data_3MGS
# 
_entry.id   3MGS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3MGS         
NDB   NA0504       
RCSB  RCSB058526   
WWPDB D_1000058526 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1KX5 . unspecified 
PDB 3MGP . unspecified 
PDB 3MGQ . unspecified 
PDB 3MGR . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3MGS 
_pdbx_database_status.recvd_initial_deposition_date   2010-04-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mohideen, K.' 1 
'Muhammad, R.' 2 
'Davey, C.A.'  3 
# 
_citation.id                        primary 
_citation.title                     'Perturbations in nucleosome structure from heavy metal association.' 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      2010 
_citation.journal_id_ASTM           NARHAD 
_citation.country                   UK 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_id_CSD            0389 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20494975 
_citation.pdbx_database_id_DOI      10.1093/nar/gkq420 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mohideen, K.' 1 
primary 'Muhammad, R.' 2 
primary 'Davey, C.A.'  3 
# 
_cell.entry_id           3MGS 
_cell.length_a           106.510 
_cell.length_b           109.668 
_cell.length_c           182.609 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3MGS 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone H3.2'       15303.930 2  ? ? ?                    ? 
2 polymer     man 'Histone H4'         11263.231 2  ? ? ?                    ? 
3 polymer     man 'Histone H2A'        12941.095 2  ? ? 'UNP RESIDUES 2-120' ? 
4 polymer     man 'Histone H2B 1.1'    13848.097 2  ? ? ?                    ? 
5 polymer     syn 'DNA (147-MER)'      45368.051 1  ? ? ?                    ? 
6 polymer     syn 'DNA (147-MER)'      45359.035 1  ? ? ?                    ? 
7 non-polymer syn 'CHLORIDE ION'       35.453    4  ? ? ?                    ? 
8 non-polymer syn 'CESIUM ION'         132.905   12 ? ? ?                    ? 
9 non-polymer syn 'MANGANESE (II) ION' 54.938    14 ? ? ?                    ? 
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        H2B1.1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
;
C,G ? 
4 'polypeptide(L)'        no no 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DG)(DA)(DA)(DT)(DC)(DC)(DA)(DG)(DC)
(DT)(DG)(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)
(DG)(DC)(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)
(DT)(DG)(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)
(DT)(DA)(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGGAATCCAGC
TGAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DG)(DA)(DT)(DT)(DC)(DC)(DA)(DG)(DC)
(DT)(DG)(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)
(DG)(DC)(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)
(DT)(DG)(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)
(DT)(DA)(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGGATTCCAGC
TGAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
J   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   THR n 
1 4   LYS n 
1 5   GLN n 
1 6   THR n 
1 7   ALA n 
1 8   ARG n 
1 9   LYS n 
1 10  SER n 
1 11  THR n 
1 12  GLY n 
1 13  GLY n 
1 14  LYS n 
1 15  ALA n 
1 16  PRO n 
1 17  ARG n 
1 18  LYS n 
1 19  GLN n 
1 20  LEU n 
1 21  ALA n 
1 22  THR n 
1 23  LYS n 
1 24  ALA n 
1 25  ALA n 
1 26  ARG n 
1 27  LYS n 
1 28  SER n 
1 29  ALA n 
1 30  PRO n 
1 31  ALA n 
1 32  THR n 
1 33  GLY n 
1 34  GLY n 
1 35  VAL n 
1 36  LYS n 
1 37  LYS n 
1 38  PRO n 
1 39  HIS n 
1 40  ARG n 
1 41  TYR n 
1 42  ARG n 
1 43  PRO n 
1 44  GLY n 
1 45  THR n 
1 46  VAL n 
1 47  ALA n 
1 48  LEU n 
1 49  ARG n 
1 50  GLU n 
1 51  ILE n 
1 52  ARG n 
1 53  ARG n 
1 54  TYR n 
1 55  GLN n 
1 56  LYS n 
1 57  SER n 
1 58  THR n 
1 59  GLU n 
1 60  LEU n 
1 61  LEU n 
1 62  ILE n 
1 63  ARG n 
1 64  LYS n 
1 65  LEU n 
1 66  PRO n 
1 67  PHE n 
1 68  GLN n 
1 69  ARG n 
1 70  LEU n 
1 71  VAL n 
1 72  ARG n 
1 73  GLU n 
1 74  ILE n 
1 75  ALA n 
1 76  GLN n 
1 77  ASP n 
1 78  PHE n 
1 79  LYS n 
1 80  THR n 
1 81  ASP n 
1 82  LEU n 
1 83  ARG n 
1 84  PHE n 
1 85  GLN n 
1 86  SER n 
1 87  SER n 
1 88  ALA n 
1 89  VAL n 
1 90  MET n 
1 91  ALA n 
1 92  LEU n 
1 93  GLN n 
1 94  GLU n 
1 95  ALA n 
1 96  SER n 
1 97  GLU n 
1 98  ALA n 
1 99  TYR n 
1 100 LEU n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 PHE n 
1 105 GLU n 
1 106 ASP n 
1 107 THR n 
1 108 ASN n 
1 109 LEU n 
1 110 CYS n 
1 111 ALA n 
1 112 ILE n 
1 113 HIS n 
1 114 ALA n 
1 115 LYS n 
1 116 ARG n 
1 117 VAL n 
1 118 THR n 
1 119 ILE n 
1 120 MET n 
1 121 PRO n 
1 122 LYS n 
1 123 ASP n 
1 124 ILE n 
1 125 GLN n 
1 126 LEU n 
1 127 ALA n 
1 128 ARG n 
1 129 ARG n 
1 130 ILE n 
1 131 ARG n 
1 132 GLY n 
1 133 GLU n 
1 134 ARG n 
1 135 ALA n 
2 1   SER n 
2 2   GLY n 
2 3   ARG n 
2 4   GLY n 
2 5   LYS n 
2 6   GLY n 
2 7   GLY n 
2 8   LYS n 
2 9   GLY n 
2 10  LEU n 
2 11  GLY n 
2 12  LYS n 
2 13  GLY n 
2 14  GLY n 
2 15  ALA n 
2 16  LYS n 
2 17  ARG n 
2 18  HIS n 
2 19  ARG n 
2 20  LYS n 
2 21  VAL n 
2 22  LEU n 
2 23  ARG n 
2 24  ASP n 
2 25  ASN n 
2 26  ILE n 
2 27  GLN n 
2 28  GLY n 
2 29  ILE n 
2 30  THR n 
2 31  LYS n 
2 32  PRO n 
2 33  ALA n 
2 34  ILE n 
2 35  ARG n 
2 36  ARG n 
2 37  LEU n 
2 38  ALA n 
2 39  ARG n 
2 40  ARG n 
2 41  GLY n 
2 42  GLY n 
2 43  VAL n 
2 44  LYS n 
2 45  ARG n 
2 46  ILE n 
2 47  SER n 
2 48  GLY n 
2 49  LEU n 
2 50  ILE n 
2 51  TYR n 
2 52  GLU n 
2 53  GLU n 
2 54  THR n 
2 55  ARG n 
2 56  GLY n 
2 57  VAL n 
2 58  LEU n 
2 59  LYS n 
2 60  VAL n 
2 61  PHE n 
2 62  LEU n 
2 63  GLU n 
2 64  ASN n 
2 65  VAL n 
2 66  ILE n 
2 67  ARG n 
2 68  ASP n 
2 69  ALA n 
2 70  VAL n 
2 71  THR n 
2 72  TYR n 
2 73  THR n 
2 74  GLU n 
2 75  HIS n 
2 76  ALA n 
2 77  LYS n 
2 78  ARG n 
2 79  LYS n 
2 80  THR n 
2 81  VAL n 
2 82  THR n 
2 83  ALA n 
2 84  MET n 
2 85  ASP n 
2 86  VAL n 
2 87  VAL n 
2 88  TYR n 
2 89  ALA n 
2 90  LEU n 
2 91  LYS n 
2 92  ARG n 
2 93  GLN n 
2 94  GLY n 
2 95  ARG n 
2 96  THR n 
2 97  LEU n 
2 98  TYR n 
2 99  GLY n 
2 100 PHE n 
2 101 GLY n 
2 102 GLY n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLN n 
3 7   GLY n 
3 8   GLY n 
3 9   LYS n 
3 10  THR n 
3 11  ARG n 
3 12  ALA n 
3 13  LYS n 
3 14  ALA n 
3 15  LYS n 
3 16  THR n 
3 17  ARG n 
3 18  SER n 
3 19  SER n 
3 20  ARG n 
3 21  ALA n 
3 22  GLY n 
3 23  LEU n 
3 24  GLN n 
3 25  PHE n 
3 26  PRO n 
3 27  VAL n 
3 28  GLY n 
3 29  ARG n 
3 30  VAL n 
3 31  HIS n 
3 32  ARG n 
3 33  LEU n 
3 34  LEU n 
3 35  ARG n 
3 36  LYS n 
3 37  GLY n 
3 38  ASN n 
3 39  TYR n 
3 40  ALA n 
3 41  GLU n 
3 42  ARG n 
3 43  VAL n 
3 44  GLY n 
3 45  ALA n 
3 46  GLY n 
3 47  ALA n 
3 48  PRO n 
3 49  VAL n 
3 50  TYR n 
3 51  LEU n 
3 52  ALA n 
3 53  ALA n 
3 54  VAL n 
3 55  LEU n 
3 56  GLU n 
3 57  TYR n 
3 58  LEU n 
3 59  THR n 
3 60  ALA n 
3 61  GLU n 
3 62  ILE n 
3 63  LEU n 
3 64  GLU n 
3 65  LEU n 
3 66  ALA n 
3 67  GLY n 
3 68  ASN n 
3 69  ALA n 
3 70  ALA n 
3 71  ARG n 
3 72  ASP n 
3 73  ASN n 
3 74  LYS n 
3 75  LYS n 
3 76  THR n 
3 77  ARG n 
3 78  ILE n 
3 79  ILE n 
3 80  PRO n 
3 81  ARG n 
3 82  HIS n 
3 83  LEU n 
3 84  GLN n 
3 85  LEU n 
3 86  ALA n 
3 87  VAL n 
3 88  ARG n 
3 89  ASN n 
3 90  ASP n 
3 91  GLU n 
3 92  GLU n 
3 93  LEU n 
3 94  ASN n 
3 95  LYS n 
3 96  LEU n 
3 97  LEU n 
3 98  GLY n 
3 99  ARG n 
3 100 VAL n 
3 101 THR n 
3 102 ILE n 
3 103 ALA n 
3 104 GLN n 
3 105 GLY n 
3 106 GLY n 
3 107 VAL n 
3 108 LEU n 
3 109 PRO n 
3 110 ASN n 
3 111 ILE n 
3 112 GLN n 
3 113 SER n 
3 114 VAL n 
3 115 LEU n 
3 116 LEU n 
3 117 PRO n 
3 118 LYS n 
3 119 LYS n 
4 1   PRO n 
4 2   GLU n 
4 3   PRO n 
4 4   ALA n 
4 5   LYS n 
4 6   SER n 
4 7   ALA n 
4 8   PRO n 
4 9   ALA n 
4 10  PRO n 
4 11  LYS n 
4 12  LYS n 
4 13  GLY n 
4 14  SER n 
4 15  LYS n 
4 16  LYS n 
4 17  ALA n 
4 18  VAL n 
4 19  THR n 
4 20  LYS n 
4 21  THR n 
4 22  GLN n 
4 23  LYS n 
4 24  LYS n 
4 25  ASP n 
4 26  GLY n 
4 27  LYS n 
4 28  LYS n 
4 29  ARG n 
4 30  ARG n 
4 31  LYS n 
4 32  THR n 
4 33  ARG n 
4 34  LYS n 
4 35  GLU n 
4 36  SER n 
4 37  TYR n 
4 38  ALA n 
4 39  ILE n 
4 40  TYR n 
4 41  VAL n 
4 42  TYR n 
4 43  LYS n 
4 44  VAL n 
4 45  LEU n 
4 46  LYS n 
4 47  GLN n 
4 48  VAL n 
4 49  HIS n 
4 50  PRO n 
4 51  ASP n 
4 52  THR n 
4 53  GLY n 
4 54  ILE n 
4 55  SER n 
4 56  SER n 
4 57  LYS n 
4 58  ALA n 
4 59  MET n 
4 60  SER n 
4 61  ILE n 
4 62  MET n 
4 63  ASN n 
4 64  SER n 
4 65  PHE n 
4 66  VAL n 
4 67  ASN n 
4 68  ASP n 
4 69  VAL n 
4 70  PHE n 
4 71  GLU n 
4 72  ARG n 
4 73  ILE n 
4 74  ALA n 
4 75  GLY n 
4 76  GLU n 
4 77  ALA n 
4 78  SER n 
4 79  ARG n 
4 80  LEU n 
4 81  ALA n 
4 82  HIS n 
4 83  TYR n 
4 84  ASN n 
4 85  LYS n 
4 86  ARG n 
4 87  SER n 
4 88  THR n 
4 89  ILE n 
4 90  THR n 
4 91  SER n 
4 92  ARG n 
4 93  GLU n 
4 94  ILE n 
4 95  GLN n 
4 96  THR n 
4 97  ALA n 
4 98  VAL n 
4 99  ARG n 
4 100 LEU n 
4 101 LEU n 
4 102 LEU n 
4 103 PRO n 
4 104 GLY n 
4 105 GLU n 
4 106 LEU n 
4 107 ALA n 
4 108 LYS n 
4 109 HIS n 
4 110 ALA n 
4 111 VAL n 
4 112 SER n 
4 113 GLU n 
4 114 GLY n 
4 115 THR n 
4 116 LYS n 
4 117 ALA n 
4 118 VAL n 
4 119 THR n 
4 120 LYS n 
4 121 TYR n 
4 122 THR n 
4 123 SER n 
4 124 ALA n 
4 125 LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DA  n 
5 5   DA  n 
5 6   DT  n 
5 7   DA  n 
5 8   DT  n 
5 9   DC  n 
5 10  DC  n 
5 11  DA  n 
5 12  DC  n 
5 13  DC  n 
5 14  DT  n 
5 15  DG  n 
5 16  DC  n 
5 17  DA  n 
5 18  DG  n 
5 19  DA  n 
5 20  DT  n 
5 21  DA  n 
5 22  DC  n 
5 23  DT  n 
5 24  DA  n 
5 25  DC  n 
5 26  DC  n 
5 27  DA  n 
5 28  DA  n 
5 29  DA  n 
5 30  DA  n 
5 31  DG  n 
5 32  DT  n 
5 33  DG  n 
5 34  DT  n 
5 35  DA  n 
5 36  DT  n 
5 37  DT  n 
5 38  DT  n 
5 39  DG  n 
5 40  DG  n 
5 41  DA  n 
5 42  DA  n 
5 43  DA  n 
5 44  DC  n 
5 45  DT  n 
5 46  DG  n 
5 47  DC  n 
5 48  DT  n 
5 49  DC  n 
5 50  DC  n 
5 51  DA  n 
5 52  DT  n 
5 53  DC  n 
5 54  DA  n 
5 55  DA  n 
5 56  DA  n 
5 57  DA  n 
5 58  DG  n 
5 59  DG  n 
5 60  DC  n 
5 61  DA  n 
5 62  DT  n 
5 63  DG  n 
5 64  DT  n 
5 65  DT  n 
5 66  DC  n 
5 67  DA  n 
5 68  DG  n 
5 69  DC  n 
5 70  DT  n 
5 71  DG  n 
5 72  DG  n 
5 73  DA  n 
5 74  DA  n 
5 75  DT  n 
5 76  DC  n 
5 77  DC  n 
5 78  DA  n 
5 79  DG  n 
5 80  DC  n 
5 81  DT  n 
5 82  DG  n 
5 83  DA  n 
5 84  DA  n 
5 85  DC  n 
5 86  DA  n 
5 87  DT  n 
5 88  DG  n 
5 89  DC  n 
5 90  DC  n 
5 91  DT  n 
5 92  DT  n 
5 93  DT  n 
5 94  DT  n 
5 95  DG  n 
5 96  DA  n 
5 97  DT  n 
5 98  DG  n 
5 99  DG  n 
5 100 DA  n 
5 101 DG  n 
5 102 DC  n 
5 103 DA  n 
5 104 DG  n 
5 105 DT  n 
5 106 DT  n 
5 107 DT  n 
5 108 DC  n 
5 109 DC  n 
5 110 DA  n 
5 111 DA  n 
5 112 DA  n 
5 113 DT  n 
5 114 DA  n 
5 115 DC  n 
5 116 DA  n 
5 117 DC  n 
5 118 DT  n 
5 119 DT  n 
5 120 DT  n 
5 121 DT  n 
5 122 DG  n 
5 123 DG  n 
5 124 DT  n 
5 125 DA  n 
5 126 DG  n 
5 127 DT  n 
5 128 DA  n 
5 129 DT  n 
5 130 DC  n 
5 131 DT  n 
5 132 DG  n 
5 133 DC  n 
5 134 DA  n 
5 135 DG  n 
5 136 DG  n 
5 137 DT  n 
5 138 DG  n 
5 139 DG  n 
5 140 DA  n 
5 141 DT  n 
5 142 DA  n 
5 143 DT  n 
5 144 DT  n 
5 145 DG  n 
5 146 DA  n 
5 147 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DA  n 
6 5   DA  n 
6 6   DT  n 
6 7   DA  n 
6 8   DT  n 
6 9   DC  n 
6 10  DC  n 
6 11  DA  n 
6 12  DC  n 
6 13  DC  n 
6 14  DT  n 
6 15  DG  n 
6 16  DC  n 
6 17  DA  n 
6 18  DG  n 
6 19  DA  n 
6 20  DT  n 
6 21  DA  n 
6 22  DC  n 
6 23  DT  n 
6 24  DA  n 
6 25  DC  n 
6 26  DC  n 
6 27  DA  n 
6 28  DA  n 
6 29  DA  n 
6 30  DA  n 
6 31  DG  n 
6 32  DT  n 
6 33  DG  n 
6 34  DT  n 
6 35  DA  n 
6 36  DT  n 
6 37  DT  n 
6 38  DT  n 
6 39  DG  n 
6 40  DG  n 
6 41  DA  n 
6 42  DA  n 
6 43  DA  n 
6 44  DC  n 
6 45  DT  n 
6 46  DG  n 
6 47  DC  n 
6 48  DT  n 
6 49  DC  n 
6 50  DC  n 
6 51  DA  n 
6 52  DT  n 
6 53  DC  n 
6 54  DA  n 
6 55  DA  n 
6 56  DA  n 
6 57  DA  n 
6 58  DG  n 
6 59  DG  n 
6 60  DC  n 
6 61  DA  n 
6 62  DT  n 
6 63  DG  n 
6 64  DT  n 
6 65  DT  n 
6 66  DC  n 
6 67  DA  n 
6 68  DG  n 
6 69  DC  n 
6 70  DT  n 
6 71  DG  n 
6 72  DG  n 
6 73  DA  n 
6 74  DT  n 
6 75  DT  n 
6 76  DC  n 
6 77  DC  n 
6 78  DA  n 
6 79  DG  n 
6 80  DC  n 
6 81  DT  n 
6 82  DG  n 
6 83  DA  n 
6 84  DA  n 
6 85  DC  n 
6 86  DA  n 
6 87  DT  n 
6 88  DG  n 
6 89  DC  n 
6 90  DC  n 
6 91  DT  n 
6 92  DT  n 
6 93  DT  n 
6 94  DT  n 
6 95  DG  n 
6 96  DA  n 
6 97  DT  n 
6 98  DG  n 
6 99  DG  n 
6 100 DA  n 
6 101 DG  n 
6 102 DC  n 
6 103 DA  n 
6 104 DG  n 
6 105 DT  n 
6 106 DT  n 
6 107 DT  n 
6 108 DC  n 
6 109 DC  n 
6 110 DA  n 
6 111 DA  n 
6 112 DA  n 
6 113 DT  n 
6 114 DA  n 
6 115 DC  n 
6 116 DA  n 
6 117 DC  n 
6 118 DT  n 
6 119 DT  n 
6 120 DT  n 
6 121 DT  n 
6 122 DG  n 
6 123 DG  n 
6 124 DT  n 
6 125 DA  n 
6 126 DG  n 
6 127 DT  n 
6 128 DA  n 
6 129 DT  n 
6 130 DC  n 
6 131 DT  n 
6 132 DG  n 
6 133 DC  n 
6 134 DA  n 
6 135 DG  n 
6 136 DG  n 
6 137 DT  n 
6 138 DG  n 
6 139 DG  n 
6 140 DA  n 
6 141 DT  n 
6 142 DA  n 
6 143 DT  n 
6 144 DT  n 
6 145 DG  n 
6 146 DA  n 
6 147 DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'African clawed frog' ? 'Histone 3 or H3'              ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 'BL21 DE3' ? ? ? ? ? ? ? Plasmid ? ? ? pET3D ? ? 
2 1 sample ? ? ? 'African clawed frog' ? 'Histone 4 or H4'              ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 'BL21 DE3' ? ? ? ? ? ? ? Plasmid ? ? ? pET3A ? ? 
3 1 sample ? ? ? 'African clawed frog' ? 'Histone 2A or H2A, LOC494591' ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 'BL21 DE3' ? ? ? ? ? ? ? Plasmid ? ? ? pET3A ? ? 
4 1 sample ? ? ? 'African clawed frog' ? 'Histone 2B or H2B'            ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? 'BL21 DE3' ? ? ? ? ? ? ? plasmid ? ? ? pET3A ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
5 1 sample ? ? ? ? ? 'Synthetic Palindromic DNA expressed in pUC18 plasmid using E.coli HB101 cells.' 
6 1 sample ? ? ? ? ? 'Synthetic Palindromic DNA expressed in pUC18 plasmid using E.coli HB101 cells.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP H32_XENLA    P84233 1 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2 ? 
2 UNP H4_XENLA     P62799 2 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2 ? 
3 UNP Q6AZJ8_XENLA Q6AZJ8 3 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
;
2 ? 
4 UNP H2B11_XENLA  P02281 4 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
2 ? 
5 PDB 3MGS         3MGS   5 ? ? ? 
6 PDB 3MGS         3MGS   6 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3MGS A 1 ? 135 ? P84233 2 ? 136 ? 1   135 
2  2 3MGS B 1 ? 102 ? P62799 2 ? 103 ? 1   102 
3  3 3MGS C 1 ? 119 ? Q6AZJ8 2 ? 120 ? 1   119 
4  4 3MGS D 1 ? 125 ? P02281 2 ? 126 ? -2  122 
5  1 3MGS E 1 ? 135 ? P84233 2 ? 136 ? 1   135 
6  2 3MGS F 1 ? 102 ? P62799 2 ? 103 ? 1   102 
7  3 3MGS G 1 ? 119 ? Q6AZJ8 2 ? 120 ? 1   119 
8  4 3MGS H 1 ? 125 ? P02281 2 ? 126 ? -2  122 
9  5 3MGS I 1 ? 147 ? 3MGS   1 ? 147 ? -73 73  
10 6 3MGS J 1 ? 147 ? 3MGS   1 ? 147 ? -73 73  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3MGS ALA A 102 ? UNP P84233 GLY 103 'SEE REMARK 999' 102 1 
4 3MGS THR D 32  ? UNP P02281 SER 33  'SEE REMARK 999' 29  2 
5 3MGS ALA E 102 ? UNP P84233 GLY 103 'SEE REMARK 999' 102 3 
8 3MGS THR H 32  ? UNP P02281 SER 33  'SEE REMARK 999' 29  4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CL  non-polymer         . 'CHLORIDE ION'                       ? 'Cl -1'           35.453  
CS  non-polymer         . 'CESIUM ION'                         ? 'Cs 1'            132.905 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ? 'Mn 2'            54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3MGS 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.70 
_exptl_crystal.density_percent_sol   54.46 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    '85mM MnCl2, 60mM KCl, 40mM K-cacodylate , pH 6.0, VAPOR DIFFUSION, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2009-06-22 
_diffrn_detector.details                'vertically collimating mirror' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Bartels Monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.93 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06DA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06DA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.93 
# 
_reflns.entry_id                     3MGS 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             94.07 
_reflns.d_resolution_high            3.15 
_reflns.number_obs                   36839 
_reflns.number_all                   37672 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.091 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.8 
_reflns.B_iso_Wilson_estimate        75.4 
_reflns.pdbx_redundancy              7.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.15 
_reflns_shell.d_res_low              3.32 
_reflns_shell.percent_possible_all   98.5 
_reflns_shell.Rmerge_I_obs           0.477 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.1 
_reflns_shell.pdbx_redundancy        5.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      5343 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3MGS 
_refine.ls_number_reflns_obs                     36839 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             94.07 
_refine.ls_d_res_high                            3.15 
_refine.ls_percent_reflns_obs                    99.71 
_refine.ls_R_factor_obs                          0.21635 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21591 
_refine.ls_R_factor_R_free                       0.23756 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.1 
_refine.ls_number_reflns_R_free                  774 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.911 
_refine.correlation_coeff_Fo_to_Fc_free          0.916 
_refine.B_iso_mean                               75.970 
_refine.aniso_B[1][1]                            1.40 
_refine.aniso_B[2][2]                            -6.24 
_refine.aniso_B[3][3]                            4.84 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1KX5 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.434 
_refine.overall_SU_ML                            0.326 
_refine.overall_SU_B                             18.708 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6156 
_refine_hist.pdbx_number_atoms_nucleic_acid   6021 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               12207 
_refine_hist.d_res_high                       3.15 
_refine_hist.d_res_low                        94.07 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.009  0.021  ? 12991 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.460  2.545  ? 18797 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.037  5.000  ? 764   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   32.962 21.131 ? 274   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   16.600 15.000 ? 1209  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   20.451 15.000 ? 89    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.072  0.200  ? 2134  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.004  0.020  ? 7656  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.207  0.200  ? 5153  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.316  0.200  ? 8187  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.153  0.200  ? 373   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.186  0.200  ? 23    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.137  0.200  ? 3     'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.654  1.500  ? 3899  'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.167  2.000  ? 6170  'X-RAY DIFFRACTION' ? 
r_scbond_it              1.058  3.000  ? 12064 'X-RAY DIFFRACTION' ? 
r_scangle_it             1.948  4.500  ? 12627 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.150 
_refine_ls_shell.d_res_low                        3.232 
_refine_ls_shell.number_reflns_R_work             2606 
_refine_ls_shell.R_factor_R_work                  0.281 
_refine_ls_shell.percent_reflns_obs               96.58 
_refine_ls_shell.R_factor_R_free                  0.325 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             51 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3MGS 
_struct.title                     'Binding of Cesium ions to the Nucleosome Core particle' 
_struct.pdbx_descriptor           'Histone H3.2, Histone H4, Histone H2A, Histone H2B 1.1/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3MGS 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
_struct_keywords.text            'PROTEIN-DNA COMPLEX, STRUCTURAL PROTEIN-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 3 ? 
D  N N 4 ? 
E  N N 1 ? 
F  N N 2 ? 
G  N N 3 ? 
H  N N 4 ? 
I  N N 5 ? 
J  N N 6 ? 
K  N N 7 ? 
L  N N 8 ? 
M  N N 7 ? 
N  N N 8 ? 
O  N N 9 ? 
P  N N 7 ? 
Q  N N 7 ? 
R  N N 8 ? 
S  N N 8 ? 
T  N N 8 ? 
U  N N 8 ? 
V  N N 8 ? 
W  N N 8 ? 
X  N N 8 ? 
Y  N N 8 ? 
Z  N N 9 ? 
AA N N 9 ? 
BA N N 9 ? 
CA N N 9 ? 
DA N N 9 ? 
EA N N 9 ? 
FA N N 8 ? 
GA N N 8 ? 
HA N N 9 ? 
IA N N 9 ? 
JA N N 9 ? 
KA N N 9 ? 
LA N N 9 ? 
MA N N 9 ? 
NA N N 9 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 44  ? SER A 57  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  2  ARG A 63  ? ASP A 77  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  3  GLN A 85  ? ALA A 114 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  4  MET A 120 ? ARG A 131 ? MET A 120 ARG A 131 1 ? 12 
HELX_P HELX_P5  5  ASP B 24  ? ILE B 29  ? ASP B 24  ILE B 29  5 ? 6  
HELX_P HELX_P6  6  THR B 30  ? GLY B 41  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  7  LEU B 49  ? ALA B 76  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  8  THR B 82  ? GLN B 93  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  9  THR C 16  ? ALA C 21  ? THR C 16  ALA C 21  1 ? 6  
HELX_P HELX_P10 10 PRO C 26  ? GLY C 37  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P11 11 GLY C 46  ? ASN C 73  ? GLY C 46  ASN C 73  1 ? 28 
HELX_P HELX_P12 12 ILE C 79  ? ASN C 89  ? ILE C 79  ASN C 89  1 ? 11 
HELX_P HELX_P13 13 ASP C 90  ? LEU C 97  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 14 GLN C 112 ? LEU C 116 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 15 TYR D 37  ? HIS D 49  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 16 SER D 55  ? ASN D 84  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P17 17 THR D 90  ? LEU D 102 ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 18 PRO D 103 ? ALA D 124 ? PRO D 100 ALA D 121 1 ? 22 
HELX_P HELX_P19 19 GLY E 44  ? SER E 57  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P20 20 ARG E 63  ? ASP E 77  ? ARG E 63  ASP E 77  1 ? 15 
HELX_P HELX_P21 21 GLN E 85  ? ALA E 114 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 22 MET E 120 ? ARG E 131 ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P23 23 ASP F 24  ? ILE F 29  ? ASP F 24  ILE F 29  5 ? 6  
HELX_P HELX_P24 24 THR F 30  ? GLY F 41  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 25 LEU F 49  ? ALA F 76  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P26 26 THR F 82  ? GLN F 93  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 27 THR G 16  ? GLY G 22  ? THR G 16  GLY G 22  1 ? 7  
HELX_P HELX_P28 28 PRO G 26  ? LYS G 36  ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P29 29 ALA G 45  ? ASN G 73  ? ALA G 45  ASN G 73  1 ? 29 
HELX_P HELX_P30 30 ILE G 79  ? ASN G 89  ? ILE G 79  ASN G 89  1 ? 11 
HELX_P HELX_P31 31 ASP G 90  ? LEU G 97  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P32 32 GLN G 112 ? LEU G 116 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P33 33 TYR H 37  ? HIS H 49  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P34 34 SER H 55  ? ASN H 84  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P35 35 THR H 90  ? LEU H 102 ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P36 36 PRO H 103 ? SER H 123 ? PRO H 100 SER H 120 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? J DG  122 N7    ? ? ? 1_555 KA MN .   MN ? ? J DG  48  J MN 3135 1_555 ? ? ? ? ? ? ?               2.181 ? 
metalc2   metalc ? ? I DG  39  N7    ? ? ? 1_555 EA MN .   MN ? ? I DG  -35 I MN 3143 1_555 ? ? ? ? ? ? ?               2.271 ? 
metalc3   metalc ? ? E ASP 77  OD1   ? ? ? 1_555 O  MN .   MN ? ? E ASP 77  E MN 3132 1_555 ? ? ? ? ? ? ?               2.277 ? 
metalc4   metalc ? ? J DG  71  N7    ? ? ? 1_555 JA MN .   MN ? ? J DG  -3  J MN 3134 1_555 ? ? ? ? ? ? ?               2.295 ? 
metalc5   metalc ? ? I DG  71  N7    ? ? ? 1_555 DA MN .   MN ? ? I DG  -3  I MN 3142 1_555 ? ? ? ? ? ? ?               2.325 ? 
metalc6   metalc ? ? I DG  122 N7    ? ? ? 1_555 Z  MN .   MN ? ? I DG  48  I MN 3137 1_555 ? ? ? ? ? ? ?               2.346 ? 
metalc7   metalc ? ? J DT  8   O2    ? ? ? 1_555 V  CS .   CS ? ? J DT  -66 I CS 77   1_555 ? ? ? ? ? ? ?               2.412 ? 
metalc8   metalc ? ? I DG  135 N7    ? ? ? 1_555 AA MN .   MN ? ? I DG  61  I MN 3138 1_555 ? ? ? ? ? ? ?               2.428 ? 
metalc9   metalc ? ? J DG  39  N7    ? ? ? 1_555 MA MN .   MN ? ? J DG  -35 J MN 3139 1_555 ? ? ? ? ? ? ?               2.458 ? 
metalc10  metalc ? ? J DT  64  O2    ? ? ? 1_555 X  CS .   CS ? ? J DT  -10 I CS 79   1_555 ? ? ? ? ? ? ?               2.501 ? 
metalc11  metalc ? ? J DG  101 N7    ? ? ? 1_555 IA MN .   MN ? ? J DG  27  J MN 3133 1_555 ? ? ? ? ? ? ?               2.527 ? 
metalc12  metalc ? ? J DG  135 N7    ? ? ? 1_555 HA MN .   MN ? ? J DG  61  J MN 3131 1_555 ? ? ? ? ? ? ?               2.533 ? 
metalc13  metalc ? ? J DT  62  O2    ? ? ? 1_555 FA CS .   CS ? ? J DT  -12 J CS 74   1_555 ? ? ? ? ? ? ?               2.560 ? 
metalc14  metalc ? ? I DG  101 N7    ? ? ? 1_555 BA MN .   MN ? ? I DG  27  I MN 3140 1_555 ? ? ? ? ? ? ?               2.595 ? 
metalc15  metalc ? ? J DG  79  O6    ? ? ? 1_555 NA MN .   MN ? ? J DG  5   J MN 3144 1_555 ? ? ? ? ? ? ?               2.601 ? 
metalc16  metalc ? ? I DT  141 O2    ? ? ? 1_555 V  CS .   CS ? ? I DT  67  I CS 77   1_555 ? ? ? ? ? ? ?               2.656 ? 
metalc17  metalc ? ? J DG  40  O6    ? ? ? 1_555 MA MN .   MN ? ? J DG  -34 J MN 3139 1_555 ? ? ? ? ? ? ?               2.666 ? 
metalc18  metalc ? ? J DG  59  N2    ? ? ? 1_555 W  CS .   CS ? ? J DG  -15 I CS 78   1_555 ? ? ? ? ? ? ?               2.698 ? 
metalc19  metalc ? ? I DG  40  O6    ? ? ? 1_555 EA MN .   MN ? ? I DG  -34 I MN 3143 1_555 ? ? ? ? ? ? ?               2.779 ? 
metalc20  metalc ? ? I DT  48  O2    ? ? ? 1_555 U  CS .   CS ? ? I DT  -26 I CS 76   1_555 ? ? ? ? ? ? ?               2.796 ? 
metalc21  metalc ? ? I DT  8   O2    ? ? ? 1_555 S  CS .   CS ? ? I DT  -66 I CS 74   1_555 ? ? ? ? ? ? ?               2.803 ? 
metalc22  metalc ? ? I DC  49  "O4'" ? ? ? 1_555 U  CS .   CS ? ? I DC  -25 I CS 76   1_555 ? ? ? ? ? ? ?               2.811 ? 
metalc23  metalc ? ? I DC  85  O2    ? ? ? 1_555 X  CS .   CS ? ? I DC  11  I CS 79   1_555 ? ? ? ? ? ? ?               2.834 ? 
metalc24  metalc ? ? I DT  14  O2    ? ? ? 1_555 Y  CS .   CS ? ? I DT  -60 I CS 80   1_555 ? ? ? ? ? ? ?               2.856 ? 
metalc25  metalc ? ? I DC  49  O2    ? ? ? 1_555 U  CS .   CS ? ? I DC  -25 I CS 76   1_555 ? ? ? ? ? ? ?               2.862 ? 
metalc26  metalc ? ? J DA  142 "O4'" ? ? ? 1_555 S  CS .   CS ? ? J DA  68  I CS 74   1_555 ? ? ? ? ? ? ?               2.919 ? 
metalc27  metalc ? ? I DG  15  "O4'" ? ? ? 1_555 Y  CS .   CS ? ? I DG  -59 I CS 80   1_555 ? ? ? ? ? ? ?               2.923 ? 
metalc28  metalc ? ? I DC  90  O2    ? ? ? 1_555 W  CS .   CS ? ? I DC  16  I CS 78   1_555 ? ? ? ? ? ? ?               2.938 ? 
metalc29  metalc ? ? J DT  14  O2    ? ? ? 1_555 GA CS .   CS ? ? J DT  -60 J CS 75   1_555 ? ? ? ? ? ? ?               3.091 ? 
metalc30  metalc ? ? J DT  141 O2    ? ? ? 1_555 S  CS .   CS ? ? J DT  67  I CS 74   1_555 ? ? ? ? ? ? ?               3.094 ? 
metalc31  metalc ? ? J DG  15  "O4'" ? ? ? 1_555 GA CS .   CS ? ? J DG  -59 J CS 75   1_555 ? ? ? ? ? ? ?               3.099 ? 
metalc32  metalc ? ? D LEU 102 O     ? ? ? 1_555 N  CS .   CS ? ? D LEU 99  D CS 123  1_555 ? ? ? ? ? ? ?               3.135 ? 
metalc33  metalc ? ? I DC  9   "O4'" ? ? ? 1_555 S  CS .   CS ? ? I DC  -65 I CS 74   1_555 ? ? ? ? ? ? ?               3.170 ? 
metalc34  metalc ? ? H ARG 99  O     ? ? ? 1_555 R  CS .   CS ? ? H ARG 96  H CS 123  1_555 ? ? ? ? ? ? ?               3.184 ? 
metalc35  metalc ? ? I DC  89  "O4'" ? ? ? 1_555 T  CS .   CS ? ? I DC  15  I CS 75   1_555 ? ? ? ? ? ? ?               3.195 ? 
metalc36  metalc ? ? H LEU 102 O     ? ? ? 1_555 R  CS .   CS ? ? H LEU 99  H CS 123  1_555 ? ? ? ? ? ? ?               3.253 ? 
metalc37  metalc ? ? D ARG 99  O     ? ? ? 1_555 N  CS .   CS ? ? D ARG 96  D CS 123  1_555 ? ? ? ? ? ? ?               3.308 ? 
metalc38  metalc ? ? J DT  62  "O4'" ? ? ? 1_555 FA CS .   CS ? ? J DT  -12 J CS 74   1_555 ? ? ? ? ? ? ?               3.312 ? 
metalc39  metalc ? ? I DA  142 "O4'" ? ? ? 1_555 V  CS .   CS ? ? I DA  68  I CS 77   1_555 ? ? ? ? ? ? ?               3.390 ? 
metalc40  metalc ? ? C GLY 37  O     ? ? ? 1_555 L  CS .   CS ? ? C GLY 37  C CS 120  1_555 ? ? ? ? ? ? ?               3.437 ? 
metalc41  metalc ? ? I DC  90  "O4'" ? ? ? 1_555 W  CS .   CS ? ? I DC  16  I CS 78   1_555 ? ? ? ? ? ? ?               3.450 ? 
metalc42  metalc ? ? D LEU 100 O     ? ? ? 1_555 N  CS .   CS ? ? D LEU 97  D CS 123  1_555 ? ? ? ? ? ? ?               3.478 ? 
hydrog1   hydrog ? ? I DA  1   N1    ? ? ? 1_555 J  DT 147 N3 ? ? I DA  -73 J DT 73   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog2   hydrog ? ? I DT  2   N3    ? ? ? 1_555 J  DA 146 N1 ? ? I DT  -72 J DA 72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? I DT  2   O4    ? ? ? 1_555 J  DA 146 N6 ? ? I DT  -72 J DA 72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? I DC  3   N3    ? ? ? 1_555 J  DG 145 N1 ? ? I DC  -71 J DG 71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? I DC  3   N4    ? ? ? 1_555 J  DG 145 O6 ? ? I DC  -71 J DG 71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? I DC  3   O2    ? ? ? 1_555 J  DG 145 N2 ? ? I DC  -71 J DG 71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? I DA  4   N1    ? ? ? 1_555 J  DT 144 N3 ? ? I DA  -70 J DT 70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? I DA  4   N6    ? ? ? 1_555 J  DT 144 O4 ? ? I DA  -70 J DT 70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? I DA  5   N1    ? ? ? 1_555 J  DT 143 N3 ? ? I DA  -69 J DT 69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? I DA  5   N6    ? ? ? 1_555 J  DT 143 O4 ? ? I DA  -69 J DT 69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? I DT  6   N3    ? ? ? 1_555 J  DA 142 N1 ? ? I DT  -68 J DA 68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? I DT  6   O4    ? ? ? 1_555 J  DA 142 N6 ? ? I DT  -68 J DA 68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? I DA  7   N1    ? ? ? 1_555 J  DT 141 N3 ? ? I DA  -67 J DT 67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? I DA  7   N6    ? ? ? 1_555 J  DT 141 O4 ? ? I DA  -67 J DT 67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? I DT  8   N3    ? ? ? 1_555 J  DA 140 N1 ? ? I DT  -66 J DA 66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? I DT  8   O4    ? ? ? 1_555 J  DA 140 N6 ? ? I DT  -66 J DA 66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? I DC  9   N3    ? ? ? 1_555 J  DG 139 N1 ? ? I DC  -65 J DG 65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? I DC  9   N4    ? ? ? 1_555 J  DG 139 O6 ? ? I DC  -65 J DG 65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? I DC  9   O2    ? ? ? 1_555 J  DG 139 N2 ? ? I DC  -65 J DG 65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? I DC  10  N3    ? ? ? 1_555 J  DG 138 N1 ? ? I DC  -64 J DG 64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? I DC  10  N4    ? ? ? 1_555 J  DG 138 O6 ? ? I DC  -64 J DG 64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? I DC  10  O2    ? ? ? 1_555 J  DG 138 N2 ? ? I DC  -64 J DG 64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? I DA  11  N1    ? ? ? 1_555 J  DT 137 N3 ? ? I DA  -63 J DT 63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? I DA  11  N6    ? ? ? 1_555 J  DT 137 O4 ? ? I DA  -63 J DT 63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? I DC  12  N3    ? ? ? 1_555 J  DG 136 N1 ? ? I DC  -62 J DG 62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? I DC  12  N4    ? ? ? 1_555 J  DG 136 O6 ? ? I DC  -62 J DG 62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? I DC  12  O2    ? ? ? 1_555 J  DG 136 N2 ? ? I DC  -62 J DG 62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? I DC  13  N3    ? ? ? 1_555 J  DG 135 N1 ? ? I DC  -61 J DG 61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? I DC  13  N4    ? ? ? 1_555 J  DG 135 O6 ? ? I DC  -61 J DG 61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? I DC  13  O2    ? ? ? 1_555 J  DG 135 N2 ? ? I DC  -61 J DG 61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? I DT  14  N3    ? ? ? 1_555 J  DA 134 N1 ? ? I DT  -60 J DA 60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? I DT  14  O4    ? ? ? 1_555 J  DA 134 N6 ? ? I DT  -60 J DA 60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? I DG  15  N1    ? ? ? 1_555 J  DC 133 N3 ? ? I DG  -59 J DC 59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? I DG  15  N2    ? ? ? 1_555 J  DC 133 O2 ? ? I DG  -59 J DC 59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? I DG  15  O6    ? ? ? 1_555 J  DC 133 N4 ? ? I DG  -59 J DC 59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? I DC  16  N3    ? ? ? 1_555 J  DG 132 N1 ? ? I DC  -58 J DG 58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? I DC  16  N4    ? ? ? 1_555 J  DG 132 O6 ? ? I DC  -58 J DG 58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? I DC  16  O2    ? ? ? 1_555 J  DG 132 N2 ? ? I DC  -58 J DG 58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? I DA  17  N1    ? ? ? 1_555 J  DT 131 N3 ? ? I DA  -57 J DT 57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? I DA  17  N6    ? ? ? 1_555 J  DT 131 O4 ? ? I DA  -57 J DT 57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? I DG  18  N1    ? ? ? 1_555 J  DC 130 N3 ? ? I DG  -56 J DC 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? I DG  18  N2    ? ? ? 1_555 J  DC 130 O2 ? ? I DG  -56 J DC 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? I DG  18  O6    ? ? ? 1_555 J  DC 130 N4 ? ? I DG  -56 J DC 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? I DA  19  N1    ? ? ? 1_555 J  DT 129 N3 ? ? I DA  -55 J DT 55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? I DA  19  N6    ? ? ? 1_555 J  DT 129 O4 ? ? I DA  -55 J DT 55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? I DT  20  N3    ? ? ? 1_555 J  DA 128 N1 ? ? I DT  -54 J DA 54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? I DT  20  O4    ? ? ? 1_555 J  DA 128 N6 ? ? I DT  -54 J DA 54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? I DA  21  N1    ? ? ? 1_555 J  DT 127 N3 ? ? I DA  -53 J DT 53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? I DA  21  N6    ? ? ? 1_555 J  DT 127 O4 ? ? I DA  -53 J DT 53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? I DC  22  N3    ? ? ? 1_555 J  DG 126 N1 ? ? I DC  -52 J DG 52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? I DC  22  N4    ? ? ? 1_555 J  DG 126 O6 ? ? I DC  -52 J DG 52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? I DC  22  O2    ? ? ? 1_555 J  DG 126 N2 ? ? I DC  -52 J DG 52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? I DT  23  N3    ? ? ? 1_555 J  DA 125 N1 ? ? I DT  -51 J DA 51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? I DT  23  O4    ? ? ? 1_555 J  DA 125 N6 ? ? I DT  -51 J DA 51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? I DA  24  N1    ? ? ? 1_555 J  DT 124 N3 ? ? I DA  -50 J DT 50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? I DA  24  N6    ? ? ? 1_555 J  DT 124 O4 ? ? I DA  -50 J DT 50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? I DC  25  N3    ? ? ? 1_555 J  DG 123 N1 ? ? I DC  -49 J DG 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? I DC  25  N4    ? ? ? 1_555 J  DG 123 O6 ? ? I DC  -49 J DG 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? I DC  25  O2    ? ? ? 1_555 J  DG 123 N2 ? ? I DC  -49 J DG 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? I DC  26  N3    ? ? ? 1_555 J  DG 122 N1 ? ? I DC  -48 J DG 48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? I DC  26  N4    ? ? ? 1_555 J  DG 122 O6 ? ? I DC  -48 J DG 48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? I DC  26  O2    ? ? ? 1_555 J  DG 122 N2 ? ? I DC  -48 J DG 48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? I DA  27  N1    ? ? ? 1_555 J  DT 121 N3 ? ? I DA  -47 J DT 47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? I DA  27  N6    ? ? ? 1_555 J  DT 121 O4 ? ? I DA  -47 J DT 47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? I DA  28  N1    ? ? ? 1_555 J  DT 120 N3 ? ? I DA  -46 J DT 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? I DA  28  N6    ? ? ? 1_555 J  DT 120 O4 ? ? I DA  -46 J DT 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? I DA  29  N1    ? ? ? 1_555 J  DT 119 N3 ? ? I DA  -45 J DT 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? I DA  29  N6    ? ? ? 1_555 J  DT 119 O4 ? ? I DA  -45 J DT 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? I DA  30  N1    ? ? ? 1_555 J  DT 118 N3 ? ? I DA  -44 J DT 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? I DA  30  N6    ? ? ? 1_555 J  DT 118 O4 ? ? I DA  -44 J DT 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? I DG  31  N2    ? ? ? 1_555 J  DC 117 O2 ? ? I DG  -43 J DC 43   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog72  hydrog ? ? I DT  32  N3    ? ? ? 1_555 J  DA 116 N1 ? ? I DT  -42 J DA 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? I DT  32  O4    ? ? ? 1_555 J  DA 116 N6 ? ? I DT  -42 J DA 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? I DG  33  N1    ? ? ? 1_555 J  DC 115 N3 ? ? I DG  -41 J DC 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? I DG  33  N2    ? ? ? 1_555 J  DC 115 O2 ? ? I DG  -41 J DC 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? I DG  33  O6    ? ? ? 1_555 J  DC 115 N4 ? ? I DG  -41 J DC 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? I DT  34  N3    ? ? ? 1_555 J  DA 114 N1 ? ? I DT  -40 J DA 40   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog78  hydrog ? ? I DA  35  N1    ? ? ? 1_555 J  DT 113 N3 ? ? I DA  -39 J DT 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? I DA  35  N6    ? ? ? 1_555 J  DT 113 O4 ? ? I DA  -39 J DT 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? I DT  36  N3    ? ? ? 1_555 J  DA 112 N1 ? ? I DT  -38 J DA 38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? I DT  36  O4    ? ? ? 1_555 J  DA 112 N6 ? ? I DT  -38 J DA 38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? I DT  37  N3    ? ? ? 1_555 J  DA 111 N1 ? ? I DT  -37 J DA 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? I DT  37  O4    ? ? ? 1_555 J  DA 111 N6 ? ? I DT  -37 J DA 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? I DT  38  N3    ? ? ? 1_555 J  DA 110 N1 ? ? I DT  -36 J DA 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? I DT  38  O4    ? ? ? 1_555 J  DA 110 N6 ? ? I DT  -36 J DA 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? I DG  39  N1    ? ? ? 1_555 J  DC 109 N3 ? ? I DG  -35 J DC 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? I DG  39  N2    ? ? ? 1_555 J  DC 109 O2 ? ? I DG  -35 J DC 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? I DG  39  O6    ? ? ? 1_555 J  DC 109 N4 ? ? I DG  -35 J DC 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? I DG  40  N1    ? ? ? 1_555 J  DC 108 N3 ? ? I DG  -34 J DC 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? I DG  40  N2    ? ? ? 1_555 J  DC 108 O2 ? ? I DG  -34 J DC 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? I DG  40  O6    ? ? ? 1_555 J  DC 108 N4 ? ? I DG  -34 J DC 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? I DA  41  N1    ? ? ? 1_555 J  DT 107 N3 ? ? I DA  -33 J DT 33   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog93  hydrog ? ? I DA  42  N1    ? ? ? 1_555 J  DT 106 N3 ? ? I DA  -32 J DT 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? I DA  42  N6    ? ? ? 1_555 J  DT 106 O4 ? ? I DA  -32 J DT 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? I DA  43  N1    ? ? ? 1_555 J  DT 105 N3 ? ? I DA  -31 J DT 31   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog96  hydrog ? ? I DC  44  O2    ? ? ? 1_555 J  DG 104 N2 ? ? I DC  -30 J DG 30   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog97  hydrog ? ? I DT  45  N3    ? ? ? 1_555 J  DA 103 N1 ? ? I DT  -29 J DA 29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? I DT  45  O4    ? ? ? 1_555 J  DA 103 N6 ? ? I DT  -29 J DA 29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? I DG  46  N1    ? ? ? 1_555 J  DC 102 N3 ? ? I DG  -28 J DC 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? I DG  46  N2    ? ? ? 1_555 J  DC 102 O2 ? ? I DG  -28 J DC 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? I DG  46  O6    ? ? ? 1_555 J  DC 102 N4 ? ? I DG  -28 J DC 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? I DC  47  N3    ? ? ? 1_555 J  DG 101 N1 ? ? I DC  -27 J DG 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? I DC  47  N4    ? ? ? 1_555 J  DG 101 O6 ? ? I DC  -27 J DG 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? I DC  47  O2    ? ? ? 1_555 J  DG 101 N2 ? ? I DC  -27 J DG 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? I DT  48  N3    ? ? ? 1_555 J  DA 100 N1 ? ? I DT  -26 J DA 26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? I DT  48  O4    ? ? ? 1_555 J  DA 100 N6 ? ? I DT  -26 J DA 26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? I DC  49  N3    ? ? ? 1_555 J  DG 99  N1 ? ? I DC  -25 J DG 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? I DC  49  N4    ? ? ? 1_555 J  DG 99  O6 ? ? I DC  -25 J DG 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? I DC  49  O2    ? ? ? 1_555 J  DG 99  N2 ? ? I DC  -25 J DG 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? I DC  50  N4    ? ? ? 1_555 J  DG 98  O6 ? ? I DC  -24 J DG 24   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog111 hydrog ? ? I DA  51  N1    ? ? ? 1_555 J  DT 97  N3 ? ? I DA  -23 J DT 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? I DA  51  N6    ? ? ? 1_555 J  DT 97  O4 ? ? I DA  -23 J DT 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? I DT  52  N3    ? ? ? 1_555 J  DA 96  N1 ? ? I DT  -22 J DA 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? I DT  52  O4    ? ? ? 1_555 J  DA 96  N6 ? ? I DT  -22 J DA 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? I DC  53  N3    ? ? ? 1_555 J  DG 95  N1 ? ? I DC  -21 J DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? I DC  53  N4    ? ? ? 1_555 J  DG 95  O6 ? ? I DC  -21 J DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? I DC  53  O2    ? ? ? 1_555 J  DG 95  N2 ? ? I DC  -21 J DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? I DA  54  N1    ? ? ? 1_555 J  DT 94  N3 ? ? I DA  -20 J DT 20   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog119 hydrog ? ? I DA  55  N1    ? ? ? 1_555 J  DT 93  N3 ? ? I DA  -19 J DT 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? I DA  55  N6    ? ? ? 1_555 J  DT 93  O4 ? ? I DA  -19 J DT 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? I DA  56  N1    ? ? ? 1_555 J  DT 92  N3 ? ? I DA  -18 J DT 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? I DA  56  N6    ? ? ? 1_555 J  DT 92  O4 ? ? I DA  -18 J DT 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? I DA  57  N1    ? ? ? 1_555 J  DT 91  N3 ? ? I DA  -17 J DT 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? I DA  57  N6    ? ? ? 1_555 J  DT 91  O4 ? ? I DA  -17 J DT 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? I DG  58  N1    ? ? ? 1_555 J  DC 90  N3 ? ? I DG  -16 J DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? I DG  58  N2    ? ? ? 1_555 J  DC 90  O2 ? ? I DG  -16 J DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? I DG  58  O6    ? ? ? 1_555 J  DC 90  N4 ? ? I DG  -16 J DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? I DG  59  N1    ? ? ? 1_555 J  DC 89  N3 ? ? I DG  -15 J DC 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? I DG  59  N2    ? ? ? 1_555 J  DC 89  O2 ? ? I DG  -15 J DC 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? I DG  59  O6    ? ? ? 1_555 J  DC 89  N4 ? ? I DG  -15 J DC 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? I DC  60  N3    ? ? ? 1_555 J  DG 88  N1 ? ? I DC  -14 J DG 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? I DC  60  N4    ? ? ? 1_555 J  DG 88  O6 ? ? I DC  -14 J DG 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? I DC  60  O2    ? ? ? 1_555 J  DG 88  N2 ? ? I DC  -14 J DG 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? I DA  61  N1    ? ? ? 1_555 J  DT 87  N3 ? ? I DA  -13 J DT 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? I DA  61  N6    ? ? ? 1_555 J  DT 87  O4 ? ? I DA  -13 J DT 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? I DT  62  N3    ? ? ? 1_555 J  DA 86  N1 ? ? I DT  -12 J DA 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? I DT  62  O4    ? ? ? 1_555 J  DA 86  N6 ? ? I DT  -12 J DA 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? I DG  63  N1    ? ? ? 1_555 J  DC 85  N3 ? ? I DG  -11 J DC 11   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog139 hydrog ? ? I DT  64  N3    ? ? ? 1_555 J  DA 84  N1 ? ? I DT  -10 J DA 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? I DT  64  O4    ? ? ? 1_555 J  DA 84  N6 ? ? I DT  -10 J DA 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? I DT  65  N3    ? ? ? 1_555 J  DA 83  N1 ? ? I DT  -9  J DA 9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? I DT  65  O4    ? ? ? 1_555 J  DA 83  N6 ? ? I DT  -9  J DA 9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? I DC  66  N3    ? ? ? 1_555 J  DG 82  N1 ? ? I DC  -8  J DG 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? I DC  66  N4    ? ? ? 1_555 J  DG 82  O6 ? ? I DC  -8  J DG 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? I DC  66  O2    ? ? ? 1_555 J  DG 82  N2 ? ? I DC  -8  J DG 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? I DA  67  N1    ? ? ? 1_555 J  DT 81  N3 ? ? I DA  -7  J DT 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? I DA  67  N6    ? ? ? 1_555 J  DT 81  O4 ? ? I DA  -7  J DT 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? I DG  68  N1    ? ? ? 1_555 J  DC 80  N3 ? ? I DG  -6  J DC 6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? I DG  68  N2    ? ? ? 1_555 J  DC 80  O2 ? ? I DG  -6  J DC 6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? I DG  68  O6    ? ? ? 1_555 J  DC 80  N4 ? ? I DG  -6  J DC 6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? I DC  69  N3    ? ? ? 1_555 J  DG 79  N1 ? ? I DC  -5  J DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? I DC  69  N4    ? ? ? 1_555 J  DG 79  O6 ? ? I DC  -5  J DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? I DC  69  O2    ? ? ? 1_555 J  DG 79  N2 ? ? I DC  -5  J DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? I DT  70  N3    ? ? ? 1_555 J  DA 78  N1 ? ? I DT  -4  J DA 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? I DT  70  O4    ? ? ? 1_555 J  DA 78  N6 ? ? I DT  -4  J DA 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? I DG  71  N1    ? ? ? 1_555 J  DC 77  N3 ? ? I DG  -3  J DC 3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? I DG  71  N2    ? ? ? 1_555 J  DC 77  O2 ? ? I DG  -3  J DC 3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? I DG  71  O6    ? ? ? 1_555 J  DC 77  N4 ? ? I DG  -3  J DC 3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? I DG  72  N1    ? ? ? 1_555 J  DC 76  N3 ? ? I DG  -2  J DC 2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? I DG  72  N2    ? ? ? 1_555 J  DC 76  O2 ? ? I DG  -2  J DC 2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? I DG  72  O6    ? ? ? 1_555 J  DC 76  N4 ? ? I DG  -2  J DC 2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? I DA  73  N1    ? ? ? 1_555 J  DT 75  N3 ? ? I DA  -1  J DT 1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? I DA  73  N6    ? ? ? 1_555 J  DT 75  O4 ? ? I DA  -1  J DT 1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? I DA  74  N1    ? ? ? 1_555 J  DT 74  N3 ? ? I DA  0   J DT 0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? I DA  74  N6    ? ? ? 1_555 J  DT 74  O4 ? ? I DA  0   J DT 0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? I DT  75  N3    ? ? ? 1_555 J  DA 73  N1 ? ? I DT  1   J DA -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? I DT  75  O4    ? ? ? 1_555 J  DA 73  N6 ? ? I DT  1   J DA -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? I DC  76  N3    ? ? ? 1_555 J  DG 72  N1 ? ? I DC  2   J DG -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? I DC  76  N4    ? ? ? 1_555 J  DG 72  O6 ? ? I DC  2   J DG -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? I DC  76  O2    ? ? ? 1_555 J  DG 72  N2 ? ? I DC  2   J DG -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? I DC  77  N3    ? ? ? 1_555 J  DG 71  N1 ? ? I DC  3   J DG -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? I DC  77  N4    ? ? ? 1_555 J  DG 71  O6 ? ? I DC  3   J DG -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? I DC  77  O2    ? ? ? 1_555 J  DG 71  N2 ? ? I DC  3   J DG -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? I DA  78  N1    ? ? ? 1_555 J  DT 70  N3 ? ? I DA  4   J DT -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? I DA  78  N6    ? ? ? 1_555 J  DT 70  O4 ? ? I DA  4   J DT -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? I DG  79  N1    ? ? ? 1_555 J  DC 69  N3 ? ? I DG  5   J DC -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? I DG  79  N2    ? ? ? 1_555 J  DC 69  O2 ? ? I DG  5   J DC -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? I DG  79  O6    ? ? ? 1_555 J  DC 69  N4 ? ? I DG  5   J DC -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? I DC  80  N3    ? ? ? 1_555 J  DG 68  N1 ? ? I DC  6   J DG -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? I DC  80  N4    ? ? ? 1_555 J  DG 68  O6 ? ? I DC  6   J DG -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? I DC  80  O2    ? ? ? 1_555 J  DG 68  N2 ? ? I DC  6   J DG -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog182 hydrog ? ? I DT  81  N3    ? ? ? 1_555 J  DA 67  N1 ? ? I DT  7   J DA -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ? ? I DT  81  O4    ? ? ? 1_555 J  DA 67  N6 ? ? I DT  7   J DA -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? I DG  82  N1    ? ? ? 1_555 J  DC 66  N3 ? ? I DG  8   J DC -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ? ? I DG  82  N2    ? ? ? 1_555 J  DC 66  O2 ? ? I DG  8   J DC -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? I DG  82  O6    ? ? ? 1_555 J  DC 66  N4 ? ? I DG  8   J DC -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ? ? I DA  83  N1    ? ? ? 1_555 J  DT 65  N3 ? ? I DA  9   J DT -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog188 hydrog ? ? I DA  83  N6    ? ? ? 1_555 J  DT 65  O4 ? ? I DA  9   J DT -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ? ? I DA  84  N1    ? ? ? 1_555 J  DT 64  N3 ? ? I DA  10  J DT -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog190 hydrog ? ? I DA  84  N6    ? ? ? 1_555 J  DT 64  O4 ? ? I DA  10  J DT -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog191 hydrog ? ? I DC  85  N3    ? ? ? 1_555 J  DG 63  N1 ? ? I DC  11  J DG -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog192 hydrog ? ? I DC  85  N4    ? ? ? 1_555 J  DG 63  O6 ? ? I DC  11  J DG -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ? ? I DC  85  O2    ? ? ? 1_555 J  DG 63  N2 ? ? I DC  11  J DG -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? I DA  86  N1    ? ? ? 1_555 J  DT 62  N3 ? ? I DA  12  J DT -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog195 hydrog ? ? I DA  86  N6    ? ? ? 1_555 J  DT 62  O4 ? ? I DA  12  J DT -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog196 hydrog ? ? I DT  87  N3    ? ? ? 1_555 J  DA 61  N1 ? ? I DT  13  J DA -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog197 hydrog ? ? I DT  87  O4    ? ? ? 1_555 J  DA 61  N6 ? ? I DT  13  J DA -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? I DG  88  N1    ? ? ? 1_555 J  DC 60  N3 ? ? I DG  14  J DC -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ? ? I DG  88  N2    ? ? ? 1_555 J  DC 60  O2 ? ? I DG  14  J DC -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog200 hydrog ? ? I DG  88  O6    ? ? ? 1_555 J  DC 60  N4 ? ? I DG  14  J DC -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog201 hydrog ? ? I DC  89  N3    ? ? ? 1_555 J  DG 59  N1 ? ? I DC  15  J DG -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog202 hydrog ? ? I DC  89  N4    ? ? ? 1_555 J  DG 59  O6 ? ? I DC  15  J DG -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog203 hydrog ? ? I DC  89  O2    ? ? ? 1_555 J  DG 59  N2 ? ? I DC  15  J DG -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ? ? I DC  90  N3    ? ? ? 1_555 J  DG 58  N1 ? ? I DC  16  J DG -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog205 hydrog ? ? I DC  90  N4    ? ? ? 1_555 J  DG 58  O6 ? ? I DC  16  J DG -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog206 hydrog ? ? I DC  90  O2    ? ? ? 1_555 J  DG 58  N2 ? ? I DC  16  J DG -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog207 hydrog ? ? I DT  91  O4    ? ? ? 1_555 J  DA 56  N6 ? ? I DT  17  J DA -18  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog208 hydrog ? ? I DT  91  N3    ? ? ? 1_555 J  DA 57  N1 ? ? I DT  17  J DA -17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog209 hydrog ? ? I DT  91  O4    ? ? ? 1_555 J  DA 57  N6 ? ? I DT  17  J DA -17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog210 hydrog ? ? I DT  92  N3    ? ? ? 1_555 J  DA 56  N1 ? ? I DT  18  J DA -18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog211 hydrog ? ? I DT  92  O4    ? ? ? 1_555 J  DA 56  N6 ? ? I DT  18  J DA -18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog212 hydrog ? ? I DT  93  N3    ? ? ? 1_555 J  DA 55  N1 ? ? I DT  19  J DA -19  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog213 hydrog ? ? I DT  94  N3    ? ? ? 1_555 J  DA 54  N1 ? ? I DT  20  J DA -20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog214 hydrog ? ? I DT  94  O4    ? ? ? 1_555 J  DA 54  N6 ? ? I DT  20  J DA -20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog215 hydrog ? ? I DG  95  N1    ? ? ? 1_555 J  DC 53  N3 ? ? I DG  21  J DC -21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog216 hydrog ? ? I DG  95  N2    ? ? ? 1_555 J  DC 53  O2 ? ? I DG  21  J DC -21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? I DG  95  O6    ? ? ? 1_555 J  DC 53  N4 ? ? I DG  21  J DC -21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? I DA  96  N1    ? ? ? 1_555 J  DT 52  N3 ? ? I DA  22  J DT -22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ? ? I DA  96  N6    ? ? ? 1_555 J  DT 52  O4 ? ? I DA  22  J DT -22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog220 hydrog ? ? I DT  97  N3    ? ? ? 1_555 J  DA 51  N1 ? ? I DT  23  J DA -23  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog221 hydrog ? ? I DG  98  N1    ? ? ? 1_555 J  DC 50  N3 ? ? I DG  24  J DC -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ? ? I DG  98  N2    ? ? ? 1_555 J  DC 50  O2 ? ? I DG  24  J DC -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog223 hydrog ? ? I DG  98  O6    ? ? ? 1_555 J  DC 50  N4 ? ? I DG  24  J DC -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? I DG  99  N1    ? ? ? 1_555 J  DC 49  N3 ? ? I DG  25  J DC -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? I DG  99  N2    ? ? ? 1_555 J  DC 49  O2 ? ? I DG  25  J DC -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? I DG  99  O6    ? ? ? 1_555 J  DC 49  N4 ? ? I DG  25  J DC -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? I DA  100 N6    ? ? ? 1_555 J  DC 47  N3 ? ? I DA  26  J DC -27  1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog228 hydrog ? ? I DA  100 N1    ? ? ? 1_555 J  DT 48  N3 ? ? I DA  26  J DT -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog229 hydrog ? ? I DA  100 N6    ? ? ? 1_555 J  DT 48  O4 ? ? I DA  26  J DT -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? I DG  101 N1    ? ? ? 1_555 J  DC 47  N3 ? ? I DG  27  J DC -27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog231 hydrog ? ? I DG  101 N2    ? ? ? 1_555 J  DC 47  O2 ? ? I DG  27  J DC -27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ? ? I DG  101 O6    ? ? ? 1_555 J  DC 47  N4 ? ? I DG  27  J DC -27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? I DC  102 N3    ? ? ? 1_555 J  DG 46  N1 ? ? I DC  28  J DG -28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ? ? I DC  102 N4    ? ? ? 1_555 J  DG 46  O6 ? ? I DC  28  J DG -28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog235 hydrog ? ? I DC  102 O2    ? ? ? 1_555 J  DG 46  N2 ? ? I DC  28  J DG -28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog236 hydrog ? ? I DA  103 N1    ? ? ? 1_555 J  DT 45  N3 ? ? I DA  29  J DT -29  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog237 hydrog ? ? I DG  104 N1    ? ? ? 1_555 J  DC 44  N3 ? ? I DG  30  J DC -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog238 hydrog ? ? I DG  104 N2    ? ? ? 1_555 J  DC 44  O2 ? ? I DG  30  J DC -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? I DG  104 O6    ? ? ? 1_555 J  DC 44  N4 ? ? I DG  30  J DC -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog240 hydrog ? ? I DT  105 N3    ? ? ? 1_555 J  DA 43  N1 ? ? I DT  31  J DA -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog241 hydrog ? ? I DT  105 O4    ? ? ? 1_555 J  DA 43  N6 ? ? I DT  31  J DA -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog242 hydrog ? ? I DT  106 N3    ? ? ? 1_555 J  DA 42  N1 ? ? I DT  32  J DA -32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ? ? I DT  106 O4    ? ? ? 1_555 J  DA 42  N6 ? ? I DT  32  J DA -32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ? ? I DT  107 N3    ? ? ? 1_555 J  DA 41  N1 ? ? I DT  33  J DA -33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? I DT  107 O4    ? ? ? 1_555 J  DA 41  N6 ? ? I DT  33  J DA -33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ? ? I DC  108 N3    ? ? ? 1_555 J  DG 40  N1 ? ? I DC  34  J DG -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? I DC  108 N4    ? ? ? 1_555 J  DG 40  O6 ? ? I DC  34  J DG -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? I DC  108 O2    ? ? ? 1_555 J  DG 40  N2 ? ? I DC  34  J DG -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ? ? I DC  109 N3    ? ? ? 1_555 J  DG 39  N1 ? ? I DC  35  J DG -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog250 hydrog ? ? I DC  109 N4    ? ? ? 1_555 J  DG 39  O6 ? ? I DC  35  J DG -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog251 hydrog ? ? I DC  109 O2    ? ? ? 1_555 J  DG 39  N2 ? ? I DC  35  J DG -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog252 hydrog ? ? I DA  110 N1    ? ? ? 1_555 J  DT 38  N3 ? ? I DA  36  J DT -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog253 hydrog ? ? I DA  110 N6    ? ? ? 1_555 J  DT 38  O4 ? ? I DA  36  J DT -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog254 hydrog ? ? I DA  111 N1    ? ? ? 1_555 J  DT 37  N3 ? ? I DA  37  J DT -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog255 hydrog ? ? I DA  111 N6    ? ? ? 1_555 J  DT 37  O4 ? ? I DA  37  J DT -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog256 hydrog ? ? I DA  112 N1    ? ? ? 1_555 J  DT 36  N3 ? ? I DA  38  J DT -38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog257 hydrog ? ? I DA  112 N6    ? ? ? 1_555 J  DT 36  O4 ? ? I DA  38  J DT -38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog258 hydrog ? ? I DT  113 N3    ? ? ? 1_555 J  DA 35  N1 ? ? I DT  39  J DA -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog259 hydrog ? ? I DT  113 O4    ? ? ? 1_555 J  DA 35  N6 ? ? I DT  39  J DA -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog260 hydrog ? ? I DA  114 N1    ? ? ? 1_555 J  DT 34  N3 ? ? I DA  40  J DT -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog261 hydrog ? ? I DA  114 N6    ? ? ? 1_555 J  DT 34  O4 ? ? I DA  40  J DT -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog262 hydrog ? ? I DC  115 N3    ? ? ? 1_555 J  DG 33  N1 ? ? I DC  41  J DG -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog263 hydrog ? ? I DC  115 N4    ? ? ? 1_555 J  DG 33  O6 ? ? I DC  41  J DG -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog264 hydrog ? ? I DC  115 O2    ? ? ? 1_555 J  DG 33  N2 ? ? I DC  41  J DG -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog265 hydrog ? ? I DA  116 N1    ? ? ? 1_555 J  DT 32  N3 ? ? I DA  42  J DT -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog266 hydrog ? ? I DA  116 N6    ? ? ? 1_555 J  DT 32  O4 ? ? I DA  42  J DT -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog267 hydrog ? ? I DC  117 N3    ? ? ? 1_555 J  DG 31  N1 ? ? I DC  43  J DG -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog268 hydrog ? ? I DC  117 N4    ? ? ? 1_555 J  DG 31  O6 ? ? I DC  43  J DG -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog269 hydrog ? ? I DC  117 O2    ? ? ? 1_555 J  DG 31  N2 ? ? I DC  43  J DG -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog270 hydrog ? ? I DT  118 N3    ? ? ? 1_555 J  DA 30  N1 ? ? I DT  44  J DA -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog271 hydrog ? ? I DT  118 O4    ? ? ? 1_555 J  DA 30  N6 ? ? I DT  44  J DA -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog272 hydrog ? ? I DT  119 N3    ? ? ? 1_555 J  DA 29  N1 ? ? I DT  45  J DA -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog273 hydrog ? ? I DT  119 O4    ? ? ? 1_555 J  DA 29  N6 ? ? I DT  45  J DA -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog274 hydrog ? ? I DT  120 N3    ? ? ? 1_555 J  DA 28  N1 ? ? I DT  46  J DA -46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog275 hydrog ? ? I DT  120 O4    ? ? ? 1_555 J  DA 28  N6 ? ? I DT  46  J DA -46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog276 hydrog ? ? I DT  121 N3    ? ? ? 1_555 J  DA 27  N1 ? ? I DT  47  J DA -47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog277 hydrog ? ? I DT  121 O4    ? ? ? 1_555 J  DA 27  N6 ? ? I DT  47  J DA -47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog278 hydrog ? ? I DG  122 N1    ? ? ? 1_555 J  DC 26  N3 ? ? I DG  48  J DC -48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog279 hydrog ? ? I DG  122 N2    ? ? ? 1_555 J  DC 26  O2 ? ? I DG  48  J DC -48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog280 hydrog ? ? I DG  122 O6    ? ? ? 1_555 J  DC 26  N4 ? ? I DG  48  J DC -48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog281 hydrog ? ? I DG  123 N1    ? ? ? 1_555 J  DC 25  N3 ? ? I DG  49  J DC -49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog282 hydrog ? ? I DG  123 N2    ? ? ? 1_555 J  DC 25  O2 ? ? I DG  49  J DC -49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog283 hydrog ? ? I DG  123 O6    ? ? ? 1_555 J  DC 25  N4 ? ? I DG  49  J DC -49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog284 hydrog ? ? I DT  124 N3    ? ? ? 1_555 J  DA 24  N1 ? ? I DT  50  J DA -50  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog285 hydrog ? ? I DA  125 N1    ? ? ? 1_555 J  DT 23  N3 ? ? I DA  51  J DT -51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog286 hydrog ? ? I DA  125 N6    ? ? ? 1_555 J  DT 23  O4 ? ? I DA  51  J DT -51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog287 hydrog ? ? I DG  126 N1    ? ? ? 1_555 J  DC 22  N3 ? ? I DG  52  J DC -52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog288 hydrog ? ? I DG  126 N2    ? ? ? 1_555 J  DC 22  O2 ? ? I DG  52  J DC -52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog289 hydrog ? ? I DG  126 O6    ? ? ? 1_555 J  DC 22  N4 ? ? I DG  52  J DC -52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog290 hydrog ? ? I DT  127 N3    ? ? ? 1_555 J  DA 21  N1 ? ? I DT  53  J DA -53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog291 hydrog ? ? I DT  127 O4    ? ? ? 1_555 J  DA 21  N6 ? ? I DT  53  J DA -53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog292 hydrog ? ? I DA  128 N1    ? ? ? 1_555 J  DT 20  N3 ? ? I DA  54  J DT -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog293 hydrog ? ? I DA  128 N6    ? ? ? 1_555 J  DT 20  O4 ? ? I DA  54  J DT -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog294 hydrog ? ? I DT  129 N3    ? ? ? 1_555 J  DA 19  N1 ? ? I DT  55  J DA -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog295 hydrog ? ? I DT  129 O4    ? ? ? 1_555 J  DA 19  N6 ? ? I DT  55  J DA -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog296 hydrog ? ? I DC  130 N3    ? ? ? 1_555 J  DG 18  N1 ? ? I DC  56  J DG -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog297 hydrog ? ? I DC  130 N4    ? ? ? 1_555 J  DG 18  O6 ? ? I DC  56  J DG -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog298 hydrog ? ? I DC  130 O2    ? ? ? 1_555 J  DG 18  N2 ? ? I DC  56  J DG -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog299 hydrog ? ? I DT  131 N3    ? ? ? 1_555 J  DA 17  N1 ? ? I DT  57  J DA -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog300 hydrog ? ? I DT  131 O4    ? ? ? 1_555 J  DA 17  N6 ? ? I DT  57  J DA -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog301 hydrog ? ? I DG  132 N1    ? ? ? 1_555 J  DC 16  N3 ? ? I DG  58  J DC -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog302 hydrog ? ? I DG  132 N2    ? ? ? 1_555 J  DC 16  O2 ? ? I DG  58  J DC -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog303 hydrog ? ? I DG  132 O6    ? ? ? 1_555 J  DC 16  N4 ? ? I DG  58  J DC -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog304 hydrog ? ? I DC  133 N3    ? ? ? 1_555 J  DG 15  N1 ? ? I DC  59  J DG -59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog305 hydrog ? ? I DC  133 N4    ? ? ? 1_555 J  DG 15  O6 ? ? I DC  59  J DG -59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog306 hydrog ? ? I DC  133 O2    ? ? ? 1_555 J  DG 15  N2 ? ? I DC  59  J DG -59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog307 hydrog ? ? I DA  134 N1    ? ? ? 1_555 J  DT 14  N3 ? ? I DA  60  J DT -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog308 hydrog ? ? I DA  134 N6    ? ? ? 1_555 J  DT 14  O4 ? ? I DA  60  J DT -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog309 hydrog ? ? I DG  135 N1    ? ? ? 1_555 J  DC 13  N3 ? ? I DG  61  J DC -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog310 hydrog ? ? I DG  135 N2    ? ? ? 1_555 J  DC 13  O2 ? ? I DG  61  J DC -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog311 hydrog ? ? I DG  135 O6    ? ? ? 1_555 J  DC 13  N4 ? ? I DG  61  J DC -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog312 hydrog ? ? I DG  136 N1    ? ? ? 1_555 J  DC 12  N3 ? ? I DG  62  J DC -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog313 hydrog ? ? I DG  136 N2    ? ? ? 1_555 J  DC 12  O2 ? ? I DG  62  J DC -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog314 hydrog ? ? I DG  136 O6    ? ? ? 1_555 J  DC 12  N4 ? ? I DG  62  J DC -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog315 hydrog ? ? I DT  137 N3    ? ? ? 1_555 J  DA 11  N1 ? ? I DT  63  J DA -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog316 hydrog ? ? I DT  137 O4    ? ? ? 1_555 J  DA 11  N6 ? ? I DT  63  J DA -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog317 hydrog ? ? I DG  138 N1    ? ? ? 1_555 J  DC 10  N3 ? ? I DG  64  J DC -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog318 hydrog ? ? I DG  138 N2    ? ? ? 1_555 J  DC 10  O2 ? ? I DG  64  J DC -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog319 hydrog ? ? I DG  138 O6    ? ? ? 1_555 J  DC 10  N4 ? ? I DG  64  J DC -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog320 hydrog ? ? I DG  139 N1    ? ? ? 1_555 J  DC 9   N3 ? ? I DG  65  J DC -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog321 hydrog ? ? I DG  139 N2    ? ? ? 1_555 J  DC 9   O2 ? ? I DG  65  J DC -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog322 hydrog ? ? I DG  139 O6    ? ? ? 1_555 J  DC 9   N4 ? ? I DG  65  J DC -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog323 hydrog ? ? I DA  140 N1    ? ? ? 1_555 J  DT 8   N3 ? ? I DA  66  J DT -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog324 hydrog ? ? I DA  140 N6    ? ? ? 1_555 J  DT 8   O4 ? ? I DA  66  J DT -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog325 hydrog ? ? I DT  141 N3    ? ? ? 1_555 J  DA 7   N1 ? ? I DT  67  J DA -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog326 hydrog ? ? I DT  141 O4    ? ? ? 1_555 J  DA 7   N6 ? ? I DT  67  J DA -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog327 hydrog ? ? I DA  142 N1    ? ? ? 1_555 J  DT 6   N3 ? ? I DA  68  J DT -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog328 hydrog ? ? I DA  142 N6    ? ? ? 1_555 J  DT 6   O4 ? ? I DA  68  J DT -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog329 hydrog ? ? I DT  143 N3    ? ? ? 1_555 J  DA 5   N1 ? ? I DT  69  J DA -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog330 hydrog ? ? I DT  143 O4    ? ? ? 1_555 J  DA 5   N6 ? ? I DT  69  J DA -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog331 hydrog ? ? I DT  144 N3    ? ? ? 1_555 J  DA 4   N1 ? ? I DT  70  J DA -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog332 hydrog ? ? I DT  144 O4    ? ? ? 1_555 J  DA 4   N6 ? ? I DT  70  J DA -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog333 hydrog ? ? I DG  145 N1    ? ? ? 1_555 J  DC 3   N3 ? ? I DG  71  J DC -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog334 hydrog ? ? I DG  145 N2    ? ? ? 1_555 J  DC 3   O2 ? ? I DG  71  J DC -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog335 hydrog ? ? I DG  145 O6    ? ? ? 1_555 J  DC 3   N4 ? ? I DG  71  J DC -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog336 hydrog ? ? I DA  146 N1    ? ? ? 1_555 J  DT 2   N3 ? ? I DA  72  J DT -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog337 hydrog ? ? I DA  146 N6    ? ? ? 1_555 J  DT 2   O4 ? ? I DA  72  J DT -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog338 hydrog ? ? I DT  147 N3    ? ? ? 1_555 J  DA 1   N1 ? ? I DT  73  J DA -73  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog339 hydrog ? ? I DT  147 O4    ? ? ? 1_555 J  DA 1   N6 ? ? I DT  73  J DA -73  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
C 1 2 ? parallel 
D 1 2 ? parallel 
E 1 2 ? parallel 
F 1 2 ? parallel 
G 1 2 ? parallel 
H 1 2 ? parallel 
I 1 2 ? parallel 
J 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 83  ? PHE A 84  ? ARG A 83  PHE A 84  
A 2 THR B 80  ? VAL B 81  ? THR B 80  VAL B 81  
B 1 THR A 118 ? ILE A 119 ? THR A 118 ILE A 119 
B 2 ARG B 45  ? ILE B 46  ? ARG B 45  ILE B 46  
C 1 THR B 96  ? TYR B 98  ? THR B 96  TYR B 98  
C 2 VAL G 100 ? ILE G 102 ? VAL G 100 ILE G 102 
D 1 ARG C 42  ? VAL C 43  ? ARG C 42  VAL C 43  
D 2 THR D 88  ? ILE D 89  ? THR D 85  ILE D 86  
E 1 ARG C 77  ? ILE C 78  ? ARG C 77  ILE C 78  
E 2 GLY D 53  ? ILE D 54  ? GLY D 50  ILE D 51  
F 1 VAL C 100 ? ILE C 102 ? VAL C 100 ILE C 102 
F 2 THR F 96  ? TYR F 98  ? THR F 96  TYR F 98  
G 1 ARG E 83  ? PHE E 84  ? ARG E 83  PHE E 84  
G 2 THR F 80  ? VAL F 81  ? THR F 80  VAL F 81  
H 1 THR E 118 ? ILE E 119 ? THR E 118 ILE E 119 
H 2 ARG F 45  ? ILE F 46  ? ARG F 45  ILE F 46  
I 1 ARG G 42  ? VAL G 43  ? ARG G 42  VAL G 43  
I 2 THR H 88  ? ILE H 89  ? THR H 85  ILE H 86  
J 1 ARG G 77  ? ILE G 78  ? ARG G 77  ILE G 78  
J 2 GLY H 53  ? ILE H 54  ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 83  ? N ARG A 83  O VAL B 81  ? O VAL B 81  
B 1 2 N ILE A 119 ? N ILE A 119 O ARG B 45  ? O ARG B 45  
C 1 2 N TYR B 98  ? N TYR B 98  O THR G 101 ? O THR G 101 
D 1 2 N ARG C 42  ? N ARG C 42  O ILE D 89  ? O ILE D 86  
E 1 2 N ILE C 78  ? N ILE C 78  O GLY D 53  ? O GLY D 50  
F 1 2 N THR C 101 ? N THR C 101 O TYR F 98  ? O TYR F 98  
G 1 2 N ARG E 83  ? N ARG E 83  O VAL F 81  ? O VAL F 81  
H 1 2 N ILE E 119 ? N ILE E 119 O ARG F 45  ? O ARG F 45  
I 1 2 N ARG G 42  ? N ARG G 42  O ILE H 89  ? O ILE H 86  
J 1 2 N ILE G 78  ? N ILE G 78  O GLY H 53  ? O GLY H 50  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CS I 74'   
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CS I 75'   
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CS H 123'  
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CS I 76'   
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CS I 77'   
AC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CS I 78'   
AC7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CS I 79'   
AC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CS C 120'  
AC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CS J 74'   
BC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CS I 80'   
BC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CS D 123'  
BC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CS J 75'   
BC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN J 3131' 
BC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN E 3132' 
BC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN J 3133' 
BC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN J 3134' 
BC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN J 3135' 
BC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN J 3136' 
CC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN I 3137' 
CC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN I 3138' 
CC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN J 3139' 
CC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN I 3140' 
CC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN I 3141' 
CC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN I 3142' 
CC7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN I 3143' 
CC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN J 3144' 
CC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL G 3145' 
DC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL C 3146' 
DC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A 3147' 
DC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL E 3148' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 DT  I  8   ? DT  I -66  . ? 1_555 ? 
2  AC1 4 DC  I  9   ? DC  I -65  . ? 1_555 ? 
3  AC1 4 DT  J  141 ? DT  J 67   . ? 1_555 ? 
4  AC1 4 DA  J  142 ? DA  J 68   . ? 1_555 ? 
5  AC2 5 DG  I  88  ? DG  I 14   . ? 1_555 ? 
6  AC2 5 DC  I  89  ? DC  I 15   . ? 1_555 ? 
7  AC2 5 DA  J  61  ? DA  J -13  . ? 1_555 ? 
8  AC2 5 CS  FA .   ? CS  J 74   . ? 1_555 ? 
9  AC2 5 MN  LA .   ? MN  J 3136 . ? 1_555 ? 
10 AC3 3 ARG H  99  ? ARG H 96   . ? 1_555 ? 
11 AC3 3 LEU H  100 ? LEU H 97   . ? 1_555 ? 
12 AC3 3 LEU H  102 ? LEU H 99   . ? 1_555 ? 
13 AC4 3 DC  I  49  ? DC  I -25  . ? 1_555 ? 
14 AC4 3 DT  I  48  ? DT  I -26  . ? 1_555 ? 
15 AC4 3 DA  J  100 ? DA  J 26   . ? 1_555 ? 
16 AC5 4 DT  I  141 ? DT  I 67   . ? 1_555 ? 
17 AC5 4 DA  I  142 ? DA  I 68   . ? 1_555 ? 
18 AC5 4 DC  J  9   ? DC  J -65  . ? 1_555 ? 
19 AC5 4 DT  J  8   ? DT  J -66  . ? 1_555 ? 
20 AC6 3 DC  I  89  ? DC  I 15   . ? 1_555 ? 
21 AC6 3 DC  I  90  ? DC  I 16   . ? 1_555 ? 
22 AC6 3 DG  J  59  ? DG  J -15  . ? 1_555 ? 
23 AC7 2 DC  I  85  ? DC  I 11   . ? 1_555 ? 
24 AC7 2 DT  J  64  ? DT  J -10  . ? 1_555 ? 
25 AC8 2 GLY C  37  ? GLY C 37   . ? 1_555 ? 
26 AC8 2 TYR C  39  ? TYR C 39   . ? 1_555 ? 
27 AC9 5 DT  I  87  ? DT  I 13   . ? 1_555 ? 
28 AC9 5 CS  T  .   ? CS  I 75   . ? 1_555 ? 
29 AC9 5 DA  J  61  ? DA  J -13  . ? 1_555 ? 
30 AC9 5 DT  J  62  ? DT  J -12  . ? 1_555 ? 
31 AC9 5 MN  LA .   ? MN  J 3136 . ? 1_555 ? 
32 BC1 2 DG  I  15  ? DG  I -59  . ? 1_555 ? 
33 BC1 2 DT  I  14  ? DT  I -60  . ? 1_555 ? 
34 BC2 3 ARG D  99  ? ARG D 96   . ? 1_555 ? 
35 BC2 3 LEU D  100 ? LEU D 97   . ? 1_555 ? 
36 BC2 3 LEU D  102 ? LEU D 99   . ? 1_555 ? 
37 BC3 2 DG  J  15  ? DG  J -59  . ? 1_555 ? 
38 BC3 2 DT  J  14  ? DT  J -60  . ? 1_555 ? 
39 BC4 1 DG  J  135 ? DG  J 61   . ? 1_555 ? 
40 BC5 2 VAL D  48  ? VAL D 45   . ? 3_545 ? 
41 BC5 2 ASP E  77  ? ASP E 77   . ? 1_555 ? 
42 BC6 2 DT  I  141 ? DT  I 67   . ? 3_455 ? 
43 BC6 2 DG  J  101 ? DG  J 27   . ? 1_555 ? 
44 BC7 1 DG  J  71  ? DG  J -3   . ? 1_555 ? 
45 BC8 1 DG  J  122 ? DG  J 48   . ? 1_555 ? 
46 BC9 2 CS  T  .   ? CS  I 75   . ? 1_555 ? 
47 BC9 2 CS  FA .   ? CS  J 74   . ? 1_555 ? 
48 CC1 1 DG  I  122 ? DG  I 48   . ? 1_555 ? 
49 CC2 1 DG  I  135 ? DG  I 61   . ? 1_555 ? 
50 CC3 2 DG  J  39  ? DG  J -35  . ? 1_555 ? 
51 CC3 2 DG  J  40  ? DG  J -34  . ? 1_555 ? 
52 CC4 1 DG  I  101 ? DG  I 27   . ? 1_555 ? 
53 CC5 1 DG  I  79  ? DG  I 5    . ? 1_555 ? 
54 CC6 2 DG  I  71  ? DG  I -3   . ? 1_555 ? 
55 CC6 2 DG  I  72  ? DG  I -2   . ? 1_555 ? 
56 CC7 2 DG  I  39  ? DG  I -35  . ? 1_555 ? 
57 CC7 2 DG  I  40  ? DG  I -34  . ? 1_555 ? 
58 CC8 2 DA  J  78  ? DA  J 4    . ? 1_555 ? 
59 CC8 2 DG  J  79  ? DG  J 5    . ? 1_555 ? 
60 CC9 5 GLY G  44  ? GLY G 44   . ? 1_555 ? 
61 CC9 5 ALA G  45  ? ALA G 45   . ? 1_555 ? 
62 CC9 5 GLY G  46  ? GLY G 46   . ? 1_555 ? 
63 CC9 5 ALA G  47  ? ALA G 47   . ? 1_555 ? 
64 CC9 5 SER H  91  ? SER H 88   . ? 1_555 ? 
65 DC1 4 GLY C  44  ? GLY C 44   . ? 1_555 ? 
66 DC1 4 GLY C  46  ? GLY C 46   . ? 1_555 ? 
67 DC1 4 THR D  90  ? THR D 87   . ? 1_555 ? 
68 DC1 4 SER D  91  ? SER D 88   . ? 1_555 ? 
69 DC2 3 MET A  120 ? MET A 120  . ? 1_555 ? 
70 DC2 3 PRO A  121 ? PRO A 121  . ? 1_555 ? 
71 DC2 3 LYS A  122 ? LYS A 122  . ? 1_555 ? 
72 DC3 2 PRO E  121 ? PRO E 121  . ? 1_555 ? 
73 DC3 2 LYS E  122 ? LYS E 122  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3MGS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3MGS 
_atom_sites.fract_transf_matrix[1][1]   0.009389 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009118 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005476 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
CS 
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . LYS A  1 37  ? -59.541 -30.343 85.473 1.00 89.89  ? 37   LYS A N     1 
ATOM   2     C  CA    . LYS A  1 37  ? -58.777 -29.354 84.661 1.00 89.99  ? 37   LYS A CA    1 
ATOM   3     C  C     . LYS A  1 37  ? -59.247 -29.347 83.195 1.00 89.86  ? 37   LYS A C     1 
ATOM   4     O  O     . LYS A  1 37  ? -59.746 -30.366 82.691 1.00 89.85  ? 37   LYS A O     1 
ATOM   5     C  CB    . LYS A  1 37  ? -57.275 -29.665 84.725 1.00 90.03  ? 37   LYS A CB    1 
ATOM   6     C  CG    . LYS A  1 37  ? -56.739 -29.959 86.127 1.00 90.48  ? 37   LYS A CG    1 
ATOM   7     C  CD    . LYS A  1 37  ? -56.065 -28.742 86.766 1.00 90.77  ? 37   LYS A CD    1 
ATOM   8     C  CE    . LYS A  1 37  ? -55.786 -29.006 88.245 1.00 90.83  ? 37   LYS A CE    1 
ATOM   9     N  NZ    . LYS A  1 37  ? -54.626 -28.239 88.784 1.00 90.69  ? 37   LYS A NZ    1 
ATOM   10    N  N     . PRO A  1 38  ? -59.116 -28.187 82.509 1.00 89.59  ? 38   PRO A N     1 
ATOM   11    C  CA    . PRO A  1 38  ? -59.179 -28.220 81.041 1.00 89.08  ? 38   PRO A CA    1 
ATOM   12    C  C     . PRO A  1 38  ? -57.871 -28.818 80.508 1.00 88.47  ? 38   PRO A C     1 
ATOM   13    O  O     . PRO A  1 38  ? -56.900 -28.957 81.265 1.00 88.75  ? 38   PRO A O     1 
ATOM   14    C  CB    . PRO A  1 38  ? -59.299 -26.735 80.649 1.00 89.11  ? 38   PRO A CB    1 
ATOM   15    C  CG    . PRO A  1 38  ? -59.541 -25.981 81.941 1.00 89.31  ? 38   PRO A CG    1 
ATOM   16    C  CD    . PRO A  1 38  ? -58.929 -26.816 83.019 1.00 89.52  ? 38   PRO A CD    1 
ATOM   17    N  N     . HIS A  1 39  ? -57.836 -29.161 79.226 1.00 87.47  ? 39   HIS A N     1 
ATOM   18    C  CA    . HIS A  1 39  ? -56.707 -29.913 78.674 1.00 86.28  ? 39   HIS A CA    1 
ATOM   19    C  C     . HIS A  1 39  ? -55.642 -29.055 77.998 1.00 84.95  ? 39   HIS A C     1 
ATOM   20    O  O     . HIS A  1 39  ? -55.928 -28.315 77.045 1.00 84.93  ? 39   HIS A O     1 
ATOM   21    C  CB    . HIS A  1 39  ? -57.211 -30.965 77.688 1.00 86.84  ? 39   HIS A CB    1 
ATOM   22    C  CG    . HIS A  1 39  ? -56.128 -31.543 76.836 1.00 87.83  ? 39   HIS A CG    1 
ATOM   23    N  ND1   . HIS A  1 39  ? -55.698 -30.934 75.669 1.00 88.22  ? 39   HIS A ND1   1 
ATOM   24    C  CD2   . HIS A  1 39  ? -55.377 -32.664 76.986 1.00 88.68  ? 39   HIS A CD2   1 
ATOM   25    C  CE1   . HIS A  1 39  ? -54.733 -31.662 75.135 1.00 89.01  ? 39   HIS A CE1   1 
ATOM   26    N  NE2   . HIS A  1 39  ? -54.521 -32.718 75.912 1.00 89.13  ? 39   HIS A NE2   1 
ATOM   27    N  N     . ARG A  1 40  ? -54.408 -29.202 78.476 1.00 83.10  ? 40   ARG A N     1 
ATOM   28    C  CA    . ARG A  1 40  ? -53.265 -28.491 77.911 1.00 81.26  ? 40   ARG A CA    1 
ATOM   29    C  C     . ARG A  1 40  ? -52.140 -29.441 77.511 1.00 80.26  ? 40   ARG A C     1 
ATOM   30    O  O     . ARG A  1 40  ? -51.828 -30.394 78.240 1.00 80.31  ? 40   ARG A O     1 
ATOM   31    C  CB    . ARG A  1 40  ? -52.727 -27.463 78.908 1.00 81.35  ? 40   ARG A CB    1 
ATOM   32    C  CG    . ARG A  1 40  ? -53.452 -26.132 78.894 1.00 80.85  ? 40   ARG A CG    1 
ATOM   33    C  CD    . ARG A  1 40  ? -52.861 -25.161 79.917 1.00 80.75  ? 40   ARG A CD    1 
ATOM   34    N  NE    . ARG A  1 40  ? -51.646 -24.493 79.453 1.00 78.70  ? 40   ARG A NE    1 
ATOM   35    C  CZ    . ARG A  1 40  ? -51.632 -23.425 78.659 1.00 78.20  ? 40   ARG A CZ    1 
ATOM   36    N  NH1   . ARG A  1 40  ? -52.770 -22.902 78.215 1.00 77.84  ? 40   ARG A NH1   1 
ATOM   37    N  NH2   . ARG A  1 40  ? -50.476 -22.886 78.298 1.00 77.64  ? 40   ARG A NH2   1 
ATOM   38    N  N     . TYR A  1 41  ? -51.525 -29.165 76.360 1.00 78.60  ? 41   TYR A N     1 
ATOM   39    C  CA    . TYR A  1 41  ? -50.356 -29.917 75.901 1.00 76.97  ? 41   TYR A CA    1 
ATOM   40    C  C     . TYR A  1 41  ? -49.044 -29.331 76.453 1.00 75.95  ? 41   TYR A C     1 
ATOM   41    O  O     . TYR A  1 41  ? -48.885 -28.106 76.523 1.00 75.68  ? 41   TYR A O     1 
ATOM   42    C  CB    . TYR A  1 41  ? -50.318 -29.955 74.375 1.00 76.83  ? 41   TYR A CB    1 
ATOM   43    C  CG    . TYR A  1 41  ? -51.280 -30.933 73.720 1.00 76.39  ? 41   TYR A CG    1 
ATOM   44    C  CD1   . TYR A  1 41  ? -52.278 -30.483 72.855 1.00 75.54  ? 41   TYR A CD1   1 
ATOM   45    C  CD2   . TYR A  1 41  ? -51.165 -32.313 73.937 1.00 76.36  ? 41   TYR A CD2   1 
ATOM   46    C  CE1   . TYR A  1 41  ? -53.149 -31.372 72.231 1.00 75.70  ? 41   TYR A CE1   1 
ATOM   47    C  CE2   . TYR A  1 41  ? -52.034 -33.214 73.325 1.00 76.13  ? 41   TYR A CE2   1 
ATOM   48    C  CZ    . TYR A  1 41  ? -53.027 -32.735 72.474 1.00 76.31  ? 41   TYR A CZ    1 
ATOM   49    O  OH    . TYR A  1 41  ? -53.894 -33.617 71.865 1.00 76.49  ? 41   TYR A OH    1 
ATOM   50    N  N     . ARG A  1 42  ? -48.109 -30.203 76.840 1.00 74.60  ? 42   ARG A N     1 
ATOM   51    C  CA    . ARG A  1 42  ? -46.832 -29.757 77.417 1.00 73.57  ? 42   ARG A CA    1 
ATOM   52    C  C     . ARG A  1 42  ? -46.086 -28.834 76.441 1.00 72.37  ? 42   ARG A C     1 
ATOM   53    O  O     . ARG A  1 42  ? -46.193 -28.992 75.223 1.00 72.39  ? 42   ARG A O     1 
ATOM   54    C  CB    . ARG A  1 42  ? -45.936 -30.944 77.828 1.00 73.85  ? 42   ARG A CB    1 
ATOM   55    C  CG    . ARG A  1 42  ? -46.607 -32.071 78.644 1.00 75.46  ? 42   ARG A CG    1 
ATOM   56    C  CD    . ARG A  1 42  ? -46.458 -31.954 80.176 1.00 79.00  ? 42   ARG A CD    1 
ATOM   57    N  NE    . ARG A  1 42  ? -46.777 -30.614 80.700 1.00 83.83  ? 42   ARG A NE    1 
ATOM   58    C  CZ    . ARG A  1 42  ? -48.006 -30.082 80.833 1.00 86.32  ? 42   ARG A CZ    1 
ATOM   59    N  NH1   . ARG A  1 42  ? -49.104 -30.758 80.477 1.00 87.43  ? 42   ARG A NH1   1 
ATOM   60    N  NH2   . ARG A  1 42  ? -48.146 -28.843 81.322 1.00 86.95  ? 42   ARG A NH2   1 
ATOM   61    N  N     . PRO A  1 43  ? -45.326 -27.860 76.967 1.00 71.14  ? 43   PRO A N     1 
ATOM   62    C  CA    . PRO A  1 43  ? -44.614 -27.026 76.019 1.00 69.96  ? 43   PRO A CA    1 
ATOM   63    C  C     . PRO A  1 43  ? -43.664 -27.890 75.223 1.00 68.72  ? 43   PRO A C     1 
ATOM   64    O  O     . PRO A  1 43  ? -43.014 -28.767 75.783 1.00 68.50  ? 43   PRO A O     1 
ATOM   65    C  CB    . PRO A  1 43  ? -43.839 -26.060 76.914 1.00 70.07  ? 43   PRO A CB    1 
ATOM   66    C  CG    . PRO A  1 43  ? -44.575 -26.054 78.202 1.00 70.52  ? 43   PRO A CG    1 
ATOM   67    C  CD    . PRO A  1 43  ? -45.046 -27.463 78.357 1.00 71.16  ? 43   PRO A CD    1 
ATOM   68    N  N     . GLY A  1 44  ? -43.616 -27.660 73.921 1.00 67.71  ? 44   GLY A N     1 
ATOM   69    C  CA    . GLY A  1 44  ? -42.767 -28.441 73.035 1.00 66.42  ? 44   GLY A CA    1 
ATOM   70    C  C     . GLY A  1 44  ? -43.554 -29.508 72.301 1.00 65.51  ? 44   GLY A C     1 
ATOM   71    O  O     . GLY A  1 44  ? -43.108 -30.013 71.267 1.00 65.54  ? 44   GLY A O     1 
ATOM   72    N  N     . THR A  1 45  ? -44.731 -29.851 72.815 1.00 64.34  ? 45   THR A N     1 
ATOM   73    C  CA    . THR A  1 45  ? -45.495 -30.914 72.196 1.00 63.30  ? 45   THR A CA    1 
ATOM   74    C  C     . THR A  1 45  ? -46.081 -30.460 70.879 1.00 62.75  ? 45   THR A C     1 
ATOM   75    O  O     . THR A  1 45  ? -46.006 -31.186 69.891 1.00 62.92  ? 45   THR A O     1 
ATOM   76    C  CB    . THR A  1 45  ? -46.552 -31.512 73.136 1.00 63.29  ? 45   THR A CB    1 
ATOM   77    O  OG1   . THR A  1 45  ? -45.891 -32.338 74.094 1.00 62.79  ? 45   THR A OG1   1 
ATOM   78    C  CG2   . THR A  1 45  ? -47.536 -32.383 72.383 1.00 63.36  ? 45   THR A CG2   1 
ATOM   79    N  N     . VAL A  1 46  ? -46.638 -29.259 70.839 1.00 62.04  ? 46   VAL A N     1 
ATOM   80    C  CA    . VAL A  1 46  ? -47.201 -28.796 69.579 1.00 61.50  ? 46   VAL A CA    1 
ATOM   81    C  C     . VAL A  1 46  ? -46.102 -28.463 68.589 1.00 61.19  ? 46   VAL A C     1 
ATOM   82    O  O     . VAL A  1 46  ? -46.245 -28.734 67.390 1.00 61.37  ? 46   VAL A O     1 
ATOM   83    C  CB    . VAL A  1 46  ? -48.154 -27.614 69.717 1.00 61.32  ? 46   VAL A CB    1 
ATOM   84    C  CG1   . VAL A  1 46  ? -49.017 -27.521 68.470 1.00 60.96  ? 46   VAL A CG1   1 
ATOM   85    C  CG2   . VAL A  1 46  ? -49.029 -27.796 70.925 1.00 61.64  ? 46   VAL A CG2   1 
ATOM   86    N  N     . ALA A  1 47  ? -45.007 -27.888 69.087 1.00 60.56  ? 47   ALA A N     1 
ATOM   87    C  CA    . ALA A  1 47  ? -43.881 -27.535 68.228 1.00 59.88  ? 47   ALA A CA    1 
ATOM   88    C  C     . ALA A  1 47  ? -43.453 -28.763 67.435 1.00 59.63  ? 47   ALA A C     1 
ATOM   89    O  O     . ALA A  1 47  ? -43.418 -28.710 66.199 1.00 59.83  ? 47   ALA A O     1 
ATOM   90    C  CB    . ALA A  1 47  ? -42.738 -26.974 69.028 1.00 59.77  ? 47   ALA A CB    1 
ATOM   91    N  N     . LEU A  1 48  ? -43.179 -29.873 68.132 1.00 58.92  ? 48   LEU A N     1 
ATOM   92    C  CA    . LEU A  1 48  ? -42.912 -31.153 67.470 1.00 58.40  ? 48   LEU A CA    1 
ATOM   93    C  C     . LEU A  1 48  ? -43.932 -31.482 66.364 1.00 58.04  ? 48   LEU A C     1 
ATOM   94    O  O     . LEU A  1 48  ? -43.570 -31.825 65.237 1.00 57.84  ? 48   LEU A O     1 
ATOM   95    C  CB    . LEU A  1 48  ? -42.869 -32.284 68.490 1.00 58.12  ? 48   LEU A CB    1 
ATOM   96    C  CG    . LEU A  1 48  ? -41.504 -32.852 68.908 1.00 59.12  ? 48   LEU A CG    1 
ATOM   97    C  CD1   . LEU A  1 48  ? -40.394 -32.552 67.889 1.00 59.88  ? 48   LEU A CD1   1 
ATOM   98    C  CD2   . LEU A  1 48  ? -41.087 -32.316 70.293 1.00 60.58  ? 48   LEU A CD2   1 
ATOM   99    N  N     . ARG A  1 49  ? -45.206 -31.343 66.707 1.00 57.78  ? 49   ARG A N     1 
ATOM   100   C  CA    . ARG A  1 49  ? -46.319 -31.653 65.825 1.00 57.47  ? 49   ARG A CA    1 
ATOM   101   C  C     . ARG A  1 49  ? -46.322 -30.752 64.593 1.00 56.71  ? 49   ARG A C     1 
ATOM   102   O  O     . ARG A  1 49  ? -46.772 -31.149 63.517 1.00 56.58  ? 49   ARG A O     1 
ATOM   103   C  CB    . ARG A  1 49  ? -47.618 -31.498 66.618 1.00 57.81  ? 49   ARG A CB    1 
ATOM   104   C  CG    . ARG A  1 49  ? -48.865 -32.059 65.965 1.00 58.96  ? 49   ARG A CG    1 
ATOM   105   C  CD    . ARG A  1 49  ? -49.916 -32.377 67.023 1.00 60.88  ? 49   ARG A CD    1 
ATOM   106   N  NE    . ARG A  1 49  ? -50.549 -31.176 67.565 1.00 62.81  ? 49   ARG A NE    1 
ATOM   107   C  CZ    . ARG A  1 49  ? -50.885 -31.018 68.846 1.00 64.27  ? 49   ARG A CZ    1 
ATOM   108   N  NH1   . ARG A  1 49  ? -50.635 -31.981 69.741 1.00 63.72  ? 49   ARG A NH1   1 
ATOM   109   N  NH2   . ARG A  1 49  ? -51.455 -29.883 69.239 1.00 64.92  ? 49   ARG A NH2   1 
ATOM   110   N  N     . GLU A  1 50  ? -45.810 -29.542 64.759 1.00 55.95  ? 50   GLU A N     1 
ATOM   111   C  CA    . GLU A  1 50  ? -45.726 -28.602 63.655 1.00 55.76  ? 50   GLU A CA    1 
ATOM   112   C  C     . GLU A  1 50  ? -44.539 -28.917 62.752 1.00 54.90  ? 50   GLU A C     1 
ATOM   113   O  O     . GLU A  1 50  ? -44.662 -28.886 61.523 1.00 54.64  ? 50   GLU A O     1 
ATOM   114   C  CB    . GLU A  1 50  ? -45.643 -27.170 64.171 1.00 55.61  ? 50   GLU A CB    1 
ATOM   115   C  CG    . GLU A  1 50  ? -46.883 -26.704 64.894 1.00 56.33  ? 50   GLU A CG    1 
ATOM   116   C  CD    . GLU A  1 50  ? -46.721 -25.337 65.539 1.00 57.35  ? 50   GLU A CD    1 
ATOM   117   O  OE1   . GLU A  1 50  ? -45.588 -24.806 65.623 1.00 60.42  ? 50   GLU A OE1   1 
ATOM   118   O  OE2   . GLU A  1 50  ? -47.745 -24.778 65.976 1.00 60.35  ? 50   GLU A OE2   1 
ATOM   119   N  N     . ILE A  1 51  ? -43.393 -29.222 63.359 1.00 54.21  ? 51   ILE A N     1 
ATOM   120   C  CA    . ILE A  1 51  ? -42.234 -29.660 62.594 1.00 53.38  ? 51   ILE A CA    1 
ATOM   121   C  C     . ILE A  1 51  ? -42.649 -30.825 61.720 1.00 53.26  ? 51   ILE A C     1 
ATOM   122   O  O     . ILE A  1 51  ? -42.356 -30.843 60.533 1.00 53.15  ? 51   ILE A O     1 
ATOM   123   C  CB    . ILE A  1 51  ? -41.052 -30.106 63.475 1.00 53.33  ? 51   ILE A CB    1 
ATOM   124   C  CG1   . ILE A  1 51  ? -40.504 -28.937 64.295 1.00 53.12  ? 51   ILE A CG1   1 
ATOM   125   C  CG2   . ILE A  1 51  ? -39.946 -30.676 62.606 1.00 52.64  ? 51   ILE A CG2   1 
ATOM   126   C  CD1   . ILE A  1 51  ? -39.446 -29.339 65.321 1.00 52.83  ? 51   ILE A CD1   1 
ATOM   127   N  N     . ARG A  1 52  ? -43.352 -31.787 62.308 1.00 53.31  ? 52   ARG A N     1 
ATOM   128   C  CA    . ARG A  1 52  ? -43.765 -32.969 61.568 1.00 53.47  ? 52   ARG A CA    1 
ATOM   129   C  C     . ARG A  1 52  ? -44.724 -32.591 60.452 1.00 53.19  ? 52   ARG A C     1 
ATOM   130   O  O     . ARG A  1 52  ? -44.664 -33.137 59.347 1.00 53.04  ? 52   ARG A O     1 
ATOM   131   C  CB    . ARG A  1 52  ? -44.364 -34.024 62.495 1.00 53.38  ? 52   ARG A CB    1 
ATOM   132   C  CG    . ARG A  1 52  ? -43.323 -34.759 63.315 1.00 55.26  ? 52   ARG A CG    1 
ATOM   133   C  CD    . ARG A  1 52  ? -43.923 -35.957 64.074 1.00 59.85  ? 52   ARG A CD    1 
ATOM   134   N  NE    . ARG A  1 52  ? -42.919 -36.663 64.885 1.00 63.09  ? 52   ARG A NE    1 
ATOM   135   C  CZ    . ARG A  1 52  ? -42.680 -36.432 66.178 1.00 64.27  ? 52   ARG A CZ    1 
ATOM   136   N  NH1   . ARG A  1 52  ? -43.372 -35.516 66.844 1.00 65.46  ? 52   ARG A NH1   1 
ATOM   137   N  NH2   . ARG A  1 52  ? -41.740 -37.119 66.811 1.00 65.30  ? 52   ARG A NH2   1 
ATOM   138   N  N     . ARG A  1 53  ? -45.584 -31.626 60.730 1.00 53.16  ? 53   ARG A N     1 
ATOM   139   C  CA    . ARG A  1 53  ? -46.556 -31.215 59.745 1.00 53.55  ? 53   ARG A CA    1 
ATOM   140   C  C     . ARG A  1 53  ? -45.916 -30.468 58.574 1.00 53.19  ? 53   ARG A C     1 
ATOM   141   O  O     . ARG A  1 53  ? -46.191 -30.757 57.400 1.00 53.29  ? 53   ARG A O     1 
ATOM   142   C  CB    . ARG A  1 53  ? -47.634 -30.378 60.405 1.00 53.81  ? 53   ARG A CB    1 
ATOM   143   C  CG    . ARG A  1 53  ? -48.521 -29.635 59.447 1.00 55.61  ? 53   ARG A CG    1 
ATOM   144   C  CD    . ARG A  1 53  ? -49.430 -28.782 60.262 1.00 59.81  ? 53   ARG A CD    1 
ATOM   145   N  NE    . ARG A  1 53  ? -50.167 -27.814 59.466 1.00 63.64  ? 53   ARG A NE    1 
ATOM   146   C  CZ    . ARG A  1 53  ? -50.788 -26.762 59.994 1.00 66.45  ? 53   ARG A CZ    1 
ATOM   147   N  NH1   . ARG A  1 53  ? -50.735 -26.555 61.313 1.00 67.66  ? 53   ARG A NH1   1 
ATOM   148   N  NH2   . ARG A  1 53  ? -51.456 -25.914 59.215 1.00 67.10  ? 53   ARG A NH2   1 
ATOM   149   N  N     . TYR A  1 54  ? -45.054 -29.516 58.893 1.00 52.69  ? 54   TYR A N     1 
ATOM   150   C  CA    . TYR A  1 54  ? -44.474 -28.688 57.858 1.00 52.18  ? 54   TYR A CA    1 
ATOM   151   C  C     . TYR A  1 54  ? -43.335 -29.335 57.066 1.00 51.84  ? 54   TYR A C     1 
ATOM   152   O  O     . TYR A  1 54  ? -43.046 -28.906 55.949 1.00 52.19  ? 54   TYR A O     1 
ATOM   153   C  CB    . TYR A  1 54  ? -44.065 -27.340 58.430 1.00 52.23  ? 54   TYR A CB    1 
ATOM   154   C  CG    . TYR A  1 54  ? -45.249 -26.497 58.831 1.00 52.21  ? 54   TYR A CG    1 
ATOM   155   C  CD1   . TYR A  1 54  ? -45.404 -26.063 60.143 1.00 52.68  ? 54   TYR A CD1   1 
ATOM   156   C  CD2   . TYR A  1 54  ? -46.219 -26.138 57.901 1.00 52.28  ? 54   TYR A CD2   1 
ATOM   157   C  CE1   . TYR A  1 54  ? -46.493 -25.281 60.523 1.00 52.70  ? 54   TYR A CE1   1 
ATOM   158   C  CE2   . TYR A  1 54  ? -47.314 -25.359 58.273 1.00 52.64  ? 54   TYR A CE2   1 
ATOM   159   C  CZ    . TYR A  1 54  ? -47.443 -24.940 59.584 1.00 52.43  ? 54   TYR A CZ    1 
ATOM   160   O  OH    . TYR A  1 54  ? -48.524 -24.181 59.959 1.00 52.34  ? 54   TYR A OH    1 
ATOM   161   N  N     . GLN A  1 55  ? -42.687 -30.356 57.613 1.00 51.17  ? 55   GLN A N     1 
ATOM   162   C  CA    . GLN A  1 55  ? -41.668 -31.055 56.836 1.00 50.86  ? 55   GLN A CA    1 
ATOM   163   C  C     . GLN A  1 55  ? -42.334 -31.954 55.797 1.00 51.28  ? 55   GLN A C     1 
ATOM   164   O  O     . GLN A  1 55  ? -41.714 -32.403 54.831 1.00 51.26  ? 55   GLN A O     1 
ATOM   165   C  CB    . GLN A  1 55  ? -40.680 -31.795 57.739 1.00 50.26  ? 55   GLN A CB    1 
ATOM   166   C  CG    . GLN A  1 55  ? -39.896 -30.817 58.596 1.00 49.18  ? 55   GLN A CG    1 
ATOM   167   C  CD    . GLN A  1 55  ? -38.669 -31.398 59.263 1.00 47.76  ? 55   GLN A CD    1 
ATOM   168   O  OE1   . GLN A  1 55  ? -38.502 -32.606 59.362 1.00 48.10  ? 55   GLN A OE1   1 
ATOM   169   N  NE2   . GLN A  1 55  ? -37.806 -30.524 59.740 1.00 46.68  ? 55   GLN A NE2   1 
ATOM   170   N  N     . LYS A  1 56  ? -43.630 -32.156 55.988 1.00 51.78  ? 56   LYS A N     1 
ATOM   171   C  CA    . LYS A  1 56  ? -44.390 -33.081 55.184 1.00 52.25  ? 56   LYS A CA    1 
ATOM   172   C  C     . LYS A  1 56  ? -45.013 -32.364 54.018 1.00 51.96  ? 56   LYS A C     1 
ATOM   173   O  O     . LYS A  1 56  ? -45.064 -32.908 52.929 1.00 52.12  ? 56   LYS A O     1 
ATOM   174   C  CB    . LYS A  1 56  ? -45.463 -33.738 56.033 1.00 52.67  ? 56   LYS A CB    1 
ATOM   175   C  CG    . LYS A  1 56  ? -45.773 -35.140 55.607 1.00 55.07  ? 56   LYS A CG    1 
ATOM   176   C  CD    . LYS A  1 56  ? -45.768 -36.090 56.809 1.00 59.75  ? 56   LYS A CD    1 
ATOM   177   C  CE    . LYS A  1 56  ? -46.970 -35.855 57.757 1.00 61.74  ? 56   LYS A CE    1 
ATOM   178   N  NZ    . LYS A  1 56  ? -47.223 -37.042 58.658 1.00 62.92  ? 56   LYS A NZ    1 
ATOM   179   N  N     . SER A  1 57  ? -45.479 -31.139 54.245 1.00 51.70  ? 57   SER A N     1 
ATOM   180   C  CA    . SER A  1 57  ? -46.034 -30.313 53.173 1.00 51.47  ? 57   SER A CA    1 
ATOM   181   C  C     . SER A  1 57  ? -44.958 -29.537 52.396 1.00 51.41  ? 57   SER A C     1 
ATOM   182   O  O     . SER A  1 57  ? -43.767 -29.583 52.743 1.00 51.91  ? 57   SER A O     1 
ATOM   183   C  CB    . SER A  1 57  ? -47.054 -29.346 53.755 1.00 51.54  ? 57   SER A CB    1 
ATOM   184   O  OG    . SER A  1 57  ? -46.431 -28.368 54.574 1.00 51.57  ? 57   SER A OG    1 
ATOM   185   N  N     . THR A  1 58  ? -45.376 -28.831 51.343 1.00 51.05  ? 58   THR A N     1 
ATOM   186   C  CA    . THR A  1 58  ? -44.460 -28.015 50.527 1.00 50.33  ? 58   THR A CA    1 
ATOM   187   C  C     . THR A  1 58  ? -44.999 -26.627 50.212 1.00 50.51  ? 58   THR A C     1 
ATOM   188   O  O     . THR A  1 58  ? -44.372 -25.866 49.491 1.00 50.33  ? 58   THR A O     1 
ATOM   189   C  CB    . THR A  1 58  ? -44.084 -28.689 49.183 1.00 49.94  ? 58   THR A CB    1 
ATOM   190   O  OG1   . THR A  1 58  ? -45.159 -28.551 48.259 1.00 48.27  ? 58   THR A OG1   1 
ATOM   191   C  CG2   . THR A  1 58  ? -43.748 -30.140 49.363 1.00 49.32  ? 58   THR A CG2   1 
ATOM   192   N  N     . GLU A  1 59  ? -46.169 -26.304 50.739 1.00 51.13  ? 59   GLU A N     1 
ATOM   193   C  CA    . GLU A  1 59  ? -46.789 -25.016 50.454 1.00 51.84  ? 59   GLU A CA    1 
ATOM   194   C  C     . GLU A  1 59  ? -45.950 -23.910 51.085 1.00 51.87  ? 59   GLU A C     1 
ATOM   195   O  O     . GLU A  1 59  ? -45.359 -24.112 52.148 1.00 51.68  ? 59   GLU A O     1 
ATOM   196   C  CB    . GLU A  1 59  ? -48.256 -24.982 50.940 1.00 52.03  ? 59   GLU A CB    1 
ATOM   197   C  CG    . GLU A  1 59  ? -48.499 -24.618 52.419 1.00 53.07  ? 59   GLU A CG    1 
ATOM   198   C  CD    . GLU A  1 59  ? -48.088 -25.711 53.386 1.00 55.37  ? 59   GLU A CD    1 
ATOM   199   O  OE1   . GLU A  1 59  ? -47.994 -25.428 54.604 1.00 56.45  ? 59   GLU A OE1   1 
ATOM   200   O  OE2   . GLU A  1 59  ? -47.852 -26.854 52.936 1.00 55.62  ? 59   GLU A OE2   1 
ATOM   201   N  N     . LEU A  1 60  ? -45.875 -22.764 50.409 1.00 51.97  ? 60   LEU A N     1 
ATOM   202   C  CA    . LEU A  1 60  ? -45.142 -21.618 50.936 1.00 52.24  ? 60   LEU A CA    1 
ATOM   203   C  C     . LEU A  1 60  ? -45.770 -21.142 52.245 1.00 52.33  ? 60   LEU A C     1 
ATOM   204   O  O     . LEU A  1 60  ? -46.954 -21.363 52.481 1.00 52.29  ? 60   LEU A O     1 
ATOM   205   C  CB    . LEU A  1 60  ? -45.062 -20.490 49.906 1.00 52.41  ? 60   LEU A CB    1 
ATOM   206   C  CG    . LEU A  1 60  ? -44.291 -20.779 48.617 1.00 52.98  ? 60   LEU A CG    1 
ATOM   207   C  CD1   . LEU A  1 60  ? -44.384 -19.634 47.645 1.00 53.69  ? 60   LEU A CD1   1 
ATOM   208   C  CD2   . LEU A  1 60  ? -42.846 -21.072 48.903 1.00 54.26  ? 60   LEU A CD2   1 
ATOM   209   N  N     . LEU A  1 61  ? -44.970 -20.504 53.092 1.00 52.56  ? 61   LEU A N     1 
ATOM   210   C  CA    . LEU A  1 61  ? -45.352 -20.300 54.479 1.00 53.26  ? 61   LEU A CA    1 
ATOM   211   C  C     . LEU A  1 61  ? -45.489 -18.834 54.860 1.00 54.12  ? 61   LEU A C     1 
ATOM   212   O  O     . LEU A  1 61  ? -45.929 -18.506 55.977 1.00 54.21  ? 61   LEU A O     1 
ATOM   213   C  CB    . LEU A  1 61  ? -44.367 -21.002 55.411 1.00 53.14  ? 61   LEU A CB    1 
ATOM   214   C  CG    . LEU A  1 61  ? -44.125 -22.492 55.178 1.00 53.25  ? 61   LEU A CG    1 
ATOM   215   C  CD1   . LEU A  1 61  ? -43.168 -23.042 56.217 1.00 52.98  ? 61   LEU A CD1   1 
ATOM   216   C  CD2   . LEU A  1 61  ? -45.431 -23.284 55.167 1.00 53.25  ? 61   LEU A CD2   1 
ATOM   217   N  N     . ILE A  1 62  ? -45.111 -17.952 53.937 1.00 54.80  ? 62   ILE A N     1 
ATOM   218   C  CA    . ILE A  1 62  ? -45.350 -16.527 54.109 1.00 55.33  ? 62   ILE A CA    1 
ATOM   219   C  C     . ILE A  1 62  ? -46.584 -16.154 53.301 1.00 56.00  ? 62   ILE A C     1 
ATOM   220   O  O     . ILE A  1 62  ? -46.749 -16.600 52.165 1.00 55.86  ? 62   ILE A O     1 
ATOM   221   C  CB    . ILE A  1 62  ? -44.137 -15.680 53.659 1.00 55.22  ? 62   ILE A CB    1 
ATOM   222   C  CG1   . ILE A  1 62  ? -42.875 -16.129 54.378 1.00 54.73  ? 62   ILE A CG1   1 
ATOM   223   C  CG2   . ILE A  1 62  ? -44.363 -14.195 53.935 1.00 55.33  ? 62   ILE A CG2   1 
ATOM   224   C  CD1   . ILE A  1 62  ? -41.631 -15.572 53.778 1.00 54.88  ? 62   ILE A CD1   1 
ATOM   225   N  N     . ARG A  1 63  ? -47.453 -15.351 53.904 1.00 57.06  ? 63   ARG A N     1 
ATOM   226   C  CA    . ARG A  1 63  ? -48.611 -14.781 53.207 1.00 58.18  ? 63   ARG A CA    1 
ATOM   227   C  C     . ARG A  1 63  ? -48.174 -14.038 51.925 1.00 58.06  ? 63   ARG A C     1 
ATOM   228   O  O     . ARG A  1 63  ? -47.292 -13.179 51.959 1.00 58.10  ? 63   ARG A O     1 
ATOM   229   C  CB    . ARG A  1 63  ? -49.398 -13.846 54.151 1.00 58.72  ? 63   ARG A CB    1 
ATOM   230   C  CG    . ARG A  1 63  ? -49.740 -14.424 55.538 1.00 60.69  ? 63   ARG A CG    1 
ATOM   231   C  CD    . ARG A  1 63  ? -49.291 -13.433 56.631 1.00 65.29  ? 63   ARG A CD    1 
ATOM   232   N  NE    . ARG A  1 63  ? -50.388 -12.633 57.203 1.00 67.67  ? 63   ARG A NE    1 
ATOM   233   C  CZ    . ARG A  1 63  ? -50.341 -11.321 57.468 1.00 67.69  ? 63   ARG A CZ    1 
ATOM   234   N  NH1   . ARG A  1 63  ? -49.266 -10.588 57.174 1.00 67.95  ? 63   ARG A NH1   1 
ATOM   235   N  NH2   . ARG A  1 63  ? -51.397 -10.730 58.006 1.00 67.42  ? 63   ARG A NH2   1 
ATOM   236   N  N     . LYS A  1 64  ? -48.812 -14.381 50.809 1.00 58.28  ? 64   LYS A N     1 
ATOM   237   C  CA    . LYS A  1 64  ? -48.396 -13.962 49.466 1.00 58.90  ? 64   LYS A CA    1 
ATOM   238   C  C     . LYS A  1 64  ? -48.239 -12.458 49.241 1.00 58.62  ? 64   LYS A C     1 
ATOM   239   O  O     . LYS A  1 64  ? -47.255 -12.013 48.652 1.00 59.12  ? 64   LYS A O     1 
ATOM   240   C  CB    . LYS A  1 64  ? -49.347 -14.551 48.419 1.00 58.83  ? 64   LYS A CB    1 
ATOM   241   C  CG    . LYS A  1 64  ? -48.880 -14.373 46.973 1.00 59.97  ? 64   LYS A CG    1 
ATOM   242   C  CD    . LYS A  1 64  ? -49.905 -14.941 45.962 1.00 60.25  ? 64   LYS A CD    1 
ATOM   243   C  CE    . LYS A  1 64  ? -50.001 -14.086 44.664 1.00 62.08  ? 64   LYS A CE    1 
ATOM   244   N  NZ    . LYS A  1 64  ? -50.270 -12.604 44.869 1.00 61.73  ? 64   LYS A NZ    1 
ATOM   245   N  N     . LEU A  1 65  ? -49.204 -11.681 49.706 1.00 58.49  ? 65   LEU A N     1 
ATOM   246   C  CA    . LEU A  1 65  ? -49.220 -10.248 49.443 1.00 58.27  ? 65   LEU A CA    1 
ATOM   247   C  C     . LEU A  1 65  ? -48.221 -9.448  50.280 1.00 58.10  ? 65   LEU A C     1 
ATOM   248   O  O     . LEU A  1 65  ? -47.485 -8.642  49.712 1.00 58.32  ? 65   LEU A O     1 
ATOM   249   C  CB    . LEU A  1 65  ? -50.637 -9.677  49.603 1.00 58.68  ? 65   LEU A CB    1 
ATOM   250   C  CG    . LEU A  1 65  ? -50.851 -8.166  49.458 1.00 58.38  ? 65   LEU A CG    1 
ATOM   251   C  CD1   . LEU A  1 65  ? -50.895 -7.790  47.979 1.00 57.83  ? 65   LEU A CD1   1 
ATOM   252   C  CD2   . LEU A  1 65  ? -52.120 -7.756  50.192 1.00 57.97  ? 65   LEU A CD2   1 
ATOM   253   N  N     . PRO A  1 66  ? -48.194 -9.645  51.619 1.00 57.74  ? 66   PRO A N     1 
ATOM   254   C  CA    . PRO A  1 66  ? -47.212 -8.903  52.400 1.00 57.77  ? 66   PRO A CA    1 
ATOM   255   C  C     . PRO A  1 66  ? -45.838 -9.071  51.778 1.00 58.14  ? 66   PRO A C     1 
