1.00 51.43  ? 44   LYS F CE    1 
ATOM   4092  N  NZ    . LYS F  2 44  ? -5.736  -18.150 77.080 1.00 52.86  ? 44   LYS F NZ    1 
ATOM   4093  N  N     . ARG F  2 45  ? -6.063  -23.496 72.267 1.00 45.60  ? 45   ARG F N     1 
ATOM   4094  C  CA    . ARG F  2 45  ? -6.015  -24.757 72.970 1.00 46.52  ? 45   ARG F CA    1 
ATOM   4095  C  C     . ARG F  2 45  ? -6.590  -25.845 72.074 1.00 47.48  ? 45   ARG F C     1 
ATOM   4096  O  O     . ARG F  2 45  ? -7.618  -25.637 71.404 1.00 47.86  ? 45   ARG F O     1 
ATOM   4097  C  CB    . ARG F  2 45  ? -6.794  -24.637 74.272 1.00 46.77  ? 45   ARG F CB    1 
ATOM   4098  C  CG    . ARG F  2 45  ? -6.243  -25.440 75.404 1.00 46.09  ? 45   ARG F CG    1 
ATOM   4099  C  CD    . ARG F  2 45  ? -7.184  -25.302 76.589 1.00 46.82  ? 45   ARG F CD    1 
ATOM   4100  N  NE    . ARG F  2 45  ? -6.741  -26.133 77.700 1.00 48.54  ? 45   ARG F NE    1 
ATOM   4101  C  CZ    . ARG F  2 45  ? -7.267  -27.313 78.025 1.00 49.61  ? 45   ARG F CZ    1 
ATOM   4102  N  NH1   . ARG F  2 45  ? -8.293  -27.820 77.347 1.00 50.94  ? 45   ARG F NH1   1 
ATOM   4103  N  NH2   . ARG F  2 45  ? -6.767  -27.987 79.049 1.00 50.98  ? 45   ARG F NH2   1 
ATOM   4104  N  N     . ILE F  2 46  ? -5.913  -26.995 72.062 1.00 48.06  ? 46   ILE F N     1 
ATOM   4105  C  CA    . ILE F  2 46  ? -6.169  -28.081 71.102 1.00 48.41  ? 46   ILE F CA    1 
ATOM   4106  C  C     . ILE F  2 46  ? -6.378  -29.446 71.790 1.00 48.88  ? 46   ILE F C     1 
ATOM   4107  O  O     . ILE F  2 46  ? -5.474  -29.954 72.470 1.00 49.67  ? 46   ILE F O     1 
ATOM   4108  C  CB    . ILE F  2 46  ? -4.982  -28.230 70.135 1.00 48.36  ? 46   ILE F CB    1 
ATOM   4109  C  CG1   . ILE F  2 46  ? -4.675  -26.904 69.422 1.00 48.61  ? 46   ILE F CG1   1 
ATOM   4110  C  CG2   . ILE F  2 46  ? -5.267  -29.337 69.156 1.00 49.00  ? 46   ILE F CG2   1 
ATOM   4111  C  CD1   . ILE F  2 46  ? -3.344  -26.854 68.700 1.00 46.87  ? 46   ILE F CD1   1 
ATOM   4112  N  N     . SER F  2 47  ? -7.547  -30.053 71.613 1.00 48.99  ? 47   SER F N     1 
ATOM   4113  C  CA    . SER F  2 47  ? -7.776  -31.388 72.182 1.00 49.03  ? 47   SER F CA    1 
ATOM   4114  C  C     . SER F  2 47  ? -6.987  -32.482 71.443 1.00 48.76  ? 47   SER F C     1 
ATOM   4115  O  O     . SER F  2 47  ? -6.763  -32.397 70.227 1.00 48.81  ? 47   SER F O     1 
ATOM   4116  C  CB    . SER F  2 47  ? -9.263  -31.698 72.276 1.00 48.74  ? 47   SER F CB    1 
ATOM   4117  O  OG    . SER F  2 47  ? -9.658  -32.640 71.324 1.00 50.90  ? 47   SER F OG    1 
ATOM   4118  N  N     . GLY F  2 48  ? -6.548  -33.494 72.191 1.00 48.78  ? 48   GLY F N     1 
ATOM   4119  C  CA    . GLY F  2 48  ? -5.674  -34.566 71.670 1.00 47.66  ? 48   GLY F CA    1 
ATOM   4120  C  C     . GLY F  2 48  ? -6.159  -35.301 70.429 1.00 47.37  ? 48   GLY F C     1 
ATOM   4121  O  O     . GLY F  2 48  ? -5.357  -35.902 69.690 1.00 47.19  ? 48   GLY F O     1 
ATOM   4122  N  N     . LEU F  2 49  ? -7.465  -35.230 70.184 1.00 46.65  ? 49   LEU F N     1 
ATOM   4123  C  CA    . LEU F  2 49  ? -8.072  -35.885 69.031 1.00 46.74  ? 49   LEU F CA    1 
ATOM   4124  C  C     . LEU F  2 49  ? -8.064  -35.073 67.730 1.00 46.47  ? 49   LEU F C     1 
ATOM   4125  O  O     . LEU F  2 49  ? -8.402  -35.603 66.669 1.00 46.79  ? 49   LEU F O     1 
ATOM   4126  C  CB    . LEU F  2 49  ? -9.499  -36.319 69.366 1.00 47.08  ? 49   LEU F CB    1 
ATOM   4127  C  CG    . LEU F  2 49  ? -9.639  -37.375 70.462 1.00 47.72  ? 49   LEU F CG    1 
ATOM   4128  C  CD1   . LEU F  2 49  ? -11.110 -37.689 70.666 1.00 49.57  ? 49   LEU F CD1   1 
ATOM   4129  C  CD2   . LEU F  2 49  ? -8.838  -38.649 70.121 1.00 48.05  ? 49   LEU F CD2   1 
ATOM   4130  N  N     . ILE F  2 50  ? -7.656  -33.805 67.822 1.00 45.74  ? 50   ILE F N     1 
ATOM   4131  C  CA    . ILE F  2 50  ? -7.638  -32.892 66.709 1.00 44.25  ? 50   ILE F CA    1 
ATOM   4132  C  C     . ILE F  2 50  ? -6.679  -33.399 65.646 1.00 44.44  ? 50   ILE F C     1 
ATOM   4133  O  O     . ILE F  2 50  ? -7.006  -33.401 64.449 1.00 44.68  ? 50   ILE F O     1 
ATOM   4134  C  CB    . ILE F  2 50  ? -7.337  -31.389 67.203 1.00 44.67  ? 50   ILE F CB    1 
ATOM   4135  C  CG1   . ILE F  2 50  ? -8.615  -30.694 67.715 1.00 43.32  ? 50   ILE F CG1   1 
ATOM   4136  C  CG2   . ILE F  2 50  ? -6.596  -30.515 66.146 1.00 42.29  ? 50   ILE F CG2   1 
ATOM   4137  C  CD1   . ILE F  2 50  ? -9.816  -30.672 66.730 1.00 41.34  ? 50   ILE F CD1   1 
ATOM   4138  N  N     . TYR F  2 51  ? -5.506  -33.850 66.069 1.00 44.06  ? 51   TYR F N     1 
ATOM   4139  C  CA    . TYR F  2 51  ? -4.456  -34.175 65.115 1.00 44.53  ? 51   TYR F CA    1 
ATOM   4140  C  C     . TYR F  2 51  ? -4.853  -35.245 64.100 1.00 45.34  ? 51   TYR F C     1 
ATOM   4141  O  O     . TYR F  2 51  ? -4.592  -35.091 62.892 1.00 46.21  ? 51   TYR F O     1 
ATOM   4142  C  CB    . TYR F  2 51  ? -3.130  -34.464 65.823 1.00 44.81  ? 51   TYR F CB    1 
ATOM   4143  C  CG    . TYR F  2 51  ? -2.814  -33.409 66.856 1.00 45.16  ? 51   TYR F CG    1 
ATOM   4144  C  CD1   . TYR F  2 51  ? -3.119  -33.613 68.214 1.00 45.48  ? 51   TYR F CD1   1 
ATOM   4145  C  CD2   . TYR F  2 51  ? -2.276  -32.177 66.477 1.00 45.06  ? 51   TYR F CD2   1 
ATOM   4146  C  CE1   . TYR F  2 51  ? -2.879  -32.626 69.175 1.00 43.46  ? 51   TYR F CE1   1 
ATOM   4147  C  CE2   . TYR F  2 51  ? -2.016  -31.187 67.431 1.00 45.52  ? 51   TYR F CE2   1 
ATOM   4148  C  CZ    . TYR F  2 51  ? -2.322  -31.428 68.778 1.00 45.80  ? 51   TYR F CZ    1 
ATOM   4149  O  OH    . TYR F  2 51  ? -2.066  -30.450 69.723 1.00 47.23  ? 51   TYR F OH    1 
ATOM   4150  N  N     . GLU F  2 52  ? -5.517  -36.302 64.561 1.00 45.44  ? 52   GLU F N     1 
ATOM   4151  C  CA    . GLU F  2 52  ? -5.997  -37.334 63.647 1.00 45.72  ? 52   GLU F CA    1 
ATOM   4152  C  C     . GLU F  2 52  ? -7.202  -36.868 62.824 1.00 44.52  ? 52   GLU F C     1 
ATOM   4153  O  O     . GLU F  2 52  ? -7.316  -37.178 61.649 1.00 44.53  ? 52   GLU F O     1 
ATOM   4154  C  CB    . GLU F  2 52  ? -6.287  -38.654 64.387 1.00 46.64  ? 52   GLU F CB    1 
ATOM   4155  C  CG    . GLU F  2 52  ? -6.000  -39.912 63.535 1.00 50.32  ? 52   GLU F CG    1 
ATOM   4156  C  CD    . GLU F  2 52  ? -4.505  -40.139 63.265 1.00 54.34  ? 52   GLU F CD    1 
ATOM   4157  O  OE1   . GLU F  2 52  ? -4.127  -40.372 62.090 1.00 57.05  ? 52   GLU F OE1   1 
ATOM   4158  O  OE2   . GLU F  2 52  ? -3.705  -40.087 64.221 1.00 55.03  ? 52   GLU F OE2   1 
ATOM   4159  N  N     . GLU F  2 53  ? -8.094  -36.113 63.435 1.00 44.06  ? 53   GLU F N     1 
ATOM   4160  C  CA    . GLU F  2 53  ? -9.180  -35.474 62.687 1.00 44.16  ? 53   GLU F CA    1 
ATOM   4161  C  C     . GLU F  2 53  ? -8.714  -34.603 61.515 1.00 43.38  ? 53   GLU F C     1 
ATOM   4162  O  O     . GLU F  2 53  ? -9.306  -34.637 60.439 1.00 43.75  ? 53   GLU F O     1 
ATOM   4163  C  CB    . GLU F  2 53  ? -10.069 -34.658 63.607 1.00 44.35  ? 53   GLU F CB    1 
ATOM   4164  C  CG    . GLU F  2 53  ? -11.422 -34.315 62.980 1.00 47.03  ? 53   GLU F CG    1 
ATOM   4165  C  CD    . GLU F  2 53  ? -12.442 -35.444 63.044 1.00 50.10  ? 53   GLU F CD    1 
ATOM   4166  O  OE1   . GLU F  2 53  ? -12.089 -36.577 63.455 1.00 50.40  ? 53   GLU F OE1   1 
ATOM   4167  O  OE2   . GLU F  2 53  ? -13.618 -35.189 62.674 1.00 53.11  ? 53   GLU F OE2   1 
ATOM   4168  N  N     . THR F  2 54  ? -7.632  -33.868 61.723 1.00 41.94  ? 54   THR F N     1 
ATOM   4169  C  CA    . THR F  2 54  ? -7.142  -32.913 60.760 1.00 41.33  ? 54   THR F CA    1 
ATOM   4170  C  C     . THR F  2 54  ? -6.512  -33.619 59.566 1.00 41.22  ? 54   THR F C     1 
ATOM   4171  O  O     . THR F  2 54  ? -6.764  -33.257 58.411 1.00 42.39  ? 54   THR F O     1 
ATOM   4172  C  CB    . THR F  2 54  ? -6.149  -31.907 61.451 1.00 41.94  ? 54   THR F CB    1 
ATOM   4173  O  OG1   . THR F  2 54  ? -6.838  -31.178 62.486 1.00 40.03  ? 54   THR F OG1   1 
ATOM   4174  C  CG2   . THR F  2 54  ? -5.562  -30.953 60.465 1.00 39.89  ? 54   THR F CG2   1 
ATOM   4175  N  N     . ARG F  2 55  ? -5.702  -34.627 59.845 1.00 40.65  ? 55   ARG F N     1 
ATOM   4176  C  CA    . ARG F  2 55  ? -5.135  -35.519 58.831 1.00 39.92  ? 55   ARG F CA    1 
ATOM   4177  C  C     . ARG F  2 55  ? -6.218  -36.170 57.956 1.00 39.61  ? 55   ARG F C     1 
ATOM   4178  O  O     . ARG F  2 55  ? -6.118  -36.206 56.726 1.00 39.14  ? 55   ARG F O     1 
ATOM   4179  C  CB    . ARG F  2 55  ? -4.330  -36.609 59.531 1.00 40.46  ? 55   ARG F CB    1 
ATOM   4180  C  CG    . ARG F  2 55  ? -3.200  -36.101 60.400 1.00 39.33  ? 55   ARG F CG    1 
ATOM   4181  C  CD    . ARG F  2 55  ? -2.258  -37.248 60.715 1.00 39.00  ? 55   ARG F CD    1 
ATOM   4182  N  NE    . ARG F  2 55  ? -1.136  -36.824 61.544 1.00 38.30  ? 55   ARG F NE    1 
ATOM   4183  C  CZ    . ARG F  2 55  ? -1.108  -36.948 62.870 1.00 39.61  ? 55   ARG F CZ    1 
ATOM   4184  N  NH1   . ARG F  2 55  ? -2.135  -37.471 63.530 1.00 39.54  ? 55   ARG F NH1   1 
ATOM   4185  N  NH2   . ARG F  2 55  ? -0.060  -36.529 63.544 1.00 39.82  ? 55   ARG F NH2   1 
ATOM   4186  N  N     . GLY F  2 56  ? -7.266  -36.658 58.599 1.00 39.40  ? 56   GLY F N     1 
ATOM   4187  C  CA    . GLY F  2 56  ? -8.437  -37.156 57.889 1.00 39.48  ? 56   GLY F CA    1 
ATOM   4188  C  C     . GLY F  2 56  ? -8.969  -36.129 56.921 1.00 39.57  ? 56   GLY F C     1 
ATOM   4189  O  O     . GLY F  2 56  ? -9.020  -36.401 55.724 1.00 40.48  ? 56   GLY F O     1 
ATOM   4190  N  N     . VAL F  2 57  ? -9.367  -34.955 57.444 1.00 39.42  ? 57   VAL F N     1 
ATOM   4191  C  CA    . VAL F  2 57  ? -9.759  -33.758 56.648 1.00 38.49  ? 57   VAL F CA    1 
ATOM   4192  C  C     . VAL F  2 57  ? -8.743  -33.358 55.531 1.00 37.79  ? 57   VAL F C     1 
ATOM   4193  O  O     . VAL F  2 57  ? -9.142  -33.087 54.421 1.00 37.51  ? 57   VAL F O     1 
ATOM   4194  C  CB    . VAL F  2 57  ? -10.074 -32.544 57.601 1.00 38.96  ? 57   VAL F CB    1 
ATOM   4195  C  CG1   . VAL F  2 57  ? -10.292 -31.237 56.838 1.00 39.41  ? 57   VAL F CG1   1 
ATOM   4196  C  CG2   . VAL F  2 57  ? -11.298 -32.830 58.488 1.00 40.49  ? 57   VAL F CG2   1 
ATOM   4197  N  N     . LEU F  2 58  ? -7.447  -33.318 55.815 1.00 37.23  ? 58   LEU F N     1 
ATOM   4198  C  CA    . LEU F  2 58  ? -6.459  -32.982 54.772 1.00 37.72  ? 58   LEU F CA    1 
ATOM   4199  C  C     . LEU F  2 58  ? -6.451  -33.964 53.587 1.00 38.87  ? 58   LEU F C     1 
ATOM   4200  O  O     . LEU F  2 58  ? -6.423  -33.557 52.424 1.00 38.98  ? 58   LEU F O     1 
ATOM   4201  C  CB    . LEU F  2 58  ? -5.053  -32.804 55.376 1.00 36.90  ? 58   LEU F CB    1 
ATOM   4202  C  CG    . LEU F  2 58  ? -3.776  -32.620 54.521 1.00 36.90  ? 58   LEU F CG    1 
ATOM   4203  C  CD1   . LEU F  2 58  ? -3.852  -31.490 53.519 1.00 33.46  ? 58   LEU F CD1   1 
ATOM   4204  C  CD2   . LEU F  2 58  ? -2.567  -32.431 55.434 1.00 37.15  ? 58   LEU F CD2   1 
ATOM   4205  N  N     . LYS F  2 59  ? -6.492  -35.262 53.906 1.00 40.23  ? 59   LYS F N     1 
ATOM   4206  C  CA    . LYS F  2 59  ? -6.532  -36.352 52.948 1.00 39.86  ? 59   LYS F CA    1 
ATOM   4207  C  C     . LYS F  2 59  ? -7.714  -36.223 52.007 1.00 39.34  ? 59   LYS F C     1 
ATOM   4208  O  O     . LYS F  2 59  ? -7.562  -36.346 50.789 1.00 39.02  ? 59   LYS F O     1 
ATOM   4209  C  CB    . LYS F  2 59  ? -6.611  -37.678 53.711 1.00 41.18  ? 59   LYS F CB    1 
ATOM   4210  C  CG    . LYS F  2 59  ? -5.918  -38.851 53.023 1.00 43.75  ? 59   LYS F CG    1 
ATOM   4211  C  CD    . LYS F  2 59  ? -5.740  -40.007 53.986 1.00 48.33  ? 59   LYS F CD    1 
ATOM   4212  C  CE    . LYS F  2 59  ? -6.102  -41.356 53.314 1.00 51.54  ? 59   LYS F CE    1 
ATOM   4213  N  NZ    . LYS F  2 59  ? -7.484  -41.331 52.666 1.00 51.92  ? 59   LYS F NZ    1 
ATOM   4214  N  N     . VAL F  2 60  ? -8.901  -35.990 52.548 1.00 38.51  ? 60   VAL F N     1 
ATOM   4215  C  CA    . VAL F  2 60  ? -10.040 -35.752 51.671 1.00 38.57  ? 60   VAL F CA    1 
ATOM   4216  C  C     . VAL F  2 60  ? -9.807  -34.557 50.767 1.00 39.03  ? 60   VAL F C     1 
ATOM   4217  O  O     . VAL F  2 60  ? -10.151 -34.578 49.577 1.00 40.19  ? 60   VAL F O     1 
ATOM   4218  C  CB    . VAL F  2 60  ? -11.351 -35.529 52.436 1.00 38.99  ? 60   VAL F CB    1 
ATOM   4219  C  CG1   . VAL F  2 60  ? -12.413 -35.052 51.486 1.00 36.72  ? 60   VAL F CG1   1 
ATOM   4220  C  CG2   . VAL F  2 60  ? -11.797 -36.835 53.129 1.00 39.85  ? 60   VAL F CG2   1 
ATOM   4221  N  N     . PHE F  2 61  ? -9.219  -33.502 51.316 1.00 38.45  ? 61   PHE F N     1 
ATOM   4222  C  CA    . PHE F  2 61  ? -9.011  -32.316 50.538 1.00 37.56  ? 61   PHE F CA    1 
ATOM   4223  C  C     . PHE F  2 61  ? -8.099  -32.623 49.385 1.00 37.55  ? 61   PHE F C     1 
ATOM   4224  O  O     . PHE F  2 61  ? -8.453  -32.370 48.213 1.00 38.40  ? 61   PHE F O     1 
ATOM   4225  C  CB    . PHE F  2 61  ? -8.453  -31.181 51.412 1.00 37.77  ? 61   PHE F CB    1 
ATOM   4226  C  CG    . PHE F  2 61  ? -8.158  -29.945 50.655 1.00 35.71  ? 61   PHE F CG    1 
ATOM   4227  C  CD1   . PHE F  2 61  ? -9.173  -29.052 50.348 1.00 33.82  ? 61   PHE F CD1   1 
ATOM   4228  C  CD2   . PHE F  2 61  ? -6.868  -29.692 50.194 1.00 35.43  ? 61   PHE F CD2   1 
ATOM   4229  C  CE1   . PHE F  2 61  ? -8.882  -27.898 49.630 1.00 34.79  ? 61   PHE F CE1   1 
ATOM   4230  C  CE2   . PHE F  2 61  ? -6.591  -28.540 49.454 1.00 34.89  ? 61   PHE F CE2   1 
ATOM   4231  C  CZ    . PHE F  2 61  ? -7.593  -27.656 49.178 1.00 32.66  ? 61   PHE F CZ    1 
ATOM   4232  N  N     . LEU F  2 62  ? -6.940  -33.178 49.714 1.00 37.57  ? 62   LEU F N     1 
ATOM   4233  C  CA    . LEU F  2 62  ? -5.937  -33.624 48.730 1.00 38.50  ? 62   LEU F CA    1 
ATOM   4234  C  C     . LEU F  2 62  ? -6.437  -34.625 47.702 1.00 39.39  ? 62   LEU F C     1 
ATOM   4235  O  O     . LEU F  2 62  ? -6.120  -34.510 46.511 1.00 40.27  ? 62   LEU F O     1 
ATOM   4236  C  CB    . LEU F  2 62  ? -4.722  -34.201 49.442 1.00 38.72  ? 62   LEU F CB    1 
ATOM   4237  C  CG    . LEU F  2 62  ? -3.761  -33.181 50.068 1.00 40.42  ? 62   LEU F CG    1 
ATOM   4238  C  CD1   . LEU F  2 62  ? -2.534  -33.891 50.689 1.00 39.88  ? 62   LEU F CD1   1 
ATOM   4239  C  CD2   . LEU F  2 62  ? -3.306  -32.183 48.982 1.00 39.59  ? 62   LEU F CD2   1 
ATOM   4240  N  N     . GLU F  2 63  ? -7.215  -35.608 48.152 1.00 39.51  ? 63   GLU F N     1 
ATOM   4241  C  CA    . GLU F  2 63  ? -7.771  -36.599 47.264 1.00 40.39  ? 63   GLU F CA    1 
ATOM   4242  C  C     . GLU F  2 63  ? -8.550  -35.916 46.165 1.00 39.47  ? 63   GLU F C     1 
ATOM   4243  O  O     . GLU F  2 63  ? -8.369  -36.214 44.991 1.00 39.05  ? 63   GLU F O     1 
ATOM   4244  C  CB    . GLU F  2 63  ? -8.695  -37.560 48.037 1.00 40.78  ? 63   GLU F CB    1 
ATOM   4245  C  CG    . GLU F  2 63  ? -8.065  -38.904 48.379 1.00 42.78  ? 63   GLU F CG    1 
ATOM   4246  C  CD    . GLU F  2 63  ? -8.704  -39.616 49.568 1.00 43.14  ? 63   GLU F CD    1 
ATOM   4247  O  OE1   . GLU F  2 63  ? -9.800  -39.241 50.029 1.00 44.58  ? 63   GLU F OE1   1 
ATOM   4248  O  OE2   . GLU F  2 63  ? -8.080  -40.584 50.060 1.00 50.58  ? 63   GLU F OE2   1 
ATOM   4249  N  N     . ASN F  2 64  ? -9.424  -34.992 46.566 1.00 39.84  ? 64   ASN F N     1 
ATOM   4250  C  CA    . ASN F  2 64  ? -10.342 -34.310 45.656 1.00 39.33  ? 64   ASN F CA    1 
ATOM   4251  C  C     . ASN F  2 64  ? -9.658  -33.427 44.617 1.00 38.74  ? 64   ASN F C     1 
ATOM   4252  O  O     . ASN F  2 64  ? -10.041 -33.424 43.468 1.00 38.89  ? 64   ASN F O     1 
ATOM   4253  C  CB    . ASN F  2 64  ? -11.367 -33.527 46.453 1.00 39.54  ? 64   ASN F CB    1 
ATOM   4254  C  CG    . ASN F  2 64  ? -12.326 -34.428 47.235 1.00 42.88  ? 64   ASN F CG    1 
ATOM   4255  O  OD1   . ASN F  2 64  ? -12.271 -35.668 47.167 1.00 49.72  ? 64   ASN F OD1   1 
ATOM   4256  N  ND2   . ASN F  2 64  ? -13.217 -33.807 47.986 1.00 44.14  ? 64   ASN F ND2   1 
ATOM   4257  N  N     . VAL F  2 65  ? -8.608  -32.727 45.018 1.00 39.13  ? 65   VAL F N     1 
ATOM   4258  C  CA    . VAL F  2 65  ? -7.900  -31.798 44.143 1.00 39.02  ? 65   VAL F CA    1 
ATOM   4259  C  C     . VAL F  2 65  ? -6.979  -32.555 43.252 1.00 38.88  ? 65   VAL F C     1 
ATOM   4260  O  O     . VAL F  2 65  ? -6.947  -32.307 42.046 1.00 39.64  ? 65   VAL F O     1 
ATOM   4261  C  CB    . VAL F  2 65  ? -7.048  -30.704 44.936 1.00 39.14  ? 65   VAL F CB    1 
ATOM   4262  C  CG1   . VAL F  2 65  ? -6.339  -29.756 43.956 1.00 39.41  ? 65   VAL F CG1   1 
ATOM   4263  C  CG2   . VAL F  2 65  ? -7.919  -29.900 45.844 1.00 39.20  ? 65   VAL F CG2   1 
ATOM   4264  N  N     . ILE F  2 66  ? -6.184  -33.452 43.837 1.00 38.99  ? 66   ILE F N     1 
ATOM   4265  C  CA    . ILE F  2 66  ? -5.342  -34.346 43.031 1.00 38.67  ? 66   ILE F CA    1 
ATOM   4266  C  C     . ILE F  2 66  ? -6.157  -35.123 41.988 1.00 39.19  ? 66   ILE F C     1 
ATOM   4267  O  O     . ILE F  2 66  ? -5.750  -35.214 40.836 1.00 39.23  ? 66   ILE F O     1 
ATOM   4268  C  CB    . ILE F  2 66  ? -4.493  -35.285 43.906 1.00 39.96  ? 66   ILE F CB    1 
ATOM   4269  C  CG1   . ILE F  2 66  ? -3.580  -34.465 44.856 1.00 38.14  ? 66   ILE F CG1   1 
ATOM   4270  C  CG2   . ILE F  2 66  ? -3.682  -36.202 43.028 1.00 39.50  ? 66   ILE F CG2   1 
ATOM   4271  C  CD1   . ILE F  2 66  ? -2.832  -35.287 45.874 1.00 37.19  ? 66   ILE F CD1   1 
ATOM   4272  N  N     . ARG F  2 67  ? -7.333  -35.624 42.359 1.00 39.49  ? 67   ARG F N     1 
ATOM   4273  C  CA    . ARG F  2 67  ? -8.157  -36.331 41.402 1.00 41.13  ? 67   ARG F CA    1 
ATOM   4274  C  C     . ARG F  2 67  ? -8.461  -35.522 40.135 1.00 41.18  ? 67   ARG F C     1 
ATOM   4275  O  O     . ARG F  2 67  ? -8.212  -35.989 39.027 1.00 41.27  ? 67   ARG F O     1 
ATOM   4276  C  CB    . ARG F  2 67  ? -9.436  -36.815 42.060 1.00 41.90  ? 67   ARG F CB    1 
ATOM   4277  C  CG    . ARG F  2 67  ? -10.369 -37.547 41.110 1.00 45.71  ? 67   ARG F CG    1 
ATOM   4278  C  CD    . ARG F  2 67  ? -11.710 -37.825 41.786 1.00 51.43  ? 67   ARG F CD    1 
ATOM   4279  N  NE    . ARG F  2 67  ? -11.518 -38.729 42.928 1.00 57.46  ? 67   ARG F NE    1 
ATOM   4280  C  CZ    . ARG F  2 67  ? -11.810 -38.446 44.203 1.00 58.01  ? 67   ARG F CZ    1 
ATOM   4281  N  NH1   . ARG F  2 67  ? -12.337 -37.262 44.529 1.00 56.81  ? 67   ARG F NH1   1 
ATOM   4282  N  NH2   . ARG F  2 67  ? -11.576 -39.360 45.147 1.00 55.33  ? 67   ARG F NH2   1 
ATOM   4283  N  N     . ASP F  2 68  ? -8.992  -34.305 40.306 1.00 41.55  ? 68   ASP F N     1 
ATOM   4284  C  CA    . ASP F  2 68  ? -9.277  -33.398 39.189 1.00 40.56  ? 68   ASP F CA    1 
ATOM   4285  C  C     . ASP F  2 68  ? -7.988  -32.986 38.518 1.00 39.62  ? 68   ASP F C     1 
ATOM   4286  O  O     . ASP F  2 68  ? -7.899  -32.958 37.293 1.00 39.47  ? 68   ASP F O     1 
ATOM   4287  C  CB    . ASP F  2 68  ? -10.017 -32.164 39.687 1.00 41.53  ? 68   ASP F CB    1 
ATOM   4288  C  CG    . ASP F  2 68  ? -11.423 -32.474 40.156 1.00 44.77  ? 68   ASP F CG    1 
ATOM   4289  O  OD1   . ASP F  2 68  ? -11.846 -33.650 40.035 1.00 48.44  ? 68   ASP F OD1   1 
ATOM   4290  O  OD2   . ASP F  2 68  ? -12.116 -31.535 40.638 1.00 48.14  ? 68   ASP F OD2   1 
ATOM   4291  N  N     . ALA F  2 69  ? -6.981  -32.671 39.333 1.00 38.76  ? 69   ALA F N     1 
ATOM   4292  C  CA    . ALA F  2 69  ? -5.688  -32.276 38.830 1.00 37.97  ? 69   ALA F CA    1 
ATOM   4293  C  C     . ALA F  2 69  ? -5.182  -33.340 37.876 1.00 38.70  ? 69   ALA F C     1 
ATOM   4294  O  O     . ALA F  2 69  ? -4.929  -33.029 36.723 1.00 39.27  ? 69   ALA F O     1 
ATOM   4295  C  CB    . ALA F  2 69  ? -4.730  -32.027 39.963 1.00 37.14  ? 69   ALA F CB    1 
ATOM   4296  N  N     . VAL F  2 70  ? -5.099  -34.600 38.342 1.00 39.07  ? 70   VAL F N     1 
ATOM   4297  C  CA    . VAL F  2 70  ? -4.677  -35.762 37.519 1.00 39.24  ? 70   VAL F CA    1 
ATOM   4298  C  C     . VAL F  2 70  ? -5.626  -36.060 36.332 1.00 39.78  ? 70   VAL F C     1 
ATOM   4299  O  O     . VAL F  2 70  ? -5.160  -36.458 35.256 1.00 39.66  ? 70   VAL F O     1 
ATOM   4300  C  CB    . VAL F  2 70  ? -4.458  -37.033 38.396 1.00 39.04  ? 70   VAL F CB    1 
ATOM   4301  C  CG1   . VAL F  2 70  ? -4.319  -38.255 37.565 1.00 39.55  ? 70   VAL F CG1   1 
ATOM   4302  C  CG2   . VAL F  2 70  ? -3.252  -36.869 39.306 1.00 39.31  ? 70   VAL F CG2   1 
ATOM   4303  N  N     . THR F  2 71  ? -6.937  -35.860 36.503 1.00 39.87  ? 71   THR F N     1 
ATOM   4304  C  CA    . THR F  2 71  ? -7.842  -35.935 35.352 1.00 40.99  ? 71   THR F CA    1 
ATOM   4305  C  C     . THR F  2 71  ? -7.413  -35.006 34.200 1.00 42.72  ? 71   THR F C     1 
ATOM   4306  O  O     . THR F  2 71  ? -7.315  -35.460 33.060 1.00 43.90  ? 71   THR F O     1 
ATOM   4307  C  CB    . THR F  2 71  ? -9.280  -35.668 35.740 1.00 40.50  ? 71   THR F CB    1 
ATOM   4308  O  OG1   . THR F  2 71  ? -9.605  -36.438 36.900 1.00 37.83  ? 71   THR F OG1   1 
ATOM   4309  C  CG2   . THR F  2 71  ? -10.215 -36.026 34.631 1.00 38.65  ? 71   THR F CG2   1 
ATOM   4310  N  N     . TYR F  2 72  ? -7.146  -33.717 34.497 1.00 44.40  ? 72   TYR F N     1 
ATOM   4311  C  CA    . TYR F  2 72  ? -6.578  -32.728 33.527 1.00 43.60  ? 72   TYR F CA    1 
ATOM   4312  C  C     . TYR F  2 72  ? -5.263  -33.159 32.876 1.00 44.93  ? 72   TYR F C     1 
ATOM   4313  O  O     . TYR F  2 72  ? -5.029  -32.964 31.666 1.00 45.39  ? 72   TYR F O     1 
ATOM   4314  C  CB    . TYR F  2 72  ? -6.338  -31.364 34.215 1.00 43.64  ? 72   TYR F CB    1 
ATOM   4315  C  CG    . TYR F  2 72  ? -7.593  -30.580 34.489 1.00 42.18  ? 72   TYR F CG    1 
ATOM   4316  C  CD1   . TYR F  2 72  ? -7.995  -30.283 35.788 1.00 42.77  ? 72   TYR F CD1   1 
ATOM   4317  C  CD2   . TYR F  2 72  ? -8.386  -30.146 33.449 1.00 40.66  ? 72   TYR F CD2   1 
ATOM   4318  C  CE1   . TYR F  2 72  ? -9.182  -29.587 36.028 1.00 41.03  ? 72   TYR F CE1   1 
ATOM   4319  C  CE2   . TYR F  2 72  ? -9.543  -29.454 33.679 1.00 41.22  ? 72   TYR F CE2   1 
ATOM   4320  C  CZ    . TYR F  2 72  ? -9.936  -29.173 34.958 1.00 40.62  ? 72   TYR F CZ    1 
ATOM   4321  O  OH    . TYR F  2 72  ? -11.096 -28.480 35.128 1.00 41.69  ? 72   TYR F OH    1 
ATOM   4322  N  N     . THR F  2 73  ? -4.374  -33.704 33.691 1.00 45.83  ? 73   THR F N     1 
ATOM   4323  C  CA    . THR F  2 73  ? -3.114  -34.261 33.200 1.00 46.99  ? 73   THR F CA    1 
ATOM   4324  C  C     . THR F  2 73  ? -3.356  -35.325 32.142 1.00 48.50  ? 73   THR F C     1 
ATOM   4325  O  O     . THR F  2 73  ? -2.808  -35.247 31.045 1.00 49.00  ? 73   THR F O     1 
ATOM   4326  C  CB    . THR F  2 73  ? -2.399  -34.884 34.345 1.00 46.57  ? 73   THR F CB    1 
ATOM   4327  O  OG1   . THR F  2 73  ? -2.431  -33.947 35.431 1.00 47.97  ? 73   THR F OG1   1 
ATOM   4328  C  CG2   . THR F  2 73  ? -1.003  -35.236 33.986 1.00 46.08  ? 73   THR F CG2   1 
ATOM   4329  N  N     . GLU F  2 74  ? -4.181  -36.318 32.481 1.00 49.96  ? 74   GLU F N     1 
ATOM   4330  C  CA    . GLU F  2 74  ? -4.500  -37.411 31.573 1.00 51.46  ? 74   GLU F CA    1 
ATOM   4331  C  C     . GLU F  2 74  ? -5.109  -36.922 30.286 1.00 51.42  ? 74   GLU F C     1 
ATOM   4332  O  O     . GLU F  2 74  ? -4.715  -37.389 29.218 1.00 51.74  ? 74   GLU F O     1 
ATOM   4333  C  CB    . GLU F  2 74  ? -5.455  -38.401 32.213 1.00 52.26  ? 74   GLU F CB    1 
ATOM   4334  C  CG    . GLU F  2 74  ? -4.824  -39.283 33.260 1.00 55.84  ? 74   GLU F CG    1 
ATOM   4335  C  CD    . GLU F  2 74  ? -5.786  -40.376 33.677 1.00 61.97  ? 74   GLU F CD    1 
ATOM   4336  O  OE1   . GLU F  2 74  ? -6.043  -41.260 32.806 1.00 64.46  ? 74   GLU F OE1   1 
ATOM   4337  O  OE2   . GLU F  2 74  ? -6.285  -40.341 34.844 1.00 60.66  ? 74   GLU F OE2   1 
ATOM   4338  N  N     . HIS F  2 75  ? -6.054  -35.977 30.381 1.00 51.37  ? 75   HIS F N     1 
ATOM   4339  C  CA    . HIS F  2 75  ? -6.662  -35.378 29.181 1.00 51.09  ? 75   HIS F CA    1 
ATOM   4340  C  C     . HIS F  2 75  ? -5.656  -34.762 28.194 1.00 51.15  ? 75   HIS F C     1 
ATOM   4341  O  O     . HIS F  2 75  ? -5.850  -34.803 26.972 1.00 51.14  ? 75   HIS F O     1 
ATOM   4342  C  CB    . HIS F  2 75  ? -7.726  -34.358 29.528 1.00 50.64  ? 75   HIS F CB    1 
ATOM   4343  C  CG    . HIS F  2 75  ? -8.582  -34.001 28.362 1.00 50.70  ? 75   HIS F CG    1 
ATOM   4344  N  ND1   . HIS F  2 75  ? -9.777  -34.634 28.100 1.00 51.39  ? 75   HIS F ND1   1 
ATOM   4345  C  CD2   . HIS F  2 75  ? -8.391  -33.122 27.350 1.00 50.32  ? 75   HIS F CD2   1 
ATOM   4346  C  CE1   . HIS F  2 75  ? -10.301 -34.137 26.993 1.00 50.25  ? 75   HIS F CE1   1 
ATOM   4347  N  NE2   . HIS F  2 75  ? -9.478  -33.220 26.516 1.00 48.79  ? 75   HIS F NE2   1 
ATOM   4348  N  N     . ALA F  2 76  ? -4.594  -34.185 28.739 1.00 51.23  ? 76   ALA F N     1 
ATOM   4349  C  CA    . ALA F  2 76  ? -3.549  -33.550 27.959 1.00 51.30  ? 76   ALA F CA    1 
ATOM   4350  C  C     . ALA F  2 76  ? -2.567  -34.593 27.432 1.00 52.11  ? 76   ALA F C     1 
ATOM   4351  O  O     . ALA F  2 76  ? -1.649  -34.244 26.677 1.00 53.03  ? 76   ALA F O     1 
ATOM   4352  C  CB    . ALA F  2 76  ? -2.821  -32.554 28.819 1.00 50.84  ? 76   ALA F CB    1 
ATOM   4353  N  N     . LYS F  2 77  ? -2.751  -35.854 27.849 1.00 52.18  ? 77   LYS F N     1 
ATOM   4354  C  CA    . LYS F  2 77  ? -1.882  -36.996 27.476 1.00 52.27  ? 77   LYS F CA    1 
ATOM   4355  C  C     . LYS F  2 77  ? -0.458  -36.838 27.977 1.00 51.89  ? 77   LYS F C     1 
ATOM   4356  O  O     . LYS F  2 77  ? 0.508   -37.097 27.252 1.00 52.68  ? 77   LYS F O     1 
ATOM   4357  C  CB    . LYS F  2 77  ? -1.882  -37.239 25.970 1.00 52.30  ? 77   LYS F CB    1 
ATOM   4358  C  CG    . LYS F  2 77  ? -3.110  -37.925 25.472 1.00 53.67  ? 77   LYS F CG    1 
ATOM   4359  C  CD    . LYS F  2 77  ? -3.378  -37.494 24.056 1.00 55.66  ? 77   LYS F CD    1 
ATOM   4360  C  CE    . LYS F  2 77  ? -4.252  -38.506 23.364 1.00 59.75  ? 77   LYS F CE    1 
ATOM   4361  N  NZ    . LYS F  2 77  ? -5.436  -38.868 24.190 1.00 61.15  ? 77   LYS F NZ    1 
ATOM   4362  N  N     . ARG F  2 78  ? -0.340  -36.411 29.224 1.00 51.11  ? 78   ARG F N     1 
ATOM   4363  C  CA    . ARG F  2 78  ? 0.940   -36.159 29.833 1.00 50.41  ? 78   ARG F CA    1 
ATOM   4364  C  C     . ARG F  2 78  ? 1.081   -37.107 30.987 1.00 50.26  ? 78   ARG F C     1 
ATOM   4365  O  O     . ARG F  2 78  ? 0.094   -37.652 31.467 1.00 49.96  ? 78   ARG F O     1 
ATOM   4366  C  CB    . ARG F  2 78  ? 1.026   -34.708 30.322 1.00 50.37  ? 78   ARG F CB    1 
ATOM   4367  C  CG    . ARG F  2 78  ? 1.234   -33.677 29.215 1.00 49.97  ? 78   ARG F CG    1 
ATOM   4368  C  CD    . ARG F  2 78  ? 1.410   -32.250 29.793 1.00 50.56  ? 78   ARG F CD    1 
ATOM   4369  N  NE    . ARG F  2 78  ? 0.135   -31.610 30.178 1.00 48.05  ? 78   ARG F NE    1 
ATOM   4370  C  CZ    . ARG F  2 78  ? -0.337  -31.541 31.426 1.00 46.84  ? 78   ARG F CZ    1 
ATOM   4371  N  NH1   . ARG F  2 78  ? 0.338   -32.072 32.441 1.00 46.96  ? 78   ARG F NH1   1 
ATOM   4372  N  NH2   . ARG F  2 78  ? -1.484  -30.924 31.666 1.00 44.45  ? 78   ARG F NH2   1 
ATOM   4373  N  N     . LYS F  2 79  ? 2.324   -37.295 31.415 1.00 50.45  ? 79   LYS F N     1 
ATOM   4374  C  CA    . LYS F  2 79  ? 2.694   -38.127 32.559 1.00 50.91  ? 79   LYS F CA    1 
ATOM   4375  C  C     . LYS F  2 79  ? 3.091   -37.232 33.742 1.00 49.89  ? 79   LYS F C     1 
ATOM   4376  O  O     . LYS F  2 79  ? 3.245   -37.705 34.879 1.00 49.79  ? 79   LYS F O     1 
ATOM   4377  C  CB    . LYS F  2 79  ? 3.845   -39.058 32.148 1.00 50.57  ? 79   LYS F CB    1 
ATOM   4378  C  CG    . LYS F  2 79  ? 3.423   -40.025 30.999 1.00 53.27  ? 79   LYS F CG    1 
ATOM   4379  C  CD    . LYS F  2 79  ? 4.573   -40.870 30.409 1.00 53.66  ? 79   LYS F CD    1 
ATOM   4380  C  CE    . LYS F  2 79  ? 4.877   -42.142 31.234 1.00 58.79  ? 79   LYS F CE    1 
ATOM   4381  N  NZ    . LYS F  2 79  ? 5.349   -41.868 32.661 1.00 59.94  ? 79   LYS F NZ    1 
ATOM   4382  N  N     . THR F  2 80  ? 3.237   -35.937 33.451 1.00 48.58  ? 80   THR F N     1 
ATOM   4383  C  CA    . THR F  2 80  ? 3.703   -34.938 34.404 1.00 47.73  ? 80   THR F CA    1 
ATOM   4384  C  C     . THR F  2 80  ? 2.562   -34.012 34.832 1.00 46.25  ? 80   THR F C     1 
ATOM   4385  O  O     . THR F  2 80  ? 1.843   -33.467 33.994 1.00 45.46  ? 80   THR F O     1 
ATOM   4386  C  CB    . THR F  2 80  ? 4.857   -34.105 33.809 1.00 47.94  ? 80   THR F CB    1 
ATOM   4387  O  OG1   . THR F  2 80  ? 5.640   -34.945 32.946 1.00 49.30  ? 80   THR F OG1   1 
ATOM   4388  C  CG2   . THR F  2 80  ? 5.738   -33.545 34.911 1.00 46.99  ? 80   THR F CG2   1 
ATOM   4389  N  N     . VAL F  2 81  ? 2.383   -33.870 36.142 1.00 45.08  ? 81   VAL F N     1 
ATOM   4390  C  CA    . VAL F  2 81  ? 1.316   -33.014 36.674 1.00 44.66  ? 81   VAL F CA    1 
ATOM   4391  C  C     . VAL F  2 81  ? 1.864   -31.583 36.783 1.00 43.69  ? 81   VAL F C     1 
ATOM   4392  O  O     . VAL F  2 81  ? 2.816   -31.341 37.502 1.00 42.68  ? 81   VAL F O     1 
ATOM   4393  C  CB    . VAL F  2 81  ? 0.745   -33.532 38.028 1.00 44.96  ? 81   VAL F CB    1 
ATOM   4394  C  CG1   . VAL F  2 81  ? -0.495  -32.731 38.454 1.00 44.03  ? 81   VAL F CG1   1 
ATOM   4395  C  CG2   . VAL F  2 81  ? 0.412   -35.028 37.945 1.00 44.56  ? 81   VAL F CG2   1 
ATOM   4396  N  N     . THR F  2 82  ? 1.276   -30.667 36.010 1.00 43.60  ? 82   THR F N     1 
ATOM   4397  C  CA    . THR F  2 82  ? 1.711   -29.269 35.953 1.00 42.99  ? 82   THR F CA    1 
ATOM   4398  C  C     . THR F  2 82  ? 1.018   -28.437 37.015 1.00 43.02  ? 82   THR F C     1 
ATOM   4399  O  O     . THR F  2 82  ? -0.068  -28.802 37.485 1.00 43.49  ? 82   THR F O     1 
ATOM   4400  C  CB    . THR F  2 82  ? 1.436   -28.633 34.574 1.00 42.89  ? 82   THR F CB    1 
ATOM   4401  O  OG1   . THR F  2 82  ? 0.027   -28.491 34.381 1.00 43.15  ? 82   THR F OG1   1 
ATOM   4402  C  CG2   . THR F  2 82  ? 2.042   -29.458 33.425 1.00 41.81  ? 82   THR F CG2   1 
ATOM   4403  N  N     . ALA F  2 83  ? 1.635   -27.314 37.385 1.00 43.04  ? 83   ALA F N     1 
ATOM   4404  C  CA    . ALA F  2 83  ? 1.002   -26.322 38.272 1.00 42.46  ? 83   ALA F CA    1 
ATOM   4405  C  C     . ALA F  2 83  ? -0.343  -25.829 37.721 1.00 42.25  ? 83   ALA F C     1 
ATOM   4406  O  O     . ALA F  2 83  ? -1.263  -25.557 38.474 1.00 42.55  ? 83   ALA F O     1 
ATOM   4407  C  CB    . ALA F  2 83  ? 1.925   -25.191 38.503 1.00 42.55  ? 83   ALA F CB    1 
ATOM   4408  N  N     . MET F  2 84  ? -0.466  -25.751 36.401 1.00 42.26  ? 84   MET F N     1 
ATOM   4409  C  CA    . MET F  2 84  ? -1.727  -25.394 35.754 1.00 41.72  ? 84   MET F CA    1 
ATOM   4410  C  C     . MET F  2 84  ? -2.855  -26.395 35.951 1.00 41.47  ? 84   MET F C     1 
ATOM   4411  O  O     . MET F  2 84  ? -4.022  -26.000 36.062 1.00 42.31  ? 84   MET F O     1 
ATOM   4412  C  CB    . MET F  2 84  ? -1.520  -25.160 34.256 1.00 42.18  ? 84   MET F CB    1 
ATOM   4413  C  CG    . MET F  2 84  ? -0.844  -23.827 33.889 1.00 44.58  ? 84   MET F CG    1 
ATOM   4414  S  SD    . MET F  2 84  ? -1.263  -22.403 34.961 1.00 49.21  ? 84   MET F SD    1 
ATOM   4415  C  CE    . MET F  2 84  ? -3.016  -22.227 34.626 1.00 46.14  ? 84   MET F CE    1 
ATOM   4416  N  N     . ASP F  2 85  ? -2.528  -27.683 35.950 1.00 40.37  ? 85   ASP F N     1 
ATOM   4417  C  CA    . ASP F  2 85  ? -3.494  -28.747 36.268 1.00 39.23  ? 85   ASP F CA    1 
ATOM   4418  C  C     . ASP F  2 85  ? -4.073  -28.564 37.665 1.00 37.82  ? 85   ASP F C     1 
ATOM   4419  O  O     . ASP F  2 85  ? -5.268  -28.713 37.858 1.00 38.08  ? 85   ASP F O     1 
ATOM   4420  C  CB    . ASP F  2 85  ? -2.835  -30.151 36.147 1.00 39.30  ? 85   ASP F CB    1 
ATOM   4421  C  CG    . ASP F  2 85  ? -2.439  -30.505 34.713 1.00 40.35  ? 85   ASP F CG    1 
ATOM   4422  O  OD1   . ASP F  2 85  ? -3.147  -30.108 33.752 1.00 41.73  ? 85   ASP F OD1   1 
ATOM   4423  O  OD2   . ASP F  2 85  ? -1.421  -31.198 34.532 1.00 42.37  ? 85   ASP F OD2   1 
ATOM   4424  N  N     . VAL F  2 86  ? -3.212  -28.279 38.637 1.00 37.16  ? 86   VAL F N     1 
ATOM   4425  C  CA    . VAL F  2 86  ? -3.634  -27.979 40.025 1.00 36.71  ? 86   VAL F CA    1 
ATOM   4426  C  C     . VAL F  2 86  ? -4.505  -26.724 40.109 1.00 37.45  ? 86   VAL F C     1 
ATOM   4427  O  O     . VAL F  2 86  ? -5.568  -26.708 40.777 1.00 36.96  ? 86   VAL F O     1 
ATOM   4428  C  CB    . VAL F  2 86  ? -2.422  -27.770 40.915 1.00 36.09  ? 86   VAL F CB    1 
ATOM   4429  C  CG1   . VAL F  2 86  ? -2.847  -27.565 42.348 1.00 35.02  ? 86   VAL F CG1   1 
ATOM   4430  C  CG2   . VAL F  2 86  ? -1.479  -28.986 40.798 1.00 37.14  ? 86   VAL F CG2   1 
ATOM   4431  N  N     . VAL F  2 87  ? -4.051  -25.678 39.410 1.00 37.90  ? 87   VAL F N     1 
ATOM   4432  C  CA    . VAL F  2 87  ? -4.690  -24.380 39.439 1.00 37.76  ? 87   VAL F CA    1 
ATOM   4433  C  C     . VAL F  2 87  ? -6.069  -24.513 38.812 1.00 39.24  ? 87   VAL F C     1 
ATOM   4434  O  O     . VAL F  2 87  ? -7.059  -24.085 39.412 1.00 40.47  ? 87   VAL F O     1 
ATOM   4435  C  CB    . VAL F  2 87  ? -3.730  -23.278 38.860 1.00 38.62  ? 87   VAL F CB    1 
ATOM   4436  C  CG1   . VAL F  2 87  ? -4.460  -22.040 38.360 1.00 35.00  ? 87   VAL F CG1   1 
ATOM   4437  C  CG2   . VAL F  2 87  ? -2.629  -22.943 39.896 1.00 33.71  ? 87   VAL F CG2   1 
ATOM   4438  N  N     . TYR F  2 88  ? -6.175  -25.200 37.678 1.00 40.57  ? 88   TYR F N     1 
ATOM   4439  C  CA    . TYR F  2 88  ? -7.502  -25.474 37.093 1.00 41.43  ? 88   TYR F CA    1 
ATOM   4440  C  C     . TYR F  2 88  ? -8.391  -26.314 37.973 1.00 41.85  ? 88   TYR F C     1 
ATOM   4441  O  O     . TYR F  2 88  ? -9.610  -26.155 37.963 1.00 42.74  ? 88   TYR F O     1 
ATOM   4442  C  CB    . TYR F  2 88  ? -7.393  -26.142 35.728 1.00 41.89  ? 88   TYR F CB    1 
ATOM   4443  C  CG    . TYR F  2 88  ? -6.708  -25.274 34.728 1.00 43.24  ? 88   TYR F CG    1 
ATOM   4444  C  CD1   . TYR F  2 88  ? -5.820  -25.800 33.801 1.00 43.50  ? 88   TYR F CD1   1 
ATOM   4445  C  CD2   . TYR F  2 88  ? -6.893  -23.893 34.749 1.00 46.17  ? 88   TYR F CD2   1 
ATOM   4446  C  CE1   . TYR F  2 88  ? -5.171  -24.969 32.879 1.00 43.94  ? 88   TYR F CE1   1 
ATOM   4447  C  CE2   . TYR F  2 88  ? -6.239  -23.065 33.844 1.00 45.71  ? 88   TYR F CE2   1 
ATOM   4448  C  CZ    . TYR F  2 88  ? -5.396  -23.617 32.910 1.00 43.82  ? 88   TYR F CZ    1 
ATOM   4449  O  OH    . TYR F  2 88  ? -4.787  -22.777 32.019 1.00 46.71  ? 88   TYR F OH    1 
ATOM   4450  N  N     . ALA F  2 89  ? -7.773  -27.213 38.730 1.00 42.02  ? 89   ALA F N     1 
ATOM   4451  C  CA    . ALA F  2 89  ? -8.492  -28.179 39.543 1.00 41.60  ? 89   ALA F CA    1 
ATOM   4452  C  C     . ALA F  2 89  ? -9.005  -27.469 40.756 1.00 41.42  ? 89   ALA F C     1 
ATOM   4453  O  O     . ALA F  2 89  ? -10.169 -27.575 41.075 1.00 41.87  ? 89   ALA F O     1 
ATOM   4454  C  CB    . ALA F  2 89  ? -7.568  -29.348 39.943 1.00 40.80  ? 89   ALA F CB    1 
ATOM   4455  N  N     . LEU F  2 90  ? -8.115  -26.762 41.447 1.00 42.16  ? 90   LEU F N     1 
ATOM   4456  C  CA    . LEU F  2 90  ? -8.498  -25.823 42.502 1.00 42.31  ? 90   LEU F CA    1 
ATOM   4457  C  C     . LEU F  2 90  ? -9.577  -24.829 42.049 1.00 43.02  ? 90   LEU F C     1 
ATOM   4458  O  O     . LEU F  2 90  ? -10.570 -24.654 42.732 1.00 42.84  ? 90   LEU F O     1 
ATOM   4459  C  CB    . LEU F  2 90  ? -7.274  -25.086 42.999 1.00 41.91  ? 90   LEU F CB    1 
ATOM   4460  C  CG    . LEU F  2 90  ? -6.405  -25.830 44.005 1.00 40.67  ? 90   LEU F CG    1 
ATOM   4461  C  CD1   . LEU F  2 90  ? -5.163  -24.977 44.280 1.00 38.16  ? 90   LEU F CD1   1 
ATOM   4462  C  CD2   . LEU F  2 90  ? -7.175  -26.147 45.315 1.00 34.64  ? 90   LEU F CD2   1 
ATOM   4463  N  N     . LYS F  2 91  ? -9.414  -24.206 40.890 1.00 43.92  ? 91   LYS F N     1 
ATOM   4464  C  CA    . LYS F  2 91  ? -10.422 -23.234 40.451 1.00 45.89  ? 91   LYS F CA    1 
ATOM   4465  C  C     . LYS F  2 91  ? -11.804 -23.844 40.311 1.00 46.54  ? 91   LYS F C     1 
ATOM   4466  O  O     . LYS F  2 91  ? -12.802 -23.251 40.742 1.00 47.11  ? 91   LYS F O     1 
ATOM   4467  C  CB    . LYS F  2 91  ? -9.999  -22.542 39.162 1.00 46.56  ? 91   LYS F CB    1 
ATOM   4468  C  CG    . LYS F  2 91  ? -11.071 -21.690 38.492 1.00 50.03  ? 91   LYS F CG    1 
ATOM   4469  C  CD    . LYS F  2 91  ? -10.422 -20.799 37.443 1.00 54.44  ? 91   LYS F CD    1 
ATOM   4470  C  CE    . LYS F  2 91  ? -11.023 -19.412 37.467 1.00 58.37  ? 91   LYS F CE    1 
ATOM   4471  N  NZ    . LYS F  2 91  ? -10.127 -18.361 36.840 1.00 63.55  ? 91   LYS F NZ    1 
ATOM   4472  N  N     . ARG F  2 92  ? -11.885 -25.040 39.726 1.00 47.61  ? 92   ARG F N     1 
ATOM   4473  C  CA    . ARG F  2 92  ? -13.198 -25.670 39.483 1.00 47.12  ? 92   ARG F CA    1 
ATOM   4474  C  C     . ARG F  2 92  ? -13.900 -26.122 40.767 1.00 47.26  ? 92   ARG F C     1 
ATOM   4475  O  O     . ARG F  2 92  ? -15.088 -26.358 40.783 1.00 47.67  ? 92   ARG F O     1 
ATOM   4476  C  CB    . ARG F  2 92  ? -13.091 -26.793 38.446 1.00 47.44  ? 92   ARG F CB    1 
ATOM   4477  C  CG    . ARG F  2 92  ? -12.418 -28.081 38.916 1.00 47.03  ? 92   ARG F CG    1 
ATOM   4478  C  CD    . ARG F  2 92  ? -12.612 -29.202 37.871 1.00 46.90  ? 92   ARG F CD    1 
ATOM   4479  N  NE    . ARG F  2 92  ? -14.016 -29.280 37.450 1.00 46.63  ? 92   ARG F NE    1 
ATOM   4480  C  CZ    . ARG F  2 92  ? -15.017 -29.757 38.193 1.00 45.07  ? 92   ARG F CZ    1 
ATOM   4481  N  NH1   . ARG F  2 92  ? -14.817 -30.251 39.414 1.00 41.26  ? 92   ARG F NH1   1 
ATOM   4482  N  NH2   . ARG F  2 92  ? -16.240 -29.730 37.698 1.00 48.16  ? 92   ARG F NH2   1 
ATOM   4483  N  N     . GLN F  2 93  ? -13.160 -26.201 41.859 1.00 47.66  ? 93   GLN F N     1 
ATOM   4484  C  CA    . GLN F  2 93  ? -13.746 -26.452 43.174 1.00 47.46  ? 93   GLN F CA    1 
ATOM   4485  C  C     . GLN F  2 93  ? -13.983 -25.204 43.995 1.00 46.75  ? 93   GLN F C     1 
ATOM   4486  O  O     . GLN F  2 93  ? -14.159 -25.303 45.201 1.00 46.73  ? 93   GLN F O     1 
ATOM   4487  C  CB    . GLN F  2 93  ? -12.785 -27.305 43.934 1.00 48.59  ? 93   GLN F CB    1 
ATOM   4488  C  CG    . GLN F  2 93  ? -12.310 -28.444 43.090 1.00 51.80  ? 93   GLN F CG    1 
ATOM   4489  C  CD    . GLN F  2 93  ? -11.927 -29.609 43.905 1.00 55.26  ? 93   GLN F CD    1 
ATOM   4490  O  OE1   . GLN F  2 93  ? -11.394 -29.459 45.024 1.00 56.35  ? 93   GLN F OE1   1 
ATOM   4491  N  NE2   . GLN F  2 93  ? -12.192 -30.802 43.370 1.00 55.36  ? 93   GLN F NE2   1 
ATOM   4492  N  N     . GLY F  2 94  ? -13.977 -24.035 43.340 1.00 46.27  ? 94   GLY F N     1 
ATOM   4493  C  CA    . GLY F  2 94  ? -14.115 -22.754 43.995 1.00 44.76  ? 94   GLY F CA    1 
ATOM   4494  C  C     . GLY F  2 94  ? -13.082 -22.464 45.065 1.00 44.35  ? 94   GLY F C     1 
ATOM   4495  O  O     . GLY F  2 94  ? -13.408 -21.857 46.085 1.00 43.97  ? 94   GLY F O     1 
ATOM   4496  N  N     . ARG F  2 95  ? -11.844 -22.910 44.840 1.00 43.75  ? 95   ARG F N     1 
ATOM   4497  C  CA    . ARG F  2 95  ? -10.717 -22.580 45.709 1.00 43.06  ? 95   ARG F CA    1 
ATOM   4498  C  C     . ARG F  2 95  ? -9.574  -21.985 44.863 1.00 42.71  ? 95   ARG F C     1 
ATOM   4499  O  O     . ARG F  2 95  ? -8.390  -22.370 45.032 1.00 42.43  ? 95   ARG F O     1 
ATOM   4500  C  CB    . ARG F  2 95  ? -10.200 -23.794 46.507 1.00 43.09  ? 95   ARG F CB    1 
ATOM   4501  C  CG    . ARG F  2 95  ? -11.204 -24.661 47.256 1.00 44.32  ? 95   ARG F CG    1 
ATOM   4502  C  CD    . ARG F  2 95  ? -11.392 -24.328 48.732 1.00 46.72  ? 95   ARG F CD    1 
ATOM   4503  N  NE    . ARG F  2 95  ? -10.239 -23.665 49.388 1.00 47.87  ? 95   ARG F NE    1 
ATOM   4504  C  CZ    . ARG F  2 95  ? -10.355 -22.968 50.525 1.00 47.17  ? 95   ARG F CZ    1 
ATOM   4505  N  NH1   . ARG F  2 95  ? -11.541 -22.871 51.122 1.00 47.71  ? 95   ARG F NH1   1 
ATOM   4506  N  NH2   . ARG F  2 95  ? -9.310  -22.371 51.072 1.00 45.55  ? 95   ARG F NH2   1 
ATOM   4507  N  N     . THR F  2 96  ? -9.937  -21.042 43.975 1.00 42.44  ? 96   THR F N     1 
ATOM   4508  C  CA    . THR F  2 96  ? -9.004  -20.245 43.106 1.00 41.40  ? 96   THR F CA    1 
ATOM   4509  C  C     . THR F  2 96  ? -7.696  -19.813 43.744 1.00 40.81  ? 96   THR F C     1 
ATOM   4510  O  O     . THR F  2 96  ? -7.689  -19.221 44.801 1.00 41.23  ? 96   THR F O     1 
ATOM   4511  C  CB    . THR F  2 96  ? -9.675  -18.952 42.583 1.00 41.48  ? 96   THR F CB    1 
ATOM   4512  O  OG1   . THR F  2 96  ? -10.914 -19.280 41.942 1.00 41.30  ? 96   THR F OG1   1 
ATOM   4513  C  CG2   . THR F  2 96  ? -8.794  -18.269 41.570 1.00 41.08  ? 96   THR F CG2   1 
ATOM   4514  N  N     . LEU F  2 97  ? -6.582  -20.111 43.090 1.00 40.36  ? 97   LEU F N     1 
ATOM   4515  C  CA    . LEU F  2 97  ? -5.284  -19.745 43.617 1.00 39.29  ? 97   LEU F CA    1 
ATOM   4516  C  C     . LEU F  2 97  ? -4.527  -18.776 42.706 1.00 39.45  ? 97   LEU F C     1 
ATOM   4517  O  O     . LEU F  2 97  ? -4.450  -18.994 41.489 1.00 39.52  ? 97   LEU F O     1 
ATOM   4518  C  CB    . LEU F  2 97  ? -4.447  -20.997 43.842 1.00 38.78  ? 97   LEU F CB    1 
ATOM   4519  C  CG    . LEU F  2 97  ? -3.088  -20.924 44.502 1.00 36.97  ? 97   LEU F CG    1 
ATOM   4520  C  CD1   . LEU F  2 97  ? -3.187  -20.783 45.993 1.00 37.73  ? 97   LEU F CD1   1 
ATOM   4521  C  CD2   . LEU F  2 97  ? -2.357  -22.194 44.165 1.00 38.41  ? 97   LEU F CD2   1 
ATOM   4522  N  N     . TYR F  2 98  ? -3.955  -17.724 43.308 1.00 38.49  ? 98   TYR F N     1 
ATOM   4523  C  CA    . TYR F  2 98  ? -3.058  -16.846 42.599 1.00 37.96  ? 98   TYR F CA    1 
ATOM   4524  C  C     . TYR F  2 98  ? -1.614  -17.087 43.015 1.00 38.14  ? 98   TYR F C     1 
ATOM   4525  O  O     . TYR F  2 98  ? -1.317  -17.285 44.216 1.00 37.70  ? 98   TYR F O     1 
ATOM   4526  C  CB    . TYR F  2 98  ? -3.377  -15.387 42.897 1.00 38.24  ? 98   TYR F CB    1 
ATOM   4527  C  CG    . TYR F  2 98  ? -4.716  -14.835 42.461 1.00 37.92  ? 98   TYR F CG    1 
ATOM   4528  C  CD1   . TYR F  2 98  ? -5.606  -15.558 41.643 1.00 36.89  ? 98   TYR F CD1   1 
ATOM   4529  C  CD2   . TYR F  2 98  ? -5.060  -13.531 42.831 1.00 36.20  ? 98   TYR F CD2   1 
ATOM   4530  C  CE1   . TYR F  2 98  ? -6.829  -14.983 41.259 1.00 37.97  ? 98   TYR F CE1   1 
ATOM   4531  C  CE2   . TYR F  2 98  ? -6.244  -12.962 42.457 1.00 34.15  ? 98   TYR F CE2   1 
ATOM   4532  C  CZ    . TYR F  2 98  ? -7.120  -13.661 41.678 1.00 36.76  ? 98   TYR F CZ    1 
ATOM   4533  O  OH    . TYR F  2 98  ? -8.289  -13.015 41.368 1.00 38.00  ? 98   TYR F OH    1 
ATOM   4534  N  N     . GLY F  2 99  ? -0.716  -17.001 42.038 1.00 37.82  ? 99   GLY F N     1 
ATOM   4535  C  CA    . GLY F  2 99  ? 0.707   -17.146 42.284 1.00 38.87  ? 99   GLY F CA    1 
ATOM   4536  C  C     . GLY F  2 99  ? 1.437   -18.203 41.468 1.00 40.22  ? 99   GLY F C     1 
ATOM   4537  O  O     . GLY F  2 99  ? 2.665   -18.286 41.527 1.00 41.54  ? 99   GLY F O     1 
ATOM   4538  N  N     . PHE F  2 100 ? 0.705   -19.007 40.696 1.00 40.70  ? 100  PHE F N     1 
ATOM   4539  C  CA    . PHE F  2 100 ? 1.298   -20.176 40.031 1.00 41.19  ? 100  PHE F CA    1 
ATOM   4540  C  C     . PHE F  2 100 ? 1.005   -20.247 38.520 1.00 42.51  ? 100  PHE F C     1 
ATOM   4541  O  O     . PHE F  2 100 ? 1.261   -21.273 37.875 1.00 43.38  ? 100  PHE F O     1 
ATOM   4542  C  CB    . PHE F  2 100 ? 0.889   -21.477 40.772 1.00 39.55  ? 100  PHE F CB    1 
ATOM   4543  C  CG    . PHE F  2 100 ? 1.537   -21.616 42.126 1.00 37.67  ? 100  PHE F CG    1 
ATOM   4544  C  CD1   . PHE F  2 100 ? 0.896   -21.167 43.271 1.00 34.68  ? 100  PHE F CD1   1 
ATOM   4545  C  CD2   . PHE F  2 100 ? 2.816   -22.145 42.247 1.00 34.81  ? 100  PHE F CD2   1 
ATOM   4546  C  CE1   . PHE F  2 100 ? 1.527   -21.262 44.535 1.00 34.03  ? 100  PHE F CE1   1 
ATOM   4547  C  CE2   . PHE F  2 100 ? 3.435   -22.230 43.495 1.00 35.11  ? 100  PHE F CE2   1 
ATOM   4548  C  CZ    . PHE F  2 100 ? 2.781   -21.800 44.637 1.00 33.40  ? 100  PHE F CZ    1 
ATOM   4549  N  N     . GLY F  2 101 ? 0.432   -19.182 37.978 1.00 43.08  ? 101  GLY F N     1 
ATOM   4550  C  CA    . GLY F  2 101 ? 0.324   -19.023 36.551 1.00 44.70  ? 101  GLY F CA    1 
ATOM   4551  C  C     . GLY F  2 101 ? -1.099  -18.933 36.052 1.00 46.49  ? 101  GLY F C     1 
ATOM   4552  O  O     . GLY F  2 101 ? -2.048  -18.898 36.833 1.00 45.86  ? 101  GLY F O     1 
ATOM   4553  N  N     . GLY F  2 102 ? -1.212  -18.859 34.724 1.00 48.84  ? 102  GLY F N     1 
ATOM   4554  C  CA    . GLY F  2 102 ? -2.487  -18.831 34.005 1.00 51.56  ? 102  GLY F CA    1 
ATOM   4555  C  C     . GLY F  2 102 ? -3.578  -17.947 34.593 1.00 53.44  ? 102  GLY F C     1 
ATOM   4556  O  O     . GLY F  2 102 ? -3.463  -16.699 34.704 1.00 53.69  ? 102  GLY F O     1 
ATOM   4557  O  OXT   . GLY F  2 102 ? -4.627  -18.510 34.951 1.00 55.03  ? 102  GLY F OXT   1 
ATOM   4558  N  N     . LYS G  3 13  ? -34.540 -37.358 4.306  1.00 97.23  ? 13   LYS G N     1 
ATOM   4559  C  CA    . LYS G  3 13  ? -33.998 -37.927 5.582  1.00 97.22  ? 13   LYS G CA    1 
ATOM   4560  C  C     . LYS G  3 13  ? -34.139 -39.452 5.632  1.00 96.69  ? 13   LYS G C     1 
ATOM   4561  O  O     . LYS G  3 13  ? -35.220 -39.991 5.355  1.00 96.86  ? 13   LYS G O     1 
ATOM   4562  C  CB    . LYS G  3 13  ? -34.713 -37.321 6.799  1.00 97.57  ? 13   LYS G CB    1 
ATOM   4563  C  CG    . LYS G  3 13  ? -34.537 -35.819 6.998  1.00 98.38  ? 13   LYS G CG    1 
ATOM   4564  C  CD    . LYS G  3 13  ? -34.954 -35.441 8.417  1.00 99.83  ? 13   LYS G CD    1 
ATOM   4565  C  CE    . LYS G  3 13  ? -34.748 -33.967 8.704  1.00 100.33 ? 13   LYS G CE    1 
ATOM   4566  N  NZ    . LYS G  3 13  ? -35.616 -33.090 7.868  1.00 100.67 ? 13   LYS G NZ    1 
ATOM   4567  N  N     . ALA G  3 14  ? -33.053 -40.140 5.985  1.00 95.77  ? 14   ALA G N     1 
ATOM   4568  C  CA    . ALA G  3 14  ? -33.098 -41.586 6.188  1.00 94.76  ? 14   ALA G CA    1 
ATOM   4569  C  C     . ALA G  3 14  ? -33.446 -41.872 7.653  1.00 93.91  ? 14   ALA G C     1 
ATOM   4570  O  O     . ALA G  3 14  ? -34.624 -41.867 8.027  1.00 93.82  ? 14   ALA G O     1 
ATOM   4571  C  CB    . ALA G  3 14  ? -31.772 -42.247 5.771  1.00 94.74  ? 14   ALA G CB    1 
ATOM   4572  N  N     . LYS G  3 15  ? -32.426 -42.105 8.477  1.00 92.79  ? 15   LYS G N     1 
ATOM   4573  C  CA    . LYS G  3 15  ? -32.621 -42.251 9.918  1.00 91.50  ? 15   LYS G CA    1 
ATOM   4574  C  C     . LYS G  3 15  ? -32.124 -41.024 10.674 1.00 90.18  ? 15   LYS G C     1 
ATOM   4575  O  O     . LYS G  3 15  ? -31.086 -40.449 10.320 1.00 90.09  ? 15   LYS G O     1 
ATOM   4576  C  CB    . LYS G  3 15  ? -31.927 -43.515 10.448 1.00 91.63  ? 15   LYS G CB    1 
ATOM   4577  C  CG    . LYS G  3 15  ? -32.700 -44.815 10.221 1.00 92.59  ? 15   LYS G CG    1 
ATOM   4578  C  CD    . LYS G  3 15  ? -34.223 -44.672 10.473 1.00 94.33  ? 15   LYS G CD    1 
ATOM   4579  C  CE    . LYS G  3 15  ? -34.613 -44.798 11.952 1.00 94.69  ? 15   LYS G CE    1 
ATOM   4580  N  NZ    . LYS G  3 15  ? -34.555 -46.206 12.454 1.00 94.35  ? 15   LYS G NZ    1 
ATOM   4581  N  N     . THR G  3 16  ? -32.871 -40.627 11.707 1.00 88.30  ? 16   THR G N     1 
ATOM   4582  C  CA    . THR G  3 16  ? -32.389 -39.628 12.658 1.00 86.40  ? 16   THR G CA    1 
ATOM   4583  C  C     . THR G  3 16  ? -31.090 -40.112 13.289 1.00 85.26  ? 16   THR G C     1 
ATOM   4584  O  O     . THR G  3 16  ? -30.864 -41.319 13.436 1.00 85.21  ? 16   THR G O     1 
ATOM   4585  C  CB    . THR G  3 16  ? -33.400 -39.326 13.801 1.00 86.30  ? 16   THR G CB    1 
ATOM   4586  O  OG1   . THR G  3 16  ? -33.672 -40.518 14.547 1.00 86.01  ? 16   THR G OG1   1 
ATOM   4587  C  CG2   . THR G  3 16  ? -34.698 -38.724 13.265 1.00 86.30  ? 16   THR G CG2   1 
ATOM   4588  N  N     . ARG G  3 17  ? -30.239 -39.166 13.666 1.00 83.63  ? 17   ARG G N     1 
ATOM   4589  C  CA    . ARG G  3 17  ? -29.002 -39.491 14.367 1.00 82.19  ? 17   ARG G CA    1 
ATOM   4590  C  C     . ARG G  3 17  ? -29.243 -40.075 15.766 1.00 81.05  ? 17   ARG G C     1 
ATOM   4591  O  O     . ARG G  3 17  ? -28.379 -40.764 16.309 1.00 80.82  ? 17   ARG G O     1 
ATOM   4592  C  CB    . ARG G  3 17  ? -28.097 -38.266 14.423 1.00 82.21  ? 17   ARG G CB    1 
ATOM   4593  C  CG    . ARG G  3 17  ? -27.679 -37.786 13.051 1.00 81.96  ? 17   ARG G CG    1 
ATOM   4594  C  CD    . ARG G  3 17  ? -26.495 -36.870 13.145 1.00 82.14  ? 17   ARG G CD    1 
ATOM   4595  N  NE    . ARG G  3 17  ? -26.898 -35.505 13.461 1.00 82.93  ? 17   ARG G NE    1 
ATOM   4596  C  CZ    . ARG G  3 17  ? -26.095 -34.582 13.984 1.00 82.91  ? 17   ARG G CZ    1 
ATOM   4597  N  NH1   . ARG G  3 17  ? -24.826 -34.874 14.276 1.00 81.48  ? 17   ARG G NH1   1 
ATOM   4598  N  NH2   . ARG G  3 17  ? -26.571 -33.365 14.225 1.00 83.06  ? 17   ARG G NH2   1 
ATOM   4599  N  N     . SER G  3 18  ? -30.422 -39.807 16.327 1.00 79.71  ? 18   SER G N     1 
ATOM   4600  C  CA    . SER G  3 18  ? -30.821 -40.352 17.618 1.00 78.64  ? 18   SER G CA    1 
ATOM   4601  C  C     . SER G  3 18  ? -30.990 -41.860 17.550 1.00 78.53  ? 18   SER G C     1 
ATOM   4602  O  O     . SER G  3 18  ? -30.431 -42.586 18.372 1.00 78.82  ? 18   SER G O     1 
ATOM   4603  C  CB    . SER G  3 18  ? -32.118 -39.711 18.104 1.00 78.24  ? 18   SER G CB    1 
ATOM   4604  O  OG    . SER G  3 18  ? -31.911 -38.369 18.480 1.00 76.94  ? 18   SER G OG    1 
ATOM   4605  N  N     . SER G  3 19  ? -31.763 -42.330 16.573 1.00 78.13  ? 19   SER G N     1 
ATOM   4606  C  CA    . SER G  3 19  ? -32.019 -43.767 16.408 1.00 77.60  ? 19   SER G CA    1 
ATOM   4607  C  C     . SER G  3 19  ? -30.765 -44.525 15.983 1.00 76.89  ? 19   SER G C     1 
ATOM   4608  O  O     . SER G  3 19  ? -30.599 -45.690 16.332 1.00 77.13  ? 19   SER G O     1 
ATOM   4609  C  CB    . SER G  3 19  ? -33.149 -44.002 15.416 1.00 77.63  ? 19   SER G CB    1 
ATOM   4610  O  OG    . SER G  3 19  ? -33.069 -43.061 14.362 1.00 78.67  ? 19   SER G OG    1 
ATOM   4611  N  N     . ARG G  3 20  ? -29.885 -43.856 15.239 1.00 76.08  ? 20   ARG G N     1 
ATOM   4612  C  CA    . ARG G  3 20  ? -28.566 -44.403 14.920 1.00 75.17  ? 20   ARG G CA    1 
ATOM   4613  C  C     . ARG G  3 20  ? -27.765 -44.646 16.196 1.00 74.31  ? 20   ARG G C     1 
ATOM   4614  O  O     . ARG G  3 20  ? -26.884 -45.508 16.225 1.00 74.25  ? 20   ARG G O     1 
ATOM   4615  C  CB    . ARG G  3 20  ? -27.774 -43.463 14.000 1.00 75.40  ? 20   ARG G CB    1 
ATOM   4616  C  CG    . ARG G  3 20  ? -28.275 -43.362 12.575 1.00 76.28  ? 20   ARG G CG    1 
ATOM   4617  C  CD    . ARG G  3 20  ? -27.157 -42.940 11.622 1.00 78.45  ? 20   ARG G CD    1 
ATOM   4618  N  NE    . ARG G  3 20  ? -27.666 -42.744 10.261 1.00 82.30  ? 20   ARG G NE    1 
ATOM   4619  C  CZ    . ARG G  3 20  ? -27.017 -43.075 9.138  1.00 84.19  ? 20   ARG G CZ    1 
ATOM   4620  N  NH1   . ARG G  3 20  ? -25.809 -43.636 9.185  1.00 84.94  ? 20   ARG G NH1   1 
ATOM   4621  N  NH2   . ARG G  3 20  ? -27.583 -42.851 7.952  1.00 83.88  ? 20   ARG G NH2   1 
ATOM   4622  N  N     . ALA G  3 21  ? -28.075 -43.875 17.241 1.00 73.19  ? 21   ALA G N     1 
ATOM   4623  C  CA    . ALA G  3 21  ? -27.358 -43.941 18.511 1.00 71.84  ? 21   ALA G CA    1 
ATOM   4624  C  C     . ALA G  3 21  ? -28.132 -44.739 19.551 1.00 71.00  ? 21   ALA G C     1 
ATOM   4625  O  O     . ALA G  3 21  ? -27.579 -45.148 20.577 1.00 71.30  ? 21   ALA G O     1 
ATOM   4626  C  CB    . ALA G  3 21  ? -27.047 -42.533 19.016 1.00 72.00  ? 21   ALA G CB    1 
ATOM   4627  N  N     . GLY G  3 22  ? -29.410 -44.971 19.275 1.00 69.80  ? 22   GLY G N     1 
ATOM   4628  C  CA    . GLY G  3 22  ? -30.252 -45.802 20.125 1.00 68.37  ? 22   GLY G CA    1 
ATOM   4629  C  C     . GLY G  3 22  ? -30.875 -44.951 21.197 1.00 67.67  ? 22   GLY G C     1 
ATOM   4630  O  O     . GLY G  3 22  ? -31.142 -45.421 22.305 1.00 67.57  ? 22   GLY G O     1 
ATOM   4631  N  N     . LEU G  3 23  ? -31.121 -43.688 20.854 1.00 66.92  ? 23   LEU G N     1 
ATOM   4632  C  CA    . LEU G  3 23  ? -31.454 -42.685 21.850 1.00 65.76  ? 23   LEU G CA    1 
ATOM   4633  C  C     . LEU G  3 23  ? -32.812 -42.065 21.632 1.00 65.44  ? 23   LEU G C     1 
ATOM   4634  O  O     . LEU G  3 23  ? -33.229 -41.857 20.493 1.00 65.49  ? 23   LEU G O     1 
ATOM   4635  C  CB    . LEU G  3 23  ? -30.394 -41.581 21.881 1.00 65.37  ? 23   LEU G CB    1 
ATOM   4636  C  CG    . LEU G  3 23  ? -28.937 -41.863 22.248 1.00 64.22  ? 23   LEU G CG    1 
ATOM   4637  C  CD1   . LEU G  3 23  ? -28.167 -40.555 22.201 1.00 62.89  ? 23   LEU G CD1   1 
ATOM   4638  C  CD2   . LEU G  3 23  ? -28.791 -42.535 23.603 1.00 63.33  ? 23   LEU G CD2   1 
ATOM   4639  N  N     . GLN G  3 24  ? -33.478 -41.771 22.749 1.00 65.00  ? 24   GLN G N     1 
ATOM   4640  C  CA    . GLN G  3 24  ? -34.699 -40.968 22.785 1.00 64.90  ? 24   GLN G CA    1 
ATOM   4641  C  C     . GLN G  3 24  ? -34.407 -39.468 22.710 1.00 64.22  ? 24   GLN G C     1 
ATOM   4642  O  O     . GLN G  3 24  ? -35.285 -38.688 22.351 1.00 64.34  ? 24   GLN G O     1 
ATOM   4643  C  CB    . GLN G  3 24  ? -35.479 -41.232 24.080 1.00 65.30  ? 24   GLN G CB    1 
ATOM   4644  C  CG    . GLN G  3 24  ? -35.891 -42.675 24.321 1.00 66.72  ? 24   GLN G CG    1 
ATOM   4645  C  CD    . GLN G  3 24  ? -36.642 -43.263 23.149 1.00 69.20  ? 24   GLN G CD    1 
ATOM   4646  O  OE1   . GLN G  3 24  ? -37.719 -42.792 22.778 1.00 69.47  ? 24   GLN G OE1   1 
ATOM   4647  N  NE2   . GLN G  3 24  ? -36.069 -44.300 22.550 1.00 71.51  ? 24   GLN G NE2   1 
ATOM   4648  N  N     . PHE G  3 25  ? -33.185 -39.070 23.071 1.00 63.40  ? 25   PHE G N     1 
ATOM   4649  C  CA    . PHE G  3 25  ? -32.809 -37.653 23.155 1.00 62.34  ? 25   PHE G CA    1 
ATOM   4650  C  C     . PHE G  3 25  ? -32.245 -37.113 21.848 1.00 61.83  ? 25   PHE G C     1 
ATOM   4651  O  O     . PHE G  3 25  ? -31.499 -37.822 21.166 1.00 62.16  ? 25   PHE G O     1 
ATOM   4652  C  CB    . PHE G  3 25  ? -31.830 -37.409 24.307 1.00 61.85  ? 25   PHE G CB    1 
ATOM   4653  C  CG    . PHE G  3 25  ? -32.498 -36.956 25.580 1.00 61.21  ? 25   PHE G CG    1 
ATOM   4654  C  CD1   . PHE G  3 25  ? -33.565 -37.669 26.116 1.00 59.76  ? 25   PHE G CD1   1 
ATOM   4655  C  CD2   . PHE G  3 25  ? -32.059 -35.806 26.244 1.00 60.46  ? 25   PHE G CD2   1 
ATOM   4656  C  CE1   . PHE G  3 25  ? -34.180 -37.252 27.295 1.00 60.01  ? 25   PHE G CE1   1 
ATOM   4657  C  CE2   . PHE G  3 25  ? -32.667 -35.382 27.426 1.00 58.77  ? 25   PHE G CE2   1 
ATOM   4658  C  CZ    . PHE G  3 25  ? -33.727 -36.102 27.954 1.00 59.32  ? 25   PHE G CZ    1 
ATOM   4659  N  N     . PRO G  3 26  ? -32.575 -35.840 21.515 1.00 61.20  ? 26   PRO G N     1 
ATOM   4660  C  CA    . PRO G  3 26  ? -32.336 -35.308 20.168 1.00 60.41  ? 26   PRO G CA    1 
ATOM   4661  C  C     . PRO G  3 26  ? -30.881 -34.954 19.911 1.00 59.80  ? 26   PRO G C     1 
ATOM   4662  O  O     . PRO G  3 26  ? -30.382 -33.955 20.421 1.00 60.35  ? 26   PRO G O     1 
ATOM   4663  C  CB    . PRO G  3 26  ? -33.216 -34.058 20.130 1.00 60.35  ? 26   PRO G CB    1 
ATOM   4664  C  CG    . PRO G  3 26  ? -33.267 -33.606 21.546 1.00 60.42  ? 26   PRO G CG    1 
ATOM   4665  C  CD    . PRO G  3 26  ? -33.171 -34.820 22.408 1.00 60.63  ? 26   PRO G CD    1 
ATOM   4666  N  N     . VAL G  3 27  ? -30.212 -35.770 19.110 1.00 59.27  ? 27   VAL G N     1 
ATOM   4667  C  CA    . VAL G  3 27  ? -28.812 -35.546 18.761 1.00 58.29  ? 27   VAL G CA    1 
ATOM   4668  C  C     . VAL G  3 27  ? -28.656 -34.294 17.895 1.00 58.36  ? 27   VAL G C     1 
ATOM   4669  O  O     . VAL G  3 27  ? -27.712 -33.529 18.084 1.00 59.04  ? 27   VAL G O     1 
ATOM   4670  C  CB    . VAL G  3 27  ? -28.195 -36.811 18.113 1.00 58.05  ? 27   VAL G CB    1 
ATOM   4671  C  CG1   . VAL G  3 27  ? -26.765 -36.571 17.635 1.00 57.87  ? 27   VAL G CG1   1 
ATOM   4672  C  CG2   . VAL G  3 27  ? -28.226 -37.965 19.100 1.00 56.48  ? 27   VAL G CG2   1 
ATOM   4673  N  N     . GLY G  3 28  ? -29.591 -34.073 16.971 1.00 58.06  ? 28   GLY G N     1 
ATOM   4674  C  CA    . GLY G  3 28  ? -29.589 -32.875 16.129 1.00 57.08  ? 28   GLY G CA    1 
ATOM   4675  C  C     . GLY G  3 28  ? -29.715 -31.587 16.933 1.00 56.75  ? 28   GLY G C     1 
ATOM   4676  O  O     . GLY G  3 28  ? -28.974 -30.626 16.694 1.00 56.75  ? 28   GLY G O     1 
ATOM   4677  N  N     . ARG G  3 29  ? -30.654 -31.562 17.880 1.00 56.05  ? 29   ARG G N     1 
ATOM   4678  C  CA    . ARG G  3 29  ? -30.822 -30.417 18.772 1.00 55.67  ? 29   ARG G CA    1 
ATOM   4679  C  C     . ARG G  3 29  ? -29.577 -30.158 19.619 1.00 55.72  ? 29   ARG G C     1 
ATOM   4680  O  O     . ARG G  3 29  ? -29.072 -29.043 19.634 1.00 55.76  ? 29   ARG G O     1 
ATOM   4681  C  CB    . ARG G  3 29  ? -32.036 -30.594 19.672 1.00 55.36  ? 29   ARG G CB    1 
ATOM   4682  C  CG    . ARG G  3 29  ? -32.223 -29.468 20.685 1.00 54.65  ? 29   ARG G CG    1 
ATOM   4683  C  CD    . ARG G  3 29  ? -33.499 -29.659 21.494 1.00 53.24  ? 29   ARG G CD    1 
ATOM   4684  N  NE    . ARG G  3 29  ? -34.684 -29.534 20.656 1.00 54.54  ? 29   ARG G NE    1 
ATOM   4685  C  CZ    . ARG G  3 29  ? -35.932 -29.418 21.107 1.00 55.30  ? 29   ARG G CZ    1 
ATOM   4686  N  NH1   . ARG G  3 29  ? -36.189 -29.419 22.411 1.00 54.52  ? 29   ARG G NH1   1 
ATOM   4687  N  NH2   . ARG G  3 29  ? -36.931 -29.301 20.240 1.00 56.83  ? 29   ARG G NH2   1 
ATOM   4688  N  N     . VAL G  3 30  ? -29.084 -31.192 20.304 1.00 55.93  ? 30   VAL G N     1 
ATOM   4689  C  CA    . VAL G  3 30  ? -27.889 -31.077 21.148 1.00 56.04  ? 30   VAL G CA    1 
ATOM   4690  C  C     . VAL G  3 30  ? -26.707 -30.571 20.331 1.00 57.17  ? 30   VAL G C     1 
ATOM   4691  O  O     . VAL G  3 30  ? -25.950 -29.730 20.811 1.00 57.74  ? 30   VAL G O     1 
ATOM   4692  C  CB    . VAL G  3 30  ? -27.550 -32.409 21.885 1.00 55.60  ? 30   VAL G CB    1 
ATOM   4693  C  CG1   . VAL G  3 30  ? -26.140 -32.394 22.461 1.00 55.00  ? 30   VAL G CG1   1 
ATOM   4694  C  CG2   . VAL G  3 30  ? -28.555 -32.697 22.979 1.00 54.56  ? 30   VAL G CG2   1 
ATOM   4695  N  N     . HIS G  3 31  ? -26.556 -31.055 19.094 1.00 58.13  ? 31   HIS G N     1 
ATOM   4696  C  CA    . HIS G  3 31  ? -25.469 -30.596 18.221 1.00 58.95  ? 31   HIS G CA    1 
ATOM   4697  C  C     . HIS G  3 31  ? -25.610 -29.107 17.930 1.00 59.57  ? 31   HIS G C     1 
ATOM   4698  O  O     . HIS G  3 31  ? -24.639 -28.353 18.006 1.00 59.58  ? 31   HIS G O     1 
ATOM   4699  C  CB    . HIS G  3 31  ? -25.469 -31.360 16.897 1.00 59.17  ? 31   HIS G CB    1 
ATOM   4700  C  CG    . HIS G  3 31  ? -24.145 -31.372 16.200 1.00 58.80  ? 31   HIS G CG    1 
ATOM   4701  N  ND1   . HIS G  3 31  ? -23.100 -30.554 16.565 1.00 61.02  ? 31   HIS G ND1   1 
ATOM   4702  C  CD2   . HIS G  3 31  ? -23.701 -32.099 15.149 1.00 59.08  ? 31   HIS G CD2   1 
ATOM   4703  C  CE1   . HIS G  3 31  ? -22.062 -30.787 15.777 1.00 60.71  ? 31   HIS G CE1   1 
ATOM   4704  N  NE2   . HIS G  3 31  ? -22.401 -31.722 14.910 1.00 59.26  ? 31   HIS G NE2   1 
ATOM   4705  N  N     . ARG G  3 32  ? -26.832 -28.708 17.582 1.00 60.12  ? 32   ARG G N     1 
ATOM   4706  C  CA    . ARG G  3 32  ? -27.154 -27.337 17.219 1.00 60.90  ? 32   ARG G CA    1 
ATOM   4707  C  C     . ARG G  3 32  ? -26.866 -26.422 18.389 1.00 61.12  ? 32   ARG G C     1 
ATOM   4708  O  O     . ARG G  3 32  ? -26.248 -25.367 18.219 1.00 61.85  ? 32   ARG G O     1 
ATOM   4709  C  CB    . ARG G  3 32  ? -28.626 -27.243 16.804 1.00 60.77  ? 32   ARG G CB    1 
ATOM   4710  C  CG    . ARG G  3 32  ? -29.119 -25.866 16.412 1.00 61.28  ? 32   ARG G CG    1 
ATOM   4711  C  CD    . ARG G  3 32  ? -30.507 -25.924 15.749 1.00 62.21  ? 32   ARG G CD    1 
ATOM   4712  N  NE    . ARG G  3 32  ? -31.492 -26.755 16.464 1.00 65.28  ? 32   ARG G NE    1 
ATOM   4713  C  CZ    . ARG G  3 32  ? -32.119 -26.394 17.590 1.00 65.44  ? 32   ARG G CZ    1 
ATOM   4714  N  NH1   . ARG G  3 32  ? -31.853 -25.223 18.159 1.00 65.06  ? 32   ARG G NH1   1 
ATOM   4715  N  NH2   . ARG G  3 32  ? -33.004 -27.209 18.159 1.00 64.88  ? 32   ARG G NH2   1 
ATOM   4716  N  N     . LEU G  3 33  ? -27.297 -26.844 19.577 1.00 61.16  ? 33   LEU G N     1 
ATOM   4717  C  CA    . LEU G  3 33  ? -27.135 -26.068 20.802 1.00 60.63  ? 33   LEU G CA    1 
ATOM   4718  C  C     . LEU G  3 33  ? -25.682 -25.945 21.260 1.00 60.75  ? 33   LEU G C     1 
ATOM   4719  O  O     . LEU G  3 33  ? -25.331 -24.985 21.946 1.00 61.49  ? 33   LEU G O     1 
ATOM   4720  C  CB    . LEU G  3 33  ? -28.003 -26.649 21.918 1.00 60.19  ? 33   LEU G CB    1 
ATOM   4721  C  CG    . LEU G  3 33  ? -29.525 -26.501 21.850 1.00 59.41  ? 33   LEU G CG    1 
ATOM   4722  C  CD1   . LEU G  3 33  ? -30.149 -27.113 23.088 1.00 59.03  ? 33   LEU G CD1   1 
ATOM   4723  C  CD2   . LEU G  3 33  ? -29.971 -25.056 21.725 1.00 58.69  ? 33   LEU G CD2   1 
ATOM   4724  N  N     . LEU G  3 34  ? -24.840 -26.899 20.888 1.00 60.69  ? 34   LEU G N     1 
ATOM   4725  C  CA    . LEU G  3 34  ? -23.407 -26.805 21.194 1.00 60.94  ? 34   LEU G CA    1 
ATOM   4726  C  C     . LEU G  3 34  ? -22.698 -25.803 20.285 1.00 61.55  ? 34   LEU G C     1 
ATOM   4727  O  O     . LEU G  3 34  ? -21.674 -25.224 20.656 1.00 61.39  ? 34   LEU G O     1 
ATOM   4728  C  CB    . LEU G  3 34  ? -22.713 -28.175 21.110 1.00 60.41  ? 34   LEU G CB    1 
ATOM   4729  C  CG    . LEU G  3 34  ? -22.902 -29.220 22.218 1.00 58.99  ? 34   LEU G CG    1 
ATOM   4730  C  CD1   . LEU G  3 34  ? -22.428 -30.581 21.728 1.00 56.45  ? 34   LEU G CD1   1 
ATOM   4731  C  CD2   . LEU G  3 34  ? -22.206 -28.842 23.539 1.00 57.52  ? 34   LEU G CD2   1 
ATOM   4732  N  N     . ARG G  3 35  ? -23.251 -25.609 19.093 1.00 62.65  ? 35   ARG G N     1 
ATOM   4733  C  CA    . ARG G  3 35  ? -22.744 -24.622 18.148 1.00 63.39  ? 35   ARG G CA    1 
ATOM   4734  C  C     . ARG G  3 35  ? -23.204 -23.248 18.582 1.00 63.45  ? 35   ARG G C     1 
ATOM   4735  O  O     . ARG G  3 35  ? -22.387 -22.366 18.841 1.00 63.84  ? 35   ARG G O     1 
ATOM   4736  C  CB    . ARG G  3 35  ? -23.271 -24.904 16.747 1.00 63.66  ? 35   ARG G CB    1 
ATOM   4737  C  CG    . ARG G  3 35  ? -22.987 -26.287 16.240 1.00 65.53  ? 35   ARG G CG    1 
ATOM   4738  C  CD    . ARG G  3 35  ? -23.223 -26.328 14.746 1.00 69.53  ? 35   ARG G CD    1 
ATOM   4739  N  NE    . ARG G  3 35  ? -22.642 -27.518 14.132 1.00 72.48  ? 35   ARG G NE    1 
ATOM   4740  C  CZ    . ARG G  3 35  ? -21.333 -27.736 13.992 1.00 75.27  ? 35   ARG G CZ    1 
ATOM   4741  N  NH1   . ARG G  3 35  ? -20.436 -26.850 14.438 1.00 75.72  ? 35   ARG G NH1   1 
ATOM   4742  N  NH2   . ARG G  3 35  ? -20.914 -28.858 13.411 1.00 76.13  ? 35   ARG G NH2   1 
ATOM   4743  N  N     . LYS G  3 36  ? -24.518 -23.077 18.687 1.00 63.72  ? 36   LYS G N     1 
ATOM   4744  C  CA    . LYS G  3 36  ? -25.101 -21.782 19.020 1.00 64.26  ? 36   LYS G CA    1 
ATOM   4745  C  C     . LYS G  3 36  ? -24.559 -21.244 20.348 1.00 63.93  ? 36   LYS G C     1 
ATOM   4746  O  O     . LYS G  3 36  ? -24.671 -20.046 20.615 1.00 64.63  ? 36   LYS G O     1 
ATOM   4747  C  CB    . LYS G  3 36  ? -26.651 -21.840 19.014 1.00 64.55  ? 36   LYS G CB    1 
ATOM   4748  C  CG    . LYS G  3 36  ? -27.344 -21.628 20.390 1.00 65.46  ? 36   LYS G CG    1 
ATOM   4749  C  CD    . LYS G  3 36  ? -28.876 -21.528 20.293 1.00 64.92  ? 36   LYS G CD    1 
ATOM   4750  C  CE    . LYS G  3 36  ? -29.509 -21.319 21.687 1.00 65.79  ? 36   LYS G CE    1 
ATOM   4751  N  NZ    . LYS G  3 36  ? -31.027 -21.414 21.687 1.00 65.59  ? 36   LYS G NZ    1 
ATOM   4752  N  N     . GLY G  3 37  ? -23.947 -22.126 21.144 1.00 63.43  ? 37   GLY G N     1 
ATOM   4753  C  CA    . GLY G  3 37  ? -23.588 -21.854 22.538 1.00 62.70  ? 37   GLY G CA    1 
ATOM   4754  C  C     . GLY G  3 37  ? -22.212 -21.270 22.803 1.00 62.50  ? 37   GLY G C     1 
ATOM   4755  O  O     . GLY G  3 37  ? -21.893 -20.933 23.940 1.00 62.58  ? 37   GLY G O     1 
ATOM   4756  N  N     . ASN G  3 38  ? -21.399 -21.134 21.761 1.00 62.34  ? 38   ASN G N     1 
ATOM   4757  C  CA    . ASN G  3 38  ? -20.068 -20.512 21.880 1.00 62.22  ? 38   ASN G CA    1 
ATOM   4758  C  C     . ASN G  3 38  ? -19.126 -21.282 22.797 1.00 61.56  ? 38   ASN G C     1 
ATOM   4759  O  O     . ASN G  3 38  ? -18.477 -20.706 23.664 1.00 62.03  ? 38   ASN G O     1 
ATOM   4760  C  CB    . ASN G  3 38  ? -20.162 -19.042 22.353 1.00 62.34  ? 38   ASN G CB    1 
ATOM   4761  C  CG    . ASN G  3 38  ? -20.784 -18.116 21.313 1.00 62.62  ? 38   ASN G CG    1 
ATOM   4762  O  OD1   . ASN G  3 38  ? -21.765 -17.432 21.604 1.00 63.25  ? 38   ASN G OD1   1 
ATOM   4763  N  ND2   . ASN G  3 38  ? -20.217 -18.087 20.103 1.00 61.32  ? 38   ASN G ND2   1 
ATOM   4764  N  N     . TYR G  3 39  ? -19.046 -22.589 22.611 1.00 60.82  ? 39   TYR G N     1 
ATOM   4765  C  CA    . TYR G  3 39  ? -18.234 -23.387 23.508 1.00 59.44  ? 39   TYR G CA    1 
ATOM   4766  C  C     . TYR G  3 39  ? -16.892 -23.654 22.881 1.00 60.09  ? 39   TYR G C     1 
ATOM   4767  O  O     . TYR G  3 39  ? -15.889 -23.745 23.581 1.00 60.38  ? 39   TYR G O     1 
ATOM   4768  C  CB    . TYR G  3 39  ? -18.950 -24.675 23.883 1.00 58.10  ? 39   TYR G CB    1 
ATOM   4769  C  CG    . TYR G  3 39  ? -20.209 -24.471 24.690 1.00 54.84  ? 39   TYR G CG    1 
ATOM   4770  C  CD1   . TYR G  3 39  ? -21.452 -24.696 24.129 1.00 51.37  ? 39   TYR G CD1   1 
ATOM   4771  C  CD2   . TYR G  3 39  ? -20.146 -24.064 26.016 1.00 52.50  ? 39   TYR G CD2   1 
ATOM   4772  C  CE1   . TYR G  3 39  ? -22.601 -24.511 24.855 1.00 52.56  ? 39   TYR G CE1   1 
ATOM   4773  C  CE2   . TYR G  3 39  ? -21.297 -23.874 26.763 1.00 52.44  ? 39   TYR G CE2   1 
ATOM   4774  C  CZ    . TYR G  3 39  ? -22.526 -24.105 26.179 1.00 53.57  ? 39   TYR G CZ    1 
ATOM   4775  O  OH    . TYR G  3 39  ? -23.685 -23.933 26.914 1.00 54.02  ? 39   TYR G OH    1 
ATOM   4776  N  N     . ALA G  3 40  ? -16.876 -23.760 21.557 1.00 61.08  ? 40   ALA G N     1 
ATOM   4777  C  CA    . ALA G  3 40  ? -15.630 -23.809 20.791 1.00 62.37  ? 40   ALA G CA    1 
ATOM   4778  C  C     . ALA G  3 40  ? -15.876 -23.403 19.339 1.00 63.42  ? 40   ALA G C     1 
ATOM   4779  O  O     . ALA G  3 40  ? -17.028 -23.334 18.898 1.00 63.64  ? 40   ALA G O     1 
ATOM   4780  C  CB    . ALA G  3 40  ? -15.002 -25.201 20.867 1.00 62.24  ? 40   ALA G CB    1 
ATOM   4781  N  N     . GLU G  3 41  ? -14.791 -23.128 18.612 1.00 64.87  ? 41   GLU G N     1 
ATOM   4782  C  CA    . GLU G  3 41  ? -14.828 -22.859 17.165 1.00 65.57  ? 41   GLU G CA    1 
ATOM   4783  C  C     . GLU G  3 41  ? -15.502 -24.010 16.403 1.00 65.08  ? 41   GLU G C     1 
ATOM   4784  O  O     . GLU G  3 41  ? -16.232 -23.770 15.440 1.00 65.09  ? 41   GLU G O     1 
ATOM   4785  C  CB    . GLU G  3 41  ? -13.393 -22.619 16.637 1.00 65.84  ? 41   GLU G CB    1 
ATOM   4786  C  CG    . GLU G  3 41  ? -13.248 -22.357 15.110 1.00 66.61  ? 41   GLU G CG    1 
ATOM   4787  C  CD    . GLU G  3 41  ? -11.905 -22.868 14.512 1.00 68.16  ? 41   GLU G CD    1 
ATOM   4788  O  OE1   . GLU G  3 41  ? -10.858 -22.796 15.202 1.00 71.94  ? 41   GLU G OE1   1 
ATOM   4789  O  OE2   . GLU G  3 41  ? -11.896 -23.335 13.341 1.00 70.66  ? 41   GLU G OE2   1 
ATOM   4790  N  N     . ARG G  3 42  ? -15.265 -25.249 16.857 1.00 64.79  ? 42   ARG G N     1 
ATOM   4791  C  CA    . ARG G  3 42  ? -15.728 -26.474 16.179 1.00 63.94  ? 42   ARG G CA    1 
ATOM   4792  C  C     . ARG G  3 42  ? -16.363 -27.510 17.107 1.00 63.19  ? 42   ARG G C     1 
ATOM   4793  O  O     . ARG G  3 42  ? -16.090 -27.545 18.294 1.00 62.97  ? 42   ARG G O     1 
ATOM   4794  C  CB    . ARG G  3 42  ? -14.569 -27.118 15.424 1.00 64.06  ? 42   ARG G CB    1 
ATOM   4795  C  CG    . ARG G  3 42  ? -14.314 -26.495 14.073 1.00 65.63  ? 42   ARG G CG    1 
ATOM   4796  C  CD    . ARG G  3 42  ? -12.855 -26.471 13.754 1.00 68.72  ? 42   ARG G CD    1 
ATOM   4797  N  NE    . ARG G  3 42  ? -12.423 -27.671 13.045 1.00 73.43  ? 42   ARG G NE    1 
ATOM   4798  C  CZ    . ARG G  3 42  ? -12.141 -27.717 11.739 1.00 75.44  ? 42   ARG G CZ    1 
ATOM   4799  N  NH1   . ARG G  3 42  ? -12.244 -26.627 10.975 1.00 75.10  ? 42   ARG G NH1   1 
ATOM   4800  N  NH2   . ARG G  3 42  ? -11.740 -28.860 11.194 1.00 76.36  ? 42   ARG G NH2   1 
ATOM   4801  N  N     . VAL G  3 43  ? -17.216 -28.358 16.549 1.00 62.70  ? 43   VAL G N     1 
ATOM   4802  C  CA    . VAL G  3 43  ? -17.840 -29.432 17.309 1.00 62.14  ? 43   VAL G CA    1 
ATOM   4803  C  C     . VAL G  3 43  ? -17.838 -30.712 16.476 1.00 62.08  ? 43   VAL G C     1 
ATOM   4804  O  O     . VAL G  3 43  ? -18.505 -30.797 15.437 1.00 62.13  ? 43   VAL G O     1 
ATOM   4805  C  CB    . VAL G  3 43  ? -19.284 -29.077 17.766 1.00 62.04  ? 43   VAL G CB    1 
ATOM   4806  C  CG1   . VAL G  3 43  ? -19.881 -30.193 18.625 1.00 61.23  ? 43   VAL G CG1   1 
ATOM   4807  C  CG2   . VAL G  3 43  ? -19.312 -27.754 18.521 1.00 61.57  ? 43   VAL G CG2   1 
ATOM   4808  N  N     . GLY G  3 44  ? -17.074 -31.696 16.942 1.00 61.76  ? 44   GLY G N     1 
ATOM   4809  C  CA    . GLY G  3 44  ? -17.001 -33.010 16.317 1.00 61.36  ? 44   GLY G CA    1 
ATOM   4810  C  C     . GLY G  3 44  ? -18.321 -33.755 16.336 1.00 61.16  ? 44   GLY G C     1 
ATOM   4811  O  O     . GLY G  3 44  ? -19.156 -33.523 17.206 1.00 61.58  ? 44   GLY G O     1 
ATOM   4812  N  N     . ALA G  3 45  ? -18.491 -34.661 15.375 1.00 61.02  ? 45   ALA G N     1 
ATOM   4813  C  CA    . ALA G  3 45  ? -19.739 -35.401 15.145 1.00 60.51  ? 45   ALA G CA    1 
ATOM   4814  C  C     . ALA G  3 45  ? -20.200 -36.266 16.317 1.00 60.32  ? 45   ALA G C     1 
ATOM   4815  O  O     . ALA G  3 45  ? -21.396 -36.459 16.499 1.00 60.56  ? 45   ALA G O     1 
ATOM   4816  C  CB    . ALA G  3 45  ? -19.600 -36.255 13.906 1.00 60.41  ? 45   ALA G CB    1 
ATOM   4817  N  N     . GLY G  3 46  ? -19.250 -36.781 17.097 1.00 60.13  ? 46   GLY G N     1 
ATOM   4818  C  CA    . GLY G  3 46  ? -19.548 -37.701 18.192 1.00 59.59  ? 46   GLY G CA    1 
ATOM   4819  C  C     . GLY G  3 46  ? -20.034 -37.065 19.482 1.00 59.57  ? 46   GLY G C     1 
ATOM   4820  O  O     . GLY G  3 46  ? -20.795 -37.697 20.232 1.00 59.95  ? 46   GLY G O     1 