ATOM   256   O  O     . PRO A  1 66  ? -45.034 -8.134  51.791 1.00 58.15  ? 66   PRO A O     1 
ATOM   257   C  CB    . PRO A  1 66  ? -47.237 -9.604  53.756 1.00 57.59  ? 66   PRO A CB    1 
ATOM   258   C  CG    . PRO A  1 66  ? -48.548 -10.187 53.854 1.00 57.52  ? 66   PRO A CG    1 
ATOM   259   C  CD    . PRO A  1 66  ? -49.003 -10.528 52.473 1.00 57.58  ? 66   PRO A CD    1 
ATOM   260   N  N     . PHE A  1 67  ? -45.593 -10.264 51.225 1.00 58.39  ? 67   PHE A N     1 
ATOM   261   C  CA    . PHE A  1 67  ? -44.348 -10.571 50.541 1.00 58.49  ? 67   PHE A CA    1 
ATOM   262   C  C     . PHE A  1 67  ? -44.208 -9.786  49.254 1.00 58.54  ? 67   PHE A C     1 
ATOM   263   O  O     . PHE A  1 67  ? -43.148 -9.206  49.001 1.00 58.71  ? 67   PHE A O     1 
ATOM   264   C  CB    . PHE A  1 67  ? -44.239 -12.058 50.231 1.00 58.67  ? 67   PHE A CB    1 
ATOM   265   C  CG    . PHE A  1 67  ? -42.908 -12.453 49.645 1.00 59.22  ? 67   PHE A CG    1 
ATOM   266   C  CD1   . PHE A  1 67  ? -41.851 -12.809 50.468 1.00 59.12  ? 67   PHE A CD1   1 
ATOM   267   C  CD2   . PHE A  1 67  ? -42.709 -12.463 48.269 1.00 59.96  ? 67   PHE A CD2   1 
ATOM   268   C  CE1   . PHE A  1 67  ? -40.628 -13.169 49.931 1.00 59.14  ? 67   PHE A CE1   1 
ATOM   269   C  CE2   . PHE A  1 67  ? -41.477 -12.825 47.729 1.00 59.60  ? 67   PHE A CE2   1 
ATOM   270   C  CZ    . PHE A  1 67  ? -40.442 -13.176 48.562 1.00 58.91  ? 67   PHE A CZ    1 
ATOM   271   N  N     . GLN A  1 68  ? -45.263 -9.784  48.436 1.00 58.37  ? 68   GLN A N     1 
ATOM   272   C  CA    . GLN A  1 68  ? -45.257 -9.023  47.190 1.00 58.26  ? 68   GLN A CA    1 
ATOM   273   C  C     . GLN A  1 68  ? -44.987 -7.542  47.462 1.00 57.77  ? 68   GLN A C     1 
ATOM   274   O  O     . GLN A  1 68  ? -44.247 -6.882  46.719 1.00 57.57  ? 68   GLN A O     1 
ATOM   275   C  CB    . GLN A  1 68  ? -46.566 -9.200  46.432 1.00 58.45  ? 68   GLN A CB    1 
ATOM   276   C  CG    . GLN A  1 68  ? -46.371 -9.061  44.923 1.00 60.58  ? 68   GLN A CG    1 
ATOM   277   C  CD    . GLN A  1 68  ? -47.662 -9.222  44.147 1.00 62.86  ? 68   GLN A CD    1 
ATOM   278   O  OE1   . GLN A  1 68  ? -48.628 -8.497  44.396 1.00 65.44  ? 68   GLN A OE1   1 
ATOM   279   N  NE2   . GLN A  1 68  ? -47.683 -10.160 43.190 1.00 62.49  ? 68   GLN A NE2   1 
ATOM   280   N  N     . ARG A  1 69  ? -45.581 -7.042  48.543 1.00 57.13  ? 69   ARG A N     1 
ATOM   281   C  CA    . ARG A  1 69  ? -45.327 -5.696  49.010 1.00 56.81  ? 69   ARG A CA    1 
ATOM   282   C  C     . ARG A  1 69  ? -43.848 -5.506  49.276 1.00 55.99  ? 69   ARG A C     1 
ATOM   283   O  O     . ARG A  1 69  ? -43.230 -4.578  48.768 1.00 55.93  ? 69   ARG A O     1 
ATOM   284   C  CB    . ARG A  1 69  ? -46.132 -5.392  50.281 1.00 57.48  ? 69   ARG A CB    1 
ATOM   285   C  CG    . ARG A  1 69  ? -47.471 -4.681  50.040 1.00 58.89  ? 69   ARG A CG    1 
ATOM   286   C  CD    . ARG A  1 69  ? -47.903 -3.847  51.257 1.00 60.83  ? 69   ARG A CD    1 
ATOM   287   N  NE    . ARG A  1 69  ? -48.366 -4.671  52.378 1.00 63.43  ? 69   ARG A NE    1 
ATOM   288   C  CZ    . ARG A  1 69  ? -49.539 -5.318  52.422 1.00 64.92  ? 69   ARG A CZ    1 
ATOM   289   N  NH1   . ARG A  1 69  ? -50.391 -5.260  51.400 1.00 65.05  ? 69   ARG A NH1   1 
ATOM   290   N  NH2   . ARG A  1 69  ? -49.867 -6.039  53.495 1.00 65.01  ? 69   ARG A NH2   1 
ATOM   291   N  N     . LEU A  1 70  ? -43.277 -6.402  50.066 1.00 55.26  ? 70   LEU A N     1 
ATOM   292   C  CA    . LEU A  1 70  ? -41.872 -6.294  50.421 1.00 54.54  ? 70   LEU A CA    1 
ATOM   293   C  C     . LEU A  1 70  ? -40.977 -6.284  49.189 1.00 54.29  ? 70   LEU A C     1 
ATOM   294   O  O     . LEU A  1 70  ? -40.087 -5.447  49.088 1.00 54.64  ? 70   LEU A O     1 
ATOM   295   C  CB    . LEU A  1 70  ? -41.462 -7.418  51.365 1.00 54.16  ? 70   LEU A CB    1 
ATOM   296   C  CG    . LEU A  1 70  ? -40.027 -7.352  51.852 1.00 52.90  ? 70   LEU A CG    1 
ATOM   297   C  CD1   . LEU A  1 70  ? -39.770 -6.041  52.538 1.00 52.47  ? 70   LEU A CD1   1 
ATOM   298   C  CD2   . LEU A  1 70  ? -39.800 -8.494  52.787 1.00 52.59  ? 70   LEU A CD2   1 
ATOM   299   N  N     . VAL A  1 71  ? -41.227 -7.197  48.255 1.00 53.60  ? 71   VAL A N     1 
ATOM   300   C  CA    . VAL A  1 71  ? -40.435 -7.284  47.038 1.00 53.33  ? 71   VAL A CA    1 
ATOM   301   C  C     . VAL A  1 71  ? -40.404 -5.951  46.305 1.00 53.46  ? 71   VAL A C     1 
ATOM   302   O  O     . VAL A  1 71  ? -39.335 -5.427  45.988 1.00 53.19  ? 71   VAL A O     1 
ATOM   303   C  CB    . VAL A  1 71  ? -40.989 -8.358  46.100 1.00 53.35  ? 71   VAL A CB    1 
ATOM   304   C  CG1   . VAL A  1 71  ? -40.298 -8.292  44.745 1.00 53.46  ? 71   VAL A CG1   1 
ATOM   305   C  CG2   . VAL A  1 71  ? -40.820 -9.731  46.712 1.00 53.07  ? 71   VAL A CG2   1 
ATOM   306   N  N     . ARG A  1 72  ? -41.594 -5.409  46.058 1.00 53.92  ? 72   ARG A N     1 
ATOM   307   C  CA    . ARG A  1 72  ? -41.765 -4.148  45.336 1.00 53.93  ? 72   ARG A CA    1 
ATOM   308   C  C     . ARG A  1 72  ? -41.052 -2.964  45.988 1.00 53.75  ? 72   ARG A C     1 
ATOM   309   O  O     . ARG A  1 72  ? -40.416 -2.173  45.297 1.00 53.52  ? 72   ARG A O     1 
ATOM   310   C  CB    . ARG A  1 72  ? -43.245 -3.855  45.163 1.00 53.86  ? 72   ARG A CB    1 
ATOM   311   C  CG    . ARG A  1 72  ? -43.876 -4.738  44.135 1.00 54.72  ? 72   ARG A CG    1 
ATOM   312   C  CD    . ARG A  1 72  ? -45.378 -4.536  44.062 1.00 56.88  ? 72   ARG A CD    1 
ATOM   313   N  NE    . ARG A  1 72  ? -46.002 -5.704  43.450 1.00 58.25  ? 72   ARG A NE    1 
ATOM   314   C  CZ    . ARG A  1 72  ? -46.135 -5.873  42.141 1.00 59.07  ? 72   ARG A CZ    1 
ATOM   315   N  NH1   . ARG A  1 72  ? -45.713 -4.937  41.303 1.00 59.63  ? 72   ARG A NH1   1 
ATOM   316   N  NH2   . ARG A  1 72  ? -46.698 -6.976  41.671 1.00 59.64  ? 72   ARG A NH2   1 
ATOM   317   N  N     . GLU A  1 73  ? -41.145 -2.860  47.310 1.00 53.69  ? 73   GLU A N     1 
ATOM   318   C  CA    . GLU A  1 73  ? -40.507 -1.777  48.038 1.00 54.04  ? 73   GLU A CA    1 
ATOM   319   C  C     . GLU A  1 73  ? -38.989 -1.801  47.874 1.00 54.28  ? 73   GLU A C     1 
ATOM   320   O  O     . GLU A  1 73  ? -38.378 -0.755  47.610 1.00 54.75  ? 73   GLU A O     1 
ATOM   321   C  CB    . GLU A  1 73  ? -40.885 -1.823  49.514 1.00 54.20  ? 73   GLU A CB    1 
ATOM   322   C  CG    . GLU A  1 73  ? -40.185 -0.783  50.374 1.00 55.20  ? 73   GLU A CG    1 
ATOM   323   C  CD    . GLU A  1 73  ? -40.109 -1.205  51.832 1.00 57.69  ? 73   GLU A CD    1 
ATOM   324   O  OE1   . GLU A  1 73  ? -41.181 -1.397  52.452 1.00 58.32  ? 73   GLU A OE1   1 
ATOM   325   O  OE2   . GLU A  1 73  ? -38.977 -1.350  52.357 1.00 58.63  ? 73   GLU A OE2   1 
ATOM   326   N  N     . ILE A  1 74  ? -38.388 -2.983  48.023 1.00 54.04  ? 74   ILE A N     1 
ATOM   327   C  CA    . ILE A  1 74  ? -36.940 -3.135  47.881 1.00 53.84  ? 74   ILE A CA    1 
ATOM   328   C  C     . ILE A  1 74  ? -36.516 -2.752  46.471 1.00 54.00  ? 74   ILE A C     1 
ATOM   329   O  O     . ILE A  1 74  ? -35.520 -2.063  46.286 1.00 53.68  ? 74   ILE A O     1 
ATOM   330   C  CB    . ILE A  1 74  ? -36.482 -4.576  48.203 1.00 53.70  ? 74   ILE A CB    1 
ATOM   331   C  CG1   . ILE A  1 74  ? -36.499 -4.824  49.708 1.00 53.34  ? 74   ILE A CG1   1 
ATOM   332   C  CG2   . ILE A  1 74  ? -35.086 -4.837  47.692 1.00 53.75  ? 74   ILE A CG2   1 
ATOM   333   C  CD1   . ILE A  1 74  ? -36.521 -6.288  50.085 1.00 51.71  ? 74   ILE A CD1   1 
ATOM   334   N  N     . ALA A  1 75  ? -37.300 -3.184  45.490 1.00 54.58  ? 75   ALA A N     1 
ATOM   335   C  CA    . ALA A  1 75  ? -36.981 -2.970  44.082 1.00 55.67  ? 75   ALA A CA    1 
ATOM   336   C  C     . ALA A  1 75  ? -36.974 -1.500  43.723 1.00 56.58  ? 75   ALA A C     1 
ATOM   337   O  O     . ALA A  1 75  ? -36.120 -1.039  42.959 1.00 56.34  ? 75   ALA A O     1 
ATOM   338   C  CB    . ALA A  1 75  ? -37.967 -3.701  43.212 1.00 55.55  ? 75   ALA A CB    1 
ATOM   339   N  N     . GLN A  1 76  ? -37.942 -0.785  44.297 1.00 57.91  ? 76   GLN A N     1 
ATOM   340   C  CA    . GLN A  1 76  ? -38.153 0.634   44.070 1.00 59.01  ? 76   GLN A CA    1 
ATOM   341   C  C     . GLN A  1 76  ? -36.878 1.403   44.377 1.00 59.60  ? 76   GLN A C     1 
ATOM   342   O  O     . GLN A  1 76  ? -36.606 2.413   43.737 1.00 60.15  ? 76   GLN A O     1 
ATOM   343   C  CB    . GLN A  1 76  ? -39.334 1.132   44.918 1.00 59.15  ? 76   GLN A CB    1 
ATOM   344   C  CG    . GLN A  1 76  ? -39.731 2.616   44.758 1.00 60.76  ? 76   GLN A CG    1 
ATOM   345   C  CD    . GLN A  1 76  ? -40.563 2.938   43.498 1.00 62.80  ? 76   GLN A CD    1 
ATOM   346   O  OE1   . GLN A  1 76  ? -40.610 2.169   42.527 1.00 64.04  ? 76   GLN A OE1   1 
ATOM   347   N  NE2   . GLN A  1 76  ? -41.205 4.102   43.514 1.00 63.31  ? 76   GLN A NE2   1 
ATOM   348   N  N     . ASP A  1 77  ? -36.083 0.912   45.327 1.00 60.03  ? 77   ASP A N     1 
ATOM   349   C  CA    . ASP A  1 77  ? -34.776 1.507   45.593 1.00 60.51  ? 77   ASP A CA    1 
ATOM   350   C  C     . ASP A  1 77  ? -33.832 1.394   44.407 1.00 60.25  ? 77   ASP A C     1 
ATOM   351   O  O     . ASP A  1 77  ? -32.925 2.197   44.287 1.00 60.64  ? 77   ASP A O     1 
ATOM   352   C  CB    . ASP A  1 77  ? -34.102 0.876   46.811 1.00 61.04  ? 77   ASP A CB    1 
ATOM   353   C  CG    . ASP A  1 77  ? -34.947 0.971   48.073 1.00 63.35  ? 77   ASP A CG    1 
ATOM   354   O  OD1   . ASP A  1 77  ? -35.141 -0.086  48.732 1.00 65.58  ? 77   ASP A OD1   1 
ATOM   355   O  OD2   . ASP A  1 77  ? -35.411 2.091   48.408 1.00 65.64  ? 77   ASP A OD2   1 
ATOM   356   N  N     . PHE A  1 78  ? -34.020 0.408   43.537 1.00 59.93  ? 78   PHE A N     1 
ATOM   357   C  CA    . PHE A  1 78  ? -33.055 0.198   42.459 1.00 59.99  ? 78   PHE A CA    1 
ATOM   358   C  C     . PHE A  1 78  ? -33.516 0.808   41.151 1.00 60.27  ? 78   PHE A C     1 
ATOM   359   O  O     . PHE A  1 78  ? -32.706 1.261   40.344 1.00 60.35  ? 78   PHE A O     1 
ATOM   360   C  CB    . PHE A  1 78  ? -32.742 -1.289  42.266 1.00 59.71  ? 78   PHE A CB    1 
ATOM   361   C  CG    . PHE A  1 78  ? -32.279 -1.977  43.515 1.00 59.54  ? 78   PHE A CG    1 
ATOM   362   C  CD1   . PHE A  1 78  ? -33.000 -3.046  44.039 1.00 58.42  ? 78   PHE A CD1   1 
ATOM   363   C  CD2   . PHE A  1 78  ? -31.129 -1.548  44.182 1.00 59.14  ? 78   PHE A CD2   1 
ATOM   364   C  CE1   . PHE A  1 78  ? -32.581 -3.677  45.201 1.00 58.10  ? 78   PHE A CE1   1 
ATOM   365   C  CE2   . PHE A  1 78  ? -30.702 -2.179  45.348 1.00 58.26  ? 78   PHE A CE2   1 
ATOM   366   C  CZ    . PHE A  1 78  ? -31.428 -3.243  45.857 1.00 58.49  ? 78   PHE A CZ    1 
ATOM   367   N  N     . LYS A  1 79  ? -34.822 0.778   40.934 1.00 60.70  ? 79   LYS A N     1 
ATOM   368   C  CA    . LYS A  1 79  ? -35.431 1.393   39.768 1.00 61.15  ? 79   LYS A CA    1 
ATOM   369   C  C     . LYS A  1 79  ? -36.897 1.642   40.066 1.00 61.53  ? 79   LYS A C     1 
ATOM   370   O  O     . LYS A  1 79  ? -37.543 0.868   40.788 1.00 61.80  ? 79   LYS A O     1 
ATOM   371   C  CB    . LYS A  1 79  ? -35.275 0.520   38.536 1.00 60.87  ? 79   LYS A CB    1 
ATOM   372   C  CG    . LYS A  1 79  ? -35.554 1.258   37.265 1.00 62.10  ? 79   LYS A CG    1 
ATOM   373   C  CD    . LYS A  1 79  ? -35.460 0.336   36.064 1.00 64.00  ? 79   LYS A CD    1 
ATOM   374   C  CE    . LYS A  1 79  ? -36.007 0.993   34.794 1.00 65.45  ? 79   LYS A CE    1 
ATOM   375   N  NZ    . LYS A  1 79  ? -35.383 2.323   34.506 1.00 67.12  ? 79   LYS A NZ    1 
ATOM   376   N  N     . THR A  1 80  ? -37.422 2.737   39.528 1.00 61.90  ? 80   THR A N     1 
ATOM   377   C  CA    . THR A  1 80  ? -38.797 3.118   39.833 1.00 61.93  ? 80   THR A CA    1 
ATOM   378   C  C     . THR A  1 80  ? -39.738 2.827   38.696 1.00 61.90  ? 80   THR A C     1 
ATOM   379   O  O     . THR A  1 80  ? -39.326 2.716   37.528 1.00 61.27  ? 80   THR A O     1 
ATOM   380   C  CB    . THR A  1 80  ? -38.923 4.589   40.202 1.00 61.91  ? 80   THR A CB    1 
ATOM   381   O  OG1   . THR A  1 80  ? -38.435 5.391   39.120 1.00 61.92  ? 80   THR A OG1   1 
ATOM   382   C  CG2   . THR A  1 80  ? -38.135 4.881   41.476 1.00 61.90  ? 80   THR A CG2   1 
ATOM   383   N  N     . ASP A  1 81  ? -41.009 2.706   39.076 1.00 62.26  ? 81   ASP A N     1 
ATOM   384   C  CA    . ASP A  1 81  ? -42.101 2.391   38.155 1.00 62.67  ? 81   ASP A CA    1 
ATOM   385   C  C     . ASP A  1 81  ? -41.897 0.998   37.552 1.00 62.46  ? 81   ASP A C     1 
ATOM   386   O  O     . ASP A  1 81  ? -41.926 0.806   36.329 1.00 62.59  ? 81   ASP A O     1 
ATOM   387   C  CB    . ASP A  1 81  ? -42.217 3.469   37.067 1.00 62.80  ? 81   ASP A CB    1 
ATOM   388   C  CG    . ASP A  1 81  ? -43.552 3.442   36.358 1.00 63.52  ? 81   ASP A CG    1 
ATOM   389   O  OD1   . ASP A  1 81  ? -44.512 2.795   36.876 1.00 62.96  ? 81   ASP A OD1   1 
ATOM   390   O  OD2   . ASP A  1 81  ? -43.622 4.082   35.279 1.00 64.39  ? 81   ASP A OD2   1 
ATOM   391   N  N     . LEU A  1 82  ? -41.662 0.030   38.430 1.00 61.99  ? 82   LEU A N     1 
ATOM   392   C  CA    . LEU A  1 82  ? -41.383 -1.318  37.987 1.00 61.37  ? 82   LEU A CA    1 
ATOM   393   C  C     . LEU A  1 82  ? -42.639 -2.157  37.995 1.00 60.94  ? 82   LEU A C     1 
ATOM   394   O  O     . LEU A  1 82  ? -43.538 -1.955  38.801 1.00 60.88  ? 82   LEU A O     1 
ATOM   395   C  CB    . LEU A  1 82  ? -40.282 -1.955  38.839 1.00 61.37  ? 82   LEU A CB    1 
ATOM   396   C  CG    . LEU A  1 82  ? -38.856 -1.648  38.370 1.00 61.38  ? 82   LEU A CG    1 
ATOM   397   C  CD1   . LEU A  1 82  ? -37.834 -2.146  39.360 1.00 61.89  ? 82   LEU A CD1   1 
ATOM   398   C  CD2   . LEU A  1 82  ? -38.584 -2.253  37.001 1.00 61.03  ? 82   LEU A CD2   1 
ATOM   399   N  N     . ARG A  1 83  ? -42.708 -3.080  37.057 1.00 60.50  ? 83   ARG A N     1 
ATOM   400   C  CA    . ARG A  1 83  ? -43.767 -4.057  37.051 1.00 60.31  ? 83   ARG A CA    1 
ATOM   401   C  C     . ARG A  1 83  ? -43.115 -5.412  37.176 1.00 59.67  ? 83   ARG A C     1 
ATOM   402   O  O     . ARG A  1 83  ? -41.995 -5.609  36.681 1.00 59.96  ? 83   ARG A O     1 
ATOM   403   C  CB    . ARG A  1 83  ? -44.590 -3.959  35.769 1.00 60.64  ? 83   ARG A CB    1 
ATOM   404   C  CG    . ARG A  1 83  ? -45.710 -2.941  35.874 1.00 62.10  ? 83   ARG A CG    1 
ATOM   405   C  CD    . ARG A  1 83  ? -46.177 -2.489  34.498 1.00 64.73  ? 83   ARG A CD    1 
ATOM   406   N  NE    . ARG A  1 83  ? -47.466 -1.817  34.617 1.00 67.02  ? 83   ARG A NE    1 
ATOM   407   C  CZ    . ARG A  1 83  ? -48.629 -2.362  34.268 1.00 68.56  ? 83   ARG A CZ    1 
ATOM   408   N  NH1   . ARG A  1 83  ? -48.675 -3.589  33.745 1.00 69.14  ? 83   ARG A NH1   1 
ATOM   409   N  NH2   . ARG A  1 83  ? -49.749 -1.673  34.432 1.00 69.29  ? 83   ARG A NH2   1 
ATOM   410   N  N     . PHE A  1 84  ? -43.805 -6.333  37.851 1.00 58.39  ? 84   PHE A N     1 
ATOM   411   C  CA    . PHE A  1 84  ? -43.301 -7.683  38.081 1.00 56.87  ? 84   PHE A CA    1 
ATOM   412   C  C     . PHE A  1 84  ? -44.206 -8.697  37.416 1.00 55.79  ? 84   PHE A C     1 
ATOM   413   O  O     . PHE A  1 84  ? -45.422 -8.660  37.617 1.00 55.72  ? 84   PHE A O     1 
ATOM   414   C  CB    . PHE A  1 84  ? -43.246 -7.965  39.585 1.00 56.84  ? 84   PHE A CB    1 
ATOM   415   C  CG    . PHE A  1 84  ? -41.998 -7.474  40.253 1.00 56.90  ? 84   PHE A CG    1 
ATOM   416   C  CD1   . PHE A  1 84  ? -41.872 -6.148  40.642 1.00 57.28  ? 84   PHE A CD1   1 
ATOM   417   C  CD2   . PHE A  1 84  ? -40.943 -8.343  40.502 1.00 57.12  ? 84   PHE A CD2   1 
ATOM   418   C  CE1   . PHE A  1 84  ? -40.700 -5.695  41.264 1.00 57.19  ? 84   PHE A CE1   1 
ATOM   419   C  CE2   . PHE A  1 84  ? -39.774 -7.899  41.122 1.00 56.44  ? 84   PHE A CE2   1 
ATOM   420   C  CZ    . PHE A  1 84  ? -39.655 -6.577  41.500 1.00 56.71  ? 84   PHE A CZ    1 
ATOM   421   N  N     . GLN A  1 85  ? -43.633 -9.594  36.619 1.00 54.41  ? 85   GLN A N     1 
ATOM   422   C  CA    . GLN A  1 85  ? -44.378 -10.773 36.209 1.00 53.49  ? 85   GLN A CA    1 
ATOM   423   C  C     . GLN A  1 85  ? -44.755 -11.495 37.487 1.00 53.37  ? 85   GLN A C     1 
ATOM   424   O  O     . GLN A  1 85  ? -43.994 -11.471 38.460 1.00 53.33  ? 85   GLN A O     1 
ATOM   425   C  CB    . GLN A  1 85  ? -43.541 -11.686 35.330 1.00 53.13  ? 85   GLN A CB    1 
ATOM   426   C  CG    . GLN A  1 85  ? -43.511 -11.265 33.882 1.00 52.55  ? 85   GLN A CG    1 
ATOM   427   C  CD    . GLN A  1 85  ? -42.895 -12.306 32.973 1.00 51.20  ? 85   GLN A CD    1 
ATOM   428   O  OE1   . GLN A  1 85  ? -42.424 -13.346 33.424 1.00 51.26  ? 85   GLN A OE1   1 
ATOM   429   N  NE2   . GLN A  1 85  ? -42.898 -12.027 31.683 1.00 49.72  ? 85   GLN A NE2   1 
ATOM   430   N  N     . SER A  1 86  ? -45.927 -12.120 37.514 1.00 53.07  ? 86   SER A N     1 
ATOM   431   C  CA    . SER A  1 86  ? -46.360 -12.777 38.737 1.00 52.62  ? 86   SER A CA    1 
ATOM   432   C  C     . SER A  1 86  ? -45.507 -14.009 38.970 1.00 52.23  ? 86   SER A C     1 
ATOM   433   O  O     . SER A  1 86  ? -45.278 -14.392 40.117 1.00 52.67  ? 86   SER A O     1 
ATOM   434   C  CB    . SER A  1 86  ? -47.838 -13.134 38.700 1.00 52.56  ? 86   SER A CB    1 
ATOM   435   O  OG    . SER A  1 86  ? -48.022 -14.394 38.085 1.00 53.49  ? 86   SER A OG    1 
ATOM   436   N  N     . SER A  1 87  ? -45.024 -14.619 37.888 1.00 51.62  ? 87   SER A N     1 
ATOM   437   C  CA    . SER A  1 87  ? -44.128 -15.767 38.011 1.00 51.12  ? 87   SER A CA    1 
ATOM   438   C  C     . SER A  1 87  ? -42.800 -15.340 38.631 1.00 50.99  ? 87   SER A C     1 
ATOM   439   O  O     . SER A  1 87  ? -42.222 -16.082 39.429 1.00 51.12  ? 87   SER A O     1 
ATOM   440   C  CB    . SER A  1 87  ? -43.893 -16.426 36.665 1.00 50.89  ? 87   SER A CB    1 
ATOM   441   O  OG    . SER A  1 87  ? -43.316 -15.504 35.771 1.00 51.32  ? 87   SER A OG    1 
ATOM   442   N  N     . ALA A  1 88  ? -42.333 -14.140 38.283 1.00 50.56  ? 88   ALA A N     1 
ATOM   443   C  CA    . ALA A  1 88  ? -41.128 -13.568 38.889 1.00 50.18  ? 88   ALA A CA    1 
ATOM   444   C  C     . ALA A  1 88  ? -41.232 -13.406 40.407 1.00 50.01  ? 88   ALA A C     1 
ATOM   445   O  O     . ALA A  1 88  ? -40.259 -13.618 41.131 1.00 49.68  ? 88   ALA A O     1 
ATOM   446   C  CB    . ALA A  1 88  ? -40.793 -12.248 38.249 1.00 50.04  ? 88   ALA A CB    1 
ATOM   447   N  N     . VAL A  1 89  ? -42.409 -13.028 40.891 1.00 50.22  ? 89   VAL A N     1 
ATOM   448   C  CA    . VAL A  1 89  ? -42.590 -12.862 42.330 1.00 50.30  ? 89   VAL A CA    1 
ATOM   449   C  C     . VAL A  1 89  ? -42.536 -14.213 43.005 1.00 51.05  ? 89   VAL A C     1 
ATOM   450   O  O     . VAL A  1 89  ? -41.886 -14.355 44.038 1.00 51.17  ? 89   VAL A O     1 
ATOM   451   C  CB    . VAL A  1 89  ? -43.891 -12.134 42.711 1.00 49.75  ? 89   VAL A CB    1 
ATOM   452   C  CG1   . VAL A  1 89  ? -44.035 -12.110 44.206 1.00 49.42  ? 89   VAL A CG1   1 
ATOM   453   C  CG2   . VAL A  1 89  ? -43.868 -10.723 42.202 1.00 48.84  ? 89   VAL A CG2   1 
ATOM   454   N  N     . MET A  1 90  ? -43.209 -15.200 42.411 1.00 51.90  ? 90   MET A N     1 
ATOM   455   C  CA    . MET A  1 90  ? -43.212 -16.575 42.926 1.00 52.85  ? 90   MET A CA    1 
ATOM   456   C  C     . MET A  1 90  ? -41.805 -17.176 42.971 1.00 52.48  ? 90   MET A C     1 
ATOM   457   O  O     . MET A  1 90  ? -41.401 -17.737 43.996 1.00 52.64  ? 90   MET A O     1 
ATOM   458   C  CB    . MET A  1 90  ? -44.172 -17.465 42.125 1.00 53.64  ? 90   MET A CB    1 
ATOM   459   C  CG    . MET A  1 90  ? -45.643 -17.142 42.355 1.00 57.51  ? 90   MET A CG    1 
ATOM   460   S  SD    . MET A  1 90  ? -45.991 -16.780 44.120 1.00 67.83  ? 90   MET A SD    1 
ATOM   461   C  CE    . MET A  1 90  ? -46.156 -18.444 44.816 1.00 64.88  ? 90   MET A CE    1 
ATOM   462   N  N     . ALA A  1 91  ? -41.052 -17.036 41.877 1.00 51.95  ? 91   ALA A N     1 
ATOM   463   C  CA    . ALA A  1 91  ? -39.641 -17.426 41.870 1.00 51.11  ? 91   ALA A CA    1 
ATOM   464   C  C     . ALA A  1 91  ? -38.976 -16.898 43.124 1.00 50.35  ? 91   ALA A C     1 
ATOM   465   O  O     . ALA A  1 91  ? -38.482 -17.672 43.926 1.00 50.51  ? 91   ALA A O     1 
ATOM   466   C  CB    . ALA A  1 91  ? -38.939 -16.915 40.639 1.00 51.10  ? 91   ALA A CB    1 
ATOM   467   N  N     . LEU A  1 92  ? -39.024 -15.584 43.316 1.00 49.65  ? 92   LEU A N     1 
ATOM   468   C  CA    . LEU A  1 92  ? -38.430 -14.951 44.498 1.00 49.16  ? 92   LEU A CA    1 
ATOM   469   C  C     . LEU A  1 92  ? -38.905 -15.519 45.827 1.00 49.04  ? 92   LEU A C     1 
ATOM   470   O  O     . LEU A  1 92  ? -38.109 -15.663 46.743 1.00 49.20  ? 92   LEU A O     1 
ATOM   471   C  CB    . LEU A  1 92  ? -38.631 -13.429 44.489 1.00 48.91  ? 92   LEU A CB    1 
ATOM   472   C  CG    . LEU A  1 92  ? -37.745 -12.570 43.576 1.00 48.06  ? 92   LEU A CG    1 
ATOM   473   C  CD1   . LEU A  1 92  ? -38.249 -11.147 43.537 1.00 47.66  ? 92   LEU A CD1   1 
ATOM   474   C  CD2   . LEU A  1 92  ? -36.288 -12.595 44.008 1.00 46.45  ? 92   LEU A CD2   1 
ATOM   475   N  N     . GLN A  1 93  ? -40.188 -15.846 45.944 1.00 48.90  ? 93   GLN A N     1 
ATOM   476   C  CA    . GLN A  1 93  ? -40.686 -16.379 47.208 1.00 48.60  ? 93   GLN A CA    1 
ATOM   477   C  C     . GLN A  1 93  ? -40.204 -17.799 47.441 1.00 48.20  ? 93   GLN A C     1 
ATOM   478   O  O     . GLN A  1 93  ? -39.774 -18.139 48.544 1.00 48.06  ? 93   GLN A O     1 
ATOM   479   C  CB    . GLN A  1 93  ? -42.208 -16.288 47.331 1.00 48.61  ? 93   GLN A CB    1 
ATOM   480   C  CG    . GLN A  1 93  ? -42.644 -16.505 48.766 1.00 49.00  ? 93   GLN A CG    1 
ATOM   481   C  CD    . GLN A  1 93  ? -44.093 -16.225 49.030 1.00 49.66  ? 93   GLN A CD    1 
ATOM   482   O  OE1   . GLN A  1 93  ? -44.781 -15.556 48.258 1.00 50.21  ? 93   GLN A OE1   1 
ATOM   483   N  NE2   . GLN A  1 93  ? -44.570 -16.730 50.156 1.00 50.69  ? 93   GLN A NE2   1 
ATOM   484   N  N     . GLU A  1 94  ? -40.277 -18.615 46.396 1.00 47.74  ? 94   GLU A N     1 
ATOM   485   C  CA    . GLU A  1 94  ? -39.721 -19.955 46.421 1.00 47.79  ? 94   GLU A CA    1 
ATOM   486   C  C     . GLU A  1 94  ? -38.268 -19.936 46.899 1.00 47.25  ? 94   GLU A C     1 
ATOM   487   O  O     . GLU A  1 94  ? -37.870 -20.710 47.773 1.00 47.16  ? 94   GLU A O     1 
ATOM   488   C  CB    . GLU A  1 94  ? -39.779 -20.553 45.019 1.00 48.32  ? 94   GLU A CB    1 
ATOM   489   C  CG    . GLU A  1 94  ? -41.143 -21.102 44.616 1.00 49.67  ? 94   GLU A CG    1 
ATOM   490   C  CD    . GLU A  1 94  ? -41.572 -22.277 45.465 1.00 50.71  ? 94   GLU A CD    1 
ATOM   491   O  OE1   . GLU A  1 94  ? -42.779 -22.311 45.810 1.00 51.12  ? 94   GLU A OE1   1 
ATOM   492   O  OE2   . GLU A  1 94  ? -40.702 -23.138 45.787 1.00 49.33  ? 94   GLU A OE2   1 
ATOM   493   N  N     . ALA A  1 95  ? -37.500 -19.019 46.326 1.00 46.38  ? 95   ALA A N     1 
ATOM   494   C  CA    . ALA A  1 95  ? -36.084 -18.926 46.557 1.00 45.71  ? 95   ALA A CA    1 
ATOM   495   C  C     . ALA A  1 95  ? -35.752 -18.479 47.977 1.00 45.45  ? 95   ALA A C     1 
ATOM   496   O  O     . ALA A  1 95  ? -34.819 -18.992 48.593 1.00 45.68  ? 95   ALA A O     1 
ATOM   497   C  CB    . ALA A  1 95  ? -35.474 -17.991 45.538 1.00 45.61  ? 95   ALA A CB    1 
ATOM   498   N  N     . SER A  1 96  ? -36.515 -17.527 48.493 1.00 45.10  ? 96   SER A N     1 
ATOM   499   C  CA    . SER A  1 96  ? -36.255 -16.952 49.806 1.00 45.00  ? 96   SER A CA    1 
ATOM   500   C  C     . SER A  1 96  ? -36.579 -17.928 50.909 1.00 44.94  ? 96   SER A C     1 
ATOM   501   O  O     . SER A  1 96  ? -35.869 -18.030 51.913 1.00 44.63  ? 96   SER A O     1 
ATOM   502   C  CB    . SER A  1 96  ? -37.123 -15.722 50.005 1.00 44.89  ? 96   SER A CB    1 
ATOM   503   O  OG    . SER A  1 96  ? -36.901 -14.795 48.968 1.00 45.76  ? 96   SER A OG    1 
ATOM   504   N  N     . GLU A  1 97  ? -37.687 -18.627 50.718 1.00 45.11  ? 97   GLU A N     1 
ATOM   505   C  CA    . GLU A  1 97  ? -38.187 -19.533 51.722 1.00 45.17  ? 97   GLU A CA    1 
ATOM   506   C  C     . GLU A  1 97  ? -37.247 -20.723 51.809 1.00 44.67  ? 97   GLU A C     1 
ATOM   507   O  O     . GLU A  1 97  ? -36.835 -21.100 52.912 1.00 45.39  ? 97   GLU A O     1 
ATOM   508   C  CB    . GLU A  1 97  ? -39.617 -19.954 51.403 1.00 45.45  ? 97   GLU A CB    1 
ATOM   509   C  CG    . GLU A  1 97  ? -40.628 -18.826 51.557 1.00 47.03  ? 97   GLU A CG    1 
ATOM   510   C  CD    . GLU A  1 97  ? -42.004 -19.343 51.915 1.00 50.31  ? 97   GLU A CD    1 
ATOM   511   O  OE1   . GLU A  1 97  ? -42.115 -20.560 52.191 1.00 51.28  ? 97   GLU A OE1   1 
ATOM   512   O  OE2   . GLU A  1 97  ? -42.972 -18.545 51.926 1.00 52.09  ? 97   GLU A OE2   1 
ATOM   513   N  N     . ALA A  1 98  ? -36.881 -21.279 50.649 1.00 43.33  ? 98   ALA A N     1 
ATOM   514   C  CA    . ALA A  1 98  ? -35.858 -22.314 50.577 1.00 41.89  ? 98   ALA A CA    1 
ATOM   515   C  C     . ALA A  1 98  ? -34.645 -21.846 51.376 1.00 41.37  ? 98   ALA A C     1 
ATOM   516   O  O     . ALA A  1 98  ? -34.199 -22.534 52.295 1.00 41.57  ? 98   ALA A O     1 
ATOM   517   C  CB    . ALA A  1 98  ? -35.486 -22.584 49.136 1.00 41.61  ? 98   ALA A CB    1 
ATOM   518   N  N     . TYR A  1 99  ? -34.156 -20.649 51.051 1.00 40.41  ? 99   TYR A N     1 
ATOM   519   C  CA    . TYR A  1 99  ? -33.032 -20.046 51.740 1.00 39.53  ? 99   TYR A CA    1 
ATOM   520   C  C     . TYR A  1 99  ? -33.231 -19.921 53.253 1.00 39.41  ? 99   TYR A C     1 
ATOM   521   O  O     . TYR A  1 99  ? -32.318 -20.232 54.030 1.00 39.64  ? 99   TYR A O     1 
ATOM   522   C  CB    . TYR A  1 99  ? -32.695 -18.678 51.139 1.00 39.16  ? 99   TYR A CB    1 
ATOM   523   C  CG    . TYR A  1 99  ? -31.709 -17.894 51.970 1.00 38.50  ? 99   TYR A CG    1 
ATOM   524   C  CD1   . TYR A  1 99  ? -30.337 -18.109 51.862 1.00 38.10  ? 99   TYR A CD1   1 
ATOM   525   C  CD2   . TYR A  1 99  ? -32.148 -16.960 52.889 1.00 38.85  ? 99   TYR A CD2   1 
ATOM   526   C  CE1   . TYR A  1 99  ? -29.430 -17.402 52.645 1.00 37.89  ? 99   TYR A CE1   1 
ATOM   527   C  CE2   . TYR A  1 99  ? -31.254 -16.247 53.674 1.00 39.12  ? 99   TYR A CE2   1 
ATOM   528   C  CZ    . TYR A  1 99  ? -29.903 -16.469 53.547 1.00 38.50  ? 99   TYR A CZ    1 
ATOM   529   O  OH    . TYR A  1 99  ? -29.048 -15.747 54.337 1.00 38.87  ? 99   TYR A OH    1 
ATOM   530   N  N     . LEU A  1 100 ? -34.396 -19.453 53.684 1.00 38.94  ? 100  LEU A N     1 
ATOM   531   C  CA    . LEU A  1 100 ? -34.576 -19.248 55.112 1.00 38.83  ? 100  LEU A CA    1 
ATOM   532   C  C     . LEU A  1 100 ? -34.682 -20.556 55.844 1.00 39.12  ? 100  LEU A C     1 
ATOM   533   O  O     . LEU A  1 100 ? -34.081 -20.706 56.910 1.00 39.53  ? 100  LEU A O     1 
ATOM   534   C  CB    . LEU A  1 100 ? -35.757 -18.341 55.442 1.00 38.50  ? 100  LEU A CB    1 
ATOM   535   C  CG    . LEU A  1 100 ? -35.543 -16.835 55.259 1.00 38.34  ? 100  LEU A CG    1 
ATOM   536   C  CD1   . LEU A  1 100 ? -36.702 -16.065 55.835 1.00 38.12  ? 100  LEU A CD1   1 
ATOM   537   C  CD2   . LEU A  1 100 ? -34.248 -16.330 55.883 1.00 38.55  ? 100  LEU A CD2   1 
ATOM   538   N  N     . VAL A  1 101 ? -35.415 -21.510 55.262 1.00 38.93  ? 101  VAL A N     1 
ATOM   539   C  CA    . VAL A  1 101 ? -35.572 -22.848 55.842 1.00 38.85  ? 101  VAL A CA    1 
ATOM   540   C  C     . VAL A  1 101 ? -34.217 -23.538 56.042 1.00 39.03  ? 101  VAL A C     1 
ATOM   541   O  O     . VAL A  1 101 ? -33.909 -24.035 57.131 1.00 38.93  ? 101  VAL A O     1 
ATOM   542   C  CB    . VAL A  1 101 ? -36.471 -23.742 54.973 1.00 38.75  ? 101  VAL A CB    1 
ATOM   543   C  CG1   . VAL A  1 101 ? -36.489 -25.164 55.508 1.00 38.89  ? 101  VAL A CG1   1 
ATOM   544   C  CG2   . VAL A  1 101 ? -37.872 -23.192 54.928 1.00 39.01  ? 101  VAL A CG2   1 
ATOM   545   N  N     . ALA A  1 102 ? -33.412 -23.553 54.984 1.00 39.07  ? 102  ALA A N     1 
ATOM   546   C  CA    . ALA A  1 102 ? -32.077 -24.118 55.039 1.00 39.04  ? 102  ALA A CA    1 
ATOM   547   C  C     . ALA A  1 102 ? -31.209 -23.401 56.068 1.00 39.16  ? 102  ALA A C     1 
ATOM   548   O  O     . ALA A  1 102 ? -30.402 -24.046 56.752 1.00 39.67  ? 102  ALA A O     1 
ATOM   549   C  CB    . ALA A  1 102 ? -31.435 -24.060 53.678 1.00 39.25  ? 102  ALA A CB    1 
ATOM   550   N  N     . LEU A  1 103 ? -31.372 -22.079 56.177 1.00 38.59  ? 103  LEU A N     1 
ATOM   551   C  CA    . LEU A  1 103 ? -30.628 -21.305 57.172 1.00 38.48  ? 103  LEU A CA    1 
ATOM   552   C  C     . LEU A  1 103 ? -31.037 -21.684 58.592 1.00 38.60  ? 103  LEU A C     1 
ATOM   553   O  O     . LEU A  1 103 ? -30.195 -21.758 59.493 1.00 38.46  ? 103  LEU A O     1 
ATOM   554   C  CB    . LEU A  1 103 ? -30.776 -19.789 56.952 1.00 38.54  ? 103  LEU A CB    1 
ATOM   555   C  CG    . LEU A  1 103 ? -30.176 -18.834 58.006 1.00 37.83  ? 103  LEU A CG    1 
ATOM   556   C  CD1   . LEU A  1 103 ? -28.674 -18.920 58.087 1.00 35.56  ? 103  LEU A CD1   1 
ATOM   557   C  CD2   . LEU A  1 103 ? -30.597 -17.416 57.747 1.00 37.78  ? 103  LEU A CD2   1 
ATOM   558   N  N     . PHE A  1 104 ? -32.330 -21.927 58.785 1.00 38.66  ? 104  PHE A N     1 
ATOM   559   C  CA    . PHE A  1 104 ? -32.830 -22.363 60.086 1.00 38.87  ? 104  PHE A CA    1 
ATOM   560   C  C     . PHE A  1 104 ? -32.271 -23.733 60.491 1.00 39.65  ? 104  PHE A C     1 
ATOM   561   O  O     . PHE A  1 104 ? -32.081 -24.004 61.674 1.00 39.72  ? 104  PHE A O     1 
ATOM   562   C  CB    . PHE A  1 104 ? -34.360 -22.363 60.117 1.00 38.11  ? 104  PHE A CB    1 
ATOM   563   C  CG    . PHE A  1 104 ? -34.956 -21.014 60.363 1.00 36.72  ? 104  PHE A CG    1 
ATOM   564   C  CD1   . PHE A  1 104 ? -35.913 -20.500 59.505 1.00 35.53  ? 104  PHE A CD1   1 
ATOM   565   C  CD2   . PHE A  1 104 ? -34.556 -20.250 61.455 1.00 34.76  ? 104  PHE A CD2   1 
ATOM   566   C  CE1   . PHE A  1 104 ? -36.458 -19.235 59.737 1.00 34.94  ? 104  PHE A CE1   1 
ATOM   567   C  CE2   . PHE A  1 104 ? -35.093 -18.991 61.687 1.00 33.34  ? 104  PHE A CE2   1 
ATOM   568   C  CZ    . PHE A  1 104 ? -36.038 -18.483 60.832 1.00 34.51  ? 104  PHE A CZ    1 
ATOM   569   N  N     . GLU A  1 105 ? -31.998 -24.584 59.506 1.00 40.31  ? 105  GLU A N     1 
ATOM   570   C  CA    . GLU A  1 105 ? -31.402 -25.871 59.780 1.00 41.12  ? 105  GLU A CA    1 
ATOM   571   C  C     . GLU A  1 105 ? -30.038 -25.637 60.395 1.00 41.48  ? 105  GLU A C     1 
ATOM   572   O  O     . GLU A  1 105 ? -29.761 -26.119 61.497 1.00 41.68  ? 105  GLU A O     1 
ATOM   573   C  CB    . GLU A  1 105 ? -31.305 -26.704 58.512 1.00 40.64  ? 105  GLU A CB    1 
ATOM   574   C  CG    . GLU A  1 105 ? -32.654 -27.088 57.938 1.00 41.71  ? 105  GLU A CG    1 
ATOM   575   C  CD    . GLU A  1 105 ? -32.560 -27.740 56.563 1.00 42.27  ? 105  GLU A CD    1 
ATOM   576   O  OE1   . GLU A  1 105 ? -31.472 -28.252 56.224 1.00 44.53  ? 105  GLU A OE1   1 
ATOM   577   O  OE2   . GLU A  1 105 ? -33.570 -27.746 55.816 1.00 43.47  ? 105  GLU A OE2   1 
ATOM   578   N  N     . ASP A  1 106 ? -29.199 -24.866 59.707 1.00 42.16  ? 106  ASP A N     1 
ATOM   579   C  CA    . ASP A  1 106 ? -27.830 -24.638 60.185 1.00 43.07  ? 106  ASP A CA    1 
ATOM   580   C  C     . ASP A  1 106 ? -27.843 -23.898 61.498 1.00 43.23  ? 106  ASP A C     1 
ATOM   581   O  O     . ASP A  1 106 ? -26.979 -24.116 62.355 1.00 43.46  ? 106  ASP A O     1 
ATOM   582   C  CB    . ASP A  1 106 ? -27.016 -23.831 59.188 1.00 43.41  ? 106  ASP A CB    1 
ATOM   583   C  CG    . ASP A  1 106 ? -26.841 -24.536 57.883 1.00 44.88  ? 106  ASP A CG    1 
ATOM   584   O  OD1   . ASP A  1 106 ? -27.035 -25.774 57.850 1.00 46.59  ? 106  ASP A OD1   1 
ATOM   585   O  OD2   . ASP A  1 106 ? -26.517 -23.848 56.887 1.00 46.82  ? 106  ASP A OD2   1 
ATOM   586   N  N     . THR A  1 107 ? -28.829 -23.017 61.643 1.00 43.22  ? 107  THR A N     1 
ATOM   587   C  CA    . THR A  1 107 ? -29.011 -22.280 62.876 1.00 43.32  ? 107  THR A CA    1 
ATOM   588   C  C     . THR A  1 107 ? -29.309 -23.250 64.007 1.00 43.67  ? 107  THR A C     1 
ATOM   589   O  O     . THR A  1 107 ? -28.667 -23.202 65.063 1.00 43.81  ? 107  THR A O     1 
ATOM   590   C  CB    . THR A  1 107 ? -30.102 -21.224 62.730 1.00 43.11  ? 107  THR A CB    1 
ATOM   591   O  OG1   . THR A  1 107 ? -29.675 -20.265 61.760 1.00 42.98  ? 107  THR A OG1   1 
ATOM   592   C  CG2   . THR A  1 107 ? -30.340 -20.512 64.032 1.00 42.55  ? 107  THR A CG2   1 
ATOM   593   N  N     . ASN A  1 108 ? -30.246 -24.163 63.760 1.00 44.06  ? 108  ASN A N     1 
ATOM   594   C  CA    . ASN A  1 108 ? -30.631 -25.157 64.760 1.00 44.22  ? 108  ASN A CA    1 
ATOM   595   C  C     . ASN A  1 108 ? -29.448 -25.997 65.175 1.00 44.00  ? 108  ASN A C     1 
ATOM   596   O  O     . ASN A  1 108 ? -29.342 -26.406 66.332 1.00 43.66  ? 108  ASN A O     1 
ATOM   597   C  CB    . ASN A  1 108 ? -31.733 -26.068 64.236 1.00 44.44  ? 108  ASN A CB    1 
ATOM   598   C  CG    . ASN A  1 108 ? -32.559 -26.637 65.343 1.00 45.18  ? 108  ASN A CG    1 
ATOM   599   O  OD1   . ASN A  1 108 ? -32.875 -25.940 66.298 1.00 47.26  ? 108  ASN A OD1   1 
ATOM   600   N  ND2   . ASN A  1 108 ? -32.921 -27.901 65.231 1.00 45.92  ? 108  ASN A ND2   1 
ATOM   601   N  N     . LEU A  1 109 ? -28.567 -26.238 64.208 1.00 43.92  ? 109  LEU A N     1 
ATOM   602   C  CA    . LEU A  1 109 ? -27.360 -26.995 64.432 1.00 44.22  ? 109  LEU A CA    1 
ATOM   603   C  C     . LEU A  1 109 ? -26.382 -26.251 65.319 1.00 44.42  ? 109  LEU A C     1 
ATOM   604   O  O     . LEU A  1 109 ? -25.686 -26.869 66.127 1.00 44.85  ? 109  LEU A O     1 
ATOM   605   C  CB    . LEU A  1 109 ? -26.697 -27.351 63.110 1.00 44.32  ? 109  LEU A CB    1 
ATOM   606   C  CG    . LEU A  1 109 ? -27.197 -28.590 62.376 1.00 44.18  ? 109  LEU A CG    1 
ATOM   607   C  CD1   . LEU A  1 109 ? -26.340 -28.793 61.169 1.00 43.82  ? 109  LEU A CD1   1 
ATOM   608   C  CD2   . LEU A  1 109 ? -27.142 -29.830 63.250 1.00 44.02  ? 109  LEU A CD2   1 
ATOM   609   N  N     . CYS A  1 110 ? -26.329 -24.933 65.177 1.00 44.39  ? 110  CYS A N     1 
ATOM   610   C  CA    . CYS A  1 110 ? -25.474 -24.134 66.052 1.00 44.69  ? 110  CYS A CA    1 
ATOM   611   C  C     . CYS A  1 110 ? -25.983 -24.055 67.489 1.00 44.81  ? 110  CYS A C     1 
ATOM   612   O  O     . CYS A  1 110 ? -25.185 -23.990 68.417 1.00 44.79  ? 110  CYS A O     1 
ATOM   613   C  CB    . CYS A  1 110 ? -25.259 -22.731 65.496 1.00 44.50  ? 110  CYS A CB    1 
ATOM   614   S  SG    . CYS A  1 110 ? -24.485 -22.770 63.896 1.00 44.11  ? 110  CYS A SG    1 
ATOM   615   N  N     . ALA A  1 111 ? -27.298 -24.060 67.677 1.00 45.00  ? 111  ALA A N     1 
ATOM   616   C  CA    . ALA A  1 111 ? -27.842 -23.968 69.030 1.00 45.40  ? 111  ALA A CA    1 
ATOM   617   C  C     . ALA A  1 111 ? -27.585 -25.281 69.765 1.00 45.59  ? 111  ALA A C     1 
ATOM   618   O  O     . ALA A  1 111 ? -27.139 -25.304 70.923 1.00 45.53  ? 111  ALA A O     1 
ATOM   619   C  CB    . ALA A  1 111 ? -29.315 -23.644 68.991 1.00 45.35  ? 111  ALA A CB    1 
ATOM   620   N  N     . ILE A  1 112 ? -27.842 -26.375 69.065 1.00 45.72  ? 112  ILE A N     1 
ATOM   621   C  CA    . ILE A  1 112 ? -27.559 -27.683 69.600 1.00 45.90  ? 112  ILE A CA    1 
ATOM   622   C  C     . ILE A  1 112 ? -26.066 -27.782 69.914 1.00 46.09  ? 112  ILE A C     1 
ATOM   623   O  O     . ILE A  1 112 ? -25.680 -28.381 70.923 1.00 46.06  ? 112  ILE A O     1 
ATOM   624   C  CB    . ILE A  1 112 ? -28.038 -28.782 68.644 1.00 45.69  ? 112  ILE A CB    1 
ATOM   625   C  CG1   . ILE A  1 112 ? -29.560 -28.788 68.612 1.00 45.74  ? 112  ILE A CG1   1 
ATOM   626   C  CG2   . ILE A  1 112 ? -27.567 -30.148 69.089 1.00 45.72  ? 112  ILE A CG2   1 
ATOM   627   C  CD1   . ILE A  1 112 ? -30.138 -29.404 67.357 1.00 46.43  ? 112  ILE A CD1   1 
ATOM   628   N  N     . HIS A  1 113 ? -25.228 -27.156 69.091 1.00 46.37  ? 113  HIS A N     1 
ATOM   629   C  CA    . HIS A  1 113 ? -23.785 -27.215 69.348 1.00 46.84  ? 113  HIS A CA    1 
ATOM   630   C  C     . HIS A  1 113 ? -23.447 -26.648 70.719 1.00 47.42  ? 113  HIS A C     1 
ATOM   631   O  O     . HIS A  1 113 ? -22.466 -27.081 71.332 1.00 47.90  ? 113  HIS A O     1 
ATOM   632   C  CB    . HIS A  1 113 ? -22.956 -26.514 68.267 1.00 46.55  ? 113  HIS A CB    1 
ATOM   633   C  CG    . HIS A  1 113 ? -21.476 -26.771 68.362 1.00 45.72  ? 113  HIS A CG    1 
ATOM   634   N  ND1   . HIS A  1 113 ? -20.876 -27.899 67.839 1.00 44.68  ? 113  HIS A ND1   1 
ATOM   635   C  CD2   . HIS A  1 113 ? -20.472 -26.022 68.879 1.00 44.93  ? 113  HIS A CD2   1 
ATOM   636   C  CE1   . HIS A  1 113 ? -19.571 -27.838 68.040 1.00 43.41  ? 113  HIS A CE1   1 
ATOM   637   N  NE2   . HIS A  1 113 ? -19.300 -26.709 68.670 1.00 43.37  ? 113  HIS A NE2   1 
ATOM   638   N  N     . ALA A  1 114 ? -24.259 -25.704 71.201 1.00 47.71  ? 114  ALA A N     1 
ATOM   639   C  CA    . ALA A  1 114 ? -23.986 -25.058 72.484 1.00 48.10  ? 114  ALA A CA    1 
ATOM   640   C  C     . ALA A  1 114 ? -24.882 -25.588 73.594 1.00 48.48  ? 114  ALA A C     1 
ATOM   641   O  O     . ALA A  1 114 ? -25.081 -24.926 74.619 1.00 48.79  ? 114  ALA A O     1 
ATOM   642   C  CB    . ALA A  1 114 ? -24.097 -23.544 72.366 1.00 48.09  ? 114  ALA A CB    1 
ATOM   643   N  N     . LYS A  1 115 ? -25.413 -26.791 73.380 1.00 48.68  ? 115  LYS A N     1 
ATOM   644   C  CA    . LYS A  1 115 ? -26.233 -27.489 74.371 1.00 49.04  ? 115  LYS A CA    1 
ATOM   645   C  C     . LYS A  1 115 ? -27.527 -26.737 74.671 1.00 48.49  ? 115  LYS A C     1 
ATOM   646   O  O     . LYS A  1 115 ? -27.990 -26.697 75.819 1.00 48.63  ? 115  LYS A O     1 
ATOM   647   C  CB    . LYS A  1 115 ? -25.452 -27.760 75.669 1.00 49.14  ? 115  LYS A CB    1 
ATOM   648   C  CG    . LYS A  1 115 ? -24.159 -28.591 75.519 1.00 50.34  ? 115  LYS A CG    1 
ATOM   649   C  CD    . LYS A  1 115 ? -23.348 -28.570 76.846 1.00 50.75  ? 115  LYS A CD    1 
ATOM   650   C  CE    . LYS A  1 115 ? -21.884 -29.010 76.684 1.00 51.60  ? 115  LYS A CE    1 
ATOM   651   N  NZ    . LYS A  1 115 ? -21.753 -30.498 76.546 1.00 53.34  ? 115  LYS A NZ    1 
ATOM   652   N  N     . ARG A  1 116 ? -28.109 -26.140 73.636 1.00 47.89  ? 116  ARG A N     1 
ATOM   653   C  CA    . ARG A  1 116 ? -29.425 -25.526 73.767 1.00 47.25  ? 116  ARG A CA    1 
ATOM   654   C  C     . ARG A  1 116 ? -30.403 -26.178 72.795 1.00 46.95  ? 116  ARG A C     1 
ATOM   655   O  O     . ARG A  1 116 ? -30.013 -27.009 71.967 1.00 46.81  ? 116  ARG A O     1 
ATOM   656   C  CB    . ARG A  1 116 ? -29.360 -24.009 73.532 1.00 47.30  ? 116  ARG A CB    1 
ATOM   657   C  CG    . ARG A  1 116 ? -28.456 -23.235 74.479 1.00 46.62  ? 116  ARG A CG    1 
ATOM   658   C  CD    . ARG A  1 116 ? -28.512 -21.734 74.207 1.00 47.16  ? 116  ARG A CD    1 
ATOM   659   N  NE    . ARG A  1 116 ? -27.508 -21.267 73.243 1.00 48.26  ? 116  ARG A NE    1 
ATOM   660   C  CZ    . ARG A  1 116 ? -27.741 -20.994 71.954 1.00 48.71  ? 116  ARG A CZ    1 
ATOM   661   N  NH1   . ARG A  1 116 ? -28.948 -21.137 71.427 1.00 49.41  ? 116  ARG A NH1   1 
ATOM   662   N  NH2   . ARG A  1 116 ? -26.760 -20.570 71.176 1.00 48.71  ? 116  ARG A NH2   1 
ATOM   663   N  N     . VAL A  1 117 ? -31.672 -25.805 72.924 1.00 46.67  ? 117  VAL A N     1 
ATOM   664   C  CA    . VAL A  1 117 ? -32.718 -26.181 71.967 1.00 46.70  ? 117  VAL A CA    1 
ATOM   665   C  C     . VAL A  1 117 ? -33.447 -24.947 71.440 1.00 46.70  ? 117  VAL A C     1 
ATOM   666   O  O     . VAL A  1 117 ? -34.415 -25.058 70.676 1.00 46.62  ? 117  VAL A O     1 
ATOM   667   C  CB    . VAL A  1 117 ? -33.761 -27.136 72.572 1.00 46.53  ? 117  VAL A CB    1 
ATOM   668   C  CG1   . VAL A  1 117 ? -33.131 -28.480 72.883 1.00 46.26  ? 117  VAL A CG1   1 
ATOM   669   C  CG2   . VAL A  1 117 ? -34.425 -26.509 73.806 1.00 46.64  ? 117  VAL A CG2   1 
ATOM   670   N  N     . THR A  1 118 ? -32.968 -23.779 71.860 1.00 46.49  ? 118  THR A N     1 
ATOM   671   C  CA    . THR A  1 118 ? -33.592 -22.518 71.517 1.00 46.21  ? 118  THR A CA    1 
ATOM   672   C  C     . THR A  1 118 ? -32.685 -21.772 70.553 1.00 46.35  ? 118  THR A C     1 
ATOM   673   O  O     . THR A  1 118 ? -31.578 -21.367 70.936 1.00 46.68  ? 118  THR A O     1 
ATOM   674   C  CB    . THR A  1 118 ? -33.790 -21.630 72.768 1.00 46.06  ? 118  THR A CB    1 
ATOM   675   O  OG1   . THR A  1 118 ? -34.158 -22.432 73.897 1.00 45.39  ? 118  THR A OG1   1 
ATOM   676   C  CG2   . THR A  1 118 ? -34.843 -20.576 72.511 1.00 45.78  ? 118  THR A CG2   1 
ATOM   677   N  N     . ILE A  1 119 ? -33.140 -21.571 69.317 1.00 45.92  ? 119  ILE A N     1 
ATOM   678   C  CA    . ILE A  1 119 ? -32.346 -20.802 68.365 1.00 45.67  ? 119  ILE A CA    1 
ATOM   679   C  C     . ILE A  1 119 ? -32.267 -19.336 68.790 1.00 45.98  ? 119  ILE A C     1 
ATOM   680   O  O     . ILE A  1 119 ? -33.257 -18.758 69.216 1.00 45.98  ? 119  ILE A O     1 
ATOM   681   C  CB    . ILE A  1 119 ? -32.833 -20.974 66.909 1.00 45.45  ? 119  ILE A CB    1 
ATOM   682   C  CG1   . ILE A  1 119 ? -34.253 -20.445 66.719 1.00 44.88  ? 119  ILE A CG1   1 
ATOM   683   C  CG2   . ILE A  1 119 ? -32.744 -22.444 66.498 1.00 45.25  ? 119  ILE A CG2   1 
ATOM   684   C  CD1   . ILE A  1 119 ? -34.515 -19.863 65.345 1.00 43.20  ? 119  ILE A CD1   1 
ATOM   685   N  N     . MET A  1 120 ? -31.076 -18.757 68.715 1.00 46.43  ? 120  MET A N     1 
ATOM   686   C  CA    . MET A  1 120 ? -30.866 -17.366 69.115 1.00 47.29  ? 120  MET A CA    1 
ATOM   687   C  C     . MET A  1 120 ? -30.153 -16.611 68.005 1.00 47.02  ? 120  MET A C     1 
ATOM   688   O  O     . MET A  1 120 ? -29.600 -17.234 67.115 1.00 46.86  ? 120  MET A O     1 
ATOM   689   C  CB    . MET A  1 120 ? -30.051 -17.301 70.404 1.00 47.20  ? 120  MET A CB    1 
ATOM   690   C  CG    . MET A  1 120 ? -30.800 -17.739 71.639 1.00 47.59  ? 120  MET A CG    1 
ATOM   691   S  SD    . MET A  1 120 ? -29.692 -17.907 73.052 1.00 49.43  ? 120  MET A SD    1 
ATOM   692   C  CE    . MET A  1 120 ? -30.789 -18.570 74.329 1.00 48.05  ? 120  MET A CE    1 
ATOM   693   N  N     . PRO A  1 121 ? -30.201 -15.265 68.020 1.00 47.32  ? 121  PRO A N     1 
ATOM   694   C  CA    . PRO A  1 121 ? -29.478 -14.489 67.009 1.00 47.46  ? 121  PRO A CA    1 
ATOM   695   C  C     . PRO A  1 121 ? -28.003 -14.881 66.824 1.00 47.32  ? 121  PRO A C     1 
ATOM   696   O  O     . PRO A  1 121 ? -27.520 -14.939 65.685 1.00 47.43  ? 121  PRO A O     1 
ATOM   697   C  CB    . PRO A  1 121 ? -29.617 -13.046 67.511 1.00 47.46  ? 121  PRO A CB    1 
ATOM   698   C  CG    . PRO A  1 121 ? -30.909 -13.041 68.225 1.00 47.23  ? 121  PRO A CG    1 
ATOM   699   C  CD    . PRO A  1 121 ? -30.981 -14.382 68.910 1.00 47.59  ? 121  PRO A CD    1 
ATOM   700   N  N     . LYS A  1 122 ? -27.300 -15.174 67.911 1.00 46.75  ? 122  LYS A N     1 
ATOM   701   C  CA    . LYS A  1 122 ? -25.913 -15.597 67.773 1.00 46.59  ? 122  LYS A CA    1 
ATOM   702   C  C     . LYS A  1 122 ? -25.753 -16.876 66.928 1.00 46.09  ? 122  LYS A C     1 
ATOM   703   O  O     . LYS A  1 122 ? -24.750 -17.047 66.246 1.00 46.03  ? 122  LYS A O     1 
ATOM   704   C  CB    . LYS A  1 122 ? -25.232 -15.716 69.140 1.00 46.75  ? 122  LYS A CB    1 
ATOM   705   C  CG    . LYS A  1 122 ? -25.798 -16.770 70.049 1.00 47.54  ? 122  LYS A CG    1 
ATOM   706   C  CD    . LYS A  1 122 ? -25.290 -16.588 71.470 1.00 49.44  ? 122  LYS A CD    1 
ATOM   707   C  CE    . LYS A  1 122 ? -25.994 -17.544 72.415 1.00 50.28  ? 122  LYS A CE    1 
ATOM   708   N  NZ    . LYS A  1 122 ? -25.645 -17.241 73.813 1.00 51.74  ? 122  LYS A NZ    1 
ATOM   709   N  N     . ASP A  1 123 ? -26.759 -17.744 66.963 1.00 45.67  ? 123  ASP A N     1 
ATOM   710   C  CA    . ASP A  1 123 ? -26.792 -18.947 66.148 1.00 45.36  ? 123  ASP A CA    1 
ATOM   711   C  C     . ASP A  1 123 ? -26.933 -18.620 64.668 1.00 45.10  ? 123  ASP A C     1 
ATOM   712   O  O     . ASP A  1 123 ? -26.192 -19.168 63.852 1.00 45.21  ? 123  ASP A O     1 
ATOM   713   C  CB    . ASP A  1 123 ? -27.934 -19.868 66.582 1.00 45.61  ? 123  ASP A CB    1 
ATOM   714   C  CG    . ASP A  1 123 ? -27.842 -20.289 68.049 1.00 46.85  ? 123  ASP A CG    1 
ATOM   715   O  OD1   . ASP A  1 123 ? -26.726 -20.622 68.521 1.00 48.75  ? 123  ASP A OD1   1 
ATOM   716   O  OD2   . ASP A  1 123 ? -28.897 -20.305 68.725 1.00 46.77  ? 123  ASP A OD2   1 
ATOM   717   N  N     . ILE A  1 124 ? -27.873 -17.737 64.313 1.00 44.82  ? 124  ILE A N     1 
ATOM   718   C  CA    . ILE A  1 124 ? -28.016 -17.302 62.912 1.00 44.39  ? 124  ILE A CA    1 
ATOM   719   C  C     . ILE A  1 124 ? -26.727 -16.623 62.461 1.00 44.35  ? 124  ILE A C     1 
ATOM   720   O  O     . ILE A  1 124 ? -26.221 -16.899 61.375 1.00 44.35  ? 124  ILE A O     1 
ATOM   721   C  CB    . ILE A  1 124 ? -29.218 -16.344 62.656 1.00 44.32  ? 124  ILE A CB    1 
ATOM   722   C  CG1   . ILE A  1 124 ? -30.548 -17.007 63.034 1.00 44.86  ? 124  ILE A CG1   1 
ATOM   723   C  CG2   . ILE A  1 124 ? -29.280 -15.944 61.184 1.00 43.23  ? 124  ILE A CG2   1 
ATOM   724   C  CD1   . ILE A  1 124 ? -31.814 -16.187 62.686 1.00 44.28  ? 124  ILE A CD1   1 
ATOM   725   N  N     . GLN A  1 125 ? -26.192 -15.759 63.316 1.00 44.13  ? 125  GLN A N     1 
ATOM   726   C  CA    . GLN A  1 125 ? -24.988 -15.001 62.997 1.00 44.35  ? 125  GLN A CA    1 
ATOM   727   C  C     . GLN A  1 125 ? -23.782 -15.906 62.722 1.00 43.49  ? 125  GLN A C     1 
ATOM   728   O  O     . GLN A  1 125 ? -23.032 -15.685 61.771 1.00 43.28  ? 125  GLN A O     1 
ATOM   729   C  CB    . GLN A  1 125 ? -24.676 -14.003 64.122 1.00 44.69  ? 125  GLN A CB    1 
ATOM   730   C  CG    . GLN A  1 125 ? -25.503 -12.692 64.091 1.00 45.72  ? 125  GLN A CG    1 
ATOM   731   C  CD    . GLN A  1 125 ? -25.697 -12.079 65.488 1.00 45.76  ? 125  GLN A CD    1 
ATOM   732   O  OE1   . GLN A  1 125 ? -24.863 -12.256 66.380 1.00 47.60  ? 125  GLN A OE1   1 
ATOM   733   N  NE2   . GLN A  1 125 ? -26.809 -11.359 65.676 1.00 47.32  ? 125  GLN A NE2   1 
ATOM   734   N  N     . LEU A  1 126 ? -23.605 -16.922 63.559 1.00 42.90  ? 126  LEU A N     1 
ATOM   735   C  CA    . LEU A  1 126 ? -22.524 -17.880 63.388 1.00 42.04  ? 126  LEU A CA    1 
ATOM   736   C  C     . LEU A  1 126 ? -22.687 -18.649 62.086 1.00 42.05  ? 126  LEU A C     1 
ATOM   737   O  O     . LEU A  1 126 ? -21.784 -18.656 61.254 1.00 42.15  ? 126  LEU A O     1 
ATOM   738   C  CB    . LEU A  1 126 ? -22.473 -18.847 64.559 1.00 41.45  ? 126  LEU A CB    1 
ATOM   739   C  CG    . LEU A  1 126 ? -21.477 -19.992 64.447 1.00 40.37  ? 126  LEU A CG    1 
ATOM   740   C  CD1   . LEU A  1 126 ? -20.038 -19.485 64.537 1.00 40.26  ? 126  LEU A CD1   1 
ATOM   741   C  CD2   . LEU A  1 126 ? -21.767 -21.038 65.511 1.00 38.68  ? 126  LEU A CD2   1 
ATOM   742   N  N     . ALA A  1 127 ? -23.839 -19.288 61.910 1.00 41.82  ? 127  ALA A N     1 
ATOM   743   C  CA    . ALA A  1 127 ? -24.128 -19.976 60.666 1.00 42.03  ? 127  ALA A CA    1 
ATOM   744   C  C     . ALA A  1 127 ? -23.802 -19.116 59.434 1.00 42.34  ? 127  ALA A C     1 
ATOM   745   O  O     . ALA A  1 127 ? -23.125 -19.568 58.519 1.00 42.79  ? 127  ALA A O     1 
ATOM   746   C  CB    . ALA A  1 127 ? -25.558 -20.415 60.641 1.00 41.96  ? 127  ALA A CB    1 
ATOM   747   N  N     . ARG A  1 128 ? -24.252 -17.868 59.425 1.00 42.44  ? 128  ARG A N     1 
ATOM   748   C  CA    . ARG A  1 128 ? -24.014 -16.992 58.292 1.00 42.51  ? 128  ARG A CA    1 
ATOM   749   C  C     . ARG A  1 128 ? -22.548 -16.637 58.097 1.00 42.85  ? 128  ARG A C     1 
ATOM   750   O  O     . ARG A  1 128 ? -22.070 -16.606 56.970 1.00 42.97  ? 128  ARG A O     1 
ATOM   751   C  CB    . ARG A  1 128 ? -24.873 -15.743 58.398 1.00 42.49  ? 128  ARG A CB    1 
ATOM   752   C  CG    . ARG A  1 128 ? -26.325 -16.039 58.131 1.00 42.73  ? 128  ARG A CG    1 
ATOM   753   C  CD    . ARG A  1 128 ? -27.176 -14.794 57.957 1.00 44.15  ? 128  ARG A CD    1 
ATOM   754   N  NE    . ARG A  1 128 ? -26.792 -13.947 56.826 1.00 44.88  ? 128  ARG A NE    1 
ATOM   755   C  CZ    . ARG A  1 128 ? -26.375 -12.689 56.957 1.00 45.53  ? 128  ARG A CZ    1 
ATOM   756   N  NH1   . ARG A  1 128 ? -26.297 -12.150 58.169 1.00 45.61  ? 128  ARG A NH1   1 
ATOM   757   N  NH2   . ARG A  1 128 ? -26.044 -11.968 55.890 1.00 45.48  ? 128  ARG A NH2   1 
ATOM   758   N  N     . ARG A  1 129 ? -21.836 -16.373 59.187 1.00 43.37  ? 129  ARG A N     1 
ATOM   759   C  CA    . ARG A  1 129 ? -20.403 -16.048 59.114 1.00 44.03  ? 129  ARG A CA    1 
ATOM   760   C  C     . ARG A  1 129 ? -19.623 -17.225 58.524 1.00 44.04  ? 129  ARG A C     1 
ATOM   761   O  O     . ARG A  1 129 ? -18.711 -17.045 57.719 1.00 43.51  ? 129  ARG A O     1 
ATOM   762   C  CB    . ARG A  1 129 ? -19.870 -15.593 60.497 1.00 44.16  ? 129  ARG A CB    1 
ATOM   763   C  CG    . ARG A  1 129 ? -18.414 -15.933 60.862 1.00 45.51  ? 129  ARG A CG    1 
ATOM   764   C  CD    . ARG A  1 129 ? -17.374 -15.078 60.126 1.00 49.84  ? 129  ARG A CD    1 
ATOM   765   N  NE    . ARG A  1 129 ? -15.999 -15.606 60.220 1.00 52.92  ? 129  ARG A NE    1 
ATOM   766   C  CZ    . ARG A  1 129 ? -15.545 -16.702 59.588 1.00 54.23  ? 129  ARG A CZ    1 
ATOM   767   N  NH1   . ARG A  1 129 ? -16.353 -17.430 58.817 1.00 54.53  ? 129  ARG A NH1   1 
ATOM   768   N  NH2   . ARG A  1 129 ? -14.280 -17.093 59.735 1.00 53.92  ? 129  ARG A NH2   1 
ATOM   769   N  N     . ILE A  1 130 ? -20.031 -18.431 58.900 1.00 44.65  ? 130  ILE A N     1 
ATOM   770   C  CA    . ILE A  1 130 ? -19.364 -19.645 58.447 1.00 45.04  ? 130  ILE A CA    1 
ATOM   771   C  C     . ILE A  1 130 ? -19.757 -19.971 57.012 1.00 45.93  ? 130  ILE A C     1 
ATOM   772   O  O     . ILE A  1 130 ? -18.960 -20.522 56.263 1.00 45.87  ? 130  ILE A O     1 
ATOM   773   C  CB    . ILE A  1 130 ? -19.597 -20.810 59.421 1.00 44.49  ? 130  ILE A CB    1 
ATOM   774   C  CG1   . ILE A  1 130 ? -18.894 -20.513 60.735 1.00 43.43  ? 130  ILE A CG1   1 
ATOM   775   C  CG2   . ILE A  1 130 ? -19.025 -22.075 58.897 1.00 44.14  ? 130  ILE A CG2   1 
ATOM   776   C  CD1   . ILE A  1 130 ? -19.108 -21.553 61.758 1.00 42.01  ? 130  ILE A CD1   1 
ATOM   777   N  N     . ARG A  1 131 ? -20.963 -19.588 56.613 1.00 47.27  ? 131  ARG A N     1 
ATOM   778   C  CA    . ARG A  1 131 ? -21.371 -19.715 55.211 1.00 48.85  ? 131  ARG A CA    1 
ATOM   779   C  C     . ARG A  1 131 ? -20.606 -18.776 54.255 1.00 50.36  ? 131  ARG A C     1 
ATOM   780   O  O     . ARG A  1 131 ? -20.628 -18.968 53.030 1.00 50.27  ? 131  ARG A O     1 
ATOM   781   C  CB    . ARG A  1 131 ? -22.869 -19.483 55.071 1.00 48.46  ? 131  ARG A CB    1 
ATOM   782   C  CG    . ARG A  1 131 ? -23.714 -20.625 55.525 1.00 47.76  ? 131  ARG A CG    1 
ATOM   783   C  CD    . ARG A  1 131 ? -25.100 -20.123 55.801 1.00 47.78  ? 131  ARG A CD    1 
ATOM   784   N  NE    . ARG A  1 131 ? -26.103 -21.170 55.664 1.00 48.19  ? 131  ARG A NE    1 
ATOM   785   C  CZ    . ARG A  1 131 ? -27.262 -21.011 55.034 1.00 48.83  ? 131  ARG A CZ    1 
ATOM   786   N  NH1   . ARG A  1 131 ? -27.554 -19.842 54.465 1.00 48.37  ? 131  ARG A NH1   1 
ATOM   787   N  NH2   . ARG A  1 131 ? -28.125 -22.022 54.957 1.00 49.00  ? 131  ARG A NH2   1 
ATOM   788   N  N     . GLY A  1 132 ? -19.938 -17.771 54.820 1.00 51.98  ? 132  GLY A N     1 
ATOM   789   C  CA    . GLY A  1 132 ? -19.260 -16.765 54.027 1.00 54.55  ? 132  GLY A CA    1 
ATOM   790   C  C     . GLY A  1 132 ? -20.181 -15.614 53.656 1.00 56.61  ? 132  GLY A C     1 
ATOM   791   O  O     . GLY A  1 132 ? -19.842 -14.786 52.811 1.00 57.15  ? 132  GLY A O     1 
ATOM   792   N  N     . GLU A  1 133 ? -21.349 -15.547 54.286 1.00 58.35  ? 133  GLU A N     1 
ATOM   793   C  CA    . GLU A  1 133 ? -22.269 -14.448 54.041 1.00 60.16  ? 133  GLU A CA    1 
ATOM   794   C  C     . GLU A  1 133 ? -21.851 -13.205 54.822 1.00 62.29  ? 133  GLU A C     1 
ATOM   795   O  O     . GLU A  1 133 ? -22.203 -12.089 54.441 1.00 62.64  ? 133  GLU A O     1 
ATOM   796   C  CB    . GLU A  1 133 ? -23.710 -14.860 54.354 1.00 59.89  ? 133  GLU A CB    1 
ATOM   797   C  CG    . GLU A  1 133 ? -24.233 -15.966 53.426 1.00 59.70  ? 133  GLU A CG    1 
ATOM   798   C  CD    . GLU A  1 133 ? -25.623 -16.479 53.776 1.00 59.44  ? 133  GLU A CD    1 
ATOM   799   O  OE1   . GLU A  1 133 ? -26.312 -15.820 54.579 1.00 58.93  ? 133  GLU A OE1   1 
ATOM   800   O  OE2   . GLU A  1 133 ? -26.028 -17.540 53.242 1.00 57.40  ? 133  GLU A OE2   1 
ATOM   801   N  N     . ARG A  1 134 ? -21.089 -13.396 55.903 1.00 64.74  ? 134  ARG A N     1 
ATOM   802   C  CA    . ARG A  1 134 ? -20.561 -12.270 56.697 1.00 67.48  ? 134  ARG A CA    1 
ATOM   803   C  C     . ARG A  1 134 ? -19.020 -12.181 56.693 1.00 68.35  ? 134  ARG A C     1 
ATOM   804   O  O     . ARG A  1 134 ? -18.450 -11.105 56.977 1.00 68.80  ? 134  ARG A O     1 
ATOM   805   C  CB    . ARG A  1 134 ? -21.057 -12.303 58.150 1.00 67.40  ? 134  ARG A CB    1 
ATOM   806   C  CG    . ARG A  1 134 ? -22.485 -12.787 58.365 1.00 68.89  ? 134  ARG A CG    1 
ATOM   807   C  CD    . ARG A  1 134 ? -22.973 -12.471 59.790 1.00 69.43  ? 134  ARG A CD    1 
ATOM   808   N  NE    . ARG A  1 134 ? -22.001 -12.853 60.818 1.00 74.28  ? 134  ARG A NE    1 
ATOM   809   C  CZ    . ARG A  1 134 ? -21.943 -12.324 62.044 1.00 76.72  ? 134  ARG A CZ    1 
ATOM   810   N  NH1   . ARG A  1 134 ? -22.807 -11.374 62.416 1.00 77.66  ? 134  ARG A NH1   1 
ATOM   811   N  NH2   . ARG A  1 134 ? -21.012 -12.744 62.906 1.00 77.75  ? 134  ARG A NH2   1 
ATOM   812   N  N     . ALA A  1 135 ? -18.350 -13.301 56.396 1.00 69.36  ? 135  ALA A N     1 
ATOM   813   C  CA    . ALA A  1 135 ? -16.886 -13.302 56.224 1.00 70.37  ? 135  ALA A CA    1 
ATOM   814   C  C     . ALA A  1 135 ? -16.423 -12.652 54.876 1.00 71.07  ? 135  ALA A C     1 
ATOM   815   O  O     . ALA A  1 135 ? -16.870 -12.983 53.746 1.00 71.26  ? 135  ALA A O     1 
ATOM   816   C  CB    . ALA A  1 135 ? -16.311 -14.725 56.392 1.00 70.13  ? 135  ALA A CB    1 
ATOM   817   O  OXT   . ALA A  1 135 ? -15.562 -11.746 54.891 1.00 71.27  ? 135  ALA A OXT   1 
ATOM   818   N  N     . ASP B  2 24  ? -45.393 -0.860  58.194 1.00 74.62  ? 24   ASP B N     1 
ATOM   819   C  CA    . ASP B  2 24  ? -45.193 -2.331  58.013 1.00 74.71  ? 24   ASP B CA    1 
ATOM   820   C  C     . ASP B  2 24  ? -44.172 -2.685  56.911 1.00 74.26  ? 24   ASP B C     1 
ATOM   821   O  O     . ASP B  2 24  ? -43.040 -2.171  56.893 1.00 74.59  ? 24   ASP B O     1 
ATOM   822   C  CB    . ASP B  2 24  ? -46.543 -3.027  57.747 1.00 75.05  ? 24   ASP B CB    1 
ATOM   823   C  CG    . ASP B  2 24  ? -47.208 -3.549  59.029 1.00 76.47  ? 24   ASP B CG    1 
ATOM   824   O  OD1   . ASP B  2 24  ? -47.384 -2.754  59.986 1.00 77.32  ? 24   ASP B OD1   1 
ATOM   825   O  OD2   . ASP B  2 24  ? -47.567 -4.755  59.071 1.00 77.65  ? 24   ASP B OD2   1 
ATOM   826   N  N     . ASN B  2 25  ? -44.599 -3.566  55.999 1.00 73.47  ? 25   ASN B N     1 
ATOM   827   C  CA    . ASN B  2 25  ? -43.790 -4.117  54.883 1.00 72.17  ? 25   ASN B CA    1 
ATOM   828   C  C     . ASN B  2 25  ? -42.855 -5.270  55.225 1.00 71.19  ? 25   ASN B C     1 
ATOM   829   O  O     . ASN B  2 25  ? -43.267 -6.431  55.127 1.00 70.91  ? 25   ASN B O     1 
ATOM   830   C  CB    . ASN B  2 25  ? -43.116 -3.029  54.053 1.00 71.97  ? 25   ASN B CB    1 
ATOM   831   C  CG    . ASN B  2 25  ? -44.020 -2.527  52.961 1.00 71.90  ? 25   ASN B CG    1 
ATOM   832   O  OD1   . ASN B  2 25  ? -45.009 -3.189  52.594 1.00 70.34  ? 25   ASN B OD1   1 
ATOM   833   N  ND2   . ASN B  2 25  ? -43.701 -1.353  52.430 1.00 72.20  ? 25   ASN B ND2   1 
ATOM   834   N  N     . ILE B  2 26  ? -41.619 -4.963  55.615 1.00 69.95  ? 26   ILE B N     1 
ATOM   835   C  CA    . ILE B  2 26  ? -40.762 -5.991  56.183 1.00 68.94  ? 26   ILE B CA    1 
ATOM   836   C  C     . ILE B  2 26  ? -41.424 -6.503  57.448 1.00 68.16  ? 26   ILE B C     1 
ATOM   837   O  O     . ILE B  2 26  ? -41.394 -7.697  57.727 1.00 68.27  ? 26   ILE B O     1 
ATOM   838   C  CB    . ILE B  2 26  ? -39.337 -5.497  56.502 1.00 69.11  ? 26   ILE B CB    1 
ATOM   839   C  CG1   . ILE B  2 26  ? -38.476 -6.654  57.023 1.00 68.62  ? 26   ILE B CG1   1 
ATOM   840   C  CG2   . ILE B  2 26  ? -39.361 -4.362  57.533 1.00 69.73  ? 26   ILE B CG2   1 
ATOM   841   C  CD1   . ILE B  2 26  ? -38.248 -7.759  56.021 1.00 67.71  ? 26   ILE B CD1   1 
ATOM   842   N  N     . GLN B  2 27  ? -42.040 -5.590  58.194 1.00 67.03  ? 27   GLN B N     1 
ATOM   843   C  CA    . GLN B  2 27  ? -42.815 -5.940  59.378 1.00 66.02  ? 27   GLN B CA    1 
ATOM   844   C  C     . GLN B  2 27  ? -44.077 -6.742  59.047 1.00 65.19  ? 27   GLN B C     1 
ATOM   845   O  O     . GLN B  2 27  ? -44.697 -7.335  59.933 1.00 65.02  ? 27   GLN B O     1 
ATOM   846   C  CB    . GLN B  2 27  ? -43.155 -4.678  60.158 1.00 65.95  ? 27   GLN B CB    1 
ATOM   847   C  CG    . GLN B  2 27  ? -41.935 -4.046  60.799 1.00 66.22  ? 27   GLN B CG    1 
ATOM   848   C  CD    . GLN B  2 27  ? -41.316 -4.936  61.860 1.00 66.73  ? 27   GLN B CD    1 
ATOM   849   O  OE1   . GLN B  2 27  ? -41.984 -5.809  62.427 1.00 66.89  ? 27   GLN B OE1   1 
ATOM   850   N  NE2   . GLN B  2 27  ? -40.034 -4.722  62.134 1.00 67.11  ? 27   GLN B NE2   1 
ATOM   851   N  N     . GLY B  2 28  ? -44.433 -6.767  57.764 1.00 64.18  ? 28   GLY B N     1 
ATOM   852   C  CA    . GLY B  2 28  ? -45.517 -7.603  57.265 1.00 63.15  ? 28   GLY B CA    1 
ATOM   853   C  C     . GLY B  2 28  ? -45.187 -9.090  57.268 1.00 62.35  ? 28   GLY B C     1 
ATOM   854   O  O     . GLY B  2 28  ? -46.088 -9.940  57.382 1.00 62.50  ? 28   GLY B O     1 
ATOM   855   N  N     . ILE B  2 29  ? -43.898 -9.404  57.115 1.00 61.14  ? 29   ILE B N     1 
ATOM   856   C  CA    . ILE B  2 29  ? -43.393 -10.765 57.278 1.00 59.50  ? 29   ILE B CA    1 
ATOM   857   C  C     . ILE B  2 29  ? -43.523 -11.076 58.768 1.00 59.12  ? 29   ILE B C     1 
ATOM   858   O  O     . ILE B  2 29  ? -42.677 -10.698 59.581 1.00 59.13  ? 29   ILE B O     1 
ATOM   859   C  CB    . ILE B  2 29  ? -41.934 -10.887 56.779 1.00 59.07  ? 29   ILE B CB    1 
ATOM   860   C  CG1   . ILE B  2 29  ? -41.786 -10.285 55.385 1.00 57.78  ? 29   ILE B CG1   1 
ATOM   861   C  CG2   . ILE B  2 29  ? -41.474 -12.325 56.773 1.00 59.09  ? 29   ILE B CG2   1 
ATOM   862   C  CD1   . ILE B  2 29  ? -42.518 -11.016 54.288 1.00 55.99  ? 29   ILE B CD1   1 
ATOM   863   N  N     . THR B  2 30  ? -44.614 -11.743 59.116 1.00 58.50  ? 30   THR B N     1 
ATOM   864   C  CA    . THR B  2 30  ? -45.055 -11.849 60.505 1.00 58.05  ? 30   THR B CA    1 
ATOM   865   C  C     . THR B  2 30  ? -44.346 -12.917 61.310 1.00 57.68  ? 30   THR B C     1 
ATOM   866   O  O     . THR B  2 30  ? -43.865 -13.908 60.751 1.00 57.55  ? 30   THR B O     1 
ATOM   867   C  CB    . THR B  2 30  ? -46.566 -12.148 60.582 1.00 58.10  ? 30   THR B CB    1 
ATOM   868   O  OG1   . THR B  2 30  ? -46.874 -13.328 59.821 1.00 57.72  ? 30   THR B OG1   1 
ATOM   869   C  CG2   . THR B  2 30  ? -47.360 -10.972 60.047 1.00 58.72  ? 30   THR B CG2   1 
ATOM   870   N  N     . LYS B  2 31  ? -44.320 -12.710 62.629 1.00 57.21  ? 31   LYS B N     1 
ATOM   871   C  CA    . LYS B  2 31  ? -43.872 -13.716 63.609 1.00 56.88  ? 31   LYS B CA    1 
ATOM   872   C  C     . LYS B  2 31  ? -44.366 -15.182 63.396 1.00 56.57  ? 31   LYS B C     1 
ATOM   873   O  O     . LYS B  2 31  ? -43.549 -16.108 63.404 1.00 56.89  ? 31   LYS B O     1 
ATOM   874   C  CB    . LYS B  2 31  ? -44.155 -13.237 65.035 1.00 56.58  ? 31   LYS B CB    1 
ATOM   875   C  CG    . LYS B  2 31  ? -44.197 -14.360 66.049 1.00 57.81  ? 31   LYS B CG    1 
ATOM   876   C  CD    . LYS B  2 31  ? -44.162 -13.848 67.476 1.00 59.67  ? 31   LYS B CD    1 
ATOM   877   C  CE    . LYS B  2 31  ? -44.298 -14.998 68.472 1.00 59.71  ? 31   LYS B CE    1 
ATOM   878   N  NZ    . LYS B  2 31  ? -44.086 -14.476 69.850 1.00 60.95  ? 31   LYS B NZ    1 
ATOM   879   N  N     . PRO B  2 32  ? -45.685 -15.408 63.228 1.00 56.08  ? 32   PRO B N     1 
ATOM   880   C  CA    . PRO B  2 32  ? -46.124 -16.784 62.975 1.00 55.62  ? 32   PRO B CA    1 
ATOM   881   C  C     . PRO B  2 32  ? -45.578 -17.405 61.687 1.00 55.19  ? 32   PRO B C     1 
ATOM   882   O  O     . PRO B  2 32  ? -45.361 -18.612 61.641 1.00 55.24  ? 32   PRO B O     1 
ATOM   883   C  CB    . PRO B  2 32  ? -47.645 -16.651 62.885 1.00 55.84  ? 32   PRO B CB    1 
ATOM   884   C  CG    . PRO B  2 32  ? -47.889 -15.211 62.570 1.00 55.94  ? 32   PRO B CG    1 
ATOM   885   C  CD    . PRO B  2 32  ? -46.830 -14.484 63.300 1.00 56.12  ? 32   PRO B CD    1 
ATOM   886   N  N     . ALA B  2 33  ? -45.374 -16.589 60.655 1.00 54.86  ? 33   ALA B N     1 
ATOM   887   C  CA    . ALA B  2 33  ? -44.845 -17.058 59.371 1.00 54.36  ? 33   ALA B CA    1 
ATOM   888   C  C     . ALA B  2 33  ? -43.381 -17.443 59.519 1.00 54.13  ? 33   ALA B C     1 
ATOM   889   O  O     . ALA B  2 33  ? -42.936 -18.477 59.012 1.00 53.85  ? 33   ALA B O     1 
ATOM   890   C  CB    . ALA B  2 33  ? -44.997 -15.991 58.327 1.00 54.30  ? 33   ALA B CB    1 
ATOM   891   N  N     . ILE B  2 34  ? -42.642 -16.594 60.229 1.00 53.80  ? 34   ILE B N     1 
ATOM   892   C  CA    . ILE B  2 34  ? -41.256 -16.866 60.569 1.00 53.34  ? 34   ILE B CA    1 
ATOM   893   C  C     . ILE B  2 34  ? -41.201 -18.134 61.403 1.00 53.45  ? 34   ILE B C     1 
ATOM   894   O  O     . ILE B  2 34  ? -40.284 -18.936 61.247 1.00 53.54  ? 34   ILE B O     1 
ATOM   895   C  CB    . ILE B  2 34  ? -40.601 -15.673 61.313 1.00 53.07  ? 34   ILE B CB    1 
ATOM   896   C  CG1   . ILE B  2 34  ? -40.390 -14.503 60.351 1.00 52.18  ? 34   ILE B CG1   1 
ATOM   897   C  CG2   . ILE B  2 34  ? -39.276 -16.076 61.924 1.00 52.81  ? 34   ILE B CG2   1 
ATOM   898   C  CD1   . ILE B  2 34  ? -40.132 -13.180 61.038 1.00 52.46  ? 34   ILE B CD1   1 
ATOM   899   N  N     . ARG B  2 35  ? -42.197 -18.325 62.264 1.00 53.54  ? 35   ARG B N     1 
ATOM   900   C  CA    . ARG B  2 35  ? -42.262 -19.534 63.070 1.00 54.25  ? 35   ARG B CA    1 
ATOM   901   C  C     . ARG B  2 35  ? -42.449 -20.758 62.174 1.00 53.53  ? 35   ARG B C     1 
ATOM   902   O  O     . ARG B  2 35  ? -41.728 -21.743 62.331 1.00 53.75  ? 35   ARG B O     1 
ATOM   903   C  CB    . ARG B  2 35  ? -43.332 -19.431 64.166 1.00 54.14  ? 35   ARG B CB    1 
ATOM   904   C  CG    . ARG B  2 35  ? -43.791 -20.777 64.742 1.00 56.15  ? 35   ARG B CG    1 
ATOM   905   C  CD    . ARG B  2 35  ? -44.713 -20.629 65.938 1.00 56.78  ? 35   ARG B CD    1 
ATOM   906   N  NE    . ARG B  2 35  ? -43.928 -20.356 67.141 1.00 63.26  ? 35   ARG B NE    1 
ATOM   907   C  CZ    . ARG B  2 35  ? -43.752 -19.150 67.684 1.00 66.63  ? 35   ARG B CZ    1 
ATOM   908   N  NH1   . ARG B  2 35  ? -44.333 -18.073 67.149 1.00 68.26  ? 35   ARG B NH1   1 
ATOM   909   N  NH2   . ARG B  2 35  ? -42.997 -19.019 68.778 1.00 67.85  ? 35   ARG B NH2   1 
ATOM   910   N  N     . ARG B  2 36  ? -43.379 -20.686 61.219 1.00 52.96  ? 36   ARG B N     1 
ATOM   911   C  CA    . ARG B  2 36  ? -43.607 -21.790 60.273 1.00 52.40  ? 36   ARG B CA    1 
ATOM   912   C  C     . ARG B  2 36  ? -42.343 -22.222 59.511 1.00 51.67  ? 36   ARG B C     1 
ATOM   913   O  O     . ARG B  2 36  ? -42.048 -23.413 59.410 1.00 51.79  ? 36   ARG B O     1 
ATOM   914   C  CB    . ARG B  2 36  ? -44.730 -21.457 59.295 1.00 52.52  ? 36   ARG B CB    1 
ATOM   915   C  CG    . ARG B  2 36  ? -46.111 -21.603 59.888 1.00 53.57  ? 36   ARG B CG    1 
ATOM   916   C  CD    . ARG B  2 36  ? -47.188 -21.558 58.804 1.00 55.86  ? 36   ARG B CD    1 
ATOM   917   N  NE    . ARG B  2 36  ? -47.279 -20.253 58.153 1.00 58.71  ? 36   ARG B NE    1 
ATOM   918   C  CZ    . ARG B  2 36  ? -47.729 -19.146 58.749 1.00 60.48  ? 36   ARG B CZ    1 
ATOM   919   N  NH1   . ARG B  2 36  ? -48.132 -19.173 60.015 1.00 61.67  ? 36   ARG B NH1   1 
ATOM   920   N  NH2   . ARG B  2 36  ? -47.775 -18.003 58.083 1.00 60.97  ? 36   ARG B NH2   1 
ATOM   921   N  N     . LEU B  2 37  ? -41.599 -21.254 58.990 1.00 50.64  ? 37   LEU B N     1 
ATOM   922   C  CA    . LEU B  2 37  ? -40.345 -21.535 58.312 1.00 49.67  ? 37   LEU B CA    1 
ATOM   923   C  C     . LEU B  2 37  ? -39.389 -22.297 59.214 1.00 49.56  ? 37   LEU B C     1 
ATOM   924   O  O     . LEU B  2 37  ? -38.899 -23.382 58.857 1.00 49.71  ? 37   LEU B O     1 
ATOM   925   C  CB    . LEU B  2 37  ? -39.708 -20.238 57.857 1.00 49.32  ? 37   LEU B CB    1 
ATOM   926   C  CG    . LEU B  2 37  ? -40.456 -19.622 56.688 1.00 48.71  ? 37   LEU B CG    1 
ATOM   927   C  CD1   . LEU B  2 37  ? -40.160 -18.140 56.610 1.00 48.31  ? 37   LEU B CD1   1 
ATOM   928   C  CD2   . LEU B  2 37  ? -40.096 -20.337 55.396 1.00 47.84  ? 37   LEU B CD2   1 
ATOM   929   N  N     . ALA B  2 38  ? -39.142 -21.731 60.392 1.00 48.98  ? 38   ALA B N     1 
ATOM   930   C  CA    . ALA B  2 38  ? -38.311 -22.367 61.406 1.00 48.28  ? 38   ALA B CA    1 
ATOM   931   C  C     . ALA B  2 38  ? -38.662 -23.841 61.561 1.00 47.90  ? 38   ALA B C     1 
ATOM   932   O  O     . ALA B  2 38  ? -37.780 -24.691 61.568 1.00 47.68  ? 38   ALA B O     1 
ATOM   933   C  CB    . ALA B  2 38  ? -38.473 -21.646 62.717 1.00 48.19  ? 38   ALA B CB    1 
ATOM   934   N  N     . ARG B  2 39  ? -39.962 -24.120 61.651 1.00 47.62  ? 39   ARG B N     1 
ATOM   935   C  CA    . ARG B  2 39  ? -40.484 -25.461 61.864 1.00 47.32  ? 39   ARG B CA    1 
ATOM   936   C  C     . ARG B  2 39  ? -40.112 -26.401 60.734 1.00 47.24  ? 39   ARG B C     1 
ATOM   937   O  O     . ARG B  2 39  ? -39.537 -27.458 60.971 1.00 47.31  ? 39   ARG B O     1 
ATOM   938   C  CB    . ARG B  2 39  ? -41.992 -25.414 62.043 1.00 47.18  ? 39   ARG B CB    1 
ATOM   939   C  CG    . ARG B  2 39  ? -42.442 -24.664 63.285 1.00 47.64  ? 39   ARG B CG    1 
ATOM   940   C  CD    . ARG B  2 39  ? -42.434 -25.555 64.508 1.00 49.25  ? 39   ARG B CD    1 
ATOM   941   N  NE    . ARG B  2 39  ? -43.011 -24.907 65.684 1.00 50.35  ? 39   ARG B NE    1 
ATOM   942   C  CZ    . ARG B  2 39  ? -42.306 -24.311 66.642 1.00 52.27  ? 39   ARG B CZ    1 
ATOM   943   N  NH1   . ARG B  2 39  ? -40.983 -24.259 66.581 1.00 53.48  ? 39   ARG B NH1   1 
ATOM   944   N  NH2   . ARG B  2 39  ? -42.925 -23.768 67.673 1.00 53.95  ? 39   ARG B NH2   1 
ATOM   945   N  N     . ARG B  2 40  ? -40.417 -26.013 59.504 1.00 47.13  ? 40   ARG B N     1 
ATOM   946   C  CA    . ARG B  2 40  ? -39.962 -26.774 58.350 1.00 47.22  ? 40   ARG B CA    1 
ATOM   947   C  C     . ARG B  2 40  ? -38.444 -27.020 58.413 1.00 47.30  ? 40   ARG B C     1 
ATOM   948   O  O     . ARG B  2 40  ? -37.946 -28.038 57.908 1.00 47.12  ? 40   ARG B O     1 
ATOM   949   C  CB    . ARG B  2 40  ? -40.343 -26.047 57.062 1.00 47.23  ? 40   ARG B CB    1 
ATOM   950   C  CG    . ARG B  2 40  ? -40.189 -26.886 55.806 1.00 47.43  ? 40   ARG B CG    1 
ATOM   951   C  CD    . ARG B  2 40  ? -40.897 -26.254 54.636 1.00 47.95  ? 40   ARG B CD    1 
ATOM   952   N  NE    . ARG B  2 40  ? -42.251 -26.767 54.448 1.00 48.31  ? 40   ARG B NE    1 
ATOM   953   C  CZ    . ARG B  2 40  ? -43.215 -26.108 53.802 1.00 49.16  ? 40   ARG B CZ    1 
ATOM   954   N  NH1   . ARG B  2 40  ? -42.979 -24.901 53.293 1.00 48.17  ? 40   ARG B NH1   1 
ATOM   955   N  NH2   . ARG B  2 40  ? -44.419 -26.651 53.666 1.00 49.23  ? 40   ARG B NH2   1 
ATOM   956   N  N     . GLY B  2 41  ? -37.725 -26.090 59.049 1.00 47.29  ? 41   GLY B N     1 
ATOM   957   C  CA    . GLY B  2 41  ? -36.273 -26.199 59.231 1.00 47.19  ? 41   GLY B CA    1 
ATOM   958   C  C     . GLY B  2 41  ? -35.867 -26.991 60.462 1.00 47.18  ? 41   GLY B C     1 
ATOM   959   O  O     . GLY B  2 41  ? -34.690 -27.065 60.806 1.00 47.36  ? 41   GLY B O     1 
ATOM   960   N  N     . GLY B  2 42  ? -36.846 -27.577 61.137 1.00 47.16  ? 42   GLY B N     1 
ATOM   961   C  CA    . GLY B  2 42  ? -36.574 -28.474 62.240 1.00 47.26  ? 42   GLY B CA    1 
ATOM   962   C  C     . GLY B  2 42  ? -36.520 -27.816 63.598 1.00 47.58  ? 42   GLY B C     1 
ATOM   963   O  O     . GLY B  2 42  ? -36.270 -28.493 64.587 1.00 48.01  ? 42   GLY B O     1 
ATOM   964   N  N     . VAL B  2 43  ? -36.765 -26.510 63.665 1.00 47.69  ? 43   VAL B N     1 
ATOM   965   C  CA    . VAL B  2 43  ? -36.623 -25.762 64.928 1.00 47.90  ? 43   VAL B CA    1 
ATOM   966   C  C     . VAL B  2 43  ? -37.785 -25.967 65.921 1.00 47.97  ? 43   VAL B C     1 
ATOM   967   O  O     . VAL B  2 43  ? -38.956 -25.831 65.561 1.00 47.66  ? 43   VAL B O     1 
ATOM   968   C  CB    . VAL B  2 43  ? -36.419 -24.248 64.670 1.00 47.89  ? 43   VAL B CB    1 
ATOM   969   C  CG1   . VAL B  2 43  ? -36.439 -23.460 65.981 1.00 48.01  ? 43   VAL B CG1   1 
ATOM   970   C  CG2   . VAL B  2 43  ? -35.119 -24.006 63.939 1.00 47.67  ? 43   VAL B CG2   1 
ATOM   971   N  N     . LYS B  2 44  ? -37.440 -26.265 67.172 1.00 47.96  ? 44   LYS B N     1 
ATOM   972   C  CA    . LYS B  2 44  ? -38.432 -26.510 68.219 1.00 48.10  ? 44   LYS B CA    1 
ATOM   973   C  C     . LYS B  2 44  ? -38.691 -25.283 69.098 1.00 48.43  ? 44   LYS B C     1 
ATOM   974   O  O     . LYS B  2 44  ? -39.827 -24.967 69.435 1.00 48.96  ? 44   LYS B O     1 
ATOM   975   C  CB    . LYS B  2 44  ? -37.964 -27.670 69.091 1.00 47.94  ? 44   LYS B CB    1 
ATOM   976   C  CG    . LYS B  2 44  ? -38.850 -28.002 70.271 1.00 47.85  ? 44   LYS B CG    1 
ATOM   977   C  CD    . LYS B  2 44  ? -38.268 -29.165 71.080 1.00 48.17  ? 44   LYS B CD    1 
ATOM   978   C  CE    . LYS B  2 44  ? -39.225 -29.640 72.173 1.00 47.71  ? 44   LYS B CE    1 
ATOM   979   N  NZ    . LYS B  2 44  ? -38.886 -31.007 72.619 1.00 47.28  ? 44   LYS B NZ    1 
ATOM   980   N  N     . ARG B  2 45  ? -37.637 -24.586 69.477 1.00 48.64  ? 45   ARG B N     1 
ATOM   981   C  CA    . ARG B  2 45  ? -37.785 -23.518 70.431 1.00 48.86  ? 45   ARG B CA    1 
ATOM   982   C  C     . ARG B  2 45  ? -37.084 -22.264 69.927 1.00 48.86  ? 45   ARG B C     1 
ATOM   983   O  O     . ARG B  2 45  ? -35.907 -22.311 69.549 1.00 49.25  ? 45   ARG B O     1 
ATOM   984   C  CB    . ARG B  2 45  ? -37.212 -23.971 71.756 1.00 49.10  ? 45   ARG B CB    1 
ATOM   985   C  CG    . ARG B  2 45  ? -37.877 -23.344 72.924 1.00 50.87  ? 45   ARG B CG    1 
ATOM   986   C  CD    . ARG B  2 45  ? -37.406 -23.989 74.202 1.00 53.13  ? 45   ARG B CD    1 
ATOM   987   N  NE    . ARG B  2 45  ? -38.013 -23.317 75.339 1.00 54.64  ? 45   ARG B NE    1 
ATOM   988   C  CZ    . ARG B  2 45  ? -37.511 -22.241 75.926 1.00 56.05  ? 45   ARG B CZ    1 
ATOM   989   N  NH1   . ARG B  2 45  ? -36.369 -21.704 75.510 1.00 55.60  ? 45   ARG B NH1   1 
ATOM   990   N  NH2   . ARG B  2 45  ? -38.157 -21.709 76.948 1.00 58.87  ? 45   ARG B NH2   1 
ATOM   991   N  N     . ILE B  2 46  ? -37.811 -21.146 69.930 1.00 48.39  ? 46   ILE B N     1 
ATOM   992   C  CA    . ILE B  2 46  ? -37.393 -19.929 69.240 1.00 47.69  ? 46   ILE B CA    1 
ATOM   993   C  C     . ILE B  2 46  ? -37.284 -18.745 70.199 1.00 47.74  ? 46   ILE B C     1 
ATOM   994   O  O     . ILE B  2 46  ? -38.243 -18.419 70.894 1.00 47.81  ? 46   ILE B O     1 
ATOM   995   C  CB    . ILE B  2 46  ? -38.391 -19.609 68.103 1.00 47.61  ? 46   ILE B CB    1 
ATOM   996   C  CG1   . ILE B  2 46  ? -38.425 -20.752 67.088 1.00 46.44  ? 46   ILE B CG1   1 
ATOM   997   C  CG2   . ILE B  2 46  ? -38.053 -18.295 67.421 1.00 48.06  ? 46   ILE B CG2   1 
ATOM   998   C  CD1   . ILE B  2 46  ? -39.494 -20.606 66.050 1.00 45.64  ? 46   ILE B CD1   1 
ATOM   999   N  N     . SER B  2 47  ? -36.110 -18.116 70.240 1.00 47.81  ? 47   SER B N     1 
ATOM   1000  C  CA    . SER B  2 47  ? -35.876 -16.936 71.082 1.00 47.84  ? 47   SER B CA    1 
ATOM   1001  C  C     . SER B  2 47  ? -36.637 -15.736 70.557 1.00 47.80  ? 47   SER B C     1 
ATOM   1002  O  O     . SER B  2 47  ? -36.787 -15.561 69.347 1.00 47.19  ? 47   SER B O     1 
ATOM   1003  C  CB    . SER B  2 47  ? -34.383 -16.599 71.152 1.00 48.09  ? 47   SER B CB    1 
ATOM   1004  O  OG    . SER B  2 47  ? -34.153 -15.230 71.478 1.00 48.46  ? 47   SER B OG    1 
ATOM   1005  N  N     . GLY B  2 48  ? -37.093 -14.902 71.484 1.00 48.14  ? 48   GLY B N     1 
ATOM   1006  C  CA    . GLY B  2 48  ? -37.904 -13.735 71.152 1.00 48.86  ? 48   GLY B CA    1 
ATOM   1007  C  C     . GLY B  2 48  ? -37.237 -12.824 70.135 1.00 49.31  ? 48   GLY B C     1 
ATOM   1008  O  O     . GLY B  2 48  ? -37.911 -12.211 69.295 1.00 49.49  ? 48   GLY B O     1 
ATOM   1009  N  N     . LEU B  2 49  ? -35.908 -12.758 70.194 1.00 49.33  ? 49   LEU B N     1 
ATOM   1010  C  CA    . LEU B  2 49  ? -35.153 -11.835 69.364 1.00 49.43  ? 49   LEU B CA    1 
ATOM   1011  C  C     . LEU B  2 49  ? -34.983 -12.305 67.922 1.00 49.44  ? 49   LEU B C     1 
ATOM   1012  O  O     . LEU B  2 49  ? -34.539 -11.527 67.067 1.00 49.80  ? 49   LEU B O     1 
ATOM   1013  C  CB    . LEU B  2 49  ? -33.793 -11.553 69.992 1.00 49.64  ? 49   LEU B CB    1 
ATOM   1014  C  CG    . LEU B  2 49  ? -33.756 -10.863 71.362 1.00 50.11  ? 49   LEU B CG    1 
ATOM   1015  C  CD1   . LEU B  2 49  ? -32.357 -10.973 71.944 1.00 51.65  ? 49   LEU B CD1   1 
ATOM   1016  C  CD2   . LEU B  2 49  ? -34.193 -9.410  71.292 1.00 49.73  ? 49   LEU B CD2   1 
ATOM   1017  N  N     . ILE B  2 50  ? -35.353 -13.561 67.652 1.00 49.11  ? 50   ILE B N     1 
ATOM   1018  C  CA    . ILE B  2 50  ? -35.171 -14.167 66.326 1.00 48.65  ? 50   ILE B CA    1 
ATOM   1019  C  C     . ILE B  2 50  ? -35.945 -13.467 65.223 1.00 48.70  ? 50   ILE B C     1 
ATOM   1020  O  O     . ILE B  2 50  ? -35.453 -13.318 64.117 1.00 48.72  ? 50   ILE B O     1 
ATOM   1021  C  CB    . ILE B  2 50  ? -35.491 -15.684 66.332 1.00 48.53  ? 50   ILE B CB    1 
ATOM   1022  C  CG1   . ILE B  2 50  ? -34.316 -16.484 66.920 1.00 48.43  ? 50   ILE B CG1   1 
ATOM   1023  C  CG2   . ILE B  2 50  ? -35.860 -16.189 64.943 1.00 47.58  ? 50   ILE B CG2   1 
ATOM   1024  C  CD1   . ILE B  2 50  ? -32.968 -16.263 66.248 1.00 47.62  ? 50   ILE B CD1   1 
ATOM   1025  N  N     . TYR B  2 51  ? -37.150 -13.018 65.526 1.00 49.06  ? 51   TYR B N     1 
ATOM   1026  C  CA    . TYR B  2 51  ? -38.019 -12.503 64.478 1.00 49.33  ? 51   TYR B CA    1 
ATOM   1027  C  C     . TYR B  2 51  ? -37.424 -11.221 63.894 1.00 50.04  ? 51   TYR B C     1 
ATOM   1028  O  O     . TYR B  2 51  ? -37.373 -11.053 62.664 1.00 50.01  ? 51   TYR B O     1 
ATOM   1029  C  CB    . TYR B  2 51  ? -39.462 -12.357 64.985 1.00 48.76  ? 51   TYR B CB    1 
ATOM   1030  C  CG    . TYR B  2 51  ? -39.921 -13.577 65.775 1.00 47.67  ? 51   TYR B CG    1 
ATOM   1031  C  CD1   . TYR B  2 51  ? -40.463 -14.688 65.136 1.00 46.18  ? 51   TYR B CD1   1 
ATOM   1032  C  CD2   . TYR B  2 51  ? -39.775 -13.625 67.162 1.00 46.80  ? 51   TYR B CD2   1 
ATOM   1033  C  CE1   . TYR B  2 51  ? -40.860 -15.812 65.862 1.00 46.43  ? 51   TYR B CE1   1 
ATOM   1034  C  CE2   . TYR B  2 51  ? -40.169 -14.740 67.896 1.00 46.93  ? 51   TYR B CE2   1 
ATOM   1035  C  CZ    . TYR B  2 51  ? -40.712 -15.834 67.244 1.00 47.35  ? 51   TYR B CZ    1 
ATOM   1036  O  OH    . TYR B  2 51  ? -41.097 -16.942 67.985 1.00 47.02  ? 51   TYR B OH    1 
ATOM   1037  N  N     . GLU B  2 52  ? -36.917 -10.346 64.765 1.00 50.65  ? 52   GLU B N     1 
ATOM   1038  C  CA    . GLU B  2 52  ? -36.213 -9.156  64.273 1.00 51.10  ? 52   GLU B CA    1 
ATOM   1039  C  C     . GLU B  2 52  ? -34.951 -9.531  63.503 1.00 50.68  ? 52   GLU B C     1 
ATOM   1040  O  O     . GLU B  2 52  ? -34.802 -9.093  62.362 1.00 51.14  ? 52   GLU B O     1 
ATOM   1041  C  CB    . GLU B  2 52  ? -35.943 -8.108  65.370 1.00 51.54  ? 52   GLU B CB    1 
ATOM   1042  C  CG    . GLU B  2 52  ? -37.077 -7.070  65.546 1.00 53.38  ? 52   GLU B CG    1 
ATOM   1043  C  CD    . GLU B  2 52  ? -37.626 -6.559  64.204 1.00 56.66  ? 52   GLU B CD    1 
ATOM   1044  O  OE1   . GLU B  2 52  ? -38.804 -6.852  63.881 1.00 58.06  ? 52   GLU B OE1   1 
ATOM   1045  O  OE2   . GLU B  2 52  ? -36.873 -5.887  63.461 1.00 56.81  ? 52   GLU B OE2   1 
ATOM   1046  N  N     . GLU B  2 53  ? -34.080 -10.362 64.085 1.00 49.78  ? 53   GLU B N     1 
ATOM   1047  C  CA    . GLU B  2 53  ? -32.892 -10.831 63.360 1.00 49.17  ? 53   GLU B CA    1 
ATOM   1048  C  C     . GLU B  2 53  ? -33.237 -11.427 61.978 1.00 48.75  ? 53   GLU B C     1 
ATOM   1049  O  O     . GLU B  2 53  ? -32.592 -11.089 60.975 1.00 48.87  ? 53   GLU B O     1 
ATOM   1050  C  CB    . GLU B  2 53  ? -32.082 -11.827 64.191 1.00 49.10  ? 53   GLU B CB    1 
ATOM   1051  C  CG    . GLU B  2 53  ? -30.710 -12.185 63.602 1.00 49.64  ? 53   GLU B CG    1 
ATOM   1052  C  CD    . GLU B  2 53  ? -29.616 -11.144 63.882 1.00 51.29  ? 53   GLU B CD    1 
ATOM   1053  O  OE1   . GLU B  2 53  ? -29.770 -10.336 64.822 1.00 53.33  ? 53   GLU B OE1   1 
ATOM   1054  O  OE2   . GLU B  2 53  ? -28.581 -11.136 63.173 1.00 50.76  ? 53   GLU B OE2   1 
ATOM   1055  N  N     . THR B  2 54  ? -34.262 -12.279 61.929 1.00 47.86  ? 54   THR B N     1 
ATOM   1056  C  CA    . THR B  2 54  ? -34.645 -12.962 60.702 1.00 47.36  ? 54   THR B CA    1 
ATOM   1057  C  C     . THR B  2 54  ? -35.038 -11.988 59.615 1.00 47.76  ? 54   THR B C     1 
ATOM   1058  O  O     . THR B  2 54  ? -34.595 -12.113 58.477 1.00 47.84  ? 54   THR B O     1 
ATOM   1059  C  CB    . THR B  2 54  ? -35.825 -13.901 60.915 1.00 47.11  ? 54   THR B CB    1 
ATOM   1060  O  OG1   . THR B  2 54  ? -35.501 -14.852 61.927 1.00 47.20  ? 54   THR B OG1   1 
ATOM   1061  C  CG2   . THR B  2 54  ? -36.165 -14.641 59.636 1.00 46.16  ? 54   THR B CG2   1 
ATOM   1062  N  N     . ARG B  2 55  ? -35.885 -11.021 59.959 1.00 48.05  ? 55   ARG B N     1 
ATOM   1063  C  CA    . ARG B  2 55  ? -36.367 -10.065 58.964 1.00 48.06  ? 55   ARG B CA    1 
ATOM   1064  C  C     . ARG B  2 55  ? -35.185 -9.366  58.326 1.00 47.55  ? 55   ARG B C     1 
ATOM   1065  O  O     . ARG B  2 55  ? -35.114 -9.239  57.097 1.00 47.62  ? 55   ARG B O     1 
ATOM   1066  C  CB    . ARG B  2 55  ? -37.344 -9.061  59.574 1.00 48.21  ? 55   ARG B CB    1 
ATOM   1067  C  CG    . ARG B  2 55  ? -38.724 -9.646  59.867 1.00 48.85  ? 55   ARG B CG    1 
ATOM   1068  C  CD    . ARG B  2 55  ? -39.668 -8.609  60.488 1.00 48.88  ? 55   ARG B CD    1 
ATOM   1069  N  NE    . ARG B  2 55  ? -40.882 -9.251  60.989 1.00 49.32  ? 55   ARG B NE    1 
ATOM   1070  C  CZ    . ARG B  2 55  ? -41.147 -9.477  62.275 1.00 50.07  ? 55   ARG B CZ    1 
ATOM   1071  N  NH1   . ARG B  2 55  ? -40.299 -9.089  63.229 1.00 49.38  ? 55   ARG B NH1   1 
ATOM   1072  N  NH2   . ARG B  2 55  ? -42.277 -10.092 62.609 1.00 50.30  ? 55   ARG B NH2   1 
ATOM   1073  N  N     . GLY B  2 56  ? -34.237 -8.956  59.163 1.00 46.95  ? 56   GLY B N     1 
ATOM   1074  C  CA    . GLY B  2 56  ? -32.998 -8.356  58.671 1.00 46.60  ? 56   GLY B CA    1 
ATOM   1075  C  C     . GLY B  2 56  ? -32.279 -9.214  57.642 1.00 45.91  ? 56   GLY B C     1 
ATOM   1076  O  O     . GLY B  2 56  ? -31.820 -8.725  56.609 1.00 45.84  ? 56   GLY B O     1 
ATOM   1077  N  N     . VAL B  2 57  ? -32.196 -10.505 57.926 1.00 45.12  ? 57   VAL B N     1 
ATOM   1078  C  CA    . VAL B  2 57  ? -31.529 -11.433 57.038 1.00 44.46  ? 57   VAL B CA    1 
ATOM   1079  C  C     . VAL B  2 57  ? -32.283 -11.556 55.714 1.00 43.89  ? 57   VAL B C     1 
ATOM   1080  O  O     . VAL B  2 57  ? -31.675 -11.606 54.639 1.00 43.85  ? 57   VAL B O     1 
ATOM   1081  C  CB    . VAL B  2 57  ? -31.387 -12.806 57.719 1.00 44.44  ? 57   VAL B CB    1 
ATOM   1082  C  CG1   . VAL B  2 57  ? -31.180 -13.913 56.705 1.00 44.98  ? 57   VAL B CG1   1 
ATOM   1083  C  CG2   . VAL B  2 57  ? -30.251 -12.776 58.723 1.00 44.67  ? 57   VAL B CG2   1 
ATOM   1084  N  N     . LEU B  2 58  ? -33.610 -11.602 55.803 1.00 43.05  ? 58   LEU B N     1 
ATOM   1085  C  CA    . LEU B  2 58  ? -34.434 -11.801 54.636 1.00 42.03  ? 58   LEU B CA    1 
ATOM   1086  C  C     . LEU B  2 58  ? -34.361 -10.566 53.784 1.00 42.17  ? 58   LEU B C     1 
ATOM   1087  O  O     . LEU B  2 58  ? -34.374 -10.669 52.546 1.00 42.55  ? 58   LEU B O     1 
ATOM   1088  C  CB    . LEU B  2 58  ? -35.871 -12.080 55.027 1.00 41.71  ? 58   LEU B CB    1 
ATOM   1089  C  CG    . LEU B  2 58  ? -36.884 -12.034 53.881 1.00 41.50  ? 58   LEU B CG    1 
ATOM   1090  C  CD1   . LEU B  2 58  ? -36.537 -12.988 52.732 1.00 40.36  ? 58   LEU B CD1   1 
ATOM   1091  C  CD2   . LEU B  2 58  ? -38.288 -12.291 54.405 1.00 41.09  ? 58   LEU B CD2   1 
ATOM   1092  N  N     . LYS B  2 59  ? -34.276 -9.400  54.436 1.00 41.55  ? 59   LYS B N     1 
ATOM   1093  C  CA    . LYS B  2 59  ? -34.166 -8.155  53.699 1.00 41.11  ? 59   LYS B CA    1 
ATOM   1094  C  C     . LYS B  2 59  ? -32.909 -8.193  52.856 1.00 39.97  ? 59   LYS B C     1 
ATOM   1095  O  O     . LYS B  2 59  ? -32.975 -7.924  51.659 1.00 40.03  ? 59   LYS B O     1 
ATOM   1096  C  CB    . LYS B  2 59  ? -34.206 -6.923  54.605 1.00 41.26  ? 59   LYS B CB    1 
ATOM   1097  C  CG    . LYS B  2 59  ? -34.117 -5.566  53.814 1.00 42.90  ? 59   LYS B CG    1 
ATOM   1098  C  CD    . LYS B  2 59  ? -34.780 -4.338  54.539 1.00 42.75  ? 59   LYS B CD    1 
ATOM   1099  C  CE    . LYS B  2 59  ? -33.833 -3.605  55.517 1.00 44.98  ? 59   LYS B CE    1 
ATOM   1100  N  NZ    . LYS B  2 59  ? -32.921 -2.629  54.843 1.00 45.79  ? 59   LYS B NZ    1 
ATOM   1101  N  N     . VAL B  2 60  ? -31.787 -8.582  53.468 1.00 38.98  ? 60   VAL B N     1 
ATOM   1102  C  CA    . VAL B  2 60  ? -30.481 -8.643  52.771 1.00 37.85  ? 60   VAL B CA    1 
ATOM   1103  C  C     . VAL B  2 60  ? -30.485 -9.647  51.607 1.00 37.62  ? 60   VAL B C     1 
ATOM   1104  O  O     . VAL B  2 60  ? -29.873 -9.404  50.569 1.00 36.75  ? 60   VAL B O     1 
ATOM   1105  C  CB    . VAL B  2 60  ? -29.302 -8.942  53.728 1.00 37.30  ? 60   VAL B CB    1 
ATOM   1106  C  CG1   . VAL B  2 60  ? -28.044 -9.003  52.963 1.00 37.16  ? 60   VAL B CG1   1 
ATOM   1107  C  CG2   . VAL B  2 60  ? -29.169 -7.893  54.768 1.00 36.24  ? 60   VAL B CG2   1 
ATOM   1108  N  N     . PHE B  2 61  ? -31.188 -10.762 51.787 1.00 37.88  ? 61   PHE B N     1 
ATOM   1109  C  CA    . PHE B  2 61  ? -31.295 -11.755 50.732 1.00 38.73  ? 61   PHE B CA    1 
ATOM   1110  C  C     . PHE B  2 61  ? -31.941 -11.071 49.547 1.00 39.54  ? 61   PHE B C     1 
ATOM   1111  O  O     . PHE B  2 61  ? -31.366 -11.017 48.449 1.00 39.59  ? 61   PHE B O     1 
ATOM   1112  C  CB    . PHE B  2 61  ? -32.109 -12.986 51.173 1.00 38.41  ? 61   PHE B CB    1 
ATOM   1113  C  CG    . PHE B  2 61  ? -32.185 -14.088 50.124 1.00 38.37  ? 61   PHE B CG    1 
ATOM   1114  C  CD1   . PHE B  2 61  ? -31.162 -15.022 49.991 1.00 38.23  ? 61   PHE B CD1   1 
ATOM   1115  C  CD2   . PHE B  2 61  ? -33.286 -14.199 49.273 1.00 38.97  ? 61   PHE B CD2   1 
ATOM   1116  C  CE1   . PHE B  2 61  ? -31.222 -16.040 49.018 1.00 37.18  ? 61   PHE B CE1   1 
ATOM   1117  C  CE2   . PHE B  2 61  ? -33.352 -15.221 48.295 1.00 37.75  ? 61   PHE B CE2   1 
ATOM   1118  C  CZ    . PHE B  2 61  ? -32.315 -16.131 48.172 1.00 37.22  ? 61   PHE B CZ    1 
ATOM   1119  N  N     . LEU B  2 62  ? -33.120 -10.504 49.793 1.00 40.42  ? 62   LEU B N     1 
ATOM   1120  C  CA    . LEU B  2 62  ? -33.929 -9.959  48.717 1.00 41.09  ? 62   LEU B CA    1 
ATOM   1121  C  C     . LEU B  2 62  ? -33.229 -8.798  48.030 1.00 41.55  ? 62   LEU B C     1 
ATOM   1122  O  O     . LEU B  2 62  ? -33.227 -8.719  46.796 1.00 41.83  ? 62   LEU B O     1 
ATOM   1123  C  CB    . LEU B  2 62  ? -35.333 -9.587  49.208 1.00 41.30  ? 62   LEU B CB    1 
ATOM   1124  C  CG    . LEU B  2 62  ? -36.301 -10.749 49.481 1.00 41.23  ? 62   LEU B CG    1 
ATOM   1125  C  CD1   . LEU B  2 62  ? -37.646 -10.262 49.969 1.00 39.76  ? 62   LEU B CD1   1 
ATOM   1126  C  CD2   . LEU B  2 62  ? -36.485 -11.582 48.235 1.00 41.29  ? 62   LEU B CD2   1 
ATOM   1127  N  N     . GLU B  2 63  ? -32.602 -7.926  48.818 1.00 41.77  ? 63   GLU B N     1 
ATOM   1128  C  CA    . GLU B  2 63  ? -31.818 -6.830  48.250 1.00 42.33  ? 63   GLU B CA    1 
ATOM   1129  C  C     . GLU B  2 63  ? -30.805 -7.354  47.243 1.00 42.62  ? 63   GLU B C     1 
ATOM   1130  O  O     . GLU B  2 63  ? -30.750 -6.875  46.104 1.00 42.57  ? 63   GLU B O     1 
ATOM   1131  C  CB    . GLU B  2 63  ? -31.083 -6.065  49.336 1.00 42.24  ? 63   GLU B CB    1 
ATOM   1132  C  CG    . GLU B  2 63  ? -31.964 -5.215  50.181 1.00 43.74  ? 63   GLU B CG    1 
ATOM   1133  C  CD    . GLU B  2 63  ? -31.236 -4.642  51.365 1.00 46.39  ? 63   GLU B CD    1 
ATOM   1134  O  OE1   . GLU B  2 63  ? -30.102 -5.082  51.657 1.00 46.42  ? 63   GLU B OE1   1 
ATOM   1135  O  OE2   . GLU B  2 63  ? -31.807 -3.744  52.013 1.00 48.90  ? 63   GLU B OE2   1 
ATOM   1136  N  N     . ASN B  2 64  ? -30.023 -8.352  47.669 1.00 42.71  ? 64   ASN B N     1 
ATOM   1137  C  CA    . ASN B  2 64  ? -28.956 -8.884  46.851 1.00 42.92  ? 64   ASN B CA    1 
ATOM   1138  C  C     . ASN B  2 64  ? -29.491 -9.459  45.570 1.00 43.18  ? 64   ASN B C     1 
ATOM   1139  O  O     . ASN B  2 64  ? -28.937 -9.202  44.493 1.00 43.35  ? 64   ASN B O     1 
ATOM   1140  C  CB    . ASN B  2 64  ? -28.154 -9.940  47.602 1.00 43.01  ? 64   ASN B CB    1 
ATOM   1141  C  CG    . ASN B  2 64  ? -27.123 -9.339  48.518 1.00 43.58  ? 64   ASN B CG    1 
ATOM   1142  O  OD1   . ASN B  2 64  ? -26.621 -8.252  48.276 1.00 45.76  ? 64   ASN B OD1   1 
ATOM   1143  N  ND2   . ASN B  2 64  ? -26.798 -10.046 49.583 1.00 44.83  ? 64   ASN B ND2   1 
ATOM   1144  N  N     . VAL B  2 65  ? -30.576 -10.224 45.688 1.00 43.28  ? 65   VAL B N     1 
ATOM   1145  C  CA    . VAL B  2 65  ? -31.147 -10.909 44.534 1.00 43.48  ? 65   VAL B CA    1 
ATOM   1146  C  C     . VAL B  2 65  ? -31.834 -9.922  43.608 1.00 44.01  ? 65   VAL B C     1 
ATOM   1147  O  O     . VAL B  2 65  ? -31.598 -9.947  42.396 1.00 44.01  ? 65   VAL B O     1 
ATOM   1148  C  CB    . VAL B  2 65  ? -32.136 -12.004 44.934 1.00 43.21  ? 65   VAL B CB    1 
ATOM   1149  C  CG1   . VAL B  2 65  ? -32.454 -12.888 43.742 1.00 42.63  ? 65   VAL B CG1   1 
ATOM   1150  C  CG2   . VAL B  2 65  ? -31.559 -12.837 46.040 1.00 43.50  ? 65   VAL B CG2   1 
ATOM   1151  N  N     . ILE B  2 66  ? -32.663 -9.051  44.189 1.00 44.49  ? 66   ILE B N     1 
ATOM   1152  C  CA    . ILE B  2 66  ? -33.475 -8.120  43.408 1.00 45.05  ? 66   ILE B CA    1 
ATOM   1153  C  C     . ILE B  2 66  ? -32.600 -7.160  42.579 1.00 45.66  ? 66   ILE B C     1 
ATOM   1154  O  O     . ILE B  2 66  ? -32.828 -6.980  41.370 1.00 45.67  ? 66   ILE B O     1 
ATOM   1155  C  CB    . ILE B  2 66  ? -34.562 -7.410  44.279 1.00 44.90  ? 66   ILE B CB    1 
ATOM   1156  C  CG1   . ILE B  2 66  ? -35.721 -8.381  44.540 1.00 44.53  ? 66   ILE B CG1   1 
ATOM   1157  C  CG2   . ILE B  2 66  ? -35.112 -6.184  43.578 1.00 44.53  ? 66   ILE B CG2   1 
ATOM   1158  C  CD1   . ILE B  2 66  ? -36.579 -8.065  45.750 1.00 44.12  ? 66   ILE B CD1   1 
ATOM   1159  N  N     . ARG B  2 67  ? -31.587 -6.587  43.226 1.00 45.91  ? 67   ARG B N     1 
ATOM   1160  C  CA    . ARG B  2 67  ? -30.618 -5.733  42.554 1.00 46.71  ? 67   ARG B CA    1 
ATOM   1161  C  C     . ARG B  2 67  ? -30.149 -6.368  41.251 1.00 45.98  ? 67   ARG B C     1 
ATOM   1162  O  O     . ARG B  2 67  ? -30.260 -5.772  40.189 1.00 45.93  ? 67   ARG B O     1 
ATOM   1163  C  CB    . ARG B  2 67  ? -29.442 -5.472  43.489 1.00 46.57  ? 67   ARG B CB    1 
ATOM   1164  C  CG    . ARG B  2 67  ? -28.231 -4.774  42.873 1.00 48.35  ? 67   ARG B CG    1 
ATOM   1165  C  CD    . ARG B  2 67  ? -27.047 -4.734  43.886 1.00 49.69  ? 67   ARG B CD    1 
ATOM   1166  N  NE    . ARG B  2 67  ? -27.301 -3.852  45.049 1.00 55.89  ? 67   ARG B NE    1 
ATOM   1167  C  CZ    . ARG B  2 67  ? -27.438 -4.241  46.326 1.00 56.89  ? 67   ARG B CZ    1 
ATOM   1168  N  NH1   . ARG B  2 67  ? -27.345 -5.521  46.682 1.00 57.43  ? 67   ARG B NH1   1 
ATOM   1169  N  NH2   . ARG B  2 67  ? -27.667 -3.323  47.263 1.00 58.14  ? 67   ARG B NH2   1 
ATOM   1170  N  N     . ASP B  2 68  ? -29.652 -7.593  41.343 1.00 45.97  ? 68   ASP B N     1 
ATOM   1171  C  CA    . ASP B  2 68  ? -29.114 -8.299  40.189 1.00 45.91  ? 68   ASP B CA    1 
ATOM   1172  C  C     . ASP B  2 68  ? -30.189 -8.530  39.150 1.00 45.93  ? 68   ASP B C     1 
ATOM   1173  O  O     . ASP B  2 68  ? -29.950 -8.371  37.958 1.00 45.90  ? 68   ASP B O     1 
ATOM   1174  C  CB    . ASP B  2 68  ? -28.528 -9.642  40.621 1.00 45.88  ? 68   ASP B CB    1 
ATOM   1175  C  CG    . ASP B  2 68  ? -27.056 -9.558  40.982 1.00 46.18  ? 68   ASP B CG    1 
ATOM   1176  O  OD1   . ASP B  2 68  ? -26.559 -8.464  41.341 1.00 46.68  ? 68   ASP B OD1   1 
ATOM   1177  O  OD2   . ASP B  2 68  ? -26.392 -10.612 40.905 1.00 45.68  ? 68   ASP B OD2   1 
ATOM   1178  N  N     . ALA B  2 69  ? -31.374 -8.911  39.623 1.00 46.18  ? 69   ALA B N     1 
ATOM   1179  C  CA    . ALA B  2 69  ? -32.513 -9.223  38.759 1.00 45.89  ? 69   ALA B CA    1 
ATOM   1180  C  C     . ALA B  2 69  ? -32.919 -7.976  38.024 1.00 45.67  ? 69   ALA B C     1 
ATOM   1181  O  O     . ALA B  2 69  ? -33.159 -8.012  36.827 1.00 46.00  ? 69   ALA B O     1 
ATOM   1182  C  CB    . ALA B  2 69  ? -33.681 -9.754  39.575 1.00 45.80  ? 69   ALA B CB    1 
ATOM   1183  N  N     . VAL B  2 70  ? -32.972 -6.865  38.745 1.00 45.14  ? 70   VAL B N     1 
ATOM   1184  C  CA    . VAL B  2 70  ? -33.390 -5.620  38.146 1.00 44.84  ? 70   VAL B CA    1 
ATOM   1185  C  C     . VAL B  2 70  ? -32.364 -5.170  37.119 1.00 44.86  ? 70   VAL B C     1 
ATOM   1186  O  O     . VAL B  2 70  ? -32.708 -4.586  36.095 1.00 44.99  ? 70   VAL B O     1 
ATOM   1187  C  CB    . VAL B  2 70  ? -33.621 -4.536  39.210 1.00 44.67  ? 70   VAL B CB    1 
ATOM   1188  C  CG1   . VAL B  2 70  ? -33.812 -3.176  38.561 1.00 44.04  ? 70   VAL B CG1   1 
ATOM   1189  C  CG2   . VAL B  2 70  ? -34.820 -4.899  40.065 1.00 44.59  ? 70   VAL B CG2   1 
ATOM   1190  N  N     . THR B  2 71  ? -31.105 -5.461  37.395 1.00 44.82  ? 71   THR B N     1 
ATOM   1191  C  CA    . THR B  2 71  ? -30.031 -5.046  36.528 1.00 45.24  ? 71   THR B CA    1 
ATOM   1192  C  C     . THR B  2 71  ? -30.114 -5.784  35.221 1.00 45.99  ? 71   THR B C     1 
ATOM   1193  O  O     . THR B  2 71  ? -29.653 -5.294  34.200 1.00 46.45  ? 71   THR B O     1 
ATOM   1194  C  CB    . THR B  2 71  ? -28.724 -5.326  37.194 1.00 45.14  ? 71   THR B CB    1 
ATOM   1195  O  OG1   . THR B  2 71  ? -28.675 -4.542  38.387 1.00 45.95  ? 71   THR B OG1   1 
ATOM   1196  C  CG2   . THR B  2 71  ? -27.562 -4.983  36.298 1.00 44.64  ? 71   THR B CG2   1 
ATOM   1197  N  N     . TYR B  2 72  ? -30.708 -6.971  35.256 1.00 46.82  ? 72   TYR B N     1 
ATOM   1198  C  CA    . TYR B  2 72  ? -30.988 -7.707  34.044 1.00 47.38  ? 72   TYR B CA    1 
ATOM   1199  C  C     . TYR B  2 72  ? -32.132 -7.061  33.318 1.00 48.12  ? 72   TYR B C     1 
ATOM   1200  O  O     . TYR B  2 72  ? -32.105 -6.978  32.097 1.00 48.64  ? 72   TYR B O     1 
ATOM   1201  C  CB    . TYR B  2 72  ? -31.330 -9.153  34.347 1.00 47.12  ? 72   TYR B CB    1 
ATOM   1202  C  CG    . TYR B  2 72  ? -30.111 -10.002 34.548 1.00 47.09  ? 72   TYR B CG    1 
ATOM   1203  C  CD1   . TYR B  2 72  ? -29.920 -10.697 35.731 1.00 46.65  ? 72   TYR B CD1   1 
ATOM   1204  C  CD2   . TYR B  2 72  ? -29.145 -10.116 33.545 1.00 46.30  ? 72   TYR B CD2   1 
ATOM   1205  C  CE1   . TYR B  2 72  ? -28.804 -11.479 35.911 1.00 46.36  ? 72   TYR B CE1   1 
ATOM   1206  C  CE2   . TYR B  2 72  ? -28.031 -10.892 33.721 1.00 45.40  ? 72   TYR B CE2   1 
ATOM   1207  C  CZ    . TYR B  2 72  ? -27.864 -11.566 34.908 1.00 45.83  ? 72   TYR B CZ    1 
ATOM   1208  O  OH    . TYR B  2 72  ? -26.752 -12.338 35.104 1.00 47.07  ? 72   TYR B OH    1 
ATOM   1209  N  N     . THR B  2 73  ? -33.131 -6.607  34.072 1.00 48.95  ? 73   THR B N     1 
ATOM   1210  C  CA    . THR B  2 73  ? -34.271 -5.896  33.505 1.00 49.74  ? 73   THR B CA    1 
ATOM   1211  C  C     . THR B  2 73  ? -33.785 -4.654  32.751 1.00 50.94  ? 73   THR B C     1 
ATOM   1212  O  O     . THR B  2 73  ? -34.150 -4.466  31.591 1.00 51.06  ? 73   THR B O     1 
ATOM   1213  C  CB    . THR B  2 73  ? -35.304 -5.499  34.581 1.00 49.22  ? 73   THR B CB    1 
ATOM   1214  O  OG1   . THR B  2 73  ? -35.682 -6.649  35.335 1.00 48.91  ? 73   THR B OG1   1 
ATOM   1215  C  CG2   . THR B  2 73  ? -36.534 -4.942  33.949 1.00 48.84  ? 73   THR B CG2   1 
ATOM   1216  N  N     . GLU B  2 74  ? -32.945 -3.833  33.390 1.00 52.19  ? 74   GLU B N     1 
ATOM   1217  C  CA    . GLU B  2 74  ? -32.461 -2.589  32.764 1.00 53.87  ? 74   GLU B CA    1 
ATOM   1218  C  C     . GLU B  2 74  ? -31.713 -2.897  31.476 1.00 53.77  ? 74   GLU B C     1 
ATOM   1219  O  O     . GLU B  2 74  ? -31.898 -2.217  30.464 1.00 54.03  ? 74   GLU B O     1 
ATOM   1220  C  CB    . GLU B  2 74  ? -31.591 -1.736  33.710 1.00 53.58  ? 74   GLU B CB    1 
ATOM   1221  C  CG    . GLU B  2 74  ? -32.362 -1.136  34.896 1.00 55.66  ? 74   GLU B CG    1 
ATOM   1222  C  CD    . GLU B  2 74  ? -31.516 -0.267  35.854 1.00 56.35  ? 74   GLU B CD    1 
ATOM   1223  O  OE1   . GLU B  2 74  ? -30.439 -0.717  36.319 1.00 59.05  ? 74   GLU B OE1   1 
ATOM   1224  O  OE2   . GLU B  2 74  ? -31.957 0.870   36.178 1.00 60.81  ? 74   GLU B OE2   1 
ATOM   1225  N  N     . HIS B  2 75  ? -30.891 -3.939  31.499 1.00 53.89  ? 75   HIS B N     1 
ATOM   1226  C  CA    . HIS B  2 75  ? -30.131 -4.281  30.312 1.00 53.95  ? 75   HIS B CA    1 
ATOM   1227  C  C     . HIS B  2 75  ? -31.068 -4.570  29.143 1.00 54.49  ? 75   HIS B C     1 
ATOM   1228  O  O     . HIS B  2 75  ? -30.831 -4.132  28.018 1.00 54.88  ? 75   HIS B O     1 
ATOM   1229  C  CB    . HIS B  2 75  ? -29.201 -5.458  30.564 1.00 53.47  ? 75   HIS B CB    1 
ATOM   1230  C  CG    . HIS B  2 75  ? -28.266 -5.721  29.432 1.00 52.29  ? 75   HIS B CG    1 
ATOM   1231  N  ND1   . HIS B  2 75  ? -27.041 -5.103  29.325 1.00 51.95  ? 75   HIS B ND1   1 
ATOM   1232  C  CD2   . HIS B  2 75  ? -28.381 -6.519  28.345 1.00 51.71  ? 75   HIS B CD2   1 
ATOM   1233  C  CE1   . HIS B  2 75  ? -26.433 -5.518  28.228 1.00 51.77  ? 75   HIS B CE1   1 
ATOM   1234  N  NE2   . HIS B  2 75  ? -27.227 -6.375  27.613 1.00 51.29  ? 75   HIS B NE2   1 
ATOM   1235  N  N     . ALA B  2 76  ? -32.145 -5.292  29.418 1.00 54.82  ? 76   ALA B N     1 
ATOM   1236  C  CA    . ALA B  2 76  ? -33.059 -5.686  28.370 1.00 55.16  ? 76   ALA B CA    1 
ATOM   1237  C  C     . ALA B  2 76  ? -34.034 -4.548  28.039 1.00 55.60  ? 76   ALA B C     1 
ATOM   1238  O  O     . ALA B  2 76  ? -34.987 -4.734  27.269 1.00 55.68  ? 76   ALA B O     1 
ATOM   1239  C  CB    . ALA B  2 76  ? -33.788 -6.956  28.770 1.00 55.17  ? 76   ALA B CB    1 
ATOM   1240  N  N     . LYS B  2 77  ? -33.786 -3.367  28.611 1.00 55.89  ? 77   LYS B N     1 
ATOM   1241  C  CA    . LYS B  2 77  ? -34.596 -2.177  28.332 1.00 56.25  ? 77   LYS B CA    1 
ATOM   1242  C  C     . LYS B  2 77  ? -36.096 -2.429  28.603 1.00 56.14  ? 77   LYS B C     1 
ATOM   1243  O  O     . LYS B  2 77  ? -36.934 -2.133  27.761 1.00 56.51  ? 77   LYS B O     1 
ATOM   1244  C  CB    . LYS B  2 77  ? -34.402 -1.736  26.867 1.00 56.48  ? 77   LYS B CB    1 
ATOM   1245  C  CG    . LYS B  2 77  ? -32.967 -1.461  26.392 1.00 57.89  ? 77   LYS B CG    1 
ATOM   1246  C  CD    . LYS B  2 77  ? -32.734 -2.130  25.008 1.00 61.25  ? 77   LYS B CD    1 
ATOM   1247  C  CE    . LYS B  2 77  ? -32.287 -1.147  23.874 1.00 63.26  ? 77   LYS B CE    1 
ATOM   1248  N  NZ    . LYS B  2 77  ? -30.830 -0.744  23.830 1.00 63.56  ? 77   LYS B NZ    1 
ATOM   1249  N  N     . ARG B  2 78  ? -36.438 -2.991  29.761 1.00 55.98  ? 78   ARG B N     1 
ATOM   1250  C  CA    . ARG B  2 78  ? -37.832 -3.320  30.073 1.00 55.84  ? 78   ARG B CA    1 
ATOM   1251  C  C     . ARG B  2 78  ? -38.272 -2.638  31.356 1.00 55.96  ? 78   ARG B C     1 
ATOM   1252  O  O     . ARG B  2 78  ? -37.447 -2.126  32.092 1.00 56.05  ? 78   ARG B O     1 
ATOM   1253  C  CB    . ARG B  2 78  ? -38.015 -4.835  30.193 1.00 55.85  ? 78   ARG B CB    1 
ATOM   1254  C  CG    . ARG B  2 78  ? -37.823 -5.588  28.891 1.00 55.63  ? 78   ARG B CG    1 
ATOM   1255  C  CD    . ARG B  2 78  ? -38.208 -7.050  29.013 1.00 56.02  ? 78   ARG B CD    1 
ATOM   1256  N  NE    . ARG B  2 78  ? -37.061 -7.903  29.299 1.00 57.47  ? 78   ARG B NE    1 
ATOM   1257  C  CZ    . ARG B  2 78  ? -36.688 -8.276  30.518 1.00 58.68  ? 78   ARG B CZ    1 
ATOM   1258  N  NH1   . ARG B  2 78  ? -37.378 -7.887  31.584 1.00 59.47  ? 78   ARG B NH1   1 
ATOM   1259  N  NH2   . ARG B  2 78  ? -35.623 -9.046  30.672 1.00 59.37  ? 78   ARG B NH2   1 
ATOM   1260  N  N     . LYS B  2 79  ? -39.571 -2.616  31.622 1.00 56.36  ? 79   LYS B N     1 
ATOM   1261  C  CA    . LYS B  2 79  ? -40.084 -1.994  32.842 1.00 56.91  ? 79   LYS B CA    1 
ATOM   1262  C  C     . LYS B  2 79  ? -40.717 -3.060  33.714 1.00 56.84  ? 79   LYS B C     1 
ATOM   1263  O  O     . LYS B  2 79  ? -41.211 -2.786  34.816 1.00 56.91  ? 79   LYS B O     1 
ATOM   1264  C  CB    . LYS B  2 79  ? -41.072 -0.875  32.509 1.00 57.25  ? 79   LYS B CB    1 
ATOM   1265  C  CG    . LYS B  2 79  ? -40.382 0.380   32.026 1.00 59.03  ? 79   LYS B CG    1 
ATOM   1266  C  CD    . LYS B  2 79  ? -41.341 1.338   31.370 1.00 62.85  ? 79   LYS B CD    1 
ATOM   1267  C  CE    . LYS B  2 79  ? -40.597 2.193   30.338 1.00 65.44  ? 79   LYS B CE    1 
ATOM   1268  N  NZ    . LYS B  2 79  ? -41.439 3.332   29.804 1.00 67.57  ? 79   LYS B NZ    1 
ATOM   1269  N  N     . THR B  2 80  ? -40.664 -4.285  33.202 1.00 56.76  ? 80   THR B N     1 
ATOM   1270  C  CA    . THR B  2 80  ? -41.135 -5.468  33.901 1.00 56.71  ? 80   THR B CA    1 
ATOM   1271  C  C     . THR B  2 80  ? -39.987 -6.447  34.215 1.00 56.35  ? 80   THR B C     1 
ATOM   1272  O  O     . THR B  2 80  ? -39.275 -6.910  33.299 1.00 56.10  ? 80   THR B O     1 
ATOM   1273  C  CB    . THR B  2 80  ? -42.180 -6.230  33.062 1.00 56.87  ? 80   THR B CB    1 
ATOM   1274  O  OG1   . THR B  2 80  ? -42.992 -5.306  32.322 1.00 57.78  ? 80   THR B OG1   1 
ATOM   1275  C  CG2   . THR B  2 80  ? -43.051 -7.087  33.959 1.00 57.06  ? 80   THR B CG2   1 
ATOM   1276  N  N     . VAL B  2 81  ? -39.823 -6.757  35.505 1.00 55.64  ? 81   VAL B N     1 
ATOM   1277  C  CA    . VAL B  2 81  ? -38.962 -7.856  35.934 1.00 55.10  ? 81   VAL B CA    1 
ATOM   1278  C  C     . VAL B  2 81  ? -39.635 -9.168  35.553 1.00 54.73  ? 81   VAL B C     1 
ATOM   1279  O  O     . VAL B  2 81  ? -40.752 -9.447  36.004 1.00 54.93  ? 81   VAL B O     1 
ATOM   1280  C  CB    . VAL B  2 81  ? -38.744 -7.862  37.454 1.00 54.99  ? 81   VAL B CB    1 
ATOM   1281  C  CG1   . VAL B  2 81  ? -37.744 -8.942  37.832 1.00 55.09  ? 81   VAL B CG1   1 
ATOM   1282  C  CG2   . VAL B  2 81  ? -38.240 -6.526  37.926 1.00 55.45  ? 81   VAL B CG2   1 
ATOM   1283  N  N     . THR B  2 82  ? -38.961 -9.960  34.721 1.00 54.04  ? 82   THR B N     1 
ATOM   1284  C  CA    . THR B  2 82  ? -39.476 -11.260 34.289 1.00 53.47  ? 82   THR B CA    1 
ATOM   1285  C  C     . THR B  2 82  ? -38.927 -12.393 35.142 1.00 53.04  ? 82   THR B C     1 
ATOM   1286  O  O     . THR B  2 82  ? -37.906 -12.250 35.797 1.00 53.02  ? 82   THR B O     1 
ATOM   1287  C  CB    . THR B  2 82  ? -39.167 -11.530 32.801 1.00 53.80  ? 82   THR B CB    1 
ATOM   1288  O  OG1   . THR B  2 82  ? -37.747 -11.650 32.585 1.00 53.34  ? 82   THR B OG1   1 
ATOM   1289  C  CG2   . THR B  2 82  ? -39.727 -10.397 31.948 1.00 54.31  ? 82   THR B CG2   1 
ATOM   1290  N  N     . ALA B  2 83  ? -39.607 -13.528 35.144 1.00 52.57  ? 83   ALA B N     1 
ATOM   1291  C  CA    . ALA B  2 83  ? -39.137 -14.647 35.942 1.00 51.89  ? 83   ALA B CA    1 
ATOM   1292  C  C     . ALA B  2 83  ? -37.697 -15.032 35.580 1.00 51.45  ? 83   ALA B C     1 
ATOM   1293  O  O     . ALA B  2 83  ? -36.917 -15.328 36.483 1.00 51.77  ? 83   ALA B O     1 
ATOM   1294  C  CB    . ALA B  2 83  ? -40.075 -15.825 35.829 1.00 51.84  ? 83   ALA B CB    1 
ATOM   1295  N  N     . MET B  2 84  ? -37.340 -15.000 34.288 1.00 50.50  ? 84   MET B N     1 
ATOM   1296  C  CA    . MET B  2 84  ? -35.955 -15.247 33.859 1.00 49.77  ? 84   MET B CA    1 
ATOM   1297  C  C     . MET B  2 84  ? -34.981 -14.267 34.481 1.00 49.46  ? 84   MET B C     1 
ATOM   1298  O  O     . MET B  2 84  ? -33.856 -14.647 34.812 1.00 49.56  ? 84   MET B O     1 
ATOM   1299  C  CB    . MET B  2 84  ? -35.788 -15.156 32.351 1.00 49.85  ? 84   MET B CB    1 
ATOM   1300  C  CG    . MET B  2 84  ? -36.472 -16.225 31.570 1.00 50.50  ? 84   MET B CG    1 
ATOM   1301  S  SD    . MET B  2 84  ? -36.145 -17.809 32.297 1.00 53.04  ? 84   MET B SD    1 
ATOM   1302  C  CE    . MET B  2 84  ? -34.413 -18.064 31.915 1.00 52.38  ? 84   MET B CE    1 
ATOM   1303  N  N     . ASP B  2 85  ? -35.402 -13.009 34.621 1.00 48.83  ? 85   ASP B N     1 
ATOM   1304  C  CA    . ASP B  2 85  ? -34.575 -11.993 35.276 1.00 48.60  ? 85   ASP B CA    1 
ATOM   1305  C  C     . ASP B  2 85  ? -34.176 -12.463 36.671 1.00 48.41  ? 85   ASP B C     1 
ATOM   1306  O  O     . ASP B  2 85  ? -33.033 -12.297 37.075 1.00 49.21  ? 85   ASP B O     1 
ATOM   1307  C  CB    . ASP B  2 85  ? -35.297 -10.636 35.393 1.00 48.62  ? 85   ASP B CB    1 
ATOM   1308  C  CG    . ASP B  2 85  ? -35.346 -9.866  34.084 1.00 48.00  ? 85   ASP B CG    1 
ATOM   1309  O  OD1   . ASP B  2 85  ? -34.539 -10.171 33.182 1.00 48.34  ? 85   ASP B OD1   1 
ATOM   1310  O  OD2   . ASP B  2 85  ? -36.187 -8.945  33.972 1.00 46.33  ? 85   ASP B OD2   1 
ATOM   1311  N  N     . VAL B  2 86  ? -35.130 -13.040 37.399 1.00 47.77  ? 86   VAL B N     1 
ATOM   1312  C  CA    . VAL B  2 86  ? -34.916 -13.536 38.760 1.00 46.75  ? 86   VAL B CA    1 
ATOM   1313  C  C     . VAL B  2 86  ? -34.047 -14.785 38.688 1.00 46.18  ? 86   VAL B C     1 
ATOM   1314  O  O     . VAL B  2 86  ? -33.022 -14.863 39.359 1.00 46.28  ? 86   VAL B O     1 
ATOM   1315  C  CB    . VAL B  2 86  ? -36.275 -13.842 39.482 1.00 46.77  ? 86   VAL B CB    1 
ATOM   1316  C  CG1   . VAL B  2 86  ? -36.053 -14.498 40.809 1.00 46.29  ? 86   VAL B CG1   1 
ATOM   1317  C  CG2   . VAL B  2 86  ? -37.081 -12.578 39.675 1.00 46.50  ? 86   VAL B CG2   1 
ATOM   1318  N  N     . VAL B  2 87  ? -34.458 -15.741 37.858 1.00 45.22  ? 87   VAL B N     1 
ATOM   1319  C  CA    . VAL B  2 87  ? -33.736 -16.991 37.683 1.00 44.66  ? 87   VAL B CA    1 
ATOM   1320  C  C     . VAL B  2 87  ? -32.244 -16.779 37.399 1.00 44.69  ? 87   VAL B C     1 
ATOM   1321  O  O     . VAL B  2 87  ? -31.386 -17.369 38.075 1.00 44.55  ? 87   VAL B O     1 
ATOM   1322  C  CB    . VAL B  2 87  ? -34.367 -17.844 36.576 1.00 44.40  ? 87   VAL B CB    1 
ATOM   1323  C  CG1   . VAL B  2 87  ? -33.464 -19.006 36.194 1.00 43.99  ? 87   VAL B CG1   1 
ATOM   1324  C  CG2   . VAL B  2 87  ? -35.702 -18.349 37.020 1.00 44.24  ? 87   VAL B CG2   1 
ATOM   1325  N  N     . TYR B  2 88  ? -31.943 -15.946 36.409 1.00 44.48  ? 88   TYR B N     1 
ATOM   1326  C  CA    . TYR B  2 88  ? -30.563 -15.676 36.055 1.00 44.86  ? 88   TYR B CA    1 
ATOM   1327  C  C     . TYR B  2 88  ? -29.755 -15.113 37.225 1.00 44.76  ? 88   TYR B C     1 
ATOM   1328  O  O     . TYR B  2 88  ? -28.557 -15.415 37.379 1.00 44.83  ? 88   TYR B O     1 
ATOM   1329  C  CB    . TYR B  2 88  ? -30.506 -14.685 34.914 1.00 45.58  ? 88   TYR B CB    1 
ATOM   1330  C  CG    . TYR B  2 88  ? -30.957 -15.226 33.597 1.00 46.31  ? 88   TYR B CG    1 
ATOM   1331  C  CD1   . TYR B  2 88  ? -31.635 -14.416 32.696 1.00 47.08  ? 88   TYR B CD1   1 
ATOM   1332  C  CD2   . TYR B  2 88  ? -30.694 -16.527 33.240 1.00 46.91  ? 88   TYR B CD2   1 
ATOM   1333  C  CE1   . TYR B  2 88  ? -32.037 -14.883 31.484 1.00 47.04  ? 88   TYR B CE1   1 
ATOM   1334  C  CE2   . TYR B  2 88  ? -31.091 -17.010 32.024 1.00 47.90  ? 88   TYR B CE2   1 
ATOM   1335  C  CZ    . TYR B  2 88  ? -31.762 -16.180 31.148 1.00 47.75  ? 88   TYR B CZ    1 
ATOM   1336  O  OH    . TYR B  2 88  ? -32.166 -16.668 29.928 1.00 48.73  ? 88   TYR B OH    1 
ATOM   1337  N  N     . ALA B  2 89  ? -30.420 -14.280 38.025 1.00 44.13  ? 89   ALA B N     1 
ATOM   1338  C  CA    . ALA B  2 89  ? -29.801 -13.607 39.153 1.00 43.48  ? 89   ALA B CA    1 
ATOM   1339  C  C     . ALA B  2 89  ? -29.576 -14.590 40.283 1.00 43.14  ? 89   ALA B C     1 
ATOM   1340  O  O     . ALA B  2 89  ? -28.527 -14.583 40.915 1.00 43.19  ? 89   ALA B O     1 
ATOM   1341  C  CB    . ALA B  2 89  ? -30.655 -12.440 39.615 1.00 43.47  ? 89   ALA B CB    1 
ATOM   1342  N  N     . LEU B  2 90  ? -30.560 -15.440 40.535 1.00 42.79  ? 90   LEU B N     1 
ATOM   1343  C  CA    . LEU B  2 90  ? -30.386 -16.504 41.498 1.00 42.60  ? 90   LEU B CA    1 
ATOM   1344  C  C     . LEU B  2 90  ? -29.199 -17.374 41.081 1.00 42.93  ? 90   LEU B C     1 
ATOM   1345  O  O     . LEU B  2 90  ? -28.291 -17.630 41.880 1.00 42.65  ? 90   LEU B O     1 
ATOM   1346  C  CB    . LEU B  2 90  ? -31.660 -17.324 41.606 1.00 42.28  ? 90   LEU B CB    1 
ATOM   1347  C  CG    . LEU B  2 90  ? -32.801 -16.626 42.337 1.00 41.82  ? 90   LEU B CG    1 
ATOM   1348  C  CD1   . LEU B  2 90  ? -34.160 -17.263 42.041 1.00 39.86  ? 90   LEU B CD1   1 
ATOM   1349  C  CD2   . LEU B  2 90  ? -32.510 -16.646 43.820 1.00 41.79  ? 90   LEU B CD2   1 
ATOM   1350  N  N     . LYS B  2 91  ? -29.185 -17.785 39.813 1.00 43.32  ? 91   LYS B N     1 
ATOM   1351  C  CA    . LYS B  2 91  ? -28.116 -18.637 39.318 1.00 43.68  ? 91   LYS B CA    1 
ATOM   1352  C  C     . LYS B  2 91  ? -26.761 -18.036 39.621 1.00 43.97  ? 91   LYS B C     1 
ATOM   1353  O  O     . LYS B  2 91  ? -25.869 -18.736 40.079 1.00 44.38  ? 91   LYS B O     1 
ATOM   1354  C  CB    . LYS B  2 91  ? -28.241 -18.909 37.827 1.00 43.45  ? 91   LYS B CB    1 
ATOM   1355  C  CG    . LYS B  2 91  ? -27.296 -20.000 37.375 1.00 44.20  ? 91   LYS B CG    1 
ATOM   1356  C  CD    . LYS B  2 91  ? -27.220 -20.122 35.871 1.00 46.45  ? 91   LYS B CD    1 
ATOM   1357  C  CE    . LYS B  2 91  ? -28.350 -20.974 35.324 1.00 48.20  ? 91   LYS B CE    1 
ATOM   1358  N  NZ    . LYS B  2 91  ? -27.893 -21.580 34.057 1.00 50.30  ? 91   LYS B NZ    1 
ATOM   1359  N  N     . ARG B  2 92  ? -26.603 -16.743 39.385 1.00 44.31  ? 92   ARG B N     1 
ATOM   1360  C  CA    . ARG B  2 92  ? -25.318 -16.138 39.638 1.00 44.87  ? 92   ARG B CA    1 
ATOM   1361  C  C     . ARG B  2 92  ? -25.089 -15.772 41.103 1.00 45.45  ? 92   ARG B C     1 
ATOM   1362  O  O     . ARG B  2 92  ? -23.951 -15.486 41.460 1.00 46.17  ? 92   ARG B O     1 
ATOM   1363  C  CB    . ARG B  2 92  ? -25.065 -14.947 38.732 1.00 44.96  ? 92   ARG B CB    1 
ATOM   1364  C  CG    . ARG B  2 92  ? -25.744 -13.670 39.180 1.00 45.77  ? 92   ARG B CG    1 
ATOM   1365  C  CD    . ARG B  2 92  ? -25.255 -12.488 38.373 1.00 46.32  ? 92   ARG B CD    1 
ATOM   1366  N  NE    . ARG B  2 92  ? -23.813 -12.323 38.509 1.00 47.12  ? 92   ARG B NE    1 
ATOM   1367  C  CZ    . ARG B  2 92  ? -23.229 -11.661 39.504 1.00 48.58  ? 92   ARG B CZ    1 
ATOM   1368  N  NH1   . ARG B  2 92  ? -23.962 -11.088 40.452 1.00 49.44  ? 92   ARG B NH1   1 
ATOM   1369  N  NH2   . ARG B  2 92  ? -21.908 -11.564 39.553 1.00 48.99  ? 92   ARG B NH2   1 
ATOM   1370  N  N     . GLN B  2 93  ? -26.130 -15.782 41.950 1.00 45.60  ? 93   GLN B N     1 
ATOM   1371  C  CA    . GLN B  2 93  ? -25.910 -15.713 43.413 1.00 45.72  ? 93   GLN B CA    1 
ATOM   1372  C  C     . GLN B  2 93  ? -25.488 -17.075 43.950 1.00 45.39  ? 93   GLN B C     1 
ATOM   1373  O  O     . GLN B  2 93  ? -25.333 -17.240 45.157 1.00 45.03  ? 93   GLN B O     1 
ATOM   1374  C  CB    . GLN B  2 93  ? -27.154 -15.275 44.196 1.00 46.04  ? 93   GLN B CB    1 
ATOM   1375  C  CG    . GLN B  2 93  ? -27.623 -13.827 44.033 1.00 48.08  ? 93   GLN B CG    1 
ATOM   1376  C  CD    . GLN B  2 93  ? -26.515 -12.779 44.164 1.00 50.49  ? 93   GLN B CD    1 
ATOM   1377  O  OE1   . GLN B  2 93  ? -26.246 -12.042 43.216 1.00 51.27  ? 93   GLN B OE1   1 
ATOM   1378  N  NE2   . GLN B  2 93  ? -25.883 -12.700 45.334 1.00 51.62  ? 93   GLN B NE2   1 
ATOM   1379  N  N     . GLY B  2 94  ? -25.309 -18.040 43.047 1.00 45.41  ? 94   GLY B N     1 
ATOM   1380  C  CA    . GLY B  2 94  ? -25.059 -19.439 43.405 1.00 45.52  ? 94   GLY B CA    1 
ATOM   1381  C  C     . GLY B  2 94  ? -26.259 -20.097 44.082 1.00 45.71  ? 94   GLY B C     1 
ATOM   1382  O  O     . GLY B  2 94  ? -26.103 -20.996 44.915 1.00 45.73  ? 94   GLY B O     1 
ATOM   1383  N  N     . ARG B  2 95  ? -27.460 -19.632 43.739 1.00 45.60  ? 95   ARG B N     1 
ATOM   1384  C  CA    . ARG B  2 95  ? -28.691 -20.150 44.317 1.00 45.16  ? 95   ARG B CA    1 
ATOM   1385  C  C     . ARG B  2 95  ? -29.657 -20.599 43.219 1.00 45.09  ? 95   ARG B C     1 
ATOM   1386  O  O     . ARG B  2 95  ? -30.829 -20.238 43.241 1.00 45.27  ? 95   ARG B O     1 
ATOM   1387  C  CB    . ARG B  2 95  ? -29.329 -19.102 45.231 1.00 44.81  ? 95   ARG B CB    1 
ATOM   1388  C  CG    . ARG B  2 95  ? -28.418 -18.660 46.363 1.00 45.85  ? 95   ARG B CG    1 
ATOM   1389  C  CD    . ARG B  2 95  ? -29.159 -18.409 47.664 1.00 47.83  ? 95   ARG B CD    1 
ATOM   1390  N  NE    . ARG B  2 95  ? -29.918 -19.595 48.090 1.00 51.75  ? 95   ARG B NE    1 
ATOM   1391  C  CZ    . ARG B  2 95  ? -29.480 -20.508 48.969 1.00 52.83  ? 95   ARG B CZ    1 
ATOM   1392  N  NH1   . ARG B  2 95  ? -28.273 -20.369 49.532 1.00 53.47  ? 95   ARG B NH1   1 
ATOM   1393  N  NH2   . ARG B  2 95  ? -30.249 -21.552 49.301 1.00 51.11  ? 95   ARG B NH2   1 
ATOM   1394  N  N     . THR B  2 96  ? -29.153 -21.386 42.263 1.00 44.90  ? 96   THR B N     1 
ATOM   1395  C  CA    . THR B  2 96  ? -29.943 -21.904 41.141 1.00 44.86  ? 96   THR B CA    1 
ATOM   1396  C  C     . THR B  2 96  ? -31.326 -22.385 41.565 1.00 45.28  ? 96   THR B C     1 
ATOM   1397  O  O     . THR B  2 96  ? -31.445 -23.060 42.596 1.00 45.97  ? 96   THR B O     1 
ATOM   1398  C  CB    . THR B  2 96  ? -29.218 -23.066 40.485 1.00 44.43  ? 96   THR B CB    1 
ATOM   1399  O  OG1   . THR B  2 96  ? -28.049 -22.573 39.842 1.00 44.42  ? 96   THR B OG1   1 
ATOM   1400  C  CG2   . THR B  2 96  ? -30.084 -23.731 39.444 1.00 45.11  ? 96   THR B CG2   1 
ATOM   1401  N  N     . LEU B  2 97  ? -32.357 -22.035 40.780 1.00 45.31  ? 97   LEU B N     1 
ATOM   1402  C  CA    . LEU B  2 97  ? -33.752 -22.446 41.049 1.00 45.21  ? 97   LEU B CA    1 
ATOM   1403  C  C     . LEU B  2 97  ? -34.359 -23.193 39.872 1.00 45.66  ? 97   LEU B C     1 
ATOM   1404  O  O     . LEU B  2 97  ? -34.275 -22.743 38.739 1.00 46.16  ? 97   LEU B O     1 
ATOM   1405  C  CB    . LEU B  2 97  ? -34.615 -21.230 41.389 1.00 44.90  ? 97   LEU B CB    1 
ATOM   1406  C  CG    . LEU B  2 97  ? -36.096 -21.380 41.768 1.00 44.92  ? 97   LEU B CG    1 
ATOM   1407  C  CD1   . LEU B  2 97  ? -36.276 -22.094 43.083 1.00 44.03  ? 97   LEU B CD1   1 
ATOM   1408  C  CD2   . LEU B  2 97  ? -36.815 -20.029 41.828 1.00 44.78  ? 97   LEU B CD2   1 
ATOM   1409  N  N     . TYR B  2 98  ? -34.972 -24.340 40.134 1.00 46.22  ? 98   TYR B N     1 
ATOM   1410  C  CA    . TYR B  2 98  ? -35.615 -25.118 39.074 1.00 46.60  ? 98   TYR B CA    1 
ATOM   1411  C  C     . TYR B  2 98  ? -37.112 -24.852 39.057 1.00 47.98  ? 98   TYR B C     1 
ATOM   1412  O  O     . TYR B  2 98  ? -37.766 -24.813 40.108 1.00 47.71  ? 98   TYR B O     1 
ATOM   1413  C  CB    . TYR B  2 98  ? -35.358 -26.616 39.257 1.00 45.51  ? 98   TYR B CB    1 
ATOM   1414  C  CG    . TYR B  2 98  ? -33.993 -27.101 38.799 1.00 44.47  ? 98   TYR B CG    1 
ATOM   1415  C  CD1   . TYR B  2 98  ? -33.013 -26.209 38.360 1.00 43.13  ? 98   TYR B CD1   1 
ATOM   1416  C  CD2   . TYR B  2 98  ? -33.669 -28.455 38.844 1.00 42.70  ? 98   TYR B CD2   1 
ATOM   1417  C  CE1   . TYR B  2 98  ? -31.770 -26.656 37.958 1.00 42.02  ? 98   TYR B CE1   1 
ATOM   1418  C  CE2   . TYR B  2 98  ? -32.432 -28.903 38.447 1.00 42.03  ? 98   TYR B CE2   1 
ATOM   1419  C  CZ    . TYR B  2 98  ? -31.490 -27.998 38.004 1.00 42.94  ? 98   TYR B CZ    1 
ATOM   1420  O  OH    . TYR B  2 98  ? -30.253 -28.441 37.615 1.00 44.01  ? 98   TYR B OH    1 
ATOM   1421  N  N     . GLY B  2 99  ? -37.646 -24.646 37.857 1.00 49.78  ? 99   GLY B N     1 
ATOM   1422  C  CA    . GLY B  2 99  ? -39.087 -24.655 37.659 1.00 52.00  ? 99   GLY B CA    1 
ATOM   1423  C  C     . GLY B  2 99  ? -39.689 -23.367 37.168 1.00 53.64  ? 99   GLY B C     1 
ATOM   1424  O  O     . GLY B  2 99  ? -40.899 -23.243 37.102 1.00 53.98  ? 99   GLY B O     1 
ATOM   1425  N  N     . PHE B  2 100 ? -38.864 -22.395 36.827 1.00 55.48  ? 100  PHE B N     1 
ATOM   1426  C  CA    . PHE B  2 100 ? -39.401 -21.150 36.308 1.00 57.45  ? 100  PHE B CA    1 
ATOM   1427  C  C     . PHE B  2 100 ? -38.686 -20.759 35.025 1.00 59.18  ? 100  PHE B C     1 
ATOM   1428  O  O     . PHE B  2 100 ? -38.737 -19.601 34.621 1.00 59.12  ? 100  PHE B O     1 
ATOM   1429  C  CB    . PHE B  2 100 ? -39.284 -20.030 37.346 1.00 56.98  ? 100  PHE B CB    1 
ATOM   1430  C  CG    . PHE B  2 100 ? -40.098 -20.257 38.605 1.00 56.80  ? 100  PHE B CG    1 
ATOM   1431  C  CD1   . PHE B  2 100 ? -39.539 -20.868 39.712 1.00 56.25  ? 100  PHE B CD1   1 
ATOM   1432  C  CD2   . PHE B  2 100 ? -41.413 -19.825 38.694 1.00 56.81  ? 100  PHE B CD2   1 
ATOM   1433  C  CE1   . PHE B  2 100 ? -40.281 -21.060 40.880 1.00 55.80  ? 100  PHE B CE1   1 
ATOM   1434  C  CE2   . PHE B  2 100 ? -42.157 -20.009 39.865 1.00 55.98  ? 100  PHE B CE2   1 
ATOM   1435  C  CZ    . PHE B  2 100 ? -41.588 -20.625 40.952 1.00 55.72  ? 100  PHE B CZ    1 
ATOM   1436  N  N     . GLY B  2 101 ? -38.027 -21.733 34.390 1.00 61.36  ? 101  GLY B N     1 
ATOM   1437  C  CA    . GLY B  2 101 ? -37.201 -21.469 33.209 1.00 64.10  ? 101  GLY B CA    1 
ATOM   1438  C  C     . GLY B  2 101 ? -38.004 -21.430 31.912 1.00 66.35  ? 101  GLY B C     1 
ATOM   1439  O  O     . GLY B  2 101 ? -37.428 -21.553 30.802 1.00 66.92  ? 101  GLY B O     1 
ATOM   1440  N  N     . GLY B  2 102 ? -39.331 -21.254 32.048 1.00 67.71  ? 102  GLY B N     1 
ATOM   1441  C  CA    . GLY B  2 102 ? -40.286 -21.291 30.911 1.00 68.94  ? 102  GLY B CA    1 
ATOM   1442  C  C     . GLY B  2 102 ? -40.309 -20.077 29.969 1.00 69.51  ? 102  GLY B C     1 
ATOM   1443  O  O     . GLY B  2 102 ? -39.342 -19.304 29.858 1.00 69.77  ? 102  GLY B O     1 
ATOM   1444  O  OXT   . GLY B  2 102 ? -41.307 -19.833 29.270 1.00 69.74  ? 102  GLY B OXT   1 
ATOM   1445  N  N     . LYS C  3 15  ? -0.292  5.082   15.428 1.00 64.62  ? 15   LYS C N     1 
ATOM   1446  C  CA    . LYS C  3 15  ? -0.956  5.448   16.724 1.00 64.68  ? 15   LYS C CA    1 
ATOM   1447  C  C     . LYS C  3 15  ? -1.836  4.326   17.327 1.00 64.12  ? 15   LYS C C     1 
ATOM   1448  O  O     . LYS C  3 15  ? -2.829  3.898   16.707 1.00 64.13  ? 15   LYS C O     1 
ATOM   1449  C  CB    . LYS C  3 15  ? -1.770  6.735   16.545 1.00 64.90  ? 15   LYS C CB    1 
ATOM   1450  C  CG    . LYS C  3 15  ? -2.851  6.919   17.590 1.00 66.27  ? 15   LYS C CG    1 
ATOM   1451  C  CD    . LYS C  3 15  ? -3.374  8.331   17.619 1.00 68.58  ? 15   LYS C CD    1 
ATOM   1452  C  CE    . LYS C  3 15  ? -2.631  9.171   18.657 1.00 69.59  ? 15   LYS C CE    1 
ATOM   1453  N  NZ    . LYS C  3 15  ? -2.937  10.624  18.470 1.00 71.08  ? 15   LYS C NZ    1 
ATOM   1454  N  N     . THR C  3 16  ? -1.483  3.877   18.538 1.00 63.20  ? 16   THR C N     1 
ATOM   1455  C  CA    . THR C  3 16  ? -2.214  2.779   19.202 1.00 62.02  ? 16   THR C CA    1 
ATOM   1456  C  C     . THR C  3 16  ? -3.617  3.180   19.627 1.00 61.57  ? 16   THR C C     1 
ATOM   1457  O  O     . THR C  3 16  ? -3.945  4.365   19.744 1.00 61.28  ? 16   THR C O     1 
ATOM   1458  C  CB    . THR C  3 16  ? -1.510  2.225   20.464 1.00 61.72  ? 16   THR C CB    1 
ATOM   1459  O  OG1   . THR C  3 16  ? -1.449  3.238   21.474 1.00 61.13  ? 16   THR C OG1   1 
ATOM   1460  C  CG2   . THR C  3 16  ? -0.126  1.705   20.146 1.00 61.47  ? 16   THR C CG2   1 
ATOM   1461  N  N     . ARG C  3 17  ? -4.433  2.164   19.864 1.00 60.88  ? 17   ARG C N     1 
ATOM   1462  C  CA    . ARG C  3 17  ? -5.777  2.362   20.360 1.00 60.41  ? 17   ARG C CA    1 
ATOM   1463  C  C     . ARG C  3 17  ? -5.743  2.681   21.849 1.00 59.95  ? 17   ARG C C     1 
ATOM   1464  O  O     . ARG C  3 17  ? -6.649  3.335   22.377 1.00 59.90  ? 17   ARG C O     1 
ATOM   1465  C  CB    . ARG C  3 17  ? -6.615  1.110   20.118 1.00 60.62  ? 17   ARG C CB    1 
ATOM   1466  C  CG    . ARG C  3 17  ? -6.823  0.760   18.660 1.00 60.38  ? 17   ARG C CG    1 
ATOM   1467  C  CD    . ARG C  3 17  ? -8.069  -0.057  18.494 1.00 59.67  ? 17   ARG C CD    1 
ATOM   1468  N  NE    . ARG C  3 17  ? -7.778  -1.481  18.522 1.00 59.99  ? 17   ARG C NE    1 
ATOM   1469  C  CZ    . ARG C  3 17  ? -8.696  -2.431  18.689 1.00 60.48  ? 17   ARG C CZ    1 
ATOM   1470  N  NH1   . ARG C  3 17  ? -9.979  -2.103  18.863 1.00 60.34  ? 17   ARG C NH1   1 
ATOM   1471  N  NH2   . ARG C  3 17  ? -8.324  -3.709  18.691 1.00 59.89  ? 17   ARG C NH2   1 
ATOM   1472  N  N     . SER C  3 18  ? -4.702  2.203   22.525 1.00 59.30  ? 18   SER C N     1 
ATOM   1473  C  CA    . SER C  3 18  ? -4.553  2.454   23.950 1.00 58.70  ? 18   SER C CA    1 
ATOM   1474  C  C     . SER C  3 18  ? -4.370  3.951   24.205 1.00 58.49  ? 18   SER C C     1 
ATOM   1475  O  O     . SER C  3 18  ? -5.096  4.538   25.016 1.00 58.39  ? 18   SER C O     1 
ATOM   1476  C  CB    . SER C  3 18  ? -3.403  1.629   24.534 1.00 58.61  ? 18   SER C CB    1 
ATOM   1477  O  OG    . SER C  3 18  ? -3.648  0.245   24.374 1.00 57.21  ? 18   SER C OG    1 
ATOM   1478  N  N     . SER C  3 19  ? -3.425  4.566   23.489 1.00 58.08  ? 19   SER C N     1 
ATOM   1479  C  CA    . SER C  3 19  ? -3.221  6.017   23.570 1.00 57.81  ? 19   SER C CA    1 
ATOM   1480  C  C     . SER C  3 19  ? -4.472  6.759   23.101 1.00 57.25  ? 19   SER C C     1 
ATOM   1481  O  O     . SER C  3 19  ? -4.891  7.741   23.706 1.00 57.05  ? 19   SER C O     1 
ATOM   1482  C  CB    . SER C  3 19  ? -1.984  6.464   22.778 1.00 57.75  ? 19   SER C CB    1 
ATOM   1483  O  OG    . SER C  3 19  ? -2.189  6.334   21.383 1.00 58.47  ? 19   SER C OG    1 
ATOM   1484  N  N     . ARG C  3 20  ? -5.080  6.261   22.038 1.00 56.88  ? 20   ARG C N     1 
ATOM   1485  C  CA    . ARG C  3 20  ? -6.284  6.871   21.514 1.00 56.81  ? 20   ARG C CA    1 
ATOM   1486  C  C     . ARG C  3 20  ? -7.423  6.868   22.554 1.00 56.05  ? 20   ARG C C     1 
ATOM   1487  O  O     . ARG C  3 20  ? -8.231  7.803   22.594 1.00 56.11  ? 20   ARG C O     1 
ATOM   1488  C  CB    . ARG C  3 20  ? -6.674  6.220   20.178 1.00 57.04  ? 20   ARG C CB    1 
ATOM   1489  C  CG    . ARG C  3 20  ? -8.049  6.611   19.659 1.00 59.75  ? 20   ARG C CG    1 
ATOM   1490  C  CD    . ARG C  3 20  ? -8.157  6.594   18.135 1.00 64.37  ? 20   ARG C CD    1 
ATOM   1491  N  NE    . ARG C  3 20  ? -7.889  5.285   17.538 1.00 67.98  ? 20   ARG C NE    1 
ATOM   1492  C  CZ    . ARG C  3 20  ? -6.750  4.958   16.928 1.00 70.21  ? 20   ARG C CZ    1 
ATOM   1493  N  NH1   . ARG C  3 20  ? -5.753  5.841   16.830 1.00 71.56  ? 20   ARG C NH1   1 
ATOM   1494  N  NH2   . ARG C  3 20  ? -6.608  3.748   16.403 1.00 71.03  ? 20   ARG C NH2   1 
ATOM   1495  N  N     . ALA C  3 21  ? -7.460  5.849   23.414 1.00 55.20  ? 21   ALA C N     1 
ATOM   1496  C  CA    . ALA C  3 21  ? -8.460  5.792   24.497 1.00 54.35  ? 21   ALA C CA    1 
ATOM   1497  C  C     . ALA C  3 21  ? -7.919  6.275   25.847 1.00 53.72  ? 21   ALA C C     1 
ATOM   1498  O  O     . ALA C  3 21  ? -8.622  6.223   26.866 1.00 53.44  ? 21   ALA C O     1 
ATOM   1499  C  CB    . ALA C  3 21  ? -9.025  4.403   24.627 1.00 54.34  ? 21   ALA C CB    1 
ATOM   1500  N  N     . GLY C  3 22  ? -6.673  6.746   25.838 1.00 52.95  ? 22   GLY C N     1 
ATOM   1501  C  CA    . GLY C  3 22  ? -6.037  7.316   27.020 1.00 52.25  ? 22   GLY C CA    1 
ATOM   1502  C  C     . GLY C  3 22  ? -5.686  6.267   28.054 1.00 51.89  ? 22   GLY C C     1 
ATOM   1503  O  O     . GLY C  3 22  ? -5.862  6.486   29.268 1.00 52.01  ? 22   GLY C O     1 
ATOM   1504  N  N     . LEU C  3 23  ? -5.183  5.128   27.578 1.00 50.99  ? 23   LEU C N     1 
ATOM   1505  C  CA    . LEU C  3 23  ? -4.974  3.988   28.452 1.00 50.29  ? 23   LEU C CA    1 
ATOM   1506  C  C     . LEU C  3 23  ? -3.562  3.445   28.436 1.00 50.07  ? 23   LEU C C     1 
ATOM   1507  O  O     . LEU C  3 23  ? -2.833  3.577   27.448 1.00 50.12  ? 23   LEU C O     1 
ATOM   1508  C  CB    . LEU C  3 23  ? -5.966  2.871   28.136 1.00 49.88  ? 23   LEU C CB    1 
ATOM   1509  C  CG    . LEU C  3 23  ? -7.449  3.137   28.389 1.00 49.68  ? 23   LEU C CG    1 
ATOM   1510  C  CD1   . LEU C  3 23  ? -8.221  1.884   28.083 1.00 51.04  ? 23   LEU C CD1   1 
ATOM   1511  C  CD2   . LEU C  3 23  ? -7.747  3.581   29.803 1.00 48.74  ? 23   LEU C CD2   1 
ATOM   1512  N  N     . GLN C  3 24  ? -3.199  2.835   29.558 1.00 49.58  ? 24   GLN C N     1 
ATOM   1513  C  CA    . GLN C  3 24  ? -1.943  2.149   29.712 1.00 49.26  ? 24   GLN C CA    1 
ATOM   1514  C  C     . GLN C  3 24  ? -2.088  0.714   29.259 1.00 49.11  ? 24   GLN C C     1 
ATOM   1515  O  O     . GLN C  3 24  ? -1.156  0.159   28.686 1.00 49.31  ? 24   GLN C O     1 
ATOM   1516  C  CB    . GLN C  3 24  ? -1.520  2.157   31.177 1.00 49.32  ? 24   GLN C CB    1 
ATOM   1517  C  CG    . GLN C  3 24  ? -1.390  3.536   31.802 1.00 49.78  ? 24   GLN C CG    1 
ATOM   1518  C  CD    . GLN C  3 24  ? -0.466  4.437   31.022 1.00 49.84  ? 24   GLN C CD    1 
ATOM   1519  O  OE1   . GLN C  3 24  ? 0.639   4.048   30.632 1.00 49.67  ? 24   GLN C OE1   1 
ATOM   1520  N  NE2   . GLN C  3 24  ? -0.920  5.649   30.777 1.00 50.39  ? 24   GLN C NE2   1 
ATOM   1521  N  N     . PHE C  3 25  ? -3.249  0.116   29.536 1.00 48.79  ? 25   PHE C N     1 
ATOM   1522  C  CA    . PHE C  3 25  ? -3.513  -1.294  29.236 1.00 48.53  ? 25   PHE C CA    1 
ATOM   1523  C  C     . PHE C  3 25  ? -3.753  -1.528  27.740 1.00 48.72  ? 25   PHE C C     1 
ATOM   1524  O  O     . PHE C  3 25  ? -4.282  -0.656  27.047 1.00 49.07  ? 25   PHE C O     1 
ATOM   1525  C  CB    . PHE C  3 25  ? -4.694  -1.784  30.059 1.00 48.24  ? 25   PHE C CB    1 
ATOM   1526  C  CG    . PHE C  3 25  ? -4.310  -2.376  31.389 1.00 48.44  ? 25   PHE C CG    1 
ATOM   1527  C  CD1   . PHE C  3 25  ? -3.323  -1.808  32.168 1.00 48.42  ? 25   PHE C CD1   1 
ATOM   1528  C  CD2   . PHE C  3 25  ? -4.970  -3.504  31.879 1.00 49.08  ? 25   PHE C CD2   1 
ATOM   1529  C  CE1   . PHE C  3 25  ? -2.981  -2.361  33.401 1.00 48.50  ? 25   PHE C CE1   1 
ATOM   1530  C  CE2   . PHE C  3 25  ? -4.638  -4.061  33.114 1.00 47.99  ? 25   PHE C CE2   1 
ATOM   1531  C  CZ    . PHE C  3 25  ? -3.637  -3.489  33.870 1.00 48.37  ? 25   PHE C CZ    1 
ATOM   1532  N  N     . PRO C  3 26  ? -3.340  -2.694  27.221 1.00 48.70  ? 26   PRO C N     1 
ATOM   1533  C  CA    . PRO C  3 26  ? -3.386  -2.865  25.770 1.00 48.99  ? 26   PRO C CA    1 
ATOM   1534  C  C     . PRO C  3 26  ? -4.772  -3.142  25.204 1.00 49.28  ? 26   PRO C C     1 
ATOM   1535  O  O     . PRO C  3 26  ? -5.285  -4.242  25.360 1.00 49.64  ? 26   PRO C O     1 
ATOM   1536  C  CB    . PRO C  3 26  ? -2.448  -4.042  25.521 1.00 48.77  ? 26   PRO C CB    1 
ATOM   1537  C  CG    . PRO C  3 26  ? -2.397  -4.773  26.800 1.00 48.63  ? 26   PRO C CG    1 
ATOM   1538  C  CD    . PRO C  3 26  ? -2.795  -3.872  27.908 1.00 48.69  ? 26   PRO C CD    1 
ATOM   1539  N  N     . VAL C  3 27  ? -5.367  -2.159  24.532 1.00 49.67  ? 27   VAL C N     1 
ATOM   1540  C  CA    . VAL C  3 27  ? -6.688  -2.353  23.918 1.00 49.95  ? 27   VAL C CA    1 
ATOM   1541  C  C     . VAL C  3 27  ? -6.684  -3.425  22.820 1.00 50.10  ? 27   VAL C C     1 
ATOM   1542  O  O     . VAL C  3 27  ? -7.643  -4.194  22.704 1.00 50.19  ? 27   VAL C O     1 
ATOM   1543  C  CB    . VAL C  3 27  ? -7.301  -1.050  23.377 1.00 49.76  ? 27   VAL C CB    1 
ATOM   1544  C  CG1   . VAL C  3 27  ? -8.654  -1.329  22.781 1.00 49.70  ? 27   VAL C CG1   1 
ATOM   1545  C  CG2   . VAL C  3 27  ? -7.469  -0.047  24.494 1.00 50.32  ? 27   VAL C CG2   1 
ATOM   1546  N  N     . GLY C  3 28  ? -5.614  -3.474  22.031 1.00 49.99  ? 28   GLY C N     1 
ATOM   1547  C  CA    . GLY C  3 28  ? -5.486  -4.486  20.990 1.00 50.12  ? 28   GLY C CA    1 
ATOM   1548  C  C     . GLY C  3 28  ? -5.477  -5.901  21.543 1.00 50.17  ? 28   GLY C C     1 
ATOM   1549  O  O     . GLY C  3 28  ? -6.185  -6.779  21.049 1.00 50.25  ? 28   GLY C O     1 
ATOM   1550  N  N     . ARG C  3 29  ? -4.678  -6.127  22.576 1.00 50.19  ? 29   ARG C N     1 
ATOM   1551  C  CA    . ARG C  3 29  ? -4.594  -7.449  23.179 1.00 50.21  ? 29   ARG C CA    1 
ATOM   1552  C  C     . ARG C  3 29  ? -5.932  -7.869  23.765 1.00 50.50  ? 29   ARG C C     1 
ATOM   1553  O  O     . ARG C  3 29  ? -6.442  -8.928  23.434 1.00 50.34  ? 29   ARG C O     1 
ATOM   1554  C  CB    . ARG C  3 29  ? -3.516  -7.480  24.253 1.00 50.10  ? 29   ARG C CB    1 
ATOM   1555  C  CG    . ARG C  3 29  ? -3.253  -8.842  24.797 1.00 49.14  ? 29   ARG C CG    1 
ATOM   1556  C  CD    . ARG C  3 29  ? -2.172  -8.779  25.817 1.00 49.37  ? 29   ARG C CD    1 
ATOM   1557  N  NE    . ARG C  3 29  ? -0.834  -8.740  25.242 1.00 50.21  ? 29   ARG C NE    1 
ATOM   1558  C  CZ    . ARG C  3 29  ? 0.277   -8.872  25.964 1.00 51.66  ? 29   ARG C CZ    1 
ATOM   1559  N  NH1   . ARG C  3 29  ? 0.192   -9.052  27.278 1.00 52.21  ? 29   ARG C NH1   1 
ATOM   1560  N  NH2   . ARG C  3 29  ? 1.472   -8.836  25.380 1.00 52.34  ? 29   ARG C NH2   1 
ATOM   1561  N  N     . VAL C  3 30  ? -6.496  -7.026  24.627 1.00 51.14  ? 30   VAL C N     1 
ATOM   1562  C  CA    . VAL C  3 30  ? -7.811  -7.273  25.226 1.00 51.97  ? 30   VAL C CA    1 
ATOM   1563  C  C     . VAL C  3 30  ? -8.854  -7.636  24.142 1.00 52.85  ? 30   VAL C C     1 
ATOM   1564  O  O     . VAL C  3 30  ? -9.597  -8.616  24.267 1.00 52.98  ? 30   VAL C O     1 
ATOM   1565  C  CB    . VAL C  3 30  ? -8.265  -6.074  26.114 1.00 51.75  ? 30   VAL C CB    1 
ATOM   1566  C  CG1   . VAL C  3 30  ? -9.696  -6.247  26.608 1.00 51.71  ? 30   VAL C CG1   1 
ATOM   1567  C  CG2   . VAL C  3 30  ? -7.343  -5.918  27.290 1.00 51.31  ? 30   VAL C CG2   1 
ATOM   1568  N  N     . HIS C  3 31  ? -8.879  -6.859  23.065 1.00 53.97  ? 31   HIS C N     1 
ATOM   1569  C  CA    . HIS C  3 31  ? -9.707  -7.173  21.912 1.00 54.70  ? 31   HIS C CA    1 
ATOM   1570  C  C     . HIS C  3 31  ? -9.413  -8.569  21.379 1.00 54.82  ? 31   HIS C C     1 
ATOM   1571  O  O     . HIS C  3 31  ? -10.333 -9.361  21.188 1.00 55.18  ? 31   HIS C O     1 
ATOM   1572  C  CB    . HIS C  3 31  ? -9.475  -6.167  20.795 1.00 55.10  ? 31   HIS C CB    1 
ATOM   1573  C  CG    . HIS C  3 31  ? -10.649 -6.004  19.894 1.00 56.17  ? 31   HIS C CG    1 
ATOM   1574  N  ND1   . HIS C  3 31  ? -11.651 -6.944  19.814 1.00 57.80  ? 31   HIS C ND1   1 
ATOM   1575  C  CD2   . HIS C  3 31  ? -10.985 -5.018  19.035 1.00 57.47  ? 31   HIS C CD2   1 
ATOM   1576  C  CE1   . HIS C  3 31  ? -12.566 -6.534  18.955 1.00 59.32  ? 31   HIS C CE1   1 
ATOM   1577  N  NE2   . HIS C  3 31  ? -12.183 -5.372  18.462 1.00 59.55  ? 31   HIS C NE2   1 
ATOM   1578  N  N     . ARG C  3 32  ? -8.137  -8.864  21.138 1.00 54.69  ? 32   ARG C N     1 
ATOM   1579  C  CA    . ARG C  3 32  ? -7.752  -10.163 20.605 1.00 54.80  ? 32   ARG C CA    1 
ATOM   1580  C  C     . ARG C  3 32  ? -8.253  -11.302 21.495 1.00 55.08  ? 32   ARG C C     1 
ATOM   1581  O  O     . ARG C  3 32  ? -8.913  -12.233 21.000 1.00 55.31  ? 32   ARG C O     1 
ATOM   1582  C  CB    . ARG C  3 32  ? -6.237  -10.244 20.426 1.00 54.68  ? 32   ARG C CB    1 
ATOM   1583  C  CG    . ARG C  3 32  ? -5.778  -11.454 19.659 1.00 54.27  ? 32   ARG C CG    1 
ATOM   1584  C  CD    . ARG C  3 32  ? -4.286  -11.447 19.491 1.00 54.95  ? 32   ARG C CD    1 
ATOM   1585  N  NE    . ARG C  3 32  ? -3.605  -11.900 20.702 1.00 55.62  ? 32   ARG C NE    1 
ATOM   1586  C  CZ    . ARG C  3 32  ? -2.770  -11.156 21.424 1.00 55.33  ? 32   ARG C CZ    1 
ATOM   1587  N  NH1   . ARG C  3 32  ? -2.501  -9.913  21.055 1.00 55.82  ? 32   ARG C NH1   1 
ATOM   1588  N  NH2   . ARG C  3 32  ? -2.197  -11.656 22.513 1.00 53.48  ? 32   ARG C NH2   1 
ATOM   1589  N  N     . LEU C  3 33  ? -7.956  -11.204 22.799 1.00 55.11  ? 33   LEU C N     1 
ATOM   1590  C  CA    . LEU C  3 33  ? -8.284  -12.244 23.775 1.00 55.01  ? 33   LEU C CA    1 
ATOM   1591  C  C     . LEU C  3 33  ? -9.780  -12.458 23.867 1.00 55.37  ? 33   LEU C C     1 
ATOM   1592  O  O     . LEU C  3 33  ? -10.233 -13.562 24.134 1.00 55.47  ? 33   LEU C O     1 
ATOM   1593  C  CB    . LEU C  3 33  ? -7.723  -11.905 25.153 1.00 54.68  ? 33   LEU C CB    1 
ATOM   1594  C  CG    . LEU C  3 33  ? -6.206  -11.780 25.306 1.00 54.42  ? 33   LEU C CG    1 
ATOM   1595  C  CD1   . LEU C  3 33  ? -5.896  -11.198 26.651 1.00 55.94  ? 33   LEU C CD1   1 
ATOM   1596  C  CD2   . LEU C  3 33  ? -5.499  -13.087 25.183 1.00 53.39  ? 33   LEU C CD2   1 
ATOM   1597  N  N     . LEU C  3 34  ? -10.543 -11.401 23.630 1.00 55.85  ? 34   LEU C N     1 
ATOM   1598  C  CA    . LEU C  3 34  ? -11.992 -11.502 23.610 1.00 56.57  ? 34   LEU C CA    1 
ATOM   1599  C  C     . LEU C  3 34  ? -12.558 -12.304 22.420 1.00 57.46  ? 34   LEU C C     1 
ATOM   1600  O  O     . LEU C  3 34  ? -13.577 -12.995 22.554 1.00 57.42  ? 34   LEU C O     1 
ATOM   1601  C  CB    . LEU C  3 34  ? -12.614 -10.113 23.658 1.00 56.33  ? 34   LEU C CB    1 
ATOM   1602  C  CG    . LEU C  3 34  ? -12.793 -9.416  25.004 1.00 55.35  ? 34   LEU C CG    1 
ATOM   1603  C  CD1   . LEU C  3 34  ? -13.522 -8.130  24.743 1.00 55.06  ? 34   LEU C CD1   1 
ATOM   1604  C  CD2   . LEU C  3 34  ? -13.585 -10.253 25.985 1.00 54.69  ? 34   LEU C CD2   1 
ATOM   1605  N  N     . ARG C  3 35  ? -11.910 -12.203 21.261 1.00 58.49  ? 35   ARG C N     1 
ATOM   1606  C  CA    . ARG C  3 35  ? -12.293 -13.005 20.095 1.00 59.57  ? 35   ARG C CA    1 
ATOM   1607  C  C     . ARG C  3 35  ? -11.897 -14.456 20.355 1.00 59.53  ? 35   ARG C C     1 
ATOM   1608  O  O     . ARG C  3 35  ? -12.732 -15.363 20.274 1.00 59.91  ? 35   ARG C O     1 
ATOM   1609  C  CB    . ARG C  3 35  ? -11.629 -12.480 18.817 1.00 59.38  ? 35   ARG C CB    1 
ATOM   1610  C  CG    . ARG C  3 35  ? -11.839 -10.991 18.578 1.00 60.38  ? 35   ARG C CG    1 
ATOM   1611  C  CD    . ARG C  3 35  ? -11.323 -10.553 17.204 1.00 61.17  ? 35   ARG C CD    1 
ATOM   1612  N  NE    . ARG C  3 35  ? -11.689 -9.168  16.862 1.00 65.45  ? 35   ARG C NE    1 
ATOM   1613  C  CZ    . ARG C  3 35  ? -12.932 -8.731  16.594 1.00 67.07  ? 35   ARG C CZ    1 
ATOM   1614  N  NH1   . ARG C  3 35  ? -13.990 -9.551  16.654 1.00 67.19  ? 35   ARG C NH1   1 
ATOM   1615  N  NH2   . ARG C  3 35  ? -13.129 -7.448  16.284 1.00 66.83  ? 35   ARG C NH2   1 
ATOM   1616  N  N     . LYS C  3 36  ? -10.626 -14.647 20.709 1.00 59.39  ? 36   LYS C N     1 
ATOM   1617  C  CA    . LYS C  3 36  ? -10.054 -15.949 21.015 1.00 59.54  ? 36   LYS C CA    1 
ATOM   1618  C  C     . LYS C  3 36  ? -10.837 -16.753 22.070 1.00 59.09  ? 36   LYS C C     1 
ATOM   1619  O  O     . LYS C  3 36  ? -10.786 -17.981 22.097 1.00 58.91  ? 36   LYS C O     1 
ATOM   1620  C  CB    . LYS C  3 36  ? -8.616  -15.741 21.495 1.00 59.60  ? 36   LYS C CB    1 
ATOM   1621  C  CG    . LYS C  3 36  ? -7.750  -16.995 21.529 1.00 60.30  ? 36   LYS C CG    1 
ATOM   1622  C  CD    . LYS C  3 36  ? -6.317  -16.679 21.979 1.00 60.62  ? 36   LYS C CD    1 
ATOM   1623  C  CE    . LYS C  3 36  ? -6.192  -16.614 23.518 1.00 62.41  ? 36   LYS C CE    1 
ATOM   1624  N  NZ    . LYS C  3 36  ? -4.743  -16.590 23.949 1.00 61.63  ? 36   LYS C NZ    1 
ATOM   1625  N  N     . GLY C  3 37  ? -11.557 -16.055 22.937 1.00 58.79  ? 37   GLY C N     1 
ATOM   1626  C  CA    . GLY C  3 37  ? -12.166 -16.691 24.096 1.00 58.47  ? 37   GLY C CA    1 
ATOM   1627  C  C     . GLY C  3 37  ? -13.520 -17.328 23.863 1.00 58.33  ? 37   GLY C C     1 
ATOM   1628  O  O     . GLY C  3 37  ? -13.976 -18.124 24.696 1.00 58.64  ? 37   GLY C O     1 
ATOM   1629  N  N     . ASN C  3 38  ? -14.165 -16.977 22.745 1.00 57.83  ? 38   ASN C N     1 
ATOM   1630  C  CA    . ASN C  3 38  ? -15.478 -17.526 22.379 1.00 57.42  ? 38   ASN C CA    1 
ATOM   1631  C  C     . ASN C  3 38  ? -16.575 -17.135 23.364 1.00 56.45  ? 38   ASN C C     1 
ATOM   1632  O  O     . ASN C  3 38  ? -17.230 -17.986 23.985 1.00 56.38  ? 38   ASN C O     1 
ATOM   1633  C  CB    . ASN C  3 38  ? -15.403 -19.049 22.192 1.00 57.79  ? 38   ASN C CB    1 
ATOM   1634  C  CG    . ASN C  3 38  ? -14.599 -19.438 20.959 1.00 60.17  ? 38   ASN C CG    1 
ATOM   1635  O  OD1   . ASN C  3 38  ? -13.872 -20.446 20.968 1.00 62.00  ? 38   ASN C OD1   1 
ATOM   1636  N  ND2   . ASN C  3 38  ? -14.715 -18.627 19.884 1.00 61.73  ? 38   ASN C ND2   1 
ATOM   1637  N  N     . TYR C  3 39  ? -16.757 -15.833 23.514 1.00 55.11  ? 39   TYR C N     1 
ATOM   1638  C  CA    . TYR C  3 39  ? -17.721 -15.327 24.460 1.00 53.95  ? 39   TYR C CA    1 
ATOM   1639  C  C     . TYR C  3 39  ? -18.980 -14.954 23.710 1.00 53.75  ? 39   TYR C C     1 
ATOM   1640  O  O     . TYR C  3 39  ? -20.085 -15.062 24.233 1.00 53.65  ? 39   TYR C O     1 
ATOM   1641  C  CB    . TYR C  3 39  ? -17.137 -14.142 25.234 1.00 53.41  ? 39   TYR C CB    1 
ATOM   1642  C  CG    . TYR C  3 39  ? -15.968 -14.507 26.143 1.00 52.29  ? 39   TYR C CG    1 
ATOM   1643  C  CD1   . TYR C  3 39  ? -14.651 -14.374 25.715 1.00 50.63  ? 39   TYR C CD1   1 
ATOM   1644  C  CD2   . TYR C  3 39  ? -16.187 -14.976 27.431 1.00 51.45  ? 39   TYR C CD2   1 
ATOM   1645  C  CE1   . TYR C  3 39  ? -13.585 -14.703 26.548 1.00 50.60  ? 39   TYR C CE1   1 
ATOM   1646  C  CE2   . TYR C  3 39  ? -15.124 -15.315 28.266 1.00 50.99  ? 39   TYR C CE2   1 
ATOM   1647  C  CZ    . TYR C  3 39  ? -13.829 -15.177 27.823 1.00 51.31  ? 39   TYR C CZ    1 
ATOM   1648  O  OH    . TYR C  3 39  ? -12.785 -15.518 28.663 1.00 51.63  ? 39   TYR C OH    1 
ATOM   1649  N  N     . ALA C  3 40  ? -18.806 -14.528 22.469 1.00 53.62  ? 40   ALA C N     1 
ATOM   1650  C  CA    . ALA C  3 40  ? -19.923 -14.247 21.597 1.00 53.96  ? 40   ALA C CA    1 
ATOM   1651  C  C     . ALA C  3 40  ? -19.468 -14.345 20.162 1.00 54.50  ? 40   ALA C C     1 
ATOM   1652  O  O     . ALA C  3 40  ? -18.271 -14.415 19.897 1.00 54.58  ? 40   ALA C O     1 
ATOM   1653  C  CB    . ALA C  3 40  ? -20.488 -12.890 21.883 1.00 53.61  ? 40   ALA C CB    1 
ATOM   1654  N  N     . GLU C  3 41  ? -20.424 -14.356 19.238 1.00 55.40  ? 41   GLU C N     1 
ATOM   1655  C  CA    . GLU C  3 41  ? -20.117 -14.399 17.803 1.00 56.32  ? 41   GLU C CA    1 
ATOM   1656  C  C     . GLU C  3 41  ? -19.309 -13.175 17.369 1.00 56.09  ? 41   GLU C C     1 
ATOM   1657  O  O     . GLU C  3 41  ? -18.346 -13.319 16.631 1.00 56.23  ? 41   GLU C O     1 
ATOM   1658  C  CB    . GLU C  3 41  ? -21.399 -14.538 16.953 1.00 56.81  ? 41   GLU C CB    1 
ATOM   1659  C  CG    . GLU C  3 41  ? -21.369 -15.686 15.943 1.00 59.57  ? 41   GLU C CG    1 
ATOM   1660  C  CD    . GLU C  3 41  ? -21.024 -17.032 16.612 1.00 65.16  ? 41   GLU C CD    1 
ATOM   1661  O  OE1   . GLU C  3 41  ? -20.023 -17.687 16.206 1.00 66.41  ? 41   GLU C OE1   1 
ATOM   1662  O  OE2   . GLU C  3 41  ? -21.742 -17.424 17.572 1.00 67.49  ? 41   GLU C OE2   1 
ATOM   1663  N  N     . ARG C  3 42  ? -19.695 -11.988 17.849 1.00 56.06  ? 42   ARG C N     1 
ATOM   1664  C  CA    . ARG C  3 42  ? -19.041 -10.717 17.483 1.00 56.03  ? 42   ARG C CA    1 
ATOM   1665  C  C     . ARG C  3 42  ? -18.570 -9.906  18.698 1.00 55.41  ? 42   ARG C C     1 
ATOM   1666  O  O     . ARG C  3 42  ? -19.139 -10.024 19.782 1.00 55.25  ? 42   ARG C O     1 
ATOM   1667  C  CB    . ARG C  3 42  ? -19.995 -9.843  16.660 1.00 56.51  ? 42   ARG C CB    1 
ATOM   1668  C  CG    . ARG C  3 42  ? -20.408 -10.410 15.309 1.00 58.08  ? 42   ARG C CG    1 
ATOM   1669  C  CD    . ARG C  3 42  ? -21.809 -9.930  14.911 1.00 60.88  ? 42   ARG C CD    1 
ATOM   1670  N  NE    . ARG C  3 42  ? -21.813 -8.677  14.154 1.00 62.72  ? 42   ARG C NE    1 
ATOM   1671  C  CZ    . ARG C  3 42  ? -21.664 -8.594  12.830 1.00 64.69  ? 42   ARG C CZ    1 
ATOM   1672  N  NH1   . ARG C  3 42  ? -21.481 -9.681  12.085 1.00 64.52  ? 42   ARG C NH1   1 
ATOM   1673  N  NH2   . ARG C  3 42  ? -21.688 -7.410  12.237 1.00 66.52  ? 42   ARG C NH2   1 
ATOM   1674  N  N     . VAL C  3 43  ? -17.540 -9.077  18.507 1.00 54.73  ? 43   VAL C N     1 
ATOM   1675  C  CA    . VAL C  3 43  ? -17.087 -8.148  19.556 1.00 53.99  ? 43   VAL C CA    1 
ATOM   1676  C  C     . VAL C  3 43  ? -17.010 -6.718  19.047 1.00 53.66  ? 43   VAL C C     1 
ATOM   1677  O  O     . VAL C  3 43  ? -16.125 -6.383  18.253 1.00 53.78  ? 43   VAL C O     1 
ATOM   1678  C  CB    . VAL C  3 43  ? -15.703 -8.515  20.112 1.00 53.79  ? 43   VAL C CB    1 
ATOM   1679  C  CG1   . VAL C  3 43  ? -15.267 -7.508  21.156 1.00 53.26  ? 43   VAL C CG1   1 
ATOM   1680  C  CG2   . VAL C  3 43  ? -15.729 -9.875  20.713 1.00 53.77  ? 43   VAL C CG2   1 
ATOM   1681  N  N     . GLY C  3 44  ? -17.924 -5.880  19.531 1.00 53.14  ? 44   GLY C N     1 
ATOM   1682  C  CA    . GLY C  3 44  ? -17.926 -4.440  19.240 1.00 52.71  ? 44   GLY C CA    1 
ATOM   1683  C  C     . GLY C  3 44  ? -16.637 -3.735  19.638 1.00 52.45  ? 44   GLY C C     1 
ATOM   1684  O  O     . GLY C  3 44  ? -15.935 -4.162  20.566 1.00 52.70  ? 44   GLY C O     1 
ATOM   1685  N  N     . ALA C  3 45  ? -16.322 -2.650  18.937 1.00 51.84  ? 45   ALA C N     1 
ATOM   1686  C  CA    . ALA C  3 45  ? -15.013 -2.004  19.070 1.00 51.24  ? 45   ALA C CA    1 
ATOM   1687  C  C     . ALA C  3 45  ? -14.824 -1.290  20.405 1.00 50.81  ? 45   ALA C C     1 
ATOM   1688  O  O     . ALA C  3 45  ? -13.692 -1.041  20.834 1.00 50.87  ? 45   ALA C O     1 
ATOM   1689  C  CB    . ALA C  3 45  ? -14.771 -1.057  17.919 1.00 51.33  ? 45   ALA C CB    1 
ATOM   1690  N  N     . GLY C  3 46  ? -15.939 -0.970  21.052 1.00 50.19  ? 46   GLY C N     1 
ATOM   1691  C  CA    . GLY C  3 46  ? -15.925 -0.333  22.358 1.00 49.55  ? 46   GLY C CA    1 
ATOM   1692  C  C     . GLY C  3 46  ? -15.741 -1.315  23.501 1.00 49.11  ? 46   GLY C C     1 
ATOM   1693  O  O     . GLY C  3 46  ? -15.457 -0.909  24.634 1.00 49.31  ? 46   GLY C O     1 
ATOM   1694  N  N     . ALA C  3 47  ? -15.891 -2.607  23.218 1.00 48.33  ? 47   ALA C N     1 
ATOM   1695  C  CA    . ALA C  3 47  ? -15.824 -3.597  24.284 1.00 47.57  ? 47   ALA C CA    1 
ATOM   1696  C  C     . ALA C  3 47  ? -14.407 -3.738  24.836 1.00 46.98  ? 47   ALA C C     1 
ATOM   1697  O  O     . ALA C  3 47  ? -14.220 -3.663  26.049 1.00 47.29  ? 47   ALA C O     1 
ATOM   1698  C  CB    . ALA C  3 47  ? -16.395 -4.932  23.845 1.00 47.51  ? 47   ALA C CB    1 
ATOM   1699  N  N     . PRO C  3 48  ? -13.398 -3.890  23.960 1.00 46.13  ? 48   PRO C N     1 
ATOM   1700  C  CA    . PRO C  3 48  ? -12.080 -4.056  24.547 1.00 45.77  ? 48   PRO C CA    1 
ATOM   1701  C  C     . PRO C  3 48  ? -11.596 -2.773  25.213 1.00 45.60  ? 48   PRO C C     1 
ATOM   1702  O  O     . PRO C  3 48  ? -10.711 -2.815  26.071 1.00 46.11  ? 48   PRO C O     1 
ATOM   1703  C  CB    . PRO C  3 48  ? -11.197 -4.398  23.350 1.00 45.38  ? 48   PRO C CB    1 
ATOM   1704  C  CG    . PRO C  3 48  ? -11.888 -3.839  22.216 1.00 45.85  ? 48   PRO C CG    1 
ATOM   1705  C  CD    . PRO C  3 48  ? -13.346 -3.915  22.492 1.00 45.90  ? 48   PRO C CD    1 
ATOM   1706  N  N     . VAL C  3 49  ? -12.178 -1.643  24.836 1.00 44.83  ? 49   VAL C N     1 
ATOM   1707  C  CA    . VAL C  3 49  ? -11.719 -0.381  25.367 1.00 44.19  ? 49   VAL C CA    1 
ATOM   1708  C  C     . VAL C  3 49  ? -12.217 -0.268  26.793 1.00 43.71  ? 49   VAL C C     1 
ATOM   1709  O  O     . VAL C  3 49  ? -11.431 -0.044  27.720 1.00 43.65  ? 49   VAL C O     1 
ATOM   1710  C  CB    . VAL C  3 49  ? -12.177 0.804   24.492 1.00 44.36  ? 49   VAL C CB    1 
ATOM   1711  C  CG1   . VAL C  3 49  ? -12.071 2.132   25.249 1.00 45.10  ? 49   VAL C CG1   1 
ATOM   1712  C  CG2   . VAL C  3 49  ? -11.349 0.860   23.228 1.00 43.51  ? 49   VAL C CG2   1 
ATOM   1713  N  N     . TYR C  3 50  ? -13.519 -0.462  26.957 1.00 43.07  ? 50   TYR C N     1 
ATOM   1714  C  CA    . TYR C  3 50  ? -14.166 -0.428  28.261 1.00 42.73  ? 50   TYR C CA    1 
ATOM   1715  C  C     . TYR C  3 50  ? -13.522 -1.416  29.238 1.00 42.66  ? 50   TYR C C     1 
ATOM   1716  O  O     . TYR C  3 50  ? -13.392 -1.141  30.438 1.00 42.77  ? 50   TYR C O     1 
ATOM   1717  C  CB    . TYR C  3 50  ? -15.633 -0.787  28.088 1.00 42.31  ? 50   TYR C CB    1 
ATOM   1718  C  CG    . TYR C  3 50  ? -16.538 -0.310  29.190 1.00 42.05  ? 50   TYR C CG    1 
ATOM   1719  C  CD1   . TYR C  3 50  ? -17.441 0.711   28.969 1.00 42.53  ? 50   TYR C CD1   1 
ATOM   1720  C  CD2   . TYR C  3 50  ? -16.509 -0.890  30.451 1.00 41.81  ? 50   TYR C CD2   1 
ATOM   1721  C  CE1   . TYR C  3 50  ? -18.290 1.145   29.978 1.00 42.47  ? 50   TYR C CE1   1 
ATOM   1722  C  CE2   . TYR C  3 50  ? -17.356 -0.461  31.459 1.00 41.06  ? 50   TYR C CE2   1 
ATOM   1723  C  CZ    . TYR C  3 50  ? -18.242 0.553   31.213 1.00 41.14  ? 50   TYR C CZ    1 
ATOM   1724  O  OH    . TYR C  3 50  ? -19.084 0.982   32.200 1.00 41.45  ? 50   TYR C OH    1 
ATOM   1725  N  N     . LEU C  3 51  ? -13.122 -2.570  28.714 1.00 42.22  ? 51   LEU C N     1 
ATOM   1726  C  CA    . LEU C  3 51  ? -12.568 -3.617  29.547 1.00 41.73  ? 51   LEU C CA    1 
ATOM   1727  C  C     . LEU C  3 51  ? -11.117 -3.331  29.937 1.00 41.57  ? 51   LEU C C     1 
ATOM   1728  O  O     . LEU C  3 51  ? -10.764 -3.454  31.110 1.00 41.74  ? 51   LEU C O     1 
ATOM   1729  C  CB    . LEU C  3 51  ? -12.725 -4.991  28.883 1.00 41.69  ? 51   LEU C CB    1 
ATOM   1730  C  CG    . LEU C  3 51  ? -12.322 -6.202  29.728 1.00 40.73  ? 51   LEU C CG    1 
ATOM   1731  C  CD1   . LEU C  3 51  ? -13.176 -6.313  30.960 1.00 39.67  ? 51   LEU C CD1   1 
ATOM   1732  C  CD2   . LEU C  3 51  ? -12.418 -7.456  28.902 1.00 40.39  ? 51   LEU C CD2   1 
ATOM   1733  N  N     . ALA C  3 52  ? -10.284 -2.945  28.971 1.00 41.08  ? 52   ALA C N     1 
ATOM   1734  C  CA    . ALA C  3 52  ? -8.943  -2.459  29.299 1.00 40.90  ? 52   ALA C CA    1 
ATOM   1735  C  C     . ALA C  3 52  ? -9.034  -1.396  30.400 1.00 40.63  ? 52   ALA C C     1 
ATOM   1736  O  O     . ALA C  3 52  ? -8.230  -1.377  31.342 1.00 40.74  ? 52   ALA C O     1 
ATOM   1737  C  CB    . ALA C  3 52  ? -8.262  -1.887  28.077 1.00 40.89  ? 52   ALA C CB    1 
ATOM   1738  N  N     . ALA C  3 53  ? -10.043 -0.539  30.286 1.00 39.77  ? 53   ALA C N     1 
ATOM   1739  C  CA    . ALA C  3 53  ? -10.242 0.528   31.235 1.00 39.29  ? 53   ALA C CA    1 
ATOM   1740  C  C     . ALA C  3 53  ? -10.480 0.003   32.644 1.00 38.90  ? 53   ALA C C     1 
ATOM   1741  O  O     . ALA C  3 53  ? -9.774  0.386   33.584 1.00 39.00  ? 53   ALA C O     1 
ATOM   1742  C  CB    . ALA C  3 53  ? -11.393 1.390   30.795 1.00 39.72  ? 53   ALA C CB    1 
ATOM   1743  N  N     . VAL C  3 54  ? -11.461 -0.887  32.783 1.00 38.19  ? 54   VAL C N     1 
ATOM   1744  C  CA    . VAL C  3 54  ? -11.818 -1.448  34.088 1.00 37.62  ? 54   VAL C CA    1 
ATOM   1745  C  C     . VAL C  3 54  ? -10.636 -2.195  34.738 1.00 37.56  ? 54   VAL C C     1 
ATOM   1746  O  O     . VAL C  3 54  ? -10.318 -2.011  35.919 1.00 36.74  ? 54   VAL C O     1 
ATOM   1747  C  CB    . VAL C  3 54  ? -13.079 -2.323  33.960 1.00 37.38  ? 54   VAL C CB    1 
ATOM   1748  C  CG1   . VAL C  3 54  ? -13.306 -3.181  35.200 1.00 36.94  ? 54   VAL C CG1   1 
ATOM   1749  C  CG2   . VAL C  3 54  ? -14.268 -1.441  33.720 1.00 37.01  ? 54   VAL C CG2   1 
ATOM   1750  N  N     . LEU C  3 55  ? -9.969  -3.006  33.930 1.00 37.76  ? 55   LEU C N     1 
ATOM   1751  C  CA    . LEU C  3 55  ? -8.842  -3.778  34.395 1.00 38.13  ? 55   LEU C CA    1 
ATOM   1752  C  C     . LEU C  3 55  ? -7.757  -2.845  34.874 1.00 38.65  ? 55   LEU C C     1 
ATOM   1753  O  O     . LEU C  3 55  ? -7.223  -3.023  35.978 1.00 38.83  ? 55   LEU C O     1 
ATOM   1754  C  CB    . LEU C  3 55  ? -8.325  -4.697  33.290 1.00 37.97  ? 55   LEU C CB    1 
ATOM   1755  C  CG    . LEU C  3 55  ? -9.292  -5.815  32.883 1.00 37.43  ? 55   LEU C CG    1 
ATOM   1756  C  CD1   . LEU C  3 55  ? -8.897  -6.390  31.546 1.00 37.78  ? 55   LEU C CD1   1 
ATOM   1757  C  CD2   . LEU C  3 55  ? -9.380  -6.920  33.925 1.00 35.94  ? 55   LEU C CD2   1 
ATOM   1758  N  N     . GLU C  3 56  ? -7.453  -1.832  34.066 1.00 38.90  ? 56   GLU C N     1 
ATOM   1759  C  CA    . GLU C  3 56  ? -6.435  -0.872  34.452 1.00 39.43  ? 56   GLU C CA    1 
ATOM   1760  C  C     . GLU C  3 56  ? -6.839  -0.169  35.747 1.00 39.80  ? 56   GLU C C     1 
ATOM   1761  O  O     . GLU C  3 56  ? -6.008  0.056   36.639 1.00 39.55  ? 56   GLU C O     1 
ATOM   1762  C  CB    . GLU C  3 56  ? -6.194  0.139   33.348 1.00 39.50  ? 56   GLU C CB    1 
ATOM   1763  C  CG    . GLU C  3 56  ? -5.077  1.099   33.662 1.00 40.08  ? 56   GLU C CG    1 
ATOM   1764  C  CD    . GLU C  3 56  ? -4.896  2.168   32.608 1.00 41.13  ? 56   GLU C CD    1 
ATOM   1765  O  OE1   . GLU C  3 56  ? -4.763  1.815   31.406 1.00 41.11  ? 56   GLU C OE1   1 
ATOM   1766  O  OE2   . GLU C  3 56  ? -4.870  3.361   32.995 1.00 41.11  ? 56   GLU C OE2   1 
ATOM   1767  N  N     . TYR C  3 57  ? -8.121  0.152   35.870 1.00 40.27  ? 57   TYR C N     1 
ATOM   1768  C  CA    . TYR C  3 57  ? -8.579  0.817   37.083 1.00 40.98  ? 57   TYR C CA    1 
ATOM   1769  C  C     . TYR C  3 57  ? -8.395  -0.017  38.358 1.00 40.99  ? 57   TYR C C     1 
ATOM   1770  O  O     . TYR C  3 57  ? -7.900  0.509   39.370 1.00 41.22  ? 57   TYR C O     1 
ATOM   1771  C  CB    . TYR C  3 57  ? -10.026 1.261   36.967 1.00 41.74  ? 57   TYR C CB    1 
ATOM   1772  C  CG    . TYR C  3 57  ? -10.655 1.555   38.308 1.00 42.61  ? 57   TYR C CG    1 
ATOM   1773  C  CD1   . TYR C  3 57  ? -10.089 2.489   39.178 1.00 43.55  ? 57   TYR C CD1   1 
ATOM   1774  C  CD2   . TYR C  3 57  ? -11.814 0.897   38.703 1.00 42.92  ? 57   TYR C CD2   1 
ATOM   1775  C  CE1   . TYR C  3 57  ? -10.662 2.757   40.414 1.00 45.42  ? 57   TYR C CE1   1 
ATOM   1776  C  CE2   . TYR C  3 57  ? -12.406 1.158   39.922 1.00 44.52  ? 57   TYR C CE2   1 
ATOM   1777  C  CZ    . TYR C  3 57  ? -11.830 2.088   40.783 1.00 45.39  ? 57   TYR C CZ    1 
ATOM   1778  O  OH    . TYR C  3 57  ? -12.422 2.348   42.016 1.00 45.57  ? 57   TYR C OH    1 
ATOM   1779  N  N     . LEU C  3 58  ? -8.816  -1.293  38.307 1.00 40.21  ? 58   LEU C N     1 
ATOM   1780  C  CA    . LEU C  3 58  ? -8.701  -2.210  39.441 1.00 38.78  ? 58   LEU C CA    1 
ATOM   1781  C  C     . LEU C  3 58  ? -7.241  -2.492  39.741 1.00 38.40  ? 58   LEU C C     1 
ATOM   1782  O  O     . LEU C  3 58  ? -6.846  -2.517  40.903 1.00 38.39  ? 58   LEU C O     1 
ATOM   1783  C  CB    . LEU C  3 58  ? -9.456  -3.506  39.188 1.00 38.46  ? 58   LEU C CB    1 
ATOM   1784  C  CG    . LEU C  3 58  ? -10.978 -3.444  39.021 1.00 37.85  ? 58   LEU C CG    1 
ATOM   1785  C  CD1   . LEU C  3 58  ? -11.488 -4.668  38.273 1.00 37.06  ? 58   LEU C CD1   1 
ATOM   1786  C  CD2   . LEU C  3 58  ? -11.719 -3.301  40.332 1.00 35.97  ? 58   LEU C CD2   1 
ATOM   1787  N  N     . THR C  3 59  ? -6.429  -2.662  38.701 1.00 37.73  ? 59   THR C N     1 
ATOM   1788  C  CA    . THR C  3 59  ? -4.996  -2.828  38.905 1.00 37.63  ? 59   THR C CA    1 
ATOM   1789  C  C     . THR C  3 59  ? -4.462  -1.652  39.704 1.00 38.14  ? 59   THR C C     1 
ATOM   1790  O  O     . THR C  3 59  ? -3.685  -1.816  40.637 1.00 38.12  ? 59   THR C O     1 
ATOM   1791  C  CB    . THR C  3 59  ? -4.269  -2.908  37.583 1.00 37.32  ? 59   THR C CB    1 
ATOM   1792  O  OG1   . THR C  3 59  ? -4.807  -3.996  36.843 1.00 37.31  ? 59   THR C OG1   1 
ATOM   1793  C  CG2   . THR C  3 59  ? -2.783  -3.125  37.769 1.00 36.09  ? 59   THR C CG2   1 
ATOM   1794  N  N     . ALA C  3 60  ? -4.905  -0.458  39.335 1.00 38.71  ? 60   ALA C N     1 
ATOM   1795  C  CA    . ALA C  3 60  ? -4.441  0.757   39.981 1.00 39.00  ? 60   ALA C CA    1 
ATOM   1796  C  C     . ALA C  3 60  ? -4.848  0.787   41.450 1.00 39.15  ? 60   ALA C C     1 
ATOM   1797  O  O     . ALA C  3 60  ? -4.050  1.152   42.315 1.00 38.99  ? 60   ALA C O     1 
ATOM   1798  C  CB    . ALA C  3 60  ? -4.973  1.966   39.248 1.00 38.93  ? 60   ALA C CB    1 
ATOM   1799  N  N     . GLU C  3 61  ? -6.087  0.375   41.708 1.00 39.52  ? 61   GLU C N     1 
ATOM   1800  C  CA    . GLU C  3 61  ? -6.690  0.380   43.039 1.00 40.07  ? 61   GLU C CA    1 
ATOM   1801  C  C     . GLU C  3 61  ? -5.921  -0.484  44.026 1.00 39.90  ? 61   GLU C C     1 
ATOM   1802  O  O     . GLU C  3 61  ? -5.649  -0.078  45.161 1.00 39.69  ? 61   GLU C O     1 
ATOM   1803  C  CB    . GLU C  3 61  ? -8.122  -0.134  42.938 1.00 40.33  ? 61   GLU C CB    1 
ATOM   1804  C  CG    . GLU C  3 61  ? -8.899  -0.061  44.223 1.00 42.71  ? 61   GLU C CG    1 
ATOM   1805  C  CD    . GLU C  3 61  ? -9.013  1.351   44.739 1.00 47.12  ? 61   GLU C CD    1 
ATOM   1806  O  OE1   . GLU C  3 61  ? -9.276  2.270   43.905 1.00 49.53  ? 61   GLU C OE1   1 
ATOM   1807  O  OE2   . GLU C  3 61  ? -8.848  1.534   45.973 1.00 47.53  ? 61   GLU C OE2   1 
ATOM   1808  N  N     . ILE C  3 62  ? -5.569  -1.679  43.571 1.00 39.73  ? 62   ILE C N     1 
ATOM   1809  C  CA    . ILE C  3 62  ? -4.915  -2.653  44.417 1.00 39.67  ? 62   ILE C CA    1 
ATOM   1810  C  C     . ILE C  3 62  ? -3.448  -2.315  44.580 1.00 39.94  ? 62   ILE C C     1 
ATOM   1811  O  O     . ILE C  3 62  ? -2.869  -2.578  45.632 1.00 40.65  ? 62   ILE C O     1 
ATOM   1812  C  CB    . ILE C  3 62  ? -5.116  -4.072  43.877 1.00 39.34  ? 62   ILE C CB    1 
ATOM   1813  C  CG1   . ILE C  3 62  ? -4.552  -5.099  44.823 1.00 39.16  ? 62   ILE C CG1   1 
ATOM   1814  C  CG2   . ILE C  3 62  ? -4.454  -4.245  42.557 1.00 39.99  ? 62   ILE C CG2   1 
ATOM   1815  C  CD1   . ILE C  3 62  ? -5.026  -6.459  44.484 1.00 40.89  ? 62   ILE C CD1   1 
ATOM   1816  N  N     . LEU C  3 63  ? -2.859  -1.712  43.550 1.00 39.95  ? 63   LEU C N     1 
ATOM   1817  C  CA    . LEU C  3 63  ? -1.472  -1.269  43.609 1.00 39.90  ? 63   LEU C CA    1 
ATOM   1818  C  C     . LEU C  3 63  ? -1.289  -0.043  44.517 1.00 40.09  ? 63   LEU C C     1 
ATOM   1819  O  O     . LEU C  3 63  ? -0.253  0.099   45.177 1.00 39.93  ? 63   LEU C O     1 
ATOM   1820  C  CB    . LEU C  3 63  ? -0.922  -1.015  42.204 1.00 39.90  ? 63   LEU C CB    1 
ATOM   1821  C  CG    . LEU C  3 63  ? -0.550  -2.242  41.367 1.00 39.55  ? 63   LEU C CG    1 
ATOM   1822  C  CD1   . LEU C  3 63  ? 0.073   -1.837  40.064 1.00 39.05  ? 63   LEU C CD1   1 
ATOM   1823  C  CD2   . LEU C  3 63  ? 0.422   -3.078  42.135 1.00 40.60  ? 63   LEU C CD2   1 
ATOM   1824  N  N     . GLU C  3 64  ? -2.297  0.827   44.569 1.00 40.21  ? 64   GLU C N     1 
ATOM   1825  C  CA    . GLU C  3 64  ? -2.272  1.937   45.508 1.00 40.46  ? 64   GLU C CA    1 
ATOM   1826  C  C     . GLU C  3 64  ? -2.218  1.360   46.902 1.00 40.30  ? 64   GLU C C     1 
ATOM   1827  O  O     . GLU C  3 64  ? -1.353  1.711   47.692 1.00 40.58  ? 64   GLU C O     1 
ATOM   1828  C  CB    . GLU C  3 64  ? -3.499  2.830   45.351 1.00 40.49  ? 64   GLU C CB    1 
ATOM   1829  C  CG    . GLU C  3 64  ? -3.612  3.965   46.381 1.00 42.52  ? 64   GLU C CG    1 
ATOM   1830  C  CD    . GLU C  3 64  ? -2.615  5.119   46.174 1.00 46.10  ? 64   GLU C CD    1 
ATOM   1831  O  OE1   . GLU C  3 64  ? -2.224  5.764   47.182 1.00 46.43  ? 64   GLU C OE1   1 
ATOM   1832  O  OE2   . GLU C  3 64  ? -2.230  5.400   45.013 1.00 48.45  ? 64   GLU C OE2   1 
ATOM   1833  N  N     . LEU C  3 65  ? -3.127  0.441   47.183 1.00 40.26  ? 65   LEU C N     1 
ATOM   1834  C  CA    . LEU C  3 65  ? -3.325  -0.038  48.544 1.00 40.23  ? 65   LEU C CA    1 
ATOM   1835  C  C     . LEU C  3 65  ? -2.212  -0.952  48.998 1.00 40.53  ? 65   LEU C C     1 
ATOM   1836  O  O     . LEU C  3 65  ? -1.856  -0.964  50.191 1.00 40.78  ? 65   LEU C O     1 
ATOM   1837  C  CB    . LEU C  3 65  ? -4.671  -0.754  48.678 1.00 40.09  ? 65   LEU C CB    1 
ATOM   1838  C  CG    . LEU C  3 65  ? -5.923  0.107   48.572 1.00 38.57  ? 65   LEU C CG    1 
ATOM   1839  C  CD1   . LEU C  3 65  ? -7.161  -0.752  48.573 1.00 37.93  ? 65   LEU C CD1   1 
ATOM   1840  C  CD2   . LEU C  3 65  ? -5.942  1.042   49.729 1.00 38.43  ? 65   LEU C CD2   1 
ATOM   1841  N  N     . ALA C  3 66  ? -1.682  -1.734  48.059 1.00 40.55  ? 66   ALA C N     1 
ATOM   1842  C  CA    . ALA C  3 66  ? -0.587  -2.651  48.378 1.00 40.73  ? 66   ALA C CA    1 
ATOM   1843  C  C     . ALA C  3 66  ? 0.682   -1.851  48.675 1.00 40.79  ? 66   ALA C C     1 
ATOM   1844  O  O     . ALA C  3 66  ? 1.283   -2.014  49.743 1.00 40.72  ? 66   ALA C O     1 
ATOM   1845  C  CB    . ALA C  3 66  ? -0.371  -3.662  47.268 1.00 40.53  ? 66   ALA C CB    1 
ATOM   1846  N  N     . GLY C  3 67  ? 1.051   -0.960  47.753 1.00 40.56  ? 67   GLY C N     1 
ATOM   1847  C  CA    . GLY C  3 67  ? 2.137   -0.029  47.987 1.00 40.76  ? 67   GLY C CA    1 
ATOM   1848  C  C     . GLY C  3 67  ? 2.077   0.639   49.354 1.00 41.04  ? 67   GLY C C     1 
ATOM   1849  O  O     . GLY C  3 67  ? 3.105   0.812   50.017 1.00 41.33  ? 67   GLY C O     1 
ATOM   1850  N  N     . ASN C  3 68  ? 0.882   1.011   49.797 1.00 40.92  ? 68   ASN C N     1 
ATOM   1851  C  CA    . ASN C  3 68  ? 0.771   1.620   51.105 1.00 41.20  ? 68   ASN C CA    1 
ATOM   1852  C  C     . ASN C  3 68  ? 1.195   0.656   52.179 1.00 41.31  ? 68   ASN C C     1 
ATOM   1853  O  O     . ASN C  3 68  ? 1.933   1.030   53.078 1.00 41.31  ? 68   ASN C O     1 
ATOM   1854  C  CB    . ASN C  3 68  ? -0.643  2.117   51.385 1.00 41.59  ? 68   ASN C CB    1 
ATOM   1855  C  CG    . ASN C  3 68  ? -1.010  3.357   50.583 1.00 41.95  ? 68   ASN C CG    1 
ATOM   1856  O  OD1   . ASN C  3 68  ? -0.161  4.016   49.981 1.00 43.16  ? 68   ASN C OD1   1 
ATOM   1857  N  ND2   . ASN C  3 68  ? -2.290  3.683   50.583 1.00 42.23  ? 68   ASN C ND2   1 
ATOM   1858  N  N     . ALA C  3 69  ? 0.743   -0.591  52.077 1.00 41.64  ? 69   ALA C N     1 
ATOM   1859  C  CA    . ALA C  3 69  ? 1.081   -1.601  53.082 1.00 42.15  ? 69   ALA C CA    1 
ATOM   1860  C  C     . ALA C  3 69  ? 2.570   -1.938  53.033 1.00 42.62  ? 69   ALA C C     1 
ATOM   1861  O  O     . ALA C  3 69  ? 3.199   -2.185  54.061 1.00 42.47  ? 69   ALA C O     1 
ATOM   1862  C  CB    . ALA C  3 69  ? 0.245   -2.838  52.888 1.00 42.10  ? 69   ALA C CB    1 
ATOM   1863  N  N     . ALA C  3 70  ? 3.120   -1.938  51.823 1.00 43.17  ? 70   ALA C N     1 
ATOM   1864  C  CA    . ALA C  3 70  ? 4.538   -2.073  51.626 1.00 43.96  ? 70   ALA C CA    1 
ATOM   1865  C  C     . ALA C  3 70  ? 5.230   -0.975  52.399 1.00 44.99  ? 70   ALA C C     1 
ATOM   1866  O  O     . ALA C  3 70  ? 6.218   -1.225  53.085 1.00 45.17  ? 70   ALA C O     1 
ATOM   1867  C  CB    . ALA C  3 70  ? 4.860   -1.964  50.169 1.00 43.78  ? 70   ALA C CB    1 
ATOM   1868  N  N     . ARG C  3 71  ? 4.694   0.238   52.293 1.00 46.18  ? 71   ARG C N     1 
ATOM   1869  C  CA    . ARG C  3 71  ? 5.258   1.392   52.970 1.00 47.61  ? 71   ARG C CA    1 
ATOM   1870  C  C     . ARG C  3 71  ? 5.095   1.292   54.487 1.00 47.88  ? 71   ARG C C     1 
ATOM   1871  O  O     . ARG C  3 71  ? 6.047   1.516   55.213 1.00 47.74  ? 71   ARG C O     1 
ATOM   1872  C  CB    . ARG C  3 71  ? 4.636   2.680   52.434 1.00 48.10  ? 71   ARG C CB    1 
ATOM   1873  C  CG    . ARG C  3 71  ? 5.305   3.977   52.915 1.00 50.80  ? 71   ARG C CG    1 
ATOM   1874  C  CD    . ARG C  3 71  ? 4.333   5.161   52.894 1.00 55.94  ? 71   ARG C CD    1 
ATOM   1875  N  NE    . ARG C  3 71  ? 3.111   4.896   53.685 1.00 60.64  ? 71   ARG C NE    1 
ATOM   1876  C  CZ    . ARG C  3 71  ? 1.860   4.831   53.192 1.00 62.91  ? 71   ARG C CZ    1 
ATOM   1877  N  NH1   . ARG C  3 71  ? 1.620   5.021   51.887 1.00 63.98  ? 71   ARG C NH1   1 
ATOM   1878  N  NH2   . ARG C  3 71  ? 0.833   4.578   54.006 1.00 62.87  ? 71   ARG C NH2   1 
ATOM   1879  N  N     . ASP C  3 72  ? 3.905   0.935   54.961 1.00 48.66  ? 72   ASP C N     1 
ATOM   1880  C  CA    . ASP C  3 72  ? 3.668   0.734   56.396 1.00 49.82  ? 72   ASP C CA    1 
ATOM   1881  C  C     . ASP C  3 72  ? 4.616   -0.265  57.075 1.00 50.65  ? 72   ASP C C     1 
ATOM   1882  O  O     . ASP C  3 72  ? 4.763   -0.255  58.297 1.00 50.74  ? 72   ASP C O     1 
ATOM   1883  C  CB    . ASP C  3 72  ? 2.239   0.271   56.637 1.00 49.83  ? 72   ASP C CB    1 
ATOM   1884  C  CG    . ASP C  3 72  ? 1.220   1.284   56.215 1.00 50.74  ? 72   ASP C CG    1 
ATOM   1885  O  OD1   . ASP C  3 72  ? 1.440   2.494   56.430 1.00 51.73  ? 72   ASP C OD1   1 
ATOM   1886  O  OD2   . ASP C  3 72  ? 0.179   0.866   55.672 1.00 52.03  ? 72   ASP C OD2   1 
ATOM   1887  N  N     . ASN C  3 73  ? 5.232   -1.140  56.285 1.00 51.64  ? 73   ASN C N     1 
ATOM   1888  C  CA    . ASN C  3 73  ? 6.130   -2.165  56.807 1.00 52.58  ? 73   ASN C CA    1 
ATOM   1889  C  C     . ASN C  3 73  ? 7.586   -1.876  56.483 1.00 52.59  ? 73   ASN C C     1 
ATOM   1890  O  O     . ASN C  3 73  ? 8.437   -2.770  56.536 1.00 52.74  ? 73   ASN C O     1 
ATOM   1891  C  CB    . ASN C  3 73  ? 5.731   -3.535  56.256 1.00 53.27  ? 73   ASN C CB    1 
ATOM   1892  C  CG    . ASN C  3 73  ? 4.406   -4.014  56.809 1.00 55.16  ? 73   ASN C CG    1 
ATOM   1893  O  OD1   . ASN C  3 73  ? 4.363   -4.609  57.892 1.00 59.05  ? 73   ASN C OD1   1 
ATOM   1894  N  ND2   . ASN C  3 73  ? 3.316   -3.755  56.082 1.00 54.58  ? 73   ASN C ND2   1 
ATOM   1895  N  N     . LYS C  3 74  ? 7.855   -0.621  56.134 1.00 52.61  ? 74   LYS C N     1 
ATOM   1896  C  CA    . LYS C  3 74  ? 9.206   -0.131  55.857 1.00 52.93  ? 74   LYS C CA    1 
ATOM   1897  C  C     . LYS C  3 74  ? 9.880   -0.837  54.679 1.00 52.07  ? 74   LYS C C     1 
ATOM   1898  O  O     . LYS C  3 74  ? 11.096  -1.012  54.648 1.00 52.00  ? 74   LYS C O     1 
ATOM   1899  C  CB    . LYS C  3 74  ? 10.059  -0.185  57.130 1.00 53.06  ? 74   LYS C CB    1 
ATOM   1900  C  CG    . LYS C  3 74  ? 9.416   0.564   58.316 1.00 54.44  ? 74   LYS C CG    1 
ATOM   1901  C  CD    . LYS C  3 74  ? 10.398  0.817   59.491 1.00 54.89  ? 74   LYS C CD    1 
ATOM   1902  C  CE    . LYS C  3 74  ? 9.659   0.999   60.844 1.00 56.48  ? 74   LYS C CE    1 
ATOM   1903  N  NZ    . LYS C  3 74  ? 8.800   2.234   60.890 1.00 57.85  ? 74   LYS C NZ    1 
ATOM   1904  N  N     . LYS C  3 75  ? 9.073   -1.229  53.703 1.00 51.48  ? 75   LYS C N     1 
ATOM   1905  C  CA    . LYS C  3 75  ? 9.568   -1.922  52.526 1.00 51.07  ? 75   LYS C CA    1 
ATOM   1906  C  C     . LYS C  3 75  ? 9.328   -1.090  51.277 1.00 50.38  ? 75   LYS C C     1 
ATOM   1907  O  O     . LYS C  3 75  ? 8.407   -0.258  51.224 1.00 50.42  ? 75   LYS C O     1 
ATOM   1908  C  CB    . LYS C  3 75  ? 8.874   -3.272  52.379 1.00 51.47  ? 75   LYS C CB    1 
ATOM   1909  C  CG    . LYS C  3 75  ? 8.899   -4.129  53.630 1.00 52.73  ? 75   LYS C CG    1 
ATOM   1910  C  CD    . LYS C  3 75  ? 10.283  -4.663  53.908 1.00 55.41  ? 75   LYS C CD    1 
ATOM   1911  C  CE    . LYS C  3 75  ? 10.414  -5.113  55.356 1.00 57.36  ? 75   LYS C CE    1 
ATOM   1912  N  NZ    . LYS C  3 75  ? 9.773   -6.436  55.569 1.00 60.26  ? 75   LYS C NZ    1 
ATOM   1913  N  N     . THR C  3 76  ? 10.154  -1.299  50.267 1.00 49.07  ? 76   THR C N     1 
ATOM   1914  C  CA    . THR C  3 76  ? 9.994   -0.505  49.070 1.00 48.32  ? 76   THR C CA    1 
ATOM   1915  C  C     . THR C  3 76  ? 9.597   -1.385  47.901 1.00 47.68  ? 76   THR C C     1 
ATOM   1916  O  O     . THR C  3 76  ? 9.229   -0.889  46.829 1.00 47.82  ? 76   THR C O     1 
ATOM   1917  C  CB    . THR C  3 76  ? 11.256  0.322   48.741 1.00 48.52  ? 76   THR C CB    1 
ATOM   1918  O  OG1   . THR C  3 76  ? 12.232  -0.495  48.072 1.00 48.39  ? 76   THR C OG1   1 
ATOM   1919  C  CG2   . THR C  3 76  ? 11.847  0.929   50.009 1.00 48.42  ? 76   THR C CG2   1 
ATOM   1920  N  N     . ARG C  3 77  ? 9.666   -2.695  48.114 1.00 46.43  ? 77   ARG C N     1 
ATOM   1921  C  CA    . ARG C  3 77  ? 9.281   -3.635  47.088 1.00 45.26  ? 77   ARG C CA    1 
ATOM   1922  C  C     . ARG C  3 77  ? 8.046   -4.389  47.532 1.00 44.35  ? 77   ARG C C     1 
ATOM   1923  O  O     . ARG C  3 77  ? 8.078   -5.093  48.550 1.00 44.55  ? 77   ARG C O     1 
ATOM   1924  C  CB    . ARG C  3 77  ? 10.404  -4.617  46.855 1.00 45.32  ? 77   ARG C CB    1 
ATOM   1925  C  CG    . ARG C  3 77  ? 10.069  -5.602  45.779 1.00 46.85  ? 77   ARG C CG    1 
ATOM   1926  C  CD    . ARG C  3 77  ? 11.125  -6.650  45.672 1.00 48.53  ? 77   ARG C CD    1 
ATOM   1927  N  NE    . ARG C  3 77  ? 12.298  -6.103  45.015 1.00 50.36  ? 77   ARG C NE    1 
ATOM   1928  C  CZ    . ARG C  3 77  ? 13.485  -5.965  45.585 1.00 51.14  ? 77   ARG C CZ    1 
ATOM   1929  N  NH1   . ARG C  3 77  ? 13.679  -6.347  46.846 1.00 50.40  ? 77   ARG C NH1   1 
ATOM   1930  N  NH2   . ARG C  3 77  ? 14.479  -5.445  44.876 1.00 52.88  ? 77   ARG C NH2   1 
ATOM   1931  N  N     . ILE C  3 78  ? 6.963   -4.248  46.775 1.00 42.90  ? 78   ILE C N     1 
ATOM   1932  C  CA    . ILE C  3 78  ? 5.735   -4.979  47.072 1.00 41.83  ? 78   ILE C CA    1 
ATOM   1933  C  C     . ILE C  3 78  ? 5.975   -6.488  46.903 1.00 41.42  ? 78   ILE C C     1 
ATOM   1934  O  O     . ILE C  3 78  ? 6.402   -6.938  45.840 1.00 42.07  ? 78   ILE C O     1 
ATOM   1935  C  CB    . ILE C  3 78  ? 4.553   -4.531  46.158 1.00 41.73  ? 78   ILE C CB    1 
ATOM   1936  C  CG1   . ILE C  3 78  ? 4.091   -3.123  46.529 1.00 41.44  ? 78   ILE C CG1   1 
ATOM   1937  C  CG2   . ILE C  3 78  ? 3.376   -5.501  46.253 1.00 40.86  ? 78   ILE C CG2   1 
ATOM   1938  C  CD1   . ILE C  3 78  ? 3.319   -2.416  45.445 1.00 41.09  ? 78   ILE C CD1   1 
ATOM   1939  N  N     . ILE C  3 79  ? 5.716   -7.248  47.963 1.00 39.99  ? 79   ILE C N     1 
ATOM   1940  C  CA    . ILE C  3 79  ? 5.642   -8.701  47.903 1.00 38.47  ? 79   ILE C CA    1 
ATOM   1941  C  C     . ILE C  3 79  ? 4.174   -9.115  48.089 1.00 37.87  ? 79   ILE C C     1 
ATOM   1942  O  O     . ILE C  3 79  ? 3.323   -8.262  48.363 1.00 37.41  ? 79   ILE C O     1 
ATOM   1943  C  CB    . ILE C  3 79  ? 6.547   -9.360  48.984 1.00 38.48  ? 79   ILE C CB    1 
ATOM   1944  C  CG1   . ILE C  3 79  ? 6.060   -9.018  50.404 1.00 36.79  ? 79   ILE C CG1   1 
ATOM   1945  C  CG2   . ILE C  3 79  ? 8.008   -8.985  48.747 1.00 39.09  ? 79   ILE C CG2   1 
ATOM   1946  C  CD1   . ILE C  3 79  ? 6.932   -9.527  51.486 1.00 33.94  ? 79   ILE C CD1   1 
ATOM   1947  N  N     . PRO C  3 80  ? 3.864   -10.421 47.936 1.00 37.33  ? 80   PRO C N     1 
ATOM   1948  C  CA    . PRO C  3 80  ? 2.482   -10.866 48.086 1.00 36.54  ? 80   PRO C CA    1 
ATOM   1949  C  C     . PRO C  3 80  ? 1.873   -10.585 49.431 1.00 35.56  ? 80   PRO C C     1 
ATOM   1950  O  O     . PRO C  3 80  ? 0.685   -10.293 49.487 1.00 35.28  ? 80   PRO C O     1 
ATOM   1951  C  CB    . PRO C  3 80  ? 2.571   -12.369 47.837 1.00 36.55  ? 80   PRO C CB    1 
ATOM   1952  C  CG    . PRO C  3 80  ? 3.719   -12.495 46.922 1.00 36.78  ? 80   PRO C CG    1 
ATOM   1953  C  CD    . PRO C  3 80  ? 4.720   -11.554 47.550 1.00 37.44  ? 80   PRO C CD    1 
ATOM   1954  N  N     . ARG C  3 81  ? 2.657   -10.646 50.500 1.00 34.87  ? 81   ARG C N     1 
ATOM   1955  C  CA    . ARG C  3 81  ? 2.108   -10.243 51.798 1.00 34.54  ? 81   ARG C CA    1 
ATOM   1956  C  C     . ARG C  3 81  ? 1.313   -8.939  51.675 1.00 34.76  ? 81   ARG C C     1 
ATOM   1957  O  O     . ARG C  3 81  ? 0.173   -8.835  52.146 1.00 34.86  ? 81   ARG C O     1 
ATOM   1958  C  CB    . ARG C  3 81  ? 3.183   -10.091 52.858 1.00 33.92  ? 81   ARG C CB    1 
ATOM   1959  C  CG    . ARG C  3 81  ? 2.641   -9.583  54.163 1.00 33.04  ? 81   ARG C CG    1 
ATOM   1960  C  CD    . ARG C  3 81  ? 1.578   -10.497 54.721 1.00 33.62  ? 81   ARG C CD    1 
ATOM   1961  N  NE    . ARG C  3 81  ? 1.324   -10.264 56.145 1.00 35.34  ? 81   ARG C NE    1 
ATOM   1962  C  CZ    . ARG C  3 81  ? 0.469   -10.970 56.889 1.00 34.92  ? 81   ARG C CZ    1 
ATOM   1963  N  NH1   . ARG C  3 81  ? -0.227  -11.975 56.355 1.00 34.24  ? 81   ARG C NH1   1 
ATOM   1964  N  NH2   . ARG C  3 81  ? 0.316   -10.678 58.177 1.00 34.31  ? 81   ARG C NH2   1 
ATOM   1965  N  N     . HIS C  3 82  ? 1.920   -7.964  51.004 1.00 34.78  ? 82   HIS C N     1 
ATOM   1966  C  CA    . HIS C  3 82  ? 1.331   -6.643  50.844 1.00 34.26  ? 82   HIS C CA    1 
ATOM   1967  C  C     . HIS C  3 82  ? 0.054   -6.688  50.035 1.00 34.32  ? 82   HIS C C     1 
ATOM   1968  O  O     . HIS C  3 82  ? -0.930  -6.044  50.407 1.00 34.85  ? 82   HIS C O     1 
ATOM   1969  C  CB    . HIS C  3 82  ? 2.336   -5.697  50.214 1.00 33.83  ? 82   HIS C CB    1 
ATOM   1970  C  CG    . HIS C  3 82  ? 3.626   -5.651  50.951 1.00 33.02  ? 82   HIS C CG    1 
ATOM   1971  N  ND1   . HIS C  3 82  ? 4.848   -5.665  50.317 1.00 32.87  ? 82   HIS C ND1   1 
ATOM   1972  C  CD2   . HIS C  3 82  ? 3.886   -5.638  52.279 1.00 32.56  ? 82   HIS C CD2   1 
ATOM   1973  C  CE1   . HIS C  3 82  ? 5.808   -5.632  51.223 1.00 32.91  ? 82   HIS C CE1   1 
ATOM   1974  N  NE2   . HIS C  3 82  ? 5.251   -5.619  52.423 1.00 33.18  ? 82   HIS C NE2   1 
ATOM   1975  N  N     . LEU C  3 83  ? 0.062   -7.460  48.950 1.00 33.78  ? 83   LEU C N     1 
ATOM   1976  C  CA    . LEU C  3 83  ? -1.132  -7.638  48.148 1.00 33.07  ? 83   LEU C CA    1 
ATOM   1977  C  C     . LEU C  3 83  ? -2.246  -8.213  49.008 1.00 33.11  ? 83   LEU C C     1 
ATOM   1978  O  O     . LEU C  3 83  ? -3.358  -7.686  49.018 1.00 32.70  ? 83   LEU C O     1 
ATOM   1979  C  CB    . LEU C  3 83  ? -0.843  -8.524  46.949 1.00 32.89  ? 83   LEU C CB    1 
ATOM   1980  C  CG    . LEU C  3 83  ? 0.034   -7.915  45.856 1.00 32.83  ? 83   LEU C CG    1 
ATOM   1981  C  CD1   . LEU C  3 83  ? 0.418   -8.972  44.843 1.00 32.73  ? 83   LEU C CD1   1 
ATOM   1982  C  CD2   . LEU C  3 83  ? -0.673  -6.763  45.153 1.00 32.98  ? 83   LEU C CD2   1 
ATOM   1983  N  N     . GLN C  3 84  ? -1.937  -9.264  49.762 1.00 33.32  ? 84   GLN C N     1 
ATOM   1984  C  CA    . GLN C  3 84  ? -2.924  -9.849  50.649 1.00 33.83  ? 84   GLN C CA    1 
ATOM   1985  C  C     . GLN C  3 84  ? -3.442  -8.812  51.643 1.00 34.49  ? 84   GLN C C     1 
ATOM   1986  O  O     . GLN C  3 84  ? -4.656  -8.615  51.757 1.00 34.91  ? 84   GLN C O     1 
ATOM   1987  C  CB    . GLN C  3 84  ? -2.364  -11.058 51.391 1.00 33.82  ? 84   GLN C CB    1 
ATOM   1988  C  CG    . GLN C  3 84  ? -3.222  -11.518 52.589 1.00 33.05  ? 84   GLN C CG    1 
ATOM   1989  C  CD    . GLN C  3 84  ? -4.383  -12.445 52.237 1.00 31.68  ? 84   GLN C CD    1 
ATOM   1990  O  OE1   . GLN C  3 84  ? -4.940  -12.439 51.127 1.00 30.49  ? 84   GLN C OE1   1 
ATOM   1991  N  NE2   . GLN C  3 84  ? -4.756  -13.253 53.207 1.00 31.75  ? 84   GLN C NE2   1 
ATOM   1992  N  N     . LEU C  3 85  ? -2.521  -8.147  52.344 1.00 34.82  ? 85   LEU C N     1 
ATOM   1993  C  CA    . LEU C  3 85  ? -2.873  -7.095  53.310 1.00 34.88  ? 85   LEU C CA    1 
ATOM   1994  C  C     . LEU C  3 85  ? -3.815  -6.078  52.710 1.00 34.86  ? 85   LEU C C     1 
ATOM   1995  O  O     . LEU C  3 85  ? -4.824  -5.735  53.312 1.00 34.64  ? 85   LEU C O     1 
ATOM   1996  C  CB    . LEU C  3 85  ? -1.621  -6.380  53.811 1.00 34.90  ? 85   LEU C CB    1 
ATOM   1997  C  CG    . LEU C  3 85  ? -0.763  -7.171  54.798 1.00 35.36  ? 85   LEU C CG    1 
ATOM   1998  C  CD1   . LEU C  3 85  ? 0.330   -6.294  55.333 1.00 36.83  ? 85   LEU C CD1   1 
ATOM   1999  C  CD2   . LEU C  3 85  ? -1.599  -7.723  55.941 1.00 35.55  ? 85   LEU C CD2   1 
ATOM   2000  N  N     . ALA C  3 86  ? -3.476  -5.619  51.510 1.00 35.01  ? 86   ALA C N     1 
ATOM   2001  C  CA    . ALA C  3 86  ? -4.265  -4.628  50.795 1.00 35.88  ? 86   ALA C CA    1 
ATOM   2002  C  C     . ALA C  3 86  ? -5.695  -5.086  50.549 1.00 36.43  ? 86   ALA C C     1 
ATOM   2003  O  O     . ALA C  3 86  ? -6.654  -4.348  50.797 1.00 36.60  ? 86   ALA C O     1 
ATOM   2004  C  CB    . ALA C  3 86  ? -3.601  -4.288  49.471 1.00 35.98  ? 86   ALA C CB    1 
ATOM   2005  N  N     . VAL C  3 87  ? -5.815  -6.312  50.051 1.00 36.80  ? 87   VAL C N     1 
ATOM   2006  C  CA    . VAL C  3 87  ? -7.086  -6.886  49.687 1.00 36.79  ? 87   VAL C CA    1 
ATOM   2007  C  C     . VAL C  3 87  ? -7.923  -7.168  50.920 1.00 37.00  ? 87   VAL C C     1 
ATOM   2008  O  O     . VAL C  3 87  ? -9.104  -6.856  50.959 1.00 37.37  ? 87   VAL C O     1 
ATOM   2009  C  CB    . VAL C  3 87  ? -6.864  -8.178  48.902 1.00 36.70  ? 87   VAL C CB    1 
ATOM   2010  C  CG1   . VAL C  3 87  ? -8.155  -8.935  48.738 1.00 37.07  ? 87   VAL C CG1   1 
ATOM   2011  C  CG2   . VAL C  3 87  ? -6.276  -7.859  47.553 1.00 36.46  ? 87   VAL C CG2   1 
ATOM   2012  N  N     . ARG C  3 88  ? -7.322  -7.755  51.937 1.00 37.29  ? 88   ARG C N     1 
ATOM   2013  C  CA    . ARG C  3 88  ? -8.137  -8.238  53.029 1.00 37.75  ? 88   ARG C CA    1 
ATOM   2014  C  C     . ARG C  3 88  ? -8.508  -7.105  53.930 1.00 38.60  ? 88   ARG C C     1 
ATOM   2015  O  O     . ARG C  3 88  ? -9.501  -7.182  54.625 1.00 39.18  ? 88   ARG C O     1 
ATOM   2016  C  CB    . ARG C  3 88  ? -7.451  -9.361  53.810 1.00 37.43  ? 88   ARG C CB    1 
ATOM   2017  C  CG    . ARG C  3 88  ? -7.110  -10.597 52.983 1.00 35.53  ? 88   ARG C CG    1 
ATOM   2018  C  CD    . ARG C  3 88  ? -8.328  -11.172 52.310 1.00 32.73  ? 88   ARG C CD    1 
ATOM   2019  N  NE    . ARG C  3 88  ? -7.975  -12.003 51.166 1.00 30.81  ? 88   ARG C NE    1 
ATOM   2020  C  CZ    . ARG C  3 88  ? -8.809  -12.295 50.173 1.00 30.39  ? 88   ARG C CZ    1 
ATOM   2021  N  NH1   . ARG C  3 88  ? -10.050 -11.819 50.165 1.00 29.73  ? 88   ARG C NH1   1 
ATOM   2022  N  NH2   . ARG C  3 88  ? -8.401  -13.062 49.176 1.00 29.90  ? 88   ARG C NH2   1 
ATOM   2023  N  N     . ASN C  3 89  ? -7.729  -6.034  53.898 1.00 39.58  ? 89   ASN C N     1 
ATOM   2024  C  CA    . ASN C  3 89  ? -8.059  -4.863  54.698 1.00 40.54  ? 89   ASN C CA    1 
ATOM   2025  C  C     . ASN C  3 89  ? -9.072  -3.952  54.042 1.00 41.28  ? 89   ASN C C     1 
ATOM   2026  O  O     . ASN C  3 89  ? -9.540  -3.000  54.667 1.00 41.85  ? 89   ASN C O     1 
ATOM   2027  C  CB    . ASN C  3 89  ? -6.810  -4.084  55.070 1.00 40.33  ? 89   ASN C CB    1 
ATOM   2028  C  CG    . ASN C  3 89  ? -6.121  -4.669  56.262 1.00 40.92  ? 89   ASN C CG    1 
ATOM   2029  O  OD1   . ASN C  3 89  ? -6.775  -5.026  57.241 1.00 41.10  ? 89   ASN C OD1   1 
ATOM   2030  N  ND2   . ASN C  3 89  ? -4.796  -4.797  56.190 1.00 41.40  ? 89   ASN C ND2   1 
ATOM   2031  N  N     . ASP C  3 90  ? -9.414  -4.242  52.790 1.00 41.87  ? 90   ASP C N     1 
ATOM   2032  C  CA    . ASP C  3 90  ? -10.355 -3.422  52.061 1.00 42.65  ? 90   ASP C CA    1 
ATOM   2033  C  C     . ASP C  3 90  ? -11.620 -4.183  51.795 1.00 43.17  ? 90   ASP C C     1 
ATOM   2034  O  O     . ASP C  3 90  ? -11.633 -5.114  50.992 1.00 43.53  ? 90   ASP C O     1 
ATOM   2035  C  CB    . ASP C  3 90  ? -9.783  -2.999  50.731 1.00 42.78  ? 90   ASP C CB    1 
ATOM   2036  C  CG    . ASP C  3 90  ? -10.785 -2.254  49.910 1.00 44.27  ? 90   ASP C CG    1 
ATOM   2037  O  OD1   . ASP C  3 90  ? -10.923 -1.041  50.124 1.00 46.83  ? 90   ASP C OD1   1 
ATOM   2038  O  OD2   . ASP C  3 90  ? -11.459 -2.879  49.068 1.00 46.26  ? 90   ASP C OD2   1 
ATOM   2039  N  N     . GLU C  3 91  ? -12.695 -3.745  52.433 1.00 43.63  ? 91   GLU C N     1 
ATOM   2040  C  CA    . GLU C  3 91  ? -13.975 -4.438  52.397 1.00 43.87  ? 91   GLU C CA    1 
ATOM   2041  C  C     . GLU C  3 91  ? -14.433 -4.870  51.006 1.00 43.27  ? 91   GLU C C     1 
ATOM   2042  O  O     . GLU C  3 91  ? -14.948 -5.975  50.842 1.00 43.48  ? 91   GLU C O     1 
ATOM   2043  C  CB    . GLU C  3 91  ? -15.016 -3.543  53.023 1.00 44.43  ? 91   GLU C CB    1 
ATOM   2044  C  CG    . GLU C  3 91  ? -16.101 -4.255  53.749 1.00 48.03  ? 91   GLU C CG    1 
ATOM   2045  C  CD    . GLU C  3 91  ? -17.356 -3.421  53.759 1.00 53.64  ? 91   GLU C CD    1 
ATOM   2046  O  OE1   . GLU C  3 91  ? -17.341 -2.354  54.427 1.00 55.27  ? 91   GLU C OE1   1 
ATOM   2047  O  OE2   . GLU C  3 91  ? -18.341 -3.817  53.076 1.00 56.10  ? 91   GLU C OE2   1 
ATOM   2048  N  N     . GLU C  3 92  ? -14.224 -4.020  50.004 1.00 42.89  ? 92   GLU C N     1 
ATOM   2049  C  CA    . GLU C  3 92  ? -14.683 -4.315  48.635 1.00 42.33  ? 92   GLU C CA    1 
ATOM   2050  C  C     . GLU C  3 92  ? -13.813 -5.286  47.824 1.00 41.80  ? 92   GLU C C     1 
ATOM   2051  O  O     . GLU C  3 92  ? -14.332 -6.243  47.238 1.00 41.77  ? 92   GLU C O     1 
ATOM   2052  C  CB    . GLU C  3 92  ? -14.949 -3.035  47.859 1.00 42.35  ? 92   GLU C CB    1 
ATOM   2053  C  CG    . GLU C  3 92  ? -16.181 -2.322  48.349 1.00 43.43  ? 92   GLU C CG    1 
ATOM   2054  C  CD    . GLU C  3 92  ? -16.705 -1.303  47.368 1.00 46.09  ? 92   GLU C CD    1 
ATOM   2055  O  OE1   . GLU C  3 92  ? -15.889 -0.761  46.570 1.00 46.40  ? 92   GLU C OE1   1 
ATOM   2056  O  OE2   . GLU C  3 92  ? -17.937 -1.043  47.406 1.00 46.78  ? 92   GLU C OE2   1 
ATOM   2057  N  N     . LEU C  3 93  ? -12.503 -5.044  47.785 1.00 41.02  ? 93   LEU C N     1 
ATOM   2058  C  CA    . LEU C  3 93  ? -11.583 -6.007  47.176 1.00 40.41  ? 93   LEU C CA    1 
ATOM   2059  C  C     . LEU C  3 93  ? -11.638 -7.352  47.895 1.00 40.65  ? 93   LEU C C     1 
ATOM   2060  O  O     . LEU C  3 93  ? -11.509 -8.393  47.255 1.00 41.05  ? 93   LEU C O     1 
ATOM   2061  C  CB    . LEU C  3 93  ? -10.141 -5.496  47.143 1.00 39.83  ? 93   LEU C CB    1 
ATOM   2062  C  CG    . LEU C  3 93  ? -9.751  -4.370  46.181 1.00 38.38  ? 93   LEU C CG    1 
ATOM   2063  C  CD1   . LEU C  3 93  ? -8.398  -3.815  46.547 1.00 37.12  ? 93   LEU C CD1   1 
ATOM   2064  C  CD2   . LEU C  3 93  ? -9.754  -4.793  44.735 1.00 36.47  ? 93   LEU C CD2   1 
ATOM   2065  N  N     . ASN C  3 94  ? -11.836 -7.338  49.212 1.00 40.55  ? 94   ASN C N     1 
ATOM   2066  C  CA    . ASN C  3 94  ? -11.976 -8.580  49.944 1.00 40.72  ? 94   ASN C CA    1 
ATOM   2067  C  C     . ASN C  3 94  ? -13.193 -9.390  49.486 1.00 41.09  ? 94   ASN C C     1 
ATOM   2068  O  O     . ASN C  3 94  ? -13.141 -10.625 49.426 1.00 41.09  ? 94   ASN C O     1 
ATOM   2069  C  CB    . ASN C  3 94  ? -12.029 -8.346  51.444 1.00 40.65  ? 94   ASN C CB    1 
ATOM   2070  C  CG    . ASN C  3 94  ? -12.241 -9.636  52.219 1.00 41.10  ? 94   ASN C CG    1 
ATOM   2071  O  OD1   . ASN C  3 94  ? -11.401 -10.534 52.192 1.00 41.25  ? 94   ASN C OD1   1 
ATOM   2072  N  ND2   . ASN C  3 94  ? -13.376 -9.741  52.897 1.00 41.21  ? 94   ASN C ND2   1 
ATOM   2073  N  N     . LYS C  3 95  ? -14.287 -8.709  49.158 1.00 41.32  ? 95   LYS C N     1 
ATOM   2074  C  CA    . LYS C  3 95  ? -15.425 -9.423  48.595 1.00 41.77  ? 95   LYS C CA    1 
ATOM   2075  C  C     . LYS C  3 95  ? -15.133 -9.867  47.159 1.00 40.58  ? 95   LYS C C     1 
ATOM   2076  O  O     . LYS C  3 95  ? -15.415 -10.998 46.789 1.00 40.77  ? 95   LYS C O     1 
ATOM   2077  C  CB    . LYS C  3 95  ? -16.712 -8.605  48.665 1.00 42.06  ? 95   LYS C CB    1 
ATOM   2078  C  CG    . LYS C  3 95  ? -17.948 -9.432  48.301 1.00 42.77  ? 95   LYS C CG    1 
ATOM   2079  C  CD    . LYS C  3 95  ? -19.236 -8.581  48.321 1.00 44.38  ? 95   LYS C CD    1 
ATOM   2080  C  CE    . LYS C  3 95  ? -20.526 -9.442  48.176 1.00 47.32  ? 95   LYS C CE    1 
ATOM   2081  N  NZ    . LYS C  3 95  ? -20.562 -10.279 46.908 1.00 50.05  ? 95   LYS C NZ    1 
ATOM   2082  N  N     . LEU C  3 96  ? -14.547 -8.988  46.354 1.00 39.35  ? 96   LEU C N     1 
ATOM   2083  C  CA    . LEU C  3 96  ? -14.276 -9.343  44.968 1.00 37.96  ? 96   LEU C CA    1 
ATOM   2084  C  C     . LEU C  3 96  ? -13.432 -10.598 44.919 1.00 37.48  ? 96   LEU C C     1 
ATOM   2085  O  O     . LEU C  3 96  ? -13.591 -11.416 44.023 1.00 37.88  ? 96   LEU C O     1 
ATOM   2086  C  CB    . LEU C  3 96  ? -13.580 -8.200  44.212 1.00 38.05  ? 96   LEU C CB    1 
ATOM   2087  C  CG    . LEU C  3 96  ? -13.290 -8.440  42.723 1.00 36.92  ? 96   LEU C CG    1 
ATOM   2088  C  CD1   . LEU C  3 96  ? -14.555 -8.775  41.993 1.00 36.41  ? 96   LEU C CD1   1 
ATOM   2089  C  CD2   . LEU C  3 96  ? -12.623 -7.254  42.075 1.00 36.98  ? 96   LEU C CD2   1 
ATOM   2090  N  N     . LEU C  3 97  ? -12.549 -10.745 45.897 1.00 36.38  ? 97   LEU C N     1 
ATOM   2091  C  CA    . LEU C  3 97  ? -11.635 -11.859 45.947 1.00 35.50  ? 97   LEU C CA    1 
ATOM   2092  C  C     . LEU C  3 97  ? -11.890 -12.701 47.188 1.00 35.48  ? 97   LEU C C     1 
ATOM   2093  O  O     . LEU C  3 97  ? -10.960 -13.216 47.818 1.00 35.34  ? 97   LEU C O     1 
ATOM   2094  C  CB    . LEU C  3 97  ? -10.213 -11.339 45.955 1.00 35.02  ? 97   LEU C CB    1 
ATOM   2095  C  CG    . LEU C  3 97  ? -9.797  -10.376 44.859 1.00 34.55  ? 97   LEU C CG    1 
ATOM   2096  C  CD1   . LEU C  3 97  ? -8.378  -9.975  45.095 1.00 34.19  ? 97   LEU C CD1   1 
ATOM   2097  C  CD2   . LEU C  3 97  ? -9.928  -11.006 43.483 1.00 35.51  ? 97   LEU C CD2   1 
ATOM   2098  N  N     . GLY C  3 98  ? -13.158 -12.847 47.539 1.00 35.18  ? 98   GLY C N     1 
ATOM   2099  C  CA    . GLY C  3 98  ? -13.514 -13.625 48.704 1.00 35.08  ? 98   GLY C CA    1 
ATOM   2100  C  C     . GLY C  3 98  ? -13.361 -15.123 48.520 1.00 35.26  ? 98   GLY C C     1 
ATOM   2101  O  O     . GLY C  3 98  ? -13.450 -15.869 49.495 1.00 35.20  ? 98   GLY C O     1 
ATOM   2102  N  N     . ARG C  3 99  ? -13.173 -15.563 47.273 1.00 35.18  ? 99   ARG C N     1 
ATOM   2103  C  CA    . ARG C  3 99  ? -12.969 -16.973 46.970 1.00 35.38  ? 99   ARG C CA    1 
ATOM   2104  C  C     . ARG C  3 99  ? -11.655 -17.182 46.217 1.00 35.07  ? 99   ARG C C     1 
ATOM   2105  O  O     . ARG C  3 99  ? -11.502 -18.140 45.449 1.00 35.49  ? 99   ARG C O     1 
ATOM   2106  C  CB    . ARG C  3 99  ? -14.123 -17.533 46.155 1.00 35.58  ? 99   ARG C CB    1 
ATOM   2107  C  CG    . ARG C  3 99  ? -15.454 -17.478 46.830 1.00 39.22  ? 99   ARG C CG    1 
ATOM   2108  C  CD    . ARG C  3 99  ? -15.752 -18.681 47.743 1.00 48.01  ? 99   ARG C CD    1 
ATOM   2109  N  NE    . ARG C  3 99  ? -17.111 -18.511 48.292 1.00 55.93  ? 99   ARG C NE    1 
ATOM   2110  C  CZ    . ARG C  3 99  ? -17.431 -18.374 49.595 1.00 58.87  ? 99   ARG C CZ    1 
ATOM   2111  N  NH1   . ARG C  3 99  ? -16.496 -18.431 50.570 1.00 58.74  ? 99   ARG C NH1   1 
ATOM   2112  N  NH2   . ARG C  3 99  ? -18.718 -18.205 49.922 1.00 59.12  ? 99   ARG C NH2   1 
ATOM   2113  N  N     . VAL C  3 100 ? -10.707 -16.286 46.446 1.00 34.34  ? 100  VAL C N     1 
ATOM   2114  C  CA    . VAL C  3 100 ? -9.439  -16.332 45.770 1.00 33.88  ? 100  VAL C CA    1 
ATOM   2115  C  C     . VAL C  3 100 ? -8.385  -16.479 46.836 1.00 34.09  ? 100  VAL C C     1 
ATOM   2116  O  O     . VAL C  3 100 ? -8.467  -15.810 47.862 1.00 34.70  ? 100  VAL C O     1 
ATOM   2117  C  CB    . VAL C  3 100 ? -9.196  -15.019 45.025 1.00 33.64  ? 100  VAL C CB    1 
ATOM   2118  C  CG1   . VAL C  3 100 ? -7.719  -14.754 44.854 1.00 33.67  ? 100  VAL C CG1   1 
ATOM   2119  C  CG2   . VAL C  3 100 ? -9.849  -15.062 43.688 1.00 33.79  ? 100  VAL C CG2   1 
ATOM   2120  N  N     . THR C  3 101 ? -7.400  -17.342 46.608 1.00 33.69  ? 101  THR C N     1 
ATOM   2121  C  CA    . THR C  3 101 ? -6.276  -17.441 47.521 1.00 33.41  ? 101  THR C CA    1 
ATOM   2122  C  C     . THR C  3 101 ? -5.035  -16.838 46.922 1.00 33.12  ? 101  THR C C     1 
ATOM   2123  O  O     . THR C  3 101 ? -4.687  -17.141 45.781 1.00 33.24  ? 101  THR C O     1 
ATOM   2124  C  CB    . THR C  3 101 ? -6.035  -18.898 47.952 1.00 33.89  ? 101  THR C CB    1 
ATOM   2125  O  OG1   . THR C  3 101 ? -6.985  -19.216 48.974 1.00 34.13  ? 101  THR C OG1   1 
ATOM   2126  C  CG2   . THR C  3 101 ? -4.626  -19.103 48.528 1.00 32.78  ? 101  THR C CG2   1 
ATOM   2127  N  N     . ILE C  3 102 ? -4.384  -15.972 47.698 1.00 32.61  ? 102  ILE C N     1 
ATOM   2128  C  CA    . ILE C  3 102 ? -3.135  -15.345 47.285 1.00 32.11  ? 102  ILE C CA    1 
ATOM   2129  C  C     . ILE C  3 102 ? -1.966  -16.090 47.893 1.00 32.38  ? 102  ILE C C     1 
ATOM   2130  O  O     . ILE C  3 102 ? -1.685  -15.991 49.094 1.00 31.96  ? 102  ILE C O     1 
ATOM   2131  C  CB    . ILE C  3 102 ? -3.059  -13.853 47.682 1.00 31.93  ? 102  ILE C CB    1 
ATOM   2132  C  CG1   . ILE C  3 102 ? -3.985  -13.005 46.815 1.00 31.12  ? 102  ILE C CG1   1 
ATOM   2133  C  CG2   . ILE C  3 102 ? -1.646  -13.332 47.519 1.00 32.15  ? 102  ILE C CG2   1 
ATOM   2134  C  CD1   . ILE C  3 102 ? -4.184  -11.616 47.323 1.00 29.22  ? 102  ILE C CD1   1 
ATOM   2135  N  N     . ALA C  3 103 ? -1.283  -16.847 47.046 1.00 33.03  ? 103  ALA C N     1 
ATOM   2136  C  CA    . ALA C  3 103 ? -0.062  -17.535 47.432 1.00 33.63  ? 103  ALA C CA    1 
ATOM   2137  C  C     . ALA C  3 103 ? 0.815   -16.618 48.260 1.00 34.21  ? 103  ALA C C     1 
ATOM   2138  O  O     . ALA C  3 103 ? 0.905   -15.427 47.976 1.00 34.54  ? 103  ALA C O     1 
ATOM   2139  C  CB    . ALA C  3 103 ? 0.687   -17.960 46.207 1.00 33.83  ? 103  ALA C CB    1 
ATOM   2140  N  N     . GLN C  3 104 ? 1.456   -17.187 49.276 1.00 34.74  ? 104  GLN C N     1 
ATOM   2141  C  CA    . GLN C  3 104 ? 2.412   -16.479 50.134 1.00 35.31  ? 104  GLN C CA    1 
ATOM   2142  C  C     . GLN C  3 104 ? 1.868   -15.218 50.829 1.00 35.75  ? 104  GLN C C     1 
ATOM   2143  O  O     . GLN C  3 104 ? 2.618   -14.309 51.192 1.00 36.10  ? 104  GLN C O     1 
ATOM   2144  C  CB    . GLN C  3 104 ? 3.725   -16.228 49.391 1.00 34.88  ? 104  GLN C CB    1 
ATOM   2145  C  CG    . GLN C  3 104 ? 4.690   -17.399 49.490 1.00 36.71  ? 104  GLN C CG    1 
ATOM   2146  C  CD    . GLN C  3 104 ? 4.905   -17.907 50.946 1.00 38.34  ? 104  GLN C CD    1 
ATOM   2147  O  OE1   . GLN C  3 104 ? 5.511   -17.224 51.792 1.00 37.38  ? 104  GLN C OE1   1 
ATOM   2148  N  NE2   . GLN C  3 104 ? 4.403   -19.115 51.228 1.00 38.50  ? 104  GLN C NE2   1 
ATOM   2149  N  N     . GLY C  3 105 ? 0.560   -15.183 51.044 1.00 36.23  ? 105  GLY C N     1 
ATOM   2150  C  CA    . GLY C  3 105 ? -0.067  -13.991 51.585 1.00 36.79  ? 105  GLY C CA    1 
ATOM   2151  C  C     . GLY C  3 105 ? -0.260  -13.966 53.090 1.00 37.24  ? 105  GLY C C     1 
ATOM   2152  O  O     . GLY C  3 105 ? -0.424  -12.886 53.677 1.00 37.19  ? 105  GLY C O     1 
ATOM   2153  N  N     . GLY C  3 106 ? -0.254  -15.142 53.718 1.00 37.38  ? 106  GLY C N     1 
ATOM   2154  C  CA    . GLY C  3 106 ? -0.570  -15.236 55.140 1.00 37.48  ? 106  GLY C CA    1 
ATOM   2155  C  C     . GLY C  3 106 ? -1.970  -14.710 55.415 1.00 37.69  ? 106  GLY C C     1 
ATOM   2156  O  O     . GLY C  3 106 ? -2.774  -14.569 54.490 1.00 37.28  ? 106  GLY C O     1 
ATOM   2157  N  N     . VAL C  3 107 ? -2.246  -14.404 56.686 1.00 38.02  ? 107  VAL C N     1 
ATOM   2158  C  CA    . VAL C  3 107 ? -3.565  -13.924 57.118 1.00 38.31  ? 107  VAL C CA    1 
ATOM   2159  C  C     . VAL C  3 107 ? -3.452  -12.581 57.860 1.00 39.08  ? 107  VAL C C     1 
ATOM   2160  O  O     . VAL C  3 107 ? -2.353  -12.156 58.199 1.00 39.35  ? 107  VAL C O     1 
ATOM   2161  C  CB    . VAL C  3 107 ? -4.261  -14.956 58.021 1.00 38.19  ? 107  VAL C CB    1 
ATOM   2162  C  CG1   . VAL C  3 107 ? -4.543  -16.249 57.264 1.00 37.07  ? 107  VAL C CG1   1 
ATOM   2163  C  CG2   . VAL C  3 107 ? -3.433  -15.223 59.276 1.00 37.91  ? 107  VAL C CG2   1 
ATOM   2164  N  N     . LEU C  3 108 ? -4.573  -11.905 58.101 1.00 39.83  ? 108  LEU C N     1 
ATOM   2165  C  CA    . LEU C  3 108 ? -4.551  -10.667 58.883 1.00 40.62  ? 108  LEU C CA    1 
ATOM   2166  C  C     . LEU C  3 108 ? -4.328  -10.979 60.365 1.00 41.72  ? 108  LEU C C     1 
ATOM   2167  O  O     . LEU C  3 108 ? -5.010  -11.853 60.915 1.00 42.11  ? 108  LEU C O     1 
ATOM   2168  C  CB    . LEU C  3 108 ? -5.864  -9.903  58.726 1.00 40.20  ? 108  LEU C CB    1 
ATOM   2169  C  CG    . LEU C  3 108 ? -6.135  -9.194  57.401 1.00 40.13  ? 108  LEU C CG    1 
ATOM   2170  C  CD1   . LEU C  3 108 ? -7.527  -8.537  57.377 1.00 39.30  ? 108  LEU C CD1   1 
ATOM   2171  C  CD2   . LEU C  3 108 ? -5.032  -8.167  57.087 1.00 40.90  ? 108  LEU C CD2   1 
ATOM   2172  N  N     . PRO C  3 109 ? -3.364  -10.293 61.023 1.00 42.49  ? 109  PRO C N     1 
ATOM   2173  C  CA    . PRO C  3 109 ? -3.267  -10.427 62.476 1.00 43.10  ? 109  PRO C CA    1 
ATOM   2174  C  C     . PRO C  3 109 ? -4.644  -10.278 63.077 1.00 43.69  ? 109  PRO C C     1 
ATOM   2175  O  O     . PRO C  3 109 ? -5.313  -9.308  62.786 1.00 43.86  ? 109  PRO C O     1 
ATOM   2176  C  CB    . PRO C  3 109 ? -2.400  -9.236  62.868 1.00 42.74  ? 109  PRO C CB    1 
ATOM   2177  C  CG    . PRO C  3 109 ? -1.478  -9.111  61.742 1.00 42.81  ? 109  PRO C CG    1 
ATOM   2178  C  CD    . PRO C  3 109 ? -2.308  -9.410  60.505 1.00 42.39  ? 109  PRO C CD    1 
ATOM   2179  N  N     . ASN C  3 110 ? -5.082  -11.245 63.871 1.00 44.63  ? 110  ASN C N     1 
ATOM   2180  C  CA    . ASN C  3 110 ? -6.407  -11.172 64.448 1.00 45.73  ? 110  ASN C CA    1 
ATOM   2181  C  C     . ASN C  3 110 ? -6.659  -12.282 65.456 1.00 46.20  ? 110  ASN C C     1 
ATOM   2182  O  O     . ASN C  3 110 ? -6.820  -13.426 65.066 1.00 46.48  ? 110  ASN C O     1 
ATOM   2183  C  CB    . ASN C  3 110 ? -7.438  -11.233 63.326 1.00 46.05  ? 110  ASN C CB    1 
ATOM   2184  C  CG    . ASN C  3 110 ? -8.851  -11.088 63.820 1.00 47.58  ? 110  ASN C CG    1 
ATOM   2185  O  OD1   . ASN C  3 110 ? -9.110  -10.415 64.817 1.00 50.49  ? 110  ASN C OD1   1 
ATOM   2186  N  ND2   . ASN C  3 110 ? -9.786  -11.709 63.112 1.00 48.82  ? 110  ASN C ND2   1 
ATOM   2187  N  N     . ILE C  3 111 ? -6.689  -11.931 66.743 1.00 46.92  ? 111  ILE C N     1 
ATOM   2188  C  CA    . ILE C  3 111 ? -6.976  -12.859 67.851 1.00 47.67  ? 111  ILE C CA    1 
ATOM   2189  C  C     . ILE C  3 111 ? -8.346  -12.548 68.471 1.00 48.69  ? 111  ILE C C     1 
ATOM   2190  O  O     . ILE C  3 111 ? -8.623  -11.402 68.813 1.00 49.03  ? 111  ILE C O     1 
ATOM   2191  C  CB    . ILE C  3 111 ? -5.908  -12.724 68.971 1.00 47.46  ? 111  ILE C CB    1 
ATOM   2192  C  CG1   . ILE C  3 111 ? -4.502  -13.050 68.445 1.00 47.22  ? 111  ILE C CG1   1 
ATOM   2193  C  CG2   . ILE C  3 111 ? -6.289  -13.554 70.201 1.00 47.04  ? 111  ILE C CG2   1 
ATOM   2194  C  CD1   . ILE C  3 111 ? -3.370  -12.720 69.419 1.00 47.50  ? 111  ILE C CD1   1 
ATOM   2195  N  N     . GLN C  3 112 ? -9.196  -13.556 68.635 1.00 49.84  ? 112  GLN C N     1 
ATOM   2196  C  CA    . GLN C  3 112 ? -10.512 -13.352 69.246 1.00 51.09  ? 112  GLN C CA    1 
ATOM   2197  C  C     . GLN C  3 112 ? -10.399 -12.924 70.698 1.00 52.16  ? 112  GLN C C     1 
ATOM   2198  O  O     . GLN C  3 112 ? -9.509  -13.381 71.408 1.00 52.40  ? 112  GLN C O     1 
ATOM   2199  C  CB    . GLN C  3 112 ? -11.315 -14.635 69.190 1.00 51.14  ? 112  GLN C CB    1 
ATOM   2200  C  CG    . GLN C  3 112 ? -11.525 -15.141 67.803 1.00 51.95  ? 112  GLN C CG    1 
ATOM   2201  C  CD    . GLN C  3 112 ? -12.582 -14.369 67.095 1.00 53.33  ? 112  GLN C CD    1 
ATOM   2202  O  OE1   . GLN C  3 112 ? -13.747 -14.375 67.509 1.00 53.61  ? 112  GLN C OE1   1 
ATOM   2203  N  NE2   . GLN C  3 112 ? -12.198 -13.684 66.018 1.00 54.60  ? 112  GLN C NE2   1 
ATOM   2204  N  N     . SER C  3 113 ? -11.326 -12.074 71.140 1.00 53.48  ? 113  SER C N     1 
ATOM   2205  C  CA    . SER C  3 113 ? -11.256 -11.416 72.450 1.00 54.53  ? 113  SER C CA    1 
ATOM   2206  C  C     . SER C  3 113 ? -11.155 -12.347 73.634 1.00 55.22  ? 113  SER C C     1 
ATOM   2207  O  O     . SER C  3 113 ? -10.277 -12.183 74.486 1.00 55.43  ? 113  SER C O     1 
ATOM   2208  C  CB    . SER C  3 113 ? -12.471 -10.540 72.647 1.00 54.50  ? 113  SER C CB    1 
ATOM   2209  O  OG    . SER C  3 113 ? -12.386 -9.446  71.770 1.00 56.00  ? 113  SER C OG    1 
ATOM   2210  N  N     . VAL C  3 114 ? -12.058 -13.324 73.674 1.00 56.03  ? 114  VAL C N     1 
ATOM   2211  C  CA    . VAL C  3 114 ? -12.165 -14.259 74.796 1.00 56.74  ? 114  VAL C CA    1 
ATOM   2212  C  C     . VAL C  3 114 ? -10.856 -15.016 75.034 1.00 57.19  ? 114  VAL C C     1 
ATOM   2213  O  O     . VAL C  3 114 ? -10.686 -15.652 76.072 1.00 57.52  ? 114  VAL C O     1 
ATOM   2214  C  CB    . VAL C  3 114 ? -13.356 -15.270 74.625 1.00 56.69  ? 114  VAL C CB    1 
ATOM   2215  C  CG1   . VAL C  3 114 ? -14.633 -14.568 74.102 1.00 57.33  ? 114  VAL C CG1   1 
ATOM   2216  C  CG2   . VAL C  3 114 ? -12.979 -16.430 73.707 1.00 56.92  ? 114  VAL C CG2   1 
ATOM   2217  N  N     . LEU C  3 115 ? -9.934  -14.938 74.080 1.00 57.75  ? 115  LEU C N     1 
ATOM   2218  C  CA    . LEU C  3 115 ? -8.675  -15.667 74.183 1.00 58.36  ? 115  LEU C CA    1 
ATOM   2219  C  C     . LEU C  3 115 ? -7.597  -14.890 74.927 1.00 59.18  ? 115  LEU C C     1 
ATOM   2220  O  O     . LEU C  3 115 ? -6.660  -15.490 75.450 1.00 59.23  ? 115  LEU C O     1 
ATOM   2221  C  CB    . LEU C  3 115 ? -8.168  -16.108 72.801 1.00 58.12  ? 115  LEU C CB    1 
ATOM   2222  C  CG    . LEU C  3 115 ? -9.083  -16.984 71.939 1.00 56.67  ? 115  LEU C CG    1 
ATOM   2223  C  CD1   . LEU C  3 115 ? -8.473  -17.186 70.569 1.00 54.86  ? 115  LEU C CD1   1 
ATOM   2224  C  CD2   . LEU C  3 115 ? -9.337  -18.308 72.611 1.00 56.06  ? 115  LEU C CD2   1 
ATOM   2225  N  N     . LEU C  3 116 ? -7.723  -13.565 74.971 1.00 60.23  ? 116  LEU C N     1 
ATOM   2226  C  CA    . LEU C  3 116 ? -6.772  -12.740 75.715 1.00 61.38  ? 116  LEU C CA    1 
ATOM   2227  C  C     . LEU C  3 116 ? -7.002  -12.949 77.212 1.00 62.49  ? 116  LEU C C     1 
ATOM   2228  O  O     . LEU C  3 116 ? -8.105  -13.295 77.618 1.00 62.37  ? 116  LEU C O     1 
ATOM   2229  C  CB    . LEU C  3 116 ? -6.903  -11.262 75.334 1.00 61.06  ? 116  LEU C CB    1 
ATOM   2230  C  CG    . LEU C  3 116 ? -6.815  -10.900 73.847 1.00 60.96  ? 116  LEU C CG    1 
ATOM   2231  C  CD1   . LEU C  3 116 ? -7.371  -9.520  73.596 1.00 60.70  ? 116  LEU C CD1   1 
ATOM   2232  C  CD2   . LEU C  3 116 ? -5.402  -11.015 73.293 1.00 60.77  ? 116  LEU C CD2   1 
ATOM   2233  N  N     . PRO C  3 117 ? -5.958  -12.766 78.038 1.00 63.85  ? 117  PRO C N     1 
ATOM   2234  C  CA    . PRO C  3 117 ? -6.170  -12.973 79.469 1.00 65.06  ? 117  PRO C CA    1 
ATOM   2235  C  C     . PRO C  3 117 ? -6.720  -11.717 80.159 1.00 66.61  ? 117  PRO C C     1 
ATOM   2236  O  O     . PRO C  3 117 ? -6.957  -10.699 79.481 1.00 66.92  ? 117  PRO C O     1 
ATOM   2237  C  CB    . PRO C  3 117 ? -4.758  -13.271 79.976 1.00 64.89  ? 117  PRO C CB    1 
ATOM   2238  C  CG    . PRO C  3 117 ? -3.849  -12.511 79.044 1.00 64.10  ? 117  PRO C CG    1 
ATOM   2239  C  CD    . PRO C  3 117 ? -4.565  -12.374 77.730 1.00 63.83  ? 117  PRO C CD    1 
ATOM   2240  N  N     . LYS C  3 118 ? -6.958  -11.816 81.476 1.00 68.07  ? 118  LYS C N     1 
ATOM   2241  C  CA    . LYS C  3 118 ? -6.991  -10.648 82.398 1.00 69.50  ? 118  LYS C CA    1 
ATOM   2242  C  C     . LYS C  3 118 ? -6.917  -11.014 83.884 1.00 70.00  ? 118  LYS C C     1 
ATOM   2243  O  O     . LYS C  3 118 ? -6.524  -12.133 84.244 1.00 70.78  ? 118  LYS C O     1 
ATOM   2244  C  CB    . LYS C  3 118 ? -8.157  -9.667  82.138 1.00 69.79  ? 118  LYS C CB    1 
ATOM   2245  C  CG    . LYS C  3 118 ? -7.714  -8.338  81.448 1.00 71.47  ? 118  LYS C CG    1 
ATOM   2246  C  CD    . LYS C  3 118 ? -7.306  -7.181  82.418 1.00 73.01  ? 118  LYS C CD    1 
ATOM   2247  C  CE    . LYS C  3 118 ? -6.178  -7.543  83.409 1.00 73.74  ? 118  LYS C CE    1 
ATOM   2248  N  NZ    . LYS C  3 118 ? -5.014  -8.213  82.750 1.00 74.53  ? 118  LYS C NZ    1 
ATOM   2249  N  N     . LYS D  4 27  ? 18.431  -17.958 20.282 1.00 117.57 ? 24   LYS D N     1 
ATOM   2250  C  CA    . LYS D  4 27  ? 17.142  -18.656 19.966 1.00 117.68 ? 24   LYS D CA    1 
ATOM   2251  C  C     . LYS D  4 27  ? 17.294  -20.196 19.945 1.00 117.35 ? 24   LYS D C     1 
ATOM   2252  O  O     . LYS D  4 27  ? 18.117  -20.737 19.190 1.00 117.47 ? 24   LYS D O     1 
ATOM   2253  C  CB    . LYS D  4 27  ? 16.551  -18.127 18.637 1.00 117.88 ? 24   LYS D CB    1 
ATOM   2254  C  CG    . LYS D  4 27  ? 15.478  -17.025 18.780 1.00 118.47 ? 24   LYS D CG    1 
ATOM   2255  C  CD    . LYS D  4 27  ? 15.986  -15.789 19.532 1.00 119.39 ? 24   LYS D CD    1 
ATOM   2256  C  CE    . LYS D  4 27  ? 14.845  -15.081 20.262 1.00 120.10 ? 24   LYS D CE    1 
ATOM   2257  N  NZ    . LYS D  4 27  ? 15.324  -14.121 21.318 1.00 120.50 ? 24   LYS D NZ    1 
ATOM   2258  N  N     . LYS D  4 28  ? 16.510  -20.885 20.786 1.00 116.72 ? 25   LYS D N     1 
ATOM   2259  C  CA    . LYS D  4 28  ? 16.515  -22.362 20.859 1.00 115.87 ? 25   LYS D CA    1 
ATOM   2260  C  C     . LYS D  4 28  ? 15.169  -22.930 20.405 1.00 114.96 ? 25   LYS D C     1 
ATOM   2261  O  O     . LYS D  4 28  ? 14.225  -23.036 21.204 1.00 114.87 ? 25   LYS D O     1 
ATOM   2262  C  CB    . LYS D  4 28  ? 16.849  -22.870 22.276 1.00 116.10 ? 25   LYS D CB    1 
ATOM   2263  C  CG    . LYS D  4 28  ? 18.327  -22.796 22.686 1.00 116.49 ? 25   LYS D CG    1 
ATOM   2264  C  CD    . LYS D  4 28  ? 18.708  -21.430 23.285 1.00 117.44 ? 25   LYS D CD    1 
ATOM   2265  C  CE    . LYS D  4 28  ? 17.798  -21.018 24.453 1.00 117.74 ? 25   LYS D CE    1 
ATOM   2266  N  NZ    . LYS D  4 28  ? 17.968  -21.906 25.649 1.00 118.14 ? 25   LYS D NZ    1 
ATOM   2267  N  N     . ARG D  4 29  ? 15.101  -23.296 19.122 1.00 113.76 ? 26   ARG D N     1 
ATOM   2268  C  CA    . ARG D  4 29  ? 13.851  -23.671 18.447 1.00 112.52 ? 26   ARG D CA    1 
ATOM   2269  C  C     . ARG D  4 29  ? 12.698  -22.752 18.897 1.00 111.51 ? 26   ARG D C     1 
ATOM   2270  O  O     . ARG D  4 29  ? 11.547  -23.190 19.026 1.00 111.50 ? 26   ARG D O     1 
ATOM   2271  C  CB    . ARG D  4 29  ? 13.541  -25.163 18.658 1.00 112.65 ? 26   ARG D CB    1 
ATOM   2272  C  CG    . ARG D  4 29  ? 12.954  -25.865 17.430 1.00 112.81 ? 26   ARG D CG    1 
ATOM   2273  C  CD    . ARG D  4 29  ? 13.315  -27.361 17.376 1.00 113.20 ? 26   ARG D CD    1 
ATOM   2274  N  NE    . ARG D  4 29  ? 12.490  -28.193 18.257 1.00 113.47 ? 26   ARG D NE    1 
ATOM   2275  C  CZ    . ARG D  4 29  ? 12.414  -29.525 18.204 1.00 114.03 ? 26   ARG D CZ    1 
ATOM   2276  N  NH1   . ARG D  4 29  ? 13.110  -30.213 17.306 1.00 114.22 ? 26   ARG D NH1   1 
ATOM   2277  N  NH2   . ARG D  4 29  ? 11.632  -30.180 19.054 1.00 114.33 ? 26   ARG D NH2   1 
ATOM   2278  N  N     . ARG D  4 30  ? 13.051  -21.475 19.122 1.00 110.04 ? 27   ARG D N     1 
ATOM   2279  C  CA    . ARG D  4 30  ? 12.186  -20.435 19.715 1.00 108.53 ? 27   ARG D CA    1 
ATOM   2280  C  C     . ARG D  4 30  ? 10.952  -20.933 20.495 1.00 106.82 ? 27   ARG D C     1 
ATOM   2281  O  O     . ARG D  4 30  ? 9.912   -21.277 19.910 1.00 106.51 ? 27   ARG D O     1 
ATOM   2282  C  CB    . ARG D  4 30  ? 11.834  -19.352 18.668 1.00 109.00 ? 27   ARG D CB    1 
ATOM   2283  C  CG    . ARG D  4 30  ? 10.800  -18.287 19.099 1.00 110.90 ? 27   ARG D CG    1 
ATOM   2284  C  CD    . ARG D  4 30  ? 11.376  -17.116 19.933 1.00 113.59 ? 27   ARG D CD    1 
ATOM   2285  N  NE    . ARG D  4 30  ? 10.293  -16.301 20.505 1.00 115.54 ? 27   ARG D NE    1 
ATOM   2286  C  CZ    . ARG D  4 30  ? 10.351  -14.987 20.741 1.00 116.38 ? 27   ARG D CZ    1 
ATOM   2287  N  NH1   . ARG D  4 30  ? 11.451  -14.293 20.455 1.00 116.72 ? 27   ARG D NH1   1 
ATOM   2288  N  NH2   . ARG D  4 30  ? 9.295   -14.360 21.260 1.00 116.22 ? 27   ARG D NH2   1 
ATOM   2289  N  N     . LYS D  4 31  ? 11.114  -20.989 21.821 1.00 104.74 ? 28   LYS D N     1 
ATOM   2290  C  CA    . LYS D  4 31  ? 10.029  -21.249 22.769 1.00 102.49 ? 28   LYS D CA    1 
ATOM   2291  C  C     . LYS D  4 31  ? 8.906   -20.268 22.467 1.00 100.80 ? 28   LYS D C     1 
ATOM   2292  O  O     . LYS D  4 31  ? 9.136   -19.052 22.481 1.00 100.86 ? 28   LYS D O     1 
ATOM   2293  C  CB    . LYS D  4 31  ? 10.537  -21.042 24.200 1.00 102.55 ? 28   LYS D CB    1 
ATOM   2294  C  CG    . LYS D  4 31  ? 9.447   -20.814 25.231 1.00 102.67 ? 28   LYS D CG    1 
ATOM   2295  C  CD    . LYS D  4 31  ? 9.949   -19.939 26.369 1.00 103.15 ? 28   LYS D CD    1 
ATOM   2296  C  CE    . LYS D  4 31  ? 8.836   -19.621 27.351 1.00 103.27 ? 28   LYS D CE    1 
ATOM   2297  N  NZ    . LYS D  4 31  ? 7.724   -18.886 26.684 1.00 103.84 ? 28   LYS D NZ    1 
ATOM   2298  N  N     . THR D  4 32  ? 7.708   -20.779 22.168 1.00 98.33  ? 29   THR D N     1 
ATOM   2299  C  CA    . THR D  4 32  ? 6.607   -19.896 21.771 1.00 95.86  ? 29   THR D CA    1 
ATOM   2300  C  C     . THR D  4 32  ? 6.280   -18.933 22.900 1.00 93.98  ? 29   THR D C     1 
ATOM   2301  O  O     . THR D  4 32  ? 6.336   -19.291 24.085 1.00 93.68  ? 29   THR D O     1 
ATOM   2302  C  CB    . THR D  4 32  ? 5.335   -20.642 21.286 1.00 96.07  ? 29   THR D CB    1 
ATOM   2303  O  OG1   . THR D  4 32  ? 4.997   -21.683 22.212 1.00 96.07  ? 29   THR D OG1   1 
ATOM   2304  C  CG2   . THR D  4 32  ? 5.542   -21.233 19.877 1.00 95.81  ? 29   THR D CG2   1 
ATOM   2305  N  N     . ARG D  4 33  ? 5.963   -17.704 22.502 1.00 91.60  ? 30   ARG D N     1 
ATOM   2306  C  CA    . ARG D  4 33  ? 5.907   -16.558 23.407 1.00 89.14  ? 30   ARG D CA    1 
ATOM   2307  C  C     . ARG D  4 33  ? 4.842   -16.693 24.493 1.00 87.10  ? 30   ARG D C     1 
ATOM   2308  O  O     . ARG D  4 33  ? 3.697   -17.050 24.211 1.00 86.75  ? 30   ARG D O     1 
ATOM   2309  C  CB    . ARG D  4 33  ? 5.728   -15.247 22.616 1.00 89.37  ? 30   ARG D CB    1 
ATOM   2310  C  CG    . ARG D  4 33  ? 4.803   -15.336 21.385 1.00 89.76  ? 30   ARG D CG    1 
ATOM   2311  C  CD    . ARG D  4 33  ? 4.015   -14.045 21.165 1.00 90.46  ? 30   ARG D CD    1 
ATOM   2312  N  NE    . ARG D  4 33  ? 4.832   -12.846 21.377 1.00 91.22  ? 30   ARG D NE    1 
ATOM   2313  C  CZ    . ARG D  4 33  ? 4.347   -11.625 21.615 1.00 91.74  ? 30   ARG D CZ    1 
ATOM   2314  N  NH1   . ARG D  4 33  ? 3.029   -11.418 21.680 1.00 91.77  ? 30   ARG D NH1   1 
ATOM   2315  N  NH2   . ARG D  4 33  ? 5.185   -10.607 21.796 1.00 91.49  ? 30   ARG D NH2   1 
ATOM   2316  N  N     . LYS D  4 34  ? 5.247   -16.429 25.735 1.00 84.53  ? 31   LYS D N     1 
ATOM   2317  C  CA    . LYS D  4 34  ? 4.317   -16.392 26.856 1.00 81.93  ? 31   LYS D CA    1 
ATOM   2318  C  C     . LYS D  4 34  ? 4.046   -14.963 27.280 1.00 79.58  ? 31   LYS D C     1 
ATOM   2319  O  O     . LYS D  4 34  ? 4.792   -14.376 28.061 1.00 79.48  ? 31   LYS D O     1 
ATOM   2320  C  CB    . LYS D  4 34  ? 4.813   -17.225 28.045 1.00 82.24  ? 31   LYS D CB    1 
ATOM   2321  C  CG    . LYS D  4 34  ? 3.708   -17.533 29.082 1.00 83.62  ? 31   LYS D CG    1 
ATOM   2322  C  CD    . LYS D  4 34  ? 2.341   -17.833 28.409 1.00 85.18  ? 31   LYS D CD    1 
ATOM   2323  C  CE    . LYS D  4 34  ? 1.538   -18.896 29.161 1.00 85.66  ? 31   LYS D CE    1 
ATOM   2324  N  NZ    . LYS D  4 34  ? 0.847   -18.363 30.373 1.00 86.73  ? 31   LYS D NZ    1 
ATOM   2325  N  N     . GLU D  4 35  ? 2.964   -14.411 26.759 1.00 76.59  ? 32   GLU D N     1 
ATOM   2326  C  CA    . GLU D  4 35  ? 2.606   -13.043 27.059 1.00 73.85  ? 32   GLU D CA    1 
ATOM   2327  C  C     . GLU D  4 35  ? 1.939   -12.913 28.430 1.00 71.49  ? 32   GLU D C     1 
ATOM   2328  O  O     . GLU D  4 35  ? 1.283   -13.847 28.890 1.00 71.37  ? 32   GLU D O     1 
ATOM   2329  C  CB    . GLU D  4 35  ? 1.700   -12.499 25.963 1.00 74.19  ? 32   GLU D CB    1 
ATOM   2330  C  CG    . GLU D  4 35  ? 0.483   -13.355 25.694 1.00 74.81  ? 32   GLU D CG    1 
ATOM   2331  C  CD    . GLU D  4 35  ? -0.533  -12.658 24.814 1.00 76.16  ? 32   GLU D CD    1 
ATOM   2332  O  OE1   . GLU D  4 35  ? -0.150  -11.763 24.016 1.00 75.58  ? 32   GLU D OE1   1 
ATOM   2333  O  OE2   . GLU D  4 35  ? -1.725  -13.017 24.922 1.00 77.49  ? 32   GLU D OE2   1 
ATOM   2334  N  N     . SER D  4 36  ? 2.132   -11.761 29.075 1.00 68.32  ? 33   SER D N     1 
ATOM   2335  C  CA    . SER D  4 36  ? 1.460   -11.429 30.332 1.00 65.29  ? 33   SER D CA    1 
ATOM   2336  C  C     . SER D  4 36  ? 1.218   -9.931  30.408 1.00 63.35  ? 33   SER D C     1 
ATOM   2337  O  O     . SER D  4 36  ? 1.572   -9.207  29.489 1.00 63.09  ? 33   SER D O     1 
ATOM   2338  C  CB    . SER D  4 36  ? 2.272   -11.901 31.538 1.00 65.14  ? 33   SER D CB    1 
ATOM   2339  O  OG    . SER D  4 36  ? 3.305   -10.996 31.845 1.00 64.66  ? 33   SER D OG    1 
ATOM   2340  N  N     . TYR D  4 37  ? 0.620   -9.471  31.505 1.00 61.01  ? 34   TYR D N     1 
ATOM   2341  C  CA    . TYR D  4 37  ? 0.324   -8.048  31.694 1.00 58.84  ? 34   TYR D CA    1 
ATOM   2342  C  C     . TYR D  4 37  ? 1.431   -7.235  32.416 1.00 57.93  ? 34   TYR D C     1 
ATOM   2343  O  O     . TYR D  4 37  ? 1.273   -6.025  32.630 1.00 57.92  ? 34   TYR D O     1 
ATOM   2344  C  CB    . TYR D  4 37  ? -1.005  -7.879  32.423 1.00 57.96  ? 34   TYR D CB    1 
ATOM   2345  C  CG    . TYR D  4 37  ? -2.222  -8.303  31.634 1.00 57.37  ? 34   TYR D CG    1 
ATOM   2346  C  CD1   . TYR D  4 37  ? -2.758  -9.574  31.771 1.00 57.23  ? 34   TYR D CD1   1 
ATOM   2347  C  CD2   . TYR D  4 37  ? -2.869  -7.419  30.774 1.00 57.26  ? 34   TYR D CD2   1 
ATOM   2348  C  CE1   . TYR D  4 37  ? -3.897  -9.962  31.055 1.00 56.74  ? 34   TYR D CE1   1 
ATOM   2349  C  CE2   . TYR D  4 37  ? -4.017  -7.800  30.057 1.00 56.22  ? 34   TYR D CE2   1 
ATOM   2350  C  CZ    . TYR D  4 37  ? -4.512  -9.072  30.205 1.00 56.29  ? 34   TYR D CZ    1 
ATOM   2351  O  OH    . TYR D  4 37  ? -5.622  -9.463  29.508 1.00 56.44  ? 34   TYR D OH    1 
ATOM   2352  N  N     . ALA D  4 38  ? 2.551   -7.889  32.746 1.00 56.40  ? 35   ALA D N     1 
ATOM   2353  C  CA    . ALA D  4 38  ? 3.617   -7.316  33.585 1.00 54.82  ? 35   ALA D CA    1 
ATOM   2354  C  C     . ALA D  4 38  ? 4.070   -5.874  33.274 1.00 54.11  ? 35   ALA D C     1 
ATOM   2355  O  O     . ALA D  4 38  ? 4.157   -5.043  34.190 1.00 54.09  ? 35   ALA D O     1 
ATOM   2356  C  CB    . ALA D  4 38  ? 4.805   -8.256  33.634 1.00 54.52  ? 35   ALA D CB    1 
ATOM   2357  N  N     . ILE D  4 39  ? 4.351   -5.569  32.004 1.00 53.05  ? 36   ILE D N     1 
ATOM   2358  C  CA    . ILE D  4 39  ? 4.838   -4.230  31.630 1.00 51.74  ? 36   ILE D CA    1 
ATOM   2359  C  C     . ILE D  4 39  ? 3.769   -3.166  31.876 1.00 51.35  ? 36   ILE D C     1 
ATOM   2360  O  O     . ILE D  4 39  ? 4.087   -2.003  32.149 1.00 51.21  ? 36   ILE D O     1 
ATOM   2361  C  CB    . ILE D  4 39  ? 5.346   -4.148  30.161 1.00 51.51  ? 36   ILE D CB    1 
ATOM   2362  C  CG1   . ILE D  4 39  ? 4.217   -4.400  29.173 1.00 50.74  ? 36   ILE D CG1   1 
ATOM   2363  C  CG2   . ILE D  4 39  ? 6.473   -5.128  29.916 1.00 51.24  ? 36   ILE D CG2   1 
ATOM   2364  C  CD1   . ILE D  4 39  ? 4.564   -4.036  27.777 1.00 51.09  ? 36   ILE D CD1   1 
ATOM   2365  N  N     . TYR D  4 40  ? 2.507   -3.581  31.787 1.00 50.55  ? 37   TYR D N     1 
ATOM   2366  C  CA    . TYR D  4 40  ? 1.390   -2.670  31.933 1.00 49.96  ? 37   TYR D CA    1 
ATOM   2367  C  C     . TYR D  4 40  ? 1.092   -2.489  33.389 1.00 49.66  ? 37   TYR D C     1 
ATOM   2368  O  O     . TYR D  4 40  ? 0.766   -1.403  33.825 1.00 49.79  ? 37   TYR D O     1 
ATOM   2369  C  CB    . TYR D  4 40  ? 0.158   -3.180  31.189 1.00 49.85  ? 37   TYR D CB    1 
ATOM   2370  C  CG    . TYR D  4 40  ? 0.437   -3.469  29.738 1.00 49.82  ? 37   TYR D CG    1 
ATOM   2371  C  CD1   . TYR D  4 40  ? 0.547   -4.775  29.277 1.00 49.32  ? 37   TYR D CD1   1 
ATOM   2372  C  CD2   . TYR D  4 40  ? 0.626   -2.434  28.830 1.00 50.64  ? 37   TYR D CD2   1 
ATOM   2373  C  CE1   . TYR D  4 40  ? 0.812   -5.043  27.942 1.00 49.54  ? 37   TYR D CE1   1 
ATOM   2374  C  CE2   . TYR D  4 40  ? 0.900   -2.693  27.492 1.00 50.57  ? 37   TYR D CE2   1 
ATOM   2375  C  CZ    . TYR D  4 40  ? 0.993   -3.997  27.058 1.00 49.69  ? 37   TYR D CZ    1 
ATOM   2376  O  OH    . TYR D  4 40  ? 1.269   -4.247  25.738 1.00 49.42  ? 37   TYR D OH    1 
ATOM   2377  N  N     . VAL D  4 41  ? 1.205   -3.561  34.152 1.00 49.65  ? 38   VAL D N     1 
ATOM   2378  C  CA    . VAL D  4 41  ? 1.064   -3.450  35.597 1.00 49.51  ? 38   VAL D CA    1 
ATOM   2379  C  C     . VAL D  4 41  ? 2.171   -2.531  36.067 1.00 49.40  ? 38   VAL D C     1 
ATOM   2380  O  O     . VAL D  4 41  ? 1.923   -1.598  36.830 1.00 49.41  ? 38   VAL D O     1 
ATOM   2381  C  CB    . VAL D  4 41  ? 1.130   -4.821  36.312 1.00 49.20  ? 38   VAL D CB    1 
ATOM   2382  C  CG1   . VAL D  4 41  ? 1.193   -4.638  37.806 1.00 49.36  ? 38   VAL D CG1   1 
ATOM   2383  C  CG2   . VAL D  4 41  ? -0.084  -5.619  35.974 1.00 49.05  ? 38   VAL D CG2   1 
ATOM   2384  N  N     . TYR D  4 42  ? 3.377   -2.773  35.566 1.00 49.33  ? 39   TYR D N     1 
ATOM   2385  C  CA    . TYR D  4 42  ? 4.523   -1.977  35.958 1.00 49.77  ? 39   TYR D CA    1 
ATOM   2386  C  C     . TYR D  4 42  ? 4.320   -0.461  35.703 1.00 49.19  ? 39   TYR D C     1 
ATOM   2387  O  O     . TYR D  4 42  ? 4.572   0.369   36.584 1.00 48.35  ? 39   TYR D O     1 
ATOM   2388  C  CB    . TYR D  4 42  ? 5.811   -2.536  35.332 1.00 50.84  ? 39   TYR D CB    1 
ATOM   2389  C  CG    . TYR D  4 42  ? 7.038   -1.882  35.889 1.00 52.38  ? 39   TYR D CG    1 
ATOM   2390  C  CD1   . TYR D  4 42  ? 7.575   -2.287  37.113 1.00 52.76  ? 39   TYR D CD1   1 
ATOM   2391  C  CD2   . TYR D  4 42  ? 7.638   -0.810  35.211 1.00 54.95  ? 39   TYR D CD2   1 
ATOM   2392  C  CE1   . TYR D  4 42  ? 8.700   -1.642  37.654 1.00 54.68  ? 39   TYR D CE1   1 
ATOM   2393  C  CE2   . TYR D  4 42  ? 8.767   -0.154  35.727 1.00 55.72  ? 39   TYR D CE2   1 
ATOM   2394  C  CZ    . TYR D  4 42  ? 9.296   -0.574  36.949 1.00 55.27  ? 39   TYR D CZ    1 
ATOM   2395  O  OH    . TYR D  4 42  ? 10.409  0.085   37.451 1.00 55.04  ? 39   TYR D OH    1 
ATOM   2396  N  N     . LYS D  4 43  ? 3.834   -0.119  34.511 1.00 49.00  ? 40   LYS D N     1 
ATOM   2397  C  CA    . LYS D  4 43  ? 3.513   1.265   34.169 1.00 48.93  ? 40   LYS D CA    1 
ATOM   2398  C  C     . LYS D  4 43  ? 2.640   1.840   35.247 1.00 48.40  ? 40   LYS D C     1 
ATOM   2399  O  O     . LYS D  4 43  ? 3.008   2.800   35.933 1.00 48.95  ? 40   LYS D O     1 
ATOM   2400  C  CB    . LYS D  4 43  ? 2.780   1.348   32.831 1.00 48.63  ? 40   LYS D CB    1 