ATOM   4821  N  N     . ALA G  3 47  ? -19.607 -35.823 19.746 1.00 58.89  ? 47   ALA G N     1 
ATOM   4822  C  CA    . ALA G  3 47  ? -19.920 -35.119 21.006 1.00 58.03  ? 47   ALA G CA    1 
ATOM   4823  C  C     . ALA G  3 47  ? -21.416 -34.926 21.290 1.00 57.72  ? 47   ALA G C     1 
ATOM   4824  O  O     . ALA G  3 47  ? -21.860 -35.164 22.419 1.00 57.76  ? 47   ALA G O     1 
ATOM   4825  C  CB    . ALA G  3 47  ? -19.175 -33.778 21.090 1.00 58.29  ? 47   ALA G CB    1 
ATOM   4826  N  N     . PRO G  3 48  ? -22.194 -34.469 20.286 1.00 57.17  ? 48   PRO G N     1 
ATOM   4827  C  CA    . PRO G  3 48  ? -23.645 -34.392 20.472 1.00 56.78  ? 48   PRO G CA    1 
ATOM   4828  C  C     . PRO G  3 48  ? -24.284 -35.734 20.841 1.00 56.30  ? 48   PRO G C     1 
ATOM   4829  O  O     . PRO G  3 48  ? -25.241 -35.772 21.619 1.00 55.94  ? 48   PRO G O     1 
ATOM   4830  C  CB    . PRO G  3 48  ? -24.149 -33.918 19.102 1.00 57.26  ? 48   PRO G CB    1 
ATOM   4831  C  CG    . PRO G  3 48  ? -23.013 -34.161 18.150 1.00 56.93  ? 48   PRO G CG    1 
ATOM   4832  C  CD    . PRO G  3 48  ? -21.793 -33.965 18.959 1.00 57.14  ? 48   PRO G CD    1 
ATOM   4833  N  N     . VAL G  3 49  ? -23.743 -36.818 20.285 1.00 56.00  ? 49   VAL G N     1 
ATOM   4834  C  CA    . VAL G  3 49  ? -24.201 -38.188 20.567 1.00 55.39  ? 49   VAL G CA    1 
ATOM   4835  C  C     . VAL G  3 49  ? -23.909 -38.529 22.032 1.00 55.05  ? 49   VAL G C     1 
ATOM   4836  O  O     . VAL G  3 49  ? -24.822 -38.874 22.808 1.00 55.49  ? 49   VAL G O     1 
ATOM   4837  C  CB    . VAL G  3 49  ? -23.530 -39.244 19.599 1.00 55.55  ? 49   VAL G CB    1 
ATOM   4838  C  CG1   . VAL G  3 49  ? -23.770 -40.658 20.086 1.00 55.83  ? 49   VAL G CG1   1 
ATOM   4839  C  CG2   . VAL G  3 49  ? -24.016 -39.085 18.153 1.00 53.37  ? 49   VAL G CG2   1 
ATOM   4840  N  N     . TYR G  3 50  ? -22.638 -38.410 22.405 1.00 54.13  ? 50   TYR G N     1 
ATOM   4841  C  CA    . TYR G  3 50  ? -22.190 -38.684 23.765 1.00 53.50  ? 50   TYR G CA    1 
ATOM   4842  C  C     . TYR G  3 50  ? -23.017 -37.904 24.783 1.00 53.62  ? 50   TYR G C     1 
ATOM   4843  O  O     . TYR G  3 50  ? -23.502 -38.481 25.769 1.00 54.31  ? 50   TYR G O     1 
ATOM   4844  C  CB    . TYR G  3 50  ? -20.704 -38.338 23.896 1.00 53.16  ? 50   TYR G CB    1 
ATOM   4845  C  CG    . TYR G  3 50  ? -19.974 -39.036 25.027 1.00 52.97  ? 50   TYR G CG    1 
ATOM   4846  C  CD1   . TYR G  3 50  ? -18.944 -39.936 24.760 1.00 51.68  ? 50   TYR G CD1   1 
ATOM   4847  C  CD2   . TYR G  3 50  ? -20.308 -38.795 26.369 1.00 53.82  ? 50   TYR G CD2   1 
ATOM   4848  C  CE1   . TYR G  3 50  ? -18.279 -40.579 25.781 1.00 50.92  ? 50   TYR G CE1   1 
ATOM   4849  C  CE2   . TYR G  3 50  ? -19.636 -39.437 27.407 1.00 52.82  ? 50   TYR G CE2   1 
ATOM   4850  C  CZ    . TYR G  3 50  ? -18.621 -40.324 27.097 1.00 52.15  ? 50   TYR G CZ    1 
ATOM   4851  O  OH    . TYR G  3 50  ? -17.939 -40.956 28.114 1.00 53.01  ? 50   TYR G OH    1 
ATOM   4852  N  N     . LEU G  3 51  ? -23.204 -36.605 24.526 1.00 53.11  ? 51   LEU G N     1 
ATOM   4853  C  CA    . LEU G  3 51  ? -23.889 -35.716 25.459 1.00 52.56  ? 51   LEU G CA    1 
ATOM   4854  C  C     . LEU G  3 51  ? -25.377 -35.989 25.542 1.00 52.18  ? 51   LEU G C     1 
ATOM   4855  O  O     . LEU G  3 51  ? -25.942 -35.974 26.620 1.00 53.06  ? 51   LEU G O     1 
ATOM   4856  C  CB    . LEU G  3 51  ? -23.608 -34.236 25.135 1.00 52.84  ? 51   LEU G CB    1 
ATOM   4857  C  CG    . LEU G  3 51  ? -24.117 -33.117 26.061 1.00 52.84  ? 51   LEU G CG    1 
ATOM   4858  C  CD1   . LEU G  3 51  ? -23.925 -33.429 27.538 1.00 51.71  ? 51   LEU G CD1   1 
ATOM   4859  C  CD2   . LEU G  3 51  ? -23.451 -31.808 25.710 1.00 52.55  ? 51   LEU G CD2   1 
ATOM   4860  N  N     . ALA G  3 52  ? -26.020 -36.243 24.419 1.00 51.89  ? 52   ALA G N     1 
ATOM   4861  C  CA    . ALA G  3 52  ? -27.409 -36.688 24.442 1.00 51.44  ? 52   ALA G CA    1 
ATOM   4862  C  C     . ALA G  3 52  ? -27.624 -37.965 25.288 1.00 51.05  ? 52   ALA G C     1 
ATOM   4863  O  O     . ALA G  3 52  ? -28.556 -38.034 26.090 1.00 51.05  ? 52   ALA G O     1 
ATOM   4864  C  CB    . ALA G  3 52  ? -27.910 -36.877 23.017 1.00 52.00  ? 52   ALA G CB    1 
ATOM   4865  N  N     . ALA G  3 53  ? -26.747 -38.957 25.116 1.00 50.90  ? 53   ALA G N     1 
ATOM   4866  C  CA    . ALA G  3 53  ? -26.766 -40.203 25.904 1.00 50.70  ? 53   ALA G CA    1 
ATOM   4867  C  C     . ALA G  3 53  ? -26.638 -39.966 27.399 1.00 50.87  ? 53   ALA G C     1 
ATOM   4868  O  O     . ALA G  3 53  ? -27.373 -40.568 28.199 1.00 50.85  ? 53   ALA G O     1 
ATOM   4869  C  CB    . ALA G  3 53  ? -25.652 -41.136 25.439 1.00 50.76  ? 53   ALA G CB    1 
ATOM   4870  N  N     . VAL G  3 54  ? -25.692 -39.100 27.774 1.00 50.86  ? 54   VAL G N     1 
ATOM   4871  C  CA    . VAL G  3 54  ? -25.495 -38.713 29.183 1.00 50.79  ? 54   VAL G CA    1 
ATOM   4872  C  C     . VAL G  3 54  ? -26.706 -37.985 29.770 1.00 50.62  ? 54   VAL G C     1 
ATOM   4873  O  O     . VAL G  3 54  ? -27.125 -38.259 30.915 1.00 51.18  ? 54   VAL G O     1 
ATOM   4874  C  CB    . VAL G  3 54  ? -24.254 -37.836 29.352 1.00 51.21  ? 54   VAL G CB    1 
ATOM   4875  C  CG1   . VAL G  3 54  ? -24.129 -37.340 30.814 1.00 50.86  ? 54   VAL G CG1   1 
ATOM   4876  C  CG2   . VAL G  3 54  ? -23.000 -38.599 28.872 1.00 50.87  ? 54   VAL G CG2   1 
ATOM   4877  N  N     . LEU G  3 55  ? -27.264 -37.066 28.989 1.00 49.85  ? 55   LEU G N     1 
ATOM   4878  C  CA    . LEU G  3 55  ? -28.470 -36.355 29.382 1.00 49.87  ? 55   LEU G CA    1 
ATOM   4879  C  C     . LEU G  3 55  ? -29.661 -37.287 29.604 1.00 50.54  ? 55   LEU G C     1 
ATOM   4880  O  O     . LEU G  3 55  ? -30.389 -37.137 30.589 1.00 49.88  ? 55   LEU G O     1 
ATOM   4881  C  CB    . LEU G  3 55  ? -28.808 -35.257 28.367 1.00 49.21  ? 55   LEU G CB    1 
ATOM   4882  C  CG    . LEU G  3 55  ? -27.844 -34.064 28.317 1.00 48.31  ? 55   LEU G CG    1 
ATOM   4883  C  CD1   . LEU G  3 55  ? -28.236 -33.097 27.212 1.00 46.37  ? 55   LEU G CD1   1 
ATOM   4884  C  CD2   . LEU G  3 55  ? -27.758 -33.366 29.667 1.00 46.28  ? 55   LEU G CD2   1 
ATOM   4885  N  N     . GLU G  3 56  ? -29.839 -38.248 28.687 1.00 51.81  ? 56   GLU G N     1 
ATOM   4886  C  CA    . GLU G  3 56  ? -30.942 -39.225 28.739 1.00 52.65  ? 56   GLU G CA    1 
ATOM   4887  C  C     . GLU G  3 56  ? -30.796 -40.111 29.950 1.00 52.34  ? 56   GLU G C     1 
ATOM   4888  O  O     . GLU G  3 56  ? -31.759 -40.352 30.683 1.00 52.10  ? 56   GLU G O     1 
ATOM   4889  C  CB    . GLU G  3 56  ? -30.935 -40.103 27.495 1.00 52.66  ? 56   GLU G CB    1 
ATOM   4890  C  CG    . GLU G  3 56  ? -32.266 -40.769 27.174 1.00 53.94  ? 56   GLU G CG    1 
ATOM   4891  C  CD    . GLU G  3 56  ? -32.217 -41.589 25.898 1.00 54.79  ? 56   GLU G CD    1 
ATOM   4892  O  OE1   . GLU G  3 56  ? -32.628 -42.770 25.939 1.00 59.11  ? 56   GLU G OE1   1 
ATOM   4893  O  OE2   . GLU G  3 56  ? -31.742 -41.074 24.859 1.00 57.55  ? 56   GLU G OE2   1 
ATOM   4894  N  N     . TYR G  3 57  ? -29.575 -40.591 30.152 1.00 52.15  ? 57   TYR G N     1 
ATOM   4895  C  CA    . TYR G  3 57  ? -29.272 -41.415 31.298 1.00 52.32  ? 57   TYR G CA    1 
ATOM   4896  C  C     . TYR G  3 57  ? -29.673 -40.750 32.628 1.00 52.70  ? 57   TYR G C     1 
ATOM   4897  O  O     . TYR G  3 57  ? -30.389 -41.364 33.438 1.00 52.97  ? 57   TYR G O     1 
ATOM   4898  C  CB    . TYR G  3 57  ? -27.792 -41.838 31.306 1.00 52.32  ? 57   TYR G CB    1 
ATOM   4899  C  CG    . TYR G  3 57  ? -27.374 -42.369 32.649 1.00 52.72  ? 57   TYR G CG    1 
ATOM   4900  C  CD1   . TYR G  3 57  ? -27.778 -43.644 33.075 1.00 52.81  ? 57   TYR G CD1   1 
ATOM   4901  C  CD2   . TYR G  3 57  ? -26.607 -41.589 33.515 1.00 52.32  ? 57   TYR G CD2   1 
ATOM   4902  C  CE1   . TYR G  3 57  ? -27.423 -44.128 34.326 1.00 52.08  ? 57   TYR G CE1   1 
ATOM   4903  C  CE2   . TYR G  3 57  ? -26.241 -42.067 34.769 1.00 52.73  ? 57   TYR G CE2   1 
ATOM   4904  C  CZ    . TYR G  3 57  ? -26.659 -43.331 35.164 1.00 52.53  ? 57   TYR G CZ    1 
ATOM   4905  O  OH    . TYR G  3 57  ? -26.305 -43.795 36.394 1.00 53.14  ? 57   TYR G OH    1 
ATOM   4906  N  N     . LEU G  3 58  ? -29.220 -39.512 32.852 1.00 52.59  ? 58   LEU G N     1 
ATOM   4907  C  CA    . LEU G  3 58  ? -29.476 -38.833 34.127 1.00 52.70  ? 58   LEU G CA    1 
ATOM   4908  C  C     . LEU G  3 58  ? -30.968 -38.551 34.323 1.00 52.63  ? 58   LEU G C     1 
ATOM   4909  O  O     . LEU G  3 58  ? -31.499 -38.679 35.421 1.00 52.00  ? 58   LEU G O     1 
ATOM   4910  C  CB    . LEU G  3 58  ? -28.615 -37.560 34.269 1.00 53.02  ? 58   LEU G CB    1 
ATOM   4911  C  CG    . LEU G  3 58  ? -27.086 -37.712 34.416 1.00 52.21  ? 58   LEU G CG    1 
ATOM   4912  C  CD1   . LEU G  3 58  ? -26.319 -36.456 33.993 1.00 51.18  ? 58   LEU G CD1   1 
ATOM   4913  C  CD2   . LEU G  3 58  ? -26.706 -38.134 35.818 1.00 50.72  ? 58   LEU G CD2   1 
ATOM   4914  N  N     . THR G  3 59  ? -31.627 -38.170 33.236 1.00 53.39  ? 59   THR G N     1 
ATOM   4915  C  CA    . THR G  3 59  ? -33.089 -38.131 33.139 1.00 54.01  ? 59   THR G CA    1 
ATOM   4916  C  C     . THR G  3 59  ? -33.749 -39.436 33.592 1.00 54.27  ? 59   THR G C     1 
ATOM   4917  O  O     . THR G  3 59  ? -34.624 -39.423 34.454 1.00 54.49  ? 59   THR G O     1 
ATOM   4918  C  CB    . THR G  3 59  ? -33.487 -37.854 31.686 1.00 54.25  ? 59   THR G CB    1 
ATOM   4919  O  OG1   . THR G  3 59  ? -32.807 -36.676 31.250 1.00 53.50  ? 59   THR G OG1   1 
ATOM   4920  C  CG2   . THR G  3 59  ? -35.005 -37.683 31.522 1.00 54.06  ? 59   THR G CG2   1 
ATOM   4921  N  N     . ALA G  3 60  ? -33.314 -40.556 33.013 1.00 54.83  ? 60   ALA G N     1 
ATOM   4922  C  CA    . ALA G  3 60  ? -33.808 -41.902 33.384 1.00 55.10  ? 60   ALA G CA    1 
ATOM   4923  C  C     . ALA G  3 60  ? -33.595 -42.207 34.865 1.00 55.11  ? 60   ALA G C     1 
ATOM   4924  O  O     . ALA G  3 60  ? -34.499 -42.701 35.544 1.00 55.08  ? 60   ALA G O     1 
ATOM   4925  C  CB    . ALA G  3 60  ? -33.146 -42.986 32.508 1.00 54.91  ? 60   ALA G CB    1 
ATOM   4926  N  N     . GLU G  3 61  ? -32.395 -41.899 35.352 1.00 55.20  ? 61   GLU G N     1 
ATOM   4927  C  CA    . GLU G  3 61  ? -32.050 -42.033 36.763 1.00 55.23  ? 61   GLU G CA    1 
ATOM   4928  C  C     . GLU G  3 61  ? -32.995 -41.270 37.681 1.00 55.18  ? 61   GLU G C     1 
ATOM   4929  O  O     . GLU G  3 61  ? -33.456 -41.810 38.681 1.00 55.69  ? 61   GLU G O     1 
ATOM   4930  C  CB    . GLU G  3 61  ? -30.605 -41.603 36.982 1.00 55.24  ? 61   GLU G CB    1 
ATOM   4931  C  CG    . GLU G  3 61  ? -30.052 -41.889 38.360 1.00 57.72  ? 61   GLU G CG    1 
ATOM   4932  C  CD    . GLU G  3 61  ? -29.866 -43.375 38.642 1.00 61.36  ? 61   GLU G CD    1 
ATOM   4933  O  OE1   . GLU G  3 61  ? -29.870 -44.168 37.668 1.00 62.95  ? 61   GLU G OE1   1 
ATOM   4934  O  OE2   . GLU G  3 61  ? -29.704 -43.742 39.841 1.00 62.12  ? 61   GLU G OE2   1 
ATOM   4935  N  N     . ILE G  3 62  ? -33.317 -40.028 37.336 1.00 55.38  ? 62   ILE G N     1 
ATOM   4936  C  CA    . ILE G  3 62  ? -34.164 -39.210 38.206 1.00 55.49  ? 62   ILE G CA    1 
ATOM   4937  C  C     . ILE G  3 62  ? -35.631 -39.618 38.146 1.00 55.17  ? 62   ILE G C     1 
ATOM   4938  O  O     . ILE G  3 62  ? -36.290 -39.695 39.180 1.00 55.45  ? 62   ILE G O     1 
ATOM   4939  C  CB    . ILE G  3 62  ? -33.980 -37.679 37.965 1.00 55.66  ? 62   ILE G CB    1 
ATOM   4940  C  CG1   . ILE G  3 62  ? -32.510 -37.302 38.162 1.00 56.34  ? 62   ILE G CG1   1 
ATOM   4941  C  CG2   . ILE G  3 62  ? -34.861 -36.866 38.909 1.00 54.68  ? 62   ILE G CG2   1 
ATOM   4942  C  CD1   . ILE G  3 62  ? -32.257 -35.856 38.494 1.00 56.53  ? 62   ILE G CD1   1 
ATOM   4943  N  N     . LEU G  3 63  ? -36.133 -39.877 36.943 1.00 55.18  ? 63   LEU G N     1 
ATOM   4944  C  CA    . LEU G  3 63  ? -37.509 -40.346 36.748 1.00 55.35  ? 63   LEU G CA    1 
ATOM   4945  C  C     . LEU G  3 63  ? -37.781 -41.706 37.419 1.00 56.20  ? 63   LEU G C     1 
ATOM   4946  O  O     . LEU G  3 63  ? -38.799 -41.872 38.106 1.00 55.66  ? 63   LEU G O     1 
ATOM   4947  C  CB    . LEU G  3 63  ? -37.843 -40.400 35.258 1.00 55.07  ? 63   LEU G CB    1 
ATOM   4948  C  CG    . LEU G  3 63  ? -37.961 -39.052 34.536 1.00 53.78  ? 63   LEU G CG    1 
ATOM   4949  C  CD1   . LEU G  3 63  ? -38.062 -39.285 33.060 1.00 52.38  ? 63   LEU G CD1   1 
ATOM   4950  C  CD2   . LEU G  3 63  ? -39.134 -38.230 35.023 1.00 50.78  ? 63   LEU G CD2   1 
ATOM   4951  N  N     . GLU G  3 64  ? -36.861 -42.656 37.231 1.00 57.09  ? 64   GLU G N     1 
ATOM   4952  C  CA    . GLU G  3 64  ? -36.840 -43.899 38.001 1.00 58.97  ? 64   GLU G CA    1 
ATOM   4953  C  C     . GLU G  3 64  ? -37.114 -43.672 39.498 1.00 59.31  ? 64   GLU G C     1 
ATOM   4954  O  O     . GLU G  3 64  ? -38.160 -44.075 39.996 1.00 60.01  ? 64   GLU G O     1 
ATOM   4955  C  CB    . GLU G  3 64  ? -35.511 -44.638 37.763 1.00 59.83  ? 64   GLU G CB    1 
ATOM   4956  C  CG    . GLU G  3 64  ? -35.145 -45.739 38.764 1.00 63.94  ? 64   GLU G CG    1 
ATOM   4957  C  CD    . GLU G  3 64  ? -36.172 -46.877 38.827 1.00 70.05  ? 64   GLU G CD    1 
ATOM   4958  O  OE1   . GLU G  3 64  ? -36.549 -47.414 37.745 1.00 70.80  ? 64   GLU G OE1   1 
ATOM   4959  O  OE2   . GLU G  3 64  ? -36.593 -47.227 39.970 1.00 71.22  ? 64   GLU G OE2   1 
ATOM   4960  N  N     . LEU G  3 65  ? -36.206 -42.995 40.205 1.00 59.66  ? 65   LEU G N     1 
ATOM   4961  C  CA    . LEU G  3 65  ? -36.320 -42.826 41.663 1.00 59.78  ? 65   LEU G CA    1 
ATOM   4962  C  C     . LEU G  3 65  ? -37.526 -41.997 42.123 1.00 60.18  ? 65   LEU G C     1 
ATOM   4963  O  O     . LEU G  3 65  ? -38.029 -42.163 43.245 1.00 60.31  ? 65   LEU G O     1 
ATOM   4964  C  CB    . LEU G  3 65  ? -35.023 -42.250 42.230 1.00 59.58  ? 65   LEU G CB    1 
ATOM   4965  C  CG    . LEU G  3 65  ? -33.756 -43.034 41.877 1.00 60.23  ? 65   LEU G CG    1 
ATOM   4966  C  CD1   . LEU G  3 65  ? -32.505 -42.184 42.006 1.00 60.29  ? 65   LEU G CD1   1 
ATOM   4967  C  CD2   . LEU G  3 65  ? -33.621 -44.303 42.711 1.00 59.69  ? 65   LEU G CD2   1 
ATOM   4968  N  N     . ALA G  3 66  ? -37.970 -41.088 41.258 1.00 60.42  ? 66   ALA G N     1 
ATOM   4969  C  CA    . ALA G  3 66  ? -39.088 -40.211 41.564 1.00 60.42  ? 66   ALA G CA    1 
ATOM   4970  C  C     . ALA G  3 66  ? -40.384 -40.943 41.262 1.00 60.70  ? 66   ALA G C     1 
ATOM   4971  O  O     . ALA G  3 66  ? -41.418 -40.695 41.899 1.00 60.80  ? 66   ALA G O     1 
ATOM   4972  C  CB    . ALA G  3 66  ? -38.974 -38.898 40.780 1.00 59.88  ? 66   ALA G CB    1 
ATOM   4973  N  N     . GLY G  3 67  ? -40.312 -41.849 40.284 1.00 61.41  ? 67   GLY G N     1 
ATOM   4974  C  CA    . GLY G  3 67  ? -41.363 -42.850 40.034 1.00 61.84  ? 67   GLY G CA    1 
ATOM   4975  C  C     . GLY G  3 67  ? -41.550 -43.748 41.246 1.00 61.86  ? 67   GLY G C     1 
ATOM   4976  O  O     . GLY G  3 67  ? -42.660 -43.888 41.750 1.00 62.24  ? 67   GLY G O     1 
ATOM   4977  N  N     . ASN G  3 68  ? -40.460 -44.336 41.728 1.00 62.07  ? 68   ASN G N     1 
ATOM   4978  C  CA    . ASN G  3 68  ? -40.473 -45.056 43.001 1.00 62.35  ? 68   ASN G CA    1 
ATOM   4979  C  C     . ASN G  3 68  ? -41.109 -44.241 44.118 1.00 62.85  ? 68   ASN G C     1 
ATOM   4980  O  O     . ASN G  3 68  ? -41.972 -44.740 44.836 1.00 63.19  ? 68   ASN G O     1 
ATOM   4981  C  CB    . ASN G  3 68  ? -39.058 -45.449 43.421 1.00 62.45  ? 68   ASN G CB    1 
ATOM   4982  C  CG    . ASN G  3 68  ? -38.433 -46.477 42.503 1.00 61.84  ? 68   ASN G CG    1 
ATOM   4983  O  OD1   . ASN G  3 68  ? -39.065 -46.964 41.565 1.00 62.99  ? 68   ASN G OD1   1 
ATOM   4984  N  ND2   . ASN G  3 68  ? -37.180 -46.816 42.771 1.00 60.56  ? 68   ASN G ND2   1 
ATOM   4985  N  N     . ALA G  3 69  ? -40.681 -42.987 44.251 1.00 63.44  ? 69   ALA G N     1 
ATOM   4986  C  CA    . ALA G  3 69  ? -41.204 -42.066 45.263 1.00 64.00  ? 69   ALA G CA    1 
ATOM   4987  C  C     . ALA G  3 69  ? -42.708 -41.860 45.177 1.00 64.67  ? 69   ALA G C     1 
ATOM   4988  O  O     . ALA G  3 69  ? -43.377 -41.776 46.210 1.00 64.35  ? 69   ALA G O     1 
ATOM   4989  C  CB    . ALA G  3 69  ? -40.484 -40.723 45.184 1.00 64.00  ? 69   ALA G CB    1 
ATOM   4990  N  N     . ALA G  3 70  ? -43.222 -41.763 43.949 1.00 65.71  ? 70   ALA G N     1 
ATOM   4991  C  CA    . ALA G  3 70  ? -44.652 -41.601 43.705 1.00 67.03  ? 70   ALA G CA    1 
ATOM   4992  C  C     . ALA G  3 70  ? -45.407 -42.826 44.192 1.00 68.36  ? 70   ALA G C     1 
ATOM   4993  O  O     . ALA G  3 70  ? -46.418 -42.710 44.890 1.00 68.68  ? 70   ALA G O     1 
ATOM   4994  C  CB    . ALA G  3 70  ? -44.923 -41.368 42.223 1.00 66.74  ? 70   ALA G CB    1 
ATOM   4995  N  N     . ARG G  3 71  ? -44.909 -44.003 43.820 1.00 69.83  ? 71   ARG G N     1 
ATOM   4996  C  CA    . ARG G  3 71  ? -45.503 -45.254 44.243 1.00 71.18  ? 71   ARG G CA    1 
ATOM   4997  C  C     . ARG G  3 71  ? -45.597 -45.275 45.766 1.00 72.03  ? 71   ARG G C     1 
ATOM   4998  O  O     . ARG G  3 71  ? -46.689 -45.342 46.314 1.00 72.38  ? 71   ARG G O     1 
ATOM   4999  C  CB    . ARG G  3 71  ? -44.670 -46.419 43.738 1.00 71.50  ? 71   ARG G CB    1 
ATOM   5000  C  CG    . ARG G  3 71  ? -45.478 -47.578 43.161 1.00 73.31  ? 71   ARG G CG    1 
ATOM   5001  C  CD    . ARG G  3 71  ? -44.730 -48.917 43.227 1.00 76.18  ? 71   ARG G CD    1 
ATOM   5002  N  NE    . ARG G  3 71  ? -43.279 -48.811 43.021 1.00 77.84  ? 71   ARG G NE    1 
ATOM   5003  C  CZ    . ARG G  3 71  ? -42.384 -48.630 44.000 1.00 78.94  ? 71   ARG G CZ    1 
ATOM   5004  N  NH1   . ARG G  3 71  ? -42.778 -48.508 45.270 1.00 78.28  ? 71   ARG G NH1   1 
ATOM   5005  N  NH2   . ARG G  3 71  ? -41.087 -48.557 43.707 1.00 78.73  ? 71   ARG G NH2   1 
ATOM   5006  N  N     . ASP G  3 72  ? -44.457 -45.161 46.445 1.00 72.93  ? 72   ASP G N     1 
ATOM   5007  C  CA    . ASP G  3 72  ? -44.395 -45.215 47.910 1.00 73.79  ? 72   ASP G CA    1 
ATOM   5008  C  C     . ASP G  3 72  ? -45.478 -44.391 48.592 1.00 74.11  ? 72   ASP G C     1 
ATOM   5009  O  O     . ASP G  3 72  ? -45.965 -44.747 49.664 1.00 73.97  ? 72   ASP G O     1 
ATOM   5010  C  CB    . ASP G  3 72  ? -43.014 -44.767 48.401 1.00 73.96  ? 72   ASP G CB    1 
ATOM   5011  C  CG    . ASP G  3 72  ? -41.879 -45.579 47.782 1.00 75.82  ? 72   ASP G CG    1 
ATOM   5012  O  OD1   . ASP G  3 72  ? -42.084 -46.783 47.487 1.00 77.63  ? 72   ASP G OD1   1 
ATOM   5013  O  OD2   . ASP G  3 72  ? -40.777 -45.013 47.580 1.00 77.41  ? 72   ASP G OD2   1 
ATOM   5014  N  N     . ASN G  3 73  ? -45.842 -43.278 47.963 1.00 74.89  ? 73   ASN G N     1 
ATOM   5015  C  CA    . ASN G  3 73  ? -46.840 -42.367 48.516 1.00 75.45  ? 73   ASN G CA    1 
ATOM   5016  C  C     . ASN G  3 73  ? -48.219 -42.585 47.891 1.00 75.36  ? 73   ASN G C     1 
ATOM   5017  O  O     . ASN G  3 73  ? -49.121 -41.753 48.060 1.00 75.73  ? 73   ASN G O     1 
ATOM   5018  C  CB    . ASN G  3 73  ? -46.375 -40.910 48.395 1.00 75.69  ? 73   ASN G CB    1 
ATOM   5019  C  CG    . ASN G  3 73  ? -45.052 -40.661 49.115 1.00 77.34  ? 73   ASN G CG    1 
ATOM   5020  O  OD1   . ASN G  3 73  ? -45.032 -40.205 50.270 1.00 78.31  ? 73   ASN G OD1   1 
ATOM   5021  N  ND2   . ASN G  3 73  ? -43.936 -40.984 48.447 1.00 77.49  ? 73   ASN G ND2   1 
ATOM   5022  N  N     . LYS G  3 74  ? -48.356 -43.718 47.189 1.00 74.83  ? 74   LYS G N     1 
ATOM   5023  C  CA    . LYS G  3 74  ? -49.628 -44.222 46.651 1.00 74.33  ? 74   LYS G CA    1 
ATOM   5024  C  C     . LYS G  3 74  ? -50.189 -43.295 45.567 1.00 73.39  ? 74   LYS G C     1 
ATOM   5025  O  O     . LYS G  3 74  ? -51.338 -42.843 45.654 1.00 73.29  ? 74   LYS G O     1 
ATOM   5026  C  CB    . LYS G  3 74  ? -50.652 -44.456 47.781 1.00 75.16  ? 74   LYS G CB    1 
ATOM   5027  C  CG    . LYS G  3 74  ? -50.177 -45.373 48.931 1.00 75.92  ? 74   LYS G CG    1 
ATOM   5028  C  CD    . LYS G  3 74  ? -50.726 -46.793 48.808 1.00 77.98  ? 74   LYS G CD    1 
ATOM   5029  C  CE    . LYS G  3 74  ? -50.131 -47.731 49.875 1.00 78.37  ? 74   LYS G CE    1 
ATOM   5030  N  NZ    . LYS G  3 74  ? -48.759 -48.231 49.524 1.00 78.90  ? 74   LYS G NZ    1 
ATOM   5031  N  N     . LYS G  3 75  ? -49.358 -43.014 44.559 1.00 71.99  ? 75   LYS G N     1 
ATOM   5032  C  CA    . LYS G  3 75  ? -49.676 -42.063 43.493 1.00 70.56  ? 75   LYS G CA    1 
ATOM   5033  C  C     . LYS G  3 75  ? -49.067 -42.492 42.170 1.00 69.67  ? 75   LYS G C     1 
ATOM   5034  O  O     . LYS G  3 75  ? -48.031 -43.170 42.139 1.00 69.72  ? 75   LYS G O     1 
ATOM   5035  C  CB    . LYS G  3 75  ? -49.149 -40.667 43.834 1.00 70.82  ? 75   LYS G CB    1 
ATOM   5036  C  CG    . LYS G  3 75  ? -49.646 -40.106 45.143 1.00 71.21  ? 75   LYS G CG    1 
ATOM   5037  C  CD    . LYS G  3 75  ? -50.055 -38.662 45.010 1.00 72.45  ? 75   LYS G CD    1 
ATOM   5038  C  CE    . LYS G  3 75  ? -50.743 -38.197 46.273 1.00 73.15  ? 75   LYS G CE    1 
ATOM   5039  N  NZ    . LYS G  3 75  ? -51.977 -39.003 46.510 1.00 73.53  ? 75   LYS G NZ    1 
ATOM   5040  N  N     . THR G  3 76  ? -49.695 -42.064 41.080 1.00 68.19  ? 76   THR G N     1 
ATOM   5041  C  CA    . THR G  3 76  ? -49.289 -42.468 39.731 1.00 67.12  ? 76   THR G CA    1 
ATOM   5042  C  C     . THR G  3 76  ? -48.670 -41.325 38.904 1.00 66.04  ? 76   THR G C     1 
ATOM   5043  O  O     . THR G  3 76  ? -48.079 -41.559 37.843 1.00 66.14  ? 76   THR G O     1 
ATOM   5044  C  CB    . THR G  3 76  ? -50.483 -43.109 38.953 1.00 67.48  ? 76   THR G CB    1 
ATOM   5045  O  OG1   . THR G  3 76  ? -51.678 -42.341 39.159 1.00 67.68  ? 76   THR G OG1   1 
ATOM   5046  C  CG2   . THR G  3 76  ? -50.735 -44.550 39.430 1.00 67.65  ? 76   THR G CG2   1 
ATOM   5047  N  N     . ARG G  3 77  ? -48.810 -40.094 39.396 1.00 64.27  ? 77   ARG G N     1 
ATOM   5048  C  CA    . ARG G  3 77  ? -48.278 -38.909 38.722 1.00 62.19  ? 77   ARG G CA    1 
ATOM   5049  C  C     . ARG G  3 77  ? -47.115 -38.343 39.520 1.00 60.30  ? 77   ARG G C     1 
ATOM   5050  O  O     . ARG G  3 77  ? -47.227 -38.153 40.729 1.00 59.73  ? 77   ARG G O     1 
ATOM   5051  C  CB    . ARG G  3 77  ? -49.377 -37.855 38.617 1.00 62.71  ? 77   ARG G CB    1 
ATOM   5052  C  CG    . ARG G  3 77  ? -49.054 -36.637 37.789 1.00 62.80  ? 77   ARG G CG    1 
ATOM   5053  C  CD    . ARG G  3 77  ? -50.292 -35.780 37.666 1.00 63.84  ? 77   ARG G CD    1 
ATOM   5054  N  NE    . ARG G  3 77  ? -51.198 -36.338 36.661 1.00 65.55  ? 77   ARG G NE    1 
ATOM   5055  C  CZ    . ARG G  3 77  ? -52.528 -36.334 36.742 1.00 65.86  ? 77   ARG G CZ    1 
ATOM   5056  N  NH1   . ARG G  3 77  ? -53.146 -35.813 37.808 1.00 64.59  ? 77   ARG G NH1   1 
ATOM   5057  N  NH2   . ARG G  3 77  ? -53.237 -36.880 35.757 1.00 64.09  ? 77   ARG G NH2   1 
ATOM   5058  N  N     . ILE G  3 78  ? -46.004 -38.079 38.841 1.00 58.19  ? 78   ILE G N     1 
ATOM   5059  C  CA    . ILE G  3 78  ? -44.864 -37.429 39.485 1.00 56.74  ? 78   ILE G CA    1 
ATOM   5060  C  C     . ILE G  3 78  ? -45.074 -35.907 39.658 1.00 55.84  ? 78   ILE G C     1 
ATOM   5061  O  O     . ILE G  3 78  ? -45.247 -35.181 38.681 1.00 55.61  ? 78   ILE G O     1 
ATOM   5062  C  CB    . ILE G  3 78  ? -43.541 -37.716 38.748 1.00 56.45  ? 78   ILE G CB    1 
ATOM   5063  C  CG1   . ILE G  3 78  ? -43.321 -39.221 38.611 1.00 55.50  ? 78   ILE G CG1   1 
ATOM   5064  C  CG2   . ILE G  3 78  ? -42.391 -37.074 39.487 1.00 56.37  ? 78   ILE G CG2   1 
ATOM   5065  C  CD1   . ILE G  3 78  ? -42.145 -39.624 37.703 1.00 56.34  ? 78   ILE G CD1   1 
ATOM   5066  N  N     . ILE G  3 79  ? -45.104 -35.465 40.917 1.00 54.95  ? 79   ILE G N     1 
ATOM   5067  C  CA    . ILE G  3 79  ? -45.084 -34.045 41.288 1.00 54.00  ? 79   ILE G CA    1 
ATOM   5068  C  C     . ILE G  3 79  ? -43.699 -33.625 41.844 1.00 53.69  ? 79   ILE G C     1 
ATOM   5069  O  O     . ILE G  3 79  ? -42.873 -34.490 42.182 1.00 53.70  ? 79   ILE G O     1 
ATOM   5070  C  CB    . ILE G  3 79  ? -46.235 -33.675 42.255 1.00 53.74  ? 79   ILE G CB    1 
ATOM   5071  C  CG1   . ILE G  3 79  ? -46.115 -34.422 43.584 1.00 53.65  ? 79   ILE G CG1   1 
ATOM   5072  C  CG2   . ILE G  3 79  ? -47.561 -33.944 41.598 1.00 53.64  ? 79   ILE G CG2   1 
ATOM   5073  C  CD1   . ILE G  3 79  ? -46.955 -33.821 44.709 1.00 53.38  ? 79   ILE G CD1   1 
ATOM   5074  N  N     . PRO G  3 80  ? -43.414 -32.303 41.898 1.00 53.16  ? 80   PRO G N     1 
ATOM   5075  C  CA    . PRO G  3 80  ? -42.093 -31.869 42.346 1.00 52.78  ? 80   PRO G CA    1 
ATOM   5076  C  C     . PRO G  3 80  ? -41.670 -32.432 43.707 1.00 52.66  ? 80   PRO G C     1 
ATOM   5077  O  O     . PRO G  3 80  ? -40.472 -32.611 43.951 1.00 52.39  ? 80   PRO G O     1 
ATOM   5078  C  CB    . PRO G  3 80  ? -42.240 -30.344 42.394 1.00 52.71  ? 80   PRO G CB    1 
ATOM   5079  C  CG    . PRO G  3 80  ? -43.239 -30.055 41.342 1.00 52.07  ? 80   PRO G CG    1 
ATOM   5080  C  CD    . PRO G  3 80  ? -44.239 -31.145 41.499 1.00 53.03  ? 80   PRO G CD    1 
ATOM   5081  N  N     . ARG G  3 81  ? -42.637 -32.715 44.578 1.00 52.68  ? 81   ARG G N     1 
ATOM   5082  C  CA    . ARG G  3 81  ? -42.351 -33.365 45.864 1.00 52.51  ? 81   ARG G CA    1 
ATOM   5083  C  C     . ARG G  3 81  ? -41.586 -34.668 45.667 1.00 52.20  ? 81   ARG G C     1 
ATOM   5084  O  O     . ARG G  3 81  ? -40.651 -34.970 46.420 1.00 52.63  ? 81   ARG G O     1 
ATOM   5085  C  CB    . ARG G  3 81  ? -43.644 -33.612 46.652 1.00 52.75  ? 81   ARG G CB    1 
ATOM   5086  C  CG    . ARG G  3 81  ? -43.466 -34.319 47.998 1.00 52.84  ? 81   ARG G CG    1 
ATOM   5087  C  CD    . ARG G  3 81  ? -42.364 -33.707 48.841 1.00 52.51  ? 81   ARG G CD    1 
ATOM   5088  N  NE    . ARG G  3 81  ? -42.477 -34.093 50.243 1.00 53.43  ? 81   ARG G NE    1 
ATOM   5089  C  CZ    . ARG G  3 81  ? -41.553 -33.848 51.167 1.00 53.32  ? 81   ARG G CZ    1 
ATOM   5090  N  NH1   . ARG G  3 81  ? -40.434 -33.214 50.846 1.00 52.87  ? 81   ARG G NH1   1 
ATOM   5091  N  NH2   . ARG G  3 81  ? -41.746 -34.239 52.417 1.00 52.27  ? 81   ARG G NH2   1 
ATOM   5092  N  N     . HIS G  3 82  ? -41.952 -35.404 44.620 1.00 51.34  ? 82   HIS G N     1 
ATOM   5093  C  CA    . HIS G  3 82  ? -41.367 -36.707 44.352 1.00 50.52  ? 82   HIS G CA    1 
ATOM   5094  C  C     . HIS G  3 82  ? -39.952 -36.617 43.813 1.00 50.27  ? 82   HIS G C     1 
ATOM   5095  O  O     . HIS G  3 82  ? -39.096 -37.463 44.141 1.00 50.79  ? 82   HIS G O     1 
ATOM   5096  C  CB    . HIS G  3 82  ? -42.277 -37.553 43.445 1.00 50.29  ? 82   HIS G CB    1 
ATOM   5097  C  CG    . HIS G  3 82  ? -43.670 -37.701 43.976 1.00 49.41  ? 82   HIS G CG    1 
ATOM   5098  N  ND1   . HIS G  3 82  ? -44.790 -37.554 43.185 1.00 48.87  ? 82   HIS G ND1   1 
ATOM   5099  C  CD2   . HIS G  3 82  ? -44.124 -37.933 45.232 1.00 48.37  ? 82   HIS G CD2   1 
ATOM   5100  C  CE1   . HIS G  3 82  ? -45.873 -37.706 43.927 1.00 48.20  ? 82   HIS G CE1   1 
ATOM   5101  N  NE2   . HIS G  3 82  ? -45.497 -37.931 45.174 1.00 48.58  ? 82   HIS G NE2   1 
ATOM   5102  N  N     . LEU G  3 83  ? -39.708 -35.600 42.988 1.00 49.58  ? 83   LEU G N     1 
ATOM   5103  C  CA    . LEU G  3 83  ? -38.357 -35.277 42.509 1.00 48.38  ? 83   LEU G CA    1 
ATOM   5104  C  C     . LEU G  3 83  ? -37.469 -34.830 43.660 1.00 48.00  ? 83   LEU G C     1 
ATOM   5105  O  O     . LEU G  3 83  ? -36.296 -35.176 43.692 1.00 47.71  ? 83   LEU G O     1 
ATOM   5106  C  CB    . LEU G  3 83  ? -38.399 -34.203 41.431 1.00 48.22  ? 83   LEU G CB    1 
ATOM   5107  C  CG    . LEU G  3 83  ? -39.184 -34.473 40.139 1.00 47.82  ? 83   LEU G CG    1 
ATOM   5108  C  CD1   . LEU G  3 83  ? -39.378 -33.142 39.380 1.00 46.24  ? 83   LEU G CD1   1 
ATOM   5109  C  CD2   . LEU G  3 83  ? -38.511 -35.519 39.254 1.00 47.20  ? 83   LEU G CD2   1 
ATOM   5110  N  N     . GLN G  3 84  ? -38.032 -34.100 44.620 1.00 48.02  ? 84   GLN G N     1 
ATOM   5111  C  CA    . GLN G  3 84  ? -37.272 -33.695 45.808 1.00 48.42  ? 84   GLN G CA    1 
ATOM   5112  C  C     . GLN G  3 84  ? -36.871 -34.877 46.667 1.00 48.75  ? 84   GLN G C     1 
ATOM   5113  O  O     . GLN G  3 84  ? -35.721 -34.977 47.071 1.00 49.65  ? 84   GLN G O     1 
ATOM   5114  C  CB    . GLN G  3 84  ? -38.023 -32.659 46.659 1.00 48.55  ? 84   GLN G CB    1 
ATOM   5115  C  CG    . GLN G  3 84  ? -37.343 -32.302 48.001 1.00 47.07  ? 84   GLN G CG    1 
ATOM   5116  C  CD    . GLN G  3 84  ? -36.099 -31.410 47.850 1.00 46.59  ? 84   GLN G CD    1 
ATOM   5117  O  OE1   . GLN G  3 84  ? -35.521 -31.284 46.766 1.00 48.02  ? 84   GLN G OE1   1 
ATOM   5118  N  NE2   . GLN G  3 84  ? -35.685 -30.804 48.943 1.00 43.80  ? 84   GLN G NE2   1 
ATOM   5119  N  N     . LEU G  3 85  ? -37.816 -35.770 46.954 1.00 49.61  ? 85   LEU G N     1 
ATOM   5120  C  CA    . LEU G  3 85  ? -37.534 -36.990 47.737 1.00 48.94  ? 85   LEU G CA    1 
ATOM   5121  C  C     . LEU G  3 85  ? -36.525 -37.867 47.027 1.00 48.51  ? 85   LEU G C     1 
ATOM   5122  O  O     . LEU G  3 85  ? -35.542 -38.318 47.631 1.00 48.47  ? 85   LEU G O     1 
ATOM   5123  C  CB    . LEU G  3 85  ? -38.815 -37.787 47.977 1.00 49.08  ? 85   LEU G CB    1 
ATOM   5124  C  CG    . LEU G  3 85  ? -39.892 -37.179 48.897 1.00 50.34  ? 85   LEU G CG    1 
ATOM   5125  C  CD1   . LEU G  3 85  ? -41.109 -38.087 48.939 1.00 50.11  ? 85   LEU G CD1   1 
ATOM   5126  C  CD2   . LEU G  3 85  ? -39.383 -36.889 50.313 1.00 49.91  ? 85   LEU G CD2   1 
ATOM   5127  N  N     . ALA G  3 86  ? -36.767 -38.090 45.740 1.00 47.77  ? 86   ALA G N     1 
ATOM   5128  C  CA    . ALA G  3 86  ? -35.898 -38.902 44.911 1.00 47.68  ? 86   ALA G CA    1 
ATOM   5129  C  C     . ALA G  3 86  ? -34.454 -38.472 45.030 1.00 47.83  ? 86   ALA G C     1 
ATOM   5130  O  O     . ALA G  3 86  ? -33.567 -39.301 45.297 1.00 48.21  ? 86   ALA G O     1 
ATOM   5131  C  CB    . ALA G  3 86  ? -36.341 -38.816 43.456 1.00 47.85  ? 86   ALA G CB    1 
ATOM   5132  N  N     . VAL G  3 87  ? -34.240 -37.168 44.805 1.00 47.76  ? 87   VAL G N     1 
ATOM   5133  C  CA    . VAL G  3 87  ? -32.912 -36.524 44.723 1.00 46.96  ? 87   VAL G CA    1 
ATOM   5134  C  C     . VAL G  3 87  ? -32.215 -36.438 46.091 1.00 46.97  ? 87   VAL G C     1 
ATOM   5135  O  O     . VAL G  3 87  ? -31.036 -36.762 46.212 1.00 46.42  ? 87   VAL G O     1 
ATOM   5136  C  CB    . VAL G  3 87  ? -33.017 -35.118 43.990 1.00 46.65  ? 87   VAL G CB    1 
ATOM   5137  C  CG1   . VAL G  3 87  ? -31.914 -34.174 44.363 1.00 45.04  ? 87   VAL G CG1   1 
ATOM   5138  C  CG2   . VAL G  3 87  ? -33.030 -35.312 42.492 1.00 46.11  ? 87   VAL G CG2   1 
ATOM   5139  N  N     . ARG G  3 88  ? -32.943 -36.009 47.115 1.00 47.65  ? 88   ARG G N     1 
ATOM   5140  C  CA    . ARG G  3 88  ? -32.344 -35.846 48.450 1.00 48.94  ? 88   ARG G CA    1 
ATOM   5141  C  C     . ARG G  3 88  ? -32.035 -37.161 49.173 1.00 49.72  ? 88   ARG G C     1 
ATOM   5142  O  O     . ARG G  3 88  ? -31.120 -37.238 49.993 1.00 50.45  ? 88   ARG G O     1 
ATOM   5143  C  CB    . ARG G  3 88  ? -33.215 -34.931 49.316 1.00 48.69  ? 88   ARG G CB    1 
ATOM   5144  C  CG    . ARG G  3 88  ? -33.396 -33.518 48.752 1.00 47.65  ? 88   ARG G CG    1 
ATOM   5145  C  CD    . ARG G  3 88  ? -32.063 -32.809 48.473 1.00 46.70  ? 88   ARG G CD    1 
ATOM   5146  N  NE    . ARG G  3 88  ? -32.207 -31.715 47.499 1.00 45.21  ? 88   ARG G NE    1 
ATOM   5147  C  CZ    . ARG G  3 88  ? -31.238 -31.241 46.715 1.00 43.18  ? 88   ARG G CZ    1 
ATOM   5148  N  NH1   . ARG G  3 88  ? -30.013 -31.744 46.768 1.00 41.58  ? 88   ARG G NH1   1 
ATOM   5149  N  NH2   . ARG G  3 88  ? -31.507 -30.255 45.868 1.00 42.57  ? 88   ARG G NH2   1 
ATOM   5150  N  N     . ASN G  3 89  ? -32.805 -38.198 48.856 1.00 50.82  ? 89   ASN G N     1 
ATOM   5151  C  CA    . ASN G  3 89  ? -32.608 -39.543 49.403 1.00 51.19  ? 89   ASN G CA    1 
ATOM   5152  C  C     . ASN G  3 89  ? -31.535 -40.359 48.714 1.00 51.99  ? 89   ASN G C     1 
ATOM   5153  O  O     . ASN G  3 89  ? -31.246 -41.479 49.146 1.00 52.73  ? 89   ASN G O     1 
ATOM   5154  C  CB    . ASN G  3 89  ? -33.918 -40.318 49.384 1.00 50.79  ? 89   ASN G CB    1 
ATOM   5155  C  CG    . ASN G  3 89  ? -34.761 -40.007 50.564 1.00 50.71  ? 89   ASN G CG    1 
ATOM   5156  O  OD1   . ASN G  3 89  ? -34.272 -40.003 51.705 1.00 49.97  ? 89   ASN G OD1   1 
ATOM   5157  N  ND2   . ASN G  3 89  ? -36.032 -39.716 50.321 1.00 50.76  ? 89   ASN G ND2   1 
ATOM   5158  N  N     . ASP G  3 90  ? -30.959 -39.801 47.650 1.00 52.50  ? 90   ASP G N     1 
ATOM   5159  C  CA    . ASP G  3 90  ? -29.880 -40.417 46.911 1.00 53.08  ? 90   ASP G CA    1 
ATOM   5160  C  C     . ASP G  3 90  ? -28.642 -39.586 47.101 1.00 53.50  ? 90   ASP G C     1 
ATOM   5161  O  O     . ASP G  3 90  ? -28.615 -38.418 46.741 1.00 53.77  ? 90   ASP G O     1 
ATOM   5162  C  CB    . ASP G  3 90  ? -30.219 -40.480 45.427 1.00 53.57  ? 90   ASP G CB    1 
ATOM   5163  C  CG    . ASP G  3 90  ? -29.257 -41.350 44.649 1.00 55.31  ? 90   ASP G CG    1 
ATOM   5164  O  OD1   . ASP G  3 90  ? -29.602 -42.523 44.405 1.00 59.17  ? 90   ASP G OD1   1 
ATOM   5165  O  OD2   . ASP G  3 90  ? -28.152 -40.882 44.289 1.00 58.24  ? 90   ASP G OD2   1 
ATOM   5166  N  N     . GLU G  3 91  ? -27.603 -40.202 47.641 1.00 54.23  ? 91   GLU G N     1 
ATOM   5167  C  CA    . GLU G  3 91  ? -26.374 -39.510 47.976 1.00 55.12  ? 91   GLU G CA    1 
ATOM   5168  C  C     . GLU G  3 91  ? -25.711 -38.802 46.797 1.00 54.63  ? 91   GLU G C     1 
ATOM   5169  O  O     . GLU G  3 91  ? -25.174 -37.707 46.954 1.00 54.66  ? 91   GLU G O     1 
ATOM   5170  C  CB    . GLU G  3 91  ? -25.392 -40.496 48.585 1.00 55.71  ? 91   GLU G CB    1 
ATOM   5171  C  CG    . GLU G  3 91  ? -24.244 -39.831 49.317 1.00 59.44  ? 91   GLU G CG    1 
ATOM   5172  C  CD    . GLU G  3 91  ? -23.047 -40.749 49.451 1.00 64.80  ? 91   GLU G CD    1 
ATOM   5173  O  OE1   . GLU G  3 91  ? -23.246 -41.991 49.523 1.00 66.70  ? 91   GLU G OE1   1 
ATOM   5174  O  OE2   . GLU G  3 91  ? -21.909 -40.225 49.485 1.00 66.14  ? 91   GLU G OE2   1 
ATOM   5175  N  N     . GLU G  3 92  ? -25.762 -39.433 45.624 1.00 54.16  ? 92   GLU G N     1 
ATOM   5176  C  CA    . GLU G  3 92  ? -25.072 -38.934 44.432 1.00 53.25  ? 92   GLU G CA    1 
ATOM   5177  C  C     . GLU G  3 92  ? -25.841 -37.862 43.657 1.00 52.50  ? 92   GLU G C     1 
ATOM   5178  O  O     . GLU G  3 92  ? -25.261 -36.876 43.217 1.00 52.21  ? 92   GLU G O     1 
ATOM   5179  C  CB    . GLU G  3 92  ? -24.680 -40.095 43.524 1.00 53.05  ? 92   GLU G CB    1 
ATOM   5180  C  CG    . GLU G  3 92  ? -23.675 -41.035 44.164 1.00 54.03  ? 92   GLU G CG    1 
ATOM   5181  C  CD    . GLU G  3 92  ? -22.799 -41.767 43.153 1.00 56.71  ? 92   GLU G CD    1 
ATOM   5182  O  OE1   . GLU G  3 92  ? -23.194 -41.863 41.954 1.00 55.71  ? 92   GLU G OE1   1 
ATOM   5183  O  OE2   . GLU G  3 92  ? -21.711 -42.248 43.573 1.00 57.06  ? 92   GLU G OE2   1 
ATOM   5184  N  N     . LEU G  3 93  ? -27.140 -38.074 43.477 1.00 51.62  ? 93   LEU G N     1 
ATOM   5185  C  CA    . LEU G  3 93  ? -28.005 -37.063 42.876 1.00 50.46  ? 93   LEU G CA    1 
ATOM   5186  C  C     . LEU G  3 93  ? -28.085 -35.814 43.770 1.00 50.11  ? 93   LEU G C     1 
ATOM   5187  O  O     . LEU G  3 93  ? -28.152 -34.684 43.273 1.00 49.97  ? 93   LEU G O     1 
ATOM   5188  C  CB    . LEU G  3 93  ? -29.407 -37.628 42.637 1.00 49.92  ? 93   LEU G CB    1 
ATOM   5189  C  CG    . LEU G  3 93  ? -29.692 -38.542 41.444 1.00 48.85  ? 93   LEU G CG    1 
ATOM   5190  C  CD1   . LEU G  3 93  ? -31.156 -38.944 41.451 1.00 47.61  ? 93   LEU G CD1   1 
ATOM   5191  C  CD2   . LEU G  3 93  ? -29.324 -37.882 40.111 1.00 48.33  ? 93   LEU G CD2   1 
ATOM   5192  N  N     . ASN G  3 94  ? -28.091 -36.042 45.087 1.00 49.21  ? 94   ASN G N     1 
ATOM   5193  C  CA    . ASN G  3 94  ? -28.105 -34.975 46.072 1.00 47.58  ? 94   ASN G CA    1 
ATOM   5194  C  C     . ASN G  3 94  ? -26.834 -34.143 46.053 1.00 47.86  ? 94   ASN G C     1 
ATOM   5195  O  O     . ASN G  3 94  ? -26.881 -32.927 46.260 1.00 48.46  ? 94   ASN G O     1 
ATOM   5196  C  CB    . ASN G  3 94  ? -28.348 -35.548 47.460 1.00 46.98  ? 94   ASN G CB    1 
ATOM   5197  C  CG    . ASN G  3 94  ? -28.341 -34.494 48.528 1.00 45.26  ? 94   ASN G CG    1 
ATOM   5198  O  OD1   . ASN G  3 94  ? -29.036 -33.484 48.428 1.00 44.52  ? 94   ASN G OD1   1 
ATOM   5199  N  ND2   . ASN G  3 94  ? -27.524 -34.698 49.540 1.00 41.63  ? 94   ASN G ND2   1 
ATOM   5200  N  N     . LYS G  3 95  ? -25.696 -34.784 45.822 1.00 47.54  ? 95   LYS G N     1 
ATOM   5201  C  CA    . LYS G  3 95  ? -24.454 -34.057 45.647 1.00 47.70  ? 95   LYS G CA    1 
ATOM   5202  C  C     . LYS G  3 95  ? -24.420 -33.249 44.330 1.00 47.42  ? 95   LYS G C     1 
ATOM   5203  O  O     . LYS G  3 95  ? -24.051 -32.072 44.310 1.00 47.81  ? 95   LYS G O     1 
ATOM   5204  C  CB    . LYS G  3 95  ? -23.264 -34.997 45.741 1.00 48.04  ? 95   LYS G CB    1 
ATOM   5205  C  CG    . LYS G  3 95  ? -21.914 -34.285 45.724 1.00 51.15  ? 95   LYS G CG    1 
ATOM   5206  C  CD    . LYS G  3 95  ? -20.776 -35.284 45.592 1.00 57.07  ? 95   LYS G CD    1 
ATOM   5207  C  CE    . LYS G  3 95  ? -19.505 -34.642 45.043 1.00 60.58  ? 95   LYS G CE    1 
ATOM   5208  N  NZ    . LYS G  3 95  ? -18.406 -35.674 44.920 1.00 63.17  ? 95   LYS G NZ    1 
ATOM   5209  N  N     . LEU G  3 96  ? -24.807 -33.879 43.232 1.00 46.89  ? 96   LEU G N     1 
ATOM   5210  C  CA    . LEU G  3 96  ? -24.847 -33.215 41.950 1.00 45.83  ? 96   LEU G CA    1 
ATOM   5211  C  C     . LEU G  3 96  ? -25.753 -31.983 42.013 1.00 45.44  ? 96   LEU G C     1 
ATOM   5212  O  O     . LEU G  3 96  ? -25.466 -30.960 41.387 1.00 46.28  ? 96   LEU G O     1 
ATOM   5213  C  CB    . LEU G  3 96  ? -25.320 -34.188 40.869 1.00 45.83  ? 96   LEU G CB    1 
ATOM   5214  C  CG    . LEU G  3 96  ? -25.483 -33.696 39.432 1.00 45.18  ? 96   LEU G CG    1 
ATOM   5215  C  CD1   . LEU G  3 96  ? -24.117 -33.404 38.793 1.00 44.80  ? 96   LEU G CD1   1 
ATOM   5216  C  CD2   . LEU G  3 96  ? -26.260 -34.729 38.658 1.00 43.78  ? 96   LEU G CD2   1 
ATOM   5217  N  N     . LEU G  3 97  ? -26.834 -32.071 42.775 1.00 44.43  ? 97   LEU G N     1 
ATOM   5218  C  CA    . LEU G  3 97  ? -27.764 -30.953 42.898 1.00 43.25  ? 97   LEU G CA    1 
ATOM   5219  C  C     . LEU G  3 97  ? -27.666 -30.270 44.259 1.00 43.27  ? 97   LEU G C     1 
ATOM   5220  O  O     . LEU G  3 97  ? -28.648 -29.752 44.773 1.00 43.39  ? 97   LEU G O     1 
ATOM   5221  C  CB    . LEU G  3 97  ? -29.197 -31.418 42.611 1.00 42.47  ? 97   LEU G CB    1 
ATOM   5222  C  CG    . LEU G  3 97  ? -29.444 -32.088 41.253 1.00 42.16  ? 97   LEU G CG    1 
ATOM   5223  C  CD1   . LEU G  3 97  ? -30.926 -32.046 40.894 1.00 40.85  ? 97   LEU G CD1   1 
ATOM   5224  C  CD2   . LEU G  3 97  ? -28.624 -31.472 40.122 1.00 39.88  ? 97   LEU G CD2   1 
ATOM   5225  N  N     . GLY G  3 98  ? -26.475 -30.273 44.842 1.00 43.65  ? 98   GLY G N     1 
ATOM   5226  C  CA    . GLY G  3 98  ? -26.258 -29.674 46.159 1.00 44.47  ? 98   GLY G CA    1 
ATOM   5227  C  C     . GLY G  3 98  ? -26.524 -28.177 46.264 1.00 45.19  ? 98   GLY G C     1 
ATOM   5228  O  O     . GLY G  3 98  ? -26.862 -27.686 47.338 1.00 45.16  ? 98   GLY G O     1 
ATOM   5229  N  N     . ARG G  3 99  ? -26.376 -27.449 45.155 1.00 45.77  ? 99   ARG G N     1 
ATOM   5230  C  CA    . ARG G  3 99  ? -26.655 -25.995 45.134 1.00 46.35  ? 99   ARG G CA    1 
ATOM   5231  C  C     . ARG G  3 99  ? -27.910 -25.659 44.295 1.00 45.55  ? 99   ARG G C     1 
ATOM   5232  O  O     . ARG G  3 99  ? -28.008 -24.597 43.699 1.00 45.84  ? 99   ARG G O     1 
ATOM   5233  C  CB    . ARG G  3 99  ? -25.425 -25.198 44.645 1.00 46.58  ? 99   ARG G CB    1 
ATOM   5234  C  CG    . ARG G  3 99  ? -24.095 -25.461 45.399 1.00 49.43  ? 99   ARG G CG    1 
ATOM   5235  C  CD    . ARG G  3 99  ? -24.174 -24.966 46.842 1.00 56.72  ? 99   ARG G CD    1 
ATOM   5236  N  NE    . ARG G  3 99  ? -24.124 -23.494 46.895 1.00 63.17  ? 99   ARG G NE    1 
ATOM   5237  C  CZ    . ARG G  3 99  ? -24.728 -22.720 47.805 1.00 65.07  ? 99   ARG G CZ    1 
ATOM   5238  N  NH1   . ARG G  3 99  ? -25.461 -23.254 48.786 1.00 65.66  ? 99   ARG G NH1   1 
ATOM   5239  N  NH2   . ARG G  3 99  ? -24.599 -21.396 47.726 1.00 64.79  ? 99   ARG G NH2   1 
ATOM   5240  N  N     . VAL G  3 100 ? -28.862 -26.578 44.260 1.00 44.92  ? 100  VAL G N     1 
ATOM   5241  C  CA    . VAL G  3 100 ? -30.088 -26.427 43.468 1.00 44.28  ? 100  VAL G CA    1 
ATOM   5242  C  C     . VAL G  3 100 ? -31.296 -26.519 44.371 1.00 44.72  ? 100  VAL G C     1 
ATOM   5243  O  O     . VAL G  3 100 ? -31.269 -27.228 45.367 1.00 44.56  ? 100  VAL G O     1 
ATOM   5244  C  CB    . VAL G  3 100 ? -30.187 -27.516 42.365 1.00 44.29  ? 100  VAL G CB    1 
ATOM   5245  C  CG1   . VAL G  3 100 ? -31.567 -27.568 41.770 1.00 42.18  ? 100  VAL G CG1   1 
ATOM   5246  C  CG2   . VAL G  3 100 ? -29.101 -27.311 41.287 1.00 41.64  ? 100  VAL G CG2   1 
ATOM   5247  N  N     . THR G  3 101 ? -32.341 -25.771 44.026 1.00 45.75  ? 101  THR G N     1 
ATOM   5248  C  CA    . THR G  3 101 ? -33.604 -25.788 44.741 1.00 46.53  ? 101  THR G CA    1 
ATOM   5249  C  C     . THR G  3 101 ? -34.665 -26.273 43.774 1.00 47.09  ? 101  THR G C     1 
ATOM   5250  O  O     . THR G  3 101 ? -34.774 -25.770 42.665 1.00 47.19  ? 101  THR G O     1 
ATOM   5251  C  CB    . THR G  3 101 ? -33.963 -24.382 45.289 1.00 46.47  ? 101  THR G CB    1 
ATOM   5252  O  OG1   . THR G  3 101 ? -32.983 -23.995 46.250 1.00 47.97  ? 101  THR G OG1   1 
ATOM   5253  C  CG2   . THR G  3 101 ? -35.335 -24.361 45.978 1.00 45.54  ? 101  THR G CG2   1 
ATOM   5254  N  N     . ILE G  3 102 ? -35.423 -27.277 44.196 1.00 48.16  ? 102  ILE G N     1 
ATOM   5255  C  CA    . ILE G  3 102 ? -36.536 -27.809 43.417 1.00 48.68  ? 102  ILE G CA    1 
ATOM   5256  C  C     . ILE G  3 102 ? -37.732 -27.097 43.990 1.00 49.55  ? 102  ILE G C     1 
ATOM   5257  O  O     . ILE G  3 102 ? -38.011 -27.202 45.188 1.00 50.31  ? 102  ILE G O     1 
ATOM   5258  C  CB    . ILE G  3 102 ? -36.639 -29.366 43.560 1.00 48.72  ? 102  ILE G CB    1 
ATOM   5259  C  CG1   . ILE G  3 102 ? -35.648 -30.042 42.619 1.00 47.57  ? 102  ILE G CG1   1 
ATOM   5260  C  CG2   . ILE G  3 102 ? -38.077 -29.895 43.310 1.00 48.29  ? 102  ILE G CG2   1 
ATOM   5261  C  CD1   . ILE G  3 102 ? -35.116 -31.356 43.110 1.00 46.43  ? 102  ILE G CD1   1 
ATOM   5262  N  N     . ALA G  3 103 ? -38.400 -26.312 43.157 1.00 50.54  ? 103  ALA G N     1 
ATOM   5263  C  CA    . ALA G  3 103 ? -39.531 -25.523 43.607 1.00 51.24  ? 103  ALA G CA    1 
ATOM   5264  C  C     . ALA G  3 103 ? -40.669 -26.468 43.984 1.00 51.86  ? 103  ALA G C     1 
ATOM   5265  O  O     . ALA G  3 103 ? -40.903 -27.464 43.295 1.00 52.65  ? 103  ALA G O     1 
ATOM   5266  C  CB    . ALA G  3 103 ? -39.951 -24.556 42.530 1.00 50.80  ? 103  ALA G CB    1 
ATOM   5267  N  N     . GLN G  3 104 ? -41.360 -26.143 45.075 1.00 52.32  ? 104  GLN G N     1 
ATOM   5268  C  CA    . GLN G  3 104 ? -42.414 -26.976 45.674 1.00 52.85  ? 104  GLN G CA    1 
ATOM   5269  C  C     . GLN G  3 104 ? -41.963 -28.406 45.926 1.00 52.77  ? 104  GLN G C     1 
ATOM   5270  O  O     . GLN G  3 104 ? -42.696 -29.328 45.611 1.00 54.03  ? 104  GLN G O     1 
ATOM   5271  C  CB    . GLN G  3 104 ? -43.713 -26.972 44.850 1.00 53.23  ? 104  GLN G CB    1 
ATOM   5272  C  CG    . GLN G  3 104 ? -44.566 -25.714 44.957 1.00 56.04  ? 104  GLN G CG    1 
ATOM   5273  C  CD    . GLN G  3 104 ? -45.347 -25.615 46.270 1.00 61.32  ? 104  GLN G CD    1 
ATOM   5274  O  OE1   . GLN G  3 104 ? -46.315 -26.371 46.507 1.00 62.22  ? 104  GLN G OE1   1 
ATOM   5275  N  NE2   . GLN G  3 104 ? -44.940 -24.667 47.128 1.00 62.10  ? 104  GLN G NE2   1 
ATOM   5276  N  N     . GLY G  3 105 ? -40.779 -28.587 46.512 1.00 52.20  ? 105  GLY G N     1 
ATOM   5277  C  CA    . GLY G  3 105 ? -40.284 -29.908 46.886 1.00 51.37  ? 105  GLY G CA    1 
ATOM   5278  C  C     . GLY G  3 105 ? -40.274 -30.206 48.386 1.00 51.21  ? 105  GLY G C     1 
ATOM   5279  O  O     . GLY G  3 105 ? -40.282 -31.375 48.802 1.00 50.68  ? 105  GLY G O     1 
ATOM   5280  N  N     . GLY G  3 106 ? -40.254 -29.149 49.195 1.00 50.69  ? 106  GLY G N     1 
ATOM   5281  C  CA    . GLY G  3 106 ? -40.171 -29.255 50.635 1.00 50.60  ? 106  GLY G CA    1 
ATOM   5282  C  C     . GLY G  3 106 ? -38.877 -29.876 51.107 1.00 51.34  ? 106  GLY G C     1 
ATOM   5283  O  O     . GLY G  3 106 ? -37.855 -29.825 50.422 1.00 51.60  ? 106  GLY G O     1 
ATOM   5284  N  N     . VAL G  3 107 ? -38.928 -30.478 52.288 1.00 51.93  ? 107  VAL G N     1 
ATOM   5285  C  CA    . VAL G  3 107 ? -37.766 -31.101 52.908 1.00 52.11  ? 107  VAL G CA    1 
ATOM   5286  C  C     . VAL G  3 107 ? -38.031 -32.581 53.258 1.00 53.30  ? 107  VAL G C     1 
ATOM   5287  O  O     . VAL G  3 107 ? -39.192 -33.047 53.278 1.00 53.44  ? 107  VAL G O     1 
ATOM   5288  C  CB    . VAL G  3 107 ? -37.371 -30.350 54.182 1.00 51.54  ? 107  VAL G CB    1 
ATOM   5289  C  CG1   . VAL G  3 107 ? -36.901 -28.948 53.852 1.00 50.58  ? 107  VAL G CG1   1 
ATOM   5290  C  CG2   . VAL G  3 107 ? -38.541 -30.316 55.162 1.00 51.74  ? 107  VAL G CG2   1 
ATOM   5291  N  N     . LEU G  3 108 ? -36.953 -33.312 53.529 1.00 54.10  ? 108  LEU G N     1 
ATOM   5292  C  CA    . LEU G  3 108 ? -37.058 -34.633 54.125 1.00 55.06  ? 108  LEU G CA    1 
ATOM   5293  C  C     . LEU G  3 108 ? -37.501 -34.494 55.565 1.00 57.01  ? 108  LEU G C     1 
ATOM   5294  O  O     . LEU G  3 108 ? -37.003 -33.616 56.287 1.00 57.10  ? 108  LEU G O     1 
ATOM   5295  C  CB    . LEU G  3 108 ? -35.719 -35.359 54.114 1.00 54.30  ? 108  LEU G CB    1 
ATOM   5296  C  CG    . LEU G  3 108 ? -34.995 -35.664 52.809 1.00 50.93  ? 108  LEU G CG    1 
ATOM   5297  C  CD1   . LEU G  3 108 ? -33.824 -36.549 53.133 1.00 46.10  ? 108  LEU G CD1   1 
ATOM   5298  C  CD2   . LEU G  3 108 ? -35.932 -36.302 51.814 1.00 47.18  ? 108  LEU G CD2   1 
ATOM   5299  N  N     . PRO G  3 109 ? -38.469 -35.329 55.981 1.00 58.62  ? 109  PRO G N     1 
ATOM   5300  C  CA    . PRO G  3 109 ? -38.734 -35.517 57.397 1.00 59.89  ? 109  PRO G CA    1 
ATOM   5301  C  C     . PRO G  3 109 ? -37.460 -35.902 58.151 1.00 61.25  ? 109  PRO G C     1 
ATOM   5302  O  O     . PRO G  3 109 ? -36.934 -37.001 57.979 1.00 62.08  ? 109  PRO G O     1 
ATOM   5303  C  CB    . PRO G  3 109 ? -39.744 -36.661 57.401 1.00 59.61  ? 109  PRO G CB    1 
ATOM   5304  C  CG    . PRO G  3 109 ? -40.511 -36.446 56.136 1.00 59.20  ? 109  PRO G CG    1 
ATOM   5305  C  CD    . PRO G  3 109 ? -39.417 -36.091 55.149 1.00 58.88  ? 109  PRO G CD    1 
ATOM   5306  N  N     . ASN G  3 110 ? -36.964 -34.970 58.950 1.00 62.61  ? 110  ASN G N     1 
ATOM   5307  C  CA    . ASN G  3 110 ? -35.831 -35.198 59.818 1.00 64.17  ? 110  ASN G CA    1 
ATOM   5308  C  C     . ASN G  3 110 ? -36.021 -34.348 61.079 1.00 65.03  ? 110  ASN G C     1 
ATOM   5309  O  O     . ASN G  3 110 ? -36.204 -33.130 60.998 1.00 65.31  ? 110  ASN G O     1 
ATOM   5310  C  CB    . ASN G  3 110 ? -34.523 -34.850 59.090 1.00 64.27  ? 110  ASN G CB    1 
ATOM   5311  C  CG    . ASN G  3 110 ? -33.265 -35.289 59.860 1.00 65.48  ? 110  ASN G CG    1 
ATOM   5312  O  OD1   . ASN G  3 110 ? -32.180 -34.712 59.688 1.00 64.24  ? 110  ASN G OD1   1 
ATOM   5313  N  ND2   . ASN G  3 110 ? -33.409 -36.308 60.710 1.00 67.00  ? 110  ASN G ND2   1 
ATOM   5314  N  N     . ILE G  3 111 ? -36.013 -35.002 62.240 1.00 66.14  ? 111  ILE G N     1 
ATOM   5315  C  CA    . ILE G  3 111 ? -36.064 -34.305 63.531 1.00 66.75  ? 111  ILE G CA    1 
ATOM   5316  C  C     . ILE G  3 111 ? -34.931 -34.770 64.442 1.00 67.03  ? 111  ILE G C     1 
ATOM   5317  O  O     . ILE G  3 111 ? -34.809 -35.952 64.734 1.00 67.39  ? 111  ILE G O     1 
ATOM   5318  C  CB    . ILE G  3 111 ? -37.422 -34.499 64.250 1.00 66.84  ? 111  ILE G CB    1 
ATOM   5319  C  CG1   . ILE G  3 111 ? -38.578 -34.125 63.319 1.00 67.29  ? 111  ILE G CG1   1 
ATOM   5320  C  CG2   . ILE G  3 111 ? -37.476 -33.662 65.531 1.00 66.85  ? 111  ILE G CG2   1 
ATOM   5321  C  CD1   . ILE G  3 111 ? -39.934 -34.638 63.759 1.00 68.29  ? 111  ILE G CD1   1 
ATOM   5322  N  N     . GLN G  3 112 ? -34.110 -33.822 64.884 1.00 67.87  ? 112  GLN G N     1 
ATOM   5323  C  CA    . GLN G  3 112 ? -32.968 -34.086 65.761 1.00 68.20  ? 112  GLN G CA    1 
ATOM   5324  C  C     . GLN G  3 112 ? -33.376 -34.808 67.027 1.00 69.11  ? 112  GLN G C     1 
ATOM   5325  O  O     . GLN G  3 112 ? -34.354 -34.422 67.688 1.00 69.29  ? 112  GLN G O     1 
ATOM   5326  C  CB    . GLN G  3 112 ? -32.267 -32.776 66.120 1.00 68.08  ? 112  GLN G CB    1 
ATOM   5327  C  CG    . GLN G  3 112 ? -31.767 -32.008 64.916 1.00 66.51  ? 112  GLN G CG    1 
ATOM   5328  C  CD    . GLN G  3 112 ? -30.748 -32.784 64.115 1.00 64.72  ? 112  GLN G CD    1 
ATOM   5329  O  OE1   . GLN G  3 112 ? -29.712 -33.190 64.636 1.00 64.00  ? 112  GLN G OE1   1 
ATOM   5330  N  NE2   . GLN G  3 112 ? -31.039 -32.996 62.837 1.00 64.49  ? 112  GLN G NE2   1 
ATOM   5331  N  N     . SER G  3 113 ? -32.611 -35.846 67.362 1.00 70.01  ? 113  SER G N     1 
ATOM   5332  C  CA    . SER G  3 113 ? -32.951 -36.774 68.445 1.00 70.92  ? 113  SER G CA    1 
ATOM   5333  C  C     . SER G  3 113 ? -33.075 -36.130 69.834 1.00 71.60  ? 113  SER G C     1 
ATOM   5334  O  O     . SER G  3 113 ? -33.863 -36.578 70.665 1.00 71.75  ? 113  SER G O     1 
ATOM   5335  C  CB    . SER G  3 113 ? -31.946 -37.925 68.483 1.00 70.79  ? 113  SER G CB    1 
ATOM   5336  O  OG    . SER G  3 113 ? -30.706 -37.500 69.015 1.00 71.14  ? 113  SER G OG    1 
ATOM   5337  N  N     . VAL G  3 114 ? -32.305 -35.072 70.066 1.00 72.68  ? 114  VAL G N     1 
ATOM   5338  C  CA    . VAL G  3 114 ? -32.302 -34.359 71.348 1.00 73.53  ? 114  VAL G CA    1 
ATOM   5339  C  C     . VAL G  3 114 ? -33.594 -33.553 71.562 1.00 74.28  ? 114  VAL G C     1 
ATOM   5340  O  O     . VAL G  3 114 ? -33.902 -33.128 72.673 1.00 74.15  ? 114  VAL G O     1 
ATOM   5341  C  CB    . VAL G  3 114 ? -31.049 -33.460 71.470 1.00 73.46  ? 114  VAL G CB    1 
ATOM   5342  C  CG1   . VAL G  3 114 ? -31.207 -32.195 70.625 1.00 73.05  ? 114  VAL G CG1   1 
ATOM   5343  C  CG2   . VAL G  3 114 ? -30.737 -33.142 72.949 1.00 73.27  ? 114  VAL G CG2   1 
ATOM   5344  N  N     . LEU G  3 115 ? -34.351 -33.370 70.488 1.00 75.57  ? 115  LEU G N     1 
ATOM   5345  C  CA    . LEU G  3 115 ? -35.610 -32.636 70.535 1.00 76.71  ? 115  LEU G CA    1 
ATOM   5346  C  C     . LEU G  3 115 ? -36.807 -33.568 70.786 1.00 77.90  ? 115  LEU G C     1 
ATOM   5347  O  O     . LEU G  3 115 ? -37.895 -33.105 71.138 1.00 78.06  ? 115  LEU G O     1 
ATOM   5348  C  CB    . LEU G  3 115 ? -35.800 -31.817 69.243 1.00 76.34  ? 115  LEU G CB    1 
ATOM   5349  C  CG    . LEU G  3 115 ? -34.701 -30.833 68.808 1.00 75.40  ? 115  LEU G CG    1 
ATOM   5350  C  CD1   . LEU G  3 115 ? -34.946 -30.347 67.393 1.00 74.57  ? 115  LEU G CD1   1 
ATOM   5351  C  CD2   . LEU G  3 115 ? -34.559 -29.651 69.758 1.00 74.51  ? 115  LEU G CD2   1 
ATOM   5352  N  N     . LEU G  3 116 ? -36.593 -34.873 70.605 1.00 79.46  ? 116  LEU G N     1 
ATOM   5353  C  CA    . LEU G  3 116 ? -37.634 -35.893 70.795 1.00 80.97  ? 116  LEU G CA    1 
ATOM   5354  C  C     . LEU G  3 116 ? -38.034 -36.065 72.270 1.00 82.08  ? 116  LEU G C     1 
ATOM   5355  O  O     . LEU G  3 116 ? -37.169 -36.005 73.149 1.00 82.01  ? 116  LEU G O     1 
ATOM   5356  C  CB    . LEU G  3 116 ? -37.198 -37.243 70.196 1.00 80.90  ? 116  LEU G CB    1 
ATOM   5357  C  CG    . LEU G  3 116 ? -37.094 -37.386 68.669 1.00 81.10  ? 116  LEU G CG    1 
ATOM   5358  C  CD1   . LEU G  3 116 ? -36.761 -38.826 68.277 1.00 81.14  ? 116  LEU G CD1   1 
ATOM   5359  C  CD2   . LEU G  3 116 ? -38.354 -36.914 67.947 1.00 80.91  ? 116  LEU G CD2   1 
ATOM   5360  N  N     . PRO G  3 117 ? -39.348 -36.278 72.532 1.00 83.28  ? 117  PRO G N     1 
ATOM   5361  C  CA    . PRO G  3 117 ? -40.003 -36.435 73.840 1.00 84.18  ? 117  PRO G CA    1 
ATOM   5362  C  C     . PRO G  3 117 ? -39.166 -37.066 74.963 1.00 84.97  ? 117  PRO G C     1 
ATOM   5363  O  O     . PRO G  3 117 ? -38.487 -38.075 74.746 1.00 84.92  ? 117  PRO G O     1 
ATOM   5364  C  CB    . PRO G  3 117 ? -41.199 -37.334 73.508 1.00 84.22  ? 117  PRO G CB    1 
ATOM   5365  C  CG    . PRO G  3 117 ? -41.593 -36.909 72.125 1.00 83.97  ? 117  PRO G CG    1 
ATOM   5366  C  CD    . PRO G  3 117 ? -40.342 -36.377 71.441 1.00 83.49  ? 117  PRO G CD    1 
ATOM   5367  N  N     . LYS G  3 118 ? -39.253 -36.460 76.151 1.00 85.95  ? 118  LYS G N     1 
ATOM   5368  C  CA    . LYS G  3 118 ? -38.527 -36.871 77.369 1.00 86.95  ? 118  LYS G CA    1 
ATOM   5369  C  C     . LYS G  3 118 ? -37.042 -37.179 77.162 1.00 86.97  ? 118  LYS G C     1 
ATOM   5370  O  O     . LYS G  3 118 ? -36.229 -36.972 78.133 1.00 87.34  ? 118  LYS G O     1 
ATOM   5371  C  CB    . LYS G  3 118 ? -39.235 -38.036 78.088 1.00 87.04  ? 118  LYS G CB    1 
ATOM   5372  C  CG    . LYS G  3 118 ? -38.957 -39.434 77.524 1.00 87.65  ? 118  LYS G CG    1 
ATOM   5373  C  CD    . LYS G  3 118 ? -39.898 -40.469 78.152 1.00 88.18  ? 118  LYS G CD    1 
ATOM   5374  C  CE    . LYS G  3 118 ? -39.982 -41.750 77.324 1.00 90.16  ? 118  LYS G CE    1 
ATOM   5375  N  NZ    . LYS G  3 118 ? -40.467 -41.498 75.924 1.00 90.31  ? 118  LYS G NZ    1 
ATOM   5376  N  N     . LYS H  4 27  ? -51.271 -19.291 11.667 1.00 118.11 ? 24   LYS H N     1 
ATOM   5377  C  CA    . LYS H  4 27  ? -50.830 -18.754 12.992 1.00 118.04 ? 24   LYS H CA    1 
ATOM   5378  C  C     . LYS H  4 27  ? -49.329 -18.946 13.209 1.00 117.85 ? 24   LYS H C     1 
ATOM   5379  O  O     . LYS H  4 27  ? -48.889 -19.839 13.951 1.00 117.88 ? 24   LYS H O     1 
ATOM   5380  C  CB    . LYS H  4 27  ? -51.655 -19.354 14.142 1.00 118.06 ? 24   LYS H CB    1 
ATOM   5381  C  CG    . LYS H  4 27  ? -52.998 -18.649 14.363 1.00 118.30 ? 24   LYS H CG    1 
ATOM   5382  C  CD    . LYS H  4 27  ? -53.876 -19.362 15.388 1.00 118.09 ? 24   LYS H CD    1 
ATOM   5383  C  CE    . LYS H  4 27  ? -54.573 -20.586 14.797 1.00 117.98 ? 24   LYS H CE    1 
ATOM   5384  N  NZ    . LYS H  4 27  ? -55.700 -20.220 13.896 1.00 117.63 ? 24   LYS H NZ    1 
ATOM   5385  N  N     . LYS H  4 28  ? -48.558 -18.096 12.534 1.00 117.54 ? 25   LYS H N     1 
ATOM   5386  C  CA    . LYS H  4 28  ? -47.100 -18.046 12.675 1.00 117.07 ? 25   LYS H CA    1 
ATOM   5387  C  C     . LYS H  4 28  ? -46.636 -16.775 13.403 1.00 116.48 ? 25   LYS H C     1 
ATOM   5388  O  O     . LYS H  4 28  ? -45.434 -16.498 13.475 1.00 116.45 ? 25   LYS H O     1 
ATOM   5389  C  CB    . LYS H  4 28  ? -46.402 -18.206 11.306 1.00 117.23 ? 25   LYS H CB    1 
ATOM   5390  C  CG    . LYS H  4 28  ? -47.092 -17.520 10.109 1.00 117.58 ? 25   LYS H CG    1 
ATOM   5391  C  CD    . LYS H  4 28  ? -46.639 -16.069 9.897  1.00 118.42 ? 25   LYS H CD    1 
ATOM   5392  C  CE    . LYS H  4 28  ? -45.293 -15.988 9.171  1.00 118.61 ? 25   LYS H CE    1 
ATOM   5393  N  NZ    . LYS H  4 28  ? -44.829 -14.582 8.995  1.00 118.41 ? 25   LYS H NZ    1 
ATOM   5394  N  N     . ARG H  4 29  ? -47.596 -16.027 13.956 1.00 115.75 ? 26   ARG H N     1 
ATOM   5395  C  CA    . ARG H  4 29  ? -47.314 -14.766 14.651 1.00 114.99 ? 26   ARG H CA    1 
ATOM   5396  C  C     . ARG H  4 29  ? -46.856 -14.941 16.109 1.00 114.23 ? 26   ARG H C     1 
ATOM   5397  O  O     . ARG H  4 29  ? -45.648 -14.988 16.370 1.00 114.05 ? 26   ARG H O     1 
ATOM   5398  C  CB    . ARG H  4 29  ? -48.490 -13.782 14.540 1.00 114.97 ? 26   ARG H CB    1 
ATOM   5399  C  CG    . ARG H  4 29  ? -48.136 -12.356 14.977 1.00 115.36 ? 26   ARG H CG    1 
ATOM   5400  C  CD    . ARG H  4 29  ? -49.224 -11.337 14.655 1.00 115.59 ? 26   ARG H CD    1 
ATOM   5401  N  NE    . ARG H  4 29  ? -50.456 -11.567 15.409 1.00 117.21 ? 26   ARG H NE    1 
ATOM   5402  C  CZ    . ARG H  4 29  ? -51.592 -12.032 14.886 1.00 117.74 ? 26   ARG H CZ    1 
ATOM   5403  N  NH1   . ARG H  4 29  ? -51.676 -12.321 13.587 1.00 117.69 ? 26   ARG H NH1   1 
ATOM   5404  N  NH2   . ARG H  4 29  ? -52.652 -12.202 15.666 1.00 117.79 ? 26   ARG H NH2   1 
ATOM   5405  N  N     . ARG H  4 30  ? -47.808 -15.047 17.045 1.00 113.28 ? 27   ARG H N     1 
ATOM   5406  C  CA    . ARG H  4 30  ? -47.497 -15.121 18.493 1.00 112.15 ? 27   ARG H CA    1 
ATOM   5407  C  C     . ARG H  4 30  ? -46.640 -16.345 18.849 1.00 110.79 ? 27   ARG H C     1 
ATOM   5408  O  O     . ARG H  4 30  ? -46.208 -16.529 19.994 1.00 110.59 ? 27   ARG H O     1 
ATOM   5409  C  CB    . ARG H  4 30  ? -48.767 -15.042 19.367 1.00 112.47 ? 27   ARG H CB    1 
ATOM   5410  C  CG    . ARG H  4 30  ? -49.590 -13.736 19.254 1.00 113.76 ? 27   ARG H CG    1 
ATOM   5411  C  CD    . ARG H  4 30  ? -48.742 -12.454 19.355 1.00 115.80 ? 27   ARG H CD    1 
ATOM   5412  N  NE    . ARG H  4 30  ? -49.554 -11.258 19.620 1.00 117.16 ? 27   ARG H NE    1 
ATOM   5413  C  CZ    . ARG H  4 30  ? -49.278 -10.029 19.176 1.00 117.58 ? 27   ARG H CZ    1 
ATOM   5414  N  NH1   . ARG H  4 30  ? -48.212 -9.804  18.412 1.00 117.88 ? 27   ARG H NH1   1 
ATOM   5415  N  NH2   . ARG H  4 30  ? -50.081 -9.017  19.484 1.00 117.25 ? 27   ARG H NH2   1 
ATOM   5416  N  N     . LYS H  4 31  ? -46.402 -17.177 17.844 1.00 109.14 ? 28   LYS H N     1 
ATOM   5417  C  CA    . LYS H  4 31  ? -45.391 -18.206 17.921 1.00 107.36 ? 28   LYS H CA    1 
ATOM   5418  C  C     . LYS H  4 31  ? -44.024 -17.567 17.703 1.00 105.71 ? 28   LYS H C     1 
ATOM   5419  O  O     . LYS H  4 31  ? -43.685 -17.141 16.592 1.00 105.74 ? 28   LYS H O     1 
ATOM   5420  C  CB    . LYS H  4 31  ? -45.655 -19.292 16.865 1.00 107.58 ? 28   LYS H CB    1 
ATOM   5421  C  CG    . LYS H  4 31  ? -44.513 -20.293 16.641 1.00 107.62 ? 28   LYS H CG    1 
ATOM   5422  C  CD    . LYS H  4 31  ? -44.644 -21.009 15.294 1.00 107.83 ? 28   LYS H CD    1 
ATOM   5423  C  CE    . LYS H  4 31  ? -44.219 -20.118 14.111 1.00 108.66 ? 28   LYS H CE    1 
ATOM   5424  N  NZ    . LYS H  4 31  ? -42.737 -19.940 14.003 1.00 108.62 ? 28   LYS H NZ    1 
ATOM   5425  N  N     . THR H  4 32  ? -43.272 -17.438 18.786 1.00 103.51 ? 29   THR H N     1 
ATOM   5426  C  CA    . THR H  4 32  ? -41.832 -17.529 18.689 1.00 101.27 ? 29   THR H CA    1 
ATOM   5427  C  C     . THR H  4 32  ? -41.568 -18.822 19.426 1.00 99.83  ? 29   THR H C     1 
ATOM   5428  O  O     . THR H  4 32  ? -41.797 -18.921 20.634 1.00 99.79  ? 29   THR H O     1 
ATOM   5429  C  CB    . THR H  4 32  ? -41.092 -16.341 19.301 1.00 101.22 ? 29   THR H CB    1 
ATOM   5430  O  OG1   . THR H  4 32  ? -41.612 -15.134 18.741 1.00 101.35 ? 29   THR H OG1   1 
ATOM   5431  C  CG2   . THR H  4 32  ? -39.605 -16.417 18.969 1.00 100.83 ? 29   THR H CG2   1 
ATOM   5432  N  N     . ARG H  4 33  ? -41.155 -19.829 18.665 1.00 97.78  ? 30   ARG H N     1 
ATOM   5433  C  CA    . ARG H  4 33  ? -41.018 -21.185 19.166 1.00 95.78  ? 30   ARG H CA    1 
ATOM   5434  C  C     . ARG H  4 33  ? -40.156 -21.240 20.417 1.00 94.00  ? 30   ARG H C     1 
ATOM   5435  O  O     . ARG H  4 33  ? -38.982 -20.866 20.388 1.00 94.00  ? 30   ARG H O     1 
ATOM   5436  C  CB    . ARG H  4 33  ? -40.434 -22.094 18.084 1.00 96.06  ? 30   ARG H CB    1 
ATOM   5437  C  CG    . ARG H  4 33  ? -41.444 -22.607 17.068 1.00 96.80  ? 30   ARG H CG    1 
ATOM   5438  C  CD    . ARG H  4 33  ? -40.742 -23.294 15.896 1.00 98.96  ? 30   ARG H CD    1 
ATOM   5439  N  NE    . ARG H  4 33  ? -39.698 -24.232 16.330 1.00 100.23 ? 30   ARG H NE    1 
ATOM   5440  C  CZ    . ARG H  4 33  ? -39.857 -25.550 16.467 1.00 100.62 ? 30   ARG H CZ    1 
ATOM   5441  N  NH1   . ARG H  4 33  ? -41.024 -26.130 16.204 1.00 101.14 ? 30   ARG H NH1   1 
ATOM   5442  N  NH2   . ARG H  4 33  ? -38.838 -26.298 16.869 1.00 100.60 ? 30   ARG H NH2   1 
ATOM   5443  N  N     . LYS H  4 34  ? -40.766 -21.681 21.515 1.00 91.67  ? 31   LYS H N     1 
ATOM   5444  C  CA    . LYS H  4 34  ? -40.046 -22.009 22.743 1.00 89.34  ? 31   LYS H CA    1 
ATOM   5445  C  C     . LYS H  4 34  ? -39.837 -23.525 22.797 1.00 87.45  ? 31   LYS H C     1 
ATOM   5446  O  O     . LYS H  4 34  ? -40.776 -24.286 23.046 1.00 87.13  ? 31   LYS H O     1 
ATOM   5447  C  CB    . LYS H  4 34  ? -40.817 -21.516 23.981 1.00 89.50  ? 31   LYS H CB    1 
ATOM   5448  C  CG    . LYS H  4 34  ? -40.027 -21.583 25.291 1.00 89.99  ? 31   LYS H CG    1 
ATOM   5449  C  CD    . LYS H  4 34  ? -38.985 -20.467 25.395 1.00 90.64  ? 31   LYS H CD    1 
ATOM   5450  C  CE    . LYS H  4 34  ? -37.693 -20.944 26.066 1.00 91.30  ? 31   LYS H CE    1 
ATOM   5451  N  NZ    . LYS H  4 34  ? -36.869 -21.871 25.213 1.00 90.93  ? 31   LYS H NZ    1 
ATOM   5452  N  N     . GLU H  4 35  ? -38.609 -23.964 22.544 1.00 85.00  ? 32   GLU H N     1 
ATOM   5453  C  CA    . GLU H  4 35  ? -38.315 -25.390 22.577 1.00 82.65  ? 32   GLU H CA    1 
ATOM   5454  C  C     . GLU H  4 35  ? -37.920 -25.856 23.980 1.00 80.48  ? 32   GLU H C     1 
ATOM   5455  O  O     . GLU H  4 35  ? -37.369 -25.094 24.769 1.00 80.39  ? 32   GLU H O     1 
ATOM   5456  C  CB    . GLU H  4 35  ? -37.282 -25.782 21.505 1.00 82.62  ? 32   GLU H CB    1 
ATOM   5457  C  CG    . GLU H  4 35  ? -35.843 -25.395 21.793 1.00 83.05  ? 32   GLU H CG    1 
ATOM   5458  C  CD    . GLU H  4 35  ? -34.958 -25.393 20.541 1.00 83.58  ? 32   GLU H CD    1 
ATOM   5459  O  OE1   . GLU H  4 35  ? -35.381 -25.935 19.478 1.00 83.99  ? 32   GLU H OE1   1 
ATOM   5460  O  OE2   . GLU H  4 35  ? -33.831 -24.840 20.632 1.00 83.77  ? 32   GLU H OE2   1 
ATOM   5461  N  N     . SER H  4 36  ? -38.247 -27.103 24.294 1.00 77.96  ? 33   SER H N     1 
ATOM   5462  C  CA    . SER H  4 36  ? -37.913 -27.690 25.579 1.00 75.37  ? 33   SER H CA    1 
ATOM   5463  C  C     . SER H  4 36  ? -37.698 -29.179 25.411 1.00 73.84  ? 33   SER H C     1 
ATOM   5464  O  O     . SER H  4 36  ? -37.981 -29.730 24.351 1.00 73.73  ? 33   SER H O     1 
ATOM   5465  C  CB    . SER H  4 36  ? -39.015 -27.421 26.600 1.00 75.40  ? 33   SER H CB    1 
ATOM   5466  O  OG    . SER H  4 36  ? -40.058 -28.359 26.497 1.00 74.27  ? 33   SER H OG    1 
ATOM   5467  N  N     . TYR H  4 37  ? -37.197 -29.823 26.462 1.00 71.92  ? 34   TYR H N     1 
ATOM   5468  C  CA    . TYR H  4 37  ? -36.925 -31.261 26.450 1.00 69.90  ? 34   TYR H CA    1 
ATOM   5469  C  C     . TYR H  4 37  ? -38.133 -32.096 26.837 1.00 69.35  ? 34   TYR H C     1 
ATOM   5470  O  O     . TYR H  4 37  ? -38.059 -33.318 26.814 1.00 69.25  ? 34   TYR H O     1 
ATOM   5471  C  CB    . TYR H  4 37  ? -35.763 -31.592 27.385 1.00 68.86  ? 34   TYR H CB    1 
ATOM   5472  C  CG    . TYR H  4 37  ? -34.416 -31.135 26.873 1.00 67.39  ? 34   TYR H CG    1 
ATOM   5473  C  CD1   . TYR H  4 37  ? -33.796 -30.004 27.407 1.00 64.97  ? 34   TYR H CD1   1 
ATOM   5474  C  CD2   . TYR H  4 37  ? -33.761 -31.834 25.854 1.00 65.57  ? 34   TYR H CD2   1 
ATOM   5475  C  CE1   . TYR H  4 37  ? -32.568 -29.583 26.949 1.00 64.32  ? 34   TYR H CE1   1 
ATOM   5476  C  CE2   . TYR H  4 37  ? -32.525 -31.415 25.384 1.00 65.64  ? 34   TYR H CE2   1 
ATOM   5477  C  CZ    . TYR H  4 37  ? -31.939 -30.289 25.940 1.00 65.27  ? 34   TYR H CZ    1 
ATOM   5478  O  OH    . TYR H  4 37  ? -30.721 -29.869 25.489 1.00 65.61  ? 34   TYR H OH    1 
ATOM   5479  N  N     . ALA H  4 38  ? -39.242 -31.429 27.161 1.00 68.92  ? 35   ALA H N     1 
ATOM   5480  C  CA    . ALA H  4 38  ? -40.446 -32.060 27.721 1.00 68.76  ? 35   ALA H CA    1 
ATOM   5481  C  C     . ALA H  4 38  ? -40.957 -33.330 27.032 1.00 68.88  ? 35   ALA H C     1 
ATOM   5482  O  O     . ALA H  4 38  ? -41.400 -34.254 27.715 1.00 69.45  ? 35   ALA H O     1 
ATOM   5483  C  CB    . ALA H  4 38  ? -41.563 -31.048 27.852 1.00 68.44  ? 35   ALA H CB    1 
ATOM   5484  N  N     . ILE H  4 39  ? -40.907 -33.387 25.703 1.00 68.56  ? 36   ILE H N     1 
ATOM   5485  C  CA    . ILE H  4 39  ? -41.382 -34.576 24.993 1.00 68.37  ? 36   ILE H CA    1 
ATOM   5486  C  C     . ILE H  4 39  ? -40.395 -35.742 25.057 1.00 68.32  ? 36   ILE H C     1 
ATOM   5487  O  O     . ILE H  4 39  ? -40.804 -36.915 25.055 1.00 68.59  ? 36   ILE H O     1 
ATOM   5488  C  CB    . ILE H  4 39  ? -41.796 -34.295 23.511 1.00 68.55  ? 36   ILE H CB    1 
ATOM   5489  C  CG1   . ILE H  4 39  ? -40.676 -33.625 22.718 1.00 67.75  ? 36   ILE H CG1   1 
ATOM   5490  C  CG2   . ILE H  4 39  ? -43.071 -33.458 23.456 1.00 69.12  ? 36   ILE H CG2   1 
ATOM   5491  C  CD1   . ILE H  4 39  ? -40.777 -33.892 21.247 1.00 67.97  ? 36   ILE H CD1   1 
ATOM   5492  N  N     . TYR H  4 40  ? -39.106 -35.418 25.113 1.00 67.74  ? 37   TYR H N     1 
ATOM   5493  C  CA    . TYR H  4 40  ? -38.057 -36.428 25.201 1.00 67.11  ? 37   TYR H CA    1 
ATOM   5494  C  C     . TYR H  4 40  ? -37.939 -36.945 26.620 1.00 66.76  ? 37   TYR H C     1 
ATOM   5495  O  O     . TYR H  4 40  ? -37.617 -38.119 26.823 1.00 67.17  ? 37   TYR H O     1 
ATOM   5496  C  CB    . TYR H  4 40  ? -36.720 -35.873 24.734 1.00 67.27  ? 37   TYR H CB    1 
ATOM   5497  C  CG    . TYR H  4 40  ? -36.794 -35.174 23.405 1.00 68.20  ? 37   TYR H CG    1 
ATOM   5498  C  CD1   . TYR H  4 40  ? -36.896 -33.785 23.332 1.00 68.53  ? 37   TYR H CD1   1 
ATOM   5499  C  CD2   . TYR H  4 40  ? -36.781 -35.898 22.214 1.00 68.68  ? 37   TYR H CD2   1 
ATOM   5500  C  CE1   . TYR H  4 40  ? -36.979 -33.140 22.109 1.00 68.74  ? 37   TYR H CE1   1 
ATOM   5501  C  CE2   . TYR H  4 40  ? -36.852 -35.260 20.987 1.00 68.98  ? 37   TYR H CE2   1 
ATOM   5502  C  CZ    . TYR H  4 40  ? -36.954 -33.879 20.942 1.00 68.82  ? 37   TYR H CZ    1 
ATOM   5503  O  OH    . TYR H  4 40  ? -37.021 -33.238 19.721 1.00 69.35  ? 37   TYR H OH    1 
ATOM   5504  N  N     . VAL H  4 41  ? -38.191 -36.073 27.595 1.00 65.77  ? 38   VAL H N     1 
ATOM   5505  C  CA    . VAL H  4 41  ? -38.265 -36.483 28.985 1.00 65.32  ? 38   VAL H CA    1 
ATOM   5506  C  C     . VAL H  4 41  ? -39.441 -37.458 29.153 1.00 65.71  ? 38   VAL H C     1 
ATOM   5507  O  O     . VAL H  4 41  ? -39.296 -38.510 29.774 1.00 65.76  ? 38   VAL H O     1 
ATOM   5508  C  CB    . VAL H  4 41  ? -38.397 -35.265 29.940 1.00 65.10  ? 38   VAL H CB    1 
ATOM   5509  C  CG1   . VAL H  4 41  ? -38.679 -35.712 31.369 1.00 64.30  ? 38   VAL H CG1   1 
ATOM   5510  C  CG2   . VAL H  4 41  ? -37.134 -34.397 29.900 1.00 64.36  ? 38   VAL H CG2   1 
ATOM   5511  N  N     . TYR H  4 42  ? -40.588 -37.110 28.569 1.00 66.04  ? 39   TYR H N     1 
ATOM   5512  C  CA    . TYR H  4 42  ? -41.799 -37.921 28.638 1.00 66.27  ? 39   TYR H CA    1 
ATOM   5513  C  C     . TYR H  4 42  ? -41.626 -39.312 28.009 1.00 65.82  ? 39   TYR H C     1 
ATOM   5514  O  O     . TYR H  4 42  ? -42.150 -40.288 28.530 1.00 65.81  ? 39   TYR H O     1 
ATOM   5515  C  CB    . TYR H  4 42  ? -42.957 -37.179 27.977 1.00 67.33  ? 39   TYR H CB    1 
ATOM   5516  C  CG    . TYR H  4 42  ? -44.320 -37.832 28.148 1.00 68.71  ? 39   TYR H CG    1 
ATOM   5517  C  CD1   . TYR H  4 42  ? -45.111 -37.556 29.266 1.00 69.58  ? 39   TYR H CD1   1 
ATOM   5518  C  CD2   . TYR H  4 42  ? -44.827 -38.705 27.177 1.00 69.62  ? 39   TYR H CD2   1 
ATOM   5519  C  CE1   . TYR H  4 42  ? -46.365 -38.147 29.420 1.00 71.12  ? 39   TYR H CE1   1 
ATOM   5520  C  CE2   . TYR H  4 42  ? -46.077 -39.298 27.315 1.00 69.82  ? 39   TYR H CE2   1 
ATOM   5521  C  CZ    . TYR H  4 42  ? -46.842 -39.016 28.437 1.00 70.32  ? 39   TYR H CZ    1 
ATOM   5522  O  OH    . TYR H  4 42  ? -48.086 -39.595 28.581 1.00 70.38  ? 39   TYR H OH    1 
ATOM   5523  N  N     . LYS H  4 43  ? -40.895 -39.388 26.896 1.00 65.13  ? 40   LYS H N     1 
ATOM   5524  C  CA    . LYS H  4 43  ? -40.535 -40.659 26.273 1.00 64.26  ? 40   LYS H CA    1 
ATOM   5525  C  C     . LYS H  4 43  ? -39.800 -41.577 27.241 1.00 63.95  ? 40   LYS H C     1 
ATOM   5526  O  O     . LYS H  4 43  ? -40.186 -42.733 27.413 1.00 64.28  ? 40   LYS H O     1 
ATOM   5527  C  CB    . LYS H  4 43  ? -39.663 -40.427 25.046 1.00 64.10  ? 40   LYS H CB    1 
ATOM   5528  C  CG    . LYS H  4 43  ? -40.418 -40.105 23.799 1.00 64.45  ? 40   LYS H CG    1 
ATOM   5529  C  CD    . LYS H  4 43  ? -39.440 -39.802 22.687 1.00 66.89  ? 40   LYS H CD    1 
ATOM   5530  C  CE    . LYS H  4 43  ? -40.134 -39.325 21.421 1.00 67.82  ? 40   LYS H CE    1 
ATOM   5531  N  NZ    . LYS H  4 43  ? -39.120 -38.756 20.488 1.00 68.50  ? 40   LYS H NZ    1 
ATOM   5532  N  N     . VAL H  4 44  ? -38.738 -41.051 27.854 1.00 63.77  ? 41   VAL H N     1 
ATOM   5533  C  CA    . VAL H  4 44  ? -37.911 -41.764 28.843 1.00 62.91  ? 41   VAL H CA    1 
ATOM   5534  C  C     . VAL H  4 44  ? -38.719 -42.157 30.086 1.00 62.88  ? 41   VAL H C     1 
ATOM   5535  O  O     . VAL H  4 44  ? -38.429 -43.170 30.735 1.00 62.44  ? 41   VAL H O     1 
ATOM   5536  C  CB    . VAL H  4 44  ? -36.667 -40.921 29.264 1.00 62.76  ? 41   VAL H CB    1 
ATOM   5537  C  CG1   . VAL H  4 44  ? -35.695 -41.747 30.103 1.00 61.84  ? 41   VAL H CG1   1 
ATOM   5538  C  CG2   . VAL H  4 44  ? -35.934 -40.373 28.039 1.00 61.88  ? 41   VAL H CG2   1 
ATOM   5539  N  N     . LEU H  4 45  ? -39.726 -41.353 30.423 1.00 62.71  ? 42   LEU H N     1 
ATOM   5540  C  CA    . LEU H  4 45  ? -40.626 -41.707 31.509 1.00 62.70  ? 42   LEU H CA    1 
ATOM   5541  C  C     . LEU H  4 45  ? -41.310 -43.056 31.234 1.00 63.34  ? 42   LEU H C     1 
ATOM   5542  O  O     . LEU H  4 45  ? -41.389 -43.906 32.117 1.00 63.85  ? 42   LEU H O     1 
ATOM   5543  C  CB    . LEU H  4 45  ? -41.659 -40.606 31.730 1.00 62.30  ? 42   LEU H CB    1 
ATOM   5544  C  CG    . LEU H  4 45  ? -42.648 -40.769 32.888 1.00 61.81  ? 42   LEU H CG    1 
ATOM   5545  C  CD1   . LEU H  4 45  ? -41.980 -41.175 34.182 1.00 61.15  ? 42   LEU H CD1   1 
ATOM   5546  C  CD2   . LEU H  4 45  ? -43.442 -39.494 33.086 1.00 62.39  ? 42   LEU H CD2   1 
ATOM   5547  N  N     . LYS H  4 46  ? -41.777 -43.251 30.001 1.00 63.63  ? 43   LYS H N     1 
ATOM   5548  C  CA    . LYS H  4 46  ? -42.566 -44.416 29.633 1.00 63.79  ? 43   LYS H CA    1 
ATOM   5549  C  C     . LYS H  4 46  ? -41.714 -45.683 29.548 1.00 64.72  ? 43   LYS H C     1 
ATOM   5550  O  O     . LYS H  4 46  ? -42.187 -46.773 29.882 1.00 64.88  ? 43   LYS H O     1 
ATOM   5551  C  CB    . LYS H  4 46  ? -43.299 -44.154 28.321 1.00 63.80  ? 43   LYS H CB    1 
ATOM   5552  C  CG    . LYS H  4 46  ? -44.040 -42.809 28.251 1.00 61.91  ? 43   LYS H CG    1 
ATOM   5553  C  CD    . LYS H  4 46  ? -45.444 -42.854 28.847 1.00 60.10  ? 43   LYS H CD    1 
ATOM   5554  C  CE    . LYS H  4 46  ? -45.432 -42.781 30.375 1.00 58.14  ? 43   LYS H CE    1 
ATOM   5555  N  NZ    . LYS H  4 46  ? -46.794 -42.696 30.933 1.00 56.36  ? 43   LYS H NZ    1 
ATOM   5556  N  N     . GLN H  4 47  ? -40.462 -45.523 29.114 1.00 65.32  ? 44   GLN H N     1 
ATOM   5557  C  CA    . GLN H  4 47  ? -39.460 -46.590 29.109 1.00 66.21  ? 44   GLN H CA    1 
ATOM   5558  C  C     . GLN H  4 47  ? -39.138 -47.104 30.513 1.00 66.12  ? 44   GLN H C     1 
ATOM   5559  O  O     . GLN H  4 47  ? -38.785 -48.276 30.688 1.00 66.42  ? 44   GLN H O     1 
ATOM   5560  C  CB    . GLN H  4 47  ? -38.156 -46.100 28.464 1.00 65.89  ? 44   GLN H CB    1 
ATOM   5561  C  CG    . GLN H  4 47  ? -38.039 -46.332 26.969 1.00 67.28  ? 44   GLN H CG    1 
ATOM   5562  C  CD    . GLN H  4 47  ? -36.580 -46.277 26.463 1.00 68.07  ? 44   GLN H CD    1 
ATOM   5563  O  OE1   . GLN H  4 47  ? -35.662 -46.845 27.071 1.00 70.52  ? 44   GLN H OE1   1 
ATOM   5564  N  NE2   . GLN H  4 47  ? -36.373 -45.599 25.340 1.00 69.92  ? 44   GLN H NE2   1 
ATOM   5565  N  N     . VAL H  4 48  ? -39.233 -46.229 31.510 1.00 66.22  ? 45   VAL H N     1 
ATOM   5566  C  CA    . VAL H  4 48  ? -38.832 -46.596 32.874 1.00 66.13  ? 45   VAL H CA    1 
ATOM   5567  C  C     . VAL H  4 48  ? -40.021 -46.853 33.799 1.00 66.29  ? 45   VAL H C     1 
ATOM   5568  O  O     . VAL H  4 48  ? -39.910 -47.642 34.730 1.00 66.17  ? 45   VAL H O     1 
ATOM   5569  C  CB    . VAL H  4 48  ? -37.803 -45.581 33.514 1.00 66.09  ? 45   VAL H CB    1 
ATOM   5570  C  CG1   . VAL H  4 48  ? -36.609 -45.342 32.577 1.00 66.15  ? 45   VAL H CG1   1 
ATOM   5571  C  CG2   . VAL H  4 48  ? -38.454 -44.263 33.888 1.00 65.22  ? 45   VAL H CG2   1 
ATOM   5572  N  N     . HIS H  4 49  ? -41.143 -46.184 33.527 1.00 66.78  ? 46   HIS H N     1 
ATOM   5573  C  CA    . HIS H  4 49  ? -42.352 -46.257 34.347 1.00 67.59  ? 46   HIS H CA    1 
ATOM   5574  C  C     . HIS H  4 49  ? -43.571 -46.020 33.458 1.00 68.09  ? 46   HIS H C     1 
ATOM   5575  O  O     . HIS H  4 49  ? -44.092 -44.897 33.410 1.00 68.52  ? 46   HIS H O     1 
ATOM   5576  C  CB    . HIS H  4 49  ? -42.328 -45.188 35.437 1.00 67.79  ? 46   HIS H CB    1 
ATOM   5577  C  CG    . HIS H  4 49  ? -41.391 -45.474 36.570 1.00 68.58  ? 46   HIS H CG    1 
ATOM   5578  N  ND1   . HIS H  4 49  ? -41.702 -46.343 37.593 1.00 69.55  ? 46   HIS H ND1   1 
ATOM   5579  C  CD2   . HIS H  4 49  ? -40.171 -44.970 36.866 1.00 68.45  ? 46   HIS H CD2   1 
ATOM   5580  C  CE1   . HIS H  4 49  ? -40.704 -46.379 38.457 1.00 69.71  ? 46   HIS H CE1   1 
ATOM   5581  N  NE2   . HIS H  4 49  ? -39.762 -45.555 38.038 1.00 69.23  ? 46   HIS H NE2   1 
ATOM   5582  N  N     . PRO H  4 50  ? -44.043 -47.067 32.749 1.00 68.50  ? 47   PRO H N     1 
ATOM   5583  C  CA    . PRO H  4 50  ? -45.058 -46.827 31.714 1.00 68.72  ? 47   PRO H CA    1 
ATOM   5584  C  C     . PRO H  4 50  ? -46.413 -46.442 32.285 1.00 69.16  ? 47   PRO H C     1 
ATOM   5585  O  O     . PRO H  4 50  ? -47.214 -45.845 31.581 1.00 69.69  ? 47   PRO H O     1 
ATOM   5586  C  CB    . PRO H  4 50  ? -45.143 -48.167 30.963 1.00 68.73  ? 47   PRO H CB    1 
ATOM   5587  C  CG    . PRO H  4 50  ? -43.988 -49.008 31.477 1.00 68.42  ? 47   PRO H CG    1 
ATOM   5588  C  CD    . PRO H  4 50  ? -43.693 -48.495 32.854 1.00 68.39  ? 47   PRO H CD    1 
ATOM   5589  N  N     . ASP H  4 51  ? -46.649 -46.754 33.556 1.00 69.54  ? 48   ASP H N     1 
ATOM   5590  C  CA    . ASP H  4 51  ? -47.926 -46.465 34.211 1.00 70.07  ? 48   ASP H CA    1 
ATOM   5591  C  C     . ASP H  4 51  ? -47.903 -45.159 34.994 1.00 69.67  ? 48   ASP H C     1 
ATOM   5592  O  O     . ASP H  4 51  ? -48.834 -44.855 35.747 1.00 69.67  ? 48   ASP H O     1 
ATOM   5593  C  CB    . ASP H  4 51  ? -48.299 -47.618 35.159 1.00 70.93  ? 48   ASP H CB    1 
ATOM   5594  C  CG    . ASP H  4 51  ? -48.407 -48.963 34.436 1.00 73.13  ? 48   ASP H CG    1 
ATOM   5595  O  OD1   . ASP H  4 51  ? -49.156 -49.045 33.429 1.00 73.63  ? 48   ASP H OD1   1 
ATOM   5596  O  OD2   . ASP H  4 51  ? -47.735 -49.932 34.876 1.00 76.53  ? 48   ASP H OD2   1 
ATOM   5597  N  N     . THR H  4 52  ? -46.833 -44.389 34.818 1.00 69.31  ? 49   THR H N     1 
ATOM   5598  C  CA    . THR H  4 52  ? -46.584 -43.198 35.634 1.00 68.18  ? 49   THR H CA    1 
ATOM   5599  C  C     . THR H  4 52  ? -46.661 -41.928 34.779 1.00 67.45  ? 49   THR H C     1 
ATOM   5600  O  O     . THR H  4 52  ? -46.148 -41.891 33.649 1.00 67.20  ? 49   THR H O     1 
ATOM   5601  C  CB    . THR H  4 52  ? -45.218 -43.316 36.364 1.00 68.27  ? 49   THR H CB    1 
ATOM   5602  O  OG1   . THR H  4 52  ? -45.163 -44.569 37.058 1.00 68.40  ? 49   THR H OG1   1 
ATOM   5603  C  CG2   . THR H  4 52  ? -45.012 -42.192 37.369 1.00 67.60  ? 49   THR H CG2   1 
ATOM   5604  N  N     . GLY H  4 53  ? -47.332 -40.911 35.320 1.00 66.26  ? 50   GLY H N     1 
ATOM   5605  C  CA    . GLY H  4 53  ? -47.432 -39.594 34.682 1.00 64.98  ? 50   GLY H CA    1 
ATOM   5606  C  C     . GLY H  4 53  ? -46.564 -38.545 35.364 1.00 64.13  ? 50   GLY H C     1 
ATOM   5607  O  O     . GLY H  4 53  ? -45.747 -38.867 36.236 1.00 63.74  ? 50   GLY H O     1 
ATOM   5608  N  N     . ILE H  4 54  ? -46.759 -37.286 34.975 1.00 63.38  ? 51   ILE H N     1 
ATOM   5609  C  CA    . ILE H  4 54  ? -45.923 -36.177 35.439 1.00 62.54  ? 51   ILE H CA    1 
ATOM   5610  C  C     . ILE H  4 54  ? -46.677 -34.853 35.311 1.00 62.27  ? 51   ILE H C     1 
ATOM   5611  O  O     . ILE H  4 54  ? -47.226 -34.551 34.252 1.00 62.53  ? 51   ILE H O     1 
ATOM   5612  C  CB    . ILE H  4 54  ? -44.552 -36.147 34.662 1.00 62.85  ? 51   ILE H CB    1 
ATOM   5613  C  CG1   . ILE H  4 54  ? -43.569 -35.117 35.256 1.00 62.43  ? 51   ILE H CG1   1 
ATOM   5614  C  CG2   . ILE H  4 54  ? -44.782 -35.945 33.154 1.00 62.93  ? 51   ILE H CG2   1 
ATOM   5615  C  CD1   . ILE H  4 54  ? -42.104 -35.382 34.936 1.00 61.95  ? 51   ILE H CD1   1 
ATOM   5616  N  N     . SER H  4 55  ? -46.717 -34.072 36.391 1.00 61.62  ? 52   SER H N     1 
ATOM   5617  C  CA    . SER H  4 55  ? -47.309 -32.732 36.355 1.00 60.97  ? 52   SER H CA    1 
ATOM   5618  C  C     . SER H  4 55  ? -46.481 -31.752 35.507 1.00 60.52  ? 52   SER H C     1 
ATOM   5619  O  O     . SER H  4 55  ? -45.316 -32.012 35.205 1.00 60.58  ? 52   SER H O     1 
ATOM   5620  C  CB    . SER H  4 55  ? -47.486 -32.183 37.770 1.00 61.10  ? 52   SER H CB    1 
ATOM   5621  O  OG    . SER H  4 55  ? -46.232 -31.820 38.328 1.00 61.38  ? 52   SER H OG    1 
ATOM   5622  N  N     . SER H  4 56  ? -47.093 -30.632 35.127 1.00 59.94  ? 53   SER H N     1 
ATOM   5623  C  CA    . SER H  4 56  ? -46.419 -29.590 34.366 1.00 59.83  ? 53   SER H CA    1 
ATOM   5624  C  C     . SER H  4 56  ? -45.295 -28.972 35.156 1.00 59.46  ? 53   SER H C     1 
ATOM   5625  O  O     . SER H  4 56  ? -44.190 -28.800 34.635 1.00 59.94  ? 53   SER H O     1 
ATOM   5626  C  CB    . SER H  4 56  ? -47.400 -28.500 33.942 1.00 60.00  ? 53   SER H CB    1 
ATOM   5627  O  OG    . SER H  4 56  ? -47.995 -28.855 32.703 1.00 61.61  ? 53   SER H OG    1 
ATOM   5628  N  N     . LYS H  4 57  ? -45.584 -28.630 36.409 1.00 58.67  ? 54   LYS H N     1 
ATOM   5629  C  CA    . LYS H  4 57  ? -44.572 -28.145 37.325 1.00 58.31  ? 54   LYS H CA    1 
ATOM   5630  C  C     . LYS H  4 57  ? -43.354 -29.080 37.347 1.00 57.48  ? 54   LYS H C     1 
ATOM   5631  O  O     . LYS H  4 57  ? -42.226 -28.626 37.140 1.00 57.68  ? 54   LYS H O     1 
ATOM   5632  C  CB    . LYS H  4 57  ? -45.134 -27.993 38.740 1.00 58.18  ? 54   LYS H CB    1 
ATOM   5633  C  CG    . LYS H  4 57  ? -46.168 -26.906 38.928 1.00 59.08  ? 54   LYS H CG    1 
ATOM   5634  C  CD    . LYS H  4 57  ? -46.436 -26.705 40.434 1.00 59.49  ? 54   LYS H CD    1 
ATOM   5635  C  CE    . LYS H  4 57  ? -47.670 -25.837 40.704 1.00 62.07  ? 54   LYS H CE    1 
ATOM   5636  N  NZ    . LYS H  4 57  ? -47.546 -24.455 40.142 1.00 63.27  ? 54   LYS H NZ    1 
ATOM   5637  N  N     . ALA H  4 58  ? -43.591 -30.375 37.583 1.00 56.53  ? 55   ALA H N     1 
ATOM   5638  C  CA    . ALA H  4 58  ? -42.521 -31.364 37.684 1.00 55.32  ? 55   ALA H CA    1 
ATOM   5639  C  C     . ALA H  4 58  ? -41.756 -31.513 36.376 1.00 54.80  ? 55   ALA H C     1 
ATOM   5640  O  O     . ALA H  4 58  ? -40.538 -31.670 36.378 1.00 54.90  ? 55   ALA H O     1 
ATOM   5641  C  CB    . ALA H  4 58  ? -43.066 -32.695 38.151 1.00 55.35  ? 55   ALA H CB    1 
ATOM   5642  N  N     . MET H  4 59  ? -42.459 -31.443 35.254 1.00 54.34  ? 56   MET H N     1 
ATOM   5643  C  CA    . MET H  4 59  ? -41.803 -31.480 33.945 1.00 54.00  ? 56   MET H CA    1 
ATOM   5644  C  C     . MET H  4 59  ? -40.967 -30.229 33.698 1.00 54.02  ? 56   MET H C     1 
ATOM   5645  O  O     . MET H  4 59  ? -39.916 -30.276 33.041 1.00 53.97  ? 56   MET H O     1 
ATOM   5646  C  CB    . MET H  4 59  ? -42.834 -31.643 32.840 1.00 53.91  ? 56   MET H CB    1 
ATOM   5647  C  CG    . MET H  4 59  ? -42.273 -31.570 31.450 1.00 53.87  ? 56   MET H CG    1 
ATOM   5648  S  SD    . MET H  4 59  ? -41.290 -33.002 31.015 1.00 55.76  ? 56   MET H SD    1 
ATOM   5649  C  CE    . MET H  4 59  ? -42.579 -34.237 30.837 1.00 54.94  ? 56   MET H CE    1 
ATOM   5650  N  N     . SER H  4 60  ? -41.445 -29.108 34.226 1.00 53.94  ? 57   SER H N     1 
ATOM   5651  C  CA    . SER H  4 60  ? -40.734 -27.842 34.122 1.00 53.68  ? 57   SER H CA    1 
ATOM   5652  C  C     . SER H  4 60  ? -39.396 -27.967 34.858 1.00 52.93  ? 57   SER H C     1 
ATOM   5653  O  O     . SER H  4 60  ? -38.342 -27.686 34.294 1.00 53.13  ? 57   SER H O     1 
ATOM   5654  C  CB    . SER H  4 60  ? -41.601 -26.719 34.679 1.00 53.61  ? 57   SER H CB    1 
ATOM   5655  O  OG    . SER H  4 60  ? -41.036 -25.462 34.375 1.00 56.44  ? 57   SER H OG    1 
ATOM   5656  N  N     . ILE H  4 61  ? -39.447 -28.453 36.094 1.00 52.20  ? 58   ILE H N     1 
ATOM   5657  C  CA    . ILE H  4 61  ? -38.254 -28.863 36.862 1.00 51.39  ? 58   ILE H CA    1 
ATOM   5658  C  C     . ILE H  4 61  ? -37.301 -29.782 36.103 1.00 51.33  ? 58   ILE H C     1 
ATOM   5659  O  O     . ILE H  4 61  ? -36.088 -29.631 36.196 1.00 52.14  ? 58   ILE H O     1 
ATOM   5660  C  CB    . ILE H  4 61  ? -38.682 -29.612 38.130 1.00 51.55  ? 58   ILE H CB    1 
ATOM   5661  C  CG1   . ILE H  4 61  ? -39.708 -28.789 38.944 1.00 50.14  ? 58   ILE H CG1   1 
ATOM   5662  C  CG2   . ILE H  4 61  ? -37.459 -30.153 38.891 1.00 51.05  ? 58   ILE H CG2   1 
ATOM   5663  C  CD1   . ILE H  4 61  ? -39.257 -28.335 40.252 1.00 50.19  ? 58   ILE H CD1   1 
ATOM   5664  N  N     . MET H  4 62  ? -37.842 -30.750 35.369 1.00 51.31  ? 59   MET H N     1 
ATOM   5665  C  CA    . MET H  4 62  ? -37.024 -31.708 34.607 1.00 51.18  ? 59   MET H CA    1 
ATOM   5666  C  C     . MET H  4 62  ? -36.380 -31.085 33.400 1.00 50.89  ? 59   MET H C     1 
ATOM   5667  O  O     . MET H  4 62  ? -35.266 -31.445 33.042 1.00 51.91  ? 59   MET H O     1 
ATOM   5668  C  CB    . MET H  4 62  ? -37.851 -32.925 34.156 1.00 51.59  ? 59   MET H CB    1 
ATOM   5669  C  CG    . MET H  4 62  ? -38.203 -33.917 35.264 1.00 50.63  ? 59   MET H CG    1 
ATOM   5670  S  SD    . MET H  4 62  ? -36.751 -34.687 36.017 1.00 51.87  ? 59   MET H SD    1 
ATOM   5671  C  CE    . MET H  4 62  ? -35.904 -35.442 34.633 1.00 49.85  ? 59   MET H CE    1 
ATOM   5672  N  N     . ASN H  4 63  ? -37.096 -30.175 32.747 1.00 50.80  ? 60   ASN H N     1 
ATOM   5673  C  CA    . ASN H  4 63  ? -36.522 -29.344 31.686 1.00 50.35  ? 60   ASN H CA    1 
ATOM   5674  C  C     . ASN H  4 63  ? -35.325 -28.528 32.207 1.00 49.76  ? 60   ASN H C     1 
ATOM   5675  O  O     . ASN H  4 63  ? -34.275 -28.496 31.568 1.00 50.16  ? 60   ASN H O     1 
ATOM   5676  C  CB    . ASN H  4 63  ? -37.593 -28.432 31.064 1.00 50.77  ? 60   ASN H CB    1 
ATOM   5677  C  CG    . ASN H  4 63  ? -37.101 -27.735 29.811 1.00 51.58  ? 60   ASN H CG    1 
ATOM   5678  O  OD1   . ASN H  4 63  ? -36.398 -28.334 28.998 1.00 53.38  ? 60   ASN H OD1   1 
ATOM   5679  N  ND2   . ASN H  4 63  ? -37.451 -26.463 29.657 1.00 50.06  ? 60   ASN H ND2   1 
ATOM   5680  N  N     . SER H  4 64  ? -35.485 -27.913 33.382 1.00 48.84  ? 61   SER H N     1 
ATOM   5681  C  CA    . SER H  4 64  ? -34.407 -27.200 34.077 1.00 48.25  ? 61   SER H CA    1 
ATOM   5682  C  C     . SER H  4 64  ? -33.206 -28.102 34.363 1.00 48.21  ? 61   SER H C     1 
ATOM   5683  O  O     . SER H  4 64  ? -32.067 -27.759 34.024 1.00 48.75  ? 61   SER H O     1 
ATOM   5684  C  CB    . SER H  4 64  ? -34.916 -26.534 35.374 1.00 48.42  ? 61   SER H CB    1 
ATOM   5685  O  OG    . SER H  4 64  ? -35.809 -25.449 35.115 1.00 46.84  ? 61   SER H OG    1 
ATOM   5686  N  N     . PHE H  4 65  ? -33.451 -29.261 34.962 1.00 48.06  ? 62   PHE H N     1 
ATOM   5687  C  CA    . PHE H  4 65  ? -32.389 -30.256 35.162 1.00 47.66  ? 62   PHE H CA    1 
ATOM   5688  C  C     . PHE H  4 65  ? -31.520 -30.509 33.933 1.00 47.31  ? 62   PHE H C     1 
ATOM   5689  O  O     . PHE H  4 65  ? -30.310 -30.392 34.020 1.00 47.11  ? 62   PHE H O     1 
ATOM   5690  C  CB    . PHE H  4 65  ? -32.955 -31.573 35.684 1.00 48.48  ? 62   PHE H CB    1 
ATOM   5691  C  CG    . PHE H  4 65  ? -31.919 -32.657 35.828 1.00 49.89  ? 62   PHE H CG    1 
ATOM   5692  C  CD1   . PHE H  4 65  ? -30.934 -32.569 36.806 1.00 50.52  ? 62   PHE H CD1   1 
ATOM   5693  C  CD2   . PHE H  4 65  ? -31.921 -33.758 34.971 1.00 51.14  ? 62   PHE H CD2   1 
ATOM   5694  C  CE1   . PHE H  4 65  ? -29.972 -33.555 36.933 1.00 52.73  ? 62   PHE H CE1   1 
ATOM   5695  C  CE2   . PHE H  4 65  ? -30.969 -34.754 35.089 1.00 51.86  ? 62   PHE H CE2   1 
ATOM   5696  C  CZ    . PHE H  4 65  ? -29.992 -34.662 36.071 1.00 52.14  ? 62   PHE H CZ    1 
ATOM   5697  N  N     . VAL H  4 66  ? -32.138 -30.826 32.793 1.00 47.32  ? 63   VAL H N     1 
ATOM   5698  C  CA    . VAL H  4 66  ? -31.411 -31.095 31.548 1.00 47.25  ? 63   VAL H CA    1 
ATOM   5699  C  C     . VAL H  4 66  ? -30.634 -29.879 31.027 1.00 47.65  ? 63   VAL H C     1 
ATOM   5700  O  O     . VAL H  4 66  ? -29.431 -29.986 30.694 1.00 47.17  ? 63   VAL H O     1 
ATOM   5701  C  CB    . VAL H  4 66  ? -32.343 -31.681 30.435 1.00 47.85  ? 63   VAL H CB    1 
ATOM   5702  C  CG1   . VAL H  4 66  ? -31.527 -32.215 29.292 1.00 47.24  ? 63   VAL H CG1   1 
ATOM   5703  C  CG2   . VAL H  4 66  ? -33.209 -32.840 30.984 1.00 48.67  ? 63   VAL H CG2   1 
ATOM   5704  N  N     . ASN H  4 67  ? -31.299 -28.720 30.973 1.00 47.92  ? 64   ASN H N     1 
ATOM   5705  C  CA    . ASN H  4 67  ? -30.603 -27.462 30.636 1.00 47.97  ? 64   ASN H CA    1 
ATOM   5706  C  C     . ASN H  4 67  ? -29.417 -27.145 31.530 1.00 47.60  ? 64   ASN H C     1 
ATOM   5707  O  O     . ASN H  4 67  ? -28.351 -26.776 31.028 1.00 48.11  ? 64   ASN H O     1 
ATOM   5708  C  CB    . ASN H  4 67  ? -31.573 -26.284 30.576 1.00 48.45  ? 64   ASN H CB    1 
ATOM   5709  C  CG    . ASN H  4 67  ? -32.382 -26.283 29.312 1.00 50.17  ? 64   ASN H CG    1 
ATOM   5710  O  OD1   . ASN H  4 67  ? -31.852 -26.543 28.227 1.00 53.82  ? 64   ASN H OD1   1 
ATOM   5711  N  ND2   . ASN H  4 67  ? -33.674 -26.017 29.432 1.00 51.35  ? 64   ASN H ND2   1 
ATOM   5712  N  N     . ASP H  4 68  ? -29.593 -27.294 32.843 1.00 46.94  ? 65   ASP H N     1 
ATOM   5713  C  CA    . ASP H  4 68  ? -28.507 -27.065 33.782 1.00 47.03  ? 65   ASP H CA    1 
ATOM   5714  C  C     . ASP H  4 68  ? -27.369 -28.028 33.483 1.00 47.14  ? 65   ASP H C     1 
ATOM   5715  O  O     . ASP H  4 68  ? -26.249 -27.598 33.237 1.00 47.16  ? 65   ASP H O     1 
ATOM   5716  C  CB    . ASP H  4 68  ? -29.019 -27.200 35.222 1.00 47.50  ? 65   ASP H CB    1 
ATOM   5717  C  CG    . ASP H  4 68  ? -27.937 -26.988 36.281 1.00 49.36  ? 65   ASP H CG    1 
ATOM   5718  O  OD1   . ASP H  4 68  ? -26.795 -26.622 35.944 1.00 52.85  ? 65   ASP H OD1   1 
ATOM   5719  O  OD2   . ASP H  4 68  ? -28.230 -27.193 37.482 1.00 49.69  ? 65   ASP H OD2   1 
ATOM   5720  N  N     . VAL H  4 69  ? -27.659 -29.331 33.478 1.00 47.63  ? 66   VAL H N     1 
ATOM   5721  C  CA    . VAL H  4 69  ? -26.630 -30.358 33.280 1.00 47.90  ? 66   VAL H CA    1 
ATOM   5722  C  C     . VAL H  4 69  ? -25.921 -30.204 31.941 1.00 48.05  ? 66   VAL H C     1 
ATOM   5723  O  O     . VAL H  4 69  ? -24.705 -30.323 31.885 1.00 48.42  ? 66   VAL H O     1 
ATOM   5724  C  CB    . VAL H  4 69  ? -27.192 -31.799 33.477 1.00 48.20  ? 66   VAL H CB    1 
ATOM   5725  C  CG1   . VAL H  4 69  ? -26.146 -32.827 33.154 1.00 48.29  ? 66   VAL H CG1   1 
ATOM   5726  C  CG2   . VAL H  4 69  ? -27.624 -31.996 34.921 1.00 48.02  ? 66   VAL H CG2   1 
ATOM   5727  N  N     . PHE H  4 70  ? -26.684 -29.927 30.880 1.00 48.66  ? 67   PHE H N     1 
ATOM   5728  C  CA    . PHE H  4 70  ? -26.147 -29.590 29.552 1.00 48.95  ? 67   PHE H CA    1 
ATOM   5729  C  C     . PHE H  4 70  ? -25.118 -28.455 29.615 1.00 49.72  ? 67   PHE H C     1 
ATOM   5730  O  O     . PHE H  4 70  ? -24.010 -28.588 29.066 1.00 49.66  ? 67   PHE H O     1 
ATOM   5731  C  CB    . PHE H  4 70  ? -27.281 -29.206 28.572 1.00 48.68  ? 67   PHE H CB    1 
ATOM   5732  C  CG    . PHE H  4 70  ? -26.787 -28.786 27.203 1.00 49.10  ? 67   PHE H CG    1 
ATOM   5733  C  CD1   . PHE H  4 70  ? -26.761 -29.693 26.147 1.00 49.56  ? 67   PHE H CD1   1 
ATOM   5734  C  CD2   . PHE H  4 70  ? -26.321 -27.486 26.973 1.00 49.68  ? 67   PHE H CD2   1 
ATOM   5735  C  CE1   . PHE H  4 70  ? -26.279 -29.324 24.875 1.00 48.88  ? 67   PHE H CE1   1 
ATOM   5736  C  CE2   . PHE H  4 70  ? -25.837 -27.097 25.713 1.00 49.73  ? 67   PHE H CE2   1 
ATOM   5737  C  CZ    . PHE H  4 70  ? -25.823 -28.026 24.659 1.00 50.37  ? 67   PHE H CZ    1 
ATOM   5738  N  N     . GLU H  4 71  ? -25.503 -27.344 30.263 1.00 50.24  ? 68   GLU H N     1 
ATOM   5739  C  CA    . GLU H  4 71  ? -24.656 -26.144 30.387 1.00 51.09  ? 68   GLU H CA    1 
ATOM   5740  C  C     . GLU H  4 71  ? -23.389 -26.430 31.200 1.00 49.84  ? 68   GLU H C     1 
ATOM   5741  O  O     . GLU H  4 71  ? -22.298 -26.020 30.817 1.00 49.75  ? 68   GLU H O     1 
ATOM   5742  C  CB    . GLU H  4 71  ? -25.429 -24.963 31.008 1.00 51.01  ? 68   GLU H CB    1 
ATOM   5743  C  CG    . GLU H  4 71  ? -26.456 -24.236 30.090 1.00 53.53  ? 68   GLU H CG    1 
ATOM   5744  C  CD    . GLU H  4 71  ? -27.525 -23.420 30.892 1.00 54.67  ? 68   GLU H CD    1 
ATOM   5745  O  OE1   . GLU H  4 71  ? -27.533 -23.479 32.155 1.00 59.56  ? 68   GLU H OE1   1 
ATOM   5746  O  OE2   . GLU H  4 71  ? -28.365 -22.715 30.269 1.00 57.88  ? 68   GLU H OE2   1 
ATOM   5747  N  N     . ARG H  4 72  ? -23.534 -27.146 32.310 1.00 49.37  ? 69   ARG H N     1 
ATOM   5748  C  CA    . ARG H  4 72  ? -22.378 -27.532 33.141 1.00 49.18  ? 69   ARG H CA    1 
ATOM   5749  C  C     . ARG H  4 72  ? -21.363 -28.402 32.404 1.00 48.84  ? 69   ARG H C     1 
ATOM   5750  O  O     . ARG H  4 72  ? -20.152 -28.207 32.526 1.00 48.69  ? 69   ARG H O     1 
ATOM   5751  C  CB    . ARG H  4 72  ? -22.839 -28.291 34.375 1.00 48.88  ? 69   ARG H CB    1 
ATOM   5752  C  CG    . ARG H  4 72  ? -23.609 -27.473 35.364 1.00 49.59  ? 69   ARG H CG    1 
ATOM   5753  C  CD    . ARG H  4 72  ? -23.573 -28.216 36.683 1.00 51.63  ? 69   ARG H CD    1 
ATOM   5754  N  NE    . ARG H  4 72  ? -24.903 -28.398 37.224 1.00 53.41  ? 69   ARG H NE    1 
ATOM   5755  C  CZ    . ARG H  4 72  ? -25.170 -29.080 38.326 1.00 55.81  ? 69   ARG H CZ    1 
ATOM   5756  N  NH1   . ARG H  4 72  ? -24.193 -29.647 39.023 1.00 55.70  ? 69   ARG H NH1   1 
ATOM   5757  N  NH2   . ARG H  4 72  ? -26.424 -29.183 38.738 1.00 58.17  ? 69   ARG H NH2   1 
ATOM   5758  N  N     . ILE H  4 73  ? -21.871 -29.378 31.656 1.00 48.93  ? 70   ILE H N     1 
ATOM   5759  C  CA    . ILE H  4 73  ? -21.009 -30.308 30.934 1.00 48.40  ? 70   ILE H CA    1 
ATOM   5760  C  C     . ILE H  4 73  ? -20.404 -29.608 29.747 1.00 47.92  ? 70   ILE H C     1 
ATOM   5761  O  O     . ILE H  4 73  ? -19.201 -29.692 29.543 1.00 47.99  ? 70   ILE H O     1 
ATOM   5762  C  CB    . ILE H  4 73  ? -21.747 -31.605 30.480 1.00 48.48  ? 70   ILE H CB    1 
ATOM   5763  C  CG1   . ILE H  4 73  ? -22.199 -32.428 31.685 1.00 47.49  ? 70   ILE H CG1   1 
ATOM   5764  C  CG2   . ILE H  4 73  ? -20.835 -32.453 29.561 1.00 48.06  ? 70   ILE H CG2   1 
ATOM   5765  C  CD1   . ILE H  4 73  ? -23.102 -33.627 31.324 1.00 48.14  ? 70   ILE H CD1   1 
ATOM   5766  N  N     . ALA H  4 74  ? -21.247 -28.941 28.956 1.00 48.08  ? 71   ALA H N     1 
ATOM   5767  C  CA    . ALA H  4 74  ? -20.786 -28.124 27.820 1.00 48.24  ? 71   ALA H CA    1 
ATOM   5768  C  C     . ALA H  4 74  ? -19.730 -27.084 28.219 1.00 47.91  ? 71   ALA H C     1 
ATOM   5769  O  O     . ALA H  4 74  ? -18.742 -26.898 27.512 1.00 47.80  ? 71   ALA H O     1 
ATOM   5770  C  CB    . ALA H  4 74  ? -21.960 -27.448 27.144 1.00 48.04  ? 71   ALA H CB    1 
ATOM   5771  N  N     . GLY H  4 75  ? -19.941 -26.412 29.345 1.00 48.02  ? 72   GLY H N     1 
ATOM   5772  C  CA    . GLY H  4 75  ? -19.005 -25.385 29.801 1.00 49.26  ? 72   GLY H CA    1 
ATOM   5773  C  C     . GLY H  4 75  ? -17.669 -25.937 30.270 1.00 50.13  ? 72   GLY H C     1 
ATOM   5774  O  O     . GLY H  4 75  ? -16.625 -25.306 30.096 1.00 50.48  ? 72   GLY H O     1 
ATOM   5775  N  N     . GLU H  4 76  ? -17.700 -27.115 30.884 1.00 50.59  ? 73   GLU H N     1 
ATOM   5776  C  CA    . GLU H  4 76  ? -16.477 -27.765 31.344 1.00 51.12  ? 73   GLU H CA    1 
ATOM   5777  C  C     . GLU H  4 76  ? -15.602 -28.273 30.190 1.00 50.80  ? 73   GLU H C     1 
ATOM   5778  O  O     . GLU H  4 76  ? -14.378 -28.242 30.283 1.00 51.28  ? 73   GLU H O     1 
ATOM   5779  C  CB    . GLU H  4 76  ? -16.820 -28.902 32.302 1.00 51.40  ? 73   GLU H CB    1 
ATOM   5780  C  CG    . GLU H  4 76  ? -15.619 -29.609 32.870 1.00 53.18  ? 73   GLU H CG    1 
ATOM   5781  C  CD    . GLU H  4 76  ? -14.837 -28.747 33.836 1.00 57.29  ? 73   GLU H CD    1 
ATOM   5782  O  OE1   . GLU H  4 76  ? -13.751 -28.226 33.419 1.00 56.04  ? 73   GLU H OE1   1 
ATOM   5783  O  OE2   . GLU H  4 76  ? -15.324 -28.612 35.004 1.00 58.40  ? 73   GLU H OE2   1 
ATOM   5784  N  N     . ALA H  4 77  ? -16.239 -28.757 29.123 1.00 50.53  ? 74   ALA H N     1 
ATOM   5785  C  CA    . ALA H  4 77  ? -15.563 -29.197 27.907 1.00 50.20  ? 74   ALA H CA    1 
ATOM   5786  C  C     . ALA H  4 77  ? -14.929 -28.030 27.177 1.00 50.63  ? 74   ALA H C     1 
ATOM   5787  O  O     . ALA H  4 77  ? -13.776 -28.112 26.767 1.00 50.85  ? 74   ALA H O     1 
ATOM   5788  C  CB    . ALA H  4 77  ? -16.531 -29.896 27.004 1.00 50.07  ? 74   ALA H CB    1 
ATOM   5789  N  N     . SER H  4 78  ? -15.698 -26.954 26.990 1.00 51.18  ? 75   SER H N     1 
ATOM   5790  C  CA    . SER H  4 78  ? -15.185 -25.675 26.482 1.00 51.36  ? 75   SER H CA    1 
ATOM   5791  C  C     . SER H  4 78  ? -13.864 -25.304 27.149 1.00 51.81  ? 75   SER H C     1 
ATOM   5792  O  O     . SER H  4 78  ? -12.848 -25.129 26.486 1.00 52.47  ? 75   SER H O     1 
ATOM   5793  C  CB    . SER H  4 78  ? -16.222 -24.578 26.729 1.00 51.51  ? 75   SER H CB    1 
ATOM   5794  O  OG    . SER H  4 78  ? -15.757 -23.311 26.293 1.00 51.05  ? 75   SER H OG    1 
ATOM   5795  N  N     . ARG H  4 79  ? -13.886 -25.202 28.472 1.00 52.35  ? 76   ARG H N     1 
ATOM   5796  C  CA    . ARG H  4 79  ? -12.684 -25.010 29.267 1.00 52.80  ? 76   ARG H CA    1 
ATOM   5797  C  C     . ARG H  4 79  ? -11.552 -26.020 28.999 1.00 52.90  ? 76   ARG H C     1 
ATOM   5798  O  O     . ARG H  4 79  ? -10.423 -25.605 28.740 1.00 53.60  ? 76   ARG H O     1 
ATOM   5799  C  CB    . ARG H  4 79  ? -13.054 -24.965 30.752 1.00 53.09  ? 76   ARG H CB    1 
ATOM   5800  C  CG    . ARG H  4 79  ? -13.310 -23.551 31.275 1.00 53.43  ? 76   ARG H CG    1 
ATOM   5801  C  CD    . ARG H  4 79  ? -13.902 -23.550 32.691 1.00 53.76  ? 76   ARG H CD    1 
ATOM   5802  N  NE    . ARG H  4 79  ? -15.364 -23.422 32.691 1.00 56.31  ? 76   ARG H NE    1 
ATOM   5803  C  CZ    . ARG H  4 79  ? -16.191 -24.248 33.332 1.00 58.07  ? 76   ARG H CZ    1 
ATOM   5804  N  NH1   . ARG H  4 79  ? -15.713 -25.264 34.044 1.00 60.03  ? 76   ARG H NH1   1 
ATOM   5805  N  NH2   . ARG H  4 79  ? -17.500 -24.061 33.269 1.00 58.67  ? 76   ARG H NH2   1 
ATOM   5806  N  N     . LEU H  4 80  ? -11.831 -27.323 29.071 1.00 52.66  ? 77   LEU H N     1 
ATOM   5807  C  CA    . LEU H  4 80  ? -10.830 -28.346 28.704 1.00 52.90  ? 77   LEU H CA    1 
ATOM   5808  C  C     . LEU H  4 80  ? -10.216 -28.127 27.331 1.00 52.92  ? 77   LEU H C     1 
ATOM   5809  O  O     . LEU H  4 80  ? -9.000  -28.144 27.209 1.00 52.96  ? 77   LEU H O     1 
ATOM   5810  C  CB    . LEU H  4 80  ? -11.410 -29.777 28.728 1.00 52.64  ? 77   LEU H CB    1 
ATOM   5811  C  CG    . LEU H  4 80  ? -11.483 -30.492 30.065 1.00 52.79  ? 77   LEU H CG    1 
ATOM   5812  C  CD1   . LEU H  4 80  ? -12.558 -31.545 30.031 1.00 50.42  ? 77   LEU H CD1   1 
ATOM   5813  C  CD2   . LEU H  4 80  ? -10.103 -31.047 30.479 1.00 54.00  ? 77   LEU H CD2   1 
ATOM   5814  N  N     . ALA H  4 81  ? -11.056 -27.964 26.304 1.00 53.35  ? 78   ALA H N     1 
ATOM   5815  C  CA    . ALA H  4 81  ? -10.582 -27.733 24.937 1.00 54.29  ? 78   ALA H CA    1 
ATOM   5816  C  C     . ALA H  4 81  ? -9.671  -26.523 24.903 1.00 55.42  ? 78   ALA H C     1 
ATOM   5817  O  O     . ALA H  4 81  ? -8.655  -26.539 24.233 1.00 55.87  ? 78   ALA H O     1 
ATOM   5818  C  CB    . ALA H  4 81  ? -11.737 -27.557 23.970 1.00 53.40  ? 78   ALA H CB    1 
ATOM   5819  N  N     . HIS H  4 82  ? -10.034 -25.482 25.646 1.00 57.05  ? 79   HIS H N     1 
ATOM   5820  C  CA    . HIS H  4 82  ? -9.218  -24.286 25.729 1.00 58.70  ? 79   HIS H CA    1 
ATOM   5821  C  C     . HIS H  4 82  ? -7.893  -24.484 26.449 1.00 58.82  ? 79   HIS H C     1 
ATOM   5822  O  O     . HIS H  4 82  ? -6.865  -24.052 25.946 1.00 59.46  ? 79   HIS H O     1 
ATOM   5823  C  CB    . HIS H  4 82  ? -9.977  -23.116 26.351 1.00 59.31  ? 79   HIS H CB    1 
ATOM   5824  C  CG    . HIS H  4 82  ? -9.231  -21.827 26.254 1.00 63.01  ? 79   HIS H CG    1 
ATOM   5825  N  ND1   . HIS H  4 82  ? -9.031  -21.175 25.051 1.00 65.99  ? 79   HIS H ND1   1 
ATOM   5826  C  CD2   . HIS H  4 82  ? -8.588  -21.094 27.195 1.00 65.63  ? 79   HIS H CD2   1 
ATOM   5827  C  CE1   . HIS H  4 82  ? -8.318  -20.083 25.260 1.00 66.29  ? 79   HIS H CE1   1 
ATOM   5828  N  NE2   . HIS H  4 82  ? -8.035  -20.011 26.551 1.00 67.92  ? 79   HIS H NE2   1 
ATOM   5829  N  N     . TYR H  4 83  ? -7.913  -25.124 27.619 1.00 59.15  ? 80   TYR H N     1 
ATOM   5830  C  CA    . TYR H  4 83  ? -6.681  -25.418 28.367 1.00 59.29  ? 80   TYR H CA    1 
ATOM   5831  C  C     . TYR H  4 83  ? -5.662  -26.107 27.505 1.00 59.62  ? 80   TYR H C     1 
ATOM   5832  O  O     . TYR H  4 83  ? -4.469  -25.945 27.697 1.00 60.14  ? 80   TYR H O     1 
ATOM   5833  C  CB    . TYR H  4 83  ? -6.961  -26.319 29.560 1.00 59.03  ? 80   TYR H CB    1 
ATOM   5834  C  CG    . TYR H  4 83  ? -7.862  -25.715 30.603 1.00 60.31  ? 80   TYR H CG    1 
ATOM   5835  C  CD1   . TYR H  4 83  ? -7.967  -24.317 30.758 1.00 61.16  ? 80   TYR H CD1   1 
ATOM   5836  C  CD2   . TYR H  4 83  ? -8.599  -26.532 31.464 1.00 59.89  ? 80   TYR H CD2   1 
ATOM   5837  C  CE1   . TYR H  4 83  ? -8.804  -23.761 31.729 1.00 59.74  ? 80   TYR H CE1   1 
ATOM   5838  C  CE2   . TYR H  4 83  ? -9.429  -25.983 32.435 1.00 59.62  ? 80   TYR H CE2   1 
ATOM   5839  C  CZ    . TYR H  4 83  ? -9.522  -24.599 32.564 1.00 59.56  ? 80   TYR H CZ    1 
ATOM   5840  O  OH    . TYR H  4 83  ? -10.338 -24.061 33.538 1.00 60.01  ? 80   TYR H OH    1 
ATOM   5841  N  N     . ASN H  4 84  ? -6.151  -26.883 26.547 1.00 60.29  ? 81   ASN H N     1 
ATOM   5842  C  CA    . ASN H  4 84  ? -5.309  -27.685 25.690 1.00 60.78  ? 81   ASN H CA    1 
ATOM   5843  C  C     . ASN H  4 84  ? -5.166  -27.169 24.273 1.00 61.53  ? 81   ASN H C     1 
ATOM   5844  O  O     . ASN H  4 84  ? -4.763  -27.921 23.394 1.00 62.00  ? 81   ASN H O     1 
ATOM   5845  C  CB    . ASN H  4 84  ? -5.836  -29.103 25.675 1.00 60.45  ? 81   ASN H CB    1 
ATOM   5846  C  CG    . ASN H  4 84  ? -5.632  -29.779 26.984 1.00 60.63  ? 81   ASN H CG    1 
ATOM   5847  O  OD1   . ASN H  4 84  ? -4.508  -30.177 27.319 1.00 59.80  ? 81   ASN H OD1   1 
ATOM   5848  N  ND2   . ASN H  4 84  ? -6.704  -29.876 27.773 1.00 59.79  ? 81   ASN H ND2   1 
ATOM   5849  N  N     . LYS H  4 85  ? -5.493  -25.893 24.063 1.00 62.37  ? 82   LYS H N     1 
ATOM   5850  C  CA    . LYS H  4 85  ? -5.303  -25.220 22.782 1.00 63.05  ? 82   LYS H CA    1 
ATOM   5851  C  C     . LYS H  4 85  ? -5.965  -25.983 21.635 1.00 63.23  ? 82   LYS H C     1 
ATOM   5852  O  O     . LYS H  4 85  ? -5.391  -26.134 20.555 1.00 63.61  ? 82   LYS H O     1 
ATOM   5853  C  CB    . LYS H  4 85  ? -3.807  -25.016 22.501 1.00 63.41  ? 82   LYS H CB    1 
ATOM   5854  C  CG    . LYS H  4 85  ? -3.131  -23.928 23.337 1.00 64.27  ? 82   LYS H CG    1 
ATOM   5855  C  CD    . LYS H  4 85  ? -1.620  -24.076 23.281 1.00 65.84  ? 82   LYS H CD    1 
ATOM   5856  C  CE    . LYS H  4 85  ? -0.953  -23.481 24.513 1.00 67.61  ? 82   LYS H CE    1 
ATOM   5857  N  NZ    . LYS H  4 85  ? -1.567  -23.975 25.785 1.00 68.22  ? 82   LYS H NZ    1 
ATOM   5858  N  N     . ARG H  4 86  ? -7.171  -26.477 21.873 1.00 63.23  ? 83   ARG H N     1 
ATOM   5859  C  CA    . ARG H  4 86  ? -7.899  -27.170 20.832 1.00 63.31  ? 83   ARG H CA    1 
ATOM   5860  C  C     . ARG H  4 86  ? -9.124  -26.367 20.430 1.00 62.97  ? 83   ARG H C     1 
ATOM   5861  O  O     . ARG H  4 86  ? -9.814  -25.792 21.279 1.00 63.11  ? 83   ARG H O     1 
ATOM   5862  C  CB    . ARG H  4 86  ? -8.285  -28.580 21.285 1.00 63.80  ? 83   ARG H CB    1 
ATOM   5863  C  CG    . ARG H  4 86  ? -7.102  -29.476 21.679 1.00 65.93  ? 83   ARG H CG    1 
ATOM   5864  C  CD    . ARG H  4 86  ? -6.286  -29.917 20.469 1.00 68.90  ? 83   ARG H CD    1 
ATOM   5865  N  NE    . ARG H  4 86  ? -5.176  -30.789 20.849 1.00 71.38  ? 83   ARG H NE    1 
ATOM   5866  C  CZ    . ARG H  4 86  ? -3.909  -30.397 20.962 1.00 73.75  ? 83   ARG H CZ    1 
ATOM   5867  N  NH1   . ARG H  4 86  ? -3.561  -29.133 20.723 1.00 75.40  ? 83   ARG H NH1   1 
ATOM   5868  N  NH2   . ARG H  4 86  ? -2.978  -31.274 21.317 1.00 75.02  ? 83   ARG H NH2   1 
ATOM   5869  N  N     . SER H  4 87  ? -9.374  -26.317 19.126 1.00 62.61  ? 84   SER H N     1 
ATOM   5870  C  CA    . SER H  4 87  ? -10.503 -25.578 18.561 1.00 62.36  ? 84   SER H CA    1 
ATOM   5871  C  C     . SER H  4 87  ? -11.812 -26.372 18.509 1.00 62.29  ? 84   SER H C     1 
ATOM   5872  O  O     . SER H  4 87  ? -12.873 -25.806 18.224 1.00 62.15  ? 84   SER H O     1 
ATOM   5873  C  CB    . SER H  4 87  ? -10.133 -25.042 17.178 1.00 62.69  ? 84   SER H CB    1 
ATOM   5874  O  OG    . SER H  4 87  ? -8.826  -25.460 16.792 1.00 63.41  ? 84   SER H OG    1 
ATOM   5875  N  N     . THR H  4 88  ? -11.735 -27.669 18.824 1.00 62.10  ? 85   THR H N     1 
ATOM   5876  C  CA    . THR H  4 88  ? -12.868 -28.594 18.701 1.00 61.59  ? 85   THR H CA    1 
ATOM   5877  C  C     . THR H  4 88  ? -13.239 -29.283 20.024 1.00 61.19  ? 85   THR H C     1 
ATOM   5878  O  O     . THR H  4 88  ? -12.377 -29.753 20.766 1.00 60.87  ? 85   THR H O     1 
ATOM   5879  C  CB    . THR H  4 88  ? -12.582 -29.685 17.631 1.00 61.51  ? 85   THR H CB    1 
ATOM   5880  O  OG1   . THR H  4 88  ? -11.997 -29.076 16.476 1.00 62.95  ? 85   THR H OG1   1 
ATOM   5881  C  CG2   . THR H  4 88  ? -13.862 -30.405 17.206 1.00 61.31  ? 85   THR H CG2   1 
ATOM   5882  N  N     . ILE H  4 89  ? -14.536 -29.323 20.302 1.00 60.72  ? 86   ILE H N     1 
ATOM   5883  C  CA    . ILE H  4 89  ? -15.077 -30.183 21.328 1.00 60.60  ? 86   ILE H CA    1 
ATOM   5884  C  C     . ILE H  4 89  ? -15.474 -31.537 20.713 1.00 60.53  ? 86   ILE H C     1 
ATOM   5885  O  O     . ILE H  4 89  ? -16.409 -31.633 19.909 1.00 60.23  ? 86   ILE H O     1 
ATOM   5886  C  CB    . ILE H  4 89  ? -16.256 -29.516 22.076 1.00 60.57  ? 86   ILE H CB    1 
ATOM   5887  C  CG1   . ILE H  4 89  ? -15.759 -28.272 22.827 1.00 60.62  ? 86   ILE H CG1   1 
ATOM   5888  C  CG2   . ILE H  4 89  ? -16.903 -30.508 23.046 1.00 60.51  ? 86   ILE H CG2   1 
ATOM   5889  C  CD1   . ILE H  4 89  ? -16.843 -27.395 23.416 1.00 60.57  ? 86   ILE H CD1   1 
ATOM   5890  N  N     . THR H  4 90  ? -14.730 -32.575 21.099 1.00 60.68  ? 87   THR H N     1 
ATOM   5891  C  CA    . THR H  4 90  ? -15.009 -33.954 20.699 1.00 60.38  ? 87   THR H CA    1 
ATOM   5892  C  C     . THR H  4 90  ? -15.685 -34.684 21.854 1.00 60.36  ? 87   THR H C     1 
ATOM   5893  O  O     . THR H  4 90  ? -15.948 -34.087 22.895 1.00 61.14  ? 87   THR H O     1 
ATOM   5894  C  CB    . THR H  4 90  ? -13.727 -34.695 20.287 1.00 60.37  ? 87   THR H CB    1 
ATOM   5895  O  OG1   . THR H  4 90  ? -12.922 -34.945 21.446 1.00 60.80  ? 87   THR H OG1   1 
ATOM   5896  C  CG2   . THR H  4 90  ? -12.923 -33.878 19.259 1.00 59.35  ? 87   THR H CG2   1 
ATOM   5897  N  N     . SER H  4 91  ? -15.980 -35.968 21.677 1.00 59.98  ? 88   SER H N     1 
ATOM   5898  C  CA    . SER H  4 91  ? -16.589 -36.769 22.742 1.00 59.06  ? 88   SER H CA    1 
ATOM   5899  C  C     . SER H  4 91  ? -15.593 -37.024 23.895 1.00 58.93  ? 88   SER H C     1 
ATOM   5900  O  O     . SER H  4 91  ? -15.986 -37.312 25.031 1.00 58.96  ? 88   SER H O     1 
ATOM   5901  C  CB    . SER H  4 91  ? -17.132 -38.078 22.169 1.00 59.05  ? 88   SER H CB    1 
ATOM   5902  O  OG    . SER H  4 91  ? -16.170 -38.702 21.341 1.00 57.92  ? 88   SER H OG    1 
ATOM   5903  N  N     . ARG H  4 92  ? -14.305 -36.903 23.597 1.00 58.42  ? 89   ARG H N     1 
ATOM   5904  C  CA    . ARG H  4 92  ? -13.277 -36.986 24.623 1.00 58.16  ? 89   ARG H CA    1 
ATOM   5905  C  C     . ARG H  4 92  ? -13.403 -35.858 25.665 1.00 57.63  ? 89   ARG H C     1 
ATOM   5906  O  O     . ARG H  4 92  ? -13.233 -36.087 26.868 1.00 57.37  ? 89   ARG H O     1 
ATOM   5907  C  CB    . ARG H  4 92  ? -11.901 -36.963 23.974 1.00 58.19  ? 89   ARG H CB    1 
ATOM   5908  C  CG    . ARG H  4 92  ? -10.919 -37.878 24.653 1.00 59.17  ? 89   ARG H CG    1 
ATOM   5909  C  CD    . ARG H  4 92  ? -9.505  -37.649 24.169 1.00 59.45  ? 89   ARG H CD    1 
ATOM   5910  N  NE    . ARG H  4 92  ? -8.570  -38.116 25.188 1.00 59.92  ? 89   ARG H NE    1 
ATOM   5911  C  CZ    . ARG H  4 92  ? -7.668  -37.351 25.785 1.00 61.29  ? 89   ARG H CZ    1 
ATOM   5912  N  NH1   . ARG H  4 92  ? -7.561  -36.078 25.435 1.00 63.09  ? 89   ARG H NH1   1 
ATOM   5913  N  NH2   . ARG H  4 92  ? -6.858  -37.862 26.713 1.00 61.46  ? 89   ARG H NH2   1 
ATOM   5914  N  N     . GLU H  4 93  ? -13.716 -34.650 25.188 1.00 57.03  ? 90   GLU H N     1 
ATOM   5915  C  CA    . GLU H  4 93  ? -13.943 -33.488 26.050 1.00 55.96  ? 90   GLU H CA    1 
ATOM   5916  C  C     . GLU H  4 93  ? -15.205 -33.637 26.876 1.00 54.77  ? 90   GLU H C     1 
ATOM   5917  O  O     . GLU H  4 93  ? -15.201 -33.332 28.072 1.00 54.75  ? 90   GLU H O     1 
ATOM   5918  C  CB    . GLU H  4 93  ? -13.980 -32.191 25.234 1.00 56.32  ? 90   GLU H CB    1 
ATOM   5919  C  CG    . GLU H  4 93  ? -12.604 -31.625 24.899 1.00 57.76  ? 90   GLU H CG    1 
ATOM   5920  C  CD    . GLU H  4 93  ? -11.868 -32.431 23.839 1.00 62.01  ? 90   GLU H CD    1 
ATOM   5921  O  OE1   . GLU H  4 93  ? -12.468 -32.687 22.758 1.00 64.00  ? 90   GLU H OE1   1 
ATOM   5922  O  OE2   . GLU H  4 93  ? -10.691 -32.802 24.078 1.00 62.17  ? 90   GLU H OE2   1 
ATOM   5923  N  N     . ILE H  4 94  ? -16.277 -34.114 26.242 1.00 53.80  ? 91   ILE H N     1 
ATOM   5924  C  CA    . ILE H  4 94  ? -17.524 -34.451 26.949 1.00 52.64  ? 91   ILE H CA    1 
ATOM   5925  C  C     . ILE H  4 94  ? -17.299 -35.496 28.038 1.00 52.58  ? 91   ILE H C     1 
ATOM   5926  O  O     . ILE H  4 94  ? -17.878 -35.388 29.119 1.00 52.60  ? 91   ILE H O     1 
ATOM   5927  C  CB    . ILE H  4 94  ? -18.661 -34.927 25.993 1.00 52.21  ? 91   ILE H CB    1 
ATOM   5928  C  CG1   . ILE H  4 94  ? -18.914 -33.900 24.870 1.00 52.66  ? 91   ILE H CG1   1 
ATOM   5929  C  CG2   . ILE H  4 94  ? -19.964 -35.242 26.776 1.00 51.03  ? 91   ILE H CG2   1 
ATOM   5930  C  CD1   . ILE H  4 94  ? -19.543 -32.530 25.313 1.00 51.40  ? 91   ILE H CD1   1 
ATOM   5931  N  N     . GLN H  4 95  ? -16.466 -36.499 27.750 1.00 52.24  ? 92   GLN H N     1 
ATOM   5932  C  CA    . GLN H  4 95  ? -16.224 -37.595 28.677 1.00 52.18  ? 92   GLN H CA    1 
ATOM   5933  C  C     . GLN H  4 95  ? -15.404 -37.163 29.896 1.00 51.93  ? 92   GLN H C     1 
ATOM   5934  O  O     . GLN H  4 95  ? -15.740 -37.543 31.018 1.00 52.02  ? 92   GLN H O     1 
ATOM   5935  C  CB    . GLN H  4 95  ? -15.532 -38.768 27.975 1.00 52.72  ? 92   GLN H CB    1 
ATOM   5936  C  CG    . GLN H  4 95  ? -15.270 -39.949 28.908 1.00 52.98  ? 92   GLN H CG    1 
ATOM   5937  C  CD    . GLN H  4 95  ? -14.766 -41.185 28.201 1.00 52.80  ? 92   GLN H CD    1 
ATOM   5938  O  OE1   . GLN H  4 95  ? -13.567 -41.346 27.994 1.00 54.52  ? 92   GLN H OE1   1 
ATOM   5939  N  NE2   . GLN H  4 95  ? -15.679 -42.078 27.855 1.00 51.80  ? 92   GLN H NE2   1 
ATOM   5940  N  N     . THR H  4 96  ? -14.326 -36.402 29.680 1.00 51.01  ? 93   THR H N     1 
ATOM   5941  C  CA    . THR H  4 96  ? -13.590 -35.806 30.801 1.00 50.95  ? 93   THR H CA    1 
ATOM   5942  C  C     . THR H  4 96  ? -14.463 -34.843 31.628 1.00 50.61  ? 93   THR H C     1 
ATOM   5943  O  O     . THR H  4 96  ? -14.415 -34.875 32.864 1.00 50.28  ? 93   THR H O     1 
ATOM   5944  C  CB    . THR H  4 96  ? -12.332 -35.095 30.362 1.00 50.88  ? 93   THR H CB    1 
ATOM   5945  O  OG1   . THR H  4 96  ? -11.594 -35.951 29.484 1.00 52.79  ? 93   THR H OG1   1 
ATOM   5946  C  CG2   . THR H  4 96  ? -11.475 -34.766 31.567 1.00 50.28  ? 93   THR H CG2   1 
ATOM   5947  N  N     . ALA H  4 97  ? -15.266 -34.017 30.942 1.00 50.13  ? 94   ALA H N     1 
ATOM   5948  C  CA    . ALA H  4 97  ? -16.249 -33.136 31.589 1.00 49.29  ? 94   ALA H CA    1 
ATOM   5949  C  C     . ALA H  4 97  ? -17.213 -33.900 32.483 1.00 49.22  ? 94   ALA H C     1 
ATOM   5950  O  O     . ALA H  4 97  ? -17.624 -33.391 33.512 1.00 49.55  ? 94   ALA H O     1 
ATOM   5951  C  CB    . ALA H  4 97  ? -17.017 -32.354 30.567 1.00 48.81  ? 94   ALA H CB    1 
ATOM   5952  N  N     . VAL H  4 98  ? -17.570 -35.127 32.088 1.00 49.43  ? 95   VAL H N     1 
ATOM   5953  C  CA    . VAL H  4 98  ? -18.535 -35.950 32.834 1.00 48.70  ? 95   VAL H CA    1 
ATOM   5954  C  C     . VAL H  4 98  ? -17.842 -36.489 34.091 1.00 48.74  ? 95   VAL H C     1 
ATOM   5955  O  O     . VAL H  4 98  ? -18.358 -36.383 35.187 1.00 48.06  ? 95   VAL H O     1 
ATOM   5956  C  CB    . VAL H  4 98  ? -19.139 -37.049 31.903 1.00 48.58  ? 95   VAL H CB    1 
ATOM   5957  C  CG1   . VAL H  4 98  ? -19.769 -38.216 32.678 1.00 48.39  ? 95   VAL H CG1   1 
ATOM   5958  C  CG2   . VAL H  4 98  ? -20.155 -36.435 30.955 1.00 48.71  ? 95   VAL H CG2   1 
ATOM   5959  N  N     . ARG H  4 99  ? -16.635 -37.013 33.904 1.00 49.68  ? 96   ARG H N     1 
ATOM   5960  C  CA    . ARG H  4 99  ? -15.766 -37.460 34.991 1.00 50.84  ? 96   ARG H CA    1 
ATOM   5961  C  C     . ARG H  4 99  ? -15.473 -36.406 36.057 1.00 50.20  ? 96   ARG H C     1 
ATOM   5962  O  O     . ARG H  4 99  ? -15.448 -36.728 37.244 1.00 51.12  ? 96   ARG H O     1 
ATOM   5963  C  CB    . ARG H  4 99  ? -14.452 -38.036 34.431 1.00 50.46  ? 96   ARG H CB    1 
ATOM   5964  C  CG    . ARG H  4 99  ? -14.564 -39.487 33.958 1.00 51.89  ? 96   ARG H CG    1 
ATOM   5965  C  CD    . ARG H  4 99  ? -13.188 -40.134 33.789 1.00 53.28  ? 96   ARG H CD    1 
ATOM   5966  N  NE    . ARG H  4 99  ? -13.297 -41.516 33.300 1.00 60.32  ? 96   ARG H NE    1 
ATOM   5967  C  CZ    . ARG H  4 99  ? -13.092 -41.908 32.034 1.00 62.65  ? 96   ARG H CZ    1 
ATOM   5968  N  NH1   . ARG H  4 99  ? -12.746 -41.023 31.084 1.00 63.39  ? 96   ARG H NH1   1 
ATOM   5969  N  NH2   . ARG H  4 99  ? -13.231 -43.196 31.713 1.00 60.59  ? 96   ARG H NH2   1 
ATOM   5970  N  N     . LEU H  4 100 ? -15.247 -35.163 35.631 1.00 49.96  ? 97   LEU H N     1 
ATOM   5971  C  CA    . LEU H  4 100 ? -14.967 -34.031 36.535 1.00 49.35  ? 97   LEU H CA    1 
ATOM   5972  C  C     . LEU H  4 100 ? -16.201 -33.584 37.302 1.00 49.90  ? 97   LEU H C     1 
ATOM   5973  O  O     . LEU H  4 100 ? -16.117 -33.075 38.403 1.00 49.79  ? 97   LEU H O     1 
ATOM   5974  C  CB    . LEU H  4 100 ? -14.420 -32.835 35.748 1.00 48.41  ? 97   LEU H CB    1 
ATOM   5975  C  CG    . LEU H  4 100 ? -13.005 -32.925 35.170 1.00 46.84  ? 97   LEU H CG    1 
ATOM   5976  C  CD1   . LEU H  4 100 ? -12.757 -31.833 34.154 1.00 43.12  ? 97   LEU H CD1   1 
ATOM   5977  C  CD2   . LEU H  4 100 ? -11.934 -32.937 36.238 1.00 45.48  ? 97   LEU H CD2   1 
ATOM   5978  N  N     . LEU H  4 101 ? -17.355 -33.826 36.709 1.00 51.01  ? 98   LEU H N     1 
ATOM   5979  C  CA    . LEU H  4 101 ? -18.580 -33.194 37.087 1.00 51.65  ? 98   LEU H CA    1 
ATOM   5980  C  C     . LEU H  4 101 ? -19.537 -34.095 37.858 1.00 51.78  ? 98   LEU H C     1 
ATOM   5981  O  O     . LEU H  4 101 ? -20.209 -33.641 38.781 1.00 52.31  ? 98   LEU H O     1 
ATOM   5982  C  CB    . LEU H  4 101 ? -19.250 -32.743 35.805 1.00 52.06  ? 98   LEU H CB    1 
ATOM   5983  C  CG    . LEU H  4 101 ? -19.968 -31.405 35.832 1.00 54.46  ? 98   LEU H CG    1 
ATOM   5984  C  CD1   . LEU H  4 101 ? -19.021 -30.309 35.328 1.00 53.45  ? 98   LEU H CD1   1 
ATOM   5985  C  CD2   . LEU H  4 101 ? -21.240 -31.559 34.978 1.00 53.87  ? 98   LEU H CD2   1 
ATOM   5986  N  N     . LEU H  4 102 ? -19.627 -35.365 37.465 1.00 51.92  ? 99   LEU H N     1 
ATOM   5987  C  CA    . LEU H  4 102 ? -20.542 -36.310 38.110 1.00 51.22  ? 99   LEU H CA    1 
ATOM   5988  C  C     . LEU H  4 102 ? -19.865 -37.105 39.246 1.00 51.66  ? 99   LEU H C     1 
ATOM   5989  O  O     . LEU H  4 102 ? -18.677 -37.439 39.163 1.00 51.26  ? 99   LEU H O     1 
ATOM   5990  C  CB    . LEU H  4 102 ? -21.190 -37.238 37.080 1.00 50.64  ? 99   LEU H CB    1 
ATOM   5991  C  CG    . LEU H  4 102 ? -21.949 -36.722 35.843 1.00 49.35  ? 99   LEU H CG    1 
ATOM   5992  C  CD1   . LEU H  4 102 ? -22.901 -37.789 35.376 1.00 47.05  ? 99   LEU H CD1   1 
ATOM   5993  C  CD2   . LEU H  4 102 ? -22.733 -35.461 36.048 1.00 46.04  ? 99   LEU H CD2   1 
ATOM   5994  N  N     . PRO H  4 103 ? -20.609 -37.348 40.342 1.00 52.35  ? 100  PRO H N     1 
ATOM   5995  C  CA    . PRO H  4 103 ? -20.130 -38.151 41.470 1.00 53.15  ? 100  PRO H CA    1 
ATOM   5996  C  C     . PRO H  4 103 ? -19.907 -39.611 41.074 1.00 53.90  ? 100  PRO H C     1 
ATOM   5997  O  O     . PRO H  4 103 ? -20.671 -40.158 40.259 1.00 53.41  ? 100  PRO H O     1 
ATOM   5998  C  CB    . PRO H  4 103 ? -21.279 -38.063 42.484 1.00 53.18  ? 100  PRO H CB    1 
ATOM   5999  C  CG    . PRO H  4 103 ? -22.089 -36.906 42.064 1.00 52.52  ? 100  PRO H CG    1 
ATOM   6000  C  CD    . PRO H  4 103 ? -21.964 -36.830 40.589 1.00 52.38  ? 100  PRO H CD    1 
ATOM   6001  N  N     . GLY H  4 104 ? -18.864 -40.203 41.666 1.00 54.59  ? 101  GLY H N     1 
ATOM   6002  C  CA    . GLY H  4 104 ? -18.404 -41.587 41.439 1.00 55.22  ? 101  GLY H CA    1 
ATOM   6003  C  C     . GLY H  4 104 ? -19.184 -42.526 40.536 1.00 55.84  ? 101  GLY H C     1 
ATOM   6004  O  O     . GLY H  4 104 ? -18.797 -42.752 39.385 1.00 55.94  ? 101  GLY H O     1 
ATOM   6005  N  N     . GLU H  4 105 ? -20.272 -43.083 41.064 1.00 56.33  ? 102  GLU H N     1 
ATOM   6006  C  CA    . GLU H  4 105 ? -21.050 -44.099 40.357 1.00 57.40  ? 102  GLU H CA    1 
ATOM   6007  C  C     . GLU H  4 105 ? -21.850 -43.543 39.168 1.00 57.42  ? 102  GLU H C     1 
ATOM   6008  O  O     . GLU H  4 105 ? -21.985 -44.211 38.134 1.00 57.67  ? 102  GLU H O     1 
ATOM   6009  C  CB    . GLU H  4 105 ? -21.965 -44.818 41.355 1.00 58.24  ? 102  GLU H CB    1 
ATOM   6010  C  CG    . GLU H  4 105 ? -22.743 -46.034 40.811 1.00 60.57  ? 102  GLU H CG    1 
ATOM   6011  C  CD    . GLU H  4 105 ? -21.915 -47.323 40.777 1.00 63.89  ? 102  GLU H CD    1 
ATOM   6012  O  OE1   . GLU H  4 105 ? -20.725 -47.323 41.214 1.00 63.37  ? 102  GLU H OE1   1 
ATOM   6013  O  OE2   . GLU H  4 105 ? -22.478 -48.334 40.295 1.00 64.19  ? 102  GLU H OE2   1 
ATOM   6014  N  N     . LEU H  4 106 ? -22.382 -42.326 39.329 1.00 57.26  ? 103  LEU H N     1 
ATOM   6015  C  CA    . LEU H  4 106 ? -23.091 -41.587 38.270 1.00 56.64  ? 103  LEU H CA    1 
ATOM   6016  C  C     . LEU H  4 106 ? -22.178 -41.310 37.073 1.00 56.70  ? 103  LEU H C     1 
ATOM   6017  O  O     . LEU H  4 106 ? -22.618 -41.362 35.918 1.00 56.45  ? 103  LEU H O     1 
ATOM   6018  C  CB    . LEU H  4 106 ? -23.595 -40.253 38.831 1.00 56.72  ? 103  LEU H CB    1 
ATOM   6019  C  CG    . LEU H  4 106 ? -25.050 -39.809 38.993 1.00 56.55  ? 103  LEU H CG    1 
ATOM   6020  C  CD1   . LEU H  4 106 ? -26.068 -40.930 39.218 1.00 55.22  ? 103  LEU H CD1   1 
ATOM   6021  C  CD2   . LEU H  4 106 ? -25.121 -38.768 40.105 1.00 56.31  ? 103  LEU H CD2   1 
ATOM   6022  N  N     . ALA H  4 107 ? -20.912 -41.009 37.365 1.00 56.85  ? 104  ALA H N     1 
ATOM   6023  C  CA    . ALA H  4 107 ? -19.892 -40.787 36.345 1.00 57.27  ? 104  ALA H CA    1 
ATOM   6024  C  C     . ALA H  4 107 ? -19.647 -42.058 35.553 1.00 57.94  ? 104  ALA H C     1 
ATOM   6025  O  O     . ALA H  4 107 ? -19.590 -42.018 34.323 1.00 58.44  ? 104  ALA H O     1 
ATOM   6026  C  CB    . ALA H  4 107 ? -18.608 -40.327 36.979 1.00 57.00  ? 104  ALA H CB    1 
ATOM   6027  N  N     . LYS H  4 108 ? -19.501 -43.176 36.274 1.00 58.45  ? 105  LYS H N     1 
ATOM   6028  C  CA    . LYS H  4 108 ? -19.218 -44.493 35.698 1.00 58.79  ? 105  LYS H CA    1 
ATOM   6029  C  C     . LYS H  4 108 ? -20.252 -44.893 34.636 1.00 57.75  ? 105  LYS H C     1 
ATOM   6030  O  O     . LYS H  4 108 ? -19.895 -45.174 33.495 1.00 57.30  ? 105  LYS H O     1 
ATOM   6031  C  CB    . LYS H  4 108 ? -19.110 -45.552 36.821 1.00 58.74  ? 105  LYS H CB    1 
ATOM   6032  C  CG    . LYS H  4 108 ? -18.892 -46.998 36.332 1.00 60.44  ? 105  LYS H CG    1 
ATOM   6033  C  CD    . LYS H  4 108 ? -18.467 -47.984 37.454 1.00 61.47  ? 105  LYS H CD    1 
ATOM   6034  C  CE    . LYS H  4 108 ? -19.649 -48.460 38.351 1.00 66.23  ? 105  LYS H CE    1 
ATOM   6035  N  NZ    . LYS H  4 108 ? -20.836 -49.062 37.615 1.00 66.38  ? 105  LYS H NZ    1 
ATOM   6036  N  N     . HIS H  4 109 ? -21.526 -44.900 35.012 1.00 57.61  ? 106  HIS H N     1 
ATOM   6037  C  CA    . HIS H  4 109 ? -22.601 -45.285 34.090 1.00 57.71  ? 106  HIS H CA    1 
ATOM   6038  C  C     . HIS H  4 109 ? -22.838 -44.346 32.936 1.00 57.31  ? 106  HIS H C     1 
ATOM   6039  O  O     . HIS H  4 109 ? -23.228 -44.787 31.861 1.00 58.08  ? 106  HIS H O     1 
ATOM   6040  C  CB    . HIS H  4 109 ? -23.909 -45.466 34.834 1.00 57.87  ? 106  HIS H CB    1 
ATOM   6041  C  CG    . HIS H  4 109 ? -23.898 -46.637 35.748 1.00 60.22  ? 106  HIS H CG    1 
ATOM   6042  N  ND1   . HIS H  4 109 ? -23.564 -46.530 37.077 1.00 62.97  ? 106  HIS H ND1   1 
ATOM   6043  C  CD2   . HIS H  4 109 ? -24.128 -47.949 35.520 1.00 63.09  ? 106  HIS H CD2   1 
ATOM   6044  C  CE1   . HIS H  4 109 ? -23.617 -47.723 37.639 1.00 64.00  ? 106  HIS H CE1   1 
ATOM   6045  N  NE2   . HIS H  4 109 ? -23.950 -48.604 36.714 1.00 65.00  ? 106  HIS H NE2   1 
ATOM   6046  N  N     . ALA H  4 110 ? -22.640 -43.051 33.174 1.00 56.69  ? 107  ALA H N     1 
ATOM   6047  C  CA    . ALA H  4 110 ? -22.856 -42.038 32.173 1.00 55.86  ? 107  ALA H CA    1 
ATOM   6048  C  C     . ALA H  4 110 ? -21.770 -42.126 31.131 1.00 55.55  ? 107  ALA H C     1 
ATOM   6049  O  O     . ALA H  4 110 ? -22.037 -41.972 29.938 1.00 55.27  ? 107  ALA H O     1 
ATOM   6050  C  CB    . ALA H  4 110 ? -22.890 -40.648 32.823 1.00 56.04  ? 107  ALA H CB    1 
ATOM   6051  N  N     . VAL H  4 111 ? -20.541 -42.355 31.589 1.00 55.69  ? 108  VAL H N     1 
ATOM   6052  C  CA    . VAL H  4 111 ? -19.410 -42.634 30.701 1.00 56.54  ? 108  VAL H CA    1 
ATOM   6053  C  C     . VAL H  4 111 ? -19.689 -43.871 29.840 1.00 57.33  ? 108  VAL H C     1 
ATOM   6054  O  O     . VAL H  4 111 ? -19.392 -43.895 28.629 1.00 57.73  ? 108  VAL H O     1 
ATOM   6055  C  CB    . VAL H  4 111 ? -18.104 -42.833 31.511 1.00 56.63  ? 108  VAL H CB    1 
ATOM   6056  C  CG1   . VAL H  4 111 ? -17.019 -43.507 30.677 1.00 54.76  ? 108  VAL H CG1   1 
ATOM   6057  C  CG2   . VAL H  4 111 ? -17.629 -41.505 32.056 1.00 56.74  ? 108  VAL H CG2   1 
ATOM   6058  N  N     . SER H  4 112 ? -20.267 -44.885 30.481 1.00 57.80  ? 109  SER H N     1 
ATOM   6059  C  CA    . SER H  4 112 ? -20.612 -46.143 29.838 1.00 58.70  ? 109  SER H CA    1 
ATOM   6060  C  C     . SER H  4 112 ? -21.753 -45.979 28.820 1.00 58.99  ? 109  SER H C     1 
ATOM   6061  O  O     . SER H  4 112 ? -21.716 -46.575 27.742 1.00 59.46  ? 109  SER H O     1 
ATOM   6062  C  CB    . SER H  4 112 ? -20.887 -47.212 30.916 1.00 58.51  ? 109  SER H CB    1 
ATOM   6063  O  OG    . SER H  4 112 ? -22.078 -47.943 30.697 1.00 59.72  ? 109  SER H OG    1 
ATOM   6064  N  N     . GLU H  4 113 ? -22.741 -45.155 29.148 1.00 59.28  ? 110  GLU H N     1 
ATOM   6065  C  CA    . GLU H  4 113 ? -23.834 -44.842 28.222 1.00 60.10  ? 110  GLU H CA    1 
ATOM   6066  C  C     . GLU H  4 113 ? -23.395 -44.098 26.973 1.00 60.47  ? 110  GLU H C     1 
ATOM   6067  O  O     . GLU H  4 113 ? -23.841 -44.409 25.873 1.00 60.79  ? 110  GLU H O     1 
ATOM   6068  C  CB    . GLU H  4 113 ? -24.916 -44.034 28.915 1.00 59.97  ? 110  GLU H CB    1 
ATOM   6069  C  CG    . GLU H  4 113 ? -25.716 -44.823 29.916 1.00 62.40  ? 110  GLU H CG    1 
ATOM   6070  C  CD    . GLU H  4 113 ? -26.357 -46.047 29.302 1.00 64.52  ? 110  GLU H CD    1 
ATOM   6071  O  OE1   . GLU H  4 113 ? -27.018 -45.894 28.251 1.00 65.81  ? 110  GLU H OE1   1 
ATOM   6072  O  OE2   . GLU H  4 113 ? -26.188 -47.157 29.862 1.00 65.68  ? 110  GLU H OE2   1 
ATOM   6073  N  N     . GLY H  4 114 ? -22.530 -43.105 27.155 1.00 61.12  ? 111  GLY H N     1 
ATOM   6074  C  CA    . GLY H  4 114 ? -22.068 -42.262 26.067 1.00 61.50  ? 111  GLY H CA    1 
ATOM   6075  C  C     . GLY H  4 114 ? -21.175 -42.967 25.075 1.00 62.08  ? 111  GLY H C     1 
ATOM   6076  O  O     . GLY H  4 114 ? -21.291 -42.725 23.885 1.00 62.14  ? 111  GLY H O     1 
ATOM   6077  N  N     . THR H  4 115 ? -20.263 -43.808 25.557 1.00 62.87  ? 112  THR H N     1 
ATOM   6078  C  CA    . THR H  4 115 ? -19.444 -44.637 24.666 1.00 64.14  ? 112  THR H CA    1 
ATOM   6079  C  C     . THR H  4 115 ? -20.324 -45.645 23.910 1.00 64.90  ? 112  THR H C     1 
ATOM   6080  O  O     . THR H  4 115 ? -20.148 -45.866 22.710 1.00 64.44  ? 112  THR H O     1 
ATOM   6081  C  CB    . THR H  4 115 ? -18.340 -45.397 25.420 1.00 64.07  ? 112  THR H CB    1 
ATOM   6082  O  OG1   . THR H  4 115 ? -17.646 -44.504 26.300 1.00 64.25  ? 112  THR H OG1   1 
ATOM   6083  C  CG2   . THR H  4 115 ? -17.352 -45.986 24.435 1.00 64.69  ? 112  THR H CG2   1 
ATOM   6084  N  N     . LYS H  4 116 ? -21.277 -46.235 24.630 1.00 66.06  ? 113  LYS H N     1 
ATOM   6085  C  CA    . LYS H  4 116 ? -22.287 -47.099 24.037 1.00 67.39  ? 113  LYS H CA    1 
ATOM   6086  C  C     . LYS H  4 116 ? -23.023 -46.435 22.864 1.00 68.00  ? 113  LYS H C     1 
ATOM   6087  O  O     . LYS H  4 116 ? -23.198 -47.053 21.817 1.00 68.59  ? 113  LYS H O     1 
ATOM   6088  C  CB    . LYS H  4 116 ? -23.294 -47.556 25.101 1.00 67.46  ? 113  LYS H CB    1 
ATOM   6089  C  CG    . LYS H  4 116 ? -24.007 -48.854 24.765 1.00 68.25  ? 113  LYS H CG    1 
ATOM   6090  C  CD    . LYS H  4 116 ? -25.490 -48.793 25.065 1.00 69.63  ? 113  LYS H CD    1 
ATOM   6091  C  CE    . LYS H  4 116 ? -25.781 -48.992 26.538 1.00 71.62  ? 113  LYS H CE    1 
ATOM   6092  N  NZ    . LYS H  4 116 ? -27.186 -49.472 26.712 1.00 73.74  ? 113  LYS H NZ    1 
ATOM   6093  N  N     . ALA H  4 117 ? -23.447 -45.187 23.035 1.00 68.82  ? 114  ALA H N     1 
ATOM   6094  C  CA    . ALA H  4 117 ? -24.187 -44.483 21.983 1.00 69.61  ? 114  ALA H CA    1 
ATOM   6095  C  C     . ALA H  4 117 ? -23.295 -44.042 20.810 1.00 70.25  ? 114  ALA H C     1 
ATOM   6096  O  O     . ALA H  4 117 ? -23.755 -43.918 19.678 1.00 70.25  ? 114  ALA H O     1 
ATOM   6097  C  CB    . ALA H  4 117 ? -24.950 -43.302 22.564 1.00 69.19  ? 114  ALA H CB    1 
ATOM   6098  N  N     . VAL H  4 118 ? -22.022 -43.801 21.086 1.00 71.28  ? 115  VAL H N     1 
ATOM   6099  C  CA    . VAL H  4 118 ? -21.087 -43.408 20.048 1.00 72.40  ? 115  VAL H CA    1 
ATOM   6100  C  C     . VAL H  4 118 ? -20.768 -44.625 19.172 1.00 73.25  ? 115  VAL H C     1 
ATOM   6101  O  O     . VAL H  4 118 ? -20.781 -44.531 17.943 1.00 73.45  ? 115  VAL H O     1 
ATOM   6102  C  CB    . VAL H  4 118 ? -19.824 -42.741 20.657 1.00 72.39  ? 115  VAL H CB    1 
ATOM   6103  C  CG1   . VAL H  4 118 ? -18.634 -42.781 19.701 1.00 72.92  ? 115  VAL H CG1   1 
ATOM   6104  C  CG2   . VAL H  4 118 ? -20.136 -41.307 21.044 1.00 72.35  ? 115  VAL H CG2   1 
ATOM   6105  N  N     . THR H  4 119 ? -20.512 -45.766 19.819 1.00 74.09  ? 116  THR H N     1 
ATOM   6106  C  CA    . THR H  4 119 ? -20.295 -47.047 19.142 1.00 74.46  ? 116  THR H CA    1 
ATOM   6107  C  C     . THR H  4 119 ? -21.487 -47.394 18.245 1.00 75.05  ? 116  THR H C     1 
ATOM   6108  O  O     . THR H  4 119 ? -21.330 -47.519 17.027 1.00 75.03  ? 116  THR H O     1 
ATOM   6109  C  CB    . THR H  4 119 ? -20.000 -48.163 20.162 1.00 74.28  ? 116  THR H CB    1 
ATOM   6110  O  OG1   . THR H  4 119 ? -18.632 -48.077 20.565 1.00 73.83  ? 116  THR H OG1   1 
ATOM   6111  C  CG2   . THR H  4 119 ? -20.251 -49.543 19.574 1.00 75.31  ? 116  THR H CG2   1 
ATOM   6112  N  N     . LYS H  4 120 ? -22.672 -47.514 18.841 1.00 75.70  ? 117  LYS H N     1 
ATOM   6113  C  CA    . LYS H  4 120 ? -23.898 -47.738 18.083 1.00 76.67  ? 117  LYS H CA    1 
ATOM   6114  C  C     . LYS H  4 120 ? -24.048 -46.772 16.894 1.00 77.45  ? 117  LYS H C     1 
ATOM   6115  O  O     . LYS H  4 120 ? -24.542 -47.151 15.835 1.00 77.89  ? 117  LYS H O     1 
ATOM   6116  C  CB    . LYS H  4 120 ? -25.113 -47.666 19.006 1.00 76.67  ? 117  LYS H CB    1 
ATOM   6117  C  CG    . LYS H  4 120 ? -26.350 -48.382 18.475 1.00 77.37  ? 117  LYS H CG    1 
ATOM   6118  C  CD    . LYS H  4 120 ? -27.239 -48.893 19.620 1.00 78.72  ? 117  LYS H CD    1 
ATOM   6119  C  CE    . LYS H  4 120 ? -28.279 -49.914 19.123 1.00 79.96  ? 117  LYS H CE    1 
ATOM   6120  N  NZ    . LYS H  4 120 ? -29.204 -49.373 18.064 1.00 79.90  ? 117  LYS H NZ    1 
ATOM   6121  N  N     . TYR H  4 121 ? -23.589 -45.539 17.063 1.00 78.33  ? 118  TYR H N     1 
ATOM   6122  C  CA    . TYR H  4 121 ? -23.702 -44.517 16.028 1.00 79.30  ? 118  TYR H CA    1 
ATOM   6123  C  C     . TYR H  4 121 ? -22.621 -44.634 14.935 1.00 80.48  ? 118  TYR H C     1 
ATOM   6124  O  O     . TYR H  4 121 ? -22.910 -44.449 13.752 1.00 80.40  ? 118  TYR H O     1 
ATOM   6125  C  CB    . TYR H  4 121 ? -23.699 -43.127 16.685 1.00 78.81  ? 118  TYR H CB    1 
ATOM   6126  C  CG    . TYR H  4 121 ? -23.714 -41.951 15.739 1.00 77.65  ? 118  TYR H CG    1 
ATOM   6127  C  CD1   . TYR H  4 121 ? -24.909 -41.486 15.189 1.00 76.78  ? 118  TYR H CD1   1 
ATOM   6128  C  CD2   . TYR H  4 121 ? -22.530 -41.287 15.411 1.00 77.03  ? 118  TYR H CD2   1 
ATOM   6129  C  CE1   . TYR H  4 121 ? -24.924 -40.396 14.314 1.00 77.20  ? 118  TYR H CE1   1 
ATOM   6130  C  CE2   . TYR H  4 121 ? -22.529 -40.194 14.542 1.00 77.23  ? 118  TYR H CE2   1 
ATOM   6131  C  CZ    . TYR H  4 121 ? -23.727 -39.753 13.997 1.00 77.89  ? 118  TYR H CZ    1 
ATOM   6132  O  OH    . TYR H  4 121 ? -23.724 -38.669 13.139 1.00 78.30  ? 118  TYR H OH    1 
ATOM   6133  N  N     . THR H  4 122 ? -21.383 -44.918 15.338 1.00 82.08  ? 119  THR H N     1 
ATOM   6134  C  CA    . THR H  4 122 ? -20.272 -45.094 14.406 1.00 83.70  ? 119  THR H CA    1 
ATOM   6135  C  C     . THR H  4 122 ? -20.538 -46.350 13.571 1.00 85.09  ? 119  THR H C     1 
ATOM   6136  O  O     . THR H  4 122 ? -20.424 -46.332 12.341 1.00 85.17  ? 119  THR H O     1 
ATOM   6137  C  CB    . THR H  4 122 ? -18.929 -45.236 15.166 1.00 83.69  ? 119  THR H CB    1 
ATOM   6138  O  OG1   . THR H  4 122 ? -18.818 -44.197 16.143 1.00 83.98  ? 119  THR H OG1   1 
ATOM   6139  C  CG2   . THR H  4 122 ? -17.724 -45.167 14.222 1.00 83.57  ? 119  THR H CG2   1 
ATOM   6140  N  N     . SER H  4 123 ? -20.909 -47.428 14.261 1.00 86.67  ? 120  SER H N     1 
ATOM   6141  C  CA    . SER H  4 123 ? -21.300 -48.681 13.634 1.00 88.17  ? 120  SER H CA    1 
ATOM   6142  C  C     . SER H  4 123 ? -22.794 -48.629 13.309 1.00 89.47  ? 120  SER H C     1 
ATOM   6143  O  O     . SER H  4 123 ? -23.620 -49.265 13.984 1.00 89.75  ? 120  SER H O     1 
ATOM   6144  C  CB    . SER H  4 123 ? -20.970 -49.860 14.556 1.00 87.93  ? 120  SER H CB    1 
ATOM   6145  O  OG    . SER H  4 123 ? -19.655 -49.736 15.080 1.00 87.92  ? 120  SER H OG    1 
ATOM   6146  N  N     . ALA H  4 124 ? -23.128 -47.838 12.286 1.00 90.90  ? 121  ALA H N     1 
ATOM   6147  C  CA    . ALA H  4 124 ? -24.503 -47.677 11.801 1.00 92.14  ? 121  ALA H CA    1 
ATOM   6148  C  C     . ALA H  4 124 ? -24.512 -47.294 10.319 1.00 93.15  ? 121  ALA H C     1 
ATOM   6149  O  O     . ALA H  4 124 ? -23.840 -46.339 9.905  1.00 93.31  ? 121  ALA H O     1 
ATOM   6150  C  CB    . ALA H  4 124 ? -25.261 -46.641 12.631 1.00 91.93  ? 121  ALA H CB    1 
ATOM   6151  N  N     . LYS H  4 125 ? -25.282 -48.053 9.536  1.00 94.32  ? 122  LYS H N     1 
ATOM   6152  C  CA    . LYS H  4 125 ? -25.369 -47.898 8.075  1.00 95.13  ? 122  LYS H CA    1 
ATOM   6153  C  C     . LYS H  4 125 ? -26.442 -46.880 7.642  1.00 95.31  ? 122  LYS H C     1 
ATOM   6154  O  O     . LYS H  4 125 ? -26.260 -46.152 6.659  1.00 95.44  ? 122  LYS H O     1 
ATOM   6155  C  CB    . LYS H  4 125 ? -25.624 -49.272 7.424  1.00 95.46  ? 122  LYS H CB    1 
ATOM   6156  C  CG    . LYS H  4 125 ? -25.874 -49.265 5.907  1.00 96.01  ? 122  LYS H CG    1 
ATOM   6157  C  CD    . LYS H  4 125 ? -24.598 -48.984 5.103  1.00 96.90  ? 122  LYS H CD    1 
ATOM   6158  C  CE    . LYS H  4 125 ? -24.809 -49.242 3.605  1.00 97.12  ? 122  LYS H CE    1 
ATOM   6159  N  NZ    . LYS H  4 125 ? -25.932 -48.444 3.004  1.00 97.61  ? 122  LYS H NZ    1 
ATOM   6160  O  OXT   . LYS H  4 125 ? -27.512 -46.757 8.252  1.00 95.34  ? 122  LYS H OXT   1 
ATOM   6161  O  "O5'" . DA  I  5 1   ? 2.638   0.163   93.308 1.00 166.52 ? -73  DA  I "O5'" 1 
ATOM   6162  C  "C5'" . DA  I  5 1   ? 3.279   0.178   94.579 1.00 166.78 ? -73  DA  I "C5'" 1 
ATOM   6163  C  "C4'" . DA  I  5 1   ? 3.645   -1.223  95.042 1.00 167.01 ? -73  DA  I "C4'" 1 
ATOM   6164  O  "O4'" . DA  I  5 1   ? 2.489   -2.096  95.012 1.00 167.37 ? -73  DA  I "O4'" 1 
ATOM   6165  C  "C3'" . DA  I  5 1   ? 4.650   -1.969  94.180 1.00 166.94 ? -73  DA  I "C3'" 1 
ATOM   6166  O  "O3'" . DA  I  5 1   ? 5.972   -1.523  94.462 1.00 166.58 ? -73  DA  I "O3'" 1 
ATOM   6167  C  "C2'" . DA  I  5 1   ? 4.428   -3.410  94.635 1.00 167.20 ? -73  DA  I "C2'" 1 
ATOM   6168  C  "C1'" . DA  I  5 1   ? 2.941   -3.442  94.998 1.00 167.53 ? -73  DA  I "C1'" 1 
ATOM   6169  N  N9    . DA  I  5 1   ? 2.097   -4.257  94.106 1.00 167.70 ? -73  DA  I N9    1 
ATOM   6170  C  C8    . DA  I  5 1   ? 0.995   -3.832  93.410 1.00 167.66 ? -73  DA  I C8    1 
ATOM   6171  N  N7    . DA  I  5 1   ? 0.415   -4.762  92.687 1.00 167.66 ? -73  DA  I N7    1 
ATOM   6172  C  C5    . DA  I  5 1   ? 1.185   -5.889  92.920 1.00 167.82 ? -73  DA  I C5    1 
ATOM   6173  C  C6    . DA  I  5 1   ? 1.094   -7.219  92.443 1.00 167.68 ? -73  DA  I C6    1 
ATOM   6174  N  N6    . DA  I  5 1   ? 0.141   -7.629  91.598 1.00 167.61 ? -73  DA  I N6    1 
ATOM   6175  N  N1    . DA  I  5 1   ? 2.020   -8.112  92.866 1.00 167.60 ? -73  DA  I N1    1 
ATOM   6176  C  C2    . DA  I  5 1   ? 2.972   -7.698  93.715 1.00 167.61 ? -73  DA  I C2    1 
ATOM   6177  N  N3    . DA  I  5 1   ? 3.161   -6.478  94.229 1.00 167.74 ? -73  DA  I N3    1 
ATOM   6178  C  C4    . DA  I  5 1   ? 2.227   -5.603  93.793 1.00 167.85 ? -73  DA  I C4    1 
ATOM   6179  P  P     . DT  I  5 2   ? 6.808   -0.641  93.411 1.00 166.33 ? -72  DT  I P     1 
ATOM   6180  O  OP1   . DT  I  5 2   ? 6.500   0.779   93.692 1.00 166.34 ? -72  DT  I OP1   1 
ATOM   6181  O  OP2   . DT  I  5 2   ? 6.588   -1.186  92.052 1.00 166.28 ? -72  DT  I OP2   1 
ATOM   6182  O  "O5'" . DT  I  5 2   ? 8.341   -0.918  93.788 1.00 165.73 ? -72  DT  I "O5'" 1 
ATOM   6183  C  "C5'" . DT  I  5 2   ? 8.715   -1.557  95.009 1.00 164.98 ? -72  DT  I "C5'" 1 
ATOM   6184  C  "C4'" . DT  I  5 2   ? 9.072   -3.018  94.786 1.00 164.44 ? -72  DT  I "C4'" 1 
ATOM   6185  O  "O4'" . DT  I  5 2   ? 7.900   -3.772  94.389 1.00 164.50 ? -72  DT  I "O4'" 1 
ATOM   6186  C  "C3'" . DT  I  5 2   ? 10.122  -3.278  93.711 1.00 164.05 ? -72  DT  I "C3'" 1 
ATOM   6187  O  "O3'" . DT  I  5 2   ? 11.270  -3.824  94.345 1.00 163.49 ? -72  DT  I "O3'" 1 
ATOM   6188  C  "C2'" . DT  I  5 2   ? 9.469   -4.258  92.730 1.00 164.06 ? -72  DT  I "C2'" 1 
ATOM   6189  C  "C1'" . DT  I  5 2   ? 8.302   -4.824  93.535 1.00 164.11 ? -72  DT  I "C1'" 1 
ATOM   6190  N  N1    . DT  I  5 2   ? 7.099   -5.301  92.743 1.00 164.08 ? -72  DT  I N1    1 
ATOM   6191  C  C2    . DT  I  5 2   ? 6.711   -6.629  92.818 1.00 163.99 ? -72  DT  I C2    1 
ATOM   6192  O  O2    . DT  I  5 2   ? 7.291   -7.470  93.484 1.00 163.93 ? -72  DT  I O2    1 
ATOM   6193  N  N3    . DT  I  5 2   ? 5.603   -6.950  92.066 1.00 163.95 ? -72  DT  I N3    1 
ATOM   6194  C  C4    . DT  I  5 2   ? 4.850   -6.104  91.266 1.00 163.95 ? -72  DT  I C4    1 
ATOM   6195  O  O4    . DT  I  5 2   ? 3.873   -6.503  90.636 1.00 163.88 ? -72  DT  I O4    1 
ATOM   6196  C  C5    . DT  I  5 2   ? 5.301   -4.731  91.233 1.00 164.02 ? -72  DT  I C5    1 
ATOM   6197  C  C7    . DT  I  5 2   ? 4.580   -3.704  90.406 1.00 164.04 ? -72  DT  I C7    1 
ATOM   6198  C  C6    . DT  I  5 2   ? 6.384   -4.405  91.959 1.00 164.12 ? -72  DT  I C6    1 
ATOM   6199  P  P     . DC  I  5 3   ? 12.747  -3.593  93.764 1.00 163.15 ? -71  DC  I P     1 
ATOM   6200  O  OP1   . DC  I  5 3   ? 13.697  -3.766  94.889 1.00 163.09 ? -71  DC  I OP1   1 
ATOM   6201  O  OP2   . DC  I  5 3   ? 12.765  -2.339  92.970 1.00 163.24 ? -71  DC  I OP2   1 
ATOM   6202  O  "O5'" . DC  I  5 3   ? 12.923  -4.826  92.758 1.00 162.11 ? -71  DC  I "O5'" 1 
ATOM   6203  C  "C5'" . DC  I  5 3   ? 12.708  -6.164  93.224 1.00 160.33 ? -71  DC  I "C5'" 1 
ATOM   6204  C  "C4'" . DC  I  5 3   ? 12.444  -7.122  92.077 1.00 158.59 ? -71  DC  I "C4'" 1 
ATOM   6205  O  "O4'" . DC  I  5 3   ? 11.083  -6.978  91.586 1.00 158.37 ? -71  DC  I "O4'" 1 
ATOM   6206  C  "C3'" . DC  I  5 3   ? 13.366  -6.933  90.874 1.00 157.24 ? -71  DC  I "C3'" 1 
ATOM   6207  O  "O3'" . DC  I  5 3   ? 14.053  -8.155  90.597 1.00 155.12 ? -71  DC  I "O3'" 1 
ATOM   6208  C  "C2'" . DC  I  5 3   ? 12.423  -6.491  89.755 1.00 157.66 ? -71  DC  I "C2'" 1 
ATOM   6209  C  "C1'" . DC  I  5 3   ? 11.126  -7.170  90.188 1.00 158.02 ? -71  DC  I "C1'" 1 
ATOM   6210  N  N1    . DC  I  5 3   ? 9.845   -6.691  89.533 1.00 157.98 ? -71  DC  I N1    1 
ATOM   6211  C  C2    . DC  I  5 3   ? 8.722   -7.541  89.532 1.00 157.85 ? -71  DC  I C2    1 
ATOM   6212  O  O2    . DC  I  5 3   ? 8.795   -8.654  90.069 1.00 157.92 ? -71  DC  I O2    1 
ATOM   6213  N  N3    . DC  I  5 3   ? 7.573   -7.118  88.939 1.00 157.77 ? -71  DC  I N3    1 
ATOM   6214  C  C4    . DC  I  5 3   ? 7.512   -5.913  88.365 1.00 157.93 ? -71  DC  I C4    1 
ATOM   6215  N  N4    . DC  I  5 3   ? 6.354   -5.554  87.799 1.00 157.91 ? -71  DC  I N4    1 
ATOM   6216  C  C5    . DC  I  5 3   ? 8.639   -5.031  88.350 1.00 157.98 ? -71  DC  I C5    1 
ATOM   6217  C  C6    . DC  I  5 3   ? 9.770   -5.456  88.937 1.00 158.01 ? -71  DC  I C6    1 
ATOM   6218  P  P     . DA  I  5 4   ? 15.646  -8.205  90.772 1.00 153.25 ? -70  DA  I P     1 
ATOM   6219  O  OP1   . DA  I  5 4   ? 15.962  -7.482  92.027 1.00 153.39 ? -70  DA  I OP1   1 
ATOM   6220  O  OP2   . DA  I  5 4   ? 16.224  -7.755  89.484 1.00 152.98 ? -70  DA  I OP2   1 
ATOM   6221  O  "O5'" . DA  I  5 4   ? 16.046  -9.749  90.970 1.00 151.11 ? -70  DA  I "O5'" 1 
ATOM   6222  C  "C5'" . DA  I  5 4   ? 15.097  -10.776 91.278 1.00 147.79 ? -70  DA  I "C5'" 1 
ATOM   6223  C  "C4'" . DA  I  5 4   ? 14.745  -11.635 90.066 1.00 145.14 ? -70  DA  I "C4'" 1 
ATOM   6224  O  "O4'" . DA  I  5 4   ? 13.644  -11.046 89.320 1.00 144.57 ? -70  DA  I "O4'" 1 
ATOM   6225  C  "C3'" . DA  I  5 4   ? 15.842  -11.887 89.035 1.00 143.38 ? -70  DA  I "C3'" 1 
ATOM   6226  O  "O3'" . DA  I  5 4   ? 15.684  -13.221 88.567 1.00 141.30 ? -70  DA  I "O3'" 1 
ATOM   6227  C  "C2'" . DA  I  5 4   ? 15.523  -10.864 87.945 1.00 143.47 ? -70  DA  I "C2'" 1 
ATOM   6228  C  "C1'" . DA  I  5 4   ? 13.997  -10.924 87.953 1.00 143.49 ? -70  DA  I "C1'" 1 
ATOM   6229  N  N9    . DA  I  5 4   ? 13.283  -9.765  87.409 1.00 143.29 ? -70  DA  I N9    1 
ATOM   6230  C  C8    . DA  I  5 4   ? 13.744  -8.484  87.258 1.00 143.13 ? -70  DA  I C8    1 
ATOM   6231  N  N7    . DA  I  5 4   ? 12.863  -7.656  86.748 1.00 143.08 ? -70  DA  I N7    1 
ATOM   6232  C  C5    . DA  I  5 4   ? 11.739  -8.445  86.555 1.00 143.17 ? -70  DA  I C5    1 
ATOM   6233  C  C6    . DA  I  5 4   ? 10.451  -8.169  86.036 1.00 143.18 ? -70  DA  I C6    1 
ATOM   6234  N  N6    . DA  I  5 4   ? 10.071  -6.961  85.610 1.00 143.08 ? -70  DA  I N6    1 
ATOM   6235  N  N1    . DA  I  5 4   ? 9.561   -9.185  85.976 1.00 143.14 ? -70  DA  I N1    1 
ATOM   6236  C  C2    . DA  I  5 4   ? 9.939   -10.398 86.401 1.00 143.01 ? -70  DA  I C2    1 
ATOM   6237  N  N3    . DA  I  5 4   ? 11.113  -10.779 86.907 1.00 142.84 ? -70  DA  I N3    1 
ATOM   6238  C  C4    . DA  I  5 4   ? 11.981  -9.749  86.956 1.00 143.08 ? -70  DA  I C4    1 
ATOM   6239  P  P     . DA  I  5 5   ? 16.884  -14.032 87.883 1.00 139.63 ? -69  DA  I P     1 
ATOM   6240  O  OP1   . DA  I  5 5   ? 17.853  -14.349 88.955 1.00 139.75 ? -69  DA  I OP1   1 
ATOM   6241  O  OP2   . DA  I  5 5   ? 17.331  -13.271 86.691 1.00 139.60 ? -69  DA  I OP2   1 
ATOM   6242  O  "O5'" . DA  I  5 5   ? 16.223  -15.411 87.375 1.00 137.98 ? -69  DA  I "O5'" 1 
ATOM   6243  C  "C5'" . DA  I  5 5   ? 14.822  -15.749 87.514 1.00 134.78 ? -69  DA  I "C5'" 1 
ATOM   6244  C  "C4'" . DA  I  5 5   ? 14.081  -15.860 86.179 1.00 132.05 ? -69  DA  I "C4'" 1 
ATOM   6245  O  "O4'" . DA  I  5 5   ? 13.504  -14.578 85.803 1.00 131.07 ? -69  DA  I "O4'" 1 
ATOM   6246  C  "C3'" . DA  I  5 5   ? 14.895  -16.330 84.971 1.00 130.64 ? -69  DA  I "C3'" 1 
ATOM   6247  O  "O3'" . DA  I  5 5   ? 14.135  -17.321 84.253 1.00 129.20 ? -69  DA  I "O3'" 1 
ATOM   6248  C  "C2'" . DA  I  5 5   ? 15.136  -15.043 84.174 1.00 129.96 ? -69  DA  I "C2'" 1 
ATOM   6249  C  "C1'" . DA  I  5 5   ? 13.864  -14.253 84.472 1.00 129.69 ? -69  DA  I "C1'" 1 
ATOM   6250  N  N9    . DA  I  5 5   ? 13.984  -12.795 84.371 1.00 129.33 ? -69  DA  I N9    1 
ATOM   6251  C  C8    . DA  I  5 5   ? 15.068  -12.029 84.702 1.00 129.24 ? -69  DA  I C8    1 
ATOM   6252  N  N7    . DA  I  5 5   ? 14.891  -10.742 84.516 1.00 129.34 ? -69  DA  I N7    1 
ATOM   6253  C  C5    . DA  I  5 5   ? 13.600  -10.649 84.027 1.00 129.15 ? -69  DA  I C5    1 
ATOM   6254  C  C6    . DA  I  5 5   ? 12.806  -9.550  83.623 1.00 129.05 ? -69  DA  I C6    1 
ATOM   6255  N  N6    . DA  I  5 5   ? 13.224  -8.283  83.659 1.00 129.05 ? -69  DA  I N6    1 
ATOM   6256  N  N1    . DA  I  5 5   ? 11.554  -9.800  83.183 1.00 129.19 ? -69  DA  I N1    1 
ATOM   6257  C  C2    . DA  I  5 5   ? 11.126  -11.071 83.143 1.00 129.24 ? -69  DA  I C2    1 
ATOM   6258  N  N3    . DA  I  5 5   ? 11.779  -12.183 83.493 1.00 129.12 ? -69  DA  I N3    1 
ATOM   6259  C  C4    . DA  I  5 5   ? 13.024  -11.906 83.932 1.00 129.19 ? -69  DA  I C4    1 
ATOM   6260  P  P     . DT  I  5 6   ? 14.739  -18.256 83.086 1.00 128.06 ? -68  DT  I P     1 
ATOM   6261  O  OP1   . DT  I  5 6   ? 14.389  -19.659 83.408 1.00 127.69 ? -68  DT  I OP1   1 
ATOM   6262  O  OP2   . DT  I  5 6   ? 16.156  -17.885 82.840 1.00 128.26 ? -68  DT  I OP2   1 
ATOM   6263  O  "O5'" . DT  I  5 6   ? 13.893  -17.794 81.804 1.00 126.21 ? -68  DT  I "O5'" 1 
ATOM   6264  C  "C5'" . DT  I  5 6   ? 14.051  -16.457 81.328 1.00 123.14 ? -68  DT  I "C5'" 1 
ATOM   6265  C  "C4'" . DT  I  5 6   ? 12.909  -15.987 80.451 1.00 120.19 ? -68  DT  I "C4'" 1 
ATOM   6266  O  "O4'" . DT  I  5 6   ? 12.599  -14.608 80.784 1.00 119.16 ? -68  DT  I "O4'" 1 
ATOM   6267  C  "C3'" . DT  I  5 6   ? 13.273  -15.994 78.974 1.00 118.82 ? -68  DT  I "C3'" 1 
ATOM   6268  O  "O3'" . DT  I  5 6   ? 12.152  -16.333 78.183 1.00 117.20 ? -68  DT  I "O3'" 1 
ATOM   6269  C  "C2'" . DT  I  5 6   ? 13.721  -14.563 78.709 1.00 118.51 ? -68  DT  I "C2'" 1 
ATOM   6270  C  "C1'" . DT  I  5 6   ? 12.838  -13.771 79.668 1.00 118.37 ? -68  DT  I "C1'" 1 
ATOM   6271  N  N1    . DT  I  5 6   ? 13.472  -12.474 80.083 1.00 118.16 ? -68  DT  I N1    1 
ATOM   6272  C  C2    . DT  I  5 6   ? 12.776  -11.284 79.924 1.00 117.92 ? -68  DT  I C2    1 
ATOM   6273  O  O2    . DT  I  5 6   ? 11.645  -11.207 79.477 1.00 117.75 ? -68  DT  I O2    1 
ATOM   6274  N  N3    . DT  I  5 6   ? 13.463  -10.163 80.322 1.00 117.83 ? -68  DT  I N3    1 
ATOM   6275  C  C4    . DT  I  5 6   ? 14.744  -10.109 80.847 1.00 118.00 ? -68  DT  I C4    1 
ATOM   6276  O  O4    . DT  I  5 6   ? 15.252  -9.040  81.171 1.00 117.97 ? -68  DT  I O4    1 
ATOM   6277  C  C5    . DT  I  5 6   ? 15.419  -11.386 80.982 1.00 117.93 ? -68  DT  I C5    1 
ATOM   6278  C  C7    . DT  I  5 6   ? 16.813  -11.482 81.535 1.00 118.00 ? -68  DT  I C7    1 
ATOM   6279  C  C6    . DT  I  5 6   ? 14.760  -12.487 80.597 1.00 118.07 ? -68  DT  I C6    1 