ATOM   2401  C  CG    . LYS D  4 43  ? 3.705   1.222   31.641 1.00 50.08  ? 40   LYS D CG    1 
ATOM   2402  C  CD    . LYS D  4 43  ? 2.982   1.186   30.295 1.00 49.95  ? 40   LYS D CD    1 
ATOM   2403  C  CE    . LYS D  4 43  ? 4.006   1.008   29.166 1.00 51.81  ? 40   LYS D CE    1 
ATOM   2404  N  NZ    . LYS D  4 43  ? 3.388   0.560   27.878 1.00 53.71  ? 40   LYS D NZ    1 
ATOM   2405  N  N     . VAL D  4 44  ? 1.488   1.209   35.408 1.00 47.78  ? 41   VAL D N     1 
ATOM   2406  C  CA    . VAL D  4 44  ? 0.483   1.645   36.347 1.00 47.10  ? 41   VAL D CA    1 
ATOM   2407  C  C     . VAL D  4 44  ? 1.080   1.772   37.742 1.00 46.81  ? 41   VAL D C     1 
ATOM   2408  O  O     . VAL D  4 44  ? 0.709   2.669   38.500 1.00 46.81  ? 41   VAL D O     1 
ATOM   2409  C  CB    . VAL D  4 44  ? -0.715  0.682   36.334 1.00 47.01  ? 41   VAL D CB    1 
ATOM   2410  C  CG1   . VAL D  4 44  ? -1.760  1.110   37.336 1.00 47.39  ? 41   VAL D CG1   1 
ATOM   2411  C  CG2   . VAL D  4 44  ? -1.330  0.636   34.954 1.00 46.43  ? 41   VAL D CG2   1 
ATOM   2412  N  N     . LEU D  4 45  ? 2.021   0.892   38.069 1.00 46.52  ? 42   LEU D N     1 
ATOM   2413  C  CA    . LEU D  4 45  ? 2.643   0.921   39.388 1.00 46.28  ? 42   LEU D CA    1 
ATOM   2414  C  C     . LEU D  4 45  ? 3.451   2.198   39.552 1.00 46.08  ? 42   LEU D C     1 
ATOM   2415  O  O     . LEU D  4 45  ? 3.362   2.863   40.586 1.00 46.53  ? 42   LEU D O     1 
ATOM   2416  C  CB    . LEU D  4 45  ? 3.524   -0.310  39.631 1.00 46.16  ? 42   LEU D CB    1 
ATOM   2417  C  CG    . LEU D  4 45  ? 4.323   -0.255  40.934 1.00 46.31  ? 42   LEU D CG    1 
ATOM   2418  C  CD1   . LEU D  4 45  ? 3.375   -0.239  42.139 1.00 46.10  ? 42   LEU D CD1   1 
ATOM   2419  C  CD2   . LEU D  4 45  ? 5.353   -1.384  41.036 1.00 46.25  ? 42   LEU D CD2   1 
ATOM   2420  N  N     . LYS D  4 46  ? 4.224   2.554   38.529 1.00 45.52  ? 43   LYS D N     1 
ATOM   2421  C  CA    . LYS D  4 46  ? 5.036   3.763   38.608 1.00 44.91  ? 43   LYS D CA    1 
ATOM   2422  C  C     . LYS D  4 46  ? 4.140   4.989   38.718 1.00 44.38  ? 43   LYS D C     1 
ATOM   2423  O  O     . LYS D  4 46  ? 4.484   5.957   39.393 1.00 44.39  ? 43   LYS D O     1 
ATOM   2424  C  CB    . LYS D  4 46  ? 6.008   3.864   37.429 1.00 45.07  ? 43   LYS D CB    1 
ATOM   2425  C  CG    . LYS D  4 46  ? 6.888   2.611   37.210 1.00 45.62  ? 43   LYS D CG    1 
ATOM   2426  C  CD    . LYS D  4 46  ? 8.065   2.503   38.186 1.00 46.92  ? 43   LYS D CD    1 
ATOM   2427  C  CE    . LYS D  4 46  ? 7.625   2.079   39.590 1.00 47.97  ? 43   LYS D CE    1 
ATOM   2428  N  NZ    . LYS D  4 46  ? 8.741   2.098   40.584 1.00 48.91  ? 43   LYS D NZ    1 
ATOM   2429  N  N     . GLN D  4 47  ? 2.975   4.925   38.082 1.00 43.59  ? 44   GLN D N     1 
ATOM   2430  C  CA    . GLN D  4 47  ? 1.966   5.954   38.247 1.00 43.25  ? 44   GLN D CA    1 
ATOM   2431  C  C     . GLN D  4 47  ? 1.487   6.144   39.695 1.00 43.05  ? 44   GLN D C     1 
ATOM   2432  O  O     . GLN D  4 47  ? 1.345   7.268   40.149 1.00 43.50  ? 44   GLN D O     1 
ATOM   2433  C  CB    . GLN D  4 47  ? 0.768   5.678   37.358 1.00 43.27  ? 44   GLN D CB    1 
ATOM   2434  C  CG    . GLN D  4 47  ? 1.021   5.809   35.872 1.00 43.76  ? 44   GLN D CG    1 
ATOM   2435  C  CD    . GLN D  4 47  ? -0.282  5.845   35.083 1.00 44.85  ? 44   GLN D CD    1 
ATOM   2436  O  OE1   . GLN D  4 47  ? -1.275  5.211   35.467 1.00 45.09  ? 44   GLN D OE1   1 
ATOM   2437  N  NE2   . GLN D  4 47  ? -0.290  6.595   33.984 1.00 44.47  ? 44   GLN D NE2   1 
ATOM   2438  N  N     . VAL D  4 48  ? 1.226   5.078   40.432 1.00 42.69  ? 45   VAL D N     1 
ATOM   2439  C  CA    . VAL D  4 48  ? 0.648   5.281   41.761 1.00 42.76  ? 45   VAL D CA    1 
ATOM   2440  C  C     . VAL D  4 48  ? 1.670   5.379   42.875 1.00 43.05  ? 45   VAL D C     1 
ATOM   2441  O  O     . VAL D  4 48  ? 1.478   6.090   43.858 1.00 43.16  ? 45   VAL D O     1 
ATOM   2442  C  CB    . VAL D  4 48  ? -0.386  4.218   42.115 1.00 42.51  ? 45   VAL D CB    1 
ATOM   2443  C  CG1   . VAL D  4 48  ? -1.591  4.374   41.233 1.00 42.19  ? 45   VAL D CG1   1 
ATOM   2444  C  CG2   . VAL D  4 48  ? 0.208   2.841   41.985 1.00 42.21  ? 45   VAL D CG2   1 
ATOM   2445  N  N     . HIS D  4 49  ? 2.751   4.644   42.733 1.00 43.42  ? 46   HIS D N     1 
ATOM   2446  C  CA    . HIS D  4 49  ? 3.797   4.717   43.707 1.00 44.45  ? 46   HIS D CA    1 
ATOM   2447  C  C     . HIS D  4 49  ? 5.089   4.749   42.931 1.00 45.11  ? 46   HIS D C     1 
ATOM   2448  O  O     . HIS D  4 49  ? 5.643   3.707   42.606 1.00 45.46  ? 46   HIS D O     1 
ATOM   2449  C  CB    . HIS D  4 49  ? 3.738   3.526   44.644 1.00 44.45  ? 46   HIS D CB    1 
ATOM   2450  C  CG    . HIS D  4 49  ? 2.557   3.537   45.556 1.00 44.94  ? 46   HIS D CG    1 
ATOM   2451  N  ND1   . HIS D  4 49  ? 2.347   4.532   46.481 1.00 46.52  ? 46   HIS D ND1   1 
ATOM   2452  C  CD2   . HIS D  4 49  ? 1.525   2.672   45.691 1.00 45.58  ? 46   HIS D CD2   1 
ATOM   2453  C  CE1   . HIS D  4 49  ? 1.232   4.281   47.147 1.00 46.78  ? 46   HIS D CE1   1 
ATOM   2454  N  NE2   . HIS D  4 49  ? 0.713   3.159   46.686 1.00 45.48  ? 46   HIS D NE2   1 
ATOM   2455  N  N     . PRO D  4 50  ? 5.572   5.959   42.614 1.00 45.76  ? 47   PRO D N     1 
ATOM   2456  C  CA    . PRO D  4 50  ? 6.662   6.085   41.658 1.00 45.76  ? 47   PRO D CA    1 
ATOM   2457  C  C     . PRO D  4 50  ? 7.975   5.540   42.171 1.00 45.79  ? 47   PRO D C     1 
ATOM   2458  O  O     . PRO D  4 50  ? 8.821   5.198   41.378 1.00 45.35  ? 47   PRO D O     1 
ATOM   2459  C  CB    . PRO D  4 50  ? 6.740   7.594   41.412 1.00 46.02  ? 47   PRO D CB    1 
ATOM   2460  C  CG    . PRO D  4 50  ? 5.422   8.154   41.946 1.00 46.08  ? 47   PRO D CG    1 
ATOM   2461  C  CD    . PRO D  4 50  ? 5.133   7.277   43.112 1.00 45.99  ? 47   PRO D CD    1 
ATOM   2462  N  N     . ASP D  4 51  ? 8.132   5.420   43.480 1.00 46.53  ? 48   ASP D N     1 
ATOM   2463  C  CA    . ASP D  4 51  ? 9.389   4.907   44.010 1.00 47.49  ? 48   ASP D CA    1 
ATOM   2464  C  C     . ASP D  4 51  ? 9.314   3.489   44.571 1.00 47.43  ? 48   ASP D C     1 
ATOM   2465  O  O     . ASP D  4 51  ? 10.251  3.016   45.229 1.00 47.83  ? 48   ASP D O     1 
ATOM   2466  C  CB    . ASP D  4 51  ? 9.946   5.866   45.053 1.00 48.02  ? 48   ASP D CB    1 
ATOM   2467  C  CG    . ASP D  4 51  ? 10.523  7.124   44.430 1.00 50.39  ? 48   ASP D CG    1 
ATOM   2468  O  OD1   . ASP D  4 51  ? 10.795  7.131   43.196 1.00 51.64  ? 48   ASP D OD1   1 
ATOM   2469  O  OD2   . ASP D  4 51  ? 10.709  8.106   45.190 1.00 53.14  ? 48   ASP D OD2   1 
ATOM   2470  N  N     . THR D  4 52  ? 8.217   2.802   44.281 1.00 46.93  ? 49   THR D N     1 
ATOM   2471  C  CA    . THR D  4 52  ? 8.008   1.462   44.787 1.00 46.19  ? 49   THR D CA    1 
ATOM   2472  C  C     . THR D  4 52  ? 8.249   0.404   43.711 1.00 45.82  ? 49   THR D C     1 
ATOM   2473  O  O     . THR D  4 52  ? 7.817   0.558   42.580 1.00 45.45  ? 49   THR D O     1 
ATOM   2474  C  CB    . THR D  4 52  ? 6.592   1.358   45.324 1.00 46.28  ? 49   THR D CB    1 
ATOM   2475  O  OG1   . THR D  4 52  ? 6.336   2.483   46.179 1.00 46.11  ? 49   THR D OG1   1 
ATOM   2476  C  CG2   . THR D  4 52  ? 6.398   0.073   46.102 1.00 46.47  ? 49   THR D CG2   1 
ATOM   2477  N  N     . GLY D  4 53  ? 8.951   -0.662  44.077 1.00 45.69  ? 50   GLY D N     1 
ATOM   2478  C  CA    . GLY D  4 53  ? 9.118   -1.822  43.204 1.00 45.83  ? 50   GLY D CA    1 
ATOM   2479  C  C     . GLY D  4 53  ? 8.105   -2.931  43.490 1.00 46.10  ? 50   GLY D C     1 
ATOM   2480  O  O     . GLY D  4 53  ? 7.243   -2.793  44.368 1.00 46.36  ? 50   GLY D O     1 
ATOM   2481  N  N     . ILE D  4 54  ? 8.211   -4.037  42.747 1.00 45.77  ? 51   ILE D N     1 
ATOM   2482  C  CA    . ILE D  4 54  ? 7.329   -5.196  42.934 1.00 44.71  ? 51   ILE D CA    1 
ATOM   2483  C  C     . ILE D  4 54  ? 8.061   -6.513  42.667 1.00 44.48  ? 51   ILE D C     1 
ATOM   2484  O  O     . ILE D  4 54  ? 8.657   -6.703  41.610 1.00 44.30  ? 51   ILE D O     1 
ATOM   2485  C  CB    . ILE D  4 54  ? 6.061   -5.080  42.059 1.00 44.84  ? 51   ILE D CB    1 
ATOM   2486  C  CG1   . ILE D  4 54  ? 5.045   -6.189  42.410 1.00 44.76  ? 51   ILE D CG1   1 
ATOM   2487  C  CG2   . ILE D  4 54  ? 6.434   -5.023  40.573 1.00 43.93  ? 51   ILE D CG2   1 
ATOM   2488  C  CD1   . ILE D  4 54  ? 3.697   -6.134  41.616 1.00 44.15  ? 51   ILE D CD1   1 
ATOM   2489  N  N     . SER D  4 55  ? 8.014   -7.407  43.650 1.00 44.15  ? 52   SER D N     1 
ATOM   2490  C  CA    . SER D  4 55  ? 8.624   -8.732  43.567 1.00 43.90  ? 52   SER D CA    1 
ATOM   2491  C  C     . SER D  4 55  ? 7.990   -9.559  42.454 1.00 43.82  ? 52   SER D C     1 
ATOM   2492  O  O     . SER D  4 55  ? 6.808   -9.400  42.167 1.00 43.95  ? 52   SER D O     1 
ATOM   2493  C  CB    . SER D  4 55  ? 8.471   -9.455  44.904 1.00 43.89  ? 52   SER D CB    1 
ATOM   2494  O  OG    . SER D  4 55  ? 7.202   -10.083 45.018 1.00 44.17  ? 52   SER D OG    1 
ATOM   2495  N  N     . SER D  4 56  ? 8.759   -10.451 41.836 1.00 43.65  ? 53   SER D N     1 
ATOM   2496  C  CA    . SER D  4 56  ? 8.241   -11.191 40.687 1.00 43.66  ? 53   SER D CA    1 
ATOM   2497  C  C     . SER D  4 56  ? 7.146   -12.164 41.069 1.00 43.81  ? 53   SER D C     1 
ATOM   2498  O  O     . SER D  4 56  ? 6.319   -12.515 40.218 1.00 44.30  ? 53   SER D O     1 
ATOM   2499  C  CB    . SER D  4 56  ? 9.339   -11.903 39.921 1.00 43.44  ? 53   SER D CB    1 
ATOM   2500  O  OG    . SER D  4 56  ? 10.181  -12.570 40.825 1.00 43.94  ? 53   SER D OG    1 
ATOM   2501  N  N     . LYS D  4 57  ? 7.127   -12.601 42.329 1.00 43.45  ? 54   LYS D N     1 
ATOM   2502  C  CA    . LYS D  4 57  ? 5.996   -13.383 42.810 1.00 43.44  ? 54   LYS D CA    1 
ATOM   2503  C  C     . LYS D  4 57  ? 4.756   -12.506 42.946 1.00 42.88  ? 54   LYS D C     1 
ATOM   2504  O  O     . LYS D  4 57  ? 3.643   -12.933 42.604 1.00 43.11  ? 54   LYS D O     1 
ATOM   2505  C  CB    . LYS D  4 57  ? 6.301   -14.048 44.138 1.00 43.88  ? 54   LYS D CB    1 
ATOM   2506  C  CG    . LYS D  4 57  ? 7.130   -15.290 44.006 1.00 46.86  ? 54   LYS D CG    1 
ATOM   2507  C  CD    . LYS D  4 57  ? 7.361   -15.978 45.356 1.00 50.41  ? 54   LYS D CD    1 
ATOM   2508  C  CE    . LYS D  4 57  ? 8.229   -17.226 45.157 1.00 51.48  ? 54   LYS D CE    1 
ATOM   2509  N  NZ    . LYS D  4 57  ? 8.547   -17.844 46.476 1.00 54.39  ? 54   LYS D NZ    1 
ATOM   2510  N  N     . ALA D  4 58  ? 4.943   -11.280 43.436 1.00 41.71  ? 55   ALA D N     1 
ATOM   2511  C  CA    . ALA D  4 58  ? 3.825   -10.369 43.581 1.00 40.55  ? 55   ALA D CA    1 
ATOM   2512  C  C     . ALA D  4 58  ? 3.305   -10.007 42.209 1.00 39.93  ? 55   ALA D C     1 
ATOM   2513  O  O     . ALA D  4 58  ? 2.107   -9.888  42.023 1.00 39.93  ? 55   ALA D O     1 
ATOM   2514  C  CB    . ALA D  4 58  ? 4.219   -9.141  44.352 1.00 40.64  ? 55   ALA D CB    1 
ATOM   2515  N  N     . MET D  4 59  ? 4.207   -9.861  41.245 1.00 39.33  ? 56   MET D N     1 
ATOM   2516  C  CA    . MET D  4 59  ? 3.818   -9.589  39.865 1.00 38.99  ? 56   MET D CA    1 
ATOM   2517  C  C     . MET D  4 59  ? 3.034   -10.767 39.318 1.00 38.79  ? 56   MET D C     1 
ATOM   2518  O  O     . MET D  4 59  ? 2.091   -10.600 38.538 1.00 38.82  ? 56   MET D O     1 
ATOM   2519  C  CB    . MET D  4 59  ? 5.049   -9.307  38.997 1.00 39.08  ? 56   MET D CB    1 
ATOM   2520  C  CG    . MET D  4 59  ? 4.768   -8.990  37.518 1.00 39.19  ? 56   MET D CG    1 
ATOM   2521  S  SD    . MET D  4 59  ? 3.585   -7.644  37.245 1.00 41.90  ? 56   MET D SD    1 
ATOM   2522  C  CE    . MET D  4 59  ? 4.572   -6.161  37.448 1.00 41.83  ? 56   MET D CE    1 
ATOM   2523  N  N     . SER D  4 60  ? 3.411   -11.964 39.746 1.00 38.30  ? 57   SER D N     1 
ATOM   2524  C  CA    . SER D  4 60  ? 2.703   -13.132 39.299 1.00 38.17  ? 57   SER D CA    1 
ATOM   2525  C  C     . SER D  4 60  ? 1.258   -13.119 39.787 1.00 37.85  ? 57   SER D C     1 
ATOM   2526  O  O     . SER D  4 60  ? 0.346   -13.327 38.984 1.00 37.83  ? 57   SER D O     1 
ATOM   2527  C  CB    . SER D  4 60  ? 3.418   -14.402 39.706 1.00 38.24  ? 57   SER D CB    1 
ATOM   2528  O  OG    . SER D  4 60  ? 2.736   -15.511 39.156 1.00 39.34  ? 57   SER D OG    1 
ATOM   2529  N  N     . ILE D  4 61  ? 1.058   -12.859 41.083 1.00 37.50  ? 58   ILE D N     1 
ATOM   2530  C  CA    . ILE D  4 61  ? -0.293  -12.640 41.646 1.00 37.29  ? 58   ILE D CA    1 
ATOM   2531  C  C     . ILE D  4 61  ? -1.093  -11.609 40.837 1.00 37.67  ? 58   ILE D C     1 
ATOM   2532  O  O     . ILE D  4 61  ? -2.243  -11.847 40.457 1.00 37.68  ? 58   ILE D O     1 
ATOM   2533  C  CB    . ILE D  4 61  ? -0.258  -12.098 43.090 1.00 36.88  ? 58   ILE D CB    1 
ATOM   2534  C  CG1   . ILE D  4 61  ? 0.632   -12.934 44.009 1.00 36.69  ? 58   ILE D CG1   1 
ATOM   2535  C  CG2   . ILE D  4 61  ? -1.666  -11.870 43.621 1.00 35.69  ? 58   ILE D CG2   1 
ATOM   2536  C  CD1   . ILE D  4 61  ? 0.244   -14.341 44.168 1.00 38.32  ? 58   ILE D CD1   1 
ATOM   2537  N  N     . MET D  4 62  ? -0.475  -10.458 40.593 1.00 37.86  ? 59   MET D N     1 
ATOM   2538  C  CA    . MET D  4 62  ? -1.116  -9.408  39.833 1.00 38.24  ? 59   MET D CA    1 
ATOM   2539  C  C     . MET D  4 62  ? -1.531  -9.916  38.471 1.00 38.56  ? 59   MET D C     1 
ATOM   2540  O  O     . MET D  4 62  ? -2.613  -9.602  37.989 1.00 38.33  ? 59   MET D O     1 
ATOM   2541  C  CB    . MET D  4 62  ? -0.199  -8.200  39.691 1.00 38.08  ? 59   MET D CB    1 
ATOM   2542  C  CG    . MET D  4 62  ? -0.068  -7.371  40.959 1.00 38.13  ? 59   MET D CG    1 
ATOM   2543  S  SD    . MET D  4 62  ? -1.638  -6.782  41.626 1.00 37.60  ? 59   MET D SD    1 
ATOM   2544  C  CE    . MET D  4 62  ? -2.283  -5.797  40.298 1.00 36.02  ? 59   MET D CE    1 
ATOM   2545  N  N     . ASN D  4 63  ? -0.682  -10.722 37.854 1.00 39.12  ? 60   ASN D N     1 
ATOM   2546  C  CA    . ASN D  4 63  ? -1.042  -11.222 36.556 1.00 40.09  ? 60   ASN D CA    1 
ATOM   2547  C  C     . ASN D  4 63  ? -2.272  -12.154 36.607 1.00 40.76  ? 60   ASN D C     1 
ATOM   2548  O  O     . ASN D  4 63  ? -3.211  -12.032 35.805 1.00 40.28  ? 60   ASN D O     1 
ATOM   2549  C  CB    . ASN D  4 63  ? 0.144   -11.869 35.863 1.00 39.81  ? 60   ASN D CB    1 
ATOM   2550  C  CG    . ASN D  4 63  ? -0.108  -12.045 34.390 1.00 40.59  ? 60   ASN D CG    1 
ATOM   2551  O  OD1   . ASN D  4 63  ? -0.591  -11.135 33.722 1.00 40.90  ? 60   ASN D OD1   1 
ATOM   2552  N  ND2   . ASN D  4 63  ? 0.177   -13.226 33.879 1.00 41.98  ? 60   ASN D ND2   1 
ATOM   2553  N  N     . SER D  4 64  ? -2.263  -13.066 37.575 1.00 41.51  ? 61   SER D N     1 
ATOM   2554  C  CA    . SER D  4 64  ? -3.377  -13.966 37.788 1.00 42.58  ? 61   SER D CA    1 
ATOM   2555  C  C     . SER D  4 64  ? -4.612  -13.159 38.093 1.00 42.90  ? 61   SER D C     1 
ATOM   2556  O  O     . SER D  4 64  ? -5.708  -13.485 37.610 1.00 43.79  ? 61   SER D O     1 
ATOM   2557  C  CB    . SER D  4 64  ? -3.094  -14.888 38.960 1.00 42.82  ? 61   SER D CB    1 
ATOM   2558  O  OG    . SER D  4 64  ? -1.935  -15.667 38.706 1.00 45.41  ? 61   SER D OG    1 
ATOM   2559  N  N     . PHE D  4 65  ? -4.429  -12.101 38.890 1.00 42.54  ? 62   PHE D N     1 
ATOM   2560  C  CA    . PHE D  4 65  ? -5.524  -11.215 39.255 1.00 41.56  ? 62   PHE D CA    1 
ATOM   2561  C  C     . PHE D  4 65  ? -6.229  -10.710 38.039 1.00 41.29  ? 62   PHE D C     1 
ATOM   2562  O  O     . PHE D  4 65  ? -7.436  -10.831 37.964 1.00 41.55  ? 62   PHE D O     1 
ATOM   2563  C  CB    . PHE D  4 65  ? -5.048  -10.013 40.047 1.00 41.32  ? 62   PHE D CB    1 
ATOM   2564  C  CG    . PHE D  4 65  ? -6.120  -8.981  40.275 1.00 41.18  ? 62   PHE D CG    1 
ATOM   2565  C  CD1   . PHE D  4 65  ? -7.303  -9.312  40.926 1.00 41.54  ? 62   PHE D CD1   1 
ATOM   2566  C  CD2   . PHE D  4 65  ? -5.944  -7.674  39.856 1.00 41.36  ? 62   PHE D CD2   1 
ATOM   2567  C  CE1   . PHE D  4 65  ? -8.293  -8.355  41.138 1.00 40.80  ? 62   PHE D CE1   1 
ATOM   2568  C  CE2   . PHE D  4 65  ? -6.925  -6.715  40.076 1.00 40.84  ? 62   PHE D CE2   1 
ATOM   2569  C  CZ    . PHE D  4 65  ? -8.095  -7.059  40.711 1.00 40.79  ? 62   PHE D CZ    1 
ATOM   2570  N  N     . VAL D  4 66  ? -5.471  -10.150 37.094 1.00 41.01  ? 63   VAL D N     1 
ATOM   2571  C  CA    . VAL D  4 66  ? -6.046  -9.516  35.889 1.00 40.35  ? 63   VAL D CA    1 
ATOM   2572  C  C     . VAL D  4 66  ? -6.751  -10.524 34.980 1.00 40.29  ? 63   VAL D C     1 
ATOM   2573  O  O     . VAL D  4 66  ? -7.843  -10.246 34.511 1.00 40.59  ? 63   VAL D O     1 
ATOM   2574  C  CB    . VAL D  4 66  ? -5.001  -8.710  35.056 1.00 40.14  ? 63   VAL D CB    1 
ATOM   2575  C  CG1   . VAL D  4 66  ? -5.634  -8.154  33.811 1.00 39.35  ? 63   VAL D CG1   1 
ATOM   2576  C  CG2   . VAL D  4 66  ? -4.387  -7.585  35.865 1.00 39.40  ? 63   VAL D CG2   1 
ATOM   2577  N  N     . ASN D  4 67  ? -6.135  -11.680 34.740 1.00 39.85  ? 64   ASN D N     1 
ATOM   2578  C  CA    . ASN D  4 67  ? -6.752  -12.708 33.923 1.00 39.89  ? 64   ASN D CA    1 
ATOM   2579  C  C     . ASN D  4 67  ? -8.039  -13.207 34.538 1.00 39.85  ? 64   ASN D C     1 
ATOM   2580  O  O     . ASN D  4 67  ? -9.037  -13.390 33.843 1.00 39.46  ? 64   ASN D O     1 
ATOM   2581  C  CB    . ASN D  4 67  ? -5.801  -13.875 33.761 1.00 40.27  ? 64   ASN D CB    1 
ATOM   2582  C  CG    . ASN D  4 67  ? -4.537  -13.486 33.045 1.00 41.45  ? 64   ASN D CG    1 
ATOM   2583  O  OD1   . ASN D  4 67  ? -4.583  -13.102 31.879 1.00 43.06  ? 64   ASN D OD1   1 
ATOM   2584  N  ND2   . ASN D  4 67  ? -3.393  -13.576 33.735 1.00 42.35  ? 64   ASN D ND2   1 
ATOM   2585  N  N     . ASP D  4 68  ? -8.001  -13.425 35.852 1.00 40.00  ? 65   ASP D N     1 
ATOM   2586  C  CA    . ASP D  4 68  ? -9.160  -13.883 36.597 1.00 40.14  ? 65   ASP D CA    1 
ATOM   2587  C  C     . ASP D  4 68  ? -10.325 -12.950 36.319 1.00 40.19  ? 65   ASP D C     1 
ATOM   2588  O  O     . ASP D  4 68  ? -11.368 -13.369 35.843 1.00 40.48  ? 65   ASP D O     1 
ATOM   2589  C  CB    . ASP D  4 68  ? -8.852  -13.960 38.097 1.00 40.04  ? 65   ASP D CB    1 
ATOM   2590  C  CG    . ASP D  4 68  ? -10.051 -14.425 38.925 1.00 40.76  ? 65   ASP D CG    1 
ATOM   2591  O  OD1   . ASP D  4 68  ? -10.734 -15.384 38.516 1.00 42.94  ? 65   ASP D OD1   1 
ATOM   2592  O  OD2   . ASP D  4 68  ? -10.312 -13.836 39.994 1.00 39.37  ? 65   ASP D OD2   1 
ATOM   2593  N  N     . VAL D  4 69  ? -10.118 -11.671 36.571 1.00 40.51  ? 66   VAL D N     1 
ATOM   2594  C  CA    . VAL D  4 69  ? -11.172 -10.679 36.417 1.00 40.93  ? 66   VAL D CA    1 
ATOM   2595  C  C     . VAL D  4 69  ? -11.604 -10.483 34.946 1.00 41.32  ? 66   VAL D C     1 
ATOM   2596  O  O     . VAL D  4 69  ? -12.786 -10.263 34.660 1.00 41.07  ? 66   VAL D O     1 
ATOM   2597  C  CB    . VAL D  4 69  ? -10.778 -9.349  37.110 1.00 40.80  ? 66   VAL D CB    1 
ATOM   2598  C  CG1   . VAL D  4 69  ? -11.696 -8.214  36.699 1.00 41.23  ? 66   VAL D CG1   1 
ATOM   2599  C  CG2   . VAL D  4 69  ? -10.809 -9.513  38.616 1.00 40.10  ? 66   VAL D CG2   1 
ATOM   2600  N  N     . PHE D  4 70  ? -10.648 -10.577 34.027 1.00 41.87  ? 67   PHE D N     1 
ATOM   2601  C  CA    . PHE D  4 70  ? -10.949 -10.520 32.610 1.00 42.50  ? 67   PHE D CA    1 
ATOM   2602  C  C     . PHE D  4 70  ? -11.997 -11.581 32.315 1.00 42.97  ? 67   PHE D C     1 
ATOM   2603  O  O     . PHE D  4 70  ? -13.019 -11.291 31.684 1.00 43.32  ? 67   PHE D O     1 
ATOM   2604  C  CB    . PHE D  4 70  ? -9.692  -10.754 31.761 1.00 42.67  ? 67   PHE D CB    1 
ATOM   2605  C  CG    . PHE D  4 70  ? -9.978  -10.991 30.293 1.00 44.11  ? 67   PHE D CG    1 
ATOM   2606  C  CD1   . PHE D  4 70  ? -9.755  -9.988  29.355 1.00 45.60  ? 67   PHE D CD1   1 
ATOM   2607  C  CD2   . PHE D  4 70  ? -10.480 -12.208 29.844 1.00 44.47  ? 67   PHE D CD2   1 
ATOM   2608  C  CE1   . PHE D  4 70  ? -10.022 -10.197 27.998 1.00 44.64  ? 67   PHE D CE1   1 
ATOM   2609  C  CE2   . PHE D  4 70  ? -10.751 -12.414 28.500 1.00 44.68  ? 67   PHE D CE2   1 
ATOM   2610  C  CZ    . PHE D  4 70  ? -10.514 -11.406 27.575 1.00 43.99  ? 67   PHE D CZ    1 
ATOM   2611  N  N     . GLU D  4 71  ? -11.750 -12.803 32.788 1.00 43.18  ? 68   GLU D N     1 
ATOM   2612  C  CA    . GLU D  4 71  ? -12.627 -13.919 32.470 1.00 43.42  ? 68   GLU D CA    1 
ATOM   2613  C  C     . GLU D  4 71  ? -13.980 -13.722 33.097 1.00 42.67  ? 68   GLU D C     1 
ATOM   2614  O  O     . GLU D  4 71  ? -14.994 -13.990 32.468 1.00 42.70  ? 68   GLU D O     1 
ATOM   2615  C  CB    . GLU D  4 71  ? -12.038 -15.245 32.931 1.00 44.00  ? 68   GLU D CB    1 
ATOM   2616  C  CG    . GLU D  4 71  ? -10.857 -15.730 32.106 1.00 47.34  ? 68   GLU D CG    1 
ATOM   2617  C  CD    . GLU D  4 71  ? -9.881  -16.604 32.910 1.00 51.79  ? 68   GLU D CD    1 
ATOM   2618  O  OE1   . GLU D  4 71  ? -8.697  -16.673 32.500 1.00 53.65  ? 68   GLU D OE1   1 
ATOM   2619  O  OE2   . GLU D  4 71  ? -10.285 -17.206 33.945 1.00 52.68  ? 68   GLU D OE2   1 
ATOM   2620  N  N     . ARG D  4 72  ? -14.000 -13.239 34.329 1.00 42.06  ? 69   ARG D N     1 
ATOM   2621  C  CA    . ARG D  4 72  ? -15.263 -13.090 35.029 1.00 42.04  ? 69   ARG D CA    1 
ATOM   2622  C  C     . ARG D  4 72  ? -16.218 -12.113 34.328 1.00 42.43  ? 69   ARG D C     1 
ATOM   2623  O  O     . ARG D  4 72  ? -17.421 -12.392 34.172 1.00 42.51  ? 69   ARG D O     1 
ATOM   2624  C  CB    . ARG D  4 72  ? -15.024 -12.650 36.452 1.00 41.70  ? 69   ARG D CB    1 
ATOM   2625  C  CG    . ARG D  4 72  ? -14.237 -13.624 37.251 1.00 40.46  ? 69   ARG D CG    1 
ATOM   2626  C  CD    . ARG D  4 72  ? -14.712 -13.514 38.641 1.00 38.79  ? 69   ARG D CD    1 
ATOM   2627  N  NE    . ARG D  4 72  ? -13.617 -13.452 39.584 1.00 36.98  ? 69   ARG D NE    1 
ATOM   2628  C  CZ    . ARG D  4 72  ? -13.746 -12.925 40.792 1.00 37.56  ? 69   ARG D CZ    1 
ATOM   2629  N  NH1   . ARG D  4 72  ? -14.901 -12.410 41.157 1.00 36.19  ? 69   ARG D NH1   1 
ATOM   2630  N  NH2   . ARG D  4 72  ? -12.726 -12.894 41.632 1.00 40.09  ? 69   ARG D NH2   1 
ATOM   2631  N  N     . ILE D  4 73  ? -15.664 -10.979 33.901 1.00 42.49  ? 70   ILE D N     1 
ATOM   2632  C  CA    . ILE D  4 73  ? -16.414 -9.965  33.178 1.00 42.21  ? 70   ILE D CA    1 
ATOM   2633  C  C     . ILE D  4 73  ? -16.788 -10.437 31.794 1.00 42.30  ? 70   ILE D C     1 
ATOM   2634  O  O     . ILE D  4 73  ? -17.931 -10.252 31.369 1.00 42.36  ? 70   ILE D O     1 
ATOM   2635  C  CB    . ILE D  4 73  ? -15.642 -8.651  33.065 1.00 42.22  ? 70   ILE D CB    1 
ATOM   2636  C  CG1   . ILE D  4 73  ? -15.415 -8.063  34.469 1.00 42.36  ? 70   ILE D CG1   1 
ATOM   2637  C  CG2   . ILE D  4 73  ? -16.406 -7.679  32.162 1.00 41.63  ? 70   ILE D CG2   1 
ATOM   2638  C  CD1   . ILE D  4 73  ? -14.457 -6.901  34.518 1.00 42.09  ? 70   ILE D CD1   1 
ATOM   2639  N  N     . ALA D  4 74  ? -15.838 -11.046 31.087 1.00 42.35  ? 71   ALA D N     1 
ATOM   2640  C  CA    . ALA D  4 74  ? -16.126 -11.543 29.747 1.00 42.59  ? 71   ALA D CA    1 
ATOM   2641  C  C     . ALA D  4 74  ? -17.187 -12.629 29.848 1.00 43.02  ? 71   ALA D C     1 
ATOM   2642  O  O     . ALA D  4 74  ? -18.092 -12.708 29.022 1.00 43.09  ? 71   ALA D O     1 
ATOM   2643  C  CB    . ALA D  4 74  ? -14.883 -12.050 29.086 1.00 42.29  ? 71   ALA D CB    1 
ATOM   2644  N  N     . GLY D  4 75  ? -17.084 -13.433 30.900 1.00 43.56  ? 72   GLY D N     1 
ATOM   2645  C  CA    . GLY D  4 75  ? -18.023 -14.506 31.152 1.00 44.35  ? 72   GLY D CA    1 
ATOM   2646  C  C     . GLY D  4 75  ? -19.420 -13.966 31.307 1.00 45.08  ? 72   GLY D C     1 
ATOM   2647  O  O     . GLY D  4 75  ? -20.334 -14.412 30.623 1.00 45.05  ? 72   GLY D O     1 
ATOM   2648  N  N     . GLU D  4 76  ? -19.578 -12.992 32.202 1.00 45.94  ? 73   GLU D N     1 
ATOM   2649  C  CA    . GLU D  4 76  ? -20.882 -12.394 32.476 1.00 46.89  ? 73   GLU D CA    1 
ATOM   2650  C  C     . GLU D  4 76  ? -21.475 -11.779 31.215 1.00 47.34  ? 73   GLU D C     1 
ATOM   2651  O  O     . GLU D  4 76  ? -22.684 -11.879 30.957 1.00 47.40  ? 73   GLU D O     1 
ATOM   2652  C  CB    . GLU D  4 76  ? -20.754 -11.335 33.556 1.00 46.72  ? 73   GLU D CB    1 
ATOM   2653  C  CG    . GLU D  4 76  ? -20.364 -11.904 34.895 1.00 49.15  ? 73   GLU D CG    1 
ATOM   2654  C  CD    . GLU D  4 76  ? -21.562 -12.325 35.747 1.00 52.06  ? 73   GLU D CD    1 
ATOM   2655  O  OE1   . GLU D  4 76  ? -22.726 -12.303 35.246 1.00 52.47  ? 73   GLU D OE1   1 
ATOM   2656  O  OE2   . GLU D  4 76  ? -21.323 -12.667 36.931 1.00 52.05  ? 73   GLU D OE2   1 
ATOM   2657  N  N     . ALA D  4 77  ? -20.607 -11.152 30.429 1.00 47.81  ? 74   ALA D N     1 
ATOM   2658  C  CA    . ALA D  4 77  ? -21.017 -10.507 29.205 1.00 48.42  ? 74   ALA D CA    1 
ATOM   2659  C  C     . ALA D  4 77  ? -21.531 -11.573 28.249 1.00 48.92  ? 74   ALA D C     1 
ATOM   2660  O  O     . ALA D  4 77  ? -22.668 -11.504 27.761 1.00 49.11  ? 74   ALA D O     1 
ATOM   2661  C  CB    . ALA D  4 77  ? -19.847 -9.781  28.609 1.00 48.47  ? 74   ALA D CB    1 
ATOM   2662  N  N     . SER D  4 78  ? -20.685 -12.574 28.020 1.00 49.25  ? 75   SER D N     1 
ATOM   2663  C  CA    . SER D  4 78  ? -21.022 -13.720 27.197 1.00 49.47  ? 75   SER D CA    1 
ATOM   2664  C  C     . SER D  4 78  ? -22.439 -14.198 27.486 1.00 49.72  ? 75   SER D C     1 
ATOM   2665  O  O     . SER D  4 78  ? -23.235 -14.368 26.557 1.00 49.83  ? 75   SER D O     1 
ATOM   2666  C  CB    . SER D  4 78  ? -20.004 -14.833 27.424 1.00 49.28  ? 75   SER D CB    1 
ATOM   2667  O  OG    . SER D  4 78  ? -20.287 -15.922 26.586 1.00 49.48  ? 75   SER D OG    1 
ATOM   2668  N  N     . ARG D  4 79  ? -22.740 -14.371 28.776 1.00 50.10  ? 76   ARG D N     1 
ATOM   2669  C  CA    . ARG D  4 79  ? -24.050 -14.813 29.272 1.00 50.74  ? 76   ARG D CA    1 
ATOM   2670  C  C     . ARG D  4 79  ? -25.185 -13.813 29.023 1.00 51.53  ? 76   ARG D C     1 
ATOM   2671  O  O     . ARG D  4 79  ? -26.284 -14.195 28.593 1.00 51.38  ? 76   ARG D O     1 
ATOM   2672  C  CB    . ARG D  4 79  ? -23.961 -15.084 30.769 1.00 50.56  ? 76   ARG D CB    1 
ATOM   2673  C  CG    . ARG D  4 79  ? -24.058 -16.528 31.169 1.00 49.49  ? 76   ARG D CG    1 
ATOM   2674  C  CD    . ARG D  4 79  ? -23.496 -16.702 32.561 1.00 47.12  ? 76   ARG D CD    1 
ATOM   2675  N  NE    . ARG D  4 79  ? -22.096 -17.114 32.497 1.00 46.24  ? 76   ARG D NE    1 
ATOM   2676  C  CZ    . ARG D  4 79  ? -21.135 -16.649 33.287 1.00 45.43  ? 76   ARG D CZ    1 
ATOM   2677  N  NH1   . ARG D  4 79  ? -21.406 -15.731 34.202 1.00 45.54  ? 76   ARG D NH1   1 
ATOM   2678  N  NH2   . ARG D  4 79  ? -19.898 -17.095 33.155 1.00 45.33  ? 76   ARG D NH2   1 
ATOM   2679  N  N     . LEU D  4 80  ? -24.913 -12.544 29.325 1.00 52.41  ? 77   LEU D N     1 
ATOM   2680  C  CA    . LEU D  4 80  ? -25.841 -11.452 29.054 1.00 53.36  ? 77   LEU D CA    1 
ATOM   2681  C  C     . LEU D  4 80  ? -26.291 -11.424 27.601 1.00 54.08  ? 77   LEU D C     1 
ATOM   2682  O  O     . LEU D  4 80  ? -27.498 -11.434 27.310 1.00 54.13  ? 77   LEU D O     1 
ATOM   2683  C  CB    . LEU D  4 80  ? -25.206 -10.105 29.404 1.00 53.30  ? 77   LEU D CB    1 
ATOM   2684  C  CG    . LEU D  4 80  ? -25.646 -9.435  30.705 1.00 53.36  ? 77   LEU D CG    1 
ATOM   2685  C  CD1   . LEU D  4 80  ? -24.807 -8.207  30.930 1.00 53.63  ? 77   LEU D CD1   1 
ATOM   2686  C  CD2   . LEU D  4 80  ? -27.110 -9.062  30.664 1.00 52.69  ? 77   LEU D CD2   1 
ATOM   2687  N  N     . ALA D  4 81  ? -25.316 -11.385 26.694 1.00 54.80  ? 78   ALA D N     1 
ATOM   2688  C  CA    . ALA D  4 81  ? -25.605 -11.386 25.277 1.00 55.78  ? 78   ALA D CA    1 
ATOM   2689  C  C     . ALA D  4 81  ? -26.493 -12.584 24.964 1.00 56.82  ? 78   ALA D C     1 
ATOM   2690  O  O     . ALA D  4 81  ? -27.565 -12.440 24.365 1.00 56.73  ? 78   ALA D O     1 
ATOM   2691  C  CB    . ALA D  4 81  ? -24.326 -11.430 24.481 1.00 55.68  ? 78   ALA D CB    1 
ATOM   2692  N  N     . HIS D  4 82  ? -26.071 -13.764 25.411 1.00 58.07  ? 79   HIS D N     1 
ATOM   2693  C  CA    . HIS D  4 82  ? -26.862 -14.945 25.157 1.00 59.43  ? 79   HIS D CA    1 
ATOM   2694  C  C     . HIS D  4 82  ? -28.260 -14.762 25.693 1.00 59.20  ? 79   HIS D C     1 
ATOM   2695  O  O     . HIS D  4 82  ? -29.205 -14.851 24.932 1.00 59.10  ? 79   HIS D O     1 
ATOM   2696  C  CB    . HIS D  4 82  ? -26.177 -16.224 25.635 1.00 60.14  ? 79   HIS D CB    1 
ATOM   2697  C  CG    . HIS D  4 82  ? -25.138 -16.733 24.674 1.00 64.31  ? 79   HIS D CG    1 
ATOM   2698  N  ND1   . HIS D  4 82  ? -25.412 -16.974 23.335 1.00 67.36  ? 79   HIS D ND1   1 
ATOM   2699  C  CD2   . HIS D  4 82  ? -23.822 -17.031 24.850 1.00 66.73  ? 79   HIS D CD2   1 
ATOM   2700  C  CE1   . HIS D  4 82  ? -24.313 -17.403 22.735 1.00 67.72  ? 79   HIS D CE1   1 
ATOM   2701  N  NE2   . HIS D  4 82  ? -23.335 -17.449 23.631 1.00 67.75  ? 79   HIS D NE2   1 
ATOM   2702  N  N     . TYR D  4 83  ? -28.401 -14.422 26.966 1.00 59.58  ? 80   TYR D N     1 
ATOM   2703  C  CA    . TYR D  4 83  ? -29.742 -14.245 27.525 1.00 60.26  ? 80   TYR D CA    1 
ATOM   2704  C  C     . TYR D  4 83  ? -30.661 -13.382 26.657 1.00 60.58  ? 80   TYR D C     1 
ATOM   2705  O  O     . TYR D  4 83  ? -31.874 -13.599 26.648 1.00 60.88  ? 80   TYR D O     1 
ATOM   2706  C  CB    . TYR D  4 83  ? -29.702 -13.664 28.929 1.00 60.32  ? 80   TYR D CB    1 
ATOM   2707  C  CG    . TYR D  4 83  ? -29.025 -14.531 29.957 1.00 61.31  ? 80   TYR D CG    1 
ATOM   2708  C  CD1   . TYR D  4 83  ? -28.595 -13.978 31.162 1.00 62.25  ? 80   TYR D CD1   1 
ATOM   2709  C  CD2   . TYR D  4 83  ? -28.794 -15.894 29.735 1.00 61.32  ? 80   TYR D CD2   1 
ATOM   2710  C  CE1   . TYR D  4 83  ? -27.968 -14.747 32.128 1.00 61.75  ? 80   TYR D CE1   1 
ATOM   2711  C  CE2   . TYR D  4 83  ? -28.158 -16.672 30.694 1.00 61.26  ? 80   TYR D CE2   1 
ATOM   2712  C  CZ    . TYR D  4 83  ? -27.752 -16.085 31.893 1.00 61.48  ? 80   TYR D CZ    1 
ATOM   2713  O  OH    . TYR D  4 83  ? -27.128 -16.820 32.874 1.00 61.91  ? 80   TYR D OH    1 
ATOM   2714  N  N     . ASN D  4 84  ? -30.085 -12.423 25.930 1.00 60.65  ? 81   ASN D N     1 
ATOM   2715  C  CA    . ASN D  4 84  ? -30.864 -11.476 25.131 1.00 60.64  ? 81   ASN D CA    1 
ATOM   2716  C  C     . ASN D  4 84  ? -30.801 -11.694 23.620 1.00 60.92  ? 81   ASN D C     1 
ATOM   2717  O  O     . ASN D  4 84  ? -31.079 -10.771 22.847 1.00 61.36  ? 81   ASN D O     1 
ATOM   2718  C  CB    . ASN D  4 84  ? -30.423 -10.051 25.443 1.00 60.41  ? 81   ASN D CB    1 
ATOM   2719  C  CG    . ASN D  4 84  ? -30.867 -9.599  26.798 1.00 60.50  ? 81   ASN D CG    1 
ATOM   2720  O  OD1   . ASN D  4 84  ? -32.016 -9.192  26.986 1.00 60.59  ? 81   ASN D OD1   1 
ATOM   2721  N  ND2   . ASN D  4 84  ? -29.956 -9.650  27.763 1.00 60.73  ? 81   ASN D ND2   1 
ATOM   2722  N  N     . LYS D  4 85  ? -30.425 -12.898 23.196 1.00 60.88  ? 82   LYS D N     1 
ATOM   2723  C  CA    . LYS D  4 85  ? -30.292 -13.230 21.767 1.00 60.64  ? 82   LYS D CA    1 
ATOM   2724  C  C     . LYS D  4 85  ? -29.462 -12.209 20.998 1.00 60.23  ? 82   LYS D C     1 
ATOM   2725  O  O     . LYS D  4 85  ? -29.787 -11.888 19.861 1.00 60.36  ? 82   LYS D O     1 
ATOM   2726  C  CB    . LYS D  4 85  ? -31.664 -13.388 21.090 1.00 60.64  ? 82   LYS D CB    1 
ATOM   2727  C  CG    . LYS D  4 85  ? -32.534 -14.507 21.634 1.00 61.75  ? 82   LYS D CG    1 
ATOM   2728  C  CD    . LYS D  4 85  ? -33.453 -13.973 22.734 1.00 65.51  ? 82   LYS D CD    1 
ATOM   2729  C  CE    . LYS D  4 85  ? -34.128 -15.099 23.530 1.00 67.33  ? 82   LYS D CE    1 
ATOM   2730  N  NZ    . LYS D  4 85  ? -35.249 -15.728 22.770 1.00 68.41  ? 82   LYS D NZ    1 
ATOM   2731  N  N     . ARG D  4 86  ? -28.411 -11.689 21.625 1.00 59.75  ? 83   ARG D N     1 
ATOM   2732  C  CA    . ARG D  4 86  ? -27.506 -10.761 20.958 1.00 59.59  ? 83   ARG D CA    1 
ATOM   2733  C  C     . ARG D  4 86  ? -26.222 -11.489 20.587 1.00 58.87  ? 83   ARG D C     1 
ATOM   2734  O  O     . ARG D  4 86  ? -25.600 -12.131 21.427 1.00 58.93  ? 83   ARG D O     1 
ATOM   2735  C  CB    . ARG D  4 86  ? -27.176 -9.567  21.856 1.00 59.97  ? 83   ARG D CB    1 
ATOM   2736  C  CG    . ARG D  4 86  ? -28.351 -8.684  22.235 1.00 61.99  ? 83   ARG D CG    1 
ATOM   2737  C  CD    . ARG D  4 86  ? -28.578 -7.529  21.238 1.00 65.88  ? 83   ARG D CD    1 
ATOM   2738  N  NE    . ARG D  4 86  ? -29.902 -6.915  21.422 1.00 68.22  ? 83   ARG D NE    1 
ATOM   2739  C  CZ    . ARG D  4 86  ? -31.048 -7.426  20.958 1.00 68.41  ? 83   ARG D CZ    1 
ATOM   2740  N  NH1   . ARG D  4 86  ? -31.055 -8.563  20.268 1.00 69.27  ? 83   ARG D NH1   1 
ATOM   2741  N  NH2   . ARG D  4 86  ? -32.197 -6.802  21.183 1.00 68.11  ? 83   ARG D NH2   1 
ATOM   2742  N  N     . SER D  4 87  ? -25.821 -11.388 19.329 1.00 58.11  ? 84   SER D N     1 
ATOM   2743  C  CA    . SER D  4 87  ? -24.639 -12.087 18.875 1.00 57.57  ? 84   SER D CA    1 
ATOM   2744  C  C     . SER D  4 87  ? -23.372 -11.236 19.015 1.00 57.23  ? 84   SER D C     1 
ATOM   2745  O  O     . SER D  4 87  ? -22.262 -11.730 18.804 1.00 57.09  ? 84   SER D O     1 
ATOM   2746  C  CB    . SER D  4 87  ? -24.838 -12.559 17.436 1.00 57.77  ? 84   SER D CB    1 
ATOM   2747  O  OG    . SER D  4 87  ? -25.287 -11.494 16.621 1.00 57.75  ? 84   SER D OG    1 
ATOM   2748  N  N     . THR D  4 88  ? -23.536 -9.966  19.386 1.00 56.73  ? 85   THR D N     1 
ATOM   2749  C  CA    . THR D  4 88  ? -22.393 -9.063  19.617 1.00 56.24  ? 85   THR D CA    1 
ATOM   2750  C  C     . THR D  4 88  ? -22.229 -8.700  21.110 1.00 55.85  ? 85   THR D C     1 
ATOM   2751  O  O     . THR D  4 88  ? -23.209 -8.384  21.784 1.00 56.08  ? 85   THR D O     1 
ATOM   2752  C  CB    . THR D  4 88  ? -22.526 -7.741  18.794 1.00 56.34  ? 85   THR D CB    1 
ATOM   2753  O  OG1   . THR D  4 88  ? -22.885 -8.026  17.433 1.00 56.26  ? 85   THR D OG1   1 
ATOM   2754  C  CG2   . THR D  4 88  ? -21.226 -6.961  18.809 1.00 56.17  ? 85   THR D CG2   1 
ATOM   2755  N  N     . ILE D  4 89  ? -21.002 -8.760  21.630 1.00 55.23  ? 86   ILE D N     1 
ATOM   2756  C  CA    . ILE D  4 89  ? -20.715 -8.186  22.952 1.00 54.55  ? 86   ILE D CA    1 
ATOM   2757  C  C     . ILE D  4 89  ? -20.237 -6.760  22.725 1.00 54.43  ? 86   ILE D C     1 
ATOM   2758  O  O     . ILE D  4 89  ? -19.138 -6.541  22.190 1.00 54.71  ? 86   ILE D O     1 
ATOM   2759  C  CB    . ILE D  4 89  ? -19.607 -8.942  23.744 1.00 54.55  ? 86   ILE D CB    1 
ATOM   2760  C  CG1   . ILE D  4 89  ? -20.118 -10.262 24.328 1.00 54.47  ? 86   ILE D CG1   1 
ATOM   2761  C  CG2   . ILE D  4 89  ? -19.095 -8.076  24.895 1.00 54.33  ? 86   ILE D CG2   1 
ATOM   2762  C  CD1   . ILE D  4 89  ? -19.022 -11.128 24.947 1.00 53.93  ? 86   ILE D CD1   1 
ATOM   2763  N  N     . THR D  4 90  ? -21.050 -5.790  23.117 1.00 53.73  ? 87   THR D N     1 
ATOM   2764  C  CA    . THR D  4 90  ? -20.630 -4.404  23.001 1.00 53.30  ? 87   THR D CA    1 
ATOM   2765  C  C     . THR D  4 90  ? -20.064 -3.924  24.323 1.00 52.76  ? 87   THR D C     1 
ATOM   2766  O  O     . THR D  4 90  ? -19.826 -4.711  25.227 1.00 52.80  ? 87   THR D O     1 
ATOM   2767  C  CB    . THR D  4 90  ? -21.777 -3.483  22.561 1.00 53.52  ? 87   THR D CB    1 
ATOM   2768  O  OG1   . THR D  4 90  ? -22.754 -3.382  23.611 1.00 53.93  ? 87   THR D OG1   1 
ATOM   2769  C  CG2   . THR D  4 90  ? -22.420 -4.002  21.272 1.00 53.76  ? 87   THR D CG2   1 
ATOM   2770  N  N     . SER D  4 91  ? -19.848 -2.625  24.433 1.00 52.29  ? 88   SER D N     1 
ATOM   2771  C  CA    . SER D  4 91  ? -19.372 -2.061  25.668 1.00 52.15  ? 88   SER D CA    1 
ATOM   2772  C  C     . SER D  4 91  ? -20.520 -1.969  26.661 1.00 51.92  ? 88   SER D C     1 
ATOM   2773  O  O     . SER D  4 91  ? -20.303 -1.856  27.865 1.00 51.91  ? 88   SER D O     1 
ATOM   2774  C  CB    . SER D  4 91  ? -18.750 -0.690  25.422 1.00 52.27  ? 88   SER D CB    1 
ATOM   2775  O  OG    . SER D  4 91  ? -19.735 0.243   25.039 1.00 53.01  ? 88   SER D OG    1 
ATOM   2776  N  N     . ARG D  4 92  ? -21.744 -2.021  26.154 1.00 51.81  ? 89   ARG D N     1 
ATOM   2777  C  CA    . ARG D  4 92  ? -22.920 -2.038  27.014 1.00 51.78  ? 89   ARG D CA    1 
ATOM   2778  C  C     . ARG D  4 92  ? -23.029 -3.369  27.806 1.00 51.40  ? 89   ARG D C     1 
ATOM   2779  O  O     . ARG D  4 92  ? -23.408 -3.391  28.989 1.00 51.36  ? 89   ARG D O     1 
ATOM   2780  C  CB    . ARG D  4 92  ? -24.168 -1.753  26.189 1.00 51.84  ? 89   ARG D CB    1 
ATOM   2781  C  CG    . ARG D  4 92  ? -25.228 -1.065  26.980 1.00 53.63  ? 89   ARG D CG    1 
ATOM   2782  C  CD    . ARG D  4 92  ? -26.461 -0.798  26.156 1.00 57.50  ? 89   ARG D CD    1 
ATOM   2783  N  NE    . ARG D  4 92  ? -27.629 -0.685  27.031 1.00 60.71  ? 89   ARG D NE    1 
ATOM   2784  C  CZ    . ARG D  4 92  ? -28.569 -1.624  27.155 1.00 62.01  ? 89   ARG D CZ    1 
ATOM   2785  N  NH1   . ARG D  4 92  ? -28.496 -2.746  26.441 1.00 61.77  ? 89   ARG D NH1   1 
ATOM   2786  N  NH2   . ARG D  4 92  ? -29.595 -1.432  27.983 1.00 62.63  ? 89   ARG D NH2   1 
ATOM   2787  N  N     . GLU D  4 93  ? -22.676 -4.470  27.154 1.00 50.81  ? 90   GLU D N     1 
ATOM   2788  C  CA    . GLU D  4 93  ? -22.556 -5.746  27.833 1.00 50.34  ? 90   GLU D CA    1 
ATOM   2789  C  C     . GLU D  4 93  ? -21.433 -5.696  28.864 1.00 50.00  ? 90   GLU D C     1 
ATOM   2790  O  O     . GLU D  4 93  ? -21.640 -6.058  30.025 1.00 50.44  ? 90   GLU D O     1 
ATOM   2791  C  CB    . GLU D  4 93  ? -22.299 -6.864  26.830 1.00 50.44  ? 90   GLU D CB    1 
ATOM   2792  C  CG    . GLU D  4 93  ? -23.550 -7.390  26.166 1.00 50.96  ? 90   GLU D CG    1 
ATOM   2793  C  CD    . GLU D  4 93  ? -24.217 -6.369  25.274 1.00 51.44  ? 90   GLU D CD    1 
ATOM   2794  O  OE1   . GLU D  4 93  ? -23.519 -5.801  24.407 1.00 51.70  ? 90   GLU D OE1   1 
ATOM   2795  O  OE2   . GLU D  4 93  ? -25.435 -6.145  25.446 1.00 50.77  ? 90   GLU D OE2   1 
ATOM   2796  N  N     . ILE D  4 94  ? -20.252 -5.234  28.456 1.00 49.11  ? 91   ILE D N     1 
ATOM   2797  C  CA    . ILE D  4 94  ? -19.143 -5.098  29.392 1.00 48.39  ? 91   ILE D CA    1 
ATOM   2798  C  C     . ILE D  4 94  ? -19.573 -4.297  30.612 1.00 48.24  ? 91   ILE D C     1 
ATOM   2799  O  O     . ILE D  4 94  ? -19.159 -4.585  31.729 1.00 48.14  ? 91   ILE D O     1 
ATOM   2800  C  CB    . ILE D  4 94  ? -17.903 -4.440  28.754 1.00 48.16  ? 91   ILE D CB    1 
ATOM   2801  C  CG1   . ILE D  4 94  ? -17.442 -5.218  27.509 1.00 47.64  ? 91   ILE D CG1   1 
ATOM   2802  C  CG2   . ILE D  4 94  ? -16.770 -4.314  29.783 1.00 48.01  ? 91   ILE D CG2   1 
ATOM   2803  C  CD1   . ILE D  4 94  ? -16.881 -6.592  27.785 1.00 45.43  ? 91   ILE D CD1   1 
ATOM   2804  N  N     . GLN D  4 95  ? -20.434 -3.309  30.396 1.00 48.19  ? 92   GLN D N     1 
ATOM   2805  C  CA    . GLN D  4 95  ? -20.809 -2.412  31.474 1.00 48.21  ? 92   GLN D CA    1 
ATOM   2806  C  C     . GLN D  4 95  ? -21.694 -3.090  32.507 1.00 48.01  ? 92   GLN D C     1 
ATOM   2807  O  O     . GLN D  4 95  ? -21.400 -3.024  33.706 1.00 48.28  ? 92   GLN D O     1 
ATOM   2808  C  CB    . GLN D  4 95  ? -21.438 -1.106  30.964 1.00 48.16  ? 92   GLN D CB    1 
ATOM   2809  C  CG    . GLN D  4 95  ? -21.878 -0.193  32.115 1.00 49.03  ? 92   GLN D CG    1 
ATOM   2810  C  CD    . GLN D  4 95  ? -22.179 1.229   31.700 1.00 49.19  ? 92   GLN D CD    1 
ATOM   2811  O  OE1   . GLN D  4 95  ? -23.318 1.559   31.375 1.00 50.05  ? 92   GLN D OE1   1 
ATOM   2812  N  NE2   . GLN D  4 95  ? -21.166 2.084   31.729 1.00 48.23  ? 92   GLN D NE2   1 
ATOM   2813  N  N     . THR D  4 96  ? -22.761 -3.742  32.052 1.00 47.60  ? 93   THR D N     1 
ATOM   2814  C  CA    . THR D  4 96  ? -23.652 -4.447  32.966 1.00 47.30  ? 93   THR D CA    1 
ATOM   2815  C  C     . THR D  4 96  ? -22.862 -5.542  33.685 1.00 47.25  ? 93   THR D C     1 
ATOM   2816  O  O     . THR D  4 96  ? -23.010 -5.745  34.892 1.00 47.13  ? 93   THR D O     1 
ATOM   2817  C  CB    . THR D  4 96  ? -24.852 -5.039  32.225 1.00 47.20  ? 93   THR D CB    1 
ATOM   2818  O  OG1   . THR D  4 96  ? -25.453 -4.026  31.427 1.00 47.24  ? 93   THR D OG1   1 
ATOM   2819  C  CG2   . THR D  4 96  ? -25.886 -5.554  33.194 1.00 47.41  ? 93   THR D CG2   1 
ATOM   2820  N  N     . ALA D  4 97  ? -21.999 -6.219  32.933 1.00 47.10  ? 94   ALA D N     1 
ATOM   2821  C  CA    . ALA D  4 97  ? -21.129 -7.238  33.484 1.00 47.00  ? 94   ALA D CA    1 
ATOM   2822  C  C     . ALA D  4 97  ? -20.412 -6.682  34.701 1.00 47.06  ? 94   ALA D C     1 
ATOM   2823  O  O     . ALA D  4 97  ? -20.325 -7.339  35.734 1.00 47.27  ? 94   ALA D O     1 
ATOM   2824  C  CB    . ALA D  4 97  ? -20.132 -7.676  32.443 1.00 46.98  ? 94   ALA D CB    1 
ATOM   2825  N  N     . VAL D  4 98  ? -19.915 -5.459  34.573 1.00 46.99  ? 95   VAL D N     1 
ATOM   2826  C  CA    . VAL D  4 98  ? -19.165 -4.826  35.634 1.00 47.21  ? 95   VAL D CA    1 
ATOM   2827  C  C     . VAL D  4 98  ? -20.059 -4.487  36.820 1.00 47.52  ? 95   VAL D C     1 
ATOM   2828  O  O     . VAL D  4 98  ? -19.628 -4.551  37.968 1.00 47.33  ? 95   VAL D O     1 
ATOM   2829  C  CB    . VAL D  4 98  ? -18.455 -3.569  35.129 1.00 47.24  ? 95   VAL D CB    1 
ATOM   2830  C  CG1   . VAL D  4 98  ? -17.816 -2.818  36.278 1.00 47.44  ? 95   VAL D CG1   1 
ATOM   2831  C  CG2   . VAL D  4 98  ? -17.401 -3.944  34.116 1.00 47.16  ? 95   VAL D CG2   1 
ATOM   2832  N  N     . ARG D  4 99  ? -21.308 -4.144  36.538 1.00 48.14  ? 96   ARG D N     1 
ATOM   2833  C  CA    . ARG D  4 99  ? -22.255 -3.780  37.591 1.00 48.73  ? 96   ARG D CA    1 
ATOM   2834  C  C     . ARG D  4 99  ? -22.726 -4.999  38.337 1.00 48.41  ? 96   ARG D C     1 
ATOM   2835  O  O     . ARG D  4 99  ? -22.935 -4.931  39.544 1.00 48.38  ? 96   ARG D O     1 
ATOM   2836  C  CB    . ARG D  4 99  ? -23.453 -3.013  37.026 1.00 49.17  ? 96   ARG D CB    1 
ATOM   2837  C  CG    . ARG D  4 99  ? -23.137 -1.568  36.659 1.00 51.70  ? 96   ARG D CG    1 
ATOM   2838  C  CD    . ARG D  4 99  ? -24.400 -0.745  36.599 1.00 57.51  ? 96   ARG D CD    1 
ATOM   2839  N  NE    . ARG D  4 99  ? -24.118 0.674   36.379 1.00 61.67  ? 96   ARG D NE    1 
ATOM   2840  C  CZ    . ARG D  4 99  ? -24.467 1.360   35.287 1.00 63.99  ? 96   ARG D CZ    1 
ATOM   2841  N  NH1   . ARG D  4 99  ? -25.123 0.775   34.279 1.00 63.85  ? 96   ARG D NH1   1 
ATOM   2842  N  NH2   . ARG D  4 99  ? -24.158 2.648   35.201 1.00 65.39  ? 96   ARG D NH2   1 
ATOM   2843  N  N     . LEU D  4 100 ? -22.877 -6.107  37.608 1.00 48.36  ? 97   LEU D N     1 
ATOM   2844  C  CA    . LEU D  4 100 ? -23.248 -7.396  38.182 1.00 48.37  ? 97   LEU D CA    1 
ATOM   2845  C  C     . LEU D  4 100 ? -22.143 -8.002  39.032 1.00 48.83  ? 97   LEU D C     1 
ATOM   2846  O  O     . LEU D  4 100 ? -22.436 -8.583  40.084 1.00 49.29  ? 97   LEU D O     1 
ATOM   2847  C  CB    . LEU D  4 100 ? -23.616 -8.387  37.095 1.00 48.01  ? 97   LEU D CB    1 
ATOM   2848  C  CG    . LEU D  4 100 ? -24.958 -8.208  36.398 1.00 48.08  ? 97   LEU D CG    1 
ATOM   2849  C  CD1   . LEU D  4 100 ? -24.944 -9.002  35.098 1.00 47.72  ? 97   LEU D CD1   1 
ATOM   2850  C  CD2   . LEU D  4 100 ? -26.114 -8.631  37.309 1.00 47.74  ? 97   LEU D CD2   1 
ATOM   2851  N  N     . LEU D  4 101 ? -20.887 -7.849  38.595 1.00 48.90  ? 98   LEU D N     1 
ATOM   2852  C  CA    . LEU D  4 101 ? -19.750 -8.504  39.240 1.00 49.09  ? 98   LEU D CA    1 
ATOM   2853  C  C     . LEU D  4 101 ? -19.088 -7.764  40.411 1.00 49.20  ? 98   LEU D C     1 
ATOM   2854  O  O     . LEU D  4 101 ? -18.758 -8.383  41.428 1.00 49.28  ? 98   LEU D O     1 
ATOM   2855  C  CB    . LEU D  4 101 ? -18.690 -8.872  38.211 1.00 49.24  ? 98   LEU D CB    1 
ATOM   2856  C  CG    . LEU D  4 101 ? -17.507 -9.628  38.823 1.00 49.93  ? 98   LEU D CG    1 
ATOM   2857  C  CD1   . LEU D  4 101 ? -17.754 -11.109 38.746 1.00 51.81  ? 98   LEU D CD1   1 
ATOM   2858  C  CD2   . LEU D  4 101 ? -16.214 -9.297  38.124 1.00 51.58  ? 98   LEU D CD2   1 
ATOM   2859  N  N     . LEU D  4 102 ? -18.868 -6.462  40.272 1.00 49.20  ? 99   LEU D N     1 
ATOM   2860  C  CA    . LEU D  4 102 ? -18.113 -5.713  41.288 1.00 49.43  ? 99   LEU D CA    1 
ATOM   2861  C  C     . LEU D  4 102 ? -19.006 -5.108  42.355 1.00 49.94  ? 99   LEU D C     1 
ATOM   2862  O  O     . LEU D  4 102 ? -20.147 -4.796  42.082 1.00 50.40  ? 99   LEU D O     1 
ATOM   2863  C  CB    . LEU D  4 102 ? -17.295 -4.594  40.646 1.00 49.27  ? 99   LEU D CB    1 
ATOM   2864  C  CG    . LEU D  4 102 ? -16.438 -4.851  39.414 1.00 48.37  ? 99   LEU D CG    1 
ATOM   2865  C  CD1   . LEU D  4 102 ? -15.615 -3.620  39.142 1.00 48.16  ? 99   LEU D CD1   1 
ATOM   2866  C  CD2   . LEU D  4 102 ? -15.541 -6.026  39.642 1.00 48.51  ? 99   LEU D CD2   1 
ATOM   2867  N  N     . PRO D  4 103 ? -18.490 -4.936  43.581 1.00 50.60  ? 100  PRO D N     1 
ATOM   2868  C  CA    . PRO D  4 103 ? -19.279 -4.361  44.667 1.00 51.05  ? 100  PRO D CA    1 
ATOM   2869  C  C     . PRO D  4 103 ? -19.384 -2.848  44.606 1.00 51.45  ? 100  PRO D C     1 
ATOM   2870  O  O     . PRO D  4 103 ? -18.477 -2.185  44.116 1.00 51.70  ? 100  PRO D O     1 
ATOM   2871  C  CB    . PRO D  4 103 ? -18.491 -4.758  45.923 1.00 51.10  ? 100  PRO D CB    1 
ATOM   2872  C  CG    . PRO D  4 103 ? -17.416 -5.691  45.463 1.00 50.99  ? 100  PRO D CG    1 
ATOM   2873  C  CD    . PRO D  4 103 ? -17.153 -5.316  44.053 1.00 50.95  ? 100  PRO D CD    1 
ATOM   2874  N  N     . GLY D  4 104 ? -20.488 -2.324  45.131 1.00 51.81  ? 101  GLY D N     1 
ATOM   2875  C  CA    . GLY D  4 104 ? -20.755 -0.894  45.196 1.00 52.43  ? 101  GLY D CA    1 
ATOM   2876  C  C     . GLY D  4 104 ? -19.777 0.080   44.560 1.00 52.97  ? 101  GLY D C     1 
ATOM   2877  O  O     . GLY D  4 104 ? -19.944 0.483   43.401 1.00 53.18  ? 101  GLY D O     1 
ATOM   2878  N  N     . GLU D  4 105 ? -18.764 0.469   45.323 1.00 53.31  ? 102  GLU D N     1 
ATOM   2879  C  CA    . GLU D  4 105 ? -17.915 1.591   44.936 1.00 54.08  ? 102  GLU D CA    1 
ATOM   2880  C  C     . GLU D  4 105 ? -16.972 1.273   43.794 1.00 54.00  ? 102  GLU D C     1 
ATOM   2881  O  O     . GLU D  4 105 ? -16.758 2.117   42.918 1.00 54.45  ? 102  GLU D O     1 
ATOM   2882  C  CB    . GLU D  4 105 ? -17.132 2.130   46.130 1.00 54.40  ? 102  GLU D CB    1 
ATOM   2883  C  CG    . GLU D  4 105 ? -17.959 2.988   47.049 1.00 57.04  ? 102  GLU D CG    1 
ATOM   2884  C  CD    . GLU D  4 105 ? -18.547 4.195   46.334 1.00 60.67  ? 102  GLU D CD    1 
ATOM   2885  O  OE1   . GLU D  4 105 ? -19.785 4.411   46.423 1.00 61.73  ? 102  GLU D OE1   1 
ATOM   2886  O  OE2   . GLU D  4 105 ? -17.764 4.915   45.669 1.00 62.43  ? 102  GLU D OE2   1 
ATOM   2887  N  N     . LEU D  4 106 ? -16.398 0.070   43.810 1.00 53.65  ? 103  LEU D N     1 
ATOM   2888  C  CA    . LEU D  4 106 ? -15.533 -0.368  42.722 1.00 53.23  ? 103  LEU D CA    1 
ATOM   2889  C  C     . LEU D  4 106 ? -16.325 -0.359  41.426 1.00 53.46  ? 103  LEU D C     1 
ATOM   2890  O  O     . LEU D  4 106 ? -15.804 0.013   40.377 1.00 53.37  ? 103  LEU D O     1 
ATOM   2891  C  CB    . LEU D  4 106 ? -14.957 -1.761  42.992 1.00 52.73  ? 103  LEU D CB    1 
ATOM   2892  C  CG    . LEU D  4 106 ? -13.850 -1.903  44.034 1.00 51.37  ? 103  LEU D CG    1 
ATOM   2893  C  CD1   . LEU D  4 106 ? -13.638 -3.361  44.351 1.00 50.02  ? 103  LEU D CD1   1 
ATOM   2894  C  CD2   . LEU D  4 106 ? -12.555 -1.259  43.580 1.00 49.50  ? 103  LEU D CD2   1 
ATOM   2895  N  N     . ALA D  4 107 ? -17.593 -0.747  41.517 1.00 53.85  ? 104  ALA D N     1 
ATOM   2896  C  CA    . ALA D  4 107 ? -18.469 -0.771  40.364 1.00 54.63  ? 104  ALA D CA    1 
ATOM   2897  C  C     . ALA D  4 107 ? -18.649 0.639   39.817 1.00 55.49  ? 104  ALA D C     1 
ATOM   2898  O  O     . ALA D  4 107 ? -18.408 0.885   38.621 1.00 55.56  ? 104  ALA D O     1 
ATOM   2899  C  CB    . ALA D  4 107 ? -19.797 -1.384  40.721 1.00 54.37  ? 104  ALA D CB    1 
ATOM   2900  N  N     . LYS D  4 108 ? -19.041 1.565   40.699 1.00 56.16  ? 105  LYS D N     1 
ATOM   2901  C  CA    . LYS D  4 108 ? -19.289 2.956   40.302 1.00 56.91  ? 105  LYS D CA    1 
ATOM   2902  C  C     . LYS D  4 108 ? -18.097 3.571   39.597 1.00 56.36  ? 105  LYS D C     1 
ATOM   2903  O  O     . LYS D  4 108 ? -18.258 4.163   38.533 1.00 56.68  ? 105  LYS D O     1 
ATOM   2904  C  CB    . LYS D  4 108 ? -19.694 3.828   41.491 1.00 57.04  ? 105  LYS D CB    1 
ATOM   2905  C  CG    . LYS D  4 108 ? -21.108 3.570   42.011 1.00 58.41  ? 105  LYS D CG    1 
ATOM   2906  C  CD    . LYS D  4 108 ? -21.523 4.646   43.047 1.00 58.68  ? 105  LYS D CD    1 
ATOM   2907  C  CE    . LYS D  4 108 ? -22.469 4.073   44.131 1.00 61.64  ? 105  LYS D CE    1 
ATOM   2908  N  NZ    . LYS D  4 108 ? -23.587 3.229   43.558 1.00 63.21  ? 105  LYS D NZ    1 
ATOM   2909  N  N     . HIS D  4 109 ? -16.912 3.425   40.182 1.00 55.87  ? 106  HIS D N     1 
ATOM   2910  C  CA    . HIS D  4 109 ? -15.705 3.950   39.568 1.00 55.82  ? 106  HIS D CA    1 
ATOM   2911  C  C     . HIS D  4 109 ? -15.356 3.221   38.284 1.00 55.15  ? 106  HIS D C     1 
ATOM   2912  O  O     . HIS D  4 109 ? -15.043 3.854   37.282 1.00 55.07  ? 106  HIS D O     1 
ATOM   2913  C  CB    . HIS D  4 109 ? -14.516 3.890   40.522 1.00 56.30  ? 106  HIS D CB    1 
ATOM   2914  C  CG    . HIS D  4 109 ? -14.595 4.855   41.665 1.00 58.64  ? 106  HIS D CG    1 
ATOM   2915  N  ND1   . HIS D  4 109 ? -14.737 6.217   41.485 1.00 61.02  ? 106  HIS D ND1   1 
ATOM   2916  C  CD2   . HIS D  4 109 ? -14.525 4.658   43.005 1.00 60.19  ? 106  HIS D CD2   1 
ATOM   2917  C  CE1   . HIS D  4 109 ? -14.773 6.813   42.665 1.00 61.57  ? 106  HIS D CE1   1 
ATOM   2918  N  NE2   . HIS D  4 109 ? -14.643 5.890   43.604 1.00 61.28  ? 106  HIS D NE2   1 
ATOM   2919  N  N     . ALA D  4 110 ? -15.400 1.892   38.304 1.00 54.58  ? 107  ALA D N     1 
ATOM   2920  C  CA    . ALA D  4 110 ? -15.068 1.128   37.104 1.00 54.00  ? 107  ALA D CA    1 
ATOM   2921  C  C     . ALA D  4 110 ? -15.931 1.592   35.930 1.00 53.66  ? 107  ALA D C     1 
ATOM   2922  O  O     . ALA D  4 110 ? -15.406 1.969   34.887 1.00 53.24  ? 107  ALA D O     1 
ATOM   2923  C  CB    . ALA D  4 110 ? -15.211 -0.356  37.343 1.00 53.82  ? 107  ALA D CB    1 
ATOM   2924  N  N     . VAL D  4 111 ? -17.250 1.603   36.128 1.00 53.39  ? 108  VAL D N     1 
ATOM   2925  C  CA    . VAL D  4 111 ? -18.188 2.115   35.131 1.00 53.23  ? 108  VAL D CA    1 
ATOM   2926  C  C     . VAL D  4 111 ? -17.736 3.463   34.599 1.00 53.20  ? 108  VAL D C     1 
ATOM   2927  O  O     . VAL D  4 111 ? -17.571 3.659   33.399 1.00 53.22  ? 108  VAL D O     1 
ATOM   2928  C  CB    . VAL D  4 111 ? -19.583 2.259   35.723 1.00 53.10  ? 108  VAL D CB    1 
ATOM   2929  C  CG1   . VAL D  4 111 ? -20.438 3.144   34.860 1.00 53.45  ? 108  VAL D CG1   1 
ATOM   2930  C  CG2   . VAL D  4 111 ? -20.225 0.906   35.848 1.00 53.74  ? 108  VAL D CG2   1 
ATOM   2931  N  N     . SER D  4 112 ? -17.521 4.381   35.525 1.00 53.38  ? 109  SER D N     1 
ATOM   2932  C  CA    . SER D  4 112 ? -17.047 5.714   35.228 1.00 53.55  ? 109  SER D CA    1 
ATOM   2933  C  C     . SER D  4 112 ? -15.803 5.750   34.320 1.00 53.23  ? 109  SER D C     1 
ATOM   2934  O  O     . SER D  4 112 ? -15.846 6.333   33.243 1.00 53.29  ? 109  SER D O     1 
ATOM   2935  C  CB    . SER D  4 112 ? -16.803 6.443   36.543 1.00 53.37  ? 109  SER D CB    1 
ATOM   2936  O  OG    . SER D  4 112 ? -16.142 7.657   36.305 1.00 55.47  ? 109  SER D OG    1 
ATOM   2937  N  N     . GLU D  4 113 ? -14.718 5.115   34.748 1.00 53.16  ? 110  GLU D N     1 
ATOM   2938  C  CA    . GLU D  4 113 ? -13.475 5.067   33.978 1.00 53.36  ? 110  GLU D CA    1 
ATOM   2939  C  C     . GLU D  4 113 ? -13.652 4.388   32.612 1.00 53.29  ? 110  GLU D C     1 
ATOM   2940  O  O     . GLU D  4 113 ? -12.912 4.632   31.661 1.00 53.13  ? 110  GLU D O     1 
ATOM   2941  C  CB    . GLU D  4 113 ? -12.413 4.314   34.777 1.00 53.35  ? 110  GLU D CB    1 
ATOM   2942  C  CG    . GLU D  4 113 ? -11.917 5.033   36.023 1.00 54.42  ? 110  GLU D CG    1 
ATOM   2943  C  CD    . GLU D  4 113 ? -10.497 5.560   35.874 1.00 56.85  ? 110  GLU D CD    1 
ATOM   2944  O  OE1   . GLU D  4 113 ? -10.283 6.468   35.038 1.00 58.93  ? 110  GLU D OE1   1 
ATOM   2945  O  OE2   . GLU D  4 113 ? -9.588  5.076   36.592 1.00 56.95  ? 110  GLU D OE2   1 
ATOM   2946  N  N     . GLY D  4 114 ? -14.637 3.517   32.527 1.00 53.48  ? 111  GLY D N     1 
ATOM   2947  C  CA    . GLY D  4 114 ? -14.838 2.751   31.322 1.00 53.98  ? 111  GLY D CA    1 
ATOM   2948  C  C     . GLY D  4 114 ? -15.522 3.621   30.312 1.00 54.33  ? 111  GLY D C     1 
ATOM   2949  O  O     . GLY D  4 114 ? -15.066 3.736   29.185 1.00 54.58  ? 111  GLY D O     1 
ATOM   2950  N  N     . THR D  4 115 ? -16.622 4.238   30.731 1.00 54.72  ? 112  THR D N     1 
ATOM   2951  C  CA    . THR D  4 115 ? -17.375 5.148   29.877 1.00 55.05  ? 112  THR D CA    1 
ATOM   2952  C  C     . THR D  4 115 ? -16.474 6.257   29.349 1.00 55.50  ? 112  THR D C     1 
ATOM   2953  O  O     . THR D  4 115 ? -16.470 6.546   28.153 1.00 55.40  ? 112  THR D O     1 
ATOM   2954  C  CB    . THR D  4 115 ? -18.518 5.810   30.641 1.00 54.84  ? 112  THR D CB    1 
ATOM   2955  O  OG1   . THR D  4 115 ? -19.200 4.834   31.433 1.00 54.29  ? 112  THR D OG1   1 
ATOM   2956  C  CG2   . THR D  4 115 ? -19.483 6.449   29.664 1.00 55.12  ? 112  THR D CG2   1 
ATOM   2957  N  N     . LYS D  4 116 ? -15.717 6.865   30.261 1.00 56.08  ? 113  LYS D N     1 
ATOM   2958  C  CA    . LYS D  4 116 ? -14.795 7.933   29.925 1.00 56.87  ? 113  LYS D CA    1 
ATOM   2959  C  C     . LYS D  4 116 ? -13.886 7.474   28.799 1.00 57.29  ? 113  LYS D C     1 
ATOM   2960  O  O     . LYS D  4 116 ? -13.843 8.102   27.746 1.00 57.76  ? 113  LYS D O     1 
ATOM   2961  C  CB    . LYS D  4 116 ? -13.966 8.363   31.147 1.00 56.58  ? 113  LYS D CB    1 
ATOM   2962  C  CG    . LYS D  4 116 ? -12.864 9.370   30.821 1.00 56.75  ? 113  LYS D CG    1 
ATOM   2963  C  CD    . LYS D  4 116 ? -11.796 9.494   31.914 1.00 57.63  ? 113  LYS D CD    1 
ATOM   2964  C  CE    . LYS D  4 116 ? -12.339 10.065  33.242 1.00 59.71  ? 113  LYS D CE    1 
ATOM   2965  N  NZ    . LYS D  4 116 ? -13.225 11.262  33.061 1.00 61.09  ? 113  LYS D NZ    1 
ATOM   2966  N  N     . ALA D  4 117 ? -13.187 6.367   29.017 1.00 57.72  ? 114  ALA D N     1 
ATOM   2967  C  CA    . ALA D  4 117 ? -12.199 5.888   28.072 1.00 58.13  ? 114  ALA D CA    1 
ATOM   2968  C  C     . ALA D  4 117 ? -12.800 5.585   26.684 1.00 58.42  ? 114  ALA D C     1 
ATOM   2969  O  O     . ALA D  4 117 ? -12.148 5.792   25.656 1.00 58.55  ? 114  ALA D O     1 
ATOM   2970  C  CB    . ALA D  4 117 ? -11.491 4.677   28.645 1.00 58.35  ? 114  ALA D CB    1 
ATOM   2971  N  N     . VAL D  4 118 ? -14.041 5.114   26.659 1.00 58.65  ? 115  VAL D N     1 
ATOM   2972  C  CA    . VAL D  4 118 ? -14.729 4.824   25.405 1.00 59.16  ? 115  VAL D CA    1 
ATOM   2973  C  C     . VAL D  4 118 ? -15.048 6.112   24.674 1.00 59.61  ? 115  VAL D C     1 
ATOM   2974  O  O     . VAL D  4 118 ? -14.725 6.260   23.490 1.00 59.83  ? 115  VAL D O     1 
ATOM   2975  C  CB    . VAL D  4 118 ? -16.030 4.022   25.640 1.00 59.33  ? 115  VAL D CB    1 
ATOM   2976  C  CG1   . VAL D  4 118 ? -16.908 3.982   24.377 1.00 58.50  ? 115  VAL D CG1   1 
ATOM   2977  C  CG2   . VAL D  4 118 ? -15.697 2.604   26.124 1.00 59.73  ? 115  VAL D CG2   1 
ATOM   2978  N  N     . THR D  4 119 ? -15.688 7.035   25.389 1.00 59.97  ? 116  THR D N     1 
ATOM   2979  C  CA    . THR D  4 119 ? -15.976 8.363   24.877 1.00 60.38  ? 116  THR D CA    1 
ATOM   2980  C  C     . THR D  4 119 ? -14.739 8.959   24.230 1.00 60.70  ? 116  THR D C     1 
ATOM   2981  O  O     . THR D  4 119 ? -14.786 9.338   23.075 1.00 60.91  ? 116  THR D O     1 
ATOM   2982  C  CB    . THR D  4 119 ? -16.456 9.286   25.981 1.00 60.26  ? 116  THR D CB    1 
ATOM   2983  O  OG1   . THR D  4 119 ? -17.531 8.657   26.684 1.00 61.23  ? 116  THR D OG1   1 
ATOM   2984  C  CG2   . THR D  4 119 ? -16.956 10.572  25.397 1.00 60.88  ? 116  THR D CG2   1 
ATOM   2985  N  N     . LYS D  4 120 ? -13.631 9.018   24.963 1.00 61.37  ? 117  LYS D N     1 
ATOM   2986  C  CA    . LYS D  4 120 ? -12.373 9.487   24.398 1.00 62.03  ? 117  LYS D CA    1 
ATOM   2987  C  C     . LYS D  4 120 ? -12.045 8.760   23.099 1.00 62.69  ? 117  LYS D C     1 
ATOM   2988  O  O     . LYS D  4 120 ? -11.800 9.406   22.079 1.00 62.92  ? 117  LYS D O     1 
ATOM   2989  C  CB    . LYS D  4 120 ? -11.213 9.347   25.387 1.00 61.81  ? 117  LYS D CB    1 
ATOM   2990  C  CG    . LYS D  4 120 ? -9.977  10.125  24.955 1.00 61.88  ? 117  LYS D CG    1 
ATOM   2991  C  CD    . LYS D  4 120 ? -8.720  9.736   25.725 1.00 62.11  ? 117  LYS D CD    1 
ATOM   2992  C  CE    . LYS D  4 120 ? -7.426  10.219  25.031 1.00 61.98  ? 117  LYS D CE    1 
ATOM   2993  N  NZ    . LYS D  4 120 ? -6.978  11.605  25.408 1.00 60.89  ? 117  LYS D NZ    1 
ATOM   2994  N  N     . TYR D  4 121 ? -12.058 7.428   23.137 1.00 63.68  ? 118  TYR D N     1 
ATOM   2995  C  CA    . TYR D  4 121 ? -11.688 6.591   21.982 1.00 64.66  ? 118  TYR D CA    1 
ATOM   2996  C  C     . TYR D  4 121 ? -12.479 6.905   20.717 1.00 65.65  ? 118  TYR D C     1 
ATOM   2997  O  O     . TYR D  4 121 ? -11.904 7.014   19.626 1.00 65.72  ? 118  TYR D O     1 
ATOM   2998  C  CB    . TYR D  4 121 ? -11.857 5.116   22.327 1.00 64.37  ? 118  TYR D CB    1 
ATOM   2999  C  CG    . TYR D  4 121 ? -11.615 4.152   21.180 1.00 64.21  ? 118  TYR D CG    1 
ATOM   3000  C  CD1   . TYR D  4 121 ? -10.317 3.697   20.878 1.00 64.18  ? 118  TYR D CD1   1 
ATOM   3001  C  CD2   . TYR D  4 121 ? -12.682 3.664   20.415 1.00 63.54  ? 118  TYR D CD2   1 
ATOM   3002  C  CE1   . TYR D  4 121 ? -10.089 2.794   19.827 1.00 63.71  ? 118  TYR D CE1   1 
ATOM   3003  C  CE2   . TYR D  4 121 ? -12.466 2.765   19.366 1.00 63.43  ? 118  TYR D CE2   1 
ATOM   3004  C  CZ    . TYR D  4 121 ? -11.171 2.336   19.078 1.00 63.87  ? 118  TYR D CZ    1 
ATOM   3005  O  OH    . TYR D  4 121 ? -10.970 1.451   18.045 1.00 63.86  ? 118  TYR D OH    1 
ATOM   3006  N  N     . THR D  4 122 ? -13.795 7.034   20.870 1.00 66.93  ? 119  THR D N     1 
ATOM   3007  C  CA    . THR D  4 122 ? -14.682 7.281   19.740 1.00 68.15  ? 119  THR D CA    1 
ATOM   3008  C  C     . THR D  4 122 ? -14.654 8.730   19.284 1.00 69.21  ? 119  THR D C     1 
ATOM   3009  O  O     . THR D  4 122 ? -15.003 9.010   18.143 1.00 69.78  ? 119  THR D O     1 
ATOM   3010  C  CB    . THR D  4 122 ? -16.140 6.901   20.048 1.00 68.01  ? 119  THR D CB    1 
ATOM   3011  O  OG1   . THR D  4 122 ? -16.626 7.725   21.109 1.00 68.29  ? 119  THR D OG1   1 
ATOM   3012  C  CG2   . THR D  4 122 ? -16.256 5.437   20.444 1.00 67.83  ? 119  THR D CG2   1 
ATOM   3013  N  N     . SER D  4 123 ? -14.249 9.647   20.168 1.00 70.56  ? 120  SER D N     1 
ATOM   3014  C  CA    . SER D  4 123 ? -14.185 11.076  19.832 1.00 71.64  ? 120  SER D CA    1 
ATOM   3015  C  C     . SER D  4 123 ? -13.020 11.368  18.890 1.00 72.72  ? 120  SER D C     1 
ATOM   3016  O  O     . SER D  4 123 ? -13.031 12.375  18.178 1.00 73.00  ? 120  SER D O     1 
ATOM   3017  C  CB    . SER D  4 123 ? -14.097 11.951  21.081 1.00 71.23  ? 120  SER D CB    1 
ATOM   3018  O  OG    . SER D  4 123 ? -12.763 12.025  21.539 1.00 71.40  ? 120  SER D OG    1 
ATOM   3019  N  N     . ALA D  4 124 ? -12.026 10.484  18.882 1.00 74.05  ? 121  ALA D N     1 
ATOM   3020  C  CA    . ALA D  4 124 ? -10.951 10.546  17.889 1.00 75.88  ? 121  ALA D CA    1 
ATOM   3021  C  C     . ALA D  4 124 ? -11.440 10.278  16.439 1.00 76.49  ? 121  ALA D C     1 
ATOM   3022  O  O     . ALA D  4 124 ? -12.431 9.556   16.229 1.00 76.82  ? 121  ALA D O     1 
ATOM   3023  C  CB    . ALA D  4 124 ? -9.822  9.597   18.268 1.00 75.20  ? 121  ALA D CB    1 
ATOM   3024  N  N     . LYS D  4 125 ? -10.756 10.900  15.463 1.00 77.35  ? 122  LYS D N     1 
ATOM   3025  C  CA    . LYS D  4 125 ? -10.898 10.638  13.992 1.00 77.85  ? 122  LYS D CA    1 
ATOM   3026  C  C     . LYS D  4 125 ? -11.701 11.687  13.159 1.00 78.43  ? 122  LYS D C     1 
ATOM   3027  O  O     . LYS D  4 125 ? -12.647 12.351  13.630 1.00 78.81  ? 122  LYS D O     1 
ATOM   3028  C  CB    . LYS D  4 125 ? -11.302 9.175   13.666 1.00 78.03  ? 122  LYS D CB    1 
ATOM   3029  C  CG    . LYS D  4 125 ? -10.179 8.157   13.923 1.00 78.18  ? 122  LYS D CG    1 
ATOM   3030  C  CD    . LYS D  4 125 ? -10.336 6.903   13.060 1.00 78.38  ? 122  LYS D CD    1 
ATOM   3031  C  CE    . LYS D  4 125 ? -9.086  5.999   13.164 1.00 78.84  ? 122  LYS D CE    1 
ATOM   3032  N  NZ    . LYS D  4 125 ? -9.285  4.694   12.448 1.00 78.72  ? 122  LYS D NZ    1 
ATOM   3033  O  OXT   . LYS D  4 125 ? -11.405 11.909  11.969 1.00 78.53  ? 122  LYS D OXT   1 
ATOM   3034  N  N     . LYS E  1 37  ? 12.370  -22.968 91.139 1.00 82.91  ? 37   LYS E N     1 
ATOM   3035  C  CA    . LYS E  1 37  ? 12.794  -21.596 90.724 1.00 82.82  ? 37   LYS E CA    1 
ATOM   3036  C  C     . LYS E  1 37  ? 12.671  -21.332 89.210 1.00 82.33  ? 37   LYS E C     1 
ATOM   3037  O  O     . LYS E  1 37  ? 12.083  -20.306 88.826 1.00 82.30  ? 37   LYS E O     1 
ATOM   3038  C  CB    . LYS E  1 37  ? 14.213  -21.252 91.241 1.00 83.02  ? 37   LYS E CB    1 
ATOM   3039  C  CG    . LYS E  1 37  ? 14.235  -20.589 92.626 1.00 83.68  ? 37   LYS E CG    1 
ATOM   3040  C  CD    . LYS E  1 37  ? 13.494  -19.243 92.616 1.00 85.25  ? 37   LYS E CD    1 
ATOM   3041  C  CE    . LYS E  1 37  ? 12.780  -18.990 93.955 1.00 87.17  ? 37   LYS E CE    1 
ATOM   3042  N  NZ    . LYS E  1 37  ? 11.515  -18.172 93.825 1.00 87.19  ? 37   LYS E NZ    1 
ATOM   3043  N  N     . PRO E  1 38  ? 13.198  -22.255 88.351 1.00 81.64  ? 38   PRO E N     1 
ATOM   3044  C  CA    . PRO E  1 38  ? 13.282  -21.971 86.901 1.00 80.80  ? 38   PRO E CA    1 
ATOM   3045  C  C     . PRO E  1 38  ? 12.021  -21.298 86.362 1.00 79.94  ? 38   PRO E C     1 
ATOM   3046  O  O     . PRO E  1 38  ? 10.901  -21.713 86.681 1.00 80.02  ? 38   PRO E O     1 
ATOM   3047  C  CB    . PRO E  1 38  ? 13.451  -23.356 86.271 1.00 80.81  ? 38   PRO E CB    1 
ATOM   3048  C  CG    . PRO E  1 38  ? 14.077  -24.190 87.329 1.00 81.23  ? 38   PRO E CG    1 
ATOM   3049  C  CD    . PRO E  1 38  ? 13.715  -23.604 88.675 1.00 81.47  ? 38   PRO E CD    1 
ATOM   3050  N  N     . HIS E  1 39  ? 12.213  -20.250 85.570 1.00 78.83  ? 39   HIS E N     1 
ATOM   3051  C  CA    . HIS E  1 39  ? 11.110  -19.478 85.002 1.00 77.58  ? 39   HIS E CA    1 
ATOM   3052  C  C     . HIS E  1 39  ? 10.137  -20.387 84.245 1.00 75.75  ? 39   HIS E C     1 
ATOM   3053  O  O     . HIS E  1 39  ? 10.567  -21.335 83.569 1.00 75.87  ? 39   HIS E O     1 
ATOM   3054  C  CB    . HIS E  1 39  ? 11.683  -18.414 84.064 1.00 78.37  ? 39   HIS E CB    1 
ATOM   3055  C  CG    . HIS E  1 39  ? 10.713  -17.335 83.699 1.00 80.89  ? 39   HIS E CG    1 
ATOM   3056  N  ND1   . HIS E  1 39  ? 10.077  -17.290 82.471 1.00 82.99  ? 39   HIS E ND1   1 
ATOM   3057  C  CD2   . HIS E  1 39  ? 10.278  -16.253 84.396 1.00 82.82  ? 39   HIS E CD2   1 
ATOM   3058  C  CE1   . HIS E  1 39  ? 9.293   -16.224 82.428 1.00 83.90  ? 39   HIS E CE1   1 
ATOM   3059  N  NE2   . HIS E  1 39  ? 9.395   -15.579 83.583 1.00 83.82  ? 39   HIS E NE2   1 
ATOM   3060  N  N     . ARG E  1 40  ? 8.836   -20.114 84.383 1.00 73.15  ? 40   ARG E N     1 
ATOM   3061  C  CA    . ARG E  1 40  ? 7.791   -20.850 83.651 1.00 70.24  ? 40   ARG E CA    1 
ATOM   3062  C  C     . ARG E  1 40  ? 6.688   -19.906 83.198 1.00 68.53  ? 40   ARG E C     1 
ATOM   3063  O  O     . ARG E  1 40  ? 6.023   -19.278 84.035 1.00 68.50  ? 40   ARG E O     1 
ATOM   3064  C  CB    . ARG E  1 40  ? 7.168   -21.961 84.518 1.00 70.33  ? 40   ARG E CB    1 
ATOM   3065  C  CG    . ARG E  1 40  ? 7.764   -23.352 84.326 1.00 69.81  ? 40   ARG E CG    1 
ATOM   3066  C  CD    . ARG E  1 40  ? 6.853   -24.475 84.869 1.00 69.42  ? 40   ARG E CD    1 
ATOM   3067  N  NE    . ARG E  1 40  ? 6.038   -25.113 83.828 1.00 68.02  ? 40   ARG E NE    1 
ATOM   3068  C  CZ    . ARG E  1 40  ? 6.462   -26.061 82.981 1.00 67.08  ? 40   ARG E CZ    1 
ATOM   3069  N  NH1   . ARG E  1 40  ? 7.709   -26.519 83.011 1.00 65.80  ? 40   ARG E NH1   1 
ATOM   3070  N  NH2   . ARG E  1 40  ? 5.623   -26.556 82.085 1.00 66.30  ? 40   ARG E NH2   1 
ATOM   3071  N  N     . TYR E  1 41  ? 6.474   -19.805 81.889 1.00 65.91  ? 41   TYR E N     1 
ATOM   3072  C  CA    . TYR E  1 41  ? 5.302   -19.077 81.415 1.00 63.46  ? 41   TYR E CA    1 
ATOM   3073  C  C     . TYR E  1 41  ? 4.056   -19.867 81.756 1.00 62.48  ? 41   TYR E C     1 
ATOM   3074  O  O     . TYR E  1 41  ? 4.078   -21.093 81.789 1.00 62.52  ? 41   TYR E O     1 
ATOM   3075  C  CB    . TYR E  1 41  ? 5.386   -18.753 79.926 1.00 62.64  ? 41   TYR E CB    1 
ATOM   3076  C  CG    . TYR E  1 41  ? 6.446   -17.728 79.623 1.00 61.32  ? 41   TYR E CG    1 
ATOM   3077  C  CD1   . TYR E  1 41  ? 7.625   -18.096 79.000 1.00 60.78  ? 41   TYR E CD1   1 
ATOM   3078  C  CD2   . TYR E  1 41  ? 6.286   -16.395 79.995 1.00 60.07  ? 41   TYR E CD2   1 
ATOM   3079  C  CE1   . TYR E  1 41  ? 8.615   -17.169 78.732 1.00 60.55  ? 41   TYR E CE1   1 
ATOM   3080  C  CE2   . TYR E  1 41  ? 7.270   -15.462 79.743 1.00 59.67  ? 41   TYR E CE2   1 
ATOM   3081  C  CZ    . TYR E  1 41  ? 8.434   -15.859 79.105 1.00 60.65  ? 41   TYR E CZ    1 
ATOM   3082  O  OH    . TYR E  1 41  ? 9.429   -14.952 78.828 1.00 61.31  ? 41   TYR E OH    1 
ATOM   3083  N  N     . ARG E  1 42  ? 2.978   -19.161 82.055 1.00 61.19  ? 42   ARG E N     1 
ATOM   3084  C  CA    . ARG E  1 42  ? 1.738   -19.820 82.392 1.00 60.06  ? 42   ARG E CA    1 
ATOM   3085  C  C     . ARG E  1 42  ? 1.111   -20.434 81.147 1.00 58.78  ? 42   ARG E C     1 
ATOM   3086  O  O     . ARG E  1 42  ? 1.392   -20.008 80.040 1.00 58.86  ? 42   ARG E O     1 
ATOM   3087  C  CB    . ARG E  1 42  ? 0.813   -18.841 83.095 1.00 60.31  ? 42   ARG E CB    1 
ATOM   3088  C  CG    . ARG E  1 42  ? 1.117   -18.759 84.584 1.00 62.49  ? 42   ARG E CG    1 
ATOM   3089  C  CD    . ARG E  1 42  ? 0.363   -17.639 85.277 1.00 67.27  ? 42   ARG E CD    1 
ATOM   3090  N  NE    . ARG E  1 42  ? -1.087  -17.726 85.035 1.00 70.55  ? 42   ARG E NE    1 
ATOM   3091  C  CZ    . ARG E  1 42  ? -1.943  -16.718 85.204 1.00 71.77  ? 42   ARG E CZ    1 
ATOM   3092  N  NH1   . ARG E  1 42  ? -1.511  -15.527 85.624 1.00 72.68  ? 42   ARG E NH1   1 
ATOM   3093  N  NH2   . ARG E  1 42  ? -3.236  -16.898 84.949 1.00 72.12  ? 42   ARG E NH2   1 
ATOM   3094  N  N     . PRO E  1 43  ? 0.287   -21.468 81.315 1.00 57.71  ? 43   PRO E N     1 
ATOM   3095  C  CA    . PRO E  1 43  ? -0.332  -22.074 80.146 1.00 56.82  ? 43   PRO E CA    1 
ATOM   3096  C  C     . PRO E  1 43  ? -1.254  -21.105 79.414 1.00 55.94  ? 43   PRO E C     1 
ATOM   3097  O  O     . PRO E  1 43  ? -2.192  -20.545 79.998 1.00 55.45  ? 43   PRO E O     1 
ATOM   3098  C  CB    . PRO E  1 43  ? -1.149  -23.227 80.733 1.00 56.96  ? 43   PRO E CB    1 
ATOM   3099  C  CG    . PRO E  1 43  ? -0.569  -23.467 82.064 1.00 57.47  ? 43   PRO E CG    1 
ATOM   3100  C  CD    . PRO E  1 43  ? -0.124  -22.138 82.556 1.00 57.65  ? 43   PRO E CD    1 
ATOM   3101  N  N     . GLY E  1 44  ? -0.969  -20.936 78.128 1.00 55.18  ? 44   GLY E N     1 
ATOM   3102  C  CA    . GLY E  1 44  ? -1.726  -20.057 77.258 1.00 54.04  ? 44   GLY E CA    1 
ATOM   3103  C  C     . GLY E  1 44  ? -0.818  -18.957 76.748 1.00 53.36  ? 44   GLY E C     1 
ATOM   3104  O  O     . GLY E  1 44  ? -1.085  -18.350 75.711 1.00 53.63  ? 44   GLY E O     1 
ATOM   3105  N  N     . THR E  1 45  ? 0.265   -18.698 77.473 1.00 52.28  ? 45   THR E N     1 
ATOM   3106  C  CA    . THR E  1 45  ? 1.097   -17.551 77.166 1.00 51.25  ? 45   THR E CA    1 
ATOM   3107  C  C     . THR E  1 45  ? 1.935   -17.826 75.935 1.00 50.85  ? 45   THR E C     1 
ATOM   3108  O  O     . THR E  1 45  ? 2.068   -16.962 75.066 1.00 51.27  ? 45   THR E O     1 
ATOM   3109  C  CB    . THR E  1 45  ? 1.979   -17.139 78.348 1.00 50.98  ? 45   THR E CB    1 
ATOM   3110  O  OG1   . THR E  1 45  ? 1.154   -16.891 79.486 1.00 50.80  ? 45   THR E OG1   1 
ATOM   3111  C  CG2   . THR E  1 45  ? 2.710   -15.870 78.036 1.00 51.35  ? 45   THR E CG2   1 
ATOM   3112  N  N     . VAL E  1 46  ? 2.487   -19.028 75.843 1.00 50.00  ? 46   VAL E N     1 
ATOM   3113  C  CA    . VAL E  1 46  ? 3.253   -19.365 74.659 1.00 49.24  ? 46   VAL E CA    1 
ATOM   3114  C  C     . VAL E  1 46  ? 2.306   -19.488 73.455 1.00 49.02  ? 46   VAL E C     1 
ATOM   3115  O  O     . VAL E  1 46  ? 2.643   -19.018 72.356 1.00 49.12  ? 46   VAL E O     1 
ATOM   3116  C  CB    . VAL E  1 46  ? 4.151   -20.608 74.849 1.00 48.98  ? 46   VAL E CB    1 
ATOM   3117  C  CG1   . VAL E  1 46  ? 5.102   -20.773 73.656 1.00 48.87  ? 46   VAL E CG1   1 
ATOM   3118  C  CG2   . VAL E  1 46  ? 4.948   -20.474 76.104 1.00 48.38  ? 46   VAL E CG2   1 
ATOM   3119  N  N     . ALA E  1 47  ? 1.123   -20.079 73.670 1.00 48.18  ? 47   ALA E N     1 
ATOM   3120  C  CA    . ALA E  1 47  ? 0.116   -20.214 72.606 1.00 47.70  ? 47   ALA E CA    1 
ATOM   3121  C  C     . ALA E  1 47  ? -0.175  -18.875 71.899 1.00 47.68  ? 47   ALA E C     1 
ATOM   3122  O  O     . ALA E  1 47  ? -0.093  -18.772 70.659 1.00 47.69  ? 47   ALA E O     1 
ATOM   3123  C  CB    . ALA E  1 47  ? -1.153  -20.807 73.153 1.00 47.37  ? 47   ALA E CB    1 
ATOM   3124  N  N     . LEU E  1 48  ? -0.498  -17.856 72.704 1.00 47.34  ? 48   LEU E N     1 
ATOM   3125  C  CA    . LEU E  1 48  ? -0.734  -16.490 72.232 1.00 46.39  ? 48   LEU E CA    1 
ATOM   3126  C  C     . LEU E  1 48  ? 0.496   -15.935 71.562 1.00 45.98  ? 48   LEU E C     1 
ATOM   3127  O  O     . LEU E  1 48  ? 0.405   -15.307 70.518 1.00 45.97  ? 48   LEU E O     1 
ATOM   3128  C  CB    . LEU E  1 48  ? -1.147  -15.594 73.389 1.00 46.05  ? 48   LEU E CB    1 
ATOM   3129  C  CG    . LEU E  1 48  ? -2.572  -15.868 73.847 1.00 46.18  ? 48   LEU E CG    1 
ATOM   3130  C  CD1   . LEU E  1 48  ? -2.793  -15.343 75.230 1.00 47.02  ? 48   LEU E CD1   1 
ATOM   3131  C  CD2   . LEU E  1 48  ? -3.562  -15.247 72.895 1.00 46.89  ? 48   LEU E CD2   1 
ATOM   3132  N  N     . ARG E  1 49  ? 1.652   -16.192 72.156 1.00 45.59  ? 49   ARG E N     1 
ATOM   3133  C  CA    . ARG E  1 49  ? 2.894   -15.759 71.572 1.00 45.52  ? 49   ARG E CA    1 
ATOM   3134  C  C     . ARG E  1 49  ? 2.997   -16.324 70.168 1.00 45.10  ? 49   ARG E C     1 
ATOM   3135  O  O     . ARG E  1 49  ? 3.385   -15.616 69.238 1.00 45.22  ? 49   ARG E O     1 
ATOM   3136  C  CB    . ARG E  1 49  ? 4.069   -16.221 72.422 1.00 45.67  ? 49   ARG E CB    1 
ATOM   3137  C  CG    . ARG E  1 49  ? 5.424   -15.763 71.883 1.00 47.58  ? 49   ARG E CG    1 
ATOM   3138  C  CD    . ARG E  1 49  ? 6.562   -16.301 72.729 1.00 50.37  ? 49   ARG E CD    1 
ATOM   3139  N  NE    . ARG E  1 49  ? 6.345   -16.021 74.147 1.00 52.63  ? 49   ARG E NE    1 
ATOM   3140  C  CZ    . ARG E  1 49  ? 6.972   -16.643 75.139 1.00 53.77  ? 49   ARG E CZ    1 
ATOM   3141  N  NH1   . ARG E  1 49  ? 7.868   -17.593 74.885 1.00 54.01  ? 49   ARG E NH1   1 
ATOM   3142  N  NH2   . ARG E  1 49  ? 6.691   -16.314 76.388 1.00 54.56  ? 49   ARG E NH2   1 
ATOM   3143  N  N     . GLU E  1 50  ? 2.626   -17.597 70.027 1.00 44.58  ? 50   GLU E N     1 
ATOM   3144  C  CA    . GLU E  1 50  ? 2.709   -18.312 68.753 1.00 44.18  ? 50   GLU E CA    1 
ATOM   3145  C  C     . GLU E  1 50  ? 1.698   -17.816 67.721 1.00 43.22  ? 50   GLU E C     1 
ATOM   3146  O  O     . GLU E  1 50  ? 2.047   -17.685 66.549 1.00 43.06  ? 50   GLU E O     1 
ATOM   3147  C  CB    . GLU E  1 50  ? 2.585   -19.825 68.965 1.00 43.94  ? 50   GLU E CB    1 
ATOM   3148  C  CG    . GLU E  1 50  ? 3.881   -20.470 69.415 1.00 45.04  ? 50   GLU E CG    1 
ATOM   3149  C  CD    . GLU E  1 50  ? 3.727   -21.863 70.032 1.00 45.99  ? 50   GLU E CD    1 
ATOM   3150  O  OE1   . GLU E  1 50  ? 4.764   -22.378 70.504 1.00 48.42  ? 50   GLU E OE1   1 
ATOM   3151  O  OE2   . GLU E  1 50  ? 2.611   -22.449 70.060 1.00 48.68  ? 50   GLU E OE2   1 
ATOM   3152  N  N     . ILE E  1 51  ? 0.458   -17.547 68.149 1.00 42.12  ? 51   ILE E N     1 
ATOM   3153  C  CA    . ILE E  1 51  ? -0.555  -17.002 67.249 1.00 41.04  ? 51   ILE E CA    1 
ATOM   3154  C  C     . ILE E  1 51  ? -0.040  -15.694 66.652 1.00 41.31  ? 51   ILE E C     1 
ATOM   3155  O  O     . ILE E  1 51  ? -0.092  -15.481 65.433 1.00 41.36  ? 51   ILE E O     1 
ATOM   3156  C  CB    . ILE E  1 51  ? -1.906  -16.774 67.946 1.00 40.62  ? 51   ILE E CB    1 
ATOM   3157  C  CG1   . ILE E  1 51  ? -2.461  -18.087 68.468 1.00 39.98  ? 51   ILE E CG1   1 
ATOM   3158  C  CG2   . ILE E  1 51  ? -2.913  -16.159 66.991 1.00 39.50  ? 51   ILE E CG2   1 
ATOM   3159  C  CD1   . ILE E  1 51  ? -3.704  -17.934 69.311 1.00 39.03  ? 51   ILE E CD1   1 
ATOM   3160  N  N     . ARG E  1 52  ? 0.489   -14.836 67.512 1.00 41.32  ? 52   ARG E N     1 
ATOM   3161  C  CA    . ARG E  1 52  ? 1.040   -13.574 67.066 1.00 41.95  ? 52   ARG E CA    1 
ATOM   3162  C  C     . ARG E  1 52  ? 2.144   -13.805 66.058 1.00 41.84  ? 52   ARG E C     1 
ATOM   3163  O  O     . ARG E  1 52  ? 2.175   -13.170 65.000 1.00 41.86  ? 52   ARG E O     1 
ATOM   3164  C  CB    . ARG E  1 52  ? 1.561   -12.780 68.252 1.00 42.36  ? 52   ARG E CB    1 
ATOM   3165  C  CG    . ARG E  1 52  ? 0.440   -12.229 69.114 1.00 44.55  ? 52   ARG E CG    1 
ATOM   3166  C  CD    . ARG E  1 52  ? 0.927   -11.410 70.295 1.00 47.16  ? 52   ARG E CD    1 
ATOM   3167  N  NE    . ARG E  1 52  ? -0.240  -10.926 71.027 1.00 50.04  ? 52   ARG E NE    1 
ATOM   3168  C  CZ    . ARG E  1 52  ? -0.661  -11.415 72.190 1.00 51.39  ? 52   ARG E CZ    1 
ATOM   3169  N  NH1   . ARG E  1 52  ? 0.017   -12.402 72.781 1.00 52.05  ? 52   ARG E NH1   1 
ATOM   3170  N  NH2   . ARG E  1 52  ? -1.749  -10.901 72.770 1.00 50.78  ? 52   ARG E NH2   1 
ATOM   3171  N  N     . ARG E  1 53  ? 3.034   -14.735 66.390 1.00 41.87  ? 53   ARG E N     1 
ATOM   3172  C  CA    . ARG E  1 53  ? 4.162   -15.070 65.539 1.00 42.10  ? 53   ARG E CA    1 
ATOM   3173  C  C     . ARG E  1 53  ? 3.730   -15.452 64.135 1.00 41.92  ? 53   ARG E C     1 
ATOM   3174  O  O     . ARG E  1 53  ? 4.244   -14.925 63.158 1.00 42.09  ? 53   ARG E O     1 
ATOM   3175  C  CB    . ARG E  1 53  ? 4.973   -16.215 66.144 1.00 42.24  ? 53   ARG E CB    1 
ATOM   3176  C  CG    . ARG E  1 53  ? 6.053   -16.719 65.198 1.00 43.76  ? 53   ARG E CG    1 
ATOM   3177  C  CD    . ARG E  1 53  ? 6.974   -17.755 65.821 1.00 46.31  ? 53   ARG E CD    1 
ATOM   3178  N  NE    . ARG E  1 53  ? 7.827   -18.291 64.762 1.00 49.44  ? 53   ARG E NE    1 
ATOM   3179  C  CZ    . ARG E  1 53  ? 8.680   -19.303 64.894 1.00 50.15  ? 53   ARG E CZ    1 
ATOM   3180  N  NH1   . ARG E  1 53  ? 8.827   -19.919 66.061 1.00 50.57  ? 53   ARG E NH1   1 
ATOM   3181  N  NH2   . ARG E  1 53  ? 9.390   -19.696 63.843 1.00 50.22  ? 53   ARG E NH2   1 
ATOM   3182  N  N     . TYR E  1 54  ? 2.776   -16.371 64.056 1.00 41.92  ? 54   TYR E N     1 
ATOM   3183  C  CA    . TYR E  1 54  ? 2.425   -17.029 62.808 1.00 41.52  ? 54   TYR E CA    1 
ATOM   3184  C  C     . TYR E  1 54  ? 1.509   -16.193 61.959 1.00 41.66  ? 54   TYR E C     1 
ATOM   3185  O  O     . TYR E  1 54  ? 1.591   -16.247 60.722 1.00 41.52  ? 54   TYR E O     1 
ATOM   3186  C  CB    . TYR E  1 54  ? 1.862   -18.427 63.088 1.00 41.43  ? 54   TYR E CB    1 
ATOM   3187  C  CG    . TYR E  1 54  ? 2.975   -19.347 63.501 1.00 41.17  ? 54   TYR E CG    1 
ATOM   3188  C  CD1   . TYR E  1 54  ? 2.985   -19.987 64.738 1.00 40.43  ? 54   TYR E CD1   1 
ATOM   3189  C  CD2   . TYR E  1 54  ? 4.071   -19.522 62.661 1.00 42.04  ? 54   TYR E CD2   1 
ATOM   3190  C  CE1   . TYR E  1 54  ? 4.063   -20.815 65.103 1.00 40.72  ? 54   TYR E CE1   1 
ATOM   3191  C  CE2   . TYR E  1 54  ? 5.137   -20.324 63.011 1.00 41.91  ? 54   TYR E CE2   1 
ATOM   3192  C  CZ    . TYR E  1 54  ? 5.134   -20.966 64.219 1.00 41.19  ? 54   TYR E CZ    1 
ATOM   3193  O  OH    . TYR E  1 54  ? 6.225   -21.743 64.484 1.00 41.22  ? 54   TYR E OH    1 
ATOM   3194  N  N     . GLN E  1 55  ? 0.656   -15.406 62.623 1.00 41.64  ? 55   GLN E N     1 
ATOM   3195  C  CA    . GLN E  1 55  ? -0.222  -14.475 61.918 1.00 42.02  ? 55   GLN E CA    1 
ATOM   3196  C  C     . GLN E  1 55  ? 0.592   -13.346 61.270 1.00 42.39  ? 55   GLN E C     1 
ATOM   3197  O  O     . GLN E  1 55  ? 0.128   -12.631 60.376 1.00 42.54  ? 55   GLN E O     1 
ATOM   3198  C  CB    . GLN E  1 55  ? -1.326  -13.953 62.838 1.00 41.73  ? 55   GLN E CB    1 
ATOM   3199  C  CG    . GLN E  1 55  ? -2.433  -14.978 63.034 1.00 41.96  ? 55   GLN E CG    1 
ATOM   3200  C  CD    . GLN E  1 55  ? -3.603  -14.496 63.881 1.00 41.93  ? 55   GLN E CD    1 
ATOM   3201  O  OE1   . GLN E  1 55  ? -3.610  -13.380 64.406 1.00 42.69  ? 55   GLN E OE1   1 
ATOM   3202  N  NE2   . GLN E  1 55  ? -4.599  -15.355 64.022 1.00 39.93  ? 55   GLN E NE2   1 
ATOM   3203  N  N     . LYS E  1 56  ? 1.832   -13.225 61.719 1.00 42.56  ? 56   LYS E N     1 
ATOM   3204  C  CA    . LYS E  1 56  ? 2.714   -12.191 61.257 1.00 42.90  ? 56   LYS E CA    1 
ATOM   3205  C  C     . LYS E  1 56  ? 3.518   -12.687 60.060 1.00 41.90  ? 56   LYS E C     1 
ATOM   3206  O  O     . LYS E  1 56  ? 3.941   -11.889 59.240 1.00 42.26  ? 56   LYS E O     1 
ATOM   3207  C  CB    . LYS E  1 56  ? 3.612   -11.734 62.410 1.00 42.68  ? 56   LYS E CB    1 
ATOM   3208  C  CG    . LYS E  1 56  ? 4.430   -10.497 62.116 1.00 44.35  ? 56   LYS E CG    1 
ATOM   3209  C  CD    . LYS E  1 56  ? 5.217   -10.010 63.363 1.00 45.55  ? 56   LYS E CD    1 
ATOM   3210  C  CE    . LYS E  1 56  ? 6.651   -9.539  62.931 1.00 49.94  ? 56   LYS E CE    1 
ATOM   3211  N  NZ    . LYS E  1 56  ? 7.375   -8.703  63.944 1.00 50.43  ? 56   LYS E NZ    1 
ATOM   3212  N  N     . SER E  1 57  ? 3.708   -13.993 59.930 1.00 40.99  ? 57   SER E N     1 
ATOM   3213  C  CA    . SER E  1 57  ? 4.550   -14.488 58.842 1.00 40.54  ? 57   SER E CA    1 
ATOM   3214  C  C     . SER E  1 57  ? 3.770   -15.139 57.709 1.00 39.99  ? 57   SER E C     1 
ATOM   3215  O  O     . SER E  1 57  ? 2.569   -15.392 57.849 1.00 40.63  ? 57   SER E O     1 
ATOM   3216  C  CB    . SER E  1 57  ? 5.624   -15.429 59.379 1.00 40.70  ? 57   SER E CB    1 
ATOM   3217  O  OG    . SER E  1 57  ? 5.056   -16.620 59.871 1.00 40.73  ? 57   SER E OG    1 
ATOM   3218  N  N     . THR E  1 58  ? 4.431   -15.414 56.589 1.00 38.82  ? 58   THR E N     1 
ATOM   3219  C  CA    . THR E  1 58  ? 3.718   -16.074 55.492 1.00 38.16  ? 58   THR E CA    1 
ATOM   3220  C  C     . THR E  1 58  ? 4.254   -17.450 55.067 1.00 37.81  ? 58   THR E C     1 
ATOM   3221  O  O     . THR E  1 58  ? 3.621   -18.129 54.255 1.00 38.13  ? 58   THR E O     1 
ATOM   3222  C  CB    . THR E  1 58  ? 3.603   -15.194 54.234 1.00 37.87  ? 58   THR E CB    1 
ATOM   3223  O  OG1   . THR E  1 58  ? 4.820   -15.256 53.502 1.00 36.86  ? 58   THR E OG1   1 
ATOM   3224  C  CG2   . THR E  1 58  ? 3.348   -13.786 54.597 1.00 38.31  ? 58   THR E CG2   1 
ATOM   3225  N  N     . GLU E  1 59  ? 5.404   -17.859 55.596 1.00 36.84  ? 59   GLU E N     1 
ATOM   3226  C  CA    . GLU E  1 59  ? 6.029   -19.093 55.159 1.00 35.80  ? 59   GLU E CA    1 
ATOM   3227  C  C     . GLU E  1 59  ? 5.095   -20.235 55.467 1.00 35.67  ? 59   GLU E C     1 
ATOM   3228  O  O     . GLU E  1 59  ? 4.208   -20.096 56.309 1.00 35.23  ? 59   GLU E O     1 
ATOM   3229  C  CB    . GLU E  1 59  ? 7.393   -19.286 55.820 1.00 35.58  ? 59   GLU E CB    1 
ATOM   3230  C  CG    . GLU E  1 59  ? 7.398   -20.026 57.145 1.00 35.80  ? 59   GLU E CG    1 
ATOM   3231  C  CD    . GLU E  1 59  ? 6.892   -19.205 58.320 1.00 37.12  ? 59   GLU E CD    1 
ATOM   3232  O  OE1   . GLU E  1 59  ? 6.967   -19.683 59.459 1.00 37.91  ? 59   GLU E OE1   1 
ATOM   3233  O  OE2   . GLU E  1 59  ? 6.402   -18.083 58.130 1.00 39.09  ? 59   GLU E OE2   1 
ATOM   3234  N  N     . LEU E  1 60  ? 5.274   -21.346 54.751 1.00 35.84  ? 60   LEU E N     1 
ATOM   3235  C  CA    . LEU E  1 60  ? 4.470   -22.555 54.944 1.00 35.61  ? 60   LEU E CA    1 
ATOM   3236  C  C     . LEU E  1 60  ? 4.808   -23.255 56.248 1.00 35.79  ? 60   LEU E C     1 
ATOM   3237  O  O     . LEU E  1 60  ? 5.892   -23.066 56.810 1.00 35.96  ? 60   LEU E O     1 
ATOM   3238  C  CB    . LEU E  1 60  ? 4.663   -23.494 53.765 1.00 35.38  ? 60   LEU E CB    1 
ATOM   3239  C  CG    . LEU E  1 60  ? 3.657   -23.432 52.617 1.00 35.39  ? 60   LEU E CG    1 
ATOM   3240  C  CD1   . LEU E  1 60  ? 2.922   -22.117 52.561 1.00 36.27  ? 60   LEU E CD1   1 
ATOM   3241  C  CD2   . LEU E  1 60  ? 4.318   -23.743 51.295 1.00 34.97  ? 60   LEU E CD2   1 
ATOM   3242  N  N     . LEU E  1 61  ? 3.883   -24.066 56.739 1.00 36.04  ? 61   LEU E N     1 
ATOM   3243  C  CA    . LEU E  1 61  ? 4.049   -24.628 58.076 1.00 36.30  ? 61   LEU E CA    1 
ATOM   3244  C  C     . LEU E  1 61  ? 4.164   -26.147 58.092 1.00 36.41  ? 61   LEU E C     1 
ATOM   3245  O  O     . LEU E  1 61  ? 4.540   -26.736 59.104 1.00 36.53  ? 61   LEU E O     1 
ATOM   3246  C  CB    . LEU E  1 61  ? 2.942   -24.137 59.002 1.00 36.19  ? 61   LEU E CB    1 
ATOM   3247  C  CG    . LEU E  1 61  ? 2.681   -22.624 58.973 1.00 36.85  ? 61   LEU E CG    1 
ATOM   3248  C  CD1   . LEU E  1 61  ? 1.406   -22.302 59.695 1.00 37.68  ? 61   LEU E CD1   1 
ATOM   3249  C  CD2   . LEU E  1 61  ? 3.816   -21.819 59.567 1.00 37.39  ? 61   LEU E CD2   1 
ATOM   3250  N  N     . ILE E  1 62  ? 3.856   -26.782 56.970 1.00 36.37  ? 62   ILE E N     1 
ATOM   3251  C  CA    . ILE E  1 62  ? 4.085   -28.205 56.843 1.00 36.48  ? 62   ILE E CA    1 
ATOM   3252  C  C     . ILE E  1 62  ? 5.432   -28.348 56.168 1.00 37.12  ? 62   ILE E C     1 
ATOM   3253  O  O     . ILE E  1 62  ? 5.697   -27.629 55.208 1.00 37.45  ? 62   ILE E O     1 
ATOM   3254  C  CB    . ILE E  1 62  ? 2.990   -28.879 55.997 1.00 36.22  ? 62   ILE E CB    1 
ATOM   3255  C  CG1   . ILE E  1 62  ? 1.630   -28.754 56.687 1.00 34.92  ? 62   ILE E CG1   1 
ATOM   3256  C  CG2   . ILE E  1 62  ? 3.333   -30.341 55.743 1.00 36.17  ? 62   ILE E CG2   1 
ATOM   3257  C  CD1   . ILE E  1 62  ? 0.477   -29.141 55.824 1.00 32.58  ? 62   ILE E CD1   1 
ATOM   3258  N  N     . ARG E  1 63  ? 6.282   -29.252 56.668 1.00 37.73  ? 63   ARG E N     1 
ATOM   3259  C  CA    . ARG E  1 63  ? 7.601   -29.513 56.072 1.00 38.47  ? 63   ARG E CA    1 
ATOM   3260  C  C     . ARG E  1 63  ? 7.433   -29.920 54.606 1.00 38.53  ? 63   ARG E C     1 
ATOM   3261  O  O     . ARG E  1 63  ? 6.519   -30.664 54.286 1.00 38.38  ? 63   ARG E O     1 
ATOM   3262  C  CB    . ARG E  1 63  ? 8.348   -30.606 56.838 1.00 38.80  ? 63   ARG E CB    1 
ATOM   3263  C  CG    . ARG E  1 63  ? 8.514   -30.415 58.361 1.00 41.89  ? 63   ARG E CG    1 
ATOM   3264  C  CD    . ARG E  1 63  ? 9.758   -29.585 58.771 1.00 46.64  ? 63   ARG E CD    1 
ATOM   3265  N  NE    . ARG E  1 63  ? 9.424   -28.175 59.013 1.00 49.82  ? 63   ARG E NE    1 
ATOM   3266  C  CZ    . ARG E  1 63  ? 9.682   -27.166 58.170 1.00 52.15  ? 63   ARG E CZ    1 
ATOM   3267  N  NH1   . ARG E  1 63  ? 10.302  -27.386 57.006 1.00 52.63  ? 63   ARG E NH1   1 
ATOM   3268  N  NH2   . ARG E  1 63  ? 9.324   -25.921 58.495 1.00 52.56  ? 63   ARG E NH2   1 
ATOM   3269  N  N     . LYS E  1 64  ? 8.294   -29.417 53.717 1.00 39.00  ? 64   LYS E N     1 
ATOM   3270  C  CA    . LYS E  1 64  ? 8.102   -29.598 52.260 1.00 39.57  ? 64   LYS E CA    1 
ATOM   3271  C  C     . LYS E  1 64  ? 8.046   -31.054 51.825 1.00 39.04  ? 64   LYS E C     1 
ATOM   3272  O  O     . LYS E  1 64  ? 7.092   -31.475 51.158 1.00 39.37  ? 64   LYS E O     1 
ATOM   3273  C  CB    . LYS E  1 64  ? 9.172   -28.885 51.414 1.00 39.68  ? 64   LYS E CB    1 
ATOM   3274  C  CG    . LYS E  1 64  ? 9.199   -27.378 51.523 1.00 43.11  ? 64   LYS E CG    1 
ATOM   3275  C  CD    . LYS E  1 64  ? 7.914   -26.662 51.030 1.00 47.11  ? 64   LYS E CD    1 
ATOM   3276  C  CE    . LYS E  1 64  ? 7.854   -25.215 51.576 1.00 49.08  ? 64   LYS E CE    1 
ATOM   3277  N  NZ    . LYS E  1 64  ? 9.042   -24.358 51.184 1.00 49.62  ? 64   LYS E NZ    1 
ATOM   3278  N  N     . LEU E  1 65  ? 9.075   -31.805 52.194 1.00 38.23  ? 65   LEU E N     1 
ATOM   3279  C  CA    . LEU E  1 65  ? 9.231   -33.159 51.726 1.00 37.71  ? 65   LEU E CA    1 
ATOM   3280  C  C     . LEU E  1 65  ? 8.121   -34.085 52.234 1.00 37.70  ? 65   LEU E C     1 
ATOM   3281  O  O     . LEU E  1 65  ? 7.465   -34.766 51.431 1.00 37.73  ? 65   LEU E O     1 
ATOM   3282  C  CB    . LEU E  1 65  ? 10.609  -33.688 52.108 1.00 37.47  ? 65   LEU E CB    1 
ATOM   3283  C  CG    . LEU E  1 65  ? 10.962  -35.090 51.631 1.00 36.28  ? 65   LEU E CG    1 
ATOM   3284  C  CD1   . LEU E  1 65  ? 10.946  -35.165 50.120 1.00 36.14  ? 65   LEU E CD1   1 
ATOM   3285  C  CD2   . LEU E  1 65  ? 12.304  -35.407 52.159 1.00 35.62  ? 65   LEU E CD2   1 
ATOM   3286  N  N     . PRO E  1 66  ? 7.902   -34.124 53.557 1.00 37.28  ? 66   PRO E N     1 
ATOM   3287  C  CA    . PRO E  1 66  ? 6.805   -34.957 53.978 1.00 37.39  ? 66   PRO E CA    1 
ATOM   3288  C  C     . PRO E  1 66  ? 5.574   -34.660 53.152 1.00 37.50  ? 66   PRO E C     1 
ATOM   3289  O  O     . PRO E  1 66  ? 4.940   -35.589 52.664 1.00 38.05  ? 66   PRO E O     1 
ATOM   3290  C  CB    . PRO E  1 66  ? 6.589   -34.542 55.427 1.00 37.33  ? 66   PRO E CB    1 
ATOM   3291  C  CG    . PRO E  1 66  ? 7.925   -34.172 55.881 1.00 37.48  ? 66   PRO E CG    1 
ATOM   3292  C  CD    . PRO E  1 66  ? 8.568   -33.490 54.701 1.00 37.26  ? 66   PRO E CD    1 
ATOM   3293  N  N     . PHE E  1 67  ? 5.256   -33.381 52.965 1.00 37.46  ? 67   PHE E N     1 
ATOM   3294  C  CA    . PHE E  1 67  ? 4.052   -33.011 52.226 1.00 37.33  ? 67   PHE E CA    1 
ATOM   3295  C  C     . PHE E  1 67  ? 4.063   -33.605 50.818 1.00 38.08  ? 67   PHE E C     1 
ATOM   3296  O  O     . PHE E  1 67  ? 3.084   -34.214 50.405 1.00 38.34  ? 67   PHE E O     1 
ATOM   3297  C  CB    . PHE E  1 67  ? 3.822   -31.497 52.190 1.00 36.48  ? 67   PHE E CB    1 
ATOM   3298  C  CG    . PHE E  1 67  ? 2.574   -31.108 51.463 1.00 35.15  ? 67   PHE E CG    1 
ATOM   3299  C  CD1   . PHE E  1 67  ? 1.369   -31.042 52.120 1.00 33.49  ? 67   PHE E CD1   1 
ATOM   3300  C  CD2   . PHE E  1 67  ? 2.599   -30.835 50.103 1.00 34.64  ? 67   PHE E CD2   1 
ATOM   3301  C  CE1   . PHE E  1 67  ? 0.200   -30.703 51.423 1.00 33.01  ? 67   PHE E CE1   1 
ATOM   3302  C  CE2   . PHE E  1 67  ? 1.438   -30.493 49.417 1.00 33.13  ? 67   PHE E CE2   1 
ATOM   3303  C  CZ    . PHE E  1 67  ? 0.244   -30.434 50.078 1.00 32.72  ? 67   PHE E CZ    1 
ATOM   3304  N  N     . GLN E  1 68  ? 5.175   -33.435 50.103 1.00 38.65  ? 68   GLN E N     1 
ATOM   3305  C  CA    . GLN E  1 68  ? 5.358   -33.972 48.755 1.00 39.60  ? 68   GLN E CA    1 
ATOM   3306  C  C     . GLN E  1 68  ? 5.042   -35.482 48.637 1.00 39.06  ? 68   GLN E C     1 
ATOM   3307  O  O     . GLN E  1 68  ? 4.397   -35.933 47.679 1.00 38.96  ? 68   GLN E O     1 
ATOM   3308  C  CB    . GLN E  1 68  ? 6.793   -33.716 48.327 1.00 39.06  ? 68   GLN E CB    1 
ATOM   3309  C  CG    . GLN E  1 68  ? 7.047   -33.934 46.859 1.00 41.71  ? 68   GLN E CG    1 
ATOM   3310  C  CD    . GLN E  1 68  ? 8.439   -33.470 46.424 1.00 43.07  ? 68   GLN E CD    1 
ATOM   3311  O  OE1   . GLN E  1 68  ? 8.580   -32.611 45.541 1.00 47.22  ? 68   GLN E OE1   1 
ATOM   3312  N  NE2   . GLN E  1 68  ? 9.477   -34.037 47.049 1.00 47.90  ? 68   GLN E NE2   1 
ATOM   3313  N  N     . ARG E  1 69  ? 5.503   -36.263 49.613 1.00 38.70  ? 69   ARG E N     1 
ATOM   3314  C  CA    . ARG E  1 69  ? 5.313   -37.702 49.576 1.00 37.91  ? 69   ARG E CA    1 
ATOM   3315  C  C     . ARG E  1 69  ? 3.862   -38.014 49.764 1.00 37.51  ? 69   ARG E C     1 
ATOM   3316  O  O     . ARG E  1 69  ? 3.359   -38.983 49.212 1.00 37.99  ? 69   ARG E O     1 
ATOM   3317  C  CB    . ARG E  1 69  ? 6.108   -38.390 50.667 1.00 38.03  ? 69   ARG E CB    1 
ATOM   3318  C  CG    . ARG E  1 69  ? 7.568   -38.567 50.360 1.00 37.83  ? 69   ARG E CG    1 
ATOM   3319  C  CD    . ARG E  1 69  ? 8.209   -39.510 51.378 1.00 39.28  ? 69   ARG E CD    1 
ATOM   3320  N  NE    . ARG E  1 69  ? 7.956   -39.141 52.776 1.00 39.12  ? 69   ARG E NE    1 
ATOM   3321  C  CZ    . ARG E  1 69  ? 8.862   -38.599 53.587 1.00 40.39  ? 69   ARG E CZ    1 
ATOM   3322  N  NH1   . ARG E  1 69  ? 10.099  -38.350 53.158 1.00 39.92  ? 69   ARG E NH1   1 
ATOM   3323  N  NH2   . ARG E  1 69  ? 8.526   -38.300 54.837 1.00 41.38  ? 69   ARG E NH2   1 
ATOM   3324  N  N     . LEU E  1 70  ? 3.178   -37.192 50.545 1.00 36.84  ? 70   LEU E N     1 
ATOM   3325  C  CA    . LEU E  1 70  ? 1.749   -37.378 50.716 1.00 36.28  ? 70   LEU E CA    1 
ATOM   3326  C  C     . LEU E  1 70  ? 1.048   -37.203 49.374 1.00 36.14  ? 70   LEU E C     1 
ATOM   3327  O  O     . LEU E  1 70  ? 0.278   -38.060 48.963 1.00 36.08  ? 70   LEU E O     1 
ATOM   3328  C  CB    . LEU E  1 70  ? 1.191   -36.423 51.760 1.00 35.85  ? 70   LEU E CB    1 
ATOM   3329  C  CG    . LEU E  1 70  ? -0.297  -36.581 52.039 1.00 35.21  ? 70   LEU E CG    1 
ATOM   3330  C  CD1   . LEU E  1 70  ? -0.659  -38.017 52.361 1.00 32.49  ? 70   LEU E CD1   1 
ATOM   3331  C  CD2   . LEU E  1 70  ? -0.680  -35.640 53.168 1.00 34.73  ? 70   LEU E CD2   1 
ATOM   3332  N  N     . VAL E  1 71  ? 1.364   -36.102 48.692 1.00 36.00  ? 71   VAL E N     1 
ATOM   3333  C  CA    . VAL E  1 71  ? 0.805   -35.759 47.397 1.00 35.67  ? 71   VAL E CA    1 
ATOM   3334  C  C     . VAL E  1 71  ? 1.095   -36.862 46.422 1.00 36.04  ? 71   VAL E C     1 
ATOM   3335  O  O     . VAL E  1 71  ? 0.219   -37.283 45.682 1.00 35.91  ? 71   VAL E O     1 
ATOM   3336  C  CB    . VAL E  1 71  ? 1.410   -34.458 46.876 1.00 35.36  ? 71   VAL E CB    1 
ATOM   3337  C  CG1   . VAL E  1 71  ? 0.998   -34.191 45.446 1.00 35.40  ? 71   VAL E CG1   1 
ATOM   3338  C  CG2   . VAL E  1 71  ? 0.985   -33.332 47.746 1.00 35.17  ? 71   VAL E CG2   1 
ATOM   3339  N  N     . ARG E  1 72  ? 2.331   -37.339 46.446 1.00 36.94  ? 72   ARG E N     1 
ATOM   3340  C  CA    . ARG E  1 72  ? 2.776   -38.385 45.522 1.00 37.80  ? 72   ARG E CA    1 
ATOM   3341  C  C     . ARG E  1 72  ? 2.098   -39.734 45.768 1.00 37.27  ? 72   ARG E C     1 
ATOM   3342  O  O     . ARG E  1 72  ? 1.695   -40.401 44.805 1.00 36.67  ? 72   ARG E O     1 
ATOM   3343  C  CB    . ARG E  1 72  ? 4.303   -38.510 45.543 1.00 38.26  ? 72   ARG E CB    1 
ATOM   3344  C  CG    . ARG E  1 72  ? 5.003   -37.466 44.691 1.00 40.24  ? 72   ARG E CG    1 
ATOM   3345  C  CD    . ARG E  1 72  ? 6.505   -37.616 44.829 1.00 44.92  ? 72   ARG E CD    1 
ATOM   3346  N  NE    . ARG E  1 72  ? 7.256   -36.423 44.426 1.00 47.22  ? 72   ARG E NE    1 
ATOM   3347  C  CZ    . ARG E  1 72  ? 7.469   -36.056 43.164 1.00 49.40  ? 72   ARG E CZ    1 
ATOM   3348  N  NH1   . ARG E  1 72  ? 6.970   -36.754 42.146 1.00 50.27  ? 72   ARG E NH1   1 
ATOM   3349  N  NH2   . ARG E  1 72  ? 8.175   -34.968 42.919 1.00 51.28  ? 72   ARG E NH2   1 
ATOM   3350  N  N     . GLU E  1 73  ? 1.975   -40.102 47.049 1.00 37.03  ? 73   GLU E N     1 
ATOM   3351  C  CA    . GLU E  1 73  ? 1.249   -41.298 47.485 1.00 37.30  ? 73   GLU E CA    1 
ATOM   3352  C  C     . GLU E  1 73  ? -0.199  -41.269 46.991 1.00 37.83  ? 73   GLU E C     1 
ATOM   3353  O  O     . GLU E  1 73  ? -0.652  -42.212 46.355 1.00 38.33  ? 73   GLU E O     1 
ATOM   3354  C  CB    . GLU E  1 73  ? 1.315   -41.440 49.010 1.00 36.70  ? 73   GLU E CB    1 
ATOM   3355  C  CG    . GLU E  1 73  ? 0.309   -42.400 49.641 1.00 36.43  ? 73   GLU E CG    1 
ATOM   3356  C  CD    . GLU E  1 73  ? 0.559   -42.637 51.146 1.00 37.35  ? 73   GLU E CD    1 
ATOM   3357  O  OE1   . GLU E  1 73  ? 1.723   -42.500 51.584 1.00 38.94  ? 73   GLU E OE1   1 
ATOM   3358  O  OE2   . GLU E  1 73  ? -0.390  -42.976 51.899 1.00 36.08  ? 73   GLU E OE2   1 
ATOM   3359  N  N     . ILE E  1 74  ? -0.899  -40.173 47.257 1.00 38.20  ? 74   ILE E N     1 
ATOM   3360  C  CA    . ILE E  1 74  ? -2.303  -40.044 46.928 1.00 38.84  ? 74   ILE E CA    1 
ATOM   3361  C  C     . ILE E  1 74  ? -2.516  -40.042 45.423 1.00 39.83  ? 74   ILE E C     1 
ATOM   3362  O  O     . ILE E  1 74  ? -3.481  -40.613 44.925 1.00 40.54  ? 74   ILE E O     1 
ATOM   3363  C  CB    . ILE E  1 74  ? -2.907  -38.751 47.533 1.00 38.65  ? 74   ILE E CB    1 
ATOM   3364  C  CG1   . ILE E  1 74  ? -2.953  -38.844 49.053 1.00 38.48  ? 74   ILE E CG1   1 
ATOM   3365  C  CG2   . ILE E  1 74  ? -4.323  -38.491 47.003 1.00 39.04  ? 74   ILE E CG2   1 
ATOM   3366  C  CD1   . ILE E  1 74  ? -3.530  -37.633 49.717 1.00 39.47  ? 74   ILE E CD1   1 
ATOM   3367  N  N     . ALA E  1 75  ? -1.635  -39.381 44.691 1.00 40.66  ? 75   ALA E N     1 
ATOM   3368  C  CA    . ALA E  1 75  ? -1.807  -39.285 43.254 1.00 41.51  ? 75   ALA E CA    1 
ATOM   3369  C  C     . ALA E  1 75  ? -1.653  -40.666 42.638 1.00 42.18  ? 75   ALA E C     1 
ATOM   3370  O  O     . ALA E  1 75  ? -2.388  -41.039 41.736 1.00 42.27  ? 75   ALA E O     1 
ATOM   3371  C  CB    . ALA E  1 75  ? -0.787  -38.311 42.659 1.00 41.35  ? 75   ALA E CB    1 
ATOM   3372  N  N     . GLN E  1 76  ? -0.687  -41.414 43.157 1.00 43.19  ? 76   GLN E N     1 
ATOM   3373  C  CA    . GLN E  1 76  ? -0.322  -42.719 42.652 1.00 44.15  ? 76   GLN E CA    1 
ATOM   3374  C  C     . GLN E  1 76  ? -1.468  -43.693 42.800 1.00 44.63  ? 76   GLN E C     1 
ATOM   3375  O  O     . GLN E  1 76  ? -1.697  -44.518 41.916 1.00 44.89  ? 76   GLN E O     1 
ATOM   3376  C  CB    . GLN E  1 76  ? 0.854   -43.216 43.452 1.00 44.52  ? 76   GLN E CB    1 
ATOM   3377  C  CG    . GLN E  1 76  ? 1.599   -44.376 42.885 1.00 45.28  ? 76   GLN E CG    1 
ATOM   3378  C  CD    . GLN E  1 76  ? 2.729   -44.748 43.801 1.00 46.63  ? 76   GLN E CD    1 
ATOM   3379  O  OE1   . GLN E  1 76  ? 2.571   -44.801 45.028 1.00 47.25  ? 76   GLN E OE1   1 
ATOM   3380  N  NE2   . GLN E  1 76  ? 3.888   -44.979 43.223 1.00 48.03  ? 76   GLN E NE2   1 
ATOM   3381  N  N     . ASP E  1 77  ? -2.189  -43.596 43.913 1.00 45.05  ? 77   ASP E N     1 
ATOM   3382  C  CA    . ASP E  1 77  ? -3.407  -44.362 44.086 1.00 45.74  ? 77   ASP E CA    1 
ATOM   3383  C  C     . ASP E  1 77  ? -4.476  -44.034 43.036 1.00 46.63  ? 77   ASP E C     1 
ATOM   3384  O  O     . ASP E  1 77  ? -5.425  -44.784 42.879 1.00 46.88  ? 77   ASP E O     1 
ATOM   3385  C  CB    . ASP E  1 77  ? -3.946  -44.209 45.500 1.00 45.44  ? 77   ASP E CB    1 
ATOM   3386  C  CG    . ASP E  1 77  ? -3.127  -44.973 46.524 1.00 46.27  ? 77   ASP E CG    1 
ATOM   3387  O  OD1   . ASP E  1 77  ? -2.424  -45.934 46.157 1.00 48.28  ? 77   ASP E OD1   1 
ATOM   3388  O  OD2   . ASP E  1 77  ? -3.188  -44.623 47.719 1.00 47.41  ? 77   ASP E OD2   1 
ATOM   3389  N  N     . PHE E  1 78  ? -4.316  -42.928 42.310 1.00 48.06  ? 78   PHE E N     1 
ATOM   3390  C  CA    . PHE E  1 78  ? -5.235  -42.574 41.220 1.00 49.28  ? 78   PHE E CA    1 
ATOM   3391  C  C     . PHE E  1 78  ? -4.715  -43.021 39.881 1.00 49.54  ? 78   PHE E C     1 
ATOM   3392  O  O     . PHE E  1 78  ? -5.475  -43.461 39.036 1.00 50.03  ? 78   PHE E O     1 
ATOM   3393  C  CB    . PHE E  1 78  ? -5.489  -41.075 41.148 1.00 49.80  ? 78   PHE E CB    1 
ATOM   3394  C  CG    . PHE E  1 78  ? -6.472  -40.578 42.158 1.00 52.39  ? 78   PHE E CG    1 
ATOM   3395  C  CD1   . PHE E  1 78  ? -6.188  -39.440 42.931 1.00 55.40  ? 78   PHE E CD1   1 
ATOM   3396  C  CD2   . PHE E  1 78  ? -7.686  -41.232 42.359 1.00 54.91  ? 78   PHE E CD2   1 
ATOM   3397  C  CE1   . PHE E  1 78  ? -7.115  -38.936 43.894 1.00 55.93  ? 78   PHE E CE1   1 
ATOM   3398  C  CE2   . PHE E  1 78  ? -8.626  -40.747 43.320 1.00 57.06  ? 78   PHE E CE2   1 
ATOM   3399  C  CZ    . PHE E  1 78  ? -8.334  -39.586 44.084 1.00 55.26  ? 78   PHE E CZ    1 
ATOM   3400  N  N     . LYS E  1 79  ? -3.420  -42.876 39.676 1.00 50.02  ? 79   LYS E N     1 
ATOM   3401  C  CA    . LYS E  1 79  ? -2.811  -43.219 38.422 1.00 50.70  ? 79   LYS E CA    1 
ATOM   3402  C  C     . LYS E  1 79  ? -1.341  -43.399 38.689 1.00 51.06  ? 79   LYS E C     1 
ATOM   3403  O  O     . LYS E  1 79  ? -0.749  -42.693 39.500 1.00 51.30  ? 79   LYS E O     1 
ATOM   3404  C  CB    . LYS E  1 79  ? -3.052  -42.103 37.418 1.00 50.89  ? 79   LYS E CB    1 
ATOM   3405  C  CG    . LYS E  1 79  ? -2.301  -42.213 36.105 1.00 53.53  ? 79   LYS E CG    1 
ATOM   3406  C  CD    . LYS E  1 79  ? -2.669  -43.479 35.303 1.00 57.42  ? 79   LYS E CD    1 
ATOM   3407  C  CE    . LYS E  1 79  ? -2.311  -43.288 33.819 1.00 58.12  ? 79   LYS E CE    1 
ATOM   3408  N  NZ    . LYS E  1 79  ? -3.314  -42.359 33.159 1.00 58.99  ? 79   LYS E NZ    1 
ATOM   3409  N  N     . THR E  1 80  ? -0.755  -44.374 38.023 1.00 51.82  ? 80   THR E N     1 
ATOM   3410  C  CA    . THR E  1 80  ? 0.648   -44.696 38.218 1.00 52.67  ? 80   THR E CA    1 
ATOM   3411  C  C     . THR E  1 80  ? 1.538   -43.899 37.275 1.00 53.11  ? 80   THR E C     1 
ATOM   3412  O  O     . THR E  1 80  ? 1.050   -43.235 36.350 1.00 53.06  ? 80   THR E O     1 
ATOM   3413  C  CB    . THR E  1 80  ? 0.883   -46.189 37.989 1.00 52.63  ? 80   THR E CB    1 
ATOM   3414  O  OG1   . THR E  1 80  ? 0.117   -46.608 36.853 1.00 53.20  ? 80   THR E OG1   1 
ATOM   3415  C  CG2   . THR E  1 80  ? 0.435   -46.984 39.211 1.00 52.50  ? 80   THR E CG2   1 
ATOM   3416  N  N     . ASP E  1 81  ? 2.846   -43.962 37.519 1.00 53.81  ? 81   ASP E N     1 
ATOM   3417  C  CA    . ASP E  1 81  ? 3.836   -43.375 36.605 1.00 54.73  ? 81   ASP E CA    1 
ATOM   3418  C  C     . ASP E  1 81  ? 3.577   -41.883 36.314 1.00 54.36  ? 81   ASP E C     1 
ATOM   3419  O  O     . ASP E  1 81  ? 3.952   -41.379 35.242 1.00 54.76  ? 81   ASP E O     1 
ATOM   3420  C  CB    . ASP E  1 81  ? 3.915   -44.161 35.272 1.00 55.35  ? 81   ASP E CB    1 
ATOM   3421  C  CG    . ASP E  1 81  ? 3.761   -45.678 35.454 1.00 57.93  ? 81   ASP E CG    1 
ATOM   3422  O  OD1   . ASP E  1 81  ? 2.846   -46.252 34.809 1.00 59.60  ? 81   ASP E OD1   1 
ATOM   3423  O  OD2   . ASP E  1 81  ? 4.540   -46.292 36.234 1.00 60.96  ? 81   ASP E OD2   1 
ATOM   3424  N  N     . LEU E  1 82  ? 2.922   -41.192 37.254 1.00 53.56  ? 82   LEU E N     1 
ATOM   3425  C  CA    . LEU E  1 82  ? 2.736   -39.741 37.178 1.00 52.33  ? 82   LEU E CA    1 
ATOM   3426  C  C     . LEU E  1 82  ? 3.972   -39.002 37.697 1.00 52.20  ? 82   LEU E C     1 
ATOM   3427  O  O     . LEU E  1 82  ? 4.605   -39.439 38.666 1.00 52.49  ? 82   LEU E O     1 
ATOM   3428  C  CB    . LEU E  1 82  ? 1.529   -39.326 38.010 1.00 51.93  ? 82   LEU E CB    1 
ATOM   3429  C  CG    . LEU E  1 82  ? 0.138   -39.669 37.490 1.00 50.80  ? 82   LEU E CG    1 
ATOM   3430  C  CD1   . LEU E  1 82  ? -0.905  -39.389 38.548 1.00 48.99  ? 82   LEU E CD1   1 
ATOM   3431  C  CD2   . LEU E  1 82  ? -0.154  -38.887 36.251 1.00 49.93  ? 82   LEU E CD2   1 
ATOM   3432  N  N     . ARG E  1 83  ? 4.318   -37.885 37.062 1.00 51.50  ? 83   ARG E N     1 
ATOM   3433  C  CA    . ARG E  1 83  ? 5.357   -37.005 37.599 1.00 50.76  ? 83   ARG E CA    1 
ATOM   3434  C  C     . ARG E  1 83  ? 4.757   -35.633 37.894 1.00 49.49  ? 83   ARG E C     1 
ATOM   3435  O  O     . ARG E  1 83  ? 3.624   -35.348 37.499 1.00 49.17  ? 83   ARG E O     1 
ATOM   3436  C  CB    . ARG E  1 83  ? 6.523   -36.878 36.625 1.00 51.58  ? 83   ARG E CB    1 
ATOM   3437  C  CG    . ARG E  1 83  ? 7.247   -38.168 36.333 1.00 53.41  ? 83   ARG E CG    1 
ATOM   3438  C  CD    . ARG E  1 83  ? 7.575   -38.271 34.832 1.00 58.37  ? 83   ARG E CD    1 
ATOM   3439  N  NE    . ARG E  1 83  ? 8.714   -37.447 34.415 1.00 62.27  ? 83   ARG E NE    1 
ATOM   3440  C  CZ    . ARG E  1 83  ? 9.996   -37.782 34.596 1.00 64.36  ? 83   ARG E CZ    1 
ATOM   3441  N  NH1   . ARG E  1 83  ? 10.325  -38.924 35.202 1.00 64.58  ? 83   ARG E NH1   1 
ATOM   3442  N  NH2   . ARG E  1 83  ? 10.960  -36.968 34.179 1.00 64.86  ? 83   ARG E NH2   1 
ATOM   3443  N  N     . PHE E  1 84  ? 5.523   -34.791 38.582 1.00 47.97  ? 84   PHE E N     1 
ATOM   3444  C  CA    . PHE E  1 84  ? 5.022   -33.517 39.092 1.00 46.65  ? 84   PHE E CA    1 
ATOM   3445  C  C     . PHE E  1 84  ? 6.015   -32.403 38.888 1.00 45.56  ? 84   PHE E C     1 
ATOM   3446  O  O     . PHE E  1 84  ? 7.154   -32.504 39.334 1.00 46.00  ? 84   PHE E O     1 
ATOM   3447  C  CB    . PHE E  1 84  ? 4.768   -33.629 40.592 1.00 46.64  ? 84   PHE E CB    1 
ATOM   3448  C  CG    . PHE E  1 84  ? 3.474   -34.296 40.942 1.00 47.19  ? 84   PHE E CG    1 
ATOM   3449  C  CD1   . PHE E  1 84  ? 3.332   -35.672 40.850 1.00 47.54  ? 84   PHE E CD1   1 
ATOM   3450  C  CD2   . PHE E  1 84  ? 2.395   -33.545 41.386 1.00 47.12  ? 84   PHE E CD2   1 
ATOM   3451  C  CE1   . PHE E  1 84  ? 2.123   -36.277 41.178 1.00 47.73  ? 84   PHE E CE1   1 
ATOM   3452  C  CE2   . PHE E  1 84  ? 1.193   -34.146 41.725 1.00 46.35  ? 84   PHE E CE2   1 
ATOM   3453  C  CZ    . PHE E  1 84  ? 1.057   -35.509 41.621 1.00 46.89  ? 84   PHE E CZ    1 
ATOM   3454  N  N     . GLN E  1 85  ? 5.594   -31.333 38.228 1.00 44.09  ? 85   GLN E N     1 
ATOM   3455  C  CA    . GLN E  1 85  ? 6.383   -30.115 38.214 1.00 42.63  ? 85   GLN E CA    1 
ATOM   3456  C  C     . GLN E  1 85  ? 6.433   -29.640 39.649 1.00 41.94  ? 85   GLN E C     1 
ATOM   3457  O  O     . GLN E  1 85  ? 5.426   -29.685 40.362 1.00 41.64  ? 85   GLN E O     1 
ATOM   3458  C  CB    . GLN E  1 85  ? 5.727   -29.052 37.356 1.00 42.54  ? 85   GLN E CB    1 
ATOM   3459  C  CG    . GLN E  1 85  ? 5.672   -29.363 35.881 1.00 42.48  ? 85   GLN E CG    1 
ATOM   3460  C  CD    . GLN E  1 85  ? 5.032   -28.232 35.112 1.00 43.53  ? 85   GLN E CD    1 
ATOM   3461  O  OE1   . GLN E  1 85  ? 4.340   -27.392 35.698 1.00 44.55  ? 85   GLN E OE1   1 
ATOM   3462  N  NE2   . GLN E  1 85  ? 5.252   -28.195 33.798 1.00 42.97  ? 85   GLN E NE2   1 
ATOM   3463  N  N     . SER E  1 86  ? 7.602   -29.209 40.099 1.00 41.13  ? 86   SER E N     1 
ATOM   3464  C  CA    . SER E  1 86  ? 7.739   -28.885 41.510 1.00 40.40  ? 86   SER E CA    1 
ATOM   3465  C  C     . SER E  1 86  ? 6.792   -27.760 41.858 1.00 39.66  ? 86   SER E C     1 
ATOM   3466  O  O     . SER E  1 86  ? 6.334   -27.678 42.982 1.00 40.16  ? 86   SER E O     1 
ATOM   3467  C  CB    . SER E  1 86  ? 9.161   -28.500 41.846 1.00 40.32  ? 86   SER E CB    1 
ATOM   3468  O  OG    . SER E  1 86  ? 9.572   -27.483 40.955 1.00 41.78  ? 86   SER E OG    1 
ATOM   3469  N  N     . SER E  1 87  ? 6.489   -26.899 40.893 1.00 38.60  ? 87   SER E N     1 
ATOM   3470  C  CA    . SER E  1 87  ? 5.571   -25.808 41.142 1.00 37.63  ? 87   SER E CA    1 
ATOM   3471  C  C     . SER E  1 87  ? 4.175   -26.328 41.341 1.00 37.28  ? 87   SER E C     1 
ATOM   3472  O  O     . SER E  1 87  ? 3.391   -25.700 42.031 1.00 37.48  ? 87   SER E O     1 
ATOM   3473  C  CB    . SER E  1 87  ? 5.570   -24.806 40.007 1.00 37.48  ? 87   SER E CB    1 