ATOM   6280  P  P     . DA  I  5 7   ? 12.352  -17.013 76.745 1.00 116.10 ? -67  DA  I P     1 
ATOM   6281  O  OP1   . DA  I  5 7   ? 11.924  -18.421 76.903 1.00 116.00 ? -67  DA  I OP1   1 
ATOM   6282  O  OP2   . DA  I  5 7   ? 13.703  -16.694 76.215 1.00 115.95 ? -67  DA  I OP2   1 
ATOM   6283  O  "O5'" . DA  I  5 7   ? 11.296  -16.251 75.818 1.00 114.12 ? -67  DA  I "O5'" 1 
ATOM   6284  C  "C5'" . DA  I  5 7   ? 10.055  -15.814 76.355 1.00 111.51 ? -67  DA  I "C5'" 1 
ATOM   6285  C  "C4'" . DA  I  5 7   ? 9.680   -14.443 75.826 1.00 109.85 ? -67  DA  I "C4'" 1 
ATOM   6286  O  "O4'" . DA  I  5 7   ? 10.469  -13.411 76.472 1.00 108.91 ? -67  DA  I "O4'" 1 
ATOM   6287  C  "C3'" . DA  I  5 7   ? 9.891   -14.273 74.326 1.00 109.25 ? -67  DA  I "C3'" 1 
ATOM   6288  O  "O3'" . DA  I  5 7   ? 8.685   -13.759 73.758 1.00 109.19 ? -67  DA  I "O3'" 1 
ATOM   6289  C  "C2'" . DA  I  5 7   ? 11.089  -13.323 74.237 1.00 108.46 ? -67  DA  I "C2'" 1 
ATOM   6290  C  "C1'" . DA  I  5 7   ? 10.910  -12.490 75.498 1.00 107.48 ? -67  DA  I "C1'" 1 
ATOM   6291  N  N9    . DA  I  5 7   ? 12.136  -11.850 75.968 1.00 106.99 ? -67  DA  I N9    1 
ATOM   6292  C  C8    . DA  I  5 7   ? 13.334  -12.464 76.197 1.00 106.91 ? -67  DA  I C8    1 
ATOM   6293  N  N7    . DA  I  5 7   ? 14.276  -11.655 76.621 1.00 107.10 ? -67  DA  I N7    1 
ATOM   6294  C  C5    . DA  I  5 7   ? 13.656  -10.419 76.674 1.00 106.86 ? -67  DA  I C5    1 
ATOM   6295  C  C6    . DA  I  5 7   ? 14.120  -9.140  77.048 1.00 106.75 ? -67  DA  I C6    1 
ATOM   6296  N  N6    . DA  I  5 7   ? 15.371  -8.911  77.450 1.00 106.89 ? -67  DA  I N6    1 
ATOM   6297  N  N1    . DA  I  5 7   ? 13.253  -8.107  76.990 1.00 106.64 ? -67  DA  I N1    1 
ATOM   6298  C  C2    . DA  I  5 7   ? 12.002  -8.347  76.579 1.00 106.76 ? -67  DA  I C2    1 
ATOM   6299  N  N3    . DA  I  5 7   ? 11.445  -9.503  76.210 1.00 106.77 ? -67  DA  I N3    1 
ATOM   6300  C  C4    . DA  I  5 7   ? 12.332  -10.516 76.276 1.00 106.88 ? -67  DA  I C4    1 
ATOM   6301  P  P     . DT  I  5 8   ? 8.625   -13.296 72.231 1.00 109.39 ? -66  DT  I P     1 
ATOM   6302  O  OP1   . DT  I  5 8   ? 7.221   -13.320 71.766 1.00 109.18 ? -66  DT  I OP1   1 
ATOM   6303  O  OP2   . DT  I  5 8   ? 9.676   -14.041 71.494 1.00 109.26 ? -66  DT  I OP2   1 
ATOM   6304  O  "O5'" . DT  I  5 8   ? 9.049   -11.764 72.355 1.00 109.87 ? -66  DT  I "O5'" 1 
ATOM   6305  C  "C5'" . DT  I  5 8   ? 8.331   -10.892 73.236 1.00 110.27 ? -66  DT  I "C5'" 1 
ATOM   6306  C  "C4'" . DT  I  5 8   ? 8.545   -9.451  72.817 1.00 110.43 ? -66  DT  I "C4'" 1 
ATOM   6307  O  "O4'" . DT  I  5 8   ? 9.785   -8.959  73.388 1.00 110.09 ? -66  DT  I "O4'" 1 
ATOM   6308  C  "C3'" . DT  I  5 8   ? 8.645   -9.270  71.305 1.00 111.05 ? -66  DT  I "C3'" 1 
ATOM   6309  O  "O3'" . DT  I  5 8   ? 7.751   -8.229  70.905 1.00 112.40 ? -66  DT  I "O3'" 1 
ATOM   6310  C  "C2'" . DT  I  5 8   ? 10.129  -8.983  71.043 1.00 110.29 ? -66  DT  I "C2'" 1 
ATOM   6311  C  "C1'" . DT  I  5 8   ? 10.627  -8.434  72.378 1.00 109.31 ? -66  DT  I "C1'" 1 
ATOM   6312  N  N1    . DT  I  5 8   ? 12.054  -8.772  72.713 1.00 108.58 ? -66  DT  I N1    1 
ATOM   6313  C  C2    . DT  I  5 8   ? 12.881  -7.790  73.236 1.00 108.40 ? -66  DT  I C2    1 
ATOM   6314  O  O2    . DT  I  5 8   ? 12.528  -6.637  73.446 1.00 108.11 ? -66  DT  I O2    1 
ATOM   6315  N  N3    . DT  I  5 8   ? 14.161  -8.216  73.511 1.00 108.48 ? -66  DT  I N3    1 
ATOM   6316  C  C4    . DT  I  5 8   ? 14.692  -9.488  73.321 1.00 108.77 ? -66  DT  I C4    1 
ATOM   6317  O  O4    . DT  I  5 8   ? 15.859  -9.760  73.601 1.00 108.52 ? -66  DT  I O4    1 
ATOM   6318  C  C5    . DT  I  5 8   ? 13.773  -10.464 72.774 1.00 108.68 ? -66  DT  I C5    1 
ATOM   6319  C  C7    . DT  I  5 8   ? 14.213  -11.881 72.521 1.00 108.55 ? -66  DT  I C7    1 
ATOM   6320  C  C6    . DT  I  5 8   ? 12.519  -10.060 72.502 1.00 108.61 ? -66  DT  I C6    1 
ATOM   6321  P  P     . DC  I  5 9   ? 7.666   -7.680  69.401 1.00 113.50 ? -65  DC  I P     1 
ATOM   6322  O  OP1   . DC  I  5 9   ? 6.296   -7.163  69.175 1.00 113.10 ? -65  DC  I OP1   1 
ATOM   6323  O  OP2   . DC  I  5 9   ? 8.248   -8.681  68.471 1.00 113.46 ? -65  DC  I OP2   1 
ATOM   6324  O  "O5'" . DC  I  5 9   ? 8.650   -6.427  69.493 1.00 115.01 ? -65  DC  I "O5'" 1 
ATOM   6325  C  "C5'" . DC  I  5 9   ? 8.344   -5.357  70.395 1.00 117.13 ? -65  DC  I "C5'" 1 
ATOM   6326  C  "C4'" . DC  I  5 9   ? 9.454   -4.327  70.383 1.00 118.60 ? -65  DC  I "C4'" 1 
ATOM   6327  O  "O4'" . DC  I  5 9   ? 10.647  -4.915  70.952 1.00 118.43 ? -65  DC  I "O4'" 1 
ATOM   6328  C  "C3'" . DC  I  5 9   ? 9.825   -3.860  68.980 1.00 119.74 ? -65  DC  I "C3'" 1 
ATOM   6329  O  "O3'" . DC  I  5 9   ? 9.175   -2.603  68.733 1.00 121.91 ? -65  DC  I "O3'" 1 
ATOM   6330  C  "C2'" . DC  I  5 9   ? 11.352  -3.758  68.988 1.00 118.92 ? -65  DC  I "C2'" 1 
ATOM   6331  C  "C1'" . DC  I  5 9   ? 11.792  -4.411  70.299 1.00 117.77 ? -65  DC  I "C1'" 1 
ATOM   6332  N  N1    . DC  I  5 9   ? 12.762  -5.540  70.154 1.00 117.20 ? -65  DC  I N1    1 
ATOM   6333  C  C2    . DC  I  5 9   ? 14.016  -5.430  70.763 1.00 117.19 ? -65  DC  I C2    1 
ATOM   6334  O  O2    . DC  I  5 9   ? 14.294  -4.404  71.395 1.00 117.43 ? -65  DC  I O2    1 
ATOM   6335  N  N3    . DC  I  5 9   ? 14.900  -6.452  70.640 1.00 117.00 ? -65  DC  I N3    1 
ATOM   6336  C  C4    . DC  I  5 9   ? 14.566  -7.545  69.951 1.00 117.09 ? -65  DC  I C4    1 
ATOM   6337  N  N4    . DC  I  5 9   ? 15.474  -8.521  69.864 1.00 117.26 ? -65  DC  I N4    1 
ATOM   6338  C  C5    . DC  I  5 9   ? 13.291  -7.681  69.323 1.00 116.98 ? -65  DC  I C5    1 
ATOM   6339  C  C6    . DC  I  5 9   ? 12.430  -6.666  69.451 1.00 117.00 ? -65  DC  I C6    1 
ATOM   6340  P  P     . DC  I  5 10  ? 8.709   -2.121  67.269 1.00 123.14 ? -64  DC  I P     1 
ATOM   6341  O  OP1   . DC  I  5 10  ? 7.540   -1.222  67.449 1.00 123.13 ? -64  DC  I OP1   1 
ATOM   6342  O  OP2   . DC  I  5 10  ? 8.606   -3.294  66.363 1.00 122.64 ? -64  DC  I OP2   1 
ATOM   6343  O  "O5'" . DC  I  5 10  ? 9.961   -1.235  66.810 1.00 123.12 ? -64  DC  I "O5'" 1 
ATOM   6344  C  "C5'" . DC  I  5 10  ? 10.555  -0.288  67.699 1.00 123.24 ? -64  DC  I "C5'" 1 
ATOM   6345  C  "C4'" . DC  I  5 10  ? 11.985  -0.023  67.274 1.00 123.56 ? -64  DC  I "C4'" 1 
ATOM   6346  O  "O4'" . DC  I  5 10  ? 12.845  -1.106  67.721 1.00 123.20 ? -64  DC  I "O4'" 1 
ATOM   6347  C  "C3'" . DC  I  5 10  ? 12.179  0.097   65.760 1.00 123.92 ? -64  DC  I "C3'" 1 
ATOM   6348  O  "O3'" . DC  I  5 10  ? 12.938  1.271   65.462 1.00 124.79 ? -64  DC  I "O3'" 1 
ATOM   6349  C  "C2'" . DC  I  5 10  ? 12.936  -1.180  65.400 1.00 123.60 ? -64  DC  I "C2'" 1 
ATOM   6350  C  "C1'" . DC  I  5 10  ? 13.748  -1.395  66.674 1.00 123.06 ? -64  DC  I "C1'" 1 
ATOM   6351  N  N1    . DC  I  5 10  ? 14.354  -2.765  66.837 1.00 122.87 ? -64  DC  I N1    1 
ATOM   6352  C  C2    . DC  I  5 10  ? 15.542  -2.909  67.580 1.00 122.93 ? -64  DC  I C2    1 
ATOM   6353  O  O2    . DC  I  5 10  ? 16.074  -1.916  68.101 1.00 122.61 ? -64  DC  I O2    1 
ATOM   6354  N  N3    . DC  I  5 10  ? 16.082  -4.154  67.711 1.00 123.10 ? -64  DC  I N3    1 
ATOM   6355  C  C4    . DC  I  5 10  ? 15.493  -5.215  67.141 1.00 122.78 ? -64  DC  I C4    1 
ATOM   6356  N  N4    . DC  I  5 10  ? 16.071  -6.410  67.304 1.00 122.66 ? -64  DC  I N4    1 
ATOM   6357  C  C5    . DC  I  5 10  ? 14.289  -5.091  66.380 1.00 122.46 ? -64  DC  I C5    1 
ATOM   6358  C  C6    . DC  I  5 10  ? 13.766  -3.863  66.256 1.00 122.65 ? -64  DC  I C6    1 
ATOM   6359  P  P     . DA  I  5 11  ? 12.875  1.995   64.033 1.00 125.04 ? -63  DA  I P     1 
ATOM   6360  O  OP1   . DA  I  5 11  ? 11.668  2.854   64.035 1.00 124.60 ? -63  DA  I OP1   1 
ATOM   6361  O  OP2   . DA  I  5 11  ? 13.049  0.977   62.969 1.00 125.10 ? -63  DA  I OP2   1 
ATOM   6362  O  "O5'" . DA  I  5 11  ? 14.193  2.914   64.024 1.00 125.54 ? -63  DA  I "O5'" 1 
ATOM   6363  C  "C5'" . DA  I  5 11  ? 15.038  3.090   65.170 1.00 125.93 ? -63  DA  I "C5'" 1 
ATOM   6364  C  "C4'" . DA  I  5 11  ? 16.476  2.665   64.895 1.00 126.41 ? -63  DA  I "C4'" 1 
ATOM   6365  O  "O4'" . DA  I  5 11  ? 16.670  1.274   65.269 1.00 126.29 ? -63  DA  I "O4'" 1 
ATOM   6366  C  "C3'" . DA  I  5 11  ? 16.964  2.795   63.448 1.00 126.89 ? -63  DA  I "C3'" 1 
ATOM   6367  O  "O3'" . DA  I  5 11  ? 18.282  3.357   63.439 1.00 128.12 ? -63  DA  I "O3'" 1 
ATOM   6368  C  "C2'" . DA  I  5 11  ? 16.974  1.345   62.974 1.00 126.77 ? -63  DA  I "C2'" 1 
ATOM   6369  C  "C1'" . DA  I  5 11  ? 17.438  0.662   64.254 1.00 126.58 ? -63  DA  I "C1'" 1 
ATOM   6370  N  N9    . DA  I  5 11  ? 17.271  -0.793  64.274 1.00 126.68 ? -63  DA  I N9    1 
ATOM   6371  C  C8    . DA  I  5 11  ? 16.180  -1.516  63.868 1.00 126.52 ? -63  DA  I C8    1 
ATOM   6372  N  N7    . DA  I  5 11  ? 16.323  -2.815  64.004 1.00 126.46 ? -63  DA  I N7    1 
ATOM   6373  C  C5    . DA  I  5 11  ? 17.597  -2.958  64.532 1.00 126.46 ? -63  DA  I C5    1 
ATOM   6374  C  C6    . DA  I  5 11  ? 18.356  -4.092  64.910 1.00 126.59 ? -63  DA  I C6    1 
ATOM   6375  N  N6    . DA  I  5 11  ? 17.905  -5.347  64.800 1.00 126.52 ? -63  DA  I N6    1 
ATOM   6376  N  N1    . DA  I  5 11  ? 19.601  -3.887  65.407 1.00 126.55 ? -63  DA  I N1    1 
ATOM   6377  C  C2    . DA  I  5 11  ? 20.055  -2.630  65.519 1.00 126.47 ? -63  DA  I C2    1 
ATOM   6378  N  N3    . DA  I  5 11  ? 19.434  -1.491  65.196 1.00 126.58 ? -63  DA  I N3    1 
ATOM   6379  C  C4    . DA  I  5 11  ? 18.198  -1.722  64.704 1.00 126.56 ? -63  DA  I C4    1 
ATOM   6380  P  P     . DC  I  5 12  ? 18.952  4.102   62.178 1.00 128.56 ? -62  DC  I P     1 
ATOM   6381  O  OP1   . DC  I  5 12  ? 18.908  5.555   62.452 1.00 128.49 ? -62  DC  I OP1   1 
ATOM   6382  O  OP2   . DC  I  5 12  ? 18.363  3.577   60.928 1.00 128.29 ? -62  DC  I OP2   1 
ATOM   6383  O  "O5'" . DC  I  5 12  ? 20.484  3.617   62.218 1.00 129.72 ? -62  DC  I "O5'" 1 
ATOM   6384  C  "C5'" . DC  I  5 12  ? 21.158  3.166   63.411 1.00 130.97 ? -62  DC  I "C5'" 1 
ATOM   6385  C  "C4'" . DC  I  5 12  ? 22.168  2.061   63.109 1.00 132.22 ? -62  DC  I "C4'" 1 
ATOM   6386  O  "O4'" . DC  I  5 12  ? 21.539  0.759   63.277 1.00 132.33 ? -62  DC  I "O4'" 1 
ATOM   6387  C  "C3'" . DC  I  5 12  ? 22.779  2.050   61.698 1.00 133.28 ? -62  DC  I "C3'" 1 
ATOM   6388  O  "O3'" . DC  I  5 12  ? 24.198  1.818   61.762 1.00 135.26 ? -62  DC  I "O3'" 1 
ATOM   6389  C  "C2'" . DC  I  5 12  ? 22.047  0.888   61.031 1.00 132.74 ? -62  DC  I "C2'" 1 
ATOM   6390  C  "C1'" . DC  I  5 12  ? 21.979  -0.070  62.215 1.00 132.01 ? -62  DC  I "C1'" 1 
ATOM   6391  N  N1    . DC  I  5 12  ? 21.101  -1.286  62.001 1.00 131.59 ? -62  DC  I N1    1 
ATOM   6392  C  C2    . DC  I  5 12  ? 21.527  -2.561  62.433 1.00 131.23 ? -62  DC  I C2    1 
ATOM   6393  O  O2    . DC  I  5 12  ? 22.616  -2.700  63.006 1.00 131.01 ? -62  DC  I O2    1 
ATOM   6394  N  N3    . DC  I  5 12  ? 20.714  -3.628  62.216 1.00 131.19 ? -62  DC  I N3    1 
ATOM   6395  C  C4    . DC  I  5 12  ? 19.538  -3.467  61.597 1.00 131.33 ? -62  DC  I C4    1 
ATOM   6396  N  N4    . DC  I  5 12  ? 18.774  -4.546  61.404 1.00 131.32 ? -62  DC  I N4    1 
ATOM   6397  C  C5    . DC  I  5 12  ? 19.088  -2.190  61.145 1.00 131.17 ? -62  DC  I C5    1 
ATOM   6398  C  C6    . DC  I  5 12  ? 19.894  -1.144  61.365 1.00 131.41 ? -62  DC  I C6    1 
ATOM   6399  P  P     . DC  I  5 13  ? 25.178  1.781   60.484 1.00 136.82 ? -61  DC  I P     1 
ATOM   6400  O  OP1   . DC  I  5 13  ? 26.112  2.921   60.617 1.00 136.96 ? -61  DC  I OP1   1 
ATOM   6401  O  OP2   . DC  I  5 13  ? 24.382  1.657   59.237 1.00 136.65 ? -61  DC  I OP2   1 
ATOM   6402  O  "O5'" . DC  I  5 13  ? 26.004  0.426   60.751 1.00 137.94 ? -61  DC  I "O5'" 1 
ATOM   6403  C  "C5'" . DC  I  5 13  ? 26.517  -0.390  59.692 1.00 140.24 ? -61  DC  I "C5'" 1 
ATOM   6404  C  "C4'" . DC  I  5 13  ? 26.590  -1.851  60.113 1.00 142.00 ? -61  DC  I "C4'" 1 
ATOM   6405  O  "O4'" . DC  I  5 13  ? 25.314  -2.265  60.675 1.00 142.31 ? -61  DC  I "O4'" 1 
ATOM   6406  C  "C3'" . DC  I  5 13  ? 26.864  -2.841  58.986 1.00 143.14 ? -61  DC  I "C3'" 1 
ATOM   6407  O  "O3'" . DC  I  5 13  ? 28.272  -3.041  58.816 1.00 144.73 ? -61  DC  I "O3'" 1 
ATOM   6408  C  "C2'" . DC  I  5 13  ? 26.176  -4.112  59.482 1.00 142.81 ? -61  DC  I "C2'" 1 
ATOM   6409  C  "C1'" . DC  I  5 13  ? 24.955  -3.560  60.214 1.00 142.23 ? -61  DC  I "C1'" 1 
ATOM   6410  N  N1    . DC  I  5 13  ? 23.671  -3.517  59.387 1.00 142.04 ? -61  DC  I N1    1 
ATOM   6411  C  C2    . DC  I  5 13  ? 22.918  -4.692  59.162 1.00 141.89 ? -61  DC  I C2    1 
ATOM   6412  O  O2    . DC  I  5 13  ? 23.293  -5.778  59.627 1.00 141.71 ? -61  DC  I O2    1 
ATOM   6413  N  N3    . DC  I  5 13  ? 21.777  -4.611  58.423 1.00 141.74 ? -61  DC  I N3    1 
ATOM   6414  C  C4    . DC  I  5 13  ? 21.375  -3.439  57.922 1.00 141.78 ? -61  DC  I C4    1 
ATOM   6415  N  N4    . DC  I  5 13  ? 20.250  -3.413  57.207 1.00 141.74 ? -61  DC  I N4    1 
ATOM   6416  C  C5    . DC  I  5 13  ? 22.114  -2.238  58.135 1.00 141.80 ? -61  DC  I C5    1 
ATOM   6417  C  C6    . DC  I  5 13  ? 23.236  -2.327  58.861 1.00 141.92 ? -61  DC  I C6    1 
ATOM   6418  P  P     . DT  I  5 14  ? 28.904  -3.408  57.385 1.00 145.72 ? -60  DT  I P     1 
ATOM   6419  O  OP1   . DT  I  5 14  ? 30.363  -3.579  57.576 1.00 145.86 ? -60  DT  I OP1   1 
ATOM   6420  O  OP2   . DT  I  5 14  ? 28.406  -2.418  56.398 1.00 145.52 ? -60  DT  I OP2   1 
ATOM   6421  O  "O5'" . DT  I  5 14  ? 28.259  -4.834  57.034 1.00 146.26 ? -60  DT  I "O5'" 1 
ATOM   6422  C  "C5'" . DT  I  5 14  ? 28.777  -6.066  57.558 1.00 146.82 ? -60  DT  I "C5'" 1 
ATOM   6423  C  "C4'" . DT  I  5 14  ? 28.160  -7.259  56.838 1.00 147.24 ? -60  DT  I "C4'" 1 
ATOM   6424  O  "O4'" . DT  I  5 14  ? 26.716  -7.095  56.748 1.00 147.32 ? -60  DT  I "O4'" 1 
ATOM   6425  C  "C3'" . DT  I  5 14  ? 28.655  -7.477  55.406 1.00 147.40 ? -60  DT  I "C3'" 1 
ATOM   6426  O  "O3'" . DT  I  5 14  ? 28.838  -8.872  55.128 1.00 147.41 ? -60  DT  I "O3'" 1 
ATOM   6427  C  "C2'" . DT  I  5 14  ? 27.541  -6.880  54.547 1.00 147.40 ? -60  DT  I "C2'" 1 
ATOM   6428  C  "C1'" . DT  I  5 14  ? 26.302  -7.164  55.393 1.00 147.20 ? -60  DT  I "C1'" 1 
ATOM   6429  N  N1    . DT  I  5 14  ? 25.157  -6.214  55.158 1.00 147.13 ? -60  DT  I N1    1 
ATOM   6430  C  C2    . DT  I  5 14  ? 23.865  -6.712  55.117 1.00 146.96 ? -60  DT  I C2    1 
ATOM   6431  O  O2    . DT  I  5 14  ? 23.587  -7.890  55.264 1.00 146.93 ? -60  DT  I O2    1 
ATOM   6432  N  N3    . DT  I  5 14  ? 22.894  -5.765  54.895 1.00 146.88 ? -60  DT  I N3    1 
ATOM   6433  C  C4    . DT  I  5 14  ? 23.078  -4.403  54.713 1.00 146.98 ? -60  DT  I C4    1 
ATOM   6434  O  O4    . DT  I  5 14  ? 22.130  -3.647  54.523 1.00 147.05 ? -60  DT  I O4    1 
ATOM   6435  C  C5    . DT  I  5 14  ? 24.452  -3.945  54.764 1.00 146.97 ? -60  DT  I C5    1 
ATOM   6436  C  C7    . DT  I  5 14  ? 24.792  -2.493  54.582 1.00 146.99 ? -60  DT  I C7    1 
ATOM   6437  C  C6    . DT  I  5 14  ? 25.409  -4.860  54.982 1.00 146.99 ? -60  DT  I C6    1 
ATOM   6438  P  P     . DG  I  5 15  ? 29.816  -9.350  53.946 1.00 147.10 ? -59  DG  I P     1 
ATOM   6439  O  OP1   . DG  I  5 15  ? 31.193  -9.019  54.378 1.00 147.20 ? -59  DG  I OP1   1 
ATOM   6440  O  OP2   . DG  I  5 15  ? 29.321  -8.797  52.664 1.00 147.06 ? -59  DG  I OP2   1 
ATOM   6441  O  "O5'" . DG  I  5 15  ? 29.647  -10.951 53.907 1.00 146.37 ? -59  DG  I "O5'" 1 
ATOM   6442  C  "C5'" . DG  I  5 15  ? 28.390  -11.626 54.126 1.00 144.92 ? -59  DG  I "C5'" 1 
ATOM   6443  C  "C4'" . DG  I  5 15  ? 27.563  -11.825 52.856 1.00 143.69 ? -59  DG  I "C4'" 1 
ATOM   6444  O  "O4'" . DG  I  5 15  ? 26.538  -10.801 52.773 1.00 143.59 ? -59  DG  I "O4'" 1 
ATOM   6445  C  "C3'" . DG  I  5 15  ? 28.326  -11.808 51.525 1.00 142.76 ? -59  DG  I "C3'" 1 
ATOM   6446  O  "O3'" . DG  I  5 15  ? 28.414  -13.147 50.964 1.00 141.22 ? -59  DG  I "O3'" 1 
ATOM   6447  C  "C2'" . DG  I  5 15  ? 27.618  -10.750 50.662 1.00 143.00 ? -59  DG  I "C2'" 1 
ATOM   6448  C  "C1'" . DG  I  5 15  ? 26.320  -10.449 51.420 1.00 143.14 ? -59  DG  I "C1'" 1 
ATOM   6449  N  N9    . DG  I  5 15  ? 25.854  -9.055  51.382 1.00 143.16 ? -59  DG  I N9    1 
ATOM   6450  C  C8    . DG  I  5 15  ? 26.614  -7.911  51.257 1.00 142.96 ? -59  DG  I C8    1 
ATOM   6451  N  N7    . DG  I  5 15  ? 25.915  -6.810  51.260 1.00 142.87 ? -59  DG  I N7    1 
ATOM   6452  C  C5    . DG  I  5 15  ? 24.603  -7.245  51.397 1.00 142.97 ? -59  DG  I C5    1 
ATOM   6453  C  C6    . DG  I  5 15  ? 23.397  -6.502  51.464 1.00 142.94 ? -59  DG  I C6    1 
ATOM   6454  O  O6    . DG  I  5 15  ? 23.258  -5.272  51.415 1.00 142.94 ? -59  DG  I O6    1 
ATOM   6455  N  N1    . DG  I  5 15  ? 22.278  -7.324  51.607 1.00 142.89 ? -59  DG  I N1    1 
ATOM   6456  C  C2    . DG  I  5 15  ? 22.321  -8.698  51.676 1.00 142.85 ? -59  DG  I C2    1 
ATOM   6457  N  N2    . DG  I  5 15  ? 21.146  -9.326  51.811 1.00 142.89 ? -59  DG  I N2    1 
ATOM   6458  N  N3    . DG  I  5 15  ? 23.442  -9.408  51.615 1.00 142.91 ? -59  DG  I N3    1 
ATOM   6459  C  C4    . DG  I  5 15  ? 24.545  -8.623  51.476 1.00 143.09 ? -59  DG  I C4    1 
ATOM   6460  P  P     . DC  I  5 16  ? 27.450  -13.776 49.842 1.00 140.21 ? -58  DC  I P     1 
ATOM   6461  O  OP1   . DC  I  5 16  ? 27.719  -15.233 49.795 1.00 140.02 ? -58  DC  I OP1   1 
ATOM   6462  O  OP2   . DC  I  5 16  ? 27.607  -12.974 48.603 1.00 140.03 ? -58  DC  I OP2   1 
ATOM   6463  O  "O5'" . DC  I  5 16  ? 25.980  -13.543 50.447 1.00 138.95 ? -58  DC  I "O5'" 1 
ATOM   6464  C  "C5'" . DC  I  5 16  ? 24.870  -14.371 50.102 1.00 136.65 ? -58  DC  I "C5'" 1 
ATOM   6465  C  "C4'" . DC  I  5 16  ? 23.934  -13.685 49.116 1.00 134.90 ? -58  DC  I "C4'" 1 
ATOM   6466  O  "O4'" . DC  I  5 16  ? 23.955  -12.241 49.257 1.00 134.25 ? -58  DC  I "O4'" 1 
ATOM   6467  C  "C3'" . DC  I  5 16  ? 24.236  -13.979 47.645 1.00 134.07 ? -58  DC  I "C3'" 1 
ATOM   6468  O  "O3'" . DC  I  5 16  ? 23.081  -14.545 47.029 1.00 133.25 ? -58  DC  I "O3'" 1 
ATOM   6469  C  "C2'" . DC  I  5 16  ? 24.566  -12.608 47.050 1.00 133.93 ? -58  DC  I "C2'" 1 
ATOM   6470  C  "C1'" . DC  I  5 16  ? 23.751  -11.700 47.967 1.00 133.69 ? -58  DC  I "C1'" 1 
ATOM   6471  N  N1    . DC  I  5 16  ? 24.078  -10.224 47.961 1.00 133.42 ? -58  DC  I N1    1 
ATOM   6472  C  C2    . DC  I  5 16  ? 23.035  -9.296  48.119 1.00 133.28 ? -58  DC  I C2    1 
ATOM   6473  O  O2    . DC  I  5 16  ? 21.877  -9.705  48.253 1.00 133.33 ? -58  DC  I O2    1 
ATOM   6474  N  N3    . DC  I  5 16  ? 23.317  -7.966  48.118 1.00 133.22 ? -58  DC  I N3    1 
ATOM   6475  C  C4    . DC  I  5 16  ? 24.573  -7.543  47.971 1.00 133.29 ? -58  DC  I C4    1 
ATOM   6476  N  N4    . DC  I  5 16  ? 24.791  -6.223  47.979 1.00 133.22 ? -58  DC  I N4    1 
ATOM   6477  C  C5    . DC  I  5 16  ? 25.654  -8.465  47.811 1.00 133.37 ? -58  DC  I C5    1 
ATOM   6478  C  C6    . DC  I  5 16  ? 25.365  -9.777  47.812 1.00 133.43 ? -58  DC  I C6    1 
ATOM   6479  P  P     . DA  I  5 17  ? 22.767  -16.117 47.083 1.00 132.62 ? -57  DA  I P     1 
ATOM   6480  O  OP1   . DA  I  5 17  ? 23.046  -16.624 48.449 1.00 132.80 ? -57  DA  I OP1   1 
ATOM   6481  O  OP2   . DA  I  5 17  ? 23.425  -16.720 45.902 1.00 132.65 ? -57  DA  I OP2   1 
ATOM   6482  O  "O5'" . DA  I  5 17  ? 21.187  -16.212 46.826 1.00 131.59 ? -57  DA  I "O5'" 1 
ATOM   6483  C  "C5'" . DA  I  5 17  ? 20.222  -15.845 47.826 1.00 129.41 ? -57  DA  I "C5'" 1 
ATOM   6484  C  "C4'" . DA  I  5 17  ? 19.200  -14.848 47.283 1.00 127.61 ? -57  DA  I "C4'" 1 
ATOM   6485  O  "O4'" . DA  I  5 17  ? 19.834  -13.582 46.948 1.00 127.43 ? -57  DA  I "O4'" 1 
ATOM   6486  C  "C3'" . DA  I  5 17  ? 18.436  -15.265 46.028 1.00 126.06 ? -57  DA  I "C3'" 1 
ATOM   6487  O  "O3'" . DA  I  5 17  ? 17.093  -14.813 46.182 1.00 123.87 ? -57  DA  I "O3'" 1 
ATOM   6488  C  "C2'" . DA  I  5 17  ? 19.189  -14.544 44.904 1.00 126.21 ? -57  DA  I "C2'" 1 
ATOM   6489  C  "C1'" . DA  I  5 17  ? 19.574  -13.239 45.597 1.00 126.75 ? -57  DA  I "C1'" 1 
ATOM   6490  N  N9    . DA  I  5 17  ? 20.756  -12.546 45.075 1.00 126.75 ? -57  DA  I N9    1 
ATOM   6491  C  C8    . DA  I  5 17  ? 21.864  -13.104 44.495 1.00 126.77 ? -57  DA  I C8    1 
ATOM   6492  N  N7    . DA  I  5 17  ? 22.770  -12.227 44.130 1.00 126.95 ? -57  DA  I N7    1 
ATOM   6493  C  C5    . DA  I  5 17  ? 22.225  -11.007 44.498 1.00 126.69 ? -57  DA  I C5    1 
ATOM   6494  C  C6    . DA  I  5 17  ? 22.692  -9.677  44.386 1.00 126.73 ? -57  DA  I C6    1 
ATOM   6495  N  N6    . DA  I  5 17  ? 23.869  -9.353  43.842 1.00 126.64 ? -57  DA  I N6    1 
ATOM   6496  N  N1    . DA  I  5 17  ? 21.900  -8.685  44.850 1.00 126.64 ? -57  DA  I N1    1 
ATOM   6497  C  C2    . DA  I  5 17  ? 20.720  -9.009  45.391 1.00 126.58 ? -57  DA  I C2    1 
ATOM   6498  N  N3    . DA  I  5 17  ? 20.177  -10.216 45.554 1.00 126.56 ? -57  DA  I N3    1 
ATOM   6499  C  C4    . DA  I  5 17  ? 20.984  -11.185 45.083 1.00 126.61 ? -57  DA  I C4    1 
ATOM   6500  P  P     . DG  I  5 18  ? 15.926  -15.190 45.150 1.00 122.50 ? -56  DG  I P     1 
ATOM   6501  O  OP1   . DG  I  5 18  ? 15.202  -16.337 45.735 1.00 122.52 ? -56  DG  I OP1   1 
ATOM   6502  O  OP2   . DG  I  5 18  ? 16.493  -15.292 43.781 1.00 122.15 ? -56  DG  I OP2   1 
ATOM   6503  O  "O5'" . DG  I  5 18  ? 14.948  -13.918 45.190 1.00 120.74 ? -56  DG  I "O5'" 1 
ATOM   6504  C  "C5'" . DG  I  5 18  ? 15.409  -12.613 45.572 1.00 117.92 ? -56  DG  I "C5'" 1 
ATOM   6505  C  "C4'" . DG  I  5 18  ? 15.468  -11.616 44.419 1.00 115.60 ? -56  DG  I "C4'" 1 
ATOM   6506  O  "O4'" . DG  I  5 18  ? 16.852  -11.363 44.046 1.00 115.29 ? -56  DG  I "O4'" 1 
ATOM   6507  C  "C3'" . DG  I  5 18  ? 14.744  -11.974 43.116 1.00 114.02 ? -56  DG  I "C3'" 1 
ATOM   6508  O  "O3'" . DG  I  5 18  ? 14.084  -10.811 42.631 1.00 112.01 ? -56  DG  I "O3'" 1 
ATOM   6509  C  "C2'" . DG  I  5 18  ? 15.905  -12.300 42.181 1.00 114.35 ? -56  DG  I "C2'" 1 
ATOM   6510  C  "C1'" . DG  I  5 18  ? 16.860  -11.205 42.644 1.00 114.87 ? -56  DG  I "C1'" 1 
ATOM   6511  N  N9    . DG  I  5 18  ? 18.224  -11.217 42.111 1.00 114.85 ? -56  DG  I N9    1 
ATOM   6512  C  C8    . DG  I  5 18  ? 18.904  -12.265 41.539 1.00 114.95 ? -56  DG  I C8    1 
ATOM   6513  N  N7    . DG  I  5 18  ? 20.110  -11.957 41.151 1.00 115.01 ? -56  DG  I N7    1 
ATOM   6514  C  C5    . DG  I  5 18  ? 20.244  -10.615 41.483 1.00 115.07 ? -56  DG  I C5    1 
ATOM   6515  C  C6    . DG  I  5 18  ? 21.338  -9.725  41.303 1.00 114.97 ? -56  DG  I C6    1 
ATOM   6516  O  O6    . DG  I  5 18  ? 22.441  -9.970  40.798 1.00 114.94 ? -56  DG  I O6    1 
ATOM   6517  N  N1    . DG  I  5 18  ? 21.065  -8.438  41.780 1.00 114.90 ? -56  DG  I N1    1 
ATOM   6518  C  C2    . DG  I  5 18  ? 19.872  -8.061  42.359 1.00 115.03 ? -56  DG  I C2    1 
ATOM   6519  N  N2    . DG  I  5 18  ? 19.772  -6.789  42.767 1.00 114.98 ? -56  DG  I N2    1 
ATOM   6520  N  N3    . DG  I  5 18  ? 18.841  -8.886  42.533 1.00 115.37 ? -56  DG  I N3    1 
ATOM   6521  C  C4    . DG  I  5 18  ? 19.090  -10.144 42.074 1.00 115.10 ? -56  DG  I C4    1 
ATOM   6522  P  P     . DA  I  5 19  ? 12.531  -10.463 42.814 1.00 110.09 ? -55  DA  I P     1 
ATOM   6523  O  OP1   . DA  I  5 19  ? 12.119  -10.595 44.231 1.00 108.99 ? -55  DA  I OP1   1 
ATOM   6524  O  OP2   . DA  I  5 19  ? 11.819  -11.194 41.749 1.00 110.06 ? -55  DA  I OP2   1 
ATOM   6525  O  "O5'" . DA  I  5 19  ? 12.539  -8.911  42.425 1.00 109.43 ? -55  DA  I "O5'" 1 
ATOM   6526  C  "C5'" . DA  I  5 19  ? 13.481  -8.044  43.068 1.00 109.28 ? -55  DA  I "C5'" 1 
ATOM   6527  C  "C4'" . DA  I  5 19  ? 14.180  -7.049  42.151 1.00 109.00 ? -55  DA  I "C4'" 1 
ATOM   6528  O  "O4'" . DA  I  5 19  ? 15.509  -7.522  41.803 1.00 108.36 ? -55  DA  I "O4'" 1 
ATOM   6529  C  "C3'" . DA  I  5 19  ? 13.466  -6.730  40.839 1.00 109.50 ? -55  DA  I "C3'" 1 
ATOM   6530  O  "O3'" . DA  I  5 19  ? 13.314  -5.330  40.684 1.00 110.87 ? -55  DA  I "O3'" 1 
ATOM   6531  C  "C2'" . DA  I  5 19  ? 14.405  -7.292  39.783 1.00 109.00 ? -55  DA  I "C2'" 1 
ATOM   6532  C  "C1'" . DA  I  5 19  ? 15.745  -7.115  40.478 1.00 108.75 ? -55  DA  I "C1'" 1 
ATOM   6533  N  N9    . DA  I  5 19  ? 16.816  -7.893  39.866 1.00 108.80 ? -55  DA  I N9    1 
ATOM   6534  C  C8    . DA  I  5 19  ? 16.820  -9.223  39.545 1.00 108.85 ? -55  DA  I C8    1 
ATOM   6535  N  N7    . DA  I  5 19  ? 17.934  -9.637  38.988 1.00 108.69 ? -55  DA  I N7    1 
ATOM   6536  C  C5    . DA  I  5 19  ? 18.718  -8.495  38.934 1.00 109.08 ? -55  DA  I C5    1 
ATOM   6537  C  C6    . DA  I  5 19  ? 20.027  -8.246  38.453 1.00 108.90 ? -55  DA  I C6    1 
ATOM   6538  N  N6    . DA  I  5 19  ? 20.812  -9.182  37.912 1.00 108.84 ? -55  DA  I N6    1 
ATOM   6539  N  N1    . DA  I  5 19  ? 20.508  -6.988  38.551 1.00 108.87 ? -55  DA  I N1    1 
ATOM   6540  C  C2    . DA  I  5 19  ? 19.734  -6.037  39.097 1.00 108.96 ? -55  DA  I C2    1 
ATOM   6541  N  N3    . DA  I  5 19  ? 18.493  -6.143  39.578 1.00 109.02 ? -55  DA  I N3    1 
ATOM   6542  C  C4    . DA  I  5 19  ? 18.040  -7.409  39.469 1.00 109.13 ? -55  DA  I C4    1 
ATOM   6543  P  P     . DT  I  5 20  ? 12.118  -4.732  39.799 1.00 112.53 ? -54  DT  I P     1 
ATOM   6544  O  OP1   . DT  I  5 20  ? 11.048  -4.308  40.731 1.00 113.08 ? -54  DT  I OP1   1 
ATOM   6545  O  OP2   . DT  I  5 20  ? 11.819  -5.671  38.694 1.00 112.15 ? -54  DT  I OP2   1 
ATOM   6546  O  "O5'" . DT  I  5 20  ? 12.733  -3.414  39.134 1.00 114.25 ? -54  DT  I "O5'" 1 
ATOM   6547  C  "C5'" . DT  I  5 20  ? 13.742  -2.650  39.775 1.00 117.02 ? -54  DT  I "C5'" 1 
ATOM   6548  C  "C4'" . DT  I  5 20  ? 14.906  -2.422  38.824 1.00 119.36 ? -54  DT  I "C4'" 1 
ATOM   6549  O  "O4'" . DT  I  5 20  ? 15.651  -3.642  38.575 1.00 119.46 ? -54  DT  I "O4'" 1 
ATOM   6550  C  "C3'" . DT  I  5 20  ? 14.531  -1.854  37.450 1.00 120.75 ? -54  DT  I "C3'" 1 
ATOM   6551  O  "O3'" . DT  I  5 20  ? 15.062  -0.518  37.408 1.00 123.59 ? -54  DT  I "O3'" 1 
ATOM   6552  C  "C2'" . DT  I  5 20  ? 15.150  -2.844  36.455 1.00 119.95 ? -54  DT  I "C2'" 1 
ATOM   6553  C  "C1'" . DT  I  5 20  ? 16.241  -3.490  37.302 1.00 119.26 ? -54  DT  I "C1'" 1 
ATOM   6554  N  N1    . DT  I  5 20  ? 16.751  -4.811  36.803 1.00 119.13 ? -54  DT  I N1    1 
ATOM   6555  C  C2    . DT  I  5 20  ? 18.068  -4.901  36.398 1.00 118.89 ? -54  DT  I C2    1 
ATOM   6556  O  O2    . DT  I  5 20  ? 18.847  -3.965  36.421 1.00 118.91 ? -54  DT  I O2    1 
ATOM   6557  N  N3    . DT  I  5 20  ? 18.449  -6.148  35.959 1.00 118.91 ? -54  DT  I N3    1 
ATOM   6558  C  C4    . DT  I  5 20  ? 17.664  -7.289  35.884 1.00 119.00 ? -54  DT  I C4    1 
ATOM   6559  O  O4    . DT  I  5 20  ? 18.118  -8.351  35.470 1.00 119.04 ? -54  DT  I O4    1 
ATOM   6560  C  C5    . DT  I  5 20  ? 16.292  -7.135  36.324 1.00 119.10 ? -54  DT  I C5    1 
ATOM   6561  C  C7    . DT  I  5 20  ? 15.333  -8.295  36.293 1.00 118.84 ? -54  DT  I C7    1 
ATOM   6562  C  C6    . DT  I  5 20  ? 15.911  -5.918  36.754 1.00 119.31 ? -54  DT  I C6    1 
ATOM   6563  P  P     . DA  I  5 21  ? 15.490  0.296   36.094 1.00 125.58 ? -53  DA  I P     1 
ATOM   6564  O  OP1   . DA  I  5 21  ? 15.718  1.690   36.541 1.00 125.49 ? -53  DA  I OP1   1 
ATOM   6565  O  OP2   . DA  I  5 21  ? 14.510  0.030   35.009 1.00 125.26 ? -53  DA  I OP2   1 
ATOM   6566  O  "O5'" . DA  I  5 21  ? 16.889  -0.387  35.698 1.00 127.09 ? -53  DA  I "O5'" 1 
ATOM   6567  C  "C5'" . DA  I  5 21  ? 18.133  0.318   35.732 1.00 129.61 ? -53  DA  I "C5'" 1 
ATOM   6568  C  "C4'" . DA  I  5 21  ? 18.981  -0.037  34.519 1.00 131.45 ? -53  DA  I "C4'" 1 
ATOM   6569  O  "O4'" . DA  I  5 21  ? 19.166  -1.477  34.428 1.00 131.65 ? -53  DA  I "O4'" 1 
ATOM   6570  C  "C3'" . DA  I  5 21  ? 18.410  0.406   33.169 1.00 132.80 ? -53  DA  I "C3'" 1 
ATOM   6571  O  "O3'" . DA  I  5 21  ? 19.443  1.055   32.415 1.00 134.91 ? -53  DA  I "O3'" 1 
ATOM   6572  C  "C2'" . DA  I  5 21  ? 17.960  -0.910  32.533 1.00 132.37 ? -53  DA  I "C2'" 1 
ATOM   6573  C  "C1'" . DA  I  5 21  ? 19.033  -1.849  33.069 1.00 131.80 ? -53  DA  I "C1'" 1 
ATOM   6574  N  N9    . DA  I  5 21  ? 18.726  -3.277  32.930 1.00 131.75 ? -53  DA  I N9    1 
ATOM   6575  C  C8    . DA  I  5 21  ? 17.563  -3.922  33.256 1.00 131.65 ? -53  DA  I C8    1 
ATOM   6576  N  N7    . DA  I  5 21  ? 17.584  -5.212  33.013 1.00 131.61 ? -53  DA  I N7    1 
ATOM   6577  C  C5    . DA  I  5 21  ? 18.846  -5.435  32.486 1.00 131.60 ? -53  DA  I C5    1 
ATOM   6578  C  C6    . DA  I  5 21  ? 19.505  -6.598  32.019 1.00 131.62 ? -53  DA  I C6    1 
ATOM   6579  N  N6    . DA  I  5 21  ? 18.950  -7.814  32.011 1.00 131.72 ? -53  DA  I N6    1 
ATOM   6580  N  N1    . DA  I  5 21  ? 20.768  -6.470  31.555 1.00 131.67 ? -53  DA  I N1    1 
ATOM   6581  C  C2    . DA  I  5 21  ? 21.338  -5.257  31.554 1.00 131.70 ? -53  DA  I C2    1 
ATOM   6582  N  N3    . DA  I  5 21  ? 20.823  -4.097  31.970 1.00 131.79 ? -53  DA  I N3    1 
ATOM   6583  C  C4    . DA  I  5 21  ? 19.563  -4.251  32.427 1.00 131.70 ? -53  DA  I C4    1 
ATOM   6584  P  P     . DC  I  5 22  ? 19.209  1.825   31.024 1.00 136.49 ? -52  DC  I P     1 
ATOM   6585  O  OP1   . DC  I  5 22  ? 19.430  3.267   31.284 1.00 136.24 ? -52  DC  I OP1   1 
ATOM   6586  O  OP2   . DC  I  5 22  ? 17.933  1.393   30.397 1.00 136.26 ? -52  DC  I OP2   1 
ATOM   6587  O  "O5'" . DC  I  5 22  ? 20.446  1.266   30.163 1.00 137.25 ? -52  DC  I "O5'" 1 
ATOM   6588  C  "C5'" . DC  I  5 22  ? 20.277  0.759   28.841 1.00 138.72 ? -52  DC  I "C5'" 1 
ATOM   6589  C  "C4'" . DC  I  5 22  ? 21.334  -0.285  28.531 1.00 139.80 ? -52  DC  I "C4'" 1 
ATOM   6590  O  "O4'" . DC  I  5 22  ? 21.234  -1.371  29.485 1.00 140.28 ? -52  DC  I "O4'" 1 
ATOM   6591  C  "C3'" . DC  I  5 22  ? 21.192  -0.930  27.161 1.00 140.53 ? -52  DC  I "C3'" 1 
ATOM   6592  O  "O3'" . DC  I  5 22  ? 22.050  -0.276  26.253 1.00 141.54 ? -52  DC  I "O3'" 1 
ATOM   6593  C  "C2'" . DC  I  5 22  ? 21.659  -2.363  27.385 1.00 140.37 ? -52  DC  I "C2'" 1 
ATOM   6594  C  "C1'" . DC  I  5 22  ? 21.190  -2.622  28.813 1.00 140.26 ? -52  DC  I "C1'" 1 
ATOM   6595  N  N1    . DC  I  5 22  ? 19.815  -3.265  28.933 1.00 140.13 ? -52  DC  I N1    1 
ATOM   6596  C  C2    . DC  I  5 22  ? 19.662  -4.646  28.682 1.00 140.21 ? -52  DC  I C2    1 
ATOM   6597  O  O2    . DC  I  5 22  ? 20.641  -5.334  28.359 1.00 139.97 ? -52  DC  I O2    1 
ATOM   6598  N  N3    . DC  I  5 22  ? 18.428  -5.207  28.804 1.00 140.18 ? -52  DC  I N3    1 
ATOM   6599  C  C4    . DC  I  5 22  ? 17.379  -4.456  29.154 1.00 140.08 ? -52  DC  I C4    1 
ATOM   6600  N  N4    . DC  I  5 22  ? 16.193  -5.062  29.254 1.00 140.10 ? -52  DC  I N4    1 
ATOM   6601  C  C5    . DC  I  5 22  ? 17.503  -3.056  29.415 1.00 139.92 ? -52  DC  I C5    1 
ATOM   6602  C  C6    . DC  I  5 22  ? 18.722  -2.515  29.294 1.00 139.88 ? -52  DC  I C6    1 
ATOM   6603  P  P     . DT  I  5 23  ? 21.511  0.300   24.861 1.00 142.21 ? -51  DT  I P     1 
ATOM   6604  O  OP1   . DT  I  5 23  ? 21.587  1.773   24.964 1.00 142.38 ? -51  DT  I OP1   1 
ATOM   6605  O  OP2   . DT  I  5 23  ? 20.209  -0.322  24.526 1.00 142.30 ? -51  DT  I OP2   1 
ATOM   6606  O  "O5'" . DT  I  5 23  ? 22.618  -0.219  23.819 1.00 142.67 ? -51  DT  I "O5'" 1 
ATOM   6607  C  "C5'" . DT  I  5 23  ? 23.391  -1.408  24.051 1.00 143.11 ? -51  DT  I "C5'" 1 
ATOM   6608  C  "C4'" . DT  I  5 23  ? 22.838  -2.594  23.276 1.00 143.58 ? -51  DT  I "C4'" 1 
ATOM   6609  O  "O4'" . DT  I  5 23  ? 21.911  -3.343  24.113 1.00 143.65 ? -51  DT  I "O4'" 1 
ATOM   6610  C  "C3'" . DT  I  5 23  ? 22.077  -2.245  21.993 1.00 143.87 ? -51  DT  I "C3'" 1 
ATOM   6611  O  "O3'" . DT  I  5 23  ? 22.544  -3.046  20.916 1.00 144.56 ? -51  DT  I "O3'" 1 
ATOM   6612  C  "C2'" . DT  I  5 23  ? 20.627  -2.572  22.342 1.00 143.67 ? -51  DT  I "C2'" 1 
ATOM   6613  C  "C1'" . DT  I  5 23  ? 20.817  -3.736  23.307 1.00 143.24 ? -51  DT  I "C1'" 1 
ATOM   6614  N  N1    . DT  I  5 23  ? 19.589  -4.068  24.123 1.00 143.08 ? -51  DT  I N1    1 
ATOM   6615  C  C2    . DT  I  5 23  ? 19.356  -5.373  24.532 1.00 142.88 ? -51  DT  I C2    1 
ATOM   6616  O  O2    . DT  I  5 23  ? 20.097  -6.314  24.289 1.00 142.74 ? -51  DT  I O2    1 
ATOM   6617  N  N3    . DT  I  5 23  ? 18.198  -5.543  25.257 1.00 142.83 ? -51  DT  I N3    1 
ATOM   6618  C  C4    . DT  I  5 23  ? 17.271  -4.572  25.605 1.00 142.81 ? -51  DT  I C4    1 
ATOM   6619  O  O4    . DT  I  5 23  ? 16.268  -4.841  26.256 1.00 142.84 ? -51  DT  I O4    1 
ATOM   6620  C  C5    . DT  I  5 23  ? 17.571  -3.235  25.144 1.00 142.84 ? -51  DT  I C5    1 
ATOM   6621  C  C7    . DT  I  5 23  ? 16.656  -2.083  25.447 1.00 142.93 ? -51  DT  I C7    1 
ATOM   6622  C  C6    . DT  I  5 23  ? 18.693  -3.057  24.436 1.00 142.94 ? -51  DT  I C6    1 
ATOM   6623  P  P     . DA  I  5 24  ? 21.982  -2.878  19.420 1.00 145.16 ? -50  DA  I P     1 
ATOM   6624  O  OP1   . DA  I  5 24  ? 22.641  -1.678  18.859 1.00 145.20 ? -50  DA  I OP1   1 
ATOM   6625  O  OP2   . DA  I  5 24  ? 20.500  -2.960  19.403 1.00 145.03 ? -50  DA  I OP2   1 
ATOM   6626  O  "O5'" . DA  I  5 24  ? 22.537  -4.201  18.697 1.00 144.97 ? -50  DA  I "O5'" 1 
ATOM   6627  C  "C5'" . DA  I  5 24  ? 22.780  -5.419  19.430 1.00 144.47 ? -50  DA  I "C5'" 1 
ATOM   6628  C  "C4'" . DA  I  5 24  ? 21.794  -6.541  19.119 1.00 144.05 ? -50  DA  I "C4'" 1 
ATOM   6629  O  "O4'" . DA  I  5 24  ? 21.050  -6.867  20.321 1.00 143.88 ? -50  DA  I "O4'" 1 
ATOM   6630  C  "C3'" . DA  I  5 24  ? 20.732  -6.259  18.059 1.00 143.95 ? -50  DA  I "C3'" 1 
ATOM   6631  O  "O3'" . DA  I  5 24  ? 21.275  -6.520  16.740 1.00 143.82 ? -50  DA  I "O3'" 1 
ATOM   6632  C  "C2'" . DA  I  5 24  ? 19.583  -7.180  18.479 1.00 143.89 ? -50  DA  I "C2'" 1 
ATOM   6633  C  "C1'" . DA  I  5 24  ? 19.772  -7.375  19.980 1.00 143.61 ? -50  DA  I "C1'" 1 
ATOM   6634  N  N9    . DA  I  5 24  ? 18.735  -6.704  20.768 1.00 143.55 ? -50  DA  I N9    1 
ATOM   6635  C  C8    . DA  I  5 24  ? 18.610  -5.361  21.005 1.00 143.43 ? -50  DA  I C8    1 
ATOM   6636  N  N7    . DA  I  5 24  ? 17.575  -5.042  21.747 1.00 143.42 ? -50  DA  I N7    1 
ATOM   6637  C  C5    . DA  I  5 24  ? 16.970  -6.260  22.016 1.00 143.52 ? -50  DA  I C5    1 
ATOM   6638  C  C6    . DA  I  5 24  ? 15.818  -6.617  22.759 1.00 143.47 ? -50  DA  I C6    1 
ATOM   6639  N  N6    . DA  I  5 24  ? 15.037  -5.735  23.394 1.00 143.35 ? -50  DA  I N6    1 
ATOM   6640  N  N1    . DA  I  5 24  ? 15.494  -7.929  22.824 1.00 143.46 ? -50  DA  I N1    1 
ATOM   6641  C  C2    . DA  I  5 24  ? 16.267  -8.822  22.190 1.00 143.38 ? -50  DA  I C2    1 
ATOM   6642  N  N3    . DA  I  5 24  ? 17.369  -8.608  21.467 1.00 143.38 ? -50  DA  I N3    1 
ATOM   6643  C  C4    . DA  I  5 24  ? 17.673  -7.297  21.417 1.00 143.47 ? -50  DA  I C4    1 
ATOM   6644  P  P     . DC  I  5 25  ? 20.598  -7.450  15.613 1.00 143.87 ? -49  DC  I P     1 
ATOM   6645  O  OP1   . DC  I  5 25  ? 21.568  -7.575  14.501 1.00 143.74 ? -49  DC  I OP1   1 
ATOM   6646  O  OP2   . DC  I  5 25  ? 19.240  -6.925  15.326 1.00 143.84 ? -49  DC  I OP2   1 
ATOM   6647  O  "O5'" . DC  I  5 25  ? 20.480  -8.872  16.353 1.00 143.19 ? -49  DC  I "O5'" 1 
ATOM   6648  C  "C5'" . DC  I  5 25  ? 20.012  -10.048 15.693 1.00 141.66 ? -49  DC  I "C5'" 1 
ATOM   6649  C  "C4'" . DC  I  5 25  ? 18.510  -10.250 15.841 1.00 140.30 ? -49  DC  I "C4'" 1 
ATOM   6650  O  "O4'" . DC  I  5 25  ? 17.963  -9.547  16.988 1.00 139.80 ? -49  DC  I "O4'" 1 
ATOM   6651  C  "C3'" . DC  I  5 25  ? 17.687  -9.760  14.649 1.00 139.48 ? -49  DC  I "C3'" 1 
ATOM   6652  O  "O3'" . DC  I  5 25  ? 17.521  -10.840 13.694 1.00 138.36 ? -49  DC  I "O3'" 1 
ATOM   6653  C  "C2'" . DC  I  5 25  ? 16.403  -9.213  15.284 1.00 139.51 ? -49  DC  I "C2'" 1 
ATOM   6654  C  "C1'" . DC  I  5 25  ? 16.568  -9.521  16.774 1.00 139.45 ? -49  DC  I "C1'" 1 
ATOM   6655  N  N1    . DC  I  5 25  ? 15.854  -8.555  17.696 1.00 139.35 ? -49  DC  I N1    1 
ATOM   6656  C  C2    . DC  I  5 25  ? 15.012  -9.040  18.721 1.00 139.16 ? -49  DC  I C2    1 
ATOM   6657  O  O2    . DC  I  5 25  ? 14.866  -10.260 18.883 1.00 139.05 ? -49  DC  I O2    1 
ATOM   6658  N  N3    . DC  I  5 25  ? 14.372  -8.148  19.526 1.00 138.91 ? -49  DC  I N3    1 
ATOM   6659  C  C4    . DC  I  5 25  ? 14.537  -6.834  19.343 1.00 139.12 ? -49  DC  I C4    1 
ATOM   6660  N  N4    . DC  I  5 25  ? 13.890  -5.996  20.161 1.00 139.09 ? -49  DC  I N4    1 
ATOM   6661  C  C5    . DC  I  5 25  ? 15.379  -6.320  18.309 1.00 139.20 ? -49  DC  I C5    1 
ATOM   6662  C  C6    . DC  I  5 25  ? 16.008  -7.204  17.520 1.00 139.28 ? -49  DC  I C6    1 
ATOM   6663  P  P     . DC  I  5 26  ? 16.142  -11.552 13.271 1.00 137.32 ? -48  DC  I P     1 
ATOM   6664  O  OP1   . DC  I  5 26  ? 16.490  -12.648 12.340 1.00 137.35 ? -48  DC  I OP1   1 
ATOM   6665  O  OP2   . DC  I  5 26  ? 15.197  -10.505 12.823 1.00 137.19 ? -48  DC  I OP2   1 
ATOM   6666  O  "O5'" . DC  I  5 26  ? 15.610  -12.202 14.640 1.00 136.51 ? -48  DC  I "O5'" 1 
ATOM   6667  C  "C5'" . DC  I  5 26  ? 14.653  -13.270 14.657 1.00 134.33 ? -48  DC  I "C5'" 1 
ATOM   6668  C  "C4'" . DC  I  5 26  ? 13.231  -12.780 14.899 1.00 132.59 ? -48  DC  I "C4'" 1 
ATOM   6669  O  "O4'" . DC  I  5 26  ? 13.201  -11.562 15.690 1.00 131.90 ? -48  DC  I "O4'" 1 
ATOM   6670  C  "C3'" . DC  I  5 26  ? 12.428  -12.473 13.634 1.00 131.77 ? -48  DC  I "C3'" 1 
ATOM   6671  O  "O3'" . DC  I  5 26  ? 11.248  -13.260 13.636 1.00 131.06 ? -48  DC  I "O3'" 1 
ATOM   6672  C  "C2'" . DC  I  5 26  ? 12.080  -10.992 13.749 1.00 131.53 ? -48  DC  I "C2'" 1 
ATOM   6673  C  "C1'" . DC  I  5 26  ? 12.058  -10.852 15.264 1.00 131.50 ? -48  DC  I "C1'" 1 
ATOM   6674  N  N1    . DC  I  5 26  ? 12.069  -9.457  15.805 1.00 131.39 ? -48  DC  I N1    1 
ATOM   6675  C  C2    . DC  I  5 26  ? 11.203  -9.143  16.861 1.00 131.14 ? -48  DC  I C2    1 
ATOM   6676  O  O2    . DC  I  5 26  ? 10.460  -10.022 17.313 1.00 131.09 ? -48  DC  I O2    1 
ATOM   6677  N  N3    . DC  I  5 26  ? 11.208  -7.880  17.362 1.00 131.01 ? -48  DC  I N3    1 
ATOM   6678  C  C4    . DC  I  5 26  ? 12.029  -6.957  16.852 1.00 131.19 ? -48  DC  I C4    1 
ATOM   6679  N  N4    . DC  I  5 26  ? 11.997  -5.731  17.379 1.00 131.20 ? -48  DC  I N4    1 
ATOM   6680  C  C5    . DC  I  5 26  ? 12.919  -7.256  15.776 1.00 131.35 ? -48  DC  I C5    1 
ATOM   6681  C  C6    . DC  I  5 26  ? 12.906  -8.505  15.290 1.00 131.55 ? -48  DC  I C6    1 
ATOM   6682  P  P     . DA  I  5 27  ? 11.118  -14.535 12.682 1.00 130.60 ? -47  DA  I P     1 
ATOM   6683  O  OP1   . DA  I  5 27  ? 12.376  -15.313 12.788 1.00 130.79 ? -47  DA  I OP1   1 
ATOM   6684  O  OP2   . DA  I  5 27  ? 10.641  -14.050 11.367 1.00 130.15 ? -47  DA  I OP2   1 
ATOM   6685  O  "O5'" . DA  I  5 27  ? 9.928   -15.390 13.338 1.00 129.58 ? -47  DA  I "O5'" 1 
ATOM   6686  C  "C5'" . DA  I  5 27  ? 9.829   -15.614 14.752 1.00 127.26 ? -47  DA  I "C5'" 1 
ATOM   6687  C  "C4'" . DA  I  5 27  ? 8.517   -15.075 15.313 1.00 125.36 ? -47  DA  I "C4'" 1 
ATOM   6688  O  "O4'" . DA  I  5 27  ? 8.573   -13.629 15.402 1.00 125.37 ? -47  DA  I "O4'" 1 
ATOM   6689  C  "C3'" . DA  I  5 27  ? 7.241   -15.379 14.529 1.00 124.08 ? -47  DA  I "C3'" 1 
ATOM   6690  O  "O3'" . DA  I  5 27  ? 6.199   -15.573 15.476 1.00 121.74 ? -47  DA  I "O3'" 1 
ATOM   6691  C  "C2'" . DA  I  5 27  ? 7.014   -14.103 13.717 1.00 124.51 ? -47  DA  I "C2'" 1 
ATOM   6692  C  "C1'" . DA  I  5 27  ? 7.458   -13.060 14.740 1.00 125.61 ? -47  DA  I "C1'" 1 
ATOM   6693  N  N9    . DA  I  5 27  ? 7.862   -11.752 14.219 1.00 125.97 ? -47  DA  I N9    1 
ATOM   6694  C  C8    . DA  I  5 27  ? 8.290   -11.432 12.956 1.00 126.13 ? -47  DA  I C8    1 
ATOM   6695  N  N7    . DA  I  5 27  ? 8.591   -10.163 12.797 1.00 126.07 ? -47  DA  I N7    1 
ATOM   6696  C  C5    . DA  I  5 27  ? 8.349   -9.609  14.042 1.00 126.07 ? -47  DA  I C5    1 
ATOM   6697  C  C6    . DA  I  5 27  ? 8.472   -8.296  14.545 1.00 125.99 ? -47  DA  I C6    1 
ATOM   6698  N  N6    . DA  I  5 27  ? 8.885   -7.260  13.810 1.00 126.08 ? -47  DA  I N6    1 
ATOM   6699  N  N1    . DA  I  5 27  ? 8.147   -8.082  15.838 1.00 125.98 ? -47  DA  I N1    1 
ATOM   6700  C  C2    . DA  I  5 27  ? 7.723   -9.112  16.579 1.00 125.95 ? -47  DA  I C2    1 
ATOM   6701  N  N3    . DA  I  5 27  ? 7.570   -10.387 16.223 1.00 126.15 ? -47  DA  I N3    1 
ATOM   6702  C  C4    . DA  I  5 27  ? 7.900   -10.573 14.931 1.00 126.15 ? -47  DA  I C4    1 
ATOM   6703  P  P     . DA  I  5 28  ? 4.868   -16.413 15.174 1.00 119.64 ? -46  DA  I P     1 
ATOM   6704  O  OP1   . DA  I  5 28  ? 5.152   -17.802 15.602 1.00 119.47 ? -46  DA  I OP1   1 
ATOM   6705  O  OP2   . DA  I  5 28  ? 4.398   -16.124 13.796 1.00 118.89 ? -46  DA  I OP2   1 
ATOM   6706  O  "O5'" . DA  I  5 28  ? 3.783   -15.790 16.183 1.00 117.78 ? -46  DA  I "O5'" 1 
ATOM   6707  C  "C5'" . DA  I  5 28  ? 4.127   -14.970 17.320 1.00 114.30 ? -46  DA  I "C5'" 1 
ATOM   6708  C  "C4'" . DA  I  5 28  ? 3.394   -13.634 17.302 1.00 111.41 ? -46  DA  I "C4'" 1 
ATOM   6709  O  "O4'" . DA  I  5 28  ? 4.193   -12.670 16.571 1.00 110.99 ? -46  DA  I "O4'" 1 
ATOM   6710  C  "C3'" . DA  I  5 28  ? 2.027   -13.643 16.612 1.00 109.31 ? -46  DA  I "C3'" 1 
ATOM   6711  O  "O3'" . DA  I  5 28  ? 0.953   -13.903 17.573 1.00 106.09 ? -46  DA  I "O3'" 1 
ATOM   6712  C  "C2'" . DA  I  5 28  ? 1.957   -12.331 15.816 1.00 109.71 ? -46  DA  I "C2'" 1 
ATOM   6713  C  "C1'" . DA  I  5 28  ? 3.329   -11.688 16.031 1.00 111.01 ? -46  DA  I "C1'" 1 
ATOM   6714  N  N9    . DA  I  5 28  ? 3.915   -11.074 14.830 1.00 111.09 ? -46  DA  I N9    1 
ATOM   6715  C  C8    . DA  I  5 28  ? 4.048   -11.625 13.586 1.00 111.16 ? -46  DA  I C8    1 
ATOM   6716  N  N7    . DA  I  5 28  ? 4.607   -10.828 12.705 1.00 111.34 ? -46  DA  I N7    1 
ATOM   6717  C  C5    . DA  I  5 28  ? 4.860   -9.666  13.414 1.00 111.41 ? -46  DA  I C5    1 
ATOM   6718  C  C6    . DA  I  5 28  ? 5.440   -8.423  13.058 1.00 111.29 ? -46  DA  I C6    1 
ATOM   6719  N  N6    . DA  I  5 28  ? 5.895   -8.140  11.837 1.00 111.19 ? -46  DA  I N6    1 
ATOM   6720  N  N1    . DA  I  5 28  ? 5.545   -7.469  14.010 1.00 111.28 ? -46  DA  I N1    1 
ATOM   6721  C  C2    . DA  I  5 28  ? 5.089   -7.738  15.240 1.00 111.23 ? -46  DA  I C2    1 
ATOM   6722  N  N3    . DA  I  5 28  ? 4.526   -8.861  15.690 1.00 111.53 ? -46  DA  I N3    1 
ATOM   6723  C  C4    . DA  I  5 28  ? 4.437   -9.799  14.726 1.00 111.40 ? -46  DA  I C4    1 
ATOM   6724  P  P     . DA  I  5 29  ? -0.034  -12.856 18.299 1.00 103.42 ? -45  DA  I P     1 
ATOM   6725  O  OP1   . DA  I  5 29  ? -0.167  -13.320 19.698 1.00 102.98 ? -45  DA  I OP1   1 
ATOM   6726  O  OP2   . DA  I  5 29  ? -1.249  -12.678 17.467 1.00 102.39 ? -45  DA  I OP2   1 
ATOM   6727  O  "O5'" . DA  I  5 29  ? 0.778   -11.477 18.279 1.00 102.72 ? -45  DA  I "O5'" 1 
ATOM   6728  C  "C5'" . DA  I  5 29  ? 0.935   -10.639 19.411 1.00 100.72 ? -45  DA  I "C5'" 1 
ATOM   6729  C  "C4'" . DA  I  5 29  ? 0.786   -9.192  18.988 1.00 99.71  ? -45  DA  I "C4'" 1 
ATOM   6730  O  "O4'" . DA  I  5 29  ? 1.395   -8.955  17.692 1.00 100.03 ? -45  DA  I "O4'" 1 
ATOM   6731  C  "C3'" . DA  I  5 29  ? -0.651  -8.719  18.849 1.00 99.22  ? -45  DA  I "C3'" 1 
ATOM   6732  O  "O3'" . DA  I  5 29  ? -0.688  -7.406  19.345 1.00 98.35  ? -45  DA  I "O3'" 1 
ATOM   6733  C  "C2'" . DA  I  5 29  ? -0.887  -8.697  17.346 1.00 99.73  ? -45  DA  I "C2'" 1 
ATOM   6734  C  "C1'" . DA  I  5 29  ? 0.487   -8.221  16.893 1.00 100.62 ? -45  DA  I "C1'" 1 
ATOM   6735  N  N9    . DA  I  5 29  ? 0.768   -8.406  15.465 1.00 101.14 ? -45  DA  I N9    1 
ATOM   6736  C  C8    . DA  I  5 29  ? 0.359   -9.434  14.657 1.00 101.04 ? -45  DA  I C8    1 
ATOM   6737  N  N7    . DA  I  5 29  ? 0.758   -9.328  13.412 1.00 101.25 ? -45  DA  I N7    1 
ATOM   6738  C  C5    . DA  I  5 29  ? 1.477   -8.148  13.395 1.00 101.38 ? -45  DA  I C5    1 
ATOM   6739  C  C6    . DA  I  5 29  ? 2.170   -7.471  12.369 1.00 101.00 ? -45  DA  I C6    1 
ATOM   6740  N  N6    . DA  I  5 29  ? 2.234   -7.919  11.117 1.00 100.98 ? -45  DA  I N6    1 
ATOM   6741  N  N1    . DA  I  5 29  ? 2.789   -6.310  12.680 1.00 100.95 ? -45  DA  I N1    1 
ATOM   6742  C  C2    . DA  I  5 29  ? 2.717   -5.855  13.939 1.00 101.05 ? -45  DA  I C2    1 
ATOM   6743  N  N3    . DA  I  5 29  ? 2.106   -6.406  14.992 1.00 101.31 ? -45  DA  I N3    1 
ATOM   6744  C  C4    . DA  I  5 29  ? 1.496   -7.561  14.652 1.00 101.51 ? -45  DA  I C4    1 
ATOM   6745  P  P     . DA  I  5 30  ? -1.875  -6.873  20.253 1.00 96.87  ? -44  DA  I P     1 
ATOM   6746  O  OP1   . DA  I  5 30  ? -1.328  -6.778  21.626 1.00 96.33  ? -44  DA  I OP1   1 
ATOM   6747  O  OP2   . DA  I  5 30  ? -3.093  -7.657  19.966 1.00 97.54  ? -44  DA  I OP2   1 
ATOM   6748  O  "O5'" . DA  I  5 30  ? -2.147  -5.426  19.640 1.00 97.52  ? -44  DA  I "O5'" 1 
ATOM   6749  C  "C5'" . DA  I  5 30  ? -1.054  -4.553  19.394 1.00 98.80  ? -44  DA  I "C5'" 1 
ATOM   6750  C  "C4'" . DA  I  5 30  ? -1.253  -3.778  18.109 1.00 99.35  ? -44  DA  I "C4'" 1 
ATOM   6751  O  "O4'" . DA  I  5 30  ? -0.869  -4.591  16.977 1.00 99.20  ? -44  DA  I "O4'" 1 
ATOM   6752  C  "C3'" . DA  I  5 30  ? -2.688  -3.331  17.847 1.00 100.31 ? -44  DA  I "C3'" 1 
ATOM   6753  O  "O3'" . DA  I  5 30  ? -2.710  -1.920  17.805 1.00 102.24 ? -44  DA  I "O3'" 1 
ATOM   6754  C  "C2'" . DA  I  5 30  ? -3.019  -3.932  16.485 1.00 100.13 ? -44  DA  I "C2'" 1 
ATOM   6755  C  "C1'" . DA  I  5 30  ? -1.627  -4.102  15.899 1.00 99.61  ? -44  DA  I "C1'" 1 
ATOM   6756  N  N9    . DA  I  5 30  ? -1.552  -4.999  14.747 1.00 99.85  ? -44  DA  I N9    1 
ATOM   6757  C  C8    . DA  I  5 30  ? -2.124  -6.234  14.588 1.00 99.72  ? -44  DA  I C8    1 
ATOM   6758  N  N7    . DA  I  5 30  ? -1.874  -6.789  13.424 1.00 99.75  ? -44  DA  I N7    1 
ATOM   6759  C  C5    . DA  I  5 30  ? -1.086  -5.853  12.775 1.00 99.71  ? -44  DA  I C5    1 
ATOM   6760  C  C6    . DA  I  5 30  ? -0.482  -5.827  11.502 1.00 99.33  ? -44  DA  I C6    1 
ATOM   6761  N  N6    . DA  I  5 30  ? -0.586  -6.815  10.618 1.00 99.57  ? -44  DA  I N6    1 
ATOM   6762  N  N1    . DA  I  5 30  ? 0.239   -4.738  11.165 1.00 99.52  ? -44  DA  I N1    1 
ATOM   6763  C  C2    . DA  I  5 30  ? 0.356   -3.733  12.043 1.00 99.59  ? -44  DA  I C2    1 
ATOM   6764  N  N3    . DA  I  5 30  ? -0.157  -3.637  13.268 1.00 99.72  ? -44  DA  I N3    1 
ATOM   6765  C  C4    . DA  I  5 30  ? -0.875  -4.741  13.575 1.00 100.12 ? -44  DA  I C4    1 
ATOM   6766  P  P     . DG  I  5 31  ? -4.071  -1.083  17.845 1.00 103.62 ? -43  DG  I P     1 
ATOM   6767  O  OP1   . DG  I  5 31  ? -4.154  -0.507  19.201 1.00 104.20 ? -43  DG  I OP1   1 
ATOM   6768  O  OP2   . DG  I  5 31  ? -5.191  -1.884  17.304 1.00 103.96 ? -43  DG  I OP2   1 
ATOM   6769  O  "O5'" . DG  I  5 31  ? -3.803  0.086   16.786 1.00 106.56 ? -43  DG  I "O5'" 1 
ATOM   6770  C  "C5'" . DG  I  5 31  ? -2.473  0.552   16.509 1.00 110.42 ? -43  DG  I "C5'" 1 
ATOM   6771  C  "C4'" . DG  I  5 31  ? -2.300  1.024   15.070 1.00 112.94 ? -43  DG  I "C4'" 1 
ATOM   6772  O  "O4'" . DG  I  5 31  ? -1.888  -0.078  14.221 1.00 112.83 ? -43  DG  I "O4'" 1 
ATOM   6773  C  "C3'" . DG  I  5 31  ? -3.540  1.652   14.439 1.00 114.73 ? -43  DG  I "C3'" 1 
ATOM   6774  O  "O3'" . DG  I  5 31  ? -3.245  2.978   14.033 1.00 118.39 ? -43  DG  I "O3'" 1 
ATOM   6775  C  "C2'" . DG  I  5 31  ? -3.877  0.762   13.250 1.00 113.93 ? -43  DG  I "C2'" 1 
ATOM   6776  C  "C1'" . DG  I  5 31  ? -2.610  -0.049  13.013 1.00 113.09 ? -43  DG  I "C1'" 1 
ATOM   6777  N  N9    . DG  I  5 31  ? -2.948  -1.416  12.640 1.00 112.90 ? -43  DG  I N9    1 
ATOM   6778  C  C8    . DG  I  5 31  ? -3.611  -2.334  13.414 1.00 112.84 ? -43  DG  I C8    1 
ATOM   6779  N  N7    . DG  I  5 31  ? -3.793  -3.477  12.823 1.00 112.90 ? -43  DG  I N7    1 
ATOM   6780  C  C5    . DG  I  5 31  ? -3.218  -3.308  11.571 1.00 113.01 ? -43  DG  I C5    1 
ATOM   6781  C  C6    . DG  I  5 31  ? -3.114  -4.213  10.485 1.00 113.05 ? -43  DG  I C6    1 
ATOM   6782  O  O6    . DG  I  5 31  ? -3.520  -5.384  10.425 1.00 112.79 ? -43  DG  I O6    1 
ATOM   6783  N  N1    . DG  I  5 31  ? -2.455  -3.640  9.393  1.00 113.10 ? -43  DG  I N1    1 
ATOM   6784  C  C2    . DG  I  5 31  ? -1.962  -2.352  9.353  1.00 113.01 ? -43  DG  I C2    1 
ATOM   6785  N  N2    . DG  I  5 31  ? -1.358  -1.968  8.218  1.00 112.92 ? -43  DG  I N2    1 
ATOM   6786  N  N3    . DG  I  5 31  ? -2.058  -1.497  10.366 1.00 113.12 ? -43  DG  I N3    1 
ATOM   6787  C  C4    . DG  I  5 31  ? -2.695  -2.039  11.440 1.00 113.01 ? -43  DG  I C4    1 
ATOM   6788  P  P     . DT  I  5 32  ? -4.392  3.977   13.525 1.00 121.64 ? -42  DT  I P     1 
ATOM   6789  O  OP1   . DT  I  5 32  ? -3.899  5.349   13.802 1.00 121.71 ? -42  DT  I OP1   1 
ATOM   6790  O  OP2   . DT  I  5 32  ? -5.708  3.545   14.060 1.00 121.17 ? -42  DT  I OP2   1 
ATOM   6791  O  "O5'" . DT  I  5 32  ? -4.420  3.715   11.941 1.00 123.80 ? -42  DT  I "O5'" 1 
ATOM   6792  C  "C5'" . DT  I  5 32  ? -3.221  3.684   11.144 1.00 127.06 ? -42  DT  I "C5'" 1 
ATOM   6793  C  "C4'" . DT  I  5 32  ? -3.525  3.374   9.684  1.00 129.43 ? -42  DT  I "C4'" 1 
ATOM   6794  O  "O4'" . DT  I  5 32  ? -3.493  1.941   9.462  1.00 129.53 ? -42  DT  I "O4'" 1 
ATOM   6795  C  "C3'" . DT  I  5 32  ? -4.892  3.859   9.197  1.00 131.11 ? -42  DT  I "C3'" 1 
ATOM   6796  O  "O3'" . DT  I  5 32  ? -4.755  4.785   8.119  1.00 133.76 ? -42  DT  I "O3'" 1 
ATOM   6797  C  "C2'" . DT  I  5 32  ? -5.625  2.592   8.764  1.00 130.59 ? -42  DT  I "C2'" 1 
ATOM   6798  C  "C1'" . DT  I  5 32  ? -4.488  1.613   8.515  1.00 129.92 ? -42  DT  I "C1'" 1 
ATOM   6799  N  N1    . DT  I  5 32  ? -4.904  0.188   8.700  1.00 129.86 ? -42  DT  I N1    1 
ATOM   6800  C  C2    . DT  I  5 32  ? -4.576  -0.758  7.743  1.00 129.86 ? -42  DT  I C2    1 
ATOM   6801  O  O2    . DT  I  5 32  ? -3.947  -0.512  6.728  1.00 129.90 ? -42  DT  I O2    1 
ATOM   6802  N  N3    . DT  I  5 32  ? -5.016  -2.031  8.026  1.00 129.82 ? -42  DT  I N3    1 
ATOM   6803  C  C4    . DT  I  5 32  ? -5.734  -2.439  9.141  1.00 129.81 ? -42  DT  I C4    1 
ATOM   6804  O  O4    . DT  I  5 32  ? -6.077  -3.605  9.298  1.00 129.75 ? -42  DT  I O4    1 
ATOM   6805  C  C5    . DT  I  5 32  ? -6.047  -1.401  10.099 1.00 129.90 ? -42  DT  I C5    1 
ATOM   6806  C  C7    . DT  I  5 32  ? -6.820  -1.706  11.351 1.00 129.78 ? -42  DT  I C7    1 
ATOM   6807  C  C6    . DT  I  5 32  ? -5.622  -0.157  9.833  1.00 129.90 ? -42  DT  I C6    1 
ATOM   6808  P  P     . DG  I  5 33  ? -6.035  5.538   7.506  1.00 135.97 ? -41  DG  I P     1 
ATOM   6809  O  OP1   . DG  I  5 33  ? -5.561  6.829   6.961  1.00 135.87 ? -41  DG  I OP1   1 
ATOM   6810  O  OP2   . DG  I  5 33  ? -7.125  5.541   8.511  1.00 135.68 ? -41  DG  I OP2   1 
ATOM   6811  O  "O5'" . DG  I  5 33  ? -6.462  4.572   6.293  1.00 137.65 ? -41  DG  I "O5'" 1 
ATOM   6812  C  "C5'" . DG  I  5 33  ? -5.519  4.178   5.279  1.00 140.11 ? -41  DG  I "C5'" 1 
ATOM   6813  C  "C4'" . DG  I  5 33  ? -6.114  3.228   4.243  1.00 141.81 ? -41  DG  I "C4'" 1 
ATOM   6814  O  "O4'" . DG  I  5 33  ? -6.183  1.879   4.784  1.00 142.16 ? -41  DG  I "O4'" 1 
ATOM   6815  C  "C3'" . DG  I  5 33  ? -7.520  3.577   3.741  1.00 142.94 ? -41  DG  I "C3'" 1 
ATOM   6816  O  "O3'" . DG  I  5 33  ? -7.567  3.565   2.298  1.00 144.48 ? -41  DG  I "O3'" 1 
ATOM   6817  C  "C2'" . DG  I  5 33  ? -8.396  2.498   4.375  1.00 142.83 ? -41  DG  I "C2'" 1 
ATOM   6818  C  "C1'" . DG  I  5 33  ? -7.437  1.319   4.455  1.00 142.74 ? -41  DG  I "C1'" 1 
ATOM   6819  N  N9    . DG  I  5 33  ? -7.847  0.351   5.471  1.00 142.84 ? -41  DG  I N9    1 
ATOM   6820  C  C8    . DG  I  5 33  ? -7.980  0.582   6.820  1.00 142.80 ? -41  DG  I C8    1 
ATOM   6821  N  N7    . DG  I  5 33  ? -8.374  -0.463  7.490  1.00 142.87 ? -41  DG  I N7    1 
ATOM   6822  C  C5    . DG  I  5 33  ? -8.518  -1.453  6.527  1.00 142.86 ? -41  DG  I C5    1 
ATOM   6823  C  C6    . DG  I  5 33  ? -8.922  -2.806  6.661  1.00 142.84 ? -41  DG  I C6    1 
ATOM   6824  O  O6    . DG  I  5 33  ? -9.242  -3.411  7.692  1.00 142.76 ? -41  DG  I O6    1 
ATOM   6825  N  N1    . DG  I  5 33  ? -8.937  -3.475  5.436  1.00 142.90 ? -41  DG  I N1    1 
ATOM   6826  C  C2    . DG  I  5 33  ? -8.602  -2.905  4.230  1.00 142.86 ? -41  DG  I C2    1 
ATOM   6827  N  N2    . DG  I  5 33  ? -8.677  -3.705  3.156  1.00 142.80 ? -41  DG  I N2    1 
ATOM   6828  N  N3    . DG  I  5 33  ? -8.221  -1.637  4.091  1.00 142.94 ? -41  DG  I N3    1 
ATOM   6829  C  C4    . DG  I  5 33  ? -8.200  -0.968  5.275  1.00 142.87 ? -41  DG  I C4    1 
ATOM   6830  P  P     . DT  I  5 34  ? -8.930  3.669   1.441  1.00 145.45 ? -40  DT  I P     1 
ATOM   6831  O  OP1   . DT  I  5 34  ? -8.579  4.224   0.114  1.00 145.36 ? -40  DT  I OP1   1 
ATOM   6832  O  OP2   . DT  I  5 34  ? -9.994  4.325   2.242  1.00 145.11 ? -40  DT  I OP2   1 
ATOM   6833  O  "O5'" . DT  I  5 34  ? -9.333  2.127   1.278  1.00 145.77 ? -40  DT  I "O5'" 1 
ATOM   6834  C  "C5'" . DT  I  5 34  ? -8.606  1.234   0.427  1.00 145.93 ? -40  DT  I "C5'" 1 
ATOM   6835  C  "C4'" . DT  I  5 34  ? -9.442  -0.009  0.160  1.00 145.88 ? -40  DT  I "C4'" 1 
ATOM   6836  O  "O4'" . DT  I  5 34  ? -9.759  -0.634  1.430  1.00 146.37 ? -40  DT  I "O4'" 1 
ATOM   6837  C  "C3'" . DT  I  5 34  ? -10.780 0.233   -0.541 1.00 145.55 ? -40  DT  I "C3'" 1 
ATOM   6838  O  "O3'" . DT  I  5 34  ? -11.059 -0.840  -1.434 1.00 144.62 ? -40  DT  I "O3'" 1 
ATOM   6839  C  "C2'" . DT  I  5 34  ? -11.782 0.270   0.611  1.00 146.09 ? -40  DT  I "C2'" 1 
ATOM   6840  C  "C1'" . DT  I  5 34  ? -11.163 -0.726  1.590  1.00 146.94 ? -40  DT  I "C1'" 1 
ATOM   6841  N  N1    . DT  I  5 34  ? -11.533 -0.504  3.034  1.00 147.25 ? -40  DT  I N1    1 
ATOM   6842  C  C2    . DT  I  5 34  ? -11.749 -1.595  3.862  1.00 147.29 ? -40  DT  I C2    1 
ATOM   6843  O  O2    . DT  I  5 34  ? -11.656 -2.756  3.500  1.00 147.33 ? -40  DT  I O2    1 
ATOM   6844  N  N3    . DT  I  5 34  ? -12.086 -1.276  5.156  1.00 147.33 ? -40  DT  I N3    1 
ATOM   6845  C  C4    . DT  I  5 34  ? -12.228 -0.007  5.699  1.00 147.41 ? -40  DT  I C4    1 
ATOM   6846  O  O4    . DT  I  5 34  ? -12.534 0.158   6.878  1.00 147.35 ? -40  DT  I O4    1 
ATOM   6847  C  C5    . DT  I  5 34  ? -11.990 1.092   4.783  1.00 147.52 ? -40  DT  I C5    1 
ATOM   6848  C  C7    . DT  I  5 34  ? -12.107 2.521   5.234  1.00 147.39 ? -40  DT  I C7    1 
ATOM   6849  C  C6    . DT  I  5 34  ? -11.659 0.792   3.516  1.00 147.51 ? -40  DT  I C6    1 
ATOM   6850  P  P     . DA  I  5 35  ? -12.239 -0.746  -2.521 1.00 144.02 ? -39  DA  I P     1 
ATOM   6851  O  OP1   . DA  I  5 35  ? -11.780 0.174   -3.584 1.00 144.08 ? -39  DA  I OP1   1 
ATOM   6852  O  OP2   . DA  I  5 35  ? -13.522 -0.457  -1.842 1.00 143.83 ? -39  DA  I OP2   1 
ATOM   6853  O  "O5'" . DA  I  5 35  ? -12.307 -2.244  -3.103 1.00 142.67 ? -39  DA  I "O5'" 1 
ATOM   6854  C  "C5'" . DA  I  5 35  ? -11.972 -3.394  -2.302 1.00 140.47 ? -39  DA  I "C5'" 1 
ATOM   6855  C  "C4'" . DA  I  5 35  ? -13.182 -4.152  -1.763 1.00 138.77 ? -39  DA  I "C4'" 1 
ATOM   6856  O  "O4'" . DA  I  5 35  ? -13.239 -4.011  -0.314 1.00 138.22 ? -39  DA  I "O4'" 1 
ATOM   6857  C  "C3'" . DA  I  5 35  ? -14.563 -3.736  -2.296 1.00 137.80 ? -39  DA  I "C3'" 1 
ATOM   6858  O  "O3'" . DA  I  5 35  ? -15.219 -4.871  -2.923 1.00 136.22 ? -39  DA  I "O3'" 1 
ATOM   6859  C  "C2'" . DA  I  5 35  ? -15.271 -3.177  -1.059 1.00 137.80 ? -39  DA  I "C2'" 1 
ATOM   6860  C  "C1'" . DA  I  5 35  ? -14.602 -3.978  0.049  1.00 137.84 ? -39  DA  I "C1'" 1 
ATOM   6861  N  N9    . DA  I  5 35  ? -14.784 -3.435  1.396  1.00 137.81 ? -39  DA  I N9    1 
ATOM   6862  C  C8    . DA  I  5 35  ? -14.738 -2.124  1.793  1.00 137.81 ? -39  DA  I C8    1 
ATOM   6863  N  N7    . DA  I  5 35  ? -14.951 -1.944  3.077  1.00 137.68 ? -39  DA  I N7    1 
ATOM   6864  C  C5    . DA  I  5 35  ? -15.153 -3.227  3.558  1.00 137.79 ? -39  DA  I C5    1 
ATOM   6865  C  C6    . DA  I  5 35  ? -15.428 -3.735  4.849  1.00 137.73 ? -39  DA  I C6    1 
ATOM   6866  N  N6    . DA  I  5 35  ? -15.547 -2.963  5.932  1.00 137.75 ? -39  DA  I N6    1 
ATOM   6867  N  N1    . DA  I  5 35  ? -15.575 -5.072  4.988  1.00 137.74 ? -39  DA  I N1    1 
ATOM   6868  C  C2    . DA  I  5 35  ? -15.456 -5.855  3.905  1.00 137.78 ? -39  DA  I C2    1 
ATOM   6869  N  N3    . DA  I  5 35  ? -15.200 -5.496  2.644  1.00 137.87 ? -39  DA  I N3    1 
ATOM   6870  C  C4    . DA  I  5 35  ? -15.057 -4.158  2.535  1.00 137.85 ? -39  DA  I C4    1 
ATOM   6871  P  P     . DT  I  5 36  ? -16.799 -5.196  -2.878 1.00 135.07 ? -38  DT  I P     1 
ATOM   6872  O  OP1   . DT  I  5 36  ? -17.045 -6.300  -3.834 1.00 134.81 ? -38  DT  I OP1   1 
ATOM   6873  O  OP2   . DT  I  5 36  ? -17.581 -3.940  -2.999 1.00 134.44 ? -38  DT  I OP2   1 
ATOM   6874  O  "O5'" . DT  I  5 36  ? -16.985 -5.758  -1.387 1.00 133.81 ? -38  DT  I "O5'" 1 
ATOM   6875  C  "C5'" . DT  I  5 36  ? -16.906 -7.152  -1.081 1.00 131.31 ? -38  DT  I "C5'" 1 
ATOM   6876  C  "C4'" . DT  I  5 36  ? -18.020 -7.510  -0.113 1.00 129.46 ? -38  DT  I "C4'" 1 
ATOM   6877  O  "O4'" . DT  I  5 36  ? -17.821 -6.753  1.110  1.00 129.31 ? -38  DT  I "O4'" 1 
ATOM   6878  C  "C3'" . DT  I  5 36  ? -19.425 -7.175  -0.627 1.00 127.98 ? -38  DT  I "C3'" 1 
ATOM   6879  O  "O3'" . DT  I  5 36  ? -20.233 -8.380  -0.747 1.00 125.73 ? -38  DT  I "O3'" 1 
ATOM   6880  C  "C2'" . DT  I  5 36  ? -19.943 -6.092  0.326  1.00 128.39 ? -38  DT  I "C2'" 1 
ATOM   6881  C  "C1'" . DT  I  5 36  ? -19.072 -6.275  1.571  1.00 128.79 ? -38  DT  I "C1'" 1 
ATOM   6882  N  N1    . DT  I  5 36  ? -18.895 -5.036  2.426  1.00 128.68 ? -38  DT  I N1    1 
ATOM   6883  C  C2    . DT  I  5 36  ? -18.882 -5.145  3.813  1.00 128.46 ? -38  DT  I C2    1 
ATOM   6884  O  O2    . DT  I  5 36  ? -19.004 -6.198  4.423  1.00 128.23 ? -38  DT  I O2    1 
ATOM   6885  N  N3    . DT  I  5 36  ? -18.717 -3.948  4.475  1.00 128.25 ? -38  DT  I N3    1 
ATOM   6886  C  C4    . DT  I  5 36  ? -18.567 -2.687  3.912  1.00 128.51 ? -38  DT  I C4    1 
ATOM   6887  O  O4    . DT  I  5 36  ? -18.425 -1.677  4.599  1.00 128.44 ? -38  DT  I O4    1 
ATOM   6888  C  C5    . DT  I  5 36  ? -18.592 -2.646  2.465  1.00 128.50 ? -38  DT  I C5    1 
ATOM   6889  C  C7    . DT  I  5 36  ? -18.442 -1.348  1.727  1.00 128.57 ? -38  DT  I C7    1 
ATOM   6890  C  C6    . DT  I  5 36  ? -18.750 -3.803  1.805  1.00 128.52 ? -38  DT  I C6    1 
ATOM   6891  P  P     . DT  I  5 37  ? -21.484 -8.809  0.174  1.00 124.22 ? -37  DT  I P     1 
ATOM   6892  O  OP1   . DT  I  5 37  ? -21.923 -10.156 -0.271 1.00 123.71 ? -37  DT  I OP1   1 
ATOM   6893  O  OP2   . DT  I  5 37  ? -22.478 -7.705  0.197  1.00 123.82 ? -37  DT  I OP2   1 
ATOM   6894  O  "O5'" . DT  I  5 37  ? -20.809 -8.919  1.630  1.00 122.25 ? -37  DT  I "O5'" 1 
ATOM   6895  C  "C5'" . DT  I  5 37  ? -20.977 -10.050 2.485  1.00 118.10 ? -37  DT  I "C5'" 1 
ATOM   6896  C  "C4'" . DT  I  5 37  ? -21.512 -9.647  3.851  1.00 114.87 ? -37  DT  I "C4'" 1 
ATOM   6897  O  "O4'" . DT  I  5 37  ? -21.250 -8.250  4.158  1.00 114.19 ? -37  DT  I "O4'" 1 
ATOM   6898  C  "C3'" . DT  I  5 37  ? -23.015 -9.842  4.028  1.00 112.75 ? -37  DT  I "C3'" 1 
ATOM   6899  O  "O3'" . DT  I  5 37  ? -23.193 -10.580 5.221  1.00 109.77 ? -37  DT  I "O3'" 1 
ATOM   6900  C  "C2'" . DT  I  5 37  ? -23.561 -8.420  4.156  1.00 112.93 ? -37  DT  I "C2'" 1 
ATOM   6901  C  "C1'" . DT  I  5 37  ? -22.382 -7.751  4.844  1.00 113.74 ? -37  DT  I "C1'" 1 
ATOM   6902  N  N1    . DT  I  5 37  ? -22.393 -6.257  4.819  1.00 113.85 ? -37  DT  I N1    1 
ATOM   6903  C  C2    . DT  I  5 37  ? -22.438 -5.560  6.015  1.00 113.97 ? -37  DT  I C2    1 
ATOM   6904  O  O2    . DT  I  5 37  ? -22.474 -6.085  7.117  1.00 114.05 ? -37  DT  I O2    1 
ATOM   6905  N  N3    . DT  I  5 37  ? -22.439 -4.194  5.873  1.00 113.85 ? -37  DT  I N3    1 
ATOM   6906  C  C4    . DT  I  5 37  ? -22.400 -3.467  4.696  1.00 113.77 ? -37  DT  I C4    1 
ATOM   6907  O  O4    . DT  I  5 37  ? -22.409 -2.241  4.705  1.00 113.68 ? -37  DT  I O4    1 
ATOM   6908  C  C5    . DT  I  5 37  ? -22.355 -4.256  3.481  1.00 114.01 ? -37  DT  I C5    1 
ATOM   6909  C  C7    . DT  I  5 37  ? -22.314 -3.606  2.124  1.00 113.94 ? -37  DT  I C7    1 
ATOM   6910  C  C6    . DT  I  5 37  ? -22.354 -5.592  3.604  1.00 114.04 ? -37  DT  I C6    1 
ATOM   6911  P  P     . DT  I  5 38  ? -24.584 -11.258 5.607  1.00 107.41 ? -36  DT  I P     1 
ATOM   6912  O  OP1   . DT  I  5 38  ? -24.488 -12.653 5.125  1.00 107.07 ? -36  DT  I OP1   1 
ATOM   6913  O  OP2   . DT  I  5 38  ? -25.692 -10.377 5.163  1.00 106.89 ? -36  DT  I OP2   1 
ATOM   6914  O  "O5'" . DT  I  5 38  ? -24.589 -11.274 7.220  1.00 105.47 ? -36  DT  I "O5'" 1 
ATOM   6915  C  "C5'" . DT  I  5 38  ? -23.806 -10.366 8.023  1.00 101.23 ? -36  DT  I "C5'" 1 
ATOM   6916  C  "C4'" . DT  I  5 38  ? -24.627 -9.416  8.898  1.00 97.85  ? -36  DT  I "C4'" 1 
ATOM   6917  O  "O4'" . DT  I  5 38  ? -24.502 -8.060  8.390  1.00 97.26  ? -36  DT  I "O4'" 1 
ATOM   6918  C  "C3'" . DT  I  5 38  ? -26.133 -9.666  9.058  1.00 95.34  ? -36  DT  I "C3'" 1 
ATOM   6919  O  "O3'" . DT  I  5 38  ? -26.519 -9.582  10.447 1.00 91.56  ? -36  DT  I "O3'" 1 
ATOM   6920  C  "C2'" . DT  I  5 38  ? -26.754 -8.519  8.266  1.00 96.09  ? -36  DT  I "C2'" 1 
ATOM   6921  C  "C1'" . DT  I  5 38  ? -25.744 -7.435  8.606  1.00 97.51  ? -36  DT  I "C1'" 1 
ATOM   6922  N  N1    . DT  I  5 38  ? -25.847 -6.146  7.841  1.00 98.06  ? -36  DT  I N1    1 
ATOM   6923  C  C2    . DT  I  5 38  ? -25.795 -4.965  8.558  1.00 98.46  ? -36  DT  I C2    1 
ATOM   6924  O  O2    . DT  I  5 38  ? -25.670 -4.904  9.768  1.00 98.71  ? -36  DT  I O2    1 
ATOM   6925  N  N3    . DT  I  5 38  ? -25.900 -3.827  7.801  1.00 98.94  ? -36  DT  I N3    1 
ATOM   6926  C  C4    . DT  I  5 38  ? -26.050 -3.733  6.426  1.00 98.75  ? -36  DT  I C4    1 
ATOM   6927  O  O4    . DT  I  5 38  ? -26.131 -2.632  5.874  1.00 98.54  ? -36  DT  I O4    1 
ATOM   6928  C  C5    . DT  I  5 38  ? -26.100 -5.005  5.724  1.00 98.59  ? -36  DT  I C5    1 
ATOM   6929  C  C7    . DT  I  5 38  ? -26.259 -5.057  4.228  1.00 98.16  ? -36  DT  I C7    1 
ATOM   6930  C  C6    . DT  I  5 38  ? -25.997 -6.132  6.459  1.00 98.60  ? -36  DT  I C6    1 
ATOM   6931  P  P     . DG  I  5 39  ? -26.749 -10.882 11.358 1.00 88.16  ? -35  DG  I P     1 
ATOM   6932  O  OP1   . DG  I  5 39  ? -25.691 -11.850 10.998 1.00 87.23  ? -35  DG  I OP1   1 
ATOM   6933  O  OP2   . DG  I  5 39  ? -28.179 -11.261 11.301 1.00 86.85  ? -35  DG  I OP2   1 
ATOM   6934  O  "O5'" . DG  I  5 39  ? -26.514 -10.370 12.850 1.00 86.84  ? -35  DG  I "O5'" 1 
ATOM   6935  C  "C5'" . DG  I  5 39  ? -25.266 -9.830  13.268 1.00 85.78  ? -35  DG  I "C5'" 1 
ATOM   6936  C  "C4'" . DG  I  5 39  ? -25.453 -8.687  14.259 1.00 84.79  ? -35  DG  I "C4'" 1 
ATOM   6937  O  "O4'" . DG  I  5 39  ? -25.859 -7.481  13.562 1.00 84.85  ? -35  DG  I "O4'" 1 
ATOM   6938  C  "C3'" . DG  I  5 39  ? -26.496 -8.897  15.354 1.00 83.12  ? -35  DG  I "C3'" 1 
ATOM   6939  O  "O3'" . DG  I  5 39  ? -26.018 -8.325  16.571 1.00 79.65  ? -35  DG  I "O3'" 1 
ATOM   6940  C  "C2'" . DG  I  5 39  ? -27.749 -8.200  14.819 1.00 84.12  ? -35  DG  I "C2'" 1 
ATOM   6941  C  "C1'" . DG  I  5 39  ? -27.179 -7.113  13.918 1.00 86.20  ? -35  DG  I "C1'" 1 
ATOM   6942  N  N9    . DG  I  5 39  ? -27.915 -6.901  12.670 1.00 87.23  ? -35  DG  I N9    1 
ATOM   6943  C  C8    . DG  I  5 39  ? -28.628 -7.819  11.928 1.00 87.34  ? -35  DG  I C8    1 
ATOM   6944  N  N7    . DG  I  5 39  ? -29.163 -7.317  10.846 1.00 87.48  ? -35  DG  I N7    1 
ATOM   6945  C  C5    . DG  I  5 39  ? -28.780 -5.982  10.868 1.00 87.37  ? -35  DG  I C5    1 
ATOM   6946  C  C6    . DG  I  5 39  ? -29.055 -4.933  9.959  1.00 87.10  ? -35  DG  I C6    1 
ATOM   6947  O  O6    . DG  I  5 39  ? -29.726 -4.976  8.920  1.00 87.65  ? -35  DG  I O6    1 
ATOM   6948  N  N1    . DG  I  5 39  ? -28.475 -3.734  10.354 1.00 86.96  ? -35  DG  I N1    1 
ATOM   6949  C  C2    . DG  I  5 39  ? -27.720 -3.560  11.486 1.00 87.12  ? -35  DG  I C2    1 
ATOM   6950  N  N2    . DG  I  5 39  ? -27.238 -2.331  11.706 1.00 87.25  ? -35  DG  I N2    1 
ATOM   6951  N  N3    . DG  I  5 39  ? -27.450 -4.530  12.345 1.00 87.47  ? -35  DG  I N3    1 
ATOM   6952  C  C4    . DG  I  5 39  ? -28.010 -5.711  11.979 1.00 87.49  ? -35  DG  I C4    1 
ATOM   6953  P  P     . DG  I  5 40  ? -26.887 -8.388  17.909 1.00 78.20  ? -34  DG  I P     1 
ATOM   6954  O  OP1   . DG  I  5 40  ? -25.949 -8.306  19.041 1.00 78.24  ? -34  DG  I OP1   1 
ATOM   6955  O  OP2   . DG  I  5 40  ? -27.851 -9.508  17.818 1.00 77.76  ? -34  DG  I OP2   1 
ATOM   6956  O  "O5'" . DG  I  5 40  ? -27.768 -7.055  17.853 1.00 78.56  ? -34  DG  I "O5'" 1 
ATOM   6957  C  "C5'" . DG  I  5 40  ? -27.236 -5.737  17.645 1.00 77.81  ? -34  DG  I "C5'" 1 
ATOM   6958  C  "C4'" . DG  I  5 40  ? -28.354 -4.718  17.447 1.00 77.29  ? -34  DG  I "C4'" 1 
ATOM   6959  O  "O4'" . DG  I  5 40  ? -28.903 -4.851  16.115 1.00 78.03  ? -34  DG  I "O4'" 1 
ATOM   6960  C  "C3'" . DG  I  5 40  ? -29.555 -4.842  18.378 1.00 77.21  ? -34  DG  I "C3'" 1 
ATOM   6961  O  "O3'" . DG  I  5 40  ? -30.074 -3.559  18.662 1.00 76.83  ? -34  DG  I "O3'" 1 
ATOM   6962  C  "C2'" . DG  I  5 40  ? -30.566 -5.624  17.554 1.00 78.16  ? -34  DG  I "C2'" 1 
ATOM   6963  C  "C1'" . DG  I  5 40  ? -30.306 -4.949  16.219 1.00 80.51  ? -34  DG  I "C1'" 1 
ATOM   6964  N  N9    . DG  I  5 40  ? -30.889 -5.580  15.034 1.00 81.58  ? -34  DG  I N9    1 
ATOM   6965  C  C8    . DG  I  5 40  ? -31.380 -6.861  14.856 1.00 82.08  ? -34  DG  I C8    1 
ATOM   6966  N  N7    . DG  I  5 40  ? -31.846 -7.084  13.658 1.00 81.75  ? -34  DG  I N7    1 
ATOM   6967  C  C5    . DG  I  5 40  ? -31.655 -5.867  13.002 1.00 82.35  ? -34  DG  I C5    1 
ATOM   6968  C  C6    . DG  I  5 40  ? -31.959 -5.465  11.668 1.00 82.22  ? -34  DG  I C6    1 
ATOM   6969  O  O6    . DG  I  5 40  ? -32.474 -6.150  10.769 1.00 82.24  ? -34  DG  I O6    1 
ATOM   6970  N  N1    . DG  I  5 40  ? -31.596 -4.132  11.413 1.00 81.94  ? -34  DG  I N1    1 
ATOM   6971  C  C2    . DG  I  5 40  ? -31.008 -3.285  12.333 1.00 81.99  ? -34  DG  I C2    1 
ATOM   6972  N  N2    . DG  I  5 40  ? -30.722 -2.038  11.939 1.00 81.79  ? -34  DG  I N2    1 
ATOM   6973  N  N3    . DG  I  5 40  ? -30.720 -3.647  13.577 1.00 82.60  ? -34  DG  I N3    1 
ATOM   6974  C  C4    . DG  I  5 40  ? -31.068 -4.939  13.838 1.00 82.03  ? -34  DG  I C4    1 
ATOM   6975  P  P     . DA  I  5 41  ? -29.921 -2.923  20.110 1.00 75.72  ? -33  DA  I P     1 
ATOM   6976  O  OP1   . DA  I  5 41  ? -28.524 -3.195  20.518 1.00 76.33  ? -33  DA  I OP1   1 
ATOM   6977  O  OP2   . DA  I  5 41  ? -31.089 -3.343  20.914 1.00 74.71  ? -33  DA  I OP2   1 
ATOM   6978  O  "O5'" . DA  I  5 41  ? -30.052 -1.343  19.908 1.00 78.93  ? -33  DA  I "O5'" 1 
ATOM   6979  C  "C5'" . DA  I  5 41  ? -29.281 -0.579  18.961 1.00 81.83  ? -33  DA  I "C5'" 1 
ATOM   6980  C  "C4'" . DA  I  5 41  ? -30.182 0.371   18.174 1.00 83.99  ? -33  DA  I "C4'" 1 
ATOM   6981  O  "O4'" . DA  I  5 41  ? -30.817 -0.365  17.099 1.00 83.86  ? -33  DA  I "O4'" 1 
ATOM   6982  C  "C3'" . DA  I  5 41  ? -31.323 1.051   18.947 1.00 85.69  ? -33  DA  I "C3'" 1 
ATOM   6983  O  "O3'" . DA  I  5 41  ? -31.439 2.412   18.495 1.00 88.44  ? -33  DA  I "O3'" 1 
ATOM   6984  C  "C2'" . DA  I  5 41  ? -32.545 0.202   18.594 1.00 84.68  ? -33  DA  I "C2'" 1 
ATOM   6985  C  "C1'" . DA  I  5 41  ? -32.216 -0.162  17.153 1.00 85.30  ? -33  DA  I "C1'" 1 
ATOM   6986  N  N9    . DA  I  5 41  ? -32.858 -1.366  16.645 1.00 85.47  ? -33  DA  I N9    1 
ATOM   6987  C  C8    . DA  I  5 41  ? -33.158 -2.514  17.325 1.00 85.92  ? -33  DA  I C8    1 
ATOM   6988  N  N7    . DA  I  5 41  ? -33.731 -3.438  16.591 1.00 85.97  ? -33  DA  I N7    1 
ATOM   6989  C  C5    . DA  I  5 41  ? -33.811 -2.852  15.336 1.00 86.28  ? -33  DA  I C5    1 
ATOM   6990  C  C6    . DA  I  5 41  ? -34.320 -3.305  14.097 1.00 85.74  ? -33  DA  I C6    1 
ATOM   6991  N  N6    . DA  I  5 41  ? -34.865 -4.507  13.932 1.00 86.23  ? -33  DA  I N6    1 
ATOM   6992  N  N1    . DA  I  5 41  ? -34.247 -2.480  13.032 1.00 85.75  ? -33  DA  I N1    1 
ATOM   6993  C  C2    . DA  I  5 41  ? -33.696 -1.265  13.196 1.00 86.36  ? -33  DA  I C2    1 
ATOM   6994  N  N3    . DA  I  5 41  ? -33.184 -0.720  14.307 1.00 86.79  ? -33  DA  I N3    1 
ATOM   6995  C  C4    . DA  I  5 41  ? -33.273 -1.573  15.352 1.00 86.27  ? -33  DA  I C4    1 
ATOM   6996  P  P     . DA  I  5 42  ? -32.366 3.538   19.172 1.00 90.18  ? -32  DA  I P     1 
ATOM   6997  O  OP1   . DA  I  5 42  ? -31.462 4.464   19.892 1.00 90.45  ? -32  DA  I OP1   1 
ATOM   6998  O  OP2   . DA  I  5 42  ? -33.505 2.929   19.897 1.00 89.72  ? -32  DA  I OP2   1 
ATOM   6999  O  "O5'" . DA  I  5 42  ? -32.949 4.304   17.889 1.00 91.83  ? -32  DA  I "O5'" 1 
ATOM   7000  C  "C5'" . DA  I  5 42  ? -33.060 3.670   16.605 1.00 93.89  ? -32  DA  I "C5'" 1 
ATOM   7001  C  "C4'" . DA  I  5 42  ? -34.476 3.713   16.034 1.00 94.95  ? -32  DA  I "C4'" 1 
ATOM   7002  O  "O4'" . DA  I  5 42  ? -34.886 2.369   15.662 1.00 94.51  ? -32  DA  I "O4'" 1 
ATOM   7003  C  "C3'" . DA  I  5 42  ? -35.589 4.252   16.936 1.00 96.20  ? -32  DA  I "C3'" 1 
ATOM   7004  O  "O3'" . DA  I  5 42  ? -36.533 4.962   16.131 1.00 98.49  ? -32  DA  I "O3'" 1 
ATOM   7005  C  "C2'" . DA  I  5 42  ? -36.196 2.966   17.487 1.00 96.00  ? -32  DA  I "C2'" 1 
ATOM   7006  C  "C1'" . DA  I  5 42  ? -36.165 2.138   16.208 1.00 95.49  ? -32  DA  I "C1'" 1 
ATOM   7007  N  N9    . DA  I  5 42  ? -36.384 0.702   16.366 1.00 95.61  ? -32  DA  I N9    1 
ATOM   7008  C  C8    . DA  I  5 42  ? -36.182 -0.070  17.475 1.00 95.58  ? -32  DA  I C8    1 