ATOM   3474  O  OG    . SER E  1 87  ? 5.315   -25.459 38.789 1.00 38.03  ? 87   SER E OG    1 
ATOM   3475  N  N     . ALA E  1 88  ? 3.857   -27.471 40.741 1.00 36.89  ? 88   ALA E N     1 
ATOM   3476  C  CA    . ALA E  1 88  ? 2.558   -28.094 40.970 1.00 36.43  ? 88   ALA E CA    1 
ATOM   3477  C  C     . ALA E  1 88  ? 2.473   -28.609 42.404 1.00 36.20  ? 88   ALA E C     1 
ATOM   3478  O  O     . ALA E  1 88  ? 1.429   -28.497 43.053 1.00 36.25  ? 88   ALA E O     1 
ATOM   3479  C  CB    . ALA E  1 88  ? 2.290   -29.195 39.973 1.00 36.10  ? 88   ALA E CB    1 
ATOM   3480  N  N     . VAL E  1 89  ? 3.576   -29.131 42.922 1.00 35.99  ? 89   VAL E N     1 
ATOM   3481  C  CA    . VAL E  1 89  ? 3.576   -29.573 44.318 1.00 36.03  ? 89   VAL E CA    1 
ATOM   3482  C  C     . VAL E  1 89  ? 3.384   -28.397 45.244 1.00 36.15  ? 89   VAL E C     1 
ATOM   3483  O  O     . VAL E  1 89  ? 2.637   -28.500 46.217 1.00 36.35  ? 89   VAL E O     1 
ATOM   3484  C  CB    . VAL E  1 89  ? 4.835   -30.363 44.730 1.00 35.84  ? 89   VAL E CB    1 
ATOM   3485  C  CG1   . VAL E  1 89  ? 4.654   -30.955 46.110 1.00 35.28  ? 89   VAL E CG1   1 
ATOM   3486  C  CG2   . VAL E  1 89  ? 5.097   -31.465 43.746 1.00 35.73  ? 89   VAL E CG2   1 
ATOM   3487  N  N     . MET E  1 90  ? 4.043   -27.285 44.929 1.00 36.34  ? 90   MET E N     1 
ATOM   3488  C  CA    . MET E  1 90  ? 3.923   -26.070 45.729 1.00 37.09  ? 90   MET E CA    1 
ATOM   3489  C  C     . MET E  1 90  ? 2.520   -25.488 45.622 1.00 36.73  ? 90   MET E C     1 
ATOM   3490  O  O     . MET E  1 90  ? 1.967   -25.035 46.627 1.00 37.03  ? 90   MET E O     1 
ATOM   3491  C  CB    . MET E  1 90  ? 4.973   -25.023 45.339 1.00 37.77  ? 90   MET E CB    1 
ATOM   3492  C  CG    . MET E  1 90  ? 6.400   -25.354 45.766 1.00 41.24  ? 90   MET E CG    1 
ATOM   3493  S  SD    . MET E  1 90  ? 6.481   -25.882 47.506 1.00 49.76  ? 90   MET E SD    1 
ATOM   3494  C  CE    . MET E  1 90  ? 6.674   -24.318 48.384 1.00 49.11  ? 90   MET E CE    1 
ATOM   3495  N  N     . ALA E  1 91  ? 1.934   -25.526 44.418 1.00 35.95  ? 91   ALA E N     1 
ATOM   3496  C  CA    . ALA E  1 91  ? 0.567   -25.045 44.223 1.00 35.03  ? 91   ALA E CA    1 
ATOM   3497  C  C     . ALA E  1 91  ? -0.341  -25.786 45.177 1.00 34.71  ? 91   ALA E C     1 
ATOM   3498  O  O     . ALA E  1 91  ? -1.182  -25.190 45.839 1.00 34.82  ? 91   ALA E O     1 
ATOM   3499  C  CB    . ALA E  1 91  ? 0.117   -25.241 42.813 1.00 34.50  ? 91   ALA E CB    1 
ATOM   3500  N  N     . LEU E  1 92  ? -0.149  -27.088 45.284 1.00 34.32  ? 92   LEU E N     1 
ATOM   3501  C  CA    . LEU E  1 92  ? -0.990  -27.863 46.186 1.00 34.33  ? 92   LEU E CA    1 
ATOM   3502  C  C     . LEU E  1 92  ? -0.821  -27.477 47.655 1.00 34.09  ? 92   LEU E C     1 
ATOM   3503  O  O     . LEU E  1 92  ? -1.798  -27.413 48.399 1.00 34.05  ? 92   LEU E O     1 
ATOM   3504  C  CB    . LEU E  1 92  ? -0.757  -29.362 45.988 1.00 34.25  ? 92   LEU E CB    1 
ATOM   3505  C  CG    . LEU E  1 92  ? -1.384  -29.870 44.695 1.00 33.98  ? 92   LEU E CG    1 
ATOM   3506  C  CD1   . LEU E  1 92  ? -0.598  -31.030 44.214 1.00 34.31  ? 92   LEU E CD1   1 
ATOM   3507  C  CD2   . LEU E  1 92  ? -2.857  -30.211 44.874 1.00 31.70  ? 92   LEU E CD2   1 
ATOM   3508  N  N     . GLN E  1 93  ? 0.410   -27.208 48.067 1.00 33.61  ? 93   GLN E N     1 
ATOM   3509  C  CA    . GLN E  1 93  ? 0.661   -26.968 49.465 1.00 33.31  ? 93   GLN E CA    1 
ATOM   3510  C  C     . GLN E  1 93  ? 0.149   -25.614 49.876 1.00 32.98  ? 93   GLN E C     1 
ATOM   3511  O  O     . GLN E  1 93  ? -0.384  -25.468 50.974 1.00 33.28  ? 93   GLN E O     1 
ATOM   3512  C  CB    . GLN E  1 93  ? 2.137   -27.112 49.803 1.00 33.38  ? 93   GLN E CB    1 
ATOM   3513  C  CG    . GLN E  1 93  ? 2.392   -27.097 51.290 1.00 34.81  ? 93   GLN E CG    1 
ATOM   3514  C  CD    . GLN E  1 93  ? 3.818   -27.417 51.643 1.00 39.12  ? 93   GLN E CD    1 
ATOM   3515  O  OE1   . GLN E  1 93  ? 4.656   -27.657 50.767 1.00 42.32  ? 93   GLN E OE1   1 
ATOM   3516  N  NE2   . GLN E  1 93  ? 4.113   -27.429 52.937 1.00 40.55  ? 93   GLN E NE2   1 
ATOM   3517  N  N     . GLU E  1 94  ? 0.310   -24.627 48.996 1.00 32.42  ? 94   GLU E N     1 
ATOM   3518  C  CA    . GLU E  1 94  ? -0.166  -23.278 49.262 1.00 31.98  ? 94   GLU E CA    1 
ATOM   3519  C  C     . GLU E  1 94  ? -1.674  -23.287 49.411 1.00 31.59  ? 94   GLU E C     1 
ATOM   3520  O  O     . GLU E  1 94  ? -2.218  -22.660 50.306 1.00 31.78  ? 94   GLU E O     1 
ATOM   3521  C  CB    . GLU E  1 94  ? 0.223   -22.346 48.134 1.00 32.11  ? 94   GLU E CB    1 
ATOM   3522  C  CG    . GLU E  1 94  ? 1.668   -21.898 48.167 1.00 33.11  ? 94   GLU E CG    1 
ATOM   3523  C  CD    . GLU E  1 94  ? 1.937   -20.753 49.140 1.00 34.22  ? 94   GLU E CD    1 
ATOM   3524  O  OE1   . GLU E  1 94  ? 0.972   -20.164 49.694 1.00 33.01  ? 94   GLU E OE1   1 
ATOM   3525  O  OE2   . GLU E  1 94  ? 3.135   -20.444 49.333 1.00 34.50  ? 94   GLU E OE2   1 
ATOM   3526  N  N     . ALA E  1 95  ? -2.332  -24.037 48.539 1.00 31.01  ? 95   ALA E N     1 
ATOM   3527  C  CA    . ALA E  1 95  ? -3.767  -24.177 48.538 1.00 30.73  ? 95   ALA E CA    1 
ATOM   3528  C  C     . ALA E  1 95  ? -4.210  -24.862 49.789 1.00 30.93  ? 95   ALA E C     1 
ATOM   3529  O  O     . ALA E  1 95  ? -5.239  -24.510 50.347 1.00 31.90  ? 95   ALA E O     1 
ATOM   3530  C  CB    . ALA E  1 95  ? -4.194  -24.991 47.356 1.00 30.64  ? 95   ALA E CB    1 
ATOM   3531  N  N     . SER E  1 96  ? -3.437  -25.853 50.217 1.00 30.94  ? 96   SER E N     1 
ATOM   3532  C  CA    . SER E  1 96  ? -3.837  -26.759 51.294 1.00 30.67  ? 96   SER E CA    1 
ATOM   3533  C  C     . SER E  1 96  ? -3.733  -26.114 52.649 1.00 30.32  ? 96   SER E C     1 
ATOM   3534  O  O     . SER E  1 96  ? -4.604  -26.299 53.504 1.00 29.78  ? 96   SER E O     1 
ATOM   3535  C  CB    . SER E  1 96  ? -2.978  -28.017 51.280 1.00 30.58  ? 96   SER E CB    1 
ATOM   3536  O  OG    . SER E  1 96  ? -3.284  -28.788 50.141 1.00 31.30  ? 96   SER E OG    1 
ATOM   3537  N  N     . GLU E  1 97  ? -2.650  -25.368 52.845 1.00 30.09  ? 97   GLU E N     1 
ATOM   3538  C  CA    . GLU E  1 97  ? -2.461  -24.657 54.086 1.00 30.06  ? 97   GLU E CA    1 
ATOM   3539  C  C     . GLU E  1 97  ? -3.478  -23.505 54.159 1.00 30.02  ? 97   GLU E C     1 
ATOM   3540  O  O     . GLU E  1 97  ? -4.042  -23.244 55.227 1.00 29.97  ? 97   GLU E O     1 
ATOM   3541  C  CB    . GLU E  1 97  ? -1.017  -24.196 54.224 1.00 30.03  ? 97   GLU E CB    1 
ATOM   3542  C  CG    . GLU E  1 97  ? -0.006  -25.320 54.168 1.00 31.16  ? 97   GLU E CG    1 
ATOM   3543  C  CD    . GLU E  1 97  ? 1.307   -24.975 54.877 1.00 35.84  ? 97   GLU E CD    1 
ATOM   3544  O  OE1   . GLU E  1 97  ? 1.360   -23.960 55.622 1.00 36.50  ? 97   GLU E OE1   1 
ATOM   3545  O  OE2   . GLU E  1 97  ? 2.299   -25.728 54.697 1.00 37.28  ? 97   GLU E OE2   1 
ATOM   3546  N  N     . ALA E  1 98  ? -3.756  -22.874 53.011 1.00 29.48  ? 98   ALA E N     1 
ATOM   3547  C  CA    . ALA E  1 98  ? -4.746  -21.814 52.934 1.00 29.42  ? 98   ALA E CA    1 
ATOM   3548  C  C     . ALA E  1 98  ? -6.089  -22.327 53.366 1.00 30.25  ? 98   ALA E C     1 
ATOM   3549  O  O     . ALA E  1 98  ? -6.819  -21.653 54.096 1.00 31.04  ? 98   ALA E O     1 
ATOM   3550  C  CB    . ALA E  1 98  ? -4.847  -21.304 51.563 1.00 28.80  ? 98   ALA E CB    1 
ATOM   3551  N  N     . TYR E  1 99  ? -6.426  -23.522 52.897 1.00 31.04  ? 99   TYR E N     1 
ATOM   3552  C  CA    . TYR E  1 99  ? -7.672  -24.166 53.271 1.00 31.47  ? 99   TYR E CA    1 
ATOM   3553  C  C     . TYR E  1 99  ? -7.693  -24.508 54.750 1.00 31.68  ? 99   TYR E C     1 
ATOM   3554  O  O     . TYR E  1 99  ? -8.668  -24.210 55.436 1.00 32.38  ? 99   TYR E O     1 
ATOM   3555  C  CB    . TYR E  1 99  ? -7.907  -25.425 52.440 1.00 31.49  ? 99   TYR E CB    1 
ATOM   3556  C  CG    . TYR E  1 99  ? -9.011  -26.324 52.965 1.00 31.42  ? 99   TYR E CG    1 
ATOM   3557  C  CD1   . TYR E  1 99  ? -10.350 -26.052 52.691 1.00 30.48  ? 99   TYR E CD1   1 
ATOM   3558  C  CD2   . TYR E  1 99  ? -8.709  -27.455 53.724 1.00 31.47  ? 99   TYR E CD2   1 
ATOM   3559  C  CE1   . TYR E  1 99  ? -11.360 -26.879 53.154 1.00 31.57  ? 99   TYR E CE1   1 
ATOM   3560  C  CE2   . TYR E  1 99  ? -9.709  -28.295 54.197 1.00 32.11  ? 99   TYR E CE2   1 
ATOM   3561  C  CZ    . TYR E  1 99  ? -11.039 -28.008 53.911 1.00 32.49  ? 99   TYR E CZ    1 
ATOM   3562  O  OH    . TYR E  1 99  ? -12.045 -28.839 54.388 1.00 32.06  ? 99   TYR E OH    1 
ATOM   3563  N  N     . LEU E  1 100 ? -6.629  -25.127 55.243 1.00 31.69  ? 100  LEU E N     1 
ATOM   3564  C  CA    . LEU E  1 100 ? -6.657  -25.628 56.611 1.00 31.91  ? 100  LEU E CA    1 
ATOM   3565  C  C     . LEU E  1 100 ? -6.695  -24.510 57.641 1.00 32.24  ? 100  LEU E C     1 
ATOM   3566  O  O     . LEU E  1 100 ? -7.370  -24.641 58.670 1.00 32.61  ? 100  LEU E O     1 
ATOM   3567  C  CB    . LEU E  1 100 ? -5.495  -26.588 56.902 1.00 31.87  ? 100  LEU E CB    1 
ATOM   3568  C  CG    . LEU E  1 100 ? -5.490  -28.023 56.352 1.00 31.01  ? 100  LEU E CG    1 
ATOM   3569  C  CD1   . LEU E  1 100 ? -4.234  -28.735 56.816 1.00 30.01  ? 100  LEU E CD1   1 
ATOM   3570  C  CD2   . LEU E  1 100 ? -6.720  -28.805 56.768 1.00 29.86  ? 100  LEU E CD2   1 
ATOM   3571  N  N     . VAL E  1 101 ? -5.990  -23.414 57.356 1.00 32.02  ? 101  VAL E N     1 
ATOM   3572  C  CA    . VAL E  1 101 ? -5.968  -22.259 58.251 1.00 32.00  ? 101  VAL E CA    1 
ATOM   3573  C  C     . VAL E  1 101 ? -7.376  -21.655 58.395 1.00 32.25  ? 101  VAL E C     1 
ATOM   3574  O  O     . VAL E  1 101 ? -7.891  -21.482 59.501 1.00 32.19  ? 101  VAL E O     1 
ATOM   3575  C  CB    . VAL E  1 101 ? -4.934  -21.212 57.783 1.00 31.65  ? 101  VAL E CB    1 
ATOM   3576  C  CG1   . VAL E  1 101 ? -5.043  -19.954 58.576 1.00 31.95  ? 101  VAL E CG1   1 
ATOM   3577  C  CG2   . VAL E  1 101 ? -3.536  -21.746 57.951 1.00 32.15  ? 101  VAL E CG2   1 
ATOM   3578  N  N     . ALA E  1 102 ? -7.998  -21.372 57.261 1.00 32.66  ? 102  ALA E N     1 
ATOM   3579  C  CA    . ALA E  1 102 ? -9.346  -20.853 57.215 1.00 33.22  ? 102  ALA E CA    1 
ATOM   3580  C  C     . ALA E  1 102 ? -10.314 -21.782 57.918 1.00 33.70  ? 102  ALA E C     1 
ATOM   3581  O  O     . ALA E  1 102 ? -11.291 -21.339 58.532 1.00 34.39  ? 102  ALA E O     1 
ATOM   3582  C  CB    . ALA E  1 102 ? -9.760  -20.680 55.788 1.00 33.51  ? 102  ALA E CB    1 
ATOM   3583  N  N     . LEU E  1 103 ? -10.065 -23.079 57.822 1.00 33.77  ? 103  LEU E N     1 
ATOM   3584  C  CA    . LEU E  1 103 ? -10.935 -24.018 58.493 1.00 34.05  ? 103  LEU E CA    1 
ATOM   3585  C  C     . LEU E  1 103 ? -10.814 -23.842 60.009 1.00 34.50  ? 103  LEU E C     1 
ATOM   3586  O  O     . LEU E  1 103 ? -11.813 -23.765 60.719 1.00 34.70  ? 103  LEU E O     1 
ATOM   3587  C  CB    . LEU E  1 103 ? -10.609 -25.444 58.082 1.00 33.70  ? 103  LEU E CB    1 
ATOM   3588  C  CG    . LEU E  1 103 ? -11.511 -26.471 58.749 1.00 33.25  ? 103  LEU E CG    1 
ATOM   3589  C  CD1   . LEU E  1 103 ? -12.946 -26.254 58.336 1.00 32.37  ? 103  LEU E CD1   1 
ATOM   3590  C  CD2   . LEU E  1 103 ? -11.060 -27.868 58.390 1.00 33.90  ? 103  LEU E CD2   1 
ATOM   3591  N  N     . PHE E  1 104 ? -9.578  -23.748 60.491 1.00 34.81  ? 104  PHE E N     1 
ATOM   3592  C  CA    . PHE E  1 104 ? -9.324  -23.611 61.917 1.00 34.62  ? 104  PHE E CA    1 
ATOM   3593  C  C     . PHE E  1 104 ? -10.014 -22.402 62.500 1.00 34.75  ? 104  PHE E C     1 
ATOM   3594  O  O     . PHE E  1 104 ? -10.542 -22.477 63.605 1.00 34.56  ? 104  PHE E O     1 
ATOM   3595  C  CB    . PHE E  1 104 ? -7.834  -23.562 62.198 1.00 34.24  ? 104  PHE E CB    1 
ATOM   3596  C  CG    . PHE E  1 104 ? -7.197  -24.894 62.205 1.00 34.00  ? 104  PHE E CG    1 
ATOM   3597  C  CD1   . PHE E  1 104 ? -6.085  -25.152 61.422 1.00 35.12  ? 104  PHE E CD1   1 
ATOM   3598  C  CD2   . PHE E  1 104 ? -7.712  -25.917 62.994 1.00 33.65  ? 104  PHE E CD2   1 
ATOM   3599  C  CE1   . PHE E  1 104 ? -5.472  -26.440 61.439 1.00 34.98  ? 104  PHE E CE1   1 
ATOM   3600  C  CE2   . PHE E  1 104 ? -7.116  -27.197 63.014 1.00 33.47  ? 104  PHE E CE2   1 
ATOM   3601  C  CZ    . PHE E  1 104 ? -5.998  -27.459 62.238 1.00 33.26  ? 104  PHE E CZ    1 
ATOM   3602  N  N     . GLU E  1 105 ? -10.016 -21.298 61.750 1.00 34.87  ? 105  GLU E N     1 
ATOM   3603  C  CA    . GLU E  1 105 ? -10.709 -20.087 62.170 1.00 34.96  ? 105  GLU E CA    1 
ATOM   3604  C  C     . GLU E  1 105 ? -12.163 -20.413 62.416 1.00 35.02  ? 105  GLU E C     1 
ATOM   3605  O  O     . GLU E  1 105 ? -12.681 -20.109 63.497 1.00 35.15  ? 105  GLU E O     1 
ATOM   3606  C  CB    . GLU E  1 105 ? -10.615 -19.005 61.117 1.00 34.80  ? 105  GLU E CB    1 
ATOM   3607  C  CG    . GLU E  1 105 ? -9.216  -18.670 60.744 1.00 36.30  ? 105  GLU E CG    1 
ATOM   3608  C  CD    . GLU E  1 105 ? -9.121  -17.642 59.633 1.00 38.93  ? 105  GLU E CD    1 
ATOM   3609  O  OE1   . GLU E  1 105 ? -10.160 -17.308 59.002 1.00 39.27  ? 105  GLU E OE1   1 
ATOM   3610  O  OE2   . GLU E  1 105 ? -7.981  -17.166 59.403 1.00 40.33  ? 105  GLU E OE2   1 
ATOM   3611  N  N     . ASP E  1 106 ? -12.812 -21.049 61.432 1.00 34.69  ? 106  ASP E N     1 
ATOM   3612  C  CA    . ASP E  1 106 ? -14.229 -21.407 61.556 1.00 34.63  ? 106  ASP E CA    1 
ATOM   3613  C  C     . ASP E  1 106 ? -14.469 -22.309 62.757 1.00 34.44  ? 106  ASP E C     1 
ATOM   3614  O  O     . ASP E  1 106 ? -15.420 -22.132 63.517 1.00 34.15  ? 106  ASP E O     1 
ATOM   3615  C  CB    . ASP E  1 106 ? -14.726 -22.064 60.283 1.00 34.57  ? 106  ASP E CB    1 
ATOM   3616  C  CG    . ASP E  1 106 ? -14.843 -21.092 59.148 1.00 35.88  ? 106  ASP E CG    1 
ATOM   3617  O  OD1   . ASP E  1 106 ? -14.797 -19.875 59.432 1.00 37.52  ? 106  ASP E OD1   1 
ATOM   3618  O  OD2   . ASP E  1 106 ? -14.987 -21.528 57.977 1.00 37.11  ? 106  ASP E OD2   1 
ATOM   3619  N  N     . THR E  1 107 ? -13.555 -23.255 62.924 1.00 34.58  ? 107  THR E N     1 
ATOM   3620  C  CA    . THR E  1 107 ? -13.550 -24.190 64.031 1.00 34.67  ? 107  THR E CA    1 
ATOM   3621  C  C     . THR E  1 107 ? -13.422 -23.441 65.344 1.00 35.00  ? 107  THR E C     1 
ATOM   3622  O  O     . THR E  1 107 ? -14.090 -23.758 66.318 1.00 34.86  ? 107  THR E O     1 
ATOM   3623  C  CB    . THR E  1 107 ? -12.367 -25.158 63.881 1.00 34.62  ? 107  THR E CB    1 
ATOM   3624  O  OG1   . THR E  1 107 ? -12.439 -25.797 62.604 1.00 34.42  ? 107  THR E OG1   1 
ATOM   3625  C  CG2   . THR E  1 107 ? -12.363 -26.199 64.969 1.00 33.65  ? 107  THR E CG2   1 
ATOM   3626  N  N     . ASN E  1 108 ? -12.556 -22.441 65.355 1.00 35.44  ? 108  ASN E N     1 
ATOM   3627  C  CA    . ASN E  1 108 ? -12.282 -21.696 66.554 1.00 36.21  ? 108  ASN E CA    1 
ATOM   3628  C  C     . ASN E  1 108 ? -13.515 -20.903 66.928 1.00 36.91  ? 108  ASN E C     1 
ATOM   3629  O  O     . ASN E  1 108 ? -13.824 -20.730 68.112 1.00 37.24  ? 108  ASN E O     1 
ATOM   3630  C  CB    . ASN E  1 108 ? -11.127 -20.757 66.291 1.00 36.38  ? 108  ASN E CB    1 
ATOM   3631  C  CG    . ASN E  1 108 ? -10.545 -20.195 67.541 1.00 36.65  ? 108  ASN E CG    1 
ATOM   3632  O  OD1   . ASN E  1 108 ? -10.469 -20.873 68.550 1.00 37.98  ? 108  ASN E OD1   1 
ATOM   3633  N  ND2   . ASN E  1 108 ? -10.109 -18.948 67.480 1.00 36.92  ? 108  ASN E ND2   1 
ATOM   3634  N  N     . LEU E  1 109 ? -14.220 -20.435 65.900 1.00 37.30  ? 109  LEU E N     1 
ATOM   3635  C  CA    . LEU E  1 109 ? -15.487 -19.743 66.066 1.00 37.77  ? 109  LEU E CA    1 
ATOM   3636  C  C     . LEU E  1 109 ? -16.542 -20.644 66.677 1.00 38.39  ? 109  LEU E C     1 
ATOM   3637  O  O     . LEU E  1 109 ? -17.346 -20.197 67.505 1.00 38.93  ? 109  LEU E O     1 
ATOM   3638  C  CB    . LEU E  1 109 ? -15.984 -19.215 64.722 1.00 37.65  ? 109  LEU E CB    1 
ATOM   3639  C  CG    . LEU E  1 109 ? -15.941 -17.703 64.542 1.00 36.52  ? 109  LEU E CG    1 
ATOM   3640  C  CD1   . LEU E  1 109 ? -14.895 -17.092 65.434 1.00 35.57  ? 109  LEU E CD1   1 
ATOM   3641  C  CD2   . LEU E  1 109 ? -15.684 -17.371 63.097 1.00 35.07  ? 109  LEU E CD2   1 
ATOM   3642  N  N     . CYS E  1 110 ? -16.537 -21.910 66.262 1.00 38.60  ? 110  CYS E N     1 
ATOM   3643  C  CA    . CYS E  1 110 ? -17.453 -22.908 66.819 1.00 38.83  ? 110  CYS E CA    1 
ATOM   3644  C  C     . CYS E  1 110 ? -17.176 -23.254 68.289 1.00 39.00  ? 110  CYS E C     1 
ATOM   3645  O  O     . CYS E  1 110 ? -18.103 -23.388 69.074 1.00 38.79  ? 110  CYS E O     1 
ATOM   3646  C  CB    . CYS E  1 110 ? -17.470 -24.170 65.950 1.00 38.58  ? 110  CYS E CB    1 
ATOM   3647  S  SG    . CYS E  1 110 ? -18.265 -23.909 64.368 1.00 37.98  ? 110  CYS E SG    1 
ATOM   3648  N  N     . ALA E  1 111 ? -15.905 -23.399 68.654 1.00 39.43  ? 111  ALA E N     1 
ATOM   3649  C  CA    . ALA E  1 111 ? -15.557 -23.753 70.022 1.00 39.86  ? 111  ALA E CA    1 
ATOM   3650  C  C     . ALA E  1 111 ? -15.978 -22.607 70.929 1.00 40.18  ? 111  ALA E C     1 
ATOM   3651  O  O     . ALA E  1 111 ? -16.636 -22.811 71.949 1.00 40.02  ? 111  ALA E O     1 
ATOM   3652  C  CB    . ALA E  1 111 ? -14.078 -24.026 70.146 1.00 39.59  ? 111  ALA E CB    1 
ATOM   3653  N  N     . ILE E  1 112 ? -15.627 -21.396 70.524 1.00 40.63  ? 112  ILE E N     1 
ATOM   3654  C  CA    . ILE E  1 112 ? -16.027 -20.215 71.260 1.00 40.97  ? 112  ILE E CA    1 
ATOM   3655  C  C     . ILE E  1 112 ? -17.541 -20.120 71.378 1.00 41.53  ? 112  ILE E C     1 
ATOM   3656  O  O     . ILE E  1 112 ? -18.049 -19.717 72.412 1.00 41.68  ? 112  ILE E O     1 
ATOM   3657  C  CB    . ILE E  1 112 ? -15.454 -18.965 70.635 1.00 40.66  ? 112  ILE E CB    1 
ATOM   3658  C  CG1   . ILE E  1 112 ? -13.934 -19.003 70.771 1.00 40.19  ? 112  ILE E CG1   1 
ATOM   3659  C  CG2   . ILE E  1 112 ? -16.032 -17.734 71.301 1.00 40.58  ? 112  ILE E CG2   1 
ATOM   3660  C  CD1   . ILE E  1 112 ? -13.219 -17.919 70.013 1.00 41.05  ? 112  ILE E CD1   1 
ATOM   3661  N  N     . HIS E  1 113 ? -18.260 -20.527 70.340 1.00 42.25  ? 113  HIS E N     1 
ATOM   3662  C  CA    . HIS E  1 113 ? -19.720 -20.578 70.418 1.00 43.11  ? 113  HIS E CA    1 
ATOM   3663  C  C     . HIS E  1 113 ? -20.210 -21.476 71.557 1.00 43.62  ? 113  HIS E C     1 
ATOM   3664  O  O     . HIS E  1 113 ? -21.203 -21.179 72.206 1.00 43.78  ? 113  HIS E O     1 
ATOM   3665  C  CB    . HIS E  1 113 ? -20.315 -21.050 69.099 1.00 42.96  ? 113  HIS E CB    1 
ATOM   3666  C  CG    . HIS E  1 113 ? -21.803 -20.940 69.039 1.00 43.39  ? 113  HIS E CG    1 
ATOM   3667  N  ND1   . HIS E  1 113 ? -22.451 -19.739 68.843 1.00 44.32  ? 113  HIS E ND1   1 
ATOM   3668  C  CD2   . HIS E  1 113 ? -22.774 -21.881 69.137 1.00 43.96  ? 113  HIS E CD2   1 
ATOM   3669  C  CE1   . HIS E  1 113 ? -23.759 -19.946 68.825 1.00 44.58  ? 113  HIS E CE1   1 
ATOM   3670  N  NE2   . HIS E  1 113 ? -23.982 -21.238 68.994 1.00 43.48  ? 113  HIS E NE2   1 
ATOM   3671  N  N     . ALA E  1 114 ? -19.494 -22.572 71.788 1.00 44.40  ? 114  ALA E N     1 
ATOM   3672  C  CA    . ALA E  1 114 ? -19.834 -23.542 72.821 1.00 44.83  ? 114  ALA E CA    1 
ATOM   3673  C  C     . ALA E  1 114 ? -19.253 -23.108 74.152 1.00 45.39  ? 114  ALA E C     1 
ATOM   3674  O  O     . ALA E  1 114 ? -19.213 -23.889 75.104 1.00 45.65  ? 114  ALA E O     1 
ATOM   3675  C  CB    . ALA E  1 114 ? -19.302 -24.915 72.444 1.00 44.64  ? 114  ALA E CB    1 
ATOM   3676  N  N     . LYS E  1 115 ? -18.783 -21.867 74.212 1.00 45.90  ? 115  LYS E N     1 
ATOM   3677  C  CA    . LYS E  1 115 ? -18.164 -21.321 75.422 1.00 46.43  ? 115  LYS E CA    1 
ATOM   3678  C  C     . LYS E  1 115 ? -16.860 -22.035 75.834 1.00 45.98  ? 115  LYS E C     1 
ATOM   3679  O  O     . LYS E  1 115 ? -16.561 -22.152 77.009 1.00 46.20  ? 115  LYS E O     1 
ATOM   3680  C  CB    . LYS E  1 115 ? -19.186 -21.282 76.576 1.00 46.76  ? 115  LYS E CB    1 
ATOM   3681  C  CG    . LYS E  1 115 ? -20.213 -20.146 76.481 1.00 48.84  ? 115  LYS E CG    1 
ATOM   3682  C  CD    . LYS E  1 115 ? -21.569 -20.558 77.082 1.00 53.21  ? 115  LYS E CD    1 
ATOM   3683  C  CE    . LYS E  1 115 ? -22.212 -19.434 77.926 1.00 54.84  ? 115  LYS E CE    1 
ATOM   3684  N  NZ    . LYS E  1 115 ? -22.209 -18.094 77.234 1.00 56.01  ? 115  LYS E NZ    1 
ATOM   3685  N  N     . ARG E  1 116 ? -16.084 -22.504 74.865 1.00 45.63  ? 116  ARG E N     1 
ATOM   3686  C  CA    . ARG E  1 116 ? -14.786 -23.120 75.151 1.00 45.22  ? 116  ARG E CA    1 
ATOM   3687  C  C     . ARG E  1 116 ? -13.658 -22.376 74.433 1.00 45.29  ? 116  ARG E C     1 
ATOM   3688  O  O     . ARG E  1 116 ? -13.910 -21.517 73.580 1.00 45.39  ? 116  ARG E O     1 
ATOM   3689  C  CB    . ARG E  1 116 ? -14.769 -24.569 74.691 1.00 45.02  ? 116  ARG E CB    1 
ATOM   3690  C  CG    . ARG E  1 116 ? -15.858 -25.424 75.234 1.00 44.13  ? 116  ARG E CG    1 
ATOM   3691  C  CD    . ARG E  1 116 ? -15.721 -26.825 74.678 1.00 43.76  ? 116  ARG E CD    1 
ATOM   3692  N  NE    . ARG E  1 116 ? -16.593 -27.077 73.524 1.00 43.93  ? 116  ARG E NE    1 
ATOM   3693  C  CZ    . ARG E  1 116 ? -16.198 -27.173 72.252 1.00 42.81  ? 116  ARG E CZ    1 
ATOM   3694  N  NH1   . ARG E  1 116 ? -14.924 -27.021 71.908 1.00 42.25  ? 116  ARG E NH1   1 
ATOM   3695  N  NH2   . ARG E  1 116 ? -17.100 -27.419 71.316 1.00 42.53  ? 116  ARG E NH2   1 
ATOM   3696  N  N     . VAL E  1 117 ? -12.418 -22.724 74.771 1.00 44.97  ? 117  VAL E N     1 
ATOM   3697  C  CA    . VAL E  1 117 ? -11.244 -22.173 74.093 1.00 44.78  ? 117  VAL E CA    1 
ATOM   3698  C  C     . VAL E  1 117 ? -10.450 -23.278 73.416 1.00 44.46  ? 117  VAL E C     1 
ATOM   3699  O  O     . VAL E  1 117 ? -9.489  -23.017 72.693 1.00 44.57  ? 117  VAL E O     1 
ATOM   3700  C  CB    . VAL E  1 117 ? -10.329 -21.424 75.058 1.00 44.72  ? 117  VAL E CB    1 
ATOM   3701  C  CG1   . VAL E  1 117 ? -11.124 -20.408 75.827 1.00 45.59  ? 117  VAL E CG1   1 
ATOM   3702  C  CG2   . VAL E  1 117 ? -9.672  -22.385 76.017 1.00 45.35  ? 117  VAL E CG2   1 
ATOM   3703  N  N     . THR E  1 118 ? -10.873 -24.511 73.653 1.00 44.08  ? 118  THR E N     1 
ATOM   3704  C  CA    . THR E  1 118 ? -10.211 -25.667 73.107 1.00 43.77  ? 118  THR E CA    1 
ATOM   3705  C  C     . THR E  1 118 ? -11.006 -26.203 71.942 1.00 43.55  ? 118  THR E C     1 
ATOM   3706  O  O     . THR E  1 118 ? -12.128 -26.669 72.135 1.00 43.67  ? 118  THR E O     1 
ATOM   3707  C  CB    . THR E  1 118 ? -10.150 -26.767 74.152 1.00 43.76  ? 118  THR E CB    1 
ATOM   3708  O  OG1   . THR E  1 118 ? -9.886  -26.190 75.438 1.00 43.89  ? 118  THR E OG1   1 
ATOM   3709  C  CG2   . THR E  1 118 ? -9.072  -27.763 73.791 1.00 43.86  ? 118  THR E CG2   1 
ATOM   3710  N  N     . ILE E  1 119 ? -10.437 -26.151 70.742 1.00 43.18  ? 119  ILE E N     1 
ATOM   3711  C  CA    . ILE E  1 119 ? -11.097 -26.740 69.571 1.00 43.36  ? 119  ILE E CA    1 
ATOM   3712  C  C     . ILE E  1 119 ? -11.144 -28.279 69.650 1.00 43.77  ? 119  ILE E C     1 
ATOM   3713  O  O     . ILE E  1 119 ? -10.166 -28.908 70.052 1.00 44.09  ? 119  ILE E O     1 
ATOM   3714  C  CB    . ILE E  1 119 ? -10.477 -26.261 68.230 1.00 43.13  ? 119  ILE E CB    1 
ATOM   3715  C  CG1   . ILE E  1 119 ? -8.972  -26.517 68.184 1.00 43.00  ? 119  ILE E CG1   1 
ATOM   3716  C  CG2   . ILE E  1 119 ? -10.742 -24.784 68.024 1.00 43.14  ? 119  ILE E CG2   1 
ATOM   3717  C  CD1   . ILE E  1 119 ? -8.416  -26.661 66.793 1.00 41.98  ? 119  ILE E CD1   1 
ATOM   3718  N  N     . MET E  1 120 ? -12.286 -28.871 69.295 1.00 43.97  ? 120  MET E N     1 
ATOM   3719  C  CA    . MET E  1 120 ? -12.480 -30.331 69.359 1.00 44.34  ? 120  MET E CA    1 
ATOM   3720  C  C     . MET E  1 120 ? -13.041 -30.833 68.028 1.00 44.20  ? 120  MET E C     1 
ATOM   3721  O  O     . MET E  1 120 ? -13.622 -30.049 67.290 1.00 44.29  ? 120  MET E O     1 
ATOM   3722  C  CB    . MET E  1 120 ? -13.435 -30.697 70.497 1.00 44.10  ? 120  MET E CB    1 
ATOM   3723  C  CG    . MET E  1 120 ? -12.960 -30.291 71.886 1.00 44.78  ? 120  MET E CG    1 
ATOM   3724  S  SD    . MET E  1 120 ? -14.253 -30.375 73.154 1.00 45.50  ? 120  MET E SD    1 
ATOM   3725  C  CE    . MET E  1 120 ? -14.318 -32.138 73.475 1.00 45.58  ? 120  MET E CE    1 
ATOM   3726  N  N     . PRO E  1 121 ? -12.871 -32.137 67.703 1.00 44.19  ? 121  PRO E N     1 
ATOM   3727  C  CA    . PRO E  1 121 ? -13.401 -32.621 66.426 1.00 43.99  ? 121  PRO E CA    1 
ATOM   3728  C  C     . PRO E  1 121 ? -14.839 -32.182 66.119 1.00 43.81  ? 121  PRO E C     1 
ATOM   3729  O  O     . PRO E  1 121 ? -15.148 -31.871 64.962 1.00 44.26  ? 121  PRO E O     1 
ATOM   3730  C  CB    . PRO E  1 121 ? -13.299 -34.140 66.562 1.00 43.73  ? 121  PRO E CB    1 
ATOM   3731  C  CG    . PRO E  1 121 ? -12.127 -34.343 67.410 1.00 43.61  ? 121  PRO E CG    1 
ATOM   3732  C  CD    . PRO E  1 121 ? -12.176 -33.224 68.423 1.00 44.39  ? 121  PRO E CD    1 
ATOM   3733  N  N     . LYS E  1 122 ? -15.701 -32.128 67.128 1.00 43.18  ? 122  LYS E N     1 
ATOM   3734  C  CA    . LYS E  1 122 ? -17.068 -31.701 66.880 1.00 42.79  ? 122  LYS E CA    1 
ATOM   3735  C  C     . LYS E  1 122 ? -17.143 -30.287 66.319 1.00 42.41  ? 122  LYS E C     1 
ATOM   3736  O  O     . LYS E  1 122 ? -18.067 -29.967 65.582 1.00 42.80  ? 122  LYS E O     1 
ATOM   3737  C  CB    . LYS E  1 122 ? -17.973 -31.884 68.109 1.00 43.04  ? 122  LYS E CB    1 
ATOM   3738  C  CG    . LYS E  1 122 ? -17.666 -31.054 69.331 1.00 43.51  ? 122  LYS E CG    1 
ATOM   3739  C  CD    . LYS E  1 122 ? -18.640 -31.421 70.434 1.00 45.57  ? 122  LYS E CD    1 
ATOM   3740  C  CE    . LYS E  1 122 ? -18.036 -31.140 71.791 1.00 49.22  ? 122  LYS E CE    1 
ATOM   3741  N  NZ    . LYS E  1 122 ? -18.895 -31.629 72.918 1.00 51.21  ? 122  LYS E NZ    1 
ATOM   3742  N  N     . ASP E  1 123 ? -16.160 -29.455 66.643 1.00 41.64  ? 123  ASP E N     1 
ATOM   3743  C  CA    . ASP E  1 123 ? -16.099 -28.116 66.086 1.00 41.08  ? 123  ASP E CA    1 
ATOM   3744  C  C     . ASP E  1 123 ? -15.744 -28.126 64.610 1.00 40.72  ? 123  ASP E C     1 
ATOM   3745  O  O     . ASP E  1 123 ? -16.366 -27.425 63.829 1.00 40.81  ? 123  ASP E O     1 
ATOM   3746  C  CB    . ASP E  1 123 ? -15.104 -27.265 66.845 1.00 41.24  ? 123  ASP E CB    1 
ATOM   3747  C  CG    . ASP E  1 123 ? -15.523 -27.014 68.263 1.00 41.91  ? 123  ASP E CG    1 
ATOM   3748  O  OD1   . ASP E  1 123 ? -16.705 -26.648 68.475 1.00 43.25  ? 123  ASP E OD1   1 
ATOM   3749  O  OD2   . ASP E  1 123 ? -14.663 -27.161 69.160 1.00 41.97  ? 123  ASP E OD2   1 
ATOM   3750  N  N     . ILE E  1 124 ? -14.747 -28.919 64.225 1.00 40.37  ? 124  ILE E N     1 
ATOM   3751  C  CA    . ILE E  1 124 ? -14.392 -29.072 62.812 1.00 39.81  ? 124  ILE E CA    1 
ATOM   3752  C  C     . ILE E  1 124 ? -15.602 -29.593 62.062 1.00 39.87  ? 124  ILE E C     1 
ATOM   3753  O  O     . ILE E  1 124 ? -15.947 -29.088 61.002 1.00 39.57  ? 124  ILE E O     1 
ATOM   3754  C  CB    . ILE E  1 124 ? -13.185 -30.021 62.604 1.00 39.66  ? 124  ILE E CB    1 
ATOM   3755  C  CG1   . ILE E  1 124 ? -11.949 -29.438 63.291 1.00 39.70  ? 124  ILE E CG1   1 
ATOM   3756  C  CG2   . ILE E  1 124 ? -12.912 -30.234 61.120 1.00 38.73  ? 124  ILE E CG2   1 
ATOM   3757  C  CD1   . ILE E  1 124 ? -10.636 -30.151 63.012 1.00 39.73  ? 124  ILE E CD1   1 
ATOM   3758  N  N     . GLN E  1 125 ? -16.262 -30.590 62.639 1.00 40.15  ? 125  GLN E N     1 
ATOM   3759  C  CA    . GLN E  1 125 ? -17.433 -31.185 62.013 1.00 40.56  ? 125  GLN E CA    1 
ATOM   3760  C  C     . GLN E  1 125 ? -18.588 -30.190 61.825 1.00 40.14  ? 125  GLN E C     1 
ATOM   3761  O  O     . GLN E  1 125 ? -19.225 -30.171 60.768 1.00 40.36  ? 125  GLN E O     1 
ATOM   3762  C  CB    . GLN E  1 125 ? -17.888 -32.426 62.783 1.00 40.92  ? 125  GLN E CB    1 
ATOM   3763  C  CG    . GLN E  1 125 ? -17.039 -33.672 62.536 1.00 42.24  ? 125  GLN E CG    1 
ATOM   3764  C  CD    . GLN E  1 125 ? -16.822 -34.481 63.811 1.00 44.76  ? 125  GLN E CD    1 
ATOM   3765  O  OE1   . GLN E  1 125 ? -15.710 -34.922 64.083 1.00 46.69  ? 125  GLN E OE1   1 
ATOM   3766  N  NE2   . GLN E  1 125 ? -17.874 -34.653 64.611 1.00 44.83  ? 125  GLN E NE2   1 
ATOM   3767  N  N     . LEU E  1 126 ? -18.856 -29.362 62.829 1.00 39.37  ? 126  LEU E N     1 
ATOM   3768  C  CA    . LEU E  1 126 ? -19.932 -28.403 62.697 1.00 38.89  ? 126  LEU E CA    1 
ATOM   3769  C  C     . LEU E  1 126 ? -19.598 -27.437 61.581 1.00 39.20  ? 126  LEU E C     1 
ATOM   3770  O  O     . LEU E  1 126 ? -20.432 -27.164 60.728 1.00 39.29  ? 126  LEU E O     1 
ATOM   3771  C  CB    . LEU E  1 126 ? -20.189 -27.659 64.001 1.00 38.42  ? 126  LEU E CB    1 
ATOM   3772  C  CG    . LEU E  1 126 ? -21.304 -26.623 63.935 1.00 37.48  ? 126  LEU E CG    1 
ATOM   3773  C  CD1   . LEU E  1 126 ? -22.646 -27.283 63.953 1.00 37.89  ? 126  LEU E CD1   1 
ATOM   3774  C  CD2   . LEU E  1 126 ? -21.215 -25.698 65.098 1.00 38.06  ? 126  LEU E CD2   1 
ATOM   3775  N  N     . ALA E  1 127 ? -18.363 -26.953 61.581 1.00 39.66  ? 127  ALA E N     1 
ATOM   3776  C  CA    . ALA E  1 127 ? -17.871 -26.031 60.562 1.00 40.29  ? 127  ALA E CA    1 
ATOM   3777  C  C     . ALA E  1 127 ? -18.057 -26.574 59.157 1.00 40.87  ? 127  ALA E C     1 
ATOM   3778  O  O     . ALA E  1 127 ? -18.567 -25.891 58.281 1.00 41.04  ? 127  ALA E O     1 
ATOM   3779  C  CB    . ALA E  1 127 ? -16.402 -25.714 60.802 1.00 40.11  ? 127  ALA E CB    1 
ATOM   3780  N  N     . ARG E  1 128 ? -17.646 -27.816 58.955 1.00 41.80  ? 128  ARG E N     1 
ATOM   3781  C  CA    . ARG E  1 128 ? -17.659 -28.412 57.646 1.00 42.45  ? 128  ARG E CA    1 
ATOM   3782  C  C     . ARG E  1 128 ? -19.076 -28.738 57.224 1.00 43.19  ? 128  ARG E C     1 
ATOM   3783  O  O     . ARG E  1 128 ? -19.378 -28.727 56.049 1.00 43.38  ? 128  ARG E O     1 
ATOM   3784  C  CB    . ARG E  1 128 ? -16.767 -29.642 57.625 1.00 42.39  ? 128  ARG E CB    1 
ATOM   3785  C  CG    . ARG E  1 128 ? -15.293 -29.320 57.715 1.00 42.37  ? 128  ARG E CG    1 
ATOM   3786  C  CD    . ARG E  1 128 ? -14.424 -30.561 57.501 1.00 44.96  ? 128  ARG E CD    1 
ATOM   3787  N  NE    . ARG E  1 128 ? -14.440 -31.047 56.115 1.00 47.01  ? 128  ARG E NE    1 
ATOM   3788  C  CZ    . ARG E  1 128 ? -14.825 -32.269 55.753 1.00 47.35  ? 128  ARG E CZ    1 
ATOM   3789  N  NH1   . ARG E  1 128 ? -15.201 -33.131 56.680 1.00 48.14  ? 128  ARG E NH1   1 
ATOM   3790  N  NH2   . ARG E  1 128 ? -14.823 -32.636 54.475 1.00 47.23  ? 128  ARG E NH2   1 
ATOM   3791  N  N     . ARG E  1 129 ? -19.956 -29.015 58.173 1.00 44.51  ? 129  ARG E N     1 
ATOM   3792  C  CA    . ARG E  1 129 ? -21.350 -29.226 57.816 1.00 45.97  ? 129  ARG E CA    1 
ATOM   3793  C  C     . ARG E  1 129 ? -21.943 -27.937 57.277 1.00 46.07  ? 129  ARG E C     1 
ATOM   3794  O  O     . ARG E  1 129 ? -22.614 -27.953 56.261 1.00 46.58  ? 129  ARG E O     1 
ATOM   3795  C  CB    . ARG E  1 129 ? -22.181 -29.765 58.981 1.00 46.22  ? 129  ARG E CB    1 
ATOM   3796  C  CG    . ARG E  1 129 ? -23.604 -30.156 58.585 1.00 49.38  ? 129  ARG E CG    1 
ATOM   3797  C  CD    . ARG E  1 129 ? -24.111 -31.324 59.472 1.00 56.80  ? 129  ARG E CD    1 
ATOM   3798  N  NE    . ARG E  1 129 ? -25.542 -31.642 59.267 1.00 61.05  ? 129  ARG E NE    1 
ATOM   3799  C  CZ    . ARG E  1 129 ? -26.330 -32.275 60.152 1.00 61.88  ? 129  ARG E CZ    1 
ATOM   3800  N  NH1   . ARG E  1 129 ? -25.859 -32.676 61.337 1.00 62.06  ? 129  ARG E NH1   1 
ATOM   3801  N  NH2   . ARG E  1 129 ? -27.609 -32.497 59.854 1.00 61.85  ? 129  ARG E NH2   1 
ATOM   3802  N  N     . ILE E  1 130 ? -21.666 -26.818 57.927 1.00 46.39  ? 130  ILE E N     1 
ATOM   3803  C  CA    . ILE E  1 130 ? -22.280 -25.553 57.518 1.00 46.77  ? 130  ILE E CA    1 
ATOM   3804  C  C     . ILE E  1 130 ? -21.714 -25.015 56.201 1.00 47.41  ? 130  ILE E C     1 
ATOM   3805  O  O     . ILE E  1 130 ? -22.474 -24.534 55.359 1.00 47.67  ? 130  ILE E O     1 
ATOM   3806  C  CB    . ILE E  1 130 ? -22.234 -24.503 58.633 1.00 46.46  ? 130  ILE E CB    1 
ATOM   3807  C  CG1   . ILE E  1 130 ? -23.080 -24.987 59.812 1.00 46.36  ? 130  ILE E CG1   1 
ATOM   3808  C  CG2   . ILE E  1 130 ? -22.780 -23.195 58.139 1.00 46.02  ? 130  ILE E CG2   1 
ATOM   3809  C  CD1   . ILE E  1 130 ? -22.759 -24.332 61.119 1.00 45.65  ? 130  ILE E CD1   1 
ATOM   3810  N  N     . ARG E  1 131 ? -20.395 -25.116 56.025 1.00 47.92  ? 131  ARG E N     1 
ATOM   3811  C  CA    . ARG E  1 131 ? -19.725 -24.838 54.753 1.00 48.39  ? 131  ARG E CA    1 
ATOM   3812  C  C     . ARG E  1 131 ? -20.306 -25.632 53.570 1.00 49.77  ? 131  ARG E C     1 
ATOM   3813  O  O     . ARG E  1 131 ? -20.028 -25.326 52.409 1.00 50.14  ? 131  ARG E O     1 
ATOM   3814  C  CB    . ARG E  1 131 ? -18.255 -25.201 54.877 1.00 47.79  ? 131  ARG E CB    1 
ATOM   3815  C  CG    . ARG E  1 131 ? -17.465 -24.265 55.725 1.00 46.56  ? 131  ARG E CG    1 
ATOM   3816  C  CD    . ARG E  1 131 ? -16.168 -24.892 56.162 1.00 43.26  ? 131  ARG E CD    1 
ATOM   3817  N  NE    . ARG E  1 131 ? -15.122 -23.897 56.367 1.00 41.21  ? 131  ARG E NE    1 
ATOM   3818  C  CZ    . ARG E  1 131 ? -13.946 -23.917 55.749 1.00 41.42  ? 131  ARG E CZ    1 
ATOM   3819  N  NH1   . ARG E  1 131 ? -13.662 -24.885 54.895 1.00 40.42  ? 131  ARG E NH1   1 
ATOM   3820  N  NH2   . ARG E  1 131 ? -13.035 -22.986 55.996 1.00 43.02  ? 131  ARG E NH2   1 
ATOM   3821  N  N     . GLY E  1 132 ? -21.089 -26.664 53.859 1.00 50.96  ? 132  GLY E N     1 
ATOM   3822  C  CA    . GLY E  1 132 ? -21.651 -27.485 52.813 1.00 52.94  ? 132  GLY E CA    1 
ATOM   3823  C  C     . GLY E  1 132 ? -20.631 -28.442 52.246 1.00 54.65  ? 132  GLY E C     1 
ATOM   3824  O  O     . GLY E  1 132 ? -20.738 -28.846 51.093 1.00 54.81  ? 132  GLY E O     1 
ATOM   3825  N  N     . GLU E  1 133 ? -19.638 -28.796 53.061 1.00 56.54  ? 133  GLU E N     1 
ATOM   3826  C  CA    . GLU E  1 133 ? -18.665 -29.836 52.732 1.00 58.37  ? 133  GLU E CA    1 
ATOM   3827  C  C     . GLU E  1 133 ? -19.174 -31.203 53.186 1.00 61.09  ? 133  GLU E C     1 
ATOM   3828  O  O     . GLU E  1 133 ? -18.806 -32.243 52.621 1.00 61.57  ? 133  GLU E O     1 
ATOM   3829  C  CB    . GLU E  1 133 ? -17.316 -29.544 53.394 1.00 58.04  ? 133  GLU E CB    1 
ATOM   3830  C  CG    . GLU E  1 133 ? -16.518 -28.419 52.730 1.00 57.27  ? 133  GLU E CG    1 
ATOM   3831  C  CD    . GLU E  1 133 ? -15.213 -28.065 53.453 1.00 56.49  ? 133  GLU E CD    1 
ATOM   3832  O  OE1   . GLU E  1 133 ? -14.538 -28.967 53.990 1.00 52.75  ? 133  GLU E OE1   1 
ATOM   3833  O  OE2   . GLU E  1 133 ? -14.855 -26.872 53.462 1.00 53.04  ? 133  GLU E OE2   1 
ATOM   3834  N  N     . ARG E  1 134 ? -20.023 -31.208 54.212 1.00 64.16  ? 134  ARG E N     1 
ATOM   3835  C  CA    . ARG E  1 134 ? -20.536 -32.468 54.761 1.00 67.02  ? 134  ARG E CA    1 
ATOM   3836  C  C     . ARG E  1 134 ? -21.980 -32.787 54.375 1.00 68.16  ? 134  ARG E C     1 
ATOM   3837  O  O     . ARG E  1 134 ? -22.224 -33.646 53.499 1.00 68.80  ? 134  ARG E O     1 
ATOM   3838  C  CB    . ARG E  1 134 ? -20.333 -32.560 56.285 1.00 67.28  ? 134  ARG E CB    1 
ATOM   3839  C  CG    . ARG E  1 134 ? -19.034 -33.232 56.663 1.00 70.19  ? 134  ARG E CG    1 
ATOM   3840  C  CD    . ARG E  1 134 ? -18.848 -34.566 55.901 1.00 75.65  ? 134  ARG E CD    1 
ATOM   3841  N  NE    . ARG E  1 134 ? -17.442 -35.019 55.909 1.00 79.85  ? 134  ARG E NE    1 
ATOM   3842  C  CZ    . ARG E  1 134 ? -17.044 -36.292 56.073 1.00 80.70  ? 134  ARG E CZ    1 
ATOM   3843  N  NH1   . ARG E  1 134 ? -17.949 -37.282 56.254 1.00 80.90  ? 134  ARG E NH1   1 
ATOM   3844  N  NH2   . ARG E  1 134 ? -15.729 -36.570 56.068 1.00 80.24  ? 134  ARG E NH2   1 
ATOM   3845  N  N     . ALA E  1 135 ? -22.930 -32.101 55.017 1.00 69.22  ? 135  ALA E N     1 
ATOM   3846  C  CA    . ALA E  1 135 ? -24.348 -32.451 54.863 1.00 70.18  ? 135  ALA E CA    1 
ATOM   3847  C  C     . ALA E  1 135 ? -25.247 -31.193 54.736 1.00 70.59  ? 135  ALA E C     1 
ATOM   3848  O  O     . ALA E  1 135 ? -24.823 -30.208 54.096 1.00 70.51  ? 135  ALA E O     1 
ATOM   3849  C  CB    . ALA E  1 135 ? -24.817 -33.423 56.024 1.00 69.76  ? 135  ALA E CB    1 
ATOM   3850  O  OXT   . ALA E  1 135 ? -26.390 -31.130 55.242 1.00 70.91  ? 135  ALA E OXT   1 
ATOM   3851  N  N     . LYS F  2 16  ? 18.138  -51.070 37.817 1.00 98.17  ? 16   LYS F N     1 
ATOM   3852  C  CA    . LYS F  2 16  ? 18.663  -49.717 38.193 1.00 97.87  ? 16   LYS F CA    1 
ATOM   3853  C  C     . LYS F  2 16  ? 17.506  -48.735 38.473 1.00 97.49  ? 16   LYS F C     1 
ATOM   3854  O  O     . LYS F  2 16  ? 17.736  -47.518 38.548 1.00 97.79  ? 16   LYS F O     1 
ATOM   3855  C  CB    . LYS F  2 16  ? 19.596  -49.176 37.083 1.00 97.94  ? 16   LYS F CB    1 
ATOM   3856  C  CG    . LYS F  2 16  ? 20.541  -48.040 37.501 1.00 98.01  ? 16   LYS F CG    1 
ATOM   3857  C  CD    . LYS F  2 16  ? 20.856  -47.114 36.321 1.00 97.91  ? 16   LYS F CD    1 
ATOM   3858  C  CE    . LYS F  2 16  ? 21.385  -45.755 36.805 1.00 97.57  ? 16   LYS F CE    1 
ATOM   3859  N  NZ    . LYS F  2 16  ? 21.194  -44.684 35.773 1.00 98.08  ? 16   LYS F NZ    1 
ATOM   3860  N  N     . ARG F  2 17  ? 16.277  -49.253 38.632 1.00 96.65  ? 17   ARG F N     1 
ATOM   3861  C  CA    . ARG F  2 17  ? 15.107  -48.365 38.807 1.00 95.66  ? 17   ARG F CA    1 
ATOM   3862  C  C     . ARG F  2 17  ? 14.244  -48.537 40.074 1.00 94.44  ? 17   ARG F C     1 
ATOM   3863  O  O     . ARG F  2 17  ? 13.726  -49.616 40.388 1.00 94.05  ? 17   ARG F O     1 
ATOM   3864  C  CB    . ARG F  2 17  ? 14.270  -48.217 37.515 1.00 96.12  ? 17   ARG F CB    1 
ATOM   3865  C  CG    . ARG F  2 17  ? 13.999  -46.732 37.149 1.00 96.68  ? 17   ARG F CG    1 
ATOM   3866  C  CD    . ARG F  2 17  ? 15.302  -45.882 37.224 1.00 98.08  ? 17   ARG F CD    1 
ATOM   3867  N  NE    . ARG F  2 17  ? 15.107  -44.425 37.183 1.00 98.52  ? 17   ARG F NE    1 
ATOM   3868  C  CZ    . ARG F  2 17  ? 16.091  -43.520 37.260 1.00 99.33  ? 17   ARG F CZ    1 
ATOM   3869  N  NH1   . ARG F  2 17  ? 17.358  -43.904 37.391 1.00 99.08  ? 17   ARG F NH1   1 
ATOM   3870  N  NH2   . ARG F  2 17  ? 15.811  -42.220 37.206 1.00 99.41  ? 17   ARG F NH2   1 
ATOM   3871  N  N     . HIS F  2 18  ? 14.079  -47.397 40.744 1.00 93.04  ? 18   HIS F N     1 
ATOM   3872  C  CA    . HIS F  2 18  ? 13.709  -47.277 42.158 1.00 91.37  ? 18   HIS F CA    1 
ATOM   3873  C  C     . HIS F  2 18  ? 12.193  -47.323 42.426 1.00 89.11  ? 18   HIS F C     1 
ATOM   3874  O  O     . HIS F  2 18  ? 11.544  -48.377 42.277 1.00 88.71  ? 18   HIS F O     1 
ATOM   3875  C  CB    . HIS F  2 18  ? 14.326  -45.956 42.690 1.00 92.01  ? 18   HIS F CB    1 
ATOM   3876  C  CG    . HIS F  2 18  ? 14.524  -45.900 44.182 1.00 94.82  ? 18   HIS F CG    1 
ATOM   3877  N  ND1   . HIS F  2 18  ? 14.452  -44.716 44.897 1.00 96.97  ? 18   HIS F ND1   1 
ATOM   3878  C  CD2   . HIS F  2 18  ? 14.814  -46.869 45.090 1.00 96.67  ? 18   HIS F CD2   1 
ATOM   3879  C  CE1   . HIS F  2 18  ? 14.681  -44.958 46.177 1.00 97.19  ? 18   HIS F CE1   1 
ATOM   3880  N  NE2   . HIS F  2 18  ? 14.904  -46.256 46.321 1.00 97.36  ? 18   HIS F NE2   1 
ATOM   3881  N  N     . ARG F  2 19  ? 11.658  -46.144 42.773 1.00 86.19  ? 19   ARG F N     1 
ATOM   3882  C  CA    . ARG F  2 19  ? 10.356  -45.955 43.418 1.00 83.12  ? 19   ARG F CA    1 
ATOM   3883  C  C     . ARG F  2 19  ? 10.164  -46.952 44.537 1.00 80.02  ? 19   ARG F C     1 
ATOM   3884  O  O     . ARG F  2 19  ? 9.661   -48.050 44.321 1.00 79.71  ? 19   ARG F O     1 
ATOM   3885  C  CB    . ARG F  2 19  ? 9.180   -45.944 42.421 1.00 83.36  ? 19   ARG F CB    1 
ATOM   3886  C  CG    . ARG F  2 19  ? 8.802   -44.535 41.954 1.00 83.98  ? 19   ARG F CG    1 
ATOM   3887  C  CD    . ARG F  2 19  ? 8.052   -44.526 40.610 1.00 84.45  ? 19   ARG F CD    1 
ATOM   3888  N  NE    . ARG F  2 19  ? 8.488   -43.396 39.771 1.00 88.00  ? 19   ARG F NE    1 
ATOM   3889  C  CZ    . ARG F  2 19  ? 7.840   -42.904 38.708 1.00 88.60  ? 19   ARG F CZ    1 
ATOM   3890  N  NH1   . ARG F  2 19  ? 6.680   -43.418 38.301 1.00 88.62  ? 19   ARG F NH1   1 
ATOM   3891  N  NH2   . ARG F  2 19  ? 8.363   -41.876 38.044 1.00 88.82  ? 19   ARG F NH2   1 
ATOM   3892  N  N     . LYS F  2 20  ? 10.626  -46.571 45.723 1.00 76.32  ? 20   LYS F N     1 
ATOM   3893  C  CA    . LYS F  2 20  ? 10.285  -47.293 46.934 1.00 72.78  ? 20   LYS F CA    1 
ATOM   3894  C  C     . LYS F  2 20  ? 8.784   -47.136 47.158 1.00 70.35  ? 20   LYS F C     1 
ATOM   3895  O  O     . LYS F  2 20  ? 8.186   -46.158 46.727 1.00 70.18  ? 20   LYS F O     1 
ATOM   3896  C  CB    . LYS F  2 20  ? 11.066  -46.753 48.137 1.00 72.83  ? 20   LYS F CB    1 
ATOM   3897  C  CG    . LYS F  2 20  ? 10.962  -47.638 49.377 1.00 71.40  ? 20   LYS F CG    1 
ATOM   3898  C  CD    . LYS F  2 20  ? 11.118  -46.833 50.646 1.00 68.85  ? 20   LYS F CD    1 
ATOM   3899  C  CE    . LYS F  2 20  ? 10.196  -47.370 51.723 1.00 67.23  ? 20   LYS F CE    1 
ATOM   3900  N  NZ    . LYS F  2 20  ? 10.277  -46.558 52.959 1.00 65.53  ? 20   LYS F NZ    1 
ATOM   3901  N  N     . VAL F  2 21  ? 8.177   -48.115 47.809 1.00 67.22  ? 21   VAL F N     1 
ATOM   3902  C  CA    . VAL F  2 21  ? 6.758   -48.070 48.114 1.00 64.09  ? 21   VAL F CA    1 
ATOM   3903  C  C     . VAL F  2 21  ? 6.463   -46.843 48.959 1.00 62.05  ? 21   VAL F C     1 
ATOM   3904  O  O     . VAL F  2 21  ? 7.176   -46.542 49.924 1.00 61.64  ? 21   VAL F O     1 
ATOM   3905  C  CB    . VAL F  2 21  ? 6.320   -49.345 48.859 1.00 64.08  ? 21   VAL F CB    1 
ATOM   3906  C  CG1   . VAL F  2 21  ? 4.923   -49.206 49.402 1.00 63.84  ? 21   VAL F CG1   1 
ATOM   3907  C  CG2   . VAL F  2 21  ? 6.412   -50.541 47.939 1.00 64.06  ? 21   VAL F CG2   1 
ATOM   3908  N  N     . LEU F  2 22  ? 5.420   -46.124 48.570 1.00 59.41  ? 22   LEU F N     1 
ATOM   3909  C  CA    . LEU F  2 22  ? 4.934   -45.018 49.367 1.00 56.89  ? 22   LEU F CA    1 
ATOM   3910  C  C     . LEU F  2 22  ? 3.758   -45.481 50.191 1.00 55.36  ? 22   LEU F C     1 
ATOM   3911  O  O     . LEU F  2 22  ? 2.769   -45.960 49.644 1.00 55.05  ? 22   LEU F O     1 
ATOM   3912  C  CB    . LEU F  2 22  ? 4.508   -43.865 48.472 1.00 56.73  ? 22   LEU F CB    1 
ATOM   3913  C  CG    . LEU F  2 22  ? 5.618   -43.178 47.679 1.00 56.11  ? 22   LEU F CG    1 
ATOM   3914  C  CD1   . LEU F  2 22  ? 5.009   -42.256 46.642 1.00 56.42  ? 22   LEU F CD1   1 
ATOM   3915  C  CD2   . LEU F  2 22  ? 6.595   -42.427 48.579 1.00 55.55  ? 22   LEU F CD2   1 
ATOM   3916  N  N     . ARG F  2 23  ? 3.874   -45.357 51.509 1.00 53.65  ? 23   ARG F N     1 
ATOM   3917  C  CA    . ARG F  2 23  ? 2.758   -45.663 52.392 1.00 52.04  ? 23   ARG F CA    1 
ATOM   3918  C  C     . ARG F  2 23  ? 2.810   -44.935 53.733 1.00 51.46  ? 23   ARG F C     1 
ATOM   3919  O  O     . ARG F  2 23  ? 3.882   -44.633 54.247 1.00 51.42  ? 23   ARG F O     1 
ATOM   3920  C  CB    . ARG F  2 23  ? 2.604   -47.178 52.583 1.00 51.70  ? 23   ARG F CB    1 
ATOM   3921  C  CG    . ARG F  2 23  ? 3.523   -47.787 53.590 1.00 49.69  ? 23   ARG F CG    1 
ATOM   3922  C  CD    . ARG F  2 23  ? 3.684   -49.270 53.363 1.00 45.68  ? 23   ARG F CD    1 
ATOM   3923  N  NE    . ARG F  2 23  ? 4.911   -49.724 53.998 1.00 41.42  ? 23   ARG F NE    1 
ATOM   3924  C  CZ    . ARG F  2 23  ? 4.963   -50.266 55.201 1.00 39.43  ? 23   ARG F CZ    1 
ATOM   3925  N  NH1   . ARG F  2 23  ? 3.857   -50.455 55.907 1.00 37.95  ? 23   ARG F NH1   1 
ATOM   3926  N  NH2   . ARG F  2 23  ? 6.131   -50.628 55.691 1.00 40.04  ? 23   ARG F NH2   1 
ATOM   3927  N  N     . ASP F  2 24  ? 1.623   -44.649 54.267 1.00 50.75  ? 24   ASP F N     1 
ATOM   3928  C  CA    . ASP F  2 24  ? 1.431   -43.999 55.562 1.00 49.93  ? 24   ASP F CA    1 
ATOM   3929  C  C     . ASP F  2 24  ? 2.041   -42.609 55.671 1.00 49.32  ? 24   ASP F C     1 
ATOM   3930  O  O     . ASP F  2 24  ? 2.391   -42.162 56.757 1.00 49.20  ? 24   ASP F O     1 
ATOM   3931  C  CB    . ASP F  2 24  ? 1.938   -44.887 56.688 1.00 50.05  ? 24   ASP F CB    1 
ATOM   3932  C  CG    . ASP F  2 24  ? 1.378   -44.486 58.029 1.00 51.34  ? 24   ASP F CG    1 
ATOM   3933  O  OD1   . ASP F  2 24  ? 0.245   -43.969 58.061 1.00 52.56  ? 24   ASP F OD1   1 
ATOM   3934  O  OD2   . ASP F  2 24  ? 2.069   -44.684 59.054 1.00 53.43  ? 24   ASP F OD2   1 
ATOM   3935  N  N     . ASN F  2 25  ? 2.143   -41.915 54.545 1.00 48.55  ? 25   ASN F N     1 
ATOM   3936  C  CA    . ASN F  2 25  ? 2.727   -40.594 54.525 1.00 47.72  ? 25   ASN F CA    1 
ATOM   3937  C  C     . ASN F  2 25  ? 1.885   -39.534 55.180 1.00 47.38  ? 25   ASN F C     1 
ATOM   3938  O  O     . ASN F  2 25  ? 2.386   -38.479 55.530 1.00 47.50  ? 25   ASN F O     1 
ATOM   3939  C  CB    . ASN F  2 25  ? 3.053   -40.198 53.112 1.00 47.66  ? 25   ASN F CB    1 
ATOM   3940  C  CG    . ASN F  2 25  ? 4.319   -40.820 52.650 1.00 48.59  ? 25   ASN F CG    1 
ATOM   3941  O  OD1   . ASN F  2 25  ? 5.408   -40.421 53.073 1.00 50.14  ? 25   ASN F OD1   1 
ATOM   3942  N  ND2   . ASN F  2 25  ? 4.203   -41.826 51.804 1.00 49.19  ? 25   ASN F ND2   1 
ATOM   3943  N  N     . ILE F  2 26  ? 0.605   -39.810 55.359 1.00 47.14  ? 26   ILE F N     1 
ATOM   3944  C  CA    . ILE F  2 26  ? -0.240  -38.892 56.096 1.00 46.67  ? 26   ILE F CA    1 
ATOM   3945  C  C     . ILE F  2 26  ? 0.378   -38.571 57.461 1.00 46.50  ? 26   ILE F C     1 
ATOM   3946  O  O     . ILE F  2 26  ? 0.239   -37.457 57.949 1.00 46.87  ? 26   ILE F O     1 
ATOM   3947  C  CB    . ILE F  2 26  ? -1.694  -39.427 56.246 1.00 46.62  ? 26   ILE F CB    1 
ATOM   3948  C  CG1   . ILE F  2 26  ? -2.648  -38.325 56.718 1.00 45.75  ? 26   ILE F CG1   1 
ATOM   3949  C  CG2   . ILE F  2 26  ? -1.752  -40.614 57.193 1.00 47.02  ? 26   ILE F CG2   1 
ATOM   3950  C  CD1   . ILE F  2 26  ? -2.787  -37.183 55.754 1.00 44.25  ? 26   ILE F CD1   1 
ATOM   3951  N  N     . GLN F  2 27  ? 1.077   -39.528 58.068 1.00 46.07  ? 27   GLN F N     1 
ATOM   3952  C  CA    . GLN F  2 27  ? 1.648   -39.293 59.395 1.00 46.02  ? 27   GLN F CA    1 
ATOM   3953  C  C     . GLN F  2 27  ? 2.763   -38.256 59.332 1.00 45.82  ? 27   GLN F C     1 
ATOM   3954  O  O     . GLN F  2 27  ? 3.272   -37.803 60.368 1.00 46.10  ? 27   GLN F O     1 
ATOM   3955  C  CB    . GLN F  2 27  ? 2.117   -40.597 60.054 1.00 45.82  ? 27   GLN F CB    1 
ATOM   3956  C  CG    . GLN F  2 27  ? 0.967   -41.511 60.439 1.00 47.05  ? 27   GLN F CG    1 
ATOM   3957  C  CD    . GLN F  2 27  ? -0.061  -40.825 61.345 1.00 49.16  ? 27   GLN F CD    1 
ATOM   3958  O  OE1   . GLN F  2 27  ? 0.290   -40.260 62.384 1.00 50.44  ? 27   GLN F OE1   1 
ATOM   3959  N  NE2   . GLN F  2 27  ? -1.335  -40.876 60.951 1.00 48.74  ? 27   GLN F NE2   1 
ATOM   3960  N  N     . GLY F  2 28  ? 3.112   -37.871 58.105 1.00 45.22  ? 28   GLY F N     1 
ATOM   3961  C  CA    . GLY F  2 28  ? 4.100   -36.835 57.854 1.00 44.69  ? 28   GLY F CA    1 
ATOM   3962  C  C     . GLY F  2 28  ? 3.509   -35.465 58.094 1.00 44.47  ? 28   GLY F C     1 
ATOM   3963  O  O     . GLY F  2 28  ? 4.219   -34.470 58.129 1.00 45.28  ? 28   GLY F O     1 
ATOM   3964  N  N     . ILE F  2 29  ? 2.194   -35.403 58.237 1.00 43.77  ? 29   ILE F N     1 
ATOM   3965  C  CA    . ILE F  2 29  ? 1.551   -34.194 58.693 1.00 42.86  ? 29   ILE F CA    1 
ATOM   3966  C  C     . ILE F  2 29  ? 1.640   -34.280 60.218 1.00 42.82  ? 29   ILE F C     1 
ATOM   3967  O  O     . ILE F  2 29  ? 0.747   -34.807 60.906 1.00 42.74  ? 29   ILE F O     1 
ATOM   3968  C  CB    . ILE F  2 29  ? 0.101   -34.088 58.174 1.00 42.72  ? 29   ILE F CB    1 
ATOM   3969  C  CG1   . ILE F  2 29  ? 0.022   -34.434 56.689 1.00 41.75  ? 29   ILE F CG1   1 
ATOM   3970  C  CG2   . ILE F  2 29  ? -0.451  -32.704 58.400 1.00 42.83  ? 29   ILE F CG2   1 
ATOM   3971  C  CD1   . ILE F  2 29  ? 0.834   -33.554 55.784 1.00 40.55  ? 29   ILE F CD1   1 
ATOM   3972  N  N     . THR F  2 30  ? 2.762   -33.791 60.726 1.00 42.47  ? 30   THR F N     1 
ATOM   3973  C  CA    . THR F  2 30  ? 3.115   -33.920 62.131 1.00 42.67  ? 30   THR F CA    1 
ATOM   3974  C  C     . THR F  2 30  ? 2.230   -33.076 63.066 1.00 42.50  ? 30   THR F C     1 
ATOM   3975  O  O     . THR F  2 30  ? 1.645   -32.064 62.658 1.00 42.54  ? 30   THR F O     1 
ATOM   3976  C  CB    . THR F  2 30  ? 4.607   -33.580 62.343 1.00 42.72  ? 30   THR F CB    1 
ATOM   3977  O  OG1   . THR F  2 30  ? 4.821   -32.184 62.137 1.00 43.78  ? 30   THR F OG1   1 
ATOM   3978  C  CG2   . THR F  2 30  ? 5.472   -34.326 61.344 1.00 43.20  ? 30   THR F CG2   1 
ATOM   3979  N  N     . LYS F  2 31  ? 2.136   -33.505 64.320 1.00 42.15  ? 31   LYS F N     1 
ATOM   3980  C  CA    . LYS F  2 31  ? 1.400   -32.766 65.343 1.00 42.00  ? 31   LYS F CA    1 
ATOM   3981  C  C     . LYS F  2 31  ? 1.857   -31.304 65.482 1.00 41.76  ? 31   LYS F C     1 
ATOM   3982  O  O     . LYS F  2 31  ? 1.021   -30.413 65.561 1.00 42.05  ? 31   LYS F O     1 
ATOM   3983  C  CB    . LYS F  2 31  ? 1.495   -33.501 66.679 1.00 42.08  ? 31   LYS F CB    1 
ATOM   3984  C  CG    . LYS F  2 31  ? 0.966   -32.745 67.869 1.00 43.17  ? 31   LYS F CG    1 
ATOM   3985  C  CD    . LYS F  2 31  ? 1.417   -33.419 69.157 1.00 45.97  ? 31   LYS F CD    1 
ATOM   3986  C  CE    . LYS F  2 31  ? 1.038   -32.573 70.378 1.00 47.92  ? 31   LYS F CE    1 
ATOM   3987  N  NZ    . LYS F  2 31  ? 0.659   -33.458 71.521 1.00 49.30  ? 31   LYS F NZ    1 
ATOM   3988  N  N     . PRO F  2 32  ? 3.183   -31.046 65.526 1.00 41.47  ? 32   PRO F N     1 
ATOM   3989  C  CA    . PRO F  2 32  ? 3.642   -29.654 65.548 1.00 40.98  ? 32   PRO F CA    1 
ATOM   3990  C  C     . PRO F  2 32  ? 3.288   -28.827 64.310 1.00 40.47  ? 32   PRO F C     1 
ATOM   3991  O  O     . PRO F  2 32  ? 3.045   -27.637 64.421 1.00 40.34  ? 32   PRO F O     1 
ATOM   3992  C  CB    . PRO F  2 32  ? 5.162   -29.789 65.670 1.00 41.14  ? 32   PRO F CB    1 
ATOM   3993  C  CG    . PRO F  2 32  ? 5.475   -31.147 65.222 1.00 41.03  ? 32   PRO F CG    1 
ATOM   3994  C  CD    . PRO F  2 32  ? 4.320   -31.983 65.614 1.00 41.42  ? 32   PRO F CD    1 
ATOM   3995  N  N     . ALA F  2 33  ? 3.264   -29.443 63.140 1.00 40.05  ? 33   ALA F N     1 
ATOM   3996  C  CA    . ALA F  2 33  ? 2.899   -28.711 61.944 1.00 39.85  ? 33   ALA F CA    1 
ATOM   3997  C  C     . ALA F  2 33  ? 1.410   -28.356 61.968 1.00 39.87  ? 33   ALA F C     1 
ATOM   3998  O  O     . ALA F  2 33  ? 1.027   -27.251 61.576 1.00 39.93  ? 33   ALA F O     1 
ATOM   3999  C  CB    . ALA F  2 33  ? 3.252   -29.506 60.708 1.00 39.76  ? 33   ALA F CB    1 
ATOM   4000  N  N     . ILE F  2 34  ? 0.578   -29.291 62.434 1.00 39.60  ? 34   ILE F N     1 
ATOM   4001  C  CA    . ILE F  2 34  ? -0.861  -29.053 62.571 1.00 39.05  ? 34   ILE F CA    1 
ATOM   4002  C  C     . ILE F  2 34  ? -1.138  -27.988 63.624 1.00 39.46  ? 34   ILE F C     1 
ATOM   4003  O  O     . ILE F  2 34  ? -2.048  -27.190 63.460 1.00 40.05  ? 34   ILE F O     1 
ATOM   4004  C  CB    . ILE F  2 34  ? -1.640  -30.346 62.906 1.00 39.03  ? 34   ILE F CB    1 
ATOM   4005  C  CG1   . ILE F  2 34  ? -1.818  -31.193 61.634 1.00 38.83  ? 34   ILE F CG1   1 
ATOM   4006  C  CG2   . ILE F  2 34  ? -3.001  -30.016 63.527 1.00 37.88  ? 34   ILE F CG2   1 
ATOM   4007  C  CD1   . ILE F  2 34  ? -2.148  -32.668 61.869 1.00 38.64  ? 34   ILE F CD1   1 
ATOM   4008  N  N     . ARG F  2 35  ? -0.352  -27.965 64.697 1.00 39.41  ? 35   ARG F N     1 
ATOM   4009  C  CA    . ARG F  2 35  ? -0.504  -26.954 65.741 1.00 39.78  ? 35   ARG F CA    1 
ATOM   4010  C  C     . ARG F  2 35  ? -0.227  -25.564 65.164 1.00 38.49  ? 35   ARG F C     1 
ATOM   4011  O  O     . ARG F  2 35  ? -1.025  -24.640 65.316 1.00 38.47  ? 35   ARG F O     1 
ATOM   4012  C  CB    . ARG F  2 35  ? 0.441   -27.261 66.905 1.00 39.65  ? 35   ARG F CB    1 
ATOM   4013  C  CG    . ARG F  2 35  ? 0.336   -26.286 68.073 1.00 41.86  ? 35   ARG F CG    1 
ATOM   4014  C  CD    . ARG F  2 35  ? 1.555   -26.320 69.003 1.00 43.30  ? 35   ARG F CD    1 
ATOM   4015  N  NE    . ARG F  2 35  ? 1.898   -27.688 69.429 1.00 52.28  ? 35   ARG F NE    1 
ATOM   4016  C  CZ    . ARG F  2 35  ? 2.999   -28.339 69.021 1.00 55.32  ? 35   ARG F CZ    1 
ATOM   4017  N  NH1   . ARG F  2 35  ? 3.858   -27.725 68.186 1.00 55.71  ? 35   ARG F NH1   1 
ATOM   4018  N  NH2   . ARG F  2 35  ? 3.248   -29.592 69.440 1.00 54.88  ? 35   ARG F NH2   1 
ATOM   4019  N  N     . ARG F  2 36  ? 0.908   -25.447 64.484 1.00 37.34  ? 36   ARG F N     1 
ATOM   4020  C  CA    . ARG F  2 36  ? 1.316   -24.229 63.822 1.00 36.36  ? 36   ARG F CA    1 
ATOM   4021  C  C     . ARG F  2 36  ? 0.208   -23.704 62.939 1.00 35.88  ? 36   ARG F C     1 
ATOM   4022  O  O     . ARG F  2 36  ? -0.059  -22.516 62.934 1.00 36.33  ? 36   ARG F O     1 
ATOM   4023  C  CB    . ARG F  2 36  ? 2.547   -24.486 62.943 1.00 36.63  ? 36   ARG F CB    1 
ATOM   4024  C  CG    . ARG F  2 36  ? 3.843   -24.629 63.677 1.00 36.33  ? 36   ARG F CG    1 
ATOM   4025  C  CD    . ARG F  2 36  ? 4.992   -24.406 62.756 1.00 36.44  ? 36   ARG F CD    1 
ATOM   4026  N  NE    . ARG F  2 36  ? 5.258   -25.523 61.852 1.00 38.74  ? 36   ARG F NE    1 
ATOM   4027  C  CZ    . ARG F  2 36  ? 5.870   -26.664 62.191 1.00 39.94  ? 36   ARG F CZ    1 
ATOM   4028  N  NH1   . ARG F  2 36  ? 6.260   -26.898 63.444 1.00 40.08  ? 36   ARG F NH1   1 
ATOM   4029  N  NH2   . ARG F  2 36  ? 6.085   -27.594 61.267 1.00 39.76  ? 36   ARG F NH2   1 
ATOM   4030  N  N     . LEU F  2 37  ? -0.417  -24.584 62.170 1.00 34.93  ? 37   LEU F N     1 
ATOM   4031  C  CA    . LEU F  2 37  ? -1.498  -24.182 61.295 1.00 34.41  ? 37   LEU F CA    1 
ATOM   4032  C  C     . LEU F  2 37  ? -2.690  -23.629 62.082 1.00 34.22  ? 37   LEU F C     1 
ATOM   4033  O  O     . LEU F  2 37  ? -3.256  -22.600 61.717 1.00 34.43  ? 37   LEU F O     1 
ATOM   4034  C  CB    . LEU F  2 37  ? -1.941  -25.358 60.442 1.00 34.40  ? 37   LEU F CB    1 
ATOM   4035  C  CG    . LEU F  2 37  ? -1.072  -25.709 59.249 1.00 34.45  ? 37   LEU F CG    1 
ATOM   4036  C  CD1   . LEU F  2 37  ? -1.417  -27.100 58.725 1.00 33.38  ? 37   LEU F CD1   1 
ATOM   4037  C  CD2   . LEU F  2 37  ? -1.236  -24.645 58.169 1.00 35.29  ? 37   LEU F CD2   1 
ATOM   4038  N  N     . ALA F  2 38  ? -3.056  -24.299 63.167 1.00 33.50  ? 38   ALA F N     1 
ATOM   4039  C  CA    . ALA F  2 38  ? -4.149  -23.841 64.004 1.00 33.35  ? 38   ALA F CA    1 
ATOM   4040  C  C     . ALA F  2 38  ? -3.862  -22.470 64.627 1.00 33.43  ? 38   ALA F C     1 
ATOM   4041  O  O     . ALA F  2 38  ? -4.782  -21.688 64.885 1.00 33.40  ? 38   ALA F O     1 
ATOM   4042  C  CB    . ALA F  2 38  ? -4.432  -24.861 65.075 1.00 33.68  ? 38   ALA F CB    1 
ATOM   4043  N  N     . ARG F  2 39  ? -2.581  -22.191 64.865 1.00 33.21  ? 39   ARG F N     1 
ATOM   4044  C  CA    . ARG F  2 39  ? -2.134  -20.902 65.389 1.00 32.92  ? 39   ARG F CA    1 
ATOM   4045  C  C     . ARG F  2 39  ? -2.374  -19.782 64.400 1.00 32.93  ? 39   ARG F C     1 
ATOM   4046  O  O     . ARG F  2 39  ? -3.034  -18.787 64.711 1.00 32.88  ? 39   ARG F O     1 
ATOM   4047  C  CB    . ARG F  2 39  ? -0.653  -20.956 65.700 1.00 32.73  ? 39   ARG F CB    1 
ATOM   4048  C  CG    . ARG F  2 39  ? -0.339  -21.882 66.810 1.00 32.83  ? 39   ARG F CG    1 
ATOM   4049  C  CD    . ARG F  2 39  ? -0.689  -21.284 68.142 1.00 32.70  ? 39   ARG F CD    1 
ATOM   4050  N  NE    . ARG F  2 39  ? -0.139  -22.119 69.190 1.00 33.64  ? 39   ARG F NE    1 
ATOM   4051  C  CZ    . ARG F  2 39  ? -0.857  -22.913 69.970 1.00 35.64  ? 39   ARG F CZ    1 
ATOM   4052  N  NH1   . ARG F  2 39  ? -2.179  -22.962 69.859 1.00 37.16  ? 39   ARG F NH1   1 
ATOM   4053  N  NH2   . ARG F  2 39  ? -0.245  -23.639 70.888 1.00 37.02  ? 39   ARG F NH2   1 
ATOM   4054  N  N     . ARG F  2 40  ? -1.830  -19.939 63.202 1.00 32.65  ? 40   ARG F N     1 
ATOM   4055  C  CA    . ARG F  2 40  ? -2.118  -19.000 62.161 1.00 32.76  ? 40   ARG F CA    1 
ATOM   4056  C  C     . ARG F  2 40  ? -3.638  -18.849 62.083 1.00 33.31  ? 40   ARG F C     1 
ATOM   4057  O  O     . ARG F  2 40  ? -4.151  -17.752 61.821 1.00 33.86  ? 40   ARG F O     1 
ATOM   4058  C  CB    . ARG F  2 40  ? -1.546  -19.499 60.854 1.00 32.52  ? 40   ARG F CB    1 
ATOM   4059  C  CG    . ARG F  2 40  ? -1.528  -18.490 59.740 1.00 31.82  ? 40   ARG F CG    1 
ATOM   4060  C  CD    . ARG F  2 40  ? -0.612  -18.972 58.642 1.00 32.45  ? 40   ARG F CD    1 
ATOM   4061  N  NE    . ARG F  2 40  ? 0.741   -18.408 58.762 1.00 33.96  ? 40   ARG F NE    1 
ATOM   4062  C  CZ    . ARG F  2 40  ? 1.808   -18.843 58.089 1.00 33.05  ? 40   ARG F CZ    1 
ATOM   4063  N  NH1   . ARG F  2 40  ? 1.717   -19.869 57.263 1.00 32.06  ? 40   ARG F NH1   1 
ATOM   4064  N  NH2   . ARG F  2 40  ? 2.974   -18.251 58.248 1.00 33.44  ? 40   ARG F NH2   1 
ATOM   4065  N  N     . GLY F  2 41  ? -4.351  -19.941 62.354 1.00 33.11  ? 41   GLY F N     1 
ATOM   4066  C  CA    . GLY F  2 41  ? -5.803  -19.933 62.321 1.00 33.52  ? 41   GLY F CA    1 
ATOM   4067  C  C     . GLY F  2 41  ? -6.401  -19.265 63.538 1.00 34.04  ? 41   GLY F C     1 
ATOM   4068  O  O     . GLY F  2 41  ? -7.627  -19.153 63.660 1.00 34.29  ? 41   GLY F O     1 
ATOM   4069  N  N     . GLY F  2 42  ? -5.543  -18.830 64.449 1.00 34.29  ? 42   GLY F N     1 
ATOM   4070  C  CA    . GLY F  2 42  ? -5.997  -18.083 65.617 1.00 35.35  ? 42   GLY F CA    1 
ATOM   4071  C  C     . GLY F  2 42  ? -6.377  -18.934 66.811 1.00 35.81  ? 42   GLY F C     1 
ATOM   4072  O  O     . GLY F  2 42  ? -6.970  -18.433 67.756 1.00 36.03  ? 42   GLY F O     1 
ATOM   4073  N  N     . VAL F  2 43  ? -6.010  -20.212 66.770 1.00 36.37  ? 43   VAL F N     1 
ATOM   4074  C  CA    . VAL F  2 43  ? -6.378  -21.181 67.798 1.00 36.77  ? 43   VAL F CA    1 
ATOM   4075  C  C     . VAL F  2 43  ? -5.377  -21.281 68.961 1.00 37.26  ? 43   VAL F C     1 
ATOM   4076  O  O     . VAL F  2 43  ? -4.168  -21.520 68.769 1.00 36.40  ? 43   VAL F O     1 
ATOM   4077  C  CB    . VAL F  2 43  ? -6.574  -22.564 67.189 1.00 36.66  ? 43   VAL F CB    1 
ATOM   4078  C  CG1   . VAL F  2 43  ? -6.802  -23.602 68.281 1.00 36.69  ? 43   VAL F CG1   1 
ATOM   4079  C  CG2   . VAL F  2 43  ? -7.725  -22.525 66.215 1.00 36.41  ? 43   VAL F CG2   1 
ATOM   4080  N  N     . LYS F  2 44  ? -5.935  -21.125 70.165 1.00 37.84  ? 44   LYS F N     1 
ATOM   4081  C  CA    . LYS F  2 44  ? -5.185  -21.099 71.412 1.00 38.18  ? 44   LYS F CA    1 
ATOM   4082  C  C     . LYS F  2 44  ? -5.023  -22.467 72.072 1.00 38.34  ? 44   LYS F C     1 
ATOM   4083  O  O     . LYS F  2 44  ? -3.965  -22.787 72.615 1.00 38.60  ? 44   LYS F O     1 
ATOM   4084  C  CB    . LYS F  2 44  ? -5.854  -20.153 72.398 1.00 37.84  ? 44   LYS F CB    1 
ATOM   4085  C  CG    . LYS F  2 44  ? -4.909  -19.714 73.480 1.00 39.02  ? 44   LYS F CG    1 
ATOM   4086  C  CD    . LYS F  2 44  ? -5.601  -18.899 74.538 1.00 40.57  ? 44   LYS F CD    1 
ATOM   4087  C  CE    . LYS F  2 44  ? -4.644  -18.576 75.672 1.00 40.74  ? 44   LYS F CE    1 
ATOM   4088  N  NZ    . LYS F  2 44  ? -5.417  -18.162 76.871 1.00 41.38  ? 44   LYS F NZ    1 
ATOM   4089  N  N     . ARG F  2 45  ? -6.074  -23.269 72.044 1.00 38.45  ? 45   ARG F N     1 
ATOM   4090  C  CA    . ARG F  2 45  ? -6.040  -24.532 72.748 1.00 38.64  ? 45   ARG F CA    1 
ATOM   4091  C  C     . ARG F  2 45  ? -6.603  -25.626 71.872 1.00 38.55  ? 45   ARG F C     1 
ATOM   4092  O  O     . ARG F  2 45  ? -7.623  -25.449 71.213 1.00 38.63  ? 45   ARG F O     1 
ATOM   4093  C  CB    . ARG F  2 45  ? -6.805  -24.429 74.057 1.00 38.65  ? 45   ARG F CB    1 
ATOM   4094  C  CG    . ARG F  2 45  ? -6.284  -25.338 75.128 1.00 39.80  ? 45   ARG F CG    1 
ATOM   4095  C  CD    . ARG F  2 45  ? -6.869  -24.953 76.465 1.00 40.61  ? 45   ARG F CD    1 
ATOM   4096  N  NE    . ARG F  2 45  ? -6.363  -25.833 77.499 1.00 42.27  ? 45   ARG F NE    1 
ATOM   4097  C  CZ    . ARG F  2 45  ? -6.934  -26.987 77.826 1.00 44.16  ? 45   ARG F CZ    1 
ATOM   4098  N  NH1   . ARG F  2 45  ? -8.040  -27.385 77.209 1.00 42.73  ? 45   ARG F NH1   1 
ATOM   4099  N  NH2   . ARG F  2 45  ? -6.406  -27.743 78.784 1.00 46.27  ? 45   ARG F NH2   1 
ATOM   4100  N  N     . ILE F  2 46  ? -5.917  -26.759 71.872 1.00 38.57  ? 46   ILE F N     1 
ATOM   4101  C  CA    . ILE F  2 46  ? -6.179  -27.822 70.923 1.00 38.60  ? 46   ILE F CA    1 
ATOM   4102  C  C     . ILE F  2 46  ? -6.364  -29.153 71.652 1.00 39.15  ? 46   ILE F C     1 
ATOM   4103  O  O     . ILE F  2 46  ? -5.433  -29.651 72.326 1.00 39.40  ? 46   ILE F O     1 
ATOM   4104  C  CB    . ILE F  2 46  ? -5.022  -27.968 69.911 1.00 38.30  ? 46   ILE F CB    1 
ATOM   4105  C  CG1   . ILE F  2 46  ? -4.625  -26.622 69.326 1.00 37.39  ? 46   ILE F CG1   1 
ATOM   4106  C  CG2   . ILE F  2 46  ? -5.409  -28.921 68.815 1.00 38.63  ? 46   ILE F CG2   1 
ATOM   4107  C  CD1   . ILE F  2 46  ? -3.496  -26.698 68.361 1.00 36.42  ? 46   ILE F CD1   1 
ATOM   4108  N  N     . SER F  2 47  ? -7.565  -29.716 71.498 1.00 39.18  ? 47   SER F N     1 
ATOM   4109  C  CA    . SER F  2 47  ? -7.911  -31.043 71.993 1.00 39.37  ? 47   SER F CA    1 
ATOM   4110  C  C     . SER F  2 47  ? -7.037  -32.113 71.362 1.00 39.37  ? 47   SER F C     1 
ATOM   4111  O  O     . SER F  2 47  ? -6.571  -31.970 70.232 1.00 39.68  ? 47   SER F O     1 
ATOM   4112  C  CB    . SER F  2 47  ? -9.360  -31.348 71.663 1.00 39.45  ? 47   SER F CB    1 
ATOM   4113  O  OG    . SER F  2 47  ? -9.554  -32.746 71.583 1.00 41.38  ? 47   SER F OG    1 
ATOM   4114  N  N     . GLY F  2 48  ? -6.830  -33.203 72.082 1.00 39.38  ? 48   GLY F N     1 
ATOM   4115  C  CA    . GLY F  2 48  ? -5.869  -34.211 71.637 1.00 39.71  ? 48   GLY F CA    1 
ATOM   4116  C  C     . GLY F  2 48  ? -6.279  -34.945 70.378 1.00 39.71  ? 48   GLY F C     1 
ATOM   4117  O  O     . GLY F  2 48  ? -5.443  -35.485 69.661 1.00 39.90  ? 48   GLY F O     1 
ATOM   4118  N  N     . LEU F  2 49  ? -7.573  -34.950 70.104 1.00 39.58  ? 49   LEU F N     1 
ATOM   4119  C  CA    . LEU F  2 49  ? -8.099  -35.716 69.002 1.00 39.84  ? 49   LEU F CA    1 
ATOM   4120  C  C     . LEU F  2 49  ? -8.122  -34.934 67.680 1.00 39.99  ? 49   LEU F C     1 
ATOM   4121  O  O     . LEU F  2 49  ? -8.533  -35.461 66.628 1.00 39.91  ? 49   LEU F O     1 
ATOM   4122  C  CB    . LEU F  2 49  ? -9.488  -36.204 69.379 1.00 39.83  ? 49   LEU F CB    1 
ATOM   4123  C  CG    . LEU F  2 49  ? -9.460  -37.440 70.265 1.00 40.30  ? 49   LEU F CG    1 
ATOM   4124  C  CD1   . LEU F  2 49  ? -10.835 -37.650 70.867 1.00 41.88  ? 49   LEU F CD1   1 
ATOM   4125  C  CD2   . LEU F  2 49  ? -8.977  -38.689 69.492 1.00 40.08  ? 49   LEU F CD2   1 
ATOM   4126  N  N     . ILE F  2 50  ? -7.680  -33.678 67.736 1.00 39.84  ? 50   ILE F N     1 
ATOM   4127  C  CA    . ILE F  2 50  ? -7.712  -32.809 66.569 1.00 39.82  ? 50   ILE F CA    1 
ATOM   4128  C  C     . ILE F  2 50  ? -6.803  -33.330 65.458 1.00 40.44  ? 50   ILE F C     1 
ATOM   4129  O  O     . ILE F  2 50  ? -7.191  -33.343 64.286 1.00 40.49  ? 50   ILE F O     1 
ATOM   4130  C  CB    . ILE F  2 50  ? -7.373  -31.346 66.934 1.00 39.34  ? 50   ILE F CB    1 
ATOM   4131  C  CG1   . ILE F  2 50  ? -8.576  -30.655 67.611 1.00 39.32  ? 50   ILE F CG1   1 
ATOM   4132  C  CG2   . ILE F  2 50  ? -6.933  -30.572 65.728 1.00 38.49  ? 50   ILE F CG2   1 
ATOM   4133  C  CD1   . ILE F  2 50  ? -9.805  -30.391 66.745 1.00 36.98  ? 50   ILE F CD1   1 
ATOM   4134  N  N     . TYR F  2 51  ? -5.614  -33.796 65.839 1.00 40.94  ? 51   TYR F N     1 
ATOM   4135  C  CA    . TYR F  2 51  ? -4.563  -34.075 64.874 1.00 41.19  ? 51   TYR F CA    1 
ATOM   4136  C  C     . TYR F  2 51  ? -4.998  -35.151 63.923 1.00 41.77  ? 51   TYR F C     1 
ATOM   4137  O  O     . TYR F  2 51  ? -4.847  -34.989 62.702 1.00 42.33  ? 51   TYR F O     1 
ATOM   4138  C  CB    . TYR F  2 51  ? -3.257  -34.409 65.576 1.00 41.35  ? 51   TYR F CB    1 
ATOM   4139  C  CG    . TYR F  2 51  ? -2.906  -33.364 66.612 1.00 41.67  ? 51   TYR F CG    1 
ATOM   4140  C  CD1   . TYR F  2 51  ? -3.235  -33.548 67.956 1.00 41.58  ? 51   TYR F CD1   1 
ATOM   4141  C  CD2   . TYR F  2 51  ? -2.282  -32.176 66.243 1.00 41.63  ? 51   TYR F CD2   1 
ATOM   4142  C  CE1   . TYR F  2 51  ? -2.940  -32.598 68.899 1.00 42.18  ? 51   TYR F CE1   1 
ATOM   4143  C  CE2   . TYR F  2 51  ? -1.992  -31.215 67.174 1.00 41.93  ? 51   TYR F CE2   1 
ATOM   4144  C  CZ    . TYR F  2 51  ? -2.318  -31.433 68.500 1.00 42.75  ? 51   TYR F CZ    1 
ATOM   4145  O  OH    . TYR F  2 51  ? -2.021  -30.471 69.437 1.00 44.09  ? 51   TYR F OH    1 
ATOM   4146  N  N     . GLU F  2 52  ? -5.589  -36.222 64.464 1.00 41.75  ? 52   GLU F N     1 
ATOM   4147  C  CA    . GLU F  2 52  ? -6.027  -37.332 63.620 1.00 41.76  ? 52   GLU F CA    1 
ATOM   4148  C  C     . GLU F  2 52  ? -7.191  -36.867 62.741 1.00 40.92  ? 52   GLU F C     1 
ATOM   4149  O  O     . GLU F  2 52  ? -7.259  -37.186 61.556 1.00 41.20  ? 52   GLU F O     1 
ATOM   4150  C  CB    . GLU F  2 52  ? -6.349  -38.589 64.453 1.00 42.20  ? 52   GLU F CB    1 
ATOM   4151  C  CG    . GLU F  2 52  ? -5.864  -39.975 63.860 1.00 45.08  ? 52   GLU F CG    1 
ATOM   4152  C  CD    . GLU F  2 52  ? -4.703  -39.892 62.801 1.00 48.78  ? 52   GLU F CD    1 
ATOM   4153  O  OE1   . GLU F  2 52  ? -5.018  -39.951 61.574 1.00 50.04  ? 52   GLU F OE1   1 
ATOM   4154  O  OE2   . GLU F  2 52  ? -3.502  -39.782 63.177 1.00 47.48  ? 52   GLU F OE2   1 
ATOM   4155  N  N     . GLU F  2 53  ? -8.060  -36.054 63.314 1.00 39.81  ? 53   GLU F N     1 
ATOM   4156  C  CA    . GLU F  2 53  ? -9.168  -35.490 62.588 1.00 38.96  ? 53   GLU F CA    1 
ATOM   4157  C  C     . GLU F  2 53  ? -8.700  -34.616 61.437 1.00 38.36  ? 53   GLU F C     1 
ATOM   4158  O  O     . GLU F  2 53  ? -9.285  -34.638 60.359 1.00 38.39  ? 53   GLU F O     1 
ATOM   4159  C  CB    . GLU F  2 53  ? -9.995  -34.649 63.546 1.00 39.28  ? 53   GLU F CB    1 
ATOM   4160  C  CG    . GLU F  2 53  ? -11.284 -34.140 62.969 1.00 40.00  ? 53   GLU F CG    1 
ATOM   4161  C  CD    . GLU F  2 53  ? -12.376 -35.173 62.981 1.00 41.10  ? 53   GLU F CD    1 
ATOM   4162  O  OE1   . GLU F  2 53  ? -12.181 -36.266 63.559 1.00 41.46  ? 53   GLU F OE1   1 
ATOM   4163  O  OE2   . GLU F  2 53  ? -13.442 -34.883 62.410 1.00 42.64  ? 53   GLU F OE2   1 
ATOM   4164  N  N     . THR F  2 54  ? -7.650  -33.837 61.673 1.00 37.67  ? 54   THR F N     1 
ATOM   4165  C  CA    . THR F  2 54  ? -7.174  -32.859 60.690 1.00 37.05  ? 54   THR F CA    1 
ATOM   4166  C  C     . THR F  2 54  ? -6.501  -33.576 59.528 1.00 36.77  ? 54   THR F C     1 
ATOM   4167  O  O     . THR F  2 54  ? -6.672  -33.218 58.356 1.00 36.60  ? 54   THR F O     1 
ATOM   4168  C  CB    . THR F  2 54  ? -6.177  -31.848 61.307 1.00 36.98  ? 54   THR F CB    1 
ATOM   4169  O  OG1   . THR F  2 54  ? -6.703  -31.323 62.528 1.00 37.09  ? 54   THR F OG1   1 
ATOM   4170  C  CG2   . THR F  2 54  ? -5.935  -30.698 60.365 1.00 36.52  ? 54   THR F CG2   1 
ATOM   4171  N  N     . ARG F  2 55  ? -5.732  -34.601 59.865 1.00 36.31  ? 55   ARG F N     1 
ATOM   4172  C  CA    . ARG F  2 55  ? -5.154  -35.456 58.855 1.00 36.13  ? 55   ARG F CA    1 
ATOM   4173  C  C     . ARG F  2 55  ? -6.253  -35.970 57.893 1.00 35.51  ? 55   ARG F C     1 
ATOM   4174  O  O     . ARG F  2 55  ? -6.116  -35.906 56.673 1.00 35.02  ? 55   ARG F O     1 
ATOM   4175  C  CB    . ARG F  2 55  ? -4.359  -36.570 59.539 1.00 36.39  ? 55   ARG F CB    1 
ATOM   4176  C  CG    . ARG F  2 55  ? -3.092  -36.041 60.168 1.00 37.23  ? 55   ARG F CG    1 
ATOM   4177  C  CD    . ARG F  2 55  ? -2.061  -37.127 60.467 1.00 39.76  ? 55   ARG F CD    1 
ATOM   4178  N  NE    . ARG F  2 55  ? -1.128  -36.673 61.514 1.00 40.53  ? 55   ARG F NE    1 
ATOM   4179  C  CZ    . ARG F  2 55  ? -1.354  -36.790 62.829 1.00 39.81  ? 55   ARG F CZ    1 
ATOM   4180  N  NH1   . ARG F  2 55  ? -2.472  -37.365 63.278 1.00 36.87  ? 55   ARG F NH1   1 
ATOM   4181  N  NH2   . ARG F  2 55  ? -0.463  -36.330 63.698 1.00 40.22  ? 55   ARG F NH2   1 
ATOM   4182  N  N     . GLY F  2 56  ? -7.364  -36.419 58.464 1.00 34.98  ? 56   GLY F N     1 
ATOM   4183  C  CA    . GLY F  2 56  ? -8.494  -36.886 57.692 1.00 34.75  ? 56   GLY F CA    1 
ATOM   4184  C  C     . GLY F  2 56  ? -9.088  -35.851 56.762 1.00 34.63  ? 56   GLY F C     1 
ATOM   4185  O  O     . GLY F  2 56  ? -9.404  -36.151 55.594 1.00 34.81  ? 56   GLY F O     1 
ATOM   4186  N  N     . VAL F  2 57  ? -9.238  -34.633 57.282 1.00 34.04  ? 57   VAL F N     1 
ATOM   4187  C  CA    . VAL F  2 57  ? -9.817  -33.530 56.525 1.00 33.36  ? 57   VAL F CA    1 
ATOM   4188  C  C     . VAL F  2 57  ? -8.887  -33.101 55.382 1.00 32.91  ? 57   VAL F C     1 
ATOM   4189  O  O     . VAL F  2 57  ? -9.342  -32.875 54.247 1.00 32.79  ? 57   VAL F O     1 
ATOM   4190  C  CB    . VAL F  2 57  ? -10.220 -32.378 57.457 1.00 33.34  ? 57   VAL F CB    1 
ATOM   4191  C  CG1   . VAL F  2 57  ? -10.466 -31.097 56.689 1.00 33.90  ? 57   VAL F CG1   1 
ATOM   4192  C  CG2   . VAL F  2 57  ? -11.482 -32.758 58.212 1.00 34.17  ? 57   VAL F CG2   1 
ATOM   4193  N  N     . LEU F  2 58  ? -7.588  -33.024 55.666 1.00 32.33  ? 58   LEU F N     1 
ATOM   4194  C  CA    . LEU F  2 58  ? -6.611  -32.777 54.609 1.00 31.75  ? 58   LEU F CA    1 
ATOM   4195  C  C     . LEU F  2 58  ? -6.618  -33.883 53.539 1.00 32.25  ? 58   LEU F C     1 
ATOM   4196  O  O     . LEU F  2 58  ? -6.565  -33.585 52.337 1.00 32.50  ? 58   LEU F O     1 
ATOM   4197  C  CB    . LEU F  2 58  ? -5.211  -32.567 55.185 1.00 31.29  ? 58   LEU F CB    1 
ATOM   4198  C  CG    . LEU F  2 58  ? -4.037  -32.416 54.212 1.00 30.17  ? 58   LEU F CG    1 
ATOM   4199  C  CD1   . LEU F  2 58  ? -4.234  -31.265 53.273 1.00 29.36  ? 58   LEU F CD1   1 
ATOM   4200  C  CD2   . LEU F  2 58  ? -2.729  -32.262 54.956 1.00 30.82  ? 58   LEU F CD2   1 
ATOM   4201  N  N     . LYS F  2 59  ? -6.704  -35.144 53.968 1.00 32.28  ? 59   LYS F N     1 
ATOM   4202  C  CA    . LYS F  2 59  ? -6.619  -36.252 53.028 1.00 32.70  ? 59   LYS F CA    1 
ATOM   4203  C  C     . LYS F  2 59  ? -7.692  -36.150 51.955 1.00 32.52  ? 59   LYS F C     1 
ATOM   4204  O  O     . LYS F  2 59  ? -7.399  -36.290 50.769 1.00 32.86  ? 59   LYS F O     1 
ATOM   4205  C  CB    . LYS F  2 59  ? -6.687  -37.604 53.737 1.00 33.12  ? 59   LYS F CB    1 
ATOM   4206  C  CG    . LYS F  2 59  ? -6.350  -38.795 52.818 1.00 34.39  ? 59   LYS F CG    1 
ATOM   4207  C  CD    . LYS F  2 59  ? -5.990  -40.054 53.591 1.00 35.66  ? 59   LYS F CD    1 
ATOM   4208  C  CE    . LYS F  2 59  ? -6.421  -41.320 52.829 1.00 36.82  ? 59   LYS F CE    1 
ATOM   4209  N  NZ    . LYS F  2 59  ? -7.876  -41.316 52.499 1.00 36.17  ? 59   LYS F NZ    1 
ATOM   4210  N  N     . VAL F  2 60  ? -8.922  -35.898 52.388 1.00 32.16  ? 60   VAL F N     1 
ATOM   4211  C  CA    . VAL F  2 60  ? -10.055 -35.646 51.504 1.00 31.93  ? 60   VAL F CA    1 
ATOM   4212  C  C     . VAL F  2 60  ? -9.790  -34.445 50.601 1.00 31.98  ? 60   VAL F C     1 
ATOM   4213  O  O     . VAL F  2 60  ? -10.082 -34.474 49.406 1.00 32.21  ? 60   VAL F O     1 
ATOM   4214  C  CB    . VAL F  2 60  ? -11.329 -35.351 52.324 1.00 31.76  ? 60   VAL F CB    1 
ATOM   4215  C  CG1   . VAL F  2 60  ? -12.387 -34.717 51.464 1.00 32.56  ? 60   VAL F CG1   1 
ATOM   4216  C  CG2   . VAL F  2 60  ? -11.869 -36.593 52.963 1.00 31.74  ? 60   VAL F CG2   1 
ATOM   4217  N  N     . PHE F  2 61  ? -9.245  -33.382 51.170 1.00 31.97  ? 61   PHE F N     1 
ATOM   4218  C  CA    . PHE F  2 61  ? -9.026  -32.193 50.385 1.00 32.43  ? 61   PHE F CA    1 
ATOM   4219  C  C     . PHE F  2 61  ? -8.076  -32.512 49.260 1.00 32.96  ? 61   PHE F C     1 
ATOM   4220  O  O     . PHE F  2 61  ? -8.330  -32.147 48.128 1.00 33.57  ? 61   PHE F O     1 
ATOM   4221  C  CB    . PHE F  2 61  ? -8.495  -31.040 51.247 1.00 32.52  ? 61   PHE F CB    1 
ATOM   4222  C  CG    . PHE F  2 61  ? -8.241  -29.756 50.481 1.00 31.37  ? 61   PHE F CG    1 
ATOM   4223  C  CD1   . PHE F  2 61  ? -9.259  -28.836 50.289 1.00 30.17  ? 61   PHE F CD1   1 
ATOM   4224  C  CD2   . PHE F  2 61  ? -6.971  -29.466 49.979 1.00 31.08  ? 61   PHE F CD2   1 
ATOM   4225  C  CE1   . PHE F  2 61  ? -9.033  -27.663 49.592 1.00 29.91  ? 61   PHE F CE1   1 
ATOM   4226  C  CE2   . PHE F  2 61  ? -6.726  -28.294 49.291 1.00 30.23  ? 61   PHE F CE2   1 
ATOM   4227  C  CZ    . PHE F  2 61  ? -7.761  -27.396 49.089 1.00 31.52  ? 61   PHE F CZ    1 
ATOM   4228  N  N     . LEU F  2 62  ? -6.989  -33.207 49.566 1.00 33.53  ? 62   LEU F N     1 
ATOM   4229  C  CA    . LEU F  2 62  ? -5.994  -33.507 48.549 1.00 34.15  ? 62   LEU F CA    1 
ATOM   4230  C  C     . LEU F  2 62  ? -6.533  -34.423 47.472 1.00 34.53  ? 62   LEU F C     1 
ATOM   4231  O  O     . LEU F  2 62  ? -6.314  -34.192 46.278 1.00 34.41  ? 62   LEU F O     1 
ATOM   4232  C  CB    . LEU F  2 62  ? -4.751  -34.103 49.187 1.00 34.25  ? 62   LEU F CB    1 
ATOM   4233  C  CG    . LEU F  2 62  ? -3.880  -33.053 49.876 1.00 35.25  ? 62   LEU F CG    1 
ATOM   4234  C  CD1   . LEU F  2 62  ? -2.662  -33.713 50.501 1.00 36.22  ? 62   LEU F CD1   1 
ATOM   4235  C  CD2   . LEU F  2 62  ? -3.437  -31.993 48.875 1.00 36.04  ? 62   LEU F CD2   1 
ATOM   4236  N  N     . GLU F  2 63  ? -7.248  -35.460 47.900 1.00 35.18  ? 63   GLU F N     1 
ATOM   4237  C  CA    . GLU F  2 63  ? -7.813  -36.426 46.978 1.00 36.03  ? 63   GLU F CA    1 
ATOM   4238  C  C     . GLU F  2 63  ? -8.636  -35.724 45.926 1.00 35.99  ? 63   GLU F C     1 
ATOM   4239  O  O     . GLU F  2 63  ? -8.503  -36.024 44.732 1.00 36.20  ? 63   GLU F O     1 
ATOM   4240  C  CB    . GLU F  2 63  ? -8.690  -37.422 47.708 1.00 36.33  ? 63   GLU F CB    1 
ATOM   4241  C  CG    . GLU F  2 63  ? -7.929  -38.519 48.394 1.00 39.78  ? 63   GLU F CG    1 
ATOM   4242  C  CD    . GLU F  2 63  ? -8.782  -39.305 49.398 1.00 44.60  ? 63   GLU F CD    1 
ATOM   4243  O  OE1   . GLU F  2 63  ? -10.011 -39.041 49.504 1.00 45.57  ? 63   GLU F OE1   1 
ATOM   4244  O  OE2   . GLU F  2 63  ? -8.207  -40.184 50.095 1.00 46.88  ? 63   GLU F OE2   1 
ATOM   4245  N  N     . ASN F  2 64  ? -9.473  -34.787 46.374 1.00 35.74  ? 64   ASN F N     1 
ATOM   4246  C  CA    . ASN F  2 64  ? -10.389 -34.095 45.488 1.00 35.84  ? 64   ASN F CA    1 
ATOM   4247  C  C     . ASN F  2 64  ? -9.662  -33.231 44.490 1.00 35.23  ? 64   ASN F C     1 
ATOM   4248  O  O     . ASN F  2 64  ? -9.963  -33.264 43.296 1.00 35.12  ? 64   ASN F O     1 
ATOM   4249  C  CB    . ASN F  2 64  ? -11.409 -33.283 46.281 1.00 36.41  ? 64   ASN F CB    1 
ATOM   4250  C  CG    . ASN F  2 64  ? -12.441 -34.166 46.956 1.00 38.87  ? 64   ASN F CG    1 
ATOM   4251  O  OD1   . ASN F  2 64  ? -12.572 -35.340 46.605 1.00 41.77  ? 64   ASN F OD1   1 
ATOM   4252  N  ND2   . ASN F  2 64  ? -13.171 -33.618 47.944 1.00 40.72  ? 64   ASN F ND2   1 
ATOM   4253  N  N     . VAL F  2 65  ? -8.700  -32.469 44.981 1.00 34.68  ? 65   VAL F N     1 
ATOM   4254  C  CA    . VAL F  2 65  ? -7.904  -31.640 44.110 1.00 34.66  ? 65   VAL F CA    1 
ATOM   4255  C  C     . VAL F  2 65  ? -7.064  -32.500 43.171 1.00 35.22  ? 65   VAL F C     1 
ATOM   4256  O  O     . VAL F  2 65  ? -7.013  -32.204 41.976 1.00 35.97  ? 65   VAL F O     1 
ATOM   4257  C  CB    . VAL F  2 65  ? -6.999  -30.670 44.872 1.00 34.16  ? 65   VAL F CB    1 
ATOM   4258  C  CG1   . VAL F  2 65  ? -6.361  -29.714 43.926 1.00 33.04  ? 65   VAL F CG1   1 
ATOM   4259  C  CG2   . VAL F  2 65  ? -7.803  -29.893 45.846 1.00 35.16  ? 65   VAL F CG2   1 
ATOM   4260  N  N     . ILE F  2 66  ? -6.417  -33.561 43.661 1.00 35.02  ? 66   ILE F N     1 
ATOM   4261  C  CA    . ILE F  2 66  ? -5.557  -34.321 42.755 1.00 34.97  ? 66   ILE F CA    1 
ATOM   4262  C  C     . ILE F  2 66  ? -6.376  -35.026 41.658 1.00 35.47  ? 66   ILE F C     1 
ATOM   4263  O  O     . ILE F  2 66  ? -6.020  -34.966 40.488 1.00 35.27  ? 66   ILE F O     1 
ATOM   4264  C  CB    . ILE F  2 66  ? -4.607  -35.268 43.478 1.00 34.77  ? 66   ILE F CB    1 
ATOM   4265  C  CG1   . ILE F  2 66  ? -3.550  -34.472 44.221 1.00 34.26  ? 66   ILE F CG1   1 
ATOM   4266  C  CG2   . ILE F  2 66  ? -3.880  -36.142 42.472 1.00 34.67  ? 66   ILE F CG2   1 
ATOM   4267  C  CD1   . ILE F  2 66  ? -2.987  -35.186 45.417 1.00 34.38  ? 66   ILE F CD1   1 
ATOM   4268  N  N     . ARG F  2 67  ? -7.481  -35.662 42.043 1.00 35.97  ? 67   ARG F N     1 
ATOM   4269  C  CA    . ARG F  2 67  ? -8.375  -36.301 41.094 1.00 36.87  ? 67   ARG F CA    1 
ATOM   4270  C  C     . ARG F  2 67  ? -8.631  -35.391 39.890 1.00 36.45  ? 67   ARG F C     1 
ATOM   4271  O  O     . ARG F  2 67  ? -8.435  -35.803 38.747 1.00 36.86  ? 67   ARG F O     1 
ATOM   4272  C  CB    . ARG F  2 67  ? -9.682  -36.705 41.780 1.00 36.53  ? 67   ARG F CB    1 
ATOM   4273  C  CG    . ARG F  2 67  ? -10.727 -37.327 40.858 1.00 38.00  ? 67   ARG F CG    1 
ATOM   4274  C  CD    . ARG F  2 67  ? -12.035 -37.628 41.598 1.00 39.83  ? 67   ARG F CD    1 
ATOM   4275  N  NE    . ARG F  2 67  ? -11.823 -38.504 42.775 1.00 49.08  ? 67   ARG F NE    1 
ATOM   4276  C  CZ    . ARG F  2 67  ? -12.096 -38.187 44.054 1.00 50.77  ? 67   ARG F CZ    1 
ATOM   4277  N  NH1   . ARG F  2 67  ? -12.619 -36.998 44.364 1.00 52.73  ? 67   ARG F NH1   1 
ATOM   4278  N  NH2   . ARG F  2 67  ? -11.854 -39.068 45.031 1.00 50.02  ? 67   ARG F NH2   1 
ATOM   4279  N  N     . ASP F  2 68  ? -9.044  -34.155 40.143 1.00 36.28  ? 68   ASP F N     1 
ATOM   4280  C  CA    . ASP F  2 68  ? -9.339  -33.223 39.067 1.00 36.16  ? 68   ASP F CA    1 
ATOM   4281  C  C     . ASP F  2 68  ? -8.085  -32.829 38.321 1.00 35.89  ? 68   ASP F C     1 
ATOM   4282  O  O     . ASP F  2 68  ? -8.064  -32.809 37.093 1.00 35.44  ? 68   ASP F O     1 
ATOM   4283  C  CB    . ASP F  2 68  ? -10.029 -31.989 39.617 1.00 36.51  ? 68   ASP F CB    1 
ATOM   4284  C  CG    . ASP F  2 68  ? -11.483 -32.242 39.953 1.00 37.87  ? 68   ASP F CG    1 
ATOM   4285  O  OD1   . ASP F  2 68  ? -11.935 -33.407 39.842 1.00 39.37  ? 68   ASP F OD1   1 
ATOM   4286  O  OD2   . ASP F  2 68  ? -12.173 -31.270 40.328 1.00 38.48  ? 68   ASP F OD2   1 
ATOM   4287  N  N     . ALA F  2 69  ? -7.035  -32.534 39.080 1.00 35.94  ? 69   ALA F N     1 
ATOM   4288  C  CA    . ALA F  2 69  ? -5.717  -32.213 38.527 1.00 35.71  ? 69   ALA F CA    1 
ATOM   4289  C  C     . ALA F  2 69  ? -5.266  -33.283 37.557 1.00 35.62  ? 69   ALA F C     1 
ATOM   4290  O  O     . ALA F  2 69  ? -4.867  -32.986 36.428 1.00 36.17  ? 69   ALA F O     1 
ATOM   4291  C  CB    . ALA F  2 69  ? -4.700  -32.051 39.628 1.00 35.20  ? 69   ALA F CB    1 
ATOM   4292  N  N     . VAL F  2 70  ? -5.354  -34.532 37.988 1.00 35.43  ? 70   VAL F N     1 
ATOM   4293  C  CA    . VAL F  2 70  ? -4.916  -35.630 37.157 1.00 35.28  ? 70   VAL F CA    1 
ATOM   4294  C  C     . VAL F  2 70  ? -5.864  -35.849 35.978 1.00 35.96  ? 70   VAL F C     1 
ATOM   4295  O  O     . VAL F  2 70  ? -5.414  -36.212 34.891 1.00 36.42  ? 70   VAL F O     1 
ATOM   4296  C  CB    . VAL F  2 70  ? -4.650  -36.878 37.979 1.00 34.80  ? 70   VAL F CB    1 
ATOM   4297  C  CG1   . VAL F  2 70  ? -4.510  -38.079 37.092 1.00 34.02  ? 70   VAL F CG1   1 
ATOM   4298  C  CG2   . VAL F  2 70  ? -3.393  -36.658 38.789 1.00 33.94  ? 70   VAL F CG2   1 
ATOM   4299  N  N     . THR F  2 71  ? -7.154  -35.587 36.159 1.00 36.13  ? 71   THR F N     1 
ATOM   4300  C  CA    . THR F  2 71  ? -8.068  -35.668 35.036 1.00 36.63  ? 71   THR F CA    1 
ATOM   4301  C  C     . THR F  2 71  ? -7.622  -34.701 33.927 1.00 38.06  ? 71   THR F C     1 
ATOM   4302  O  O     . THR F  2 71  ? -7.591  -35.056 32.741 1.00 38.41  ? 71   THR F O     1 
ATOM   4303  C  CB    . THR F  2 71  ? -9.479  -35.418 35.487 1.00 36.25  ? 71   THR F CB    1 
ATOM   4304  O  OG1   . THR F  2 71  ? -9.799  -36.373 36.491 1.00 35.21  ? 71   THR F OG1   1 
ATOM   4305  C  CG2   . THR F  2 71  ? -10.444 -35.578 34.365 1.00 35.47  ? 71   THR F CG2   1 
ATOM   4306  N  N     . TYR F  2 72  ? -7.227  -33.495 34.316 1.00 39.51  ? 72   TYR F N     1 
ATOM   4307  C  CA    . TYR F  2 72  ? -6.650  -32.554 33.355 1.00 40.84  ? 72   TYR F CA    1 
ATOM   4308  C  C     . TYR F  2 72  ? -5.381  -33.110 32.681 1.00 41.87  ? 72   TYR F C     1 
ATOM   4309  O  O     . TYR F  2 72  ? -5.289  -33.116 31.447 1.00 42.21  ? 72   TYR F O     1 
ATOM   4310  C  CB    . TYR F  2 72  ? -6.428  -31.168 33.980 1.00 40.49  ? 72   TYR F CB    1 
ATOM   4311  C  CG    . TYR F  2 72  ? -7.723  -30.391 34.199 1.00 40.26  ? 72   TYR F CG    1 
ATOM   4312  C  CD1   . TYR F  2 72  ? -8.082  -29.920 35.456 1.00 39.24  ? 72   TYR F CD1   1 
ATOM   4313  C  CD2   . TYR F  2 72  ? -8.585  -30.127 33.142 1.00 39.88  ? 72   TYR F CD2   1 
ATOM   4314  C  CE1   . TYR F  2 72  ? -9.260  -29.214 35.646 1.00 39.10  ? 72   TYR F CE1   1 
ATOM   4315  C  CE2   . TYR F  2 72  ? -9.758  -29.428 33.329 1.00 39.33  ? 72   TYR F CE2   1 
ATOM   4316  C  CZ    . TYR F  2 72  ? -10.094 -28.979 34.577 1.00 39.68  ? 72   TYR F CZ    1 
ATOM   4317  O  OH    . TYR F  2 72  ? -11.279 -28.290 34.741 1.00 40.92  ? 72   TYR F OH    1 
ATOM   4318  N  N     . THR F  2 73  ? -4.428  -33.602 33.475 1.00 42.80  ? 73   THR F N     1 
ATOM   4319  C  CA    . THR F  2 73  ? -3.199  -34.175 32.921 1.00 43.76  ? 73   THR F CA    1 
ATOM   4320  C  C     . THR F  2 73  ? -3.514  -35.221 31.881 1.00 45.01  ? 73   THR F C     1 
ATOM   4321  O  O     . THR F  2 73  ? -2.955  -35.205 30.806 1.00 45.04  ? 73   THR F O     1 
ATOM   4322  C  CB    . THR F  2 73  ? -2.385  -34.886 33.982 1.00 43.38  ? 73   THR F CB    1 
ATOM   4323  O  OG1   . THR F  2 73  ? -2.311  -34.073 35.153 1.00 42.83  ? 73   THR F OG1   1 
ATOM   4324  C  CG2   . THR F  2 73  ? -1.001  -35.168 33.459 1.00 43.09  ? 73   THR F CG2   1 
ATOM   4325  N  N     . GLU F  2 74  ? -4.417  -36.133 32.234 1.00 46.74  ? 74   GLU F N     1 
ATOM   4326  C  CA    . GLU F  2 74  ? -4.739  -37.289 31.416 1.00 48.76  ? 74   GLU F CA    1 
ATOM   4327  C  C     . GLU F  2 74  ? -5.378  -36.819 30.143 1.00 48.42  ? 74   GLU F C     1 
ATOM   4328  O  O     . GLU F  2 74  ? -4.961  -37.217 29.046 1.00 48.65  ? 74   GLU F O     1 
ATOM   4329  C  CB    . GLU F  2 74  ? -5.702  -38.231 32.138 1.00 48.44  ? 74   GLU F CB    1 
ATOM   4330  C  CG    . GLU F  2 74  ? -5.042  -39.184 33.140 1.00 51.29  ? 74   GLU F CG    1 
ATOM   4331  C  CD    . GLU F  2 74  ? -5.984  -40.327 33.591 1.00 52.52  ? 74   GLU F CD    1 
ATOM   4332  O  OE1   . GLU F  2 74  ? -6.403  -41.155 32.733 1.00 57.27  ? 74   GLU F OE1   1 
ATOM   4333  O  OE2   . GLU F  2 74  ? -6.305  -40.406 34.806 1.00 57.17  ? 74   GLU F OE2   1 
ATOM   4334  N  N     . HIS F  2 75  ? -6.387  -35.960 30.282 1.00 48.36  ? 75   HIS F N     1 
ATOM   4335  C  CA    . HIS F  2 75  ? -7.059  -35.444 29.104 1.00 48.22  ? 75   HIS F CA    1 
ATOM   4336  C  C     . HIS F  2 75  ? -6.069  -34.820 28.135 1.00 47.78  ? 75   HIS F C     1 
ATOM   4337  O  O     . HIS F  2 75  ? -6.358  -34.668 26.961 1.00 47.68  ? 75   HIS F O     1 
ATOM   4338  C  CB    . HIS F  2 75  ? -8.110  -34.425 29.462 1.00 48.27  ? 75   HIS F CB    1 
ATOM   4339  C  CG    . HIS F  2 75  ? -8.811  -33.879 28.266 1.00 49.86  ? 75   HIS F CG    1 
ATOM   4340  N  ND1   . HIS F  2 75  ? -9.895  -34.506 27.694 1.00 51.41  ? 75   HIS F ND1   1 
ATOM   4341  C  CD2   . HIS F  2 75  ? -8.557  -32.789 27.502 1.00 51.86  ? 75   HIS F CD2   1 
ATOM   4342  C  CE1   . HIS F  2 75  ? -10.298 -33.812 26.644 1.00 52.97  ? 75   HIS F CE1   1 
ATOM   4343  N  NE2   . HIS F  2 75  ? -9.502  -32.766 26.503 1.00 53.29  ? 75   HIS F NE2   1 
ATOM   4344  N  N     . ALA F  2 76  ? -4.898  -34.465 28.647 1.00 47.51  ? 76   ALA F N     1 
ATOM   4345  C  CA    . ALA F  2 76  ? -3.896  -33.771 27.876 1.00 47.26  ? 76   ALA F CA    1 
ATOM   4346  C  C     . ALA F  2 76  ? -2.873  -34.756 27.394 1.00 47.28  ? 76   ALA F C     1 
ATOM   4347  O  O     . ALA F  2 76  ? -1.893  -34.373 26.782 1.00 47.37  ? 76   ALA F O     1 
ATOM   4348  C  CB    . ALA F  2 76  ? -3.237  -32.702 28.724 1.00 47.15  ? 76   ALA F CB    1 
ATOM   4349  N  N     . LYS F  2 77  ? -3.098  -36.031 27.685 1.00 47.65  ? 77   LYS F N     1 
ATOM   4350  C  CA    . LYS F  2 77  ? -2.172  -37.107 27.305 1.00 48.03  ? 77   LYS F CA    1 
ATOM   4351  C  C     . LYS F  2 77  ? -0.735  -36.865 27.787 1.00 47.51  ? 77   LYS F C     1 
ATOM   4352  O  O     . LYS F  2 77  ? 0.221   -37.191 27.085 1.00 47.70  ? 77   LYS F O     1 
ATOM   4353  C  CB    . LYS F  2 77  ? -2.207  -37.344 25.788 1.00 48.30  ? 77   LYS F CB    1 
ATOM   4354  C  CG    . LYS F  2 77  ? -3.608  -37.539 25.219 1.00 50.47  ? 77   LYS F CG    1 
ATOM   4355  C  CD    . LYS F  2 77  ? -3.544  -38.234 23.850 1.00 55.09  ? 77   LYS F CD    1 
ATOM   4356  C  CE    . LYS F  2 77  ? -4.951  -38.499 23.294 1.00 56.96  ? 77   LYS F CE    1 
ATOM   4357  N  NZ    . LYS F  2 77  ? -5.430  -37.365 22.402 1.00 59.31  ? 77   LYS F NZ    1 
ATOM   4358  N  N     . ARG F  2 78  ? -0.601  -36.288 28.979 1.00 46.94  ? 78   ARG F N     1 
ATOM   4359  C  CA    . ARG F  2 78  ? 0.692   -36.035 29.585 1.00 46.78  ? 78   ARG F CA    1 
ATOM   4360  C  C     . ARG F  2 78  ? 0.907   -37.002 30.725 1.00 47.16  ? 78   ARG F C     1 
ATOM   4361  O  O     . ARG F  2 78  ? -0.047  -37.617 31.197 1.00 47.23  ? 78   ARG F O     1 
ATOM   4362  C  CB    . ARG F  2 78  ? 0.750   -34.618 30.120 1.00 46.54  ? 78   ARG F CB    1 
ATOM   4363  C  CG    . ARG F  2 78  ? 0.958   -33.588 29.061 1.00 46.58  ? 78   ARG F CG    1 
ATOM   4364  C  CD    . ARG F  2 78  ? 1.271   -32.233 29.669 1.00 47.89  ? 78   ARG F CD    1 
ATOM   4365  N  NE    . ARG F  2 78  ? 0.069   -31.422 29.876 1.00 48.83  ? 78   ARG F NE    1 
ATOM   4366  C  CZ    . ARG F  2 78  ? -0.599  -31.330 31.025 1.00 47.79  ? 78   ARG F CZ    1 
ATOM   4367  N  NH1   . ARG F  2 78  ? -0.196  -31.995 32.102 1.00 46.08  ? 78   ARG F NH1   1 
ATOM   4368  N  NH2   . ARG F  2 78  ? -1.678  -30.566 31.089 1.00 47.21  ? 78   ARG F NH2   1 
ATOM   4369  N  N     . LYS F  2 79  ? 2.156   -37.133 31.167 1.00 47.44  ? 79   LYS F N     1 
ATOM   4370  C  CA    . LYS F  2 79  ? 2.501   -38.019 32.283 1.00 48.27  ? 79   LYS F CA    1 
ATOM   4371  C  C     . LYS F  2 79  ? 2.944   -37.189 33.482 1.00 47.62  ? 79   LYS F C     1 
ATOM   4372  O  O     . LYS F  2 79  ? 3.153   -37.698 34.590 1.00 47.87  ? 79   LYS F O     1 
ATOM   4373  C  CB    . LYS F  2 79  ? 3.567   -39.040 31.851 1.00 47.96  ? 79   LYS F CB    1 
ATOM   4374  C  CG    . LYS F  2 79  ? 3.026   -40.025 30.764 1.00 50.39  ? 79   LYS F CG    1 
ATOM   4375  C  CD    . LYS F  2 79  ? 4.086   -40.968 30.158 1.00 50.98  ? 79   LYS F CD    1 
ATOM   4376  C  CE    . LYS F  2 79  ? 4.394   -42.216 31.056 1.00 55.94  ? 79   LYS F CE    1 
ATOM   4377  N  NZ    . LYS F  2 79  ? 5.029   -41.887 32.398 1.00 57.56  ? 79   LYS F NZ    1 
ATOM   4378  N  N     . THR F  2 80  ? 3.062   -35.889 33.248 1.00 47.07  ? 80   THR F N     1 
ATOM   4379  C  CA    . THR F  2 80  ? 3.446   -34.942 34.278 1.00 46.04  ? 80   THR F CA    1 
ATOM   4380  C  C     . THR F  2 80  ? 2.275   -34.025 34.632 1.00 45.21  ? 80   THR F C     1 
ATOM   4381  O  O     . THR F  2 80  ? 1.679   -33.391 33.763 1.00 45.04  ? 80   THR F O     1 
ATOM   4382  C  CB    . THR F  2 80  ? 4.641   -34.097 33.819 1.00 46.09  ? 80   THR F CB    1 
ATOM   4383  O  OG1   . THR F  2 80  ? 5.708   -34.961 33.412 1.00 46.32  ? 80   THR F OG1   1 
ATOM   4384  C  CG2   . THR F  2 80  ? 5.119   -33.214 34.948 1.00 46.54  ? 80   THR F CG2   1 
ATOM   4385  N  N     . VAL F  2 81  ? 1.951   -33.987 35.916 1.00 44.25  ? 81   VAL F N     1 
ATOM   4386  C  CA    . VAL F  2 81  ? 0.988   -33.059 36.462 1.00 43.42  ? 81   VAL F CA    1 
ATOM   4387  C  C     . VAL F  2 81  ? 1.672   -31.688 36.514 1.00 43.32  ? 81   VAL F C     1 
ATOM   4388  O  O     . VAL F  2 81  ? 2.627   -31.499 37.265 1.00 43.58  ? 81   VAL F O     1 
ATOM   4389  C  CB    . VAL F  2 81  ? 0.566   -33.506 37.885 1.00 43.40  ? 81   VAL F CB    1 
ATOM   4390  C  CG1   . VAL F  2 81  ? -0.442  -32.548 38.502 1.00 42.81  ? 81   VAL F CG1   1 
ATOM   4391  C  CG2   . VAL F  2 81  ? -0.001  -34.916 37.854 1.00 43.35  ? 81   VAL F CG2   1 
ATOM   4392  N  N     . THR F  2 82  ? 1.188   -30.744 35.707 1.00 42.78  ? 82   THR F N     1 
ATOM   4393  C  CA    . THR F  2 82  ? 1.714   -29.378 35.647 1.00 41.92  ? 82   THR F CA    1 
ATOM   4394  C  C     . THR F  2 82  ? 1.045   -28.526 36.714 1.00 41.54  ? 82   THR F C     1 
ATOM   4395  O  O     . THR F  2 82  ? 0.017   -28.922 37.258 1.00 41.38  ? 82   THR F O     1 
ATOM   4396  C  CB    . THR F  2 82  ? 1.401   -28.736 34.286 1.00 42.14  ? 82   THR F CB    1 
ATOM   4397  O  OG1   . THR F  2 82  ? 0.004   -28.454 34.208 1.00 42.39  ? 82   THR F OG1   1 
ATOM   4398  C  CG2   . THR F  2 82  ? 1.755   -29.670 33.138 1.00 42.29  ? 82   THR F CG2   1 
ATOM   4399  N  N     . ALA F  2 83  ? 1.598   -27.349 37.006 1.00 41.08  ? 83   ALA F N     1 
ATOM   4400  C  CA    . ALA F  2 83  ? 0.958   -26.457 37.978 1.00 40.49  ? 83   ALA F CA    1 
ATOM   4401  C  C     . ALA F  2 83  ? -0.380  -25.897 37.459 1.00 40.45  ? 83   ALA F C     1 
ATOM   4402  O  O     . ALA F  2 83  ? -1.287  -25.600 38.248 1.00 40.38  ? 83   ALA F O     1 
ATOM   4403  C  CB    . ALA F  2 83  ? 1.872   -25.359 38.375 1.00 40.08  ? 83   ALA F CB    1 
ATOM   4404  N  N     . MET F  2 84  ? -0.514  -25.767 36.139 1.00 39.99  ? 84   MET F N     1 
ATOM   4405  C  CA    . MET F  2 84  ? -1.777  -25.321 35.572 1.00 39.72  ? 84   MET F CA    1 
ATOM   4406  C  C     . MET F  2 84  ? -2.872  -26.325 35.852 1.00 39.27  ? 84   MET F C     1 
ATOM   4407  O  O     . MET F  2 84  ? -4.010  -25.955 36.131 1.00 39.41  ? 84   MET F O     1 
ATOM   4408  C  CB    . MET F  2 84  ? -1.669  -25.076 34.071 1.00 40.05  ? 84   MET F CB    1 
ATOM   4409  C  CG    . MET F  2 84  ? -0.992  -23.772 33.703 1.00 41.88  ? 84   MET F CG    1 
ATOM   4410  S  SD    . MET F  2 84  ? -1.412  -22.389 34.801 1.00 47.83  ? 84   MET F SD    1 
ATOM   4411  C  CE    . MET F  2 84  ? -3.108  -22.027 34.319 1.00 45.84  ? 84   MET F CE    1 
ATOM   4412  N  N     . ASP F  2 85  ? -2.518  -27.601 35.782 1.00 38.63  ? 85   ASP F N     1 
ATOM   4413  C  CA    . ASP F  2 85  ? -3.455  -28.668 36.091 1.00 38.08  ? 85   ASP F CA    1 
ATOM   4414  C  C     . ASP F  2 85  ? -4.029  -28.475 37.475 1.00 36.92  ? 85   ASP F C     1 
ATOM   4415  O  O     . ASP F  2 85  ? -5.229  -28.551 37.660 1.00 36.90  ? 85   ASP F O     1 
ATOM   4416  C  CB    . ASP F  2 85  ? -2.764  -30.028 36.002 1.00 38.63  ? 85   ASP F CB    1 
ATOM   4417  C  CG    . ASP F  2 85  ? -2.308  -30.360 34.593 1.00 40.70  ? 85   ASP F CG    1 
ATOM   4418  O  OD1   . ASP F  2 85  ? -2.852  -29.764 33.628 1.00 43.11  ? 85   ASP F OD1   1 
ATOM   4419  O  OD2   . ASP F  2 85  ? -1.402  -31.214 34.452 1.00 42.42  ? 85   ASP F OD2   1 
ATOM   4420  N  N     . VAL F  2 86  ? -3.152  -28.212 38.437 1.00 35.78  ? 86   VAL F N     1 
ATOM   4421  C  CA    . VAL F  2 86  ? -3.531  -27.998 39.811 1.00 34.67  ? 86   VAL F CA    1 
ATOM   4422  C  C     . VAL F  2 86  ? -4.337  -26.713 39.898 1.00 35.15  ? 86   VAL F C     1 
ATOM   4423  O  O     . VAL F  2 86  ? -5.323  -26.624 40.647 1.00 35.32  ? 86   VAL F O     1 
ATOM   4424  C  CB    . VAL F  2 86  ? -2.300  -27.889 40.678 1.00 34.02  ? 86   VAL F CB    1 
ATOM   4425  C  CG1   . VAL F  2 86  ? -2.686  -27.587 42.071 1.00 33.67  ? 86   VAL F CG1   1 
ATOM   4426  C  CG2   . VAL F  2 86  ? -1.544  -29.181 40.640 1.00 33.86  ? 86   VAL F CG2   1 
ATOM   4427  N  N     . VAL F  2 87  ? -3.925  -25.718 39.115 1.00 35.14  ? 87   VAL F N     1 
ATOM   4428  C  CA    . VAL F  2 87  ? -4.611  -24.439 39.117 1.00 34.90  ? 87   VAL F CA    1 
ATOM   4429  C  C     . VAL F  2 87  ? -6.036  -24.577 38.575 1.00 35.19  ? 87   VAL F C     1 
ATOM   4430  O  O     . VAL F  2 87  ? -6.972  -24.097 39.209 1.00 35.57  ? 87   VAL F O     1 
ATOM   4431  C  CB    . VAL F  2 87  ? -3.825  -23.354 38.374 1.00 34.50  ? 87   VAL F CB    1 
ATOM   4432  C  CG1   . VAL F  2 87  ? -4.656  -22.101 38.258 1.00 34.02  ? 87   VAL F CG1   1 
ATOM   4433  C  CG2   . VAL F  2 87  ? -2.569  -23.051 39.114 1.00 34.19  ? 87   VAL F CG2   1 
ATOM   4434  N  N     . TYR F  2 88  ? -6.204  -25.237 37.428 1.00 35.32  ? 88   TYR F N     1 
ATOM   4435  C  CA    . TYR F  2 88  ? -7.535  -25.423 36.865 1.00 35.78  ? 88   TYR F CA    1 
ATOM   4436  C  C     . TYR F  2 88  ? -8.369  -26.261 37.794 1.00 35.78  ? 88   TYR F C     1 
ATOM   4437  O  O     . TYR F  2 88  ? -9.581  -26.078 37.882 1.00 36.06  ? 88   TYR F O     1 
ATOM   4438  C  CB    . TYR F  2 88  ? -7.493  -26.087 35.491 1.00 36.44  ? 88   TYR F CB    1 
ATOM   4439  C  CG    . TYR F  2 88  ? -6.746  -25.294 34.470 1.00 37.29  ? 88   TYR F CG    1 
ATOM   4440  C  CD1   . TYR F  2 88  ? -5.829  -25.894 33.636 1.00 38.50  ? 88   TYR F CD1   1 
ATOM   4441  C  CD2   . TYR F  2 88  ? -6.946  -23.933 34.348 1.00 38.37  ? 88   TYR F CD2   1 
ATOM   4442  C  CE1   . TYR F  2 88  ? -5.144  -25.164 32.699 1.00 39.45  ? 88   TYR F CE1   1 
ATOM   4443  C  CE2   . TYR F  2 88  ? -6.272  -23.193 33.429 1.00 37.94  ? 88   TYR F CE2   1 
ATOM   4444  C  CZ    . TYR F  2 88  ? -5.376  -23.808 32.608 1.00 38.98  ? 88   TYR F CZ    1 
ATOM   4445  O  OH    . TYR F  2 88  ? -4.698  -23.054 31.686 1.00 40.23  ? 88   TYR F OH    1 
ATOM   4446  N  N     . ALA F  2 89  ? -7.711  -27.182 38.484 1.00 35.60  ? 89   ALA F N     1 
ATOM   4447  C  CA    . ALA F  2 89  ? -8.395  -28.067 39.392 1.00 35.74  ? 89   ALA F CA    1 
ATOM   4448  C  C     . ALA F  2 89  ? -8.897  -27.241 40.558 1.00 36.01  ? 89   ALA F C     1 
ATOM   4449  O  O     . ALA F  2 89  ? -10.073 -27.323 40.933 1.00 36.37  ? 89   ALA F O     1 
ATOM   4450  C  CB    . ALA F  2 89  ? -7.478  -29.163 39.857 1.00 35.52  ? 89   ALA F CB    1 
ATOM   4451  N  N     . LEU F  2 90  ? -8.023  -26.410 41.110 1.00 36.11  ? 90   LEU F N     1 
ATOM   4452  C  CA    . LEU F  2 90  ? -8.435  -25.567 42.214 1.00 36.33  ? 90   LEU F CA    1 
ATOM   4453  C  C     . LEU F  2 90  ? -9.554  -24.614 41.816 1.00 36.92  ? 90   LEU F C     1 
ATOM   4454  O  O     . LEU F  2 90  ? -10.518 -24.461 42.564 1.00 37.05  ? 90   LEU F O     1 
ATOM   4455  C  CB    . LEU F  2 90  ? -7.250  -24.828 42.825 1.00 35.91  ? 90   LEU F CB    1 
ATOM   4456  C  CG    . LEU F  2 90  ? -6.342  -25.686 43.705 1.00 34.96  ? 90   LEU F CG    1 
ATOM   4457  C  CD1   . LEU F  2 90  ? -5.030  -24.971 43.978 1.00 32.99  ? 90   LEU F CD1   1 
ATOM   4458  C  CD2   . LEU F  2 90  ? -7.048  -26.111 45.015 1.00 33.16  ? 90   LEU F CD2   1 
ATOM   4459  N  N     . LYS F  2 91  ? -9.452  -23.996 40.643 1.00 37.63  ? 91   LYS F N     1 
ATOM   4460  C  CA    . LYS F  2 91  ? -10.484 -23.052 40.248 1.00 38.90  ? 91   LYS F CA    1 
ATOM   4461  C  C     . LYS F  2 91  ? -11.847 -23.719 40.265 1.00 39.58  ? 91   LYS F C     1 
ATOM   4462  O  O     . LYS F  2 91  ? -12.760 -23.259 40.968 1.00 39.82  ? 91   LYS F O     1 
ATOM   4463  C  CB    . LYS F  2 91  ? -10.228 -22.417 38.888 1.00 38.95  ? 91   LYS F CB    1 
ATOM   4464  C  CG    . LYS F  2 91  ? -11.338 -21.449 38.470 1.00 40.40  ? 91   LYS F CG    1 
ATOM   4465  C  CD    . LYS F  2 91  ? -11.060 -20.764 37.149 1.00 43.79  ? 91   LYS F CD    1 
ATOM   4466  C  CE    . LYS F  2 91  ? -10.118 -19.580 37.342 1.00 47.37  ? 91   LYS F CE    1 
ATOM   4467  N  NZ    . LYS F  2 91  ? -10.135 -18.644 36.162 1.00 49.94  ? 91   LYS F NZ    1 
ATOM   4468  N  N     . ARG F  2 92  ? -11.973 -24.817 39.521 1.00 40.32  ? 92   ARG F N     1 
ATOM   4469  C  CA    . ARG F  2 92  ? -13.253 -25.527 39.395 1.00 40.93  ? 92   ARG F CA    1 
ATOM   4470  C  C     . ARG F  2 92  ? -13.830 -26.092 40.705 1.00 41.27  ? 92   ARG F C     1 
ATOM   4471  O  O     . ARG F  2 92  ? -14.967 -26.535 40.741 1.00 41.71  ? 92   ARG F O     1 
ATOM   4472  C  CB    . ARG F  2 92  ? -13.167 -26.616 38.336 1.00 40.86  ? 92   ARG F CB    1 
ATOM   4473  C  CG    . ARG F  2 92  ? -12.600 -27.910 38.820 1.00 40.97  ? 92   ARG F CG    1 
ATOM   4474  C  CD    . ARG F  2 92  ? -12.874 -28.978 37.775 1.00 41.88  ? 92   ARG F CD    1 
ATOM   4475  N  NE    . ARG F  2 92  ? -14.308 -29.195 37.575 1.00 40.68  ? 92   ARG F NE    1 
ATOM   4476  C  CZ    . ARG F  2 92  ? -15.089 -29.881 38.411 1.00 41.41  ? 92   ARG F CZ    1 
ATOM   4477  N  NH1   . ARG F  2 92  ? -14.602 -30.429 39.523 1.00 39.20  ? 92   ARG F NH1   1 
ATOM   4478  N  NH2   . ARG F  2 92  ? -16.379 -30.021 38.134 1.00 44.00  ? 92   ARG F NH2   1 
ATOM   4479  N  N     . GLN F  2 93  ? -13.060 -26.053 41.782 1.00 41.61  ? 93   GLN F N     1 
ATOM   4480  C  CA    . GLN F  2 93  ? -13.597 -26.391 43.090 1.00 41.81  ? 93   GLN F CA    1 
ATOM   4481  C  C     . GLN F  2 93  ? -13.904 -25.157 43.920 1.00 41.37  ? 93   GLN F C     1 
ATOM   4482  O  O     . GLN F  2 93  ? -14.165 -25.235 45.121 1.00 41.16  ? 93   GLN F O     1 
ATOM   4483  C  CB    . GLN F  2 93  ? -12.600 -27.278 43.791 1.00 42.20  ? 93   GLN F CB    1 
ATOM   4484  C  CG    . GLN F  2 93  ? -12.355 -28.515 42.975 1.00 44.91  ? 93   GLN F CG    1 
ATOM   4485  C  CD    . GLN F  2 93  ? -11.703 -29.620 43.754 1.00 48.59  ? 93   GLN F CD    1 
ATOM   4486  O  OE1   . GLN F  2 93  ? -11.267 -29.435 44.914 1.00 50.33  ? 93   GLN F OE1   1 
ATOM   4487  N  NE2   . GLN F  2 93  ? -11.609 -30.791 43.120 1.00 49.50  ? 93   GLN F NE2   1 
ATOM   4488  N  N     . GLY F  2 94  ? -13.863 -24.006 43.268 1.00 41.14  ? 94   GLY F N     1 
ATOM   4489  C  CA    . GLY F  2 94  ? -14.044 -22.743 43.957 1.00 41.05  ? 94   GLY F CA    1 
ATOM   4490  C  C     . GLY F  2 94  ? -12.991 -22.465 45.010 1.00 40.71  ? 94   GLY F C     1 
ATOM   4491  O  O     . GLY F  2 94  ? -13.298 -21.890 46.059 1.00 40.87  ? 94   GLY F O     1 
ATOM   4492  N  N     . ARG F  2 95  ? -11.759 -22.897 44.745 1.00 40.12  ? 95   ARG F N     1 
ATOM   4493  C  CA    . ARG F  2 95  ? -10.622 -22.471 45.541 1.00 39.54  ? 95   ARG F CA    1 
ATOM   4494  C  C     . ARG F  2 95  ? -9.586  -21.834 44.598 1.00 39.41  ? 95   ARG F C     1 
ATOM   4495  O  O     . ARG F  2 95  ? -8.413  -22.227 44.613 1.00 39.66  ? 95   ARG F O     1 
ATOM   4496  C  CB    . ARG F  2 95  ? -9.999  -23.629 46.334 1.00 39.15  ? 95   ARG F CB    1 
ATOM   4497  C  CG    . ARG F  2 95  ? -10.941 -24.586 47.050 1.00 39.61  ? 95   ARG F CG    1 
ATOM   4498  C  CD    . ARG F  2 95  ? -11.369 -24.168 48.456 1.00 41.75  ? 95   ARG F CD    1 
ATOM   4499  N  NE    . ARG F  2 95  ? -10.301 -23.561 49.268 1.00 44.82  ? 95   ARG F NE    1 
ATOM   4500  C  CZ    . ARG F  2 95  ? -10.509 -22.818 50.369 1.00 44.18  ? 95   ARG F CZ    1 
ATOM   4501  N  NH1   . ARG F  2 95  ? -11.749 -22.596 50.800 1.00 44.12  ? 95   ARG F NH1   1 
ATOM   4502  N  NH2   . ARG F  2 95  ? -9.485  -22.307 51.056 1.00 41.57  ? 95   ARG F NH2   1 
ATOM   4503  N  N     . THR F  2 96  ? -10.019 -20.861 43.781 1.00 38.87  ? 96   THR F N     1 
ATOM   4504  C  CA    . THR F  2 96  ? -9.132  -20.150 42.840 1.00 38.27  ? 96   THR F CA    1 
ATOM   4505  C  C     . THR F  2 96  ? -7.844  -19.730 43.500 1.00 38.23  ? 96   THR F C     1 
ATOM   4506  O  O     . THR F  2 96  ? -7.869  -19.158 44.594 1.00 38.88  ? 96   THR F O     1 
ATOM   4507  C  CB    . THR F  2 96  ? -9.771  -18.891 42.318 1.00 37.93  ? 96   THR F CB    1 
ATOM   4508  O  OG1   . THR F  2 96  ? -10.927 -19.240 41.569 1.00 38.29  ? 96   THR F OG1   1 
ATOM   4509  C  CG2   . THR F  2 96  ? -8.832  -18.192 41.390 1.00 38.52  ? 96   THR F CG2   1 
ATOM   4510  N  N     . LEU F  2 97  ? -6.721  -20.013 42.849 1.00 37.90  ? 97   LEU F N     1 
ATOM   4511  C  CA    . LEU F  2 97  ? -5.427  -19.709 43.449 1.00 37.58  ? 97   LEU F CA    1 
ATOM   4512  C  C     . LEU F  2 97  ? -4.631  -18.752 42.588 1.00 38.27  ? 97   LEU F C     1 
ATOM   4513  O  O     . LEU F  2 97  ? -4.504  -18.964 41.393 1.00 38.49  ? 97   LEU F O     1 
ATOM   4514  C  CB    . LEU F  2 97  ? -4.631  -20.991 43.693 1.00 37.21  ? 97   LEU F CB    1 
ATOM   4515  C  CG    . LEU F  2 97  ? -3.174  -20.838 44.120 1.00 35.91  ? 97   LEU F CG    1 
ATOM   4516  C  CD1   . LEU F  2 97  ? -3.050  -20.120 45.441 1.00 35.28  ? 97   LEU F CD1   1 
ATOM   4517  C  CD2   . LEU F  2 97  ? -2.505  -22.177 44.195 1.00 36.55  ? 97   LEU F CD2   1 
ATOM   4518  N  N     . TYR F  2 98  ? -4.102  -17.695 43.197 1.00 38.95  ? 98   TYR F N     1 
ATOM   4519  C  CA    . TYR F  2 98  ? -3.240  -16.764 42.484 1.00 39.38  ? 98   TYR F CA    1 
ATOM   4520  C  C     . TYR F  2 98  ? -1.808  -17.080 42.771 1.00 39.57  ? 98   TYR F C     1 
ATOM   4521  O  O     . TYR F  2 98  ? -1.466  -17.464 43.881 1.00 39.18  ? 98   TYR F O     1 
ATOM   4522  C  CB    . TYR F  2 98  ? -3.483  -15.325 42.916 1.00 39.84  ? 98   TYR F CB    1 
ATOM   4523  C  CG    . TYR F  2 98  ? -4.764  -14.694 42.422 1.00 40.70  ? 98   TYR F CG    1 
ATOM   4524  C  CD1   . TYR F  2 98  ? -5.591  -15.346 41.517 1.00 40.04  ? 98   TYR F CD1   1 
ATOM   4525  C  CD2   . TYR F  2 98  ? -5.129  -13.414 42.844 1.00 41.50  ? 98   TYR F CD2   1 
ATOM   4526  C  CE1   . TYR F  2 98  ? -6.753  -14.766 41.076 1.00 40.25  ? 98   TYR F CE1   1 
ATOM   4527  C  CE2   . TYR F  2 98  ? -6.294  -12.822 42.398 1.00 41.23  ? 98   TYR F CE2   1 
ATOM   4528  C  CZ    . TYR F  2 98  ? -7.095  -13.513 41.517 1.00 41.11  ? 98   TYR F CZ    1 
ATOM   4529  O  OH    . TYR F  2 98  ? -8.253  -12.946 41.078 1.00 42.51  ? 98   TYR F OH    1 
ATOM   4530  N  N     . GLY F  2 99  ? -0.967  -16.902 41.765 1.00 40.24  ? 99   GLY F N     1 
ATOM   4531  C  CA    . GLY F  2 99  ? 0.463   -16.940 41.986 1.00 41.34  ? 99   GLY F CA    1 
ATOM   4532  C  C     . GLY F  2 99  ? 1.219   -17.996 41.229 1.00 42.15  ? 99   GLY F C     1 
ATOM   4533  O  O     . GLY F  2 99  ? 2.446   -17.969 41.223 1.00 42.45  ? 99   GLY F O     1 
ATOM   4534  N  N     . PHE F  2 100 ? 0.507   -18.917 40.583 1.00 42.71  ? 100  PHE F N     1 
ATOM   4535  C  CA    . PHE F  2 100 ? 1.163   -20.054 39.945 1.00 43.13  ? 100  PHE F CA    1 
ATOM   4536  C  C     . PHE F  2 100 ? 0.861   -20.159 38.466 1.00 43.91  ? 100  PHE F C     1 
ATOM   4537  O  O     . PHE F  2 100 ? 1.024   -21.223 37.854 1.00 44.11  ? 100  PHE F O     1 
ATOM   4538  C  CB    . PHE F  2 100 ? 0.833   -21.355 40.674 1.00 42.58  ? 100  PHE F CB    1 
ATOM   4539  C  CG    . PHE F  2 100 ? 1.488   -21.475 42.022 1.00 42.05  ? 100  PHE F CG    1 
ATOM   4540  C  CD1   . PHE F  2 100 ? 0.894   -20.920 43.158 1.00 41.47  ? 100  PHE F CD1   1 
ATOM   4541  C  CD2   . PHE F  2 100 ? 2.706   -22.146 42.163 1.00 41.56  ? 100  PHE F CD2   1 
ATOM   4542  C  CE1   . PHE F  2 100 ? 1.495   -21.039 44.421 1.00 41.38  ? 100  PHE F CE1   1 
ATOM   4543  C  CE2   . PHE F  2 100 ? 3.319   -22.272 43.416 1.00 41.02  ? 100  PHE F CE2   1 
ATOM   4544  C  CZ    . PHE F  2 100 ? 2.712   -21.712 44.549 1.00 41.72  ? 100  PHE F CZ    1 
ATOM   4545  N  N     . GLY F  2 101 ? 0.447   -19.040 37.889 1.00 44.73  ? 101  GLY F N     1 
ATOM   4546  C  CA    . GLY F  2 101 ? 0.236   -18.957 36.450 1.00 45.89  ? 101  GLY F CA    1 