ATOM   7009  N  N7    . DA  I  5 42  ? -36.477 -1.335  17.296 1.00 95.62  ? -32  DA  I N7    1 
ATOM   7010  C  C5    . DA  I  5 42  ? -36.906 -1.401  15.980 1.00 95.72  ? -32  DA  I C5    1 
ATOM   7011  C  C6    . DA  I  5 42  ? -37.361 -2.464  15.164 1.00 95.60  ? -32  DA  I C6    1 
ATOM   7012  N  N6    . DA  I  5 42  ? -37.466 -3.726  15.585 1.00 95.63  ? -32  DA  I N6    1 
ATOM   7013  N  N1    . DA  I  5 42  ? -37.708 -2.186  13.887 1.00 95.71  ? -32  DA  I N1    1 
ATOM   7014  C  C2    . DA  I  5 42  ? -37.608 -0.920  13.456 1.00 95.87  ? -32  DA  I C2    1 
ATOM   7015  N  N3    . DA  I  5 42  ? -37.193 0.161   14.124 1.00 96.01  ? -32  DA  I N3    1 
ATOM   7016  C  C4    . DA  I  5 42  ? -36.854 -0.149  15.392 1.00 95.89  ? -32  DA  I C4    1 
ATOM   7017  P  P     . DA  I  5 43  ? -37.453 6.172   16.659 1.00 99.81  ? -31  DA  I P     1 
ATOM   7018  O  OP1   . DA  I  5 43  ? -36.641 7.406   16.559 1.00 99.84  ? -31  DA  I OP1   1 
ATOM   7019  O  OP2   . DA  I  5 43  ? -38.081 5.801   17.953 1.00 99.68  ? -31  DA  I OP2   1 
ATOM   7020  O  "O5'" . DA  I  5 43  ? -38.626 6.244   15.565 1.00 100.56 ? -31  DA  I "O5'" 1 
ATOM   7021  C  "C5'" . DA  I  5 43  ? -38.622 5.455   14.364 1.00 101.80 ? -31  DA  I "C5'" 1 
ATOM   7022  C  "C4'" . DA  I  5 43  ? -39.924 4.686   14.146 1.00 102.41 ? -31  DA  I "C4'" 1 
ATOM   7023  O  "O4'" . DA  I  5 43  ? -39.699 3.281   14.430 1.00 102.47 ? -31  DA  I "O4'" 1 
ATOM   7024  C  "C3'" . DA  I  5 43  ? -41.149 5.086   14.977 1.00 102.98 ? -31  DA  I "C3'" 1 
ATOM   7025  O  "O3'" . DA  I  5 43  ? -42.316 5.002   14.154 1.00 104.42 ? -31  DA  I "O3'" 1 
ATOM   7026  C  "C2'" . DA  I  5 43  ? -41.173 4.020   16.065 1.00 102.72 ? -31  DA  I "C2'" 1 
ATOM   7027  C  "C1'" . DA  I  5 43  ? -40.783 2.822   15.212 1.00 102.71 ? -31  DA  I "C1'" 1 
ATOM   7028  N  N9    . DA  I  5 43  ? -40.412 1.617   15.954 1.00 103.05 ? -31  DA  I N9    1 
ATOM   7029  C  C8    . DA  I  5 43  ? -39.717 1.536   17.133 1.00 102.83 ? -31  DA  I C8    1 
ATOM   7030  N  N7    . DA  I  5 43  ? -39.543 0.307   17.554 1.00 102.80 ? -31  DA  I N7    1 
ATOM   7031  C  C5    . DA  I  5 43  ? -40.164 -0.474  16.589 1.00 102.89 ? -31  DA  I C5    1 
ATOM   7032  C  C6    . DA  I  5 43  ? -40.339 -1.872  16.446 1.00 102.79 ? -31  DA  I C6    1 
ATOM   7033  N  N6    . DA  I  5 43  ? -39.873 -2.760  17.328 1.00 102.67 ? -31  DA  I N6    1 
ATOM   7034  N  N1    . DA  I  5 43  ? -41.014 -2.327  15.361 1.00 102.83 ? -31  DA  I N1    1 
ATOM   7035  C  C2    . DA  I  5 43  ? -41.490 -1.439  14.472 1.00 102.69 ? -31  DA  I C2    1 
ATOM   7036  N  N3    . DA  I  5 43  ? -41.389 -0.108  14.504 1.00 102.64 ? -31  DA  I N3    1 
ATOM   7037  C  C4    . DA  I  5 43  ? -40.711 0.318   15.593 1.00 102.92 ? -31  DA  I C4    1 
ATOM   7038  P  P     . DC  I  5 44  ? -43.767 5.562   14.563 1.00 104.96 ? -30  DC  I P     1 
ATOM   7039  O  OP1   . DC  I  5 44  ? -44.181 6.499   13.499 1.00 105.21 ? -30  DC  I OP1   1 
ATOM   7040  O  OP2   . DC  I  5 44  ? -43.756 6.009   15.976 1.00 105.10 ? -30  DC  I OP2   1 
ATOM   7041  O  "O5'" . DC  I  5 44  ? -44.697 4.267   14.461 1.00 105.65 ? -30  DC  I "O5'" 1 
ATOM   7042  C  "C5'" . DC  I  5 44  ? -44.692 3.439   13.299 1.00 107.08 ? -30  DC  I "C5'" 1 
ATOM   7043  C  "C4'" . DC  I  5 44  ? -45.459 2.153   13.560 1.00 108.34 ? -30  DC  I "C4'" 1 
ATOM   7044  O  "O4'" . DC  I  5 44  ? -44.619 1.213   14.287 1.00 108.62 ? -30  DC  I "O4'" 1 
ATOM   7045  C  "C3'" . DC  I  5 44  ? -46.749 2.318   14.371 1.00 108.86 ? -30  DC  I "C3'" 1 
ATOM   7046  O  "O3'" . DC  I  5 44  ? -47.842 1.698   13.664 1.00 109.61 ? -30  DC  I "O3'" 1 
ATOM   7047  C  "C2'" . DC  I  5 44  ? -46.423 1.659   15.714 1.00 108.66 ? -30  DC  I "C2'" 1 
ATOM   7048  C  "C1'" . DC  I  5 44  ? -45.370 0.625   15.328 1.00 108.75 ? -30  DC  I "C1'" 1 
ATOM   7049  N  N1    . DC  I  5 44  ? -44.479 0.219   16.475 1.00 108.99 ? -30  DC  I N1    1 
ATOM   7050  C  C2    . DC  I  5 44  ? -44.302 -1.147  16.782 1.00 108.85 ? -30  DC  I C2    1 
ATOM   7051  O  O2    . DC  I  5 44  ? -44.870 -2.009  16.101 1.00 108.69 ? -30  DC  I O2    1 
ATOM   7052  N  N3    . DC  I  5 44  ? -43.504 -1.492  17.830 1.00 108.89 ? -30  DC  I N3    1 
ATOM   7053  C  C4    . DC  I  5 44  ? -42.897 -0.543  18.557 1.00 109.11 ? -30  DC  I C4    1 
ATOM   7054  N  N4    . DC  I  5 44  ? -42.119 -0.934  19.573 1.00 108.85 ? -30  DC  I N4    1 
ATOM   7055  C  C5    . DC  I  5 44  ? -43.058 0.852   18.269 1.00 109.12 ? -30  DC  I C5    1 
ATOM   7056  C  C6    . DC  I  5 44  ? -43.851 1.181   17.233 1.00 109.41 ? -30  DC  I C6    1 
ATOM   7057  P  P     . DT  I  5 45  ? -49.307 1.459   14.286 1.00 109.48 ? -29  DT  I P     1 
ATOM   7058  O  OP1   . DT  I  5 45  ? -50.252 1.352   13.153 1.00 109.58 ? -29  DT  I OP1   1 
ATOM   7059  O  OP2   . DT  I  5 45  ? -49.558 2.437   15.369 1.00 109.16 ? -29  DT  I OP2   1 
ATOM   7060  O  "O5'" . DT  I  5 45  ? -49.147 0.014   14.949 1.00 110.30 ? -29  DT  I "O5'" 1 
ATOM   7061  C  "C5'" . DT  I  5 45  ? -48.993 -1.157  14.143 1.00 111.20 ? -29  DT  I "C5'" 1 
ATOM   7062  C  "C4'" . DT  I  5 45  ? -49.557 -2.369  14.868 1.00 112.21 ? -29  DT  I "C4'" 1 
ATOM   7063  O  "O4'" . DT  I  5 45  ? -48.634 -2.801  15.901 1.00 112.35 ? -29  DT  I "O4'" 1 
ATOM   7064  C  "C3'" . DT  I  5 45  ? -50.898 -2.185  15.584 1.00 112.66 ? -29  DT  I "C3'" 1 
ATOM   7065  O  "O3'" . DT  I  5 45  ? -51.601 -3.420  15.511 1.00 113.29 ? -29  DT  I "O3'" 1 
ATOM   7066  C  "C2'" . DT  I  5 45  ? -50.485 -1.848  17.019 1.00 112.22 ? -29  DT  I "C2'" 1 
ATOM   7067  C  "C1'" . DT  I  5 45  ? -49.261 -2.751  17.173 1.00 111.75 ? -29  DT  I "C1'" 1 
ATOM   7068  N  N1    . DT  I  5 45  ? -48.222 -2.339  18.177 1.00 111.54 ? -29  DT  I N1    1 
ATOM   7069  C  C2    . DT  I  5 45  ? -47.356 -3.317  18.632 1.00 111.33 ? -29  DT  I C2    1 
ATOM   7070  O  O2    . DT  I  5 45  ? -47.402 -4.483  18.265 1.00 111.08 ? -29  DT  I O2    1 
ATOM   7071  N  N3    . DT  I  5 45  ? -46.428 -2.873  19.543 1.00 111.29 ? -29  DT  I N3    1 
ATOM   7072  C  C4    . DT  I  5 45  ? -46.276 -1.586  20.034 1.00 111.38 ? -29  DT  I C4    1 
ATOM   7073  O  O4    . DT  I  5 45  ? -45.401 -1.308  20.851 1.00 111.34 ? -29  DT  I O4    1 
ATOM   7074  C  C5    . DT  I  5 45  ? -47.212 -0.609  19.514 1.00 111.25 ? -29  DT  I C5    1 
ATOM   7075  C  C7    . DT  I  5 45  ? -47.151 0.824   19.966 1.00 111.23 ? -29  DT  I C7    1 
ATOM   7076  C  C6    . DT  I  5 45  ? -48.126 -1.027  18.622 1.00 111.22 ? -29  DT  I C6    1 
ATOM   7077  P  P     . DG  I  5 46  ? -53.172 -3.524  15.794 1.00 113.33 ? -28  DG  I P     1 
ATOM   7078  O  OP1   . DG  I  5 46  ? -53.841 -2.921  14.617 1.00 113.59 ? -28  DG  I OP1   1 
ATOM   7079  O  OP2   . DG  I  5 46  ? -53.474 -2.994  17.147 1.00 113.09 ? -28  DG  I OP2   1 
ATOM   7080  O  "O5'" . DG  I  5 46  ? -53.419 -5.115  15.820 1.00 112.49 ? -28  DG  I "O5'" 1 
ATOM   7081  C  "C5'" . DG  I  5 46  ? -52.351 -6.082  15.933 1.00 111.52 ? -28  DG  I "C5'" 1 
ATOM   7082  C  "C4'" . DG  I  5 46  ? -52.373 -6.903  17.227 1.00 110.83 ? -28  DG  I "C4'" 1 
ATOM   7083  O  "O4'" . DG  I  5 46  ? -51.405 -6.374  18.175 1.00 110.74 ? -28  DG  I "O4'" 1 
ATOM   7084  C  "C3'" . DG  I  5 46  ? -53.678 -6.988  18.023 1.00 110.45 ? -28  DG  I "C3'" 1 
ATOM   7085  O  "O3'" . DG  I  5 46  ? -53.710 -8.203  18.757 1.00 110.22 ? -28  DG  I "O3'" 1 
ATOM   7086  C  "C2'" . DG  I  5 46  ? -53.536 -5.827  19.002 1.00 110.43 ? -28  DG  I "C2'" 1 
ATOM   7087  C  "C1'" . DG  I  5 46  ? -52.071 -6.033  19.382 1.00 110.23 ? -28  DG  I "C1'" 1 
ATOM   7088  N  N9    . DG  I  5 46  ? -51.374 -4.906  19.999 1.00 110.10 ? -28  DG  I N9    1 
ATOM   7089  C  C8    . DG  I  5 46  ? -51.632 -3.559  19.902 1.00 109.99 ? -28  DG  I C8    1 
ATOM   7090  N  N7    . DG  I  5 46  ? -50.799 -2.820  20.584 1.00 110.13 ? -28  DG  I N7    1 
ATOM   7091  C  C5    . DG  I  5 46  ? -49.929 -3.734  21.170 1.00 110.17 ? -28  DG  I C5    1 
ATOM   7092  C  C6    . DG  I  5 46  ? -48.811 -3.541  22.024 1.00 109.89 ? -28  DG  I C6    1 
ATOM   7093  O  O6    . DG  I  5 46  ? -48.345 -2.479  22.456 1.00 109.93 ? -28  DG  I O6    1 
ATOM   7094  N  N1    . DG  I  5 46  ? -48.218 -4.750  22.386 1.00 109.92 ? -28  DG  I N1    1 
ATOM   7095  C  C2    . DG  I  5 46  ? -48.648 -5.993  21.970 1.00 110.05 ? -28  DG  I C2    1 
ATOM   7096  N  N2    . DG  I  5 46  ? -47.967 -7.063  22.403 1.00 110.16 ? -28  DG  I N2    1 
ATOM   7097  N  N3    . DG  I  5 46  ? -49.684 -6.185  21.172 1.00 110.11 ? -28  DG  I N3    1 
ATOM   7098  C  C4    . DG  I  5 46  ? -50.275 -5.019  20.814 1.00 110.22 ? -28  DG  I C4    1 
ATOM   7099  P  P     . DC  I  5 47  ? -54.490 -9.511  18.264 1.00 110.06 ? -27  DC  I P     1 
ATOM   7100  O  OP1   . DC  I  5 47  ? -53.805 -10.036 17.052 1.00 109.33 ? -27  DC  I OP1   1 
ATOM   7101  O  OP2   . DC  I  5 47  ? -55.931 -9.169  18.253 1.00 109.73 ? -27  DC  I OP2   1 
ATOM   7102  O  "O5'" . DC  I  5 47  ? -54.255 -10.536 19.480 1.00 109.75 ? -27  DC  I "O5'" 1 
ATOM   7103  C  "C5'" . DC  I  5 47  ? -52.936 -10.779 20.001 1.00 109.22 ? -27  DC  I "C5'" 1 
ATOM   7104  C  "C4'" . DC  I  5 47  ? -52.805 -10.522 21.500 1.00 108.78 ? -27  DC  I "C4'" 1 
ATOM   7105  O  "O4'" . DC  I  5 47  ? -52.539 -9.117  21.767 1.00 108.73 ? -27  DC  I "O4'" 1 
ATOM   7106  C  "C3'" . DC  I  5 47  ? -54.008 -10.906 22.372 1.00 108.53 ? -27  DC  I "C3'" 1 
ATOM   7107  O  "O3'" . DC  I  5 47  ? -53.601 -11.764 23.441 1.00 107.74 ? -27  DC  I "O3'" 1 
ATOM   7108  C  "C2'" . DC  I  5 47  ? -54.497 -9.569  22.929 1.00 108.63 ? -27  DC  I "C2'" 1 
ATOM   7109  C  "C1'" . DC  I  5 47  ? -53.188 -8.785  22.978 1.00 108.81 ? -27  DC  I "C1'" 1 
ATOM   7110  N  N1    . DC  I  5 47  ? -53.303 -7.291  23.093 1.00 108.80 ? -27  DC  I N1    1 
ATOM   7111  C  C2    . DC  I  5 47  ? -52.187 -6.539  23.492 1.00 108.58 ? -27  DC  I C2    1 
ATOM   7112  O  O2    . DC  I  5 47  ? -51.120 -7.108  23.743 1.00 108.86 ? -27  DC  I O2    1 
ATOM   7113  N  N3    . DC  I  5 47  ? -52.301 -5.191  23.593 1.00 108.52 ? -27  DC  I N3    1 
ATOM   7114  C  C4    . DC  I  5 47  ? -53.460 -4.592  23.316 1.00 108.80 ? -27  DC  I C4    1 
ATOM   7115  N  N4    . DC  I  5 47  ? -53.519 -3.261  23.434 1.00 108.87 ? -27  DC  I N4    1 
ATOM   7116  C  C5    . DC  I  5 47  ? -54.612 -5.334  22.911 1.00 109.02 ? -27  DC  I C5    1 
ATOM   7117  C  C6    . DC  I  5 47  ? -54.487 -6.664  22.813 1.00 109.11 ? -27  DC  I C6    1 
ATOM   7118  P  P     . DT  I  5 48  ? -53.349 -13.342 23.267 1.00 107.40 ? -26  DT  I P     1 
ATOM   7119  O  OP1   . DT  I  5 48  ? -52.743 -13.648 21.939 1.00 107.02 ? -26  DT  I OP1   1 
ATOM   7120  O  OP2   . DT  I  5 48  ? -54.597 -14.017 23.691 1.00 106.97 ? -26  DT  I OP2   1 
ATOM   7121  O  "O5'" . DT  I  5 48  ? -52.238 -13.603 24.395 1.00 105.53 ? -26  DT  I "O5'" 1 
ATOM   7122  C  "C5'" . DT  I  5 48  ? -50.930 -13.024 24.287 1.00 102.21 ? -26  DT  I "C5'" 1 
ATOM   7123  C  "C4'" . DT  I  5 48  ? -50.449 -12.479 25.623 1.00 99.88  ? -26  DT  I "C4'" 1 
ATOM   7124  O  "O4'" . DT  I  5 48  ? -50.936 -11.125 25.804 1.00 99.27  ? -26  DT  I "O4'" 1 
ATOM   7125  C  "C3'" . DT  I  5 48  ? -50.875 -13.246 26.880 1.00 98.38  ? -26  DT  I "C3'" 1 
ATOM   7126  O  "O3'" . DT  I  5 48  ? -49.729 -13.357 27.747 1.00 95.10  ? -26  DT  I "O3'" 1 
ATOM   7127  C  "C2'" . DT  I  5 48  ? -51.989 -12.376 27.470 1.00 98.33  ? -26  DT  I "C2'" 1 
ATOM   7128  C  "C1'" . DT  I  5 48  ? -51.455 -10.994 27.110 1.00 99.59  ? -26  DT  I "C1'" 1 
ATOM   7129  N  N1    . DT  I  5 48  ? -52.417 -9.856  27.081 1.00 100.02 ? -26  DT  I N1    1 
ATOM   7130  C  C2    . DT  I  5 48  ? -51.941 -8.594  27.386 1.00 100.45 ? -26  DT  I C2    1 
ATOM   7131  O  O2    . DT  I  5 48  ? -50.786 -8.358  27.692 1.00 100.70 ? -26  DT  I O2    1 
ATOM   7132  N  N3    . DT  I  5 48  ? -52.877 -7.595  27.323 1.00 100.56 ? -26  DT  I N3    1 
ATOM   7133  C  C4    . DT  I  5 48  ? -54.213 -7.720  26.993 1.00 100.47 ? -26  DT  I C4    1 
ATOM   7134  O  O4    . DT  I  5 48  ? -54.947 -6.739  26.981 1.00 100.24 ? -26  DT  I O4    1 
ATOM   7135  C  C5    . DT  I  5 48  ? -54.654 -9.068  26.679 1.00 100.98 ? -26  DT  I C5    1 
ATOM   7136  C  C7    . DT  I  5 48  ? -56.081 -9.360  26.301 1.00 100.68 ? -26  DT  I C7    1 
ATOM   7137  C  C6    . DT  I  5 48  ? -53.742 -10.056 26.733 1.00 100.82 ? -26  DT  I C6    1 
ATOM   7138  P  P     . DC  I  5 49  ? -49.521 -14.521 28.834 1.00 91.87  ? -25  DC  I P     1 
ATOM   7139  O  OP1   . DC  I  5 49  ? -48.258 -15.216 28.494 1.00 90.92  ? -25  DC  I OP1   1 
ATOM   7140  O  OP2   . DC  I  5 49  ? -50.784 -15.277 29.005 1.00 91.49  ? -25  DC  I OP2   1 
ATOM   7141  O  "O5'" . DC  I  5 49  ? -49.304 -13.681 30.174 1.00 89.61  ? -25  DC  I "O5'" 1 
ATOM   7142  C  "C5'" . DC  I  5 49  ? -48.449 -12.546 30.153 1.00 87.47  ? -25  DC  I "C5'" 1 
ATOM   7143  C  "C4'" . DC  I  5 49  ? -48.970 -11.501 31.109 1.00 85.29  ? -25  DC  I "C4'" 1 
ATOM   7144  O  "O4'" . DC  I  5 49  ? -50.168 -10.899 30.570 1.00 86.32  ? -25  DC  I "O4'" 1 
ATOM   7145  C  "C3'" . DC  I  5 49  ? -49.373 -12.018 32.478 1.00 84.04  ? -25  DC  I "C3'" 1 
ATOM   7146  O  "O3'" . DC  I  5 49  ? -49.031 -11.014 33.377 1.00 81.32  ? -25  DC  I "O3'" 1 
ATOM   7147  C  "C2'" . DC  I  5 49  ? -50.891 -12.102 32.408 1.00 85.81  ? -25  DC  I "C2'" 1 
ATOM   7148  C  "C1'" . DC  I  5 49  ? -51.107 -10.817 31.621 1.00 87.77  ? -25  DC  I "C1'" 1 
ATOM   7149  N  N1    . DC  I  5 49  ? -52.481 -10.566 31.085 1.00 88.93  ? -25  DC  I N1    1 
ATOM   7150  C  C2    . DC  I  5 49  ? -52.878 -9.236  30.894 1.00 89.27  ? -25  DC  I C2    1 
ATOM   7151  O  O2    . DC  I  5 49  ? -52.094 -8.318  31.170 1.00 89.91  ? -25  DC  I O2    1 
ATOM   7152  N  N3    . DC  I  5 49  ? -54.128 -8.994  30.419 1.00 89.83  ? -25  DC  I N3    1 
ATOM   7153  C  C4    . DC  I  5 49  ? -54.956 -10.004 30.124 1.00 89.56  ? -25  DC  I C4    1 
ATOM   7154  N  N4    . DC  I  5 49  ? -56.166 -9.689  29.651 1.00 89.17  ? -25  DC  I N4    1 
ATOM   7155  C  C5    . DC  I  5 49  ? -54.571 -11.374 30.304 1.00 89.71  ? -25  DC  I C5    1 
ATOM   7156  C  C6    . DC  I  5 49  ? -53.337 -11.602 30.785 1.00 89.63  ? -25  DC  I C6    1 
ATOM   7157  P  P     . DC  I  5 50  ? -47.858 -11.237 34.407 1.00 77.80  ? -24  DC  I P     1 
ATOM   7158  O  OP1   . DC  I  5 50  ? -46.647 -11.503 33.609 1.00 78.27  ? -24  DC  I OP1   1 
ATOM   7159  O  OP2   . DC  I  5 50  ? -48.368 -12.181 35.422 1.00 78.94  ? -24  DC  I OP2   1 
ATOM   7160  O  "O5'" . DC  I  5 50  ? -47.708 -9.834  35.141 1.00 76.96  ? -24  DC  I "O5'" 1 
ATOM   7161  C  "C5'" . DC  I  5 50  ? -47.345 -8.650  34.440 1.00 76.79  ? -24  DC  I "C5'" 1 
ATOM   7162  C  "C4'" . DC  I  5 50  ? -48.207 -7.498  34.928 1.00 76.54  ? -24  DC  I "C4'" 1 
ATOM   7163  O  "O4'" . DC  I  5 50  ? -49.508 -7.607  34.300 1.00 76.96  ? -24  DC  I "O4'" 1 
ATOM   7164  C  "C3'" . DC  I  5 50  ? -48.469 -7.485  36.431 1.00 75.81  ? -24  DC  I "C3'" 1 
ATOM   7165  O  "O3'" . DC  I  5 50  ? -48.110 -6.233  36.965 1.00 74.93  ? -24  DC  I "O3'" 1 
ATOM   7166  C  "C2'" . DC  I  5 50  ? -49.968 -7.776  36.575 1.00 76.64  ? -24  DC  I "C2'" 1 
ATOM   7167  C  "C1'" . DC  I  5 50  ? -50.513 -7.297  35.241 1.00 77.53  ? -24  DC  I "C1'" 1 
ATOM   7168  N  N1    . DC  I  5 50  ? -51.758 -7.952  34.760 1.00 78.07  ? -24  DC  I N1    1 
ATOM   7169  C  C2    . DC  I  5 50  ? -52.731 -7.191  34.070 1.00 78.14  ? -24  DC  I C2    1 
ATOM   7170  O  O2    . DC  I  5 50  ? -52.565 -5.982  33.884 1.00 78.20  ? -24  DC  I O2    1 
ATOM   7171  N  N3    . DC  I  5 50  ? -53.853 -7.810  33.620 1.00 78.07  ? -24  DC  I N3    1 
ATOM   7172  C  C4    . DC  I  5 50  ? -54.019 -9.120  33.830 1.00 78.39  ? -24  DC  I C4    1 
ATOM   7173  N  N4    . DC  I  5 50  ? -55.134 -9.684  33.363 1.00 78.47  ? -24  DC  I N4    1 
ATOM   7174  C  C5    . DC  I  5 50  ? -53.044 -9.916  34.519 1.00 78.67  ? -24  DC  I C5    1 
ATOM   7175  C  C6    . DC  I  5 50  ? -51.937 -9.297  34.958 1.00 78.46  ? -24  DC  I C6    1 
ATOM   7176  P  P     . DA  I  5 51  ? -47.905 -6.006  38.534 1.00 75.08  ? -23  DA  I P     1 
ATOM   7177  O  OP1   . DA  I  5 51  ? -46.520 -5.569  38.755 1.00 74.24  ? -23  DA  I OP1   1 
ATOM   7178  O  OP2   . DA  I  5 51  ? -48.463 -7.159  39.266 1.00 75.77  ? -23  DA  I OP2   1 
ATOM   7179  O  "O5'" . DA  I  5 51  ? -48.868 -4.784  38.878 1.00 79.59  ? -23  DA  I "O5'" 1 
ATOM   7180  C  "C5'" . DA  I  5 51  ? -48.961 -3.597  38.079 1.00 84.11  ? -23  DA  I "C5'" 1 
ATOM   7181  C  "C4'" . DA  I  5 51  ? -50.252 -2.847  38.382 1.00 87.35  ? -23  DA  I "C4'" 1 
ATOM   7182  O  "O4'" . DA  I  5 51  ? -51.378 -3.527  37.775 1.00 88.43  ? -23  DA  I "O4'" 1 
ATOM   7183  C  "C3'" . DA  I  5 51  ? -50.595 -2.688  39.861 1.00 89.41  ? -23  DA  I "C3'" 1 
ATOM   7184  O  "O3'" . DA  I  5 51  ? -51.070 -1.372  40.043 1.00 92.32  ? -23  DA  I "O3'" 1 
ATOM   7185  C  "C2'" . DA  I  5 51  ? -51.678 -3.732  40.115 1.00 89.63  ? -23  DA  I "C2'" 1 
ATOM   7186  C  "C1'" . DA  I  5 51  ? -52.348 -3.843  38.753 1.00 90.98  ? -23  DA  I "C1'" 1 
ATOM   7187  N  N9    . DA  I  5 51  ? -52.851 -5.175  38.448 1.00 91.69  ? -23  DA  I N9    1 
ATOM   7188  C  C8    . DA  I  5 51  ? -52.327 -6.366  38.865 1.00 92.35  ? -23  DA  I C8    1 
ATOM   7189  N  N7    . DA  I  5 51  ? -52.985 -7.412  38.430 1.00 92.87  ? -23  DA  I N7    1 
ATOM   7190  C  C5    . DA  I  5 51  ? -54.015 -6.875  37.672 1.00 92.66  ? -23  DA  I C5    1 
ATOM   7191  C  C6    . DA  I  5 51  ? -55.072 -7.464  36.933 1.00 92.69  ? -23  DA  I C6    1 
ATOM   7192  N  N6    . DA  I  5 51  ? -55.267 -8.788  36.842 1.00 92.19  ? -23  DA  I N6    1 
ATOM   7193  N  N1    . DA  I  5 51  ? -55.930 -6.635  36.286 1.00 92.58  ? -23  DA  I N1    1 
ATOM   7194  C  C2    . DA  I  5 51  ? -55.745 -5.308  36.375 1.00 92.60  ? -23  DA  I C2    1 
ATOM   7195  N  N3    . DA  I  5 51  ? -54.788 -4.645  37.034 1.00 93.02  ? -23  DA  I N3    1 
ATOM   7196  C  C4    . DA  I  5 51  ? -53.945 -5.492  37.668 1.00 92.62  ? -23  DA  I C4    1 
ATOM   7197  P  P     . DT  I  5 52  ? -51.433 -0.737  41.466 1.00 95.67  ? -22  DT  I P     1 
ATOM   7198  O  OP1   . DT  I  5 52  ? -50.973 0.670   41.425 1.00 96.13  ? -22  DT  I OP1   1 
ATOM   7199  O  OP2   . DT  I  5 52  ? -50.999 -1.611  42.578 1.00 94.98  ? -22  DT  I OP2   1 
ATOM   7200  O  "O5'" . DT  I  5 52  ? -53.029 -0.758  41.428 1.00 98.34  ? -22  DT  I "O5'" 1 
ATOM   7201  C  "C5'" . DT  I  5 52  ? -53.753 -0.237  40.320 1.00 102.92 ? -22  DT  I "C5'" 1 
ATOM   7202  C  "C4'" . DT  I  5 52  ? -55.218 -0.592  40.477 1.00 106.85 ? -22  DT  I "C4'" 1 
ATOM   7203  O  "O4'" . DT  I  5 52  ? -55.435 -1.929  39.971 1.00 107.59 ? -22  DT  I "O4'" 1 
ATOM   7204  C  "C3'" . DT  I  5 52  ? -55.716 -0.591  41.922 1.00 109.25 ? -22  DT  I "C3'" 1 
ATOM   7205  O  "O3'" . DT  I  5 52  ? -56.731 0.404   42.086 1.00 113.51 ? -22  DT  I "O3'" 1 
ATOM   7206  C  "C2'" . DT  I  5 52  ? -56.243 -2.002  42.168 1.00 108.35 ? -22  DT  I "C2'" 1 
ATOM   7207  C  "C1'" . DT  I  5 52  ? -56.430 -2.541  40.756 1.00 108.07 ? -22  DT  I "C1'" 1 
ATOM   7208  N  N1    . DT  I  5 52  ? -56.253 -4.010  40.658 1.00 108.14 ? -22  DT  I N1    1 
ATOM   7209  C  C2    . DT  I  5 52  ? -57.027 -4.744  39.775 1.00 108.03 ? -22  DT  I C2    1 
ATOM   7210  O  O2    . DT  I  5 52  ? -57.872 -4.264  39.044 1.00 108.09 ? -22  DT  I O2    1 
ATOM   7211  N  N3    . DT  I  5 52  ? -56.768 -6.092  39.777 1.00 108.20 ? -22  DT  I N3    1 
ATOM   7212  C  C4    . DT  I  5 52  ? -55.839 -6.765  40.558 1.00 108.33 ? -22  DT  I C4    1 
ATOM   7213  O  O4    . DT  I  5 52  ? -55.701 -7.982  40.471 1.00 108.30 ? -22  DT  I O4    1 
ATOM   7214  C  C5    . DT  I  5 52  ? -55.062 -5.935  41.461 1.00 108.31 ? -22  DT  I C5    1 
ATOM   7215  C  C7    . DT  I  5 52  ? -54.014 -6.511  42.370 1.00 108.04 ? -22  DT  I C7    1 
ATOM   7216  C  C6    . DT  I  5 52  ? -55.304 -4.618  41.461 1.00 108.34 ? -22  DT  I C6    1 
ATOM   7217  P  P     . DC  I  5 53  ? -57.251 0.873   43.534 1.00 116.50 ? -21  DC  I P     1 
ATOM   7218  O  OP1   . DC  I  5 53  ? -57.460 2.337   43.459 1.00 116.58 ? -21  DC  I OP1   1 
ATOM   7219  O  OP2   . DC  I  5 53  ? -56.365 0.339   44.595 1.00 116.12 ? -21  DC  I OP2   1 
ATOM   7220  O  "O5'" . DC  I  5 53  ? -58.659 0.112   43.638 1.00 119.13 ? -21  DC  I "O5'" 1 
ATOM   7221  C  "C5'" . DC  I  5 53  ? -59.483 -0.087  42.480 1.00 123.83 ? -21  DC  I "C5'" 1 
ATOM   7222  C  "C4'" . DC  I  5 53  ? -60.560 -1.140  42.706 1.00 127.43 ? -21  DC  I "C4'" 1 
ATOM   7223  O  "O4'" . DC  I  5 53  ? -60.015 -2.476  42.519 1.00 128.17 ? -21  DC  I "O4'" 1 
ATOM   7224  C  "C3'" . DC  I  5 53  ? -61.216 -1.146  44.089 1.00 129.74 ? -21  DC  I "C3'" 1 
ATOM   7225  O  "O3'" . DC  I  5 53  ? -62.628 -1.324  43.942 1.00 132.63 ? -21  DC  I "O3'" 1 
ATOM   7226  C  "C2'" . DC  I  5 53  ? -60.558 -2.345  44.772 1.00 129.49 ? -21  DC  I "C2'" 1 
ATOM   7227  C  "C1'" . DC  I  5 53  ? -60.463 -3.295  43.584 1.00 129.11 ? -21  DC  I "C1'" 1 
ATOM   7228  N  N1    . DC  I  5 53  ? -59.560 -4.489  43.760 1.00 129.33 ? -21  DC  I N1    1 
ATOM   7229  C  C2    . DC  I  5 53  ? -59.507 -5.475  42.752 1.00 129.40 ? -21  DC  I C2    1 
ATOM   7230  O  O2    . DC  I  5 53  ? -60.196 -5.358  41.725 1.00 129.32 ? -21  DC  I O2    1 
ATOM   7231  N  N3    . DC  I  5 53  ? -58.688 -6.550  42.931 1.00 129.39 ? -21  DC  I N3    1 
ATOM   7232  C  C4    . DC  I  5 53  ? -57.951 -6.662  44.047 1.00 129.36 ? -21  DC  I C4    1 
ATOM   7233  N  N4    . DC  I  5 53  ? -57.164 -7.736  44.172 1.00 129.23 ? -21  DC  I N4    1 
ATOM   7234  C  C5    . DC  I  5 53  ? -57.993 -5.676  45.084 1.00 129.32 ? -21  DC  I C5    1 
ATOM   7235  C  C6    . DC  I  5 53  ? -58.803 -4.622  44.899 1.00 129.38 ? -21  DC  I C6    1 
ATOM   7236  P  P     . DA  I  5 54  ? -63.660 -1.087  45.145 1.00 134.78 ? -20  DA  I P     1 
ATOM   7237  O  OP1   . DA  I  5 54  ? -64.393 0.147   44.792 1.00 134.87 ? -20  DA  I OP1   1 
ATOM   7238  O  OP2   . DA  I  5 54  ? -62.944 -1.144  46.443 1.00 134.51 ? -20  DA  I OP2   1 
ATOM   7239  O  "O5'" . DA  I  5 54  ? -64.620 -2.380  45.057 1.00 136.91 ? -20  DA  I "O5'" 1 
ATOM   7240  C  "C5'" . DA  I  5 54  ? -65.898 -2.343  44.397 1.00 140.43 ? -20  DA  I "C5'" 1 
ATOM   7241  C  "C4'" . DA  I  5 54  ? -66.394 -3.697  43.897 1.00 143.07 ? -20  DA  I "C4'" 1 
ATOM   7242  O  "O4'" . DA  I  5 54  ? -65.370 -4.369  43.110 1.00 143.93 ? -20  DA  I "O4'" 1 
ATOM   7243  C  "C3'" . DA  I  5 54  ? -66.815 -4.717  44.958 1.00 144.42 ? -20  DA  I "C3'" 1 
ATOM   7244  O  "O3'" . DA  I  5 54  ? -68.180 -4.524  45.366 1.00 145.63 ? -20  DA  I "O3'" 1 
ATOM   7245  C  "C2'" . DA  I  5 54  ? -66.645 -6.026  44.188 1.00 144.64 ? -20  DA  I "C2'" 1 
ATOM   7246  C  "C1'" . DA  I  5 54  ? -65.364 -5.757  43.408 1.00 144.99 ? -20  DA  I "C1'" 1 
ATOM   7247  N  N9    . DA  I  5 54  ? -64.150 -6.096  44.157 1.00 145.39 ? -20  DA  I N9    1 
ATOM   7248  C  C8    . DA  I  5 54  ? -63.270 -5.219  44.737 1.00 145.62 ? -20  DA  I C8    1 
ATOM   7249  N  N7    . DA  I  5 54  ? -62.259 -5.784  45.351 1.00 145.72 ? -20  DA  I N7    1 
ATOM   7250  C  C5    . DA  I  5 54  ? -62.489 -7.136  45.165 1.00 145.69 ? -20  DA  I C5    1 
ATOM   7251  C  C6    . DA  I  5 54  ? -61.771 -8.277  45.578 1.00 145.45 ? -20  DA  I C6    1 
ATOM   7252  N  N6    . DA  I  5 54  ? -60.640 -8.195  46.285 1.00 145.44 ? -20  DA  I N6    1 
ATOM   7253  N  N1    . DA  I  5 54  ? -62.261 -9.493  45.235 1.00 145.45 ? -20  DA  I N1    1 
ATOM   7254  C  C2    . DA  I  5 54  ? -63.400 -9.558  44.524 1.00 145.56 ? -20  DA  I C2    1 
ATOM   7255  N  N3    . DA  I  5 54  ? -64.161 -8.552  44.079 1.00 145.73 ? -20  DA  I N3    1 
ATOM   7256  C  C4    . DA  I  5 54  ? -63.650 -7.354  44.434 1.00 145.64 ? -20  DA  I C4    1 
ATOM   7257  P  P     . DA  I  5 55  ? -68.703 -4.875  46.848 1.00 146.39 ? -19  DA  I P     1 
ATOM   7258  O  OP1   . DA  I  5 55  ? -70.180 -4.783  46.825 1.00 146.49 ? -19  DA  I OP1   1 
ATOM   7259  O  OP2   . DA  I  5 55  ? -67.936 -4.063  47.822 1.00 146.36 ? -19  DA  I OP2   1 
ATOM   7260  O  "O5'" . DA  I  5 55  ? -68.282 -6.402  47.072 1.00 146.87 ? -19  DA  I "O5'" 1 
ATOM   7261  C  "C5'" . DA  I  5 55  ? -69.010 -7.497  46.506 1.00 147.29 ? -19  DA  I "C5'" 1 
ATOM   7262  C  "C4'" . DA  I  5 55  ? -68.413 -8.818  46.973 1.00 147.55 ? -19  DA  I "C4'" 1 
ATOM   7263  O  "O4'" . DA  I  5 55  ? -66.960 -8.744  47.013 1.00 147.87 ? -19  DA  I "O4'" 1 
ATOM   7264  C  "C3'" . DA  I  5 55  ? -68.830 -9.285  48.368 1.00 147.54 ? -19  DA  I "C3'" 1 
ATOM   7265  O  "O3'" . DA  I  5 55  ? -68.815 -10.707 48.436 1.00 147.59 ? -19  DA  I "O3'" 1 
ATOM   7266  C  "C2'" . DA  I  5 55  ? -67.708 -8.721  49.236 1.00 147.51 ? -19  DA  I "C2'" 1 
ATOM   7267  C  "C1'" . DA  I  5 55  ? -66.513 -9.027  48.329 1.00 147.55 ? -19  DA  I "C1'" 1 
ATOM   7268  N  N9    . DA  I  5 55  ? -65.284 -8.279  48.615 1.00 147.56 ? -19  DA  I N9    1 
ATOM   7269  C  C8    . DA  I  5 55  ? -65.151 -6.930  48.807 1.00 147.45 ? -19  DA  I C8    1 
ATOM   7270  N  N7    . DA  I  5 55  ? -63.920 -6.543  49.047 1.00 147.52 ? -19  DA  I N7    1 
ATOM   7271  C  C5    . DA  I  5 55  ? -63.187 -7.718  49.013 1.00 147.53 ? -19  DA  I C5    1 
ATOM   7272  C  C6    . DA  I  5 55  ? -61.812 -7.995  49.194 1.00 147.27 ? -19  DA  I C6    1 
ATOM   7273  N  N6    . DA  I  5 55  ? -60.897 -7.058  49.454 1.00 147.40 ? -19  DA  I N6    1 
ATOM   7274  N  N1    . DA  I  5 55  ? -61.406 -9.277  49.092 1.00 147.27 ? -19  DA  I N1    1 
ATOM   7275  C  C2    . DA  I  5 55  ? -62.317 -10.224 48.825 1.00 147.44 ? -19  DA  I C2    1 
ATOM   7276  N  N3    . DA  I  5 55  ? -63.632 -10.091 48.639 1.00 147.54 ? -19  DA  I N3    1 
ATOM   7277  C  C4    . DA  I  5 55  ? -64.012 -8.800  48.746 1.00 147.66 ? -19  DA  I C4    1 
ATOM   7278  P  P     . DA  I  5 56  ? -69.969 -11.654 47.852 1.00 147.42 ? -18  DA  I P     1 
ATOM   7279  O  OP1   . DA  I  5 56  ? -70.119 -11.404 46.396 1.00 147.10 ? -18  DA  I OP1   1 
ATOM   7280  O  OP2   . DA  I  5 56  ? -71.130 -11.524 48.765 1.00 147.54 ? -18  DA  I OP2   1 
ATOM   7281  O  "O5'" . DA  I  5 56  ? -69.342 -13.119 48.062 1.00 146.76 ? -18  DA  I "O5'" 1 
ATOM   7282  C  "C5'" . DA  I  5 56  ? -68.069 -13.468 47.493 1.00 145.46 ? -18  DA  I "C5'" 1 
ATOM   7283  C  "C4'" . DA  I  5 56  ? -67.080 -14.044 48.503 1.00 144.43 ? -18  DA  I "C4'" 1 
ATOM   7284  O  "O4'" . DA  I  5 56  ? -66.167 -13.012 48.974 1.00 144.37 ? -18  DA  I "O4'" 1 
ATOM   7285  C  "C3'" . DA  I  5 56  ? -67.676 -14.702 49.752 1.00 143.63 ? -18  DA  I "C3'" 1 
ATOM   7286  O  "O3'" . DA  I  5 56  ? -67.295 -16.099 49.755 1.00 142.33 ? -18  DA  I "O3'" 1 
ATOM   7287  C  "C2'" . DA  I  5 56  ? -67.126 -13.865 50.912 1.00 143.93 ? -18  DA  I "C2'" 1 
ATOM   7288  C  "C1'" . DA  I  5 56  ? -65.841 -13.301 50.319 1.00 144.39 ? -18  DA  I "C1'" 1 
ATOM   7289  N  N9    . DA  I  5 56  ? -65.349 -12.093 50.985 1.00 144.57 ? -18  DA  I N9    1 
ATOM   7290  C  C8    . DA  I  5 56  ? -66.083 -10.999 51.360 1.00 144.60 ? -18  DA  I C8    1 
ATOM   7291  N  N7    . DA  I  5 56  ? -65.382 -10.053 51.941 1.00 144.70 ? -18  DA  I N7    1 
ATOM   7292  C  C5    . DA  I  5 56  ? -64.091 -10.557 51.956 1.00 144.71 ? -18  DA  I C5    1 
ATOM   7293  C  C6    . DA  I  5 56  ? -62.867 -10.036 52.441 1.00 144.51 ? -18  DA  I C6    1 
ATOM   7294  N  N6    . DA  I  5 56  ? -62.751 -8.840  53.027 1.00 144.37 ? -18  DA  I N6    1 
ATOM   7295  N  N1    . DA  I  5 56  ? -61.759 -10.798 52.299 1.00 144.55 ? -18  DA  I N1    1 
ATOM   7296  C  C2    . DA  I  5 56  ? -61.870 -12.000 51.712 1.00 144.49 ? -18  DA  I C2    1 
ATOM   7297  N  N3    . DA  I  5 56  ? -62.960 -12.595 51.219 1.00 144.47 ? -18  DA  I N3    1 
ATOM   7298  C  C4    . DA  I  5 56  ? -64.052 -11.818 51.372 1.00 144.68 ? -18  DA  I C4    1 
ATOM   7299  P  P     . DA  I  5 57  ? -66.917 -16.987 51.044 1.00 141.16 ? -17  DA  I P     1 
ATOM   7300  O  OP1   . DA  I  5 57  ? -66.905 -18.401 50.599 1.00 141.19 ? -17  DA  I OP1   1 
ATOM   7301  O  OP2   . DA  I  5 57  ? -67.772 -16.606 52.196 1.00 140.95 ? -17  DA  I OP2   1 
ATOM   7302  O  "O5'" . DA  I  5 57  ? -65.415 -16.527 51.363 1.00 139.49 ? -17  DA  I "O5'" 1 
ATOM   7303  C  "C5'" . DA  I  5 57  ? -64.298 -17.067 50.659 1.00 136.52 ? -17  DA  I "C5'" 1 
ATOM   7304  C  "C4'" . DA  I  5 57  ? -63.093 -17.139 51.581 1.00 134.33 ? -17  DA  I "C4'" 1 
ATOM   7305  O  "O4'" . DA  I  5 57  ? -62.835 -15.828 52.149 1.00 134.00 ? -17  DA  I "O4'" 1 
ATOM   7306  C  "C3'" . DA  I  5 57  ? -63.210 -18.106 52.760 1.00 132.70 ? -17  DA  I "C3'" 1 
ATOM   7307  O  "O3'" . DA  I  5 57  ? -61.999 -18.864 52.830 1.00 130.30 ? -17  DA  I "O3'" 1 
ATOM   7308  C  "C2'" . DA  I  5 57  ? -63.404 -17.187 53.972 1.00 132.95 ? -17  DA  I "C2'" 1 
ATOM   7309  C  "C1'" . DA  I  5 57  ? -62.623 -15.946 53.544 1.00 133.59 ? -17  DA  I "C1'" 1 
ATOM   7310  N  N9    . DA  I  5 57  ? -63.018 -14.676 54.163 1.00 133.58 ? -17  DA  I N9    1 
ATOM   7311  C  C8    . DA  I  5 57  ? -64.287 -14.252 54.450 1.00 133.58 ? -17  DA  I C8    1 
ATOM   7312  N  N7    . DA  I  5 57  ? -64.339 -13.060 54.996 1.00 133.74 ? -17  DA  I N7    1 
ATOM   7313  C  C5    . DA  I  5 57  ? -63.012 -12.665 55.071 1.00 133.76 ? -17  DA  I C5    1 
ATOM   7314  C  C6    . DA  I  5 57  ? -62.387 -11.488 55.553 1.00 133.64 ? -17  DA  I C6    1 
ATOM   7315  N  N6    . DA  I  5 57  ? -63.061 -10.460 56.072 1.00 133.51 ? -17  DA  I N6    1 
ATOM   7316  N  N1    . DA  I  5 57  ? -61.038 -11.406 55.486 1.00 133.53 ? -17  DA  I N1    1 
ATOM   7317  C  C2    . DA  I  5 57  ? -60.361 -12.440 54.965 1.00 133.50 ? -17  DA  I C2    1 
ATOM   7318  N  N3    . DA  I  5 57  ? -60.836 -13.591 54.479 1.00 133.48 ? -17  DA  I N3    1 
ATOM   7319  C  C4    . DA  I  5 57  ? -62.182 -13.650 54.561 1.00 133.61 ? -17  DA  I C4    1 
ATOM   7320  P  P     . DG  I  5 58  ? -61.850 -20.259 53.611 1.00 128.44 ? -16  DG  I P     1 
ATOM   7321  O  OP1   . DG  I  5 58  ? -61.249 -21.240 52.674 1.00 127.82 ? -16  DG  I OP1   1 
ATOM   7322  O  OP2   . DG  I  5 58  ? -63.136 -20.572 54.277 1.00 128.39 ? -16  DG  I OP2   1 
ATOM   7323  O  "O5'" . DG  I  5 58  ? -60.784 -19.918 54.763 1.00 126.70 ? -16  DG  I "O5'" 1 
ATOM   7324  C  "C5'" . DG  I  5 58  ? -59.636 -19.098 54.512 1.00 123.84 ? -16  DG  I "C5'" 1 
ATOM   7325  C  "C4'" . DG  I  5 58  ? -59.087 -18.458 55.781 1.00 121.86 ? -16  DG  I "C4'" 1 
ATOM   7326  O  "O4'" . DG  I  5 58  ? -59.799 -17.223 56.059 1.00 121.60 ? -16  DG  I "O4'" 1 
ATOM   7327  C  "C3'" . DG  I  5 58  ? -59.154 -19.288 57.066 1.00 120.43 ? -16  DG  I "C3'" 1 
ATOM   7328  O  "O3'" . DG  I  5 58  ? -57.915 -19.196 57.758 1.00 117.95 ? -16  DG  I "O3'" 1 
ATOM   7329  C  "C2'" . DG  I  5 58  ? -60.243 -18.599 57.879 1.00 121.04 ? -16  DG  I "C2'" 1 
ATOM   7330  C  "C1'" . DG  I  5 58  ? -60.048 -17.148 57.448 1.00 121.66 ? -16  DG  I "C1'" 1 
ATOM   7331  N  N9    . DG  I  5 58  ? -61.198 -16.270 57.687 1.00 121.98 ? -16  DG  I N9    1 
ATOM   7332  C  C8    . DG  I  5 58  ? -62.537 -16.607 57.629 1.00 121.92 ? -16  DG  I C8    1 
ATOM   7333  N  N7    . DG  I  5 58  ? -63.340 -15.614 57.890 1.00 121.99 ? -16  DG  I N7    1 
ATOM   7334  C  C5    . DG  I  5 58  ? -62.483 -14.546 58.136 1.00 121.90 ? -16  DG  I C5    1 
ATOM   7335  C  C6    . DG  I  5 58  ? -62.779 -13.202 58.473 1.00 121.89 ? -16  DG  I C6    1 
ATOM   7336  O  O6    . DG  I  5 58  ? -63.895 -12.687 58.622 1.00 121.83 ? -16  DG  I O6    1 
ATOM   7337  N  N1    . DG  I  5 58  ? -61.623 -12.431 58.636 1.00 121.89 ? -16  DG  I N1    1 
ATOM   7338  C  C2    . DG  I  5 58  ? -60.337 -12.905 58.494 1.00 121.75 ? -16  DG  I C2    1 
ATOM   7339  N  N2    . DG  I  5 58  ? -59.350 -12.020 58.691 1.00 121.76 ? -16  DG  I N2    1 
ATOM   7340  N  N3    . DG  I  5 58  ? -60.045 -14.164 58.183 1.00 121.65 ? -16  DG  I N3    1 
ATOM   7341  C  C4    . DG  I  5 58  ? -61.160 -14.929 58.017 1.00 121.86 ? -16  DG  I C4    1 
ATOM   7342  P  P     . DG  I  5 59  ? -56.746 -20.278 57.604 1.00 115.43 ? -15  DG  I P     1 
ATOM   7343  O  OP1   . DG  I  5 59  ? -56.666 -20.744 56.199 1.00 115.57 ? -15  DG  I OP1   1 
ATOM   7344  O  OP2   . DG  I  5 59  ? -56.901 -21.263 58.697 1.00 115.36 ? -15  DG  I OP2   1 
ATOM   7345  O  "O5'" . DG  I  5 59  ? -55.464 -19.382 57.920 1.00 113.67 ? -15  DG  I "O5'" 1 
ATOM   7346  C  "C5'" . DG  I  5 59  ? -55.086 -18.301 57.068 1.00 111.38 ? -15  DG  I "C5'" 1 
ATOM   7347  C  "C4'" . DG  I  5 59  ? -54.302 -17.256 57.848 1.00 109.99 ? -15  DG  I "C4'" 1 
ATOM   7348  O  "O4'" . DG  I  5 59  ? -55.224 -16.381 58.543 1.00 109.95 ? -15  DG  I "O4'" 1 
ATOM   7349  C  "C3'" . DG  I  5 59  ? -53.324 -17.773 58.912 1.00 108.71 ? -15  DG  I "C3'" 1 
ATOM   7350  O  "O3'" . DG  I  5 59  ? -52.078 -17.016 58.830 1.00 105.54 ? -15  DG  I "O3'" 1 
ATOM   7351  C  "C2'" . DG  I  5 59  ? -54.131 -17.679 60.213 1.00 109.17 ? -15  DG  I "C2'" 1 
ATOM   7352  C  "C1'" . DG  I  5 59  ? -55.107 -16.535 59.946 1.00 110.59 ? -15  DG  I "C1'" 1 
ATOM   7353  N  N9    . DG  I  5 59  ? -56.469 -16.711 60.453 1.00 111.01 ? -15  DG  I N9    1 
ATOM   7354  C  C8    . DG  I  5 59  ? -57.193 -17.876 60.583 1.00 111.18 ? -15  DG  I C8    1 
ATOM   7355  N  N7    . DG  I  5 59  ? -58.397 -17.692 61.057 1.00 111.34 ? -15  DG  I N7    1 
ATOM   7356  C  C5    . DG  I  5 59  ? -58.484 -16.316 61.250 1.00 111.39 ? -15  DG  I C5    1 
ATOM   7357  C  C6    . DG  I  5 59  ? -59.549 -15.508 61.742 1.00 111.33 ? -15  DG  I C6    1 
ATOM   7358  O  O6    . DG  I  5 59  ? -60.673 -15.866 62.121 1.00 111.06 ? -15  DG  I O6    1 
ATOM   7359  N  N1    . DG  I  5 59  ? -59.215 -14.150 61.777 1.00 111.22 ? -15  DG  I N1    1 
ATOM   7360  C  C2    . DG  I  5 59  ? -57.999 -13.631 61.383 1.00 111.11 ? -15  DG  I C2    1 
ATOM   7361  N  N2    . DG  I  5 59  ? -57.839 -12.303 61.477 1.00 111.02 ? -15  DG  I N2    1 
ATOM   7362  N  N3    . DG  I  5 59  ? -57.000 -14.375 60.921 1.00 111.26 ? -15  DG  I N3    1 
ATOM   7363  C  C4    . DG  I  5 59  ? -57.305 -15.700 60.878 1.00 111.28 ? -15  DG  I C4    1 
ATOM   7364  P  P     . DC  I  5 60  ? -51.181 -16.436 60.031 1.00 102.78 ? -14  DC  I P     1 
ATOM   7365  O  OP1   . DC  I  5 60  ? -49.969 -15.914 59.360 1.00 102.53 ? -14  DC  I OP1   1 
ATOM   7366  O  OP2   . DC  I  5 60  ? -51.058 -17.433 61.123 1.00 101.78 ? -14  DC  I OP2   1 
ATOM   7367  O  "O5'" . DC  I  5 60  ? -52.066 -15.220 60.599 1.00 102.37 ? -14  DC  I "O5'" 1 
ATOM   7368  C  "C5'" . DC  I  5 60  ? -51.622 -13.862 60.628 1.00 101.13 ? -14  DC  I "C5'" 1 
ATOM   7369  C  "C4'" . DC  I  5 60  ? -52.091 -13.158 61.892 1.00 100.42 ? -14  DC  I "C4'" 1 
ATOM   7370  O  "O4'" . DC  I  5 60  ? -53.409 -13.624 62.276 1.00 100.80 ? -14  DC  I "O4'" 1 
ATOM   7371  C  "C3'" . DC  I  5 60  ? -51.198 -13.374 63.107 1.00 99.96  ? -14  DC  I "C3'" 1 
ATOM   7372  O  "O3'" . DC  I  5 60  ? -51.059 -12.168 63.832 1.00 98.73  ? -14  DC  I "O3'" 1 
ATOM   7373  C  "C2'" . DC  I  5 60  ? -51.945 -14.423 63.931 1.00 100.83 ? -14  DC  I "C2'" 1 
ATOM   7374  C  "C1'" . DC  I  5 60  ? -53.404 -14.107 63.612 1.00 101.80 ? -14  DC  I "C1'" 1 
ATOM   7375  N  N1    . DC  I  5 60  ? -54.364 -15.273 63.693 1.00 102.32 ? -14  DC  I N1    1 
ATOM   7376  C  C2    . DC  I  5 60  ? -55.741 -15.051 63.901 1.00 102.58 ? -14  DC  I C2    1 
ATOM   7377  O  O2    . DC  I  5 60  ? -56.169 -13.895 64.032 1.00 102.64 ? -14  DC  I O2    1 
ATOM   7378  N  N3    . DC  I  5 60  ? -56.578 -16.127 63.955 1.00 102.74 ? -14  DC  I N3    1 
ATOM   7379  C  C4    . DC  I  5 60  ? -56.103 -17.376 63.811 1.00 102.87 ? -14  DC  I C4    1 
ATOM   7380  N  N4    . DC  I  5 60  ? -56.959 -18.409 63.870 1.00 102.46 ? -14  DC  I N4    1 
ATOM   7381  C  C5    . DC  I  5 60  ? -54.710 -17.619 63.599 1.00 102.95 ? -14  DC  I C5    1 
ATOM   7382  C  C6    . DC  I  5 60  ? -53.895 -16.553 63.546 1.00 102.68 ? -14  DC  I C6    1 
ATOM   7383  P  P     . DA  I  5 61  ? -49.861 -11.155 63.550 1.00 98.24  ? -13  DA  I P     1 
ATOM   7384  O  OP1   . DA  I  5 61  ? -50.037 -10.607 62.191 1.00 97.83  ? -13  DA  I OP1   1 
ATOM   7385  O  OP2   . DA  I  5 61  ? -48.607 -11.814 63.958 1.00 98.68  ? -13  DA  I OP2   1 
ATOM   7386  O  "O5'" . DA  I  5 61  ? -50.121 -9.984  64.610 1.00 100.90 ? -13  DA  I "O5'" 1 
ATOM   7387  C  "C5'" . DA  I  5 61  ? -51.190 -9.044  64.438 1.00 102.96 ? -13  DA  I "C5'" 1 
ATOM   7388  C  "C4'" . DA  I  5 61  ? -51.971 -8.808  65.722 1.00 104.44 ? -13  DA  I "C4'" 1 
ATOM   7389  O  "O4'" . DA  I  5 61  ? -52.795 -9.956  66.040 1.00 104.74 ? -13  DA  I "O4'" 1 
ATOM   7390  C  "C3'" . DA  I  5 61  ? -51.133 -8.523  66.961 1.00 105.78 ? -13  DA  I "C3'" 1 
ATOM   7391  O  "O3'" . DA  I  5 61  ? -51.686 -7.376  67.574 1.00 107.82 ? -13  DA  I "O3'" 1 
ATOM   7392  C  "C2'" . DA  I  5 61  ? -51.286 -9.772  67.827 1.00 105.59 ? -13  DA  I "C2'" 1 
ATOM   7393  C  "C1'" . DA  I  5 61  ? -52.642 -10.313 67.397 1.00 105.96 ? -13  DA  I "C1'" 1 
ATOM   7394  N  N9    . DA  I  5 61  ? -52.750 -11.764 67.418 1.00 106.41 ? -13  DA  I N9    1 
ATOM   7395  C  C8    . DA  I  5 61  ? -51.726 -12.666 67.333 1.00 106.64 ? -13  DA  I C8    1 
ATOM   7396  N  N7    . DA  I  5 61  ? -52.117 -13.917 67.356 1.00 106.80 ? -13  DA  I N7    1 
ATOM   7397  C  C5    . DA  I  5 61  ? -53.494 -13.838 67.457 1.00 106.79 ? -13  DA  I C5    1 
ATOM   7398  C  C6    . DA  I  5 61  ? -54.504 -14.825 67.525 1.00 106.82 ? -13  DA  I C6    1 
ATOM   7399  N  N6    . DA  I  5 61  ? -54.256 -16.140 67.501 1.00 106.62 ? -13  DA  I N6    1 
ATOM   7400  N  N1    . DA  I  5 61  ? -55.787 -14.408 67.618 1.00 106.63 ? -13  DA  I N1    1 
ATOM   7401  C  C2    . DA  I  5 61  ? -56.037 -13.091 67.641 1.00 106.73 ? -13  DA  I C2    1 
ATOM   7402  N  N3    . DA  I  5 61  ? -55.174 -12.072 67.583 1.00 106.95 ? -13  DA  I N3    1 
ATOM   7403  C  C4    . DA  I  5 61  ? -53.904 -12.513 67.492 1.00 106.94 ? -13  DA  I C4    1 
ATOM   7404  P  P     . DT  I  5 62  ? -50.972 -6.598  68.777 1.00 109.88 ? -12  DT  I P     1 
ATOM   7405  O  OP1   . DT  I  5 62  ? -51.382 -5.183  68.633 1.00 110.31 ? -12  DT  I OP1   1 
ATOM   7406  O  OP2   . DT  I  5 62  ? -49.529 -6.941  68.839 1.00 109.22 ? -12  DT  I OP2   1 
ATOM   7407  O  "O5'" . DT  I  5 62  ? -51.689 -7.219  70.072 1.00 111.54 ? -12  DT  I "O5'" 1 
ATOM   7408  C  "C5'" . DT  I  5 62  ? -53.114 -7.141  70.258 1.00 113.71 ? -12  DT  I "C5'" 1 
ATOM   7409  C  "C4'" . DT  I  5 62  ? -53.588 -8.033  71.396 1.00 115.22 ? -12  DT  I "C4'" 1 
ATOM   7410  O  "O4'" . DT  I  5 62  ? -53.747 -9.387  70.907 1.00 115.46 ? -12  DT  I "O4'" 1 
ATOM   7411  C  "C3'" . DT  I  5 62  ? -52.640 -8.126  72.591 1.00 116.28 ? -12  DT  I "C3'" 1 
ATOM   7412  O  "O3'" . DT  I  5 62  ? -53.179 -7.439  73.710 1.00 118.27 ? -12  DT  I "O3'" 1 
ATOM   7413  C  "C2'" . DT  I  5 62  ? -52.525 -9.616  72.900 1.00 116.23 ? -12  DT  I "C2'" 1 
ATOM   7414  C  "C1'" . DT  I  5 62  ? -53.549 -10.275 71.986 1.00 116.28 ? -12  DT  I "C1'" 1 
ATOM   7415  N  N1    . DT  I  5 62  ? -53.082 -11.594 71.470 1.00 116.36 ? -12  DT  I N1    1 
ATOM   7416  C  C2    . DT  I  5 62  ? -53.995 -12.599 71.214 1.00 116.46 ? -12  DT  I C2    1 
ATOM   7417  O  O2    . DT  I  5 62  ? -55.193 -12.491 71.377 1.00 116.60 ? -12  DT  I O2    1 
ATOM   7418  N  N3    . DT  I  5 62  ? -53.443 -13.765 70.745 1.00 116.66 ? -12  DT  I N3    1 
ATOM   7419  C  C4    . DT  I  5 62  ? -52.102 -14.028 70.515 1.00 116.68 ? -12  DT  I C4    1 
ATOM   7420  O  O4    . DT  I  5 62  ? -51.724 -15.117 70.090 1.00 116.71 ? -12  DT  I O4    1 
ATOM   7421  C  C5    . DT  I  5 62  ? -51.195 -12.934 70.802 1.00 116.83 ? -12  DT  I C5    1 
ATOM   7422  C  C7    . DT  I  5 62  ? -49.714 -13.078 70.595 1.00 116.70 ? -12  DT  I C7    1 
ATOM   7423  C  C6    . DT  I  5 62  ? -51.725 -11.790 71.260 1.00 116.61 ? -12  DT  I C6    1 
ATOM   7424  P  P     . DG  I  5 63  ? -52.269 -7.025  74.970 1.00 120.07 ? -11  DG  I P     1 
ATOM   7425  O  OP1   . DG  I  5 63  ? -52.348 -5.549  75.059 1.00 119.60 ? -11  DG  I OP1   1 
ATOM   7426  O  OP2   . DG  I  5 63  ? -50.936 -7.667  74.880 1.00 119.49 ? -11  DG  I OP2   1 
ATOM   7427  O  "O5'" . DG  I  5 63  ? -53.025 -7.664  76.234 1.00 120.63 ? -11  DG  I "O5'" 1 
ATOM   7428  C  "C5'" . DG  I  5 63  ? -54.079 -8.612  76.084 1.00 122.15 ? -11  DG  I "C5'" 1 
ATOM   7429  C  "C4'" . DG  I  5 63  ? -54.133 -9.622  77.226 1.00 123.52 ? -11  DG  I "C4'" 1 
ATOM   7430  O  "O4'" . DG  I  5 63  ? -53.812 -10.953 76.737 1.00 123.90 ? -11  DG  I "O4'" 1 
ATOM   7431  C  "C3'" . DG  I  5 63  ? -53.202 -9.454  78.424 1.00 124.27 ? -11  DG  I "C3'" 1 
ATOM   7432  O  "O3'" . DG  I  5 63  ? -53.823 -10.175 79.481 1.00 124.90 ? -11  DG  I "O3'" 1 
ATOM   7433  C  "C2'" . DG  I  5 63  ? -51.942 -10.172 77.946 1.00 124.06 ? -11  DG  I "C2'" 1 
ATOM   7434  C  "C1'" . DG  I  5 63  ? -52.594 -11.400 77.312 1.00 123.85 ? -11  DG  I "C1'" 1 
ATOM   7435  N  N9    . DG  I  5 63  ? -51.833 -12.062 76.258 1.00 123.79 ? -11  DG  I N9    1 
ATOM   7436  C  C8    . DG  I  5 63  ? -50.768 -11.577 75.536 1.00 123.76 ? -11  DG  I C8    1 
ATOM   7437  N  N7    . DG  I  5 63  ? -50.312 -12.418 74.652 1.00 123.60 ? -11  DG  I N7    1 
ATOM   7438  C  C5    . DG  I  5 63  ? -51.128 -13.529 74.796 1.00 123.61 ? -11  DG  I C5    1 
ATOM   7439  C  C6    . DG  I  5 63  ? -51.114 -14.763 74.106 1.00 123.79 ? -11  DG  I C6    1 
ATOM   7440  O  O6    . DG  I  5 63  ? -50.348 -15.121 73.202 1.00 123.67 ? -11  DG  I O6    1 
ATOM   7441  N  N1    . DG  I  5 63  ? -52.120 -15.622 74.560 1.00 124.08 ? -11  DG  I N1    1 
ATOM   7442  C  C2    . DG  I  5 63  ? -53.025 -15.323 75.560 1.00 123.81 ? -11  DG  I C2    1 
ATOM   7443  N  N2    . DG  I  5 63  ? -53.921 -16.272 75.865 1.00 123.65 ? -11  DG  I N2    1 
ATOM   7444  N  N3    . DG  I  5 63  ? -53.045 -14.168 76.215 1.00 123.53 ? -11  DG  I N3    1 
ATOM   7445  C  C4    . DG  I  5 63  ? -52.072 -13.324 75.779 1.00 123.65 ? -11  DG  I C4    1 
ATOM   7446  P  P     . DT  I  5 64  ? -53.503 -9.969  81.035 1.00 124.83 ? -10  DT  I P     1 
ATOM   7447  O  OP1   . DT  I  5 64  ? -54.073 -8.652  81.403 1.00 124.63 ? -10  DT  I OP1   1 
ATOM   7448  O  OP2   . DT  I  5 64  ? -52.069 -10.268 81.291 1.00 124.34 ? -10  DT  I OP2   1 
ATOM   7449  O  "O5'" . DT  I  5 64  ? -54.382 -11.144 81.697 1.00 124.67 ? -10  DT  I "O5'" 1 
ATOM   7450  C  "C5'" . DT  I  5 64  ? -54.909 -12.238 80.914 1.00 124.25 ? -10  DT  I "C5'" 1 
ATOM   7451  C  "C4'" . DT  I  5 64  ? -54.259 -13.580 81.234 1.00 124.08 ? -10  DT  I "C4'" 1 
ATOM   7452  O  "O4'" . DT  I  5 64  ? -53.447 -14.050 80.117 1.00 124.59 ? -10  DT  I "O4'" 1 
ATOM   7453  C  "C3'" . DT  I  5 64  ? -53.341 -13.615 82.457 1.00 123.64 ? -10  DT  I "C3'" 1 
ATOM   7454  O  "O3'" . DT  I  5 64  ? -53.596 -14.800 83.192 1.00 122.32 ? -10  DT  I "O3'" 1 
ATOM   7455  C  "C2'" . DT  I  5 64  ? -51.944 -13.650 81.845 1.00 124.17 ? -10  DT  I "C2'" 1 
ATOM   7456  C  "C1'" . DT  I  5 64  ? -52.219 -14.537 80.636 1.00 124.50 ? -10  DT  I "C1'" 1 
ATOM   7457  N  N1    . DT  I  5 64  ? -51.121 -14.550 79.599 1.00 124.59 ? -10  DT  I N1    1 
ATOM   7458  C  C2    . DT  I  5 64  ? -50.927 -15.684 78.822 1.00 124.51 ? -10  DT  I C2    1 
ATOM   7459  O  O2    . DT  I  5 64  ? -51.604 -16.695 78.913 1.00 124.35 ? -10  DT  I O2    1 
ATOM   7460  N  N3    . DT  I  5 64  ? -49.893 -15.589 77.915 1.00 124.52 ? -10  DT  I N3    1 
ATOM   7461  C  C4    . DT  I  5 64  ? -49.051 -14.504 77.711 1.00 124.54 ? -10  DT  I C4    1 
ATOM   7462  O  O4    . DT  I  5 64  ? -48.157 -14.529 76.867 1.00 124.50 ? -10  DT  I O4    1 
ATOM   7463  C  C5    . DT  I  5 64  ? -49.304 -13.353 78.557 1.00 124.52 ? -10  DT  I C5    1 
ATOM   7464  C  C7    . DT  I  5 64  ? -48.469 -12.109 78.447 1.00 124.49 ? -10  DT  I C7    1 
ATOM   7465  C  C6    . DT  I  5 64  ? -50.309 -13.434 79.445 1.00 124.53 ? -10  DT  I C6    1 
ATOM   7466  P  P     . DT  I  5 65  ? -53.055 -14.979 84.688 1.00 121.46 ? -9   DT  I P     1 
ATOM   7467  O  OP1   . DT  I  5 65  ? -53.810 -14.008 85.512 1.00 121.77 ? -9   DT  I OP1   1 
ATOM   7468  O  OP2   . DT  I  5 65  ? -51.570 -14.938 84.692 1.00 121.06 ? -9   DT  I OP2   1 
ATOM   7469  O  "O5'" . DT  I  5 65  ? -53.523 -16.468 85.073 1.00 119.54 ? -9   DT  I "O5'" 1 
ATOM   7470  C  "C5'" . DT  I  5 65  ? -53.859 -17.446 84.073 1.00 116.82 ? -9   DT  I "C5'" 1 
ATOM   7471  C  "C4'" . DT  I  5 65  ? -52.724 -18.424 83.791 1.00 114.62 ? -9   DT  I "C4'" 1 
ATOM   7472  O  "O4'" . DT  I  5 65  ? -51.891 -17.962 82.688 1.00 114.00 ? -9   DT  I "O4'" 1 
ATOM   7473  C  "C3'" . DT  I  5 65  ? -51.769 -18.701 84.958 1.00 113.10 ? -9   DT  I "C3'" 1 
ATOM   7474  O  "O3'" . DT  I  5 65  ? -51.804 -20.099 85.268 1.00 111.18 ? -9   DT  I "O3'" 1 
ATOM   7475  C  "C2'" . DT  I  5 65  ? -50.399 -18.253 84.442 1.00 113.04 ? -9   DT  I "C2'" 1 
ATOM   7476  C  "C1'" . DT  I  5 65  ? -50.589 -18.451 82.940 1.00 113.21 ? -9   DT  I "C1'" 1 
ATOM   7477  N  N1    . DT  I  5 65  ? -49.572 -17.801 82.035 1.00 113.06 ? -9   DT  I N1    1 
ATOM   7478  C  C2    . DT  I  5 65  ? -49.090 -18.519 80.948 1.00 112.98 ? -9   DT  I C2    1 
ATOM   7479  O  O2    . DT  I  5 65  ? -49.439 -19.656 80.668 1.00 112.85 ? -9   DT  I O2    1 
ATOM   7480  N  N3    . DT  I  5 65  ? -48.167 -17.847 80.181 1.00 112.72 ? -9   DT  I N3    1 
ATOM   7481  C  C4    . DT  I  5 65  ? -47.685 -16.564 80.380 1.00 112.91 ? -9   DT  I C4    1 
ATOM   7482  O  O4    . DT  I  5 65  ? -46.857 -16.066 79.620 1.00 113.00 ? -9   DT  I O4    1 
ATOM   7483  C  C5    . DT  I  5 65  ? -48.224 -15.868 81.531 1.00 113.00 ? -9   DT  I C5    1 
ATOM   7484  C  C7    . DT  I  5 65  ? -47.786 -14.468 81.861 1.00 113.03 ? -9   DT  I C7    1 
ATOM   7485  C  C6    . DT  I  5 65  ? -49.128 -16.512 82.291 1.00 112.94 ? -9   DT  I C6    1 
ATOM   7486  P  P     . DC  I  5 66  ? -51.236 -20.682 86.652 1.00 109.42 ? -8   DC  I P     1 
ATOM   7487  O  OP1   . DC  I  5 66  ? -52.268 -21.579 87.220 1.00 109.17 ? -8   DC  I OP1   1 
ATOM   7488  O  OP2   . DC  I  5 66  ? -50.709 -19.534 87.430 1.00 109.57 ? -8   DC  I OP2   1 
ATOM   7489  O  "O5'" . DC  I  5 66  ? -49.979 -21.585 86.238 1.00 107.67 ? -8   DC  I "O5'" 1 
ATOM   7490  C  "C5'" . DC  I  5 66  ? -50.020 -22.526 85.150 1.00 104.19 ? -8   DC  I "C5'" 1 
ATOM   7491  C  "C4'" . DC  I  5 66  ? -48.623 -22.747 84.588 1.00 101.03 ? -8   DC  I "C4'" 1 
ATOM   7492  O  "O4'" . DC  I  5 66  ? -48.161 -21.535 83.933 1.00 99.75  ? -8   DC  I "O4'" 1 
ATOM   7493  C  "C3'" . DC  I  5 66  ? -47.563 -23.100 85.634 1.00 99.48  ? -8   DC  I "C3'" 1 
ATOM   7494  O  "O3'" . DC  I  5 66  ? -46.846 -24.256 85.226 1.00 97.89  ? -8   DC  I "O3'" 1 
ATOM   7495  C  "C2'" . DC  I  5 66  ? -46.652 -21.873 85.658 1.00 99.31  ? -8   DC  I "C2'" 1 
ATOM   7496  C  "C1'" . DC  I  5 66  ? -46.788 -21.389 84.216 1.00 99.45  ? -8   DC  I "C1'" 1 
ATOM   7497  N  N1    . DC  I  5 66  ? -46.325 -19.981 83.939 1.00 99.39  ? -8   DC  I N1    1 
ATOM   7498  C  C2    . DC  I  5 66  ? -45.774 -19.649 82.681 1.00 99.51  ? -8   DC  I C2    1 
ATOM   7499  O  O2    . DC  I  5 66  ? -45.672 -20.507 81.792 1.00 98.91  ? -8   DC  I O2    1 
ATOM   7500  N  N3    . DC  I  5 66  ? -45.361 -18.368 82.465 1.00 99.64  ? -8   DC  I N3    1 
ATOM   7501  C  C4    . DC  I  5 66  ? -45.473 -17.448 83.432 1.00 99.53  ? -8   DC  I C4    1 
ATOM   7502  N  N4    . DC  I  5 66  ? -45.052 -16.205 83.171 1.00 99.48  ? -8   DC  I N4    1 
ATOM   7503  C  C5    . DC  I  5 66  ? -46.021 -17.764 84.714 1.00 99.33  ? -8   DC  I C5    1 
ATOM   7504  C  C6    . DC  I  5 66  ? -46.427 -19.025 84.916 1.00 99.34  ? -8   DC  I C6    1 
ATOM   7505  P  P     . DA  I  5 67  ? -47.133 -25.711 85.838 1.00 96.34  ? -7   DA  I P     1 
ATOM   7506  O  OP1   . DA  I  5 67  ? -48.603 -25.871 85.931 1.00 96.57  ? -7   DA  I OP1   1 
ATOM   7507  O  OP2   . DA  I  5 67  ? -46.248 -25.868 87.017 1.00 95.44  ? -7   DA  I OP2   1 
ATOM   7508  O  "O5'" . DA  I  5 67  ? -46.612 -26.717 84.705 1.00 95.16  ? -7   DA  I "O5'" 1 
ATOM   7509  C  "C5'" . DA  I  5 67  ? -46.808 -26.419 83.305 1.00 93.02  ? -7   DA  I "C5'" 1 
ATOM   7510  C  "C4'" . DA  I  5 67  ? -45.578 -26.667 82.428 1.00 90.35  ? -7   DA  I "C4'" 1 
ATOM   7511  O  "O4'" . DA  I  5 67  ? -44.798 -25.458 82.250 1.00 89.56  ? -7   DA  I "O4'" 1 
ATOM   7512  C  "C3'" . DA  I  5 67  ? -44.558 -27.711 82.868 1.00 88.98  ? -7   DA  I "C3'" 1 
ATOM   7513  O  "O3'" . DA  I  5 67  ? -44.008 -28.180 81.663 1.00 87.51  ? -7   DA  I "O3'" 1 
ATOM   7514  C  "C2'" . DA  I  5 67  ? -43.537 -26.896 83.660 1.00 89.25  ? -7   DA  I "C2'" 1 
ATOM   7515  C  "C1'" . DA  I  5 67  ? -43.512 -25.608 82.837 1.00 90.33  ? -7   DA  I "C1'" 1 
ATOM   7516  N  N9    . DA  I  5 67  ? -43.257 -24.356 83.550 1.00 90.42  ? -7   DA  I N9    1 
ATOM   7517  C  C8    . DA  I  5 67  ? -43.405 -24.068 84.879 1.00 90.40  ? -7   DA  I C8    1 
ATOM   7518  N  N7    . DA  I  5 67  ? -43.104 -22.829 85.195 1.00 90.32  ? -7   DA  I N7    1 
ATOM   7519  C  C5    . DA  I  5 67  ? -42.741 -22.260 83.986 1.00 90.69  ? -7   DA  I C5    1 
ATOM   7520  C  C6    . DA  I  5 67  ? -42.313 -20.963 83.617 1.00 90.80  ? -7   DA  I C6    1 
ATOM   7521  N  N6    . DA  I  5 67  ? -42.177 -19.961 84.488 1.00 90.62  ? -7   DA  I N6    1 
ATOM   7522  N  N1    . DA  I  5 67  ? -42.025 -20.725 82.314 1.00 90.67  ? -7   DA  I N1    1 
ATOM   7523  C  C2    . DA  I  5 67  ? -42.155 -21.727 81.433 1.00 90.78  ? -7   DA  I C2    1 
ATOM   7524  N  N3    . DA  I  5 67  ? -42.551 -22.984 81.656 1.00 91.15  ? -7   DA  I N3    1 
ATOM   7525  C  C4    . DA  I  5 67  ? -42.832 -23.188 82.962 1.00 90.95  ? -7   DA  I C4    1 
ATOM   7526  P  P     . DG  I  5 68  ? -43.185 -29.536 81.502 1.00 86.51  ? -6   DG  I P     1 
ATOM   7527  O  OP1   . DG  I  5 68  ? -43.848 -30.278 80.404 1.00 86.81  ? -6   DG  I OP1   1 
ATOM   7528  O  OP2   . DG  I  5 68  ? -42.980 -30.168 82.822 1.00 86.19  ? -6   DG  I OP2   1 
ATOM   7529  O  "O5'" . DG  I  5 68  ? -41.747 -29.035 81.002 1.00 86.05  ? -6   DG  I "O5'" 1 
ATOM   7530  C  "C5'" . DG  I  5 68  ? -41.592 -28.029 79.987 1.00 85.11  ? -6   DG  I "C5'" 1 
ATOM   7531  C  "C4'" . DG  I  5 68  ? -40.255 -27.317 80.110 1.00 84.06  ? -6   DG  I "C4'" 1 
ATOM   7532  O  "O4'" . DG  I  5 68  ? -40.385 -26.166 80.980 1.00 84.20  ? -6   DG  I "O4'" 1 
ATOM   7533  C  "C3'" . DG  I  5 68  ? -39.114 -28.156 80.695 1.00 83.88  ? -6   DG  I "C3'" 1 
ATOM   7534  O  "O3'" . DG  I  5 68  ? -37.889 -27.901 80.000 1.00 82.62  ? -6   DG  I "O3'" 1 
ATOM   7535  C  "C2'" . DG  I  5 68  ? -39.017 -27.659 82.131 1.00 83.58  ? -6   DG  I "C2'" 1 
ATOM   7536  C  "C1'" . DG  I  5 68  ? -39.284 -26.187 81.866 1.00 84.93  ? -6   DG  I "C1'" 1 
ATOM   7537  N  N9    . DG  I  5 68  ? -39.508 -25.383 83.067 1.00 85.18  ? -6   DG  I N9    1 
ATOM   7538  C  C8    . DG  I  5 68  ? -39.899 -25.798 84.321 1.00 85.62  ? -6   DG  I C8    1 
ATOM   7539  N  N7    . DG  I  5 68  ? -39.982 -24.828 85.189 1.00 86.10  ? -6   DG  I N7    1 
ATOM   7540  C  C5    . DG  I  5 68  ? -39.615 -23.695 84.463 1.00 85.96  ? -6   DG  I C5    1 
ATOM   7541  C  C6    . DG  I  5 68  ? -39.509 -22.330 84.857 1.00 85.76  ? -6   DG  I C6    1 
ATOM   7542  O  O6    . DG  I  5 68  ? -39.732 -21.834 85.973 1.00 85.60  ? -6   DG  I O6    1 
ATOM   7543  N  N1    . DG  I  5 68  ? -39.096 -21.507 83.798 1.00 85.69  ? -6   DG  I N1    1 
ATOM   7544  C  C2    . DG  I  5 68  ? -38.818 -21.959 82.518 1.00 85.83  ? -6   DG  I C2    1 
ATOM   7545  N  N2    . DG  I  5 68  ? -38.434 -21.053 81.604 1.00 85.86  ? -6   DG  I N2    1 
ATOM   7546  N  N3    . DG  I  5 68  ? -38.916 -23.229 82.147 1.00 85.57  ? -6   DG  I N3    1 
ATOM   7547  C  C4    . DG  I  5 68  ? -39.318 -24.032 83.160 1.00 85.24  ? -6   DG  I C4    1 
ATOM   7548  P  P     . DC  I  5 69  ? -37.366 -28.829 78.807 1.00 80.82  ? -5   DC  I P     1 
ATOM   7549  O  OP1   . DC  I  5 69  ? -38.526 -29.257 77.981 1.00 80.27  ? -5   DC  I OP1   1 
ATOM   7550  O  OP2   . DC  I  5 69  ? -36.431 -29.819 79.396 1.00 80.33  ? -5   DC  I OP2   1 
ATOM   7551  O  "O5'" . DC  I  5 69  ? -36.488 -27.785 77.973 1.00 79.54  ? -5   DC  I "O5'" 1 
ATOM   7552  C  "C5'" . DC  I  5 69  ? -37.068 -26.607 77.432 1.00 76.66  ? -5   DC  I "C5'" 1 
ATOM   7553  C  "C4'" . DC  I  5 69  ? -36.210 -25.389 77.715 1.00 74.78  ? -5   DC  I "C4'" 1 
ATOM   7554  O  "O4'" . DC  I  5 69  ? -36.495 -24.913 79.052 1.00 74.93  ? -5   DC  I "O4'" 1 
ATOM   7555  C  "C3'" . DC  I  5 69  ? -34.697 -25.576 77.633 1.00 73.02  ? -5   DC  I "C3'" 1 
ATOM   7556  O  "O3'" . DC  I  5 69  ? -34.131 -24.492 76.895 1.00 71.13  ? -5   DC  I "O3'" 1 
ATOM   7557  C  "C2'" . DC  I  5 69  ? -34.260 -25.537 79.089 1.00 73.41  ? -5   DC  I "C2'" 1 
ATOM   7558  C  "C1'" . DC  I  5 69  ? -35.283 -24.584 79.687 1.00 74.08  ? -5   DC  I "C1'" 1 
ATOM   7559  N  N1    . DC  I  5 69  ? -35.491 -24.751 81.151 1.00 74.10  ? -5   DC  I N1    1 
ATOM   7560  C  C2    . DC  I  5 69  ? -35.647 -23.613 81.960 1.00 74.41  ? -5   DC  I C2    1 
ATOM   7561  O  O2    . DC  I  5 69  ? -35.610 -22.476 81.463 1.00 74.62  ? -5   DC  I O2    1 
ATOM   7562  N  N3    . DC  I  5 69  ? -35.833 -23.796 83.289 1.00 74.37  ? -5   DC  I N3    1 
ATOM   7563  C  C4    . DC  I  5 69  ? -35.867 -25.030 83.795 1.00 74.39  ? -5   DC  I C4    1 
ATOM   7564  N  N4    . DC  I  5 69  ? -36.065 -25.147 85.110 1.00 74.84  ? -5   DC  I N4    1 
ATOM   7565  C  C5    . DC  I  5 69  ? -35.707 -26.201 82.990 1.00 74.24  ? -5   DC  I C5    1 
ATOM   7566  C  C6    . DC  I  5 69  ? -35.526 -26.012 81.685 1.00 73.72  ? -5   DC  I C6    1 
ATOM   7567  P  P     . DT  I  5 70  ? -32.610 -24.495 76.422 1.00 68.22  ? -4   DT  I P     1 
ATOM   7568  O  OP1   . DT  I  5 70  ? -32.625 -24.190 74.979 1.00 69.16  ? -4   DT  I OP1   1 
ATOM   7569  O  OP2   . DT  I  5 70  ? -31.931 -25.695 76.948 1.00 67.65  ? -4   DT  I OP2   1 
ATOM   7570  O  "O5'" . DT  I  5 70  ? -31.953 -23.262 77.182 1.00 70.12  ? -4   DT  I "O5'" 1 
ATOM   7571  C  "C5'" . DT  I  5 70  ? -32.392 -21.903 77.035 1.00 71.66  ? -4   DT  I "C5'" 1 
ATOM   7572  C  "C4'" . DT  I  5 70  ? -31.820 -21.120 78.195 1.00 72.82  ? -4   DT  I "C4'" 1 
ATOM   7573  O  "O4'" . DT  I  5 70  ? -32.307 -21.722 79.417 1.00 73.38  ? -4   DT  I "O4'" 1 
ATOM   7574  C  "C3'" . DT  I  5 70  ? -30.300 -21.203 78.265 1.00 74.55  ? -4   DT  I "C3'" 1 
ATOM   7575  O  "O3'" . DT  I  5 70  ? -29.727 -19.907 78.288 1.00 76.40  ? -4   DT  I "O3'" 1 
ATOM   7576  C  "C2'" . DT  I  5 70  ? -29.992 -21.996 79.534 1.00 74.64  ? -4   DT  I "C2'" 1 
ATOM   7577  C  "C1'" . DT  I  5 70  ? -31.255 -21.788 80.355 1.00 75.03  ? -4   DT  I "C1'" 1 
ATOM   7578  N  N1    . DT  I  5 70  ? -31.518 -22.863 81.379 1.00 75.27  ? -4   DT  I N1    1 
ATOM   7579  C  C2    . DT  I  5 70  ? -31.813 -22.502 82.689 1.00 75.87  ? -4   DT  I C2    1 
ATOM   7580  O  O2    . DT  I  5 70  ? -31.879 -21.349 83.080 1.00 76.17  ? -4   DT  I O2    1 
ATOM   7581  N  N3    . DT  I  5 70  ? -32.034 -23.551 83.552 1.00 75.51  ? -4   DT  I N3    1 
ATOM   7582  C  C4    . DT  I  5 70  ? -31.982 -24.899 83.241 1.00 75.77  ? -4   DT  I C4    1 
ATOM   7583  O  O4    . DT  I  5 70  ? -32.192 -25.758 84.090 1.00 75.69  ? -4   DT  I O4    1 
ATOM   7584  C  C5    . DT  I  5 70  ? -31.670 -25.217 81.859 1.00 76.17  ? -4   DT  I C5    1 
ATOM   7585  C  C7    . DT  I  5 70  ? -31.586 -26.649 81.398 1.00 76.14  ? -4   DT  I C7    1 
ATOM   7586  C  C6    . DT  I  5 70  ? -31.456 -24.195 81.007 1.00 75.46  ? -4   DT  I C6    1 
ATOM   7587  P  P     . DG  I  5 71  ? -28.177 -19.677 77.933 1.00 78.13  ? -3   DG  I P     1 
ATOM   7588  O  OP1   . DG  I  5 71  ? -28.196 -18.775 76.753 1.00 78.10  ? -3   DG  I OP1   1 
ATOM   7589  O  OP2   . DG  I  5 71  ? -27.432 -20.965 77.934 1.00 76.07  ? -3   DG  I OP2   1 
ATOM   7590  O  "O5'" . DG  I  5 71  ? -27.615 -18.883 79.202 1.00 79.19  ? -3   DG  I "O5'" 1 
ATOM   7591  C  "C5'" . DG  I  5 71  ? -28.386 -17.852 79.837 1.00 82.03  ? -3   DG  I "C5'" 1 
ATOM   7592  C  "C4'" . DG  I  5 71  ? -28.046 -17.753 81.318 1.00 83.02  ? -3   DG  I "C4'" 1 
ATOM   7593  O  "O4'" . DG  I  5 71  ? -28.551 -18.910 82.036 1.00 82.49  ? -3   DG  I "O4'" 1 
ATOM   7594  C  "C3'" . DG  I  5 71  ? -26.553 -17.690 81.618 1.00 84.10  ? -3   DG  I "C3'" 1 
ATOM   7595  O  "O3'" . DG  I  5 71  ? -26.359 -16.728 82.638 1.00 85.99  ? -3   DG  I "O3'" 1 
ATOM   7596  C  "C2'" . DG  I  5 71  ? -26.219 -19.112 82.075 1.00 83.21  ? -3   DG  I "C2'" 1 
ATOM   7597  C  "C1'" . DG  I  5 71  ? -27.509 -19.500 82.781 1.00 82.51  ? -3   DG  I "C1'" 1 
ATOM   7598  N  N9    . DG  I  5 71  ? -27.751 -20.932 82.829 1.00 82.35  ? -3   DG  I N9    1 
ATOM   7599  C  C8    . DG  I  5 71  ? -27.562 -21.844 81.825 1.00 82.51  ? -3   DG  I C8    1 
ATOM   7600  N  N7    . DG  I  5 71  ? -27.873 -23.061 82.157 1.00 82.47  ? -3   DG  I N7    1 
ATOM   7601  C  C5    . DG  I  5 71  ? -28.295 -22.953 83.476 1.00 82.68  ? -3   DG  I C5    1 
ATOM   7602  C  C6    . DG  I  5 71  ? -28.757 -23.941 84.388 1.00 82.52  ? -3   DG  I C6    1 
ATOM   7603  O  O6    . DG  I  5 71  ? -28.892 -25.157 84.206 1.00 82.49  ? -3   DG  I O6    1 
ATOM   7604  N  N1    . DG  I  5 71  ? -29.075 -23.403 85.631 1.00 82.30  ? -3   DG  I N1    1 
ATOM   7605  C  C2    . DG  I  5 71  ? -28.969 -22.072 85.947 1.00 82.50  ? -3   DG  I C2    1 
ATOM   7606  N  N2    . DG  I  5 71  ? -29.319 -21.715 87.186 1.00 82.63  ? -3   DG  I N2    1 
ATOM   7607  N  N3    . DG  I  5 71  ? -28.546 -21.140 85.107 1.00 83.10  ? -3   DG  I N3    1 
ATOM   7608  C  C4    . DG  I  5 71  ? -28.225 -21.647 83.896 1.00 82.45  ? -3   DG  I C4    1 
ATOM   7609  P  P     . DG  I  5 72  ? -24.914 -16.144 83.000 1.00 87.39  ? -2   DG  I P     1 
ATOM   7610  O  OP1   . DG  I  5 72  ? -24.909 -14.732 82.555 1.00 87.35  ? -2   DG  I OP1   1 
ATOM   7611  O  OP2   . DG  I  5 72  ? -23.850 -17.074 82.556 1.00 86.39  ? -2   DG  I OP2   1 
ATOM   7612  O  "O5'" . DG  I  5 72  ? -24.936 -16.164 84.601 1.00 88.50  ? -2   DG  I "O5'" 1 
ATOM   7613  C  "C5'" . DG  I  5 72  ? -26.150 -16.333 85.351 1.00 89.46  ? -2   DG  I "C5'" 1 
ATOM   7614  C  "C4'" . DG  I  5 72  ? -25.835 -16.840 86.749 1.00 90.26  ? -2   DG  I "C4'" 1 
ATOM   7615  O  "O4'" . DG  I  5 72  ? -26.218 -18.231 86.884 1.00 89.85  ? -2   DG  I "O4'" 1 
ATOM   7616  C  "C3'" . DG  I  5 72  ? -24.363 -16.772 87.147 1.00 91.53  ? -2   DG  I "C3'" 1 
ATOM   7617  O  "O3'" . DG  I  5 72  ? -24.261 -16.301 88.501 1.00 94.27  ? -2   DG  I "O3'" 1 
ATOM   7618  C  "C2'" . DG  I  5 72  ? -23.859 -18.204 86.973 1.00 90.10  ? -2   DG  I "C2'" 1 
ATOM   7619  C  "C1'" . DG  I  5 72  ? -25.109 -19.015 87.279 1.00 89.56  ? -2   DG  I "C1'" 1 
ATOM   7620  N  N9    . DG  I  5 72  ? -25.153 -20.268 86.537 1.00 89.63  ? -2   DG  I N9    1 
ATOM   7621  C  C8    . DG  I  5 72  ? -24.733 -20.459 85.241 1.00 89.41  ? -2   DG  I C8    1 
ATOM   7622  N  N7    . DG  I  5 72  ? -24.889 -21.684 84.826 1.00 89.79  ? -2   DG  I N7    1 
ATOM   7623  C  C5    . DG  I  5 72  ? -25.446 -22.354 85.909 1.00 89.54  ? -2   DG  I C5    1 
ATOM   7624  C  C6    . DG  I  5 72  ? -25.834 -23.714 86.044 1.00 89.38  ? -2   DG  I C6    1 
ATOM   7625  O  O6    . DG  I  5 72  ? -25.756 -24.627 85.211 1.00 89.07  ? -2   DG  I O6    1 
ATOM   7626  N  N1    . DG  I  5 72  ? -26.356 -23.983 87.310 1.00 89.63  ? -2   DG  I N1    1 
ATOM   7627  C  C2    . DG  I  5 72  ? -26.491 -23.059 88.321 1.00 89.39  ? -2   DG  I C2    1 
ATOM   7628  N  N2    . DG  I  5 72  ? -27.019 -23.519 89.462 1.00 89.25  ? -2   DG  I N2    1 
ATOM   7629  N  N3    . DG  I  5 72  ? -26.133 -21.780 88.209 1.00 89.58  ? -2   DG  I N3    1 
ATOM   7630  C  C4    . DG  I  5 72  ? -25.618 -21.493 86.978 1.00 89.81  ? -2   DG  I C4    1 
ATOM   7631  P  P     . DA  I  5 73  ? -22.842 -16.163 89.239 1.00 94.75  ? -1   DA  I P     1 
ATOM   7632  O  OP1   . DA  I  5 73  ? -22.943 -15.026 90.180 1.00 94.81  ? -1   DA  I OP1   1 
ATOM   7633  O  OP2   . DA  I  5 73  ? -21.768 -16.171 88.214 1.00 95.16  ? -1   DA  I OP2   1 
ATOM   7634  O  "O5'" . DA  I  5 73  ? -22.759 -17.531 90.062 1.00 94.71  ? -1   DA  I "O5'" 1 
ATOM   7635  C  "C5'" . DA  I  5 73  ? -23.858 -18.003 90.839 1.00 95.16  ? -1   DA  I "C5'" 1 
ATOM   7636  C  "C4'" . DA  I  5 73  ? -23.407 -19.172 91.698 1.00 96.02  ? -1   DA  I "C4'" 1 
ATOM   7637  O  "O4'" . DA  I  5 73  ? -23.701 -20.398 90.992 1.00 95.94  ? -1   DA  I "O4'" 1 
ATOM   7638  C  "C3'" . DA  I  5 73  ? -21.915 -19.216 92.049 1.00 96.89  ? -1   DA  I "C3'" 1 
ATOM   7639  O  "O3'" . DA  I  5 73  ? -21.743 -19.497 93.443 1.00 98.54  ? -1   DA  I "O3'" 1 
ATOM   7640  C  "C2'" . DA  I  5 73  ? -21.338 -20.319 91.167 1.00 96.31  ? -1   DA  I "C2'" 1 
ATOM   7641  C  "C1'" . DA  I  5 73  ? -22.543 -21.203 90.875 1.00 95.96  ? -1   DA  I "C1'" 1 
ATOM   7642  N  N9    . DA  I  5 73  ? -22.514 -21.781 89.530 1.00 95.77  ? -1   DA  I N9    1 
ATOM   7643  C  C8    . DA  I  5 73  ? -22.203 -21.142 88.356 1.00 95.63  ? -1   DA  I C8    1 
ATOM   7644  N  N7    . DA  I  5 73  ? -22.263 -21.913 87.297 1.00 95.75  ? -1   DA  I N7    1 
ATOM   7645  C  C5    . DA  I  5 73  ? -22.640 -23.147 87.810 1.00 95.96  ? -1   DA  I C5    1 
ATOM   7646  C  C6    . DA  I  5 73  ? -22.879 -24.406 87.209 1.00 95.90  ? -1   DA  I C6    1 
ATOM   7647  N  N6    . DA  I  5 73  ? -22.763 -24.615 85.897 1.00 95.82  ? -1   DA  I N6    1 
ATOM   7648  N  N1    . DA  I  5 73  ? -23.241 -25.444 88.005 1.00 95.93  ? -1   DA  I N1    1 
ATOM   7649  C  C2    . DA  I  5 73  ? -23.358 -25.233 89.326 1.00 95.75  ? -1   DA  I C2    1 
ATOM   7650  N  N3    . DA  I  5 73  ? -23.162 -24.096 90.003 1.00 95.51  ? -1   DA  I N3    1 
ATOM   7651  C  C4    . DA  I  5 73  ? -22.800 -23.084 89.186 1.00 95.66  ? -1   DA  I C4    1 
ATOM   7652  P  P     . DA  I  5 74  ? -20.309 -19.591 94.169 1.00 99.48  ? 0    DA  I P     1 
ATOM   7653  O  OP1   . DA  I  5 74  ? -20.463 -18.988 95.515 1.00 99.61  ? 0    DA  I OP1   1 
ATOM   7654  O  OP2   . DA  I  5 74  ? -19.227 -19.132 93.261 1.00 99.54  ? 0    DA  I OP2   1 
ATOM   7655  O  "O5'" . DA  I  5 74  ? -20.138 -21.164 94.339 1.00 99.20  ? 0    DA  I "O5'" 1 
ATOM   7656  C  "C5'" . DA  I  5 74  ? -21.204 -21.963 94.842 1.00 99.91  ? 0    DA  I "C5'" 1 
ATOM   7657  C  "C4'" . DA  I  5 74  ? -20.798 -23.415 94.718 1.00 100.03 ? 0    DA  I "C4'" 1 
ATOM   7658  O  "O4'" . DA  I  5 74  ? -21.024 -23.858 93.356 1.00 99.87  ? 0    DA  I "O4'" 1 
ATOM   7659  C  "C3'" . DA  I  5 74  ? -19.315 -23.632 95.012 1.00 100.22 ? 0    DA  I "C3'" 1 
ATOM   7660  O  "O3'" . DA  I  5 74  ? -19.138 -24.629 96.016 1.00 101.14 ? 0    DA  I "O3'" 1 
ATOM   7661  C  "C2'" . DA  I  5 74  ? -18.705 -24.014 93.664 1.00 100.06 ? 0    DA  I "C2'" 1 
ATOM   7662  C  "C1'" . DA  I  5 74  ? -19.897 -24.587 92.912 1.00 99.56  ? 0    DA  I "C1'" 1 
ATOM   7663  N  N9    . DA  I  5 74  ? -19.752 -24.438 91.468 1.00 99.23  ? 0    DA  I N9    1 
ATOM   7664  C  C8    . DA  I  5 74  ? -19.467 -23.282 90.793 1.00 99.16  ? 0    DA  I C8    1 
ATOM   7665  N  N7    . DA  I  5 74  ? -19.384 -23.429 89.494 1.00 99.20  ? 0    DA  I N7    1 
ATOM   7666  C  C5    . DA  I  5 74  ? -19.630 -24.779 89.306 1.00 99.10  ? 0    DA  I C5    1 
ATOM   7667  C  C6    . DA  I  5 74  ? -19.687 -25.570 88.142 1.00 99.31  ? 0    DA  I C6    1 
ATOM   7668  N  N6    . DA  I  5 74  ? -19.487 -25.066 86.918 1.00 99.02  ? 0    DA  I N6    1 
ATOM   7669  N  N1    . DA  I  5 74  ? -19.956 -26.891 88.298 1.00 99.43  ? 0    DA  I N1    1 
ATOM   7670  C  C2    . DA  I  5 74  ? -20.155 -27.382 89.534 1.00 99.16  ? 0    DA  I C2    1 
ATOM   7671  N  N3    . DA  I  5 74  ? -20.126 -26.731 90.697 1.00 98.75  ? 0    DA  I N3    1 
ATOM   7672  C  C4    . DA  I  5 74  ? -19.857 -25.423 90.512 1.00 98.93  ? 0    DA  I C4    1 
ATOM   7673  P  P     . DT  I  5 75  ? -17.668 -25.126 96.433 1.00 102.18 ? 1    DT  I P     1 
ATOM   7674  O  OP1   . DT  I  5 75  ? -17.757 -25.624 97.826 1.00 102.31 ? 1    DT  I OP1   1 
ATOM   7675  O  OP2   . DT  I  5 75  ? -16.670 -24.077 96.091 1.00 101.29 ? 1    DT  I OP2   1 
ATOM   7676  O  "O5'" . DT  I  5 75  ? -17.469 -26.393 95.462 1.00 102.01 ? 1    DT  I "O5'" 1 
ATOM   7677  C  "C5'" . DT  I  5 75  ? -18.472 -27.423 95.429 1.00 101.40 ? 1    DT  I "C5'" 1 
ATOM   7678  C  "C4'" . DT  I  5 75  ? -17.996 -28.664 94.697 1.00 100.74 ? 1    DT  I "C4'" 1 
ATOM   7679  O  "O4'" . DT  I  5 75  ? -18.132 -28.442 93.273 1.00 100.75 ? 1    DT  I "O4'" 1 
ATOM   7680  C  "C3'" . DT  I  5 75  ? -16.544 -29.055 94.963 1.00 100.72 ? 1    DT  I "C3'" 1 
ATOM   7681  O  "O3'" . DT  I  5 75  ? -16.495 -30.404 95.452 1.00 100.89 ? 1    DT  I "O3'" 1 
ATOM   7682  C  "C2'" . DT  I  5 75  ? -15.834 -28.849 93.619 1.00 100.72 ? 1    DT  I "C2'" 1 
ATOM   7683  C  "C1'" . DT  I  5 75  ? -16.962 -28.844 92.586 1.00 99.79  ? 1    DT  I "C1'" 1 
ATOM   7684  N  N1    . DT  I  5 75  ? -16.739 -27.915 91.406 1.00 99.54  ? 1    DT  I N1    1 
ATOM   7685  C  C2    . DT  I  5 75  ? -16.875 -28.368 90.094 1.00 99.29  ? 1    DT  I C2    1 
ATOM   7686  O  O2    . DT  I  5 75  ? -17.174 -29.512 89.784 1.00 99.00  ? 1    DT  I O2    1 
ATOM   7687  N  N3    . DT  I  5 75  ? -16.642 -27.412 89.127 1.00 98.80  ? 1    DT  I N3    1 
ATOM   7688  C  C4    . DT  I  5 75  ? -16.297 -26.083 89.327 1.00 98.91  ? 1    DT  I C4    1 
ATOM   7689  O  O4    . DT  I  5 75  ? -16.109 -25.311 88.392 1.00 98.79  ? 1    DT  I O4    1 
ATOM   7690  C  C5    . DT  I  5 75  ? -16.171 -25.675 90.711 1.00 99.00  ? 1    DT  I C5    1 
ATOM   7691  C  C7    . DT  I  5 75  ? -15.803 -24.266 91.075 1.00 99.18  ? 1    DT  I C7    1 
ATOM   7692  C  C6    . DT  I  5 75  ? -16.396 -26.594 91.662 1.00 99.34  ? 1    DT  I C6    1 
ATOM   7693  P  P     . DC  I  5 76  ? -15.130 -31.130 95.903 1.00 101.48 ? 2    DC  I P     1 
ATOM   7694  O  OP1   . DC  I  5 76  ? -15.490 -32.155 96.908 1.00 100.93 ? 2    DC  I OP1   1 
ATOM   7695  O  OP2   . DC  I  5 76  ? -14.085 -30.117 96.199 1.00 101.52 ? 2    DC  I OP2   1 
ATOM   7696  O  "O5'" . DC  I  5 76  ? -14.673 -31.875 94.561 1.00 101.57 ? 2    DC  I "O5'" 1 
ATOM   7697  C  "C5'" . DC  I  5 76  ? -15.558 -32.758 93.849 1.00 101.00 ? 2    DC  I "C5'" 1 
ATOM   7698  C  "C4'" . DC  I  5 76  ? -14.936 -33.183 92.527 1.00 99.93  ? 2    DC  I "C4'" 1 
ATOM   7699  O  "O4'" . DC  I  5 76  ? -14.969 -32.079 91.583 1.00 99.42  ? 2    DC  I "O4'" 1 
ATOM   7700  C  "C3'" . DC  I  5 76  ? -13.475 -33.616 92.625 1.00 99.65  ? 2    DC  I "C3'" 1 
ATOM   7701  O  "O3'" . DC  I  5 76  ? -13.357 -34.874 91.974 1.00 99.57  ? 2    DC  I "O3'" 1 
ATOM   7702  C  "C2'" . DC  I  5 76  ? -12.696 -32.500 91.915 1.00 98.99  ? 2    DC  I "C2'" 1 
ATOM   7703  C  "C1'" . DC  I  5 76  ? -13.731 -32.007 90.905 1.00 98.28  ? 2    DC  I "C1'" 1 
ATOM   7704  N  N1    . DC  I  5 76  ? -13.542 -30.612 90.375 1.00 97.77  ? 2    DC  I N1    1 
ATOM   7705  C  C2    . DC  I  5 76  ? -13.828 -30.315 89.022 1.00 97.60  ? 2    DC  I C2    1 
ATOM   7706  O  O2    . DC  I  5 76  ? -14.236 -31.198 88.251 1.00 97.19  ? 2    DC  I O2    1 
ATOM   7707  N  N3    . DC  I  5 76  ? -13.647 -29.042 88.578 1.00 97.29  ? 2    DC  I N3    1 
ATOM   7708  C  C4    . DC  I  5 76  ? -13.206 -28.093 89.408 1.00 97.39  ? 2    DC  I C4    1 
ATOM   7709  N  N4    . DC  I  5 76  ? -13.045 -26.862 88.918 1.00 97.23  ? 2    DC  I N4    1 
ATOM   7710  C  C5    . DC  I  5 76  ? -12.913 -28.369 90.779 1.00 97.48  ? 2    DC  I C5    1 
ATOM   7711  C  C6    . DC  I  5 76  ? -13.095 -29.625 91.214 1.00 97.65  ? 2    DC  I C6    1 
ATOM   7712  P  P     . DC  I  5 77  ? -12.182 -35.911 92.320 1.00 99.32  ? 3    DC  I P     1 
ATOM   7713  O  OP1   . DC  I  5 77  ? -12.816 -36.857 93.265 1.00 99.42  ? 3    DC  I OP1   1 
ATOM   7714  O  OP2   . DC  I  5 77  ? -10.934 -35.168 92.666 1.00 97.85  ? 3    DC  I OP2   1 
ATOM   7715  O  "O5'" . DC  I  5 77  ? -11.898 -36.717 90.950 1.00 97.38  ? 3    DC  I "O5'" 1 
ATOM   7716  C  "C5'" . DC  I  5 77  ? -12.495 -36.361 89.685 1.00 93.01  ? 3    DC  I "C5'" 1 
ATOM   7717  C  "C4'" . DC  I  5 77  ? -11.517 -35.751 88.679 1.00 89.40  ? 3    DC  I "C4'" 1 
ATOM   7718  O  "O4'" . DC  I  5 77  ? -11.500 -34.300 88.760 1.00 87.96  ? 3    DC  I "O4'" 1 
ATOM   7719  C  "C3'" . DC  I  5 77  ? -10.051 -36.176 88.750 1.00 87.24  ? 3    DC  I "C3'" 1 
ATOM   7720  O  "O3'" . DC  I  5 77  ? -9.709  -36.641 87.468 1.00 86.99  ? 3    DC  I "O3'" 1 
ATOM   7721  C  "C2'" . DC  I  5 77  ? -9.303  -34.872 89.022 1.00 86.15  ? 3    DC  I "C2'" 1 
ATOM   7722  C  "C1'" . DC  I  5 77  ? -10.228 -33.896 88.303 1.00 85.94  ? 3    DC  I "C1'" 1 
ATOM   7723  N  N1    . DC  I  5 77  ? -10.040 -32.412 88.539 1.00 85.49  ? 3    DC  I N1    1 
ATOM   7724  C  C2    . DC  I  5 77  ? -10.380 -31.481 87.528 1.00 84.93  ? 3    DC  I C2    1 
ATOM   7725  O  O2    . DC  I  5 77  ? -10.834 -31.858 86.438 1.00 84.47  ? 3    DC  I O2    1 
ATOM   7726  N  N3    . DC  I  5 77  ? -10.200 -30.157 87.774 1.00 85.26  ? 3    DC  I N3    1 
ATOM   7727  C  C4    . DC  I  5 77  ? -9.707  -29.748 88.954 1.00 85.73  ? 3    DC  I C4    1 
ATOM   7728  N  N4    . DC  I  5 77  ? -9.552  -28.437 89.147 1.00 85.15  ? 3    DC  I N4    1 
ATOM   7729  C  C5    . DC  I  5 77  ? -9.353  -30.666 89.992 1.00 85.04  ? 3    DC  I C5    1 
ATOM   7730  C  C6    . DC  I  5 77  ? -9.538  -31.968 89.738 1.00 85.50  ? 3    DC  I C6    1 
ATOM   7731  P  P     . DA  I  5 78  ? -9.618  -38.188 87.096 1.00 85.56  ? 4    DA  I P     1 
ATOM   7732  O  OP1   . DA  I  5 78  ? -10.869 -38.828 87.552 1.00 86.85  ? 4    DA  I OP1   1 
ATOM   7733  O  OP2   . DA  I  5 78  ? -8.280  -38.618 87.567 1.00 85.73  ? 4    DA  I OP2   1 
ATOM   7734  O  "O5'" . DA  I  5 78  ? -9.617  -38.256 85.489 1.00 85.93  ? 4    DA  I "O5'" 1 
ATOM   7735  C  "C5'" . DA  I  5 78  ? -10.605 -37.576 84.678 1.00 84.70  ? 4    DA  I "C5'" 1 
ATOM   7736  C  "C4'" . DA  I  5 78  ? -9.967  -36.708 83.590 1.00 83.67  ? 4    DA  I "C4'" 1 
ATOM   7737  O  "O4'" . DA  I  5 78  ? -9.420  -35.469 84.134 1.00 83.33  ? 4    DA  I "O4'" 1 