ATOM   4547  C  C     . GLY F  2 101 ? -1.220  -18.857 36.050 1.00 46.67  ? 101  GLY F C     1 
ATOM   4548  O  O     . GLY F  2 101 ? -2.119  -18.736 36.898 1.00 46.80  ? 101  GLY F O     1 
ATOM   4549  N  N     . GLY F  2 102 ? -1.447  -18.899 34.742 1.00 47.36  ? 102  GLY F N     1 
ATOM   4550  C  CA    . GLY F  2 102 ? -2.792  -18.836 34.191 1.00 48.38  ? 102  GLY F CA    1 
ATOM   4551  C  C     . GLY F  2 102 ? -3.571  -17.617 34.644 1.00 48.94  ? 102  GLY F C     1 
ATOM   4552  O  O     . GLY F  2 102 ? -2.990  -16.561 34.923 1.00 49.53  ? 102  GLY F O     1 
ATOM   4553  O  OXT   . GLY F  2 102 ? -4.799  -17.665 34.741 1.00 49.18  ? 102  GLY F OXT   1 
ATOM   4554  N  N     . LYS G  3 13  ? -35.811 -36.423 4.891  1.00 97.26  ? 13   LYS G N     1 
ATOM   4555  C  CA    . LYS G  3 13  ? -34.868 -36.859 5.972  1.00 97.20  ? 13   LYS G CA    1 
ATOM   4556  C  C     . LYS G  3 13  ? -34.894 -38.396 6.157  1.00 96.72  ? 13   LYS G C     1 
ATOM   4557  O  O     . LYS G  3 13  ? -35.924 -38.958 6.559  1.00 96.74  ? 13   LYS G O     1 
ATOM   4558  C  CB    . LYS G  3 13  ? -35.194 -36.147 7.302  1.00 97.36  ? 13   LYS G CB    1 
ATOM   4559  C  CG    . LYS G  3 13  ? -35.294 -34.597 7.262  1.00 97.60  ? 13   LYS G CG    1 
ATOM   4560  C  CD    . LYS G  3 13  ? -35.402 -34.026 8.700  1.00 97.58  ? 13   LYS G CD    1 
ATOM   4561  C  CE    . LYS G  3 13  ? -36.170 -32.697 8.779  1.00 97.33  ? 13   LYS G CE    1 
ATOM   4562  N  NZ    . LYS G  3 13  ? -36.731 -32.410 10.145 1.00 96.15  ? 13   LYS G NZ    1 
ATOM   4563  N  N     . ALA G  3 14  ? -33.770 -39.062 5.865  1.00 96.00  ? 14   ALA G N     1 
ATOM   4564  C  CA    . ALA G  3 14  ? -33.680 -40.535 5.947  1.00 95.13  ? 14   ALA G CA    1 
ATOM   4565  C  C     . ALA G  3 14  ? -33.864 -41.073 7.378  1.00 94.46  ? 14   ALA G C     1 
ATOM   4566  O  O     . ALA G  3 14  ? -34.970 -41.491 7.742  1.00 94.44  ? 14   ALA G O     1 
ATOM   4567  C  CB    . ALA G  3 14  ? -32.371 -41.055 5.308  1.00 95.11  ? 14   ALA G CB    1 
ATOM   4568  N  N     . LYS G  3 15  ? -32.799 -41.055 8.186  1.00 93.49  ? 15   LYS G N     1 
ATOM   4569  C  CA    . LYS G  3 15  ? -32.886 -41.506 9.586  1.00 92.34  ? 15   LYS G CA    1 
ATOM   4570  C  C     . LYS G  3 15  ? -32.351 -40.504 10.598 1.00 91.07  ? 15   LYS G C     1 
ATOM   4571  O  O     . LYS G  3 15  ? -31.201 -40.057 10.493 1.00 90.92  ? 15   LYS G O     1 
ATOM   4572  C  CB    . LYS G  3 15  ? -32.208 -42.873 9.786  1.00 92.58  ? 15   LYS G CB    1 
ATOM   4573  C  CG    . LYS G  3 15  ? -33.107 -44.081 9.485  1.00 93.41  ? 15   LYS G CG    1 
ATOM   4574  C  CD    . LYS G  3 15  ? -34.563 -43.900 9.985  1.00 94.88  ? 15   LYS G CD    1 
ATOM   4575  C  CE    . LYS G  3 15  ? -34.702 -43.983 11.513 1.00 95.57  ? 15   LYS G CE    1 
ATOM   4576  N  NZ    . LYS G  3 15  ? -34.533 -45.373 12.034 1.00 95.63  ? 15   LYS G NZ    1 
ATOM   4577  N  N     . THR G  3 16  ? -33.185 -40.163 11.582 1.00 89.41  ? 16   THR G N     1 
ATOM   4578  C  CA    . THR G  3 16  ? -32.775 -39.207 12.613 1.00 87.75  ? 16   THR G CA    1 
ATOM   4579  C  C     . THR G  3 16  ? -31.548 -39.724 13.353 1.00 86.67  ? 16   THR G C     1 
ATOM   4580  O  O     . THR G  3 16  ? -31.453 -40.918 13.672 1.00 86.53  ? 16   THR G O     1 
ATOM   4581  C  CB    . THR G  3 16  ? -33.890 -38.871 13.638 1.00 87.63  ? 16   THR G CB    1 
ATOM   4582  O  OG1   . THR G  3 16  ? -34.204 -40.031 14.419 1.00 87.23  ? 16   THR G OG1   1 
ATOM   4583  C  CG2   . THR G  3 16  ? -35.141 -38.331 12.942 1.00 87.44  ? 16   THR G CG2   1 
ATOM   4584  N  N     . ARG G  3 17  ? -30.612 -38.812 13.611 1.00 85.08  ? 17   ARG G N     1 
ATOM   4585  C  CA    . ARG G  3 17  ? -29.352 -39.146 14.260 1.00 83.31  ? 17   ARG G CA    1 
ATOM   4586  C  C     . ARG G  3 17  ? -29.558 -39.711 15.669 1.00 82.37  ? 17   ARG G C     1 
ATOM   4587  O  O     . ARG G  3 17  ? -28.719 -40.461 16.172 1.00 82.19  ? 17   ARG G O     1 
ATOM   4588  C  CB    . ARG G  3 17  ? -28.442 -37.925 14.277 1.00 83.15  ? 17   ARG G CB    1 
ATOM   4589  C  CG    . ARG G  3 17  ? -28.123 -37.397 12.904 1.00 82.27  ? 17   ARG G CG    1 
ATOM   4590  C  CD    . ARG G  3 17  ? -26.990 -36.414 12.970 1.00 81.76  ? 17   ARG G CD    1 
ATOM   4591  N  NE    . ARG G  3 17  ? -27.456 -35.040 13.154 1.00 81.95  ? 17   ARG G NE    1 
ATOM   4592  C  CZ    . ARG G  3 17  ? -26.681 -34.026 13.540 1.00 81.87  ? 17   ARG G CZ    1 
ATOM   4593  N  NH1   . ARG G  3 17  ? -25.391 -34.224 13.809 1.00 81.56  ? 17   ARG G NH1   1 
ATOM   4594  N  NH2   . ARG G  3 17  ? -27.199 -32.810 13.673 1.00 81.53  ? 17   ARG G NH2   1 
ATOM   4595  N  N     . SER G  3 18  ? -30.684 -39.357 16.285 1.00 81.06  ? 18   SER G N     1 
ATOM   4596  C  CA    . SER G  3 18  ? -31.055 -39.872 17.593 1.00 79.96  ? 18   SER G CA    1 
ATOM   4597  C  C     . SER G  3 18  ? -31.350 -41.357 17.512 1.00 79.32  ? 18   SER G C     1 
ATOM   4598  O  O     . SER G  3 18  ? -30.933 -42.131 18.380 1.00 79.31  ? 18   SER G O     1 
ATOM   4599  C  CB    . SER G  3 18  ? -32.282 -39.141 18.119 1.00 79.96  ? 18   SER G CB    1 
ATOM   4600  O  OG    . SER G  3 18  ? -32.097 -37.746 18.018 1.00 80.03  ? 18   SER G OG    1 
ATOM   4601  N  N     . SER G  3 19  ? -32.072 -41.751 16.466 1.00 78.29  ? 19   SER G N     1 
ATOM   4602  C  CA    . SER G  3 19  ? -32.416 -43.153 16.275 1.00 77.17  ? 19   SER G CA    1 
ATOM   4603  C  C     . SER G  3 19  ? -31.203 -43.958 15.828 1.00 76.14  ? 19   SER G C     1 
ATOM   4604  O  O     . SER G  3 19  ? -31.105 -45.137 16.150 1.00 75.75  ? 19   SER G O     1 
ATOM   4605  C  CB    . SER G  3 19  ? -33.594 -43.313 15.312 1.00 77.29  ? 19   SER G CB    1 
ATOM   4606  O  OG    . SER G  3 19  ? -33.451 -42.477 14.180 1.00 78.20  ? 19   SER G OG    1 
ATOM   4607  N  N     . ARG G  3 20  ? -30.276 -43.315 15.114 1.00 75.11  ? 20   ARG G N     1 
ATOM   4608  C  CA    . ARG G  3 20  ? -28.998 -43.951 14.753 1.00 74.57  ? 20   ARG G CA    1 
ATOM   4609  C  C     . ARG G  3 20  ? -28.175 -44.223 16.009 1.00 73.25  ? 20   ARG G C     1 
ATOM   4610  O  O     . ARG G  3 20  ? -27.439 -45.209 16.082 1.00 73.21  ? 20   ARG G O     1 
ATOM   4611  C  CB    . ARG G  3 20  ? -28.168 -43.104 13.764 1.00 74.54  ? 20   ARG G CB    1 
ATOM   4612  C  CG    . ARG G  3 20  ? -28.867 -42.759 12.457 1.00 75.81  ? 20   ARG G CG    1 
ATOM   4613  C  CD    . ARG G  3 20  ? -27.909 -42.483 11.290 1.00 76.42  ? 20   ARG G CD    1 
ATOM   4614  N  NE    . ARG G  3 20  ? -28.499 -43.029 10.055 1.00 82.01  ? 20   ARG G NE    1 
ATOM   4615  C  CZ    . ARG G  3 20  ? -28.260 -42.607 8.805  1.00 83.39  ? 20   ARG G CZ    1 
ATOM   4616  N  NH1   . ARG G  3 20  ? -27.430 -41.591 8.557  1.00 84.20  ? 20   ARG G NH1   1 
ATOM   4617  N  NH2   . ARG G  3 20  ? -28.871 -43.209 7.788  1.00 83.88  ? 20   ARG G NH2   1 
ATOM   4618  N  N     . ALA G  3 21  ? -28.308 -43.336 16.992 1.00 71.69  ? 21   ALA G N     1 
ATOM   4619  C  CA    . ALA G  3 21  ? -27.556 -43.441 18.227 1.00 70.17  ? 21   ALA G CA    1 
ATOM   4620  C  C     . ALA G  3 21  ? -28.340 -44.243 19.259 1.00 69.17  ? 21   ALA G C     1 
ATOM   4621  O  O     . ALA G  3 21  ? -27.820 -44.622 20.311 1.00 68.95  ? 21   ALA G O     1 
ATOM   4622  C  CB    . ALA G  3 21  ? -27.227 -42.069 18.740 1.00 70.17  ? 21   ALA G CB    1 
ATOM   4623  N  N     . GLY G  3 22  ? -29.601 -44.504 18.940 1.00 68.12  ? 22   GLY G N     1 
ATOM   4624  C  CA    . GLY G  3 22  ? -30.455 -45.332 19.781 1.00 66.78  ? 22   GLY G CA    1 
ATOM   4625  C  C     . GLY G  3 22  ? -31.023 -44.546 20.939 1.00 65.82  ? 22   GLY G C     1 
ATOM   4626  O  O     . GLY G  3 22  ? -31.213 -45.083 22.032 1.00 65.97  ? 22   GLY G O     1 
ATOM   4627  N  N     . LEU G  3 23  ? -31.311 -43.273 20.699 1.00 64.55  ? 23   LEU G N     1 
ATOM   4628  C  CA    . LEU G  3 23  ? -31.666 -42.377 21.784 1.00 63.18  ? 23   LEU G CA    1 
ATOM   4629  C  C     . LEU G  3 23  ? -32.999 -41.710 21.535 1.00 62.75  ? 23   LEU G C     1 
ATOM   4630  O  O     . LEU G  3 23  ? -33.428 -41.541 20.388 1.00 62.76  ? 23   LEU G O     1 
ATOM   4631  C  CB    . LEU G  3 23  ? -30.581 -41.314 21.979 1.00 62.82  ? 23   LEU G CB    1 
ATOM   4632  C  CG    . LEU G  3 23  ? -29.129 -41.751 22.167 1.00 61.38  ? 23   LEU G CG    1 
ATOM   4633  C  CD1   . LEU G  3 23  ? -28.251 -40.563 21.923 1.00 61.23  ? 23   LEU G CD1   1 
ATOM   4634  C  CD2   . LEU G  3 23  ? -28.881 -42.316 23.547 1.00 59.59  ? 23   LEU G CD2   1 
ATOM   4635  N  N     . GLN G  3 24  ? -33.642 -41.332 22.631 1.00 61.88  ? 24   GLN G N     1 
ATOM   4636  C  CA    . GLN G  3 24  ? -34.879 -40.580 22.591 1.00 61.16  ? 24   GLN G CA    1 
ATOM   4637  C  C     . GLN G  3 24  ? -34.604 -39.092 22.532 1.00 60.42  ? 24   GLN G C     1 
ATOM   4638  O  O     . GLN G  3 24  ? -35.392 -38.344 21.953 1.00 60.70  ? 24   GLN G O     1 
ATOM   4639  C  CB    . GLN G  3 24  ? -35.696 -40.871 23.838 1.00 61.54  ? 24   GLN G CB    1 
ATOM   4640  C  CG    . GLN G  3 24  ? -35.820 -42.340 24.144 1.00 62.22  ? 24   GLN G CG    1 
ATOM   4641  C  CD    . GLN G  3 24  ? -36.559 -43.072 23.063 1.00 63.16  ? 24   GLN G CD    1 
ATOM   4642  O  OE1   . GLN G  3 24  ? -37.507 -42.546 22.468 1.00 64.32  ? 24   GLN G OE1   1 
ATOM   4643  N  NE2   . GLN G  3 24  ? -36.133 -44.297 22.794 1.00 63.44  ? 24   GLN G NE2   1 
ATOM   4644  N  N     . PHE G  3 25  ? -33.498 -38.670 23.146 1.00 59.23  ? 25   PHE G N     1 
ATOM   4645  C  CA    . PHE G  3 25  ? -33.101 -37.258 23.196 1.00 58.00  ? 25   PHE G CA    1 
ATOM   4646  C  C     . PHE G  3 25  ? -32.590 -36.757 21.858 1.00 56.99  ? 25   PHE G C     1 
ATOM   4647  O  O     . PHE G  3 25  ? -31.872 -37.472 21.163 1.00 56.85  ? 25   PHE G O     1 
ATOM   4648  C  CB    . PHE G  3 25  ? -32.038 -37.033 24.265 1.00 58.06  ? 25   PHE G CB    1 
ATOM   4649  C  CG    . PHE G  3 25  ? -32.598 -36.673 25.606 1.00 57.92  ? 25   PHE G CG    1 
ATOM   4650  C  CD1   . PHE G  3 25  ? -33.485 -37.522 26.258 1.00 57.56  ? 25   PHE G CD1   1 
ATOM   4651  C  CD2   . PHE G  3 25  ? -32.228 -35.489 26.223 1.00 57.42  ? 25   PHE G CD2   1 
ATOM   4652  C  CE1   . PHE G  3 25  ? -33.990 -37.202 27.497 1.00 57.52  ? 25   PHE G CE1   1 
ATOM   4653  C  CE2   . PHE G  3 25  ? -32.734 -35.157 27.463 1.00 57.84  ? 25   PHE G CE2   1 
ATOM   4654  C  CZ    . PHE G  3 25  ? -33.618 -36.019 28.104 1.00 57.93  ? 25   PHE G CZ    1 
ATOM   4655  N  N     . PRO G  3 26  ? -32.937 -35.509 21.509 1.00 56.09  ? 26   PRO G N     1 
ATOM   4656  C  CA    . PRO G  3 26  ? -32.713 -35.025 20.154 1.00 55.51  ? 26   PRO G CA    1 
ATOM   4657  C  C     . PRO G  3 26  ? -31.254 -34.623 19.860 1.00 54.86  ? 26   PRO G C     1 
ATOM   4658  O  O     . PRO G  3 26  ? -30.847 -33.481 20.107 1.00 54.57  ? 26   PRO G O     1 
ATOM   4659  C  CB    . PRO G  3 26  ? -33.681 -33.845 20.053 1.00 55.50  ? 26   PRO G CB    1 
ATOM   4660  C  CG    . PRO G  3 26  ? -33.759 -33.323 21.447 1.00 55.68  ? 26   PRO G CG    1 
ATOM   4661  C  CD    . PRO G  3 26  ? -33.541 -34.479 22.373 1.00 55.89  ? 26   PRO G CD    1 
ATOM   4662  N  N     . VAL G  3 27  ? -30.492 -35.577 19.327 1.00 54.21  ? 27   VAL G N     1 
ATOM   4663  C  CA    . VAL G  3 27  ? -29.113 -35.352 18.901 1.00 53.68  ? 27   VAL G CA    1 
ATOM   4664  C  C     . VAL G  3 27  ? -28.981 -34.077 18.070 1.00 53.98  ? 27   VAL G C     1 
ATOM   4665  O  O     . VAL G  3 27  ? -28.169 -33.208 18.392 1.00 54.54  ? 27   VAL G O     1 
ATOM   4666  C  CB    . VAL G  3 27  ? -28.563 -36.557 18.119 1.00 53.29  ? 27   VAL G CB    1 
ATOM   4667  C  CG1   . VAL G  3 27  ? -27.212 -36.239 17.516 1.00 52.38  ? 27   VAL G CG1   1 
ATOM   4668  C  CG2   . VAL G  3 27  ? -28.461 -37.757 19.029 1.00 52.80  ? 27   VAL G CG2   1 
ATOM   4669  N  N     . GLY G  3 28  ? -29.790 -33.957 17.022 1.00 53.87  ? 28   GLY G N     1 
ATOM   4670  C  CA    . GLY G  3 28  ? -29.773 -32.768 16.175 1.00 53.68  ? 28   GLY G CA    1 
ATOM   4671  C  C     . GLY G  3 28  ? -29.854 -31.459 16.941 1.00 53.55  ? 28   GLY G C     1 
ATOM   4672  O  O     . GLY G  3 28  ? -29.086 -30.534 16.671 1.00 53.46  ? 28   GLY G O     1 
ATOM   4673  N  N     . ARG G  3 29  ? -30.783 -31.388 17.894 1.00 53.49  ? 29   ARG G N     1 
ATOM   4674  C  CA    . ARG G  3 29  ? -30.998 -30.176 18.685 1.00 53.56  ? 29   ARG G CA    1 
ATOM   4675  C  C     . ARG G  3 29  ? -29.797 -29.900 19.561 1.00 53.76  ? 29   ARG G C     1 
ATOM   4676  O  O     . ARG G  3 29  ? -29.284 -28.788 19.592 1.00 53.73  ? 29   ARG G O     1 
ATOM   4677  C  CB    . ARG G  3 29  ? -32.241 -30.312 19.554 1.00 53.41  ? 29   ARG G CB    1 
ATOM   4678  C  CG    . ARG G  3 29  ? -32.470 -29.146 20.490 1.00 53.62  ? 29   ARG G CG    1 
ATOM   4679  C  CD    . ARG G  3 29  ? -33.698 -29.329 21.367 1.00 54.66  ? 29   ARG G CD    1 
ATOM   4680  N  NE    . ARG G  3 29  ? -34.948 -29.393 20.610 1.00 55.69  ? 29   ARG G NE    1 
ATOM   4681  C  CZ    . ARG G  3 29  ? -36.141 -29.094 21.121 1.00 57.28  ? 29   ARG G CZ    1 
ATOM   4682  N  NH1   . ARG G  3 29  ? -36.249 -28.696 22.389 1.00 58.35  ? 29   ARG G NH1   1 
ATOM   4683  N  NH2   . ARG G  3 29  ? -37.229 -29.178 20.367 1.00 57.72  ? 29   ARG G NH2   1 
ATOM   4684  N  N     . VAL G  3 30  ? -29.352 -30.928 20.270 1.00 54.13  ? 30   VAL G N     1 
ATOM   4685  C  CA    . VAL G  3 30  ? -28.180 -30.823 21.116 1.00 54.34  ? 30   VAL G CA    1 
ATOM   4686  C  C     . VAL G  3 30  ? -27.007 -30.311 20.292 1.00 55.22  ? 30   VAL G C     1 
ATOM   4687  O  O     . VAL G  3 30  ? -26.265 -29.450 20.758 1.00 56.14  ? 30   VAL G O     1 
ATOM   4688  C  CB    . VAL G  3 30  ? -27.854 -32.159 21.819 1.00 53.93  ? 30   VAL G CB    1 
ATOM   4689  C  CG1   . VAL G  3 30  ? -26.570 -32.071 22.575 1.00 53.42  ? 30   VAL G CG1   1 
ATOM   4690  C  CG2   . VAL G  3 30  ? -28.950 -32.509 22.773 1.00 53.36  ? 30   VAL G CG2   1 
ATOM   4691  N  N     . HIS G  3 31  ? -26.852 -30.788 19.062 1.00 55.78  ? 31   HIS G N     1 
ATOM   4692  C  CA    . HIS G  3 31  ? -25.748 -30.309 18.225 1.00 56.70  ? 31   HIS G CA    1 
ATOM   4693  C  C     . HIS G  3 31  ? -25.856 -28.808 17.938 1.00 57.12  ? 31   HIS G C     1 
ATOM   4694  O  O     . HIS G  3 31  ? -24.895 -28.051 18.114 1.00 56.88  ? 31   HIS G O     1 
ATOM   4695  C  CB    . HIS G  3 31  ? -25.680 -31.088 16.909 1.00 57.01  ? 31   HIS G CB    1 
ATOM   4696  C  CG    . HIS G  3 31  ? -24.335 -31.051 16.252 1.00 57.52  ? 31   HIS G CG    1 
ATOM   4697  N  ND1   . HIS G  3 31  ? -23.465 -29.990 16.387 1.00 58.53  ? 31   HIS G ND1   1 
ATOM   4698  C  CD2   . HIS G  3 31  ? -23.718 -31.939 15.439 1.00 58.09  ? 31   HIS G CD2   1 
ATOM   4699  C  CE1   . HIS G  3 31  ? -22.364 -30.236 15.701 1.00 58.76  ? 31   HIS G CE1   1 
ATOM   4700  N  NE2   . HIS G  3 31  ? -22.492 -31.410 15.113 1.00 58.35  ? 31   HIS G NE2   1 
ATOM   4701  N  N     . ARG G  3 32  ? -27.040 -28.392 17.493 1.00 57.90  ? 32   ARG G N     1 
ATOM   4702  C  CA    . ARG G  3 32  ? -27.308 -26.992 17.186 1.00 58.66  ? 32   ARG G CA    1 
ATOM   4703  C  C     . ARG G  3 32  ? -27.071 -26.136 18.410 1.00 58.85  ? 32   ARG G C     1 
ATOM   4704  O  O     . ARG G  3 32  ? -26.507 -25.050 18.305 1.00 59.26  ? 32   ARG G O     1 
ATOM   4705  C  CB    . ARG G  3 32  ? -28.744 -26.793 16.673 1.00 58.60  ? 32   ARG G CB    1 
ATOM   4706  C  CG    . ARG G  3 32  ? -29.210 -25.334 16.677 1.00 58.76  ? 32   ARG G CG    1 
ATOM   4707  C  CD    . ARG G  3 32  ? -30.618 -25.187 16.159 1.00 59.23  ? 32   ARG G CD    1 
ATOM   4708  N  NE    . ARG G  3 32  ? -31.568 -26.085 16.822 1.00 61.47  ? 32   ARG G NE    1 
ATOM   4709  C  CZ    . ARG G  3 32  ? -32.374 -25.737 17.829 1.00 62.04  ? 32   ARG G CZ    1 
ATOM   4710  N  NH1   . ARG G  3 32  ? -32.354 -24.504 18.316 1.00 62.61  ? 32   ARG G NH1   1 
ATOM   4711  N  NH2   . ARG G  3 32  ? -33.210 -26.627 18.354 1.00 62.15  ? 32   ARG G NH2   1 
ATOM   4712  N  N     . LEU G  3 33  ? -27.507 -26.631 19.565 1.00 59.22  ? 33   LEU G N     1 
ATOM   4713  C  CA    . LEU G  3 33  ? -27.387 -25.881 20.804 1.00 59.61  ? 33   LEU G CA    1 
ATOM   4714  C  C     . LEU G  3 33  ? -25.938 -25.698 21.200 1.00 60.07  ? 33   LEU G C     1 
ATOM   4715  O  O     . LEU G  3 33  ? -25.589 -24.669 21.789 1.00 60.36  ? 33   LEU G O     1 
ATOM   4716  C  CB    . LEU G  3 33  ? -28.170 -26.541 21.931 1.00 59.36  ? 33   LEU G CB    1 
ATOM   4717  C  CG    . LEU G  3 33  ? -29.687 -26.410 21.862 1.00 59.22  ? 33   LEU G CG    1 
ATOM   4718  C  CD1   . LEU G  3 33  ? -30.291 -26.985 23.127 1.00 60.07  ? 33   LEU G CD1   1 
ATOM   4719  C  CD2   . LEU G  3 33  ? -30.131 -24.964 21.663 1.00 58.82  ? 33   LEU G CD2   1 
ATOM   4720  N  N     . LEU G  3 34  ? -25.103 -26.681 20.864 1.00 60.45  ? 34   LEU G N     1 
ATOM   4721  C  CA    . LEU G  3 34  ? -23.678 -26.577 21.135 1.00 61.20  ? 34   LEU G CA    1 
ATOM   4722  C  C     . LEU G  3 34  ? -23.012 -25.477 20.328 1.00 61.96  ? 34   LEU G C     1 
ATOM   4723  O  O     . LEU G  3 34  ? -22.218 -24.729 20.883 1.00 62.40  ? 34   LEU G O     1 
ATOM   4724  C  CB    . LEU G  3 34  ? -22.941 -27.902 20.926 1.00 60.97  ? 34   LEU G CB    1 
ATOM   4725  C  CG    . LEU G  3 34  ? -22.947 -28.946 22.043 1.00 60.38  ? 34   LEU G CG    1 
ATOM   4726  C  CD1   . LEU G  3 34  ? -22.152 -30.118 21.569 1.00 60.11  ? 34   LEU G CD1   1 
ATOM   4727  C  CD2   . LEU G  3 34  ? -22.320 -28.432 23.327 1.00 60.61  ? 34   LEU G CD2   1 
ATOM   4728  N  N     . ARG G  3 35  ? -23.335 -25.366 19.038 1.00 62.80  ? 35   ARG G N     1 
ATOM   4729  C  CA    . ARG G  3 35  ? -22.709 -24.351 18.177 1.00 63.57  ? 35   ARG G CA    1 
ATOM   4730  C  C     . ARG G  3 35  ? -23.076 -22.924 18.585 1.00 63.77  ? 35   ARG G C     1 
ATOM   4731  O  O     . ARG G  3 35  ? -22.200 -22.068 18.759 1.00 63.75  ? 35   ARG G O     1 
ATOM   4732  C  CB    . ARG G  3 35  ? -23.090 -24.557 16.722 1.00 63.77  ? 35   ARG G CB    1 
ATOM   4733  C  CG    . ARG G  3 35  ? -23.155 -25.983 16.275 1.00 65.60  ? 35   ARG G CG    1 
ATOM   4734  C  CD    . ARG G  3 35  ? -23.641 -26.000 14.831 1.00 69.39  ? 35   ARG G CD    1 
ATOM   4735  N  NE    . ARG G  3 35  ? -23.415 -27.291 14.181 1.00 72.35  ? 35   ARG G NE    1 
ATOM   4736  C  CZ    . ARG G  3 35  ? -22.225 -27.745 13.784 1.00 74.23  ? 35   ARG G CZ    1 
ATOM   4737  N  NH1   . ARG G  3 35  ? -21.119 -27.024 13.978 1.00 75.12  ? 35   ARG G NH1   1 
ATOM   4738  N  NH2   . ARG G  3 35  ? -22.137 -28.935 13.195 1.00 75.10  ? 35   ARG G NH2   1 
ATOM   4739  N  N     . LYS G  3 36  ? -24.374 -22.675 18.736 1.00 64.14  ? 36   LYS G N     1 
ATOM   4740  C  CA    . LYS G  3 36  ? -24.860 -21.355 19.113 1.00 64.89  ? 36   LYS G CA    1 
ATOM   4741  C  C     . LYS G  3 36  ? -24.444 -21.048 20.554 1.00 64.53  ? 36   LYS G C     1 
ATOM   4742  O  O     . LYS G  3 36  ? -24.574 -19.913 21.034 1.00 64.65  ? 36   LYS G O     1 
ATOM   4743  C  CB    . LYS G  3 36  ? -26.389 -21.258 18.946 1.00 65.15  ? 36   LYS G CB    1 
ATOM   4744  C  CG    . LYS G  3 36  ? -27.194 -21.478 20.253 1.00 66.06  ? 36   LYS G CG    1 
ATOM   4745  C  CD    . LYS G  3 36  ? -28.630 -20.924 20.179 1.00 66.13  ? 36   LYS G CD    1 
ATOM   4746  C  CE    . LYS G  3 36  ? -29.367 -21.135 21.519 1.00 67.21  ? 36   LYS G CE    1 
ATOM   4747  N  NZ    . LYS G  3 36  ? -30.861 -21.149 21.400 1.00 67.45  ? 36   LYS G NZ    1 
ATOM   4748  N  N     . GLY G  3 37  ? -23.949 -22.076 21.236 1.00 63.99  ? 37   GLY G N     1 
ATOM   4749  C  CA    . GLY G  3 37  ? -23.559 -21.944 22.621 1.00 63.61  ? 37   GLY G CA    1 
ATOM   4750  C  C     . GLY G  3 37  ? -22.324 -21.095 22.778 1.00 63.31  ? 37   GLY G C     1 
ATOM   4751  O  O     . GLY G  3 37  ? -22.098 -20.512 23.835 1.00 63.76  ? 37   GLY G O     1 
ATOM   4752  N  N     . ASN G  3 38  ? -21.543 -20.998 21.709 1.00 62.89  ? 38   ASN G N     1 
ATOM   4753  C  CA    . ASN G  3 38  ? -20.244 -20.337 21.756 1.00 62.57  ? 38   ASN G CA    1 
ATOM   4754  C  C     . ASN G  3 38  ? -19.362 -21.033 22.768 1.00 62.22  ? 38   ASN G C     1 
ATOM   4755  O  O     . ASN G  3 38  ? -18.796 -20.402 23.657 1.00 62.48  ? 38   ASN G O     1 
ATOM   4756  C  CB    . ASN G  3 38  ? -20.378 -18.835 22.058 1.00 62.53  ? 38   ASN G CB    1 
ATOM   4757  C  CG    . ASN G  3 38  ? -20.910 -18.047 20.869 1.00 62.84  ? 38   ASN G CG    1 
ATOM   4758  O  OD1   . ASN G  3 38  ? -21.556 -17.011 21.049 1.00 62.84  ? 38   ASN G OD1   1 
ATOM   4759  N  ND2   . ASN G  3 38  ? -20.647 -18.542 19.644 1.00 62.80  ? 38   ASN G ND2   1 
ATOM   4760  N  N     . TYR G  3 39  ? -19.278 -22.352 22.626 1.00 61.74  ? 39   TYR G N     1 
ATOM   4761  C  CA    . TYR G  3 39  ? -18.498 -23.187 23.519 1.00 61.28  ? 39   TYR G CA    1 
ATOM   4762  C  C     . TYR G  3 39  ? -17.108 -23.432 22.934 1.00 61.98  ? 39   TYR G C     1 
ATOM   4763  O  O     . TYR G  3 39  ? -16.100 -23.347 23.638 1.00 62.02  ? 39   TYR G O     1 
ATOM   4764  C  CB    . TYR G  3 39  ? -19.249 -24.488 23.804 1.00 60.25  ? 39   TYR G CB    1 
ATOM   4765  C  CG    . TYR G  3 39  ? -20.502 -24.286 24.627 1.00 58.84  ? 39   TYR G CG    1 
ATOM   4766  C  CD1   . TYR G  3 39  ? -21.753 -24.586 24.121 1.00 57.22  ? 39   TYR G CD1   1 
ATOM   4767  C  CD2   . TYR G  3 39  ? -20.430 -23.778 25.913 1.00 58.27  ? 39   TYR G CD2   1 
ATOM   4768  C  CE1   . TYR G  3 39  ? -22.899 -24.392 24.883 1.00 57.09  ? 39   TYR G CE1   1 
ATOM   4769  C  CE2   . TYR G  3 39  ? -21.564 -23.577 26.676 1.00 57.64  ? 39   TYR G CE2   1 
ATOM   4770  C  CZ    . TYR G  3 39  ? -22.794 -23.883 26.162 1.00 57.87  ? 39   TYR G CZ    1 
ATOM   4771  O  OH    . TYR G  3 39  ? -23.907 -23.678 26.947 1.00 58.33  ? 39   TYR G OH    1 
ATOM   4772  N  N     . ALA G  3 40  ? -17.062 -23.728 21.640 1.00 62.81  ? 40   ALA G N     1 
ATOM   4773  C  CA    . ALA G  3 40  ? -15.812 -23.758 20.894 1.00 63.72  ? 40   ALA G CA    1 
ATOM   4774  C  C     . ALA G  3 40  ? -16.053 -23.233 19.484 1.00 64.68  ? 40   ALA G C     1 
ATOM   4775  O  O     . ALA G  3 40  ? -17.198 -23.086 19.061 1.00 65.15  ? 40   ALA G O     1 
ATOM   4776  C  CB    . ALA G  3 40  ? -15.251 -25.149 20.855 1.00 63.41  ? 40   ALA G CB    1 
ATOM   4777  N  N     . GLU G  3 41  ? -14.976 -22.927 18.767 1.00 65.55  ? 41   GLU G N     1 
ATOM   4778  C  CA    . GLU G  3 41  ? -15.070 -22.551 17.369 1.00 66.75  ? 41   GLU G CA    1 
ATOM   4779  C  C     . GLU G  3 41  ? -15.740 -23.675 16.550 1.00 66.45  ? 41   GLU G C     1 
ATOM   4780  O  O     . GLU G  3 41  ? -16.450 -23.405 15.585 1.00 66.63  ? 41   GLU G O     1 
ATOM   4781  C  CB    . GLU G  3 41  ? -13.670 -22.240 16.830 1.00 66.72  ? 41   GLU G CB    1 
ATOM   4782  C  CG    . GLU G  3 41  ? -13.621 -21.644 15.412 1.00 68.38  ? 41   GLU G CG    1 
ATOM   4783  C  CD    . GLU G  3 41  ? -12.393 -22.118 14.587 1.00 69.22  ? 41   GLU G CD    1 
ATOM   4784  O  OE1   . GLU G  3 41  ? -11.778 -23.165 14.929 1.00 71.16  ? 41   GLU G OE1   1 
ATOM   4785  O  OE2   . GLU G  3 41  ? -12.050 -21.443 13.576 1.00 72.99  ? 41   GLU G OE2   1 
ATOM   4786  N  N     . ARG G  3 42  ? -15.531 -24.929 16.950 1.00 66.44  ? 42   ARG G N     1 
ATOM   4787  C  CA    . ARG G  3 42  ? -16.030 -26.087 16.191 1.00 66.56  ? 42   ARG G CA    1 
ATOM   4788  C  C     . ARG G  3 42  ? -16.676 -27.143 17.083 1.00 66.04  ? 42   ARG G C     1 
ATOM   4789  O  O     . ARG G  3 42  ? -16.577 -27.064 18.306 1.00 66.26  ? 42   ARG G O     1 
ATOM   4790  C  CB    . ARG G  3 42  ? -14.894 -26.725 15.393 1.00 66.85  ? 42   ARG G CB    1 
ATOM   4791  C  CG    . ARG G  3 42  ? -14.462 -25.908 14.191 1.00 68.89  ? 42   ARG G CG    1 
ATOM   4792  C  CD    . ARG G  3 42  ? -12.971 -26.061 13.924 1.00 72.79  ? 42   ARG G CD    1 
ATOM   4793  N  NE    . ARG G  3 42  ? -12.625 -27.274 13.175 1.00 75.87  ? 42   ARG G NE    1 
ATOM   4794  C  CZ    . ARG G  3 42  ? -12.598 -27.351 11.842 1.00 77.64  ? 42   ARG G CZ    1 
ATOM   4795  N  NH1   . ARG G  3 42  ? -12.911 -26.291 11.095 1.00 77.89  ? 42   ARG G NH1   1 
ATOM   4796  N  NH2   . ARG G  3 42  ? -12.258 -28.493 11.253 1.00 78.35  ? 42   ARG G NH2   1 
ATOM   4797  N  N     . VAL G  3 43  ? -17.347 -28.119 16.465 1.00 65.22  ? 43   VAL G N     1 
ATOM   4798  C  CA    . VAL G  3 43  ? -17.999 -29.217 17.189 1.00 64.32  ? 43   VAL G CA    1 
ATOM   4799  C  C     . VAL G  3 43  ? -18.010 -30.509 16.381 1.00 63.70  ? 43   VAL G C     1 
ATOM   4800  O  O     . VAL G  3 43  ? -18.654 -30.594 15.327 1.00 63.49  ? 43   VAL G O     1 
ATOM   4801  C  CB    . VAL G  3 43  ? -19.471 -28.904 17.581 1.00 64.46  ? 43   VAL G CB    1 
ATOM   4802  C  CG1   . VAL G  3 43  ? -20.100 -30.101 18.295 1.00 64.03  ? 43   VAL G CG1   1 
ATOM   4803  C  CG2   . VAL G  3 43  ? -19.573 -27.660 18.462 1.00 64.77  ? 43   VAL G CG2   1 
ATOM   4804  N  N     . GLY G  3 44  ? -17.313 -31.516 16.910 1.00 63.02  ? 44   GLY G N     1 
ATOM   4805  C  CA    . GLY G  3 44  ? -17.288 -32.866 16.348 1.00 61.85  ? 44   GLY G CA    1 
ATOM   4806  C  C     . GLY G  3 44  ? -18.661 -33.493 16.252 1.00 61.14  ? 44   GLY G C     1 
ATOM   4807  O  O     . GLY G  3 44  ? -19.608 -33.045 16.888 1.00 61.21  ? 44   GLY G O     1 
ATOM   4808  N  N     . ALA G  3 45  ? -18.768 -34.533 15.438 1.00 60.57  ? 45   ALA G N     1 
ATOM   4809  C  CA    . ALA G  3 45  ? -20.042 -35.199 15.206 1.00 59.74  ? 45   ALA G CA    1 
ATOM   4810  C  C     . ALA G  3 45  ? -20.427 -36.094 16.375 1.00 59.11  ? 45   ALA G C     1 
ATOM   4811  O  O     . ALA G  3 45  ? -21.605 -36.284 16.642 1.00 59.02  ? 45   ALA G O     1 
ATOM   4812  C  CB    . ALA G  3 45  ? -19.984 -36.001 13.925 1.00 59.86  ? 45   ALA G CB    1 
ATOM   4813  N  N     . GLY G  3 46  ? -19.430 -36.637 17.066 1.00 58.40  ? 46   GLY G N     1 
ATOM   4814  C  CA    . GLY G  3 46  ? -19.674 -37.557 18.168 1.00 57.61  ? 46   GLY G CA    1 
ATOM   4815  C  C     . GLY G  3 46  ? -20.182 -36.866 19.415 1.00 57.16  ? 46   GLY G C     1 
ATOM   4816  O  O     . GLY G  3 46  ? -20.883 -37.477 20.234 1.00 57.18  ? 46   GLY G O     1 
ATOM   4817  N  N     . ALA G  3 47  ? -19.842 -35.586 19.549 1.00 56.42  ? 47   ALA G N     1 
ATOM   4818  C  CA    . ALA G  3 47  ? -20.088 -34.851 20.788 1.00 55.72  ? 47   ALA G CA    1 
ATOM   4819  C  C     . ALA G  3 47  ? -21.564 -34.686 21.136 1.00 55.18  ? 47   ALA G C     1 
ATOM   4820  O  O     . ALA G  3 47  ? -21.949 -34.955 22.273 1.00 55.41  ? 47   ALA G O     1 
ATOM   4821  C  CB    . ALA G  3 47  ? -19.372 -33.509 20.783 1.00 55.78  ? 47   ALA G CB    1 
ATOM   4822  N  N     . PRO G  3 48  ? -22.401 -34.267 20.169 1.00 54.57  ? 48   PRO G N     1 
ATOM   4823  C  CA    . PRO G  3 48  ? -23.820 -34.144 20.506 1.00 54.29  ? 48   PRO G CA    1 
ATOM   4824  C  C     . PRO G  3 48  ? -24.453 -35.497 20.776 1.00 53.97  ? 48   PRO G C     1 
ATOM   4825  O  O     . PRO G  3 48  ? -25.387 -35.595 21.565 1.00 54.49  ? 48   PRO G O     1 
ATOM   4826  C  CB    . PRO G  3 48  ? -24.432 -33.532 19.255 1.00 54.10  ? 48   PRO G CB    1 
ATOM   4827  C  CG    . PRO G  3 48  ? -23.514 -33.906 18.183 1.00 54.57  ? 48   PRO G CG    1 
ATOM   4828  C  CD    . PRO G  3 48  ? -22.147 -33.895 18.772 1.00 54.47  ? 48   PRO G CD    1 
ATOM   4829  N  N     . VAL G  3 49  ? -23.933 -36.532 20.132 1.00 53.36  ? 49   VAL G N     1 
ATOM   4830  C  CA    . VAL G  3 49  ? -24.399 -37.890 20.351 1.00 52.67  ? 49   VAL G CA    1 
ATOM   4831  C  C     . VAL G  3 49  ? -24.152 -38.259 21.811 1.00 52.09  ? 49   VAL G C     1 
ATOM   4832  O  O     . VAL G  3 49  ? -25.087 -38.560 22.562 1.00 51.78  ? 49   VAL G O     1 
ATOM   4833  C  CB    . VAL G  3 49  ? -23.679 -38.857 19.382 1.00 52.77  ? 49   VAL G CB    1 
ATOM   4834  C  CG1   . VAL G  3 49  ? -24.005 -40.299 19.705 1.00 52.97  ? 49   VAL G CG1   1 
ATOM   4835  C  CG2   . VAL G  3 49  ? -24.071 -38.525 17.951 1.00 52.13  ? 49   VAL G CG2   1 
ATOM   4836  N  N     . TYR G  3 50  ? -22.883 -38.186 22.193 1.00 51.49  ? 50   TYR G N     1 
ATOM   4837  C  CA    . TYR G  3 50  ? -22.428 -38.440 23.552 1.00 51.06  ? 50   TYR G CA    1 
ATOM   4838  C  C     . TYR G  3 50  ? -23.209 -37.655 24.614 1.00 50.89  ? 50   TYR G C     1 
ATOM   4839  O  O     . TYR G  3 50  ? -23.718 -38.235 25.586 1.00 50.78  ? 50   TYR G O     1 
ATOM   4840  C  CB    . TYR G  3 50  ? -20.948 -38.068 23.647 1.00 50.94  ? 50   TYR G CB    1 
ATOM   4841  C  CG    . TYR G  3 50  ? -20.202 -38.745 24.763 1.00 50.20  ? 50   TYR G CG    1 
ATOM   4842  C  CD1   . TYR G  3 50  ? -19.101 -39.550 24.488 1.00 49.61  ? 50   TYR G CD1   1 
ATOM   4843  C  CD2   . TYR G  3 50  ? -20.589 -38.580 26.092 1.00 49.33  ? 50   TYR G CD2   1 
ATOM   4844  C  CE1   . TYR G  3 50  ? -18.407 -40.179 25.507 1.00 50.21  ? 50   TYR G CE1   1 
ATOM   4845  C  CE2   . TYR G  3 50  ? -19.901 -39.192 27.120 1.00 49.68  ? 50   TYR G CE2   1 
ATOM   4846  C  CZ    . TYR G  3 50  ? -18.811 -39.991 26.823 1.00 50.54  ? 50   TYR G CZ    1 
ATOM   4847  O  OH    . TYR G  3 50  ? -18.121 -40.610 27.837 1.00 51.44  ? 50   TYR G OH    1 
ATOM   4848  N  N     . LEU G  3 51  ? -23.290 -36.338 24.433 1.00 50.27  ? 51   LEU G N     1 
ATOM   4849  C  CA    . LEU G  3 51  ? -23.934 -35.499 25.422 1.00 49.71  ? 51   LEU G CA    1 
ATOM   4850  C  C     . LEU G  3 51  ? -25.413 -35.813 25.508 1.00 49.75  ? 51   LEU G C     1 
ATOM   4851  O  O     . LEU G  3 51  ? -25.956 -35.904 26.610 1.00 49.98  ? 51   LEU G O     1 
ATOM   4852  C  CB    . LEU G  3 51  ? -23.700 -34.010 25.143 1.00 49.58  ? 51   LEU G CB    1 
ATOM   4853  C  CG    . LEU G  3 51  ? -24.505 -32.980 25.955 1.00 48.55  ? 51   LEU G CG    1 
ATOM   4854  C  CD1   . LEU G  3 51  ? -24.460 -33.218 27.442 1.00 46.92  ? 51   LEU G CD1   1 
ATOM   4855  C  CD2   . LEU G  3 51  ? -24.003 -31.601 25.652 1.00 49.36  ? 51   LEU G CD2   1 
ATOM   4856  N  N     . ALA G  3 52  ? -26.059 -35.992 24.357 1.00 49.46  ? 52   ALA G N     1 
ATOM   4857  C  CA    . ALA G  3 52  ? -27.487 -36.287 24.340 1.00 49.41  ? 52   ALA G CA    1 
ATOM   4858  C  C     . ALA G  3 52  ? -27.746 -37.572 25.109 1.00 49.40  ? 52   ALA G C     1 
ATOM   4859  O  O     . ALA G  3 52  ? -28.695 -37.656 25.893 1.00 49.53  ? 52   ALA G O     1 
ATOM   4860  C  CB    . ALA G  3 52  ? -28.006 -36.393 22.934 1.00 49.38  ? 52   ALA G CB    1 
ATOM   4861  N  N     . ALA G  3 53  ? -26.876 -38.557 24.905 1.00 49.15  ? 53   ALA G N     1 
ATOM   4862  C  CA    . ALA G  3 53  ? -26.953 -39.803 25.653 1.00 49.24  ? 53   ALA G CA    1 
ATOM   4863  C  C     . ALA G  3 53  ? -26.868 -39.549 27.159 1.00 49.31  ? 53   ALA G C     1 
ATOM   4864  O  O     . ALA G  3 53  ? -27.658 -40.100 27.946 1.00 49.27  ? 53   ALA G O     1 
ATOM   4865  C  CB    . ALA G  3 53  ? -25.851 -40.738 25.214 1.00 49.43  ? 53   ALA G CB    1 
ATOM   4866  N  N     . VAL G  3 54  ? -25.913 -38.698 27.536 1.00 49.30  ? 54   VAL G N     1 
ATOM   4867  C  CA    . VAL G  3 54  ? -25.633 -38.373 28.937 1.00 49.12  ? 54   VAL G CA    1 
ATOM   4868  C  C     . VAL G  3 54  ? -26.805 -37.687 29.637 1.00 48.99  ? 54   VAL G C     1 
ATOM   4869  O  O     . VAL G  3 54  ? -27.104 -37.977 30.797 1.00 48.73  ? 54   VAL G O     1 
ATOM   4870  C  CB    . VAL G  3 54  ? -24.352 -37.535 29.054 1.00 48.99  ? 54   VAL G CB    1 
ATOM   4871  C  CG1   . VAL G  3 54  ? -24.179 -36.985 30.465 1.00 49.05  ? 54   VAL G CG1   1 
ATOM   4872  C  CG2   . VAL G  3 54  ? -23.167 -38.389 28.686 1.00 49.19  ? 54   VAL G CG2   1 
ATOM   4873  N  N     . LEU G  3 55  ? -27.471 -36.790 28.923 1.00 49.05  ? 55   LEU G N     1 
ATOM   4874  C  CA    . LEU G  3 55  ? -28.633 -36.123 29.475 1.00 49.42  ? 55   LEU G CA    1 
ATOM   4875  C  C     . LEU G  3 55  ? -29.780 -37.125 29.620 1.00 50.13  ? 55   LEU G C     1 
ATOM   4876  O  O     . LEU G  3 55  ? -30.435 -37.195 30.677 1.00 49.89  ? 55   LEU G O     1 
ATOM   4877  C  CB    . LEU G  3 55  ? -29.030 -34.936 28.605 1.00 49.00  ? 55   LEU G CB    1 
ATOM   4878  C  CG    . LEU G  3 55  ? -27.958 -33.865 28.444 1.00 48.46  ? 55   LEU G CG    1 
ATOM   4879  C  CD1   . LEU G  3 55  ? -28.226 -33.023 27.219 1.00 47.89  ? 55   LEU G CD1   1 
ATOM   4880  C  CD2   . LEU G  3 55  ? -27.846 -32.995 29.693 1.00 48.30  ? 55   LEU G CD2   1 
ATOM   4881  N  N     . GLU G  3 56  ? -29.987 -37.921 28.564 1.00 50.78  ? 56   GLU G N     1 
ATOM   4882  C  CA    . GLU G  3 56  ? -31.026 -38.941 28.554 1.00 51.23  ? 56   GLU G CA    1 
ATOM   4883  C  C     . GLU G  3 56  ? -30.883 -39.841 29.768 1.00 50.94  ? 56   GLU G C     1 
ATOM   4884  O  O     . GLU G  3 56  ? -31.820 -39.980 30.555 1.00 50.82  ? 56   GLU G O     1 
ATOM   4885  C  CB    . GLU G  3 56  ? -30.985 -39.765 27.273 1.00 51.41  ? 56   GLU G CB    1 
ATOM   4886  C  CG    . GLU G  3 56  ? -32.214 -40.646 27.101 1.00 54.00  ? 56   GLU G CG    1 
ATOM   4887  C  CD    . GLU G  3 56  ? -32.312 -41.283 25.720 1.00 57.68  ? 56   GLU G CD    1 
ATOM   4888  O  OE1   . GLU G  3 56  ? -32.374 -42.525 25.653 1.00 60.17  ? 56   GLU G OE1   1 
ATOM   4889  O  OE2   . GLU G  3 56  ? -32.332 -40.558 24.700 1.00 58.90  ? 56   GLU G OE2   1 
ATOM   4890  N  N     . TYR G  3 57  ? -29.701 -40.423 29.931 1.00 50.81  ? 57   TYR G N     1 
ATOM   4891  C  CA    . TYR G  3 57  ? -29.464 -41.301 31.061 1.00 51.04  ? 57   TYR G CA    1 
ATOM   4892  C  C     . TYR G  3 57  ? -29.825 -40.667 32.402 1.00 50.75  ? 57   TYR G C     1 
ATOM   4893  O  O     . TYR G  3 57  ? -30.553 -41.274 33.201 1.00 50.71  ? 57   TYR G O     1 
ATOM   4894  C  CB    . TYR G  3 57  ? -28.016 -41.772 31.108 1.00 51.72  ? 57   TYR G CB    1 
ATOM   4895  C  CG    . TYR G  3 57  ? -27.623 -42.324 32.470 1.00 52.07  ? 57   TYR G CG    1 
ATOM   4896  C  CD1   . TYR G  3 57  ? -28.165 -43.520 32.940 1.00 52.25  ? 57   TYR G CD1   1 
ATOM   4897  C  CD2   . TYR G  3 57  ? -26.723 -41.642 33.285 1.00 51.77  ? 57   TYR G CD2   1 
ATOM   4898  C  CE1   . TYR G  3 57  ? -27.818 -44.021 34.176 1.00 53.01  ? 57   TYR G CE1   1 
ATOM   4899  C  CE2   . TYR G  3 57  ? -26.360 -42.138 34.521 1.00 52.20  ? 57   TYR G CE2   1 
ATOM   4900  C  CZ    . TYR G  3 57  ? -26.907 -43.328 34.961 1.00 53.14  ? 57   TYR G CZ    1 
ATOM   4901  O  OH    . TYR G  3 57  ? -26.550 -43.834 36.191 1.00 53.76  ? 57   TYR G OH    1 
ATOM   4902  N  N     . LEU G  3 58  ? -29.305 -39.463 32.646 1.00 50.07  ? 58   LEU G N     1 
ATOM   4903  C  CA    . LEU G  3 58  ? -29.521 -38.787 33.915 1.00 49.50  ? 58   LEU G CA    1 
ATOM   4904  C  C     . LEU G  3 58  ? -31.001 -38.518 34.139 1.00 49.76  ? 58   LEU G C     1 
ATOM   4905  O  O     . LEU G  3 58  ? -31.502 -38.627 35.255 1.00 49.46  ? 58   LEU G O     1 
ATOM   4906  C  CB    . LEU G  3 58  ? -28.724 -37.492 33.976 1.00 49.21  ? 58   LEU G CB    1 
ATOM   4907  C  CG    . LEU G  3 58  ? -27.211 -37.557 34.214 1.00 48.39  ? 58   LEU G CG    1 
ATOM   4908  C  CD1   . LEU G  3 58  ? -26.575 -36.231 33.878 1.00 48.19  ? 58   LEU G CD1   1 
ATOM   4909  C  CD2   . LEU G  3 58  ? -26.868 -37.940 35.634 1.00 46.83  ? 58   LEU G CD2   1 
ATOM   4910  N  N     . THR G  3 59  ? -31.700 -38.195 33.056 1.00 50.29  ? 59   THR G N     1 
ATOM   4911  C  CA    . THR G  3 59  ? -33.136 -37.964 33.100 1.00 50.89  ? 59   THR G CA    1 
ATOM   4912  C  C     . THR G  3 59  ? -33.879 -39.216 33.544 1.00 51.31  ? 59   THR G C     1 
ATOM   4913  O  O     . THR G  3 59  ? -34.770 -39.150 34.403 1.00 51.54  ? 59   THR G O     1 
ATOM   4914  C  CB    . THR G  3 59  ? -33.641 -37.558 31.733 1.00 50.80  ? 59   THR G CB    1 
ATOM   4915  O  OG1   . THR G  3 59  ? -33.003 -36.339 31.342 1.00 51.41  ? 59   THR G OG1   1 
ATOM   4916  C  CG2   . THR G  3 59  ? -35.129 -37.354 31.757 1.00 51.29  ? 59   THR G CG2   1 
ATOM   4917  N  N     . ALA G  3 60  ? -33.503 -40.350 32.950 1.00 51.56  ? 60   ALA G N     1 
ATOM   4918  C  CA    . ALA G  3 60  ? -34.056 -41.651 33.317 1.00 51.65  ? 60   ALA G CA    1 
ATOM   4919  C  C     . ALA G  3 60  ? -33.845 -41.918 34.801 1.00 51.66  ? 60   ALA G C     1 
ATOM   4920  O  O     . ALA G  3 60  ? -34.795 -42.176 35.545 1.00 51.45  ? 60   ALA G O     1 
ATOM   4921  C  CB    . ALA G  3 60  ? -33.418 -42.746 32.487 1.00 51.55  ? 60   ALA G CB    1 
ATOM   4922  N  N     . GLU G  3 61  ? -32.591 -41.825 35.221 1.00 51.72  ? 61   GLU G N     1 
ATOM   4923  C  CA    . GLU G  3 61  ? -32.241 -41.991 36.613 1.00 52.08  ? 61   GLU G CA    1 
ATOM   4924  C  C     . GLU G  3 61  ? -33.137 -41.175 37.556 1.00 52.03  ? 61   GLU G C     1 
ATOM   4925  O  O     . GLU G  3 61  ? -33.646 -41.713 38.536 1.00 52.23  ? 61   GLU G O     1 
ATOM   4926  C  CB    . GLU G  3 61  ? -30.770 -41.651 36.819 1.00 52.16  ? 61   GLU G CB    1 
ATOM   4927  C  CG    . GLU G  3 61  ? -30.290 -41.786 38.247 1.00 53.55  ? 61   GLU G CG    1 
ATOM   4928  C  CD    . GLU G  3 61  ? -30.113 -43.222 38.691 1.00 54.88  ? 61   GLU G CD    1 
ATOM   4929  O  OE1   . GLU G  3 61  ? -29.988 -44.109 37.815 1.00 54.34  ? 61   GLU G OE1   1 
ATOM   4930  O  OE2   . GLU G  3 61  ? -30.071 -43.451 39.924 1.00 56.52  ? 61   GLU G OE2   1 
ATOM   4931  N  N     . ILE G  3 62  ? -33.354 -39.897 37.267 1.00 51.82  ? 62   ILE G N     1 
ATOM   4932  C  CA    . ILE G  3 62  ? -34.199 -39.110 38.153 1.00 52.02  ? 62   ILE G CA    1 
ATOM   4933  C  C     . ILE G  3 62  ? -35.659 -39.550 38.098 1.00 52.55  ? 62   ILE G C     1 
ATOM   4934  O  O     . ILE G  3 62  ? -36.282 -39.758 39.141 1.00 52.49  ? 62   ILE G O     1 
ATOM   4935  C  CB    . ILE G  3 62  ? -34.084 -37.603 37.907 1.00 51.92  ? 62   ILE G CB    1 
ATOM   4936  C  CG1   . ILE G  3 62  ? -32.645 -37.168 38.146 1.00 52.32  ? 62   ILE G CG1   1 
ATOM   4937  C  CG2   . ILE G  3 62  ? -35.000 -36.827 38.850 1.00 50.96  ? 62   ILE G CG2   1 
ATOM   4938  C  CD1   . ILE G  3 62  ? -32.479 -35.691 38.315 1.00 52.56  ? 62   ILE G CD1   1 
ATOM   4939  N  N     . LEU G  3 63  ? -36.198 -39.707 36.890 1.00 53.08  ? 63   LEU G N     1 
ATOM   4940  C  CA    . LEU G  3 63  ? -37.587 -40.133 36.735 1.00 53.34  ? 63   LEU G CA    1 
ATOM   4941  C  C     . LEU G  3 63  ? -37.809 -41.483 37.400 1.00 54.02  ? 63   LEU G C     1 
ATOM   4942  O  O     . LEU G  3 63  ? -38.844 -41.699 38.027 1.00 53.96  ? 63   LEU G O     1 
ATOM   4943  C  CB    . LEU G  3 63  ? -37.979 -40.182 35.262 1.00 53.07  ? 63   LEU G CB    1 
ATOM   4944  C  CG    . LEU G  3 63  ? -38.021 -38.828 34.556 1.00 52.48  ? 63   LEU G CG    1 
ATOM   4945  C  CD1   . LEU G  3 63  ? -38.189 -38.976 33.051 1.00 50.99  ? 63   LEU G CD1   1 
ATOM   4946  C  CD2   . LEU G  3 63  ? -39.121 -37.965 35.142 1.00 52.25  ? 63   LEU G CD2   1 
ATOM   4947  N  N     . GLU G  3 64  ? -36.819 -42.370 37.277 1.00 54.77  ? 64   GLU G N     1 
ATOM   4948  C  CA    . GLU G  3 64  ? -36.837 -43.672 37.939 1.00 55.64  ? 64   GLU G CA    1 
ATOM   4949  C  C     . GLU G  3 64  ? -37.103 -43.524 39.435 1.00 55.61  ? 64   GLU G C     1 
ATOM   4950  O  O     . GLU G  3 64  ? -38.137 -43.980 39.924 1.00 55.74  ? 64   GLU G O     1 
ATOM   4951  C  CB    . GLU G  3 64  ? -35.531 -44.431 37.679 1.00 55.94  ? 64   GLU G CB    1 
ATOM   4952  C  CG    . GLU G  3 64  ? -35.320 -45.695 38.528 1.00 59.06  ? 64   GLU G CG    1 
ATOM   4953  C  CD    . GLU G  3 64  ? -36.399 -46.768 38.326 1.00 63.83  ? 64   GLU G CD    1 
ATOM   4954  O  OE1   . GLU G  3 64  ? -36.730 -47.100 37.154 1.00 65.36  ? 64   GLU G OE1   1 
ATOM   4955  O  OE2   . GLU G  3 64  ? -36.904 -47.297 39.350 1.00 65.43  ? 64   GLU G OE2   1 
ATOM   4956  N  N     . LEU G  3 65  ? -36.186 -42.862 40.144 1.00 55.70  ? 65   LEU G N     1 
ATOM   4957  C  CA    . LEU G  3 65  ? -36.297 -42.678 41.592 1.00 55.66  ? 65   LEU G CA    1 
ATOM   4958  C  C     . LEU G  3 65  ? -37.548 -41.904 41.940 1.00 55.87  ? 65   LEU G C     1 
ATOM   4959  O  O     . LEU G  3 65  ? -38.311 -42.311 42.810 1.00 55.56  ? 65   LEU G O     1 
ATOM   4960  C  CB    . LEU G  3 65  ? -35.062 -41.975 42.158 1.00 55.41  ? 65   LEU G CB    1 
ATOM   4961  C  CG    . LEU G  3 65  ? -33.725 -42.691 41.931 1.00 55.72  ? 65   LEU G CG    1 
ATOM   4962  C  CD1   . LEU G  3 65  ? -32.566 -41.866 42.460 1.00 57.26  ? 65   LEU G CD1   1 
ATOM   4963  C  CD2   . LEU G  3 65  ? -33.692 -44.068 42.562 1.00 56.10  ? 65   LEU G CD2   1 
ATOM   4964  N  N     . ALA G  3 66  ? -37.760 -40.800 41.230 1.00 56.57  ? 66   ALA G N     1 
ATOM   4965  C  CA    . ALA G  3 66  ? -38.911 -39.937 41.450 1.00 57.16  ? 66   ALA G CA    1 
ATOM   4966  C  C     . ALA G  3 66  ? -40.194 -40.713 41.263 1.00 57.76  ? 66   ALA G C     1 
ATOM   4967  O  O     . ALA G  3 66  ? -41.141 -40.513 42.023 1.00 58.15  ? 66   ALA G O     1 
ATOM   4968  C  CB    . ALA G  3 66  ? -38.874 -38.736 40.530 1.00 57.02  ? 66   ALA G CB    1 
ATOM   4969  N  N     . GLY G  3 67  ? -40.214 -41.601 40.265 1.00 58.29  ? 67   GLY G N     1 
ATOM   4970  C  CA    . GLY G  3 67  ? -41.345 -42.505 40.038 1.00 58.91  ? 67   GLY G CA    1 
ATOM   4971  C  C     . GLY G  3 67  ? -41.610 -43.339 41.278 1.00 59.42  ? 67   GLY G C     1 
ATOM   4972  O  O     . GLY G  3 67  ? -42.687 -43.271 41.868 1.00 59.44  ? 67   GLY G O     1 
ATOM   4973  N  N     . ASN G  3 68  ? -40.602 -44.102 41.688 1.00 59.86  ? 68   ASN G N     1 
ATOM   4974  C  CA    . ASN G  3 68  ? -40.673 -44.885 42.908 1.00 60.40  ? 68   ASN G CA    1 
ATOM   4975  C  C     . ASN G  3 68  ? -41.250 -44.102 44.062 1.00 60.83  ? 68   ASN G C     1 
ATOM   4976  O  O     . ASN G  3 68  ? -41.990 -44.643 44.866 1.00 61.25  ? 68   ASN G O     1 
ATOM   4977  C  CB    . ASN G  3 68  ? -39.283 -45.372 43.314 1.00 60.62  ? 68   ASN G CB    1 
ATOM   4978  C  CG    . ASN G  3 68  ? -38.675 -46.307 42.298 1.00 60.73  ? 68   ASN G CG    1 
ATOM   4979  O  OD1   . ASN G  3 68  ? -39.378 -46.875 41.458 1.00 60.70  ? 68   ASN G OD1   1 
ATOM   4980  N  ND2   . ASN G  3 68  ? -37.355 -46.473 42.366 1.00 60.14  ? 68   ASN G ND2   1 
ATOM   4981  N  N     . ALA G  3 69  ? -40.904 -42.827 44.148 1.00 61.25  ? 69   ALA G N     1 
ATOM   4982  C  CA    . ALA G  3 69  ? -41.321 -42.016 45.272 1.00 61.77  ? 69   ALA G CA    1 
ATOM   4983  C  C     . ALA G  3 69  ? -42.794 -41.728 45.178 1.00 62.19  ? 69   ALA G C     1 
ATOM   4984  O  O     . ALA G  3 69  ? -43.455 -41.540 46.194 1.00 62.04  ? 69   ALA G O     1 
ATOM   4985  C  CB    . ALA G  3 69  ? -40.545 -40.732 45.299 1.00 62.19  ? 69   ALA G CB    1 
ATOM   4986  N  N     . ALA G  3 70  ? -43.296 -41.689 43.949 1.00 63.04  ? 70   ALA G N     1 
ATOM   4987  C  CA    . ALA G  3 70  ? -44.720 -41.497 43.697 1.00 64.08  ? 70   ALA G CA    1 
ATOM   4988  C  C     . ALA G  3 70  ? -45.486 -42.715 44.185 1.00 64.65  ? 70   ALA G C     1 
ATOM   4989  O  O     . ALA G  3 70  ? -46.479 -42.584 44.898 1.00 64.61  ? 70   ALA G O     1 
ATOM   4990  C  CB    . ALA G  3 70  ? -44.975 -41.256 42.219 1.00 64.06  ? 70   ALA G CB    1 
ATOM   4991  N  N     . ARG G  3 71  ? -45.007 -43.894 43.804 1.00 65.49  ? 71   ARG G N     1 
ATOM   4992  C  CA    . ARG G  3 71  ? -45.525 -45.137 44.330 1.00 66.69  ? 71   ARG G CA    1 
ATOM   4993  C  C     . ARG G  3 71  ? -45.626 -45.016 45.852 1.00 66.78  ? 71   ARG G C     1 
ATOM   4994  O  O     . ARG G  3 71  ? -46.722 -44.974 46.392 1.00 66.78  ? 71   ARG G O     1 
ATOM   4995  C  CB    . ARG G  3 71  ? -44.604 -46.283 43.939 1.00 67.15  ? 71   ARG G CB    1 
ATOM   4996  C  CG    . ARG G  3 71  ? -45.292 -47.605 43.608 1.00 70.26  ? 71   ARG G CG    1 
ATOM   4997  C  CD    . ARG G  3 71  ? -44.426 -48.832 44.017 1.00 75.99  ? 71   ARG G CD    1 
ATOM   4998  N  NE    . ARG G  3 71  ? -42.977 -48.706 43.743 1.00 80.20  ? 71   ARG G NE    1 
ATOM   4999  C  CZ    . ARG G  3 71  ? -42.027 -48.476 44.668 1.00 82.34  ? 71   ARG G CZ    1 
ATOM   5000  N  NH1   . ARG G  3 71  ? -42.344 -48.328 45.958 1.00 82.38  ? 71   ARG G NH1   1 
ATOM   5001  N  NH2   . ARG G  3 71  ? -40.744 -48.386 44.305 1.00 82.98  ? 71   ARG G NH2   1 
ATOM   5002  N  N     . ASP G  3 72  ? -44.484 -44.900 46.524 1.00 67.23  ? 72   ASP G N     1 
ATOM   5003  C  CA    . ASP G  3 72  ? -44.411 -44.823 47.990 1.00 67.89  ? 72   ASP G CA    1 
ATOM   5004  C  C     . ASP G  3 72  ? -45.476 -43.965 48.639 1.00 67.94  ? 72   ASP G C     1 
ATOM   5005  O  O     . ASP G  3 72  ? -45.873 -44.223 49.767 1.00 67.80  ? 72   ASP G O     1 
ATOM   5006  C  CB    . ASP G  3 72  ? -43.054 -44.274 48.455 1.00 68.35  ? 72   ASP G CB    1 
ATOM   5007  C  CG    . ASP G  3 72  ? -41.867 -45.052 47.906 1.00 69.58  ? 72   ASP G CG    1 
ATOM   5008  O  OD1   . ASP G  3 72  ? -42.039 -46.211 47.442 1.00 70.87  ? 72   ASP G OD1   1 
ATOM   5009  O  OD2   . ASP G  3 72  ? -40.751 -44.484 47.943 1.00 70.36  ? 72   ASP G OD2   1 
ATOM   5010  N  N     . ASN G  3 73  ? -45.908 -42.920 47.944 1.00 68.41  ? 73   ASN G N     1 
ATOM   5011  C  CA    . ASN G  3 73  ? -46.869 -41.974 48.514 1.00 68.99  ? 73   ASN G CA    1 
ATOM   5012  C  C     . ASN G  3 73  ? -48.283 -42.211 48.007 1.00 68.85  ? 73   ASN G C     1 
ATOM   5013  O  O     . ASN G  3 73  ? -49.157 -41.357 48.201 1.00 68.96  ? 73   ASN G O     1 
ATOM   5014  C  CB    . ASN G  3 73  ? -46.444 -40.523 48.247 1.00 69.25  ? 73   ASN G CB    1 
ATOM   5015  C  CG    . ASN G  3 73  ? -45.094 -40.169 48.886 1.00 70.88  ? 73   ASN G CG    1 
ATOM   5016  O  OD1   . ASN G  3 73  ? -44.961 -39.118 49.525 1.00 73.17  ? 73   ASN G OD1   1 
ATOM   5017  N  ND2   . ASN G  3 73  ? -44.089 -41.036 48.710 1.00 71.09  ? 73   ASN G ND2   1 
ATOM   5018  N  N     . LYS G  3 74  ? -48.478 -43.369 47.358 1.00 68.54  ? 74   LYS G N     1 
ATOM   5019  C  CA    . LYS G  3 74  ? -49.777 -43.850 46.844 1.00 68.28  ? 74   LYS G CA    1 
ATOM   5020  C  C     . LYS G  3 74  ? -50.260 -43.068 45.628 1.00 67.54  ? 74   LYS G C     1 
ATOM   5021  O  O     . LYS G  3 74  ? -51.452 -42.815 45.481 1.00 67.41  ? 74   LYS G O     1 
ATOM   5022  C  CB    . LYS G  3 74  ? -50.864 -43.844 47.944 1.00 68.95  ? 74   LYS G CB    1 
ATOM   5023  C  CG    . LYS G  3 74  ? -50.659 -44.834 49.098 1.00 69.92  ? 74   LYS G CG    1 
ATOM   5024  C  CD    . LYS G  3 74  ? -51.163 -46.253 48.759 1.00 71.55  ? 74   LYS G CD    1 
ATOM   5025  C  CE    . LYS G  3 74  ? -51.070 -47.175 49.977 1.00 71.69  ? 74   LYS G CE    1 
ATOM   5026  N  NZ    . LYS G  3 74  ? -49.651 -47.400 50.418 1.00 72.54  ? 74   LYS G NZ    1 
ATOM   5027  N  N     . LYS G  3 75  ? -49.332 -42.694 44.755 1.00 66.86  ? 75   LYS G N     1 
ATOM   5028  C  CA    . LYS G  3 75  ? -49.645 -41.805 43.631 1.00 66.01  ? 75   LYS G CA    1 
ATOM   5029  C  C     . LYS G  3 75  ? -49.017 -42.250 42.323 1.00 65.13  ? 75   LYS G C     1 
ATOM   5030  O  O     . LYS G  3 75  ? -47.981 -42.915 42.297 1.00 64.85  ? 75   LYS G O     1 
ATOM   5031  C  CB    . LYS G  3 75  ? -49.186 -40.378 43.929 1.00 66.35  ? 75   LYS G CB    1 
ATOM   5032  C  CG    . LYS G  3 75  ? -49.750 -39.758 45.202 1.00 66.70  ? 75   LYS G CG    1 
ATOM   5033  C  CD    . LYS G  3 75  ? -49.575 -38.244 45.155 1.00 68.71  ? 75   LYS G CD    1 
ATOM   5034  C  CE    . LYS G  3 75  ? -50.077 -37.574 46.419 1.00 70.19  ? 75   LYS G CE    1 
ATOM   5035  N  NZ    . LYS G  3 75  ? -51.501 -37.937 46.732 1.00 71.49  ? 75   LYS G NZ    1 
ATOM   5036  N  N     . THR G  3 76  ? -49.643 -41.844 41.230 1.00 64.28  ? 76   THR G N     1 
ATOM   5037  C  CA    . THR G  3 76  ? -49.217 -42.294 39.907 1.00 63.47  ? 76   THR G CA    1 
ATOM   5038  C  C     . THR G  3 76  ? -48.671 -41.173 39.026 1.00 62.74  ? 76   THR G C     1 
ATOM   5039  O  O     . THR G  3 76  ? -48.039 -41.446 38.000 1.00 62.73  ? 76   THR G O     1 
ATOM   5040  C  CB    . THR G  3 76  ? -50.352 -43.021 39.168 1.00 63.48  ? 76   THR G CB    1 
ATOM   5041  O  OG1   . THR G  3 76  ? -51.569 -42.264 39.301 1.00 63.30  ? 76   THR G OG1   1 
ATOM   5042  C  CG2   . THR G  3 76  ? -50.533 -44.427 39.752 1.00 63.46  ? 76   THR G CG2   1 
ATOM   5043  N  N     . ARG G  3 77  ? -48.922 -39.924 39.425 1.00 61.47  ? 77   ARG G N     1 
ATOM   5044  C  CA    . ARG G  3 77  ? -48.368 -38.759 38.736 1.00 60.03  ? 77   ARG G CA    1 
ATOM   5045  C  C     . ARG G  3 77  ? -47.299 -38.078 39.594 1.00 58.90  ? 77   ARG G C     1 
ATOM   5046  O  O     . ARG G  3 77  ? -47.574 -37.713 40.752 1.00 59.06  ? 77   ARG G O     1 
ATOM   5047  C  CB    . ARG G  3 77  ? -49.470 -37.758 38.406 1.00 60.10  ? 77   ARG G CB    1 
ATOM   5048  C  CG    . ARG G  3 77  ? -48.959 -36.351 38.075 1.00 60.97  ? 77   ARG G CG    1 
ATOM   5049  C  CD    . ARG G  3 77  ? -50.104 -35.387 37.858 1.00 62.37  ? 77   ARG G CD    1 
ATOM   5050  N  NE    . ARG G  3 77  ? -50.969 -35.916 36.814 1.00 62.56  ? 77   ARG G NE    1 
ATOM   5051  C  CZ    . ARG G  3 77  ? -52.291 -35.862 36.827 1.00 62.10  ? 77   ARG G CZ    1 
ATOM   5052  N  NH1   . ARG G  3 77  ? -52.943 -35.280 37.831 1.00 60.76  ? 77   ARG G NH1   1 
ATOM   5053  N  NH2   . ARG G  3 77  ? -52.953 -36.408 35.821 1.00 63.18  ? 77   ARG G NH2   1 
ATOM   5054  N  N     . ILE G  3 78  ? -46.104 -37.900 39.016 1.00 56.92  ? 78   ILE G N     1 
ATOM   5055  C  CA    . ILE G  3 78  ? -45.001 -37.187 39.659 1.00 55.07  ? 78   ILE G CA    1 
ATOM   5056  C  C     . ILE G  3 78  ? -45.276 -35.687 39.803 1.00 54.59  ? 78   ILE G C     1 
ATOM   5057  O  O     . ILE G  3 78  ? -45.549 -34.988 38.821 1.00 54.73  ? 78   ILE G O     1 
ATOM   5058  C  CB    . ILE G  3 78  ? -43.682 -37.363 38.887 1.00 54.70  ? 78   ILE G CB    1 
ATOM   5059  C  CG1   . ILE G  3 78  ? -43.286 -38.833 38.830 1.00 54.00  ? 78   ILE G CG1   1 
ATOM   5060  C  CG2   . ILE G  3 78  ? -42.568 -36.543 39.526 1.00 54.18  ? 78   ILE G CG2   1 
ATOM   5061  C  CD1   . ILE G  3 78  ? -42.114 -39.121 37.939 1.00 52.33  ? 78   ILE G CD1   1 
ATOM   5062  N  N     . ILE G  3 79  ? -45.210 -35.202 41.038 1.00 53.58  ? 79   ILE G N     1 
ATOM   5063  C  CA    . ILE G  3 79  ? -45.165 -33.772 41.299 1.00 52.46  ? 79   ILE G CA    1 
ATOM   5064  C  C     . ILE G  3 79  ? -43.762 -33.351 41.777 1.00 51.73  ? 79   ILE G C     1 
ATOM   5065  O  O     . ILE G  3 79  ? -42.883 -34.202 41.966 1.00 51.43  ? 79   ILE G O     1 
ATOM   5066  C  CB    . ILE G  3 79  ? -46.274 -33.328 42.275 1.00 52.36  ? 79   ILE G CB    1 
ATOM   5067  C  CG1   . ILE G  3 79  ? -46.180 -34.068 43.612 1.00 51.98  ? 79   ILE G CG1   1 
ATOM   5068  C  CG2   . ILE G  3 79  ? -47.620 -33.520 41.624 1.00 52.96  ? 79   ILE G CG2   1 
ATOM   5069  C  CD1   . ILE G  3 79  ? -46.830 -33.326 44.773 1.00 51.41  ? 79   ILE G CD1   1 
ATOM   5070  N  N     . PRO G  3 80  ? -43.534 -32.037 41.941 1.00 50.98  ? 80   PRO G N     1 
ATOM   5071  C  CA    . PRO G  3 80  ? -42.227 -31.607 42.380 1.00 50.56  ? 80   PRO G CA    1 
ATOM   5072  C  C     . PRO G  3 80  ? -41.760 -32.329 43.635 1.00 49.98  ? 80   PRO G C     1 
ATOM   5073  O  O     . PRO G  3 80  ? -40.624 -32.821 43.664 1.00 49.72  ? 80   PRO G O     1 
ATOM   5074  C  CB    . PRO G  3 80  ? -42.439 -30.119 42.643 1.00 50.50  ? 80   PRO G CB    1 
ATOM   5075  C  CG    . PRO G  3 80  ? -43.441 -29.750 41.634 1.00 50.56  ? 80   PRO G CG    1 
ATOM   5076  C  CD    . PRO G  3 80  ? -44.409 -30.878 41.709 1.00 50.95  ? 80   PRO G CD    1 
ATOM   5077  N  N     . ARG G  3 81  ? -42.630 -32.426 44.643 1.00 49.38  ? 81   ARG G N     1 
ATOM   5078  C  CA    . ARG G  3 81  ? -42.249 -33.085 45.888 1.00 48.60  ? 81   ARG G CA    1 
ATOM   5079  C  C     . ARG G  3 81  ? -41.566 -34.392 45.572 1.00 48.50  ? 81   ARG G C     1 
ATOM   5080  O  O     . ARG G  3 81  ? -40.526 -34.700 46.144 1.00 48.70  ? 81   ARG G O     1 
ATOM   5081  C  CB    . ARG G  3 81  ? -43.438 -33.319 46.810 1.00 48.41  ? 81   ARG G CB    1 
ATOM   5082  C  CG    . ARG G  3 81  ? -43.119 -34.163 48.046 1.00 47.36  ? 81   ARG G CG    1 
ATOM   5083  C  CD    . ARG G  3 81  ? -42.076 -33.525 48.923 1.00 45.30  ? 81   ARG G CD    1 
ATOM   5084  N  NE    . ARG G  3 81  ? -42.089 -34.080 50.271 1.00 45.74  ? 81   ARG G NE    1 
ATOM   5085  C  CZ    . ARG G  3 81  ? -41.408 -33.575 51.303 1.00 46.52  ? 81   ARG G CZ    1 
ATOM   5086  N  NH1   . ARG G  3 81  ? -40.644 -32.493 51.153 1.00 46.42  ? 81   ARG G NH1   1 
ATOM   5087  N  NH2   . ARG G  3 81  ? -41.488 -34.153 52.497 1.00 46.02  ? 81   ARG G NH2   1 
ATOM   5088  N  N     . HIS G  3 82  ? -42.118 -35.142 44.629 1.00 48.29  ? 82   HIS G N     1 
ATOM   5089  C  CA    . HIS G  3 82  ? -41.518 -36.430 44.288 1.00 48.08  ? 82   HIS G CA    1 
ATOM   5090  C  C     . HIS G  3 82  ? -40.091 -36.324 43.784 1.00 47.68  ? 82   HIS G C     1 
ATOM   5091  O  O     . HIS G  3 82  ? -39.242 -37.094 44.235 1.00 48.31  ? 82   HIS G O     1 
ATOM   5092  C  CB    . HIS G  3 82  ? -42.397 -37.228 43.338 1.00 48.13  ? 82   HIS G CB    1 
ATOM   5093  C  CG    . HIS G  3 82  ? -43.788 -37.403 43.846 1.00 48.00  ? 82   HIS G CG    1 
ATOM   5094  N  ND1   . HIS G  3 82  ? -44.898 -37.128 43.083 1.00 47.23  ? 82   HIS G ND1   1 
ATOM   5095  C  CD2   . HIS G  3 82  ? -44.245 -37.772 45.065 1.00 47.90  ? 82   HIS G CD2   1 
ATOM   5096  C  CE1   . HIS G  3 82  ? -45.983 -37.349 43.799 1.00 47.87  ? 82   HIS G CE1   1 
ATOM   5097  N  NE2   . HIS G  3 82  ? -45.615 -37.739 45.006 1.00 48.44  ? 82   HIS G NE2   1 
ATOM   5098  N  N     . LEU G  3 83  ? -39.820 -35.363 42.895 1.00 46.77  ? 83   LEU G N     1 
ATOM   5099  C  CA    . LEU G  3 83  ? -38.454 -35.134 42.388 1.00 45.51  ? 83   LEU G CA    1 
ATOM   5100  C  C     . LEU G  3 83  ? -37.518 -34.691 43.501 1.00 44.78  ? 83   LEU G C     1 
ATOM   5101  O  O     . LEU G  3 83  ? -36.349 -35.046 43.494 1.00 44.35  ? 83   LEU G O     1 
ATOM   5102  C  CB    . LEU G  3 83  ? -38.438 -34.104 41.256 1.00 45.52  ? 83   LEU G CB    1 
ATOM   5103  C  CG    . LEU G  3 83  ? -39.343 -34.338 40.033 1.00 44.86  ? 83   LEU G CG    1 
ATOM   5104  C  CD1   . LEU G  3 83  ? -39.575 -33.044 39.242 1.00 43.35  ? 83   LEU G CD1   1 
ATOM   5105  C  CD2   . LEU G  3 83  ? -38.796 -35.438 39.140 1.00 42.56  ? 83   LEU G CD2   1 
ATOM   5106  N  N     . GLN G  3 84  ? -38.044 -33.938 44.464 1.00 44.18  ? 84   GLN G N     1 
ATOM   5107  C  CA    . GLN G  3 84  ? -37.256 -33.501 45.611 1.00 43.87  ? 84   GLN G CA    1 
ATOM   5108  C  C     . GLN G  3 84  ? -36.895 -34.639 46.535 1.00 44.21  ? 84   GLN G C     1 
ATOM   5109  O  O     . GLN G  3 84  ? -35.735 -34.749 46.930 1.00 45.31  ? 84   GLN G O     1 
ATOM   5110  C  CB    . GLN G  3 84  ? -37.957 -32.400 46.400 1.00 43.83  ? 84   GLN G CB    1 
ATOM   5111  C  CG    . GLN G  3 84  ? -37.377 -32.116 47.794 1.00 41.99  ? 84   GLN G CG    1 
ATOM   5112  C  CD    . GLN G  3 84  ? -36.112 -31.285 47.785 1.00 40.40  ? 84   GLN G CD    1 
ATOM   5113  O  OE1   . GLN G  3 84  ? -35.459 -31.107 46.760 1.00 40.91  ? 84   GLN G OE1   1 
ATOM   5114  N  NE2   . GLN G  3 84  ? -35.749 -30.785 48.947 1.00 40.21  ? 84   GLN G NE2   1 
ATOM   5115  N  N     . LEU G  3 85  ? -37.857 -35.488 46.888 1.00 43.79  ? 85   LEU G N     1 
ATOM   5116  C  CA    . LEU G  3 85  ? -37.533 -36.679 47.687 1.00 43.45  ? 85   LEU G CA    1 
ATOM   5117  C  C     . LEU G  3 85  ? -36.603 -37.600 46.920 1.00 43.10  ? 85   LEU G C     1 
ATOM   5118  O  O     . LEU G  3 85  ? -35.736 -38.225 47.506 1.00 42.97  ? 85   LEU G O     1 
ATOM   5119  C  CB    . LEU G  3 85  ? -38.783 -37.458 48.093 1.00 43.55  ? 85   LEU G CB    1 
ATOM   5120  C  CG    . LEU G  3 85  ? -39.900 -36.746 48.862 1.00 43.60  ? 85   LEU G CG    1 
ATOM   5121  C  CD1   . LEU G  3 85  ? -41.122 -37.608 48.819 1.00 44.35  ? 85   LEU G CD1   1 
ATOM   5122  C  CD2   . LEU G  3 85  ? -39.536 -36.427 50.294 1.00 43.21  ? 85   LEU G CD2   1 
ATOM   5123  N  N     . ALA G  3 86  ? -36.791 -37.679 45.607 1.00 43.07  ? 86   ALA G N     1 
ATOM   5124  C  CA    . ALA G  3 86  ? -35.923 -38.484 44.744 1.00 43.63  ? 86   ALA G CA    1 
ATOM   5125  C  C     . ALA G  3 86  ? -34.457 -38.084 44.879 1.00 44.03  ? 86   ALA G C     1 
ATOM   5126  O  O     . ALA G  3 86  ? -33.577 -38.928 45.111 1.00 44.11  ? 86   ALA G O     1 
ATOM   5127  C  CB    . ALA G  3 86  ? -36.350 -38.356 43.306 1.00 43.48  ? 86   ALA G CB    1 
ATOM   5128  N  N     . VAL G  3 87  ? -34.227 -36.778 44.737 1.00 44.21  ? 87   VAL G N     1 
ATOM   5129  C  CA    . VAL G  3 87  ? -32.900 -36.190 44.741 1.00 43.83  ? 87   VAL G CA    1 
ATOM   5130  C  C     . VAL G  3 87  ? -32.270 -36.181 46.136 1.00 43.63  ? 87   VAL G C     1 
ATOM   5131  O  O     . VAL G  3 87  ? -31.124 -36.582 46.297 1.00 43.51  ? 87   VAL G O     1 
ATOM   5132  C  CB    . VAL G  3 87  ? -32.909 -34.785 44.053 1.00 43.67  ? 87   VAL G CB    1 
ATOM   5133  C  CG1   . VAL G  3 87  ? -31.669 -33.992 44.394 1.00 44.43  ? 87   VAL G CG1   1 
ATOM   5134  C  CG2   . VAL G  3 87  ? -32.987 -34.943 42.544 1.00 42.99  ? 87   VAL G CG2   1 
ATOM   5135  N  N     . ARG G  3 88  ? -33.004 -35.759 47.150 1.00 43.69  ? 88   ARG G N     1 
ATOM   5136  C  CA    . ARG G  3 88  ? -32.363 -35.614 48.450 1.00 44.48  ? 88   ARG G CA    1 
ATOM   5137  C  C     . ARG G  3 88  ? -32.047 -36.949 49.131 1.00 45.18  ? 88   ARG G C     1 
ATOM   5138  O  O     . ARG G  3 88  ? -31.167 -37.034 49.984 1.00 45.27  ? 88   ARG G O     1 
ATOM   5139  C  CB    . ARG G  3 88  ? -33.157 -34.687 49.366 1.00 44.11  ? 88   ARG G CB    1 
ATOM   5140  C  CG    . ARG G  3 88  ? -33.362 -33.279 48.828 1.00 43.62  ? 88   ARG G CG    1 
ATOM   5141  C  CD    . ARG G  3 88  ? -32.059 -32.606 48.391 1.00 43.71  ? 88   ARG G CD    1 
ATOM   5142  N  NE    . ARG G  3 88  ? -32.297 -31.476 47.486 1.00 43.63  ? 88   ARG G NE    1 
ATOM   5143  C  CZ    . ARG G  3 88  ? -31.420 -31.030 46.588 1.00 43.32  ? 88   ARG G CZ    1 
ATOM   5144  N  NH1   . ARG G  3 88  ? -30.235 -31.609 46.463 1.00 43.17  ? 88   ARG G NH1   1 
ATOM   5145  N  NH2   . ARG G  3 88  ? -31.731 -30.011 45.801 1.00 43.46  ? 88   ARG G NH2   1 
ATOM   5146  N  N     . ASN G  3 89  ? -32.746 -37.998 48.723 1.00 45.91  ? 89   ASN G N     1 
ATOM   5147  C  CA    . ASN G  3 89  ? -32.548 -39.303 49.320 1.00 46.57  ? 89   ASN G CA    1 
ATOM   5148  C  C     . ASN G  3 89  ? -31.477 -40.080 48.630 1.00 47.24  ? 89   ASN G C     1 
ATOM   5149  O  O     . ASN G  3 89  ? -31.230 -41.231 48.987 1.00 47.66  ? 89   ASN G O     1 
ATOM   5150  C  CB    . ASN G  3 89  ? -33.836 -40.109 49.294 1.00 46.25  ? 89   ASN G CB    1 
ATOM   5151  C  CG    . ASN G  3 89  ? -34.765 -39.710 50.384 1.00 46.67  ? 89   ASN G CG    1 
ATOM   5152  O  OD1   . ASN G  3 89  ? -34.334 -39.444 51.511 1.00 47.09  ? 89   ASN G OD1   1 
ATOM   5153  N  ND2   . ASN G  3 89  ? -36.056 -39.645 50.068 1.00 47.07  ? 89   ASN G ND2   1 
ATOM   5154  N  N     . ASP G  3 90  ? -30.856 -39.466 47.631 1.00 48.05  ? 90   ASP G N     1 
ATOM   5155  C  CA    . ASP G  3 90  ? -29.830 -40.136 46.847 1.00 48.94  ? 90   ASP G CA    1 
ATOM   5156  C  C     . ASP G  3 90  ? -28.539 -39.374 46.988 1.00 49.07  ? 90   ASP G C     1 
ATOM   5157  O  O     . ASP G  3 90  ? -28.446 -38.219 46.577 1.00 49.24  ? 90   ASP G O     1 
ATOM   5158  C  CB    . ASP G  3 90  ? -30.223 -40.222 45.375 1.00 49.29  ? 90   ASP G CB    1 
ATOM   5159  C  CG    . ASP G  3 90  ? -29.220 -40.993 44.571 1.00 51.08  ? 90   ASP G CG    1 
ATOM   5160  O  OD1   . ASP G  3 90  ? -29.296 -42.236 44.553 1.00 53.68  ? 90   ASP G OD1   1 
ATOM   5161  O  OD2   . ASP G  3 90  ? -28.333 -40.360 43.976 1.00 53.97  ? 90   ASP G OD2   1 
ATOM   5162  N  N     . GLU G  3 91  ? -27.540 -40.023 47.569 1.00 49.31  ? 91   GLU G N     1 
ATOM   5163  C  CA    . GLU G  3 91  ? -26.317 -39.331 47.915 1.00 49.73  ? 91   GLU G CA    1 
ATOM   5164  C  C     . GLU G  3 91  ? -25.774 -38.591 46.715 1.00 48.97  ? 91   GLU G C     1 
ATOM   5165  O  O     . GLU G  3 91  ? -25.520 -37.387 46.798 1.00 49.48  ? 91   GLU G O     1 
ATOM   5166  C  CB    . GLU G  3 91  ? -25.269 -40.283 48.472 1.00 50.29  ? 91   GLU G CB    1 
ATOM   5167  C  CG    . GLU G  3 91  ? -23.979 -39.575 48.858 1.00 54.51  ? 91   GLU G CG    1 
ATOM   5168  C  CD    . GLU G  3 91  ? -22.963 -40.515 49.482 1.00 60.45  ? 91   GLU G CD    1 
ATOM   5169  O  OE1   . GLU G  3 91  ? -22.628 -41.538 48.838 1.00 62.68  ? 91   GLU G OE1   1 
ATOM   5170  O  OE2   . GLU G  3 91  ? -22.502 -40.236 50.621 1.00 63.07  ? 91   GLU G OE2   1 
ATOM   5171  N  N     . GLU G  3 92  ? -25.636 -39.296 45.596 1.00 48.02  ? 92   GLU G N     1 
ATOM   5172  C  CA    . GLU G  3 92  ? -24.995 -38.722 44.420 1.00 47.07  ? 92   GLU G CA    1 
ATOM   5173  C  C     . GLU G  3 92  ? -25.807 -37.642 43.698 1.00 45.88  ? 92   GLU G C     1 
ATOM   5174  O  O     . GLU G  3 92  ? -25.295 -36.563 43.421 1.00 45.66  ? 92   GLU G O     1 
ATOM   5175  C  CB    . GLU G  3 92  ? -24.527 -39.816 43.478 1.00 47.49  ? 92   GLU G CB    1 
ATOM   5176  C  CG    . GLU G  3 92  ? -23.276 -40.519 43.988 1.00 49.18  ? 92   GLU G CG    1 
ATOM   5177  C  CD    . GLU G  3 92  ? -22.672 -41.484 42.976 1.00 52.03  ? 92   GLU G CD    1 
ATOM   5178  O  OE1   . GLU G  3 92  ? -23.349 -41.841 41.976 1.00 53.48  ? 92   GLU G OE1   1 
ATOM   5179  O  OE2   . GLU G  3 92  ? -21.511 -41.897 43.192 1.00 52.82  ? 92   GLU G OE2   1 
ATOM   5180  N  N     . LEU G  3 93  ? -27.074 -37.919 43.425 1.00 44.74  ? 93   LEU G N     1 
ATOM   5181  C  CA    . LEU G  3 93  ? -27.939 -36.914 42.825 1.00 44.00  ? 93   LEU G CA    1 
ATOM   5182  C  C     . LEU G  3 93  ? -28.030 -35.660 43.699 1.00 43.59  ? 93   LEU G C     1 
ATOM   5183  O  O     . LEU G  3 93  ? -28.110 -34.544 43.192 1.00 43.59  ? 93   LEU G O     1 
ATOM   5184  C  CB    . LEU G  3 93  ? -29.340 -37.474 42.546 1.00 43.82  ? 93   LEU G CB    1 
ATOM   5185  C  CG    . LEU G  3 93  ? -29.645 -38.253 41.254 1.00 43.39  ? 93   LEU G CG    1 
ATOM   5186  C  CD1   . LEU G  3 93  ? -31.107 -38.694 41.236 1.00 43.21  ? 93   LEU G CD1   1 
ATOM   5187  C  CD2   . LEU G  3 93  ? -29.318 -37.488 39.982 1.00 40.91  ? 93   LEU G CD2   1 
ATOM   5188  N  N     . ASN G  3 94  ? -28.010 -35.852 45.012 1.00 42.99  ? 94   ASN G N     1 
ATOM   5189  C  CA    . ASN G  3 94  ? -28.097 -34.741 45.938 1.00 42.49  ? 94   ASN G CA    1 
ATOM   5190  C  C     . ASN G  3 94  ? -26.842 -33.876 45.883 1.00 42.25  ? 94   ASN G C     1 
ATOM   5191  O  O     . ASN G  3 94  ? -26.905 -32.654 46.023 1.00 41.75  ? 94   ASN G O     1 
ATOM   5192  C  CB    . ASN G  3 94  ? -28.343 -35.251 47.353 1.00 42.36  ? 94   ASN G CB    1 
ATOM   5193  C  CG    . ASN G  3 94  ? -28.119 -34.183 48.397 1.00 42.69  ? 94   ASN G CG    1 
ATOM   5194  O  OD1   . ASN G  3 94  ? -28.892 -33.225 48.512 1.00 42.76  ? 94   ASN G OD1   1 
ATOM   5195  N  ND2   . ASN G  3 94  ? -27.046 -34.334 49.162 1.00 42.28  ? 94   ASN G ND2   1 
ATOM   5196  N  N     . LYS G  3 95  ? -25.701 -34.519 45.674 1.00 42.21  ? 95   LYS G N     1 
ATOM   5197  C  CA    . LYS G  3 95  ? -24.454 -33.798 45.495 1.00 42.28  ? 95   LYS G CA    1 
ATOM   5198  C  C     . LYS G  3 95  ? -24.480 -33.005 44.190 1.00 41.57  ? 95   LYS G C     1 
ATOM   5199  O  O     . LYS G  3 95  ? -24.117 -31.837 44.154 1.00 41.50  ? 95   LYS G O     1 
ATOM   5200  C  CB    . LYS G  3 95  ? -23.286 -34.765 45.504 1.00 42.48  ? 95   LYS G CB    1 
ATOM   5201  C  CG    . LYS G  3 95  ? -21.929 -34.099 45.355 1.00 45.04  ? 95   LYS G CG    1 
ATOM   5202  C  CD    . LYS G  3 95  ? -20.843 -35.120 45.671 1.00 49.66  ? 95   LYS G CD    1 
ATOM   5203  C  CE    . LYS G  3 95  ? -19.470 -34.599 45.338 1.00 52.27  ? 95   LYS G CE    1 
ATOM   5204  N  NZ    . LYS G  3 95  ? -18.526 -35.750 45.231 1.00 54.97  ? 95   LYS G NZ    1 
ATOM   5205  N  N     . LEU G  3 96  ? -24.929 -33.640 43.121 1.00 40.80  ? 96   LEU G N     1 
ATOM   5206  C  CA    . LEU G  3 96  ? -24.978 -32.970 41.844 1.00 40.09  ? 96   LEU G CA    1 
ATOM   5207  C  C     . LEU G  3 96  ? -25.896 -31.753 41.876 1.00 39.52  ? 96   LEU G C     1 
ATOM   5208  O  O     . LEU G  3 96  ? -25.633 -30.761 41.212 1.00 40.02  ? 96   LEU G O     1 
ATOM   5209  C  CB    . LEU G  3 96  ? -25.418 -33.939 40.753 1.00 40.17  ? 96   LEU G CB    1 
ATOM   5210  C  CG    . LEU G  3 96  ? -25.482 -33.376 39.333 1.00 40.08  ? 96   LEU G CG    1 
ATOM   5211  C  CD1   . LEU G  3 96  ? -24.101 -33.137 38.769 1.00 39.66  ? 96   LEU G CD1   1 
ATOM   5212  C  CD2   . LEU G  3 96  ? -26.262 -34.326 38.471 1.00 40.25  ? 96   LEU G CD2   1 
ATOM   5213  N  N     . LEU G  3 97  ? -26.975 -31.829 42.634 1.00 38.50  ? 97   LEU G N     1 
ATOM   5214  C  CA    . LEU G  3 97  ? -27.922 -30.727 42.676 1.00 38.03  ? 97   LEU G CA    1 
ATOM   5215  C  C     . LEU G  3 97  ? -27.851 -30.034 44.040 1.00 37.97  ? 97   LEU G C     1 
ATOM   5216  O  O     . LEU G  3 97  ? -28.862 -29.583 44.608 1.00 37.59  ? 97   LEU G O     1 
ATOM   5217  C  CB    . LEU G  3 97  ? -29.336 -31.213 42.319 1.00 37.75  ? 97   LEU G CB    1 
ATOM   5218  C  CG    . LEU G  3 97  ? -29.496 -31.925 40.961 1.00 37.58  ? 97   LEU G CG    1 
ATOM   5219  C  CD1   . LEU G  3 97  ? -30.945 -32.094 40.584 1.00 37.35  ? 97   LEU G CD1   1 
ATOM   5220  C  CD2   . LEU G  3 97  ? -28.793 -31.217 39.833 1.00 37.80  ? 97   LEU G CD2   1 
ATOM   5221  N  N     . GLY G  3 98  ? -26.626 -29.947 44.542 1.00 37.70  ? 98   GLY G N     1 
ATOM   5222  C  CA    . GLY G  3 98  ? -26.369 -29.479 45.889 1.00 37.62  ? 98   GLY G CA    1 
ATOM   5223  C  C     . GLY G  3 98  ? -26.522 -27.992 46.071 1.00 37.71  ? 98   GLY G C     1 
ATOM   5224  O  O     . GLY G  3 98  ? -26.697 -27.518 47.186 1.00 37.43  ? 98   GLY G O     1 
ATOM   5225  N  N     . ARG G  3 99  ? -26.435 -27.250 44.975 1.00 38.24  ? 99   ARG G N     1 
ATOM   5226  C  CA    . ARG G  3 99  ? -26.659 -25.805 45.017 1.00 38.56  ? 99   ARG G CA    1 
ATOM   5227  C  C     . ARG G  3 99  ? -27.908 -25.450 44.198 1.00 38.09  ? 99   ARG G C     1 
ATOM   5228  O  O     . ARG G  3 99  ? -28.098 -24.308 43.799 1.00 38.33  ? 99   ARG G O     1 
ATOM   5229  C  CB    . ARG G  3 99  ? -25.407 -25.033 44.555 1.00 38.58  ? 99   ARG G CB    1 
ATOM   5230  C  CG    . ARG G  3 99  ? -24.145 -25.310 45.388 1.00 40.91  ? 99   ARG G CG    1 
ATOM   5231  C  CD    . ARG G  3 99  ? -24.223 -24.711 46.803 1.00 47.14  ? 99   ARG G CD    1 
ATOM   5232  N  NE    . ARG G  3 99  ? -24.100 -23.240 46.765 1.00 53.40  ? 99   ARG G NE    1 
ATOM   5233  C  CZ    . ARG G  3 99  ? -24.816 -22.361 47.491 1.00 54.66  ? 99   ARG G CZ    1 
ATOM   5234  N  NH1   . ARG G  3 99  ? -25.752 -22.751 48.359 1.00 55.57  ? 99   ARG G NH1   1 
ATOM   5235  N  NH2   . ARG G  3 99  ? -24.595 -21.062 47.332 1.00 55.40  ? 99   ARG G NH2   1 
ATOM   5236  N  N     . VAL G  3 100 ? -28.765 -26.443 43.982 1.00 37.58  ? 100  VAL G N     1 
ATOM   5237  C  CA    . VAL G  3 100 ? -29.990 -26.263 43.221 1.00 37.44  ? 100  VAL G CA    1 
ATOM   5238  C  C     . VAL G  3 100 ? -31.231 -26.362 44.102 1.00 37.62  ? 100  VAL G C     1 
ATOM   5239  O  O     . VAL G  3 100 ? -31.271 -27.148 45.037 1.00 37.47  ? 100  VAL G O     1 
ATOM   5240  C  CB    . VAL G  3 100 ? -30.087 -27.306 42.112 1.00 37.28  ? 100  VAL G CB    1 
ATOM   5241  C  CG1   . VAL G  3 100 ? -31.419 -27.237 41.433 1.00 36.76  ? 100  VAL G CG1   1 
ATOM   5242  C  CG2   . VAL G  3 100 ? -28.982 -27.111 41.121 1.00 37.45  ? 100  VAL G CG2   1 
ATOM   5243  N  N     . THR G  3 101 ? -32.243 -25.567 43.787 1.00 38.04  ? 101  THR G N     1 
ATOM   5244  C  CA    . THR G  3 101 ? -33.475 -25.559 44.545 1.00 38.92  ? 101  THR G CA    1 
ATOM   5245  C  C     . THR G  3 101 ? -34.604 -25.945 43.634 1.00 39.45  ? 101  THR G C     1 
ATOM   5246  O  O     . THR G  3 101 ? -34.820 -25.314 42.612 1.00 39.50  ? 101  THR G O     1 
ATOM   5247  C  CB    . THR G  3 101 ? -33.763 -24.167 45.141 1.00 39.08  ? 101  THR G CB    1 
ATOM   5248  O  OG1   . THR G  3 101 ? -32.809 -23.890 46.168 1.00 39.93  ? 101  THR G OG1   1 
ATOM   5249  C  CG2   . THR G  3 101 ? -35.143 -24.111 45.751 1.00 38.49  ? 101  THR G CG2   1 
ATOM   5250  N  N     . ILE G  3 102 ? -35.312 -26.999 44.013 1.00 40.40  ? 102  ILE G N     1 
ATOM   5251  C  CA    . ILE G  3 102 ? -36.457 -27.492 43.265 1.00 41.03  ? 102  ILE G CA    1 
ATOM   5252  C  C     . ILE G  3 102 ? -37.675 -26.781 43.825 1.00 42.22  ? 102  ILE G C     1 
ATOM   5253  O  O     . ILE G  3 102 ? -37.987 -26.897 45.010 1.00 42.40  ? 102  ILE G O     1 
ATOM   5254  C  CB    . ILE G  3 102 ? -36.599 -29.015 43.434 1.00 40.47  ? 102  ILE G CB    1 
ATOM   5255  C  CG1   . ILE G  3 102 ? -35.463 -29.716 42.721 1.00 40.29  ? 102  ILE G CG1   1 
ATOM   5256  C  CG2   . ILE G  3 102 ? -37.882 -29.506 42.867 1.00 40.17  ? 102  ILE G CG2   1 
ATOM   5257  C  CD1   . ILE G  3 102 ? -35.403 -31.160 42.980 1.00 40.63  ? 102  ILE G CD1   1 
ATOM   5258  N  N     . ALA G  3 103 ? -38.365 -26.022 42.987 1.00 43.66  ? 103  ALA G N     1 
ATOM   5259  C  CA    . ALA G  3 103 ? -39.512 -25.291 43.488 1.00 45.01  ? 103  ALA G CA    1 
ATOM   5260  C  C     . ALA G  3 103 ? -40.584 -26.265 43.950 1.00 45.97  ? 103  ALA G C     1 
ATOM   5261  O  O     . ALA G  3 103 ? -40.781 -27.335 43.357 1.00 45.72  ? 103  ALA G O     1 
ATOM   5262  C  CB    . ALA G  3 103 ? -40.053 -24.339 42.449 1.00 45.15  ? 103  ALA G CB    1 
ATOM   5263  N  N     . GLN G  3 104 ? -41.251 -25.886 45.035 1.00 47.22  ? 104  GLN G N     1 
ATOM   5264  C  CA    . GLN G  3 104 ? -42.340 -26.665 45.608 1.00 48.26  ? 104  GLN G CA    1 
ATOM   5265  C  C     . GLN G  3 104 ? -41.878 -28.060 45.943 1.00 48.09  ? 104  GLN G C     1 
ATOM   5266  O  O     . GLN G  3 104 ? -42.593 -29.021 45.704 1.00 48.74  ? 104  GLN G O     1 
ATOM   5267  C  CB    . GLN G  3 104 ? -43.553 -26.701 44.663 1.00 48.57  ? 104  GLN G CB    1 
ATOM   5268  C  CG    . GLN G  3 104 ? -44.422 -25.451 44.755 1.00 51.94  ? 104  GLN G CG    1 
ATOM   5269  C  CD    . GLN G  3 104 ? -45.185 -25.355 46.089 1.00 55.96  ? 104  GLN G CD    1 
ATOM   5270  O  OE1   . GLN G  3 104 ? -45.997 -26.230 46.408 1.00 56.99  ? 104  GLN G OE1   1 
ATOM   5271  N  NE2   . GLN G  3 104 ? -44.925 -24.290 46.866 1.00 56.59  ? 104  GLN G NE2   1 
ATOM   5272  N  N     . GLY G  3 105 ? -40.676 -28.168 46.492 1.00 47.87  ? 105  GLY G N     1 
ATOM   5273  C  CA    . GLY G  3 105 ? -40.134 -29.470 46.844 1.00 47.71  ? 105  GLY G CA    1 
ATOM   5274  C  C     . GLY G  3 105 ? -40.224 -29.781 48.329 1.00 47.65  ? 105  GLY G C     1 
ATOM   5275  O  O     . GLY G  3 105 ? -40.118 -30.943 48.734 1.00 47.90  ? 105  GLY G O     1 
ATOM   5276  N  N     . GLY G  3 106 ? -40.419 -28.754 49.152 1.00 47.08  ? 106  GLY G N     1 
ATOM   5277  C  CA    . GLY G  3 106 ? -40.332 -28.936 50.587 1.00 46.55  ? 106  GLY G CA    1 
ATOM   5278  C  C     . GLY G  3 106 ? -38.993 -29.554 50.930 1.00 46.54  ? 106  GLY G C     1 
ATOM   5279  O  O     . GLY G  3 106 ? -38.071 -29.535 50.123 1.00 45.92  ? 106  GLY G O     1 
ATOM   5280  N  N     . VAL G  3 107 ? -38.902 -30.113 52.132 1.00 47.05  ? 107  VAL G N     1 
ATOM   5281  C  CA    . VAL G  3 107 ? -37.663 -30.687 52.659 1.00 47.24  ? 107  VAL G CA    1 
ATOM   5282  C  C     . VAL G  3 107 ? -37.964 -32.103 53.147 1.00 48.10  ? 107  VAL G C     1 
ATOM   5283  O  O     . VAL G  3 107 ? -39.135 -32.412 53.386 1.00 48.30  ? 107  VAL G O     1 
ATOM   5284  C  CB    . VAL G  3 107 ? -37.104 -29.837 53.814 1.00 46.84  ? 107  VAL G CB    1 
ATOM   5285  C  CG1   . VAL G  3 107 ? -36.913 -28.408 53.371 1.00 46.20  ? 107  VAL G CG1   1 
ATOM   5286  C  CG2   . VAL G  3 107 ? -38.033 -29.868 54.999 1.00 46.06  ? 107  VAL G CG2   1 
ATOM   5287  N  N     . LEU G  3 108 ? -36.935 -32.960 53.264 1.00 48.87  ? 108  LEU G N     1 
ATOM   5288  C  CA    . LEU G  3 108 ? -37.094 -34.297 53.866 1.00 49.54  ? 108  LEU G CA    1 
ATOM   5289  C  C     . LEU G  3 108 ? -37.433 -34.170 55.352 1.00 50.77  ? 108  LEU G C     1 
ATOM   5290  O  O     . LEU G  3 108 ? -36.878 -33.301 56.043 1.00 50.95  ? 108  LEU G O     1 
ATOM   5291  C  CB    . LEU G  3 108 ? -35.825 -35.129 53.761 1.00 48.99  ? 108  LEU G CB    1 
ATOM   5292  C  CG    . LEU G  3 108 ? -35.093 -35.370 52.453 1.00 49.02  ? 108  LEU G CG    1 
ATOM   5293  C  CD1   . LEU G  3 108 ? -33.921 -36.319 52.693 1.00 48.16  ? 108  LEU G CD1   1 
ATOM   5294  C  CD2   . LEU G  3 108 ? -36.007 -35.921 51.370 1.00 49.74  ? 108  LEU G CD2   1 
ATOM   5295  N  N     . PRO G  3 109 ? -38.343 -35.030 55.852 1.00 51.68  ? 109  PRO G N     1 
ATOM   5296  C  CA    . PRO G  3 109 ? -38.646 -35.072 57.274 1.00 52.45  ? 109  PRO G CA    1 
ATOM   5297  C  C     . PRO G  3 109 ? -37.425 -35.500 58.063 1.00 53.14  ? 109  PRO G C     1 
ATOM   5298  O  O     . PRO G  3 109 ? -36.870 -36.566 57.817 1.00 53.32  ? 109  PRO G O     1 
ATOM   5299  C  CB    . PRO G  3 109 ? -39.738 -36.139 57.371 1.00 52.50  ? 109  PRO G CB    1 
ATOM   5300  C  CG    . PRO G  3 109 ? -40.327 -36.193 56.022 1.00 52.25  ? 109  PRO G CG    1 
ATOM   5301  C  CD    . PRO G  3 109 ? -39.161 -35.998 55.109 1.00 51.75  ? 109  PRO G CD    1 
ATOM   5302  N  N     . ASN G  3 110 ? -37.005 -34.644 58.984 1.00 54.09  ? 110  ASN G N     1 
ATOM   5303  C  CA    . ASN G  3 110 ? -35.837 -34.889 59.802 1.00 55.15  ? 110  ASN G CA    1 
ATOM   5304  C  C     . ASN G  3 110 ? -35.846 -33.986 61.013 1.00 55.39  ? 110  ASN G C     1 
ATOM   5305  O  O     . ASN G  3 110 ? -35.723 -32.769 60.896 1.00 55.20  ? 110  ASN G O     1 
ATOM   5306  C  CB    . ASN G  3 110 ? -34.544 -34.672 59.006 1.00 55.54  ? 110  ASN G CB    1 
ATOM   5307  C  CG    . ASN G  3 110 ? -33.307 -35.174 59.746 1.00 57.00  ? 110  ASN G CG    1 
ATOM   5308  O  OD1   . ASN G  3 110 ? -32.213 -34.617 59.597 1.00 58.68  ? 110  ASN G OD1   1 
ATOM   5309  N  ND2   . ASN G  3 110 ? -33.474 -36.233 60.550 1.00 57.61  ? 110  ASN G ND2   1 
ATOM   5310  N  N     . ILE G  3 111 ? -36.006 -34.607 62.174 1.00 56.01  ? 111  ILE G N     1 
ATOM   5311  C  CA    . ILE G  3 111 ? -35.904 -33.921 63.454 1.00 56.65  ? 111  ILE G CA    1 
ATOM   5312  C  C     . ILE G  3 111 ? -34.636 -34.393 64.177 1.00 57.19  ? 111  ILE G C     1 
ATOM   5313  O  O     . ILE G  3 111 ? -34.403 -35.604 64.294 1.00 57.16  ? 111  ILE G O     1 
ATOM   5314  C  CB    . ILE G  3 111 ? -37.155 -34.199 64.325 1.00 56.37  ? 111  ILE G CB    1 
ATOM   5315  C  CG1   . ILE G  3 111 ? -38.426 -33.887 63.525 1.00 56.40  ? 111  ILE G CG1   1 
ATOM   5316  C  CG2   . ILE G  3 111 ? -37.094 -33.416 65.639 1.00 56.16  ? 111  ILE G CG2   1 
ATOM   5317  C  CD1   . ILE G  3 111 ? -39.755 -34.154 64.256 1.00 56.92  ? 111  ILE G CD1   1 
ATOM   5318  N  N     . GLN G  3 112 ? -33.815 -33.449 64.645 1.00 57.80  ? 112  GLN G N     1 
ATOM   5319  C  CA    . GLN G  3 112 ? -32.664 -33.804 65.491 1.00 58.50  ? 112  GLN G CA    1 
ATOM   5320  C  C     . GLN G  3 112 ? -33.122 -34.515 66.763 1.00 58.96  ? 112  GLN G C     1 
ATOM   5321  O  O     . GLN G  3 112 ? -34.107 -34.115 67.403 1.00 58.74  ? 112  GLN G O     1 
ATOM   5322  C  CB    . GLN G  3 112 ? -31.823 -32.584 65.853 1.00 58.33  ? 112  GLN G CB    1 
ATOM   5323  C  CG    . GLN G  3 112 ? -31.348 -31.791 64.671 1.00 58.93  ? 112  GLN G CG    1 
ATOM   5324  C  CD    . GLN G  3 112 ? -30.461 -32.586 63.747 1.00 60.20  ? 112  GLN G CD    1 
ATOM   5325  O  OE1   . GLN G  3 112 ? -29.363 -32.996 64.122 1.00 61.89  ? 112  GLN G OE1   1 
ATOM   5326  N  NE2   . GLN G  3 112 ? -30.929 -32.804 62.521 1.00 60.39  ? 112  GLN G NE2   1 
ATOM   5327  N  N     . SER G  3 113 ? -32.397 -35.570 67.118 1.00 59.72  ? 113  SER G N     1 
ATOM   5328  C  CA    . SER G  3 113 ? -32.803 -36.464 68.200 1.00 60.58  ? 113  SER G CA    1 
ATOM   5329  C  C     . SER G  3 113 ? -32.885 -35.807 69.585 1.00 61.00  ? 113  SER G C     1 
ATOM   5330  O  O     . SER G  3 113 ? -33.701 -36.202 70.413 1.00 61.22  ? 113  SER G O     1 
ATOM   5331  C  CB    . SER G  3 113 ? -31.868 -37.665 68.263 1.00 60.52  ? 113  SER G CB    1 
ATOM   5332  O  OG    . SER G  3 113 ? -30.752 -37.376 69.095 1.00 61.50  ? 113  SER G OG    1 
ATOM   5333  N  N     . VAL G  3 114 ? -32.043 -34.813 69.838 1.00 61.65  ? 114  VAL G N     1 
ATOM   5334  C  CA    . VAL G  3 114 ? -32.053 -34.128 71.129 1.00 62.25  ? 114  VAL G CA    1 
ATOM   5335  C  C     . VAL G  3 114 ? -33.312 -33.259 71.324 1.00 62.82  ? 114  VAL G C     1 
ATOM   5336  O  O     . VAL G  3 114 ? -33.541 -32.713 72.399 1.00 62.84  ? 114  VAL G O     1 
ATOM   5337  C  CB    . VAL G  3 114 ? -30.725 -33.348 71.377 1.00 62.20  ? 114  VAL G CB    1 
ATOM   5338  C  CG1   . VAL G  3 114 ? -30.530 -32.240 70.349 1.00 62.04  ? 114  VAL G CG1   1 
ATOM   5339  C  CG2   . VAL G  3 114 ? -30.655 -32.814 72.825 1.00 62.20  ? 114  VAL G CG2   1 
ATOM   5340  N  N     . LEU G  3 115 ? -34.139 -33.163 70.289 1.00 63.71  ? 115  LEU G N     1 
ATOM   5341  C  CA    . LEU G  3 115 ? -35.411 -32.454 70.392 1.00 64.65  ? 115  LEU G CA    1 
ATOM   5342  C  C     . LEU G  3 115 ? -36.577 -33.402 70.681 1.00 65.66  ? 115  LEU G C     1 
ATOM   5343  O  O     . LEU G  3 115 ? -37.712 -32.951 70.893 1.00 65.77  ? 115  LEU G O     1 
ATOM   5344  C  CB    . LEU G  3 115 ? -35.683 -31.655 69.118 1.00 64.29  ? 115  LEU G CB    1 
ATOM   5345  C  CG    . LEU G  3 115 ? -34.613 -30.639 68.725 1.00 63.85  ? 115  LEU G CG    1 
ATOM   5346  C  CD1   . LEU G  3 115 ? -34.723 -30.320 67.244 1.00 63.89  ? 115  LEU G CD1   1 
ATOM   5347  C  CD2   . LEU G  3 115 ? -34.685 -29.376 69.571 1.00 63.40  ? 115  LEU G CD2   1 
ATOM   5348  N  N     . LEU G  3 116 ? -36.289 -34.707 70.692 1.00 66.81  ? 116  LEU G N     1 
ATOM   5349  C  CA    . LEU G  3 116 ? -37.306 -35.742 70.894 1.00 67.76  ? 116  LEU G CA    1 
ATOM   5350  C  C     . LEU G  3 116 ? -37.678 -35.946 72.361 1.00 68.85  ? 116  LEU G C     1 
ATOM   5351  O  O     . LEU G  3 116 ? -36.795 -36.061 73.217 1.00 68.56  ? 116  LEU G O     1 
ATOM   5352  C  CB    . LEU G  3 116 ? -36.881 -37.064 70.255 1.00 67.44  ? 116  LEU G CB    1 
ATOM   5353  C  CG    . LEU G  3 116 ? -36.856 -37.070 68.723 1.00 67.30  ? 116  LEU G CG    1 
ATOM   5354  C  CD1   . LEU G  3 116 ? -36.378 -38.431 68.192 1.00 67.67  ? 116  LEU G CD1   1 
ATOM   5355  C  CD2   . LEU G  3 116 ? -38.215 -36.682 68.128 1.00 66.13  ? 116  LEU G CD2   1 
ATOM   5356  N  N     . PRO G  3 117 ? -38.998 -35.986 72.646 1.00 70.23  ? 117  PRO G N     1 
ATOM   5357  C  CA    . PRO G  3 117 ? -39.608 -36.114 73.976 1.00 71.39  ? 117  PRO G CA    1 
ATOM   5358  C  C     . PRO G  3 117 ? -38.839 -36.994 74.969 1.00 72.39  ? 117  PRO G C     1 
ATOM   5359  O  O     . PRO G  3 117 ? -38.359 -38.069 74.601 1.00 72.52  ? 117  PRO G O     1 
ATOM   5360  C  CB    . PRO G  3 117 ? -40.980 -36.712 73.658 1.00 71.39  ? 117  PRO G CB    1 
ATOM   5361  C  CG    . PRO G  3 117 ? -41.343 -36.068 72.356 1.00 70.77  ? 117  PRO G CG    1 
ATOM   5362  C  CD    . PRO G  3 117 ? -40.039 -35.888 71.595 1.00 70.36  ? 117  PRO G CD    1 
ATOM   5363  N  N     . LYS G  3 118 ? -38.764 -36.522 76.216 1.00 73.54  ? 118  LYS G N     1 
ATOM   5364  C  CA    . LYS G  3 118 ? -37.906 -37.078 77.282 1.00 74.90  ? 118  LYS G CA    1 
ATOM   5365  C  C     . LYS G  3 118 ? -36.435 -37.180 76.858 1.00 75.04  ? 118  LYS G C     1 
ATOM   5366  O  O     . LYS G  3 118 ? -35.631 -36.280 77.135 1.00 75.40  ? 118  LYS G O     1 
ATOM   5367  C  CB    . LYS G  3 118 ? -38.436 -38.421 77.834 1.00 74.97  ? 118  LYS G CB    1 
ATOM   5368  C  CG    . LYS G  3 118 ? -37.825 -39.697 77.225 1.00 75.90  ? 118  LYS G CG    1 
ATOM   5369  C  CD    . LYS G  3 118 ? -38.662 -40.939 77.569 1.00 76.31  ? 118  LYS G CD    1 
ATOM   5370  C  CE    . LYS G  3 118 ? -37.844 -42.241 77.432 1.00 78.79  ? 118  LYS G CE    1 
ATOM   5371  N  NZ    . LYS G  3 118 ? -37.608 -42.664 76.007 1.00 79.53  ? 118  LYS G NZ    1 
ATOM   5372  N  N     . LYS H  4 27  ? -50.641 -18.673 10.218 1.00 114.56 ? 24   LYS H N     1 
ATOM   5373  C  CA    . LYS H  4 27  ? -50.514 -18.574 11.704 1.00 114.52 ? 24   LYS H CA    1 
ATOM   5374  C  C     . LYS H  4 27  ? -49.045 -18.725 12.128 1.00 114.33 ? 24   LYS H C     1 
ATOM   5375  O  O     . LYS H  4 27  ? -48.592 -19.821 12.497 1.00 114.44 ? 24   LYS H O     1 
ATOM   5376  C  CB    . LYS H  4 27  ? -51.411 -19.621 12.386 1.00 114.70 ? 24   LYS H CB    1 
ATOM   5377  C  CG    . LYS H  4 27  ? -51.729 -19.350 13.866 1.00 114.79 ? 24   LYS H CG    1 
ATOM   5378  C  CD    . LYS H  4 27  ? -52.630 -20.446 14.448 1.00 114.56 ? 24   LYS H CD    1 
ATOM   5379  C  CE    . LYS H  4 27  ? -54.118 -20.203 14.179 1.00 114.19 ? 24   LYS H CE    1 
ATOM   5380  N  NZ    . LYS H  4 27  ? -54.708 -19.173 15.081 1.00 113.81 ? 24   LYS H NZ    1 
ATOM   5381  N  N     . LYS H  4 28  ? -48.311 -17.611 12.068 1.00 113.94 ? 25   LYS H N     1 
ATOM   5382  C  CA    . LYS H  4 28  ? -46.860 -17.603 12.314 1.00 113.39 ? 25   LYS H CA    1 
ATOM   5383  C  C     . LYS H  4 28  ? -46.383 -16.439 13.201 1.00 112.83 ? 25   LYS H C     1 
ATOM   5384  O  O     . LYS H  4 28  ? -45.193 -16.344 13.524 1.00 112.83 ? 25   LYS H O     1 
ATOM   5385  C  CB    . LYS H  4 28  ? -46.085 -17.634 10.973 1.00 113.51 ? 25   LYS H CB    1 
ATOM   5386  C  CG    . LYS H  4 28  ? -46.221 -16.380 10.065 1.00 113.39 ? 25   LYS H CG    1 
ATOM   5387  C  CD    . LYS H  4 28  ? -45.131 -15.321 10.337 1.00 112.88 ? 25   LYS H CD    1 
ATOM   5388  C  CE    . LYS H  4 28  ? -43.819 -15.646 9.617  1.00 112.54 ? 25   LYS H CE    1 
ATOM   5389  N  NZ    . LYS H  4 28  ? -42.617 -15.230 10.400 1.00 112.15 ? 25   LYS H NZ    1 
ATOM   5390  N  N     . ARG H  4 29  ? -47.319 -15.573 13.592 1.00 111.98 ? 26   ARG H N     1 
ATOM   5391  C  CA    . ARG H  4 29  ? -47.006 -14.314 14.270 1.00 111.14 ? 26   ARG H CA    1 
ATOM   5392  C  C     . ARG H  4 29  ? -46.482 -14.507 15.702 1.00 110.41 ? 26   ARG H C     1 
ATOM   5393  O  O     . ARG H  4 29  ? -45.272 -14.659 15.906 1.00 110.23 ? 26   ARG H O     1 
ATOM   5394  C  CB    . ARG H  4 29  ? -48.228 -13.387 14.237 1.00 111.15 ? 26   ARG H CB    1 
ATOM   5395  C  CG    . ARG H  4 29  ? -47.942 -11.921 14.546 1.00 111.25 ? 26   ARG H CG    1 
ATOM   5396  C  CD    . ARG H  4 29  ? -49.239 -11.124 14.606 1.00 111.44 ? 26   ARG H CD    1 
ATOM   5397  N  NE    . ARG H  4 29  ? -50.254 -11.815 15.405 1.00 112.46 ? 26   ARG H NE    1 
ATOM   5398  C  CZ    . ARG H  4 29  ? -51.358 -11.250 15.891 1.00 112.48 ? 26   ARG H CZ    1 
ATOM   5399  N  NH1   . ARG H  4 29  ? -51.612 -9.965  15.675 1.00 112.60 ? 26   ARG H NH1   1 
ATOM   5400  N  NH2   . ARG H  4 29  ? -52.211 -11.975 16.604 1.00 111.95 ? 26   ARG H NH2   1 
ATOM   5401  N  N     . ARG H  4 30  ? -47.396 -14.522 16.677 1.00 109.51 ? 27   ARG H N     1 
ATOM   5402  C  CA    . ARG H  4 30  ? -47.057 -14.626 18.112 1.00 108.46 ? 27   ARG H CA    1 
ATOM   5403  C  C     . ARG H  4 30  ? -46.459 -16.002 18.466 1.00 107.10 ? 27   ARG H C     1 
ATOM   5404  O  O     . ARG H  4 30  ? -46.344 -16.386 19.638 1.00 107.10 ? 27   ARG H O     1 
ATOM   5405  C  CB    . ARG H  4 30  ? -48.288 -14.299 18.988 1.00 108.85 ? 27   ARG H CB    1 
ATOM   5406  C  CG    . ARG H  4 30  ? -49.109 -13.061 18.553 1.00 110.38 ? 27   ARG H CG    1 
ATOM   5407  C  CD    . ARG H  4 30  ? -48.381 -11.730 18.825 1.00 113.14 ? 27   ARG H CD    1 
ATOM   5408  N  NE    . ARG H  4 30  ? -48.773 -10.675 17.882 1.00 114.82 ? 27   ARG H NE    1 
ATOM   5409  C  CZ    . ARG H  4 30  ? -48.202 -9.472  17.792 1.00 115.60 ? 27   ARG H CZ    1 
ATOM   5410  N  NH1   . ARG H  4 30  ? -47.196 -9.136  18.596 1.00 115.88 ? 27   ARG H NH1   1 
ATOM   5411  N  NH2   . ARG H  4 30  ? -48.640 -8.597  16.891 1.00 115.67 ? 27   ARG H NH2   1 
ATOM   5412  N  N     . LYS H  4 31  ? -46.057 -16.719 17.425 1.00 105.23 ? 28   LYS H N     1 
ATOM   5413  C  CA    . LYS H  4 31  ? -45.619 -18.099 17.523 1.00 103.39 ? 28   LYS H CA    1 
ATOM   5414  C  C     . LYS H  4 31  ? -44.233 -18.236 18.180 1.00 101.44 ? 28   LYS H C     1 
ATOM   5415  O  O     . LYS H  4 31  ? -43.993 -19.219 18.897 1.00 101.49 ? 28   LYS H O     1 
ATOM   5416  C  CB    . LYS H  4 31  ? -45.674 -18.730 16.113 1.00 103.69 ? 28   LYS H CB    1 
ATOM   5417  C  CG    . LYS H  4 31  ? -45.078 -20.135 15.933 1.00 103.93 ? 28   LYS H CG    1 
ATOM   5418  C  CD    . LYS H  4 31  ? -44.925 -20.480 14.438 1.00 103.92 ? 28   LYS H CD    1 
ATOM   5419  C  CE    . LYS H  4 31  ? -43.961 -19.524 13.691 1.00 104.70 ? 28   LYS H CE    1 
ATOM   5420  N  NZ    . LYS H  4 31  ? -42.517 -19.633 14.103 1.00 105.06 ? 28   LYS H NZ    1 
ATOM   5421  N  N     . THR H  4 32  ? -43.357 -17.243 17.968 1.00 98.75  ? 29   THR H N     1 
ATOM   5422  C  CA    . THR H  4 32  ? -41.920 -17.360 18.289 1.00 96.05  ? 29   THR H CA    1 
ATOM   5423  C  C     . THR H  4 32  ? -41.616 -18.564 19.167 1.00 94.28  ? 29   THR H C     1 
ATOM   5424  O  O     . THR H  4 32  ? -41.757 -18.515 20.390 1.00 93.95  ? 29   THR H O     1 
ATOM   5425  C  CB    . THR H  4 32  ? -41.344 -16.082 18.907 1.00 96.01  ? 29   THR H CB    1 
ATOM   5426  O  OG1   . THR H  4 32  ? -41.692 -14.971 18.081 1.00 96.07  ? 29   THR H OG1   1 
ATOM   5427  C  CG2   . THR H  4 32  ? -39.828 -16.161 18.992 1.00 95.41  ? 29   THR H CG2   1 
ATOM   5428  N  N     . ARG H  4 33  ? -41.207 -19.643 18.505 1.00 92.03  ? 30   ARG H N     1 
ATOM   5429  C  CA    . ARG H  4 33  ? -41.083 -20.960 19.109 1.00 89.93  ? 30   ARG H CA    1 
ATOM   5430  C  C     . ARG H  4 33  ? -40.403 -20.954 20.473 1.00 88.14  ? 30   ARG H C     1 
ATOM   5431  O  O     . ARG H  4 33  ? -39.303 -20.413 20.621 1.00 88.20  ? 30   ARG H O     1 
ATOM   5432  C  CB    . ARG H  4 33  ? -40.323 -21.884 18.159 1.00 90.19  ? 30   ARG H CB    1 
ATOM   5433  C  CG    . ARG H  4 33  ? -41.146 -22.382 16.991 1.00 91.14  ? 30   ARG H CG    1 
ATOM   5434  C  CD    . ARG H  4 33  ? -40.270 -23.033 15.931 1.00 93.25  ? 30   ARG H CD    1 
ATOM   5435  N  NE    . ARG H  4 33  ? -39.430 -24.115 16.457 1.00 95.22  ? 30   ARG H NE    1 
ATOM   5436  C  CZ    . ARG H  4 33  ? -39.828 -25.381 16.621 1.00 96.31  ? 30   ARG H CZ    1 
ATOM   5437  N  NH1   . ARG H  4 33  ? -41.073 -25.749 16.310 1.00 97.18  ? 30   ARG H NH1   1 
ATOM   5438  N  NH2   . ARG H  4 33  ? -38.980 -26.287 17.106 1.00 95.97  ? 30   ARG H NH2   1 
ATOM   5439  N  N     . LYS H  4 34  ? -41.065 -21.550 21.464 1.00 85.56  ? 31   LYS H N     1 
ATOM   5440  C  CA    . LYS H  4 34  ? -40.448 -21.780 22.766 1.00 83.00  ? 31   LYS H CA    1 
ATOM   5441  C  C     . LYS H  4 34  ? -40.164 -23.268 22.958 1.00 80.79  ? 31   LYS H C     1 
ATOM   5442  O  O     . LYS H  4 34  ? -40.968 -23.986 23.541 1.00 80.50  ? 31   LYS H O     1 
ATOM   5443  C  CB    . LYS H  4 34  ? -41.340 -21.250 23.892 1.00 83.32  ? 31   LYS H CB    1 
ATOM   5444  C  CG    . LYS H  4 34  ? -40.602 -21.011 25.206 1.00 84.47  ? 31   LYS H CG    1 
ATOM   5445  C  CD    . LYS H  4 34  ? -39.992 -19.605 25.239 1.00 86.42  ? 31   LYS H CD    1 
ATOM   5446  C  CE    . LYS H  4 34  ? -39.007 -19.432 26.385 1.00 86.89  ? 31   LYS H CE    1 
ATOM   5447  N  NZ    . LYS H  4 34  ? -37.652 -19.970 26.028 1.00 88.14  ? 31   LYS H NZ    1 
ATOM   5448  N  N     . GLU H  4 35  ? -39.022 -23.731 22.463 1.00 78.11  ? 32   GLU H N     1 
ATOM   5449  C  CA    . GLU H  4 35  ? -38.684 -25.147 22.560 1.00 75.67  ? 32   GLU H CA    1 
ATOM   5450  C  C     . GLU H  4 35  ? -38.237 -25.551 23.963 1.00 73.63  ? 32   GLU H C     1 
ATOM   5451  O  O     . GLU H  4 35  ? -37.732 -24.728 24.725 1.00 73.50  ? 32   GLU H O     1 
ATOM   5452  C  CB    . GLU H  4 35  ? -37.641 -25.544 21.516 1.00 75.70  ? 32   GLU H CB    1 
ATOM   5453  C  CG    . GLU H  4 35  ? -36.256 -24.966 21.727 1.00 75.91  ? 32   GLU H CG    1 
ATOM   5454  C  CD    . GLU H  4 35  ? -35.328 -25.225 20.544 1.00 76.31  ? 32   GLU H CD    1 
ATOM   5455  O  OE1   . GLU H  4 35  ? -35.755 -25.897 19.571 1.00 76.47  ? 32   GLU H OE1   1 
ATOM   5456  O  OE2   . GLU H  4 35  ? -34.166 -24.754 20.587 1.00 76.94  ? 32   GLU H OE2   1 
ATOM   5457  N  N     . SER H  4 36  ? -38.454 -26.823 24.291 1.00 71.04  ? 33   SER H N     1 
ATOM   5458  C  CA    . SER H  4 36  ? -38.093 -27.389 25.580 1.00 68.55  ? 33   SER H CA    1 
ATOM   5459  C  C     . SER H  4 36  ? -37.794 -28.876 25.403 1.00 67.14  ? 33   SER H C     1 
ATOM   5460  O  O     . SER H  4 36  ? -38.076 -29.438 24.350 1.00 66.85  ? 33   SER H O     1 
ATOM   5461  C  CB    . SER H  4 36  ? -39.221 -27.186 26.593 1.00 68.42  ? 33   SER H CB    1 
ATOM   5462  O  OG    . SER H  4 36  ? -40.050 -28.324 26.666 1.00 67.12  ? 33   SER H OG    1 
ATOM   5463  N  N     . TYR H  4 37  ? -37.221 -29.507 26.428 1.00 65.37  ? 34   TYR H N     1 
ATOM   5464  C  CA    . TYR H  4 37  ? -36.897 -30.926 26.370 1.00 63.72  ? 34   TYR H CA    1 
ATOM   5465  C  C     . TYR H  4 37  ? -38.101 -31.785 26.724 1.00 63.23  ? 34   TYR H C     1 
ATOM   5466  O  O     . TYR H  4 37  ? -38.017 -33.015 26.702 1.00 62.83  ? 34   TYR H O     1 
ATOM   5467  C  CB    . TYR H  4 37  ? -35.727 -31.258 27.290 1.00 63.12  ? 34   TYR H CB    1 
ATOM   5468  C  CG    . TYR H  4 37  ? -34.389 -30.738 26.813 1.00 62.65  ? 34   TYR H CG    1 
ATOM   5469  C  CD1   . TYR H  4 37  ? -33.852 -29.563 27.332 1.00 62.65  ? 34   TYR H CD1   1 
ATOM   5470  C  CD2   . TYR H  4 37  ? -33.649 -31.425 25.851 1.00 61.78  ? 34   TYR H CD2   1 
ATOM   5471  C  CE1   . TYR H  4 37  ? -32.613 -29.082 26.898 1.00 62.08  ? 34   TYR H CE1   1 
ATOM   5472  C  CE2   . TYR H  4 37  ? -32.413 -30.950 25.410 1.00 61.01  ? 34   TYR H CE2   1 
ATOM   5473  C  CZ    . TYR H  4 37  ? -31.907 -29.781 25.938 1.00 61.68  ? 34   TYR H CZ    1 
ATOM   5474  O  OH    . TYR H  4 37  ? -30.692 -29.305 25.518 1.00 61.75  ? 34   TYR H OH    1 
ATOM   5475  N  N     . ALA H  4 38  ? -39.227 -31.125 27.008 1.00 62.79  ? 35   ALA H N     1 
ATOM   5476  C  CA    . ALA H  4 38  ? -40.414 -31.773 27.578 1.00 62.43  ? 35   ALA H CA    1 
ATOM   5477  C  C     . ALA H  4 38  ? -40.925 -33.017 26.858 1.00 62.39  ? 35   ALA H C     1 
ATOM   5478  O  O     . ALA H  4 38  ? -41.274 -33.988 27.523 1.00 62.69  ? 35   ALA H O     1 
ATOM   5479  C  CB    . ALA H  4 38  ? -41.531 -30.777 27.783 1.00 62.18  ? 35   ALA H CB    1 
ATOM   5480  N  N     . ILE H  4 39  ? -40.981 -33.016 25.527 1.00 62.23  ? 36   ILE H N     1 
ATOM   5481  C  CA    . ILE H  4 39  ? -41.461 -34.222 24.836 1.00 62.24  ? 36   ILE H CA    1 
ATOM   5482  C  C     . ILE H  4 39  ? -40.495 -35.393 24.998 1.00 62.38  ? 36   ILE H C     1 
ATOM   5483  O  O     . ILE H  4 39  ? -40.924 -36.542 25.103 1.00 62.81  ? 36   ILE H O     1 
ATOM   5484  C  CB    . ILE H  4 39  ? -41.825 -34.025 23.328 1.00 62.04  ? 36   ILE H CB    1 
ATOM   5485  C  CG1   . ILE H  4 39  ? -40.666 -33.446 22.525 1.00 61.55  ? 36   ILE H CG1   1 
ATOM   5486  C  CG2   . ILE H  4 39  ? -43.065 -33.171 23.178 1.00 62.62  ? 36   ILE H CG2   1 
ATOM   5487  C  CD1   . ILE H  4 39  ? -40.744 -33.742 21.050 1.00 60.18  ? 36   ILE H CD1   1 
ATOM   5488  N  N     . TYR H  4 40  ? -39.200 -35.093 25.040 1.00 62.20  ? 37   TYR H N     1 
ATOM   5489  C  CA    . TYR H  4 40  ? -38.174 -36.119 25.132 1.00 61.93  ? 37   TYR H CA    1 
ATOM   5490  C  C     . TYR H  4 40  ? -38.063 -36.604 26.554 1.00 62.01  ? 37   TYR H C     1 
ATOM   5491  O  O     . TYR H  4 40  ? -37.673 -37.743 26.781 1.00 62.18  ? 37   TYR H O     1 
ATOM   5492  C  CB    . TYR H  4 40  ? -36.834 -35.588 24.642 1.00 61.96  ? 37   TYR H CB    1 
ATOM   5493  C  CG    . TYR H  4 40  ? -36.941 -34.920 23.297 1.00 61.77  ? 37   TYR H CG    1 
ATOM   5494  C  CD1   . TYR H  4 40  ? -37.196 -33.555 23.195 1.00 61.17  ? 37   TYR H CD1   1 
ATOM   5495  C  CD2   . TYR H  4 40  ? -36.812 -35.658 22.123 1.00 62.07  ? 37   TYR H CD2   1 
ATOM   5496  C  CE1   . TYR H  4 40  ? -37.310 -32.941 21.961 1.00 61.94  ? 37   TYR H CE1   1 
ATOM   5497  C  CE2   . TYR H  4 40  ? -36.919 -35.055 20.880 1.00 62.24  ? 37   TYR H CE2   1 
ATOM   5498  C  CZ    . TYR H  4 40  ? -37.173 -33.697 20.806 1.00 62.27  ? 37   TYR H CZ    1 
ATOM   5499  O  OH    . TYR H  4 40  ? -37.282 -33.096 19.577 1.00 62.42  ? 37   TYR H OH    1 
ATOM   5500  N  N     . VAL H  4 41  ? -38.409 -35.742 27.509 1.00 62.16  ? 38   VAL H N     1 
ATOM   5501  C  CA    . VAL H  4 41  ? -38.495 -36.142 28.915 1.00 62.35  ? 38   VAL H CA    1 
ATOM   5502  C  C     . VAL H  4 41  ? -39.600 -37.165 29.043 1.00 62.91  ? 38   VAL H C     1 
ATOM   5503  O  O     . VAL H  4 41  ? -39.398 -38.240 29.617 1.00 62.95  ? 38   VAL H O     1 
ATOM   5504  C  CB    . VAL H  4 41  ? -38.806 -34.963 29.858 1.00 61.96  ? 38   VAL H CB    1 
ATOM   5505  C  CG1   . VAL H  4 41  ? -39.202 -35.461 31.217 1.00 61.77  ? 38   VAL H CG1   1 
ATOM   5506  C  CG2   . VAL H  4 41  ? -37.611 -34.079 30.003 1.00 62.21  ? 38   VAL H CG2   1 
ATOM   5507  N  N     . TYR H  4 42  ? -40.759 -36.824 28.479 1.00 63.72  ? 39   TYR H N     1 
ATOM   5508  C  CA    . TYR H  4 42  ? -41.952 -37.664 28.560 1.00 64.37  ? 39   TYR H CA    1 
ATOM   5509  C  C     . TYR H  4 42  ? -41.740 -39.069 27.971 1.00 64.39  ? 39   TYR H C     1 
ATOM   5510  O  O     . TYR H  4 42  ? -42.134 -40.062 28.590 1.00 64.51  ? 39   TYR H O     1 
ATOM   5511  C  CB    . TYR H  4 42  ? -43.166 -36.964 27.939 1.00 64.88  ? 39   TYR H CB    1 
ATOM   5512  C  CG    . TYR H  4 42  ? -44.465 -37.677 28.237 1.00 65.92  ? 39   TYR H CG    1 
ATOM   5513  C  CD1   . TYR H  4 42  ? -45.086 -37.538 29.480 1.00 66.96  ? 39   TYR H CD1   1 
ATOM   5514  C  CD2   . TYR H  4 42  ? -45.071 -38.504 27.281 1.00 66.36  ? 39   TYR H CD2   1 
ATOM   5515  C  CE1   . TYR H  4 42  ? -46.282 -38.206 29.770 1.00 67.82  ? 39   TYR H CE1   1 
ATOM   5516  C  CE2   . TYR H  4 42  ? -46.263 -39.174 27.553 1.00 66.78  ? 39   TYR H CE2   1 
ATOM   5517  C  CZ    . TYR H  4 42  ? -46.862 -39.023 28.801 1.00 67.40  ? 39   TYR H CZ    1 
ATOM   5518  O  OH    . TYR H  4 42  ? -48.037 -39.683 29.089 1.00 67.45  ? 39   TYR H OH    1 
ATOM   5519  N  N     . LYS H  4 43  ? -41.105 -39.154 26.801 1.00 64.17  ? 40   LYS H N     1 
ATOM   5520  C  CA    . LYS H  4 43  ? -40.762 -40.452 26.213 1.00 64.27  ? 40   LYS H CA    1 
ATOM   5521  C  C     . LYS H  4 43  ? -39.986 -41.321 27.201 1.00 64.05  ? 40   LYS H C     1 
ATOM   5522  O  O     . LYS H  4 43  ? -40.345 -42.481 27.455 1.00 64.13  ? 40   LYS H O     1 
ATOM   5523  C  CB    . LYS H  4 43  ? -39.955 -40.280 24.927 1.00 64.36  ? 40   LYS H CB    1 
ATOM   5524  C  CG    . LYS H  4 43  ? -40.747 -39.715 23.751 1.00 65.50  ? 40   LYS H CG    1 
ATOM   5525  C  CD    . LYS H  4 43  ? -39.942 -39.856 22.466 1.00 66.64  ? 40   LYS H CD    1 
ATOM   5526  C  CE    . LYS H  4 43  ? -40.283 -38.772 21.462 1.00 66.93  ? 40   LYS H CE    1 
ATOM   5527  N  NZ    . LYS H  4 43  ? -39.176 -38.646 20.465 1.00 67.02  ? 40   LYS H NZ    1 
ATOM   5528  N  N     . VAL H  4 44  ? -38.932 -40.736 27.766 1.00 63.81  ? 41   VAL H N     1 
ATOM   5529  C  CA    . VAL H  4 44  ? -38.066 -41.416 28.722 1.00 63.49  ? 41   VAL H CA    1 
ATOM   5530  C  C     . VAL H  4 44  ? -38.863 -41.881 29.944 1.00 63.50  ? 41   VAL H C     1 
ATOM   5531  O  O     . VAL H  4 44  ? -38.569 -42.935 30.512 1.00 63.32  ? 41   VAL H O     1 
ATOM   5532  C  CB    . VAL H  4 44  ? -36.857 -40.518 29.128 1.00 63.42  ? 41   VAL H CB    1 
ATOM   5533  C  CG1   . VAL H  4 44  ? -36.040 -41.147 30.254 1.00 63.06  ? 41   VAL H CG1   1 
ATOM   5534  C  CG2   . VAL H  4 44  ? -35.965 -40.244 27.921 1.00 62.79  ? 41   VAL H CG2   1 
ATOM   5535  N  N     . LEU H  4 45  ? -39.881 -41.107 30.325 1.00 63.58  ? 42   LEU H N     1 
ATOM   5536  C  CA    . LEU H  4 45  ? -40.718 -41.449 31.475 1.00 63.67  ? 42   LEU H CA    1 
ATOM   5537  C  C     . LEU H  4 45  ? -41.398 -42.798 31.275 1.00 64.54  ? 42   LEU H C     1 
ATOM   5538  O  O     . LEU H  4 45  ? -41.348 -43.669 32.155 1.00 64.78  ? 42   LEU H O     1 
ATOM   5539  C  CB    . LEU H  4 45  ? -41.755 -40.362 31.748 1.00 63.12  ? 42   LEU H CB    1 
ATOM   5540  C  CG    . LEU H  4 45  ? -42.784 -40.614 32.850 1.00 62.44  ? 42   LEU H CG    1 
ATOM   5541  C  CD1   . LEU H  4 45  ? -42.161 -41.194 34.092 1.00 62.22  ? 42   LEU H CD1   1 
ATOM   5542  C  CD2   . LEU H  4 45  ? -43.512 -39.338 33.210 1.00 63.26  ? 42   LEU H CD2   1 
ATOM   5543  N  N     . LYS H  4 46  ? -42.007 -42.977 30.104 1.00 65.27  ? 43   LYS H N     1 
ATOM   5544  C  CA    . LYS H  4 46  ? -42.785 -44.176 29.821 1.00 65.53  ? 43   LYS H CA    1 
ATOM   5545  C  C     . LYS H  4 46  ? -41.907 -45.420 29.727 1.00 65.88  ? 43   LYS H C     1 
ATOM   5546  O  O     . LYS H  4 46  ? -42.301 -46.491 30.176 1.00 66.24  ? 43   LYS H O     1 
ATOM   5547  C  CB    . LYS H  4 46  ? -43.617 -43.977 28.566 1.00 65.46  ? 43   LYS H CB    1 
ATOM   5548  C  CG    . LYS H  4 46  ? -44.474 -42.703 28.587 1.00 65.56  ? 43   LYS H CG    1 
ATOM   5549  C  CD    . LYS H  4 46  ? -45.801 -42.880 29.336 1.00 65.84  ? 43   LYS H CD    1 
ATOM   5550  C  CE    . LYS H  4 46  ? -45.814 -42.156 30.672 1.00 65.45  ? 43   LYS H CE    1 
ATOM   5551  N  NZ    . LYS H  4 46  ? -47.204 -41.811 31.115 1.00 64.53  ? 43   LYS H NZ    1 
ATOM   5552  N  N     . GLN H  4 47  ? -40.704 -45.275 29.183 1.00 66.07  ? 44   GLN H N     1 
ATOM   5553  C  CA    . GLN H  4 47  ? -39.751 -46.384 29.177 1.00 66.37  ? 44   GLN H CA    1 
ATOM   5554  C  C     . GLN H  4 47  ? -39.443 -46.926 30.565 1.00 66.09  ? 44   GLN H C     1 
ATOM   5555  O  O     . GLN H  4 47  ? -39.148 -48.103 30.718 1.00 66.32  ? 44   GLN H O     1 
ATOM   5556  C  CB    . GLN H  4 47  ? -38.448 -45.970 28.530 1.00 66.48  ? 44   GLN H CB    1 
ATOM   5557  C  CG    . GLN H  4 47  ? -38.537 -45.809 27.052 1.00 68.34  ? 44   GLN H CG    1 
ATOM   5558  C  CD    . GLN H  4 47  ? -37.167 -45.641 26.433 1.00 71.92  ? 44   GLN H CD    1 
ATOM   5559  O  OE1   . GLN H  4 47  ? -36.175 -46.253 26.896 1.00 73.19  ? 44   GLN H OE1   1 
ATOM   5560  N  NE2   . GLN H  4 47  ? -37.100 -44.810 25.372 1.00 73.41  ? 44   GLN H NE2   1 
ATOM   5561  N  N     . VAL H  4 48  ? -39.498 -46.074 31.578 1.00 65.85  ? 45   VAL H N     1 
ATOM   5562  C  CA    . VAL H  4 48  ? -39.090 -46.510 32.907 1.00 65.82  ? 45   VAL H CA    1 
ATOM   5563  C  C     . VAL H  4 48  ? -40.268 -46.663 33.875 1.00 65.76  ? 45   VAL H C     1 
ATOM   5564  O  O     . VAL H  4 48  ? -40.177 -47.397 34.859 1.00 65.72  ? 45   VAL H O     1 
ATOM   5565  C  CB    . VAL H  4 48  ? -37.967 -45.601 33.514 1.00 65.83  ? 45   VAL H CB    1 
ATOM   5566  C  CG1   . VAL H  4 48  ? -36.759 -45.546 32.592 1.00 65.74  ? 45   VAL H CG1   1 
ATOM   5567  C  CG2   . VAL H  4 48  ? -38.470 -44.198 33.801 1.00 65.80  ? 45   VAL H CG2   1 
ATOM   5568  N  N     . HIS H  4 49  ? -41.363 -45.967 33.587 1.00 65.56  ? 46   HIS H N     1 
ATOM   5569  C  CA    . HIS H  4 49  ? -42.525 -45.946 34.462 1.00 65.65  ? 46   HIS H CA    1 
ATOM   5570  C  C     . HIS H  4 49  ? -43.746 -45.674 33.602 1.00 65.61  ? 46   HIS H C     1 
ATOM   5571  O  O     . HIS H  4 49  ? -44.325 -44.578 33.677 1.00 65.68  ? 46   HIS H O     1 
ATOM   5572  C  CB    . HIS H  4 49  ? -42.378 -44.854 35.527 1.00 65.69  ? 46   HIS H CB    1 
ATOM   5573  C  CG    . HIS H  4 49  ? -41.478 -45.225 36.665 1.00 66.33  ? 46   HIS H CG    1 
ATOM   5574  N  ND1   . HIS H  4 49  ? -41.752 -46.268 37.524 1.00 67.09  ? 46   HIS H ND1   1 
ATOM   5575  C  CD2   . HIS H  4 49  ? -40.314 -44.680 37.095 1.00 66.98  ? 46   HIS H CD2   1 
ATOM   5576  C  CE1   . HIS H  4 49  ? -40.792 -46.357 38.428 1.00 66.91  ? 46   HIS H CE1   1 
ATOM   5577  N  NE2   . HIS H  4 49  ? -39.908 -45.404 38.192 1.00 66.86  ? 46   HIS H NE2   1 
ATOM   5578  N  N     . PRO H  4 50  ? -44.155 -46.672 32.786 1.00 65.47  ? 47   PRO H N     1 
ATOM   5579  C  CA    . PRO H  4 50  ? -45.112 -46.424 31.703 1.00 65.30  ? 47   PRO H CA    1 
ATOM   5580  C  C     . PRO H  4 50  ? -46.497 -46.100 32.231 1.00 65.28  ? 47   PRO H C     1 
ATOM   5581  O  O     . PRO H  4 50  ? -47.320 -45.550 31.512 1.00 65.32  ? 47   PRO H O     1 
ATOM   5582  C  CB    . PRO H  4 50  ? -45.123 -47.744 30.922 1.00 65.03  ? 47   PRO H CB    1 
ATOM   5583  C  CG    . PRO H  4 50  ? -43.955 -48.520 31.433 1.00 64.98  ? 47   PRO H CG    1 
ATOM   5584  C  CD    . PRO H  4 50  ? -43.774 -48.091 32.844 1.00 65.29  ? 47   PRO H CD    1 
ATOM   5585  N  N     . ASP H  4 51  ? -46.742 -46.417 33.490 1.00 65.25  ? 48   ASP H N     1 
ATOM   5586  C  CA    . ASP H  4 51  ? -48.013 -46.086 34.079 1.00 65.51  ? 48   ASP H CA    1 
ATOM   5587  C  C     . ASP H  4 51  ? -47.917 -44.884 35.017 1.00 65.33  ? 48   ASP H C     1 
ATOM   5588  O  O     . ASP H  4 51  ? -48.886 -44.528 35.700 1.00 65.43  ? 48   ASP H O     1 
ATOM   5589  C  CB    . ASP H  4 51  ? -48.590 -47.321 34.752 1.00 65.95  ? 48   ASP H CB    1 
ATOM   5590  C  CG    . ASP H  4 51  ? -48.907 -48.416 33.745 1.00 67.41  ? 48   ASP H CG    1 
ATOM   5591  O  OD1   . ASP H  4 51  ? -49.720 -48.148 32.829 1.00 69.26  ? 48   ASP H OD1   1 
ATOM   5592  O  OD2   . ASP H  4 51  ? -48.336 -49.532 33.848 1.00 68.85  ? 48   ASP H OD2   1 
ATOM   5593  N  N     . THR H  4 52  ? -46.752 -44.238 35.019 1.00 64.80  ? 49   THR H N     1 
ATOM   5594  C  CA    . THR H  4 52  ? -46.555 -43.028 35.808 1.00 63.98  ? 49   THR H CA    1 
ATOM   5595  C  C     . THR H  4 52  ? -46.627 -41.798 34.911 1.00 63.34  ? 49   THR H C     1 
ATOM   5596  O  O     . THR H  4 52  ? -46.127 -41.818 33.788 1.00 63.14  ? 49   THR H O     1 
ATOM   5597  C  CB    . THR H  4 52  ? -45.221 -43.053 36.571 1.00 64.03  ? 49   THR H CB    1 
ATOM   5598  O  OG1   . THR H  4 52  ? -45.000 -44.368 37.107 1.00 64.46  ? 49   THR H OG1   1 
ATOM   5599  C  CG2   . THR H  4 52  ? -45.254 -42.068 37.725 1.00 64.20  ? 49   THR H CG2   1 
ATOM   5600  N  N     . GLY H  4 53  ? -47.280 -40.750 35.418 1.00 62.72  ? 50   GLY H N     1 
ATOM   5601  C  CA    . GLY H  4 53  ? -47.409 -39.460 34.738 1.00 61.91  ? 50   GLY H CA    1 
ATOM   5602  C  C     . GLY H  4 53  ? -46.689 -38.368 35.509 1.00 61.55  ? 50   GLY H C     1 
ATOM   5603  O  O     . GLY H  4 53  ? -45.942 -38.655 36.450 1.00 61.55  ? 50   GLY H O     1 
ATOM   5604  N  N     . ILE H  4 54  ? -46.923 -37.112 35.134 1.00 60.99  ? 51   ILE H N     1 
ATOM   5605  C  CA    . ILE H  4 54  ? -46.079 -36.012 35.608 1.00 60.42  ? 51   ILE H CA    1 
ATOM   5606  C  C     . ILE H  4 54  ? -46.765 -34.653 35.505 1.00 59.90  ? 51   ILE H C     1 
ATOM   5607  O  O     . ILE H  4 54  ? -47.246 -34.295 34.437 1.00 60.23  ? 51   ILE H O     1 
ATOM   5608  C  CB    . ILE H  4 54  ? -44.733 -36.000 34.817 1.00 60.48  ? 51   ILE H CB    1 
ATOM   5609  C  CG1   . ILE H  4 54  ? -43.818 -34.861 35.289 1.00 60.79  ? 51   ILE H CG1   1 
ATOM   5610  C  CG2   . ILE H  4 54  ? -44.982 -35.955 33.303 1.00 60.06  ? 51   ILE H CG2   1 
ATOM   5611  C  CD1   . ILE H  4 54  ? -42.339 -35.086 34.976 1.00 60.65  ? 51   ILE H CD1   1 
ATOM   5612  N  N     . SER H  4 55  ? -46.798 -33.889 36.595 1.00 59.22  ? 52   SER H N     1 
ATOM   5613  C  CA    . SER H  4 55  ? -47.437 -32.562 36.570 1.00 58.75  ? 52   SER H CA    1 
ATOM   5614  C  C     . SER H  4 55  ? -46.653 -31.534 35.742 1.00 58.34  ? 52   SER H C     1 
ATOM   5615  O  O     . SER H  4 55  ? -45.486 -31.738 35.432 1.00 58.21  ? 52   SER H O     1 
ATOM   5616  C  CB    . SER H  4 55  ? -47.719 -32.040 37.990 1.00 58.88  ? 52   SER H CB    1 
ATOM   5617  O  OG    . SER H  4 55  ? -46.620 -31.349 38.548 1.00 58.66  ? 52   SER H OG    1 
ATOM   5618  N  N     . SER H  4 56  ? -47.311 -30.440 35.375 1.00 58.04  ? 53   SER H N     1 
ATOM   5619  C  CA    . SER H  4 56  ? -46.682 -29.395 34.578 1.00 58.14  ? 53   SER H CA    1 
ATOM   5620  C  C     . SER H  4 56  ? -45.457 -28.830 35.264 1.00 58.33  ? 53   SER H C     1 
ATOM   5621  O  O     . SER H  4 56  ? -44.345 -28.868 34.710 1.00 58.63  ? 53   SER H O     1 
ATOM   5622  C  CB    . SER H  4 56  ? -47.662 -28.270 34.291 1.00 57.99  ? 53   SER H CB    1 
ATOM   5623  O  OG    . SER H  4 56  ? -48.204 -28.440 32.998 1.00 58.52  ? 53   SER H OG    1 
ATOM   5624  N  N     . LYS H  4 57  ? -45.674 -28.308 36.473 1.00 58.06  ? 54   LYS H N     1 
ATOM   5625  C  CA    . LYS H  4 57  ? -44.600 -27.828 37.334 1.00 57.62  ? 54   LYS H CA    1 
ATOM   5626  C  C     . LYS H  4 57  ? -43.448 -28.837 37.402 1.00 56.94  ? 54   LYS H C     1 
ATOM   5627  O  O     . LYS H  4 57  ? -42.288 -28.449 37.289 1.00 57.46  ? 54   LYS H O     1 
ATOM   5628  C  CB    . LYS H  4 57  ? -45.133 -27.546 38.737 1.00 57.61  ? 54   LYS H CB    1 
ATOM   5629  C  CG    . LYS H  4 57  ? -46.252 -26.507 38.806 1.00 58.35  ? 54   LYS H CG    1 
ATOM   5630  C  CD    . LYS H  4 57  ? -46.907 -26.501 40.199 1.00 58.56  ? 54   LYS H CD    1 
ATOM   5631  C  CE    . LYS H  4 57  ? -47.815 -25.299 40.412 1.00 59.17  ? 54   LYS H CE    1 
ATOM   5632  N  NZ    . LYS H  4 57  ? -46.990 -24.083 40.608 1.00 60.51  ? 54   LYS H NZ    1 
ATOM   5633  N  N     . ALA H  4 58  ? -43.767 -30.123 37.560 1.00 55.67  ? 55   ALA H N     1 
ATOM   5634  C  CA    . ALA H  4 58  ? -42.749 -31.164 37.624 1.00 54.47  ? 55   ALA H CA    1 
ATOM   5635  C  C     . ALA H  4 58  ? -41.946 -31.249 36.338 1.00 53.62  ? 55   ALA H C     1 
ATOM   5636  O  O     . ALA H  4 58  ? -40.732 -31.371 36.374 1.00 53.38  ? 55   ALA H O     1 
ATOM   5637  C  CB    . ALA H  4 58  ? -43.370 -32.503 37.956 1.00 54.53  ? 55   ALA H CB    1 
ATOM   5638  N  N     . MET H  4 59  ? -42.629 -31.167 35.205 1.00 53.02  ? 56   MET H N     1 
ATOM   5639  C  CA    . MET H  4 59  ? -41.981 -31.261 33.904 1.00 52.57  ? 56   MET H CA    1 
ATOM   5640  C  C     . MET H  4 59  ? -41.077 -30.071 33.702 1.00 52.30  ? 56   MET H C     1 
ATOM   5641  O  O     . MET H  4 59  ? -40.018 -30.164 33.074 1.00 52.21  ? 56   MET H O     1 
ATOM   5642  C  CB    . MET H  4 59  ? -43.024 -31.279 32.803 1.00 52.59  ? 56   MET H CB    1 
ATOM   5643  C  CG    . MET H  4 59  ? -42.446 -31.194 31.408 1.00 53.25  ? 56   MET H CG    1 
ATOM   5644  S  SD    . MET H  4 59  ? -41.490 -32.650 30.959 1.00 54.41  ? 56   MET H SD    1 
ATOM   5645  C  CE    . MET H  4 59  ? -42.765 -33.885 30.768 1.00 53.62  ? 56   MET H CE    1 
ATOM   5646  N  N     . SER H  4 60  ? -41.519 -28.941 34.241 1.00 51.91  ? 57   SER H N     1 
ATOM   5647  C  CA    . SER H  4 60  ? -40.761 -27.710 34.163 1.00 51.36  ? 57   SER H CA    1 
ATOM   5648  C  C     . SER H  4 60  ? -39.436 -27.841 34.935 1.00 50.85  ? 57   SER H C     1 
ATOM   5649  O  O     . SER H  4 60  ? -38.389 -27.424 34.434 1.00 51.19  ? 57   SER H O     1 
ATOM   5650  C  CB    . SER H  4 60  ? -41.605 -26.550 34.669 1.00 51.23  ? 57   SER H CB    1 
ATOM   5651  O  OG    . SER H  4 60  ? -40.970 -25.323 34.395 1.00 52.44  ? 57   SER H OG    1 
ATOM   5652  N  N     . ILE H  4 61  ? -39.485 -28.442 36.131 1.00 49.84  ? 58   ILE H N     1 
ATOM   5653  C  CA    . ILE H  4 61  ? -38.288 -28.741 36.922 1.00 48.55  ? 58   ILE H CA    1 
ATOM   5654  C  C     . ILE H  4 61  ? -37.369 -29.612 36.098 1.00 48.27  ? 58   ILE H C     1 
ATOM   5655  O  O     . ILE H  4 61  ? -36.161 -29.415 36.086 1.00 48.33  ? 58   ILE H O     1 
ATOM   5656  C  CB    . ILE H  4 61  ? -38.614 -29.544 38.197 1.00 48.49  ? 58   ILE H CB    1 
ATOM   5657  C  CG1   . ILE H  4 61  ? -39.721 -28.892 39.044 1.00 48.01  ? 58   ILE H CG1   1 
ATOM   5658  C  CG2   . ILE H  4 61  ? -37.342 -29.869 38.982 1.00 47.76  ? 58   ILE H CG2   1 
ATOM   5659  C  CD1   . ILE H  4 61  ? -39.304 -27.760 39.915 1.00 48.97  ? 58   ILE H CD1   1 
ATOM   5660  N  N     . MET H  4 62  ? -37.947 -30.585 35.406 1.00 47.91  ? 59   MET H N     1 
ATOM   5661  C  CA    . MET H  4 62  ? -37.146 -31.515 34.635 1.00 47.82  ? 59   MET H CA    1 
ATOM   5662  C  C     . MET H  4 62  ? -36.494 -30.800 33.476 1.00 47.96  ? 59   MET H C     1 
ATOM   5663  O  O     . MET H  4 62  ? -35.374 -31.114 33.091 1.00 48.15  ? 59   MET H O     1 
ATOM   5664  C  CB    . MET H  4 62  ? -37.982 -32.685 34.134 1.00 47.58  ? 59   MET H CB    1 
ATOM   5665  C  CG    . MET H  4 62  ? -38.284 -33.721 35.180 1.00 47.09  ? 59   MET H CG    1 
ATOM   5666  S  SD    . MET H  4 62  ? -36.824 -34.517 35.854 1.00 46.62  ? 59   MET H SD    1 
ATOM   5667  C  CE    . MET H  4 62  ? -36.022 -35.092 34.360 1.00 46.22  ? 59   MET H CE    1 
ATOM   5668  N  N     . ASN H  4 63  ? -37.192 -29.827 32.921 1.00 48.04  ? 60   ASN H N     1 
ATOM   5669  C  CA    . ASN H  4 63  ? -36.629 -29.103 31.810 1.00 48.47  ? 60   ASN H CA    1 
ATOM   5670  C  C     . ASN H  4 63  ? -35.417 -28.266 32.271 1.00 48.42  ? 60   ASN H C     1 
ATOM   5671  O  O     . ASN H  4 63  ? -34.343 -28.275 31.634 1.00 48.17  ? 60   ASN H O     1 
ATOM   5672  C  CB    . ASN H  4 63  ? -37.707 -28.247 31.137 1.00 48.62  ? 60   ASN H CB    1 
ATOM   5673  C  CG    . ASN H  4 63  ? -37.226 -27.634 29.844 1.00 49.23  ? 60   ASN H CG    1 
ATOM   5674  O  OD1   . ASN H  4 63  ? -36.575 -28.297 29.024 1.00 49.00  ? 60   ASN H OD1   1 
ATOM   5675  N  ND2   . ASN H  4 63  ? -37.519 -26.355 29.660 1.00 50.93  ? 60   ASN H ND2   1 
ATOM   5676  N  N     . SER H  4 64  ? -35.599 -27.575 33.400 1.00 48.17  ? 61   SER H N     1 
ATOM   5677  C  CA    . SER H  4 64  ? -34.535 -26.830 34.052 1.00 48.04  ? 61   SER H CA    1 
ATOM   5678  C  C     . SER H  4 64  ? -33.377 -27.754 34.327 1.00 47.83  ? 61   SER H C     1 
ATOM   5679  O  O     . SER H  4 64  ? -32.229 -27.392 34.101 1.00 48.32  ? 61   SER H O     1 
ATOM   5680  C  CB    . SER H  4 64  ? -35.021 -26.212 35.355 1.00 47.90  ? 61   SER H CB    1 
ATOM   5681  O  OG    . SER H  4 64  ? -36.015 -25.236 35.101 1.00 49.42  ? 61   SER H OG    1 
ATOM   5682  N  N     . PHE H  4 65  ? -33.675 -28.963 34.782 1.00 47.33  ? 62   PHE H N     1 
ATOM   5683  C  CA    . PHE H  4 65  ? -32.621 -29.914 35.039 1.00 46.98  ? 62   PHE H CA    1 
ATOM   5684  C  C     . PHE H  4 65  ? -31.758 -30.193 33.827 1.00 46.64  ? 62   PHE H C     1 
ATOM   5685  O  O     . PHE H  4 65  ? -30.543 -30.129 33.916 1.00 46.86  ? 62   PHE H O     1 
ATOM   5686  C  CB    . PHE H  4 65  ? -33.169 -31.223 35.559 1.00 46.99  ? 62   PHE H CB    1 
ATOM   5687  C  CG    . PHE H  4 65  ? -32.119 -32.284 35.709 1.00 47.32  ? 62   PHE H CG    1 
ATOM   5688  C  CD1   . PHE H  4 65  ? -31.087 -32.135 36.631 1.00 47.56  ? 62   PHE H CD1   1 
ATOM   5689  C  CD2   . PHE H  4 65  ? -32.154 -33.432 34.927 1.00 47.52  ? 62   PHE H CD2   1 
ATOM   5690  C  CE1   . PHE H  4 65  ? -30.111 -33.124 36.779 1.00 47.55  ? 62   PHE H CE1   1 
ATOM   5691  C  CE2   . PHE H  4 65  ? -31.189 -34.429 35.073 1.00 46.75  ? 62   PHE H CE2   1 
ATOM   5692  C  CZ    . PHE H  4 65  ? -30.163 -34.271 35.995 1.00 47.01  ? 62   PHE H CZ    1 
ATOM   5693  N  N     . VAL H  4 66  ? -32.379 -30.511 32.702 1.00 46.42  ? 63   VAL H N     1 
ATOM   5694  C  CA    . VAL H  4 66  ? -31.605 -30.844 31.509 1.00 46.43  ? 63   VAL H CA    1 
ATOM   5695  C  C     . VAL H  4 66  ? -30.816 -29.627 31.025 1.00 46.70  ? 63   VAL H C     1 
ATOM   5696  O  O     . VAL H  4 66  ? -29.629 -29.742 30.692 1.00 46.66  ? 63   VAL H O     1 
ATOM   5697  C  CB    . VAL H  4 66  ? -32.476 -31.434 30.374 1.00 46.29  ? 63   VAL H CB    1 
ATOM   5698  C  CG1   . VAL H  4 66  ? -31.627 -31.728 29.159 1.00 45.61  ? 63   VAL H CG1   1 
ATOM   5699  C  CG2   . VAL H  4 66  ? -33.146 -32.713 30.837 1.00 45.85  ? 63   VAL H CG2   1 
ATOM   5700  N  N     . ASN H  4 67  ? -31.468 -28.466 31.013 1.00 46.65  ? 64   ASN H N     1 
ATOM   5701  C  CA    . ASN H  4 67  ? -30.788 -27.224 30.669 1.00 46.79  ? 64   ASN H CA    1 
ATOM   5702  C  C     . ASN H  4 67  ? -29.581 -26.936 31.534 1.00 46.70  ? 64   ASN H C     1 
ATOM   5703  O  O     . ASN H  4 67  ? -28.522 -26.575 31.021 1.00 46.81  ? 64   ASN H O     1 
ATOM   5704  C  CB    . ASN H  4 67  ? -31.739 -26.051 30.766 1.00 46.92  ? 64   ASN H CB    1 
ATOM   5705  C  CG    . ASN H  4 67  ? -32.555 -25.898 29.544 1.00 47.42  ? 64   ASN H CG    1 
ATOM   5706  O  OD1   . ASN H  4 67  ? -32.136 -26.303 28.460 1.00 48.00  ? 64   ASN H OD1   1 
ATOM   5707  N  ND2   . ASN H  4 67  ? -33.740 -25.320 29.690 1.00 48.76  ? 64   ASN H ND2   1 
ATOM   5708  N  N     . ASP H  4 68  ? -29.752 -27.094 32.843 1.00 46.38  ? 65   ASP H N     1 
ATOM   5709  C  CA    . ASP H  4 68  ? -28.687 -26.844 33.776 1.00 46.32  ? 65   ASP H CA    1 
ATOM   5710  C  C     . ASP H  4 68  ? -27.529 -27.741 33.417 1.00 45.93  ? 65   ASP H C     1 
ATOM   5711  O  O     . ASP H  4 68  ? -26.428 -27.264 33.151 1.00 46.32  ? 65   ASP H O     1 
ATOM   5712  C  CB    . ASP H  4 68  ? -29.150 -27.116 35.201 1.00 46.71  ? 65   ASP H CB    1 
ATOM   5713  C  CG    . ASP H  4 68  ? -28.090 -26.777 36.240 1.00 48.31  ? 65   ASP H CG    1 
ATOM   5714  O  OD1   . ASP H  4 68  ? -27.194 -25.952 35.952 1.00 50.16  ? 65   ASP H OD1   1 
ATOM   5715  O  OD2   . ASP H  4 68  ? -28.153 -27.342 37.352 1.00 48.73  ? 65   ASP H OD2   1 
ATOM   5716  N  N     . VAL H  4 69  ? -27.786 -29.040 33.364 1.00 45.49  ? 66   VAL H N     1 
ATOM   5717  C  CA    . VAL H  4 69  ? -26.712 -30.001 33.136 1.00 45.06  ? 66   VAL H CA    1 
ATOM   5718  C  C     . VAL H  4 69  ? -26.059 -29.819 31.763 1.00 44.83  ? 66   VAL H C     1 
ATOM   5719  O  O     . VAL H  4 69  ? -24.832 -29.890 31.650 1.00 44.58  ? 66   VAL H O     1 
ATOM   5720  C  CB    . VAL H  4 69  ? -27.168 -31.451 33.396 1.00 45.09  ? 66   VAL H CB    1 
ATOM   5721  C  CG1   . VAL H  4 69  ? -26.074 -32.429 33.033 1.00 45.34  ? 66   VAL H CG1   1 
ATOM   5722  C  CG2   . VAL H  4 69  ? -27.522 -31.623 34.859 1.00 44.30  ? 66   VAL H CG2   1 
ATOM   5723  N  N     . PHE H  4 70  ? -26.873 -29.550 30.740 1.00 44.58  ? 67   PHE H N     1 
ATOM   5724  C  CA    . PHE H  4 70  ? -26.342 -29.201 29.426 1.00 44.29  ? 67   PHE H CA    1 
ATOM   5725  C  C     . PHE H  4 70  ? -25.268 -28.133 29.563 1.00 44.63  ? 67   PHE H C     1 
ATOM   5726  O  O     . PHE H  4 70  ? -24.136 -28.311 29.080 1.00 44.46  ? 67   PHE H O     1 
ATOM   5727  C  CB    . PHE H  4 70  ? -27.426 -28.687 28.480 1.00 43.88  ? 67   PHE H CB    1 
ATOM   5728  C  CG    . PHE H  4 70  ? -26.898 -28.328 27.118 1.00 43.57  ? 67   PHE H CG    1 
ATOM   5729  C  CD1   . PHE H  4 70  ? -26.733 -29.308 26.141 1.00 43.44  ? 67   PHE H CD1   1 
ATOM   5730  C  CD2   . PHE H  4 70  ? -26.525 -27.022 26.820 1.00 43.48  ? 67   PHE H CD2   1 
ATOM   5731  C  CE1   . PHE H  4 70  ? -26.221 -28.996 24.878 1.00 42.65  ? 67   PHE H CE1   1 
ATOM   5732  C  CE2   . PHE H  4 70  ? -26.018 -26.692 25.562 1.00 43.56  ? 67   PHE H CE2   1 
ATOM   5733  C  CZ    . PHE H  4 70  ? -25.867 -27.693 24.586 1.00 43.55  ? 67   PHE H CZ    1 
ATOM   5734  N  N     . GLU H  4 71  ? -25.636 -27.032 30.233 1.00 44.69  ? 68   GLU H N     1 
ATOM   5735  C  CA    . GLU H  4 71  ? -24.746 -25.881 30.397 1.00 44.91  ? 68   GLU H CA    1 
ATOM   5736  C  C     . GLU H  4 71  ? -23.492 -26.256 31.176 1.00 44.02  ? 68   GLU H C     1 
ATOM   5737  O  O     . GLU H  4 71  ? -22.381 -25.914 30.756 1.00 44.18  ? 68   GLU H O     1 
ATOM   5738  C  CB    . GLU H  4 71  ? -25.460 -24.660 30.998 1.00 44.47  ? 68   GLU H CB    1 
ATOM   5739  C  CG    . GLU H  4 71  ? -26.412 -23.921 30.022 1.00 45.85  ? 68   GLU H CG    1 
ATOM   5740  C  CD    . GLU H  4 71  ? -27.422 -22.959 30.726 1.00 47.12  ? 68   GLU H CD    1 
ATOM   5741  O  OE1   . GLU H  4 71  ? -27.468 -22.920 31.980 1.00 50.60  ? 68   GLU H OE1   1 
ATOM   5742  O  OE2   . GLU H  4 71  ? -28.181 -22.234 30.032 1.00 49.34  ? 68   GLU H OE2   1 
ATOM   5743  N  N     . ARG H  4 72  ? -23.643 -26.996 32.265 1.00 43.16  ? 69   ARG H N     1 
ATOM   5744  C  CA    . ARG H  4 72  ? -22.457 -27.367 33.040 1.00 43.07  ? 69   ARG H CA    1 
ATOM   5745  C  C     . ARG H  4 72  ? -21.445 -28.171 32.214 1.00 43.04  ? 69   ARG H C     1 
ATOM   5746  O  O     . ARG H  4 72  ? -20.251 -27.842 32.125 1.00 42.76  ? 69   ARG H O     1 
ATOM   5747  C  CB    . ARG H  4 72  ? -22.839 -28.138 34.287 1.00 42.76  ? 69   ARG H CB    1 
ATOM   5748  C  CG    . ARG H  4 72  ? -23.790 -27.411 35.187 1.00 42.55  ? 69   ARG H CG    1 
ATOM   5749  C  CD    . ARG H  4 72  ? -23.641 -27.964 36.547 1.00 42.09  ? 69   ARG H CD    1 
ATOM   5750  N  NE    . ARG H  4 72  ? -24.888 -27.961 37.280 1.00 42.20  ? 69   ARG H NE    1 
ATOM   5751  C  CZ    . ARG H  4 72  ? -25.063 -28.642 38.408 1.00 44.07  ? 69   ARG H CZ    1 
ATOM   5752  N  NH1   . ARG H  4 72  ? -24.080 -29.376 38.908 1.00 43.57  ? 69   ARG H NH1   1 
ATOM   5753  N  NH2   . ARG H  4 72  ? -26.223 -28.600 39.037 1.00 46.30  ? 69   ARG H NH2   1 
ATOM   5754  N  N     . ILE H  4 73  ? -21.953 -29.215 31.584 1.00 43.01  ? 70   ILE H N     1 
ATOM   5755  C  CA    . ILE H  4 73  ? -21.124 -30.104 30.818 1.00 42.80  ? 70   ILE H CA    1 
ATOM   5756  C  C     . ILE H  4 73  ? -20.478 -29.332 29.685 1.00 43.06  ? 70   ILE H C     1 
ATOM   5757  O  O     . ILE H  4 73  ? -19.252 -29.291 29.580 1.00 42.84  ? 70   ILE H O     1 
ATOM   5758  C  CB    . ILE H  4 73  ? -21.940 -31.316 30.344 1.00 42.59  ? 70   ILE H CB    1 
ATOM   5759  C  CG1   . ILE H  4 73  ? -22.327 -32.147 31.571 1.00 41.50  ? 70   ILE H CG1   1 
ATOM   5760  C  CG2   . ILE H  4 73  ? -21.150 -32.153 29.354 1.00 42.49  ? 70   ILE H CG2   1 
ATOM   5761  C  CD1   . ILE H  4 73  ? -22.940 -33.445 31.261 1.00 40.54  ? 70   ILE H CD1   1 
ATOM   5762  N  N     . ALA H  4 74  ? -21.309 -28.678 28.878 1.00 43.43  ? 71   ALA H N     1 
ATOM   5763  C  CA    . ALA H  4 74  ? -20.825 -27.879 27.753 1.00 43.68  ? 71   ALA H CA    1 
ATOM   5764  C  C     . ALA H  4 74  ? -19.789 -26.833 28.184 1.00 43.92  ? 71   ALA H C     1 
ATOM   5765  O  O     . ALA H  4 74  ? -18.758 -26.671 27.534 1.00 43.80  ? 71   ALA H O     1 
ATOM   5766  C  CB    . ALA H  4 74  ? -21.978 -27.224 27.053 1.00 43.63  ? 71   ALA H CB    1 
ATOM   5767  N  N     . GLY H  4 75  ? -20.060 -26.142 29.290 1.00 44.06  ? 72   GLY H N     1 
ATOM   5768  C  CA    . GLY H  4 75  ? -19.128 -25.144 29.810 1.00 44.28  ? 72   GLY H CA    1 
ATOM   5769  C  C     . GLY H  4 75  ? -17.764 -25.719 30.157 1.00 44.37  ? 72   GLY H C     1 
ATOM   5770  O  O     . GLY H  4 75  ? -16.721 -25.165 29.799 1.00 43.87  ? 72   GLY H O     1 
ATOM   5771  N  N     . GLU H  4 76  ? -17.782 -26.845 30.858 1.00 44.72  ? 73   GLU H N     1 
ATOM   5772  C  CA    . GLU H  4 76  ? -16.562 -27.489 31.286 1.00 45.17  ? 73   GLU H CA    1 
ATOM   5773  C  C     . GLU H  4 76  ? -15.788 -28.037 30.094 1.00 45.29  ? 73   GLU H C     1 
ATOM   5774  O  O     . GLU H  4 76  ? -14.558 -27.997 30.070 1.00 45.28  ? 73   GLU H O     1 
ATOM   5775  C  CB    . GLU H  4 76  ? -16.907 -28.603 32.250 1.00 45.30  ? 73   GLU H CB    1 
ATOM   5776  C  CG    . GLU H  4 76  ? -15.721 -29.228 32.888 1.00 46.97  ? 73   GLU H CG    1 
ATOM   5777  C  CD    . GLU H  4 76  ? -15.128 -28.353 33.945 1.00 50.97  ? 73   GLU H CD    1 
ATOM   5778  O  OE1   . GLU H  4 76  ? -14.027 -27.790 33.665 1.00 52.48  ? 73   GLU H OE1   1 
ATOM   5779  O  OE2   . GLU H  4 76  ? -15.769 -28.234 35.035 1.00 51.14  ? 73   GLU H OE2   1 
ATOM   5780  N  N     . ALA H  4 77  ? -16.524 -28.541 29.105 1.00 45.59  ? 74   ALA H N     1 
ATOM   5781  C  CA    . ALA H  4 77  ? -15.939 -29.132 27.917 1.00 45.92  ? 74   ALA H CA    1 
ATOM   5782  C  C     . ALA H  4 77  ? -15.267 -28.046 27.140 1.00 46.58  ? 74   ALA H C     1 
ATOM   5783  O  O     . ALA H  4 77  ? -14.205 -28.246 26.580 1.00 47.00  ? 74   ALA H O     1 
ATOM   5784  C  CB    . ALA H  4 77  ? -16.996 -29.756 27.089 1.00 45.91  ? 74   ALA H CB    1 
ATOM   5785  N  N     . SER H  4 78  ? -15.913 -26.888 27.116 1.00 47.39  ? 75   SER H N     1 
ATOM   5786  C  CA    . SER H  4 78  ? -15.363 -25.682 26.529 1.00 48.08  ? 75   SER H CA    1 
ATOM   5787  C  C     . SER H  4 78  ? -14.012 -25.311 27.168 1.00 48.22  ? 75   SER H C     1 
ATOM   5788  O  O     . SER H  4 78  ? -13.000 -25.230 26.469 1.00 48.53  ? 75   SER H O     1 
ATOM   5789  C  CB    . SER H  4 78  ? -16.383 -24.548 26.664 1.00 48.24  ? 75   SER H CB    1 
ATOM   5790  O  OG    . SER H  4 78  ? -15.820 -23.284 26.346 1.00 50.03  ? 75   SER H OG    1 
ATOM   5791  N  N     . ARG H  4 79  ? -13.987 -25.102 28.482 1.00 48.26  ? 76   ARG H N     1 
ATOM   5792  C  CA    . ARG H  4 79  ? -12.732 -24.776 29.159 1.00 48.68  ? 76   ARG H CA    1 
ATOM   5793  C  C     . ARG H  4 79  ? -11.637 -25.785 28.812 1.00 48.98  ? 76   ARG H C     1 
ATOM   5794  O  O     . ARG H  4 79  ? -10.518 -25.408 28.457 1.00 49.11  ? 76   ARG H O     1 
ATOM   5795  C  CB    . ARG H  4 79  ? -12.916 -24.689 30.675 1.00 48.50  ? 76   ARG H CB    1 
ATOM   5796  C  CG    . ARG H  4 79  ? -13.586 -23.423 31.124 1.00 48.61  ? 76   ARG H CG    1 
ATOM   5797  C  CD    . ARG H  4 79  ? -14.139 -23.527 32.531 1.00 49.48  ? 76   ARG H CD    1 
ATOM   5798  N  NE    . ARG H  4 79  ? -15.514 -23.028 32.549 1.00 51.14  ? 76   ARG H NE    1 
ATOM   5799  C  CZ    . ARG H  4 79  ? -16.569 -23.715 32.986 1.00 51.59  ? 76   ARG H CZ    1 
ATOM   5800  N  NH1   . ARG H  4 79  ? -16.416 -24.937 33.502 1.00 50.71  ? 76   ARG H NH1   1 
ATOM   5801  N  NH2   . ARG H  4 79  ? -17.782 -23.159 32.937 1.00 51.69  ? 76   ARG H NH2   1 
ATOM   5802  N  N     . LEU H  4 80  ? -11.976 -27.064 28.892 1.00 49.19  ? 77   LEU H N     1 
ATOM   5803  C  CA    . LEU H  4 80  ? -11.038 -28.109 28.552 1.00 49.58  ? 77   LEU H CA    1 
ATOM   5804  C  C     . LEU H  4 80  ? -10.344 -27.840 27.226 1.00 49.97  ? 77   LEU H C     1 
ATOM   5805  O  O     . LEU H  4 80  ? -9.110  -27.875 27.142 1.00 49.89  ? 77   LEU H O     1 
ATOM   5806  C  CB    . LEU H  4 80  ? -11.760 -29.448 28.484 1.00 49.57  ? 77   LEU H CB    1 
ATOM   5807  C  CG    . LEU H  4 80  ? -11.717 -30.302 29.743 1.00 49.22  ? 77   LEU H CG    1 
ATOM   5808  C  CD1   . LEU H  4 80  ? -12.573 -31.529 29.554 1.00 49.31  ? 77   LEU H CD1   1 
ATOM   5809  C  CD2   . LEU H  4 80  ? -10.302 -30.710 30.032 1.00 49.08  ? 77   LEU H CD2   1 
ATOM   5810  N  N     . ALA H  4 81  ? -11.149 -27.565 26.202 1.00 50.35  ? 78   ALA H N     1 
ATOM   5811  C  CA    . ALA H  4 81  ? -10.648 -27.330 24.865 1.00 51.07  ? 78   ALA H CA    1 
ATOM   5812  C  C     . ALA H  4 81  ? -9.739  -26.120 24.847 1.00 51.98  ? 78   ALA H C     1 
ATOM   5813  O  O     . ALA H  4 81  ? -8.688  -26.142 24.216 1.00 51.95  ? 78   ALA H O     1 
ATOM   5814  C  CB    . ALA H  4 81  ? -11.785 -27.150 23.904 1.00 50.81  ? 78   ALA H CB    1 
ATOM   5815  N  N     . HIS H  4 82  ? -10.131 -25.071 25.559 1.00 53.29  ? 79   HIS H N     1 
ATOM   5816  C  CA    . HIS H  4 82  ? -9.323  -23.862 25.586 1.00 54.87  ? 79   HIS H CA    1 
ATOM   5817  C  C     . HIS H  4 82  ? -8.003  -24.092 26.287 1.00 54.74  ? 79   HIS H C     1 
ATOM   5818  O  O     . HIS H  4 82  ? -6.964  -23.705 25.771 1.00 54.64  ? 79   HIS H O     1 
ATOM   5819  C  CB    . HIS H  4 82  ? -10.081 -22.680 26.193 1.00 55.74  ? 79   HIS H CB    1 
ATOM   5820  C  CG    . HIS H  4 82  ? -11.008 -22.002 25.224 1.00 59.77  ? 79   HIS H CG    1 
ATOM   5821  N  ND1   . HIS H  4 82  ? -12.373 -22.248 25.193 1.00 63.02  ? 79   HIS H ND1   1 
ATOM   5822  C  CD2   . HIS H  4 82  ? -10.762 -21.104 24.233 1.00 61.98  ? 79   HIS H CD2   1 
ATOM   5823  C  CE1   . HIS H  4 82  ? -12.929 -21.521 24.236 1.00 63.64  ? 79   HIS H CE1   1 
ATOM   5824  N  NE2   . HIS H  4 82  ? -11.974 -20.819 23.638 1.00 64.17  ? 79   HIS H NE2   1 
ATOM   5825  N  N     . TYR H  4 83  ? -8.041  -24.743 27.444 1.00 55.07  ? 80   TYR H N     1 
ATOM   5826  C  CA    . TYR H  4 83  ? -6.817  -25.077 28.152 1.00 55.48  ? 80   TYR H CA    1 
ATOM   5827  C  C     . TYR H  4 83  ? -5.867  -25.739 27.191 1.00 55.65  ? 80   TYR H C     1 
ATOM   5828  O  O     . TYR H  4 83  ? -4.723  -25.333 27.084 1.00 56.10  ? 80   TYR H O     1 
ATOM   5829  C  CB    . TYR H  4 83  ? -7.082  -25.998 29.337 1.00 55.72  ? 80   TYR H CB    1 
ATOM   5830  C  CG    . TYR H  4 83  ? -7.968  -25.387 30.404 1.00 56.93  ? 80   TYR H CG    1 
ATOM   5831  C  CD1   . TYR H  4 83  ? -8.186  -24.005 30.454 1.00 57.04  ? 80   TYR H CD1   1 
ATOM   5832  C  CD2   . TYR H  4 83  ? -8.572  -26.182 31.382 1.00 57.04  ? 80   TYR H CD2   1 
ATOM   5833  C  CE1   . TYR H  4 83  ? -8.988  -23.443 31.419 1.00 56.18  ? 80   TYR H CE1   1 
ATOM   5834  C  CE2   . TYR H  4 83  ? -9.370  -25.615 32.363 1.00 56.45  ? 80   TYR H CE2   1 
ATOM   5835  C  CZ    . TYR H  4 83  ? -9.572  -24.245 32.369 1.00 56.12  ? 80   TYR H CZ    1 
ATOM   5836  O  OH    . TYR H  4 83  ? -10.360 -23.657 33.329 1.00 56.98  ? 80   TYR H OH    1 
ATOM   5837  N  N     . ASN H  4 84  ? -6.357  -26.726 26.452 1.00 55.80  ? 81   ASN H N     1 
ATOM   5838  C  CA    . ASN H  4 84  ? -5.517  -27.453 25.518 1.00 55.89  ? 81   ASN H CA    1 
ATOM   5839  C  C     . ASN H  4 84  ? -5.447  -26.891 24.104 1.00 56.23  ? 81   ASN H C     1 
ATOM   5840  O  O     . ASN H  4 84  ? -5.113  -27.614 23.172 1.00 56.14  ? 81   ASN H O     1 
ATOM   5841  C  CB    . ASN H  4 84  ? -5.941  -28.903 25.492 1.00 55.85  ? 81   ASN H CB    1 
ATOM   5842  C  CG    . ASN H  4 84  ? -5.800  -29.556 26.841 1.00 55.71  ? 81   ASN H CG    1 
ATOM   5843  O  OD1   . ASN H  4 84  ? -4.687  -29.844 27.298 1.00 54.62  ? 81   ASN H OD1   1 
ATOM   5844  N  ND2   . ASN H  4 84  ? -6.934  -29.789 27.499 1.00 55.71  ? 81   ASN H ND2   1 
ATOM   5845  N  N     . LYS H  4 85  ? -5.751  -25.602 23.955 1.00 56.73  ? 82   LYS H N     1 
ATOM   5846  C  CA    . LYS H  4 85  ? -5.581  -24.885 22.692 1.00 57.15  ? 82   LYS H CA    1 
ATOM   5847  C  C     . LYS H  4 85  ? -6.219  -25.632 21.530 1.00 57.10  ? 82   LYS H C     1 
ATOM   5848  O  O     . LYS H  4 85  ? -5.597  -25.839 20.495 1.00 57.46  ? 82   LYS H O     1 
ATOM   5849  C  CB    . LYS H  4 85  ? -4.090  -24.670 22.403 1.00 57.51  ? 82   LYS H CB    1 
ATOM   5850  C  CG    . LYS H  4 85  ? -3.398  -23.640 23.275 1.00 59.14  ? 82   LYS H CG    1 
ATOM   5851  C  CD    . LYS H  4 85  ? -1.907  -23.978 23.436 1.00 62.27  ? 82   LYS H CD    1 
ATOM   5852  C  CE    . LYS H  4 85  ? -1.133  -22.891 24.195 1.00 63.49  ? 82   LYS H CE    1 
ATOM   5853  N  NZ    . LYS H  4 85  ? -1.752  -22.579 25.523 1.00 65.08  ? 82   LYS H NZ    1 
ATOM   5854  N  N     . ARG H  4 86  ? -7.455  -26.061 21.704 1.00 57.09  ? 83   ARG H N     1 
ATOM   5855  C  CA    . ARG H  4 86  ? -8.140  -26.780 20.649 1.00 56.99  ? 83   ARG H CA    1 
ATOM   5856  C  C     . ARG H  4 86  ? -9.381  -26.003 20.253 1.00 56.79  ? 83   ARG H C     1 
ATOM   5857  O  O     . ARG H  4 86  ? -10.051 -25.413 21.095 1.00 56.67  ? 83   ARG H O     1 
ATOM   5858  C  CB    . ARG H  4 86  ? -8.511  -28.184 21.116 1.00 57.21  ? 83   ARG H CB    1 
ATOM   5859  C  CG    . ARG H  4 86  ? -7.339  -29.035 21.566 1.00 58.21  ? 83   ARG H CG    1 
ATOM   5860  C  CD    . ARG H  4 86  ? -6.663  -29.707 20.401 1.00 60.79  ? 83   ARG H CD    1 
ATOM   5861  N  NE    . ARG H  4 86  ? -5.542  -30.543 20.832 1.00 63.76  ? 83   ARG H NE    1 
ATOM   5862  C  CZ    . ARG H  4 86  ? -4.256  -30.249 20.628 1.00 65.47  ? 83   ARG H CZ    1 
ATOM   5863  N  NH1   . ARG H  4 86  ? -3.906  -29.134 19.990 1.00 66.30  ? 83   ARG H NH1   1 
ATOM   5864  N  NH2   . ARG H  4 86  ? -3.308  -31.075 21.056 1.00 66.37  ? 83   ARG H NH2   1 
ATOM   5865  N  N     . SER H  4 87  ? -9.682  -25.992 18.966 1.00 56.81  ? 84   SER H N     1 
ATOM   5866  C  CA    . SER H  4 87  ? -10.830 -25.238 18.483 1.00 57.04  ? 84   SER H CA    1 
ATOM   5867  C  C     . SER H  4 87  ? -12.082 -26.108 18.341 1.00 56.93  ? 84   SER H C     1 
ATOM   5868  O  O     . SER H  4 87  ? -13.152 -25.613 17.998 1.00 57.13  ? 84   SER H O     1 
ATOM   5869  C  CB    . SER H  4 87  ? -10.489 -24.490 17.182 1.00 57.28  ? 84   SER H CB    1 
ATOM   5870  O  OG    . SER H  4 87  ? -9.445  -25.128 16.448 1.00 57.35  ? 84   SER H OG    1 
ATOM   5871  N  N     . THR H  4 88  ? -11.946 -27.395 18.644 1.00 56.71  ? 85   THR H N     1 
ATOM   5872  C  CA    . THR H  4 88  ? -13.044 -28.346 18.504 1.00 56.57  ? 85   THR H CA    1 
ATOM   5873  C  C     . THR H  4 88  ? -13.407 -29.067 19.818 1.00 56.22  ? 85   THR H C     1 
ATOM   5874  O  O     . THR H  4 88  ? -12.550 -29.706 20.452 1.00 56.34  ? 85   THR H O     1 
ATOM   5875  C  CB    . THR H  4 88  ? -12.699 -29.409 17.440 1.00 56.73  ? 85   THR H CB    1 
ATOM   5876  O  OG1   . THR H  4 88  ? -12.001 -28.785 16.356 1.00 57.35  ? 85   THR H OG1   1 
ATOM   5877  C  CG2   . THR H  4 88  ? -13.968 -30.097 16.920 1.00 56.68  ? 85   THR H CG2   1 
ATOM   5878  N  N     . ILE H  4 89  ? -14.678 -28.969 20.211 1.00 55.40  ? 86   ILE H N     1 
ATOM   5879  C  CA    . ILE H  4 89  ? -15.216 -29.810 21.269 1.00 54.77  ? 86   ILE H CA    1 
ATOM   5880  C  C     . ILE H  4 89  ? -15.643 -31.145 20.662 1.00 54.67  ? 86   ILE H C     1 
ATOM   5881  O  O     . ILE H  4 89  ? -16.553 -31.191 19.834 1.00 54.83  ? 86   ILE H O     1 
ATOM   5882  C  CB    . ILE H  4 89  ? -16.410 -29.153 21.963 1.00 54.69  ? 86   ILE H CB    1 
ATOM   5883  C  CG1   . ILE H  4 89  ? -15.933 -28.008 22.843 1.00 54.60  ? 86   ILE H CG1   1 
ATOM   5884  C  CG2   . ILE H  4 89  ? -17.166 -30.173 22.820 1.00 54.60  ? 86   ILE H CG2   1 
ATOM   5885  C  CD1   . ILE H  4 89  ? -17.032 -27.090 23.272 1.00 54.27  ? 86   ILE H CD1   1 
ATOM   5886  N  N     . THR H  4 90  ? -14.968 -32.222 21.063 1.00 54.33  ? 87   THR H N     1 
ATOM   5887  C  CA    . THR H  4 90  ? -15.281 -33.571 20.593 1.00 53.66  ? 87   THR H CA    1 
ATOM   5888  C  C     . THR H  4 90  ? -15.981 -34.339 21.700 1.00 53.71  ? 87   THR H C     1 
ATOM   5889  O  O     . THR H  4 90  ? -16.231 -33.798 22.766 1.00 54.13  ? 87   THR H O     1 
ATOM   5890  C  CB    . THR H  4 90  ? -14.018 -34.345 20.237 1.00 53.32  ? 87   THR H CB    1 
ATOM   5891  O  OG1   . THR H  4 90  ? -13.310 -34.652 21.442 1.00 52.87  ? 87   THR H OG1   1 
ATOM   5892  C  CG2   . THR H  4 90  ? -13.141 -33.534 19.328 1.00 52.61  ? 87   THR H CG2   1 
ATOM   5893  N  N     . SER H  4 91  ? -16.287 -35.604 21.444 1.00 53.57  ? 88   SER H N     1 
ATOM   5894  C  CA    . SER H  4 91  ? -16.835 -36.501 22.459 1.00 53.53  ? 88   SER H CA    1 
ATOM   5895  C  C     . SER H  4 91  ? -15.838 -36.742 23.618 1.00 53.21  ? 88   SER H C     1 
ATOM   5896  O  O     . SER H  4 91  ? -16.234 -36.928 24.782 1.00 53.06  ? 88   SER H O     1 
ATOM   5897  C  CB    . SER H  4 91  ? -17.235 -37.821 21.803 1.00 53.58  ? 88   SER H CB    1 
ATOM   5898  O  OG    . SER H  4 91  ? -16.271 -38.175 20.819 1.00 54.46  ? 88   SER H OG    1 
ATOM   5899  N  N     . ARG H  4 92  ? -14.547 -36.717 23.301 1.00 52.53  ? 89   ARG H N     1 
ATOM   5900  C  CA    . ARG H  4 92  ? -13.531 -36.854 24.329 1.00 51.96  ? 89   ARG H CA    1 
ATOM   5901  C  C     . ARG H  4 92  ? -13.665 -35.776 25.405 1.00 51.27  ? 89   ARG H C     1 
ATOM   5902  O  O     . ARG H  4 92  ? -13.539 -36.059 26.599 1.00 50.86  ? 89   ARG H O     1 
ATOM   5903  C  CB    . ARG H  4 92  ? -12.145 -36.816 23.706 1.00 52.15  ? 89   ARG H CB    1 
ATOM   5904  C  CG    . ARG H  4 92  ? -11.073 -37.160 24.689 1.00 53.37  ? 89   ARG H CG    1 
ATOM   5905  C  CD    . ARG H  4 92  ? -9.802  -37.526 24.001 1.00 55.83  ? 89   ARG H CD    1 
ATOM   5906  N  NE    . ARG H  4 92  ? -8.805  -37.859 25.010 1.00 57.60  ? 89   ARG H NE    1 
ATOM   5907  C  CZ    . ARG H  4 92  ? -7.716  -37.139 25.239 1.00 58.12  ? 89   ARG H CZ    1 
ATOM   5908  N  NH1   . ARG H  4 92  ? -7.479  -36.058 24.499 1.00 58.58  ? 89   ARG H NH1   1 
ATOM   5909  N  NH2   . ARG H  4 92  ? -6.861  -37.514 26.186 1.00 58.33  ? 89   ARG H NH2   1 
ATOM   5910  N  N     . GLU H  4 93  ? -13.919 -34.547 24.963 1.00 50.65  ? 90   GLU H N     1 
ATOM   5911  C  CA    . GLU H  4 93  ? -14.120 -33.419 25.861 1.00 50.17  ? 90   GLU H CA    1 
ATOM   5912  C  C     . GLU H  4 93  ? -15.366 -33.581 26.707 1.00 49.82  ? 90   GLU H C     1 
ATOM   5913  O  O     . GLU H  4 93  ? -15.341 -33.289 27.903 1.00 49.95  ? 90   GLU H O     1 
ATOM   5914  C  CB    . GLU H  4 93  ? -14.202 -32.109 25.087 1.00 50.29  ? 90   GLU H CB    1 
ATOM   5915  C  CG    . GLU H  4 93  ? -12.852 -31.485 24.789 1.00 50.97  ? 90   GLU H CG    1 
ATOM   5916  C  CD    . GLU H  4 93  ? -12.123 -32.194 23.672 1.00 51.86  ? 90   GLU H CD    1 
ATOM   5917  O  OE1   . GLU H  4 93  ? -12.741 -32.417 22.611 1.00 52.04  ? 90   GLU H OE1   1 
ATOM   5918  O  OE2   . GLU H  4 93  ? -10.934 -32.530 23.856 1.00 52.64  ? 90   GLU H OE2   1 
ATOM   5919  N  N     . ILE H  4 94  ? -16.449 -34.050 26.092 1.00 49.20  ? 91   ILE H N     1 
ATOM   5920  C  CA    . ILE H  4 94  ? -17.680 -34.341 26.821 1.00 48.63  ? 91   ILE H CA    1 
ATOM   5921  C  C     . ILE H  4 94  ? -17.456 -35.420 27.876 1.00 48.45  ? 91   ILE H C     1 
ATOM   5922  O  O     . ILE H  4 94  ? -18.100 -35.412 28.921 1.00 48.29  ? 91   ILE H O     1 
ATOM   5923  C  CB    . ILE H  4 94  ? -18.815 -34.794 25.881 1.00 48.64  ? 91   ILE H CB    1 
ATOM   5924  C  CG1   . ILE H  4 94  ? -19.115 -33.726 24.822 1.00 48.41  ? 91   ILE H CG1   1 
ATOM   5925  C  CG2   . ILE H  4 94  ? -20.081 -35.181 26.682 1.00 48.46  ? 91   ILE H CG2   1 
ATOM   5926  C  CD1   . ILE H  4 94  ? -19.631 -32.399 25.373 1.00 48.24  ? 91   ILE H CD1   1 
ATOM   5927  N  N     . GLN H  4 95  ? -16.543 -36.344 27.595 1.00 48.20  ? 92   GLN H N     1 
ATOM   5928  C  CA    . GLN H  4 95  ? -16.273 -37.433 28.510 1.00 48.01  ? 92   GLN H CA    1 
ATOM   5929  C  C     . GLN H  4 95  ? -15.520 -36.943 29.738 1.00 47.68  ? 92   GLN H C     1 
ATOM   5930  O  O     . GLN H  4 95  ? -15.963 -37.171 30.862 1.00 47.82  ? 92   GLN H O     1 
ATOM   5931  C  CB    . GLN H  4 95  ? -15.500 -38.541 27.809 1.00 48.25  ? 92   GLN H CB    1 
ATOM   5932  C  CG    . GLN H  4 95  ? -15.256 -39.768 28.681 1.00 49.25  ? 92   GLN H CG    1 
ATOM   5933  C  CD    . GLN H  4 95  ? -14.795 -40.975 27.876 1.00 50.62  ? 92   GLN H CD    1 
ATOM   5934  O  OE1   . GLN H  4 95  ? -13.588 -41.222 27.754 1.00 51.19  ? 92   GLN H OE1   1 
ATOM   5935  N  NE2   . GLN H  4 95  ? -15.753 -41.724 27.307 1.00 49.56  ? 92   GLN H NE2   1 
ATOM   5936  N  N     . THR H  4 96  ? -14.395 -36.266 29.520 1.00 47.17  ? 93   THR H N     1 
ATOM   5937  C  CA    . THR H  4 96  ? -13.609 -35.716 30.613 1.00 46.86  ? 93   THR H CA    1 
ATOM   5938  C  C     . THR H  4 96  ? -14.479 -34.767 31.408 1.00 46.97  ? 93   THR H C     1 
ATOM   5939  O  O     . THR H  4 96  ? -14.457 -34.788 32.645 1.00 47.31  ? 93   THR H O     1 
ATOM   5940  C  CB    . THR H  4 96  ? -12.411 -34.929 30.111 1.00 46.76  ? 93   THR H CB    1 
ATOM   5941  O  OG1   . THR H  4 96  ? -11.808 -35.626 29.024 1.00 47.67  ? 93   THR H OG1   1 
ATOM   5942  C  CG2   . THR H  4 96  ? -11.404 -34.750 31.197 1.00 46.35  ? 93   THR H CG2   1 
ATOM   5943  N  N     . ALA H  4 97  ? -15.252 -33.942 30.699 1.00 46.73  ? 94   ALA H N     1 
ATOM   5944  C  CA    . ALA H  4 97  ? -16.188 -33.030 31.355 1.00 46.67  ? 94   ALA H CA    1 
ATOM   5945  C  C     . ALA H  4 97  ? -17.078 -33.772 32.346 1.00 46.79  ? 94   ALA H C     1 
ATOM   5946  O  O     . ALA H  4 97  ? -17.236 -33.333 33.487 1.00 47.15  ? 94   ALA H O     1 
ATOM   5947  C  CB    . ALA H  4 97  ? -17.031 -32.286 30.345 1.00 46.39  ? 94   ALA H CB    1 
ATOM   5948  N  N     . VAL H  4 98  ? -17.640 -34.903 31.915 1.00 46.70  ? 95   VAL H N     1 
ATOM   5949  C  CA    . VAL H  4 98  ? -18.531 -35.684 32.762 1.00 46.64  ? 95   VAL H CA    1 
ATOM   5950  C  C     . VAL H  4 98  ? -17.769 -36.220 33.970 1.00 46.84  ? 95   VAL H C     1 
ATOM   5951  O  O     . VAL H  4 98  ? -18.269 -36.209 35.103 1.00 46.49  ? 95   VAL H O     1 
ATOM   5952  C  CB    . VAL H  4 98  ? -19.196 -36.834 31.986 1.00 46.44  ? 95   VAL H CB    1 
ATOM   5953  C  CG1   . VAL H  4 98  ? -19.856 -37.792 32.934 1.00 46.23  ? 95   VAL H CG1   1 
ATOM   5954  C  CG2   . VAL H  4 98  ? -20.239 -36.295 31.032 1.00 46.61  ? 95   VAL H CG2   1 
ATOM   5955  N  N     . ARG H  4 99  ? -16.547 -36.666 33.718 1.00 47.07  ? 96   ARG H N     1 
ATOM   5956  C  CA    . ARG H  4 99  ? -15.735 -37.229 34.768 1.00 47.53  ? 96   ARG H CA    1 
ATOM   5957  C  C     . ARG H  4 99  ? -15.508 -36.184 35.840 1.00 47.50  ? 96   ARG H C     1 
ATOM   5958  O  O     . ARG H  4 99  ? -15.698 -36.452 37.029 1.00 47.62  ? 96   ARG H O     1 
ATOM   5959  C  CB    . ARG H  4 99  ? -14.423 -37.765 34.204 1.00 47.72  ? 96   ARG H CB    1 
ATOM   5960  C  CG    . ARG H  4 99  ? -14.598 -39.077 33.474 1.00 49.31  ? 96   ARG H CG    1 
ATOM   5961  C  CD    . ARG H  4 99  ? -13.354 -39.943 33.551 1.00 53.84  ? 96   ARG H CD    1 
ATOM   5962  N  NE    . ARG H  4 99  ? -13.561 -41.179 32.792 1.00 58.66  ? 96   ARG H NE    1 
ATOM   5963  C  CZ    . ARG H  4 99  ? -13.074 -41.418 31.567 1.00 60.77  ? 96   ARG H CZ    1 
ATOM   5964  N  NH1   . ARG H  4 99  ? -12.313 -40.516 30.935 1.00 61.19  ? 96   ARG H NH1   1 
ATOM   5965  N  NH2   . ARG H  4 99  ? -13.343 -42.575 30.968 1.00 60.79  ? 96   ARG H NH2   1 
ATOM   5966  N  N     . LEU H  4 100 ? -15.153 -34.982 35.399 1.00 47.48  ? 97   LEU H N     1 
ATOM   5967  C  CA    . LEU H  4 100 ? -14.958 -33.848 36.285 1.00 47.50  ? 97   LEU H CA    1 
ATOM   5968  C  C     . LEU H  4 100 ? -16.212 -33.405 37.031 1.00 47.86  ? 97   LEU H C     1 
ATOM   5969  O  O     . LEU H  4 100 ? -16.135 -32.903 38.146 1.00 47.94  ? 97   LEU H O     1 
ATOM   5970  C  CB    . LEU H  4 100 ? -14.435 -32.675 35.481 1.00 47.27  ? 97   LEU H CB    1 
ATOM   5971  C  CG    . LEU H  4 100 ? -12.982 -32.749 35.034 1.00 47.49  ? 97   LEU H CG    1 
ATOM   5972  C  CD1   . LEU H  4 100 ? -12.682 -31.599 34.072 1.00 47.28  ? 97   LEU H CD1   1 
ATOM   5973  C  CD2   . LEU H  4 100 ? -12.057 -32.713 36.254 1.00 47.39  ? 97   LEU H CD2   1 
ATOM   5974  N  N     . LEU H  4 101 ? -17.371 -33.599 36.423 1.00 48.47  ? 98   LEU H N     1 
ATOM   5975  C  CA    . LEU H  4 101 ? -18.589 -32.984 36.927 1.00 49.18  ? 98   LEU H CA    1 
ATOM   5976  C  C     . LEU H  4 101 ? -19.561 -33.897 37.720 1.00 49.23  ? 98   LEU H C     1 
ATOM   5977  O  O     . LEU H  4 101 ? -20.277 -33.434 38.616 1.00 49.12  ? 98   LEU H O     1 
ATOM   5978  C  CB    . LEU H  4 101 ? -19.317 -32.313 35.767 1.00 49.42  ? 98   LEU H CB    1 
ATOM   5979  C  CG    . LEU H  4 101 ? -20.357 -31.317 36.272 1.00 51.15  ? 98   LEU H CG    1 
ATOM   5980  C  CD1   . LEU H  4 101 ? -19.766 -29.885 36.223 1.00 53.72  ? 98   LEU H CD1   1 
ATOM   5981  C  CD2   . LEU H  4 101 ? -21.575 -31.456 35.410 1.00 53.50  ? 98   LEU H CD2   1 
ATOM   5982  N  N     . LEU H  4 102 ? -19.608 -35.184 37.390 1.00 49.29  ? 99   LEU H N     1 
ATOM   5983  C  CA    . LEU H  4 102 ? -20.568 -36.061 38.054 1.00 49.23  ? 99   LEU H CA    1 
ATOM   5984  C  C     . LEU H  4 102 ? -19.922 -36.912 39.143 1.00 49.80  ? 99   LEU H C     1 
ATOM   5985  O  O     . LEU H  4 102 ? -18.769 -37.338 39.019 1.00 49.68  ? 99   LEU H O     1 
ATOM   5986  C  CB    . LEU H  4 102 ? -21.344 -36.925 37.053 1.00 48.79  ? 99   LEU H CB    1 
ATOM   5987  C  CG    . LEU H  4 102 ? -21.924 -36.258 35.804 1.00 47.73  ? 99   LEU H CG    1 
ATOM   5988  C  CD1   . LEU H  4 102 ? -22.751 -37.239 35.053 1.00 47.89  ? 99   LEU H CD1   1 
ATOM   5989  C  CD2   . LEU H  4 102 ? -22.779 -35.073 36.136 1.00 47.77  ? 99   LEU H CD2   1 
ATOM   5990  N  N     . PRO H  4 103 ? -20.649 -37.095 40.253 1.00 50.42  ? 100  PRO H N     1 
ATOM   5991  C  CA    . PRO H  4 103 ? -20.316 -37.991 41.338 1.00 50.93  ? 100  PRO H CA    1 
ATOM   5992  C  C     . PRO H  4 103 ? -19.958 -39.374 40.839 1.00 51.75  ? 100  PRO H C     1 
ATOM   5993  O  O     . PRO H  4 103 ? -20.650 -39.917 39.976 1.00 51.66  ? 100  PRO H O     1 
ATOM   5994  C  CB    . PRO H  4 103 ? -21.605 -38.028 42.134 1.00 50.71  ? 100  PRO H CB    1 
ATOM   5995  C  CG    . PRO H  4 103 ? -22.122 -36.658 41.992 1.00 50.44  ? 100  PRO H CG    1 
ATOM   5996  C  CD    . PRO H  4 103 ? -21.867 -36.322 40.559 1.00 50.59  ? 100  PRO H CD    1 
ATOM   5997  N  N     . GLY H  4 104 ? -18.872 -39.919 41.394 1.00 52.69  ? 101  GLY H N     1 
ATOM   5998  C  CA    . GLY H  4 104 ? -18.261 -41.178 40.950 1.00 53.66  ? 101  GLY H CA    1 
ATOM   5999  C  C     . GLY H  4 104 ? -19.141 -42.137 40.164 1.00 54.20  ? 101  GLY H C     1 
ATOM   6000  O  O     . GLY H  4 104 ? -18.947 -42.331 38.959 1.00 54.41  ? 101  GLY H O     1 
ATOM   6001  N  N     . GLU H  4 105 ? -20.116 -42.725 40.847 1.00 54.49  ? 102  GLU H N     1 
ATOM   6002  C  CA    . GLU H  4 105 ? -20.893 -43.815 40.281 1.00 55.43  ? 102  GLU H CA    1 
ATOM   6003  C  C     . GLU H  4 105 ? -21.810 -43.339 39.154 1.00 55.25  ? 102  GLU H C     1 
ATOM   6004  O  O     . GLU H  4 105 ? -22.003 -44.032 38.159 1.00 55.27  ? 102  GLU H O     1 
ATOM   6005  C  CB    . GLU H  4 105 ? -21.680 -44.520 41.393 1.00 55.81  ? 102  GLU H CB    1 
ATOM   6006  C  CG    . GLU H  4 105 ? -22.309 -45.852 40.997 1.00 58.74  ? 102  GLU H CG    1 
ATOM   6007  C  CD    . GLU H  4 105 ? -21.291 -46.959 40.745 1.00 62.39  ? 102  GLU H CD    1 
ATOM   6008  O  OE1   . GLU H  4 105 ? -20.137 -46.878 41.252 1.00 63.33  ? 102  GLU H OE1   1 
ATOM   6009  O  OE2   . GLU H  4 105 ? -21.668 -47.922 40.038 1.00 64.06  ? 102  GLU H OE2   1 
ATOM   6010  N  N     . LEU H  4 106 ? -22.361 -42.144 39.330 1.00 55.32  ? 103  LEU H N     1 
ATOM   6011  C  CA    . LEU H  4 106 ? -23.212 -41.503 38.343 1.00 55.34  ? 103  LEU H CA    1 
ATOM   6012  C  C     . LEU H  4 106 ? -22.374 -41.216 37.094 1.00 55.99  ? 103  LEU H C     1 
ATOM   6013  O  O     . LEU H  4 106 ? -22.841 -41.371 35.964 1.00 55.88  ? 103  LEU H O     1 
ATOM   6014  C  CB    . LEU H  4 106 ? -23.752 -40.208 38.954 1.00 54.91  ? 103  LEU H CB    1 
ATOM   6015  C  CG    . LEU H  4 106 ? -25.145 -39.611 38.733 1.00 54.20  ? 103  LEU H CG    1 
ATOM   6016  C  CD1   . LEU H  4 106 ? -26.246 -40.624 38.360 1.00 53.51  ? 103  LEU H CD1   1 
ATOM   6017  C  CD2   . LEU H  4 106 ? -25.521 -38.836 39.992 1.00 52.51  ? 103  LEU H CD2   1 
ATOM   6018  N  N     . ALA H  4 107 ? -21.117 -40.827 37.321 1.00 56.80  ? 104  ALA H N     1 
ATOM   6019  C  CA    . ALA H  4 107 ? -20.152 -40.558 36.255 1.00 57.41  ? 104  ALA H CA    1 
ATOM   6020  C  C     . ALA H  4 107 ? -19.817 -41.817 35.481 1.00 58.03  ? 104  ALA H C     1 
ATOM   6021  O  O     . ALA H  4 107 ? -19.761 -41.799 34.251 1.00 58.26  ? 104  ALA H O     1 
ATOM   6022  C  CB    . ALA H  4 107 ? -18.886 -39.950 36.827 1.00 57.25  ? 104  ALA H CB    1 
ATOM   6023  N  N     . LYS H  4 108 ? -19.595 -42.908 36.206 1.00 58.74  ? 105  LYS H N     1 
ATOM   6024  C  CA    . LYS H  4 108 ? -19.199 -44.160 35.582 1.00 59.88  ? 105  LYS H CA    1 
ATOM   6025  C  C     . LYS H  4 108 ? -20.235 -44.594 34.540 1.00 59.56  ? 105  LYS H C     1 
ATOM   6026  O  O     . LYS H  4 108 ? -19.888 -44.810 33.370 1.00 59.65  ? 105  LYS H O     1 
ATOM   6027  C  CB    . LYS H  4 108 ? -18.967 -45.235 36.642 1.00 59.85  ? 105  LYS H CB    1 
ATOM   6028  C  CG    . LYS H  4 108 ? -18.288 -46.499 36.101 1.00 61.68  ? 105  LYS H CG    1 
ATOM   6029  C  CD    . LYS H  4 108 ? -18.112 -47.603 37.180 1.00 61.94  ? 105  LYS H CD    1 
ATOM   6030  C  CE    . LYS H  4 108 ? -19.450 -48.123 37.749 1.00 64.62  ? 105  LYS H CE    1 
ATOM   6031  N  NZ    . LYS H  4 108 ? -20.495 -48.421 36.701 1.00 65.81  ? 105  LYS H NZ    1 
ATOM   6032  N  N     . HIS H  4 109 ? -21.498 -44.672 34.965 1.00 59.30  ? 106  HIS H N     1 
ATOM   6033  C  CA    . HIS H  4 109 ? -22.627 -45.006 34.085 1.00 59.22  ? 106  HIS H CA    1 
ATOM   6034  C  C     . HIS H  4 109 ? -22.822 -44.035 32.933 1.00 58.50  ? 106  HIS H C     1 
ATOM   6035  O  O     . HIS H  4 109 ? -23.258 -44.426 31.854 1.00 58.62  ? 106  HIS H O     1 
ATOM   6036  C  CB    . HIS H  4 109 ? -23.921 -45.063 34.881 1.00 59.49  ? 106  HIS H CB    1 
ATOM   6037  C  CG    . HIS H  4 109 ? -24.034 -46.274 35.744 1.00 61.62  ? 106  HIS H CG    1 
ATOM   6038  N  ND1   . HIS H  4 109 ? -24.977 -47.255 35.525 1.00 63.69  ? 106  HIS H ND1   1 
ATOM   6039  C  CD2   . HIS H  4 109 ? -23.309 -46.676 36.815 1.00 63.22  ? 106  HIS H CD2   1 
ATOM   6040  C  CE1   . HIS H  4 109 ? -24.837 -48.204 36.435 1.00 64.48  ? 106  HIS H CE1   1 
ATOM   6041  N  NE2   . HIS H  4 109 ? -23.830 -47.878 37.228 1.00 64.18  ? 106  HIS H NE2   1 
ATOM   6042  N  N     . ALA H  4 110 ? -22.518 -42.767 33.174 1.00 57.57  ? 107  ALA H N     1 
ATOM   6043  C  CA    . ALA H  4 110 ? -22.690 -41.756 32.160 1.00 56.61  ? 107  ALA H CA    1 
ATOM   6044  C  C     . ALA H  4 110 ? -21.718 -42.006 31.024 1.00 56.32  ? 107  ALA H C     1 
ATOM   6045  O  O     . ALA H  4 110 ? -22.100 -41.933 29.856 1.00 56.17  ? 107  ALA H O     1 
ATOM   6046  C  CB    . ALA H  4 110 ? -22.496 -40.400 32.747 1.00 56.39  ? 107  ALA H CB    1 
ATOM   6047  N  N     . VAL H  4 111 ? -20.470 -42.324 31.366 1.00 56.02  ? 108  VAL H N     1 
ATOM   6048  C  CA    . VAL H  4 111 ? -19.444 -42.587 30.355 1.00 55.71  ? 108  VAL H CA    1 
ATOM   6049  C  C     . VAL H  4 111 ? -19.820 -43.831 29.554 1.00 56.05  ? 108  VAL H C     1 
ATOM   6050  O  O     . VAL H  4 111 ? -19.702 -43.865 28.323 1.00 55.99  ? 108  VAL H O     1 
ATOM   6051  C  CB    . VAL H  4 111 ? -18.064 -42.735 30.987 1.00 55.30  ? 108  VAL H CB    1 
ATOM   6052  C  CG1   . VAL H  4 111 ? -17.013 -42.948 29.929 1.00 54.46  ? 108  VAL H CG1   1 
ATOM   6053  C  CG2   . VAL H  4 111 ? -17.745 -41.493 31.757 1.00 55.21  ? 108  VAL H CG2   1 
ATOM   6054  N  N     . SER H  4 112 ? -20.303 -44.836 30.274 1.00 56.32  ? 109  SER H N     1 
ATOM   6055  C  CA    . SER H  4 112 ? -20.800 -46.059 29.687 1.00 56.58  ? 109  SER H CA    1 
ATOM   6056  C  C     . SER H  4 112 ? -21.910 -45.771 28.672 1.00 57.00  ? 109  SER H C     1 
ATOM   6057  O  O     . SER H  4 112 ? -21.825 -46.207 27.527 1.00 57.22  ? 109  SER H O     1 
ATOM   6058  C  CB    . SER H  4 112 ? -21.266 -46.981 30.806 1.00 56.44  ? 109  SER H CB    1 
ATOM   6059  O  OG    . SER H  4 112 ? -22.492 -47.623 30.475 1.00 56.92  ? 109  SER H OG    1 
ATOM   6060  N  N     . GLU H  4 113 ? -22.927 -45.015 29.081 1.00 57.52  ? 110  GLU H N     1 
ATOM   6061  C  CA    . GLU H  4 113 ? -24.022 -44.628 28.189 1.00 58.27  ? 110  GLU H CA    1 
ATOM   6062  C  C     . GLU H  4 113 ? -23.528 -43.803 27.019 1.00 58.54  ? 110  GLU H C     1 
ATOM   6063  O  O     . GLU H  4 113 ? -24.054 -43.878 25.906 1.00 58.52  ? 110  GLU H O     1 
ATOM   6064  C  CB    . GLU H  4 113 ? -25.051 -43.795 28.944 1.00 58.47  ? 110  GLU H CB    1 
ATOM   6065  C  CG    . GLU H  4 113 ? -25.937 -44.589 29.864 1.00 60.20  ? 110  GLU H CG    1 
ATOM   6066  C  CD    . GLU H  4 113 ? -26.652 -45.711 29.144 1.00 62.60  ? 110  GLU H CD    1 
ATOM   6067  O  OE1   . GLU H  4 113 ? -27.289 -45.441 28.102 1.00 63.72  ? 110  GLU H OE1   1 
ATOM   6068  O  OE2   . GLU H  4 113 ? -26.569 -46.865 29.621 1.00 63.83  ? 110  GLU H OE2   1 
ATOM   6069  N  N     . GLY H  4 114 ? -22.517 -42.996 27.297 1.00 59.02  ? 111  GLY H N     1 
ATOM   6070  C  CA    . GLY H  4 114 ? -21.951 -42.107 26.307 1.00 59.46  ? 111  GLY H CA    1 
ATOM   6071  C  C     . GLY H  4 114 ? -21.242 -42.878 25.231 1.00 59.52  ? 111  GLY H C     1 
ATOM   6072  O  O     . GLY H  4 114 ? -21.558 -42.723 24.064 1.00 59.51  ? 111  GLY H O     1 
ATOM   6073  N  N     . THR H  4 115 ? -20.291 -43.719 25.622 1.00 59.97  ? 112  THR H N     1 
ATOM   6074  C  CA    . THR H  4 115 ? -19.537 -44.496 24.647 1.00 60.76  ? 112  THR H CA    1 
ATOM   6075  C  C     . THR H  4 115 ? -20.487 -45.344 23.801 1.00 61.67  ? 112  THR H C     1 
ATOM   6076  O  O     . THR H  4 115 ? -20.298 -45.496 22.588 1.00 61.33  ? 112  THR H O     1 
ATOM   6077  C  CB    . THR H  4 115 ? -18.484 -45.381 25.318 1.00 60.32  ? 112  THR H CB    1 
ATOM   6078  O  OG1   . THR H  4 115 ? -17.776 -44.606 26.287 1.00 59.89  ? 112  THR H OG1   1 
ATOM   6079  C  CG2   . THR H  4 115 ? -17.496 -45.891 24.289 1.00 60.25  ? 112  THR H CG2   1 
ATOM   6080  N  N     . LYS H  4 116 ? -21.526 -45.859 24.452 1.00 62.89  ? 113  LYS H N     1 
ATOM   6081  C  CA    . LYS H  4 116 ? -22.488 -46.718 23.795 1.00 64.27  ? 113  LYS H CA    1 
ATOM   6082  C  C     . LYS H  4 116 ? -23.142 -46.028 22.613 1.00 64.86  ? 113  LYS H C     1 
ATOM   6083  O  O     . LYS H  4 116 ? -23.090 -46.535 21.498 1.00 65.44  ? 113  LYS H O     1 
ATOM   6084  C  CB    . LYS H  4 116 ? -23.557 -47.193 24.773 1.00 64.44  ? 113  LYS H CB    1 
ATOM   6085  C  CG    . LYS H  4 116 ? -24.665 -47.991 24.102 1.00 65.55  ? 113  LYS H CG    1 
ATOM   6086  C  CD    . LYS H  4 116 ? -25.796 -48.264 25.054 1.00 67.46  ? 113  LYS H CD    1 
ATOM   6087  C  CE    . LYS H  4 116 ? -25.437 -49.420 25.966 1.00 68.97  ? 113  LYS H CE    1 
ATOM   6088  N  NZ    . LYS H  4 116 ? -26.622 -49.774 26.783 1.00 71.50  ? 113  LYS H NZ    1 
ATOM   6089  N  N     . ALA H  4 117 ? -23.753 -44.878 22.857 1.00 65.66  ? 114  ALA H N     1 
ATOM   6090  C  CA    . ALA H  4 117 ? -24.464 -44.166 21.810 1.00 66.44  ? 114  ALA H CA    1 
ATOM   6091  C  C     . ALA H  4 117 ? -23.543 -43.683 20.684 1.00 67.16  ? 114  ALA H C     1 
ATOM   6092  O  O     . ALA H  4 117 ? -23.982 -43.542 19.549 1.00 67.33  ? 114  ALA H O     1 
ATOM   6093  C  CB    . ALA H  4 117 ? -25.252 -43.021 22.397 1.00 66.48  ? 114  ALA H CB    1 
ATOM   6094  N  N     . VAL H  4 118 ? -22.273 -43.437 20.992 1.00 68.15  ? 115  VAL H N     1 
ATOM   6095  C  CA    . VAL H  4 118 ? -21.314 -43.005 19.971 1.00 69.27  ? 115  VAL H CA    1 
ATOM   6096  C  C     . VAL H  4 118 ? -20.869 -44.177 19.097 1.00 70.23  ? 115  VAL H C     1 
ATOM   6097  O  O     . VAL H  4 118 ? -20.579 -43.998 17.913 1.00 70.51  ? 115  VAL H O     1 
ATOM   6098  C  CB    . VAL H  4 118 ? -20.112 -42.223 20.584 1.00 69.15  ? 115  VAL H CB    1 
ATOM   6099  C  CG1   . VAL H  4 118 ? -18.859 -42.312 19.714 1.00 68.69  ? 115  VAL H CG1   1 
ATOM   6100  C  CG2   . VAL H  4 118 ? -20.498 -40.772 20.780 1.00 69.34  ? 115  VAL H CG2   1 
ATOM   6101  N  N     . THR H  4 119 ? -20.830 -45.372 19.682 1.00 71.35  ? 116  THR H N     1 
ATOM   6102  C  CA    . THR H  4 119 ? -20.540 -46.581 18.927 1.00 72.36  ? 116  THR H CA    1 
ATOM   6103  C  C     . THR H  4 119 ? -21.725 -46.893 18.036 1.00 73.22  ? 116  THR H C     1 
ATOM   6104  O  O     . THR H  4 119 ? -21.625 -46.805 16.818 1.00 73.20  ? 116  THR H O     1 
ATOM   6105  C  CB    . THR H  4 119 ? -20.238 -47.757 19.850 1.00 72.20  ? 116  THR H CB    1 
ATOM   6106  O  OG1   . THR H  4 119 ? -19.043 -47.475 20.587 1.00 72.52  ? 116  THR H OG1   1 
ATOM   6107  C  CG2   . THR H  4 119 ? -20.031 -49.019 19.047 1.00 72.53  ? 116  THR H CG2   1 
ATOM   6108  N  N     . LYS H  4 120 ? -22.848 -47.230 18.654 1.00 74.61  ? 117  LYS H N     1 
ATOM   6109  C  CA    . LYS H  4 120 ? -24.096 -47.465 17.944 1.00 76.60  ? 117  LYS H CA    1 
ATOM   6110  C  C     . LYS H  4 120 ? -24.309 -46.512 16.744 1.00 77.50  ? 117  LYS H C     1 
ATOM   6111  O  O     . LYS H  4 120 ? -24.816 -46.924 15.692 1.00 77.76  ? 117  LYS H O     1 
ATOM   6112  C  CB    . LYS H  4 120 ? -25.269 -47.402 18.942 1.00 76.83  ? 117  LYS H CB    1 
ATOM   6113  C  CG    . LYS H  4 120 ? -26.679 -47.565 18.342 1.00 78.80  ? 117  LYS H CG    1 
ATOM   6114  C  CD    . LYS H  4 120 ? -27.044 -49.035 18.032 1.00 81.46  ? 117  LYS H CD    1 
ATOM   6115  C  CE    . LYS H  4 120 ? -27.757 -49.177 16.659 1.00 82.61  ? 117  LYS H CE    1 
ATOM   6116  N  NZ    . LYS H  4 120 ? -29.139 -48.561 16.587 1.00 83.74  ? 117  LYS H NZ    1 
ATOM   6117  N  N     . TYR H  4 121 ? -23.901 -45.254 16.905 1.00 78.66  ? 118  TYR H N     1 
ATOM   6118  C  CA    . TYR H  4 121 ? -24.038 -44.235 15.867 1.00 79.87  ? 118  TYR H CA    1 
ATOM   6119  C  C     . TYR H  4 121 ? -23.019 -44.418 14.729 1.00 81.24  ? 118  TYR H C     1 
ATOM   6120  O  O     . TYR H  4 121 ? -23.395 -44.339 13.556 1.00 81.59  ? 118  TYR H O     1 
ATOM   6121  C  CB    . TYR H  4 121 ? -23.928 -42.847 16.507 1.00 79.38  ? 118  TYR H CB    1 
ATOM   6122  C  CG    . TYR H  4 121 ? -23.983 -41.638 15.582 1.00 79.09  ? 118  TYR H CG    1 
ATOM   6123  C  CD1   . TYR H  4 121 ? -25.205 -41.119 15.144 1.00 79.30  ? 118  TYR H CD1   1 
ATOM   6124  C  CD2   . TYR H  4 121 ? -22.813 -40.973 15.194 1.00 78.58  ? 118  TYR H CD2   1 
ATOM   6125  C  CE1   . TYR H  4 121 ? -25.260 -39.984 14.310 1.00 78.93  ? 118  TYR H CE1   1 
ATOM   6126  C  CE2   . TYR H  4 121 ? -22.855 -39.841 14.365 1.00 78.28  ? 118  TYR H CE2   1 
ATOM   6127  C  CZ    . TYR H  4 121 ? -24.080 -39.354 13.930 1.00 78.71  ? 118  TYR H CZ    1 
ATOM   6128  O  OH    . TYR H  4 121 ? -24.130 -38.243 13.119 1.00 78.84  ? 118  TYR H OH    1 
ATOM   6129  N  N     . THR H  4 122 ? -21.746 -44.660 15.068 1.00 82.69  ? 119  THR H N     1 
ATOM   6130  C  CA    . THR H  4 122 ? -20.693 -44.893 14.064 1.00 84.20  ? 119  THR H CA    1 
ATOM   6131  C  C     . THR H  4 122 ? -21.003 -46.133 13.224 1.00 85.53  ? 119  THR H C     1 
ATOM   6132  O  O     . THR H  4 122 ? -20.972 -46.091 11.989 1.00 85.81  ? 119  THR H O     1 
ATOM   6133  C  CB    . THR H  4 122 ? -19.304 -45.084 14.715 1.00 84.06  ? 119  THR H CB    1 
ATOM   6134  O  OG1   . THR H  4 122 ? -19.031 -43.989 15.592 1.00 84.24  ? 119  THR H OG1   1 
ATOM   6135  C  CG2   . THR H  4 122 ? -18.199 -45.173 13.656 1.00 83.91  ? 119  THR H CG2   1 
ATOM   6136  N  N     . SER H  4 123 ? -21.312 -47.230 13.909 1.00 87.03  ? 120  SER H N     1 
ATOM   6137  C  CA    . SER H  4 123 ? -21.637 -48.496 13.266 1.00 88.49  ? 120  SER H CA    1 
ATOM   6138  C  C     . SER H  4 123 ? -22.960 -48.457 12.492 1.00 89.46  ? 120  SER H C     1 
ATOM   6139  O  O     . SER H  4 123 ? -23.302 -49.416 11.800 1.00 89.83  ? 120  SER H O     1 
ATOM   6140  C  CB    . SER H  4 123 ? -21.652 -49.621 14.306 1.00 88.47  ? 120  SER H CB    1 
ATOM   6141  O  OG    . SER H  4 123 ? -20.416 -49.668 15.001 1.00 88.79  ? 120  SER H OG    1 
ATOM   6142  N  N     . ALA H  4 124 ? -23.692 -47.350 12.602 1.00 90.67  ? 121  ALA H N     1 
ATOM   6143  C  CA    . ALA H  4 124 ? -24.933 -47.159 11.846 1.00 91.88  ? 121  ALA H CA    1 
ATOM   6144  C  C     . ALA H  4 124 ? -24.683 -46.669 10.404 1.00 92.72  ? 121  ALA H C     1 
ATOM   6145  O  O     . ALA H  4 124 ? -23.536 -46.337 10.034 1.00 92.85  ? 121  ALA H O     1 
ATOM   6146  C  CB    . ALA H  4 124 ? -25.880 -46.211 12.594 1.00 91.91  ? 121  ALA H CB    1 
ATOM   6147  N  N     . LYS H  4 125 ? -25.770 -46.629 9.612  1.00 93.59  ? 122  LYS H N     1 
ATOM   6148  C  CA    . LYS H  4 125 ? -25.755 -46.246 8.182  1.00 94.28  ? 122  LYS H CA    1 
ATOM   6149  C  C     . LYS H  4 125 ? -25.091 -44.890 7.868  1.00 94.47  ? 122  LYS H C     1 
ATOM   6150  O  O     . LYS H  4 125 ? -24.618 -44.669 6.745  1.00 94.70  ? 122  LYS H O     1 
ATOM   6151  C  CB    . LYS H  4 125 ? -27.190 -46.275 7.613  1.00 94.38  ? 122  LYS H CB    1 
ATOM   6152  C  CG    . LYS H  4 125 ? -27.295 -46.346 6.079  1.00 94.77  ? 122  LYS H CG    1 
ATOM   6153  C  CD    . LYS H  4 125 ? -26.731 -47.673 5.534  1.00 95.62  ? 122  LYS H CD    1 
ATOM   6154  C  CE    . LYS H  4 125 ? -27.430 -48.128 4.247  1.00 95.70  ? 122  LYS H CE    1 
ATOM   6155  N  NZ    . LYS H  4 125 ? -27.151 -47.253 3.073  1.00 95.92  ? 122  LYS H NZ    1 
ATOM   6156  O  OXT   . LYS H  4 125 ? -25.013 -43.984 8.711  1.00 94.43  ? 122  LYS H OXT   1 
ATOM   6157  O  "O5'" . DA  I  5 1   ? 2.459   0.167   94.817 1.00 130.94 ? -73  DA  I "O5'" 1 
ATOM   6158  C  "C5'" . DA  I  5 1   ? 3.682   0.706   95.339 1.00 131.26 ? -73  DA  I "C5'" 1 
ATOM   6159  C  "C4'" . DA  I  5 1   ? 4.846   -0.262  95.141 1.00 131.24 ? -73  DA  I "C4'" 1 
ATOM   6160  O  "O4'" . DA  I  5 1   ? 4.368   -1.640  95.167 1.00 131.74 ? -73  DA  I "O4'" 1 
ATOM   6161  C  "C3'" . DA  I  5 1   ? 5.630   -0.088  93.836 1.00 130.68 ? -73  DA  I "C3'" 1 
ATOM   6162  O  "O3'" . DA  I  5 1   ? 7.052   0.034   94.102 1.00 129.29 ? -73  DA  I "O3'" 1 
ATOM   6163  C  "C2'" . DA  I  5 1   ? 5.227   -1.327  93.042 1.00 131.36 ? -73  DA  I "C2'" 1 
ATOM   6164  C  "C1'" . DA  I  5 1   ? 5.056   -2.347  94.160 1.00 132.19 ? -73  DA  I "C1'" 1 
ATOM   6165  N  N9    . DA  I  5 1   ? 4.347   -3.562  93.745 1.00 132.54 ? -73  DA  I N9    1 
ATOM   6166  C  C8    . DA  I  5 1   ? 3.255   -3.663  92.919 1.00 132.50 ? -73  DA  I C8    1 
ATOM   6167  N  N7    . DA  I  5 1   ? 2.849   -4.894  92.713 1.00 132.51 ? -73  DA  I N7    1 
ATOM   6168  C  C5    . DA  I  5 1   ? 3.740   -5.658  93.450 1.00 132.73 ? -73  DA  I C5    1 
ATOM   6169  C  C6    . DA  I  5 1   ? 3.856   -7.052  93.657 1.00 132.59 ? -73  DA  I C6    1 
ATOM   6170  N  N6    . DA  I  5 1   ? 3.029   -7.949  93.107 1.00 132.43 ? -73  DA  I N6    1 
ATOM   6171  N  N1    . DA  I  5 1   ? 4.860   -7.485  94.456 1.00 132.51 ? -73  DA  I N1    1 
ATOM   6172  C  C2    . DA  I  5 1   ? 5.689   -6.587  95.014 1.00 132.51 ? -73  DA  I C2    1 
ATOM   6173  N  N3    . DA  I  5 1   ? 5.681   -5.257  94.894 1.00 132.54 ? -73  DA  I N3    1 
ATOM   6174  C  C4    . DA  I  5 1   ? 4.673   -4.853  94.094 1.00 132.70 ? -73  DA  I C4    1 
ATOM   6175  P  P     . DT  I  5 2   ? 8.230   -0.755  93.337 1.00 128.25 ? -72  DT  I P     1 
ATOM   6176  O  OP1   . DT  I  5 2   ? 9.504   -0.040  93.574 1.00 128.38 ? -72  DT  I OP1   1 
ATOM   6177  O  OP2   . DT  I  5 2   ? 7.832   -1.032  91.936 1.00 128.07 ? -72  DT  I OP2   1 
ATOM   6178  O  "O5'" . DT  I  5 2   ? 8.263   -2.128  94.159 1.00 127.26 ? -72  DT  I "O5'" 1 
ATOM   6179  C  "C5'" . DT  I  5 2   ? 9.056   -2.257  95.338 1.00 125.43 ? -72  DT  I "C5'" 1 
ATOM   6180  C  "C4'" . DT  I  5 2   ? 10.097  -3.363  95.198 1.00 124.02 ? -72  DT  I "C4'" 1 
ATOM   6181  O  "O4'" . DT  I  5 2   ? 9.483   -4.609  94.780 1.00 123.59 ? -72  DT  I "O4'" 1 
ATOM   6182  C  "C3'" . DT  I  5 2   ? 11.235  -3.136  94.207 1.00 123.08 ? -72  DT  I "C3'" 1 
ATOM   6183  O  "O3'" . DT  I  5 2   ? 12.356  -3.817  94.760 1.00 122.20 ? -72  DT  I "O3'" 1 
ATOM   6184  C  "C2'" . DT  I  5 2   ? 10.730  -3.814  92.932 1.00 122.86 ? -72  DT  I "C2'" 1 
ATOM   6185  C  "C1'" . DT  I  5 2   ? 9.962   -5.007  93.505 1.00 122.76 ? -72  DT  I "C1'" 1 
ATOM   6186  N  N1    . DT  I  5 2   ? 8.743   -5.470  92.760 1.00 122.50 ? -72  DT  I N1    1 
ATOM   6187  C  C2    . DT  I  5 2   ? 8.412   -6.811  92.800 1.00 122.24 ? -72  DT  I C2    1 
ATOM   6188  O  O2    . DT  I  5 2   ? 9.075   -7.652  93.390 1.00 122.15 ? -72  DT  I O2    1 
ATOM   6189  N  N3    . DT  I  5 2   ? 7.267   -7.133  92.105 1.00 122.20 ? -72  DT  I N3    1 
ATOM   6190  C  C4    . DT  I  5 2   ? 6.436   -6.273  91.397 1.00 122.37 ? -72  DT  I C4    1 
ATOM   6191  O  O4    . DT  I  5 2   ? 5.432   -6.670  90.809 1.00 122.30 ? -72  DT  I O4    1 
ATOM   6192  C  C5    . DT  I  5 2   ? 6.837   -4.883  91.404 1.00 122.37 ? -72  DT  I C5    1 
ATOM   6193  C  C7    . DT  I  5 2   ? 6.037   -3.840  90.676 1.00 122.21 ? -72  DT  I C7    1 
ATOM   6194  C  C6    . DT  I  5 2   ? 7.949   -4.558  92.081 1.00 122.62 ? -72  DT  I C6    1 
ATOM   6195  P  P     . DC  I  5 3   ? 13.810  -3.803  94.094 1.00 121.69 ? -71  DC  I P     1 
ATOM   6196  O  OP1   . DC  I  5 3   ? 14.816  -3.841  95.181 1.00 121.83 ? -71  DC  I OP1   1 
ATOM   6197  O  OP2   . DC  I  5 3   ? 13.845  -2.734  93.066 1.00 122.20 ? -71  DC  I OP2   1 
ATOM   6198  O  "O5'" . DC  I  5 3   ? 13.861  -5.213  93.353 1.00 120.70 ? -71  DC  I "O5'" 1 
ATOM   6199  C  "C5'" . DC  I  5 3   ? 14.031  -6.412  94.108 1.00 118.47 ? -71  DC  I "C5'" 1 
ATOM   6200  C  "C4'" . DC  I  5 3   ? 13.907  -7.617  93.192 1.00 116.56 ? -71  DC  I "C4'" 1 
ATOM   6201  O  "O4'" . DC  I  5 3   ? 12.599  -7.672  92.559 1.00 116.42 ? -71  DC  I "O4'" 1 
ATOM   6202  C  "C3'" . DC  I  5 3   ? 14.895  -7.645  92.039 1.00 114.60 ? -71  DC  I "C3'" 1 
ATOM   6203  O  "O3'" . DC  I  5 3   ? 15.259  -8.980  91.899 1.00 112.17 ? -71  DC  I "O3'" 1 
ATOM   6204  C  "C2'" . DC  I  5 3   ? 14.090  -7.199  90.823 1.00 114.65 ? -71  DC  I "C2'" 1 
ATOM   6205  C  "C1'" . DC  I  5 3   ? 12.790  -7.913  91.176 1.00 115.46 ? -71  DC  I "C1'" 1 
ATOM   6206  N  N1    . DC  I  5 3   ? 11.571  -7.459  90.462 1.00 115.48 ? -71  DC  I N1    1 
ATOM   6207  C  C2    . DC  I  5 3   ? 10.622  -8.418  90.061 1.00 115.23 ? -71  DC  I C2    1 
ATOM   6208  O  O2    . DC  I  5 3   ? 10.819  -9.621  90.298 1.00 114.91 ? -71  DC  I O2    1 
ATOM   6209  N  N3    . DC  I  5 3   ? 9.507   -7.984  89.411 1.00 115.08 ? -71  DC  I N3    1 
ATOM   6210  C  C4    . DC  I  5 3   ? 9.332   -6.678  89.167 1.00 115.14 ? -71  DC  I C4    1 
ATOM   6211  N  N4    . DC  I  5 3   ? 8.223   -6.304  88.525 1.00 115.11 ? -71  DC  I N4    1 
ATOM   6212  C  C5    . DC  I  5 3   ? 10.287  -5.692  89.571 1.00 115.26 ? -71  DC  I C5    1 
ATOM   6213  C  C6    . DC  I  5 3   ? 11.380  -6.124  90.212 1.00 115.48 ? -71  DC  I C6    1 
ATOM   6214  P  P     . DA  I  5 4   ? 16.769  -9.260  91.505 1.00 110.78 ? -70  DA  I P     1 
ATOM   6215  O  OP1   . DA  I  5 4   ? 17.449  -9.612  92.777 1.00 110.67 ? -70  DA  I OP1   1 
ATOM   6216  O  OP2   . DA  I  5 4   ? 17.195  -8.115  90.656 1.00 111.11 ? -70  DA  I OP2   1 
ATOM   6217  O  "O5'" . DA  I  5 4   ? 16.769  -10.548 90.549 1.00 108.40 ? -70  DA  I "O5'" 1 
ATOM   6218  C  "C5'" . DA  I  5 4   ? 15.950  -11.697 90.784 1.00 103.97 ? -70  DA  I "C5'" 1 
ATOM   6219  C  "C4'" . DA  I  5 4   ? 15.437  -12.235 89.457 1.00 100.25 ? -70  DA  I "C4'" 1 
ATOM   6220  O  "O4'" . DA  I  5 4   ? 14.293  -11.465 89.018 1.00 99.49  ? -70  DA  I "O4'" 1 
ATOM   6221  C  "C3'" . DA  I  5 4   ? 16.422  -12.175 88.295 1.00 98.43  ? -70  DA  I "C3'" 1 
ATOM   6222  O  "O3'" . DA  I  5 4   ? 16.220  -13.302 87.489 1.00 95.88  ? -70  DA  I "O3'" 1 
ATOM   6223  C  "C2'" . DA  I  5 4   ? 16.008  -10.922 87.533 1.00 98.65  ? -70  DA  I "C2'" 1 
ATOM   6224  C  "C1'" . DA  I  5 4   ? 14.503  -11.097 87.666 1.00 98.83  ? -70  DA  I "C1'" 1 
ATOM   6225  N  N9    . DA  I  5 4   ? 13.689  -9.931  87.335 1.00 98.68  ? -70  DA  I N9    1 
ATOM   6226  C  C8    . DA  I  5 4   ? 13.992  -8.604  87.478 1.00 98.59  ? -70  DA  I C8    1 
ATOM   6227  N  N7    . DA  I  5 4   ? 13.031  -7.803  87.081 1.00 98.58  ? -70  DA  I N7    1 
ATOM   6228  C  C5    . DA  I  5 4   ? 12.030  -8.663  86.652 1.00 98.49  ? -70  DA  I C5    1 
ATOM   6229  C  C6    . DA  I  5 4   ? 10.737  -8.451  86.114 1.00 98.62  ? -70  DA  I C6    1 
ATOM   6230  N  N6    . DA  I  5 4   ? 10.199  -7.246  85.906 1.00 98.38  ? -70  DA  I N6    1 
ATOM   6231  N  N1    . DA  I  5 4   ? 10.006  -9.540  85.796 1.00 98.66  ? -70  DA  I N1    1 
ATOM   6232  C  C2    . DA  I  5 4   ? 10.531  -10.759 85.997 1.00 98.56  ? -70  DA  I C2    1 
ATOM   6233  N  N3    . DA  I  5 4   ? 11.722  -11.084 86.495 1.00 98.07  ? -70  DA  I N3    1 
ATOM   6234  C  C4    . DA  I  5 4   ? 12.425  -9.980  86.804 1.00 98.32  ? -70  DA  I C4    1 
ATOM   6235  P  P     . DA  I  5 5   ? 17.219  -14.532 87.603 1.00 93.96  ? -69  DA  I P     1 
ATOM   6236  O  OP1   . DA  I  5 5   ? 16.955  -15.219 88.888 1.00 93.96  ? -69  DA  I OP1   1 
ATOM   6237  O  OP2   . DA  I  5 5   ? 18.566  -14.015 87.284 1.00 93.82  ? -69  DA  I OP2   1 
ATOM   6238  O  "O5'" . DA  I  5 5   ? 16.739  -15.476 86.396 1.00 93.32  ? -69  DA  I "O5'" 1 
ATOM   6239  C  "C5'" . DA  I  5 5   ? 15.466  -16.163 86.434 1.00 91.10  ? -69  DA  I "C5'" 1 
ATOM   6240  C  "C4'" . DA  I  5 5   ? 14.642  -15.937 85.171 1.00 89.37  ? -69  DA  I "C4'" 1 
ATOM   6241  O  "O4'" . DA  I  5 5   ? 14.077  -14.601 85.138 1.00 88.66  ? -69  DA  I "O4'" 1 
ATOM   6242  C  "C3'" . DA  I  5 5   ? 15.384  -16.108 83.844 1.00 88.52  ? -69  DA  I "C3'" 1 
ATOM   6243  O  "O3'" . DA  I  5 5   ? 14.613  -16.985 83.049 1.00 88.26  ? -69  DA  I "O3'" 1 
ATOM   6244  C  "C2'" . DA  I  5 5   ? 15.433  -14.710 83.236 1.00 87.42  ? -69  DA  I "C2'" 1 
ATOM   6245  C  "C1'" . DA  I  5 5   ? 14.129  -14.158 83.799 1.00 87.80  ? -69  DA  I "C1'" 1 
ATOM   6246  N  N9    . DA  I  5 5   ? 14.006  -12.706 83.789 1.00 87.74  ? -69  DA  I N9    1 
ATOM   6247  C  C8    . DA  I  5 5   ? 14.928  -11.795 84.217 1.00 87.81  ? -69  DA  I C8    1 
ATOM   6248  N  N7    . DA  I  5 5   ? 14.539  -10.550 84.084 1.00 87.72  ? -69  DA  I N7    1 
ATOM   6249  C  C5    . DA  I  5 5   ? 13.278  -10.650 83.532 1.00 87.21  ? -69  DA  I C5    1 
ATOM   6250  C  C6    . DA  I  5 5   ? 12.329  -9.683  83.149 1.00 87.30  ? -69  DA  I C6    1 
ATOM   6251  N  N6    . DA  I  5 5   ? 12.524  -8.371  83.274 1.00 87.27  ? -69  DA  I N6    1 
ATOM   6252  N  N1    . DA  I  5 5   ? 11.159  -10.119 82.634 1.00 87.79  ? -69  DA  I N1    1 
ATOM   6253  C  C2    . DA  I  5 5   ? 10.954  -11.440 82.506 1.00 87.70  ? -69  DA  I C2    1 
ATOM   6254  N  N3    . DA  I  5 5   ? 11.774  -12.441 82.829 1.00 87.63  ? -69  DA  I N3    1 
ATOM   6255  C  C4    . DA  I  5 5   ? 12.929  -11.975 83.344 1.00 87.50  ? -69  DA  I C4    1 
ATOM   6256  P  P     . DT  I  5 6   ? 15.278  -17.954 81.960 1.00 88.21  ? -68  DT  I P     1 
ATOM   6257  O  OP1   . DT  I  5 6   ? 15.012  -19.345 82.410 1.00 87.71  ? -68  DT  I OP1   1 
ATOM   6258  O  OP2   . DT  I  5 6   ? 16.653  -17.470 81.660 1.00 87.70  ? -68  DT  I OP2   1 
ATOM   6259  O  "O5'" . DT  I  5 6   ? 14.401  -17.676 80.647 1.00 86.71  ? -68  DT  I "O5'" 1 
ATOM   6260  C  "C5'" . DT  I  5 6   ? 13.066  -17.180 80.749 1.00 83.35  ? -68  DT  I "C5'" 1 
ATOM   6261  C  "C4'" . DT  I  5 6   ? 12.771  -16.117 79.704 1.00 80.48  ? -68  DT  I "C4'" 1 
ATOM   6262  O  "O4'" . DT  I  5 6   ? 12.977  -14.795 80.244 1.00 79.68  ? -68  DT  I "O4'" 1 
ATOM   6263  C  "C3'" . DT  I  5 6   ? 13.590  -16.180 78.418 1.00 78.99  ? -68  DT  I "C3'" 1 
ATOM   6264  O  "O3'" . DT  I  5 6   ? 12.733  -16.769 77.435 1.00 78.44  ? -68  DT  I "O3'" 1 
ATOM   6265  C  "C2'" . DT  I  5 6   ? 13.977  -14.724 78.150 1.00 78.43  ? -68  DT  I "C2'" 1 
ATOM   6266  C  "C1'" . DT  I  5 6   ? 13.099  -13.948 79.126 1.00 78.30  ? -68  DT  I "C1'" 1 
ATOM   6267  N  N1    . DT  I  5 6   ? 13.635  -12.628 79.584 1.00 77.85  ? -68  DT  I N1    1 
ATOM   6268  C  C2    . DT  I  5 6   ? 12.837  -11.494 79.491 1.00 77.58  ? -68  DT  I C2    1 
ATOM   6269  O  O2    . DT  I  5 6   ? 11.703  -11.476 79.052 1.00 77.44  ? -68  DT  I O2    1 
ATOM   6270  N  N3    . DT  I  5 6   ? 13.422  -10.339 79.941 1.00 77.89  ? -68  DT  I N3    1 
ATOM   6271  C  C4    . DT  I  5 6   ? 14.693  -10.209 80.473 1.00 78.11  ? -68  DT  I C4    1 
ATOM   6272  O  O4    . DT  I  5 6   ? 15.119  -9.125  80.848 1.00 78.15  ? -68  DT  I O4    1 
ATOM   6273  C  C5    . DT  I  5 6   ? 15.474  -11.426 80.547 1.00 77.59  ? -68  DT  I C5    1 
ATOM   6274  C  C7    . DT  I  5 6   ? 16.868  -11.399 81.096 1.00 77.61  ? -68  DT  I C7    1 
ATOM   6275  C  C6    . DT  I  5 6   ? 14.917  -12.564 80.109 1.00 77.53  ? -68  DT  I C6    1 
ATOM   6276  P  P     . DA  I  5 7   ? 12.903  -16.641 75.845 1.00 77.17  ? -67  DA  I P     1 
ATOM   6277  O  OP1   . DA  I  5 7   ? 12.308  -17.848 75.249 1.00 77.38  ? -67  DA  I OP1   1 
ATOM   6278  O  OP2   . DA  I  5 7   ? 14.285  -16.272 75.487 1.00 77.31  ? -67  DA  I OP2   1 
ATOM   6279  O  "O5'" . DA  I  5 7   ? 11.941  -15.421 75.532 1.00 76.42  ? -67  DA  I "O5'" 1 
ATOM   6280  C  "C5'" . DA  I  5 7   ? 10.560  -15.576 75.803 1.00 76.07  ? -67  DA  I "C5'" 1 
ATOM   6281  C  "C4'" . DA  I  5 7   ? 9.831   -14.311 75.398 1.00 76.03  ? -67  DA  I "C4'" 1 
ATOM   6282  O  "O4'" . DA  I  5 7   ? 10.453  -13.173 76.045 1.00 75.53  ? -67  DA  I "O4'" 1 
ATOM   6283  C  "C3'" . DA  I  5 7   ? 9.847   -13.984 73.910 1.00 75.97  ? -67  DA  I "C3'" 1 
ATOM   6284  O  "O3'" . DA  I  5 7   ? 8.688   -13.224 73.595 1.00 76.83  ? -67  DA  I "O3'" 1 
ATOM   6285  C  "C2'" . DA  I  5 7   ? 11.093  -13.121 73.787 1.00 75.72  ? -67  DA  I "C2'" 1 
ATOM   6286  C  "C1'" . DA  I  5 7   ? 10.962  -12.295 75.065 1.00 74.87  ? -67  DA  I "C1'" 1 
ATOM   6287  N  N9    . DA  I  5 7   ? 12.227  -11.759 75.552 1.00 74.70  ? -67  DA  I N9    1 
ATOM   6288  C  C8    . DA  I  5 7   ? 13.382  -12.452 75.760 1.00 74.13  ? -67  DA  I C8    1 
ATOM   6289  N  N7    . DA  I  5 7   ? 14.359  -11.702 76.200 1.00 74.20  ? -67  DA  I N7    1 
ATOM   6290  C  C5    . DA  I  5 7   ? 13.813  -10.435 76.290 1.00 74.12  ? -67  DA  I C5    1 
ATOM   6291  C  C6    . DA  I  5 7   ? 14.340  -9.192  76.699 1.00 74.44  ? -67  DA  I C6    1 
ATOM   6292  N  N6    . DA  I  5 7   ? 15.604  -9.026  77.110 1.00 74.11  ? -67  DA  I N6    1 
ATOM   6293  N  N1    . DA  I  5 7   ? 13.511  -8.121  76.666 1.00 74.70  ? -67  DA  I N1    1 
ATOM   6294  C  C2    . DA  I  5 7   ? 12.248  -8.278  76.246 1.00 74.15  ? -67  DA  I C2    1 
ATOM   6295  N  N3    . DA  I  5 7   ? 11.641  -9.396  75.849 1.00 74.01  ? -67  DA  I N3    1 
ATOM   6296  C  C4    . DA  I  5 7   ? 12.489  -10.447 75.892 1.00 74.39  ? -67  DA  I C4    1 
ATOM   6297  P  P     . DT  I  5 8   ? 8.361   -12.853 72.077 1.00 77.71  ? -66  DT  I P     1 
ATOM   6298  O  OP1   . DT  I  5 8   ? 6.886   -12.822 71.940 1.00 77.51  ? -66  DT  I OP1   1 
ATOM   6299  O  OP2   . DT  I  5 8   ? 9.203   -13.719 71.213 1.00 77.71  ? -66  DT  I OP2   1 
ATOM   6300  O  "O5'" . DT  I  5 8   ? 8.884   -11.355 71.922 1.00 78.50  ? -66  DT  I "O5'" 1 
ATOM   6301  C  "C5'" . DT  I  5 8   ? 8.248   -10.317 72.677 1.00 79.07  ? -66  DT  I "C5'" 1 
ATOM   6302  C  "C4'" . DT  I  5 8   ? 8.924   -8.991  72.407 1.00 78.68  ? -66  DT  I "C4'" 1 
ATOM   6303  O  "O4'" . DT  I  5 8   ? 10.254  -9.027  72.967 1.00 78.22  ? -66  DT  I "O4'" 1 
ATOM   6304  C  "C3'" . DT  I  5 8   ? 9.110   -8.717  70.924 1.00 79.80  ? -66  DT  I "C3'" 1 
ATOM   6305  O  "O3'" . DT  I  5 8   ? 8.424   -7.504  70.663 1.00 81.84  ? -66  DT  I "O3'" 1 
ATOM   6306  C  "C2'" . DT  I  5 8   ? 10.631  -8.669  70.710 1.00 78.72  ? -66  DT  I "C2'" 1 
ATOM   6307  C  "C1'" . DT  I  5 8   ? 11.123  -8.335  72.109 1.00 76.95  ? -66  DT  I "C1'" 1 
ATOM   6308  N  N1    . DT  I  5 8   ? 12.507  -8.742  72.462 1.00 76.07  ? -66  DT  I N1    1 
ATOM   6309  C  C2    . DT  I  5 8   ? 13.364  -7.768  72.955 1.00 76.11  ? -66  DT  I C2    1 
ATOM   6310  O  O2    . DT  I  5 8   ? 13.051  -6.590  73.105 1.00 76.10  ? -66  DT  I O2    1 
ATOM   6311  N  N3    . DT  I  5 8   ? 14.624  -8.232  73.269 1.00 76.34  ? -66  DT  I N3    1 
ATOM   6312  C  C4    . DT  I  5 8   ? 15.099  -9.537  73.151 1.00 76.59  ? -66  DT  I C4    1 
ATOM   6313  O  O4    . DT  I  5 8   ? 16.251  -9.848  73.458 1.00 76.35  ? -66  DT  I O4    1 
ATOM   6314  C  C5    . DT  I  5 8   ? 14.148  -10.506 72.639 1.00 76.53  ? -66  DT  I C5    1 
ATOM   6315  C  C7    . DT  I  5 8   ? 14.562  -11.948 72.470 1.00 75.95  ? -66  DT  I C7    1 
ATOM   6316  C  C6    . DT  I  5 8   ? 12.908  -10.063 72.326 1.00 75.98  ? -66  DT  I C6    1 
ATOM   6317  P  P     . DC  I  5 9   ? 8.253   -6.897  69.192 1.00 83.03  ? -65  DC  I P     1 
ATOM   6318  O  OP1   . DC  I  5 9   ? 6.925   -6.245  69.142 1.00 82.82  ? -65  DC  I OP1   1 
ATOM   6319  O  OP2   . DC  I  5 9   ? 8.633   -7.898  68.168 1.00 82.63  ? -65  DC  I OP2   1 
ATOM   6320  O  "O5'" . DC  I  5 9   ? 9.384   -5.765  69.226 1.00 85.87  ? -65  DC  I "O5'" 1 
ATOM   6321  C  "C5'" . DC  I  5 9   ? 9.361   -4.735  70.230 1.00 89.00  ? -65  DC  I "C5'" 1 
ATOM   6322  C  "C4'" . DC  I  5 9   ? 10.675  -3.978  70.242 1.00 91.02  ? -65  DC  I "C4'" 1 
ATOM   6323  O  "O4'" . DC  I  5 9   ? 11.739  -4.827  70.734 1.00 90.61  ? -65  DC  I "O4'" 1 
ATOM   6324  C  "C3'" . DC  I  5 9   ? 11.100  -3.498  68.862 1.00 92.81  ? -65  DC  I "C3'" 1 
ATOM   6325  O  "O3'" . DC  I  5 9   ? 10.878  -2.095  68.807 1.00 96.78  ? -65  DC  I "O3'" 1 
ATOM   6326  C  "C2'" . DC  I  5 9   ? 12.577  -3.861  68.743 1.00 92.07  ? -65  DC  I "C2'" 1 
ATOM   6327  C  "C1'" . DC  I  5 9   ? 12.941  -4.468  70.096 1.00 90.83  ? -65  DC  I "C1'" 1 
ATOM   6328  N  N1    . DC  I  5 9   ? 13.785  -5.701  70.007 1.00 90.73  ? -65  DC  I N1    1 
ATOM   6329  C  C2    . DC  I  5 9   ? 15.096  -5.723  70.541 1.00 90.92  ? -65  DC  I C2    1 
ATOM   6330  O  O2    . DC  I  5 9   ? 15.587  -4.729  71.092 1.00 91.05  ? -65  DC  I O2    1 
ATOM   6331  N  N3    . DC  I  5 9   ? 15.828  -6.859  70.445 1.00 90.62  ? -65  DC  I N3    1 
ATOM   6332  C  C4    . DC  I  5 9   ? 15.301  -7.932  69.860 1.00 90.59  ? -65  DC  I C4    1 
ATOM   6333  N  N4    . DC  I  5 9   ? 16.068  -9.024  69.798 1.00 90.67  ? -65  DC  I N4    1 
ATOM   6334  C  C5    . DC  I  5 9   ? 13.978  -7.934  69.312 1.00 90.62  ? -65  DC  I C5    1 
ATOM   6335  C  C6    . DC  I  5 9   ? 13.261  -6.811  69.405 1.00 90.14  ? -65  DC  I C6    1 
ATOM   6336  P  P     . DC  I  5 10  ? 10.668  -1.290  67.432 1.00 99.34  ? -64  DC  I P     1 
ATOM   6337  O  OP1   . DC  I  5 10  ? 9.984   -0.020  67.783 1.00 99.24  ? -64  DC  I OP1   1 
ATOM   6338  O  OP2   . DC  I  5 10  ? 10.056  -2.199  66.424 1.00 99.36  ? -64  DC  I OP2   1 
ATOM   6339  O  "O5'" . DC  I  5 10  ? 12.172  -0.942  67.006 1.00 99.88  ? -64  DC  I "O5'" 1 
ATOM   6340  C  "C5'" . DC  I  5 10  ? 12.952  -0.148  67.902 1.00 102.14 ? -64  DC  I "C5'" 1 
ATOM   6341  C  "C4'" . DC  I  5 10  ? 14.417  -0.207  67.537 1.00 103.45 ? -64  DC  I "C4'" 1 
ATOM   6342  O  "O4'" . DC  I  5 10  ? 14.945  -1.494  67.945 1.00 103.28 ? -64  DC  I "O4'" 1 
ATOM   6343  C  "C3'" . DC  I  5 10  ? 14.678  -0.082  66.035 1.00 104.82 ? -64  DC  I "C3'" 1 
ATOM   6344  O  "O3'" . DC  I  5 10  ? 15.803  0.774   65.805 1.00 106.07 ? -64  DC  I "O3'" 1 
ATOM   6345  C  "C2'" . DC  I  5 10  ? 14.956  -1.527  65.624 1.00 104.47 ? -64  DC  I "C2'" 1 
ATOM   6346  C  "C1'" . DC  I  5 10  ? 15.730  -1.959  66.867 1.00 103.99 ? -64  DC  I "C1'" 1 
ATOM   6347  N  N1    . DC  I  5 10  ? 16.035  -3.425  66.970 1.00 104.04 ? -64  DC  I N1    1 
ATOM   6348  C  C2    . DC  I  5 10  ? 17.184  -3.852  67.674 1.00 103.72 ? -64  DC  I C2    1 
ATOM   6349  O  O2    . DC  I  5 10  ? 17.940  -3.031  68.214 1.00 103.32 ? -64  DC  I O2    1 
ATOM   6350  N  N3    . DC  I  5 10  ? 17.442  -5.183  67.749 1.00 103.69 ? -64  DC  I N3    1 
ATOM   6351  C  C4    . DC  I  5 10  ? 16.620  -6.057  67.160 1.00 103.77 ? -64  DC  I C4    1 
ATOM   6352  N  N4    . DC  I  5 10  ? 16.927  -7.348  67.263 1.00 103.77 ? -64  DC  I N4    1 
ATOM   6353  C  C5    . DC  I  5 10  ? 15.453  -5.651  66.440 1.00 103.69 ? -64  DC  I C5    1 
ATOM   6354  C  C6    . DC  I  5 10  ? 15.204  -4.337  66.366 1.00 103.93 ? -64  DC  I C6    1 
ATOM   6355  P  P     . DA  I  5 11  ? 15.855  1.831   64.597 1.00 106.47 ? -63  DA  I P     1 
ATOM   6356  O  OP1   . DA  I  5 11  ? 14.557  2.550   64.586 1.00 106.23 ? -63  DA  I OP1   1 
ATOM   6357  O  OP2   . DA  I  5 11  ? 16.314  1.151   63.363 1.00 105.73 ? -63  DA  I OP2   1 
ATOM   6358  O  "O5'" . DA  I  5 11  ? 17.035  2.800   65.085 1.00 107.15 ? -63  DA  I "O5'" 1 
ATOM   6359  C  "C5'" . DA  I  5 11  ? 17.762  2.517   66.295 1.00 108.60 ? -63  DA  I "C5'" 1 
ATOM   6360  C  "C4'" . DA  I  5 11  ? 19.097  1.826   66.035 1.00 109.85 ? -63  DA  I "C4'" 1 
ATOM   6361  O  "O4'" . DA  I  5 11  ? 18.984  0.387   66.217 1.00 110.29 ? -63  DA  I "O4'" 1 
ATOM   6362  C  "C3'" . DA  I  5 11  ? 19.689  2.020   64.637 1.00 110.86 ? -63  DA  I "C3'" 1 
ATOM   6363  O  "O3'" . DA  I  5 11  ? 21.107  2.191   64.700 1.00 112.44 ? -63  DA  I "O3'" 1 
ATOM   6364  C  "C2'" . DA  I  5 11  ? 19.369  0.698   63.955 1.00 110.85 ? -63  DA  I "C2'" 1 
ATOM   6365  C  "C1'" . DA  I  5 11  ? 19.646  -0.235  65.124 1.00 110.82 ? -63  DA  I "C1'" 1 
ATOM   6366  N  N9    . DA  I  5 11  ? 19.215  -1.622  64.910 1.00 110.85 ? -63  DA  I N9    1 
ATOM   6367  C  C8    . DA  I  5 11  ? 17.988  -2.061  64.488 1.00 110.63 ? -63  DA  I C8    1 
ATOM   6368  N  N7    . DA  I  5 11  ? 17.885  -3.362  64.390 1.00 110.53 ? -63  DA  I N7    1 
ATOM   6369  C  C5    . DA  I  5 11  ? 19.145  -3.815  64.764 1.00 111.01 ? -63  DA  I C5    1 
ATOM   6370  C  C6    . DA  I  5 11  ? 19.708  -5.111  64.869 1.00 111.02 ? -63  DA  I C6    1 
ATOM   6371  N  N6    . DA  I  5 11  ? 19.019  -6.222  64.587 1.00 110.70 ? -63  DA  I N6    1 
ATOM   6372  N  N1    . DA  I  5 11  ? 21.001  -5.219  65.273 1.00 110.85 ? -63  DA  I N1    1 
ATOM   6373  C  C2    . DA  I  5 11  ? 21.691  -4.103  65.553 1.00 110.69 ? -63  DA  I C2    1 
ATOM   6374  N  N3    . DA  I  5 11  ? 21.270  -2.837  65.489 1.00 110.76 ? -63  DA  I N3    1 
ATOM   6375  C  C4    . DA  I  5 11  ? 19.981  -2.757  65.087 1.00 110.87 ? -63  DA  I C4    1 
ATOM   6376  P  P     . DC  I  5 12  ? 21.901  3.065   63.607 1.00 113.45 ? -62  DC  I P     1 
ATOM   6377  O  OP1   . DC  I  5 12  ? 22.348  4.290   64.324 1.00 113.75 ? -62  DC  I OP1   1 
ATOM   6378  O  OP2   . DC  I  5 12  ? 21.057  3.169   62.385 1.00 113.39 ? -62  DC  I OP2   1 
ATOM   6379  O  "O5'" . DC  I  5 12  ? 23.198  2.196   63.230 1.00 112.64 ? -62  DC  I "O5'" 1 
ATOM   6380  C  "C5'" . DC  I  5 12  ? 23.891  1.422   64.209 1.00 112.07 ? -62  DC  I "C5'" 1 
ATOM   6381  C  "C4'" . DC  I  5 12  ? 24.266  0.062   63.635 1.00 112.12 ? -62  DC  I "C4'" 1 
ATOM   6382  O  "O4'" . DC  I  5 12  ? 23.175  -0.889  63.769 1.00 111.54 ? -62  DC  I "O4'" 1 
ATOM   6383  C  "C3'" . DC  I  5 12  ? 24.611  0.059   62.146 1.00 112.17 ? -62  DC  I "C3'" 1 
ATOM   6384  O  "O3'" . DC  I  5 12  ? 26.029  0.233   61.975 1.00 112.94 ? -62  DC  I "O3'" 1 
ATOM   6385  C  "C2'" . DC  I  5 12  ? 24.128  -1.306  61.659 1.00 111.25 ? -62  DC  I "C2'" 1 
ATOM   6386  C  "C1'" . DC  I  5 12  ? 23.407  -1.934  62.846 1.00 110.22 ? -62  DC  I "C1'" 1 
ATOM   6387  N  N1    . DC  I  5 12  ? 22.139  -2.592  62.393 1.00 109.53 ? -62  DC  I N1    1 
ATOM   6388  C  C2    . DC  I  5 12  ? 22.088  -3.988  62.276 1.00 109.09 ? -62  DC  I C2    1 
ATOM   6389  O  O2    . DC  I  5 12  ? 23.080  -4.657  62.578 1.00 109.04 ? -62  DC  I O2    1 
ATOM   6390  N  N3    . DC  I  5 12  ? 20.941  -4.573  61.848 1.00 108.94 ? -62  DC  I N3    1 
ATOM   6391  C  C4    . DC  I  5 12  ? 19.885  -3.822  61.531 1.00 109.15 ? -62  DC  I C4    1 
ATOM   6392  N  N4    . DC  I  5 12  ? 18.779  -4.440  61.115 1.00 109.33 ? -62  DC  I N4    1 
ATOM   6393  C  C5    . DC  I  5 12  ? 19.912  -2.401  61.631 1.00 108.98 ? -62  DC  I C5    1 
ATOM   6394  C  C6    . DC  I  5 12  ? 21.050  -1.837  62.053 1.00 109.35 ? -62  DC  I C6    1 
ATOM   6395  P  P     . DC  I  5 13  ? 26.761  0.275   60.544 1.00 113.08 ? -61  DC  I P     1 
ATOM   6396  O  OP1   . DC  I  5 13  ? 28.163  0.686   60.779 1.00 113.40 ? -61  DC  I OP1   1 
ATOM   6397  O  OP2   . DC  I  5 13  ? 25.918  1.039   59.596 1.00 112.93 ? -61  DC  I OP2   1 
ATOM   6398  O  "O5'" . DC  I  5 13  ? 26.795  -1.262  60.118 1.00 113.65 ? -61  DC  I "O5'" 1 
ATOM   6399  C  "C5'" . DC  I  5 13  ? 27.418  -2.224  60.981 1.00 114.63 ? -61  DC  I "C5'" 1 
ATOM   6400  C  "C4'" . DC  I  5 13  ? 27.276  -3.601  60.370 1.00 115.45 ? -61  DC  I "C4'" 1 
ATOM   6401  O  "O4'" . DC  I  5 13  ? 25.875  -3.970  60.368 1.00 115.78 ? -61  DC  I "O4'" 1 
ATOM   6402  C  "C3'" . DC  I  5 13  ? 27.741  -3.654  58.917 1.00 116.08 ? -61  DC  I "C3'" 1 
ATOM   6403  O  "O3'" . DC  I  5 13  ? 28.926  -4.442  58.798 1.00 116.67 ? -61  DC  I "O3'" 1 
ATOM   6404  C  "C2'" . DC  I  5 13  ? 26.564  -4.229  58.116 1.00 116.05 ? -61  DC  I "C2'" 1 
ATOM   6405  C  "C1'" . DC  I  5 13  ? 25.564  -4.677  59.179 1.00 115.21 ? -61  DC  I "C1'" 1 
ATOM   6406  N  N1    . DC  I  5 13  ? 24.120  -4.452  58.796 1.00 114.82 ? -61  DC  I N1    1 
ATOM   6407  C  C2    . DC  I  5 13  ? 23.265  -5.556  58.632 1.00 114.66 ? -61  DC  I C2    1 
ATOM   6408  O  O2    . DC  I  5 13  ? 23.703  -6.701  58.803 1.00 114.50 ? -61  DC  I O2    1 
ATOM   6409  N  N3    . DC  I  5 13  ? 21.967  -5.336  58.288 1.00 114.52 ? -61  DC  I N3    1 
ATOM   6410  C  C4    . DC  I  5 13  ? 21.519  -4.091  58.111 1.00 114.41 ? -61  DC  I C4    1 
ATOM   6411  N  N4    . DC  I  5 13  ? 20.238  -3.933  57.777 1.00 114.46 ? -61  DC  I N4    1 
ATOM   6412  C  C5    . DC  I  5 13  ? 22.366  -2.954  58.268 1.00 114.40 ? -61  DC  I C5    1 
ATOM   6413  C  C6    . DC  I  5 13  ? 23.643  -3.180  58.605 1.00 114.61 ? -61  DC  I C6    1 
ATOM   6414  P  P     . DT  I  5 14  ? 29.753  -4.480  57.420 1.00 117.25 ? -60  DT  I P     1 
ATOM   6415  O  OP1   . DT  I  5 14  ? 31.173  -4.743  57.759 1.00 117.70 ? -60  DT  I OP1   1 
ATOM   6416  O  OP2   . DT  I  5 14  ? 29.393  -3.296  56.599 1.00 117.01 ? -60  DT  I OP2   1 
ATOM   6417  O  "O5'" . DT  I  5 14  ? 29.175  -5.787  56.694 1.00 117.59 ? -60  DT  I "O5'" 1 
ATOM   6418  C  "C5'" . DT  I  5 14  ? 28.936  -7.004  57.414 1.00 118.31 ? -60  DT  I "C5'" 1 
ATOM   6419  C  "C4'" . DT  I  5 14  ? 28.395  -8.054  56.455 1.00 118.80 ? -60  DT  I "C4'" 1 
ATOM   6420  O  "O4'" . DT  I  5 14  ? 26.948  -7.920  56.339 1.00 119.10 ? -60  DT  I "O4'" 1 
ATOM   6421  C  "C3'" . DT  I  5 14  ? 28.929  -7.915  55.028 1.00 119.02 ? -60  DT  I "C3'" 1 
ATOM   6422  O  "O3'" . DT  I  5 14  ? 29.020  -9.194  54.422 1.00 118.83 ? -60  DT  I "O3'" 1 
ATOM   6423  C  "C2'" . DT  I  5 14  ? 27.869  -7.060  54.336 1.00 119.20 ? -60  DT  I "C2'" 1 
ATOM   6424  C  "C1'" . DT  I  5 14  ? 26.608  -7.631  54.985 1.00 118.69 ? -60  DT  I "C1'" 1 
ATOM   6425  N  N1    . DT  I  5 14  ? 25.403  -6.738  54.938 1.00 118.37 ? -60  DT  I N1    1 
ATOM   6426  C  C2    . DT  I  5 14  ? 24.162  -7.316  55.125 1.00 118.02 ? -60  DT  I C2    1 
ATOM   6427  O  O2    . DT  I  5 14  ? 23.996  -8.510  55.325 1.00 118.15 ? -60  DT  I O2    1 
ATOM   6428  N  N3    . DT  I  5 14  ? 23.116  -6.430  55.069 1.00 117.74 ? -60  DT  I N3    1 
ATOM   6429  C  C4    . DT  I  5 14  ? 23.190  -5.065  54.849 1.00 118.04 ? -60  DT  I C4    1 
ATOM   6430  O  O4    . DT  I  5 14  ? 22.180  -4.373  54.821 1.00 118.18 ? -60  DT  I O4    1 
ATOM   6431  C  C5    . DT  I  5 14  ? 24.519  -4.521  54.658 1.00 117.99 ? -60  DT  I C5    1 
ATOM   6432  C  C7    . DT  I  5 14  ? 24.735  -3.056  54.409 1.00 117.89 ? -60  DT  I C7    1 
ATOM   6433  C  C6    . DT  I  5 14  ? 25.551  -5.375  54.714 1.00 118.03 ? -60  DT  I C6    1 
ATOM   6434  P  P     . DG  I  5 15  ? 30.067  -9.456  53.244 1.00 118.55 ? -59  DG  I P     1 
ATOM   6435  O  OP1   . DG  I  5 15  ? 31.320  -9.919  53.892 1.00 118.73 ? -59  DG  I OP1   1 
ATOM   6436  O  OP2   . DG  I  5 15  ? 30.062  -8.278  52.334 1.00 118.62 ? -59  DG  I OP2   1 
ATOM   6437  O  "O5'" . DG  I  5 15  ? 29.432  -10.700 52.463 1.00 117.45 ? -59  DG  I "O5'" 1 
ATOM   6438  C  "C5'" . DG  I  5 15  ? 29.150  -11.909 53.156 1.00 115.78 ? -59  DG  I "C5'" 1 
ATOM   6439  C  "C4'" . DG  I  5 15  ? 27.835  -12.459 52.654 1.00 114.47 ? -59  DG  I "C4'" 1 
ATOM   6440  O  "O4'" . DG  I  5 15  ? 26.765  -11.494 52.810 1.00 114.52 ? -59  DG  I "O4'" 1 
ATOM   6441  C  "C3'" . DG  I  5 15  ? 27.854  -12.817 51.186 1.00 113.96 ? -59  DG  I "C3'" 1 
ATOM   6442  O  "O3'" . DG  I  5 15  ? 27.188  -14.034 51.112 1.00 113.79 ? -59  DG  I "O3'" 1 
ATOM   6443  C  "C2'" . DG  I  5 15  ? 27.073  -11.700 50.497 1.00 113.93 ? -59  DG  I "C2'" 1 
ATOM   6444  C  "C1'" . DG  I  5 15  ? 26.081  -11.304 51.586 1.00 114.05 ? -59  DG  I "C1'" 1 
ATOM   6445  N  N9    . DG  I  5 15  ? 25.644  -9.908  51.548 1.00 114.01 ? -59  DG  I N9    1 
ATOM   6446  C  C8    . DG  I  5 15  ? 26.450  -8.798  51.522 1.00 113.93 ? -59  DG  I C8    1 
ATOM   6447  N  N7    . DG  I  5 15  ? 25.798  -7.671  51.502 1.00 113.93 ? -59  DG  I N7    1 
ATOM   6448  C  C5    . DG  I  5 15  ? 24.468  -8.050  51.520 1.00 113.83 ? -59  DG  I C5    1 
ATOM   6449  C  C6    . DG  I  5 15  ? 23.302  -7.248  51.511 1.00 113.72 ? -59  DG  I C6    1 
ATOM   6450  O  O6    . DG  I  5 15  ? 23.222  -6.014  51.484 1.00 113.68 ? -59  DG  I O6    1 
ATOM   6451  N  N1    . DG  I  5 15  ? 22.145  -8.022  51.537 1.00 113.87 ? -59  DG  I N1    1 
ATOM   6452  C  C2    . DG  I  5 15  ? 22.135  -9.401  51.567 1.00 113.97 ? -59  DG  I C2    1 
ATOM   6453  N  N2    . DG  I  5 15  ? 20.930  -9.981  51.588 1.00 114.03 ? -59  DG  I N2    1 
ATOM   6454  N  N3    . DG  I  5 15  ? 23.222  -10.167 51.575 1.00 113.78 ? -59  DG  I N3    1 
ATOM   6455  C  C4    . DG  I  5 15  ? 24.355  -9.425  51.551 1.00 113.88 ? -59  DG  I C4    1 
ATOM   6456  P  P     . DC  I  5 16  ? 27.359  -14.948 49.825 1.00 113.73 ? -58  DC  I P     1 
ATOM   6457  O  OP1   . DC  I  5 16  ? 27.468  -16.336 50.329 1.00 113.77 ? -58  DC  I OP1   1 
ATOM   6458  O  OP2   . DC  I  5 16  ? 28.413  -14.353 48.962 1.00 113.40 ? -58  DC  I OP2   1 
ATOM   6459  O  "O5'" . DC  I  5 16  ? 25.954  -14.794 49.066 1.00 113.39 ? -58  DC  I "O5'" 1 
ATOM   6460  C  "C5'" . DC  I  5 16  ? 24.706  -14.619 49.752 1.00 112.26 ? -58  DC  I "C5'" 1 
ATOM   6461  C  "C4'" . DC  I  5 16  ? 23.687  -14.029 48.796 1.00 111.36 ? -58  DC  I "C4'" 1 
ATOM   6462  O  "O4'" . DC  I  5 16  ? 23.580  -12.598 49.001 1.00 111.35 ? -58  DC  I "O4'" 1 
ATOM   6463  C  "C3'" . DC  I  5 16  ? 24.052  -14.213 47.322 1.00 110.98 ? -58  DC  I "C3'" 1 
ATOM   6464  O  "O3'" . DC  I  5 16  ? 22.926  -14.674 46.634 1.00 110.46 ? -58  DC  I "O3'" 1 
ATOM   6465  C  "C2'" . DC  I  5 16  ? 24.437  -12.823 46.835 1.00 111.20 ? -58  DC  I "C2'" 1 
ATOM   6466  C  "C1'" . DC  I  5 16  ? 23.549  -11.970 47.731 1.00 111.21 ? -58  DC  I "C1'" 1 
ATOM   6467  N  N1    . DC  I  5 16  ? 23.963  -10.539 47.874 1.00 111.17 ? -58  DC  I N1    1 
ATOM   6468  C  C2    . DC  I  5 16  ? 22.969  -9.563  47.989 1.00 111.11 ? -58  DC  I C2    1 
ATOM   6469  O  O2    . DC  I  5 16  ? 21.785  -9.912  47.963 1.00 111.44 ? -58  DC  I O2    1 
ATOM   6470  N  N3    . DC  I  5 16  ? 23.330  -8.264  48.127 1.00 110.90 ? -58  DC  I N3    1 
ATOM   6471  C  C4    . DC  I  5 16  ? 24.621  -7.931  48.147 1.00 110.87 ? -58  DC  I C4    1 
ATOM   6472  N  N4    . DC  I  5 16  ? 24.923  -6.640  48.281 1.00 111.21 ? -58  DC  I N4    1 
ATOM   6473  C  C5    . DC  I  5 16  ? 25.659  -8.903  48.033 1.00 111.04 ? -58  DC  I C5    1 
ATOM   6474  C  C6    . DC  I  5 16  ? 25.285  -10.181 47.901 1.00 111.32 ? -58  DC  I C6    1 
ATOM   6475  P  P     . DA  I  5 17  ? 22.800  -16.222 46.292 1.00 110.27 ? -57  DA  I P     1 
ATOM   6476  O  OP1   . DA  I  5 17  ? 23.284  -17.022 47.440 1.00 110.36 ? -57  DA  I OP1   1 
ATOM   6477  O  OP2   . DA  I  5 17  ? 23.402  -16.386 44.951 1.00 110.39 ? -57  DA  I OP2   1 
ATOM   6478  O  "O5'" . DA  I  5 17  ? 21.218  -16.449 46.178 1.00 110.33 ? -57  DA  I "O5'" 1 
ATOM   6479  C  "C5'" . DA  I  5 17  ? 20.311  -16.159 47.261 1.00 109.55 ? -57  DA  I "C5'" 1 
ATOM   6480  C  "C4'" . DA  I  5 17  ? 19.160  -15.260 46.810 1.00 108.78 ? -57  DA  I "C4'" 1 
ATOM   6481  O  "O4'" . DA  I  5 17  ? 19.599  -13.879 46.662 1.00 109.08 ? -57  DA  I "O4'" 1 
ATOM   6482  C  "C3'" . DA  I  5 17  ? 18.506  -15.621 45.480 1.00 108.11 ? -57  DA  I "C3'" 1 
ATOM   6483  O  "O3'" . DA  I  5 17  ? 17.119  -15.356 45.578 1.00 107.12 ? -57  DA  I "O3'" 1 
ATOM   6484  C  "C2'" . DA  I  5 17  ? 19.197  -14.696 44.477 1.00 108.00 ? -57  DA  I "C2'" 1 
ATOM   6485  C  "C1'" . DA  I  5 17  ? 19.444  -13.448 45.318 1.00 108.17 ? -57  DA  I "C1'" 1 
ATOM   6486  N  N9    . DA  I  5 17  ? 20.623  -12.692 44.898 1.00 108.12 ? -57  DA  I N9    1 
ATOM   6487  C  C8    . DA  I  5 17  ? 21.781  -13.193 44.363 1.00 108.07 ? -57  DA  I C8    1 
ATOM   6488  N  N7    . DA  I  5 17  ? 22.673  -12.278 44.073 1.00 108.27 ? -57  DA  I N7    1 
ATOM   6489  C  C5    . DA  I  5 17  ? 22.056  -11.095 44.440 1.00 108.04 ? -57  DA  I C5    1 
ATOM   6490  C  C6    . DA  I  5 17  ? 22.475  -9.755  44.385 1.00 107.85 ? -57  DA  I C6    1 
ATOM   6491  N  N6    . DA  I  5 17  ? 23.667  -9.402  43.914 1.00 107.96 ? -57  DA  I N6    1 
ATOM   6492  N  N1    . DA  I  5 17  ? 21.631  -8.799  44.823 1.00 107.74 ? -57  DA  I N1    1 
ATOM   6493  C  C2    . DA  I  5 17  ? 20.435  -9.171  45.293 1.00 107.87 ? -57  DA  I C2    1 
ATOM   6494  N  N3    . DA  I  5 17  ? 19.925  -10.400 45.393 1.00 107.89 ? -57  DA  I N3    1 
ATOM   6495  C  C4    . DA  I  5 17  ? 20.792  -11.326 44.948 1.00 108.05 ? -57  DA  I C4    1 
ATOM   6496  P  P     . DG  I  5 18  ? 16.100  -15.626 44.367 1.00 106.16 ? -56  DG  I P     1 
ATOM   6497  O  OP1   . DG  I  5 18  ? 15.594  -17.007 44.561 1.00 106.08 ? -56  DG  I OP1   1 
ATOM   6498  O  OP2   . DG  I  5 18  ? 16.727  -15.252 43.069 1.00 105.76 ? -56  DG  I OP2   1 
ATOM   6499  O  "O5'" . DG  I  5 18  ? 14.938  -14.566 44.688 1.00 103.48 ? -56  DG  I "O5'" 1 
ATOM   6500  C  "C5'" . DG  I  5 18  ? 15.270  -13.345 45.338 1.00 100.78 ? -56  DG  I "C5'" 1 
ATOM   6501  C  "C4'" . DG  I  5 18  ? 15.526  -12.211 44.356 1.00 99.01  ? -56  DG  I "C4'" 1 
ATOM   6502  O  "O4'" . DG  I  5 18  ? 16.905  -12.097 43.934 1.00 98.61  ? -56  DG  I "O4'" 1 
ATOM   6503  C  "C3'" . DG  I  5 18  ? 14.710  -12.190 43.069 1.00 97.78  ? -56  DG  I "C3'" 1 
ATOM   6504  O  "O3'" . DG  I  5 18  ? 13.853  -11.099 43.273 1.00 96.76  ? -56  DG  I "O3'" 1 
ATOM   6505  C  "C2'" . DG  I  5 18  ? 15.721  -11.885 41.960 1.00 97.54  ? -56  DG  I "C2'" 1 
ATOM   6506  C  "C1'" . DG  I  5 18  ? 16.877  -11.302 42.762 1.00 97.69  ? -56  DG  I "C1'" 1 
ATOM   6507  N  N9    . DG  I  5 18  ? 18.191  -11.339 42.115 1.00 97.60  ? -56  DG  I N9    1 
ATOM   6508  C  C8    . DG  I  5 18  ? 18.794  -12.412 41.498 1.00 97.41  ? -56  DG  I C8    1 
ATOM   6509  N  N7    . DG  I  5 18  ? 19.976  -12.147 41.022 1.00 97.03  ? -56  DG  I N7    1 
ATOM   6510  C  C5    . DG  I  5 18  ? 20.172  -10.816 41.346 1.00 97.09  ? -56  DG  I C5    1 
ATOM   6511  C  C6    . DG  I  5 18  ? 21.279  -9.979  41.087 1.00 97.41  ? -56  DG  I C6    1 
ATOM   6512  O  O6    . DG  I  5 18  ? 22.326  -10.268 40.496 1.00 97.43  ? -56  DG  I O6    1 
ATOM   6513  N  N1    . DG  I  5 18  ? 21.087  -8.687  41.582 1.00 97.62  ? -56  DG  I N1    1 
ATOM   6514  C  C2    . DG  I  5 18  ? 19.961  -8.261  42.246 1.00 97.32  ? -56  DG  I C2    1 
ATOM   6515  N  N2    . DG  I  5 18  ? 19.961  -6.986  42.652 1.00 97.29  ? -56  DG  I N2    1 
ATOM   6516  N  N3    . DG  I  5 18  ? 18.915  -9.039  42.498 1.00 97.36  ? -56  DG  I N3    1 
ATOM   6517  C  C4    . DG  I  5 18  ? 19.089  -10.301 42.022 1.00 97.27  ? -56  DG  I C4    1 
ATOM   6518  P  P     . DA  I  5 19  ? 12.614  -10.760 42.346 1.00 95.75  ? -55  DA  I P     1 
ATOM   6519  O  OP1   . DA  I  5 19  ? 11.451  -10.670 43.253 1.00 95.00  ? -55  DA  I OP1   1 
ATOM   6520  O  OP2   . DA  I  5 19  ? 12.623  -11.640 41.155 1.00 95.30  ? -55  DA  I OP2   1 
ATOM   6521  O  "O5'" . DA  I  5 19  ? 12.982  -9.302  41.831 1.00 96.36  ? -55  DA  I "O5'" 1 
ATOM   6522  C  "C5'" . DA  I  5 19  ? 13.556  -8.395  42.751 1.00 97.92  ? -55  DA  I "C5'" 1 
ATOM   6523  C  "C4'" . DA  I  5 19  ? 14.345  -7.328  42.023 1.00 98.83  ? -55  DA  I "C4'" 1 
ATOM   6524  O  "O4'" . DA  I  5 19  ? 15.616  -7.873  41.601 1.00 99.21  ? -55  DA  I "O4'" 1 
ATOM   6525  C  "C3'" . DA  I  5 19  ? 13.673  -6.763  40.776 1.00 98.89  ? -55  DA  I "C3'" 1 
ATOM   6526  O  "O3'" . DA  I  5 19  ? 13.619  -5.362  40.921 1.00 99.90  ? -55  DA  I "O3'" 1 
ATOM   6527  C  "C2'" . DA  I  5 19  ? 14.583  -7.211  39.637 1.00 98.86  ? -55  DA  I "C2'" 1 
ATOM   6528  C  "C1'" . DA  I  5 19  ? 15.915  -7.273  40.366 1.00 99.22  ? -55  DA  I "C1'" 1 
ATOM   6529  N  N9    . DA  I  5 19  ? 16.940  -8.087  39.739 1.00 99.14  ? -55  DA  I N9    1 
ATOM   6530  C  C8    . DA  I  5 19  ? 16.876  -9.407  39.379 1.00 99.32  ? -55  DA  I C8    1 
ATOM   6531  N  N7    . DA  I  5 19  ? 17.981  -9.861  38.837 1.00 99.25  ? -55  DA  I N7    1 
ATOM   6532  C  C5    . DA  I  5 19  ? 18.823  -8.759  38.856 1.00 99.54  ? -55  DA  I C5    1 
ATOM   6533  C  C6    . DA  I  5 19  ? 20.153  -8.561  38.425 1.00 99.56  ? -55  DA  I C6    1 
ATOM   6534  N  N6    . DA  I  5 19  ? 20.893  -9.525  37.870 1.00 99.34  ? -55  DA  I N6    1 
ATOM   6535  N  N1    . DA  I  5 19  ? 20.695  -7.330  38.593 1.00 99.45  ? -55  DA  I N1    1 
ATOM   6536  C  C2    . DA  I  5 19  ? 19.956  -6.357  39.154 1.00 99.24  ? -55  DA  I C2    1 
ATOM   6537  N  N3    . DA  I  5 19  ? 18.699  -6.423  39.594 1.00 98.96  ? -55  DA  I N3    1 
ATOM   6538  C  C4    . DA  I  5 19  ? 18.194  -7.657  39.412 1.00 99.19  ? -55  DA  I C4    1 
ATOM   6539  P  P     . DT  I  5 20  ? 13.036  -4.440  39.756 1.00 101.56 ? -54  DT  I P     1 
ATOM   6540  O  OP1   . DT  I  5 20  ? 12.569  -3.167  40.351 1.00 101.64 ? -54  DT  I OP1   1 
ATOM   6541  O  OP2   . DT  I  5 20  ? 12.127  -5.245  38.908 1.00 100.64 ? -54  DT  I OP2   1 
ATOM   6542  O  "O5'" . DT  I  5 20  ? 14.358  -4.123  38.919 1.00 103.63 ? -54  DT  I "O5'" 1 
ATOM   6543  C  "C5'" . DT  I  5 20  ? 15.390  -3.285  39.457 1.00 105.33 ? -54  DT  I "C5'" 1 
ATOM   6544  C  "C4'" . DT  I  5 20  ? 16.530  -3.143  38.462 1.00 106.44 ? -54  DT  I "C4'" 1 
ATOM   6545  O  "O4'" . DT  I  5 20  ? 17.107  -4.439  38.184 1.00 106.26 ? -54  DT  I "O4'" 1 
ATOM   6546  C  "C3'" . DT  I  5 20  ? 16.135  -2.555  37.109 1.00 107.17 ? -54  DT  I "C3'" 1 
ATOM   6547  O  "O3'" . DT  I  5 20  ? 16.616  -1.224  37.083 1.00 108.93 ? -54  DT  I "O3'" 1 
ATOM   6548  C  "C2'" . DT  I  5 20  ? 16.793  -3.463  36.063 1.00 106.75 ? -54  DT  I "C2'" 1 
ATOM   6549  C  "C1'" . DT  I  5 20  ? 17.665  -4.396  36.894 1.00 106.10 ? -54  DT  I "C1'" 1 
ATOM   6550  N  N1    . DT  I  5 20  ? 17.745  -5.798  36.406 1.00 105.81 ? -54  DT  I N1    1 
ATOM   6551  C  C2    . DT  I  5 20  ? 18.961  -6.252  35.953 1.00 105.97 ? -54  DT  I C2    1 
ATOM   6552  O  O2    . DT  I  5 20  ? 19.957  -5.546  35.936 1.00 106.22 ? -54  DT  I O2    1 
ATOM   6553  N  N3    . DT  I  5 20  ? 18.961  -7.561  35.523 1.00 105.89 ? -54  DT  I N3    1 
ATOM   6554  C  C4    . DT  I  5 20  ? 17.882  -8.435  35.507 1.00 105.97 ? -54  DT  I C4    1 
ATOM   6555  O  O4    . DT  I  5 20  ? 17.973  -9.590  35.103 1.00 106.08 ? -54  DT  I O4    1 
ATOM   6556  C  C5    . DT  I  5 20  ? 16.637  -7.897  35.998 1.00 106.10 ? -54  DT  I C5    1 
ATOM   6557  C  C7    . DT  I  5 20  ? 15.403  -8.756  36.026 1.00 106.01 ? -54  DT  I C7    1 
ATOM   6558  C  C6    . DT  I  5 20  ? 16.630  -6.620  36.420 1.00 106.06 ? -54  DT  I C6    1 
ATOM   6559  P  P     . DA  I  5 21  ? 16.409  -0.262  35.827 1.00 110.66 ? -53  DA  I P     1 
ATOM   6560  O  OP1   . DA  I  5 21  ? 16.562  1.131   36.304 1.00 110.49 ? -53  DA  I OP1   1 
ATOM   6561  O  OP2   . DA  I  5 21  ? 15.192  -0.654  35.078 1.00 110.33 ? -53  DA  I OP2   1 
ATOM   6562  O  "O5'" . DA  I  5 21  ? 17.684  -0.653  34.952 1.00 112.38 ? -53  DA  I "O5'" 1 
ATOM   6563  C  "C5'" . DA  I  5 21  ? 19.016  -0.451  35.434 1.00 114.47 ? -53  DA  I "C5'" 1 
ATOM   6564  C  "C4'" . DA  I  5 21  ? 19.986  -0.758  34.309 1.00 116.15 ? -53  DA  I "C4'" 1 
ATOM   6565  O  "O4'" . DA  I  5 21  ? 20.068  -2.200  34.162 1.00 116.50 ? -53  DA  I "O4'" 1 
ATOM   6566  C  "C3'" . DA  I  5 21  ? 19.591  -0.204  32.932 1.00 117.08 ? -53  DA  I "C3'" 1 
ATOM   6567  O  "O3'" . DA  I  5 21  ? 20.724  0.414   32.286 1.00 118.43 ? -53  DA  I "O3'" 1 
ATOM   6568  C  "C2'" . DA  I  5 21  ? 19.078  -1.444  32.190 1.00 116.95 ? -53  DA  I "C2'" 1 
ATOM   6569  C  "C1'" . DA  I  5 21  ? 19.980  -2.518  32.786 1.00 116.73 ? -53  DA  I "C1'" 1 
ATOM   6570  N  N9    . DA  I  5 21  ? 19.508  -3.894  32.641 1.00 116.67 ? -53  DA  I N9    1 
ATOM   6571  C  C8    . DA  I  5 21  ? 18.286  -4.402  32.989 1.00 116.59 ? -53  DA  I C8    1 
ATOM   6572  N  N7    . DA  I  5 21  ? 18.161  -5.685  32.739 1.00 116.63 ? -53  DA  I N7    1 
ATOM   6573  C  C5    . DA  I  5 21  ? 19.383  -6.048  32.194 1.00 116.47 ? -53  DA  I C5    1 
ATOM   6574  C  C6    . DA  I  5 21  ? 19.902  -7.275  31.721 1.00 116.46 ? -53  DA  I C6    1 
ATOM   6575  N  N6    . DA  I  5 21  ? 19.216  -8.419  31.711 1.00 116.45 ? -53  DA  I N6    1 
ATOM   6576  N  N1    . DA  I  5 21  ? 21.163  -7.284  31.239 1.00 116.83 ? -53  DA  I N1    1 
ATOM   6577  C  C2    . DA  I  5 21  ? 21.866  -6.141  31.230 1.00 116.85 ? -53  DA  I C2    1 
ATOM   6578  N  N3    . DA  I  5 21  ? 21.487  -4.933  31.652 1.00 116.77 ? -53  DA  I N3    1 
ATOM   6579  C  C4    . DA  I  5 21  ? 20.226  -4.952  32.126 1.00 116.59 ? -53  DA  I C4    1 
ATOM   6580  P  P     . DC  I  5 22  ? 20.616  1.260   30.915 1.00 119.26 ? -52  DC  I P     1 
ATOM   6581  O  OP1   . DC  I  5 22  ? 21.056  2.648   31.203 1.00 119.07 ? -52  DC  I OP1   1 
ATOM   6582  O  OP2   . DC  I  5 22  ? 19.277  1.044   30.293 1.00 119.35 ? -52  DC  I OP2   1 
ATOM   6583  O  "O5'" . DC  I  5 22  ? 21.731  0.584   29.976 1.00 119.42 ? -52  DC  I "O5'" 1 
ATOM   6584  C  "C5'" . DC  I  5 22  ? 21.682  -0.817  29.755 1.00 121.29 ? -52  DC  I "C5'" 1 
ATOM   6585  C  "C4'" . DC  I  5 22  ? 22.435  -1.145  28.473 1.00 122.96 ? -52  DC  I "C4'" 1 
ATOM   6586  O  "O4'" . DC  I  5 22  ? 22.511  -2.591  28.331 1.00 123.02 ? -52  DC  I "O4'" 1 
ATOM   6587  C  "C3'" . DC  I  5 22  ? 21.746  -0.626  27.208 1.00 124.46 ? -52  DC  I "C3'" 1 
ATOM   6588  O  "O3'" . DC  I  5 22  ? 22.750  -0.311  26.234 1.00 126.98 ? -52  DC  I "O3'" 1 
ATOM   6589  C  "C2'" . DC  I  5 22  ? 20.868  -1.799  26.765 1.00 124.10 ? -52  DC  I "C2'" 1 
ATOM   6590  C  "C1'" . DC  I  5 22  ? 21.609  -3.026  27.319 1.00 123.55 ? -52  DC  I "C1'" 1 
ATOM   6591  N  N1    . DC  I  5 22  ? 20.645  -4.038  27.870 1.00 123.82 ? -52  DC  I N1    1 
ATOM   6592  C  C2    . DC  I  5 22  ? 21.008  -5.395  27.945 1.00 123.75 ? -52  DC  I C2    1 
ATOM   6593  O  O2    . DC  I  5 22  ? 22.135  -5.747  27.575 1.00 123.74 ? -52  DC  I O2    1 
ATOM   6594  N  N3    . DC  I  5 22  ? 20.106  -6.292  28.431 1.00 123.51 ? -52  DC  I N3    1 
ATOM   6595  C  C4    . DC  I  5 22  ? 18.893  -5.886  28.823 1.00 123.46 ? -52  DC  I C4    1 
ATOM   6596  N  N4    . DC  I  5 22  ? 18.044  -6.803  29.291 1.00 123.40 ? -52  DC  I N4    1 
ATOM   6597  C  C5    . DC  I  5 22  ? 18.497  -4.515  28.750 1.00 123.67 ? -52  DC  I C5    1 
ATOM   6598  C  C6    . DC  I  5 22  ? 19.392  -3.639  28.272 1.00 123.91 ? -52  DC  I C6    1 
ATOM   6599  P  P     . DT  I  5 23  ? 22.439  -0.015  24.681 1.00 128.48 ? -51  DT  I P     1 
ATOM   6600  O  OP1   . DT  I  5 23  ? 23.524  0.865   24.190 1.00 128.68 ? -51  DT  I OP1   1 
ATOM   6601  O  OP2   . DT  I  5 23  ? 21.024  0.396   24.508 1.00 128.40 ? -51  DT  I OP2   1 
ATOM   6602  O  "O5'" . DT  I  5 23  ? 22.621  -1.452  24.013 1.00 128.66 ? -51  DT  I "O5'" 1 
ATOM   6603  C  "C5'" . DT  I  5 23  ? 23.859  -2.148  24.129 1.00 129.54 ? -51  DT  I "C5'" 1 
ATOM   6604  C  "C4'" . DT  I  5 23  ? 23.734  -3.455  23.373 1.00 130.39 ? -51  DT  I "C4'" 1 
ATOM   6605  O  "O4'" . DT  I  5 23  ? 22.880  -4.363  24.123 1.00 130.58 ? -51  DT  I "O4'" 1 
ATOM   6606  C  "C3'" . DT  I  5 23  ? 23.122  -3.308  21.977 1.00 130.71 ? -51  DT  I "C3'" 1 
ATOM   6607  O  "O3'" . DT  I  5 23  ? 23.923  -3.999  21.021 1.00 130.96 ? -51  DT  I "O3'" 1 
ATOM   6608  C  "C2'" . DT  I  5 23  ? 21.738  -3.937  22.120 1.00 130.96 ? -51  DT  I "C2'" 1 
ATOM   6609  C  "C1'" . DT  I  5 23  ? 21.946  -4.954  23.239 1.00 130.72 ? -51  DT  I "C1'" 1 
ATOM   6610  N  N1    . DT  I  5 23  ? 20.678  -5.287  23.969 1.00 130.66 ? -51  DT  I N1    1 
ATOM   6611  C  C2    . DT  I  5 23  ? 20.464  -6.573  24.443 1.00 130.39 ? -51  DT  I C2    1 
ATOM   6612  O  O2    . DT  I  5 23  ? 21.252  -7.498  24.316 1.00 130.17 ? -51  DT  I O2    1 
ATOM   6613  N  N3    . DT  I  5 23  ? 19.259  -6.733  25.088 1.00 130.48 ? -51  DT  I N3    1 
ATOM   6614  C  C4    . DT  I  5 23  ? 18.273  -5.775  25.297 1.00 130.61 ? -51  DT  I C4    1 
ATOM   6615  O  O4    . DT  I  5 23  ? 17.232  -6.039  25.890 1.00 130.59 ? -51  DT  I O4    1 
ATOM   6616  C  C5    . DT  I  5 23  ? 18.560  -4.455  24.774 1.00 130.49 ? -51  DT  I C5    1 
ATOM   6617  C  C7    . DT  I  5 23  ? 17.590  -3.320  24.929 1.00 130.25 ? -51  DT  I C7    1 
ATOM   6618  C  C6    . DT  I  5 23  ? 19.732  -4.284  24.145 1.00 130.64 ? -51  DT  I C6    1 
ATOM   6619  P  P     . DA  I  5 24  ? 23.666  -3.947  19.436 1.00 130.96 ? -50  DA  I P     1 
ATOM   6620  O  OP1   . DA  I  5 24  ? 24.825  -3.219  18.865 1.00 131.10 ? -50  DA  I OP1   1 
ATOM   6621  O  OP2   . DA  I  5 24  ? 22.288  -3.469  19.142 1.00 130.62 ? -50  DA  I OP2   1 
ATOM   6622  O  "O5'" . DA  I  5 24  ? 23.770  -5.500  19.017 1.00 130.36 ? -50  DA  I "O5'" 1 
ATOM   6623  C  "C5'" . DA  I  5 24  ? 23.439  -6.569  19.918 1.00 129.34 ? -50  DA  I "C5'" 1 
ATOM   6624  C  "C4'" . DA  I  5 24  ? 22.399  -7.520  19.342 1.00 128.85 ? -50  DA  I "C4'" 1 
ATOM   6625  O  "O4'" . DA  I  5 24  ? 21.321  -7.708  20.301 1.00 128.89 ? -50  DA  I "O4'" 1 
ATOM   6626  C  "C3'" . DA  I  5 24  ? 21.749  -7.093  18.023 1.00 128.44 ? -50  DA  I "C3'" 1 
ATOM   6627  O  "O3'" . DA  I  5 24  ? 21.933  -8.130  17.044 1.00 127.59 ? -50  DA  I "O3'" 1 
ATOM   6628  C  "C2'" . DA  I  5 24  ? 20.284  -6.852  18.384 1.00 128.72 ? -50  DA  I "C2'" 1 
ATOM   6629  C  "C1'" . DA  I  5 24  ? 20.082  -7.718  19.621 1.00 128.86 ? -50  DA  I "C1'" 1 
ATOM   6630  N  N9    . DA  I  5 24  ? 19.016  -7.216  20.493 1.00 128.85 ? -50  DA  I N9    1 
ATOM   6631  C  C8    . DA  I  5 24  ? 18.776  -5.909  20.832 1.00 128.81 ? -50  DA  I C8    1 
ATOM   6632  N  N7    . DA  I  5 24  ? 17.746  -5.733  21.625 1.00 128.77 ? -50  DA  I N7    1 
ATOM   6633  C  C5    . DA  I  5 24  ? 17.269  -7.018  21.822 1.00 128.95 ? -50  DA  I C5    1 
ATOM   6634  C  C6    . DA  I  5 24  ? 16.185  -7.521  22.575 1.00 128.93 ? -50  DA  I C6    1 
ATOM   6635  N  N6    . DA  I  5 24  ? 15.369  -6.734  23.285 1.00 128.75 ? -50  DA  I N6    1 
ATOM   6636  N  N1    . DA  I  5 24  ? 15.973  -8.860  22.567 1.00 128.88 ? -50  DA  I N1    1 
ATOM   6637  C  C2    . DA  I  5 24  ? 16.797  -9.642  21.851 1.00 128.78 ? -50  DA  I C2    1 
ATOM   6638  N  N3    . DA  I  5 24  ? 17.848  -9.283  21.108 1.00 128.81 ? -50  DA  I N3    1 
ATOM   6639  C  C4    . DA  I  5 24  ? 18.036  -7.947  21.132 1.00 128.93 ? -50  DA  I C4    1 
ATOM   6640  P  P     . DC  I  5 25  ? 21.174  -8.195  15.624 1.00 126.76 ? -49  DC  I P     1 
ATOM   6641  O  OP1   . DC  I  5 25  ? 22.020  -8.974  14.694 1.00 126.40 ? -49  DC  I OP1   1 
ATOM   6642  O  OP2   . DC  I  5 25  ? 20.651  -6.867  15.226 1.00 126.59 ? -49  DC  I OP2   1 
ATOM   6643  O  "O5'" . DC  I  5 25  ? 19.912  -9.075  16.002 1.00 125.56 ? -49  DC  I "O5'" 1 
ATOM   6644  C  "C5'" . DC  I  5 25  ? 20.090  -10.346 16.595 1.00 123.77 ? -49  DC  I "C5'" 1 
ATOM   6645  C  "C4'" . DC  I  5 25  ? 18.719  -10.974 16.631 1.00 122.44 ? -49  DC  I "C4'" 1 
ATOM   6646  O  "O4'" . DC  I  5 25  ? 17.944  -10.291 17.647 1.00 122.59 ? -49  DC  I "O4'" 1 
ATOM   6647  C  "C3'" . DC  I  5 25  ? 17.953  -10.785 15.325 1.00 121.19 ? -49  DC  I "C3'" 1 
ATOM   6648  O  "O3'" . DC  I  5 25  ? 17.396  -12.023 14.932 1.00 118.91 ? -49  DC  I "O3'" 1 
ATOM   6649  C  "C2'" . DC  I  5 25  ? 16.880  -9.742  15.649 1.00 121.68 ? -49  DC  I "C2'" 1 
ATOM   6650  C  "C1'" . DC  I  5 25  ? 16.657  -10.042 17.127 1.00 122.12 ? -49  DC  I "C1'" 1 
ATOM   6651  N  N1    . DC  I  5 25  ? 15.988  -8.958  17.913 1.00 122.04 ? -49  DC  I N1    1 
ATOM   6652  C  C2    . DC  I  5 25  ? 14.959  -9.313  18.800 1.00 121.61 ? -49  DC  I C2    1 
ATOM   6653  O  O2    . DC  I  5 25  ? 14.633  -10.503 18.913 1.00 121.53 ? -49  DC  I O2    1 
ATOM   6654  N  N3    . DC  I  5 25  ? 14.347  -8.334  19.508 1.00 121.31 ? -49  DC  I N3    1 
ATOM   6655  C  C4    . DC  I  5 25  ? 14.726  -7.063  19.355 1.00 121.61 ? -49  DC  I C4    1 
ATOM   6656  N  N4    . DC  I  5 25  ? 14.090  -6.138  20.080 1.00 121.87 ? -49  DC  I N4    1 
ATOM   6657  C  C5    . DC  I  5 25  ? 15.772  -6.681  18.459 1.00 121.63 ? -49  DC  I C5    1 
ATOM   6658  C  C6    . DC  I  5 25  ? 16.373  -7.651  17.763 1.00 121.75 ? -49  DC  I C6    1 
ATOM   6659  P  P     . DC  I  5 26  ? 16.761  -12.176 13.473 1.00 117.36 ? -48  DC  I P     1 
ATOM   6660  O  OP1   . DC  I  5 26  ? 17.297  -13.442 12.920 1.00 117.05 ? -48  DC  I OP1   1 
ATOM   6661  O  OP2   . DC  I  5 26  ? 16.917  -10.894 12.743 1.00 116.80 ? -48  DC  I OP2   1 
ATOM   6662  O  "O5'" . DC  I  5 26  ? 15.190  -12.327 13.752 1.00 116.11 ? -48  DC  I "O5'" 1 
ATOM   6663  C  "C5'" . DC  I  5 26  ? 14.641  -13.308 14.630 1.00 113.44 ? -48  DC  I "C5'" 1 
ATOM   6664  C  "C4'" . DC  I  5 26  ? 13.157  -13.035 14.792 1.00 111.51 ? -48  DC  I "C4'" 1 
ATOM   6665  O  "O4'" . DC  I  5 26  ? 12.949  -11.873 15.627 1.00 111.16 ? -48  DC  I "O4'" 1 
ATOM   6666  C  "C3'" . DC  I  5 26  ? 12.421  -12.729 13.489 1.00 110.48 ? -48  DC  I "C3'" 1 
ATOM   6667  O  "O3'" . DC  I  5 26  ? 11.240  -13.497 13.457 1.00 109.57 ? -48  DC  I "O3'" 1 
ATOM   6668  C  "C2'" . DC  I  5 26  ? 12.097  -11.242 13.572 1.00 110.48 ? -48  DC  I "C2'" 1 
ATOM   6669  C  "C1'" . DC  I  5 26  ? 11.881  -11.137 15.072 1.00 110.66 ? -48  DC  I "C1'" 1 
ATOM   6670  N  N1    . DC  I  5 26  ? 11.968  -9.792  15.657 1.00 110.61 ? -48  DC  I N1    1 
ATOM   6671  C  C2    . DC  I  5 26  ? 11.254  -9.539  16.830 1.00 110.53 ? -48  DC  I C2    1 
ATOM   6672  O  O2    . DC  I  5 26  ? 10.564  -10.440 17.320 1.00 110.39 ? -48  DC  I O2    1 
ATOM   6673  N  N3    . DC  I  5 26  ? 11.338  -8.307  17.391 1.00 110.61 ? -48  DC  I N3    1 
ATOM   6674  C  C4    . DC  I  5 26  ? 12.102  -7.366  16.828 1.00 110.55 ? -48  DC  I C4    1 
ATOM   6675  N  N4    . DC  I  5 26  ? 12.157  -6.170  17.413 1.00 110.47 ? -48  DC  I N4    1 
ATOM   6676  C  C5    . DC  I  5 26  ? 12.846  -7.611  15.635 1.00 110.74 ? -48  DC  I C5    1 
ATOM   6677  C  C6    . DC  I  5 26  ? 12.754  -8.830  15.090 1.00 110.82 ? -48  DC  I C6    1 
ATOM   6678  P  P     . DA  I  5 27  ? 11.300  -14.983 12.875 1.00 108.66 ? -47  DA  I P     1 
ATOM   6679  O  OP1   . DA  I  5 27  ? 12.527  -15.625 13.415 1.00 108.36 ? -47  DA  I OP1   1 
ATOM   6680  O  OP2   . DA  I  5 27  ? 11.054  -14.879 11.420 1.00 107.99 ? -47  DA  I OP2   1 
ATOM   6681  O  "O5'" . DA  I  5 27  ? 10.023  -15.720 13.505 1.00 107.49 ? -47  DA  I "O5'" 1 
ATOM   6682  C  "C5'" . DA  I  5 27  ? 9.922   -15.942 14.916 1.00 104.92 ? -47  DA  I "C5'" 1 
ATOM   6683  C  "C4'" . DA  I  5 27  ? 8.574   -15.461 15.423 1.00 102.43 ? -47  DA  I "C4'" 1 
ATOM   6684  O  "O4'" . DA  I  5 27  ? 8.554   -14.017 15.562 1.00 101.26 ? -47  DA  I "O4'" 1 
ATOM   6685  C  "C3'" . DA  I  5 27  ? 7.396   -15.787 14.521 1.00 101.43 ? -47  DA  I "C3'" 1 
ATOM   6686  O  "O3'" . DA  I  5 27  ? 6.329   -16.045 15.401 1.00 101.57 ? -47  DA  I "O3'" 1 
ATOM   6687  C  "C2'" . DA  I  5 27  ? 7.194   -14.495 13.730 1.00 100.55 ? -47  DA  I "C2'" 1 
ATOM   6688  C  "C1'" . DA  I  5 27  ? 7.475   -13.470 14.821 1.00 100.26 ? -47  DA  I "C1'" 1 
ATOM   6689  N  N9    . DA  I  5 27  ? 7.880   -12.133 14.378 1.00 100.16 ? -47  DA  I N9    1 
ATOM   6690  C  C8    . DA  I  5 27  ? 8.312   -11.760 13.138 1.00 99.89  ? -47  DA  I C8    1 
ATOM   6691  N  N7    . DA  I  5 27  ? 8.622   -10.489 13.044 1.00 99.87  ? -47  DA  I N7    1 