ATOM   7738  C  "C3'" . DA  I  5 78  ? -8.811  -37.327 82.808 1.00 82.70  ? 4    DA  I "C3'" 1 
ATOM   7739  O  "O3'" . DA  I  5 78  ? -8.863  -36.815 81.479 1.00 81.99  ? 4    DA  I "O3'" 1 
ATOM   7740  C  "C2'" . DA  I  5 78  ? -7.575  -36.816 83.559 1.00 82.58  ? 4    DA  I "C2'" 1 
ATOM   7741  C  "C1'" . DA  I  5 78  ? -8.015  -35.404 83.929 1.00 83.25  ? 4    DA  I "C1'" 1 
ATOM   7742  N  N9    . DA  I  5 78  ? -7.414  -34.803 85.126 1.00 83.80  ? 4    DA  I N9    1 
ATOM   7743  C  C8    . DA  I  5 78  ? -6.823  -35.428 86.193 1.00 83.98  ? 4    DA  I C8    1 
ATOM   7744  N  N7    . DA  I  5 78  ? -6.385  -34.612 87.126 1.00 83.62  ? 4    DA  I N7    1 
ATOM   7745  C  C5    . DA  I  5 78  ? -6.708  -33.354 86.648 1.00 83.84  ? 4    DA  I C5    1 
ATOM   7746  C  C6    . DA  I  5 78  ? -6.518  -32.046 87.167 1.00 84.00  ? 4    DA  I C6    1 
ATOM   7747  N  N6    . DA  I  5 78  ? -5.930  -31.773 88.338 1.00 83.69  ? 4    DA  I N6    1 
ATOM   7748  N  N1    . DA  I  5 78  ? -6.963  -31.004 86.430 1.00 84.07  ? 4    DA  I N1    1 
ATOM   7749  C  C2    . DA  I  5 78  ? -7.562  -31.253 85.256 1.00 84.07  ? 4    DA  I C2    1 
ATOM   7750  N  N3    . DA  I  5 78  ? -7.797  -32.429 84.667 1.00 83.97  ? 4    DA  I N3    1 
ATOM   7751  C  C4    . DA  I  5 78  ? -7.344  -33.454 85.419 1.00 83.92  ? 4    DA  I C4    1 
ATOM   7752  P  P     . DG  I  5 79  ? -9.416  -37.648 80.226 1.00 80.58  ? 5    DG  I P     1 
ATOM   7753  O  OP1   . DG  I  5 79  ? -10.844 -37.952 80.457 1.00 78.69  ? 5    DG  I OP1   1 
ATOM   7754  O  OP2   . DG  I  5 79  ? -8.375  -38.679 79.983 1.00 80.57  ? 5    DG  I OP2   1 
ATOM   7755  O  "O5'" . DG  I  5 79  ? -9.371  -36.636 78.983 1.00 78.57  ? 5    DG  I "O5'" 1 
ATOM   7756  C  "C5'" . DG  I  5 79  ? -9.879  -35.305 79.123 1.00 75.32  ? 5    DG  I "C5'" 1 
ATOM   7757  C  "C4'" . DG  I  5 79  ? -8.750  -34.297 79.017 1.00 72.53  ? 5    DG  I "C4'" 1 
ATOM   7758  O  "O4'" . DG  I  5 79  ? -8.012  -34.185 80.255 1.00 70.66  ? 5    DG  I "O4'" 1 
ATOM   7759  C  "C3'" . DG  I  5 79  ? -7.691  -34.582 77.954 1.00 71.26  ? 5    DG  I "C3'" 1 
ATOM   7760  O  "O3'" . DG  I  5 79  ? -7.455  -33.381 77.298 1.00 68.92  ? 5    DG  I "O3'" 1 
ATOM   7761  C  "C2'" . DG  I  5 79  ? -6.446  -34.928 78.755 1.00 70.86  ? 5    DG  I "C2'" 1 
ATOM   7762  C  "C1'" . DG  I  5 79  ? -6.679  -33.952 79.885 1.00 72.64  ? 5    DG  I "C1'" 1 
ATOM   7763  N  N9    . DG  I  5 79  ? -5.861  -34.126 81.067 1.00 73.52  ? 5    DG  I N9    1 
ATOM   7764  C  C8    . DG  I  5 79  ? -5.313  -35.282 81.569 1.00 74.04  ? 5    DG  I C8    1 
ATOM   7765  N  N7    . DG  I  5 79  ? -4.634  -35.104 82.666 1.00 74.33  ? 5    DG  I N7    1 
ATOM   7766  C  C5    . DG  I  5 79  ? -4.740  -33.740 82.900 1.00 74.44  ? 5    DG  I C5    1 
ATOM   7767  C  C6    . DG  I  5 79  ? -4.209  -32.953 83.947 1.00 74.37  ? 5    DG  I C6    1 
ATOM   7768  O  O6    . DG  I  5 79  ? -3.517  -33.336 84.903 1.00 74.28  ? 5    DG  I O6    1 
ATOM   7769  N  N1    . DG  I  5 79  ? -4.553  -31.605 83.808 1.00 74.01  ? 5    DG  I N1    1 
ATOM   7770  C  C2    . DG  I  5 79  ? -5.321  -31.085 82.784 1.00 73.96  ? 5    DG  I C2    1 
ATOM   7771  N  N2    . DG  I  5 79  ? -5.558  -29.766 82.819 1.00 74.10  ? 5    DG  I N2    1 
ATOM   7772  N  N3    . DG  I  5 79  ? -5.828  -31.808 81.799 1.00 73.91  ? 5    DG  I N3    1 
ATOM   7773  C  C4    . DG  I  5 79  ? -5.497  -33.121 81.924 1.00 74.27  ? 5    DG  I C4    1 
ATOM   7774  P  P     . DC  I  5 80  ? -7.557  -33.182 75.732 1.00 66.12  ? 6    DC  I P     1 
ATOM   7775  O  OP1   . DC  I  5 80  ? -8.895  -32.583 75.490 1.00 64.12  ? 6    DC  I OP1   1 
ATOM   7776  O  OP2   . DC  I  5 80  ? -7.074  -34.376 75.003 1.00 65.26  ? 6    DC  I OP2   1 
ATOM   7777  O  "O5'" . DC  I  5 80  ? -6.373  -32.115 75.551 1.00 64.83  ? 6    DC  I "O5'" 1 
ATOM   7778  C  "C5'" . DC  I  5 80  ? -6.590  -30.727 75.760 1.00 62.23  ? 6    DC  I "C5'" 1 
ATOM   7779  C  "C4'" . DC  I  5 80  ? -5.539  -30.099 76.664 1.00 59.56  ? 6    DC  I "C4'" 1 
ATOM   7780  O  "O4'" . DC  I  5 80  ? -5.322  -30.904 77.841 1.00 58.26  ? 6    DC  I "O4'" 1 
ATOM   7781  C  "C3'" . DC  I  5 80  ? -4.160  -29.943 76.053 1.00 58.29  ? 6    DC  I "C3'" 1 
ATOM   7782  O  "O3'" . DC  I  5 80  ? -4.151  -28.754 75.256 1.00 54.38  ? 6    DC  I "O3'" 1 
ATOM   7783  C  "C2'" . DC  I  5 80  ? -3.321  -29.806 77.318 1.00 59.58  ? 6    DC  I "C2'" 1 
ATOM   7784  C  "C1'" . DC  I  5 80  ? -4.110  -30.497 78.421 1.00 60.67  ? 6    DC  I "C1'" 1 
ATOM   7785  N  N1    . DC  I  5 80  ? -3.400  -31.676 79.016 1.00 61.97  ? 6    DC  I N1    1 
ATOM   7786  C  C2    . DC  I  5 80  ? -2.579  -31.537 80.161 1.00 62.97  ? 6    DC  I C2    1 
ATOM   7787  O  O2    . DC  I  5 80  ? -2.441  -30.427 80.701 1.00 61.18  ? 6    DC  I O2    1 
ATOM   7788  N  N3    . DC  I  5 80  ? -1.957  -32.658 80.649 1.00 63.55  ? 6    DC  I N3    1 
ATOM   7789  C  C4    . DC  I  5 80  ? -2.129  -33.850 80.052 1.00 63.48  ? 6    DC  I C4    1 
ATOM   7790  N  N4    . DC  I  5 80  ? -1.519  -34.936 80.549 1.00 62.75  ? 6    DC  I N4    1 
ATOM   7791  C  C5    . DC  I  5 80  ? -2.949  -33.994 78.892 1.00 62.98  ? 6    DC  I C5    1 
ATOM   7792  C  C6    . DC  I  5 80  ? -3.545  -32.897 78.422 1.00 62.02  ? 6    DC  I C6    1 
ATOM   7793  P  P     . DT  I  5 81  ? -2.875  -28.105 74.556 1.00 52.10  ? 7    DT  I P     1 
ATOM   7794  O  OP1   . DT  I  5 81  ? -3.381  -27.111 73.597 1.00 56.90  ? 7    DT  I OP1   1 
ATOM   7795  O  OP2   . DT  I  5 81  ? -1.890  -29.078 74.048 1.00 51.91  ? 7    DT  I OP2   1 
ATOM   7796  O  "O5'" . DT  I  5 81  ? -2.156  -27.336 75.747 1.00 54.23  ? 7    DT  I "O5'" 1 
ATOM   7797  C  "C5'" . DT  I  5 81  ? -2.686  -26.289 76.555 1.00 54.87  ? 7    DT  I "C5'" 1 
ATOM   7798  C  "C4'" . DT  I  5 81  ? -1.543  -25.764 77.423 1.00 56.71  ? 7    DT  I "C4'" 1 
ATOM   7799  O  "O4'" . DT  I  5 81  ? -1.109  -26.763 78.388 1.00 56.53  ? 7    DT  I "O4'" 1 
ATOM   7800  C  "C3'" . DT  I  5 81  ? -0.274  -25.371 76.657 1.00 57.22  ? 7    DT  I "C3'" 1 
ATOM   7801  O  "O3'" . DT  I  5 81  ? 0.315   -24.234 77.286 1.00 56.62  ? 7    DT  I "O3'" 1 
ATOM   7802  C  "C2'" . DT  I  5 81  ? 0.608   -26.610 76.776 1.00 56.83  ? 7    DT  I "C2'" 1 
ATOM   7803  C  "C1'" . DT  I  5 81  ? 0.248   -27.111 78.165 1.00 59.53  ? 7    DT  I "C1'" 1 
ATOM   7804  N  N1    . DT  I  5 81  ? 0.417   -28.592 78.335 1.00 60.82  ? 7    DT  I N1    1 
ATOM   7805  C  C2    . DT  I  5 81  ? 0.961   -29.106 79.505 1.00 62.18  ? 7    DT  I C2    1 
ATOM   7806  O  O2    . DT  I  5 81  ? 1.348   -28.434 80.463 1.00 62.13  ? 7    DT  I O2    1 
ATOM   7807  N  N3    . DT  I  5 81  ? 1.050   -30.479 79.517 1.00 62.52  ? 7    DT  I N3    1 
ATOM   7808  C  C4    . DT  I  5 81  ? 0.666   -31.357 78.522 1.00 62.04  ? 7    DT  I C4    1 
ATOM   7809  O  O4    . DT  I  5 81  ? 0.809   -32.569 78.663 1.00 62.56  ? 7    DT  I O4    1 
ATOM   7810  C  C5    . DT  I  5 81  ? 0.101   -30.755 77.330 1.00 61.78  ? 7    DT  I C5    1 
ATOM   7811  C  C7    . DT  I  5 81  ? -0.366  -31.583 76.159 1.00 60.77  ? 7    DT  I C7    1 
ATOM   7812  C  C6    . DT  I  5 81  ? 0.014   -29.423 77.308 1.00 60.61  ? 7    DT  I C6    1 
ATOM   7813  P  P     . DG  I  5 82  ? 1.442   -23.331 76.616 1.00 57.08  ? 8    DG  I P     1 
ATOM   7814  O  OP1   . DG  I  5 82  ? 0.979   -21.951 76.815 1.00 60.15  ? 8    DG  I OP1   1 
ATOM   7815  O  OP2   . DG  I  5 82  ? 1.823   -23.817 75.273 1.00 57.55  ? 8    DG  I OP2   1 
ATOM   7816  O  "O5'" . DG  I  5 82  ? 2.712   -23.515 77.546 1.00 59.82  ? 8    DG  I "O5'" 1 
ATOM   7817  C  "C5'" . DG  I  5 82  ? 2.603   -23.502 78.965 1.00 63.69  ? 8    DG  I "C5'" 1 
ATOM   7818  C  "C4'" . DG  I  5 82  ? 3.880   -24.042 79.582 1.00 67.19  ? 8    DG  I "C4'" 1 
ATOM   7819  O  "O4'" . DG  I  5 82  ? 3.837   -25.485 79.666 1.00 67.22  ? 8    DG  I "O4'" 1 
ATOM   7820  C  "C3'" . DG  I  5 82  ? 5.170   -23.678 78.846 1.00 69.47  ? 8    DG  I "C3'" 1 
ATOM   7821  O  "O3'" . DG  I  5 82  ? 6.028   -23.111 79.828 1.00 72.15  ? 8    DG  I "O3'" 1 
ATOM   7822  C  "C2'" . DG  I  5 82  ? 5.651   -25.008 78.252 1.00 69.32  ? 8    DG  I "C2'" 1 
ATOM   7823  C  "C1'" . DG  I  5 82  ? 5.055   -26.040 79.205 1.00 69.96  ? 8    DG  I "C1'" 1 
ATOM   7824  N  N9    . DG  I  5 82  ? 4.682   -27.331 78.630 1.00 70.69  ? 8    DG  I N9    1 
ATOM   7825  C  C8    . DG  I  5 82  ? 4.051   -27.542 77.426 1.00 71.26  ? 8    DG  I C8    1 
ATOM   7826  N  N7    . DG  I  5 82  ? 3.810   -28.796 77.171 1.00 71.40  ? 8    DG  I N7    1 
ATOM   7827  C  C5    . DG  I  5 82  ? 4.296   -29.468 78.280 1.00 71.18  ? 8    DG  I C5    1 
ATOM   7828  C  C6    . DG  I  5 82  ? 4.308   -30.855 78.577 1.00 71.03  ? 8    DG  I C6    1 
ATOM   7829  O  O6    . DG  I  5 82  ? 3.882   -31.775 77.881 1.00 71.43  ? 8    DG  I O6    1 
ATOM   7830  N  N1    . DG  I  5 82  ? 4.897   -31.149 79.805 1.00 70.70  ? 8    DG  I N1    1 
ATOM   7831  C  C2    . DG  I  5 82  ? 5.408   -30.196 80.652 1.00 71.14  ? 8    DG  I C2    1 
ATOM   7832  N  N2    . DG  I  5 82  ? 5.935   -30.641 81.804 1.00 70.86  ? 8    DG  I N2    1 
ATOM   7833  N  N3    . DG  I  5 82  ? 5.391   -28.885 80.388 1.00 71.99  ? 8    DG  I N3    1 
ATOM   7834  C  C4    . DG  I  5 82  ? 4.828   -28.584 79.190 1.00 71.10  ? 8    DG  I C4    1 
ATOM   7835  P  P     . DA  I  5 83  ? 7.553   -22.717 79.576 1.00 75.19  ? 9    DA  I P     1 
ATOM   7836  O  OP1   . DA  I  5 83  ? 7.905   -21.781 80.680 1.00 75.00  ? 9    DA  I OP1   1 
ATOM   7837  O  OP2   . DA  I  5 83  ? 7.742   -22.323 78.156 1.00 74.29  ? 9    DA  I OP2   1 
ATOM   7838  O  "O5'" . DA  I  5 83  ? 8.309   -24.112 79.781 1.00 76.90  ? 9    DA  I "O5'" 1 
ATOM   7839  C  "C5'" . DA  I  5 83  ? 8.473   -24.702 81.063 1.00 80.20  ? 9    DA  I "C5'" 1 
ATOM   7840  C  "C4'" . DA  I  5 83  ? 9.460   -25.860 81.001 1.00 83.16  ? 9    DA  I "C4'" 1 
ATOM   7841  O  "O4'" . DA  I  5 83  ? 8.794   -27.031 80.469 1.00 83.89  ? 9    DA  I "O4'" 1 
ATOM   7842  C  "C3'" . DA  I  5 83  ? 10.715  -25.673 80.141 1.00 84.92  ? 9    DA  I "C3'" 1 
ATOM   7843  O  "O3'" . DA  I  5 83  ? 11.799  -26.373 80.749 1.00 87.94  ? 9    DA  I "O3'" 1 
ATOM   7844  C  "C2'" . DA  I  5 83  ? 10.333  -26.341 78.830 1.00 84.14  ? 9    DA  I "C2'" 1 
ATOM   7845  C  "C1'" . DA  I  5 83  ? 9.556   -27.525 79.390 1.00 84.36  ? 9    DA  I "C1'" 1 
ATOM   7846  N  N9    . DA  I  5 83  ? 8.673   -28.167 78.428 1.00 84.70  ? 9    DA  I N9    1 
ATOM   7847  C  C8    . DA  I  5 83  ? 7.981   -27.590 77.395 1.00 84.65  ? 9    DA  I C8    1 
ATOM   7848  N  N7    . DA  I  5 83  ? 7.275   -28.443 76.693 1.00 84.83  ? 9    DA  I N7    1 
ATOM   7849  C  C5    . DA  I  5 83  ? 7.533   -29.663 77.307 1.00 84.98  ? 9    DA  I C5    1 
ATOM   7850  C  C6    . DA  I  5 83  ? 7.102   -30.979 77.048 1.00 84.52  ? 9    DA  I C6    1 
ATOM   7851  N  N6    . DA  I  5 83  ? 6.270   -31.295 76.060 1.00 84.45  ? 9    DA  I N6    1 
ATOM   7852  N  N1    . DA  I  5 83  ? 7.548   -31.966 77.854 1.00 84.85  ? 9    DA  I N1    1 
ATOM   7853  C  C2    . DA  I  5 83  ? 8.383   -31.662 78.856 1.00 84.73  ? 9    DA  I C2    1 
ATOM   7854  N  N3    . DA  I  5 83  ? 8.863   -30.468 79.196 1.00 84.65  ? 9    DA  I N3    1 
ATOM   7855  C  C4    . DA  I  5 83  ? 8.394   -29.508 78.378 1.00 84.78  ? 9    DA  I C4    1 
ATOM   7856  P  P     . DA  I  5 84  ? 13.333  -25.938 80.571 1.00 90.95  ? 10   DA  I P     1 
ATOM   7857  O  OP1   . DA  I  5 84  ? 13.518  -24.700 81.367 1.00 90.04  ? 10   DA  I OP1   1 
ATOM   7858  O  OP2   . DA  I  5 84  ? 13.676  -25.952 79.125 1.00 89.37  ? 10   DA  I OP2   1 
ATOM   7859  O  "O5'" . DA  I  5 84  ? 14.136  -27.154 81.269 1.00 92.48  ? 10   DA  I "O5'" 1 
ATOM   7860  C  "C5'" . DA  I  5 84  ? 13.493  -28.143 82.106 1.00 95.03  ? 10   DA  I "C5'" 1 
ATOM   7861  C  "C4'" . DA  I  5 84  ? 13.894  -29.587 81.794 1.00 96.99  ? 10   DA  I "C4'" 1 
ATOM   7862  O  "O4'" . DA  I  5 84  ? 12.936  -30.208 80.892 1.00 97.54  ? 10   DA  I "O4'" 1 
ATOM   7863  C  "C3'" . DA  I  5 84  ? 15.264  -29.836 81.159 1.00 98.52  ? 10   DA  I "C3'" 1 
ATOM   7864  O  "O3'" . DA  I  5 84  ? 15.776  -31.050 81.720 1.00 101.59 ? 10   DA  I "O3'" 1 
ATOM   7865  C  "C2'" . DA  I  5 84  ? 14.935  -29.987 79.677 1.00 97.54  ? 10   DA  I "C2'" 1 
ATOM   7866  C  "C1'" . DA  I  5 84  ? 13.620  -30.755 79.772 1.00 97.29  ? 10   DA  I "C1'" 1 
ATOM   7867  N  N9    . DA  I  5 84  ? 12.787  -30.705 78.560 1.00 97.23  ? 10   DA  I N9    1 
ATOM   7868  C  C8    . DA  I  5 84  ? 12.551  -29.618 77.755 1.00 97.00  ? 10   DA  I C8    1 
ATOM   7869  N  N7    . DA  I  5 84  ? 11.769  -29.873 76.734 1.00 97.30  ? 10   DA  I N7    1 
ATOM   7870  C  C5    . DA  I  5 84  ? 11.468  -31.224 76.873 1.00 97.40  ? 10   DA  I C5    1 
ATOM   7871  C  C6    . DA  I  5 84  ? 10.676  -32.119 76.109 1.00 97.21  ? 10   DA  I C6    1 
ATOM   7872  N  N6    . DA  I  5 84  ? 10.018  -31.752 75.004 1.00 96.83  ? 10   DA  I N6    1 
ATOM   7873  N  N1    . DA  I  5 84  ? 10.586  -33.407 76.524 1.00 97.02  ? 10   DA  I N1    1 
ATOM   7874  C  C2    . DA  I  5 84  ? 11.241  -33.782 77.632 1.00 96.92  ? 10   DA  I C2    1 
ATOM   7875  N  N3    . DA  I  5 84  ? 12.011  -33.034 78.426 1.00 97.04  ? 10   DA  I N3    1 
ATOM   7876  C  C4    . DA  I  5 84  ? 12.088  -31.755 77.994 1.00 97.21  ? 10   DA  I C4    1 
ATOM   7877  P  P     . DC  I  5 85  ? 17.275  -31.604 81.513 1.00 103.64 ? 11   DC  I P     1 
ATOM   7878  O  OP1   . DC  I  5 85  ? 18.079  -31.122 82.661 1.00 103.48 ? 11   DC  I OP1   1 
ATOM   7879  O  OP2   . DC  I  5 85  ? 17.739  -31.316 80.128 1.00 103.30 ? 11   DC  I OP2   1 
ATOM   7880  O  "O5'" . DC  I  5 85  ? 17.056  -33.193 81.659 1.00 104.05 ? 11   DC  I "O5'" 1 
ATOM   7881  C  "C5'" . DC  I  5 85  ? 15.878  -33.855 81.137 1.00 104.93 ? 11   DC  I "C5'" 1 
ATOM   7882  C  "C4'" . DC  I  5 85  ? 16.080  -34.524 79.776 1.00 105.10 ? 11   DC  I "C4'" 1 
ATOM   7883  O  "O4'" . DC  I  5 85  ? 15.266  -33.880 78.753 1.00 104.59 ? 11   DC  I "O4'" 1 
ATOM   7884  C  "C3'" . DC  I  5 85  ? 17.509  -34.565 79.221 1.00 105.43 ? 11   DC  I "C3'" 1 
ATOM   7885  O  "O3'" . DC  I  5 85  ? 17.867  -35.926 78.938 1.00 106.41 ? 11   DC  I "O3'" 1 
ATOM   7886  C  "C2'" . DC  I  5 85  ? 17.443  -33.704 77.959 1.00 104.88 ? 11   DC  I "C2'" 1 
ATOM   7887  C  "C1'" . DC  I  5 85  ? 15.990  -33.899 77.540 1.00 104.33 ? 11   DC  I "C1'" 1 
ATOM   7888  N  N1    . DC  I  5 85  ? 15.445  -32.871 76.576 1.00 104.18 ? 11   DC  I N1    1 
ATOM   7889  C  C2    . DC  I  5 85  ? 14.375  -33.219 75.733 1.00 103.75 ? 11   DC  I C2    1 
ATOM   7890  O  O2    . DC  I  5 85  ? 13.890  -34.355 75.799 1.00 103.44 ? 11   DC  I O2    1 
ATOM   7891  N  N3    . DC  I  5 85  ? 13.893  -32.288 74.865 1.00 104.02 ? 11   DC  I N3    1 
ATOM   7892  C  C4    . DC  I  5 85  ? 14.432  -31.062 74.814 1.00 104.22 ? 11   DC  I C4    1 
ATOM   7893  N  N4    . DC  I  5 85  ? 13.920  -30.185 73.940 1.00 103.92 ? 11   DC  I N4    1 
ATOM   7894  C  C5    . DC  I  5 85  ? 15.526  -30.687 75.656 1.00 103.92 ? 11   DC  I C5    1 
ATOM   7895  C  C6    . DC  I  5 85  ? 15.993  -31.612 76.509 1.00 104.06 ? 11   DC  I C6    1 
ATOM   7896  P  P     . DA  I  5 86  ? 19.331  -36.372 78.442 1.00 107.07 ? 12   DA  I P     1 
ATOM   7897  O  OP1   . DA  I  5 86  ? 19.775  -37.417 79.389 1.00 107.23 ? 12   DA  I OP1   1 
ATOM   7898  O  OP2   . DA  I  5 86  ? 20.187  -35.186 78.171 1.00 106.49 ? 12   DA  I OP2   1 
ATOM   7899  O  "O5'" . DA  I  5 86  ? 19.038  -37.050 77.024 1.00 107.99 ? 12   DA  I "O5'" 1 
ATOM   7900  C  "C5'" . DA  I  5 86  ? 18.306  -38.269 76.902 1.00 109.30 ? 12   DA  I "C5'" 1 
ATOM   7901  C  "C4'" . DA  I  5 86  ? 18.141  -38.613 75.431 1.00 110.35 ? 12   DA  I "C4'" 1 
ATOM   7902  O  "O4'" . DA  I  5 86  ? 17.397  -37.549 74.781 1.00 110.82 ? 12   DA  I "O4'" 1 
ATOM   7903  C  "C3'" . DA  I  5 86  ? 19.438  -38.793 74.637 1.00 110.57 ? 12   DA  I "C3'" 1 
ATOM   7904  O  "O3'" . DA  I  5 86  ? 19.309  -39.965 73.807 1.00 111.10 ? 12   DA  I "O3'" 1 
ATOM   7905  C  "C2'" . DA  I  5 86  ? 19.561  -37.482 73.853 1.00 110.78 ? 12   DA  I "C2'" 1 
ATOM   7906  C  "C1'" . DA  I  5 86  ? 18.096  -37.104 73.633 1.00 111.34 ? 12   DA  I "C1'" 1 
ATOM   7907  N  N9    . DA  I  5 86  ? 17.822  -35.674 73.432 1.00 111.72 ? 12   DA  I N9    1 
ATOM   7908  C  C8    . DA  I  5 86  ? 18.515  -34.598 73.927 1.00 111.79 ? 12   DA  I C8    1 
ATOM   7909  N  N7    . DA  I  5 86  ? 18.028  -33.428 73.572 1.00 111.81 ? 12   DA  I N7    1 
ATOM   7910  C  C5    . DA  I  5 86  ? 16.932  -33.754 72.788 1.00 111.79 ? 12   DA  I C5    1 
ATOM   7911  C  C6    . DA  I  5 86  ? 15.981  -32.967 72.104 1.00 111.46 ? 12   DA  I C6    1 
ATOM   7912  N  N6    . DA  I  5 86  ? 15.989  -31.634 72.107 1.00 111.54 ? 12   DA  I N6    1 
ATOM   7913  N  N1    . DA  I  5 86  ? 15.012  -33.604 71.412 1.00 111.68 ? 12   DA  I N1    1 
ATOM   7914  C  C2    . DA  I  5 86  ? 14.995  -34.947 71.401 1.00 111.72 ? 12   DA  I C2    1 
ATOM   7915  N  N3    . DA  I  5 86  ? 15.829  -35.798 72.005 1.00 111.61 ? 12   DA  I N3    1 
ATOM   7916  C  C4    . DA  I  5 86  ? 16.787  -35.134 72.689 1.00 112.01 ? 12   DA  I C4    1 
ATOM   7917  P  P     . DT  I  5 87  ? 20.419  -40.504 72.770 1.00 111.39 ? 13   DT  I P     1 
ATOM   7918  O  OP1   . DT  I  5 87  ? 20.350  -41.980 72.820 1.00 111.51 ? 13   DT  I OP1   1 
ATOM   7919  O  OP2   . DT  I  5 87  ? 21.701  -39.787 72.971 1.00 111.34 ? 13   DT  I OP2   1 
ATOM   7920  O  "O5'" . DT  I  5 87  ? 19.879  -40.044 71.338 1.00 112.24 ? 13   DT  I "O5'" 1 
ATOM   7921  C  "C5'" . DT  I  5 87  ? 18.494  -40.102 71.006 1.00 113.19 ? 13   DT  I "C5'" 1 
ATOM   7922  C  "C4'" . DT  I  5 87  ? 18.226  -39.181 69.835 1.00 113.97 ? 13   DT  I "C4'" 1 
ATOM   7923  O  "O4'" . DT  I  5 87  ? 18.233  -37.812 70.296 1.00 113.41 ? 13   DT  I "O4'" 1 
ATOM   7924  C  "C3'" . DT  I  5 87  ? 19.282  -39.237 68.732 1.00 115.14 ? 13   DT  I "C3'" 1 
ATOM   7925  O  "O3'" . DT  I  5 87  ? 18.774  -39.875 67.555 1.00 117.63 ? 13   DT  I "O3'" 1 
ATOM   7926  C  "C2'" . DT  I  5 87  ? 19.655  -37.780 68.469 1.00 114.27 ? 13   DT  I "C2'" 1 
ATOM   7927  C  "C1'" . DT  I  5 87  ? 18.512  -37.044 69.152 1.00 113.90 ? 13   DT  I "C1'" 1 
ATOM   7928  N  N1    . DT  I  5 87  ? 18.816  -35.610 69.483 1.00 114.06 ? 13   DT  I N1    1 
ATOM   7929  C  C2    . DT  I  5 87  ? 18.072  -34.625 68.852 1.00 113.87 ? 13   DT  I C2    1 
ATOM   7930  O  O2    . DT  I  5 87  ? 17.176  -34.861 68.055 1.00 113.63 ? 13   DT  I O2    1 
ATOM   7931  N  N3    . DT  I  5 87  ? 18.419  -33.338 69.197 1.00 113.89 ? 13   DT  I N3    1 
ATOM   7932  C  C4    . DT  I  5 87  ? 19.408  -32.940 70.083 1.00 114.00 ? 13   DT  I C4    1 
ATOM   7933  O  O4    . DT  I  5 87  ? 19.631  -31.753 70.312 1.00 113.90 ? 13   DT  I O4    1 
ATOM   7934  C  C5    . DT  I  5 87  ? 20.151  -34.017 70.707 1.00 114.05 ? 13   DT  I C5    1 
ATOM   7935  C  C7    . DT  I  5 87  ? 21.254  -33.718 71.684 1.00 113.84 ? 13   DT  I C7    1 
ATOM   7936  C  C6    . DT  I  5 87  ? 19.825  -35.283 70.380 1.00 114.07 ? 13   DT  I C6    1 
ATOM   7937  P  P     . DG  I  5 88  ? 19.757  -40.761 66.654 1.00 119.29 ? 14   DG  I P     1 
ATOM   7938  O  OP1   . DG  I  5 88  ? 19.464  -42.174 66.968 1.00 119.51 ? 14   DG  I OP1   1 
ATOM   7939  O  OP2   . DG  I  5 88  ? 21.137  -40.248 66.811 1.00 119.93 ? 14   DG  I OP2   1 
ATOM   7940  O  "O5'" . DG  I  5 88  ? 19.337  -40.409 65.154 1.00 121.37 ? 14   DG  I "O5'" 1 
ATOM   7941  C  "C5'" . DG  I  5 88  ? 18.199  -41.003 64.551 1.00 124.39 ? 14   DG  I "C5'" 1 
ATOM   7942  C  "C4'" . DG  I  5 88  ? 16.964  -40.111 64.603 1.00 126.38 ? 14   DG  I "C4'" 1 
ATOM   7943  O  "O4'" . DG  I  5 88  ? 17.291  -38.769 65.051 1.00 127.31 ? 14   DG  I "O4'" 1 
ATOM   7944  C  "C3'" . DG  I  5 88  ? 16.298  -39.935 63.241 1.00 127.12 ? 14   DG  I "C3'" 1 
ATOM   7945  O  "O3'" . DG  I  5 88  ? 14.873  -40.180 63.302 1.00 127.98 ? 14   DG  I "O3'" 1 
ATOM   7946  C  "C2'" . DG  I  5 88  ? 16.677  -38.515 62.816 1.00 127.55 ? 14   DG  I "C2'" 1 
ATOM   7947  C  "C1'" . DG  I  5 88  ? 16.697  -37.832 64.174 1.00 127.69 ? 14   DG  I "C1'" 1 
ATOM   7948  N  N9    . DG  I  5 88  ? 17.410  -36.556 64.260 1.00 127.83 ? 14   DG  I N9    1 
ATOM   7949  C  C8    . DG  I  5 88  ? 16.816  -35.321 64.152 1.00 127.81 ? 14   DG  I C8    1 
ATOM   7950  N  N7    . DG  I  5 88  ? 17.648  -34.328 64.286 1.00 127.83 ? 14   DG  I N7    1 
ATOM   7951  C  C5    . DG  I  5 88  ? 18.876  -34.942 64.504 1.00 127.87 ? 14   DG  I C5    1 
ATOM   7952  C  C6    . DG  I  5 88  ? 20.147  -34.357 64.720 1.00 127.77 ? 14   DG  I C6    1 
ATOM   7953  O  O6    . DG  I  5 88  ? 20.420  -33.151 64.758 1.00 128.00 ? 14   DG  I O6    1 
ATOM   7954  N  N1    . DG  I  5 88  ? 21.152  -35.308 64.901 1.00 127.67 ? 14   DG  I N1    1 
ATOM   7955  C  C2    . DG  I  5 88  ? 20.946  -36.669 64.878 1.00 127.87 ? 14   DG  I C2    1 
ATOM   7956  N  N2    . DG  I  5 88  ? 22.032  -37.436 65.073 1.00 127.78 ? 14   DG  I N2    1 
ATOM   7957  N  N3    . DG  I  5 88  ? 19.752  -37.233 64.677 1.00 128.13 ? 14   DG  I N3    1 
ATOM   7958  C  C4    . DG  I  5 88  ? 18.756  -36.316 64.496 1.00 127.98 ? 14   DG  I C4    1 
ATOM   7959  P  P     . DC  I  5 89  ? 14.252  -41.663 63.454 1.00 129.04 ? 15   DC  I P     1 
ATOM   7960  O  OP1   . DC  I  5 89  ? 13.057  -41.755 62.581 1.00 128.58 ? 15   DC  I OP1   1 
ATOM   7961  O  OP2   . DC  I  5 89  ? 14.094  -41.906 64.910 1.00 128.69 ? 15   DC  I OP2   1 
ATOM   7962  O  "O5'" . DC  I  5 89  ? 15.403  -42.668 62.933 1.00 128.88 ? 15   DC  I "O5'" 1 
ATOM   7963  C  "C5'" . DC  I  5 89  ? 15.568  -43.124 61.573 1.00 128.32 ? 15   DC  I "C5'" 1 
ATOM   7964  C  "C4'" . DC  I  5 89  ? 15.782  -41.987 60.573 1.00 128.06 ? 15   DC  I "C4'" 1 
ATOM   7965  O  "O4'" . DC  I  5 89  ? 17.007  -41.241 60.803 1.00 128.53 ? 15   DC  I "O4'" 1 
ATOM   7966  C  "C3'" . DC  I  5 89  ? 15.773  -42.366 59.095 1.00 127.38 ? 15   DC  I "C3'" 1 
ATOM   7967  O  "O3'" . DC  I  5 89  ? 14.772  -41.582 58.399 1.00 125.16 ? 15   DC  I "O3'" 1 
ATOM   7968  C  "C2'" . DC  I  5 89  ? 17.213  -42.129 58.609 1.00 127.94 ? 15   DC  I "C2'" 1 
ATOM   7969  C  "C1'" . DC  I  5 89  ? 17.960  -41.499 59.796 1.00 128.82 ? 15   DC  I "C1'" 1 
ATOM   7970  N  N1    . DC  I  5 89  ? 19.091  -42.271 60.473 1.00 129.21 ? 15   DC  I N1    1 
ATOM   7971  C  C2    . DC  I  5 89  ? 20.019  -41.576 61.283 1.00 129.20 ? 15   DC  I C2    1 
ATOM   7972  O  O2    . DC  I  5 89  ? 19.924  -40.347 61.431 1.00 129.04 ? 15   DC  I O2    1 
ATOM   7973  N  N3    . DC  I  5 89  ? 21.020  -42.274 61.891 1.00 129.27 ? 15   DC  I N3    1 
ATOM   7974  C  C4    . DC  I  5 89  ? 21.121  -43.599 61.729 1.00 129.24 ? 15   DC  I C4    1 
ATOM   7975  N  N4    . DC  I  5 89  ? 22.123  -44.233 62.350 1.00 129.05 ? 15   DC  I N4    1 
ATOM   7976  C  C5    . DC  I  5 89  ? 20.192  -44.328 60.922 1.00 129.30 ? 15   DC  I C5    1 
ATOM   7977  C  C6    . DC  I  5 89  ? 19.207  -43.634 60.326 1.00 129.49 ? 15   DC  I C6    1 
ATOM   7978  P  P     . DC  I  5 90  ? 13.300  -41.300 59.019 1.00 124.18 ? 16   DC  I P     1 
ATOM   7979  O  OP1   . DC  I  5 90  ? 12.824  -42.511 59.728 1.00 124.63 ? 16   DC  I OP1   1 
ATOM   7980  O  OP2   . DC  I  5 90  ? 12.439  -40.781 57.926 1.00 124.20 ? 16   DC  I OP2   1 
ATOM   7981  O  "O5'" . DC  I  5 90  ? 13.606  -40.162 60.129 1.00 121.00 ? 16   DC  I "O5'" 1 
ATOM   7982  C  "C5'" . DC  I  5 90  ? 12.676  -39.139 60.543 1.00 115.40 ? 16   DC  I "C5'" 1 
ATOM   7983  C  "C4'" . DC  I  5 90  ? 13.131  -37.744 60.120 1.00 111.03 ? 16   DC  I "C4'" 1 
ATOM   7984  O  "O4'" . DC  I  5 90  ? 14.485  -37.462 60.554 1.00 109.78 ? 16   DC  I "O4'" 1 
ATOM   7985  C  "C3'" . DC  I  5 90  ? 13.132  -37.528 58.610 1.00 108.61 ? 16   DC  I "C3'" 1 
ATOM   7986  O  "O3'" . DC  I  5 90  ? 12.278  -36.455 58.285 1.00 104.80 ? 16   DC  I "O3'" 1 
ATOM   7987  C  "C2'" . DC  I  5 90  ? 14.590  -37.249 58.247 1.00 108.61 ? 16   DC  I "C2'" 1 
ATOM   7988  C  "C1'" . DC  I  5 90  ? 15.135  -36.703 59.556 1.00 109.53 ? 16   DC  I "C1'" 1 
ATOM   7989  N  N1    . DC  I  5 90  ? 16.637  -36.788 59.739 1.00 110.08 ? 16   DC  I N1    1 
ATOM   7990  C  C2    . DC  I  5 90  ? 17.311  -35.782 60.468 1.00 110.36 ? 16   DC  I C2    1 
ATOM   7991  O  O2    . DC  I  5 90  ? 16.678  -34.829 60.949 1.00 110.32 ? 16   DC  I O2    1 
ATOM   7992  N  N3    . DC  I  5 90  ? 18.662  -35.874 60.630 1.00 110.32 ? 16   DC  I N3    1 
ATOM   7993  C  C4    . DC  I  5 90  ? 19.340  -36.901 60.108 1.00 109.84 ? 16   DC  I C4    1 
ATOM   7994  N  N4    . DC  I  5 90  ? 20.662  -36.933 60.302 1.00 109.84 ? 16   DC  I N4    1 
ATOM   7995  C  C5    . DC  I  5 90  ? 18.682  -37.931 59.367 1.00 109.90 ? 16   DC  I C5    1 
ATOM   7996  C  C6    . DC  I  5 90  ? 17.350  -37.838 59.213 1.00 109.89 ? 16   DC  I C6    1 
ATOM   7997  P  P     . DT  I  5 91  ? 11.538  -36.395 56.868 1.00 102.69 ? 17   DT  I P     1 
ATOM   7998  O  OP1   . DT  I  5 91  ? 10.140  -36.825 57.096 1.00 102.51 ? 17   DT  I OP1   1 
ATOM   7999  O  OP2   . DT  I  5 91  ? 12.375  -37.003 55.805 1.00 101.68 ? 17   DT  I OP2   1 
ATOM   8000  O  "O5'" . DT  I  5 91  ? 11.524  -34.828 56.562 1.00 102.83 ? 17   DT  I "O5'" 1 
ATOM   8001  C  "C5'" . DT  I  5 91  ? 11.334  -33.864 57.600 1.00 100.89 ? 17   DT  I "C5'" 1 
ATOM   8002  C  "C4'" . DT  I  5 91  ? 12.314  -32.728 57.411 1.00 99.76  ? 17   DT  I "C4'" 1 
ATOM   8003  O  "O4'" . DT  I  5 91  ? 13.640  -33.187 57.759 1.00 99.95  ? 17   DT  I "O4'" 1 
ATOM   8004  C  "C3'" . DT  I  5 91  ? 12.409  -32.189 55.982 1.00 99.54  ? 17   DT  I "C3'" 1 
ATOM   8005  O  "O3'" . DT  I  5 91  ? 12.197  -30.764 55.992 1.00 97.99  ? 17   DT  I "O3'" 1 
ATOM   8006  C  "C2'" . DT  I  5 91  ? 13.809  -32.608 55.524 1.00 99.89  ? 17   DT  I "C2'" 1 
ATOM   8007  C  "C1'" . DT  I  5 91  ? 14.556  -32.616 56.850 1.00 101.56 ? 17   DT  I "C1'" 1 
ATOM   8008  N  N1    . DT  I  5 91  ? 15.856  -33.378 56.930 1.00 102.38 ? 17   DT  I N1    1 
ATOM   8009  C  C2    . DT  I  5 91  ? 16.944  -32.780 57.551 1.00 102.84 ? 17   DT  I C2    1 
ATOM   8010  O  O2    . DT  I  5 91  ? 16.922  -31.658 58.029 1.00 102.73 ? 17   DT  I O2    1 
ATOM   8011  N  N3    . DT  I  5 91  ? 18.085  -33.551 57.592 1.00 103.05 ? 17   DT  I N3    1 
ATOM   8012  C  C4    . DT  I  5 91  ? 18.257  -34.835 57.093 1.00 102.70 ? 17   DT  I C4    1 
ATOM   8013  O  O4    . DT  I  5 91  ? 19.336  -35.423 57.189 1.00 102.36 ? 17   DT  I O4    1 
ATOM   8014  C  C5    . DT  I  5 91  ? 17.082  -35.407 56.460 1.00 103.11 ? 17   DT  I C5    1 
ATOM   8015  C  C7    . DT  I  5 91  ? 17.119  -36.788 55.862 1.00 102.89 ? 17   DT  I C7    1 
ATOM   8016  C  C6    . DT  I  5 91  ? 15.959  -34.662 56.412 1.00 102.93 ? 17   DT  I C6    1 
ATOM   8017  P  P     . DT  I  5 92  ? 11.985  -29.887 54.673 1.00 96.66  ? 18   DT  I P     1 
ATOM   8018  O  OP1   . DT  I  5 92  ? 10.879  -28.950 54.943 1.00 97.34  ? 18   DT  I OP1   1 
ATOM   8019  O  OP2   . DT  I  5 92  ? 11.949  -30.741 53.465 1.00 96.00  ? 18   DT  I OP2   1 
ATOM   8020  O  "O5'" . DT  I  5 92  ? 13.348  -29.067 54.615 1.00 98.57  ? 18   DT  I "O5'" 1 
ATOM   8021  C  "C5'" . DT  I  5 92  ? 13.824  -28.268 55.693 1.00 100.89 ? 18   DT  I "C5'" 1 
ATOM   8022  C  "C4'" . DT  I  5 92  ? 15.236  -27.808 55.370 1.00 103.23 ? 18   DT  I "C4'" 1 
ATOM   8023  O  "O4'" . DT  I  5 92  ? 16.133  -28.935 55.551 1.00 103.38 ? 18   DT  I "O4'" 1 
ATOM   8024  C  "C3'" . DT  I  5 92  ? 15.457  -27.316 53.938 1.00 105.39 ? 18   DT  I "C3'" 1 
ATOM   8025  O  "O3'" . DT  I  5 92  ? 16.334  -26.181 53.908 1.00 109.20 ? 18   DT  I "O3'" 1 
ATOM   8026  C  "C2'" . DT  I  5 92  ? 16.086  -28.525 53.247 1.00 104.62 ? 18   DT  I "C2'" 1 
ATOM   8027  C  "C1'" . DT  I  5 92  ? 16.921  -29.099 54.387 1.00 104.30 ? 18   DT  I "C1'" 1 
ATOM   8028  N  N1    . DT  I  5 92  ? 17.348  -30.544 54.224 1.00 104.68 ? 18   DT  I N1    1 
ATOM   8029  C  C2    . DT  I  5 92  ? 18.618  -30.922 54.634 1.00 104.42 ? 18   DT  I C2    1 
ATOM   8030  O  O2    . DT  I  5 92  ? 19.426  -30.152 55.129 1.00 104.09 ? 18   DT  I O2    1 
ATOM   8031  N  N3    . DT  I  5 92  ? 18.913  -32.256 54.440 1.00 104.26 ? 18   DT  I N3    1 
ATOM   8032  C  C4    . DT  I  5 92  ? 18.095  -33.235 53.893 1.00 104.21 ? 18   DT  I C4    1 
ATOM   8033  O  O4    . DT  I  5 92  ? 18.465  -34.400 53.767 1.00 104.12 ? 18   DT  I O4    1 
ATOM   8034  C  C5    . DT  I  5 92  ? 16.782  -32.779 53.485 1.00 104.74 ? 18   DT  I C5    1 
ATOM   8035  C  C7    . DT  I  5 92  ? 15.798  -33.737 52.870 1.00 104.39 ? 18   DT  I C7    1 
ATOM   8036  C  C6    . DT  I  5 92  ? 16.481  -31.477 53.666 1.00 104.90 ? 18   DT  I C6    1 
ATOM   8037  P  P     . DT  I  5 93  ? 16.447  -25.227 52.618 1.00 112.01 ? 19   DT  I P     1 
ATOM   8038  O  OP1   . DT  I  5 93  ? 15.400  -24.208 52.825 1.00 111.85 ? 19   DT  I OP1   1 
ATOM   8039  O  OP2   . DT  I  5 93  ? 16.465  -26.018 51.365 1.00 111.50 ? 19   DT  I OP2   1 
ATOM   8040  O  "O5'" . DT  I  5 93  ? 17.897  -24.539 52.729 1.00 114.60 ? 19   DT  I "O5'" 1 
ATOM   8041  C  "C5'" . DT  I  5 93  ? 19.013  -25.173 53.371 1.00 118.50 ? 19   DT  I "C5'" 1 
ATOM   8042  C  "C4'" . DT  I  5 93  ? 20.078  -25.685 52.402 1.00 121.51 ? 19   DT  I "C4'" 1 
ATOM   8043  O  "O4'" . DT  I  5 93  ? 20.082  -27.138 52.404 1.00 121.94 ? 19   DT  I "O4'" 1 
ATOM   8044  C  "C3'" . DT  I  5 93  ? 19.982  -25.268 50.927 1.00 123.74 ? 19   DT  I "C3'" 1 
ATOM   8045  O  "O3'" . DT  I  5 93  ? 21.295  -24.955 50.451 1.00 127.37 ? 19   DT  I "O3'" 1 
ATOM   8046  C  "C2'" . DT  I  5 93  ? 19.443  -26.522 50.243 1.00 122.98 ? 19   DT  I "C2'" 1 
ATOM   8047  C  "C1'" . DT  I  5 93  ? 20.164  -27.588 51.064 1.00 122.21 ? 19   DT  I "C1'" 1 
ATOM   8048  N  N1    . DT  I  5 93  ? 19.631  -28.993 50.963 1.00 122.12 ? 19   DT  I N1    1 
ATOM   8049  C  C2    . DT  I  5 93  ? 20.486  -30.050 51.231 1.00 121.98 ? 19   DT  I C2    1 
ATOM   8050  O  O2    . DT  I  5 93  ? 21.658  -29.910 51.546 1.00 121.83 ? 19   DT  I O2    1 
ATOM   8051  N  N3    . DT  I  5 93  ? 19.915  -31.296 51.115 1.00 121.82 ? 19   DT  I N3    1 
ATOM   8052  C  C4    . DT  I  5 93  ? 18.606  -31.591 50.771 1.00 121.85 ? 19   DT  I C4    1 
ATOM   8053  O  O4    . DT  I  5 93  ? 18.209  -32.751 50.697 1.00 121.77 ? 19   DT  I O4    1 
ATOM   8054  C  C5    . DT  I  5 93  ? 17.763  -30.443 50.505 1.00 121.97 ? 19   DT  I C5    1 
ATOM   8055  C  C7    . DT  I  5 93  ? 16.322  -30.615 50.117 1.00 122.19 ? 19   DT  I C7    1 
ATOM   8056  C  C6    . DT  I  5 93  ? 18.308  -29.220 50.612 1.00 122.04 ? 19   DT  I C6    1 
ATOM   8057  P  P     . DT  I  5 94  ? 21.582  -24.050 49.154 1.00 129.91 ? 20   DT  I P     1 
ATOM   8058  O  OP1   . DT  I  5 94  ? 21.087  -22.686 49.456 1.00 129.66 ? 20   DT  I OP1   1 
ATOM   8059  O  OP2   . DT  I  5 94  ? 21.089  -24.753 47.945 1.00 129.55 ? 20   DT  I OP2   1 
ATOM   8060  O  "O5'" . DT  I  5 94  ? 23.189  -24.037 49.092 1.00 131.71 ? 20   DT  I "O5'" 1 
ATOM   8061  C  "C5'" . DT  I  5 94  ? 23.976  -25.052 49.748 1.00 134.65 ? 20   DT  I "C5'" 1 
ATOM   8062  C  "C4'" . DT  I  5 94  ? 24.420  -26.179 48.818 1.00 136.87 ? 20   DT  I "C4'" 1 
ATOM   8063  O  "O4'" . DT  I  5 94  ? 23.584  -27.356 48.996 1.00 137.17 ? 20   DT  I "O4'" 1 
ATOM   8064  C  "C3'" . DT  I  5 94  ? 24.405  -25.866 47.318 1.00 138.31 ? 20   DT  I "C3'" 1 
ATOM   8065  O  "O3'" . DT  I  5 94  ? 25.694  -26.119 46.775 1.00 140.32 ? 20   DT  I "O3'" 1 
ATOM   8066  C  "C2'" . DT  I  5 94  ? 23.367  -26.821 46.732 1.00 137.92 ? 20   DT  I "C2'" 1 
ATOM   8067  C  "C1'" . DT  I  5 94  ? 23.425  -27.971 47.731 1.00 137.69 ? 20   DT  I "C1'" 1 
ATOM   8068  N  N1    . DT  I  5 94  ? 22.221  -28.885 47.719 1.00 137.80 ? 20   DT  I N1    1 
ATOM   8069  C  C2    . DT  I  5 94  ? 22.400  -30.228 48.010 1.00 137.79 ? 20   DT  I C2    1 
ATOM   8070  O  O2    . DT  I  5 94  ? 23.484  -30.717 48.284 1.00 137.72 ? 20   DT  I O2    1 
ATOM   8071  N  N3    . DT  I  5 94  ? 21.250  -30.985 47.974 1.00 137.71 ? 20   DT  I N3    1 
ATOM   8072  C  C4    . DT  I  5 94  ? 19.966  -30.549 47.680 1.00 137.72 ? 20   DT  I C4    1 
ATOM   8073  O  O4    . DT  I  5 94  ? 19.008  -31.319 47.675 1.00 137.60 ? 20   DT  I O4    1 
ATOM   8074  C  C5    . DT  I  5 94  ? 19.847  -29.135 47.382 1.00 137.77 ? 20   DT  I C5    1 
ATOM   8075  C  C7    . DT  I  5 94  ? 18.516  -28.526 47.044 1.00 137.82 ? 20   DT  I C7    1 
ATOM   8076  C  C6    . DT  I  5 94  ? 20.962  -28.386 47.416 1.00 137.79 ? 20   DT  I C6    1 
ATOM   8077  P  P     . DG  I  5 95  ? 26.182  -25.449 45.403 1.00 141.51 ? 21   DG  I P     1 
ATOM   8078  O  OP1   . DG  I  5 95  ? 26.803  -24.150 45.751 1.00 141.16 ? 21   DG  I OP1   1 
ATOM   8079  O  OP2   . DG  I  5 95  ? 25.075  -25.503 44.415 1.00 141.53 ? 21   DG  I OP2   1 
ATOM   8080  O  "O5'" . DG  I  5 95  ? 27.325  -26.465 44.911 1.00 141.86 ? 21   DG  I "O5'" 1 
ATOM   8081  C  "C5'" . DG  I  5 95  ? 27.344  -27.833 45.345 1.00 142.39 ? 21   DG  I "C5'" 1 
ATOM   8082  C  "C4'" . DG  I  5 95  ? 26.920  -28.814 44.258 1.00 142.84 ? 21   DG  I "C4'" 1 
ATOM   8083  O  "O4'" . DG  I  5 95  ? 25.674  -29.460 44.632 1.00 142.87 ? 21   DG  I "O4'" 1 
ATOM   8084  C  "C3'" . DG  I  5 95  ? 26.694  -28.254 42.850 1.00 143.24 ? 21   DG  I "C3'" 1 
ATOM   8085  O  "O3'" . DG  I  5 95  ? 27.363  -29.101 41.917 1.00 143.98 ? 21   DG  I "O3'" 1 
ATOM   8086  C  "C2'" . DG  I  5 95  ? 25.178  -28.318 42.675 1.00 142.91 ? 21   DG  I "C2'" 1 
ATOM   8087  C  "C1'" . DG  I  5 95  ? 24.892  -29.592 43.461 1.00 142.44 ? 21   DG  I "C1'" 1 
ATOM   8088  N  N9    . DG  I  5 95  ? 23.487  -29.851 43.791 1.00 142.32 ? 21   DG  I N9    1 
ATOM   8089  C  C8    . DG  I  5 95  ? 22.461  -28.944 43.946 1.00 142.26 ? 21   DG  I C8    1 
ATOM   8090  N  N7    . DG  I  5 95  ? 21.314  -29.498 44.236 1.00 142.21 ? 21   DG  I N7    1 
ATOM   8091  C  C5    . DG  I  5 95  ? 21.594  -30.859 44.276 1.00 142.17 ? 21   DG  I C5    1 
ATOM   8092  C  C6    . DG  I  5 95  ? 20.748  -31.968 44.541 1.00 142.10 ? 21   DG  I C6    1 
ATOM   8093  O  O6    . DG  I  5 95  ? 19.540  -31.962 44.803 1.00 142.13 ? 21   DG  I O6    1 
ATOM   8094  N  N1    . DG  I  5 95  ? 21.432  -33.184 44.480 1.00 142.18 ? 21   DG  I N1    1 
ATOM   8095  C  C2    . DG  I  5 95  ? 22.775  -33.312 44.196 1.00 142.24 ? 21   DG  I C2    1 
ATOM   8096  N  N2    . DG  I  5 95  ? 23.275  -34.557 44.180 1.00 142.19 ? 21   DG  I N2    1 
ATOM   8097  N  N3    . DG  I  5 95  ? 23.578  -32.281 43.948 1.00 142.17 ? 21   DG  I N3    1 
ATOM   8098  C  C4    . DG  I  5 95  ? 22.926  -31.090 44.002 1.00 142.18 ? 21   DG  I C4    1 
ATOM   8099  P  P     . DA  I  5 96  ? 27.765  -28.620 40.439 1.00 144.43 ? 22   DA  I P     1 
ATOM   8100  O  OP1   . DA  I  5 96  ? 28.545  -27.365 40.567 1.00 144.21 ? 22   DA  I OP1   1 
ATOM   8101  O  OP2   . DA  I  5 96  ? 26.546  -28.650 39.596 1.00 144.33 ? 22   DA  I OP2   1 
ATOM   8102  O  "O5'" . DA  I  5 96  ? 28.736  -29.794 39.928 1.00 143.80 ? 22   DA  I "O5'" 1 
ATOM   8103  C  "C5'" . DA  I  5 96  ? 28.877  -31.023 40.661 1.00 142.70 ? 22   DA  I "C5'" 1 
ATOM   8104  C  "C4'" . DA  I  5 96  ? 27.886  -32.088 40.213 1.00 141.40 ? 22   DA  I "C4'" 1 
ATOM   8105  O  "O4'" . DA  I  5 96  ? 26.576  -31.908 40.824 1.00 141.28 ? 22   DA  I "O4'" 1 
ATOM   8106  C  "C3'" . DA  I  5 96  ? 27.641  -32.180 38.706 1.00 140.58 ? 22   DA  I "C3'" 1 
ATOM   8107  O  "O3'" . DA  I  5 96  ? 27.919  -33.523 38.324 1.00 139.37 ? 22   DA  I "O3'" 1 
ATOM   8108  C  "C2'" . DA  I  5 96  ? 26.158  -31.830 38.564 1.00 140.61 ? 22   DA  I "C2'" 1 
ATOM   8109  C  "C1'" . DA  I  5 96  ? 25.631  -32.383 39.885 1.00 140.55 ? 22   DA  I "C1'" 1 
ATOM   8110  N  N9    . DA  I  5 96  ? 24.253  -32.005 40.234 1.00 140.39 ? 22   DA  I N9    1 
ATOM   8111  C  C8    . DA  I  5 96  ? 23.726  -30.744 40.346 1.00 140.23 ? 22   DA  I C8    1 
ATOM   8112  N  N7    . DA  I  5 96  ? 22.453  -30.718 40.670 1.00 140.02 ? 22   DA  I N7    1 
ATOM   8113  C  C5    . DA  I  5 96  ? 22.114  -32.057 40.776 1.00 140.24 ? 22   DA  I C5    1 
ATOM   8114  C  C6    . DA  I  5 96  ? 20.903  -32.715 41.094 1.00 140.21 ? 22   DA  I C6    1 
ATOM   8115  N  N6    . DA  I  5 96  ? 19.770  -32.066 41.373 1.00 140.21 ? 22   DA  I N6    1 
ATOM   8116  N  N1    . DA  I  5 96  ? 20.899  -34.069 41.117 1.00 140.26 ? 22   DA  I N1    1 
ATOM   8117  C  C2    . DA  I  5 96  ? 22.037  -34.727 40.838 1.00 140.22 ? 22   DA  I C2    1 
ATOM   8118  N  N3    . DA  I  5 96  ? 23.234  -34.218 40.525 1.00 140.29 ? 22   DA  I N3    1 
ATOM   8119  C  C4    . DA  I  5 96  ? 23.210  -32.867 40.510 1.00 140.32 ? 22   DA  I C4    1 
ATOM   8120  P  P     . DT  I  5 97  ? 28.128  -33.984 36.804 1.00 138.19 ? 23   DT  I P     1 
ATOM   8121  O  OP1   . DT  I  5 97  ? 29.549  -33.737 36.462 1.00 138.00 ? 23   DT  I OP1   1 
ATOM   8122  O  OP2   . DT  I  5 97  ? 27.057  -33.396 35.961 1.00 138.01 ? 23   DT  I OP2   1 
ATOM   8123  O  "O5'" . DT  I  5 97  ? 27.894  -35.572 36.904 1.00 136.79 ? 23   DT  I "O5'" 1 
ATOM   8124  C  "C5'" . DT  I  5 97  ? 26.915  -36.156 37.784 1.00 134.25 ? 23   DT  I "C5'" 1 
ATOM   8125  C  "C4'" . DT  I  5 97  ? 25.718  -36.718 37.025 1.00 132.50 ? 23   DT  I "C4'" 1 
ATOM   8126  O  "O4'" . DT  I  5 97  ? 24.476  -36.129 37.508 1.00 132.03 ? 23   DT  I "O4'" 1 
ATOM   8127  C  "C3'" . DT  I  5 97  ? 25.734  -36.511 35.508 1.00 131.39 ? 23   DT  I "C3'" 1 
ATOM   8128  O  "O3'" . DT  I  5 97  ? 25.491  -37.761 34.861 1.00 129.54 ? 23   DT  I "O3'" 1 
ATOM   8129  C  "C2'" . DT  I  5 97  ? 24.616  -35.495 35.267 1.00 131.42 ? 23   DT  I "C2'" 1 
ATOM   8130  C  "C1'" . DT  I  5 97  ? 23.649  -35.847 36.393 1.00 131.30 ? 23   DT  I "C1'" 1 
ATOM   8131  N  N1    . DT  I  5 97  ? 22.634  -34.782 36.740 1.00 131.07 ? 23   DT  I N1    1 
ATOM   8132  C  C2    . DT  I  5 97  ? 21.393  -35.167 37.222 1.00 130.88 ? 23   DT  I C2    1 
ATOM   8133  O  O2    . DT  I  5 97  ? 21.057  -36.327 37.394 1.00 130.79 ? 23   DT  I O2    1 
ATOM   8134  N  N3    . DT  I  5 97  ? 20.540  -34.126 37.506 1.00 130.73 ? 23   DT  I N3    1 
ATOM   8135  C  C4    . DT  I  5 97  ? 20.790  -32.772 37.362 1.00 130.85 ? 23   DT  I C4    1 
ATOM   8136  O  O4    . DT  I  5 97  ? 19.944  -31.931 37.653 1.00 130.76 ? 23   DT  I O4    1 
ATOM   8137  C  C5    . DT  I  5 97  ? 22.104  -32.434 36.850 1.00 130.91 ? 23   DT  I C5    1 
ATOM   8138  C  C7    . DT  I  5 97  ? 22.512  -31.002 36.642 1.00 130.97 ? 23   DT  I C7    1 
ATOM   8139  C  C6    . DT  I  5 97  ? 22.947  -33.441 36.569 1.00 130.91 ? 23   DT  I C6    1 
ATOM   8140  P  P     . DG  I  5 98  ? 25.821  -37.997 33.309 1.00 127.58 ? 24   DG  I P     1 
ATOM   8141  O  OP1   . DG  I  5 98  ? 27.294  -38.047 33.189 1.00 127.85 ? 24   DG  I OP1   1 
ATOM   8142  O  OP2   . DG  I  5 98  ? 25.042  -37.027 32.498 1.00 127.08 ? 24   DG  I OP2   1 
ATOM   8143  O  "O5'" . DG  I  5 98  ? 25.245  -39.471 33.032 1.00 125.44 ? 24   DG  I "O5'" 1 
ATOM   8144  C  "C5'" . DG  I  5 98  ? 24.480  -40.191 34.012 1.00 121.54 ? 24   DG  I "C5'" 1 
ATOM   8145  C  "C4'" . DG  I  5 98  ? 22.980  -40.104 33.742 1.00 118.48 ? 24   DG  I "C4'" 1 
ATOM   8146  O  "O4'" . DG  I  5 98  ? 22.402  -38.842 34.179 1.00 117.60 ? 24   DG  I "O4'" 1 
ATOM   8147  C  "C3'" . DG  I  5 98  ? 22.556  -40.274 32.287 1.00 116.49 ? 24   DG  I "C3'" 1 
ATOM   8148  O  "O3'" . DG  I  5 98  ? 21.497  -41.213 32.294 1.00 114.40 ? 24   DG  I "O3'" 1 
ATOM   8149  C  "C2'" . DG  I  5 98  ? 22.088  -38.873 31.889 1.00 116.26 ? 24   DG  I "C2'" 1 
ATOM   8150  C  "C1'" . DG  I  5 98  ? 21.466  -38.421 33.206 1.00 115.88 ? 24   DG  I "C1'" 1 
ATOM   8151  N  N9    . DG  I  5 98  ? 21.222  -36.985 33.368 1.00 115.72 ? 24   DG  I N9    1 
ATOM   8152  C  C8    . DG  I  5 98  ? 22.009  -35.931 32.953 1.00 115.52 ? 24   DG  I C8    1 
ATOM   8153  N  N7    . DG  I  5 98  ? 21.525  -34.755 33.249 1.00 115.25 ? 24   DG  I N7    1 
ATOM   8154  C  C5    . DG  I  5 98  ? 20.335  -35.043 33.912 1.00 115.62 ? 24   DG  I C5    1 
ATOM   8155  C  C6    . DG  I  5 98  ? 19.361  -34.176 34.479 1.00 115.41 ? 24   DG  I C6    1 
ATOM   8156  O  O6    . DG  I  5 98  ? 19.356  -32.938 34.506 1.00 115.39 ? 24   DG  I O6    1 
ATOM   8157  N  N1    . DG  I  5 98  ? 18.302  -34.874 35.056 1.00 115.36 ? 24   DG  I N1    1 
ATOM   8158  C  C2    . DG  I  5 98  ? 18.192  -36.244 35.086 1.00 115.37 ? 24   DG  I C2    1 
ATOM   8159  N  N2    . DG  I  5 98  ? 17.100  -36.741 35.683 1.00 115.42 ? 24   DG  I N2    1 
ATOM   8160  N  N3    . DG  I  5 98  ? 19.092  -37.071 34.561 1.00 115.51 ? 24   DG  I N3    1 
ATOM   8161  C  C4    . DG  I  5 98  ? 20.135  -36.408 33.992 1.00 115.74 ? 24   DG  I C4    1 
ATOM   8162  P  P     . DG  I  5 99  ? 21.119  -42.080 31.008 1.00 112.87 ? 25   DG  I P     1 
ATOM   8163  O  OP1   . DG  I  5 99  ? 21.749  -43.406 31.180 1.00 112.76 ? 25   DG  I OP1   1 
ATOM   8164  O  OP2   . DG  I  5 99  ? 21.405  -41.252 29.805 1.00 112.31 ? 25   DG  I OP2   1 
ATOM   8165  O  "O5'" . DG  I  5 99  ? 19.533  -42.318 31.139 1.00 110.74 ? 25   DG  I "O5'" 1 
ATOM   8166  C  "C5'" . DG  I  5 99  ? 18.741  -41.720 32.180 1.00 107.06 ? 25   DG  I "C5'" 1 
ATOM   8167  C  "C4'" . DG  I  5 99  ? 17.772  -40.669 31.652 1.00 104.15 ? 25   DG  I "C4'" 1 
ATOM   8168  O  "O4'" . DG  I  5 99  ? 18.297  -39.324 31.808 1.00 103.31 ? 25   DG  I "O4'" 1 
ATOM   8169  C  "C3'" . DG  I  5 99  ? 17.394  -40.779 30.175 1.00 102.53 ? 25   DG  I "C3'" 1 
ATOM   8170  O  "O3'" . DG  I  5 99  ? 15.997  -40.759 30.109 1.00 100.66 ? 25   DG  I "O3'" 1 
ATOM   8171  C  "C2'" . DG  I  5 99  ? 17.976  -39.532 29.519 1.00 102.44 ? 25   DG  I "C2'" 1 
ATOM   8172  C  "C1'" . DG  I  5 99  ? 17.821  -38.585 30.698 1.00 102.67 ? 25   DG  I "C1'" 1 
ATOM   8173  N  N9    . DG  I  5 99  ? 18.518  -37.307 30.599 1.00 102.52 ? 25   DG  I N9    1 
ATOM   8174  C  C8    . DG  I  5 99  ? 19.732  -37.015 30.020 1.00 102.52 ? 25   DG  I C8    1 
ATOM   8175  N  N7    . DG  I  5 99  ? 20.063  -35.754 30.117 1.00 102.55 ? 25   DG  I N7    1 
ATOM   8176  C  C5    . DG  I  5 99  ? 18.995  -35.178 30.804 1.00 102.76 ? 25   DG  I C5    1 
ATOM   8177  C  C6    . DG  I  5 99  ? 18.761  -33.835 31.209 1.00 102.78 ? 25   DG  I C6    1 
ATOM   8178  O  O6    . DG  I  5 99  ? 19.489  -32.846 31.040 1.00 102.86 ? 25   DG  I O6    1 
ATOM   8179  N  N1    . DG  I  5 99  ? 17.546  -33.686 31.883 1.00 102.38 ? 25   DG  I N1    1 
ATOM   8180  C  C2    . DG  I  5 99  ? 16.660  -34.709 32.135 1.00 102.54 ? 25   DG  I C2    1 
ATOM   8181  N  N2    . DG  I  5 99  ? 15.538  -34.395 32.797 1.00 102.49 ? 25   DG  I N2    1 
ATOM   8182  N  N3    . DG  I  5 99  ? 16.862  -35.965 31.759 1.00 102.67 ? 25   DG  I N3    1 
ATOM   8183  C  C4    . DG  I  5 99  ? 18.042  -36.125 31.105 1.00 102.57 ? 25   DG  I C4    1 
ATOM   8184  P  P     . DA  I  5 100 ? 15.239  -42.077 29.650 1.00 99.32  ? 26   DA  I P     1 
ATOM   8185  O  OP1   . DA  I  5 100 ? 15.803  -43.203 30.440 1.00 99.37  ? 26   DA  I OP1   1 
ATOM   8186  O  OP2   . DA  I  5 100 ? 15.261  -42.073 28.165 1.00 99.02  ? 26   DA  I OP2   1 
ATOM   8187  O  "O5'" . DA  I  5 100 ? 13.727  -41.840 30.125 1.00 96.88  ? 26   DA  I "O5'" 1 
ATOM   8188  C  "C5'" . DA  I  5 100 ? 13.404  -41.719 31.514 1.00 93.26  ? 26   DA  I "C5'" 1 
ATOM   8189  C  "C4'" . DA  I  5 100 ? 12.335  -40.659 31.744 1.00 90.47  ? 26   DA  I "C4'" 1 
ATOM   8190  O  "O4'" . DA  I  5 100 ? 12.837  -39.315 31.509 1.00 89.85  ? 26   DA  I "O4'" 1 
ATOM   8191  C  "C3'" . DA  I  5 100 ? 11.098  -40.782 30.868 1.00 88.46  ? 26   DA  I "C3'" 1 
ATOM   8192  O  "O3'" . DA  I  5 100 ? 9.994   -40.378 31.669 1.00 85.35  ? 26   DA  I "O3'" 1 
ATOM   8193  C  "C2'" . DA  I  5 100 ? 11.382  -39.832 29.698 1.00 88.64  ? 26   DA  I "C2'" 1 
ATOM   8194  C  "C1'" . DA  I  5 100 ? 12.217  -38.740 30.366 1.00 89.69  ? 26   DA  I "C1'" 1 
ATOM   8195  N  N9    . DA  I  5 100 ? 13.284  -38.155 29.553 1.00 89.81  ? 26   DA  I N9    1 
ATOM   8196  C  C8    . DA  I  5 100 ? 14.075  -38.783 28.623 1.00 90.19  ? 26   DA  I C8    1 
ATOM   8197  N  N7    . DA  I  5 100 ? 14.969  -37.998 28.063 1.00 90.41  ? 26   DA  I N7    1 
ATOM   8198  C  C5    . DA  I  5 100 ? 14.757  -36.769 28.675 1.00 90.16  ? 26   DA  I C5    1 
ATOM   8199  C  C6    . DA  I  5 100 ? 15.375  -35.504 28.528 1.00 90.21  ? 26   DA  I C6    1 
ATOM   8200  N  N6    . DA  I  5 100 ? 16.377  -35.277 27.674 1.00 90.16  ? 26   DA  I N6    1 
ATOM   8201  N  N1    . DA  I  5 100 ? 14.922  -34.474 29.285 1.00 89.96  ? 26   DA  I N1    1 
ATOM   8202  C  C2    . DA  I  5 100 ? 13.907  -34.702 30.134 1.00 90.05  ? 26   DA  I C2    1 
ATOM   8203  N  N3    . DA  I  5 100 ? 13.251  -35.843 30.360 1.00 89.85  ? 26   DA  I N3    1 
ATOM   8204  C  C4    . DA  I  5 100 ? 13.723  -36.848 29.595 1.00 89.86  ? 26   DA  I C4    1 
ATOM   8205  P  P     . DG  I  5 101 ? 8.481   -40.600 31.201 1.00 83.34  ? 27   DG  I P     1 
ATOM   8206  O  OP1   . DG  I  5 101 ? 7.805   -41.226 32.361 1.00 82.65  ? 27   DG  I OP1   1 
ATOM   8207  O  OP2   . DG  I  5 101 ? 8.497   -41.252 29.865 1.00 83.69  ? 27   DG  I OP2   1 
ATOM   8208  O  "O5'" . DG  I  5 101 ? 7.871   -39.138 30.962 1.00 81.17  ? 27   DG  I "O5'" 1 
ATOM   8209  C  "C5'" . DG  I  5 101 ? 8.485   -37.948 31.452 1.00 77.93  ? 27   DG  I "C5'" 1 
ATOM   8210  C  "C4'" . DG  I  5 101 ? 8.263   -36.774 30.521 1.00 75.54  ? 27   DG  I "C4'" 1 
ATOM   8211  O  "O4'" . DG  I  5 101 ? 9.462   -36.574 29.744 1.00 75.08  ? 27   DG  I "O4'" 1 
ATOM   8212  C  "C3'" . DG  I  5 101 ? 7.128   -36.890 29.504 1.00 74.34  ? 27   DG  I "C3'" 1 
ATOM   8213  O  "O3'" . DG  I  5 101 ? 6.508   -35.607 29.390 1.00 71.83  ? 27   DG  I "O3'" 1 
ATOM   8214  C  "C2'" . DG  I  5 101 ? 7.861   -37.220 28.213 1.00 74.20  ? 27   DG  I "C2'" 1 
ATOM   8215  C  "C1'" . DG  I  5 101 ? 9.064   -36.317 28.418 1.00 77.47  ? 27   DG  I "C1'" 1 
ATOM   8216  N  N9    . DG  I  5 101 ? 10.210  -36.530 27.541 1.00 78.51  ? 27   DG  I N9    1 
ATOM   8217  C  C8    . DG  I  5 101 ? 10.516  -37.663 26.830 1.00 78.96  ? 27   DG  I C8    1 
ATOM   8218  N  N7    . DG  I  5 101 ? 11.608  -37.552 26.133 1.00 79.35  ? 27   DG  I N7    1 
ATOM   8219  C  C5    . DG  I  5 101 ? 12.061  -36.271 26.400 1.00 79.08  ? 27   DG  I C5    1 
ATOM   8220  C  C6    . DG  I  5 101 ? 13.212  -35.596 25.926 1.00 79.29  ? 27   DG  I C6    1 
ATOM   8221  O  O6    . DG  I  5 101 ? 14.085  -36.022 25.148 1.00 79.23  ? 27   DG  I O6    1 
ATOM   8222  N  N1    . DG  I  5 101 ? 13.304  -34.299 26.436 1.00 79.28  ? 27   DG  I N1    1 
ATOM   8223  C  C2    . DG  I  5 101 ? 12.402  -33.726 27.301 1.00 79.07  ? 27   DG  I C2    1 
ATOM   8224  N  N2    . DG  I  5 101 ? 12.665  -32.470 27.688 1.00 78.76  ? 27   DG  I N2    1 
ATOM   8225  N  N3    . DG  I  5 101 ? 11.325  -34.359 27.757 1.00 79.79  ? 27   DG  I N3    1 
ATOM   8226  C  C4    . DG  I  5 101 ? 11.214  -35.625 27.267 1.00 79.02  ? 27   DG  I C4    1 
ATOM   8227  P  P     . DC  I  5 102 ? 4.958   -35.296 29.607 1.00 67.44  ? 28   DC  I P     1 
ATOM   8228  O  OP1   . DC  I  5 102 ? 4.605   -35.678 30.981 1.00 67.02  ? 28   DC  I OP1   1 
ATOM   8229  O  OP2   . DC  I  5 102 ? 4.187   -35.782 28.441 1.00 64.41  ? 28   DC  I OP2   1 
ATOM   8230  O  "O5'" . DC  I  5 102 ? 4.984   -33.702 29.528 1.00 71.52  ? 28   DC  I "O5'" 1 
ATOM   8231  C  "C5'" . DC  I  5 102 ? 5.997   -32.946 30.202 1.00 75.55  ? 28   DC  I "C5'" 1 
ATOM   8232  C  "C4'" . DC  I  5 102 ? 6.592   -31.880 29.299 1.00 78.51  ? 28   DC  I "C4'" 1 
ATOM   8233  O  "O4'" . DC  I  5 102 ? 7.588   -32.443 28.407 1.00 78.48  ? 28   DC  I "O4'" 1 
ATOM   8234  C  "C3'" . DC  I  5 102 ? 5.595   -31.144 28.409 1.00 80.88  ? 28   DC  I "C3'" 1 
ATOM   8235  O  "O3'" . DC  I  5 102 ? 5.914   -29.749 28.496 1.00 84.13  ? 28   DC  I "O3'" 1 
ATOM   8236  C  "C2'" . DC  I  5 102 ? 5.832   -31.747 27.019 1.00 80.08  ? 28   DC  I "C2'" 1 
ATOM   8237  C  "C1'" . DC  I  5 102 ? 7.333   -32.010 27.078 1.00 80.08  ? 28   DC  I "C1'" 1 
ATOM   8238  N  N1    . DC  I  5 102 ? 7.905   -33.062 26.168 1.00 80.49  ? 28   DC  I N1    1 
ATOM   8239  C  C2    . DC  I  5 102 ? 9.139   -32.824 25.526 1.00 81.13  ? 28   DC  I C2    1 
ATOM   8240  O  O2    . DC  I  5 102 ? 9.732   -31.743 25.686 1.00 81.01  ? 28   DC  I O2    1 
ATOM   8241  N  N3    . DC  I  5 102 ? 9.658   -33.797 24.726 1.00 81.18  ? 28   DC  I N3    1 
ATOM   8242  C  C4    . DC  I  5 102 ? 9.012   -34.956 24.563 1.00 80.81  ? 28   DC  I C4    1 
ATOM   8243  N  N4    . DC  I  5 102 ? 9.573   -35.870 23.763 1.00 81.06  ? 28   DC  I N4    1 
ATOM   8244  C  C5    . DC  I  5 102 ? 7.765   -35.220 25.210 1.00 80.49  ? 28   DC  I C5    1 
ATOM   8245  C  C6    . DC  I  5 102 ? 7.262   -34.260 25.999 1.00 80.35  ? 28   DC  I C6    1 
ATOM   8246  P  P     . DA  I  5 103 ? 4.879   -28.568 28.162 1.00 86.76  ? 29   DA  I P     1 
ATOM   8247  O  OP1   . DA  I  5 103 ? 5.041   -27.581 29.259 1.00 86.67  ? 29   DA  I OP1   1 
ATOM   8248  O  OP2   . DA  I  5 103 ? 3.555   -29.133 27.819 1.00 85.93  ? 29   DA  I OP2   1 
ATOM   8249  O  "O5'" . DA  I  5 103 ? 5.448   -27.945 26.800 1.00 88.53  ? 29   DA  I "O5'" 1 
ATOM   8250  C  "C5'" . DA  I  5 103 ? 6.799   -27.482 26.707 1.00 91.08  ? 29   DA  I "C5'" 1 
ATOM   8251  C  "C4'" . DA  I  5 103 ? 7.290   -27.603 25.277 1.00 92.61  ? 29   DA  I "C4'" 1 
ATOM   8252  O  "O4'" . DA  I  5 103 ? 7.460   -29.005 24.943 1.00 92.56  ? 29   DA  I "O4'" 1 
ATOM   8253  C  "C3'" . DA  I  5 103 ? 6.349   -27.035 24.208 1.00 93.66  ? 29   DA  I "C3'" 1 
ATOM   8254  O  "O3'" . DA  I  5 103 ? 7.089   -26.210 23.299 1.00 95.92  ? 29   DA  I "O3'" 1 
ATOM   8255  C  "C2'" . DA  I  5 103 ? 5.807   -28.281 23.508 1.00 92.81  ? 29   DA  I "C2'" 1 
ATOM   8256  C  "C1'" . DA  I  5 103 ? 7.063   -29.131 23.592 1.00 91.64  ? 29   DA  I "C1'" 1 
ATOM   8257  N  N9    . DA  I  5 103 ? 6.917   -30.537 23.251 1.00 91.21  ? 29   DA  I N9    1 
ATOM   8258  C  C8    . DA  I  5 103 ? 5.912   -31.397 23.594 1.00 91.24  ? 29   DA  I C8    1 
ATOM   8259  N  N7    . DA  I  5 103 ? 6.080   -32.612 23.129 1.00 91.25  ? 29   DA  I N7    1 
ATOM   8260  C  C5    . DA  I  5 103 ? 7.280   -32.537 22.435 1.00 91.08  ? 29   DA  I C5    1 
ATOM   8261  C  C6    . DA  I  5 103 ? 8.030   -33.482 21.702 1.00 91.05  ? 29   DA  I C6    1 
ATOM   8262  N  N6    . DA  I  5 103 ? 7.669   -34.760 21.539 1.00 91.06  ? 29   DA  I N6    1 
ATOM   8263  N  N1    . DA  I  5 103 ? 9.181   -33.064 21.137 1.00 91.13  ? 29   DA  I N1    1 
ATOM   8264  C  C2    . DA  I  5 103 ? 9.560   -31.792 21.285 1.00 90.91  ? 29   DA  I C2    1 
ATOM   8265  N  N3    . DA  I  5 103 ? 8.948   -30.820 21.949 1.00 90.56  ? 29   DA  I N3    1 
ATOM   8266  C  C4    . DA  I  5 103 ? 7.808   -31.262 22.504 1.00 90.90  ? 29   DA  I C4    1 
ATOM   8267  P  P     . DG  I  5 104 ? 6.381   -25.093 22.382 1.00 97.00  ? 30   DG  I P     1 
ATOM   8268  O  OP1   . DG  I  5 104 ? 6.496   -23.820 23.133 1.00 96.62  ? 30   DG  I OP1   1 
ATOM   8269  O  OP2   . DG  I  5 104 ? 5.075   -25.578 21.865 1.00 95.86  ? 30   DG  I OP2   1 
ATOM   8270  O  "O5'" . DG  I  5 104 ? 7.337   -25.049 21.108 1.00 98.14  ? 30   DG  I "O5'" 1 
ATOM   8271  C  "C5'" . DG  I  5 104 ? 8.734   -24.801 21.208 1.00 100.11 ? 30   DG  I "C5'" 1 
ATOM   8272  C  "C4'" . DG  I  5 104 ? 9.372   -25.274 19.917 1.00 101.52 ? 30   DG  I "C4'" 1 
ATOM   8273  O  "O4'" . DG  I  5 104 ? 9.312   -26.724 19.880 1.00 101.25 ? 30   DG  I "O4'" 1 
ATOM   8274  C  "C3'" . DG  I  5 104 ? 8.678   -24.776 18.651 1.00 102.85 ? 30   DG  I "C3'" 1 
ATOM   8275  O  "O3'" . DG  I  5 104 ? 9.660   -24.388 17.685 1.00 105.64 ? 30   DG  I "O3'" 1 
ATOM   8276  C  "C2'" . DG  I  5 104 ? 7.836   -25.970 18.193 1.00 102.02 ? 30   DG  I "C2'" 1 
ATOM   8277  C  "C1'" . DG  I  5 104 ? 8.660   -27.149 18.701 1.00 101.21 ? 30   DG  I "C1'" 1 
ATOM   8278  N  N9    . DG  I  5 104 ? 7.881   -28.352 18.992 1.00 101.11 ? 30   DG  I N9    1 
ATOM   8279  C  C8    . DG  I  5 104 ? 6.777   -28.475 19.800 1.00 101.07 ? 30   DG  I C8    1 
ATOM   8280  N  N7    . DG  I  5 104 ? 6.293   -29.683 19.852 1.00 100.80 ? 30   DG  I N7    1 
ATOM   8281  C  C5    . DG  I  5 104 ? 7.137   -30.418 19.032 1.00 101.16 ? 30   DG  I C5    1 
ATOM   8282  C  C6    . DG  I  5 104 ? 7.125   -31.799 18.695 1.00 101.31 ? 30   DG  I C6    1 
ATOM   8283  O  O6    . DG  I  5 104 ? 6.328   -32.674 19.075 1.00 101.01 ? 30   DG  I O6    1 
ATOM   8284  N  N1    . DG  I  5 104 ? 8.168   -32.129 17.818 1.00 101.34 ? 30   DG  I N1    1 
ATOM   8285  C  C2    . DG  I  5 104 ? 9.105   -31.242 17.330 1.00 100.97 ? 30   DG  I C2    1 
ATOM   8286  N  N2    . DG  I  5 104 ? 10.039  -31.726 16.501 1.00 101.01 ? 30   DG  I N2    1 
ATOM   8287  N  N3    . DG  I  5 104 ? 9.125   -29.956 17.644 1.00 101.13 ? 30   DG  I N3    1 
ATOM   8288  C  C4    . DG  I  5 104 ? 8.119   -29.612 18.493 1.00 101.28 ? 30   DG  I C4    1 
ATOM   8289  P  P     . DT  I  5 105 ? 9.272   -23.642 16.319 1.00 107.90 ? 31   DT  I P     1 
ATOM   8290  O  OP1   . DT  I  5 105 ? 10.417  -22.784 15.940 1.00 108.09 ? 31   DT  I OP1   1 
ATOM   8291  O  OP2   . DT  I  5 105 ? 7.921   -23.051 16.462 1.00 108.12 ? 31   DT  I OP2   1 
ATOM   8292  O  "O5'" . DT  I  5 105 ? 9.133   -24.840 15.268 1.00 109.53 ? 31   DT  I "O5'" 1 
ATOM   8293  C  "C5'" . DT  I  5 105 ? 10.195  -25.774 15.075 1.00 111.75 ? 31   DT  I "C5'" 1 
ATOM   8294  C  "C4'" . DT  I  5 105 ? 9.842   -26.817 14.023 1.00 113.33 ? 31   DT  I "C4'" 1 
ATOM   8295  O  "O4'" . DT  I  5 105 ? 9.191   -27.961 14.631 1.00 113.23 ? 31   DT  I "O4'" 1 
ATOM   8296  C  "C3'" . DT  I  5 105 ? 8.918   -26.351 12.903 1.00 114.58 ? 31   DT  I "C3'" 1 
ATOM   8297  O  "O3'" . DT  I  5 105 ? 9.558   -26.663 11.678 1.00 117.49 ? 31   DT  I "O3'" 1 
ATOM   8298  C  "C2'" . DT  I  5 105 ? 7.641   -27.166 13.089 1.00 113.82 ? 31   DT  I "C2'" 1 
ATOM   8299  C  "C1'" . DT  I  5 105 ? 8.160   -28.418 13.787 1.00 113.13 ? 31   DT  I "C1'" 1 
ATOM   8300  N  N1    . DT  I  5 105 ? 7.160   -29.145 14.641 1.00 113.17 ? 31   DT  I N1    1 
ATOM   8301  C  C2    . DT  I  5 105 ? 7.086   -30.532 14.598 1.00 113.11 ? 31   DT  I C2    1 
ATOM   8302  O  O2    . DT  I  5 105 ? 7.783   -31.241 13.886 1.00 112.98 ? 31   DT  I O2    1 
ATOM   8303  N  N3    . DT  I  5 105 ? 6.136   -31.076 15.434 1.00 112.95 ? 31   DT  I N3    1 
ATOM   8304  C  C4    . DT  I  5 105 ? 5.278   -30.396 16.286 1.00 112.96 ? 31   DT  I C4    1 
ATOM   8305  O  O4    . DT  I  5 105 ? 4.467   -30.987 16.992 1.00 113.10 ? 31   DT  I O4    1 
ATOM   8306  C  C5    . DT  I  5 105 ? 5.411   -28.955 16.291 1.00 112.92 ? 31   DT  I C5    1 
ATOM   8307  C  C7    . DT  I  5 105 ? 4.542   -28.101 17.167 1.00 112.88 ? 31   DT  I C7    1 
ATOM   8308  C  C6    . DT  I  5 105 ? 6.333   -28.411 15.483 1.00 113.00 ? 31   DT  I C6    1 
ATOM   8309  P  P     . DT  I  5 106 ? 9.307   -25.840 10.326 1.00 119.26 ? 32   DT  I P     1 
ATOM   8310  O  OP1   . DT  I  5 106 ? 10.627  -25.296 9.919  1.00 118.97 ? 32   DT  I OP1   1 
ATOM   8311  O  OP2   . DT  I  5 106 ? 8.130   -24.948 10.501 1.00 118.67 ? 32   DT  I OP2   1 
ATOM   8312  O  "O5'" . DT  I  5 106 ? 8.905   -26.999 9.298  1.00 120.39 ? 32   DT  I "O5'" 1 
ATOM   8313  C  "C5'" . DT  I  5 106 ? 9.641   -28.228 9.276  1.00 122.58 ? 32   DT  I "C5'" 1 
ATOM   8314  C  "C4'" . DT  I  5 106 ? 8.743   -29.406 8.940  1.00 123.95 ? 32   DT  I "C4'" 1 
ATOM   8315  O  "O4'" . DT  I  5 106 ? 7.995   -29.813 10.114 1.00 124.32 ? 32   DT  I "O4'" 1 
ATOM   8316  C  "C3'" . DT  I  5 106 ? 7.707   -29.128 7.850  1.00 124.68 ? 32   DT  I "C3'" 1 
ATOM   8317  O  "O3'" . DT  I  5 106 ? 8.110   -29.766 6.628  1.00 125.64 ? 32   DT  I "O3'" 1 
ATOM   8318  C  "C2'" . DT  I  5 106 ? 6.397   -29.684 8.413  1.00 124.54 ? 32   DT  I "C2'" 1 
ATOM   8319  C  "C1'" . DT  I  5 106 ? 6.831   -30.463 9.650  1.00 124.36 ? 32   DT  I "C1'" 1 
ATOM   8320  N  N1    . DT  I  5 106 ? 5.766   -30.504 10.708 1.00 124.42 ? 32   DT  I N1    1 
ATOM   8321  C  C2    . DT  I  5 106 ? 5.333   -31.724 11.202 1.00 124.40 ? 32   DT  I C2    1 
ATOM   8322  O  O2    . DT  I  5 106 ? 5.775   -32.803 10.842 1.00 124.37 ? 32   DT  I O2    1 
ATOM   8323  N  N3    . DT  I  5 106 ? 4.346   -31.635 12.157 1.00 124.34 ? 32   DT  I N3    1 
ATOM   8324  C  C4    . DT  I  5 106 ? 3.757   -30.483 12.654 1.00 124.23 ? 32   DT  I C4    1 
ATOM   8325  O  O4    . DT  I  5 106 ? 2.880   -30.530 13.511 1.00 124.18 ? 32   DT  I O4    1 
ATOM   8326  C  C5    . DT  I  5 106 ? 4.253   -29.241 12.093 1.00 124.38 ? 32   DT  I C5    1 
ATOM   8327  C  C7    . DT  I  5 106 ? 3.711   -27.911 12.533 1.00 124.43 ? 32   DT  I C7    1 
ATOM   8328  C  C6    . DT  I  5 106 ? 5.216   -29.314 11.161 1.00 124.41 ? 32   DT  I C6    1 
ATOM   8329  P  P     . DT  I  5 107 ? 7.190   -29.809 5.310  1.00 126.24 ? 33   DT  I P     1 
ATOM   8330  O  OP1   . DT  I  5 107 ? 8.097   -29.965 4.151  1.00 126.22 ? 33   DT  I OP1   1 
ATOM   8331  O  OP2   . DT  I  5 107 ? 6.226   -28.683 5.353  1.00 125.87 ? 33   DT  I OP2   1 
ATOM   8332  O  "O5'" . DT  I  5 107 ? 6.365   -31.170 5.477  1.00 126.47 ? 33   DT  I "O5'" 1 
ATOM   8333  C  "C5'" . DT  I  5 107 ? 7.002   -32.397 5.855  1.00 126.94 ? 33   DT  I "C5'" 1 
ATOM   8334  C  "C4'" . DT  I  5 107 ? 5.955   -33.441 6.209  1.00 127.30 ? 33   DT  I "C4'" 1 
ATOM   8335  O  "O4'" . DT  I  5 107 ? 5.216   -33.037 7.397  1.00 127.65 ? 33   DT  I "O4'" 1 
ATOM   8336  C  "C3'" . DT  I  5 107 ? 4.902   -33.676 5.126  1.00 127.24 ? 33   DT  I "C3'" 1 
ATOM   8337  O  "O3'" . DT  I  5 107 ? 4.732   -35.072 4.925  1.00 126.99 ? 33   DT  I "O3'" 1 
ATOM   8338  C  "C2'" . DT  I  5 107 ? 3.641   -33.022 5.691  1.00 127.26 ? 33   DT  I "C2'" 1 
ATOM   8339  C  "C1'" . DT  I  5 107 ? 3.844   -33.300 7.174  1.00 127.24 ? 33   DT  I "C1'" 1 
ATOM   8340  N  N1    . DT  I  5 107 ? 2.979   -32.491 8.092  1.00 127.09 ? 33   DT  I N1    1 
ATOM   8341  C  C2    . DT  I  5 107 ? 2.095   -33.151 8.927  1.00 127.07 ? 33   DT  I C2    1 
ATOM   8342  O  O2    . DT  I  5 107 ? 1.977   -34.367 8.967  1.00 126.91 ? 33   DT  I O2    1 
ATOM   8343  N  N3    . DT  I  5 107 ? 1.343   -32.320 9.728  1.00 127.19 ? 33   DT  I N3    1 
ATOM   8344  C  C4    . DT  I  5 107 ? 1.383   -30.932 9.777  1.00 127.13 ? 33   DT  I C4    1 
ATOM   8345  O  O4    . DT  I  5 107 ? 0.664   -30.287 10.536 1.00 127.00 ? 33   DT  I O4    1 
ATOM   8346  C  C5    . DT  I  5 107 ? 2.329   -30.308 8.875  1.00 127.10 ? 33   DT  I C5    1 
ATOM   8347  C  C7    . DT  I  5 107 ? 2.477   -28.813 8.824  1.00 127.08 ? 33   DT  I C7    1 
ATOM   8348  C  C6    . DT  I  5 107 ? 3.068   -31.108 8.088  1.00 127.09 ? 33   DT  I C6    1 
ATOM   8349  P  P     . DC  I  5 108 ? 3.848   -35.624 3.711  1.00 126.80 ? 34   DC  I P     1 
ATOM   8350  O  OP1   . DC  I  5 108 ? 4.288   -37.017 3.457  1.00 126.78 ? 34   DC  I OP1   1 
ATOM   8351  O  OP2   . DC  I  5 108 ? 3.864   -34.617 2.622  1.00 126.23 ? 34   DC  I OP2   1 
ATOM   8352  O  "O5'" . DC  I  5 108 ? 2.370   -35.631 4.325  1.00 126.10 ? 34   DC  I "O5'" 1 
ATOM   8353  C  "C5'" . DC  I  5 108 ? 1.840   -36.763 5.007  1.00 124.97 ? 34   DC  I "C5'" 1 
ATOM   8354  C  "C4'" . DC  I  5 108 ? 0.345   -36.583 5.207  1.00 124.21 ? 34   DC  I "C4'" 1 
ATOM   8355  O  "O4'" . DC  I  5 108 ? 0.099   -35.382 5.982  1.00 124.01 ? 34   DC  I "O4'" 1 
ATOM   8356  C  "C3'" . DC  I  5 108 ? -0.482  -36.438 3.929  1.00 123.65 ? 34   DC  I "C3'" 1 
ATOM   8357  O  "O3'" . DC  I  5 108 ? -1.677  -37.186 4.077  1.00 123.09 ? 34   DC  I "O3'" 1 
ATOM   8358  C  "C2'" . DC  I  5 108 ? -0.779  -34.945 3.849  1.00 123.56 ? 34   DC  I "C2'" 1 
ATOM   8359  C  "C1'" . DC  I  5 108 ? -0.901  -34.619 5.337  1.00 123.42 ? 34   DC  I "C1'" 1 
ATOM   8360  N  N1    . DC  I  5 108 ? -0.726  -33.184 5.731  1.00 123.18 ? 34   DC  I N1    1 
ATOM   8361  C  C2    . DC  I  5 108 ? -1.119  -32.788 7.021  1.00 122.84 ? 34   DC  I C2    1 
ATOM   8362  O  O2    . DC  I  5 108 ? -1.598  -33.626 7.798  1.00 122.55 ? 34   DC  I O2    1 
ATOM   8363  N  N3    . DC  I  5 108 ? -0.963  -31.487 7.383  1.00 122.76 ? 34   DC  I N3    1 
ATOM   8364  C  C4    . DC  I  5 108 ? -0.443  -30.607 6.521  1.00 123.00 ? 34   DC  I C4    1 
ATOM   8365  N  N4    . DC  I  5 108 ? -0.313  -29.340 6.925  1.00 122.90 ? 34   DC  I N4    1 
ATOM   8366  C  C5    . DC  I  5 108 ? -0.034  -30.989 5.204  1.00 123.11 ? 34   DC  I C5    1 
ATOM   8367  C  C6    . DC  I  5 108 ? -0.191  -32.274 4.855  1.00 123.13 ? 34   DC  I C6    1 
ATOM   8368  P  P     . DC  I  5 109 ? -1.836  -38.599 3.351  1.00 122.42 ? 35   DC  I P     1 
ATOM   8369  O  OP1   . DC  I  5 109 ? -0.573  -39.356 3.530  1.00 122.26 ? 35   DC  I OP1   1 
ATOM   8370  O  OP2   . DC  I  5 109 ? -2.368  -38.301 2.001  1.00 122.54 ? 35   DC  I OP2   1 
ATOM   8371  O  "O5'" . DC  I  5 109 ? -2.999  -39.365 4.147  1.00 121.85 ? 35   DC  I "O5'" 1 
ATOM   8372  C  "C5'" . DC  I  5 109 ? -3.141  -39.303 5.568  1.00 120.70 ? 35   DC  I "C5'" 1 
ATOM   8373  C  "C4'" . DC  I  5 109 ? -4.467  -38.667 5.963  1.00 119.74 ? 35   DC  I "C4'" 1 
ATOM   8374  O  "O4'" . DC  I  5 109 ? -4.285  -37.242 6.158  1.00 119.71 ? 35   DC  I "O4'" 1 
ATOM   8375  C  "C3'" . DC  I  5 109 ? -5.626  -38.806 4.970  1.00 118.99 ? 35   DC  I "C3'" 1 
ATOM   8376  O  "O3'" . DC  I  5 109 ? -6.795  -39.212 5.674  1.00 118.04 ? 35   DC  I "O3'" 1 
ATOM   8377  C  "C2'" . DC  I  5 109 ? -5.790  -37.403 4.385  1.00 118.82 ? 35   DC  I "C2'" 1 
ATOM   8378  C  "C1'" . DC  I  5 109 ? -5.417  -36.588 5.618  1.00 119.27 ? 35   DC  I "C1'" 1 
ATOM   8379  N  N1    . DC  I  5 109 ? -5.088  -35.136 5.431  1.00 119.30 ? 35   DC  I N1    1 
ATOM   8380  C  C2    . DC  I  5 109 ? -5.217  -34.292 6.542  1.00 119.23 ? 35   DC  I C2    1 
ATOM   8381  O  O2    . DC  I  5 109 ? -5.596  -34.769 7.622  1.00 119.26 ? 35   DC  I O2    1 
ATOM   8382  N  N3    . DC  I  5 109 ? -4.924  -32.973 6.401  1.00 119.06 ? 35   DC  I N3    1 
ATOM   8383  C  C4    . DC  I  5 109 ? -4.518  -32.488 5.224  1.00 119.16 ? 35   DC  I C4    1 
ATOM   8384  N  N4    . DC  I  5 109 ? -4.245  -31.181 5.147  1.00 119.02 ? 35   DC  I N4    1 
ATOM   8385  C  C5    . DC  I  5 109 ? -4.378  -33.332 4.078  1.00 119.24 ? 35   DC  I C5    1 
ATOM   8386  C  C6    . DC  I  5 109 ? -4.668  -34.634 4.225  1.00 119.42 ? 35   DC  I C6    1 
ATOM   8387  P  P     . DA  I  5 110 ? -7.450  -40.655 5.436  1.00 117.04 ? 36   DA  I P     1 
ATOM   8388  O  OP1   . DA  I  5 110 ? -6.379  -41.678 5.576  1.00 116.74 ? 36   DA  I OP1   1 
ATOM   8389  O  OP2   . DA  I  5 110 ? -8.250  -40.537 4.192  1.00 116.66 ? 36   DA  I OP2   1 
ATOM   8390  O  "O5'" . DA  I  5 110 ? -8.477  -40.837 6.659  1.00 115.51 ? 36   DA  I "O5'" 1 
ATOM   8391  C  "C5'" . DA  I  5 110 ? -8.014  -40.764 8.016  1.00 113.28 ? 36   DA  I "C5'" 1 
ATOM   8392  C  "C4'" . DA  I  5 110 ? -8.775  -39.729 8.831  1.00 111.63 ? 36   DA  I "C4'" 1 
ATOM   8393  O  "O4'" . DA  I  5 110 ? -8.465  -38.387 8.374  1.00 110.99 ? 36   DA  I "O4'" 1 
ATOM   8394  C  "C3'" . DA  I  5 110 ? -10.295 -39.871 8.799  1.00 110.96 ? 36   DA  I "C3'" 1 
ATOM   8395  O  "O3'" . DA  I  5 110 ? -10.772 -39.891 10.148 1.00 110.22 ? 36   DA  I "O3'" 1 
ATOM   8396  C  "C2'" . DA  I  5 110 ? -10.788 -38.667 7.990  1.00 110.56 ? 36   DA  I "C2'" 1 
ATOM   8397  C  "C1'" . DA  I  5 110 ? -9.652  -37.657 8.117  1.00 110.73 ? 36   DA  I "C1'" 1 
ATOM   8398  N  N9    . DA  I  5 110 ? -9.425  -36.842 6.922  1.00 110.68 ? 36   DA  I N9    1 
ATOM   8399  C  C8    . DA  I  5 110 ? -9.491  -37.252 5.618  1.00 110.85 ? 36   DA  I C8    1 
ATOM   8400  N  N7    . DA  I  5 110 ? -9.226  -36.311 4.744  1.00 111.03 ? 36   DA  I N7    1 
ATOM   8401  C  C5    . DA  I  5 110 ? -8.964  -35.194 5.524  1.00 111.01 ? 36   DA  I C5    1 
ATOM   8402  C  C6    . DA  I  5 110 ? -8.615  -33.854 5.205  1.00 110.90 ? 36   DA  I C6    1 
ATOM   8403  N  N6    . DA  I  5 110 ? -8.465  -33.391 3.959  1.00 110.67 ? 36   DA  I N6    1 
ATOM   8404  N  N1    . DA  I  5 110 ? -8.423  -32.992 6.229  1.00 110.79 ? 36   DA  I N1    1 
ATOM   8405  C  C2    . DA  I  5 110 ? -8.572  -33.436 7.484  1.00 110.80 ? 36   DA  I C2    1 
ATOM   8406  N  N3    . DA  I  5 110 ? -8.892  -34.662 7.903  1.00 110.93 ? 36   DA  I N3    1 
ATOM   8407  C  C4    . DA  I  5 110 ? -9.080  -35.507 6.870  1.00 110.81 ? 36   DA  I C4    1 
ATOM   8408  P  P     . DA  I  5 111 ? -12.326 -40.009 10.532 1.00 109.42 ? 37   DA  I P     1 
ATOM   8409  O  OP1   . DA  I  5 111 ? -12.416 -40.741 11.813 1.00 109.58 ? 37   DA  I OP1   1 
ATOM   8410  O  OP2   . DA  I  5 111 ? -13.080 -40.490 9.353  1.00 109.10 ? 37   DA  I OP2   1 
ATOM   8411  O  "O5'" . DA  I  5 111 ? -12.762 -38.490 10.784 1.00 108.43 ? 37   DA  I "O5'" 1 
ATOM   8412  C  "C5'" . DA  I  5 111 ? -12.015 -37.578 11.591 1.00 106.69 ? 37   DA  I "C5'" 1 
ATOM   8413  C  "C4'" . DA  I  5 111 ? -12.561 -36.170 11.405 1.00 105.82 ? 37   DA  I "C4'" 1 
ATOM   8414  O  "O4'" . DA  I  5 111 ? -12.089 -35.661 10.134 1.00 105.88 ? 37   DA  I "O4'" 1 
ATOM   8415  C  "C3'" . DA  I  5 111 ? -14.090 -36.034 11.370 1.00 105.50 ? 37   DA  I "C3'" 1 
ATOM   8416  O  "O3'" . DA  I  5 111 ? -14.502 -34.881 12.109 1.00 104.71 ? 37   DA  I "O3'" 1 
ATOM   8417  C  "C2'" . DA  I  5 111 ? -14.397 -35.870 9.883  1.00 105.54 ? 37   DA  I "C2'" 1 
ATOM   8418  C  "C1'" . DA  I  5 111 ? -13.178 -35.072 9.451  1.00 105.80 ? 37   DA  I "C1'" 1 
ATOM   8419  N  N9    . DA  I  5 111 ? -12.968 -35.055 8.004  1.00 105.74 ? 37   DA  I N9    1 
ATOM   8420  C  C8    . DA  I  5 111 ? -13.173 -36.073 7.116  1.00 105.97 ? 37   DA  I C8    1 
ATOM   8421  N  N7    . DA  I  5 111 ? -12.902 -35.756 5.873  1.00 106.19 ? 37   DA  I N7    1 
ATOM   8422  C  C5    . DA  I  5 111 ? -12.498 -34.433 5.945  1.00 106.19 ? 37   DA  I C5    1 
ATOM   8423  C  C6    . DA  I  5 111 ? -12.072 -33.499 4.965  1.00 106.18 ? 37   DA  I C6    1 
ATOM   8424  N  N6    . DA  I  5 111 ? -11.981 -33.771 3.656  1.00 105.84 ? 37   DA  I N6    1 
ATOM   8425  N  N1    . DA  I  5 111 ? -11.738 -32.257 5.388  1.00 106.02 ? 37   DA  I N1    1 
ATOM   8426  C  C2    . DA  I  5 111 ? -11.818 -31.971 6.697  1.00 106.03 ? 37   DA  I C2    1 
ATOM   8427  N  N3    . DA  I  5 111 ? -12.205 -32.760 7.702  1.00 105.80 ? 37   DA  I N3    1 
ATOM   8428  C  C4    . DA  I  5 111 ? -12.533 -33.987 7.258  1.00 105.83 ? 37   DA  I C4    1 
ATOM   8429  P  P     . DA  I  5 112 ? -16.031 -34.563 12.486 1.00 103.43 ? 38   DA  I P     1 
ATOM   8430  O  OP1   . DA  I  5 112 ? -16.196 -34.984 13.890 1.00 103.48 ? 38   DA  I OP1   1 
ATOM   8431  O  OP2   . DA  I  5 112 ? -16.947 -35.084 11.449 1.00 103.25 ? 38   DA  I OP2   1 
ATOM   8432  O  "O5'" . DA  I  5 112 ? -16.086 -32.963 12.395 1.00 103.79 ? 38   DA  I "O5'" 1 
ATOM   8433  C  "C5'" . DA  I  5 112 ? -15.006 -32.158 12.889 1.00 103.70 ? 38   DA  I "C5'" 1 
ATOM   8434  C  "C4'" . DA  I  5 112 ? -14.879 -30.842 12.139 1.00 103.57 ? 38   DA  I "C4'" 1 
ATOM   8435  O  "O4'" . DA  I  5 112 ? -14.202 -31.094 10.882 1.00 103.45 ? 38   DA  I "O4'" 1 
ATOM   8436  C  "C3'" . DA  I  5 112 ? -16.202 -30.153 11.816 1.00 103.71 ? 38   DA  I "C3'" 1 
ATOM   8437  O  "O3'" . DA  I  5 112 ? -16.363 -28.924 12.524 1.00 104.16 ? 38   DA  I "O3'" 1 
ATOM   8438  C  "C2'" . DA  I  5 112 ? -16.158 -29.880 10.317 1.00 104.08 ? 38   DA  I "C2'" 1 
ATOM   8439  C  "C1'" . DA  I  5 112 ? -14.831 -30.414 9.815  1.00 103.77 ? 38   DA  I "C1'" 1 
ATOM   8440  N  N9    . DA  I  5 112 ? -15.091 -31.327 8.708  1.00 103.83 ? 38   DA  I N9    1 
ATOM   8441  C  C8    . DA  I  5 112 ? -15.573 -32.607 8.798  1.00 103.85 ? 38   DA  I C8    1 
ATOM   8442  N  N7    . DA  I  5 112 ? -15.731 -33.210 7.647  1.00 103.81 ? 38   DA  I N7    1 
ATOM   8443  C  C5    . DA  I  5 112 ? -15.339 -32.250 6.732  1.00 103.95 ? 38   DA  I C5    1 
ATOM   8444  C  C6    . DA  I  5 112 ? -15.274 -32.267 5.328  1.00 103.82 ? 38   DA  I C6    1 
ATOM   8445  N  N6    . DA  I  5 112 ? -15.627 -33.336 4.612  1.00 103.85 ? 38   DA  I N6    1 
ATOM   8446  N  N1    . DA  I  5 112 ? -14.835 -31.151 4.699  1.00 103.88 ? 38   DA  I N1    1 
ATOM   8447  C  C2    . DA  I  5 112 ? -14.482 -30.084 5.434  1.00 103.84 ? 38   DA  I C2    1 
ATOM   8448  N  N3    . DA  I  5 112 ? -14.501 -29.949 6.766  1.00 103.93 ? 38   DA  I N3    1 
ATOM   8449  C  C4    . DA  I  5 112 ? -14.946 -31.077 7.362  1.00 104.02 ? 38   DA  I C4    1 
ATOM   8450  P  P     . DT  I  5 113 ? -17.734 -28.098 12.402 1.00 104.46 ? 39   DT  I P     1 
ATOM   8451  O  OP1   . DT  I  5 113 ? -17.874 -27.231 13.590 1.00 104.12 ? 39   DT  I OP1   1 
ATOM   8452  O  OP2   . DT  I  5 113 ? -18.797 -29.074 12.087 1.00 104.62 ? 39   DT  I OP2   1 
ATOM   8453  O  "O5'" . DT  I  5 113 ? -17.541 -27.177 11.108 1.00 107.07 ? 39   DT  I "O5'" 1 
ATOM   8454  C  "C5'" . DT  I  5 113 ? -16.377 -26.363 10.906 1.00 110.51 ? 39   DT  I "C5'" 1 
ATOM   8455  C  "C4'" . DT  I  5 113 ? -16.273 -25.878 9.464  1.00 112.68 ? 39   DT  I "C4'" 1 
ATOM   8456  O  "O4'" . DT  I  5 113 ? -16.207 -26.999 8.543  1.00 112.40 ? 39   DT  I "O4'" 1 
ATOM   8457  C  "C3'" . DT  I  5 113 ? -17.429 -24.991 9.003  1.00 114.58 ? 39   DT  I "C3'" 1 
ATOM   8458  O  "O3'" . DT  I  5 113 ? -16.920 -23.728 8.558  1.00 117.71 ? 39   DT  I "O3'" 1 
ATOM   8459  C  "C2'" . DT  I  5 113 ? -18.116 -25.783 7.886  1.00 113.71 ? 39   DT  I "C2'" 1 
ATOM   8460  C  "C1'" . DT  I  5 113 ? -17.038 -26.757 7.422  1.00 112.83 ? 39   DT  I "C1'" 1 
ATOM   8461  N  N1    . DT  I  5 113 ? -17.560 -28.081 6.920  1.00 112.91 ? 39   DT  I N1    1 
ATOM   8462  C  C2    . DT  I  5 113 ? -17.334 -28.480 5.608  1.00 112.58 ? 39   DT  I C2    1 
ATOM   8463  O  O2    . DT  I  5 113 ? -16.721 -27.827 4.781  1.00 112.69 ? 39   DT  I O2    1 
ATOM   8464  N  N3    . DT  I  5 113 ? -17.853 -29.710 5.285  1.00 112.28 ? 39   DT  I N3    1 
ATOM   8465  C  C4    . DT  I  5 113 ? -18.563 -30.565 6.113  1.00 112.68 ? 39   DT  I C4    1 
ATOM   8466  O  O4    . DT  I  5 113 ? -18.984 -31.646 5.708  1.00 112.89 ? 39   DT  I O4    1 
ATOM   8467  C  C5    . DT  I  5 113 ? -18.771 -30.095 7.468  1.00 112.70 ? 39   DT  I C5    1 
ATOM   8468  C  C7    . DT  I  5 113 ? -19.525 -30.917 8.475  1.00 112.57 ? 39   DT  I C7    1 
ATOM   8469  C  C6    . DT  I  5 113 ? -18.267 -28.896 7.794  1.00 112.83 ? 39   DT  I C6    1 
ATOM   8470  P  P     . DA  I  5 114 ? -17.876 -22.454 8.344  1.00 120.08 ? 40   DA  I P     1 
ATOM   8471  O  OP1   . DA  I  5 114 ? -17.019 -21.244 8.367  1.00 119.73 ? 40   DA  I OP1   1 
ATOM   8472  O  OP2   . DA  I  5 114 ? -19.045 -22.565 9.256  1.00 119.54 ? 40   DA  I OP2   1 
ATOM   8473  O  "O5'" . DA  I  5 114 ? -18.396 -22.664 6.843  1.00 121.89 ? 40   DA  I "O5'" 1 
ATOM   8474  C  "C5'" . DA  I  5 114 ? -17.494 -22.866 5.745  1.00 123.78 ? 40   DA  I "C5'" 1 
ATOM   8475  C  "C4'" . DA  I  5 114 ? -18.267 -23.191 4.480  1.00 125.06 ? 40   DA  I "C4'" 1 
ATOM   8476  O  "O4'" . DA  I  5 114 ? -18.505 -24.619 4.394  1.00 124.93 ? 40   DA  I "O4'" 1 
ATOM   8477  C  "C3'" . DA  I  5 114 ? -19.642 -22.527 4.379  1.00 126.45 ? 40   DA  I "C3'" 1 
ATOM   8478  O  "O3'" . DA  I  5 114 ? -19.668 -21.699 3.212  1.00 129.10 ? 40   DA  I "O3'" 1 
ATOM   8479  C  "C2'" . DA  I  5 114 ? -20.631 -23.696 4.314  1.00 125.77 ? 40   DA  I "C2'" 1 
ATOM   8480  C  "C1'" . DA  I  5 114 ? -19.755 -24.815 3.761  1.00 124.73 ? 40   DA  I "C1'" 1 
ATOM   8481  N  N9    . DA  I  5 114 ? -20.234 -26.177 4.020  1.00 124.45 ? 40   DA  I N9    1 
ATOM   8482  C  C8    . DA  I  5 114 ? -20.654 -26.693 5.217  1.00 124.33 ? 40   DA  I C8    1 
ATOM   8483  N  N7    . DA  I  5 114 ? -21.026 -27.951 5.158  1.00 124.29 ? 40   DA  I N7    1 
ATOM   8484  C  C5    . DA  I  5 114 ? -20.835 -28.293 3.831  1.00 124.32 ? 40   DA  I C5    1 
ATOM   8485  C  C6    . DA  I  5 114 ? -21.044 -29.496 3.115  1.00 124.33 ? 40   DA  I C6    1 
ATOM   8486  N  N6    . DA  I  5 114 ? -21.511 -30.615 3.673  1.00 124.28 ? 40   DA  I N6    1 
ATOM   8487  N  N1    . DA  I  5 114 ? -20.754 -29.508 1.794  1.00 124.33 ? 40   DA  I N1    1 
ATOM   8488  C  C2    . DA  I  5 114 ? -20.291 -28.383 1.230  1.00 124.44 ? 40   DA  I C2    1 
ATOM   8489  N  N3    . DA  I  5 114 ? -20.049 -27.196 1.798  1.00 124.48 ? 40   DA  I N3    1 
ATOM   8490  C  C4    . DA  I  5 114 ? -20.346 -27.211 3.113  1.00 124.45 ? 40   DA  I C4    1 
ATOM   8491  P  P     . DC  I  5 115 ? -20.859 -20.672 2.883  1.00 130.93 ? 41   DC  I P     1 
ATOM   8492  O  OP1   . DC  I  5 115 ? -20.283 -19.608 2.029  1.00 131.23 ? 41   DC  I OP1   1 
ATOM   8493  O  OP2   . DC  I  5 115 ? -21.575 -20.314 4.130  1.00 130.74 ? 41   DC  I OP2   1 
ATOM   8494  O  "O5'" . DC  I  5 115 ? -21.843 -21.559 1.993  1.00 131.99 ? 41   DC  I "O5'" 1 
ATOM   8495  C  "C5'" . DC  I  5 115 ? -21.335 -22.341 0.917  1.00 133.66 ? 41   DC  I "C5'" 1 
ATOM   8496  C  "C4'" . DC  I  5 115 ? -22.450 -23.193 0.349  1.00 135.10 ? 41   DC  I "C4'" 1 
ATOM   8497  O  "O4'" . DC  I  5 115 ? -22.468 -24.496 0.992  1.00 135.25 ? 41   DC  I "O4'" 1 
ATOM   8498  C  "C3'" . DC  I  5 115 ? -23.856 -22.606 0.514  1.00 136.01 ? 41   DC  I "C3'" 1 
ATOM   8499  O  "O3'" . DC  I  5 115 ? -24.458 -22.577 -0.777 1.00 137.32 ? 41   DC  I "O3'" 1 
ATOM   8500  C  "C2'" . DC  I  5 115 ? -24.539 -23.585 1.472  1.00 135.80 ? 41   DC  I "C2'" 1 
ATOM   8501  C  "C1'" . DC  I  5 115 ? -23.826 -24.874 1.077  1.00 135.41 ? 41   DC  I "C1'" 1 
ATOM   8502  N  N1    . DC  I  5 115 ? -23.999 -26.048 2.000  1.00 135.34 ? 41   DC  I N1    1 
ATOM   8503  C  C2    . DC  I  5 115 ? -24.083 -27.345 1.454  1.00 135.30 ? 41   DC  I C2    1 
ATOM   8504  O  O2    . DC  I  5 115 ? -24.011 -27.511 0.228  1.00 135.08 ? 41   DC  I O2    1 
ATOM   8505  N  N3    . DC  I  5 115 ? -24.243 -28.401 2.296  1.00 135.21 ? 41   DC  I N3    1 
ATOM   8506  C  C4    . DC  I  5 115 ? -24.320 -28.202 3.616  1.00 135.13 ? 41   DC  I C4    1 
ATOM   8507  N  N4    . DC  I  5 115 ? -24.477 -29.275 4.395  1.00 135.21 ? 41   DC  I N4    1 
ATOM   8508  C  C5    . DC  I  5 115 ? -24.240 -26.895 4.190  1.00 135.08 ? 41   DC  I C5    1 
ATOM   8509  C  C6    . DC  I  5 115 ? -24.081 -25.858 3.356  1.00 135.12 ? 41   DC  I C6    1 
ATOM   8510  P  P     . DA  I  5 116 ? -25.831 -21.830 -1.131 1.00 138.04 ? 42   DA  I P     1 
ATOM   8511  O  OP1   . DA  I  5 116 ? -25.548 -20.375 -1.190 1.00 137.89 ? 42   DA  I OP1   1 
ATOM   8512  O  OP2   . DA  I  5 116 ? -26.919 -22.333 -0.256 1.00 137.78 ? 42   DA  I OP2   1 
ATOM   8513  O  "O5'" . DA  I  5 116 ? -26.092 -22.407 -2.606 1.00 138.20 ? 42   DA  I "O5'" 1 
ATOM   8514  C  "C5'" . DA  I  5 116 ? -25.392 -23.572 -3.082 1.00 138.78 ? 42   DA  I "C5'" 1 
ATOM   8515  C  "C4'" . DA  I  5 116 ? -26.294 -24.793 -3.230 1.00 139.42 ? 42   DA  I "C4'" 1 
ATOM   8516  O  "O4'" . DA  I  5 116 ? -26.102 -25.711 -2.116 1.00 139.72 ? 42   DA  I "O4'" 1 
ATOM   8517  C  "C3'" . DA  I  5 116 ? -27.797 -24.507 -3.291 1.00 139.79 ? 42   DA  I "C3'" 1 
ATOM   8518  O  "O3'" . DA  I  5 116 ? -28.374 -25.134 -4.442 1.00 139.84 ? 42   DA  I "O3'" 1 
ATOM   8519  C  "C2'" . DA  I  5 116 ? -28.319 -25.090 -1.980 1.00 140.05 ? 42   DA  I "C2'" 1 
ATOM   8520  C  "C1'" . DA  I  5 116 ? -27.366 -26.264 -1.807 1.00 140.13 ? 42   DA  I "C1'" 1 
ATOM   8521  N  N9    . DA  I  5 116 ? -27.419 -26.855 -0.465 1.00 140.15 ? 42   DA  I N9    1 
ATOM   8522  C  C8    . DA  I  5 116 ? -27.270 -26.209 0.733  1.00 140.07 ? 42   DA  I C8    1 
ATOM   8523  N  N7    . DA  I  5 116 ? -27.383 -26.995 1.776  1.00 140.17 ? 42   DA  I N7    1 
ATOM   8524  C  C5    . DA  I  5 116 ? -27.628 -28.245 1.229  1.00 140.18 ? 42   DA  I C5    1 
ATOM   8525  C  C6    . DA  I  5 116 ? -27.841 -29.520 1.807  1.00 140.19 ? 42   DA  I C6    1 
ATOM   8526  N  N6    . DA  I  5 116 ? -27.839 -29.732 3.128  1.00 140.12 ? 42   DA  I N6    1 
ATOM   8527  N  N1    . DA  I  5 116 ? -28.061 -30.570 0.978  1.00 140.13 ? 42   DA  I N1    1 
ATOM   8528  C  C2    . DA  I  5 116 ? -28.066 -30.356 -0.346 1.00 140.14 ? 42   DA  I C2    1 
ATOM   8529  N  N3    . DA  I  5 116 ? -27.875 -29.206 -1.001 1.00 140.27 ? 42   DA  I N3    1 
ATOM   8530  C  C4    . DA  I  5 116 ? -27.659 -28.178 -0.153 1.00 140.16 ? 42   DA  I C4    1 
ATOM   8531  P  P     . DC  I  5 117 ? -29.959 -25.265 -4.656 1.00 140.07 ? 43   DC  I P     1 
ATOM   8532  O  OP1   . DC  I  5 117 ? -30.190 -25.364 -6.117 1.00 140.28 ? 43   DC  I OP1   1 
ATOM   8533  O  OP2   . DC  I  5 117 ? -30.672 -24.221 -3.877 1.00 139.49 ? 43   DC  I OP2   1 
ATOM   8534  O  "O5'" . DC  I  5 117 ? -30.257 -26.681 -3.967 1.00 139.79 ? 43   DC  I "O5'" 1 
ATOM   8535  C  "C5'" . DC  I  5 117 ? -30.102 -27.920 -4.670 1.00 139.06 ? 43   DC  I "C5'" 1 
ATOM   8536  C  "C4'" . DC  I  5 117 ? -30.969 -28.998 -4.032 1.00 138.44 ? 43   DC  I "C4'" 1 
ATOM   8537  O  "O4'" . DC  I  5 117 ? -30.575 -29.166 -2.640 1.00 138.35 ? 43   DC  I "O4'" 1 
ATOM   8538  C  "C3'" . DC  I  5 117 ? -32.474 -28.709 -4.037 1.00 137.78 ? 43   DC  I "C3'" 1 
ATOM   8539  O  "O3'" . DC  I  5 117 ? -33.219 -29.861 -4.463 1.00 136.57 ? 43   DC  I "O3'" 1 
ATOM   8540  C  "C2'" . DC  I  5 117 ? -32.768 -28.336 -2.587 1.00 137.98 ? 43   DC  I "C2'" 1 
ATOM   8541  C  "C1'" . DC  I  5 117 ? -31.729 -29.152 -1.826 1.00 138.28 ? 43   DC  I "C1'" 1 
ATOM   8542  N  N1    . DC  I  5 117 ? -31.424 -28.593 -0.466 1.00 138.37 ? 43   DC  I N1    1 
ATOM   8543  C  C2    . DC  I  5 117 ? -31.276 -29.461 0.631  1.00 138.36 ? 43   DC  I C2    1 
ATOM   8544  O  O2    . DC  I  5 117 ? -31.382 -30.686 0.465  1.00 138.29 ? 43   DC  I O2    1 
ATOM   8545  N  N3    . DC  I  5 117 ? -31.010 -28.925 1.856  1.00 138.30 ? 43   DC  I N3    1 
ATOM   8546  C  C4    . DC  I  5 117 ? -30.898 -27.598 2.005  1.00 138.32 ? 43   DC  I C4    1 
ATOM   8547  N  N4    . DC  I  5 117 ? -30.635 -27.120 3.226  1.00 138.26 ? 43   DC  I N4    1 
ATOM   8548  C  C5    . DC  I  5 117 ? -31.050 -26.700 0.904  1.00 138.39 ? 43   DC  I C5    1 
ATOM   8549  C  C6    . DC  I  5 117 ? -31.310 -27.235 -0.297 1.00 138.38 ? 43   DC  I C6    1 
ATOM   8550  P  P     . DT  I  5 118 ? -34.818 -29.993 -4.318 1.00 135.51 ? 44   DT  I P     1 
ATOM   8551  O  OP1   . DT  I  5 118 ? -35.286 -30.736 -5.511 1.00 135.71 ? 44   DT  I OP1   1 
ATOM   8552  O  OP2   . DT  I  5 118 ? -35.413 -28.670 -3.999 1.00 135.22 ? 44   DT  I OP2   1 
ATOM   8553  O  "O5'" . DT  I  5 118 ? -34.985 -30.941 -3.039 1.00 134.26 ? 44   DT  I "O5'" 1 
ATOM   8554  C  "C5'" . DT  I  5 118 ? -34.364 -32.238 -3.020 1.00 132.42 ? 44   DT  I "C5'" 1 
ATOM   8555  C  "C4'" . DT  I  5 118 ? -34.911 -33.128 -1.914 1.00 130.63 ? 44   DT  I "C4'" 1 
ATOM   8556  O  "O4'" . DT  I  5 118 ? -34.394 -32.692 -0.628 1.00 130.16 ? 44   DT  I "O4'" 1 
ATOM   8557  C  "C3'" . DT  I  5 118 ? -36.433 -33.149 -1.805 1.00 129.63 ? 44   DT  I "C3'" 1 
ATOM   8558  O  "O3'" . DT  I  5 118 ? -36.881 -34.503 -1.704 1.00 128.33 ? 44   DT  I "O3'" 1 
ATOM   8559  C  "C2'" . DT  I  5 118 ? -36.738 -32.323 -0.555 1.00 129.75 ? 44   DT  I "C2'" 1 
ATOM   8560  C  "C1'" . DT  I  5 118 ? -35.454 -32.406 0.270  1.00 129.71 ? 44   DT  I "C1'" 1 
ATOM   8561  N  N1    . DT  I  5 118 ? -35.139 -31.143 1.048  1.00 129.57 ? 44   DT  I N1    1 
ATOM   8562  C  C2    . DT  I  5 118 ? -34.823 -31.220 2.397  1.00 129.13 ? 44   DT  I C2    1 
ATOM   8563  O  O2    . DT  I  5 118 ? -34.773 -32.259 3.031  1.00 129.13 ? 44   DT  I O2    1 
ATOM   8564  N  N3    . DT  I  5 118 ? -34.558 -30.011 2.991  1.00 129.08 ? 44   DT  I N3    1 
ATOM   8565  C  C4    . DT  I  5 118 ? -34.575 -28.756 2.400  1.00 129.45 ? 44   DT  I C4    1 
ATOM   8566  O  O4    . DT  I  5 118 ? -34.319 -27.735 3.034  1.00 129.42 ? 44   DT  I O4    1 
ATOM   8567  C  C5    . DT  I  5 118 ? -34.914 -28.738 0.994  1.00 129.43 ? 44   DT  I C5    1 
ATOM   8568  C  C7    . DT  I  5 118 ? -34.971 -27.442 0.234  1.00 129.28 ? 44   DT  I C7    1 
ATOM   8569  C  C6    . DT  I  5 118 ? -35.174 -29.915 0.399  1.00 129.54 ? 44   DT  I C6    1 
ATOM   8570  P  P     . DT  I  5 119 ? -38.422 -34.898 -1.465 1.00 126.99 ? 45   DT  I P     1 
ATOM   8571  O  OP1   . DT  I  5 119 ? -38.666 -36.200 -2.125 1.00 126.85 ? 45   DT  I OP1   1 
ATOM   8572  O  OP2   . DT  I  5 119 ? -39.293 -33.738 -1.777 1.00 126.86 ? 45   DT  I OP2   1 
ATOM   8573  O  "O5'" . DT  I  5 119 ? -38.464 -35.125 0.115  1.00 125.98 ? 45   DT  I "O5'" 1 
ATOM   8574  C  "C5'" . DT  I  5 119 ? -37.395 -35.788 0.803  1.00 123.73 ? 45   DT  I "C5'" 1 
ATOM   8575  C  "C4'" . DT  I  5 119 ? -37.514 -35.558 2.300  1.00 121.51 ? 45   DT  I "C4'" 1 
ATOM   8576  O  "O4'" . DT  I  5 119 ? -37.152 -34.191 2.634  1.00 121.27 ? 45   DT  I "O4'" 1 
ATOM   8577  C  "C3'" . DT  I  5 119 ? -38.921 -35.767 2.848  1.00 119.97 ? 45   DT  I "C3'" 1 
ATOM   8578  O  "O3'" . DT  I  5 119 ? -38.824 -36.543 4.013  1.00 117.80 ? 45   DT  I "O3'" 1 
ATOM   8579  C  "C2'" . DT  I  5 119 ? -39.407 -34.353 3.158  1.00 120.37 ? 45   DT  I "C2'" 1 
ATOM   8580  C  "C1'" . DT  I  5 119 ? -38.095 -33.698 3.567  1.00 120.77 ? 45   DT  I "C1'" 1 
ATOM   8581  N  N1    . DT  I  5 119 ? -38.082 -32.192 3.592  1.00 120.71 ? 45   DT  I N1    1 
ATOM   8582  C  C2    . DT  I  5 119 ? -37.747 -31.545 4.770  1.00 120.66 ? 45   DT  I C2    1 
ATOM   8583  O  O2    . DT  I  5 119 ? -37.463 -32.121 5.805  1.00 120.63 ? 45   DT  I O2    1 
ATOM   8584  N  N3    . DT  I  5 119 ? -37.757 -30.172 4.698  1.00 120.71 ? 45   DT  I N3    1 
ATOM   8585  C  C4    . DT  I  5 119 ? -38.060 -29.387 3.598  1.00 120.79 ? 45   DT  I C4    1 
ATOM   8586  O  O4    . DT  I  5 119 ? -38.036 -28.158 3.656  1.00 120.60 ? 45   DT  I O4    1 
ATOM   8587  C  C5    . DT  I  5 119 ? -38.404 -30.122 2.395  1.00 120.91 ? 45   DT  I C5    1 
ATOM   8588  C  C7    . DT  I  5 119 ? -38.755 -29.398 1.125  1.00 120.82 ? 45   DT  I C7    1 
ATOM   8589  C  C6    . DT  I  5 119 ? -38.397 -31.467 2.451  1.00 120.90 ? 45   DT  I C6    1 
ATOM   8590  P  P     . DT  I  5 120 ? -40.009 -37.507 4.465  1.00 115.94 ? 46   DT  I P     1 
ATOM   8591  O  OP1   . DT  I  5 120 ? -39.857 -38.756 3.690  1.00 116.24 ? 46   DT  I OP1   1 
ATOM   8592  O  OP2   . DT  I  5 120 ? -41.282 -36.750 4.460  1.00 115.92 ? 46   DT  I OP2   1 
ATOM   8593  O  "O5'" . DT  I  5 120 ? -39.643 -37.805 5.990  1.00 115.35 ? 46   DT  I "O5'" 1 
ATOM   8594  C  "C5'" . DT  I  5 120 ? -38.359 -37.432 6.499  1.00 113.80 ? 46   DT  I "C5'" 1 
ATOM   8595  C  "C4'" . DT  I  5 120 ? -38.443 -36.395 7.610  1.00 112.02 ? 46   DT  I "C4'" 1 
ATOM   8596  O  "O4'" . DT  I  5 120 ? -38.620 -35.057 7.079  1.00 111.63 ? 46   DT  I "O4'" 1 
ATOM   8597  C  "C3'" . DT  I  5 120 ? -39.574 -36.598 8.617  1.00 111.01 ? 46   DT  I "C3'" 1 
ATOM   8598  O  "O3'" . DT  I  5 120 ? -38.974 -36.886 9.856  1.00 109.22 ? 46   DT  I "O3'" 1 
ATOM   8599  C  "C2'" . DT  I  5 120 ? -40.327 -35.266 8.641  1.00 111.14 ? 46   DT  I "C2'" 1 
ATOM   8600  C  "C1'" . DT  I  5 120 ? -39.278 -34.316 8.083  1.00 111.22 ? 46   DT  I "C1'" 1 
ATOM   8601  N  N1    . DT  I  5 120 ? -39.826 -33.050 7.522  1.00 111.25 ? 46   DT  I N1    1 
ATOM   8602  C  C2    . DT  I  5 120 ? -39.609 -31.873 8.214  1.00 111.37 ? 46   DT  I C2    1 
ATOM   8603  O  O2    . DT  I  5 120 ? -38.995 -31.805 9.267  1.00 111.35 ? 46   DT  I O2    1 
ATOM   8604  N  N3    . DT  I  5 120 ? -40.149 -30.757 7.617  1.00 111.50 ? 46   DT  I N3    1 
ATOM   8605  C  C4    . DT  I  5 120 ? -40.868 -30.694 6.430  1.00 111.38 ? 46   DT  I C4    1 
ATOM   8606  O  O4    . DT  I  5 120 ? -41.307 -29.631 5.994  1.00 111.13 ? 46   DT  I O4    1 
ATOM   8607  C  C5    . DT  I  5 120 ? -41.058 -31.962 5.755  1.00 111.47 ? 46   DT  I C5    1 
ATOM   8608  C  C7    . DT  I  5 120 ? -41.821 -32.035 4.462  1.00 111.25 ? 46   DT  I C7    1 
ATOM   8609  C  C6    . DT  I  5 120 ? -40.535 -33.062 6.328  1.00 111.63 ? 46   DT  I C6    1 
ATOM   8610  P  P     . DT  I  5 121 ? -39.806 -37.422 11.111 1.00 108.55 ? 47   DT  I P     1 
ATOM   8611  O  OP1   . DT  I  5 121 ? -38.901 -38.379 11.791 1.00 108.80 ? 47   DT  I OP1   1 
ATOM   8612  O  OP2   . DT  I  5 121 ? -41.173 -37.831 10.709 1.00 107.83 ? 47   DT  I OP2   1 
ATOM   8613  O  "O5'" . DT  I  5 121 ? -39.971 -36.111 12.018 1.00 107.48 ? 47   DT  I "O5'" 1 
ATOM   8614  C  "C5'" . DT  I  5 121 ? -38.901 -35.176 12.222 1.00 104.99 ? 47   DT  I "C5'" 1 
ATOM   8615  C  "C4'" . DT  I  5 121 ? -39.378 -33.982 13.029 1.00 103.13 ? 47   DT  I "C4'" 1 
ATOM   8616  O  "O4'" . DT  I  5 121 ? -39.790 -32.922 12.129 1.00 103.38 ? 47   DT  I "O4'" 1 
ATOM   8617  C  "C3'" . DT  I  5 121 ? -40.569 -34.247 13.949 1.00 102.18 ? 47   DT  I "C3'" 1 
ATOM   8618  O  "O3'" . DT  I  5 121 ? -40.345 -33.641 15.193 1.00 99.88  ? 47   DT  I "O3'" 1 
ATOM   8619  C  "C2'" . DT  I  5 121 ? -41.739 -33.552 13.261 1.00 103.04 ? 47   DT  I "C2'" 1 
ATOM   8620  C  "C1'" . DT  I  5 121 ? -41.033 -32.399 12.558 1.00 103.78 ? 47   DT  I "C1'" 1 
ATOM   8621  N  N1    . DT  I  5 121 ? -41.778 -31.870 11.375 1.00 104.27 ? 47   DT  I N1    1 
ATOM   8622  C  C2    . DT  I  5 121 ? -41.909 -30.504 11.190 1.00 104.27 ? 47   DT  I C2    1 
ATOM   8623  O  O2    . DT  I  5 121 ? -41.451 -29.662 11.942 1.00 103.98 ? 47   DT  I O2    1 
ATOM   8624  N  N3    . DT  I  5 121 ? -42.613 -30.153 10.064 1.00 104.55 ? 47   DT  I N3    1 
ATOM   8625  C  C4    . DT  I  5 121 ? -43.187 -31.001 9.125  1.00 104.28 ? 47   DT  I C4    1 
ATOM   8626  O  O4    . DT  I  5 121 ? -43.798 -30.565 8.151  1.00 104.03 ? 47   DT  I O4    1 
ATOM   8627  C  C5    . DT  I  5 121 ? -43.012 -32.415 9.380  1.00 104.27 ? 47   DT  I C5    1 
ATOM   8628  C  C7    . DT  I  5 121 ? -43.575 -33.455 8.455  1.00 104.37 ? 47   DT  I C7    1 
ATOM   8629  C  C6    . DT  I  5 121 ? -42.329 -32.772 10.475 1.00 104.43 ? 47   DT  I C6    1 
ATOM   8630  P  P     . DG  I  5 122 ? -40.244 -34.468 16.554 1.00 97.90  ? 48   DG  I P     1 
ATOM   8631  O  OP1   . DG  I  5 122 ? -38.995 -35.262 16.549 1.00 97.82  ? 48   DG  I OP1   1 
ATOM   8632  O  OP2   . DG  I  5 122 ? -41.538 -35.122 16.823 1.00 97.74  ? 48   DG  I OP2   1 
ATOM   8633  O  "O5'" . DG  I  5 122 ? -40.078 -33.255 17.582 1.00 97.23  ? 48   DG  I "O5'" 1 
ATOM   8634  C  "C5'" . DG  I  5 122 ? -39.089 -32.245 17.340 1.00 95.21  ? 48   DG  I "C5'" 1 
ATOM   8635  C  "C4'" . DG  I  5 122 ? -39.616 -30.853 17.645 1.00 93.75  ? 48   DG  I "C4'" 1 
ATOM   8636  O  "O4'" . DG  I  5 122 ? -40.513 -30.391 16.602 1.00 94.45  ? 48   DG  I "O4'" 1 
ATOM   8637  C  "C3'" . DG  I  5 122 ? -40.373 -30.700 18.957 1.00 92.49  ? 48   DG  I "C3'" 1 
ATOM   8638  O  "O3'" . DG  I  5 122 ? -39.924 -29.497 19.528 1.00 89.98  ? 48   DG  I "O3'" 1 
ATOM   8639  C  "C2'" . DG  I  5 122 ? -41.849 -30.640 18.559 1.00 93.48  ? 48   DG  I "C2'" 1 
ATOM   8640  C  "C1'" . DG  I  5 122 ? -41.801 -30.109 17.129 1.00 95.29  ? 48   DG  I "C1'" 1 
ATOM   8641  N  N9    . DG  I  5 122 ? -42.806 -30.674 16.222 1.00 95.71  ? 48   DG  I N9    1 
ATOM   8642  C  C8    . DG  I  5 122 ? -43.348 -31.939 16.224 1.00 95.71  ? 48   DG  I C8    1 
ATOM   8643  N  N7    . DG  I  5 122 ? -44.224 -32.134 15.277 1.00 95.84  ? 48   DG  I N7    1 
ATOM   8644  C  C5    . DG  I  5 122 ? -44.267 -30.925 14.591 1.00 96.04  ? 48   DG  I C5    1 
ATOM   8645  C  C6    . DG  I  5 122 ? -45.032 -30.520 13.459 1.00 95.98  ? 48   DG  I C6    1 
ATOM   8646  O  O6    . DG  I  5 122 ? -45.862 -31.176 12.809 1.00 95.83  ? 48   DG  I O6    1 
ATOM   8647  N  N1    . DG  I  5 122 ? -44.769 -29.197 13.096 1.00 95.61  ? 48   DG  I N1    1 
ATOM   8648  C  C2    . DG  I  5 122 ? -43.877 -28.371 13.743 1.00 95.74  ? 48   DG  I C2    1 
ATOM   8649  N  N2    . DG  I  5 122 ? -43.740 -27.125 13.274 1.00 95.87  ? 48   DG  I N2    1 
ATOM   8650  N  N3    . DG  I  5 122 ? -43.156 -28.739 14.792 1.00 96.14  ? 48   DG  I N3    1 
ATOM   8651  C  C4    . DG  I  5 122 ? -43.397 -30.021 15.163 1.00 96.02  ? 48   DG  I C4    1 
ATOM   8652  P  P     . DG  I  5 123 ? -40.406 -28.991 20.957 1.00 87.90  ? 49   DG  I P     1 
ATOM   8653  O  OP1   . DG  I  5 123 ? -39.186 -28.508 21.626 1.00 87.93  ? 49   DG  I OP1   1 
ATOM   8654  O  OP2   . DG  I  5 123 ? -41.258 -30.001 21.612 1.00 88.12  ? 49   DG  I OP2   1 
ATOM   8655  O  "O5'" . DG  I  5 123 ? -41.363 -27.763 20.604 1.00 89.54  ? 49   DG  I "O5'" 1 
ATOM   8656  C  "C5'" . DG  I  5 123 ? -40.900 -26.581 19.940 1.00 90.78  ? 49   DG  I "C5'" 1 
ATOM   8657  C  "C4'" . DG  I  5 123 ? -42.085 -25.733 19.501 1.00 92.17  ? 49   DG  I "C4'" 1 
ATOM   8658  O  "O4'" . DG  I  5 123 ? -42.819 -26.431 18.461 1.00 92.37  ? 49   DG  I "O4'" 1 
ATOM   8659  C  "C3'" . DG  I  5 123 ? -43.107 -25.387 20.586 1.00 93.19  ? 49   DG  I "C3'" 1 
ATOM   8660  O  "O3'" . DG  I  5 123 ? -43.395 -23.986 20.552 1.00 94.90  ? 49   DG  I "O3'" 1 
ATOM   8661  C  "C2'" . DG  I  5 123 ? -44.325 -26.234 20.224 1.00 93.03  ? 49   DG  I "C2'" 1 
ATOM   8662  C  "C1'" . DG  I  5 123 ? -44.197 -26.291 18.710 1.00 92.96  ? 49   DG  I "C1'" 1 
ATOM   8663  N  N9    . DG  I  5 123 ? -44.913 -27.397 18.080 1.00 93.27  ? 49   DG  I N9    1 
ATOM   8664  C  C8    . DG  I  5 123 ? -45.009 -28.707 18.495 1.00 93.19  ? 49   DG  I C8    1 
ATOM   8665  N  N7    . DG  I  5 123 ? -45.732 -29.454 17.708 1.00 92.94  ? 49   DG  I N7    1 
ATOM   8666  C  C5    . DG  I  5 123 ? -46.144 -28.584 16.704 1.00 93.27  ? 49   DG  I C5    1 
ATOM   8667  C  C6    . DG  I  5 123 ? -46.953 -28.808 15.559 1.00 93.33  ? 49   DG  I C6    1 
ATOM   8668  O  O6    . DG  I  5 123 ? -47.487 -29.870 15.193 1.00 93.38  ? 49   DG  I O6    1 
ATOM   8669  N  N1    . DG  I  5 123 ? -47.123 -27.643 14.799 1.00 93.24  ? 49   DG  I N1    1 
ATOM   8670  C  C2    . DG  I  5 123 ? -46.579 -26.413 15.102 1.00 93.31  ? 49   DG  I C2    1 
ATOM   8671  N  N2    . DG  I  5 123 ? -46.841 -25.399 14.264 1.00 93.12  ? 49   DG  I N2    1 
ATOM   8672  N  N3    . DG  I  5 123 ? -45.822 -26.194 16.170 1.00 93.79  ? 49   DG  I N3    1 
ATOM   8673  C  C4    . DG  I  5 123 ? -45.646 -27.316 16.921 1.00 93.54  ? 49   DG  I C4    1 
ATOM   8674  P  P     . DT  I  5 124 ? -44.327 -23.245 21.637 1.00 96.65  ? 50   DT  I P     1 
ATOM   8675  O  OP1   . DT  I  5 124 ? -43.620 -22.004 22.027 1.00 96.18  ? 50   DT  I OP1   1 
ATOM   8676  O  OP2   . DT  I  5 124 ? -44.811 -24.197 22.668 1.00 95.16  ? 50   DT  I OP2   1 
ATOM   8677  O  "O5'" . DT  I  5 124 ? -45.608 -22.842 20.772 1.00 99.46  ? 50   DT  I "O5'" 1 
ATOM   8678  C  "C5'" . DT  I  5 124 ? -45.502 -22.229 19.487 1.00 102.97 ? 50   DT  I "C5'" 1 
ATOM   8679  C  "C4'" . DT  I  5 124 ? -46.856 -22.244 18.801 1.00 105.61 ? 50   DT  I "C4'" 1 
ATOM   8680  O  "O4'" . DT  I  5 124 ? -47.132 -23.579 18.311 1.00 105.65 ? 50   DT  I "O4'" 1 
ATOM   8681  C  "C3'" . DT  I  5 124 ? -48.018 -21.851 19.714 1.00 107.91 ? 50   DT  I "C3'" 1 
ATOM   8682  O  "O3'" . DT  I  5 124 ? -48.736 -20.734 19.155 1.00 111.48 ? 50   DT  I "O3'" 1 
ATOM   8683  C  "C2'" . DT  I  5 124 ? -48.854 -23.128 19.833 1.00 106.93 ? 50   DT  I "C2'" 1 
ATOM   8684  C  "C1'" . DT  I  5 124 ? -48.479 -23.898 18.575 1.00 106.33 ? 50   DT  I "C1'" 1 
ATOM   8685  N  N1    . DT  I  5 124 ? -48.627 -25.385 18.706 1.00 106.45 ? 50   DT  I N1    1 
ATOM   8686  C  C2    . DT  I  5 124 ? -49.035 -26.131 17.611 1.00 106.48 ? 50   DT  I C2    1 
ATOM   8687  O  O2    . DT  I  5 124 ? -49.284 -25.652 16.517 1.00 106.56 ? 50   DT  I O2    1 
ATOM   8688  N  N3    . DT  I  5 124 ? -49.144 -27.482 17.843 1.00 106.23 ? 50   DT  I N3    1 
ATOM   8689  C  C4    . DT  I  5 124 ? -48.894 -28.150 19.032 1.00 106.46 ? 50   DT  I C4    1 
ATOM   8690  O  O4    . DT  I  5 124 ? -49.024 -29.369 19.126 1.00 106.54 ? 50   DT  I O4    1 
ATOM   8691  C  C5    . DT  I  5 124 ? -48.472 -27.315 20.140 1.00 106.65 ? 50   DT  I C5    1 
ATOM   8692  C  C7    . DT  I  5 124 ? -48.168 -27.908 21.488 1.00 106.48 ? 50   DT  I C7    1 
ATOM   8693  C  C6    . DT  I  5 124 ? -48.363 -25.993 19.925 1.00 106.60 ? 50   DT  I C6    1 
ATOM   8694  P  P     . DA  I  5 125 ? -49.936 -19.977 19.918 1.00 114.30 ? 51   DA  I P     1 
ATOM   8695  O  OP1   . DA  I  5 125 ? -49.589 -18.537 19.963 1.00 114.00 ? 51   DA  I OP1   1 
ATOM   8696  O  OP2   . DA  I  5 125 ? -50.257 -20.697 21.178 1.00 113.82 ? 51   DA  I OP2   1 
ATOM   8697  O  "O5'" . DA  I  5 125 ? -51.182 -20.158 18.914 1.00 116.46 ? 51   DA  I "O5'" 1 
ATOM   8698  C  "C5'" . DA  I  5 125 ? -51.226 -21.197 17.922 1.00 119.86 ? 51   DA  I "C5'" 1 
ATOM   8699  C  "C4'" . DA  I  5 125 ? -52.608 -21.815 17.755 1.00 122.46 ? 51   DA  I "C4'" 1 
ATOM   8700  O  "O4'" . DA  I  5 125 ? -52.493 -23.256 17.615 1.00 122.34 ? 51   DA  I "O4'" 1 
ATOM   8701  C  "C3'" . DA  I  5 125 ? -53.628 -21.593 18.875 1.00 124.52 ? 51   DA  I "C3'" 1 
ATOM   8702  O  "O3'" . DA  I  5 125 ? -54.928 -21.465 18.284 1.00 127.93 ? 51   DA  I "O3'" 1 
ATOM   8703  C  "C2'" . DA  I  5 125 ? -53.515 -22.890 19.673 1.00 123.81 ? 51   DA  I "C2'" 1 
ATOM   8704  C  "C1'" . DA  I  5 125 ? -53.417 -23.859 18.499 1.00 123.00 ? 51   DA  I "C1'" 1 
ATOM   8705  N  N9    . DA  I  5 125 ? -52.967 -25.217 18.791 1.00 123.14 ? 51   DA  I N9    1 
ATOM   8706  C  C8    . DA  I  5 125 ? -52.210 -25.659 19.844 1.00 123.03 ? 51   DA  I C8    1 
ATOM   8707  N  N7    . DA  I  5 125 ? -51.971 -26.950 19.811 1.00 123.02 ? 51   DA  I N7    1 
ATOM   8708  C  C5    . DA  I  5 125 ? -52.613 -27.384 18.660 1.00 122.92 ? 51   DA  I C5    1 
ATOM   8709  C  C6    . DA  I  5 125 ? -52.744 -28.650 18.049 1.00 122.88 ? 51   DA  I C6    1 
ATOM   8710  N  N6    . DA  I  5 125 ? -52.202 -29.765 18.550 1.00 123.05 ? 51   DA  I N6    1 
ATOM   8711  N  N1    . DA  I  5 125 ? -53.455 -28.734 16.900 1.00 122.92 ? 51   DA  I N1    1 
ATOM   8712  C  C2    . DA  I  5 125 ? -54.006 -27.622 16.391 1.00 122.98 ? 51   DA  I C2    1 
ATOM   8713  N  N3    . DA  I  5 125 ? -53.948 -26.379 16.872 1.00 123.07 ? 51   DA  I N3    1 
ATOM   8714  C  C4    . DA  I  5 125 ? -53.233 -26.326 18.017 1.00 123.14 ? 51   DA  I C4    1 
ATOM   8715  P  P     . DG  I  5 126 ? -55.916 -20.220 18.517 1.00 130.39 ? 52   DG  I P     1 
ATOM   8716  O  OP1   . DG  I  5 126 ? -56.788 -20.151 17.322 1.00 130.50 ? 52   DG  I OP1   1 
ATOM   8717  O  OP2   . DG  I  5 126 ? -55.113 -19.030 18.886 1.00 130.37 ? 52   DG  I OP2   1 
ATOM   8718  O  "O5'" . DG  I  5 126 ? -56.813 -20.641 19.784 1.00 131.39 ? 52   DG  I "O5'" 1 
ATOM   8719  C  "C5'" . DG  I  5 126 ? -57.200 -21.996 20.049 1.00 133.51 ? 52   DG  I "C5'" 1 
ATOM   8720  C  "C4'" . DG  I  5 126 ? -58.086 -22.597 18.961 1.00 135.02 ? 52   DG  I "C4'" 1 
ATOM   8721  O  "O4'" . DG  I  5 126 ? -57.410 -23.738 18.367 1.00 135.27 ? 52   DG  I "O4'" 1 
ATOM   8722  C  "C3'" . DG  I  5 126 ? -59.438 -23.126 19.433 1.00 136.03 ? 52   DG  I "C3'" 1 
ATOM   8723  O  "O3'" . DG  I  5 126 ? -60.432 -23.056 18.394 1.00 136.90 ? 52   DG  I "O3'" 1 
ATOM   8724  C  "C2'" . DG  I  5 126 ? -59.106 -24.571 19.788 1.00 135.94 ? 52   DG  I "C2'" 1 
ATOM   8725  C  "C1'" . DG  I  5 126 ? -58.058 -24.939 18.744 1.00 135.67 ? 52   DG  I "C1'" 1 
ATOM   8726  N  N9    . DG  I  5 126 ? -57.103 -25.874 19.322 1.00 135.69 ? 52   DG  I N9    1 
ATOM   8727  C  C8    . DG  I  5 126 ? -56.109 -25.588 20.230 1.00 135.77 ? 52   DG  I C8    1 
ATOM   8728  N  N7    . DG  I  5 126 ? -55.417 -26.633 20.588 1.00 135.87 ? 52   DG  I N7    1 
ATOM   8729  C  C5    . DG  I  5 126 ? -55.994 -27.681 19.878 1.00 135.83 ? 52   DG  I C5    1 
ATOM   8730  C  C6    . DG  I  5 126 ? -55.668 -29.062 19.859 1.00 135.73 ? 52   DG  I C6    1 
ATOM   8731  O  O6    . DG  I  5 126 ? -54.772 -29.639 20.488 1.00 135.61 ? 52   DG  I O6    1 
ATOM   8732  N  N1    . DG  I  5 126 ? -56.503 -29.791 19.006 1.00 135.80 ? 52   DG  I N1    1 
ATOM   8733  C  C2    . DG  I  5 126 ? -57.528 -29.245 18.259 1.00 135.79 ? 52   DG  I C2    1 
ATOM   8734  N  N2    . DG  I  5 126 ? -58.228 -30.094 17.492 1.00 135.72 ? 52   DG  I N2    1 
ATOM   8735  N  N3    . DG  I  5 126 ? -57.844 -27.951 18.269 1.00 135.72 ? 52   DG  I N3    1 
ATOM   8736  C  C4    . DG  I  5 126 ? -57.040 -27.230 19.097 1.00 135.72 ? 52   DG  I C4    1 
ATOM   8737  P  P     . DT  I  5 127 ? -61.937 -23.584 18.618 1.00 137.24 ? 53   DT  I P     1 
ATOM   8738  O  OP1   . DT  I  5 127 ? -62.678 -23.284 17.369 1.00 137.30 ? 53   DT  I OP1   1 
ATOM   8739  O  OP2   . DT  I  5 127 ? -62.416 -23.056 19.918 1.00 137.05 ? 53   DT  I OP2   1 
ATOM   8740  O  "O5'" . DT  I  5 127 ? -61.787 -25.176 18.792 1.00 137.32 ? 53   DT  I "O5'" 1 
ATOM   8741  C  "C5'" . DT  I  5 127 ? -62.124 -26.111 17.759 1.00 136.99 ? 53   DT  I "C5'" 1 
ATOM   8742  C  "C4'" . DT  I  5 127 ? -62.513 -27.459 18.351 1.00 136.76 ? 53   DT  I "C4'" 1 
ATOM   8743  O  "O4'" . DT  I  5 127 ? -61.333 -28.137 18.856 1.00 136.32 ? 53   DT  I "O4'" 1 
ATOM   8744  C  "C3'" . DT  I  5 127 ? -63.511 -27.407 19.509 1.00 136.90 ? 53   DT  I "C3'" 1 
ATOM   8745  O  "O3'" . DT  I  5 127 ? -64.545 -28.381 19.308 1.00 137.35 ? 53   DT  I "O3'" 1 
ATOM   8746  C  "C2'" . DT  I  5 127 ? -62.650 -27.706 20.734 1.00 136.52 ? 53   DT  I "C2'" 1 
ATOM   8747  C  "C1'" . DT  I  5 127 ? -61.591 -28.633 20.153 1.00 136.02 ? 53   DT  I "C1'" 1 
ATOM   8748  N  N1    . DT  I  5 127 ? -60.320 -28.653 20.947 1.00 136.02 ? 53   DT  I N1    1 
ATOM   8749  C  C2    . DT  I  5 127 ? -59.547 -29.803 20.999 1.00 135.76 ? 53   DT  I C2    1 
ATOM   8750  O  O2    . DT  I  5 127 ? -59.821 -30.843 20.423 1.00 135.70 ? 53   DT  I O2    1 
ATOM   8751  N  N3    . DT  I  5 127 ? -58.410 -29.686 21.766 1.00 135.71 ? 53   DT  I N3    1 
ATOM   8752  C  C4    . DT  I  5 127 ? -57.976 -28.571 22.471 1.00 135.81 ? 53   DT  I C4    1 
ATOM   8753  O  O4    . DT  I  5 127 ? -56.937 -28.586 23.123 1.00 135.79 ? 53   DT  I O4    1 
ATOM   8754  C  C5    . DT  I  5 127 ? -58.828 -27.404 22.378 1.00 135.80 ? 53   DT  I C5    1 
ATOM   8755  C  C7    . DT  I  5 127 ? -58.481 -26.128 23.090 1.00 135.70 ? 53   DT  I C7    1 
ATOM   8756  C  C6    . DT  I  5 127 ? -59.939 -27.506 21.633 1.00 136.07 ? 53   DT  I C6    1 
ATOM   8757  P  P     . DA  I  5 128 ? -65.568 -28.831 20.465 1.00 137.39 ? 54   DA  I P     1 
ATOM   8758  O  OP1   . DA  I  5 128 ? -66.833 -29.222 19.804 1.00 137.52 ? 54   DA  I OP1   1 
ATOM   8759  O  OP2   . DA  I  5 128 ? -65.596 -27.792 21.523 1.00 137.29 ? 54   DA  I OP2   1 
ATOM   8760  O  "O5'" . DA  I  5 128 ? -64.876 -30.149 21.056 1.00 137.29 ? 54   DA  I "O5'" 1 
ATOM   8761  C  "C5'" . DA  I  5 128 ? -64.579 -31.258 20.199 1.00 137.16 ? 54   DA  I "C5'" 1 
ATOM   8762  C  "C4'" . DA  I  5 128 ? -64.273 -32.515 20.999 1.00 137.03 ? 54   DA  I "C4'" 1 
ATOM   8763  O  "O4'" . DA  I  5 128 ? -62.930 -32.441 21.550 1.00 136.96 ? 54   DA  I "O4'" 1 
ATOM   8764  C  "C3'" . DA  I  5 128 ? -65.221 -32.802 22.163 1.00 136.96 ? 54   DA  I "C3'" 1 
ATOM   8765  O  "O3'" . DA  I  5 128 ? -65.641 -34.174 22.096 1.00 137.06 ? 54   DA  I "O3'" 1 
ATOM   8766  C  "C2'" . DA  I  5 128 ? -64.389 -32.482 23.405 1.00 136.83 ? 54   DA  I "C2'" 1 
ATOM   8767  C  "C1'" . DA  I  5 128 ? -62.954 -32.711 22.938 1.00 136.60 ? 54   DA  I "C1'" 1 
ATOM   8768  N  N9    . DA  I  5 128 ? -61.990 -31.839 23.610 1.00 136.54 ? 54   DA  I N9    1 
ATOM   8769  C  C8    . DA  I  5 128 ? -62.075 -30.478 23.756 1.00 136.43 ? 54   DA  I C8    1 
ATOM   8770  N  N7    . DA  I  5 128 ? -61.071 -29.945 24.411 1.00 136.44 ? 54   DA  I N7    1 
ATOM   8771  C  C5    . DA  I  5 128 ? -60.265 -31.030 24.718 1.00 136.49 ? 54   DA  I C5    1 
ATOM   8772  C  C6    . DA  I  5 128 ? -59.035 -31.139 25.406 1.00 136.33 ? 54   DA  I C6    1 
ATOM   8773  N  N6    . DA  I  5 128 ? -58.389 -30.092 25.925 1.00 136.27 ? 54   DA  I N6    1 
ATOM   8774  N  N1    . DA  I  5 128 ? -58.493 -32.370 25.542 1.00 136.34 ? 54   DA  I N1    1 
ATOM   8775  C  C2    . DA  I  5 128 ? -59.139 -33.424 25.023 1.00 136.38 ? 54   DA  I C2    1 
ATOM   8776  N  N3    . DA  I  5 128 ? -60.297 -33.447 24.356 1.00 136.33 ? 54   DA  I N3    1 
ATOM   8777  C  C4    . DA  I  5 128 ? -60.815 -32.208 24.233 1.00 136.48 ? 54   DA  I C4    1 
ATOM   8778  P  P     . DT  I  5 129 ? -66.537 -34.905 23.217 1.00 136.85 ? 55   DT  I P     1 
ATOM   8779  O  OP1   . DT  I  5 129 ? -67.355 -35.939 22.538 1.00 136.88 ? 55   DT  I OP1   1 
ATOM   8780  O  OP2   . DT  I  5 129 ? -67.198 -33.884 24.070 1.00 136.69 ? 55   DT  I OP2   1 
ATOM   8781  O  "O5'" . DT  I  5 129 ? -65.420 -35.653 24.082 1.00 135.60 ? 55   DT  I "O5'" 1 
ATOM   8782  C  "C5'" . DT  I  5 129 ? -64.578 -36.614 23.456 1.00 133.80 ? 55   DT  I "C5'" 1 
ATOM   8783  C  "C4'" . DT  I  5 129 ? -63.590 -37.157 24.465 1.00 132.47 ? 55   DT  I "C4'" 1 
ATOM   8784  O  "O4'" . DT  I  5 129 ? -62.746 -36.075 24.933 1.00 131.93 ? 55   DT  I "O4'" 1 
ATOM   8785  C  "C3'" . DT  I  5 129 ? -64.224 -37.791 25.702 1.00 131.69 ? 55   DT  I "C3'" 1 
ATOM   8786  O  "O3'" . DT  I  5 129 ? -63.585 -39.052 25.905 1.00 130.80 ? 55   DT  I "O3'" 1 
ATOM   8787  C  "C2'" . DT  I  5 129 ? -63.954 -36.769 26.810 1.00 131.51 ? 55   DT  I "C2'" 1 
ATOM   8788  C  "C1'" . DT  I  5 129 ? -62.638 -36.154 26.340 1.00 131.49 ? 55   DT  I "C1'" 1 
ATOM   8789  N  N1    . DT  I  5 129 ? -62.301 -34.786 26.881 1.00 131.39 ? 55   DT  I N1    1 
ATOM   8790  C  C2    . DT  I  5 129 ? -61.066 -34.579 27.483 1.00 131.17 ? 55   DT  I C2    1 
ATOM   8791  O  O2    . DT  I  5 129 ? -60.214 -35.443 27.613 1.00 130.95 ? 55   DT  I O2    1 
ATOM   8792  N  N3    . DT  I  5 129 ? -60.855 -33.295 27.932 1.00 131.11 ? 55   DT  I N3    1 
ATOM   8793  C  C4    . DT  I  5 129 ? -61.728 -32.219 27.847 1.00 131.15 ? 55   DT  I C4    1 
ATOM   8794  O  O4    . DT  I  5 129 ? -61.435 -31.110 28.287 1.00 130.94 ? 55   DT  I O4    1 
ATOM   8795  C  C5    . DT  I  5 129 ? -62.998 -32.500 27.208 1.00 131.12 ? 55   DT  I C5    1 
ATOM   8796  C  C7    . DT  I  5 129 ? -64.033 -31.424 27.052 1.00 131.21 ? 55   DT  I C7    1 
ATOM   8797  C  C6    . DT  I  5 129 ? -63.217 -33.749 26.762 1.00 131.29 ? 55   DT  I C6    1 
ATOM   8798  P  P     . DC  I  5 130 ? -64.051 -40.144 26.987 1.00 130.21 ? 56   DC  I P     1 
ATOM   8799  O  OP1   . DC  I  5 130 ? -64.546 -41.321 26.234 1.00 129.99 ? 56   DC  I OP1   1 
ATOM   8800  O  OP2   . DC  I  5 130 ? -64.913 -39.500 28.011 1.00 130.00 ? 56   DC  I OP2   1 
ATOM   8801  O  "O5'" . DC  I  5 130 ? -62.663 -40.557 27.687 1.00 128.86 ? 56   DC  I "O5'" 1 
ATOM   8802  C  "C5'" . DC  I  5 130 ? -61.510 -39.681 27.690 1.00 125.82 ? 56   DC  I "C5'" 1 
ATOM   8803  C  "C4'" . DC  I  5 130 ? -60.965 -39.380 29.086 1.00 123.14 ? 56   DC  I "C4'" 1 
ATOM   8804  O  "O4'" . DC  I  5 130 ? -60.917 -37.940 29.291 1.00 122.27 ? 56   DC  I "O4'" 1 
ATOM   8805  C  "C3'" . DC  I  5 130 ? -61.746 -39.938 30.280 1.00 121.40 ? 56   DC  I "C3'" 1 
ATOM   8806  O  "O3'" . DC  I  5 130 ? -60.854 -40.383 31.286 1.00 119.11 ? 56   DC  I "O3'" 1 
ATOM   8807  C  "C2'" . DC  I  5 130 ? -62.492 -38.711 30.780 1.00 121.50 ? 56   DC  I "C2'" 1 
ATOM   8808  C  "C1'" . DC  I  5 130 ? -61.377 -37.691 30.602 1.00 121.71 ? 56   DC  I "C1'" 1 
ATOM   8809  N  N1    . DC  I  5 130 ? -61.777 -36.262 30.765 1.00 121.79 ? 56   DC  I N1    1 
ATOM   8810  C  C2    . DC  I  5 130 ? -60.934 -35.377 31.466 1.00 121.69 ? 56   DC  I C2    1 
ATOM   8811  O  O2    . DC  I  5 130 ? -59.861 -35.779 31.941 1.00 121.42 ? 56   DC  I O2    1 
ATOM   8812  N  N3    . DC  I  5 130 ? -61.325 -34.083 31.601 1.00 121.68 ? 56   DC  I N3    1 
ATOM   8813  C  C4    . DC  I  5 130 ? -62.486 -33.666 31.082 1.00 121.76 ? 56   DC  I C4    1 
ATOM   8814  N  N4    . DC  I  5 130 ? -62.821 -32.383 31.247 1.00 121.61 ? 56   DC  I N4    1 
ATOM   8815  C  C5    . DC  I  5 130 ? -63.357 -34.548 30.370 1.00 121.75 ? 56   DC  I C5    1 
ATOM   8816  C  C6    . DC  I  5 130 ? -62.963 -35.822 30.238 1.00 121.88 ? 56   DC  I C6    1 
ATOM   8817  P  P     . DT  I  5 131 ? -60.527 -41.931 31.501 1.00 117.37 ? 57   DT  I P     1 
ATOM   8818  O  OP1   . DT  I  5 131 ? -59.860 -42.444 30.280 1.00 117.38 ? 57   DT  I OP1   1 
ATOM   8819  O  OP2   . DT  I  5 131 ? -61.747 -42.580 32.029 1.00 117.43 ? 57   DT  I OP2   1 
ATOM   8820  O  "O5'" . DT  I  5 131 ? -59.465 -41.906 32.702 1.00 115.55 ? 57   DT  I "O5'" 1 
ATOM   8821  C  "C5'" . DT  I  5 131 ? -58.262 -41.129 32.628 1.00 111.55 ? 57   DT  I "C5'" 1 
ATOM   8822  C  "C4'" . DT  I  5 131 ? -57.956 -40.430 33.945 1.00 108.34 ? 57   DT  I "C4'" 1 
ATOM   8823  O  "O4'" . DT  I  5 131 ? -58.588 -39.123 33.966 1.00 107.98 ? 57   DT  I "O4'" 1 
ATOM   8824  C  "C3'" . DT  I  5 131 ? -58.417 -41.121 35.227 1.00 106.26 ? 57   DT  I "C3'" 1 
ATOM   8825  O  "O3'" . DT  I  5 131 ? -57.401 -40.945 36.194 1.00 103.10 ? 57   DT  I "O3'" 1 
ATOM   8826  C  "C2'" . DT  I  5 131 ? -59.675 -40.343 35.613 1.00 106.92 ? 57   DT  I "C2'" 1 
ATOM   8827  C  "C1'" . DT  I  5 131 ? -59.222 -38.940 35.217 1.00 107.69 ? 57   DT  I "C1'" 1 
ATOM   8828  N  N1    . DT  I  5 131 ? -60.271 -37.887 35.042 1.00 107.54 ? 57   DT  I N1    1 
ATOM   8829  C  C2    . DT  I  5 131 ? -59.939 -36.573 35.313 1.00 107.87 ? 57   DT  I C2    1 
ATOM   8830  O  O2    . DT  I  5 131 ? -58.840 -36.214 35.703 1.00 107.66 ? 57   DT  I O2    1 
ATOM   8831  N  N3    . DT  I  5 131 ? -60.962 -35.674 35.113 1.00 108.44 ? 57   DT  I N3    1 
ATOM   8832  C  C4    . DT  I  5 131 ? -62.253 -35.946 34.673 1.00 108.11 ? 57   DT  I C4    1 
ATOM   8833  O  O4    . DT  I  5 131 ? -63.093 -35.059 34.530 1.00 107.68 ? 57   DT  I O4    1 
ATOM   8834  C  C5    . DT  I  5 131 ? -62.530 -37.343 34.404 1.00 108.08 ? 57   DT  I C5    1 
ATOM   8835  C  C7    . DT  I  5 131 ? -63.888 -37.780 33.930 1.00 107.95 ? 57   DT  I C7    1 
ATOM   8836  C  C6    . DT  I  5 131 ? -61.538 -38.229 34.596 1.00 107.88 ? 57   DT  I C6    1 
ATOM   8837  P  P     . DG  I  5 132 ? -56.441 -42.145 36.624 1.00 100.34 ? 58   DG  I P     1 
ATOM   8838  O  OP1   . DG  I  5 132 ? -55.816 -42.705 35.408 1.00 100.36 ? 58   DG  I OP1   1 
ATOM   8839  O  OP2   . DG  I  5 132 ? -57.218 -43.001 37.546 1.00 100.50 ? 58   DG  I OP2   1 
ATOM   8840  O  "O5'" . DG  I  5 132 ? -55.307 -41.431 37.503 1.00 98.99  ? 58   DG  I "O5'" 1 
ATOM   8841  C  "C5'" . DG  I  5 132 ? -54.612 -40.256 37.057 1.00 95.86  ? 58   DG  I "C5'" 1 
ATOM   8842  C  "C4'" . DG  I  5 132 ? -54.275 -39.316 38.210 1.00 93.29  ? 58   DG  I "C4'" 1 
ATOM   8843  O  "O4'" . DG  I  5 132 ? -55.373 -38.395 38.428 1.00 92.40  ? 58   DG  I "O4'" 1 
ATOM   8844  C  "C3'" . DG  I  5 132 ? -53.980 -39.907 39.585 1.00 92.37  ? 58   DG  I "C3'" 1 
ATOM   8845  O  "O3'" . DG  I  5 132 ? -52.973 -39.079 40.190 1.00 91.33  ? 58   DG  I "O3'" 1 
ATOM   8846  C  "C2'" . DG  I  5 132 ? -55.340 -39.841 40.291 1.00 92.50  ? 58   DG  I "C2'" 1 
ATOM   8847  C  "C1'" . DG  I  5 132 ? -55.983 -38.592 39.689 1.00 92.38  ? 58   DG  I "C1'" 1 
ATOM   8848  N  N9    . DG  I  5 132 ? -57.404 -38.664 39.364 1.00 92.63  ? 58   DG  I N9    1 
ATOM   8849  C  C8    . DG  I  5 132 ? -58.146 -39.780 39.047 1.00 92.63  ? 58   DG  I C8    1 
ATOM   8850  N  N7    . DG  I  5 132 ? -59.392 -39.514 38.771 1.00 92.62  ? 58   DG  I N7    1 
ATOM   8851  C  C5    . DG  I  5 132 ? -59.486 -38.132 38.896 1.00 92.67  ? 58   DG  I C5    1 
ATOM   8852  C  C6    . DG  I  5 132 ? -60.592 -37.256 38.723 1.00 92.65  ? 58   DG  I C6    1 
ATOM   8853  O  O6    . DG  I  5 132 ? -61.755 -37.530 38.403 1.00 92.81  ? 58   DG  I O6    1 
ATOM   8854  N  N1    . DG  I  5 132 ? -60.260 -35.925 38.954 1.00 92.42  ? 58   DG  I N1    1 
ATOM   8855  C  C2    . DG  I  5 132 ? -59.010 -35.487 39.306 1.00 92.64  ? 58   DG  I C2    1 
ATOM   8856  N  N2    . DG  I  5 132 ? -58.865 -34.166 39.487 1.00 92.62  ? 58   DG  I N2    1 
ATOM   8857  N  N3    . DG  I  5 132 ? -57.968 -36.295 39.471 1.00 93.18  ? 58   DG  I N3    1 
ATOM   8858  C  C4    . DG  I  5 132 ? -58.271 -37.599 39.255 1.00 92.60  ? 58   DG  I C4    1 
ATOM   8859  P  P     . DC  I  5 133 ? -52.255 -39.333 41.607 1.00 90.23  ? 59   DC  I P     1 
ATOM   8860  O  OP1   . DC  I  5 133 ? -50.860 -38.864 41.464 1.00 90.83  ? 59   DC  I OP1   1 
ATOM   8861  O  OP2   . DC  I  5 133 ? -52.514 -40.717 42.064 1.00 91.01  ? 59   DC  I OP2   1 
ATOM   8862  O  "O5'" . DC  I  5 133 ? -53.024 -38.348 42.595 1.00 89.90  ? 59   DC  I "O5'" 1 
ATOM   8863  C  "C5'" . DC  I  5 133 ? -53.354 -37.043 42.151 1.00 90.17  ? 59   DC  I "C5'" 1 
ATOM   8864  C  "C4'" . DC  I  5 133 ? -54.330 -36.353 43.085 1.00 90.60  ? 59   DC  I "C4'" 1 
ATOM   8865  O  "O4'" . DC  I  5 133 ? -55.689 -36.577 42.638 1.00 91.71  ? 59   DC  I "O4'" 1 
ATOM   8866  C  "C3'" . DC  I  5 133 ? -54.319 -36.776 44.546 1.00 90.41  ? 59   DC  I "C3'" 1 
ATOM   8867  O  "O3'" . DC  I  5 133 ? -54.582 -35.607 45.296 1.00 89.89  ? 59   DC  I "O3'" 1 
ATOM   8868  C  "C2'" . DC  I  5 133 ? -55.485 -37.762 44.620 1.00 91.28  ? 59   DC  I "C2'" 1 
ATOM   8869  C  "C1'" . DC  I  5 133 ? -56.474 -37.008 43.734 1.00 91.81  ? 59   DC  I "C1'" 1 
ATOM   8870  N  N1    . DC  I  5 133 ? -57.652 -37.741 43.161 1.00 91.81  ? 59   DC  I N1    1 
ATOM   8871  C  C2    . DC  I  5 133 ? -58.735 -36.980 42.681 1.00 92.21  ? 59   DC  I C2    1 
ATOM   8872  O  O2    . DC  I  5 133 ? -58.711 -35.740 42.752 1.00 92.27  ? 59   DC  I O2    1 
ATOM   8873  N  N3    . DC  I  5 133 ? -59.801 -37.629 42.144 1.00 92.40  ? 59   DC  I N3    1 
ATOM   8874  C  C4    . DC  I  5 133 ? -59.811 -38.965 42.073 1.00 92.36  ? 59   DC  I C4    1 
ATOM   8875  N  N4    . DC  I  5 133 ? -60.896 -39.538 41.533 1.00 92.12  ? 59   DC  I N4    1 
ATOM   8876  C  C5    . DC  I  5 133 ? -58.717 -39.761 42.549 1.00 92.01  ? 59   DC  I C5    1 
ATOM   8877  C  C6    . DC  I  5 133 ? -57.669 -39.111 43.077 1.00 91.80  ? 59   DC  I C6    1 
ATOM   8878  P  P     . DA  I  5 134 ? -53.437 -34.877 46.143 1.00 89.66  ? 60   DA  I P     1 
ATOM   8879  O  OP1   . DA  I  5 134 ? -52.271 -34.696 45.247 1.00 89.66  ? 60   DA  I OP1   1 
ATOM   8880  O  OP2   . DA  I  5 134 ? -53.290 -35.632 47.413 1.00 89.09  ? 60   DA  I OP2   1 
ATOM   8881  O  "O5'" . DA  I  5 134 ? -54.072 -33.444 46.498 1.00 89.95  ? 60   DA  I "O5'" 1 
ATOM   8882  C  "C5'" . DA  I  5 134 ? -54.647 -32.621 45.486 1.00 91.25  ? 60   DA  I "C5'" 1 
ATOM   8883  C  "C4'" . DA  I  5 134 ? -55.929 -31.940 45.946 1.00 92.58  ? 60   DA  I "C4'" 1 
ATOM   8884  O  "O4'" . DA  I  5 134 ? -57.092 -32.775 45.721 1.00 92.67  ? 60   DA  I "O4'" 1 
ATOM   8885  C  "C3'" . DA  I  5 134 ? -56.002 -31.530 47.413 1.00 94.07  ? 60   DA  I "C3'" 1 
ATOM   8886  O  "O3'" . DA  I  5 134 ? -56.665 -30.271 47.478 1.00 95.95  ? 60   DA  I "O3'" 1 
ATOM   8887  C  "C2'" . DA  I  5 134 ? -56.817 -32.637 48.077 1.00 93.54  ? 60   DA  I "C2'" 1 
ATOM   8888  C  "C1'" . DA  I  5 134 ? -57.725 -33.119 46.945 1.00 93.13  ? 60   DA  I "C1'" 1 
ATOM   8889  N  N9    . DA  I  5 134 ? -57.920 -34.568 46.884 1.00 93.10  ? 60   DA  I N9    1 
ATOM   8890  C  C8    . DA  I  5 134 ? -57.056 -35.537 47.321 1.00 92.62  ? 60   DA  I C8    1 
ATOM   8891  N  N7    . DA  I  5 134 ? -57.477 -36.756 47.118 1.00 92.37  ? 60   DA  I N7    1 
ATOM   8892  C  C5    . DA  I  5 134 ? -58.698 -36.577 46.494 1.00 92.85  ? 60   DA  I C5    1 
ATOM   8893  C  C6    . DA  I  5 134 ? -59.654 -37.490 46.011 1.00 92.82  ? 60   DA  I C6    1 
ATOM   8894  N  N6    . DA  I  5 134 ? -59.492 -38.810 46.101 1.00 93.02  ? 60   DA  I N6    1 
ATOM   8895  N  N1    . DA  I  5 134 ? -60.772 -36.995 45.436 1.00 92.86  ? 60   DA  I N1    1 
ATOM   8896  C  C2    . DA  I  5 134 ? -60.929 -35.667 45.353 1.00 92.46  ? 60   DA  I C2    1 
ATOM   8897  N  N3    . DA  I  5 134 ? -60.101 -34.710 45.771 1.00 93.01  ? 60   DA  I N3    1 
ATOM   8898  C  C4    . DA  I  5 134 ? -58.992 -35.235 46.335 1.00 93.09  ? 60   DA  I C4    1 
ATOM   8899  P  P     . DG  I  5 135 ? -56.711 -29.408 48.821 1.00 97.01  ? 61   DG  I P     1 
ATOM   8900  O  OP1   . DG  I  5 135 ? -56.708 -27.984 48.423 1.00 97.67  ? 61   DG  I OP1   1 
ATOM   8901  O  OP2   . DG  I  5 135 ? -55.718 -29.917 49.798 1.00 96.37  ? 61   DG  I OP2   1 
ATOM   8902  O  "O5'" . DG  I  5 135 ? -58.159 -29.758 49.374 1.00 98.59  ? 61   DG  I "O5'" 1 
ATOM   8903  C  "C5'" . DG  I  5 135 ? -59.315 -29.619 48.553 1.00 100.31 ? 61   DG  I "C5'" 1 
ATOM   8904  C  "C4'" . DG  I  5 135 ? -60.437 -30.430 49.168 1.00 101.65 ? 61   DG  I "C4'" 1 
ATOM   8905  O  "O4'" . DG  I  5 135 ? -60.214 -31.840 48.911 1.00 101.51 ? 61   DG  I "O4'" 1 
ATOM   8906  C  "C3'" . DG  I  5 135 ? -60.555 -30.307 50.689 1.00 102.87 ? 61   DG  I "C3'" 1 
ATOM   8907  O  "O3'" . DG  I  5 135 ? -61.919 -30.074 51.012 1.00 105.65 ? 61   DG  I "O3'" 1 
ATOM   8908  C  "C2'" . DG  I  5 135 ? -60.062 -31.660 51.209 1.00 101.65 ? 61   DG  I "C2'" 1 
ATOM   8909  C  "C1'" . DG  I  5 135 ? -60.602 -32.526 50.082 1.00 100.60 ? 61   DG  I "C1'" 1 
ATOM   8910  N  N9    . DG  I  5 135 ? -60.154 -33.916 50.026 1.00 100.34 ? 61   DG  I N9    1 
ATOM   8911  C  C8    . DG  I  5 135 ? -58.943 -34.450 50.401 1.00 99.96  ? 61   DG  I C8    1 
ATOM   8912  N  N7    . DG  I  5 135 ? -58.875 -35.739 50.221 1.00 99.72  ? 61   DG  I N7    1 
ATOM   8913  C  C5    . DG  I  5 135 ? -60.118 -36.080 49.695 1.00 99.93  ? 61   DG  I C5    1 
ATOM   8914  C  C6    . DG  I  5 135 ? -60.642 -37.337 49.295 1.00 100.06 ? 61   DG  I C6    1 
ATOM   8915  O  O6    . DG  I  5 135 ? -60.081 -38.437 49.330 1.00 100.00 ? 61   DG  I O6    1 
ATOM   8916  N  N1    . DG  I  5 135 ? -61.953 -37.240 48.815 1.00 100.31 ? 61   DG  I N1    1 
ATOM   8917  C  C2    . DG  I  5 135 ? -62.675 -36.066 48.734 1.00 100.03 ? 61   DG  I C2    1 
ATOM   8918  N  N2    . DG  I  5 135 ? -63.923 -36.150 48.251 1.00 99.86  ? 61   DG  I N2    1 
ATOM   8919  N  N3    . DG  I  5 135 ? -62.194 -34.885 49.105 1.00 99.73  ? 61   DG  I N3    1 
ATOM   8920  C  C4    . DG  I  5 135 ? -60.917 -34.967 49.568 1.00 99.94  ? 61   DG  I C4    1 
ATOM   8921  P  P     . DG  I  5 136 ? -62.357 -29.434 52.416 1.00 108.18 ? 62   DG  I P     1 
ATOM   8922  O  OP1   . DG  I  5 136 ? -62.999 -28.133 52.097 1.00 108.05 ? 62   DG  I OP1   1 
ATOM   8923  O  OP2   . DG  I  5 136 ? -61.212 -29.469 53.361 1.00 107.94 ? 62   DG  I OP2   1 
ATOM   8924  O  "O5'" . DG  I  5 136 ? -63.454 -30.488 52.942 1.00 108.24 ? 62   DG  I "O5'" 1 
ATOM   8925  C  "C5'" . DG  I  5 136 ? -64.840 -30.295 52.665 1.00 108.74 ? 62   DG  I "C5'" 1 
ATOM   8926  C  "C4'" . DG  I  5 136 ? -65.559 -31.603 52.393 1.00 109.39 ? 62   DG  I "C4'" 1 
ATOM   8927  O  "O4'" . DG  I  5 136 ? -64.765 -32.475 51.555 1.00 109.29 ? 62   DG  I "O4'" 1 
ATOM   8928  C  "C3'" . DG  I  5 136 ? -65.828 -32.458 53.615 1.00 110.16 ? 62   DG  I "C3'" 1 
ATOM   8929  O  "O3'" . DG  I  5 136 ? -66.963 -31.971 54.296 1.00 112.08 ? 62   DG  I "O3'" 1 
ATOM   8930  C  "C2'" . DG  I  5 136 ? -66.122 -33.808 52.976 1.00 109.65 ? 62   DG  I "C2'" 1 
ATOM   8931  C  "C1'" . DG  I  5 136 ? -65.146 -33.822 51.805 1.00 108.35 ? 62   DG  I "C1'" 1 
ATOM   8932  N  N9    . DG  I  5 136 ? -63.962 -34.652 52.047 1.00 107.93 ? 62   DG  I N9    1 
ATOM   8933  C  C8    . DG  I  5 136 ? -62.698 -34.223 52.369 1.00 107.64 ? 62   DG  I C8    1 
ATOM   8934  N  N7    . DG  I  5 136 ? -61.839 -35.189 52.521 1.00 107.57 ? 62   DG  I N7    1 
ATOM   8935  C  C5    . DG  I  5 136 ? -62.576 -36.339 52.283 1.00 107.55 ? 62   DG  I C5    1 
ATOM   8936  C  C6    . DG  I  5 136 ? -62.175 -37.698 52.308 1.00 107.57 ? 62   DG  I C6    1 
ATOM   8937  O  O6    . DG  I  5 136 ? -61.050 -38.155 52.548 1.00 107.49 ? 62   DG  I O6    1 
ATOM   8938  N  N1    . DG  I  5 136 ? -63.233 -38.560 52.012 1.00 107.78 ? 62   DG  I N1    1 
ATOM   8939  C  C2    . DG  I  5 136 ? -64.521 -38.155 51.737 1.00 107.65 ? 62   DG  I C2    1 
ATOM   8940  N  N2    . DG  I  5 136 ? -65.405 -39.126 51.479 1.00 107.63 ? 62   DG  I N2    1 
ATOM   8941  N  N3    . DG  I  5 136 ? -64.911 -36.883 51.711 1.00 107.48 ? 62   DG  I N3    1 
ATOM   8942  C  C4    . DG  I  5 136 ? -63.889 -36.029 51.993 1.00 107.72 ? 62   DG  I C4    1 
ATOM   8943  P  P     . DT  I  5 137 ? -67.081 -32.176 55.874 1.00 113.59 ? 63   DT  I P     1 
ATOM   8944  O  OP1   . DT  I  5 137 ? -68.196 -31.326 56.352 1.00 113.17 ? 63   DT  I OP1   1 
ATOM   8945  O  OP2   . DT  I  5 137 ? -65.718 -32.020 56.438 1.00 113.28 ? 63   DT  I OP2   1 
ATOM   8946  O  "O5'" . DT  I  5 137 ? -67.497 -33.716 56.029 1.00 114.25 ? 63   DT  I "O5'" 1 
ATOM   8947  C  "C5'" . DT  I  5 137 ? -68.751 -34.207 55.564 1.00 115.31 ? 63   DT  I "C5'" 1 
ATOM   8948  C  "C4'" . DT  I  5 137 ? -68.737 -35.725 55.527 1.00 116.00 ? 63   DT  I "C4'" 1 
ATOM   8949  O  "O4'" . DT  I  5 137 ? -67.645 -36.185 54.690 1.00 115.80 ? 63   DT  I "O4'" 1 
ATOM   8950  C  "C3'" . DT  I  5 137 ? -68.518 -36.392 56.879 1.00 116.31 ? 63   DT  I "C3'" 1 
ATOM   8951  O  "O3'" . DT  I  5 137 ? -69.785 -36.543 57.546 1.00 117.19 ? 63   DT  I "O3'" 1 
ATOM   8952  C  "C2'" . DT  I  5 137 ? -67.866 -37.718 56.490 1.00 116.12 ? 63   DT  I "C2'" 1 
ATOM   8953  C  "C1'" . DT  I  5 137 ? -67.132 -37.405 55.193 1.00 115.95 ? 63   DT  I "C1'" 1 
ATOM   8954  N  N1    . DT  I  5 137 ? -65.652 -37.304 55.394 1.00 115.93 ? 63   DT  I N1    1 
ATOM   8955  C  C2    . DT  I  5 137 ? -64.853 -38.412 55.159 1.00 115.84 ? 63   DT  I C2    1 
ATOM   8956  O  O2    . DT  I  5 137 ? -65.280 -39.489 54.785 1.00 115.75 ? 63   DT  I O2    1 
ATOM   8957  N  N3    . DT  I  5 137 ? -63.510 -38.209 55.375 1.00 115.94 ? 63   DT  I N3    1 
ATOM   8958  C  C4    . DT  I  5 137 ? -62.903 -37.034 55.796 1.00 116.02 ? 63   DT  I C4    1 
ATOM   8959  O  O4    . DT  I  5 137 ? -61.689 -36.960 55.958 1.00 116.08 ? 63   DT  I O4    1 
ATOM   8960  C  C5    . DT  I  5 137 ? -63.794 -35.914 56.028 1.00 115.96 ? 63   DT  I C5    1 
ATOM   8961  C  C7    . DT  I  5 137 ? -63.278 -34.581 56.486 1.00 115.87 ? 63   DT  I C7    1 
ATOM   8962  C  C6    . DT  I  5 137 ? -65.104 -36.105 55.820 1.00 115.92 ? 63   DT  I C6    1 
ATOM   8963  P  P     . DG  I  5 138 ? -70.138 -37.784 58.507 1.00 117.76 ? 64   DG  I P     1 
ATOM   8964  O  OP1   . DG  I  5 138 ? -71.557 -37.658 58.921 1.00 117.92 ? 64   DG  I OP1   1 
ATOM   8965  O  OP2   . DG  I  5 138 ? -69.088 -37.846 59.556 1.00 117.65 ? 64   DG  I OP2   1 
ATOM   8966  O  "O5'" . DG  I  5 138 ? -70.009 -39.044 57.510 1.00 116.79 ? 64   DG  I "O5'" 1 
ATOM   8967  C  "C5'" . DG  I  5 138 ? -70.721 -40.270 57.688 1.00 115.05 ? 64   DG  I "C5'" 1 
ATOM   8968  C  "C4'" . DG  I  5 138 ? -69.906 -41.244 58.524 1.00 113.89 ? 64   DG  I "C4'" 1 
ATOM   8969  O  "O4'" . DG  I  5 138 ? -68.517 -41.203 58.110 1.00 113.01 ? 64   DG  I "O4'" 1 
ATOM   8970  C  "C3'" . DG  I  5 138 ? -69.926 -40.933 60.024 1.00 113.29 ? 64   DG  I "C3'" 1 
ATOM   8971  O  "O3'" . DG  I  5 138 ? -70.797 -41.855 60.730 1.00 112.79 ? 64   DG  I "O3'" 1 
ATOM   8972  C  "C2'" . DG  I  5 138 ? -68.454 -40.920 60.457 1.00 112.94 ? 64   DG  I "C2'" 1 
ATOM   8973  C  "C1'" . DG  I  5 138 ? -67.702 -41.457 59.236 1.00 112.42 ? 64   DG  I "C1'" 1 
ATOM   8974  N  N9    . DG  I  5 138 ? -66.389 -40.844 59.034 1.00 112.30 ? 64   DG  I N9    1 
ATOM   8975  C  C8    . DG  I  5 138 ? -66.090 -39.507 59.156 1.00 112.30 ? 64   DG  I C8    1 
ATOM   8976  N  N7    . DG  I  5 138 ? -64.838 -39.222 58.925 1.00 112.31 ? 64   DG  I N7    1 
ATOM   8977  C  C5    . DG  I  5 138 ? -64.262 -40.449 58.630 1.00 112.14 ? 64   DG  I C5    1 
ATOM   8978  C  C6    . DG  I  5 138 ? -62.923 -40.757 58.295 1.00 111.92 ? 64   DG  I C6    1 
ATOM   8979  O  O6    . DG  I  5 138 ? -61.973 -39.973 58.195 1.00 111.96 ? 64   DG  I O6    1 
ATOM   8980  N  N1    . DG  I  5 138 ? -62.740 -42.122 58.066 1.00 112.09 ? 64   DG  I N1    1 
ATOM   8981  C  C2    . DG  I  5 138 ? -63.737 -43.072 58.151 1.00 112.12 ? 64   DG  I C2    1 
ATOM   8982  N  N2    . DG  I  5 138 ? -63.380 -44.339 57.894 1.00 112.10 ? 64   DG  I N2    1 
ATOM   8983  N  N3    . DG  I  5 138 ? -65.000 -42.792 58.464 1.00 112.23 ? 64   DG  I N3    1 
ATOM   8984  C  C4    . DG  I  5 138 ? -65.199 -41.464 58.691 1.00 112.28 ? 64   DG  I C4    1 
ATOM   8985  P  P     . DG  I  5 139 ? -70.339 -43.202 61.477 1.00 112.25 ? 65   DG  I P     1 
ATOM   8986  O  OP1   . DG  I  5 139 ? -71.510 -44.111 61.515 1.00 112.34 ? 65   DG  I OP1   1 
ATOM   8987  O  OP2   . DG  I  5 139 ? -69.704 -42.770 62.748 1.00 111.98 ? 65   DG  I OP2   1 
ATOM   8988  O  "O5'" . DG  I  5 139 ? -69.249 -43.859 60.495 1.00 110.72 ? 65   DG  I "O5'" 1 
ATOM   8989  C  "C5'" . DG  I  5 139 ? -69.034 -45.268 60.387 1.00 108.38 ? 65   DG  I "C5'" 1 
ATOM   8990  C  "C4'" . DG  I  5 139 ? -67.811 -45.674 61.192 1.00 106.20 ? 65   DG  I "C4'" 1 
ATOM   8991  O  "O4'" . DG  I  5 139 ? -66.720 -44.734 60.965 1.00 105.02 ? 65   DG  I "O4'" 1 
ATOM   8992  C  "C3'" . DG  I  5 139 ? -68.060 -45.712 62.699 1.00 105.01 ? 65   DG  I "C3'" 1 
ATOM   8993  O  "O3'" . DG  I  5 139 ? -67.789 -47.034 63.188 1.00 104.45 ? 65   DG  I "O3'" 1 
ATOM   8994  C  "C2'" . DG  I  5 139 ? -67.152 -44.612 63.254 1.00 104.50 ? 65   DG  I "C2'" 1 
ATOM   8995  C  "C1'" . DG  I  5 139 ? -66.058 -44.511 62.197 1.00 103.36 ? 65   DG  I "C1'" 1 
ATOM   8996  N  N9    . DG  I  5 139 ? -65.355 -43.220 62.212 1.00 102.88 ? 65   DG  I N9    1 
ATOM   8997  C  C8    . DG  I  5 139 ? -65.883 -41.990 62.544 1.00 102.37 ? 65   DG  I C8    1 
ATOM   8998  N  N7    . DG  I  5 139 ? -65.022 -41.014 62.477 1.00 102.20 ? 65   DG  I N7    1 
ATOM   8999  C  C5    . DG  I  5 139 ? -63.838 -41.627 62.082 1.00 102.32 ? 65   DG  I C5    1 
ATOM   9000  C  C6    . DG  I  5 139 ? -62.552 -41.073 61.840 1.00 102.53 ? 65   DG  I C6    1 
ATOM   9001  O  O6    . DG  I  5 139 ? -62.187 -39.891 61.931 1.00 102.54 ? 65   DG  I O6    1 
ATOM   9002  N  N1    . DG  I  5 139 ? -61.625 -42.041 61.457 1.00 102.44 ? 65   DG  I N1    1 
ATOM   9003  C  C2    . DG  I  5 139 ? -61.908 -43.378 61.318 1.00 102.29 ? 65   DG  I C2    1 
ATOM   9004  N  N2    . DG  I  5 139 ? -60.888 -44.156 60.939 1.00 102.32 ? 65   DG  I N2    1 
ATOM   9005  N  N3    . DG  I  5 139 ? -63.106 -43.912 61.539 1.00 102.19 ? 65   DG  I N3    1 
ATOM   9006  C  C4    . DG  I  5 139 ? -64.025 -42.986 61.915 1.00 102.35 ? 65   DG  I C4    1 
ATOM   9007  P  P     . DA  I  5 140 ? -66.997 -47.384 64.544 1.00 104.17 ? 66   DA  I P     1 
ATOM   9008  O  OP1   . DA  I  5 140 ? -67.330 -48.787 64.887 1.00 104.34 ? 66   DA  I OP1   1 
ATOM   9009  O  OP2   . DA  I  5 140 ? -67.217 -46.338 65.576 1.00 104.02 ? 66   DA  I OP2   1 
ATOM   9010  O  "O5'" . DA  I  5 140 ? -65.476 -47.304 64.043 1.00 102.32 ? 66   DA  I "O5'" 1 
ATOM   9011  C  "C5'" . DA  I  5 140 ? -64.908 -48.354 63.263 1.00 99.79  ? 66   DA  I "C5'" 1 
ATOM   9012  C  "C4'" . DA  I  5 140 ? -63.398 -48.387 63.435 1.00 97.75  ? 66   DA  I "C4'" 1 
ATOM   9013  O  "O4'" . DA  I  5 140 ? -62.865 -47.046 63.274 1.00 96.51  ? 66   DA  I "O4'" 1 
ATOM   9014  C  "C3'" . DA  I  5 140 ? -62.865 -48.874 64.779 1.00 97.13  ? 66   DA  I "C3'" 1 
ATOM   9015  O  "O3'" . DA  I  5 140 ? -61.606 -49.515 64.549 1.00 98.32  ? 66   DA  I "O3'" 1 
ATOM   9016  C  "C2'" . DA  I  5 140 ? -62.674 -47.568 65.541 1.00 95.99  ? 66   DA  I "C2'" 1 
ATOM   9017  C  "C1'" . DA  I  5 140 ? -62.119 -46.693 64.419 1.00 94.51  ? 66   DA  I "C1'" 1 
ATOM   9018  N  N9    . DA  I  5 140 ? -62.263 -45.252 64.614 1.00 94.26  ? 66   DA  I N9    1 
ATOM   9019  C  C8    . DA  I  5 140 ? -63.411 -44.568 64.926 1.00 93.66  ? 66   DA  I C8    1 
ATOM   9020  N  N7    . DA  I  5 140 ? -63.254 -43.275 65.046 1.00 93.33  ? 66   DA  I N7    1 
ATOM   9021  C  C5    . DA  I  5 140 ? -61.904 -43.090 64.783 1.00 94.09  ? 66   DA  I C5    1 
ATOM   9022  C  C6    . DA  I  5 140 ? -61.096 -41.934 64.747 1.00 93.74  ? 66   DA  I C6    1 
ATOM   9023  N  N6    . DA  I  5 140 ? -61.579 -40.709 64.984 1.00 93.37  ? 66   DA  I N6    1 
ATOM   9024  N  N1    . DA  I  5 140 ? -59.780 -42.095 64.455 1.00 93.73  ? 66   DA  I N1    1 
ATOM   9025  C  C2    . DA  I  5 140 ? -59.295 -43.324 64.214 1.00 93.32  ? 66   DA  I C2    1 
ATOM   9026  N  N3    . DA  I  5 140 ? -59.954 -44.483 64.221 1.00 93.50  ? 66   DA  I N3    1 
ATOM   9027  C  C4    . DA  I  5 140 ? -61.267 -44.299 64.515 1.00 94.37  ? 66   DA  I C4    1 
ATOM   9028  P  P     . DT  I  5 141 ? -60.894 -50.475 65.624 1.00 99.56  ? 67   DT  I P     1 
ATOM   9029  O  OP1   . DT  I  5 141 ? -60.490 -51.727 64.935 1.00 100.14 ? 67   DT  I OP1   1 
ATOM   9030  O  OP2   . DT  I  5 141 ? -61.731 -50.492 66.849 1.00 99.39  ? 67   DT  I OP2   1 
ATOM   9031  O  "O5'" . DT  I  5 141 ? -59.540 -49.728 66.005 1.00 98.72  ? 67   DT  I "O5'" 1 
ATOM   9032  C  "C5'" . DT  I  5 141 ? -58.655 -49.230 65.017 1.00 96.80  ? 67   DT  I "C5'" 1 
ATOM   9033  C  "C4'" . DT  I  5 141 ? -57.842 -48.127 65.661 1.00 95.51  ? 67   DT  I "C4'" 1 
ATOM   9034  O  "O4'" . DT  I  5 141 ? -58.664 -46.953 65.886 1.00 94.66  ? 67   DT  I "O4'" 1 
ATOM   9035  C  "C3'" . DT  I  5 141 ? -57.275 -48.482 67.032 1.00 95.13  ? 67   DT  I "C3'" 1 
ATOM   9036  O  "O3'" . DT  I  5 141 ? -55.895 -48.273 66.945 1.00 95.45  ? 67   DT  I "O3'" 1 
ATOM   9037  C  "C2'" . DT  I  5 141 ? -57.942 -47.494 67.996 1.00 94.32  ? 67   DT  I "C2'" 1 
ATOM   9038  C  "C1'" . DT  I  5 141 ? -58.143 -46.330 67.040 1.00 93.03  ? 67   DT  I "C1'" 1 
ATOM   9039  N  N1    . DT  I  5 141 ? -59.042 -45.215 67.464 1.00 92.64  ? 67   DT  I N1    1 
ATOM   9040  C  C2    . DT  I  5 141 ? -58.510 -43.936 67.521 1.00 92.23  ? 67   DT  I C2    1 
ATOM   9041  O  O2    . DT  I  5 141 ? -57.342 -43.680 67.257 1.00 91.71  ? 67   DT  I O2    1 
ATOM   9042  N  N3    . DT  I  5 141 ? -59.407 -42.964 67.905 1.00 91.37  ? 67   DT  I N3    1 
ATOM   9043  C  C4    . DT  I  5 141 ? -60.746 -43.141 68.219 1.00 92.03  ? 67   DT  I C4    1 
ATOM   9044  O  O4    . DT  I  5 141 ? -61.456 -42.196 68.553 1.00 91.92  ? 67   DT  I O4    1 
ATOM   9045  C  C5    . DT  I  5 141 ? -61.239 -44.504 68.129 1.00 92.04  ? 67   DT  I C5    1 
ATOM   9046  C  C7    . DT  I  5 141 ? -62.669 -44.843 68.445 1.00 92.23  ? 67   DT  I C7    1 
ATOM   9047  C  C6    . DT  I  5 141 ? -60.374 -45.461 67.759 1.00 92.30  ? 67   DT  I C6    1 
ATOM   9048  P  P     . DA  I  5 142 ? -54.862 -49.056 67.876 1.00 96.63  ? 68   DA  I P     1 
ATOM   9049  O  OP1   . DA  I  5 142 ? -54.564 -50.346 67.207 1.00 95.79  ? 68   DA  I OP1   1 
ATOM   9050  O  OP2   . DA  I  5 142 ? -55.379 -49.015 69.276 1.00 95.39  ? 68   DA  I OP2   1 
ATOM   9051  O  "O5'" . DA  I  5 142 ? -53.542 -48.132 67.770 1.00 95.41  ? 68   DA  I "O5'" 1 
ATOM   9052  C  "C5'" . DA  I  5 142 ? -53.413 -47.082 66.788 1.00 93.45  ? 68   DA  I "C5'" 1 
ATOM   9053  C  "C4'" . DA  I  5 142 ? -52.953 -45.750 67.372 1.00 92.06  ? 68   DA  I "C4'" 1 
ATOM   9054  O  "O4'" . DA  I  5 142 ? -54.081 -44.905 67.735 1.00 91.01  ? 68   DA  I "O4'" 1 
ATOM   9055  C  "C3'" . DA  I  5 142 ? -52.074 -45.811 68.619 1.00 92.05  ? 68   DA  I "C3'" 1 
ATOM   9056  O  "O3'" . DA  I  5 142 ? -50.993 -44.902 68.446 1.00 92.67  ? 68   DA  I "O3'" 1 
ATOM   9057  C  "C2'" . DA  I  5 142 ? -53.021 -45.382 69.740 1.00 90.78  ? 68   DA  I "C2'" 1 
ATOM   9058  C  "C1'" . DA  I  5 142 ? -53.859 -44.344 69.016 1.00 88.64  ? 68   DA  I "C1'" 1 
ATOM   9059  N  N9    . DA  I  5 142 ? -55.163 -44.082 69.613 1.00 87.76  ? 68   DA  I N9    1 
ATOM   9060  C  C8    . DA  I  5 142 ? -56.115 -45.007 69.930 1.00 87.49  ? 68   DA  I C8    1 
ATOM   9061  N  N7    . DA  I  5 142 ? -57.207 -44.500 70.443 1.00 87.12  ? 68   DA  I N7    1 
ATOM   9062  C  C5    . DA  I  5 142 ? -56.957 -43.141 70.460 1.00 87.44  ? 68   DA  I C5    1 
ATOM   9063  C  C6    . DA  I  5 142 ? -57.732 -42.042 70.889 1.00 87.59  ? 68   DA  I C6    1 
ATOM   9064  N  N6    . DA  I  5 142 ? -58.959 -42.175 71.393 1.00 87.41  ? 68   DA  I N6    1 
ATOM   9065  N  N1    . DA  I  5 142 ? -57.193 -40.806 70.773 1.00 87.51  ? 68   DA  I N1    1 
ATOM   9066  C  C2    . DA  I  5 142 ? -55.958 -40.680 70.262 1.00 87.29  ? 68   DA  I C2    1 
ATOM   9067  N  N3    . DA  I  5 142 ? -55.135 -41.634 69.823 1.00 87.13  ? 68   DA  I N3    1 
ATOM   9068  C  C4    . DA  I  5 142 ? -55.697 -42.858 69.951 1.00 87.58  ? 68   DA  I C4    1 
ATOM   9069  P  P     . DT  I  5 143 ? -49.760 -44.827 69.470 1.00 93.08  ? 69   DT  I P     1 
ATOM   9070  O  OP1   . DT  I  5 143 ? -48.701 -45.707 68.934 1.00 93.25  ? 69   DT  I OP1   1 
ATOM   9071  O  OP2   . DT  I  5 143 ? -50.216 -44.991 70.876 1.00 92.75  ? 69   DT  I OP2   1 
ATOM   9072  O  "O5'" . DT  I  5 143 ? -49.320 -43.298 69.298 1.00 92.72  ? 69   DT  I "O5'" 1 
ATOM   9073  C  "C5'" . DT  I  5 143 ? -50.248 -42.323 68.807 1.00 91.79  ? 69   DT  I "C5'" 1 
ATOM   9074  C  "C4'" . DT  I  5 143 ? -50.361 -41.113 69.716 1.00 90.72  ? 69   DT  I "C4'" 1 
ATOM   9075  O  "O4'" . DT  I  5 143 ? -51.681 -41.053 70.309 1.00 90.62  ? 69   DT  I "O4'" 1 
ATOM   9076  C  "C3'" . DT  I  5 143 ? -49.374 -41.025 70.874 1.00 90.19  ? 69   DT  I "C3'" 1 
ATOM   9077  O  "O3'" . DT  I  5 143 ? -48.789 -39.720 70.824 1.00 89.54  ? 69   DT  I "O3'" 1 
ATOM   9078  C  "C2'" . DT  I  5 143 ? -50.236 -41.261 72.119 1.00 89.90  ? 69   DT  I "C2'" 1 
ATOM   9079  C  "C1'" . DT  I  5 143 ? -51.577 -40.694 71.671 1.00 89.85  ? 69   DT  I "C1'" 1 
ATOM   9080  N  N1    . DT  I  5 143 ? -52.794 -41.248 72.343 1.00 89.69  ? 69   DT  I N1    1 
ATOM   9081  C  C2    . DT  I  5 143 ? -53.807 -40.394 72.746 1.00 89.45  ? 69   DT  I C2    1 
ATOM   9082  O  O2    . DT  I  5 143 ? -53.796 -39.181 72.614 1.00 89.83  ? 69   DT  I O2    1 
ATOM   9083  N  N3    . DT  I  5 143 ? -54.869 -41.024 73.333 1.00 89.16  ? 69   DT  I N3    1 
ATOM   9084  C  C4    . DT  I  5 143 ? -55.029 -42.378 73.552 1.00 89.72  ? 69   DT  I C4    1 
ATOM   9085  O  O4    . DT  I  5 143 ? -56.041 -42.814 74.091 1.00 90.08  ? 69   DT  I O4    1 
ATOM   9086  C  C5    . DT  I  5 143 ? -53.941 -43.220 73.105 1.00 89.70  ? 69   DT  I C5    1 
ATOM   9087  C  C7    . DT  I  5 143 ? -53.983 -44.712 73.281 1.00 89.60  ? 69   DT  I C7    1 
ATOM   9088  C  C6    . DT  I  5 143 ? -52.894 -42.618 72.526 1.00 89.65  ? 69   DT  I C6    1 
ATOM   9089  P  P     . DT  I  5 144 ? -47.623 -39.245 71.820 1.00 89.32  ? 70   DT  I P     1 
ATOM   9090  O  OP1   . DT  I  5 144 ? -46.778 -38.282 71.079 1.00 89.51  ? 70   DT  I OP1   1 
ATOM   9091  O  OP2   . DT  I  5 144 ? -46.982 -40.446 72.422 1.00 88.86  ? 70   DT  I OP2   1 
ATOM   9092  O  "O5'" . DT  I  5 144 ? -48.453 -38.424 72.922 1.00 87.75  ? 70   DT  I "O5'" 1 
ATOM   9093  C  "C5'" . DT  I  5 144 ? -49.286 -37.341 72.490 1.00 86.11  ? 70   DT  I "C5'" 1 
ATOM   9094  C  "C4'" . DT  I  5 144 ? -50.090 -36.733 73.623 1.00 85.03  ? 70   DT  I "C4'" 1 
ATOM   9095  O  "O4'" . DT  I  5 144 ? -51.177 -37.615 74.007 1.00 84.46  ? 70   DT  I "O4'" 1 
ATOM   9096  C  "C3'" . DT  I  5 144 ? -49.266 -36.457 74.870 1.00 85.11  ? 70   DT  I "C3'" 1 
ATOM   9097  O  "O3'" . DT  I  5 144 ? -49.436 -35.071 75.206 1.00 85.62  ? 70   DT  I "O3'" 1 
ATOM   9098  C  "C2'" . DT  I  5 144 ? -49.811 -37.451 75.903 1.00 84.91  ? 70   DT  I "C2'" 1 
ATOM   9099  C  "C1'" . DT  I  5 144 ? -51.229 -37.749 75.412 1.00 84.59  ? 70   DT  I "C1'" 1 
ATOM   9100  N  N1    . DT  I  5 144 ? -51.759 -39.128 75.752 1.00 84.54  ? 70   DT  I N1    1 
ATOM   9101  C  C2    . DT  I  5 144 ? -53.061 -39.302 76.225 1.00 84.40  ? 70   DT  I C2    1 
ATOM   9102  O  O2    . DT  I  5 144 ? -53.859 -38.399 76.403 1.00 84.19  ? 70   DT  I O2    1 
ATOM   9103  N  N3    . DT  I  5 144 ? -53.415 -40.612 76.489 1.00 84.27  ? 70   DT  I N3    1 
ATOM   9104  C  C4    . DT  I  5 144 ? -52.621 -41.743 76.331 1.00 84.21  ? 70   DT  I C4    1 
ATOM   9105  O  O4    . DT  I  5 144 ? -53.029 -42.871 76.594 1.00 84.42  ? 70   DT  I O4    1 
ATOM   9106  C  C5    . DT  I  5 144 ? -51.280 -41.499 75.838 1.00 84.37  ? 70   DT  I C5    1 
ATOM   9107  C  C7    . DT  I  5 144 ? -50.320 -42.640 75.624 1.00 84.31  ? 70   DT  I C7    1 
ATOM   9108  C  C6    . DT  I  5 144 ? -50.925 -40.226 75.578 1.00 84.45  ? 70   DT  I C6    1 
ATOM   9109  P  P     . DG  I  5 145 ? -48.691 -34.377 76.448 1.00 86.01  ? 71   DG  I P     1 
ATOM   9110  O  OP1   . DG  I  5 145 ? -48.468 -32.951 76.118 1.00 86.09  ? 71   DG  I OP1   1 
ATOM   9111  O  OP2   . DG  I  5 145 ? -47.576 -35.225 76.923 1.00 85.04  ? 71   DG  I OP2   1 
ATOM   9112  O  "O5'" . DG  I  5 145 ? -49.820 -34.467 77.564 1.00 87.85  ? 71   DG  I "O5'" 1 
ATOM   9113  C  "C5'" . DG  I  5 145 ? -51.101 -33.831 77.461 1.00 88.43  ? 71   DG  I "C5'" 1 
ATOM   9114  C  "C4'" . DG  I  5 145 ? -51.838 -34.098 78.764 1.00 89.15  ? 71   DG  I "C4'" 1 
ATOM   9115  O  "O4'" . DG  I  5 145 ? -52.217 -35.499 78.818 1.00 88.38  ? 71   DG  I "O4'" 1 
ATOM   9116  C  "C3'" . DG  I  5 145 ? -50.996 -33.859 80.014 1.00 90.29  ? 71   DG  I "C3'" 1 
ATOM   9117  O  "O3'" . DG  I  5 145 ? -51.803 -33.270 81.022 1.00 94.42  ? 71   DG  I "O3'" 1 
ATOM   9118  C  "C2'" . DG  I  5 145 ? -50.495 -35.256 80.390 1.00 88.48  ? 71   DG  I "C2'" 1 
ATOM   9119  C  "C1'" . DG  I  5 145 ? -51.716 -36.077 80.010 1.00 86.92  ? 71   DG  I "C1'" 1 
ATOM   9120  N  N9    . DG  I  5 145 ? -51.504 -37.515 79.814 1.00 86.58  ? 71   DG  I N9    1 
ATOM   9121  C  C8    . DG  I  5 145 ? -50.352 -38.205 79.487 1.00 86.19  ? 71   DG  I C8    1 
ATOM   9122  N  N7    . DG  I  5 145 ? -50.527 -39.498 79.392 1.00 85.85  ? 71   DG  I N7    1 
ATOM   9123  C  C5    . DG  I  5 145 ? -51.880 -39.682 79.674 1.00 86.00  ? 71   DG  I C5    1 
ATOM   9124  C  C6    . DG  I  5 145 ? -52.675 -40.864 79.735 1.00 86.09  ? 71   DG  I C6    1 
ATOM   9125  O  O6    . DG  I  5 145 ? -52.338 -42.041 79.540 1.00 86.29  ? 71   DG  I O6    1 
ATOM   9126  N  N1    . DG  I  5 145 ? -54.006 -40.591 80.064 1.00 85.85  ? 71   DG  I N1    1 
ATOM   9127  C  C2    . DG  I  5 145 ? -54.514 -39.337 80.304 1.00 85.93  ? 71   DG  I C2    1 
ATOM   9128  N  N2    . DG  I  5 145 ? -55.814 -39.270 80.604 1.00 86.17  ? 71   DG  I N2    1 
ATOM   9129  N  N3    . DG  I  5 145 ? -53.794 -38.222 80.256 1.00 86.19  ? 71   DG  I N3    1 
ATOM   9130  C  C4    . DG  I  5 145 ? -52.490 -38.469 79.935 1.00 86.36  ? 71   DG  I C4    1 
ATOM   9131  P  P     . DA  I  5 146 ? -51.176 -32.770 82.425 1.00 98.72  ? 72   DA  I P     1 
ATOM   9132  O  OP1   . DA  I  5 146 ? -50.990 -31.292 82.359 1.00 99.11  ? 72   DA  I OP1   1 
ATOM   9133  O  OP2   . DA  I  5 146 ? -50.015 -33.620 82.823 1.00 97.77  ? 72   DA  I OP2   1 
ATOM   9134  O  "O5'" . DA  I  5 146 ? -52.393 -33.050 83.442 1.00 99.45  ? 72   DA  I "O5'" 1 
ATOM   9135  C  "C5'" . DA  I  5 146 ? -53.755 -32.691 83.116 1.00 99.95  ? 72   DA  I "C5'" 1 
ATOM   9136  C  "C4'" . DA  I  5 146 ? -54.716 -33.668 83.782 1.00 99.99  ? 72   DA  I "C4'" 1 
ATOM   9137  O  "O4'" . DA  I  5 146 ? -54.536 -34.990 83.207 1.00 98.66  ? 72   DA  I "O4'" 1 
ATOM   9138  C  "C3'" . DA  I  5 146 ? -54.517 -33.833 85.292 1.00 100.94 ? 72   DA  I "C3'" 1 
ATOM   9139  O  "O3'" . DA  I  5 146 ? -55.767 -33.917 85.984 1.00 103.89 ? 72   DA  I "O3'" 1 
ATOM   9140  C  "C2'" . DA  I  5 146 ? -53.762 -35.149 85.401 1.00 99.03  ? 72   DA  I "C2'" 1 
ATOM   9141  C  "C1'" . DA  I  5 146 ? -54.406 -35.918 84.257 1.00 96.68  ? 72   DA  I "C1'" 1 
ATOM   9142  N  N9    . DA  I  5 146 ? -53.575 -37.035 83.845 1.00 96.10  ? 72   DA  I N9    1 
ATOM   9143  C  C8    . DA  I  5 146 ? -52.258 -36.996 83.481 1.00 95.62  ? 72   DA  I C8    1 
ATOM   9144  N  N7    . DA  I  5 146 ? -51.759 -38.170 83.180 1.00 95.37  ? 72   DA  I N7    1 
ATOM   9145  C  C5    . DA  I  5 146 ? -52.825 -39.037 83.363 1.00 95.33  ? 72   DA  I C5    1 
ATOM   9146  C  C6    . DA  I  5 146 ? -52.958 -40.432 83.208 1.00 95.51  ? 72   DA  I C6    1 
ATOM   9147  N  N6    . DA  I  5 146 ? -51.959 -41.226 82.816 1.00 95.58  ? 72   DA  I N6    1 
ATOM   9148  N  N1    . DA  I  5 146 ? -54.166 -40.980 83.475 1.00 95.86  ? 72   DA  I N1    1 
ATOM   9149  C  C2    . DA  I  5 146 ? -55.174 -40.191 83.874 1.00 95.57  ? 72   DA  I C2    1 
ATOM   9150  N  N3    . DA  I  5 146 ? -55.165 -38.872 84.056 1.00 95.27  ? 72   DA  I N3    1 
ATOM   9151  C  C4    . DA  I  5 146 ? -53.954 -38.353 83.777 1.00 95.51  ? 72   DA  I C4    1 
ATOM   9152  P  P     . DT  I  5 147 ? -55.869 -33.686 87.575 1.00 105.97 ? 73   DT  I P     1 
ATOM   9153  O  OP1   . DT  I  5 147 ? -57.031 -32.773 87.724 1.00 105.87 ? 73   DT  I OP1   1 
ATOM   9154  O  OP2   . DT  I  5 147 ? -54.528 -33.289 88.098 1.00 105.35 ? 73   DT  I OP2   1 
ATOM   9155  O  "O5'" . DT  I  5 147 ? -56.285 -35.132 88.167 1.00 105.55 ? 73   DT  I "O5'" 1 
ATOM   9156  C  "C5'" . DT  I  5 147 ? -55.331 -36.113 88.619 1.00 105.34 ? 73   DT  I "C5'" 1 
ATOM   9157  C  "C4'" . DT  I  5 147 ? -55.958 -37.504 88.661 1.00 105.09 ? 73   DT  I "C4'" 1 
ATOM   9158  O  "O4'" . DT  I  5 147 ? -55.727 -38.183 87.394 1.00 104.28 ? 73   DT  I "O4'" 1 
ATOM   9159  C  "C3'" . DT  I  5 147 ? -55.400 -38.440 89.735 1.00 105.24 ? 73   DT  I "C3'" 1 
ATOM   9160  O  "O3'" . DT  I  5 147 ? -56.186 -38.380 90.920 1.00 105.93 ? 73   DT  I "O3'" 1 
ATOM   9161  C  "C2'" . DT  I  5 147 ? -55.505 -39.820 89.090 1.00 104.51 ? 73   DT  I "C2'" 1 
ATOM   9162  C  "C1'" . DT  I  5 147 ? -55.268 -39.509 87.615 1.00 103.00 ? 73   DT  I "C1'" 1 
ATOM   9163  N  N1    . DT  I  5 147 ? -53.827 -39.693 87.169 1.00 102.24 ? 73   DT  I N1    1 
ATOM   9164  C  C2    . DT  I  5 147 ? -53.390 -40.964 86.826 1.00 102.03 ? 73   DT  I C2    1 
ATOM   9165  O  O2    . DT  I  5 147 ? -54.095 -41.960 86.860 1.00 101.85 ? 73   DT  I O2    1 
ATOM   9166  N  N3    . DT  I  5 147 ? -52.074 -41.041 86.433 1.00 101.98 ? 73   DT  I N3    1 
ATOM   9167  C  C4    . DT  I  5 147 ? -51.161 -40.002 86.345 1.00 102.00 ? 73   DT  I C4    1 
ATOM   9168  O  O4    . DT  I  5 147 ? -50.005 -40.195 85.976 1.00 102.02 ? 73   DT  I O4    1 
ATOM   9169  C  C5    . DT  I  5 147 ? -51.677 -38.699 86.717 1.00 101.71 ? 73   DT  I C5    1 
ATOM   9170  C  C7    . DT  I  5 147 ? -50.806 -37.478 86.672 1.00 102.11 ? 73   DT  I C7    1 
ATOM   9171  C  C6    . DT  I  5 147 ? -52.959 -38.612 87.105 1.00 101.84 ? 73   DT  I C6    1 
ATOM   9172  O  "O5'" . DA  J  6 1   ? -50.377 -52.019 83.626 1.00 123.08 ? -73  DA  J "O5'" 1 
ATOM   9173  C  "C5'" . DA  J  6 1   ? -51.579 -51.295 83.357 1.00 123.37 ? -73  DA  J "C5'" 1 
ATOM   9174  C  "C4'" . DA  J  6 1   ? -52.221 -50.828 84.651 1.00 123.28 ? -73  DA  J "C4'" 1 
ATOM   9175  O  "O4'" . DA  J  6 1   ? -51.247 -50.078 85.425 1.00 123.09 ? -73  DA  J "O4'" 1 
ATOM   9176  C  "C3'" . DA  J  6 1   ? -53.399 -49.873 84.498 1.00 123.39 ? -73  DA  J "C3'" 1 
ATOM   9177  O  "O3'" . DA  J  6 1   ? -54.627 -50.579 84.228 1.00 123.51 ? -73  DA  J "O3'" 1 
ATOM   9178  C  "C2'" . DA  J  6 1   ? -53.394 -49.185 85.864 1.00 123.00 ? -73  DA  J "C2'" 1 
ATOM   9179  C  "C1'" . DA  J  6 1   ? -51.906 -49.070 86.177 1.00 122.45 ? -73  DA  J "C1'" 1 
ATOM   9180  N  N9    . DA  J  6 1   ? -51.315 -47.754 85.899 1.00 122.32 ? -73  DA  J N9    1 
ATOM   9181  C  C8    . DA  J  6 1   ? -50.166 -47.500 85.193 1.00 122.12 ? -73  DA  J C8    1 
ATOM   9182  N  N7    . DA  J  6 1   ? -49.862 -46.227 85.103 1.00 122.06 ? -73  DA  J N7    1 
ATOM   9183  C  C5    . DA  J  6 1   ? -50.876 -45.591 85.804 1.00 122.13 ? -73  DA  J C5    1 
ATOM   9184  C  C6    . DA  J  6 1   ? -51.139 -44.227 86.083 1.00 121.99 ? -73  DA  J C6    1 
ATOM   9185  N  N6    . DA  J  6 1   ? -50.361 -43.223 85.668 1.00 121.96 ? -73  DA  J N6    1 
ATOM   9186  N  N1    . DA  J  6 1   ? -52.240 -43.931 86.809 1.00 121.88 ? -73  DA  J N1    1 
ATOM   9187  C  C2    . DA  J  6 1   ? -53.031 -44.930 87.230 1.00 122.10 ? -73  DA  J C2    1 
ATOM   9188  N  N3    . DA  J  6 1   ? -52.890 -46.244 87.032 1.00 122.16 ? -73  DA  J N3    1 
ATOM   9189  C  C4    . DA  J  6 1   ? -51.783 -46.517 86.305 1.00 122.27 ? -73  DA  J C4    1 
ATOM   9190  P  P     . DT  J  6 2   ? -56.059 -49.842 84.257 1.00 123.75 ? -72  DT  J P     1 
ATOM   9191  O  OP1   . DT  J  6 2   ? -57.115 -50.853 84.030 1.00 124.09 ? -72  DT  J OP1   1 
ATOM   9192  O  OP2   . DT  J  6 2   ? -55.992 -48.681 83.345 1.00 123.76 ? -72  DT  J OP2   1 
ATOM   9193  O  "O5'" . DT  J  6 2   ? -56.147 -49.324 85.776 1.00 123.76 ? -72  DT  J "O5'" 1 
ATOM   9194  C  "C5'" . DT  J  6 2   ? -57.385 -49.064 86.434 1.00 123.51 ? -72  DT  J "C5'" 1 
ATOM   9195  C  "C4'" . DT  J  6 2   ? -57.773 -47.598 86.324 1.00 123.13 ? -72  DT  J "C4'" 1 
ATOM   9196  O  "O4'" . DT  J  6 2   ? -56.606 -46.753 86.116 1.00 122.53 ? -72  DT  J "O4'" 1 
ATOM   9197  C  "C3'" . DT  J  6 2   ? -58.727 -47.307 85.170 1.00 123.10 ? -72  DT  J "C3'" 1 
ATOM   9198  O  "O3'" . DT  J  6 2   ? -59.889 -46.646 85.657 1.00 123.69 ? -72  DT  J "O3'" 1 
ATOM   9199  C  "C2'" . DT  J  6 2   ? -57.931 -46.414 84.220 1.00 122.56 ? -72  DT  J "C2'" 1 
ATOM   9200  C  "C1'" . DT  J  6 2   ? -56.947 -45.754 85.174 1.00 121.47 ? -72  DT  J "C1'" 1 
ATOM   9201  N  N1    . DT  J  6 2   ? -55.726 -45.211 84.491 1.00 121.07 ? -72  DT  J N1    1 
ATOM   9202  C  C2    . DT  J  6 2   ? -55.571 -43.838 84.412 1.00 120.85 ? -72  DT  J C2    1 
ATOM   9203  O  O2    . DT  J  6 2   ? -56.374 -43.038 84.872 1.00 120.59 ? -72  DT  J O2    1 
ATOM   9204  N  N3    . DT  J  6 2   ? -54.422 -43.437 83.769 1.00 120.49 ? -72  DT  J N3    1 
ATOM   9205  C  C4    . DT  J  6 2   ? -53.441 -44.239 83.207 1.00 120.62 ? -72  DT  J C4    1 
ATOM   9206  O  O4    . DT  J  6 2   ? -52.454 -43.765 82.654 1.00 120.59 ? -72  DT  J O4    1 
ATOM   9207  C  C5    . DT  J  6 2   ? -53.666 -45.663 83.320 1.00 120.58 ? -72  DT  J C5    1 
ATOM   9208  C  C7    . DT  J  6 2   ? -52.679 -46.644 82.751 1.00 120.76 ? -72  DT  J C7    1 
ATOM   9209  C  C6    . DT  J  6 2   ? -54.780 -46.070 83.948 1.00 120.67 ? -72  DT  J C6    1 
ATOM   9210  P  P     . DC  J  6 3   ? -61.256 -46.719 84.821 1.00 124.16 ? -71  DC  J P     1 
ATOM   9211  O  OP1   . DC  J  6 3   ? -62.364 -46.398 85.754 1.00 124.00 ? -71  DC  J OP1   1 
ATOM   9212  O  OP2   . DC  J  6 3   ? -61.248 -48.003 84.070 1.00 123.78 ? -71  DC  J OP2   1 
ATOM   9213  O  "O5'" . DC  J  6 3   ? -61.125 -45.530 83.751 1.00 123.00 ? -71  DC  J "O5'" 1 
ATOM   9214  C  "C5'" . DC  J  6 3   ? -60.859 -44.177 84.132 1.00 121.07 ? -71  DC  J "C5'" 1 
ATOM   9215  C  "C4'" . DC  J  6 3   ? -60.555 -43.343 82.899 1.00 119.56 ? -71  DC  J "C4'" 1 
ATOM   9216  O  "O4'" . DC  J  6 3   ? -59.151 -43.463 82.542 1.00 119.03 ? -71  DC  J "O4'" 1 
ATOM   9217  C  "C3'" . DC  J  6 3   ? -61.340 -43.742 81.647 1.00 118.80 ? -71  DC  J "C3'" 1 
ATOM   9218  O  "O3'" . DC  J  6 3   ? -61.998 -42.604 81.103 1.00 118.23 ? -71  DC  J "O3'" 1 
ATOM   9219  C  "C2'" . DC  J  6 3   ? -60.276 -44.272 80.693 1.00 118.57 ? -71  DC  J "C2'" 1 
ATOM   9220  C  "C1'" . DC  J  6 3   ? -59.085 -43.424 81.131 1.00 117.95 ? -71  DC  J "C1'" 1 
ATOM   9221  N  N1    . DC  J  6 3   ? -57.740 -43.881 80.634 1.00 117.34 ? -71  DC  J N1    1 
ATOM   9222  C  C2    . DC  J  6 3   ? -56.620 -43.034 80.748 1.00 116.85 ? -71  DC  J C2    1 
ATOM   9223  O  O2    . DC  J  6 3   ? -56.740 -41.912 81.269 1.00 116.37 ? -71  DC  J O2    1 
ATOM   9224  N  N3    . DC  J  6 3   ? -55.422 -43.485 80.279 1.00 116.79 ? -71  DC  J N3    1 
ATOM   9225  C  C4    . DC  J  6 3   ? -55.319 -44.704 79.722 1.00 117.08 ? -71  DC  J C4    1 
ATOM   9226  N  N4    . DC  J  6 3   ? -54.125 -45.109 79.276 1.00 117.00 ? -71  DC  J N4    1 
ATOM   9227  C  C5    . DC  J  6 3   ? -56.444 -45.572 79.594 1.00 116.81 ? -71  DC  J C5    1 
ATOM   9228  C  C6    . DC  J  6 3   ? -57.616 -45.121 80.057 1.00 117.23 ? -71  DC  J C6    1 
ATOM   9229  P  P     . DA  J  6 4   ? -63.584 -42.454 81.248 1.00 117.41 ? -70  DA  J P     1 
ATOM   9230  O  OP1   . DA  J  6 4   ? -63.924 -42.806 82.651 1.00 117.39 ? -70  DA  J OP1   1 
ATOM   9231  O  OP2   . DA  J  6 4   ? -64.182 -43.196 80.110 1.00 116.74 ? -70  DA  J OP2   1 
ATOM   9232  O  "O5'" . DA  J  6 4   ? -63.873 -40.886 81.021 1.00 115.39 ? -70  DA  J "O5'" 1 
ATOM   9233  C  "C5'" . DA  J  6 4   ? -63.272 -39.865 81.832 1.00 112.42 ? -70  DA  J "C5'" 1 
ATOM   9234  C  "C4'" . DA  J  6 4   ? -62.602 -38.778 80.995 1.00 110.62 ? -70  DA  J "C4'" 1 
ATOM   9235  O  "O4'" . DA  J  6 4   ? -61.296 -39.196 80.503 1.00 109.48 ? -70  DA  J "O4'" 1 
ATOM   9236  C  "C3'" . DA  J  6 4   ? -63.362 -38.286 79.764 1.00 109.99 ? -70  DA  J "C3'" 1 
ATOM   9237  O  "O3'" . DA  J  6 4   ? -63.282 -36.851 79.756 1.00 109.90 ? -70  DA  J "O3'" 1 
ATOM   9238  C  "C2'" . DA  J  6 4   ? -62.633 -38.973 78.597 1.00 108.95 ? -70  DA  J "C2'" 1 
ATOM   9239  C  "C1'" . DA  J  6 4   ? -61.193 -38.985 79.103 1.00 107.28 ? -70  DA  J "C1'" 1 
ATOM   9240  N  N9    . DA  J  6 4   ? -60.305 -40.030 78.586 1.00 106.59 ? -70  DA  J N9    1 
ATOM   9241  C  C8    . DA  J  6 4   ? -60.607 -41.341 78.332 1.00 106.19 ? -70  DA  J C8    1 
ATOM   9242  N  N7    . DA  J  6 4   ? -59.593 -42.051 77.896 1.00 106.15 ? -70  DA  J N7    1 
ATOM   9243  C  C5    . DA  J  6 4   ? -58.543 -41.145 77.864 1.00 106.16 ? -70  DA  J C5    1 
ATOM   9244  C  C6    . DA  J  6 4   ? -57.184 -41.263 77.493 1.00 106.00 ? -70  DA  J C6    1 
ATOM   9245  N  N6    . DA  J  6 4   ? -56.644 -42.403 77.064 1.00 106.18 ? -70  DA  J N6    1 
ATOM   9246  N  N1    . DA  J  6 4   ? -56.398 -40.167 77.574 1.00 106.00 ? -70  DA  J N1    1 
ATOM   9247  C  C2    . DA  J  6 4   ? -56.943 -39.019 77.998 1.00 106.19 ? -70  DA  J C2    1 
ATOM   9248  N  N3    . DA  J  6 4   ? -58.201 -38.782 78.381 1.00 106.35 ? -70  DA  J N3    1 
ATOM   9249  C  C4    . DA  J  6 4   ? -58.962 -39.894 78.290 1.00 106.45 ? -70  DA  J C4    1 
ATOM   9250  P  P     . DA  J  6 5   ? -63.790 -35.951 78.528 1.00 110.47 ? -69  DA  J P     1 
ATOM   9251  O  OP1   . DA  J  6 5   ? -64.105 -34.607 79.066 1.00 110.43 ? -69  DA  J OP1   1 
ATOM   9252  O  OP2   . DA  J  6 5   ? -64.825 -36.704 77.773 1.00 110.11 ? -69  DA  J OP2   1 
ATOM   9253  O  "O5'" . DA  J  6 5   ? -62.479 -35.840 77.612 1.00 110.09 ? -69  DA  J "O5'" 1 
ATOM   9254  C  "C5'" . DA  J  6 5   ? -61.277 -35.250 78.146 1.00 109.37 ? -69  DA  J "C5'" 1 
ATOM   9255  C  "C4'" . DA  J  6 5   ? -60.398 -34.581 77.089 1.00 107.76 ? -69  DA  J "C4'" 1 
ATOM   9256  O  "O4'" . DA  J  6 5   ? -59.480 -35.537 76.502 1.00 106.68 ? -69  DA  J "O4'" 1 
ATOM   9257  C  "C3'" . DA  J  6 5   ? -61.112 -33.919 75.911 1.00 106.86 ? -69  DA  J "C3'" 1 
ATOM   9258  O  "O3'" . DA  J  6 5   ? -60.376 -32.735 75.548 1.00 106.32 ? -69  DA  J "O3'" 1 
ATOM   9259  C  "C2'" . DA  J  6 5   ? -61.113 -35.010 74.836 1.00 105.97 ? -69  DA  J "C2'" 1 
ATOM   9260  C  "C1'" . DA  J  6 5   ? -59.834 -35.784 75.152 1.00 105.43 ? -69  DA  J "C1'" 1 
ATOM   9261  N  N9    . DA  J  6 5   ? -59.888 -37.241 75.000 1.00 105.28 ? -69  DA  J N9    1 
ATOM   9262  C  C8    . DA  J  6 5   ? -60.969 -38.080 75.071 1.00 104.90 ? -69  DA  J C8    1 
ATOM   9263  N  N7    . DA  J  6 5   ? -60.661 -39.344 74.895 1.00 104.81 ? -69  DA  J N7    1 
ATOM   9264  C  C5    . DA  J  6 5   ? -59.290 -39.335 74.699 1.00 104.50 ? -69  DA  J C5    1 
ATOM   9265  C  C6    . DA  J  6 5   ? -58.341 -40.349 74.454 1.00 104.76 ? -69  DA  J C6    1 
ATOM   9266  N  N6    . DA  J  6 5   ? -58.647 -41.644 74.368 1.00 104.74 ? -69  DA  J N6    1 
ATOM   9267  N  N1    . DA  J  6 5   ? -57.047 -39.986 74.304 1.00 104.92 ? -69  DA  J N1    1 
ATOM   9268  C  C2    . DA  J  6 5   ? -56.714 -38.693 74.390 1.00 104.85 ? -69  DA  J C2    1 
ATOM   9269  N  N3    . DA  J  6 5   ? -57.516 -37.656 74.614 1.00 104.72 ? -69  DA  J N3    1 
ATOM   9270  C  C4    . DA  J  6 5   ? -58.798 -38.047 74.763 1.00 104.81 ? -69  DA  J C4    1 
ATOM   9271  P  P     . DT  J  6 6   ? -60.870 -31.684 74.431 1.00 105.24 ? -68  DT  J P     1 
ATOM   9272  O  OP1   . DT  J  6 6   ? -60.493 -30.329 74.907 1.00 104.80 ? -68  DT  J OP1   1 
ATOM   9273  O  OP2   . DT  J  6 6   ? -62.276 -31.991 74.068 1.00 105.24 ? -68  DT  J OP2   1 
ATOM   9274  O  "O5'" . DT  J  6 6   ? -59.960 -32.073 73.171 1.00 102.91 ? -68  DT  J "O5'" 1 
ATOM   9275  C  "C5'" . DT  J  6 6   ? -58.549 -32.176 73.324 1.00 99.60  ? -68  DT  J "C5'" 1 
ATOM   9276  C  "C4'" . DT  J  6 6   ? -57.947 -33.103 72.286 1.00 97.15  ? -68  DT  J "C4'" 1 
ATOM   9277  O  "O4'" . DT  J  6 6   ? -58.288 -34.490 72.547 1.00 96.40  ? -68  DT  J "O4'" 1 
ATOM   9278  C  "C3'" . DT  J  6 6   ? -58.374 -32.824 70.848 1.00 95.75  ? -68  DT  J "C3'" 1 
ATOM   9279  O  "O3'" . DT  J  6 6   ? -57.197 -32.786 70.079 1.00 94.28  ? -68  DT  J "O3'" 1 
ATOM   9280  C  "C2'" . DT  J  6 6   ? -59.193 -34.054 70.482 1.00 95.58  ? -68  DT  J "C2'" 1 
ATOM   9281  C  "C1'" . DT  J  6 6   ? -58.410 -35.092 71.278 1.00 95.49  ? -68  DT  J "C1'" 1 
ATOM   9282  N  N1    . DT  J  6 6   ? -59.028 -36.456 71.360 1.00 95.23  ? -68  DT  J N1    1 
ATOM   9283  C  C2    . DT  J  6 6   ? -58.212 -37.576 71.275 1.00 94.89  ? -68  DT  J C2    1 
ATOM   9284  O  O2    . DT  J  6 6   ? -56.996 -37.528 71.144 1.00 94.73  ? -68  DT  J O2    1 
ATOM   9285  N  N3    . DT  J  6 6   ? -58.884 -38.775 71.352 1.00 94.58  ? -68  DT  J N3    1 
ATOM   9286  C  C4    . DT  J  6 6   ? -60.250 -38.963 71.496 1.00 95.06  ? -68  DT  J C4    1 
ATOM   9287  O  O4    . DT  J  6 6   ? -60.740 -40.084 71.551 1.00 94.80  ? -68  DT  J O4    1 
ATOM   9288  C  C5    . DT  J  6 6   ? -61.046 -37.752 71.578 1.00 95.38  ? -68  DT  J C5    1 
ATOM   9289  C  C7    . DT  J  6 6   ? -62.541 -37.811 71.734 1.00 95.30  ? -68  DT  J C7    1 
ATOM   9290  C  C6    . DT  J  6 6   ? -60.404 -36.574 71.504 1.00 95.24  ? -68  DT  J C6    1 
ATOM   9291  P  P     . DA  J  6 7   ? -56.999 -31.823 68.818 1.00 92.79  ? -67  DA  J P     1 
ATOM   9292  O  OP1   . DA  J  6 7   ? -56.582 -30.499 69.348 1.00 92.58  ? -67  DA  J OP1   1 
ATOM   9293  O  OP2   . DA  J  6 7   ? -58.131 -31.967 67.871 1.00 91.06  ? -67  DA  J OP2   1 
ATOM   9294  O  "O5'" . DA  J  6 7   ? -55.739 -32.521 68.132 1.00 90.16  ? -67  DA  J "O5'" 1 
ATOM   9295  C  "C5'" . DA  J  6 7   ? -54.631 -32.921 68.930 1.00 86.36  ? -67  DA  J "C5'" 1 
ATOM   9296  C  "C4'" . DA  J  6 7   ? -54.054 -34.230 68.424 1.00 83.55  ? -67  DA  J "C4'" 1 
ATOM   9297  O  "O4'" . DA  J  6 7   ? -54.940 -35.338 68.724 1.00 82.54  ? -67  DA  J "O4'" 1 
ATOM   9298  C  "C3'" . DA  J  6 7   ? -53.832 -34.268 66.920 1.00 82.15  ? -67  DA  J "C3'" 1 
ATOM   9299  O  "O3'" . DA  J  6 7   ? -52.580 -34.886 66.690 1.00 80.85  ? -67  DA  J "O3'" 1 
ATOM   9300  C  "C2'" . DA  J  6 7   ? -55.019 -35.079 66.399 1.00 81.69  ? -67  DA  J "C2'" 1 
ATOM   9301  C  "C1'" . DA  J  6 7   ? -55.217 -36.065 67.542 1.00 81.30  ? -67  DA  J "C1'" 1 
ATOM   9302  N  N9    . DA  J  6 7   ? -56.558 -36.651 67.618 1.00 81.09  ? -67  DA  J N9    1 
ATOM   9303  C  C8    . DA  J  6 7   ? -57.747 -35.989 67.789 1.00 81.00  ? -67  DA  J C8    1 
ATOM   9304  N  N7    . DA  J  6 7   ? -58.798 -36.774 67.820 1.00 80.83  ? -67  DA  J N7    1 
ATOM   9305  C  C5    . DA  J  6 7   ? -58.263 -38.038 67.661 1.00 80.76  ? -67  DA  J C5    1 
ATOM   9306  C  C6    . DA  J  6 7   ? -58.857 -39.314 67.607 1.00 80.84  ? -67  DA  J C6    1 
ATOM   9307  N  N6    . DA  J  6 7   ? -60.175 -39.501 67.719 1.00 80.83  ? -67  DA  J N6    1 
ATOM   9308  N  N1    . DA  J  6 7   ? -58.044 -40.384 67.437 1.00 80.68  ? -67  DA  J N1    1 
ATOM   9309  C  C2    . DA  J  6 7   ? -56.723 -40.185 67.324 1.00 80.72  ? -67  DA  J C2    1 
ATOM   9310  N  N3    . DA  J  6 7   ? -56.046 -39.034 67.363 1.00 80.83  ? -67  DA  J N3    1 
ATOM   9311  C  C4    . DA  J  6 7   ? -56.883 -37.987 67.535 1.00 80.80  ? -67  DA  J C4    1 
ATOM   9312  P  P     . DT  J  6 8   ? -51.908 -34.913 65.240 1.00 80.53  ? -66  DT  J P     1 
ATOM   9313  O  OP1   . DT  J  6 8   ? -50.456 -35.002 65.499 1.00 79.38  ? -66  DT  J OP1   1 
ATOM   9314  O  OP2   . DT  J  6 8   ? -52.497 -33.840 64.395 1.00 79.11  ? -66  DT  J OP2   1 
ATOM   9315  O  "O5'" . DT  J  6 8   ? -52.355 -36.324 64.638 1.00 80.89  ? -66  DT  J "O5'" 1 
ATOM   9316  C  "C5'" . DT  J  6 8   ? -51.893 -37.541 65.243 1.00 81.52  ? -66  DT  J "C5'" 1 
ATOM   9317  C  "C4'" . DT  J  6 8   ? -52.485 -38.761 64.557 1.00 81.62  ? -66  DT  J "C4'" 1 
ATOM   9318  O  "O4'" . DT  J  6 8   ? -53.891 -38.888 64.890 1.00 80.94  ? -66  DT  J "O4'" 1 
ATOM   9319  C  "C3'" . DT  J  6 8   ? -52.406 -38.746 63.034 1.00 82.46  ? -66  DT  J "C3'" 1 
ATOM   9320  O  "O3'" . DT  J  6 8   ? -51.903 -40.010 62.640 1.00 84.65  ? -66  DT  J "O3'" 1 
ATOM   9321  C  "C2'" . DT  J  6 8   ? -53.856 -38.524 62.601 1.00 81.55  ? -66  DT  J "C2'" 1 
ATOM   9322  C  "C1'" . DT  J  6 8   ? -54.600 -39.250 63.720 1.00 80.87  ? -66  DT  J "C1'" 1 
ATOM   9323  N  N1    . DT  J  6 8   ? -56.075 -38.934 63.895 1.00 80.65  ? -66  DT  J N1    1 
ATOM   9324  C  C2    . DT  J  6 8   ? -56.997 -39.960 63.993 1.00 79.90  ? -66  DT  J C2    1 
ATOM   9325  O  O2    . DT  J  6 8   ? -56.696 -41.134 63.942 1.00 80.47  ? -66  DT  J O2    1 
ATOM   9326  N  N3    . DT  J  6 8   ? -58.301 -39.565 64.157 1.00 79.27  ? -66  DT  J N3    1 
ATOM   9327  C  C4    . DT  J  6 8   ? -58.777 -38.267 64.233 1.00 80.27  ? -66  DT  J C4    1 
ATOM   9328  O  O4    . DT  J  6 8   ? -59.971 -38.017 64.382 1.00 80.29  ? -66  DT  J O4    1 
ATOM   9329  C  C5    . DT  J  6 8   ? -57.765 -37.233 64.122 1.00 80.73  ? -66  DT  J C5    1 
ATOM   9330  C  C7    . DT  J  6 8   ? -58.126 -35.777 64.189 1.00 80.53  ? -66  DT  J C7    1 
ATOM   9331  C  C6    . DT  J  6 8   ? -56.488 -37.612 63.962 1.00 80.93  ? -66  DT  J C6    1 
ATOM   9332  P  P     . DC  J  6 9   ? -51.176 -40.288 61.237 1.00 86.83  ? -65  DC  J P     1 
ATOM   9333  O  OP1   . DC  J  6 9   ? -49.778 -40.698 61.535 1.00 85.63  ? -65  DC  J OP1   1 
ATOM   9334  O  OP2   . DC  J  6 9   ? -51.488 -39.143 60.341 1.00 85.89  ? -65  DC  J OP2   1 
ATOM   9335  O  "O5'" . DC  J  6 9   ? -51.919 -41.589 60.673 1.00 86.37  ? -65  DC  J "O5'" 1 
ATOM   9336  C  "C5'" . DC  J  6 9   ? -52.210 -42.691 61.546 1.00 87.98  ? -65  DC  J "C5'" 1 
ATOM   9337  C  "C4'" . DC  J  6 9   ? -53.515 -43.362 61.146 1.00 88.72  ? -65  DC  J "C4'" 1 
ATOM   9338  O  "O4'" . DC  J  6 9   ? -54.642 -42.570 61.587 1.00 88.36  ? -65  DC  J "O4'" 1 
ATOM   9339  C  "C3'" . DC  J  6 9   ? -53.683 -43.509 59.637 1.00 89.35  ? -65  DC  J "C3'" 1 
ATOM   9340  O  "O3'" . DC  J  6 9   ? -53.380 -44.857 59.257 1.00 90.90  ? -65  DC  J "O3'" 1 
ATOM   9341  C  "C2'" . DC  J  6 9   ? -55.133 -43.125 59.360 1.00 88.70  ? -65  DC  J "C2'" 1 
ATOM   9342  C  "C1'" . DC  J  6 9   ? -55.727 -42.848 60.735 1.00 88.06  ? -65  DC  J "C1'" 1 
ATOM   9343  N  N1    . DC  J  6 9   ? -56.676 -41.695 60.768 1.00 87.83  ? -65  DC  J N1    1 
ATOM   9344  C  C2    . DC  J  6 9   ? -58.064 -41.913 60.890 1.00 87.99  ? -65  DC  J C2    1 
ATOM   9345  O  O2    . DC  J  6 9   ? -58.513 -43.068 60.973 1.00 87.92  ? -65  DC  J O2    1 
ATOM   9346  N  N3    . DC  J  6 9   ? -58.896 -40.836 60.919 1.00 87.73  ? -65  DC  J N3    1 
ATOM   9347  C  C4    . DC  J  6 9   ? -58.404 -39.595 60.833 1.00 87.87  ? -65  DC  J C4    1 
ATOM   9348  N  N4    . DC  J  6 9   ? -59.265 -38.570 60.861 1.00 87.58  ? -65  DC  J N4    1 
ATOM   9349  C  C5    . DC  J  6 9   ? -57.001 -39.357 60.699 1.00 88.24  ? -65  DC  J C5    1 
ATOM   9350  C  C6    . DC  J  6 9   ? -56.186 -40.423 60.673 1.00 87.96  ? -65  DC  J C6    1 
ATOM   9351  P  P     . DC  J  6 10  ? -53.015 -45.254 57.742 1.00 91.04  ? -64  DC  J P     1 
ATOM   9352  O  OP1   . DC  J  6 10  ? -52.082 -46.406 57.770 1.00 91.55  ? -64  DC  J OP1   1 
ATOM   9353  O  OP2   . DC  J  6 10  ? -52.684 -44.029 56.980 1.00 90.14  ? -64  DC  J OP2   1 
ATOM   9354  O  "O5'" . DC  J  6 10  ? -54.420 -45.818 57.238 1.00 91.04  ? -64  DC  J "O5'" 1 
ATOM   9355  C  "C5'" . DC  J  6 10  ? -55.220 -46.661 58.080 1.00 90.24  ? -64  DC  J "C5'" 1 
ATOM   9356  C  "C4'" . DC  J  6 10  ? -56.617 -46.774 57.491 1.00 89.90  ? -64  DC  J "C4'" 1 
ATOM   9357  O  "O4'" . DC  J  6 10  ? -57.461 -45.671 57.929 1.00 88.81  ? -64  DC  J "O4'" 1 
ATOM   9358  C  "C3'" . DC  J  6 10  ? -56.650 -46.783 55.960 1.00 89.50  ? -64  DC  J "C3'" 1 
ATOM   9359  O  "O3'" . DC  J  6 10  ? -57.456 -47.872 55.542 1.00 89.49  ? -64  DC  J "O3'" 1 
ATOM   9360  C  "C2'" . DC  J  6 10  ? -57.262 -45.433 55.587 1.00 88.67  ? -64  DC  J "C2'" 1 
ATOM   9361  C  "C1'" . DC  J  6 10  ? -58.127 -45.126 56.810 1.00 88.08  ? -64  DC  J "C1'" 1 
ATOM   9362  N  N1    . DC  J  6 10  ? -58.334 -43.673 57.070 1.00 87.83  ? -64  DC  J N1    1 
ATOM   9363  C  C2    . DC  J  6 10  ? -59.574 -43.219 57.547 1.00 87.46  ? -64  DC  J C2    1 
ATOM   9364  O  O2    . DC  J  6 10  ? -60.489 -44.027 57.745 1.00 87.40  ? -64  DC  J O2    1 
ATOM   9365  N  N3    . DC  J  6 10  ? -59.738 -41.892 57.779 1.00 87.13  ? -64  DC  J N3    1 
ATOM   9366  C  C4    . DC  J  6 10  ? -58.731 -41.041 57.557 1.00 87.36  ? -64  DC  J C4    1 
ATOM   9367  N  N4    . DC  J  6 10  ? -58.941 -39.746 57.796 1.00 87.49  ? -64  DC  J N4    1 
ATOM   9368  C  C5    . DC  J  6 10  ? -57.462 -41.477 57.072 1.00 87.39  ? -64  DC  J C5    1 
ATOM   9369  C  C6    . DC  J  6 10  ? -57.312 -42.787 56.844 1.00 87.76  ? -64  DC  J C6    1 
ATOM   9370  P  P     . DA  J  6 11  ? -57.405 -48.510 54.071 1.00 88.72  ? -63  DA  J P     1 
ATOM   9371  O  OP1   . DA  J  6 11  ? -56.885 -49.888 54.241 1.00 89.21  ? -63  DA  J OP1   1 
ATOM   9372  O  OP2   . DA  J  6 11  ? -56.782 -47.586 53.098 1.00 88.13  ? -63  DA  J OP2   1 
ATOM   9373  O  "O5'" . DA  J  6 11  ? -58.961 -48.589 53.727 1.00 87.97  ? -63  DA  J "O5'" 1 
ATOM   9374  C  "C5'" . DA  J  6 11  ? -59.919 -48.616 54.782 1.00 86.80  ? -63  DA  J "C5'" 1 
ATOM   9375  C  "C4'" . DA  J  6 11  ? -61.283 -48.270 54.230 1.00 85.93  ? -63  DA  J "C4'" 1 
ATOM   9376  O  "O4'" . DA  J  6 11  ? -61.633 -46.938 54.669 1.00 85.03  ? -63  DA  J "O4'" 1 
ATOM   9377  C  "C3'" . DA  J  6 11  ? -61.350 -48.308 52.706 1.00 86.05  ? -63  DA  J "C3'" 1 
ATOM   9378  O  "O3'" . DA  J  6 11  ? -62.492 -49.100 52.307 1.00 87.32  ? -63  DA  J "O3'" 1 
ATOM   9379  C  "C2'" . DA  J  6 11  ? -61.401 -46.830 52.309 1.00 85.73  ? -63  DA  J "C2'" 1 
ATOM   9380  C  "C1'" . DA  J  6 11  ? -61.929 -46.122 53.559 1.00 84.86  ? -63  DA  J "C1'" 1 
ATOM   9381  N  N9    . DA  J  6 11  ? -61.346 -44.793 53.786 1.00 84.88  ? -63  DA  J N9    1 
ATOM   9382  C  C8    . DA  J  6 11  ? -60.029 -44.422 53.652 1.00 84.28  ? -63  DA  J C8    1 
ATOM   9383  N  N7    . DA  J  6 11  ? -59.797 -43.160 53.919 1.00 83.80  ? -63  DA  J N7    1 
ATOM   9384  C  C5    . DA  J  6 11  ? -61.044 -42.657 54.250 1.00 84.17  ? -63  DA  J C5    1 
ATOM   9385  C  C6    . DA  J  6 11  ? -61.485 -41.368 54.631 1.00 84.29  ? -63  DA  J C6    1 
ATOM   9386  N  N6    . DA  J  6 11  ? -60.659 -40.321 54.746 1.00 84.69  ? -63  DA  J N6    1 
ATOM   9387  N  N1    . DA  J  6 11  ? -62.803 -41.193 54.890 1.00 84.07  ? -63  DA  J N1    1 
ATOM   9388  C  C2    . DA  J  6 11  ? -63.624 -42.247 54.773 1.00 84.13  ? -63  DA  J C2    1 
ATOM   9389  N  N3    . DA  J  6 11  ? -63.330 -43.507 54.428 1.00 84.34  ? -63  DA  J N3    1 
ATOM   9390  C  C4    . DA  J  6 11  ? -62.013 -43.649 54.174 1.00 84.61  ? -63  DA  J C4    1 
ATOM   9391  P  P     . DC  J  6 12  ? -62.935 -49.417 50.785 1.00 87.61  ? -62  DC  J P     1 
ATOM   9392  O  OP1   . DC  J  6 12  ? -63.480 -50.788 50.753 1.00 88.03  ? -62  DC  J OP1   1 
ATOM   9393  O  OP2   . DC  J  6 12  ? -61.858 -49.040 49.837 1.00 86.80  ? -62  DC  J OP2   1 
ATOM   9394  O  "O5'" . DC  J  6 12  ? -64.173 -48.430 50.582 1.00 87.98  ? -62  DC  J "O5'" 1 
ATOM   9395  C  "C5'" . DC  J  6 12  ? -64.878 -47.843 51.692 1.00 88.64  ? -62  DC  J "C5'" 1 
ATOM   9396  C  "C4'" . DC  J  6 12  ? -65.615 -46.611 51.209 1.00 89.03  ? -62  DC  J "C4'" 1 
ATOM   9397  O  "O4'" . DC  J  6 12  ? -64.887 -45.443 51.667 1.00 89.72  ? -62  DC  J "O4'" 1 
ATOM   9398  C  "C3'" . DC  J  6 12  ? -65.723 -46.486 49.682 1.00 89.64  ? -62  DC  J "C3'" 1 
ATOM   9399  O  "O3'" . DC  J  6 12  ? -67.050 -46.095 49.291 1.00 91.66  ? -62  DC  J "O3'" 1 
ATOM   9400  C  "C2'" . DC  J  6 12  ? -64.685 -45.418 49.343 1.00 89.69  ? -62  DC  J "C2'" 1 
ATOM   9401  C  "C1'" . DC  J  6 12  ? -64.810 -44.534 50.580 1.00 89.38  ? -62  DC  J "C1'" 1 
ATOM   9402  N  N1    . DC  J  6 12  ? -63.701 -43.541 50.747 1.00 88.69  ? -62  DC  J N1    1 
ATOM   9403  C  C2    . DC  J  6 12  ? -63.970 -42.274 51.294 1.00 88.45  ? -62  DC  J C2    1 
ATOM   9404  O  O2    . DC  J  6 12  ? -65.122 -41.987 51.652 1.00 88.31  ? -62  DC  J O2    1 
ATOM   9405  N  N3    . DC  J  6 12  ? -62.947 -41.385 51.424 1.00 88.41  ? -62  DC  J N3    1 
ATOM   9406  C  C4    . DC  J  6 12  ? -61.713 -41.718 51.036 1.00 88.46  ? -62  DC  J C4    1 
ATOM   9407  N  N4    . DC  J  6 12  ? -60.742 -40.818 51.186 1.00 88.32  ? -62  DC  J N4    1 
ATOM   9408  C  C5    . DC  J  6 12  ? -61.419 -42.998 50.473 1.00 89.03  ? -62  DC  J C5    1 
ATOM   9409  C  C6    . DC  J  6 12  ? -62.432 -43.869 50.346 1.00 89.09  ? -62  DC  J C6    1 
ATOM   9410  P  P     . DC  J  6 13  ? -67.518 -45.858 47.767 1.00 92.90  ? -61  DC  J P     1 
ATOM   9411  O  OP1   . DC  J  6 13  ? -68.876 -46.434 47.637 1.00 92.35  ? -61  DC  J OP1   1 
ATOM   9412  O  OP2   . DC  J  6 13  ? -66.441 -46.298 46.847 1.00 92.02  ? -61  DC  J OP2   1 
ATOM   9413  O  "O5'" . DC  J  6 13  ? -67.634 -44.256 47.667 1.00 94.09  ? -61  DC  J "O5'" 1 
ATOM   9414  C  "C5'" . DC  J  6 13  ? -68.467 -43.493 48.557 1.00 96.13  ? -61  DC  J "C5'" 1 
ATOM   9415  C  "C4'" . DC  J  6 13  ? -68.346 -41.998 48.294 1.00 98.22  ? -61  DC  J "C4'" 1 
ATOM   9416  O  "O4'" . DC  J  6 13  ? -67.072 -41.518 48.809 1.00 98.24  ? -61  DC  J "O4'" 1 
ATOM   9417  C  "C3'" . DC  J  6 13  ? -68.411 -41.596 46.815 1.00 99.72  ? -61  DC  J "C3'" 1 
ATOM   9418  O  "O3'" . DC  J  6 13  ? -69.593 -40.839 46.515 1.00 102.04 ? -61  DC  J "O3'" 1 
ATOM   9419  C  "C2'" . DC  J  6 13  ? -67.173 -40.737 46.560 1.00 99.01  ? -61  DC  J "C2'" 1 
ATOM   9420  C  "C1'" . DC  J  6 13  ? -66.499 -40.572 47.917 1.00 97.77  ? -61  DC  J "C1'" 1 
ATOM   9421  N  N1    . DC  J  6 13  ? -65.004 -40.757 47.807 1.00 97.21  ? -61  DC  J N1    1 
ATOM   9422  C  C2    . DC  J  6 13  ? -64.125 -39.739 48.233 1.00 96.90  ? -61  DC  J C2    1 
ATOM   9423  O  O2    . DC  J  6 13  ? -64.587 -38.696 48.709 1.00 96.89  ? -61  DC  J O2    1 
ATOM   9424  N  N3    . DC  J  6 13  ? -62.780 -39.932 48.114 1.00 96.51  ? -61  DC  J N3    1 
ATOM   9425  C  C4    . DC  J  6 13  ? -62.313 -41.075 47.594 1.00 96.62  ? -61  DC  J C4    1 
ATOM   9426  N  N4    . DC  J  6 13  ? -60.992 -41.235 47.496 1.00 96.59  ? -61  DC  J N4    1 
ATOM   9427  C  C5    . DC  J  6 13  ? -63.185 -42.117 47.148 1.00 96.69  ? -61  DC  J C5    1 
ATOM   9428  C  C6    . DC  J  6 13  ? -64.505 -41.917 47.271 1.00 96.73  ? -61  DC  J C6    1 
ATOM   9429  P  P     . DT  J  6 14  ? -70.157 -40.689 45.013 1.00 103.31 ? -60  DT  J P     1 
ATOM   9430  O  OP1   . DT  J  6 14  ? -71.510 -41.285 45.023 1.00 103.10 ? -60  DT  J OP1   1 
ATOM   9431  O  OP2   . DT  J  6 14  ? -69.159 -41.181 44.030 1.00 102.22 ? -60  DT  J OP2   1 
ATOM   9432  O  "O5'" . DT  J  6 14  ? -70.312 -39.100 44.831 1.00 104.67 ? -60  DT  J "O5'" 1 
ATOM   9433  C  "C5'" . DT  J  6 14  ? -69.875 -38.148 45.815 1.00 107.11 ? -60  DT  J "C5'" 1 
ATOM   9434  C  "C4'" . DT  J  6 14  ? -69.025 -37.041 45.199 1.00 108.96 ? -60  DT  J "C4'" 1 
ATOM   9435  O  "O4'" . DT  J  6 14  ? -67.607 -37.291 45.407 1.00 108.64 ? -60  DT  J "O4'" 1 
ATOM   9436  C  "C3'" . DT  J  6 14  ? -69.196 -36.821 43.694 1.00 110.74 ? -60  DT  J "C3'" 1 
ATOM   9437  O  "O3'" . DT  J  6 14  ? -69.314 -35.424 43.446 1.00 113.89 ? -60  DT  J "O3'" 1 
ATOM   9438  C  "C2'" . DT  J  6 14  ? -67.919 -37.398 43.081 1.00 109.79 ? -60  DT  J "C2'" 1 
ATOM   9439  C  "C1'" . DT  J  6 14  ? -66.917 -37.062 44.186 1.00 108.46 ? -60  DT  J "C1'" 1 
ATOM   9440  N  N1    . DT  J  6 14  ? -65.608 -37.824 44.169 1.00 107.99 ? -60  DT  J N1    1 
ATOM   9441  C  C2    . DT  J  6 14  ? -64.440 -37.142 44.464 1.00 107.54 ? -60  DT  J C2    1 
ATOM   9442  O  O2    . DT  J  6 14  ? -64.405 -35.955 44.738 1.00 107.39 ? -60  DT  J O2    1 
ATOM   9443  N  N3    . DT  J  6 14  ? -63.299 -37.907 44.431 1.00 107.27 ? -60  DT  J N3    1 
ATOM   9444  C  C4    . DT  J  6 14  ? -63.204 -39.258 44.140 1.00 107.65 ? -60  DT  J C4    1 
ATOM   9445  O  O4    . DT  J  6 14  ? -62.123 -39.840 44.142 1.00 107.31 ? -60  DT  J O4    1 
ATOM   9446  C  C5    . DT  J  6 14  ? -64.460 -39.917 43.836 1.00 107.79 ? -60  DT  J C5    1 
ATOM   9447  C  C7    . DT  J  6 14  ? -64.503 -41.381 43.503 1.00 107.72 ? -60  DT  J C7    1 
ATOM   9448  C  C6    . DT  J  6 14  ? -65.583 -39.178 43.865 1.00 107.89 ? -60  DT  J C6    1 
ATOM   9449  P  P     . DG  J  6 15  ? -70.105 -34.880 42.159 1.00 116.49 ? -59  DG  J P     1 
ATOM   9450  O  OP1   . DG  J  6 15  ? -71.538 -35.196 42.383 1.00 116.13 ? -59  DG  J OP1   1 
ATOM   9451  O  OP2   . DG  J  6 15  ? -69.419 -35.380 40.937 1.00 115.76 ? -59  DG  J OP2   1 
ATOM   9452  O  "O5'" . DG  J  6 15  ? -69.909 -33.280 42.228 1.00 116.14 ? -59  DG  J "O5'" 1 
ATOM   9453  C  "C5'" . DG  J  6 15  ? -69.046 -32.625 43.183 1.00 115.82 ? -59  DG  J "C5'" 1 
ATOM   9454  C  "C4'" . DG  J  6 15  ? -67.868 -31.909 42.529 1.00 115.14 ? -59  DG  J "C4'" 1 
ATOM   9455  O  "O4'" . DG  J  6 15  ? -66.685 -32.744 42.578 1.00 114.88 ? -59  DG  J "O4'" 1 
ATOM   9456  C  "C3'" . DG  J  6 15  ? -68.068 -31.490 41.071 1.00 115.11 ? -59  DG  J "C3'" 1 
ATOM   9457  O  "O3'" . DG  J  6 15  ? -67.954 -30.046 40.973 1.00 115.55 ? -59  DG  J "O3'" 1 
ATOM   9458  C  "C2'" . DG  J  6 15  ? -67.055 -32.319 40.276 1.00 114.75 ? -59  DG  J "C2'" 1 
ATOM   9459  C  "C1'" . DG  J  6 15  ? -66.044 -32.783 41.321 1.00 114.57 ? -59  DG  J "C1'" 1 
ATOM   9460  N  N9    . DG  J  6 15  ? -65.561 -34.147 41.109 1.00 114.48 ? -59  DG  J N9    1 
ATOM   9461  C  C8    . DG  J  6 15  ? -66.289 -35.218 40.645 1.00 114.51 ? -59  DG  J C8    1 
ATOM   9462  N  N7    . DG  J  6 15  ? -65.607 -36.325 40.557 1.00 114.60 ? -59  DG  J N7    1 
ATOM   9463  C  C5    . DG  J  6 15  ? -64.338 -35.969 40.993 1.00 114.56 ? -59  DG  J C5    1 
ATOM   9464  C  C6    . DG  J  6 15  ? -63.167 -36.760 41.118 1.00 114.50 ? -59  DG  J C6    1 
ATOM   9465  O  O6    . DG  J  6 15  ? -63.029 -37.964 40.857 1.00 114.39 ? -59  DG  J O6    1 
ATOM   9466  N  N1    . DG  J  6 15  ? -62.085 -36.018 41.599 1.00 114.55 ? -59  DG  J N1    1 
ATOM   9467  C  C2    . DG  J  6 15  ? -62.133 -34.676 41.922 1.00 114.52 ? -59  DG  J C2    1 
ATOM   9468  N  N2    . DG  J  6 15  ? -60.992 -34.131 42.371 1.00 114.42 ? -59  DG  J N2    1 
ATOM   9469  N  N3    . DG  J  6 15  ? -63.226 -33.923 41.812 1.00 114.39 ? -59  DG  J N3    1 
ATOM   9470  C  C4    . DG  J  6 15  ? -64.290 -34.630 41.340 1.00 114.52 ? -59  DG  J C4    1 
ATOM   9471  P  P     . DC  J  6 16  ? -67.049 -29.206 39.942 1.00 115.02 ? -58  DC  J P     1 
ATOM   9472  O  OP1   . DC  J  6 16  ? -67.306 -27.772 40.220 1.00 115.18 ? -58  DC  J OP1   1 
ATOM   9473  O  OP2   . DC  J  6 16  ? -67.248 -29.737 38.568 1.00 114.26 ? -58  DC  J OP2   1 
ATOM   9474  O  "O5'" . DC  J  6 16  ? -65.574 -29.568 40.459 1.00 114.94 ? -58  DC  J "O5'" 1 
ATOM   9475  C  "C5'" . DC  J  6 16  ? -64.595 -28.592 40.806 1.00 113.52 ? -58  DC  J "C5'" 1 
ATOM   9476  C  "C4'" . DC  J  6 16  ? -63.347 -28.812 39.967 1.00 112.89 ? -58  DC  J "C4'" 1 
ATOM   9477  O  "O4'" . DC  J  6 16  ? -63.046 -30.225 39.813 1.00 112.23 ? -58  DC  J "O4'" 1 
ATOM   9478  C  "C3'" . DC  J  6 16  ? -63.434 -28.262 38.545 1.00 112.76 ? -58  DC  J "C3'" 1 
ATOM   9479  O  "O3'" . DC  J  6 16  ? -62.163 -27.748 38.205 1.00 113.00 ? -58  DC  J "O3'" 1 
ATOM   9480  C  "C2'" . DC  J  6 16  ? -63.745 -29.495 37.707 1.00 112.14 ? -58  DC  J "C2'" 1 
ATOM   9481  C  "C1'" . DC  J  6 16  ? -62.845 -30.487 38.435 1.00 111.79 ? -58  DC  J "C1'" 1 
ATOM   9482  N  N1    . DC  J  6 16  ? -63.115 -31.928 38.179 1.00 111.55 ? -58  DC  J N1    1 
ATOM   9483  C  C2    . DC  J  6 16  ? -62.184 -32.878 38.620 1.00 111.14 ? -58  DC  J C2    1 
ATOM   9484  O  O2    . DC  J  6 16  ? -61.157 -32.507 39.209 1.00 111.05 ? -58  DC  J O2    1 
ATOM   9485  N  N3    . DC  J  6 16  ? -62.443 -34.189 38.383 1.00 111.24 ? -58  DC  J N3    1 
ATOM   9486  C  C4    . DC  J  6 16  ? -63.560 -34.559 37.747 1.00 111.38 ? -58  DC  J C4    1 
ATOM   9487  N  N4    . DC  J  6 16  ? -63.763 -35.862 37.545 1.00 111.48 ? -58  DC  J N4    1 
ATOM   9488  C  C5    . DC  J  6 16  ? -64.521 -33.608 37.292 1.00 111.49 ? -58  DC  J C5    1 
ATOM   9489  C  C6    . DC  J  6 16  ? -64.257 -32.317 37.529 1.00 111.70 ? -58  DC  J C6    1 
ATOM   9490  P  P     . DA  J  6 17  ? -61.851 -26.191 38.342 1.00 113.41 ? -57  DA  J P     1 
ATOM   9491  O  OP1   . DA  J  6 17  ? -62.452 -25.663 39.596 1.00 113.54 ? -57  DA  J OP1   1 
ATOM   9492  O  OP2   . DA  J  6 17  ? -62.219 -25.598 37.034 1.00 113.74 ? -57  DA  J OP2   1 
ATOM   9493  O  "O5'" . DA  J  6 17  ? -60.253 -26.164 38.474 1.00 112.47 ? -57  DA  J "O5'" 1 
ATOM   9494  C  "C5'" . DA  J  6 17  ? -59.580 -26.502 39.693 1.00 110.66 ? -57  DA  J "C5'" 1 
ATOM   9495  C  "C4'" . DA  J  6 17  ? -58.351 -27.356 39.409 1.00 109.30 ? -57  DA  J "C4'" 1 
ATOM   9496  O  "O4'" . DA  J  6 17  ? -58.727 -28.600 38.765 1.00 108.34 ? -57  DA  J "O4'" 1 
ATOM   9497  C  "C3'" . DA  J  6 17  ? -57.293 -26.749 38.493 1.00 109.13 ? -57  DA  J "C3'" 1 
ATOM   9498  O  "O3'" . DA  J  6 17  ? -56.022 -27.223 38.962 1.00 109.51 ? -57  DA  J "O3'" 1 
ATOM   9499  C  "C2'" . DA  J  6 17  ? -57.662 -27.289 37.105 1.00 108.19 ? -57  DA  J "C2'" 1 
ATOM   9500  C  "C1'" . DA  J  6 17  ? -58.200 -28.677 37.452 1.00 107.02 ? -57  DA  J "C1'" 1 
ATOM   9501  N  N9    . DA  J  6 17  ? -59.280 -29.191 36.613 1.00 106.77 ? -57  DA  J N9    1 
ATOM   9502  C  C8    . DA  J  6 17  ? -60.234 -28.484 35.930 1.00 106.37 ? -57  DA  J C8    1 
ATOM   9503  N  N7    . DA  J  6 17  ? -61.083 -29.240 35.274 1.00 106.22 ? -57  DA  J N7    1 
ATOM   9504  C  C5    . DA  J  6 17  ? -60.662 -30.531 35.548 1.00 106.22 ? -57  DA  J C5    1 
ATOM   9505  C  C6    . DA  J  6 17  ? -61.142 -31.798 35.154 1.00 106.26 ? -57  DA  J C6    1 
ATOM   9506  N  N6    . DA  J  6 17  ? -62.201 -31.963 34.356 1.00 106.43 ? -57  DA  J N6    1 
ATOM   9507  N  N1    . DA  J  6 17  ? -60.485 -32.892 35.599 1.00 106.14 ? -57  DA  J N1    1 
ATOM   9508  C  C2    . DA  J  6 17  ? -59.423 -32.731 36.396 1.00 106.10 ? -57  DA  J C2    1 
ATOM   9509  N  N3    . DA  J  6 17  ? -58.884 -31.595 36.839 1.00 106.12 ? -57  DA  J N3    1 
ATOM   9510  C  C4    . DA  J  6 17  ? -59.553 -30.522 36.375 1.00 106.46 ? -57  DA  J C4    1 
ATOM   9511  P  P     . DG  J  6 18  ? -54.617 -26.743 38.361 1.00 109.25 ? -56  DG  J P     1 
ATOM   9512  O  OP1   . DG  J  6 18  ? -53.621 -26.900 39.449 1.00 108.95 ? -56  DG  J OP1   1 
ATOM   9513  O  OP2   . DG  J  6 18  ? -54.801 -25.429 37.702 1.00 109.03 ? -56  DG  J OP2   1 
ATOM   9514  O  "O5'" . DG  J  6 18  ? -54.336 -27.818 37.209 1.00 108.81 ? -56  DG  J "O5'" 1 
ATOM   9515  C  "C5'" . DG  J  6 18  ? -53.825 -29.105 37.539 1.00 108.93 ? -56  DG  J "C5'" 1 
ATOM   9516  C  "C4'" . DG  J  6 18  ? -53.855 -30.013 36.325 1.00 109.27 ? -56  DG  J "C4'" 1 
ATOM   9517  O  "O4'" . DG  J  6 18  ? -55.226 -30.194 35.887 1.00 109.79 ? -56  DG  J "O4'" 1 
ATOM   9518  C  "C3'" . DG  J  6 18  ? -53.076 -29.526 35.096 1.00 109.11 ? -56  DG  J "C3'" 1 
ATOM   9519  O  "O3'" . DG  J  6 18  ? -52.339 -30.595 34.530 1.00 109.04 ? -56  DG  J "O3'" 1 
ATOM   9520  C  "C2'" . DG  J  6 18  ? -54.176 -29.127 34.121 1.00 109.18 ? -56  DG  J "C2'" 1 
ATOM   9521  C  "C1'" . DG  J  6 18  ? -55.174 -30.224 34.479 1.00 109.63 ? -56  DG  J "C1'" 1 
ATOM   9522  N  N9    . DG  J  6 18  ? -56.509 -30.115 33.897 1.00 109.59 ? -56  DG  J N9    1 
ATOM   9523  C  C8    . DG  J  6 18  ? -57.234 -28.983 33.612 1.00 109.70 ? -56  DG  J C8    1 
ATOM   9524  N  N7    . DG  J  6 18  ? -58.401 -29.234 33.082 1.00 109.86 ? -56  DG  J N7    1 
ATOM   9525  C  C5    . DG  J  6 18  ? -58.450 -30.620 33.012 1.00 109.74 ? -56  DG  J C5    1 
ATOM   9526  C  C6    . DG  J  6 18  ? -59.464 -31.482 32.531 1.00 109.59 ? -56  DG  J C6    1 
ATOM   9527  O  O6    . DG  J  6 18  ? -60.561 -31.169 32.059 1.00 109.48 ? -56  DG  J O6    1 
ATOM   9528  N  N1    . DG  J  6 18  ? -59.112 -32.830 32.647 1.00 109.75 ? -56  DG  J N1    1 
ATOM   9529  C  C2    . DG  J  6 18  ? -57.921 -33.290 33.170 1.00 109.69 ? -56  DG  J C2    1 
ATOM   9530  N  N2    . DG  J  6 18  ? -57.736 -34.617 33.205 1.00 109.62 ? -56  DG  J N2    1 
ATOM   9531  N  N3    . DG  J  6 18  ? -56.964 -32.490 33.621 1.00 109.73 ? -56  DG  J N3    1 
ATOM   9532  C  C4    . DG  J  6 18  ? -57.294 -31.176 33.514 1.00 109.72 ? -56  DG  J C4    1 
ATOM   9533  P  P     . DA  J  6 19  ? -51.001 -31.190 35.175 1.00 109.12 ? -55  DA  J P     1 
ATOM   9534  O  OP1   . DA  J  6 19  ? -51.218 -31.530 36.601 1.00 108.78 ? -55  DA  J OP1   1 
ATOM   9535  O  OP2   . DA  J  6 19  ? -49.889 -30.294 34.811 1.00 109.32 ? -55  DA  J OP2   1 
ATOM   9536  O  "O5'" . DA  J  6 19  ? -50.866 -32.532 34.313 1.00 109.87 ? -55  DA  J "O5'" 1 
ATOM   9537  C  "C5'" . DA  J  6 19  ? -51.615 -33.684 34.701 1.00 111.06 ? -55  DA  J "C5'" 1 
ATOM   9538  C  "C4'" . DA  J  6 19  ? -52.427 -34.309 33.580 1.00 111.50 ? -55  DA  J "C4'" 1 
ATOM   9539  O  "O4'" . DA  J  6 19  ? -53.548 -33.473 33.210 1.00 111.14 ? -55  DA  J "O4'" 1 
ATOM   9540  C  "C3'" . DA  J  6 19  ? -51.661 -34.576 32.293 1.00 112.40 ? -55  DA  J "C3'" 1 
ATOM   9541  O  "O3'" . DA  J  6 19  ? -51.523 -35.970 32.110 1.00 115.02 ? -55  DA  J "O3'" 1 
ATOM   9542  C  "C2'" . DA  J  6 19  ? -52.528 -33.963 31.198 1.00 111.92 ? -55  DA  J "C2'" 1 
ATOM   9543  C  "C1'" . DA  J  6 19  ? -53.875 -33.861 31.897 1.00 111.06 ? -55  DA  J "C1'" 1 
ATOM   9544  N  N9    . DA  J  6 19  ? -54.808 -32.901 31.309 1.00 110.82 ? -55  DA  J N9    1 
ATOM   9545  C  C8    . DA  J  6 19  ? -54.707 -31.536 31.290 1.00 110.76 ? -55  DA  J C8    1 
ATOM   9546  N  N7    . DA  J  6 19  ? -55.705 -30.933 30.688 1.00 110.75 ? -55  DA  J N7    1 
ATOM   9547  C  C5    . DA  J  6 19  ? -56.520 -31.978 30.280 1.00 110.91 ? -55  DA  J C5    1 
ATOM   9548  C  C6    . DA  J  6 19  ? -57.747 -32.019 29.585 1.00 110.75 ? -55  DA  J C6    1 
ATOM   9549  N  N6    . DA  J  6 19  ? -58.383 -30.923 29.162 1.00 110.87 ? -55  DA  J N6    1 
ATOM   9550  N  N1    . DA  J  6 19  ? -58.299 -33.229 29.337 1.00 110.78 ? -55  DA  J N1    1 
ATOM   9551  C  C2    . DA  J  6 19  ? -57.666 -34.331 29.760 1.00 110.83 ? -55  DA  J C2    1 
ATOM   9552  N  N3    . DA  J  6 19  ? -56.509 -34.420 30.418 1.00 110.94 ? -55  DA  J N3    1 
ATOM   9553  C  C4    . DA  J  6 19  ? -55.980 -33.200 30.648 1.00 110.87 ? -55  DA  J C4    1 
ATOM   9554  P  P     . DT  J  6 20  ? -50.357 -36.529 31.164 1.00 117.31 ? -54  DT  J P     1 
ATOM   9555  O  OP1   . DT  J  6 20  ? -49.768 -37.704 31.844 1.00 117.34 ? -54  DT  J OP1   1 
ATOM   9556  O  OP2   . DT  J  6 20  ? -49.473 -35.397 30.801 1.00 116.83 ? -54  DT  J OP2   1 
ATOM   9557  O  "O5'" . DT  J  6 20  ? -51.141 -36.991 29.840 1.00 118.93 ? -54  DT  J "O5'" 1 
ATOM   9558  C  "C5'" . DT  J  6 20  ? -52.061 -38.084 29.872 1.00 122.12 ? -54  DT  J "C5'" 1 
ATOM   9559  C  "C4'" . DT  J  6 20  ? -53.221 -37.912 28.897 1.00 124.40 ? -54  DT  J "C4'" 1 
ATOM   9560  O  "O4'" . DT  J  6 20  ? -53.803 -36.586 28.949 1.00 124.63 ? -54  DT  J "O4'" 1 
ATOM   9561  C  "C3'" . DT  J  6 20  ? -52.882 -38.148 27.426 1.00 125.95 ? -54  DT  J "C3'" 1 
ATOM   9562  O  "O3'" . DT  J  6 20  ? -53.353 -39.443 27.039 1.00 128.20 ? -54  DT  J "O3'" 1 
ATOM   9563  C  "C2'" . DT  J  6 20  ? -53.615 -37.032 26.676 1.00 125.56 ? -54  DT  J "C2'" 1 
ATOM   9564  C  "C1'" . DT  J  6 20  ? -54.514 -36.420 27.741 1.00 125.08 ? -54  DT  J "C1'" 1 
ATOM   9565  N  N1    . DT  J  6 20  ? -54.815 -34.972 27.510 1.00 125.19 ? -54  DT  J N1    1 
ATOM   9566  C  C2    . DT  J  6 20  ? -56.024 -34.598 26.946 1.00 125.32 ? -54  DT  J C2    1 
ATOM   9567  O  O2    . DT  J  6 20  ? -56.899 -35.382 26.614 1.00 125.34 ? -54  DT  J O2    1 
ATOM   9568  N  N3    . DT  J  6 20  ? -56.184 -33.241 26.786 1.00 125.41 ? -54  DT  J N3    1 
ATOM   9569  C  C4    . DT  J  6 20  ? -55.283 -32.238 27.117 1.00 125.32 ? -54  DT  J C4    1 
ATOM   9570  O  O4    . DT  J  6 20  ? -55.534 -31.050 26.927 1.00 125.10 ? -54  DT  J O4    1 
ATOM   9571  C  C5    . DT  J  6 20  ? -54.040 -32.696 27.701 1.00 125.38 ? -54  DT  J C5    1 
ATOM   9572  C  C7    . DT  J  6 20  ? -52.970 -31.725 28.111 1.00 125.23 ? -54  DT  J C7    1 
ATOM   9573  C  C6    . DT  J  6 20  ? -53.872 -34.019 27.861 1.00 125.40 ? -54  DT  J C6    1 
ATOM   9574  P  P     . DA  J  6 21  ? -52.779 -40.236 25.764 1.00 130.10 ? -53  DA  J P     1 
ATOM   9575  O  OP1   . DA  J  6 21  ? -52.167 -41.493 26.250 1.00 129.88 ? -53  DA  J OP1   1 
ATOM   9576  O  OP2   . DA  J  6 21  ? -51.976 -39.308 24.933 1.00 130.02 ? -53  DA  J OP2   1 
ATOM   9577  O  "O5'" . DA  J  6 21  ? -54.104 -40.617 24.946 1.00 131.59 ? -53  DA  J "O5'" 1 
ATOM   9578  C  "C5'" . DA  J  6 21  ? -55.356 -39.964 25.194 1.00 133.72 ? -53  DA  J "C5'" 1 
ATOM   9579  C  "C4'" . DA  J  6 21  ? -55.866 -39.213 23.972 1.00 135.02 ? -53  DA  J "C4'" 1 
ATOM   9580  O  "O4'" . DA  J  6 21  ? -55.992 -37.796 24.249 1.00 135.29 ? -53  DA  J "O4'" 1 
ATOM   9581  C  "C3'" . DA  J  6 21  ? -55.018 -39.325 22.701 1.00 135.80 ? -53  DA  J "C3'" 1 
ATOM   9582  O  "O3'" . DA  J  6 21  ? -55.771 -40.104 21.752 1.00 137.02 ? -53  DA  J "O3'" 1 
ATOM   9583  C  "C2'" . DA  J  6 21  ? -54.746 -37.871 22.301 1.00 135.65 ? -53  DA  J "C2'" 1 
ATOM   9584  C  "C1'" . DA  J  6 21  ? -55.895 -37.154 22.997 1.00 135.56 ? -53  DA  J "C1'" 1 
ATOM   9585  N  N9    . DA  J  6 21  ? -55.700 -35.719 23.186 1.00 135.59 ? -53  DA  J N9    1 
ATOM   9586  C  C8    . DA  J  6 21  ? -54.673 -35.096 23.844 1.00 135.51 ? -53  DA  J C8    1 
ATOM   9587  N  N7    . DA  J  6 21  ? -54.766 -33.787 23.854 1.00 135.34 ? -53  DA  J N7    1 
ATOM   9588  C  C5    . DA  J  6 21  ? -55.934 -33.536 23.152 1.00 135.51 ? -53  DA  J C5    1 
ATOM   9589  C  C6    . DA  J  6 21  ? -56.598 -32.339 22.807 1.00 135.52 ? -53  DA  J C6    1 
ATOM   9590  N  N6    . DA  J  6 21  ? -56.132 -31.137 23.153 1.00 135.52 ? -53  DA  J N6    1 
ATOM   9591  N  N1    . DA  J  6 21  ? -57.751 -32.429 22.096 1.00 135.59 ? -53  DA  J N1    1 
ATOM   9592  C  C2    . DA  J  6 21  ? -58.211 -33.644 21.749 1.00 135.51 ? -53  DA  J C2    1 
ATOM   9593  N  N3    . DA  J  6 21  ? -57.674 -34.838 22.022 1.00 135.55 ? -53  DA  J N3    1 
ATOM   9594  C  C4    . DA  J  6 21  ? -56.528 -34.715 22.730 1.00 135.66 ? -53  DA  J C4    1 
ATOM   9595  P  P     . DC  J  6 22  ? -55.794 -39.914 20.158 1.00 137.99 ? -52  DC  J P     1 
ATOM   9596  O  OP1   . DC  J  6 22  ? -56.222 -41.210 19.588 1.00 138.18 ? -52  DC  J OP1   1 
ATOM   9597  O  OP2   . DC  J  6 22  ? -54.514 -39.326 19.697 1.00 138.11 ? -52  DC  J OP2   1 
ATOM   9598  O  "O5'" . DC  J  6 22  ? -56.971 -38.840 19.957 1.00 138.41 ? -52  DC  J "O5'" 1 
ATOM   9599  C  "C5'" . DC  J  6 22  ? -57.876 -38.918 18.851 1.00 139.02 ? -52  DC  J "C5'" 1 
ATOM   9600  C  "C4'" . DC  J  6 22  ? -57.532 -37.889 17.788 1.00 139.59 ? -52  DC  J "C4'" 1 
ATOM   9601  O  "O4'" . DC  J  6 22  ? -57.242 -36.628 18.438 1.00 139.81 ? -52  DC  J "O4'" 1 
ATOM   9602  C  "C3'" . DC  J  6 22  ? -56.307 -38.224 16.929 1.00 139.96 ? -52  DC  J "C3'" 1 
ATOM   9603  O  "O3'" . DC  J  6 22  ? -56.683 -38.547 15.557 1.00 140.33 ? -52  DC  J "O3'" 1 
ATOM   9604  C  "C2'" . DC  J  6 22  ? -55.362 -37.030 17.104 1.00 140.00 ? -52  DC  J "C2'" 1 
ATOM   9605  C  "C1'" . DC  J  6 22  ? -56.288 -35.948 17.656 1.00 140.15 ? -52  DC  J "C1'" 1 
ATOM   9606  N  N1    . DC  J  6 22  ? -55.622 -34.883 18.485 1.00 140.40 ? -52  DC  J N1    1 
ATOM   9607  C  C2    . DC  J  6 22  ? -56.208 -33.601 18.595 1.00 140.51 ? -52  DC  J C2    1 
ATOM   9608  O  O2    . DC  J  6 22  ? -57.274 -33.347 18.014 1.00 140.47 ? -52  DC  J O2    1 
ATOM   9609  N  N3    . DC  J  6 22  ? -55.582 -32.656 19.348 1.00 140.35 ? -52  DC  J N3    1 
ATOM   9610  C  C4    . DC  J  6 22  ? -54.432 -32.947 19.970 1.00 140.32 ? -52  DC  J C4    1 
ATOM   9611  N  N4    . DC  J  6 22  ? -53.857 -31.987 20.698 1.00 140.28 ? -52  DC  J N4    1 
ATOM   9612  C  C5    . DC  J  6 22  ? -53.821 -34.236 19.874 1.00 140.38 ? -52  DC  J C5    1 
ATOM   9613  C  C6    . DC  J  6 22  ? -54.443 -35.161 19.130 1.00 140.37 ? -52  DC  J C6    1 
ATOM   9614  P  P     . DT  J  6 23  ? -56.781 -37.540 14.302 1.00 140.48 ? -51  DT  J P     1 
ATOM   9615  O  OP1   . DT  J  6 23  ? -57.355 -38.319 13.182 1.00 140.36 ? -51  DT  J OP1   1 
ATOM   9616  O  OP2   . DT  J  6 23  ? -55.460 -36.893 14.109 1.00 140.14 ? -51  DT  J OP2   1 
ATOM   9617  O  "O5'" . DT  J  6 23  ? -57.855 -36.436 14.765 1.00 140.26 ? -51  DT  J "O5'" 1 
ATOM   9618  C  "C5'" . DT  J  6 23  ? -58.732 -35.788 13.829 1.00 139.82 ? -51  DT  J "C5'" 1 
ATOM   9619  C  "C4'" . DT  J  6 23  ? -58.186 -34.448 13.350 1.00 139.51 ? -51  DT  J "C4'" 1 
ATOM   9620  O  "O4'" . DT  J  6 23  ? -57.447 -33.809 14.423 1.00 139.23 ? -51  DT  J "O4'" 1 
ATOM   9621  C  "C3'" . DT  J  6 23  ? -57.242 -34.512 12.140 1.00 139.55 ? -51  DT  J "C3'" 1 
ATOM   9622  O  "O3'" . DT  J  6 23  ? -57.880 -33.939 10.960 1.00 139.42 ? -51  DT  J "O3'" 1 
ATOM   9623  C  "C2'" . DT  J  6 23  ? -55.961 -33.809 12.607 1.00 139.34 ? -51  DT  J "C2'" 1 
ATOM   9624  C  "C1'" . DT  J  6 23  ? -56.406 -33.046 13.852 1.00 139.05 ? -51  DT  J "C1'" 1 
ATOM   9625  N  N1    . DT  J  6 23  ? -55.312 -32.822 14.864 1.00 138.91 ? -51  DT  J N1    1 
ATOM   9626  C  C2    . DT  J  6 23  ? -55.284 -31.646 15.597 1.00 138.70 ? -51  DT  J C2    1 
ATOM   9627  O  O2    . DT  J  6 23  ? -56.108 -30.751 15.486 1.00 138.49 ? -51  DT  J O2    1 
ATOM   9628  N  N3    . DT  J  6 23  ? -54.236 -31.555 16.486 1.00 138.67 ? -51  DT  J N3    1 
ATOM   9629  C  C4    . DT  J  6 23  ? -53.237 -32.492 16.710 1.00 138.82 ? -51  DT  J C4    1 
ATOM   9630  O  O4    . DT  J  6 23  ? -52.342 -32.307 17.531 1.00 138.78 ? -51  DT  J O4    1 
ATOM   9631  C  C5    . DT  J  6 23  ? -53.323 -33.694 15.911 1.00 138.75 ? -51  DT  J C5    1 
ATOM   9632  C  C7    . DT  J  6 23  ? -52.306 -34.790 16.054 1.00 138.79 ? -51  DT  J C7    1 
ATOM   9633  C  C6    . DT  J  6 23  ? -54.340 -33.797 15.042 1.00 138.86 ? -51  DT  J C6    1 
ATOM   9634  P  P     . DA  J  6 24  ? -57.286 -32.810 9.971  1.00 139.13 ? -50  DA  J P     1 
ATOM   9635  O  OP1   . DA  J  6 24  ? -58.287 -32.647 8.892  1.00 139.20 ? -50  DA  J OP1   1 
ATOM   9636  O  OP2   . DA  J  6 24  ? -55.888 -33.149 9.605  1.00 138.87 ? -50  DA  J OP2   1 
ATOM   9637  O  "O5'" . DA  J  6 24  ? -57.289 -31.486 10.884 1.00 138.40 ? -50  DA  J "O5'" 1 
ATOM   9638  C  "C5'" . DA  J  6 24  ? -57.561 -30.181 10.353 1.00 137.01 ? -50  DA  J "C5'" 1 
ATOM   9639  C  "C4'" . DA  J  6 24  ? -56.305 -29.326 10.306 1.00 136.03 ? -50  DA  J "C4'" 1 
ATOM   9640  O  "O4'" . DA  J  6 24  ? -55.597 -29.420 11.568 1.00 135.44 ? -50  DA  J "O4'" 1 
ATOM   9641  C  "C3'" . DA  J  6 24  ? -55.295 -29.750 9.237  1.00 135.58 ? -50  DA  J "C3'" 1 
ATOM   9642  O  "O3'" . DA  J  6 24  ? -55.479 -28.994 8.004  1.00 134.52 ? -50  DA  J "O3'" 1 
ATOM   9643  C  "C2'" . DA  J  6 24  ? -53.928 -29.580 9.909  1.00 135.55 ? -50  DA  J "C2'" 1 
ATOM   9644  C  "C1'" . DA  J  6 24  ? -54.237 -29.127 11.333 1.00 135.30 ? -50  DA  J "C1'" 1 
ATOM   9645  N  N9    . DA  J  6 24  ? -53.400 -29.822 12.309 1.00 135.31 ? -50  DA  J N9    1 
ATOM   9646  C  C8    . DA  J  6 24  ? -53.304 -31.176 12.491 1.00 135.35 ? -50  DA  J C8    1 
ATOM   9647  N  N7    . DA  J  6 24  ? -52.464 -31.535 13.431 1.00 135.26 ? -50  DA  J N7    1 
ATOM   9648  C  C5    . DA  J  6 24  ? -51.968 -30.331 13.901 1.00 135.31 ? -50  DA  J C5    1 
ATOM   9649  C  C6    . DA  J  6 24  ? -51.030 -30.021 14.910 1.00 135.27 ? -50  DA  J C6    1 
ATOM   9650  N  N6    . DA  J  6 24  ? -50.412 -30.951 15.647 1.00 135.25 ? -50  DA  J N6    1 
ATOM   9651  N  N1    . DA  J  6 24  ? -50.753 -28.715 15.134 1.00 135.29 ? -50  DA  J N1    1 
ATOM   9652  C  C2    . DA  J  6 24  ? -51.373 -27.783 14.394 1.00 135.24 ? -50  DA  J C2    1 
ATOM   9653  N  N3    . DA  J  6 24  ? -52.273 -27.956 13.422 1.00 135.28 ? -50  DA  J N3    1 
ATOM   9654  C  C4    . DA  J  6 24  ? -52.530 -29.263 13.219 1.00 135.27 ? -50  DA  J C4    1 
ATOM   9655  P  P     . DC  J  6 25  ? -54.596 -27.731 7.528  1.00 133.73 ? -49  DC  J P     1 
ATOM   9656  O  OP1   . DC  J  6 25  ? -55.347 -27.039 6.455  1.00 133.66 ? -49  DC  J OP1   1 
ATOM   9657  O  OP2   . DC  J  6 25  ? -53.229 -28.223 7.231  1.00 133.29 ? -49  DC  J OP2   1 
ATOM   9658  O  "O5'" . DC  J  6 25  ? -54.567 -26.771 8.824  1.00 131.93 ? -49  DC  J "O5'" 1 
ATOM   9659  C  "C5'" . DC  J  6 25  ? -54.321 -25.363 8.735  1.00 128.89 ? -49  DC  J "C5'" 1 
ATOM   9660  C  "C4'" . DC  J  6 25  ? -52.850 -25.039 8.951  1.00 126.84 ? -49  DC  J "C4'" 1 
ATOM   9661  O  "O4'" . DC  J  6 25  ? -52.265 -25.927 9.938  1.00 126.02 ? -49  DC  J "O4'" 1 
ATOM   9662  C  "C3'" . DC  J  6 25  ? -51.978 -25.166 7.700  1.00 125.73 ? -49  DC  J "C3'" 1 
ATOM   9663  O  "O3'" . DC  J  6 25  ? -51.738 -23.849 7.158  1.00 124.71 ? -49  DC  J "O3'" 1 
ATOM   9664  C  "C2'" . DC  J  6 25  ? -50.740 -25.957 8.149  1.00 125.43 ? -49  DC  J "C2'" 1 
ATOM   9665  C  "C1'" . DC  J  6 25  ? -50.879 -26.013 9.671  1.00 125.12 ? -49  DC  J "C1'" 1 
ATOM   9666  N  N1    . DC  J  6 25  ? -50.295 -27.245 10.335 1.00 124.62 ? -49  DC  J N1    1 
ATOM   9667  C  C2    . DC  J  6 25  ? -49.507 -27.120 11.497 1.00 124.05 ? -49  DC  J C2    1 
ATOM   9668  O  O2    . DC  J  6 25  ? -49.286 -26.007 11.988 1.00 123.73 ? -49  DC  J O2    1 
ATOM   9669  N  N3    . DC  J  6 25  ? -48.998 -28.243 12.069 1.00 124.07 ? -49  DC  J N3    1 
ATOM   9670  C  C4    . DC  J  6 25  ? -49.243 -29.444 11.538 1.00 124.35 ? -49  DC  J C4    1 
ATOM   9671  N  N4    . DC  J  6 25  ? -48.717 -30.513 12.143 1.00 124.22 ? -49  DC  J N4    1 
ATOM   9672  C  C5    . DC  J  6 25  ? -50.037 -29.598 10.360 1.00 124.23 ? -49  DC  J C5    1 
ATOM   9673  C  C6    . DC  J  6 25  ? -50.534 -28.485 9.801  1.00 124.40 ? -49  DC  J C6    1 
ATOM   9674  P  P     . DC  J  6 26  ? -50.318 -23.108 7.034  1.00 123.79 ? -48  DC  J P     1 
ATOM   9675  O  OP1   . DC  J  6 26  ? -50.604 -21.739 6.549  1.00 123.75 ? -48  DC  J OP1   1 
ATOM   9676  O  OP2   . DC  J  6 26  ? -49.398 -23.976 6.260  1.00 123.52 ? -48  DC  J OP2   1 
ATOM   9677  O  "O5'" . DC  J  6 26  ? -49.805 -23.018 8.554  1.00 123.21 ? -48  DC  J "O5'" 1 
ATOM   9678  C  "C5'" . DC  J  6 26  ? -48.933 -21.972 9.006  1.00 121.75 ? -48  DC  J "C5'" 1 
ATOM   9679  C  "C4'" . DC  J  6 26  ? -47.516 -22.468 9.270  1.00 120.53 ? -48  DC  J "C4'" 1 
ATOM   9680  O  "O4'" . DC  J  6 26  ? -47.508 -23.867 9.662  1.00 119.98 ? -48  DC  J "O4'" 1 
ATOM   9681  C  "C3'" . DC  J  6 26  ? -46.553 -22.358 8.085  1.00 119.64 ? -48  DC  J "C3'" 1 
ATOM   9682  O  "O3'" . DC  J  6 26  ? -45.426 -21.567 8.459  1.00 118.84 ? -48  DC  J "O3'" 1 
ATOM   9683  C  "C2'" . DC  J  6 26  ? -46.149 -23.806 7.808  1.00 119.37 ? -48  DC  J "C2'" 1 
ATOM   9684  C  "C1'" . DC  J  6 26  ? -46.289 -24.404 9.202  1.00 119.49 ? -48  DC  J "C1'" 1 
ATOM   9685  N  N1    . DC  J  6 26  ? -46.297 -25.908 9.306  1.00 119.41 ? -48  DC  J N1    1 
ATOM   9686  C  C2    . DC  J  6 26  ? -46.002 -26.522 10.540 1.00 119.29 ? -48  DC  J C2    1 
ATOM   9687  O  O2    . DC  J  6 26  ? -45.741 -25.830 11.534 1.00 119.20 ? -48  DC  J O2    1 
ATOM   9688  N  N3    . DC  J  6 26  ? -46.007 -27.879 10.617 1.00 119.31 ? -48  DC  J N3    1 
ATOM   9689  C  C4    . DC  J  6 26  ? -46.287 -28.616 9.537  1.00 119.40 ? -48  DC  J C4    1 
ATOM   9690  N  N4    . DC  J  6 26  ? -46.282 -29.946 9.667  1.00 119.30 ? -48  DC  J N4    1 
ATOM   9691  C  C5    . DC  J  6 26  ? -46.589 -28.017 8.277  1.00 119.34 ? -48  DC  J C5    1 
ATOM   9692  C  C6    . DC  J  6 26  ? -46.582 -26.678 8.210  1.00 119.40 ? -48  DC  J C6    1 
ATOM   9693  P  P     . DA  J  6 27  ? -44.571 -20.742 7.381  1.00 118.40 ? -47  DA  J P     1 
ATOM   9694  O  OP1   . DA  J  6 27  ? -45.283 -19.461 7.164  1.00 118.55 ? -47  DA  J OP1   1 
ATOM   9695  O  OP2   . DA  J  6 27  ? -44.257 -21.623 6.232  1.00 117.88 ? -47  DA  J OP2   1 
ATOM   9696  O  "O5'" . DA  J  6 27  ? -43.184 -20.450 8.130  1.00 117.54 ? -47  DA  J "O5'" 1 
ATOM   9697  C  "C5'" . DA  J  6 27  ? -43.152 -19.847 9.430  1.00 116.55 ? -47  DA  J "C5'" 1 
ATOM   9698  C  "C4'" . DA  J  6 27  ? -42.121 -20.502 10.341 1.00 115.14 ? -47  DA  J "C4'" 1 
ATOM   9699  O  "O4'" . DA  J  6 27  ? -42.343 -21.932 10.398 1.00 114.77 ? -47  DA  J "O4'" 1 
ATOM   9700  C  "C3'" . DA  J  6 27  ? -40.661 -20.320 9.941  1.00 114.82 ? -47  DA  J "C3'" 1 
ATOM   9701  O  "O3'" . DA  J  6 27  ? -39.891 -20.092 11.121 1.00 114.74 ? -47  DA  J "O3'" 1 
ATOM   9702  C  "C2'" . DA  J  6 27  ? -40.301 -21.635 9.248  1.00 114.45 ? -47  DA  J "C2'" 1 
ATOM   9703  C  "C1'" . DA  J  6 27  ? -41.235 -22.652 9.895  1.00 114.37 ? -47  DA  J "C1'" 1 
ATOM   9704  N  N9    . DA  J  6 27  ? -41.787 -23.656 8.987  1.00 114.44 ? -47  DA  J N9    1 
ATOM   9705  C  C8    . DA  J  6 27  ? -42.048 -23.513 7.650  1.00 114.55 ? -47  DA  J C8    1 
ATOM   9706  N  N7    . DA  J  6 27  ? -42.559 -24.579 7.078  1.00 114.49 ? -47  DA  J N7    1 
ATOM   9707  C  C5    . DA  J  6 27  ? -42.650 -25.491 8.116  1.00 114.71 ? -47  DA  J C5    1 
ATOM   9708  C  C6    . DA  J  6 27  ? -43.115 -26.825 8.171  1.00 114.56 ? -47  DA  J C6    1 
ATOM   9709  N  N6    . DA  J  6 27  ? -43.589 -27.477 7.106  1.00 114.42 ? -47  DA  J N6    1 
ATOM   9710  N  N1    . DA  J  6 27  ? -43.073 -27.461 9.364  1.00 114.41 ? -47  DA  J N1    1 
ATOM   9711  C  C2    . DA  J  6 27  ? -42.589 -26.802 10.426 1.00 114.36 ? -47  DA  J C2    1 
ATOM   9712  N  N3    . DA  J  6 27  ? -42.126 -25.552 10.501 1.00 114.39 ? -47  DA  J N3    1 
ATOM   9713  C  C4    . DA  J  6 27  ? -42.181 -24.939 9.302  1.00 114.63 ? -47  DA  J C4    1 
ATOM   9714  P  P     . DA  J  6 28  ? -38.360 -19.598 11.102 1.00 114.74 ? -46  DA  J P     1 
ATOM   9715  O  OP1   . DA  J  6 28  ? -38.341 -18.226 11.659 1.00 114.16 ? -46  DA  J OP1   1 
ATOM   9716  O  OP2   . DA  J  6 28  ? -37.766 -19.857 9.767  1.00 114.06 ? -46  DA  J OP2   1 
ATOM   9717  O  "O5'" . DA  J  6 28  ? -37.644 -20.571 12.159 1.00 114.47 ? -46  DA  J "O5'" 1 
ATOM   9718  C  "C5'" . DA  J  6 28  ? -38.322 -21.646 12.837 1.00 113.95 ? -46  DA  J "C5'" 1 
ATOM   9719  C  "C4'" . DA  J  6 28  ? -37.633 -22.989 12.606 1.00 113.69 ? -46  DA  J "C4'" 1 
ATOM   9720  O  "O4'" . DA  J  6 28  ? -38.378 -23.756 11.619 1.00 113.07 ? -46  DA  J "O4'" 1 
ATOM   9721  C  "C3'" . DA  J  6 28  ? -36.180 -22.940 12.100 1.00 113.71 ? -46  DA  J "C3'" 1 
ATOM   9722  O  "O3'" . DA  J  6 28  ? -35.376 -23.958 12.715 1.00 113.68 ? -46  DA  J "O3'" 1 
ATOM   9723  C  "C2'" . DA  J  6 28  ? -36.333 -23.261 10.618 1.00 113.16 ? -46  DA  J "C2'" 1 
ATOM   9724  C  "C1'" . DA  J  6 28  ? -37.424 -24.314 10.741 1.00 112.97 ? -46  DA  J "C1'" 1 
ATOM   9725  N  N9    . DA  J  6 28  ? -38.013 -24.739 9.476  1.00 112.86 ? -46  DA  J N9    1 
ATOM   9726  C  C8    . DA  J  6 28  ? -38.089 -24.035 8.307  1.00 112.92 ? -46  DA  J C8    1 
ATOM   9727  N  N7    . DA  J  6 28  ? -38.666 -24.692 7.331  1.00 113.02 ? -46  DA  J N7    1 
ATOM   9728  C  C5    . DA  J  6 28  ? -38.977 -25.916 7.896  1.00 112.99 ? -46  DA  J C5    1 
ATOM   9729  C  C6    . DA  J  6 28  ? -39.605 -27.072 7.384  1.00 113.00 ? -46  DA  J C6    1 
ATOM   9730  N  N6    . DA  J  6 28  ? -40.046 -27.177 6.126  1.00 112.75 ? -46  DA  J N6    1 
ATOM   9731  N  N1    . DA  J  6 28  ? -39.764 -28.122 8.226  1.00 113.20 ? -46  DA  J N1    1 
ATOM   9732  C  C2    . DA  J  6 28  ? -39.328 -28.027 9.492  1.00 113.04 ? -46  DA  J C2    1 
ATOM   9733  N  N3    . DA  J  6 28  ? -38.724 -26.993 10.080 1.00 112.92 ? -46  DA  J N3    1 
ATOM   9734  C  C4    . DA  J  6 28  ? -38.580 -25.963 9.221  1.00 112.93 ? -46  DA  J C4    1 
ATOM   9735  P  P     . DA  J  6 29  ? -34.405 -23.706 13.968 1.00 112.70 ? -45  DA  J P     1 
ATOM   9736  O  OP1   . DA  J  6 29  ? -35.123 -22.906 14.992 1.00 111.77 ? -45  DA  J OP1   1 
ATOM   9737  O  OP2   . DA  J  6 29  ? -33.091 -23.272 13.431 1.00 112.03 ? -45  DA  J OP2   1 
ATOM   9738  O  "O5'" . DA  J  6 29  ? -34.239 -25.193 14.520 1.00 111.98 ? -45  DA  J "O5'" 1 
ATOM   9739  C  "C5'" . DA  J  6 29  ? -35.389 -25.989 14.754 1.00 112.18 ? -45  DA  J "C5'" 1 
ATOM   9740  C  "C4'" . DA  J  6 29  ? -35.291 -27.294 13.991 1.00 112.72 ? -45  DA  J "C4'" 1 
ATOM   9741  O  "O4'" . DA  J  6 29  ? -35.807 -27.124 12.648 1.00 112.74 ? -45  DA  J "O4'" 1 
ATOM   9742  C  "C3'" . DA  J  6 29  ? -33.876 -27.849 13.830 1.00 113.35 ? -45  DA  J "C3'" 1 
ATOM   9743  O  "O3'" . DA  J  6 29  ? -33.904 -29.260 14.030 1.00 114.26 ? -45  DA  J "O3'" 1 
ATOM   9744  C  "C2'" . DA  J  6 29  ? -33.548 -27.532 12.379 1.00 113.22 ? -45  DA  J "C2'" 1 
ATOM   9745  C  "C1'" . DA  J  6 29  ? -34.923 -27.809 11.785 1.00 113.28 ? -45  DA  J "C1'" 1 
ATOM   9746  N  N9    . DA  J  6 29  ? -35.121 -27.405 10.393 1.00 113.36 ? -45  DA  J N9    1 
ATOM   9747  C  C8    . DA  J  6 29  ? -34.823 -26.204 9.808  1.00 113.33 ? -45  DA  J C8    1 
ATOM   9748  N  N7    . DA  J  6 29  ? -35.125 -26.144 8.533  1.00 113.41 ? -45  DA  J N7    1 
ATOM   9749  C  C5    . DA  J  6 29  ? -35.650 -27.396 8.261  1.00 113.41 ? -45  DA  J C5    1 
ATOM   9750  C  C6    . DA  J  6 29  ? -36.161 -27.982 7.086  1.00 113.21 ? -45  DA  J C6    1 
ATOM   9751  N  N6    . DA  J  6 29  ? -36.217 -27.340 5.918  1.00 113.36 ? -45  DA  J N6    1 
ATOM   9752  N  N1    . DA  J  6 29  ? -36.605 -29.257 7.152  1.00 113.23 ? -45  DA  J N1    1 
ATOM   9753  C  C2    . DA  J  6 29  ? -36.547 -29.903 8.323  1.00 113.40 ? -45  DA  J C2    1 
ATOM   9754  N  N3    . DA  J  6 29  ? -36.094 -29.459 9.497  1.00 113.49 ? -45  DA  J N3    1 
ATOM   9755  C  C4    . DA  J  6 29  ? -35.655 -28.188 9.396  1.00 113.48 ? -45  DA  J C4    1 
ATOM   9756  P  P     . DA  J  6 30  ? -33.003 -29.986 15.132 1.00 113.92 ? -44  DA  J P     1 
ATOM   9757  O  OP1   . DA  J  6 30  ? -33.852 -30.213 16.326 1.00 113.27 ? -44  DA  J OP1   1 
ATOM   9758  O  OP2   . DA  J  6 30  ? -31.733 -29.222 15.243 1.00 113.97 ? -44  DA  J OP2   1 
ATOM   9759  O  "O5'" . DA  J  6 30  ? -32.687 -31.390 14.435 1.00 114.01 ? -44  DA  J "O5'" 1 
ATOM   9760  C  "C5'" . DA  J  6 30  ? -33.720 -32.108 13.771 1.00 115.20 ? -44  DA  J "C5'" 1 
ATOM   9761  C  "C4'" . DA  J  6 30  ? -33.333 -32.518 12.357 1.00 116.31 ? -44  DA  J "C4'" 1 
ATOM   9762  O  "O4'" . DA  J  6 30  ? -33.544 -31.428 11.424 1.00 116.59 ? -44  DA  J "O4'" 1 
ATOM   9763  C  "C3'" . DA  J  6 30  ? -31.884 -32.955 12.157 1.00 117.18 ? -44  DA  J "C3'" 1 
ATOM   9764  O  "O3'" . DA  J  6 30  ? -31.856 -34.331 11.801 1.00 118.94 ? -44  DA  J "O3'" 1 
ATOM   9765  C  "C2'" . DA  J  6 30  ? -31.368 -32.074 11.019 1.00 116.98 ? -44  DA  J "C2'" 1 
ATOM   9766  C  "C1'" . DA  J  6 30  ? -32.668 -31.660 10.339 1.00 116.67 ? -44  DA  J "C1'" 1 
ATOM   9767  N  N9    . DA  J  6 30  ? -32.604 -30.486 9.456  1.00 116.64 ? -44  DA  J N9    1 
ATOM   9768  C  C8    . DA  J  6 30  ? -32.217 -29.216 9.789  1.00 116.61 ? -44  DA  J C8    1 
ATOM   9769  N  N7    . DA  J  6 30  ? -32.265 -28.355 8.800  1.00 116.50 ? -44  DA  J N7    1 
ATOM   9770  C  C5    . DA  J  6 30  ? -32.714 -29.112 7.731  1.00 116.62 ? -44  DA  J C5    1 
ATOM   9771  C  C6    . DA  J  6 30  ? -32.977 -28.794 6.378  1.00 116.49 ? -44  DA  J C6    1 
ATOM   9772  N  N6    . DA  J  6 30  ? -32.816 -27.570 5.865  1.00 116.51 ? -44  DA  J N6    1 
ATOM   9773  N  N1    . DA  J  6 30  ? -33.417 -29.781 5.568  1.00 116.52 ? -44  DA  J N1    1 
ATOM   9774  C  C2    . DA  J  6 30  ? -33.585 -31.009 6.074  1.00 116.49 ? -44  DA  J C2    1 
ATOM   9775  N  N3    . DA  J  6 30  ? -33.365 -31.424 7.322  1.00 116.63 ? -44  DA  J N3    1 
ATOM   9776  C  C4    . DA  J  6 30  ? -32.929 -30.426 8.114  1.00 116.63 ? -44  DA  J C4    1 
ATOM   9777  P  P     . DG  J  6 31  ? -30.607 -35.262 12.182 1.00 120.69 ? -43  DG  J P     1 
ATOM   9778  O  OP1   . DG  J  6 31  ? -31.014 -36.143 13.304 1.00 120.27 ? -43  DG  J OP1   1 
ATOM   9779  O  OP2   . DG  J  6 31  ? -29.402 -34.415 12.325 1.00 120.70 ? -43  DG  J OP2   1 
ATOM   9780  O  "O5'" . DG  J  6 31  ? -30.401 -36.132 10.853 1.00 122.25 ? -43  DG  J "O5'" 1 
ATOM   9781  C  "C5'" . DG  J  6 31  ? -31.502 -36.766 10.200 1.00 124.32 ? -43  DG  J "C5'" 1 
ATOM   9782  C  "C4'" . DG  J  6 31  ? -31.394 -36.643 8.691  1.00 125.68 ? -43  DG  J "C4'" 1 
ATOM   9783  O  "O4'" . DG  J  6 31  ? -31.525 -35.253 8.288  1.00 125.96 ? -43  DG  J "O4'" 1 
ATOM   9784  C  "C3'" . DG  J  6 31  ? -30.085 -37.148 8.087  1.00 126.79 ? -43  DG  J "C3'" 1 
ATOM   9785  O  "O3'" . DG  J  6 31  ? -30.381 -38.130 7.103  1.00 128.28 ? -43  DG  J "O3'" 1 
ATOM   9786  C  "C2'" . DG  J  6 31  ? -29.460 -35.901 7.463  1.00 126.61 ? -43  DG  J "C2'" 1 
ATOM   9787  C  "C1'" . DG  J  6 31  ? -30.691 -35.054 7.168  1.00 126.45 ? -43  DG  J "C1'" 1 
ATOM   9788  N  N9    . DG  J  6 31  ? -30.390 -33.634 6.994  1.00 126.53 ? -43  DG  J N9    1 
ATOM   9789  C  C8    . DG  J  6 31  ? -29.817 -32.784 7.912  1.00 126.60 ? -43  DG  J C8    1 
ATOM   9790  N  N7    . DG  J  6 31  ? -29.661 -31.565 7.477  1.00 126.52 ? -43  DG  J N7    1 
ATOM   9791  C  C5    . DG  J  6 31  ? -30.159 -31.603 6.181  1.00 126.59 ? -43  DG  J C5    1 
ATOM   9792  C  C6    . DG  J  6 31  ? -30.254 -30.576 5.205  1.00 126.56 ? -43  DG  J C6    1 
ATOM   9793  O  O6    . DG  J  6 31  ? -29.908 -29.389 5.298  1.00 126.53 ? -43  DG  J O6    1 
ATOM   9794  N  N1    . DG  J  6 31  ? -30.822 -31.035 4.016  1.00 126.58 ? -43  DG  J N1    1 
ATOM   9795  C  C2    . DG  J  6 31  ? -31.246 -32.327 3.796  1.00 126.58 ? -43  DG  J C2    1 
ATOM   9796  N  N2    . DG  J  6 31  ? -31.767 -32.590 2.589  1.00 126.57 ? -43  DG  J N2    1 
ATOM   9797  N  N3    . DG  J  6 31  ? -31.161 -33.298 4.700  1.00 126.82 ? -43  DG  J N3    1 
ATOM   9798  C  C4    . DG  J  6 31  ? -30.610 -32.870 5.868  1.00 126.69 ? -43  DG  J C4    1 
ATOM   9799  P  P     . DT  J  6 32  ? -29.294 -39.197 6.610  1.00 129.44 ? -42  DT  J P     1 
ATOM   9800  O  OP1   . DT  J  6 32  ? -29.547 -40.437 7.378  1.00 129.41 ? -42  DT  J OP1   1 
ATOM   9801  O  OP2   . DT  J  6 32  ? -27.944 -38.585 6.622  1.00 129.02 ? -42  DT  J OP2   1 
ATOM   9802  O  "O5'" . DT  J  6 32  ? -29.694 -39.429 5.074  1.00 131.28 ? -42  DT  J "O5'" 1 
ATOM   9803  C  "C5'" . DT  J  6 32  ? -30.537 -38.505 4.372  1.00 133.41 ? -42  DT  J "C5'" 1 
ATOM   9804  C  "C4'" . DT  J  6 32  ? -29.978 -38.021 3.039  1.00 135.13 ? -42  DT  J "C4'" 1 
ATOM   9805  O  "O4'" . DT  J  6 32  ? -29.823 -36.579 3.090  1.00 135.11 ? -42  DT  J "O4'" 1 
ATOM   9806  C  "C3'" . DT  J  6 32  ? -28.641 -38.611 2.581  1.00 136.46 ? -42  DT  J "C3'" 1 
ATOM   9807  O  "O3'" . DT  J  6 32  ? -28.828 -39.259 1.308  1.00 138.74 ? -42  DT  J "O3'" 1 
ATOM   9808  C  "C2'" . DT  J  6 32  ? -27.682 -37.421 2.543  1.00 135.96 ? -42  DT  J "C2'" 1 
ATOM   9809  C  "C1'" . DT  J  6 32  ? -28.591 -36.197 2.524  1.00 135.36 ? -42  DT  J "C1'" 1 
ATOM   9810  N  N1    . DT  J  6 32  ? -28.061 -35.054 3.324  1.00 135.28 ? -42  DT  J N1    1 
ATOM   9811  C  C2    . DT  J  6 32  ? -28.318 -33.761 2.917  1.00 135.24 ? -42  DT  J C2    1 
ATOM   9812  O  O2    . DT  J  6 32  ? -28.967 -33.487 1.925  1.00 135.37 ? -42  DT  J O2    1 
ATOM   9813  N  N3    . DT  J  6 32  ? -27.783 -32.785 3.727  1.00 135.20 ? -42  DT  J N3    1 
ATOM   9814  C  C4    . DT  J  6 32  ? -27.030 -32.971 4.879  1.00 135.34 ? -42  DT  J C4    1 
ATOM   9815  O  O4    . DT  J  6 32  ? -26.595 -32.024 5.531  1.00 135.24 ? -42  DT  J O4    1 
ATOM   9816  C  C5    . DT  J  6 32  ? -26.796 -34.352 5.251  1.00 135.44 ? -42  DT  J C5    1 
ATOM   9817  C  C7    . DT  J  6 32  ? -25.997 -34.704 6.474  1.00 135.32 ? -42  DT  J C7    1 
ATOM   9818  C  C6    . DT  J  6 32  ? -27.318 -35.308 4.467  1.00 135.50 ? -42  DT  J C6    1 
ATOM   9819  P  P     . DG  J  6 33  ? -27.697 -39.482 0.188  1.00 140.27 ? -41  DG  J P     1 
ATOM   9820  O  OP1   . DG  J  6 33  ? -28.185 -40.581 -0.676 1.00 140.52 ? -41  DG  J OP1   1 
ATOM   9821  O  OP2   . DG  J  6 33  ? -26.360 -39.614 0.818  1.00 140.26 ? -41  DG  J OP2   1 
ATOM   9822  O  "O5'" . DG  J  6 33  ? -27.762 -38.098 -0.618 1.00 141.33 ? -41  DG  J "O5'" 1 
ATOM   9823  C  "C5'" . DG  J  6 33  ? -27.759 -38.070 -2.042 1.00 143.54 ? -41  DG  J "C5'" 1 
ATOM   9824  C  "C4'" . DG  J  6 33  ? -26.840 -36.968 -2.537 1.00 145.24 ? -41  DG  J "C4'" 1 
ATOM   9825  O  "O4'" . DG  J  6 33  ? -26.810 -35.899 -1.553 1.00 145.56 ? -41  DG  J "O4'" 1 
ATOM   9826  C  "C3'" . DG  J  6 33  ? -25.383 -37.372 -2.783 1.00 146.29 ? -41  DG  J "C3'" 1 
ATOM   9827  O  "O3'" . DG  J  6 33  ? -24.960 -36.860 -4.071 1.00 147.89 ? -41  DG  J "O3'" 1 
ATOM   9828  C  "C2'" . DG  J  6 33  ? -24.657 -36.758 -1.585 1.00 146.06 ? -41  DG  J "C2'" 1 
ATOM   9829  C  "C1'" . DG  J  6 33  ? -25.470 -35.482 -1.403 1.00 145.69 ? -41  DG  J "C1'" 1 
ATOM   9830  N  N9    . DG  J  6 33  ? -25.285 -34.808 -0.118 1.00 145.65 ? -41  DG  J N9    1 
ATOM   9831  C  C8    . DG  J  6 33  ? -25.265 -35.383 1.131  1.00 145.53 ? -41  DG  J C8    1 
ATOM   9832  N  N7    . DG  J  6 33  ? -25.077 -34.526 2.094  1.00 145.58 ? -41  DG  J N7    1 
ATOM   9833  C  C5    . DG  J  6 33  ? -24.962 -33.300 1.446  1.00 145.59 ? -41  DG  J C5    1 
ATOM   9834  C  C6    . DG  J  6 33  ? -24.747 -31.997 1.972  1.00 145.55 ? -41  DG  J C6    1 
ATOM   9835  O  O6    . DG  J  6 33  ? -24.612 -31.660 3.156  1.00 145.52 ? -41  DG  J O6    1 
ATOM   9836  N  N1    . DG  J  6 33  ? -24.693 -31.026 0.972  1.00 145.49 ? -41  DG  J N1    1 
ATOM   9837  C  C2    . DG  J  6 33  ? -24.829 -31.282 -0.371 1.00 145.50 ? -41  DG  J C2    1 
ATOM   9838  N  N2    . DG  J  6 33  ? -24.750 -30.219 -1.182 1.00 145.60 ? -41  DG  J N2    1 
ATOM   9839  N  N3    . DG  J  6 33  ? -25.033 -32.494 -0.879 1.00 145.47 ? -41  DG  J N3    1 
ATOM   9840  C  C4    . DG  J  6 33  ? -25.087 -33.456 0.081  1.00 145.57 ? -41  DG  J C4    1 
ATOM   9841  P  P     . DT  J  6 34  ? -23.468 -36.397 -4.472 1.00 149.07 ? -40  DT  J P     1 
ATOM   9842  O  OP1   . DT  J  6 34  ? -23.335 -36.606 -5.932 1.00 149.30 ? -40  DT  J OP1   1 
ATOM   9843  O  OP2   . DT  J  6 34  ? -22.481 -37.043 -3.572 1.00 149.21 ? -40  DT  J OP2   1 
ATOM   9844  O  "O5'" . DT  J  6 34  ? -23.492 -34.820 -4.160 1.00 149.36 ? -40  DT  J "O5'" 1 
ATOM   9845  C  "C5'" . DT  J  6 34  ? -23.318 -33.834 -5.191 1.00 149.67 ? -40  DT  J "C5'" 1 
ATOM   9846  C  "C4'" . DT  J  6 34  ? -22.100 -32.954 -4.937 1.00 149.94 ? -40  DT  J "C4'" 1 
ATOM   9847  O  "O4'" . DT  J  6 34  ? -22.115 -32.478 -3.563 1.00 150.03 ? -40  DT  J "O4'" 1 
ATOM   9848  C  "C3'" . DT  J  6 34  ? -20.744 -33.631 -5.147 1.00 150.11 ? -40  DT  J "C3'" 1 
ATOM   9849  O  "O3'" . DT  J  6 34  ? -19.825 -32.746 -5.801 1.00 150.51 ? -40  DT  J "O3'" 1 
ATOM   9850  C  "C2'" . DT  J  6 34  ? -20.289 -33.939 -3.725 1.00 150.05 ? -40  DT  J "C2'" 1 
ATOM   9851  C  "C1'" . DT  J  6 34  ? -20.862 -32.750 -2.961 1.00 150.07 ? -40  DT  J "C1'" 1 
ATOM   9852  N  N1    . DT  J  6 34  ? -21.008 -32.991 -1.480 1.00 150.02 ? -40  DT  J N1    1 
ATOM   9853  C  C2    . DT  J  6 34  ? -20.859 -31.936 -0.595 1.00 149.89 ? -40  DT  J C2    1 
ATOM   9854  O  O2    . DT  J  6 34  ? -20.624 -30.789 -0.937 1.00 149.82 ? -40  DT  J O2    1 
ATOM   9855  N  N3    . DT  J  6 34  ? -21.004 -32.279 0.729  1.00 149.98 ? -40  DT  J N3    1 
ATOM   9856  C  C4    . DT  J  6 34  ? -21.270 -33.540 1.248  1.00 150.09 ? -40  DT  J C4    1 
ATOM   9857  O  O4    . DT  J  6 34  ? -21.379 -33.734 2.457  1.00 150.01 ? -40  DT  J O4    1 
ATOM   9858  C  C5    . DT  J  6 34  ? -21.410 -34.599 0.270  1.00 150.02 ? -40  DT  J C5    1 
ATOM   9859  C  C7    . DT  J  6 34  ? -21.700 -36.013 0.687  1.00 149.96 ? -40  DT  J C7    1 
ATOM   9860  C  C6    . DT  J  6 34  ? -21.272 -34.274 -1.024 1.00 150.05 ? -40  DT  J C6    1 
ATOM   9861  P  P     . DA  J  6 35  ? -18.431 -33.255 -6.429 1.00 150.84 ? -39  DA  J P     1 
ATOM   9862  O  OP1   . DA  J  6 35  ? -18.617 -33.320 -7.898 1.00 150.90 ? -39  DA  J OP1   1 
ATOM   9863  O  OP2   . DA  J  6 35  ? -17.957 -34.455 -5.695 1.00 150.57 ? -39  DA  J OP2   1 
ATOM   9864  O  "O5'" . DA  J  6 35  ? -17.417 -32.060 -6.089 1.00 150.06 ? -39  DA  J "O5'" 1 
ATOM   9865  C  "C5'" . DA  J  6 35  ? -17.626 -30.750 -6.618 1.00 148.72 ? -39  DA  J "C5'" 1 
ATOM   9866  C  "C4'" . DA  J  6 35  ? -17.216 -29.682 -5.617 1.00 147.70 ? -39  DA  J "C4'" 1 
ATOM   9867  O  "O4'" . DA  J  6 35  ? -17.756 -29.986 -4.303 1.00 147.39 ? -39  DA  J "O4'" 1 
ATOM   9868  C  "C3'" . DA  J  6 35  ? -15.706 -29.491 -5.441 1.00 146.87 ? -39  DA  J "C3'" 1 
ATOM   9869  O  "O3'" . DA  J  6 35  ? -15.382 -28.112 -5.748 1.00 145.52 ? -39  DA  J "O3'" 1 
ATOM   9870  C  "C2'" . DA  J  6 35  ? -15.461 -29.918 -3.991 1.00 146.93 ? -39  DA  J "C2'" 1 
ATOM   9871  C  "C1'" . DA  J  6 35  ? -16.801 -29.591 -3.343 1.00 147.17 ? -39  DA  J "C1'" 1 
ATOM   9872  N  N9    . DA  J  6 35  ? -17.030 -30.287 -2.076 1.00 147.21 ? -39  DA  J N9    1 
ATOM   9873  C  C8    . DA  J  6 35  ? -17.230 -31.629 -1.890 1.00 147.17 ? -39  DA  J C8    1 
ATOM   9874  N  N7    . DA  J  6 35  ? -17.403 -31.975 -0.636 1.00 147.11 ? -39  DA  J N7    1 
ATOM   9875  C  C5    . DA  J  6 35  ? -17.310 -30.777 0.052  1.00 147.16 ? -39  DA  J C5    1 
ATOM   9876  C  C6    . DA  J  6 35  ? -17.405 -30.458 1.424  1.00 147.12 ? -39  DA  J C6    1 
ATOM   9877  N  N6    . DA  J  6 35  ? -17.625 -31.378 2.369  1.00 147.08 ? -39  DA  J N6    1 
ATOM   9878  N  N1    . DA  J  6 35  ? -17.262 -29.160 1.785  1.00 147.17 ? -39  DA  J N1    1 
ATOM   9879  C  C2    . DA  J  6 35  ? -17.043 -28.240 0.831  1.00 147.17 ? -39  DA  J C2    1 
ATOM   9880  N  N3    . DA  J  6 35  ? -16.935 -28.423 -0.488 1.00 147.29 ? -39  DA  J N3    1 
ATOM   9881  C  C4    . DA  J  6 35  ? -17.079 -29.723 -0.818 1.00 147.24 ? -39  DA  J C4    1 
ATOM   9882  P  P     . DT  J  6 36  ? -14.202 -27.239 -5.086 1.00 144.23 ? -38  DT  J P     1 
ATOM   9883  O  OP1   . DT  J  6 36  ? -14.011 -26.035 -5.929 1.00 144.12 ? -38  DT  J OP1   1 
ATOM   9884  O  OP2   . DT  J  6 36  ? -13.046 -28.130 -4.821 1.00 144.25 ? -38  DT  J OP2   1 
ATOM   9885  O  "O5'" . DT  J  6 36  ? -14.844 -26.773 -3.689 1.00 142.33 ? -38  DT  J "O5'" 1 
ATOM   9886  C  "C5'" . DT  J  6 36  ? -14.358 -25.621 -2.992 1.00 138.98 ? -38  DT  J "C5'" 1 
ATOM   9887  C  "C4'" . DT  J  6 36  ? -13.465 -25.991 -1.814 1.00 136.37 ? -38  DT  J "C4'" 1 
ATOM   9888  O  "O4'" . DT  J  6 36  ? -13.979 -27.153 -1.117 1.00 135.67 ? -38  DT  J "O4'" 1 
ATOM   9889  C  "C3'" . DT  J  6 36  ? -12.017 -26.358 -2.162 1.00 134.69 ? -38  DT  J "C3'" 1 
ATOM   9890  O  "O3'" . DT  J  6 36  ? -11.113 -25.221 -2.050 1.00 132.39 ? -38  DT  J "O3'" 1 
ATOM   9891  C  "C2'" . DT  J  6 36  ? -11.676 -27.543 -1.250 1.00 134.79 ? -38  DT  J "C2'" 1 
ATOM   9892  C  "C1'" . DT  J  6 36  ? -12.904 -27.633 -0.341 1.00 134.99 ? -38  DT  J "C1'" 1 
ATOM   9893  N  N1    . DT  J  6 36  ? -13.229 -28.983 0.232  1.00 134.77 ? -38  DT  J N1    1 
ATOM   9894  C  C2    . DT  J  6 36  ? -13.893 -29.053 1.446  1.00 134.70 ? -38  DT  J C2    1 
ATOM   9895  O  O2    . DT  J  6 36  ? -14.248 -28.081 2.095  1.00 134.60 ? -38  DT  J O2    1 
ATOM   9896  N  N3    . DT  J  6 36  ? -14.142 -30.330 1.885  1.00 134.79 ? -38  DT  J N3    1 
ATOM   9897  C  C4    . DT  J  6 36  ? -13.797 -31.517 1.258  1.00 134.84 ? -38  DT  J C4    1 
ATOM   9898  O  O4    . DT  J  6 36  ? -14.070 -32.609 1.751  1.00 134.81 ? -38  DT  J O4    1 
ATOM   9899  C  C5    . DT  J  6 36  ? -13.101 -31.375 -0.003 1.00 134.87 ? -38  DT  J C5    1 
ATOM   9900  C  C7    . DT  J  6 36  ? -12.672 -32.584 -0.787 1.00 134.81 ? -38  DT  J C7    1 
ATOM   9901  C  C6    . DT  J  6 36  ? -12.855 -30.132 -0.447 1.00 134.82 ? -38  DT  J C6    1 
ATOM   9902  P  P     . DT  J  6 37  ? -10.561 -24.527 -0.704 1.00 130.69 ? -37  DT  J P     1 
ATOM   9903  O  OP1   . DT  J  6 37  ? -10.649 -23.059 -0.895 1.00 130.25 ? -37  DT  J OP1   1 
ATOM   9904  O  OP2   . DT  J  6 37  ? -9.243  -25.140 -0.417 1.00 130.52 ? -37  DT  J OP2   1 
ATOM   9905  O  "O5'" . DT  J  6 37  ? -11.577 -24.961 0.462  1.00 129.25 ? -37  DT  J "O5'" 1 
ATOM   9906  C  "C5'" . DT  J  6 37  ? -12.087 -24.052 1.446  1.00 126.70 ? -37  DT  J "C5'" 1 
ATOM   9907  C  "C4'" . DT  J  6 37  ? -11.689 -24.481 2.853  1.00 124.60 ? -37  DT  J "C4'" 1 
ATOM   9908  O  "O4'" . DT  J  6 37  ? -11.886 -25.910 3.035  1.00 124.37 ? -37  DT  J "O4'" 1 
ATOM   9909  C  "C3'" . DT  J  6 37  ? -10.232 -24.197 3.218  1.00 122.94 ? -37  DT  J "C3'" 1 
ATOM   9910  O  "O3'" . DT  J  6 37  ? -10.202 -23.485 4.456  1.00 120.22 ? -37  DT  J "O3'" 1 
ATOM   9911  C  "C2'" . DT  J  6 37  ? -9.582  -25.581 3.291  1.00 123.38 ? -37  DT  J "C2'" 1 
ATOM   9912  C  "C1'" . DT  J  6 37  ? -10.761 -26.458 3.691  1.00 124.18 ? -37  DT  J "C1'" 1 
ATOM   9913  N  N1    . DT  J  6 37  ? -10.633 -27.906 3.322  1.00 124.36 ? -37  DT  J N1    1 
ATOM   9914  C  C2    . DT  J  6 37  ? -11.102 -28.858 4.208  1.00 124.43 ? -37  DT  J C2    1 
ATOM   9915  O  O2    . DT  J  6 37  ? -11.616 -28.593 5.281  1.00 124.63 ? -37  DT  J O2    1 
ATOM   9916  N  N3    . DT  J  6 37  ? -10.947 -30.156 3.791  1.00 124.38 ? -37  DT  J N3    1 
ATOM   9917  C  C4    . DT  J  6 37  ? -10.386 -30.596 2.604  1.00 124.56 ? -37  DT  J C4    1 
ATOM   9918  O  O4    . DT  J  6 37  ? -10.302 -31.795 2.339  1.00 124.73 ? -37  DT  J O4    1 
ATOM   9919  C  C5    . DT  J  6 37  ? -9.914  -29.553 1.716  1.00 124.58 ? -37  DT  J C5    1 
ATOM   9920  C  C7    . DT  J  6 37  ? -9.279  -29.898 0.396  1.00 124.47 ? -37  DT  J C7    1 
ATOM   9921  C  C6    . DT  J  6 37  ? -10.059 -28.276 2.114  1.00 124.45 ? -37  DT  J C6    1 
ATOM   9922  P  P     . DT  J  6 38  ? -8.847  -23.158 5.253  1.00 118.61 ? -36  DT  J P     1 
ATOM   9923  O  OP1   . DT  J  6 38  ? -9.101  -21.921 6.027  1.00 118.41 ? -36  DT  J OP1   1 
ATOM   9924  O  OP2   . DT  J  6 38  ? -7.675  -23.236 4.347  1.00 118.04 ? -36  DT  J OP2   1 
ATOM   9925  O  "O5'" . DT  J  6 38  ? -8.750  -24.398 6.263  1.00 116.23 ? -36  DT  J "O5'" 1 
ATOM