ATOM   6692  C  C5    . DA  I  5 27  ? 8.390   -9.995  14.307 1.00 99.59  ? -47  DA  I C5    1 
ATOM   6693  C  C6    . DA  I  5 27  ? 8.532   -8.715  14.856 1.00 99.62  ? -47  DA  I C6    1 
ATOM   6694  N  N6    . DA  I  5 27  ? 8.957   -7.672  14.152 1.00 99.94  ? -47  DA  I N6    1 
ATOM   6695  N  N1    . DA  I  5 27  ? 8.211   -8.540  16.151 1.00 99.73  ? -47  DA  I N1    1 
ATOM   6696  C  C2    . DA  I  5 27  ? 7.775   -9.588  16.851 1.00 99.62  ? -47  DA  I C2    1 
ATOM   6697  N  N3    . DA  I  5 27  ? 7.606   -10.843 16.444 1.00 99.85  ? -47  DA  I N3    1 
ATOM   6698  C  C4    . DA  I  5 27  ? 7.931   -10.986 15.146 1.00 99.97  ? -47  DA  I C4    1 
ATOM   6699  P  P     . DA  I  5 28  ? 4.968   -16.723 14.911 1.00 101.68 ? -46  DA  I P     1 
ATOM   6700  O  OP1   . DA  I  5 28  ? 5.155   -18.183 15.061 1.00 101.48 ? -46  DA  I OP1   1 
ATOM   6701  O  OP2   . DA  I  5 28  ? 4.584   -16.132 13.601 1.00 101.59 ? -46  DA  I OP2   1 
ATOM   6702  O  "O5'" . DA  I  5 28  ? 3.877   -16.251 15.987 1.00 100.22 ? -46  DA  I "O5'" 1 
ATOM   6703  C  "C5'" . DA  I  5 28  ? 4.243   -15.588 17.195 1.00 98.15  ? -46  DA  I "C5'" 1 
ATOM   6704  C  "C4'" . DA  I  5 28  ? 3.642   -14.188 17.285 1.00 96.48  ? -46  DA  I "C4'" 1 
ATOM   6705  O  "O4'" . DA  I  5 28  ? 4.385   -13.247 16.463 1.00 96.33  ? -46  DA  I "O4'" 1 
ATOM   6706  C  "C3'" . DA  I  5 28  ? 2.172   -14.039 16.897 1.00 95.09  ? -46  DA  I "C3'" 1 
ATOM   6707  O  "O3'" . DA  I  5 28  ? 1.493   -13.706 18.114 1.00 93.94  ? -46  DA  I "O3'" 1 
ATOM   6708  C  "C2'" . DA  I  5 28  ? 2.171   -12.941 15.822 1.00 95.25  ? -46  DA  I "C2'" 1 
ATOM   6709  C  "C1'" . DA  I  5 28  ? 3.506   -12.223 16.043 1.00 95.56  ? -46  DA  I "C1'" 1 
ATOM   6710  N  N9    . DA  I  5 28  ? 4.103   -11.490 14.903 1.00 95.30  ? -46  DA  I N9    1 
ATOM   6711  C  C8    . DA  I  5 28  ? 4.358   -11.953 13.641 1.00 94.84  ? -46  DA  I C8    1 
ATOM   6712  N  N7    . DA  I  5 28  ? 4.906   -11.071 12.841 1.00 94.52  ? -46  DA  I N7    1 
ATOM   6713  C  C5    . DA  I  5 28  ? 5.034   -9.942  13.623 1.00 95.04  ? -46  DA  I C5    1 
ATOM   6714  C  C6    . DA  I  5 28  ? 5.544   -8.645  13.368 1.00 95.21  ? -46  DA  I C6    1 
ATOM   6715  N  N6    . DA  I  5 28  ? 6.047   -8.258  12.197 1.00 94.88  ? -46  DA  I N6    1 
ATOM   6716  N  N1    . DA  I  5 28  ? 5.523   -7.743  14.373 1.00 95.35  ? -46  DA  I N1    1 
ATOM   6717  C  C2    . DA  I  5 28  ? 5.020   -8.114  15.559 1.00 95.13  ? -46  DA  I C2    1 
ATOM   6718  N  N3    . DA  I  5 28  ? 4.512   -9.297  15.916 1.00 95.24  ? -46  DA  I N3    1 
ATOM   6719  C  C4    . DA  I  5 28  ? 4.546   -10.181 14.898 1.00 95.28  ? -46  DA  I C4    1 
ATOM   6720  P  P     . DA  I  5 29  ? -0.015  -13.176 18.240 1.00 93.13  ? -45  DA  I P     1 
ATOM   6721  O  OP1   . DA  I  5 29  ? -0.470  -13.573 19.587 1.00 93.09  ? -45  DA  I OP1   1 
ATOM   6722  O  OP2   . DA  I  5 29  ? -0.803  -13.504 17.034 1.00 93.07  ? -45  DA  I OP2   1 
ATOM   6723  O  "O5'" . DA  I  5 29  ? 0.139   -11.601 18.237 1.00 92.48  ? -45  DA  I "O5'" 1 
ATOM   6724  C  "C5'" . DA  I  5 29  ? 0.798   -10.970 19.306 1.00 91.67  ? -45  DA  I "C5'" 1 
ATOM   6725  C  "C4'" . DA  I  5 29  ? 0.811   -9.500  18.981 1.00 91.10  ? -45  DA  I "C4'" 1 
ATOM   6726  O  "O4'" . DA  I  5 29  ? 1.571   -9.288  17.768 1.00 91.17  ? -45  DA  I "O4'" 1 
ATOM   6727  C  "C3'" . DA  I  5 29  ? -0.569  -8.924  18.719 1.00 90.58  ? -45  DA  I "C3'" 1 
ATOM   6728  O  "O3'" . DA  I  5 29  ? -0.582  -7.678  19.332 1.00 90.67  ? -45  DA  I "O3'" 1 
ATOM   6729  C  "C2'" . DA  I  5 29  ? -0.632  -8.745  17.212 1.00 90.82  ? -45  DA  I "C2'" 1 
ATOM   6730  C  "C1'" . DA  I  5 29  ? 0.832   -8.443  16.917 1.00 91.60  ? -45  DA  I "C1'" 1 
ATOM   6731  N  N9    . DA  I  5 29  ? 1.200   -8.729  15.537 1.00 92.05  ? -45  DA  I N9    1 
ATOM   6732  C  C8    . DA  I  5 29  ? 0.992   -9.897  14.858 1.00 92.15  ? -45  DA  I C8    1 
ATOM   6733  N  N7    . DA  I  5 29  ? 1.420   -9.880  13.619 1.00 92.17  ? -45  DA  I N7    1 
ATOM   6734  C  C5    . DA  I  5 29  ? 1.934   -8.608  13.475 1.00 92.03  ? -45  DA  I C5    1 
ATOM   6735  C  C6    . DA  I  5 29  ? 2.539   -7.960  12.389 1.00 91.77  ? -45  DA  I C6    1 
ATOM   6736  N  N6    . DA  I  5 29  ? 2.719   -8.548  11.210 1.00 91.89  ? -45  DA  I N6    1 
ATOM   6737  N  N1    . DA  I  5 29  ? 2.957   -6.691  12.566 1.00 92.17  ? -45  DA  I N1    1 
ATOM   6738  C  C2    . DA  I  5 29  ? 2.771   -6.103  13.757 1.00 92.11  ? -45  DA  I C2    1 
ATOM   6739  N  N3    . DA  I  5 29  ? 2.214   -6.617  14.854 1.00 92.02  ? -45  DA  I N3    1 
ATOM   6740  C  C4    . DA  I  5 29  ? 1.812   -7.882  14.645 1.00 92.03  ? -45  DA  I C4    1 
ATOM   6741  P  P     . DA  I  5 30  ? -1.880  -7.123  20.062 1.00 90.75  ? -44  DA  I P     1 
ATOM   6742  O  OP1   . DA  I  5 30  ? -1.534  -7.053  21.505 1.00 90.11  ? -44  DA  I OP1   1 
ATOM   6743  O  OP2   . DA  I  5 30  ? -3.067  -7.869  19.568 1.00 90.86  ? -44  DA  I OP2   1 
ATOM   6744  O  "O5'" . DA  I  5 30  ? -2.014  -5.653  19.464 1.00 89.76  ? -44  DA  I "O5'" 1 
ATOM   6745  C  "C5'" . DA  I  5 30  ? -0.840  -4.904  19.234 1.00 89.50  ? -44  DA  I "C5'" 1 
ATOM   6746  C  "C4'" . DA  I  5 30  ? -0.961  -4.158  17.927 1.00 89.17  ? -44  DA  I "C4'" 1 
ATOM   6747  O  "O4'" . DA  I  5 30  ? -0.627  -5.045  16.847 1.00 88.93  ? -44  DA  I "O4'" 1 
ATOM   6748  C  "C3'" . DA  I  5 30  ? -2.366  -3.674  17.615 1.00 88.89  ? -44  DA  I "C3'" 1 
ATOM   6749  O  "O3'" . DA  I  5 30  ? -2.418  -2.311  17.951 1.00 89.25  ? -44  DA  I "O3'" 1 
ATOM   6750  C  "C2'" . DA  I  5 30  ? -2.550  -3.957  16.123 1.00 88.89  ? -44  DA  I "C2'" 1 
ATOM   6751  C  "C1'" . DA  I  5 30  ? -1.165  -4.435  15.696 1.00 88.82  ? -44  DA  I "C1'" 1 
ATOM   6752  N  N9    . DA  I  5 30  ? -1.079  -5.372  14.560 1.00 89.08  ? -44  DA  I N9    1 
ATOM   6753  C  C8    . DA  I  5 30  ? -1.496  -6.678  14.495 1.00 88.44  ? -44  DA  I C8    1 
ATOM   6754  N  N7    . DA  I  5 30  ? -1.256  -7.256  13.341 1.00 87.88  ? -44  DA  I N7    1 
ATOM   6755  C  C5    . DA  I  5 30  ? -0.642  -6.270  12.599 1.00 87.80  ? -44  DA  I C5    1 
ATOM   6756  C  C6    . DA  I  5 30  ? -0.139  -6.243  11.295 1.00 87.85  ? -44  DA  I C6    1 
ATOM   6757  N  N6    . DA  I  5 30  ? -0.189  -7.288  10.482 1.00 88.42  ? -44  DA  I N6    1 
ATOM   6758  N  N1    . DA  I  5 30  ? 0.421   -5.105  10.847 1.00 88.41  ? -44  DA  I N1    1 
ATOM   6759  C  C2    . DA  I  5 30  ? 0.480   -4.045  11.661 1.00 88.42  ? -44  DA  I C2    1 
ATOM   6760  N  N3    . DA  I  5 30  ? 0.043   -3.945  12.913 1.00 88.50  ? -44  DA  I N3    1 
ATOM   6761  C  C4    . DA  I  5 30  ? -0.513  -5.104  13.327 1.00 88.61  ? -44  DA  I C4    1 
ATOM   6762  P  P     . DG  I  5 31  ? -3.745  -1.454  17.731 1.00 90.65  ? -43  DG  I P     1 
ATOM   6763  O  OP1   . DG  I  5 31  ? -3.820  -0.379  18.748 1.00 90.70  ? -43  DG  I OP1   1 
ATOM   6764  O  OP2   . DG  I  5 31  ? -4.897  -2.369  17.563 1.00 90.47  ? -43  DG  I OP2   1 
ATOM   6765  O  "O5'" . DG  I  5 31  ? -3.373  -0.793  16.321 1.00 92.57  ? -43  DG  I "O5'" 1 
ATOM   6766  C  "C5'" . DG  I  5 31  ? -2.091  -0.165  16.122 1.00 94.10  ? -43  DG  I "C5'" 1 
ATOM   6767  C  "C4'" . DG  I  5 31  ? -1.934  0.431   14.727 1.00 94.93  ? -43  DG  I "C4'" 1 
ATOM   6768  O  "O4'" . DG  I  5 31  ? -1.554  -0.596  13.781 1.00 93.79  ? -43  DG  I "O4'" 1 
ATOM   6769  C  "C3'" . DG  I  5 31  ? -3.178  1.105   14.157 1.00 96.27  ? -43  DG  I "C3'" 1 
ATOM   6770  O  "O3'" . DG  I  5 31  ? -2.797  2.293   13.502 1.00 99.94  ? -43  DG  I "O3'" 1 
ATOM   6771  C  "C2'" . DG  I  5 31  ? -3.721  0.100   13.157 1.00 94.81  ? -43  DG  I "C2'" 1 
ATOM   6772  C  "C1'" . DG  I  5 31  ? -2.453  -0.596  12.698 1.00 93.42  ? -43  DG  I "C1'" 1 
ATOM   6773  N  N9    . DG  I  5 31  ? -2.735  -1.975  12.357 1.00 93.09  ? -43  DG  I N9    1 
ATOM   6774  C  C8    . DG  I  5 31  ? -3.177  -2.948  13.211 1.00 92.97  ? -43  DG  I C8    1 
ATOM   6775  N  N7    . DG  I  5 31  ? -3.355  -4.103  12.641 1.00 92.96  ? -43  DG  I N7    1 
ATOM   6776  C  C5    . DG  I  5 31  ? -3.019  -3.872  11.319 1.00 92.96  ? -43  DG  I C5    1 
ATOM   6777  C  C6    . DG  I  5 31  ? -3.026  -4.758  10.223 1.00 92.95  ? -43  DG  I C6    1 
ATOM   6778  O  O6    . DG  I  5 31  ? -3.340  -5.951  10.234 1.00 92.90  ? -43  DG  I O6    1 
ATOM   6779  N  N1    . DG  I  5 31  ? -2.618  -4.134  9.040  1.00 93.23  ? -43  DG  I N1    1 
ATOM   6780  C  C2    . DG  I  5 31  ? -2.243  -2.808  8.941  1.00 93.13  ? -43  DG  I C2    1 
ATOM   6781  N  N2    . DG  I  5 31  ? -1.875  -2.371  7.729  1.00 93.06  ? -43  DG  I N2    1 
ATOM   6782  N  N3    . DG  I  5 31  ? -2.237  -1.963  9.965  1.00 93.18  ? -43  DG  I N3    1 
ATOM   6783  C  C4    . DG  I  5 31  ? -2.636  -2.563  11.120 1.00 93.19  ? -43  DG  I C4    1 
ATOM   6784  P  P     . DT  I  5 32  ? -3.860  3.423   13.093 1.00 102.84 ? -42  DT  I P     1 
ATOM   6785  O  OP1   . DT  I  5 32  ? -3.300  4.712   13.585 1.00 102.93 ? -42  DT  I OP1   1 
ATOM   6786  O  OP2   . DT  I  5 32  ? -5.235  3.017   13.473 1.00 102.41 ? -42  DT  I OP2   1 
ATOM   6787  O  "O5'" . DT  I  5 32  ? -3.782  3.364   11.494 1.00 104.47 ? -42  DT  I "O5'" 1 
ATOM   6788  C  "C5'" . DT  I  5 32  ? -2.594  2.910   10.822 1.00 107.04 ? -42  DT  I "C5'" 1 
ATOM   6789  C  "C4'" . DT  I  5 32  ? -2.842  2.727   9.335  1.00 108.80 ? -42  DT  I "C4'" 1 
ATOM   6790  O  "O4'" . DT  I  5 32  ? -2.979  1.317   9.022  1.00 108.74 ? -42  DT  I "O4'" 1 
ATOM   6791  C  "C3'" . DT  I  5 32  ? -4.103  3.412   8.819  1.00 110.35 ? -42  DT  I "C3'" 1 
ATOM   6792  O  "O3'" . DT  I  5 32  ? -3.791  4.091   7.624  1.00 113.52 ? -42  DT  I "O3'" 1 
ATOM   6793  C  "C2'" . DT  I  5 32  ? -5.089  2.272   8.585  1.00 109.81 ? -42  DT  I "C2'" 1 
ATOM   6794  C  "C1'" . DT  I  5 32  ? -4.151  1.118   8.257  1.00 109.07 ? -42  DT  I "C1'" 1 
ATOM   6795  N  N1    . DT  I  5 32  ? -4.731  -0.228  8.562  1.00 109.00 ? -42  DT  I N1    1 
ATOM   6796  C  C2    . DT  I  5 32  ? -4.731  -1.182  7.567  1.00 108.94 ? -42  DT  I C2    1 
ATOM   6797  O  O2    . DT  I  5 32  ? -4.273  -0.990  6.455  1.00 109.04 ? -42  DT  I O2    1 
ATOM   6798  N  N3    . DT  I  5 32  ? -5.282  -2.387  7.928  1.00 108.95 ? -42  DT  I N3    1 
ATOM   6799  C  C4    . DT  I  5 32  ? -5.826  -2.723  9.157  1.00 108.90 ? -42  DT  I C4    1 
ATOM   6800  O  O4    . DT  I  5 32  ? -6.294  -3.832  9.376  1.00 109.03 ? -42  DT  I O4    1 
ATOM   6801  C  C5    . DT  I  5 32  ? -5.803  -1.684  10.156 1.00 108.83 ? -42  DT  I C5    1 
ATOM   6802  C  C7    . DT  I  5 32  ? -6.367  -1.938  11.525 1.00 108.72 ? -42  DT  I C7    1 
ATOM   6803  C  C6    . DT  I  5 32  ? -5.264  -0.501  9.814  1.00 108.99 ? -42  DT  I C6    1 
ATOM   6804  P  P     . DG  I  5 33  ? -4.867  5.014   6.876  1.00 116.33 ? -41  DG  I P     1 
ATOM   6805  O  OP1   . DG  I  5 33  ? -4.107  6.106   6.225  1.00 116.13 ? -41  DG  I OP1   1 
ATOM   6806  O  OP2   . DG  I  5 33  ? -5.980  5.343   7.805  1.00 115.61 ? -41  DG  I OP2   1 
ATOM   6807  O  "O5'" . DG  I  5 33  ? -5.424  4.027   5.740  1.00 118.13 ? -41  DG  I "O5'" 1 
ATOM   6808  C  "C5'" . DG  I  5 33  ? -4.597  3.562   4.663  1.00 120.87 ? -41  DG  I "C5'" 1 
ATOM   6809  C  "C4'" . DG  I  5 33  ? -5.396  2.649   3.744  1.00 123.11 ? -41  DG  I "C4'" 1 
ATOM   6810  O  "O4'" . DG  I  5 33  ? -5.644  1.387   4.421  1.00 123.23 ? -41  DG  I "O4'" 1 
ATOM   6811  C  "C3'" . DG  I  5 33  ? -6.769  3.197   3.348  1.00 124.76 ? -41  DG  I "C3'" 1 
ATOM   6812  O  "O3'" . DG  I  5 33  ? -7.001  3.106   1.937  1.00 127.87 ? -41  DG  I "O3'" 1 
ATOM   6813  C  "C2'" . DG  I  5 33  ? -7.753  2.328   4.124  1.00 124.07 ? -41  DG  I "C2'" 1 
ATOM   6814  C  "C1'" . DG  I  5 33  ? -6.987  1.013   4.186  1.00 123.28 ? -41  DG  I "C1'" 1 
ATOM   6815  N  N9    . DG  I  5 33  ? -7.474  0.097   5.221  1.00 123.18 ? -41  DG  I N9    1 
ATOM   6816  C  C8    . DG  I  5 33  ? -7.631  0.350   6.564  1.00 123.11 ? -41  DG  I C8    1 
ATOM   6817  N  N7    . DG  I  5 33  ? -8.094  -0.668  7.237  1.00 123.05 ? -41  DG  I N7    1 
ATOM   6818  C  C5    . DG  I  5 33  ? -8.261  -1.662  6.280  1.00 123.10 ? -41  DG  I C5    1 
ATOM   6819  C  C6    . DG  I  5 33  ? -8.736  -2.992  6.408  1.00 123.10 ? -41  DG  I C6    1 
ATOM   6820  O  O6    . DG  I  5 33  ? -9.115  -3.575  7.429  1.00 123.05 ? -41  DG  I O6    1 
ATOM   6821  N  N1    . DG  I  5 33  ? -8.751  -3.672  5.192  1.00 123.10 ? -41  DG  I N1    1 
ATOM   6822  C  C2    . DG  I  5 33  ? -8.353  -3.129  3.996  1.00 123.03 ? -41  DG  I C2    1 
ATOM   6823  N  N2    . DG  I  5 33  ? -8.436  -3.930  2.928  1.00 123.13 ? -41  DG  I N2    1 
ATOM   6824  N  N3    . DG  I  5 33  ? -7.907  -1.886  3.857  1.00 123.07 ? -41  DG  I N3    1 
ATOM   6825  C  C4    . DG  I  5 33  ? -7.887  -1.207  5.034  1.00 123.15 ? -41  DG  I C4    1 
ATOM   6826  P  P     . DT  I  5 34  ? -7.933  4.198   1.203  1.00 130.35 ? -40  DT  I P     1 
ATOM   6827  O  OP1   . DT  I  5 34  ? -7.059  4.919   0.244  1.00 130.48 ? -40  DT  I OP1   1 
ATOM   6828  O  OP2   . DT  I  5 34  ? -8.707  4.948   2.232  1.00 130.26 ? -40  DT  I OP2   1 
ATOM   6829  O  "O5'" . DT  I  5 34  ? -8.982  3.330   0.360  1.00 130.43 ? -40  DT  I "O5'" 1 
ATOM   6830  C  "C5'" . DT  I  5 34  ? -9.958  2.543   1.018  1.00 130.65 ? -40  DT  I "C5'" 1 
ATOM   6831  C  "C4'" . DT  I  5 34  ? -10.088 1.204   0.315  1.00 130.76 ? -40  DT  I "C4'" 1 
ATOM   6832  O  "O4'" . DT  I  5 34  ? -9.717  0.111   1.193  1.00 130.95 ? -40  DT  I "O4'" 1 
ATOM   6833  C  "C3'" . DT  I  5 34  ? -11.502 0.918   -0.159 1.00 130.54 ? -40  DT  I "C3'" 1 
ATOM   6834  O  "O3'" . DT  I  5 34  ? -11.464 0.319   -1.431 1.00 129.48 ? -40  DT  I "O3'" 1 
ATOM   6835  C  "C2'" . DT  I  5 34  ? -12.083 -0.055  0.859  1.00 131.16 ? -40  DT  I "C2'" 1 
ATOM   6836  C  "C1'" . DT  I  5 34  ? -10.864 -0.639  1.566  1.00 131.67 ? -40  DT  I "C1'" 1 
ATOM   6837  N  N1    . DT  I  5 34  ? -11.051 -0.639  3.061  1.00 131.92 ? -40  DT  I N1    1 
ATOM   6838  C  C2    . DT  I  5 34  ? -11.372 -1.822  3.701  1.00 131.87 ? -40  DT  I C2    1 
ATOM   6839  O  O2    . DT  I  5 34  ? -11.502 -2.887  3.128  1.00 132.18 ? -40  DT  I O2    1 
ATOM   6840  N  N3    . DT  I  5 34  ? -11.525 -1.716  5.059  1.00 131.84 ? -40  DT  I N3    1 
ATOM   6841  C  C4    . DT  I  5 34  ? -11.404 -0.567  5.823  1.00 131.99 ? -40  DT  I C4    1 
ATOM   6842  O  O4    . DT  I  5 34  ? -11.564 -0.584  7.037  1.00 132.18 ? -40  DT  I O4    1 
ATOM   6843  C  C5    . DT  I  5 34  ? -11.074 0.642   5.101  1.00 132.10 ? -40  DT  I C5    1 
ATOM   6844  C  C7    . DT  I  5 34  ? -10.912 1.956   5.814  1.00 131.87 ? -40  DT  I C7    1 
ATOM   6845  C  C6    . DT  I  5 34  ? -10.922 0.544   3.774  1.00 132.21 ? -40  DT  I C6    1 
ATOM   6846  P  P     . DA  I  5 35  ? -12.735 0.475   -2.381 1.00 128.56 ? -39  DA  I P     1 
ATOM   6847  O  OP1   . DA  I  5 35  ? -12.221 0.848   -3.717 1.00 128.87 ? -39  DA  I OP1   1 
ATOM   6848  O  OP2   . DA  I  5 35  ? -13.727 1.353   -1.711 1.00 127.99 ? -39  DA  I OP2   1 
ATOM   6849  O  "O5'" . DA  I  5 35  ? -13.330 -1.015  -2.448 1.00 128.26 ? -39  DA  I "O5'" 1 
ATOM   6850  C  "C5'" . DA  I  5 35  ? -12.505 -2.200  -2.466 1.00 127.20 ? -39  DA  I "C5'" 1 
ATOM   6851  C  "C4'" . DA  I  5 35  ? -13.293 -3.403  -1.953 1.00 126.67 ? -39  DA  I "C4'" 1 
ATOM   6852  O  "O4'" . DA  I  5 35  ? -13.273 -3.405  -0.494 1.00 126.59 ? -39  DA  I "O4'" 1 
ATOM   6853  C  "C3'" . DA  I  5 35  ? -14.775 -3.458  -2.376 1.00 126.03 ? -39  DA  I "C3'" 1 
ATOM   6854  O  "O3'" . DA  I  5 35  ? -15.118 -4.750  -2.979 1.00 124.33 ? -39  DA  I "O3'" 1 
ATOM   6855  C  "C2'" . DA  I  5 35  ? -15.526 -3.116  -1.081 1.00 126.13 ? -39  DA  I "C2'" 1 
ATOM   6856  C  "C1'" . DA  I  5 35  ? -14.582 -3.699  -0.031 1.00 126.10 ? -39  DA  I "C1'" 1 
ATOM   6857  N  N9    . DA  I  5 35  ? -14.828 -3.237  1.344  1.00 125.93 ? -39  DA  I N9    1 
ATOM   6858  C  C8    . DA  I  5 35  ? -14.865 -1.954  1.833  1.00 125.78 ? -39  DA  I C8    1 
ATOM   6859  N  N7    . DA  I  5 35  ? -15.123 -1.867  3.118  1.00 125.28 ? -39  DA  I N7    1 
ATOM   6860  C  C5    . DA  I  5 35  ? -15.269 -3.189  3.501  1.00 125.61 ? -39  DA  I C5    1 
ATOM   6861  C  C6    . DA  I  5 35  ? -15.554 -3.799  4.742  1.00 125.78 ? -39  DA  I C6    1 
ATOM   6862  N  N6    . DA  I  5 35  ? -15.748 -3.102  5.861  1.00 125.90 ? -39  DA  I N6    1 
ATOM   6863  N  N1    . DA  I  5 35  ? -15.635 -5.150  4.795  1.00 125.84 ? -39  DA  I N1    1 
ATOM   6864  C  C2    . DA  I  5 35  ? -15.445 -5.852  3.666  1.00 125.82 ? -39  DA  I C2    1 
ATOM   6865  N  N3    . DA  I  5 35  ? -15.169 -5.393  2.440  1.00 125.86 ? -39  DA  I N3    1 
ATOM   6866  C  C4    . DA  I  5 35  ? -15.095 -4.045  2.425  1.00 125.82 ? -39  DA  I C4    1 
ATOM   6867  P  P     . DT  I  5 36  ? -16.581 -5.441  -2.959 1.00 122.97 ? -38  DT  I P     1 
ATOM   6868  O  OP1   . DT  I  5 36  ? -16.538 -6.603  -3.883 1.00 122.25 ? -38  DT  I OP1   1 
ATOM   6869  O  OP2   . DT  I  5 36  ? -17.631 -4.397  -3.121 1.00 122.42 ? -38  DT  I OP2   1 
ATOM   6870  O  "O5'" . DT  I  5 36  ? -16.651 -5.985  -1.449 1.00 121.81 ? -38  DT  I "O5'" 1 
ATOM   6871  C  "C5'" . DT  I  5 36  ? -16.564 -7.377  -1.101 1.00 118.88 ? -38  DT  I "C5'" 1 
ATOM   6872  C  "C4'" . DT  I  5 36  ? -17.647 -7.724  -0.094 1.00 116.43 ? -38  DT  I "C4'" 1 
ATOM   6873  O  "O4'" . DT  I  5 36  ? -17.507 -6.873  1.080  1.00 116.05 ? -38  DT  I "O4'" 1 
ATOM   6874  C  "C3'" . DT  I  5 36  ? -19.070 -7.517  -0.622 1.00 114.98 ? -38  DT  I "C3'" 1 
ATOM   6875  O  "O3'" . DT  I  5 36  ? -19.862 -8.701  -0.397 1.00 113.18 ? -38  DT  I "O3'" 1 
ATOM   6876  C  "C2'" . DT  I  5 36  ? -19.545 -6.267  0.121  1.00 115.06 ? -38  DT  I "C2'" 1 
ATOM   6877  C  "C1'" . DT  I  5 36  ? -18.790 -6.394  1.444  1.00 115.44 ? -38  DT  I "C1'" 1 
ATOM   6878  N  N1    . DT  I  5 36  ? -18.728 -5.112  2.251  1.00 115.35 ? -38  DT  I N1    1 
ATOM   6879  C  C2    . DT  I  5 36  ? -18.859 -5.133  3.638  1.00 115.12 ? -38  DT  I C2    1 
ATOM   6880  O  O2    . DT  I  5 36  ? -19.018 -6.146  4.308  1.00 114.62 ? -38  DT  I O2    1 
ATOM   6881  N  N3    . DT  I  5 36  ? -18.797 -3.887  4.226  1.00 115.10 ? -38  DT  I N3    1 
ATOM   6882  C  C4    . DT  I  5 36  ? -18.619 -2.658  3.598  1.00 115.06 ? -38  DT  I C4    1 
ATOM   6883  O  O4    . DT  I  5 36  ? -18.568 -1.598  4.218  1.00 114.74 ? -38  DT  I O4    1 
ATOM   6884  C  C5    . DT  I  5 36  ? -18.497 -2.711  2.160  1.00 115.19 ? -38  DT  I C5    1 
ATOM   6885  C  C7    . DT  I  5 36  ? -18.306 -1.458  1.353  1.00 115.30 ? -38  DT  I C7    1 
ATOM   6886  C  C6    . DT  I  5 36  ? -18.555 -3.914  1.569  1.00 115.32 ? -38  DT  I C6    1 
ATOM   6887  P  P     . DT  I  5 37  ? -21.407 -8.718  0.079  1.00 112.15 ? -37  DT  I P     1 
ATOM   6888  O  OP1   . DT  I  5 37  ? -21.970 -10.050 -0.257 1.00 111.83 ? -37  DT  I OP1   1 
ATOM   6889  O  OP2   . DT  I  5 37  ? -22.114 -7.485  -0.359 1.00 111.82 ? -37  DT  I OP2   1 
ATOM   6890  O  "O5'" . DT  I  5 37  ? -21.253 -8.627  1.669  1.00 110.40 ? -37  DT  I "O5'" 1 
ATOM   6891  C  "C5'" . DT  I  5 37  ? -20.507 -9.579  2.439  1.00 106.19 ? -37  DT  I "C5'" 1 
ATOM   6892  C  "C4'" . DT  I  5 37  ? -21.076 -9.582  3.842  1.00 102.93 ? -37  DT  I "C4'" 1 
ATOM   6893  O  "O4'" . DT  I  5 37  ? -20.890 -8.276  4.447  1.00 102.22 ? -37  DT  I "O4'" 1 
ATOM   6894  C  "C3'" . DT  I  5 37  ? -22.573 -9.874  3.881  1.00 100.84 ? -37  DT  I "C3'" 1 
ATOM   6895  O  "O3'" . DT  I  5 37  ? -22.787 -10.810 4.917  1.00 98.01  ? -37  DT  I "O3'" 1 
ATOM   6896  C  "C2'" . DT  I  5 37  ? -23.240 -8.518  4.139  1.00 101.00 ? -37  DT  I "C2'" 1 
ATOM   6897  C  "C1'" . DT  I  5 37  ? -22.141 -7.764  4.881  1.00 101.84 ? -37  DT  I "C1'" 1 
ATOM   6898  N  N1    . DT  I  5 37  ? -22.131 -6.286  4.675  1.00 101.81 ? -37  DT  I N1    1 
ATOM   6899  C  C2    . DT  I  5 37  ? -22.176 -5.456  5.780  1.00 102.05 ? -37  DT  I C2    1 
ATOM   6900  O  O2    . DT  I  5 37  ? -22.237 -5.853  6.933  1.00 102.39 ? -37  DT  I O2    1 
ATOM   6901  N  N3    . DT  I  5 37  ? -22.156 -4.116  5.495  1.00 101.51 ? -37  DT  I N3    1 
ATOM   6902  C  C4    . DT  I  5 37  ? -22.093 -3.540  4.247  1.00 101.53 ? -37  DT  I C4    1 
ATOM   6903  O  O4    . DT  I  5 37  ? -22.083 -2.328  4.116  1.00 101.75 ? -37  DT  I O4    1 
ATOM   6904  C  C5    . DT  I  5 37  ? -22.049 -4.455  3.130  1.00 101.88 ? -37  DT  I C5    1 
ATOM   6905  C  C7    . DT  I  5 37  ? -21.984 -3.945  1.718  1.00 102.03 ? -37  DT  I C7    1 
ATOM   6906  C  C6    . DT  I  5 37  ? -22.069 -5.770  3.394  1.00 101.81 ? -37  DT  I C6    1 
ATOM   6907  P  P     . DT  I  5 38  ? -24.248 -11.337 5.283  1.00 96.06  ? -36  DT  I P     1 
ATOM   6908  O  OP1   . DT  I  5 38  ? -24.092 -12.718 5.800  1.00 95.49  ? -36  DT  I OP1   1 
ATOM   6909  O  OP2   . DT  I  5 38  ? -25.137 -11.067 4.134  1.00 96.45  ? -36  DT  I OP2   1 
ATOM   6910  O  "O5'" . DT  I  5 38  ? -24.706 -10.356 6.468  1.00 93.88  ? -36  DT  I "O5'" 1 
ATOM   6911  C  "C5'" . DT  I  5 38  ? -24.163 -10.498 7.783  1.00 89.28  ? -36  DT  I "C5'" 1 
ATOM   6912  C  "C4'" . DT  I  5 38  ? -24.709 -9.419  8.693  1.00 85.89  ? -36  DT  I "C4'" 1 
ATOM   6913  O  "O4'" . DT  I  5 38  ? -24.485 -8.130  8.075  1.00 85.16  ? -36  DT  I "O4'" 1 
ATOM   6914  C  "C3'" . DT  I  5 38  ? -26.207 -9.516  8.983  1.00 83.79  ? -36  DT  I "C3'" 1 
ATOM   6915  O  "O3'" . DT  I  5 38  ? -26.436 -9.588  10.400 1.00 81.23  ? -36  DT  I "O3'" 1 
ATOM   6916  C  "C2'" . DT  I  5 38  ? -26.789 -8.237  8.381  1.00 83.86  ? -36  DT  I "C2'" 1 
ATOM   6917  C  "C1'" . DT  I  5 38  ? -25.583 -7.309  8.404  1.00 84.75  ? -36  DT  I "C1'" 1 
ATOM   6918  N  N1    . DT  I  5 38  ? -25.637 -6.168  7.440  1.00 84.92  ? -36  DT  I N1    1 
ATOM   6919  C  C2    . DT  I  5 38  ? -25.717 -4.876  7.931  1.00 84.85  ? -36  DT  I C2    1 
ATOM   6920  O  O2    . DT  I  5 38  ? -25.756 -4.600  9.113  1.00 84.90  ? -36  DT  I O2    1 
ATOM   6921  N  N3    . DT  I  5 38  ? -25.755 -3.892  6.975  1.00 85.03  ? -36  DT  I N3    1 
ATOM   6922  C  C4    . DT  I  5 38  ? -25.723 -4.072  5.603  1.00 85.23  ? -36  DT  I C4    1 
ATOM   6923  O  O4    . DT  I  5 38  ? -25.770 -3.113  4.843  1.00 85.27  ? -36  DT  I O4    1 
ATOM   6924  C  C5    . DT  I  5 38  ? -25.635 -5.448  5.143  1.00 85.15  ? -36  DT  I C5    1 
ATOM   6925  C  C7    . DT  I  5 38  ? -25.595 -5.777  3.677  1.00 84.73  ? -36  DT  I C7    1 
ATOM   6926  C  C6    . DT  I  5 38  ? -25.593 -6.416  6.074  1.00 85.32  ? -36  DT  I C6    1 
ATOM   6927  P  P     . DG  I  5 39  ? -26.503 -10.980 11.201 1.00 78.73  ? -35  DG  I P     1 
ATOM   6928  O  OP1   . DG  I  5 39  ? -25.368 -11.829 10.773 1.00 78.00  ? -35  DG  I OP1   1 
ATOM   6929  O  OP2   . DG  I  5 39  ? -27.892 -11.481 11.099 1.00 78.04  ? -35  DG  I OP2   1 
ATOM   6930  O  "O5'" . DG  I  5 39  ? -26.283 -10.561 12.728 1.00 77.88  ? -35  DG  I "O5'" 1 
ATOM   6931  C  "C5'" . DG  I  5 39  ? -25.068 -9.992  13.185 1.00 77.37  ? -35  DG  I "C5'" 1 
ATOM   6932  C  "C4'" . DG  I  5 39  ? -25.319 -8.742  14.018 1.00 77.78  ? -35  DG  I "C4'" 1 
ATOM   6933  O  "O4'" . DG  I  5 39  ? -25.692 -7.638  13.151 1.00 79.26  ? -35  DG  I "O4'" 1 
ATOM   6934  C  "C3'" . DG  I  5 39  ? -26.409 -8.815  15.085 1.00 76.77  ? -35  DG  I "C3'" 1 
ATOM   6935  O  "O3'" . DG  I  5 39  ? -26.020 -8.053  16.211 1.00 74.05  ? -35  DG  I "O3'" 1 
ATOM   6936  C  "C2'" . DG  I  5 39  ? -27.611 -8.167  14.416 1.00 78.64  ? -35  DG  I "C2'" 1 
ATOM   6937  C  "C1'" . DG  I  5 39  ? -26.945 -7.107  13.546 1.00 81.10  ? -35  DG  I "C1'" 1 
ATOM   6938  N  N9    . DG  I  5 39  ? -27.715 -6.788  12.342 1.00 82.03  ? -35  DG  I N9    1 
ATOM   6939  C  C8    . DG  I  5 39  ? -28.471 -7.660  11.588 1.00 82.24  ? -35  DG  I C8    1 
ATOM   6940  N  N7    . DG  I  5 39  ? -29.054 -7.099  10.563 1.00 82.49  ? -35  DG  I N7    1 
ATOM   6941  C  C5    . DG  I  5 39  ? -28.657 -5.770  10.637 1.00 82.35  ? -35  DG  I C5    1 
ATOM   6942  C  C6    . DG  I  5 39  ? -28.974 -4.685  9.791  1.00 81.87  ? -35  DG  I C6    1 
ATOM   6943  O  O6    . DG  I  5 39  ? -29.695 -4.691  8.788  1.00 82.04  ? -35  DG  I O6    1 
ATOM   6944  N  N1    . DG  I  5 39  ? -28.377 -3.501  10.210 1.00 81.85  ? -35  DG  I N1    1 
ATOM   6945  C  C2    . DG  I  5 39  ? -27.568 -3.381  11.313 1.00 82.03  ? -35  DG  I C2    1 
ATOM   6946  N  N2    . DG  I  5 39  ? -27.078 -2.157  11.563 1.00 82.20  ? -35  DG  I N2    1 
ATOM   6947  N  N3    . DG  I  5 39  ? -27.260 -4.393  12.116 1.00 82.27  ? -35  DG  I N3    1 
ATOM   6948  C  C4    . DG  I  5 39  ? -27.838 -5.557  11.725 1.00 82.35  ? -35  DG  I C4    1 
ATOM   6949  P  P     . DG  I  5 40  ? -26.773 -8.205  17.605 1.00 72.24  ? -34  DG  I P     1 
ATOM   6950  O  OP1   . DG  I  5 40  ? -25.780 -7.968  18.672 1.00 72.28  ? -34  DG  I OP1   1 
ATOM   6951  O  OP2   . DG  I  5 40  ? -27.588 -9.433  17.582 1.00 72.11  ? -34  DG  I OP2   1 
ATOM   6952  O  "O5'" . DG  I  5 40  ? -27.806 -7.003  17.595 1.00 73.25  ? -34  DG  I "O5'" 1 
ATOM   6953  C  "C5'" . DG  I  5 40  ? -27.378 -5.668  17.840 1.00 74.63  ? -34  DG  I "C5'" 1 
ATOM   6954  C  "C4'" . DG  I  5 40  ? -28.442 -4.703  17.356 1.00 75.02  ? -34  DG  I "C4'" 1 
ATOM   6955  O  "O4'" . DG  I  5 40  ? -28.767 -5.061  15.992 1.00 75.38  ? -34  DG  I "O4'" 1 
ATOM   6956  C  "C3'" . DG  I  5 40  ? -29.756 -4.767  18.139 1.00 75.41  ? -34  DG  I "C3'" 1 
ATOM   6957  O  "O3'" . DG  I  5 40  ? -30.255 -3.477  18.413 1.00 76.30  ? -34  DG  I "O3'" 1 
ATOM   6958  C  "C2'" . DG  I  5 40  ? -30.712 -5.516  17.220 1.00 75.74  ? -34  DG  I "C2'" 1 
ATOM   6959  C  "C1'" . DG  I  5 40  ? -30.175 -4.998  15.898 1.00 75.96  ? -34  DG  I "C1'" 1 
ATOM   6960  N  N9    . DG  I  5 40  ? -30.665 -5.586  14.655 1.00 76.02  ? -34  DG  I N9    1 
ATOM   6961  C  C8    . DG  I  5 40  ? -31.017 -6.871  14.317 1.00 75.86  ? -34  DG  I C8    1 
ATOM   6962  N  N7    . DG  I  5 40  ? -31.425 -6.974  13.079 1.00 75.71  ? -34  DG  I N7    1 
ATOM   6963  C  C5    . DG  I  5 40  ? -31.334 -5.678  12.578 1.00 76.17  ? -34  DG  I C5    1 
ATOM   6964  C  C6    . DG  I  5 40  ? -31.629 -5.124  11.305 1.00 76.33  ? -34  DG  I C6    1 
ATOM   6965  O  O6    . DG  I  5 40  ? -32.042 -5.707  10.293 1.00 76.23  ? -34  DG  I O6    1 
ATOM   6966  N  N1    . DG  I  5 40  ? -31.384 -3.744  11.254 1.00 76.24  ? -34  DG  I N1    1 
ATOM   6967  C  C2    . DG  I  5 40  ? -30.911 -2.983  12.303 1.00 75.99  ? -34  DG  I C2    1 
ATOM   6968  N  N2    . DG  I  5 40  ? -30.721 -1.668  12.120 1.00 76.04  ? -34  DG  I N2    1 
ATOM   6969  N  N3    . DG  I  5 40  ? -30.639 -3.488  13.485 1.00 76.28  ? -34  DG  I N3    1 
ATOM   6970  C  C4    . DG  I  5 40  ? -30.870 -4.824  13.544 1.00 76.26  ? -34  DG  I C4    1 
ATOM   6971  P  P     . DA  I  5 41  ? -29.972 -2.820  19.839 1.00 77.48  ? -33  DA  I P     1 
ATOM   6972  O  OP1   . DA  I  5 41  ? -28.620 -3.290  20.206 1.00 77.96  ? -33  DA  I OP1   1 
ATOM   6973  O  OP2   . DA  I  5 41  ? -31.140 -3.042  20.728 1.00 77.16  ? -33  DA  I OP2   1 
ATOM   6974  O  "O5'" . DA  I  5 41  ? -29.899 -1.238  19.592 1.00 79.28  ? -33  DA  I "O5'" 1 
ATOM   6975  C  "C5'" . DA  I  5 41  ? -29.270 -0.676  18.430 1.00 80.63  ? -33  DA  I "C5'" 1 
ATOM   6976  C  "C4'" . DA  I  5 41  ? -30.152 0.381   17.772 1.00 81.69  ? -33  DA  I "C4'" 1 
ATOM   6977  O  "O4'" . DA  I  5 41  ? -30.862 -0.194  16.646 1.00 81.70  ? -33  DA  I "O4'" 1 
ATOM   6978  C  "C3'" . DA  I  5 41  ? -31.229 1.057   18.620 1.00 82.44  ? -33  DA  I "C3'" 1 
ATOM   6979  O  "O3'" . DA  I  5 41  ? -31.194 2.431   18.267 1.00 84.29  ? -33  DA  I "O3'" 1 
ATOM   6980  C  "C2'" . DA  I  5 41  ? -32.522 0.353   18.193 1.00 81.87  ? -33  DA  I "C2'" 1 
ATOM   6981  C  "C1'" . DA  I  5 41  ? -32.246 0.099   16.718 1.00 82.05  ? -33  DA  I "C1'" 1 
ATOM   6982  N  N9    . DA  I  5 41  ? -32.870 -1.059  16.093 1.00 82.07  ? -33  DA  I N9    1 
ATOM   6983  C  C8    . DA  I  5 41  ? -33.169 -2.264  16.663 1.00 82.43  ? -33  DA  I C8    1 
ATOM   6984  N  N7    . DA  I  5 41  ? -33.692 -3.135  15.831 1.00 82.48  ? -33  DA  I N7    1 
ATOM   6985  C  C5    . DA  I  5 41  ? -33.726 -2.459  14.626 1.00 82.47  ? -33  DA  I C5    1 
ATOM   6986  C  C6    . DA  I  5 41  ? -34.173 -2.830  13.340 1.00 82.30  ? -33  DA  I C6    1 
ATOM   6987  N  N6    . DA  I  5 41  ? -34.691 -4.023  13.053 1.00 82.15  ? -33  DA  I N6    1 
ATOM   6988  N  N1    . DA  I  5 41  ? -34.066 -1.916  12.351 1.00 82.38  ? -33  DA  I N1    1 
ATOM   6989  C  C2    . DA  I  5 41  ? -33.551 -0.706  12.632 1.00 82.39  ? -33  DA  I C2    1 
ATOM   6990  N  N3    . DA  I  5 41  ? -33.092 -0.244  13.797 1.00 82.49  ? -33  DA  I N3    1 
ATOM   6991  C  C4    . DA  I  5 41  ? -33.213 -1.177  14.766 1.00 82.52  ? -33  DA  I C4    1 
ATOM   6992  P  P     . DA  I  5 42  ? -32.214 3.526   18.823 1.00 86.40  ? -32  DA  I P     1 
ATOM   6993  O  OP1   . DA  I  5 42  ? -31.479 4.803   18.825 1.00 87.23  ? -32  DA  I OP1   1 
ATOM   6994  O  OP2   . DA  I  5 42  ? -32.858 3.044   20.062 1.00 86.16  ? -32  DA  I OP2   1 
ATOM   6995  O  "O5'" . DA  I  5 42  ? -33.343 3.584   17.698 1.00 88.43  ? -32  DA  I "O5'" 1 
ATOM   6996  C  "C5'" . DA  I  5 42  ? -33.106 4.109   16.394 1.00 90.74  ? -32  DA  I "C5'" 1 
ATOM   6997  C  "C4'" . DA  I  5 42  ? -34.389 4.002   15.581 1.00 92.81  ? -32  DA  I "C4'" 1 
ATOM   6998  O  "O4'" . DA  I  5 42  ? -34.641 2.609   15.249 1.00 92.89  ? -32  DA  I "O4'" 1 
ATOM   6999  C  "C3'" . DA  I  5 42  ? -35.650 4.521   16.278 1.00 93.82  ? -32  DA  I "C3'" 1 
ATOM   7000  O  "O3'" . DA  I  5 42  ? -36.284 5.522   15.482 1.00 95.76  ? -32  DA  I "O3'" 1 
ATOM   7001  C  "C2'" . DA  I  5 42  ? -36.544 3.290   16.429 1.00 93.39  ? -32  DA  I "C2'" 1 
ATOM   7002  C  "C1'" . DA  I  5 42  ? -36.033 2.385   15.313 1.00 92.93  ? -32  DA  I "C1'" 1 
ATOM   7003  N  N9    . DA  I  5 42  ? -36.275 0.965   15.555 1.00 93.00  ? -32  DA  I N9    1 
ATOM   7004  C  C8    . DA  I  5 42  ? -36.202 0.285   16.739 1.00 92.96  ? -32  DA  I C8    1 
ATOM   7005  N  N7    . DA  I  5 42  ? -36.490 -0.991  16.632 1.00 93.06  ? -32  DA  I N7    1 
ATOM   7006  C  C5    . DA  I  5 42  ? -36.770 -1.170  15.286 1.00 92.98  ? -32  DA  I C5    1 
ATOM   7007  C  C6    . DA  I  5 42  ? -37.143 -2.296  14.503 1.00 92.80  ? -32  DA  I C6    1 
ATOM   7008  N  N6    . DA  I  5 42  ? -37.313 -3.533  14.972 1.00 92.79  ? -32  DA  I N6    1 
ATOM   7009  N  N1    . DA  I  5 42  ? -37.339 -2.114  13.181 1.00 93.00  ? -32  DA  I N1    1 
ATOM   7010  C  C2    . DA  I  5 42  ? -37.181 -0.884  12.673 1.00 93.19  ? -32  DA  I C2    1 
ATOM   7011  N  N3    . DA  I  5 42  ? -36.835 0.246   13.299 1.00 93.23  ? -32  DA  I N3    1 
ATOM   7012  C  C4    . DA  I  5 42  ? -36.641 0.034   14.613 1.00 93.17  ? -32  DA  I C4    1 
ATOM   7013  P  P     . DA  I  5 43  ? -37.293 6.604   16.111 1.00 97.08  ? -31  DA  I P     1 
ATOM   7014  O  OP1   . DA  I  5 43  ? -36.683 7.941   15.919 1.00 97.22  ? -31  DA  I OP1   1 
ATOM   7015  O  OP2   . DA  I  5 43  ? -37.705 6.170   17.468 1.00 97.16  ? -31  DA  I OP2   1 
ATOM   7016  O  "O5'" . DA  I  5 43  ? -38.577 6.480   15.158 1.00 98.23  ? -31  DA  I "O5'" 1 
ATOM   7017  C  "C5'" . DA  I  5 43  ? -38.575 5.633   13.999 1.00 99.58  ? -31  DA  I "C5'" 1 
ATOM   7018  C  "C4'" . DA  I  5 43  ? -39.880 4.867   13.822 1.00 100.43 ? -31  DA  I "C4'" 1 
ATOM   7019  O  "O4'" . DA  I  5 43  ? -39.667 3.465   14.130 1.00 100.31 ? -31  DA  I "O4'" 1 
ATOM   7020  C  "C3'" . DA  I  5 43  ? -41.082 5.301   14.666 1.00 101.29 ? -31  DA  I "C3'" 1 
ATOM   7021  O  "O3'" . DA  I  5 43  ? -42.237 5.219   13.830 1.00 102.84 ? -31  DA  I "O3'" 1 
ATOM   7022  C  "C2'" . DA  I  5 43  ? -41.107 4.250   15.775 1.00 101.01 ? -31  DA  I "C2'" 1 
ATOM   7023  C  "C1'" . DA  I  5 43  ? -40.748 3.030   14.932 1.00 100.49 ? -31  DA  I "C1'" 1 
ATOM   7024  N  N9    . DA  I  5 43  ? -40.347 1.820   15.648 1.00 100.49 ? -31  DA  I N9    1 
ATOM   7025  C  C8    . DA  I  5 43  ? -39.638 1.715   16.816 1.00 100.44 ? -31  DA  I C8    1 
ATOM   7026  N  N7    . DA  I  5 43  ? -39.427 0.478   17.205 1.00 100.21 ? -31  DA  I N7    1 
ATOM   7027  C  C5    . DA  I  5 43  ? -40.036 -0.276  16.219 1.00 100.33 ? -31  DA  I C5    1 
ATOM   7028  C  C6    . DA  I  5 43  ? -40.178 -1.665  16.039 1.00 100.38 ? -31  DA  I C6    1 
ATOM   7029  N  N6    . DA  I  5 43  ? -39.673 -2.548  16.902 1.00 100.35 ? -31  DA  I N6    1 
ATOM   7030  N  N1    . DA  I  5 43  ? -40.855 -2.107  14.946 1.00 100.43 ? -31  DA  I N1    1 
ATOM   7031  C  C2    . DA  I  5 43  ? -41.360 -1.212  14.084 1.00 100.13 ? -31  DA  I C2    1 
ATOM   7032  N  N3    . DA  I  5 43  ? -41.291 0.121   14.152 1.00 100.32 ? -31  DA  I N3    1 
ATOM   7033  C  C4    . DA  I  5 43  ? -40.612 0.529   15.249 1.00 100.49 ? -31  DA  I C4    1 
ATOM   7034  P  P     . DC  I  5 44  ? -43.651 5.890   14.179 1.00 103.72 ? -30  DC  I P     1 
ATOM   7035  O  OP1   . DC  I  5 44  ? -43.938 6.896   13.125 1.00 103.82 ? -30  DC  I OP1   1 
ATOM   7036  O  OP2   . DC  I  5 44  ? -43.679 6.259   15.616 1.00 103.68 ? -30  DC  I OP2   1 
ATOM   7037  O  "O5'" . DC  I  5 44  ? -44.654 4.670   13.959 1.00 104.49 ? -30  DC  I "O5'" 1 
ATOM   7038  C  "C5'" . DC  I  5 44  ? -44.865 4.100   12.663 1.00 105.97 ? -30  DC  I "C5'" 1 
ATOM   7039  C  "C4'" . DC  I  5 44  ? -45.598 2.779   12.824 1.00 107.08 ? -30  DC  I "C4'" 1 
ATOM   7040  O  "O4'" . DC  I  5 44  ? -44.722 1.841   13.512 1.00 107.39 ? -30  DC  I "O4'" 1 
ATOM   7041  C  "C3'" . DC  I  5 44  ? -46.879 2.868   13.664 1.00 107.39 ? -30  DC  I "C3'" 1 
ATOM   7042  O  "O3'" . DC  I  5 44  ? -47.961 2.126   13.076 1.00 107.54 ? -30  DC  I "O3'" 1 
ATOM   7043  C  "C2'" . DC  I  5 44  ? -46.439 2.297   15.013 1.00 107.38 ? -30  DC  I "C2'" 1 
ATOM   7044  C  "C1'" . DC  I  5 44  ? -45.474 1.223   14.534 1.00 107.27 ? -30  DC  I "C1'" 1 
ATOM   7045  N  N1    . DC  I  5 44  ? -44.597 0.679   15.606 1.00 107.09 ? -30  DC  I N1    1 
ATOM   7046  C  C2    . DC  I  5 44  ? -44.465 -0.713  15.718 1.00 107.15 ? -30  DC  I C2    1 
ATOM   7047  O  O2    . DC  I  5 44  ? -45.067 -1.440  14.921 1.00 107.27 ? -30  DC  I O2    1 
ATOM   7048  N  N3    . DC  I  5 44  ? -43.678 -1.228  16.698 1.00 107.25 ? -30  DC  I N3    1 
ATOM   7049  C  C4    . DC  I  5 44  ? -43.046 -0.401  17.540 1.00 107.45 ? -30  DC  I C4    1 
ATOM   7050  N  N4    . DC  I  5 44  ? -42.277 -0.951  18.487 1.00 107.48 ? -30  DC  I N4    1 
ATOM   7051  C  C5    . DC  I  5 44  ? -43.169 1.024   17.446 1.00 107.29 ? -30  DC  I C5    1 
ATOM   7052  C  C6    . DC  I  5 44  ? -43.949 1.517   16.474 1.00 107.06 ? -30  DC  I C6    1 
ATOM   7053  P  P     . DT  I  5 45  ? -49.307 1.810   13.902 1.00 107.83 ? -29  DT  I P     1 
ATOM   7054  O  OP1   . DT  I  5 45  ? -50.370 1.455   12.933 1.00 108.03 ? -29  DT  I OP1   1 
ATOM   7055  O  OP2   . DT  I  5 45  ? -49.536 2.877   14.910 1.00 107.22 ? -29  DT  I OP2   1 
ATOM   7056  O  "O5'" . DT  I  5 45  ? -48.905 0.468   14.662 1.00 108.51 ? -29  DT  I "O5'" 1 
ATOM   7057  C  "C5'" . DT  I  5 45  ? -49.145 -0.804  14.064 1.00 108.98 ? -29  DT  I "C5'" 1 
ATOM   7058  C  "C4'" . DT  I  5 45  ? -49.500 -1.800  15.153 1.00 109.41 ? -29  DT  I "C4'" 1 
ATOM   7059  O  "O4'" . DT  I  5 45  ? -48.404 -1.897  16.103 1.00 109.78 ? -29  DT  I "O4'" 1 
ATOM   7060  C  "C3'" . DT  I  5 45  ? -50.737 -1.460  15.988 1.00 109.45 ? -29  DT  I "C3'" 1 
ATOM   7061  O  "O3'" . DT  I  5 45  ? -51.416 -2.681  16.257 1.00 108.98 ? -29  DT  I "O3'" 1 
ATOM   7062  C  "C2'" . DT  I  5 45  ? -50.152 -0.846  17.264 1.00 109.63 ? -29  DT  I "C2'" 1 
ATOM   7063  C  "C1'" . DT  I  5 45  ? -48.931 -1.758  17.415 1.00 109.73 ? -29  DT  I "C1'" 1 
ATOM   7064  N  N1    . DT  I  5 45  ? -47.828 -1.356  18.364 1.00 109.54 ? -29  DT  I N1    1 
ATOM   7065  C  C2    . DT  I  5 45  ? -46.991 -2.361  18.816 1.00 109.39 ? -29  DT  I C2    1 
ATOM   7066  O  O2    . DT  I  5 45  ? -47.106 -3.532  18.488 1.00 109.15 ? -29  DT  I O2    1 
ATOM   7067  N  N3    . DT  I  5 45  ? -46.004 -1.940  19.675 1.00 109.50 ? -29  DT  I N3    1 
ATOM   7068  C  C4    . DT  I  5 45  ? -45.770 -0.647  20.119 1.00 109.58 ? -29  DT  I C4    1 
ATOM   7069  O  O4    . DT  I  5 45  ? -44.849 -0.387  20.893 1.00 109.59 ? -29  DT  I O4    1 
ATOM   7070  C  C5    . DT  I  5 45  ? -46.681 0.358   19.609 1.00 109.44 ? -29  DT  I C5    1 
ATOM   7071  C  C7    . DT  I  5 45  ? -46.532 1.798   20.014 1.00 109.43 ? -29  DT  I C7    1 
ATOM   7072  C  C6    . DT  I  5 45  ? -47.653 -0.040  18.767 1.00 109.47 ? -29  DT  I C6    1 
ATOM   7073  P  P     . DG  I  5 46  ? -52.788 -3.054  15.541 1.00 107.85 ? -28  DG  I P     1 
ATOM   7074  O  OP1   . DG  I  5 46  ? -52.930 -2.163  14.369 1.00 107.83 ? -28  DG  I OP1   1 
ATOM   7075  O  OP2   . DG  I  5 46  ? -53.802 -3.030  16.621 1.00 107.27 ? -28  DG  I OP2   1 
ATOM   7076  O  "O5'" . DG  I  5 46  ? -52.626 -4.571  15.012 1.00 107.85 ? -28  DG  I "O5'" 1 
ATOM   7077  C  "C5'" . DG  I  5 46  ? -51.443 -5.363  15.189 1.00 108.18 ? -28  DG  I "C5'" 1 
ATOM   7078  C  "C4'" . DG  I  5 46  ? -51.522 -6.403  16.316 1.00 108.71 ? -28  DG  I "C4'" 1 
ATOM   7079  O  "O4'" . DG  I  5 46  ? -50.707 -5.996  17.452 1.00 109.29 ? -28  DG  I "O4'" 1 
ATOM   7080  C  "C3'" . DG  I  5 46  ? -52.870 -6.767  16.949 1.00 108.79 ? -28  DG  I "C3'" 1 
ATOM   7081  O  "O3'" . DG  I  5 46  ? -52.783 -8.123  17.403 1.00 108.60 ? -28  DG  I "O3'" 1 
ATOM   7082  C  "C2'" . DG  I  5 46  ? -52.960 -5.804  18.135 1.00 109.16 ? -28  DG  I "C2'" 1 
ATOM   7083  C  "C1'" . DG  I  5 46  ? -51.515 -5.893  18.624 1.00 109.49 ? -28  DG  I "C1'" 1 
ATOM   7084  N  N9    . DG  I  5 46  ? -50.985 -4.786  19.432 1.00 109.59 ? -28  DG  I N9    1 
ATOM   7085  C  C8    . DG  I  5 46  ? -51.396 -3.473  19.506 1.00 109.33 ? -28  DG  I C8    1 
ATOM   7086  N  N7    . DG  I  5 46  ? -50.679 -2.750  20.325 1.00 109.36 ? -28  DG  I N7    1 
ATOM   7087  C  C5    . DG  I  5 46  ? -49.727 -3.635  20.827 1.00 109.57 ? -28  DG  I C5    1 
ATOM   7088  C  C6    . DG  I  5 46  ? -48.666 -3.442  21.756 1.00 109.27 ? -28  DG  I C6    1 
ATOM   7089  O  O6    . DG  I  5 46  ? -48.334 -2.409  22.353 1.00 109.20 ? -28  DG  I O6    1 
ATOM   7090  N  N1    . DG  I  5 46  ? -47.949 -4.617  21.977 1.00 109.29 ? -28  DG  I N1    1 
ATOM   7091  C  C2    . DG  I  5 46  ? -48.218 -5.827  21.375 1.00 109.33 ? -28  DG  I C2    1 
ATOM   7092  N  N2    . DG  I  5 46  ? -47.428 -6.854  21.699 1.00 109.58 ? -28  DG  I N2    1 
ATOM   7093  N  N3    . DG  I  5 46  ? -49.196 -6.025  20.508 1.00 109.38 ? -28  DG  I N3    1 
ATOM   7094  C  C4    . DG  I  5 46  ? -49.906 -4.890  20.281 1.00 109.69 ? -28  DG  I C4    1 
ATOM   7095  P  P     . DC  I  5 47  ? -54.061 -9.013  17.802 1.00 108.73 ? -27  DC  I P     1 
ATOM   7096  O  OP1   . DC  I  5 47  ? -54.119 -10.143 16.841 1.00 108.23 ? -27  DC  I OP1   1 
ATOM   7097  O  OP2   . DC  I  5 47  ? -55.229 -8.122  18.023 1.00 108.06 ? -27  DC  I OP2   1 
ATOM   7098  O  "O5'" . DC  I  5 47  ? -53.696 -9.625  19.236 1.00 107.83 ? -27  DC  I "O5'" 1 
ATOM   7099  C  "C5'" . DC  I  5 47  ? -52.518 -10.392 19.502 1.00 106.07 ? -27  DC  I "C5'" 1 
ATOM   7100  C  "C4'" . DC  I  5 47  ? -52.329 -10.429 21.006 1.00 104.51 ? -27  DC  I "C4'" 1 
ATOM   7101  O  "O4'" . DC  I  5 47  ? -51.940 -9.099  21.442 1.00 104.46 ? -27  DC  I "O4'" 1 
ATOM   7102  C  "C3'" . DC  I  5 47  ? -53.592 -10.783 21.801 1.00 103.46 ? -27  DC  I "C3'" 1 
ATOM   7103  O  "O3'" . DC  I  5 47  ? -53.273 -11.550 22.960 1.00 101.95 ? -27  DC  I "O3'" 1 
ATOM   7104  C  "C2'" . DC  I  5 47  ? -54.128 -9.416  22.218 1.00 103.73 ? -27  DC  I "C2'" 1 
ATOM   7105  C  "C1'" . DC  I  5 47  ? -52.805 -8.699  22.491 1.00 103.94 ? -27  DC  I "C1'" 1 
ATOM   7106  N  N1    . DC  I  5 47  ? -52.841 -7.203  22.572 1.00 103.68 ? -27  DC  I N1    1 
ATOM   7107  C  C2    . DC  I  5 47  ? -51.791 -6.537  23.220 1.00 103.83 ? -27  DC  I C2    1 
ATOM   7108  O  O2    . DC  I  5 47  ? -50.858 -7.186  23.712 1.00 103.83 ? -27  DC  I O2    1 
ATOM   7109  N  N3    . DC  I  5 47  ? -51.825 -5.181  23.288 1.00 103.95 ? -27  DC  I N3    1 
ATOM   7110  C  C4    . DC  I  5 47  ? -52.839 -4.501  22.749 1.00 103.78 ? -27  DC  I C4    1 
ATOM   7111  N  N4    . DC  I  5 47  ? -52.818 -3.172  22.850 1.00 103.77 ? -27  DC  I N4    1 
ATOM   7112  C  C5    . DC  I  5 47  ? -53.916 -5.158  22.084 1.00 103.91 ? -27  DC  I C5    1 
ATOM   7113  C  C6    . DC  I  5 47  ? -53.872 -6.495  22.020 1.00 103.92 ? -27  DC  I C6    1 
ATOM   7114  P  P     . DT  I  5 48  ? -53.299 -13.153 22.991 1.00 100.63 ? -26  DT  I P     1 
ATOM   7115  O  OP1   . DT  I  5 48  ? -52.747 -13.723 21.733 1.00 100.61 ? -26  DT  I OP1   1 
ATOM   7116  O  OP2   . DT  I  5 48  ? -54.644 -13.522 23.484 1.00 100.49 ? -26  DT  I OP2   1 
ATOM   7117  O  "O5'" . DT  I  5 48  ? -52.239 -13.486 24.137 1.00 99.22  ? -26  DT  I "O5'" 1 
ATOM   7118  C  "C5'" . DT  I  5 48  ? -50.876 -13.072 23.989 1.00 96.53  ? -26  DT  I "C5'" 1 
ATOM   7119  C  "C4'" . DT  I  5 48  ? -50.384 -12.364 25.241 1.00 94.15  ? -26  DT  I "C4'" 1 
ATOM   7120  O  "O4'" . DT  I  5 48  ? -50.843 -10.984 25.271 1.00 93.69  ? -26  DT  I "O4'" 1 
ATOM   7121  C  "C3'" . DT  I  5 48  ? -50.821 -12.974 26.572 1.00 92.41  ? -26  DT  I "C3'" 1 
ATOM   7122  O  "O3'" . DT  I  5 48  ? -49.629 -13.092 27.361 1.00 89.74  ? -26  DT  I "O3'" 1 
ATOM   7123  C  "C2'" . DT  I  5 48  ? -51.841 -11.965 27.119 1.00 92.25  ? -26  DT  I "C2'" 1 
ATOM   7124  C  "C1'" . DT  I  5 48  ? -51.235 -10.664 26.593 1.00 92.94  ? -26  DT  I "C1'" 1 
ATOM   7125  N  N1    . DT  I  5 48  ? -52.087 -9.420  26.541 1.00 92.85  ? -26  DT  I N1    1 
ATOM   7126  C  C2    . DT  I  5 48  ? -51.558 -8.224  27.001 1.00 92.69  ? -26  DT  I C2    1 
ATOM   7127  O  O2    . DT  I  5 48  ? -50.446 -8.095  27.477 1.00 92.96  ? -26  DT  I O2    1 
ATOM   7128  N  N3    . DT  I  5 48  ? -52.394 -7.147  26.898 1.00 92.86  ? -26  DT  I N3    1 
ATOM   7129  C  C4    . DT  I  5 48  ? -53.676 -7.130  26.386 1.00 93.05  ? -26  DT  I C4    1 
ATOM   7130  O  O4    . DT  I  5 48  ? -54.322 -6.088  26.352 1.00 93.23  ? -26  DT  I O4    1 
ATOM   7131  C  C5    . DT  I  5 48  ? -54.172 -8.403  25.906 1.00 92.82  ? -26  DT  I C5    1 
ATOM   7132  C  C7    . DT  I  5 48  ? -55.548 -8.532  25.324 1.00 92.85  ? -26  DT  I C7    1 
ATOM   7133  C  C6    . DT  I  5 48  ? -53.364 -9.470  26.005 1.00 93.00  ? -26  DT  I C6    1 
ATOM   7134  P  P     . DC  I  5 49  ? -49.459 -14.117 28.576 1.00 86.42  ? -25  DC  I P     1 
ATOM   7135  O  OP1   . DC  I  5 49  ? -48.170 -14.823 28.384 1.00 85.88  ? -25  DC  I OP1   1 
ATOM   7136  O  OP2   . DC  I  5 49  ? -50.722 -14.878 28.689 1.00 86.60  ? -25  DC  I OP2   1 
ATOM   7137  O  "O5'" . DC  I  5 49  ? -49.379 -13.148 29.853 1.00 84.68  ? -25  DC  I "O5'" 1 
ATOM   7138  C  "C5'" . DC  I  5 49  ? -48.617 -11.944 29.848 1.00 82.40  ? -25  DC  I "C5'" 1 
ATOM   7139  C  "C4'" . DC  I  5 49  ? -49.012 -11.056 31.013 1.00 81.23  ? -25  DC  I "C4'" 1 
ATOM   7140  O  "O4'" . DC  I  5 49  ? -50.027 -10.106 30.601 1.00 82.46  ? -25  DC  I "O4'" 1 
ATOM   7141  C  "C3'" . DC  I  5 49  ? -49.596 -11.742 32.246 1.00 80.03  ? -25  DC  I "C3'" 1 
ATOM   7142  O  "O3'" . DC  I  5 49  ? -49.359 -10.938 33.381 1.00 76.92  ? -25  DC  I "O3'" 1 
ATOM   7143  C  "C2'" . DC  I  5 49  ? -51.086 -11.714 31.958 1.00 81.55  ? -25  DC  I "C2'" 1 
ATOM   7144  C  "C1'" . DC  I  5 49  ? -51.170 -10.286 31.428 1.00 83.54  ? -25  DC  I "C1'" 1 
ATOM   7145  N  N1    . DC  I  5 49  ? -52.413 -9.954  30.668 1.00 84.48  ? -25  DC  I N1    1 
ATOM   7146  C  C2    . DC  I  5 49  ? -52.749 -8.605  30.453 1.00 84.72  ? -25  DC  I C2    1 
ATOM   7147  O  O2    . DC  I  5 49  ? -52.021 -7.708  30.909 1.00 84.77  ? -25  DC  I O2    1 
ATOM   7148  N  N3    . DC  I  5 49  ? -53.881 -8.329  29.752 1.00 84.97  ? -25  DC  I N3    1 
ATOM   7149  C  C4    . DC  I  5 49  ? -54.645 -9.328  29.283 1.00 84.93  ? -25  DC  I C4    1 
ATOM   7150  N  N4    . DC  I  5 49  ? -55.744 -9.016  28.596 1.00 84.73  ? -25  DC  I N4    1 
ATOM   7151  C  C5    . DC  I  5 49  ? -54.322 -10.704 29.493 1.00 85.23  ? -25  DC  I C5    1 
ATOM   7152  C  C6    . DC  I  5 49  ? -53.206 -10.963 30.185 1.00 85.22  ? -25  DC  I C6    1 
ATOM   7153  P  P     . DC  I  5 50  ? -48.019 -11.115 34.203 1.00 73.82  ? -24  DC  I P     1 
ATOM   7154  O  OP1   . DC  I  5 50  ? -46.927 -11.369 33.234 1.00 74.07  ? -24  DC  I OP1   1 
ATOM   7155  O  OP2   . DC  I  5 50  ? -48.331 -12.046 35.305 1.00 74.22  ? -24  DC  I OP2   1 
ATOM   7156  O  "O5'" . DC  I  5 50  ? -47.793 -9.700  34.877 1.00 72.89  ? -24  DC  I "O5'" 1 
ATOM   7157  C  "C5'" . DC  I  5 50  ? -47.370 -8.603  34.101 1.00 72.53  ? -24  DC  I "C5'" 1 
ATOM   7158  C  "C4'" . DC  I  5 50  ? -48.132 -7.380  34.559 1.00 72.29  ? -24  DC  I "C4'" 1 
ATOM   7159  O  "O4'" . DC  I  5 50  ? -49.420 -7.390  33.904 1.00 72.42  ? -24  DC  I "O4'" 1 
ATOM   7160  C  "C3'" . DC  I  5 50  ? -48.397 -7.358  36.056 1.00 71.98  ? -24  DC  I "C3'" 1 
ATOM   7161  O  "O3'" . DC  I  5 50  ? -47.782 -6.203  36.594 1.00 72.43  ? -24  DC  I "O3'" 1 
ATOM   7162  C  "C2'" . DC  I  5 50  ? -49.923 -7.394  36.187 1.00 72.26  ? -24  DC  I "C2'" 1 
ATOM   7163  C  "C1'" . DC  I  5 50  ? -50.412 -6.963  34.807 1.00 72.77  ? -24  DC  I "C1'" 1 
ATOM   7164  N  N1    . DC  I  5 50  ? -51.715 -7.529  34.285 1.00 72.77  ? -24  DC  I N1    1 
ATOM   7165  C  C2    . DC  I  5 50  ? -52.713 -6.663  33.828 1.00 72.33  ? -24  DC  I C2    1 
ATOM   7166  O  O2    . DC  I  5 50  ? -52.512 -5.454  33.883 1.00 73.14  ? -24  DC  I O2    1 
ATOM   7167  N  N3    . DC  I  5 50  ? -53.876 -7.158  33.341 1.00 72.52  ? -24  DC  I N3    1 
ATOM   7168  C  C4    . DC  I  5 50  ? -54.074 -8.475  33.289 1.00 73.18  ? -24  DC  I C4    1 
ATOM   7169  N  N4    . DC  I  5 50  ? -55.235 -8.933  32.799 1.00 72.97  ? -24  DC  I N4    1 
ATOM   7170  C  C5    . DC  I  5 50  ? -53.074 -9.384  33.752 1.00 73.70  ? -24  DC  I C5    1 
ATOM   7171  C  C6    . DC  I  5 50  ? -51.923 -8.876  34.226 1.00 73.48  ? -24  DC  I C6    1 
ATOM   7172  P  P     . DA  I  5 51  ? -47.862 -5.861  38.153 1.00 73.49  ? -23  DA  I P     1 
ATOM   7173  O  OP1   . DA  I  5 51  ? -46.632 -5.158  38.558 1.00 72.57  ? -23  DA  I OP1   1 
ATOM   7174  O  OP2   . DA  I  5 51  ? -48.288 -7.063  38.887 1.00 73.32  ? -23  DA  I OP2   1 
ATOM   7175  O  "O5'" . DA  I  5 51  ? -49.094 -4.841  38.185 1.00 77.55  ? -23  DA  I "O5'" 1 
ATOM   7176  C  "C5'" . DA  I  5 51  ? -49.033 -3.540  37.561 1.00 81.74  ? -23  DA  I "C5'" 1 
ATOM   7177  C  "C4'" . DA  I  5 51  ? -50.152 -2.582  37.978 1.00 84.06  ? -23  DA  I "C4'" 1 
ATOM   7178  O  "O4'" . DA  I  5 51  ? -51.414 -2.957  37.391 1.00 85.15  ? -23  DA  I "O4'" 1 
ATOM   7179  C  "C3'" . DA  I  5 51  ? -50.456 -2.425  39.459 1.00 85.58  ? -23  DA  I "C3'" 1 
ATOM   7180  O  "O3'" . DA  I  5 51  ? -50.843 -1.095  39.635 1.00 88.21  ? -23  DA  I "O3'" 1 
ATOM   7181  C  "C2'" . DA  I  5 51  ? -51.626 -3.364  39.718 1.00 85.92  ? -23  DA  I "C2'" 1 
ATOM   7182  C  "C1'" . DA  I  5 51  ? -52.353 -3.317  38.387 1.00 87.49  ? -23  DA  I "C1'" 1 
ATOM   7183  N  N9    . DA  I  5 51  ? -52.868 -4.601  37.939 1.00 88.36  ? -23  DA  I N9    1 
ATOM   7184  C  C8    . DA  I  5 51  ? -52.288 -5.830  38.110 1.00 88.75  ? -23  DA  I C8    1 
ATOM   7185  N  N7    . DA  I  5 51  ? -52.965 -6.819  37.579 1.00 88.91  ? -23  DA  I N7    1 
ATOM   7186  C  C5    . DA  I  5 51  ? -54.058 -6.190  37.016 1.00 88.83  ? -23  DA  I C5    1 
ATOM   7187  C  C6    . DA  I  5 51  ? -55.155 -6.692  36.302 1.00 88.64  ? -23  DA  I C6    1 
ATOM   7188  N  N6    . DA  I  5 51  ? -55.281 -7.993  36.055 1.00 88.52  ? -23  DA  I N6    1 
ATOM   7189  N  N1    . DA  I  5 51  ? -56.096 -5.813  35.865 1.00 88.88  ? -23  DA  I N1    1 
ATOM   7190  C  C2    . DA  I  5 51  ? -55.936 -4.503  36.135 1.00 88.88  ? -23  DA  I C2    1 
ATOM   7191  N  N3    . DA  I  5 51  ? -54.939 -3.906  36.804 1.00 88.94  ? -23  DA  I N3    1 
ATOM   7192  C  C4    . DA  I  5 51  ? -54.024 -4.817  37.221 1.00 89.07  ? -23  DA  I C4    1 
ATOM   7193  P  P     . DT  I  5 52  ? -51.243 -0.514  41.069 1.00 90.73  ? -22  DT  I P     1 
ATOM   7194  O  OP1   . DT  I  5 52  ? -50.732 0.873   41.131 1.00 90.66  ? -22  DT  I OP1   1 
ATOM   7195  O  OP2   . DT  I  5 52  ? -50.891 -1.480  42.132 1.00 90.00  ? -22  DT  I OP2   1 
ATOM   7196  O  "O5'" . DT  I  5 52  ? -52.838 -0.473  40.948 1.00 94.06  ? -22  DT  I "O5'" 1 
ATOM   7197  C  "C5'" . DT  I  5 52  ? -53.510 -0.024  39.760 1.00 97.98  ? -22  DT  I "C5'" 1 
ATOM   7198  C  "C4'" . DT  I  5 52  ? -55.012 -0.174  39.927 1.00 101.60 ? -22  DT  I "C4'" 1 
ATOM   7199  O  "O4'" . DT  I  5 52  ? -55.430 -1.457  39.404 1.00 102.38 ? -22  DT  I "O4'" 1 
ATOM   7200  C  "C3'" . DT  I  5 52  ? -55.493 -0.137  41.376 1.00 104.28 ? -22  DT  I "C3'" 1 
ATOM   7201  O  "O3'" . DT  I  5 52  ? -56.482 0.874   41.549 1.00 108.48 ? -22  DT  I "O3'" 1 
ATOM   7202  C  "C2'" . DT  I  5 52  ? -56.046 -1.534  41.655 1.00 103.65 ? -22  DT  I "C2'" 1 
ATOM   7203  C  "C1'" . DT  I  5 52  ? -56.409 -2.014  40.259 1.00 103.35 ? -22  DT  I "C1'" 1 
ATOM   7204  N  N1    . DT  I  5 52  ? -56.345 -3.490  40.084 1.00 103.32 ? -22  DT  I N1    1 
ATOM   7205  C  C2    . DT  I  5 52  ? -57.196 -4.123  39.192 1.00 103.48 ? -22  DT  I C2    1 
ATOM   7206  O  O2    . DT  I  5 52  ? -58.040 -3.562  38.514 1.00 104.00 ? -22  DT  I O2    1 
ATOM   7207  N  N3    . DT  I  5 52  ? -57.028 -5.481  39.113 1.00 103.43 ? -22  DT  I N3    1 
ATOM   7208  C  C4    . DT  I  5 52  ? -56.116 -6.248  39.818 1.00 103.71 ? -22  DT  I C4    1 
ATOM   7209  O  O4    . DT  I  5 52  ? -56.051 -7.463  39.669 1.00 103.89 ? -22  DT  I O4    1 
ATOM   7210  C  C5    . DT  I  5 52  ? -55.257 -5.527  40.733 1.00 103.81 ? -22  DT  I C5    1 
ATOM   7211  C  C7    . DT  I  5 52  ? -54.226 -6.245  41.558 1.00 103.58 ? -22  DT  I C7    1 
ATOM   7212  C  C6    . DT  I  5 52  ? -55.410 -4.199  40.815 1.00 103.53 ? -22  DT  I C6    1 
ATOM   7213  P  P     . DC  I  5 53  ? -56.729 1.571   42.979 1.00 112.10 ? -21  DC  I P     1 
ATOM   7214  O  OP1   . DC  I  5 53  ? -56.451 3.021   42.833 1.00 111.58 ? -21  DC  I OP1   1 
ATOM   7215  O  OP2   . DC  I  5 53  ? -56.077 0.805   44.071 1.00 111.71 ? -21  DC  I OP2   1 
ATOM   7216  O  "O5'" . DC  I  5 53  ? -58.292 1.311   43.138 1.00 114.47 ? -21  DC  I "O5'" 1 
ATOM   7217  C  "C5'" . DC  I  5 53  ? -58.696 -0.031  43.216 1.00 118.99 ? -21  DC  I "C5'" 1 
ATOM   7218  C  "C4'" . DC  I  5 53  ? -59.975 -0.216  42.444 1.00 122.64 ? -21  DC  I "C4'" 1 
ATOM   7219  O  "O4'" . DC  I  5 53  ? -59.857 -1.353  41.554 1.00 123.63 ? -21  DC  I "O4'" 1 
ATOM   7220  C  "C3'" . DC  I  5 53  ? -61.100 -0.519  43.412 1.00 125.09 ? -21  DC  I "C3'" 1 
ATOM   7221  O  "O3'" . DC  I  5 53  ? -62.261 0.212   43.081 1.00 128.19 ? -21  DC  I "O3'" 1 
ATOM   7222  C  "C2'" . DC  I  5 53  ? -61.325 -2.021  43.303 1.00 124.75 ? -21  DC  I "C2'" 1 
ATOM   7223  C  "C1'" . DC  I  5 53  ? -60.760 -2.375  41.936 1.00 124.37 ? -21  DC  I "C1'" 1 
ATOM   7224  N  N1    . DC  I  5 53  ? -60.054 -3.680  42.010 1.00 124.57 ? -21  DC  I N1    1 
ATOM   7225  C  C2    . DC  I  5 53  ? -60.596 -4.795  41.350 1.00 124.65 ? -21  DC  I C2    1 
ATOM   7226  O  O2    . DC  I  5 53  ? -61.646 -4.678  40.700 1.00 124.61 ? -21  DC  I O2    1 
ATOM   7227  N  N3    . DC  I  5 53  ? -59.938 -5.982  41.439 1.00 124.73 ? -21  DC  I N3    1 
ATOM   7228  C  C4    . DC  I  5 53  ? -58.803 -6.077  42.147 1.00 124.71 ? -21  DC  I C4    1 
ATOM   7229  N  N4    . DC  I  5 53  ? -58.197 -7.269  42.202 1.00 124.55 ? -21  DC  I N4    1 
ATOM   7230  C  C5    . DC  I  5 53  ? -58.240 -4.954  42.835 1.00 124.66 ? -21  DC  I C5    1 
ATOM   7231  C  C6    . DC  I  5 53  ? -58.894 -3.788  42.741 1.00 124.69 ? -21  DC  I C6    1 
ATOM   7232  P  P     . DA  I  5 54  ? -63.284 0.538   44.265 1.00 130.37 ? -20  DA  I P     1 
ATOM   7233  O  OP1   . DA  I  5 54  ? -64.132 1.657   43.788 1.00 130.52 ? -20  DA  I OP1   1 
ATOM   7234  O  OP2   . DA  I  5 54  ? -62.528 0.672   45.540 1.00 129.76 ? -20  DA  I OP2   1 
ATOM   7235  O  "O5'" . DA  I  5 54  ? -64.150 -0.810  44.322 1.00 132.01 ? -20  DA  I "O5'" 1 
ATOM   7236  C  "C5'" . DA  I  5 54  ? -64.861 -1.244  43.159 1.00 135.23 ? -20  DA  I "C5'" 1 
ATOM   7237  C  "C4'" . DA  I  5 54  ? -65.749 -2.433  43.471 1.00 137.90 ? -20  DA  I "C4'" 1 
ATOM   7238  O  "O4'" . DA  I  5 54  ? -64.964 -3.643  43.313 1.00 138.37 ? -20  DA  I "O4'" 1 
ATOM   7239  C  "C3'" . DA  I  5 54  ? -66.346 -2.472  44.881 1.00 139.82 ? -20  DA  I "C3'" 1 
ATOM   7240  O  "O3'" . DA  I  5 54  ? -67.730 -2.911  44.809 1.00 142.75 ? -20  DA  I "O3'" 1 
ATOM   7241  C  "C2'" . DA  I  5 54  ? -65.390 -3.394  45.639 1.00 139.42 ? -20  DA  I "C2'" 1 
ATOM   7242  C  "C1'" . DA  I  5 54  ? -64.892 -4.335  44.544 1.00 139.14 ? -20  DA  I "C1'" 1 
ATOM   7243  N  N9    . DA  I  5 54  ? -63.517 -4.786  44.756 1.00 139.38 ? -20  DA  I N9    1 
ATOM   7244  C  C8    . DA  I  5 54  ? -62.484 -4.072  45.305 1.00 139.22 ? -20  DA  I C8    1 
ATOM   7245  N  N7    . DA  I  5 54  ? -61.356 -4.737  45.378 1.00 139.20 ? -20  DA  I N7    1 
ATOM   7246  C  C5    . DA  I  5 54  ? -61.671 -5.980  44.850 1.00 139.25 ? -20  DA  I C5    1 
ATOM   7247  C  C6    . DA  I  5 54  ? -60.906 -7.149  44.648 1.00 139.09 ? -20  DA  I C6    1 
ATOM   7248  N  N6    . DA  I  5 54  ? -59.614 -7.239  44.977 1.00 139.13 ? -20  DA  I N6    1 
ATOM   7249  N  N1    . DA  I  5 54  ? -61.524 -8.221  44.101 1.00 139.09 ? -20  DA  I N1    1 
ATOM   7250  C  C2    . DA  I  5 54  ? -62.824 -8.123  43.780 1.00 139.17 ? -20  DA  I C2    1 
ATOM   7251  N  N3    . DA  I  5 54  ? -63.646 -7.081  43.913 1.00 139.22 ? -20  DA  I N3    1 
ATOM   7252  C  C4    . DA  I  5 54  ? -63.002 -6.030  44.461 1.00 139.38 ? -20  DA  I C4    1 
ATOM   7253  P  P     . DA  I  5 55  ? -68.520 -3.771  45.921 1.00 144.88 ? -19  DA  I P     1 
ATOM   7254  O  OP1   . DA  I  5 55  ? -69.967 -3.659  45.632 1.00 145.04 ? -19  DA  I OP1   1 
ATOM   7255  O  OP2   . DA  I  5 55  ? -68.031 -3.387  47.270 1.00 144.75 ? -19  DA  I OP2   1 
ATOM   7256  O  "O5'" . DA  I  5 55  ? -68.061 -5.267  45.557 1.00 146.42 ? -19  DA  I "O5'" 1 
ATOM   7257  C  "C5'" . DA  I  5 55  ? -68.919 -6.405  45.706 1.00 148.55 ? -19  DA  I "C5'" 1 
ATOM   7258  C  "C4'" . DA  I  5 55  ? -68.526 -7.193  46.945 1.00 150.43 ? -19  DA  I "C4'" 1 
ATOM   7259  O  "O4'" . DA  I  5 55  ? -67.099 -7.494  46.912 1.00 151.08 ? -19  DA  I "O4'" 1 
ATOM   7260  C  "C3'" . DA  I  5 55  ? -68.774 -6.428  48.248 1.00 151.53 ? -19  DA  I "C3'" 1 
ATOM   7261  O  "O3'" . DA  I  5 55  ? -69.497 -7.211  49.192 1.00 152.93 ? -19  DA  I "O3'" 1 
ATOM   7262  C  "C2'" . DA  I  5 55  ? -67.373 -6.091  48.759 1.00 151.50 ? -19  DA  I "C2'" 1 
ATOM   7263  C  "C1'" . DA  I  5 55  ? -66.571 -7.267  48.211 1.00 151.16 ? -19  DA  I "C1'" 1 
ATOM   7264  N  N9    . DA  I  5 55  ? -65.113 -7.061  48.232 1.00 151.11 ? -19  DA  I N9    1 
ATOM   7265  C  C8    . DA  I  5 55  ? -64.444 -5.952  48.691 1.00 151.00 ? -19  DA  I C8    1 
ATOM   7266  N  N7    . DA  I  5 55  ? -63.139 -6.042  48.611 1.00 151.09 ? -19  DA  I N7    1 
ATOM   7267  C  C5    . DA  I  5 55  ? -62.929 -7.302  48.071 1.00 151.01 ? -19  DA  I C5    1 
ATOM   7268  C  C6    . DA  I  5 55  ? -61.755 -8.007  47.735 1.00 150.91 ? -19  DA  I C6    1 
ATOM   7269  N  N6    . DA  I  5 55  ? -60.528 -7.506  47.907 1.00 150.97 ? -19  DA  I N6    1 
ATOM   7270  N  N1    . DA  I  5 55  ? -61.889 -9.246  47.210 1.00 150.96 ? -19  DA  I N1    1 
ATOM   7271  C  C2    . DA  I  5 55  ? -63.119 -9.747  47.033 1.00 150.93 ? -19  DA  I C2    1 
ATOM   7272  N  N3    . DA  I  5 55  ? -64.294 -9.183  47.311 1.00 150.91 ? -19  DA  I N3    1 
ATOM   7273  C  C4    . DA  I  5 55  ? -64.132 -7.948  47.833 1.00 151.02 ? -19  DA  I C4    1 
ATOM   7274  P  P     . DA  I  5 56  ? -70.407 -6.479  50.297 1.00 153.98 ? -18  DA  I P     1 
ATOM   7275  O  OP1   . DA  I  5 56  ? -71.620 -6.030  49.566 1.00 154.08 ? -18  DA  I OP1   1 
ATOM   7276  O  OP2   . DA  I  5 56  ? -69.578 -5.487  51.033 1.00 153.90 ? -18  DA  I OP2   1 
ATOM   7277  O  "O5'" . DA  I  5 56  ? -70.789 -7.656  51.325 1.00 153.83 ? -18  DA  I "O5'" 1 
ATOM   7278  C  "C5'" . DA  I  5 56  ? -69.803 -8.490  51.941 1.00 153.18 ? -18  DA  I "C5'" 1 
ATOM   7279  C  "C4'" . DA  I  5 56  ? -69.655 -9.795  51.166 1.00 152.90 ? -18  DA  I "C4'" 1 
ATOM   7280  O  "O4'" . DA  I  5 56  ? -68.415 -9.794  50.401 1.00 153.21 ? -18  DA  I "O4'" 1 
ATOM   7281  C  "C3'" . DA  I  5 56  ? -69.619 -11.073 51.996 1.00 152.41 ? -18  DA  I "C3'" 1 
ATOM   7282  O  "O3'" . DA  I  5 56  ? -70.205 -12.141 51.236 1.00 151.16 ? -18  DA  I "O3'" 1 
ATOM   7283  C  "C2'" . DA  I  5 56  ? -68.118 -11.269 52.223 1.00 152.93 ? -18  DA  I "C2'" 1 
ATOM   7284  C  "C1'" . DA  I  5 56  ? -67.498 -10.750 50.920 1.00 153.17 ? -18  DA  I "C1'" 1 
ATOM   7285  N  N9    . DA  I  5 56  ? -66.167 -10.136 51.089 1.00 153.34 ? -18  DA  I N9    1 
ATOM   7286  C  C8    . DA  I  5 56  ? -65.888 -8.944  51.715 1.00 153.23 ? -18  DA  I C8    1 
ATOM   7287  N  N7    . DA  I  5 56  ? -64.615 -8.620  51.736 1.00 153.20 ? -18  DA  I N7    1 
ATOM   7288  C  C5    . DA  I  5 56  ? -64.003 -9.672  51.078 1.00 153.19 ? -18  DA  I C5    1 
ATOM   7289  C  C6    . DA  I  5 56  ? -62.652 -9.922  50.770 1.00 152.87 ? -18  DA  I C6    1 
ATOM   7290  N  N6    . DA  I  5 56  ? -61.670 -9.085  51.109 1.00 152.81 ? -18  DA  I N6    1 
ATOM   7291  N  N1    . DA  I  5 56  ? -62.364 -11.061 50.101 1.00 153.11 ? -18  DA  I N1    1 
ATOM   7292  C  C2    . DA  I  5 56  ? -63.363 -11.899 49.765 1.00 153.17 ? -18  DA  I C2    1 
ATOM   7293  N  N3    . DA  I  5 56  ? -64.674 -11.772 49.999 1.00 153.16 ? -18  DA  I N3    1 
ATOM   7294  C  C4    . DA  I  5 56  ? -64.937 -10.623 50.667 1.00 153.40 ? -18  DA  I C4    1 
ATOM   7295  P  P     . DA  I  5 57  ? -70.732 -13.499 51.913 1.00 149.90 ? -17  DA  I P     1 
ATOM   7296  O  OP1   . DA  I  5 57  ? -71.427 -14.296 50.874 1.00 149.98 ? -17  DA  I OP1   1 
ATOM   7297  O  OP2   . DA  I  5 57  ? -71.435 -13.130 53.165 1.00 149.84 ? -17  DA  I OP2   1 
ATOM   7298  O  "O5'" . DA  I  5 57  ? -69.390 -14.271 52.319 1.00 148.27 ? -17  DA  I "O5'" 1 
ATOM   7299  C  "C5'" . DA  I  5 57  ? -68.411 -14.757 51.379 1.00 145.36 ? -17  DA  I "C5'" 1 
ATOM   7300  C  "C4'" . DA  I  5 57  ? -67.272 -15.357 52.185 1.00 143.04 ? -17  DA  I "C4'" 1 
ATOM   7301  O  "O4'" . DA  I  5 57  ? -66.186 -14.396 52.340 1.00 142.77 ? -17  DA  I "O4'" 1 
ATOM   7302  C  "C3'" . DA  I  5 57  ? -67.719 -15.727 53.600 1.00 141.52 ? -17  DA  I "C3'" 1 
ATOM   7303  O  "O3'" . DA  I  5 57  ? -67.432 -17.111 53.862 1.00 139.14 ? -17  DA  I "O3'" 1 
ATOM   7304  C  "C2'" . DA  I  5 57  ? -66.997 -14.729 54.516 1.00 141.70 ? -17  DA  I "C2'" 1 
ATOM   7305  C  "C1'" . DA  I  5 57  ? -65.751 -14.391 53.699 1.00 141.67 ? -17  DA  I "C1'" 1 
ATOM   7306  N  N9    . DA  I  5 57  ? -65.097 -13.119 54.074 1.00 141.49 ? -17  DA  I N9    1 
ATOM   7307  C  C8    . DA  I  5 57  ? -65.676 -12.034 54.688 1.00 141.03 ? -17  DA  I C8    1 
ATOM   7308  N  N7    . DA  I  5 57  ? -64.852 -11.033 54.905 1.00 140.93 ? -17  DA  I N7    1 
ATOM   7309  C  C5    . DA  I  5 57  ? -63.639 -11.483 54.407 1.00 141.02 ? -17  DA  I C5    1 
ATOM   7310  C  C6    . DA  I  5 57  ? -62.359 -10.886 54.333 1.00 140.87 ? -17  DA  I C6    1 
ATOM   7311  N  N6    . DA  I  5 57  ? -62.083 -9.661  54.785 1.00 140.90 ? -17  DA  I N6    1 
ATOM   7312  N  N1    . DA  I  5 57  ? -61.362 -11.607 53.780 1.00 140.93 ? -17  DA  I N1    1 
ATOM   7313  C  C2    . DA  I  5 57  ? -61.628 -12.841 53.327 1.00 140.91 ? -17  DA  I C2    1 
ATOM   7314  N  N3    . DA  I  5 57  ? -62.785 -13.507 53.335 1.00 140.76 ? -17  DA  I N3    1 
ATOM   7315  C  C4    . DA  I  5 57  ? -63.766 -12.769 53.894 1.00 141.17 ? -17  DA  I C4    1 
ATOM   7316  P  P     . DG  I  5 58  ? -67.655 -17.784 55.308 1.00 137.05 ? -16  DG  I P     1 
ATOM   7317  O  OP1   . DG  I  5 58  ? -67.918 -19.228 55.102 1.00 136.92 ? -16  DG  I OP1   1 
ATOM   7318  O  OP2   . DG  I  5 58  ? -68.630 -16.978 56.085 1.00 137.03 ? -16  DG  I OP2   1 
ATOM   7319  O  "O5'" . DG  I  5 58  ? -66.206 -17.609 55.977 1.00 134.88 ? -16  DG  I "O5'" 1 
ATOM   7320  C  "C5'" . DG  I  5 58  ? -64.991 -17.776 55.216 1.00 130.82 ? -16  DG  I "C5'" 1 
ATOM   7321  C  "C4'" . DG  I  5 58  ? -63.765 -17.540 56.080 1.00 127.60 ? -16  DG  I "C4'" 1 
ATOM   7322  O  "O4'" . DG  I  5 58  ? -63.484 -16.122 56.193 1.00 126.79 ? -16  DG  I "O4'" 1 
ATOM   7323  C  "C3'" . DG  I  5 58  ? -63.885 -18.072 57.511 1.00 125.83 ? -16  DG  I "C3'" 1 
ATOM   7324  O  "O3'" . DG  I  5 58  ? -62.720 -18.798 57.887 1.00 123.57 ? -16  DG  I "O3'" 1 
ATOM   7325  C  "C2'" . DG  I  5 58  ? -64.025 -16.810 58.351 1.00 125.90 ? -16  DG  I "C2'" 1 
ATOM   7326  C  "C1'" . DG  I  5 58  ? -63.150 -15.868 57.539 1.00 126.03 ? -16  DG  I "C1'" 1 
ATOM   7327  N  N9    . DG  I  5 58  ? -63.353 -14.459 57.836 1.00 125.94 ? -16  DG  I N9    1 
ATOM   7328  C  C8    . DG  I  5 58  ? -64.427 -13.872 58.463 1.00 125.87 ? -16  DG  I C8    1 
ATOM   7329  N  N7    . DG  I  5 58  ? -64.304 -12.581 58.587 1.00 125.91 ? -16  DG  I N7    1 
ATOM   7330  C  C5    . DG  I  5 58  ? -63.073 -12.293 58.005 1.00 125.99 ? -16  DG  I C5    1 
ATOM   7331  C  C6    . DG  I  5 58  ? -62.394 -11.053 57.835 1.00 126.12 ? -16  DG  I C6    1 
ATOM   7332  O  O6    . DG  I  5 58  ? -62.751 -9.914  58.175 1.00 126.06 ? -16  DG  I O6    1 
ATOM   7333  N  N1    . DG  I  5 58  ? -61.166 -11.218 57.195 1.00 125.93 ? -16  DG  I N1    1 
ATOM   7334  C  C2    . DG  I  5 58  ? -60.664 -12.425 56.770 1.00 125.75 ? -16  DG  I C2    1 
ATOM   7335  N  N2    . DG  I  5 58  ? -59.473 -12.371 56.172 1.00 126.03 ? -16  DG  I N2    1 
ATOM   7336  N  N3    . DG  I  5 58  ? -61.280 -13.590 56.913 1.00 125.57 ? -16  DG  I N3    1 
ATOM   7337  C  C4    . DG  I  5 58  ? -62.476 -13.447 57.539 1.00 125.85 ? -16  DG  I C4    1 
ATOM   7338  P  P     . DG  I  5 59  ? -62.425 -20.279 57.347 1.00 122.03 ? -15  DG  I P     1 
ATOM   7339  O  OP1   . DG  I  5 59  ? -63.374 -20.602 56.252 1.00 122.14 ? -15  DG  I OP1   1 
ATOM   7340  O  OP2   . DG  I  5 59  ? -62.358 -21.164 58.534 1.00 121.86 ? -15  DG  I OP2   1 
ATOM   7341  O  "O5'" . DG  I  5 59  ? -60.942 -20.158 56.720 1.00 119.94 ? -15  DG  I "O5'" 1 
ATOM   7342  C  "C5'" . DG  I  5 59  ? -60.523 -19.072 55.854 1.00 115.21 ? -15  DG  I "C5'" 1 
ATOM   7343  C  "C4'" . DG  I  5 59  ? -59.254 -18.393 56.358 1.00 111.63 ? -15  DG  I "C4'" 1 
ATOM   7344  O  "O4'" . DG  I  5 59  ? -59.546 -17.158 57.075 1.00 111.18 ? -15  DG  I "O4'" 1 
ATOM   7345  C  "C3'" . DG  I  5 59  ? -58.384 -19.209 57.310 1.00 109.32 ? -15  DG  I "C3'" 1 
ATOM   7346  O  "O3'" . DG  I  5 59  ? -57.047 -18.917 56.965 1.00 105.66 ? -15  DG  I "O3'" 1 
ATOM   7347  C  "C2'" . DG  I  5 59  ? -58.739 -18.648 58.687 1.00 109.66 ? -15  DG  I "C2'" 1 
ATOM   7348  C  "C1'" . DG  I  5 59  ? -58.906 -17.172 58.345 1.00 110.64 ? -15  DG  I "C1'" 1 
ATOM   7349  N  N9    . DG  I  5 59  ? -59.718 -16.402 59.293 1.00 110.73 ? -15  DG  I N9    1 
ATOM   7350  C  C8    . DG  I  5 59  ? -60.797 -16.845 60.025 1.00 110.81 ? -15  DG  I C8    1 
ATOM   7351  N  N7    . DG  I  5 59  ? -61.337 -15.932 60.785 1.00 110.58 ? -15  DG  I N7    1 
ATOM   7352  C  C5    . DG  I  5 59  ? -60.570 -14.805 60.549 1.00 110.47 ? -15  DG  I C5    1 
ATOM   7353  C  C6    . DG  I  5 59  ? -60.684 -13.503 61.096 1.00 110.63 ? -15  DG  I C6    1 
ATOM   7354  O  O6    . DG  I  5 59  ? -61.511 -13.077 61.913 1.00 110.49 ? -15  DG  I O6    1 
ATOM   7355  N  N1    . DG  I  5 59  ? -59.702 -12.650 60.590 1.00 110.89 ? -15  DG  I N1    1 
ATOM   7356  C  C2    . DG  I  5 59  ? -58.737 -13.014 59.670 1.00 110.73 ? -15  DG  I C2    1 
ATOM   7357  N  N2    . DG  I  5 59  ? -57.879 -12.051 59.301 1.00 110.65 ? -15  DG  I N2    1 
ATOM   7358  N  N3    . DG  I  5 59  ? -58.621 -14.233 59.149 1.00 110.47 ? -15  DG  I N3    1 
ATOM   7359  C  C4    . DG  I  5 59  ? -59.569 -15.076 59.632 1.00 110.54 ? -15  DG  I C4    1 
ATOM   7360  P  P     . DC  I  5 60  ? -55.807 -19.790 57.459 1.00 102.05 ? -14  DC  I P     1 
ATOM   7361  O  OP1   . DC  I  5 60  ? -55.217 -20.401 56.248 1.00 102.28 ? -14  DC  I OP1   1 
ATOM   7362  O  OP2   . DC  I  5 60  ? -56.189 -20.608 58.629 1.00 101.96 ? -14  DC  I OP2   1 
ATOM   7363  O  "O5'" . DC  I  5 60  ? -54.795 -18.679 57.971 1.00 99.38  ? -14  DC  I "O5'" 1 
ATOM   7364  C  "C5'" . DC  I  5 60  ? -54.699 -17.452 57.305 1.00 95.72  ? -14  DC  I "C5'" 1 
ATOM   7365  C  "C4'" . DC  I  5 60  ? -54.461 -16.446 58.395 1.00 93.53  ? -14  DC  I "C4'" 1 
ATOM   7366  O  "O4'" . DC  I  5 60  ? -55.686 -16.276 59.146 1.00 92.95  ? -14  DC  I "O4'" 1 
ATOM   7367  C  "C3'" . DC  I  5 60  ? -53.408 -16.908 59.395 1.00 92.17  ? -14  DC  I "C3'" 1 
ATOM   7368  O  "O3'" . DC  I  5 60  ? -52.475 -15.884 59.544 1.00 90.78  ? -14  DC  I "O3'" 1 
ATOM   7369  C  "C2'" . DC  I  5 60  ? -54.184 -17.092 60.692 1.00 92.53  ? -14  DC  I "C2'" 1 
ATOM   7370  C  "C1'" . DC  I  5 60  ? -55.306 -16.087 60.490 1.00 92.48  ? -14  DC  I "C1'" 1 
ATOM   7371  N  N1    . DC  I  5 60  ? -56.488 -16.266 61.382 1.00 92.30  ? -14  DC  I N1    1 
ATOM   7372  C  C2    . DC  I  5 60  ? -56.949 -15.166 62.118 1.00 91.95  ? -14  DC  I C2    1 
ATOM   7373  O  O2    . DC  I  5 60  ? -56.371 -14.079 62.025 1.00 91.42  ? -14  DC  I O2    1 
ATOM   7374  N  N3    . DC  I  5 60  ? -58.029 -15.337 62.925 1.00 92.47  ? -14  DC  I N3    1 
ATOM   7375  C  C4    . DC  I  5 60  ? -58.636 -16.531 63.008 1.00 92.41  ? -14  DC  I C4    1 
ATOM   7376  N  N4    . DC  I  5 60  ? -59.696 -16.633 63.818 1.00 92.06  ? -14  DC  I N4    1 
ATOM   7377  C  C5    . DC  I  5 60  ? -58.181 -17.668 62.266 1.00 92.05  ? -14  DC  I C5    1 
ATOM   7378  C  C6    . DC  I  5 60  ? -57.114 -17.487 61.476 1.00 92.22  ? -14  DC  I C6    1 
ATOM   7379  P  P     . DA  I  5 61  ? -50.966 -16.175 59.957 1.00 89.23  ? -13  DA  I P     1 
ATOM   7380  O  OP1   . DA  I  5 61  ? -50.240 -16.503 58.709 1.00 88.52  ? -13  DA  I OP1   1 
ATOM   7381  O  OP2   . DA  I  5 61  ? -50.934 -17.080 61.130 1.00 88.50  ? -13  DA  I OP2   1 
ATOM   7382  O  "O5'" . DA  I  5 61  ? -50.521 -14.729 60.479 1.00 88.82  ? -13  DA  I "O5'" 1 
ATOM   7383  C  "C5'" . DA  I  5 61  ? -51.146 -13.544 59.981 1.00 87.73  ? -13  DA  I "C5'" 1 
ATOM   7384  C  "C4'" . DA  I  5 61  ? -51.536 -12.553 61.065 1.00 87.10  ? -13  DA  I "C4'" 1 
ATOM   7385  O  "O4'" . DA  I  5 61  ? -52.788 -12.955 61.667 1.00 87.56  ? -13  DA  I "O4'" 1 
ATOM   7386  C  "C3'" . DA  I  5 61  ? -50.541 -12.382 62.204 1.00 86.35  ? -13  DA  I "C3'" 1 
ATOM   7387  O  "O3'" . DA  I  5 61  ? -50.278 -11.014 62.344 1.00 85.24  ? -13  DA  I "O3'" 1 
ATOM   7388  C  "C2'" . DA  I  5 61  ? -51.256 -12.937 63.428 1.00 87.02  ? -13  DA  I "C2'" 1 
ATOM   7389  C  "C1'" . DA  I  5 61  ? -52.723 -12.787 63.065 1.00 88.13  ? -13  DA  I "C1'" 1 
ATOM   7390  N  N9    . DA  I  5 61  ? -53.586 -13.799 63.676 1.00 88.58  ? -13  DA  I N9    1 
ATOM   7391  C  C8    . DA  I  5 61  ? -53.651 -15.128 63.362 1.00 88.37  ? -13  DA  I C8    1 
ATOM   7392  N  N7    . DA  I  5 61  ? -54.521 -15.801 64.067 1.00 88.01  ? -13  DA  I N7    1 
ATOM   7393  C  C5    . DA  I  5 61  ? -55.063 -14.847 64.908 1.00 88.40  ? -13  DA  I C5    1 
ATOM   7394  C  C6    . DA  I  5 61  ? -56.050 -14.914 65.915 1.00 88.74  ? -13  DA  I C6    1 
ATOM   7395  N  N6    . DA  I  5 61  ? -56.682 -16.048 66.230 1.00 88.71  ? -13  DA  I N6    1 
ATOM   7396  N  N1    . DA  I  5 61  ? -56.368 -13.776 66.584 1.00 88.75  ? -13  DA  I N1    1 
ATOM   7397  C  C2    . DA  I  5 61  ? -55.741 -12.638 66.251 1.00 88.52  ? -13  DA  I C2    1 
ATOM   7398  N  N3    . DA  I  5 61  ? -54.797 -12.455 65.325 1.00 88.81  ? -13  DA  I N3    1 
ATOM   7399  C  C4    . DA  I  5 61  ? -54.504 -13.605 64.682 1.00 88.58  ? -13  DA  I C4    1 
ATOM   7400  P  P     . DT  I  5 62  ? -49.250 -10.459 63.431 1.00 84.84  ? -12  DT  I P     1 
ATOM   7401  O  OP1   . DT  I  5 62  ? -48.633 -9.249  62.847 1.00 84.73  ? -12  DT  I OP1   1 
ATOM   7402  O  OP2   . DT  I  5 62  ? -48.404 -11.548 63.966 1.00 83.94  ? -12  DT  I OP2   1 
ATOM   7403  O  "O5'" . DT  I  5 62  ? -50.250 -10.034 64.601 1.00 86.66  ? -12  DT  I "O5'" 1 
ATOM   7404  C  "C5'" . DT  I  5 62  ? -51.174 -8.952  64.443 1.00 88.02  ? -12  DT  I "C5'" 1 
ATOM   7405  C  "C4'" . DT  I  5 62  ? -51.890 -8.688  65.754 1.00 89.00  ? -12  DT  I "C4'" 1 
ATOM   7406  O  "O4'" . DT  I  5 62  ? -52.703 -9.840  66.081 1.00 89.31  ? -12  DT  I "O4'" 1 
ATOM   7407  C  "C3'" . DT  I  5 62  ? -50.956 -8.461  66.937 1.00 89.82  ? -12  DT  I "C3'" 1 
ATOM   7408  O  "O3'" . DT  I  5 62  ? -51.344 -7.285  67.629 1.00 90.88  ? -12  DT  I "O3'" 1 
ATOM   7409  C  "C2'" . DT  I  5 62  ? -51.117 -9.715  67.790 1.00 90.19  ? -12  DT  I "C2'" 1 
ATOM   7410  C  "C1'" . DT  I  5 62  ? -52.534 -10.141 67.445 1.00 91.14  ? -12  DT  I "C1'" 1 
ATOM   7411  N  N1    . DT  I  5 62  ? -52.804 -11.591 67.655 1.00 91.80  ? -12  DT  I N1    1 
ATOM   7412  C  C2    . DT  I  5 62  ? -53.765 -11.976 68.580 1.00 92.40  ? -12  DT  I C2    1 
ATOM   7413  O  O2    . DT  I  5 62  ? -54.426 -11.207 69.254 1.00 92.74  ? -12  DT  I O2    1 
ATOM   7414  N  N3    . DT  I  5 62  ? -53.937 -13.331 68.701 1.00 92.51  ? -12  DT  I N3    1 
ATOM   7415  C  C4    . DT  I  5 62  ? -53.260 -14.319 68.010 1.00 92.41  ? -12  DT  I C4    1 
ATOM   7416  O  O4    . DT  I  5 62  ? -53.494 -15.510 68.195 1.00 92.49  ? -12  DT  I O4    1 
ATOM   7417  C  C5    . DT  I  5 62  ? -52.267 -13.857 67.065 1.00 92.52  ? -12  DT  I C5    1 
ATOM   7418  C  C7    . DT  I  5 62  ? -51.474 -14.852 66.264 1.00 92.46  ? -12  DT  I C7    1 
ATOM   7419  C  C6    . DT  I  5 62  ? -52.084 -12.531 66.935 1.00 92.04  ? -12  DT  I C6    1 
ATOM   7420  P  P     . DG  I  5 63  ? -50.460 -6.646  68.806 1.00 91.42  ? -11  DG  I P     1 
ATOM   7421  O  OP1   . DG  I  5 63  ? -50.427 -5.182  68.605 1.00 91.39  ? -11  DG  I OP1   1 
ATOM   7422  O  OP2   . DG  I  5 63  ? -49.186 -7.371  68.962 1.00 90.99  ? -11  DG  I OP2   1 
ATOM   7423  O  "O5'" . DG  I  5 63  ? -51.342 -7.002  70.085 1.00 93.35  ? -11  DG  I "O5'" 1 
ATOM   7424  C  "C5'" . DG  I  5 63  ? -52.769 -6.921  70.121 1.00 95.51  ? -11  DG  I "C5'" 1 
ATOM   7425  C  "C4'" . DG  I  5 63  ? -53.262 -7.333  71.506 1.00 97.66  ? -11  DG  I "C4'" 1 
ATOM   7426  O  "O4'" . DG  I  5 63  ? -53.598 -8.744  71.495 1.00 98.49  ? -11  DG  I "O4'" 1 
ATOM   7427  C  "C3'" . DG  I  5 63  ? -52.284 -7.148  72.671 1.00 98.34  ? -11  DG  I "C3'" 1 
ATOM   7428  O  "O3'" . DG  I  5 63  ? -52.992 -6.706  73.825 1.00 99.45  ? -11  DG  I "O3'" 1 
ATOM   7429  C  "C2'" . DG  I  5 63  ? -51.688 -8.539  72.861 1.00 98.70  ? -11  DG  I "C2'" 1 
ATOM   7430  C  "C1'" . DG  I  5 63  ? -52.871 -9.422  72.499 1.00 99.69  ? -11  DG  I "C1'" 1 
ATOM   7431  N  N9    . DG  I  5 63  ? -52.467 -10.701 71.944 1.00 100.11 ? -11  DG  I N9    1 
ATOM   7432  C  C8    . DG  I  5 63  ? -51.494 -10.930 70.997 1.00 100.34 ? -11  DG  I C8    1 
ATOM   7433  N  N7    . DG  I  5 63  ? -51.347 -12.188 70.688 1.00 100.28 ? -11  DG  I N7    1 
ATOM   7434  C  C5    . DG  I  5 63  ? -52.290 -12.828 71.480 1.00 100.46 ? -11  DG  I C5    1 
ATOM   7435  C  C6    . DG  I  5 63  ? -52.602 -14.204 71.580 1.00 100.41 ? -11  DG  I C6    1 
ATOM   7436  O  O6    . DG  I  5 63  ? -52.082 -15.146 70.962 1.00 100.26 ? -11  DG  I O6    1 
ATOM   7437  N  N1    . DG  I  5 63  ? -53.626 -14.435 72.509 1.00 100.44 ? -11  DG  I N1    1 
ATOM   7438  C  C2    . DG  I  5 63  ? -54.267 -13.462 73.251 1.00 100.28 ? -11  DG  I C2    1 
ATOM   7439  N  N2    . DG  I  5 63  ? -55.224 -13.880 74.098 1.00 100.21 ? -11  DG  I N2    1 
ATOM   7440  N  N3    . DG  I  5 63  ? -53.980 -12.167 73.160 1.00 100.30 ? -11  DG  I N3    1 
ATOM   7441  C  C4    . DG  I  5 63  ? -52.991 -11.927 72.259 1.00 100.38 ? -11  DG  I C4    1 
ATOM   7442  P  P     . DT  I  5 64  ? -52.394 -6.776  75.316 1.00 100.98 ? -10  DT  I P     1 
ATOM   7443  O  OP1   . DT  I  5 64  ? -53.086 -5.727  76.095 1.00 101.34 ? -10  DT  I OP1   1 
ATOM   7444  O  OP2   . DT  I  5 64  ? -50.913 -6.808  75.282 1.00 101.56 ? -10  DT  I OP2   1 
ATOM   7445  O  "O5'" . DT  I  5 64  ? -52.875 -8.201  75.840 1.00 101.12 ? -10  DT  I "O5'" 1 
ATOM   7446  C  "C5'" . DT  I  5 64  ? -54.257 -8.519  75.937 1.00 101.70 ? -10  DT  I "C5'" 1 
ATOM   7447  C  "C4'" . DT  I  5 64  ? -54.417 -9.635  76.949 1.00 102.42 ? -10  DT  I "C4'" 1 
ATOM   7448  O  "O4'" . DT  I  5 64  ? -54.114 -10.911 76.323 1.00 102.77 ? -10  DT  I "O4'" 1 
ATOM   7449  C  "C3'" . DT  I  5 64  ? -53.491 -9.529  78.159 1.00 102.78 ? -10  DT  I "C3'" 1 
ATOM   7450  O  "O3'" . DT  I  5 64  ? -54.221 -9.979  79.293 1.00 103.07 ? -10  DT  I "O3'" 1 
ATOM   7451  C  "C2'" . DT  I  5 64  ? -52.333 -10.457 77.784 1.00 102.77 ? -10  DT  I "C2'" 1 
ATOM   7452  C  "C1'" . DT  I  5 64  ? -53.098 -11.566 77.066 1.00 102.21 ? -10  DT  I "C1'" 1 
ATOM   7453  N  N1    . DT  I  5 64  ? -52.262 -12.441 76.167 1.00 101.87 ? -10  DT  I N1    1 
ATOM   7454  C  C2    . DT  I  5 64  ? -52.498 -13.805 76.155 1.00 101.68 ? -10  DT  I C2    1 
ATOM   7455  O  O2    . DT  I  5 64  ? -53.350 -14.359 76.829 1.00 101.75 ? -10  DT  I O2    1 
ATOM   7456  N  N3    . DT  I  5 64  ? -51.685 -14.516 75.309 1.00 101.49 ? -10  DT  I N3    1 
ATOM   7457  C  C4    . DT  I  5 64  ? -50.686 -14.021 74.490 1.00 101.58 ? -10  DT  I C4    1 
ATOM   7458  O  O4    . DT  I  5 64  ? -50.024 -14.760 73.772 1.00 101.38 ? -10  DT  I O4    1 
ATOM   7459  C  C5    . DT  I  5 64  ? -50.488 -12.589 74.546 1.00 101.78 ? -10  DT  I C5    1 
ATOM   7460  C  C7    . DT  I  5 64  ? -49.433 -11.926 73.704 1.00 101.76 ? -10  DT  I C7    1 
ATOM   7461  C  C6    . DT  I  5 64  ? -51.275 -11.879 75.372 1.00 101.80 ? -10  DT  I C6    1 
ATOM   7462  P  P     . DT  I  5 65  ? -53.636 -9.999  80.786 1.00 103.42 ? -9   DT  I P     1 
ATOM   7463  O  OP1   . DT  I  5 65  ? -54.121 -8.752  81.416 1.00 103.35 ? -9   DT  I OP1   1 
ATOM   7464  O  OP2   . DT  I  5 65  ? -52.177 -10.292 80.796 1.00 103.66 ? -9   DT  I OP2   1 
ATOM   7465  O  "O5'" . DT  I  5 65  ? -54.391 -11.290 81.377 1.00 102.76 ? -9   DT  I "O5'" 1 
ATOM   7466  C  "C5'" . DT  I  5 65  ? -54.716 -12.394 80.509 1.00 101.57 ? -9   DT  I "C5'" 1 
ATOM   7467  C  "C4'" . DT  I  5 65  ? -54.428 -13.749 81.139 1.00 100.97 ? -9   DT  I "C4'" 1 
ATOM   7468  O  "O4'" . DT  I  5 65  ? -53.670 -14.589 80.223 1.00 101.46 ? -9   DT  I "O4'" 1 
ATOM   7469  C  "C3'" . DT  I  5 65  ? -53.652 -13.748 82.452 1.00 100.08 ? -9   DT  I "C3'" 1 
ATOM   7470  O  "O3'" . DT  I  5 65  ? -54.307 -14.671 83.318 1.00 98.45  ? -9   DT  I "O3'" 1 
ATOM   7471  C  "C2'" . DT  I  5 65  ? -52.234 -14.174 82.053 1.00 100.72 ? -9   DT  I "C2'" 1 
ATOM   7472  C  "C1'" . DT  I  5 65  ? -52.471 -15.059 80.828 1.00 101.36 ? -9   DT  I "C1'" 1 
ATOM   7473  N  N1    . DT  I  5 65  ? -51.389 -15.022 79.768 1.00 101.54 ? -9   DT  I N1    1 
ATOM   7474  C  C2    . DT  I  5 65  ? -51.136 -16.151 79.002 1.00 101.40 ? -9   DT  I C2    1 
ATOM   7475  O  O2    . DT  I  5 65  ? -51.724 -17.208 79.131 1.00 101.62 ? -9   DT  I O2    1 
ATOM   7476  N  N3    . DT  I  5 65  ? -50.148 -16.002 78.059 1.00 101.26 ? -9   DT  I N3    1 
ATOM   7477  C  C4    . DT  I  5 65  ? -49.402 -14.864 77.800 1.00 101.42 ? -9   DT  I C4    1 
ATOM   7478  O  O4    . DT  I  5 65  ? -48.541 -14.850 76.929 1.00 101.54 ? -9   DT  I O4    1 
ATOM   7479  C  C5    . DT  I  5 65  ? -49.709 -13.714 78.624 1.00 101.56 ? -9   DT  I C5    1 
ATOM   7480  C  C7    . DT  I  5 65  ? -48.976 -12.416 78.451 1.00 101.36 ? -9   DT  I C7    1 
ATOM   7481  C  C6    . DT  I  5 65  ? -50.674 -13.849 79.549 1.00 101.84 ? -9   DT  I C6    1 
ATOM   7482  P  P     . DC  I  5 66  ? -53.706 -15.117 84.736 1.00 97.76  ? -8   DC  I P     1 
ATOM   7483  O  OP1   . DC  I  5 66  ? -54.837 -15.551 85.591 1.00 97.52  ? -8   DC  I OP1   1 
ATOM   7484  O  OP2   . DC  I  5 66  ? -52.732 -14.102 85.204 1.00 97.46  ? -8   DC  I OP2   1 
ATOM   7485  O  "O5'" . DC  I  5 66  ? -52.852 -16.410 84.372 1.00 96.51  ? -8   DC  I "O5'" 1 
ATOM   7486  C  "C5'" . DC  I  5 66  ? -53.425 -17.551 83.755 1.00 93.81  ? -8   DC  I "C5'" 1 
ATOM   7487  C  "C4'" . DC  I  5 66  ? -52.321 -18.578 83.673 1.00 91.82  ? -8   DC  I "C4'" 1 
ATOM   7488  O  "O4'" . DC  I  5 66  ? -51.410 -18.212 82.607 1.00 91.37  ? -8   DC  I "O4'" 1 
ATOM   7489  C  "C3'" . DC  I  5 66  ? -51.471 -18.645 84.938 1.00 90.80  ? -8   DC  I "C3'" 1 
ATOM   7490  O  "O3'" . DC  I  5 66  ? -51.268 -20.020 85.237 1.00 89.95  ? -8   DC  I "O3'" 1 
ATOM   7491  C  "C2'" . DC  I  5 66  ? -50.180 -17.908 84.563 1.00 90.52  ? -8   DC  I "C2'" 1 
ATOM   7492  C  "C1'" . DC  I  5 66  ? -50.080 -18.318 83.094 1.00 90.81  ? -8   DC  I "C1'" 1 
ATOM   7493  N  N1    . DC  I  5 66  ? -49.154 -17.538 82.188 1.00 90.36  ? -8   DC  I N1    1 
ATOM   7494  C  C2    . DC  I  5 66  ? -48.772 -18.104 80.958 1.00 89.62  ? -8   DC  I C2    1 
ATOM   7495  O  O2    . DC  I  5 66  ? -49.184 -19.224 80.645 1.00 89.51  ? -8   DC  I O2    1 
ATOM   7496  N  N3    . DC  I  5 66  ? -47.952 -17.409 80.130 1.00 89.68  ? -8   DC  I N3    1 
ATOM   7497  C  C4    . DC  I  5 66  ? -47.516 -16.197 80.481 1.00 90.30  ? -8   DC  I C4    1 
ATOM   7498  N  N4    . DC  I  5 66  ? -46.707 -15.555 79.630 1.00 90.02  ? -8   DC  I N4    1 
ATOM   7499  C  C5    . DC  I  5 66  ? -47.890 -15.595 81.725 1.00 90.46  ? -8   DC  I C5    1 
ATOM   7500  C  C6    . DC  I  5 66  ? -48.702 -16.292 82.538 1.00 90.67  ? -8   DC  I C6    1 
ATOM   7501  P  P     . DA  I  5 67  ? -50.730 -20.500 86.669 1.00 89.06  ? -7   DA  I P     1 
ATOM   7502  O  OP1   . DA  I  5 67  ? -51.875 -21.082 87.399 1.00 89.34  ? -7   DA  I OP1   1 
ATOM   7503  O  OP2   . DA  I  5 67  ? -49.945 -19.390 87.267 1.00 88.77  ? -7   DA  I OP2   1 
ATOM   7504  O  "O5'" . DA  I  5 67  ? -49.735 -21.711 86.327 1.00 88.88  ? -7   DA  I "O5'" 1 
ATOM   7505  C  "C5'" . DA  I  5 67  ? -49.835 -22.514 85.118 1.00 86.87  ? -7   DA  I "C5'" 1 
ATOM   7506  C  "C4'" . DA  I  5 67  ? -48.464 -22.908 84.575 1.00 84.40  ? -7   DA  I "C4'" 1 
ATOM   7507  O  "O4'" . DA  I  5 67  ? -47.914 -21.821 83.780 1.00 83.42  ? -7   DA  I "O4'" 1 
ATOM   7508  C  "C3'" . DA  I  5 67  ? -47.414 -23.212 85.645 1.00 83.33  ? -7   DA  I "C3'" 1 
ATOM   7509  O  "O3'" . DA  I  5 67  ? -46.601 -24.286 85.223 1.00 82.43  ? -7   DA  I "O3'" 1 
ATOM   7510  C  "C2'" . DA  I  5 67  ? -46.605 -21.922 85.713 1.00 83.06  ? -7   DA  I "C2'" 1 
ATOM   7511  C  "C1'" . DA  I  5 67  ? -46.600 -21.560 84.235 1.00 83.47  ? -7   DA  I "C1'" 1 
ATOM   7512  N  N9    . DA  I  5 67  ? -46.204 -20.186 83.937 1.00 83.65  ? -7   DA  I N9    1 
ATOM   7513  C  C8    . DA  I  5 67  ? -46.309 -19.085 84.746 1.00 83.61  ? -7   DA  I C8    1 
ATOM   7514  N  N7    . DA  I  5 67  ? -45.857 -17.980 84.200 1.00 83.53  ? -7   DA  I N7    1 
ATOM   7515  C  C5    . DA  I  5 67  ? -45.420 -18.385 82.949 1.00 83.87  ? -7   DA  I C5    1 
ATOM   7516  C  C6    . DA  I  5 67  ? -44.830 -17.688 81.870 1.00 83.88  ? -7   DA  I C6    1 
ATOM   7517  N  N6    . DA  I  5 67  ? -44.582 -16.376 81.921 1.00 83.64  ? -7   DA  I N6    1 
ATOM   7518  N  N1    . DA  I  5 67  ? -44.511 -18.384 80.745 1.00 83.68  ? -7   DA  I N1    1 
ATOM   7519  C  C2    . DA  I  5 67  ? -44.761 -19.702 80.710 1.00 83.43  ? -7   DA  I C2    1 
ATOM   7520  N  N3    . DA  I  5 67  ? -45.309 -20.467 81.663 1.00 83.58  ? -7   DA  I N3    1 
ATOM   7521  C  C4    . DA  I  5 67  ? -45.620 -19.745 82.767 1.00 84.02  ? -7   DA  I C4    1 
ATOM   7522  P  P     . DG  I  5 68  ? -46.688 -25.732 85.903 1.00 81.52  ? -6   DG  I P     1 
ATOM   7523  O  OP1   . DG  I  5 68  ? -48.126 -26.095 85.996 1.00 81.57  ? -6   DG  I OP1   1 
ATOM   7524  O  OP2   . DG  I  5 68  ? -45.796 -25.687 87.085 1.00 81.16  ? -6   DG  I OP2   1 
ATOM   7525  O  "O5'" . DG  I  5 68  ? -46.018 -26.727 84.833 1.00 80.42  ? -6   DG  I "O5'" 1 
ATOM   7526  C  "C5'" . DG  I  5 68  ? -46.445 -26.717 83.447 1.00 77.43  ? -6   DG  I "C5'" 1 
ATOM   7527  C  "C4'" . DG  I  5 68  ? -45.290 -26.542 82.467 1.00 74.20  ? -6   DG  I "C4'" 1 
ATOM   7528  O  "O4'" . DG  I  5 68  ? -44.764 -25.185 82.472 1.00 72.99  ? -6   DG  I "O4'" 1 
ATOM   7529  C  "C3'" . DG  I  5 68  ? -44.109 -27.456 82.733 1.00 72.67  ? -6   DG  I "C3'" 1 
ATOM   7530  O  "O3'" . DG  I  5 68  ? -43.735 -27.994 81.491 1.00 71.19  ? -6   DG  I "O3'" 1 
ATOM   7531  C  "C2'" . DG  I  5 68  ? -43.049 -26.531 83.338 1.00 73.02  ? -6   DG  I "C2'" 1 
ATOM   7532  C  "C1'" . DG  I  5 68  ? -43.361 -25.197 82.670 1.00 73.86  ? -6   DG  I "C1'" 1 
ATOM   7533  N  N9    . DG  I  5 68  ? -43.041 -23.977 83.413 1.00 73.76  ? -6   DG  I N9    1 
ATOM   7534  C  C8    . DG  I  5 68  ? -43.215 -23.736 84.751 1.00 73.93  ? -6   DG  I C8    1 
ATOM   7535  N  N7    . DG  I  5 68  ? -42.858 -22.543 85.125 1.00 73.55  ? -6   DG  I N7    1 
ATOM   7536  C  C5    . DG  I  5 68  ? -42.431 -21.942 83.957 1.00 73.90  ? -6   DG  I C5    1 
ATOM   7537  C  C6    . DG  I  5 68  ? -41.929 -20.633 83.729 1.00 74.48  ? -6   DG  I C6    1 
ATOM   7538  O  O6    . DG  I  5 68  ? -41.767 -19.716 84.543 1.00 74.35  ? -6   DG  I O6    1 
ATOM   7539  N  N1    . DG  I  5 68  ? -41.591 -20.410 82.393 1.00 74.28  ? -6   DG  I N1    1 
ATOM   7540  C  C2    . DG  I  5 68  ? -41.730 -21.344 81.397 1.00 74.11  ? -6   DG  I C2    1 
ATOM   7541  N  N2    . DG  I  5 68  ? -41.356 -20.940 80.177 1.00 73.85  ? -6   DG  I N2    1 
ATOM   7542  N  N3    . DG  I  5 68  ? -42.201 -22.578 81.595 1.00 74.40  ? -6   DG  I N3    1 
ATOM   7543  C  C4    . DG  I  5 68  ? -42.535 -22.809 82.893 1.00 73.94  ? -6   DG  I C4    1 
ATOM   7544  P  P     . DC  I  5 69  ? -42.822 -29.296 81.389 1.00 70.41  ? -5   DC  I P     1 
ATOM   7545  O  OP1   . DC  I  5 69  ? -43.501 -30.289 80.520 1.00 71.03  ? -5   DC  I OP1   1 
ATOM   7546  O  OP2   . DC  I  5 69  ? -42.448 -29.713 82.751 1.00 70.71  ? -5   DC  I OP2   1 
ATOM   7547  O  "O5'" . DC  I  5 69  ? -41.503 -28.742 80.661 1.00 70.36  ? -5   DC  I "O5'" 1 
ATOM   7548  C  "C5'" . DC  I  5 69  ? -41.510 -27.506 79.934 1.00 70.65  ? -5   DC  I "C5'" 1 
ATOM   7549  C  "C4'" . DC  I  5 69  ? -40.130 -26.877 79.962 1.00 71.36  ? -5   DC  I "C4'" 1 
ATOM   7550  O  "O4'" . DC  I  5 69  ? -40.121 -25.724 80.848 1.00 72.56  ? -5   DC  I "O4'" 1 
ATOM   7551  C  "C3'" . DC  I  5 69  ? -39.008 -27.790 80.461 1.00 70.88  ? -5   DC  I "C3'" 1 
ATOM   7552  O  "O3'" . DC  I  5 69  ? -37.802 -27.482 79.779 1.00 69.81  ? -5   DC  I "O3'" 1 
ATOM   7553  C  "C2'" . DC  I  5 69  ? -38.849 -27.372 81.913 1.00 71.86  ? -5   DC  I "C2'" 1 
ATOM   7554  C  "C1'" . DC  I  5 69  ? -39.025 -25.864 81.747 1.00 73.98  ? -5   DC  I "C1'" 1 
ATOM   7555  N  N1    . DC  I  5 69  ? -39.279 -25.108 83.027 1.00 75.02  ? -5   DC  I N1    1 
ATOM   7556  C  C2    . DC  I  5 69  ? -39.177 -23.703 83.059 1.00 75.34  ? -5   DC  I C2    1 
ATOM   7557  O  O2    . DC  I  5 69  ? -38.875 -23.077 82.032 1.00 75.17  ? -5   DC  I O2    1 
ATOM   7558  N  N3    . DC  I  5 69  ? -39.418 -23.066 84.240 1.00 75.90  ? -5   DC  I N3    1 
ATOM   7559  C  C4    . DC  I  5 69  ? -39.742 -23.763 85.341 1.00 75.61  ? -5   DC  I C4    1 
ATOM   7560  N  N4    . DC  I  5 69  ? -39.970 -23.096 86.475 1.00 75.35  ? -5   DC  I N4    1 
ATOM   7561  C  C5    . DC  I  5 69  ? -39.849 -25.187 85.331 1.00 75.63  ? -5   DC  I C5    1 
ATOM   7562  C  C6    . DC  I  5 69  ? -39.608 -25.804 84.167 1.00 75.56  ? -5   DC  I C6    1 
ATOM   7563  P  P     . DT  I  5 70  ? -37.258 -28.348 78.547 1.00 67.59  ? -4   DT  I P     1 
ATOM   7564  O  OP1   . DT  I  5 70  ? -38.418 -28.765 77.714 1.00 66.70  ? -4   DT  I OP1   1 
ATOM   7565  O  OP2   . DT  I  5 70  ? -36.315 -29.361 79.091 1.00 66.76  ? -4   DT  I OP2   1 
ATOM   7566  O  "O5'" . DT  I  5 70  ? -36.397 -27.245 77.772 1.00 65.90  ? -4   DT  I "O5'" 1 
ATOM   7567  C  "C5'" . DT  I  5 70  ? -36.959 -26.006 77.411 1.00 64.18  ? -4   DT  I "C5'" 1 
ATOM   7568  C  "C4'" . DT  I  5 70  ? -36.018 -24.883 77.784 1.00 63.91  ? -4   DT  I "C4'" 1 
ATOM   7569  O  "O4'" . DT  I  5 70  ? -36.201 -24.567 79.183 1.00 64.19  ? -4   DT  I "O4'" 1 
ATOM   7570  C  "C3'" . DT  I  5 70  ? -34.521 -25.142 77.603 1.00 63.37  ? -4   DT  I "C3'" 1 
ATOM   7571  O  "O3'" . DT  I  5 70  ? -33.982 -24.108 76.751 1.00 61.03  ? -4   DT  I "O3'" 1 
ATOM   7572  C  "C2'" . DT  I  5 70  ? -33.995 -25.105 79.045 1.00 63.79  ? -4   DT  I "C2'" 1 
ATOM   7573  C  "C1'" . DT  I  5 70  ? -34.966 -24.123 79.682 1.00 64.49  ? -4   DT  I "C1'" 1 
ATOM   7574  N  N1    . DT  I  5 70  ? -35.132 -24.186 81.146 1.00 64.80  ? -4   DT  I N1    1 
ATOM   7575  C  C2    . DT  I  5 70  ? -35.257 -23.017 81.896 1.00 65.35  ? -4   DT  I C2    1 
ATOM   7576  O  O2    . DT  I  5 70  ? -35.211 -21.886 81.452 1.00 66.00  ? -4   DT  I O2    1 
ATOM   7577  N  N3    . DT  I  5 70  ? -35.431 -23.201 83.236 1.00 65.14  ? -4   DT  I N3    1 
ATOM   7578  C  C4    . DT  I  5 70  ? -35.493 -24.420 83.876 1.00 65.40  ? -4   DT  I C4    1 
ATOM   7579  O  O4    . DT  I  5 70  ? -35.654 -24.450 85.090 1.00 66.05  ? -4   DT  I O4    1 
ATOM   7580  C  C5    . DT  I  5 70  ? -35.363 -25.608 83.040 1.00 65.19  ? -4   DT  I C5    1 
ATOM   7581  C  C7    . DT  I  5 70  ? -35.408 -27.001 83.596 1.00 65.10  ? -4   DT  I C7    1 
ATOM   7582  C  C6    . DT  I  5 70  ? -35.201 -25.434 81.728 1.00 64.54  ? -4   DT  I C6    1 
ATOM   7583  P  P     . DG  I  5 71  ? -32.445 -24.022 76.329 1.00 59.00  ? -3   DG  I P     1 
ATOM   7584  O  OP1   . DG  I  5 71  ? -32.388 -23.678 74.897 1.00 59.12  ? -3   DG  I OP1   1 
ATOM   7585  O  OP2   . DG  I  5 71  ? -31.730 -25.214 76.815 1.00 59.16  ? -3   DG  I OP2   1 
ATOM   7586  O  "O5'" . DG  I  5 71  ? -31.944 -22.789 77.194 1.00 59.79  ? -3   DG  I "O5'" 1 
ATOM   7587  C  "C5'" . DG  I  5 71  ? -32.518 -21.512 77.001 1.00 61.62  ? -3   DG  I "C5'" 1 
ATOM   7588  C  "C4'" . DG  I  5 71  ? -31.831 -20.484 77.878 1.00 63.07  ? -3   DG  I "C4'" 1 
ATOM   7589  O  "O4'" . DG  I  5 71  ? -32.004 -20.820 79.273 1.00 63.43  ? -3   DG  I "O4'" 1 
ATOM   7590  C  "C3'" . DG  I  5 71  ? -30.328 -20.353 77.716 1.00 65.03  ? -3   DG  I "C3'" 1 
ATOM   7591  O  "O3'" . DG  I  5 71  ? -30.018 -19.009 78.010 1.00 68.00  ? -3   DG  I "O3'" 1 
ATOM   7592  C  "C2'" . DG  I  5 71  ? -29.736 -21.297 78.763 1.00 64.05  ? -3   DG  I "C2'" 1 
ATOM   7593  C  "C1'" . DG  I  5 71  ? -30.766 -21.150 79.879 1.00 63.07  ? -3   DG  I "C1'" 1 
ATOM   7594  N  N9    . DG  I  5 71  ? -31.029 -22.347 80.659 1.00 62.52  ? -3   DG  I N9    1 
ATOM   7595  C  C8    . DG  I  5 71  ? -31.025 -23.639 80.216 1.00 62.51  ? -3   DG  I C8    1 
ATOM   7596  N  N7    . DG  I  5 71  ? -31.318 -24.501 81.143 1.00 62.48  ? -3   DG  I N7    1 
ATOM   7597  C  C5    . DG  I  5 71  ? -31.540 -23.730 82.269 1.00 62.43  ? -3   DG  I C5    1 
ATOM   7598  C  C6    . DG  I  5 71  ? -31.896 -24.120 83.580 1.00 62.40  ? -3   DG  I C6    1 
ATOM   7599  O  O6    . DG  I  5 71  ? -32.084 -25.263 84.002 1.00 62.54  ? -3   DG  I O6    1 
ATOM   7600  N  N1    . DG  I  5 71  ? -32.022 -23.034 84.440 1.00 62.72  ? -3   DG  I N1    1 
ATOM   7601  C  C2    . DG  I  5 71  ? -31.827 -21.720 84.061 1.00 63.17  ? -3   DG  I C2    1 
ATOM   7602  N  N2    . DG  I  5 71  ? -31.982 -20.788 85.019 1.00 62.82  ? -3   DG  I N2    1 
ATOM   7603  N  N3    . DG  I  5 71  ? -31.497 -21.342 82.824 1.00 63.28  ? -3   DG  I N3    1 
ATOM   7604  C  C4    . DG  I  5 71  ? -31.368 -22.399 81.985 1.00 62.50  ? -3   DG  I C4    1 
ATOM   7605  P  P     . DG  I  5 72  ? -28.586 -18.418 77.642 1.00 69.41  ? -2   DG  I P     1 
ATOM   7606  O  OP1   . DG  I  5 72  ? -28.831 -17.148 76.908 1.00 67.87  ? -2   DG  I OP1   1 
ATOM   7607  O  OP2   . DG  I  5 72  ? -27.771 -19.512 77.056 1.00 68.30  ? -2   DG  I OP2   1 
ATOM   7608  O  "O5'" . DG  I  5 72  ? -27.956 -18.134 79.081 1.00 69.65  ? -2   DG  I "O5'" 1 
ATOM   7609  C  "C5'" . DG  I  5 72  ? -28.567 -17.332 80.077 1.00 70.94  ? -2   DG  I "C5'" 1 
ATOM   7610  C  "C4'" . DG  I  5 72  ? -27.943 -17.704 81.412 1.00 72.77  ? -2   DG  I "C4'" 1 
ATOM   7611  O  "O4'" . DG  I  5 72  ? -28.384 -19.025 81.834 1.00 73.17  ? -2   DG  I "O4'" 1 
ATOM   7612  C  "C3'" . DG  I  5 72  ? -26.416 -17.790 81.426 1.00 73.47  ? -2   DG  I "C3'" 1 
ATOM   7613  O  "O3'" . DG  I  5 72  ? -25.980 -17.258 82.639 1.00 75.30  ? -2   DG  I "O3'" 1 
ATOM   7614  C  "C2'" . DG  I  5 72  ? -26.106 -19.281 81.409 1.00 72.68  ? -2   DG  I "C2'" 1 
ATOM   7615  C  "C1'" . DG  I  5 72  ? -27.253 -19.731 82.298 1.00 72.78  ? -2   DG  I "C1'" 1 
ATOM   7616  N  N9    . DG  I  5 72  ? -27.510 -21.165 82.345 1.00 72.67  ? -2   DG  I N9    1 
ATOM   7617  C  C8    . DG  I  5 72  ? -27.305 -22.141 81.394 1.00 72.94  ? -2   DG  I C8    1 
ATOM   7618  N  N7    . DG  I  5 72  ? -27.638 -23.336 81.797 1.00 72.65  ? -2   DG  I N7    1 
ATOM   7619  C  C5    . DG  I  5 72  ? -28.089 -23.128 83.095 1.00 72.53  ? -2   DG  I C5    1 
ATOM   7620  C  C6    . DG  I  5 72  ? -28.589 -24.034 84.064 1.00 72.97  ? -2   DG  I C6    1 
ATOM   7621  O  O6    . DG  I  5 72  ? -28.748 -25.259 83.967 1.00 72.96  ? -2   DG  I O6    1 
ATOM   7622  N  N1    . DG  I  5 72  ? -28.928 -23.394 85.259 1.00 73.17  ? -2   DG  I N1    1 
ATOM   7623  C  C2    . DG  I  5 72  ? -28.799 -22.043 85.486 1.00 73.02  ? -2   DG  I C2    1 
ATOM   7624  N  N2    . DG  I  5 72  ? -29.179 -21.587 86.685 1.00 72.87  ? -2   DG  I N2    1 
ATOM   7625  N  N3    . DG  I  5 72  ? -28.334 -21.189 84.589 1.00 72.81  ? -2   DG  I N3    1 
ATOM   7626  C  C4    . DG  I  5 72  ? -28.010 -21.802 83.433 1.00 72.24  ? -2   DG  I C4    1 
ATOM   7627  P  P     . DA  I  5 73  ? -24.831 -16.171 82.665 1.00 75.99  ? -1   DA  I P     1 
ATOM   7628  O  OP1   . DA  I  5 73  ? -25.318 -15.050 81.831 1.00 75.46  ? -1   DA  I OP1   1 
ATOM   7629  O  OP2   . DA  I  5 73  ? -23.562 -16.889 82.382 1.00 75.69  ? -1   DA  I OP2   1 
ATOM   7630  O  "O5'" . DA  I  5 73  ? -24.807 -15.694 84.195 1.00 77.72  ? -1   DA  I "O5'" 1 
ATOM   7631  C  "C5'" . DA  I  5 73  ? -25.946 -15.920 85.032 1.00 79.79  ? -1   DA  I "C5'" 1 
ATOM   7632  C  "C4'" . DA  I  5 73  ? -25.572 -16.618 86.331 1.00 81.40  ? -1   DA  I "C4'" 1 
ATOM   7633  O  "O4'" . DA  I  5 73  ? -25.974 -18.011 86.352 1.00 81.24  ? -1   DA  I "O4'" 1 
ATOM   7634  C  "C3'" . DA  I  5 73  ? -24.091 -16.634 86.685 1.00 82.86  ? -1   DA  I "C3'" 1 
ATOM   7635  O  "O3'" . DA  I  5 73  ? -24.076 -16.478 88.070 1.00 85.44  ? -1   DA  I "O3'" 1 
ATOM   7636  C  "C2'" . DA  I  5 73  ? -23.622 -18.033 86.319 1.00 81.92  ? -1   DA  I "C2'" 1 
ATOM   7637  C  "C1'" . DA  I  5 73  ? -24.863 -18.802 86.740 1.00 81.98  ? -1   DA  I "C1'" 1 
ATOM   7638  N  N9    . DA  I  5 73  ? -25.002 -20.083 86.071 1.00 82.31  ? -1   DA  I N9    1 
ATOM   7639  C  C8    . DA  I  5 73  ? -24.858 -20.326 84.736 1.00 82.35  ? -1   DA  I C8    1 
ATOM   7640  N  N7    . DA  I  5 73  ? -25.051 -21.581 84.409 1.00 82.49  ? -1   DA  I N7    1 
ATOM   7641  C  C5    . DA  I  5 73  ? -25.343 -22.199 85.608 1.00 81.97  ? -1   DA  I C5    1 
ATOM   7642  C  C6    . DA  I  5 73  ? -25.642 -23.529 85.938 1.00 81.63  ? -1   DA  I C6    1 
ATOM   7643  N  N6    . DA  I  5 73  ? -25.698 -24.507 85.041 1.00 81.62  ? -1   DA  I N6    1 
ATOM   7644  N  N1    . DA  I  5 73  ? -25.880 -23.818 87.235 1.00 82.33  ? -1   DA  I N1    1 
ATOM   7645  C  C2    . DA  I  5 73  ? -25.826 -22.841 88.153 1.00 82.30  ? -1   DA  I C2    1 
ATOM   7646  N  N3    . DA  I  5 73  ? -25.553 -21.549 87.959 1.00 82.57  ? -1   DA  I N3    1 
ATOM   7647  C  C4    . DA  I  5 73  ? -25.319 -21.291 86.652 1.00 82.50  ? -1   DA  I C4    1 
ATOM   7648  P  P     . DA  I  5 74  ? -22.843 -15.816 88.819 1.00 86.31  ? 0    DA  I P     1 
ATOM   7649  O  OP1   . DA  I  5 74  ? -23.352 -14.659 89.588 1.00 86.38  ? 0    DA  I OP1   1 
ATOM   7650  O  OP2   . DA  I  5 74  ? -21.726 -15.662 87.852 1.00 86.03  ? 0    DA  I OP2   1 
ATOM   7651  O  "O5'" . DA  I  5 74  ? -22.529 -16.989 89.845 1.00 87.05  ? 0    DA  I "O5'" 1 
ATOM   7652  C  "C5'" . DA  I  5 74  ? -23.610 -17.532 90.581 1.00 89.34  ? 0    DA  I "C5'" 1 
ATOM   7653  C  "C4'" . DA  I  5 74  ? -23.167 -18.782 91.312 1.00 91.24  ? 0    DA  I "C4'" 1 
ATOM   7654  O  "O4'" . DA  I  5 74  ? -23.396 -19.944 90.479 1.00 92.29  ? 0    DA  I "O4'" 1 
ATOM   7655  C  "C3'" . DA  I  5 74  ? -21.692 -18.819 91.696 1.00 91.77  ? 0    DA  I "C3'" 1 
ATOM   7656  O  "O3'" . DA  I  5 74  ? -21.611 -19.296 93.025 1.00 91.86  ? 0    DA  I "O3'" 1 
ATOM   7657  C  "C2'" . DA  I  5 74  ? -21.060 -19.783 90.694 1.00 92.26  ? 0    DA  I "C2'" 1 
ATOM   7658  C  "C1'" . DA  I  5 74  ? -22.221 -20.730 90.451 1.00 92.85  ? 0    DA  I "C1'" 1 
ATOM   7659  N  N9    . DA  I  5 74  ? -22.158 -21.366 89.147 1.00 93.20  ? 0    DA  I N9    1 
ATOM   7660  C  C8    . DA  I  5 74  ? -21.841 -20.792 87.942 1.00 93.34  ? 0    DA  I C8    1 
ATOM   7661  N  N7    . DA  I  5 74  ? -21.877 -21.631 86.934 1.00 93.23  ? 0    DA  I N7    1 
ATOM   7662  C  C5    . DA  I  5 74  ? -22.251 -22.828 87.525 1.00 93.27  ? 0    DA  I C5    1 
ATOM   7663  C  C6    . DA  I  5 74  ? -22.467 -24.119 87.007 1.00 93.17  ? 0    DA  I C6    1 
ATOM   7664  N  N6    . DA  I  5 74  ? -22.323 -24.402 85.713 1.00 93.23  ? 0    DA  I N6    1 
ATOM   7665  N  N1    . DA  I  5 74  ? -22.829 -25.100 87.868 1.00 93.29  ? 0    DA  I N1    1 
ATOM   7666  C  C2    . DA  I  5 74  ? -22.967 -24.808 89.171 1.00 93.34  ? 0    DA  I C2    1 
ATOM   7667  N  N3    . DA  I  5 74  ? -22.791 -23.630 89.777 1.00 93.30  ? 0    DA  I N3    1 
ATOM   7668  C  C4    . DA  I  5 74  ? -22.430 -22.682 88.890 1.00 93.22  ? 0    DA  I C4    1 
ATOM   7669  P  P     . DT  I  5 75  ? -20.211 -19.568 93.746 1.00 91.53  ? 1    DT  I P     1 
ATOM   7670  O  OP1   . DT  I  5 75  ? -20.427 -19.219 95.174 1.00 91.57  ? 1    DT  I OP1   1 
ATOM   7671  O  OP2   . DT  I  5 75  ? -19.108 -18.938 92.971 1.00 90.53  ? 1    DT  I OP2   1 
ATOM   7672  O  "O5'" . DT  I  5 75  ? -20.079 -21.153 93.590 1.00 89.67  ? 1    DT  I "O5'" 1 
ATOM   7673  C  "C5'" . DT  I  5 75  ? -20.948 -21.994 94.318 1.00 88.56  ? 1    DT  I "C5'" 1 
ATOM   7674  C  "C4'" . DT  I  5 75  ? -20.452 -23.399 94.131 1.00 88.43  ? 1    DT  I "C4'" 1 
ATOM   7675  O  "O4'" . DT  I  5 75  ? -20.590 -23.750 92.738 1.00 88.58  ? 1    DT  I "O4'" 1 
ATOM   7676  C  "C3'" . DT  I  5 75  ? -18.973 -23.527 94.439 1.00 88.80  ? 1    DT  I "C3'" 1 
ATOM   7677  O  "O3'" . DT  I  5 75  ? -18.821 -24.492 95.454 1.00 89.68  ? 1    DT  I "O3'" 1 
ATOM   7678  C  "C2'" . DT  I  5 75  ? -18.305 -23.931 93.120 1.00 88.62  ? 1    DT  I "C2'" 1 
ATOM   7679  C  "C1'" . DT  I  5 75  ? -19.474 -24.530 92.350 1.00 88.16  ? 1    DT  I "C1'" 1 
ATOM   7680  N  N1    . DT  I  5 75  ? -19.352 -24.488 90.843 1.00 87.67  ? 1    DT  I N1    1 
ATOM   7681  C  C2    . DT  I  5 75  ? -19.636 -25.620 90.088 1.00 87.29  ? 1    DT  I C2    1 
ATOM   7682  O  O2    . DT  I  5 75  ? -19.980 -26.697 90.548 1.00 87.49  ? 1    DT  I O2    1 
ATOM   7683  N  N3    . DT  I  5 75  ? -19.501 -25.450 88.736 1.00 86.68  ? 1    DT  I N3    1 
ATOM   7684  C  C4    . DT  I  5 75  ? -19.128 -24.299 88.071 1.00 87.36  ? 1    DT  I C4    1 
ATOM   7685  O  O4    . DT  I  5 75  ? -19.040 -24.252 86.847 1.00 87.58  ? 1    DT  I O4    1 
ATOM   7686  C  C5    . DT  I  5 75  ? -18.848 -23.157 88.910 1.00 87.61  ? 1    DT  I C5    1 
ATOM   7687  C  C7    . DT  I  5 75  ? -18.429 -21.849 88.297 1.00 87.93  ? 1    DT  I C7    1 
ATOM   7688  C  C6    . DT  I  5 75  ? -18.975 -23.303 90.237 1.00 87.53  ? 1    DT  I C6    1 
ATOM   7689  P  P     . DC  I  5 76  ? -17.356 -24.762 96.038 1.00 90.95  ? 2    DC  I P     1 
ATOM   7690  O  OP1   . DC  I  5 76  ? -17.483 -25.190 97.453 1.00 91.18  ? 2    DC  I OP1   1 
ATOM   7691  O  OP2   . DC  I  5 76  ? -16.489 -23.607 95.685 1.00 90.34  ? 2    DC  I OP2   1 
ATOM   7692  O  "O5'" . DC  I  5 76  ? -16.912 -26.037 95.177 1.00 90.36  ? 2    DC  I "O5'" 1 
ATOM   7693  C  "C5'" . DC  I  5 76  ? -17.768 -27.176 95.175 1.00 89.41  ? 2    DC  I "C5'" 1 
ATOM   7694  C  "C4'" . DC  I  5 76  ? -17.281 -28.259 94.232 1.00 88.67  ? 2    DC  I "C4'" 1 
ATOM   7695  O  "O4'" . DC  I  5 76  ? -17.493 -27.868 92.851 1.00 88.32  ? 2    DC  I "O4'" 1 
ATOM   7696  C  "C3'" . DC  I  5 76  ? -15.808 -28.606 94.367 1.00 88.01  ? 2    DC  I "C3'" 1 
ATOM   7697  O  "O3'" . DC  I  5 76  ? -15.731 -29.996 94.568 1.00 87.77  ? 2    DC  I "O3'" 1 
ATOM   7698  C  "C2'" . DC  I  5 76  ? -15.199 -28.209 93.025 1.00 88.07  ? 2    DC  I "C2'" 1 
ATOM   7699  C  "C1'" . DC  I  5 76  ? -16.400 -28.334 92.090 1.00 87.77  ? 2    DC  I "C1'" 1 
ATOM   7700  N  N1    . DC  I  5 76  ? -16.314 -27.509 90.842 1.00 87.61  ? 2    DC  I N1    1 
ATOM   7701  C  C2    . DC  I  5 76  ? -16.609 -28.063 89.569 1.00 87.55  ? 2    DC  I C2    1 
ATOM   7702  O  O2    . DC  I  5 76  ? -16.942 -29.255 89.440 1.00 86.94  ? 2    DC  I O2    1 
ATOM   7703  N  N3    . DC  I  5 76  ? -16.512 -27.248 88.481 1.00 87.29  ? 2    DC  I N3    1 
ATOM   7704  C  C4    . DC  I  5 76  ? -16.150 -25.967 88.626 1.00 87.30  ? 2    DC  I C4    1 
ATOM   7705  N  N4    . DC  I  5 76  ? -16.062 -25.211 87.535 1.00 87.22  ? 2    DC  I N4    1 
ATOM   7706  C  C5    . DC  I  5 76  ? -15.853 -25.393 89.897 1.00 87.33  ? 2    DC  I C5    1 
ATOM   7707  C  C6    . DC  I  5 76  ? -15.948 -26.193 90.965 1.00 87.44  ? 2    DC  I C6    1 
ATOM   7708  P  P     . DC  I  5 77  ? -14.459 -30.591 95.320 1.00 88.15  ? 3    DC  I P     1 
ATOM   7709  O  OP1   . DC  I  5 77  ? -14.977 -31.575 96.301 1.00 88.14  ? 3    DC  I OP1   1 
ATOM   7710  O  OP2   . DC  I  5 77  ? -13.607 -29.441 95.718 1.00 87.61  ? 3    DC  I OP2   1 
ATOM   7711  O  "O5'" . DC  I  5 77  ? -13.648 -31.384 94.189 1.00 87.36  ? 3    DC  I "O5'" 1 
ATOM   7712  C  "C5'" . DC  I  5 77  ? -14.076 -32.639 93.643 1.00 85.35  ? 3    DC  I "C5'" 1 
ATOM   7713  C  "C4'" . DC  I  5 77  ? -13.434 -32.832 92.277 1.00 83.74  ? 3    DC  I "C4'" 1 
ATOM   7714  O  "O4'" . DC  I  5 77  ? -13.762 -31.710 91.410 1.00 83.06  ? 3    DC  I "O4'" 1 
ATOM   7715  C  "C3'" . DC  I  5 77  ? -11.904 -32.902 92.287 1.00 82.87  ? 3    DC  I "C3'" 1 
ATOM   7716  O  "O3'" . DC  I  5 77  ? -11.502 -33.973 91.476 1.00 82.91  ? 3    DC  I "O3'" 1 
ATOM   7717  C  "C2'" . DC  I  5 77  ? -11.453 -31.600 91.642 1.00 82.40  ? 3    DC  I "C2'" 1 
ATOM   7718  C  "C1'" . DC  I  5 77  ? -12.599 -31.420 90.652 1.00 81.76  ? 3    DC  I "C1'" 1 
ATOM   7719  N  N1    . DC  I  5 77  ? -12.683 -30.061 90.042 1.00 81.30  ? 3    DC  I N1    1 
ATOM   7720  C  C2    . DC  I  5 77  ? -12.978 -29.904 88.669 1.00 80.65  ? 3    DC  I C2    1 
ATOM   7721  O  O2    . DC  I  5 77  ? -13.176 -30.896 87.950 1.00 79.84  ? 3    DC  I O2    1 
ATOM   7722  N  N3    . DC  I  5 77  ? -13.037 -28.640 88.167 1.00 79.94  ? 3    DC  I N3    1 
ATOM   7723  C  C4    . DC  I  5 77  ? -12.816 -27.589 88.968 1.00 80.06  ? 3    DC  I C4    1 
ATOM   7724  N  N4    . DC  I  5 77  ? -12.880 -26.368 88.445 1.00 80.47  ? 3    DC  I N4    1 
ATOM   7725  C  C5    . DC  I  5 77  ? -12.520 -27.728 90.354 1.00 80.06  ? 3    DC  I C5    1 
ATOM   7726  C  C6    . DC  I  5 77  ? -12.463 -28.971 90.842 1.00 80.86  ? 3    DC  I C6    1 
ATOM   7727  P  P     . DA  I  5 78  ? -10.991 -35.320 92.150 1.00 82.65  ? 4    DA  I P     1 
ATOM   7728  O  OP1   . DA  I  5 78  ? -12.025 -35.694 93.144 1.00 83.18  ? 4    DA  I OP1   1 
ATOM   7729  O  OP2   . DA  I  5 78  ? -9.564  -35.099 92.494 1.00 82.37  ? 4    DA  I OP2   1 
ATOM   7730  O  "O5'" . DA  I  5 78  ? -11.055 -36.451 91.024 1.00 82.21  ? 4    DA  I "O5'" 1 
ATOM   7731  C  "C5'" . DA  I  5 78  ? -12.168 -36.535 90.142 1.00 81.38  ? 4    DA  I "C5'" 1 
ATOM   7732  C  "C4'" . DA  I  5 78  ? -11.695 -36.348 88.709 1.00 80.56  ? 4    DA  I "C4'" 1 
ATOM   7733  O  "O4'" . DA  I  5 78  ? -11.439 -34.958 88.402 1.00 80.24  ? 4    DA  I "O4'" 1 
ATOM   7734  C  "C3'" . DA  I  5 78  ? -10.408 -37.069 88.355 1.00 79.91  ? 4    DA  I "C3'" 1 
ATOM   7735  O  "O3'" . DA  I  5 78  ? -10.683 -37.594 87.110 1.00 80.61  ? 4    DA  I "O3'" 1 
ATOM   7736  C  "C2'" . DA  I  5 78  ? -9.336  -35.983 88.278 1.00 79.34  ? 4    DA  I "C2'" 1 
ATOM   7737  C  "C1'" . DA  I  5 78  ? -10.172 -34.815 87.789 1.00 80.05  ? 4    DA  I "C1'" 1 
ATOM   7738  N  N9    . DA  I  5 78  ? -9.715  -33.489 88.170 1.00 80.17  ? 4    DA  I N9    1 
ATOM   7739  C  C8    . DA  I  5 78  ? -9.084  -33.112 89.322 1.00 80.30  ? 4    DA  I C8    1 
ATOM   7740  N  N7    . DA  I  5 78  ? -8.821  -31.829 89.385 1.00 80.44  ? 4    DA  I N7    1 
ATOM   7741  C  C5    . DA  I  5 78  ? -9.325  -31.334 88.198 1.00 80.44  ? 4    DA  I C5    1 
ATOM   7742  C  C6    . DA  I  5 78  ? -9.357  -30.039 87.649 1.00 80.43  ? 4    DA  I C6    1 
ATOM   7743  N  N6    . DA  I  5 78  ? -8.846  -28.981 88.277 1.00 80.25  ? 4    DA  I N6    1 
ATOM   7744  N  N1    . DA  I  5 78  ? -9.925  -29.872 86.433 1.00 80.34  ? 4    DA  I N1    1 
ATOM   7745  C  C2    . DA  I  5 78  ? -10.429 -30.945 85.812 1.00 80.29  ? 4    DA  I C2    1 
ATOM   7746  N  N3    . DA  I  5 78  ? -10.463 -32.211 86.226 1.00 80.28  ? 4    DA  I N3    1 
ATOM   7747  C  C4    . DA  I  5 78  ? -9.884  -32.340 87.436 1.00 80.45  ? 4    DA  I C4    1 
ATOM   7748  P  P     . DG  I  5 79  ? -9.703  -38.669 86.488 1.00 81.56  ? 5    DG  I P     1 
ATOM   7749  O  OP1   . DG  I  5 79  ? -10.564 -39.755 85.973 1.00 81.60  ? 5    DG  I OP1   1 
ATOM   7750  O  OP2   . DG  I  5 79  ? -8.603  -38.911 87.458 1.00 80.29  ? 5    DG  I OP2   1 
ATOM   7751  O  "O5'" . DG  I  5 79  ? -9.082  -37.924 85.212 1.00 82.36  ? 5    DG  I "O5'" 1 
ATOM   7752  C  "C5'" . DG  I  5 79  ? -9.833  -37.264 84.175 1.00 81.49  ? 5    DG  I "C5'" 1 
ATOM   7753  C  "C4'" . DG  I  5 79  ? -8.841  -36.386 83.430 1.00 81.13  ? 5    DG  I "C4'" 1 
ATOM   7754  O  "O4'" . DG  I  5 79  ? -8.515  -35.247 84.266 1.00 81.67  ? 5    DG  I "O4'" 1 
ATOM   7755  C  "C3'" . DG  I  5 79  ? -7.482  -37.038 83.109 1.00 80.59  ? 5    DG  I "C3'" 1 
ATOM   7756  O  "O3'" . DG  I  5 79  ? -7.035  -36.682 81.791 1.00 78.86  ? 5    DG  I "O3'" 1 
ATOM   7757  C  "C2'" . DG  I  5 79  ? -6.525  -36.478 84.164 1.00 81.04  ? 5    DG  I "C2'" 1 
ATOM   7758  C  "C1'" . DG  I  5 79  ? -7.108  -35.077 84.260 1.00 82.00  ? 5    DG  I "C1'" 1 
ATOM   7759  N  N9    . DG  I  5 79  ? -6.748  -34.289 85.427 1.00 82.14  ? 5    DG  I N9    1 
ATOM   7760  C  C8    . DG  I  5 79  ? -6.402  -34.719 86.684 1.00 82.27  ? 5    DG  I C8    1 
ATOM   7761  N  N7    . DG  I  5 79  ? -6.150  -33.736 87.505 1.00 82.34  ? 5    DG  I N7    1 
ATOM   7762  C  C5    . DG  I  5 79  ? -6.348  -32.591 86.741 1.00 82.22  ? 5    DG  I C5    1 
ATOM   7763  C  C6    . DG  I  5 79  ? -6.232  -31.218 87.078 1.00 82.10  ? 5    DG  I C6    1 
ATOM   7764  O  O6    . DG  I  5 79  ? -5.917  -30.710 88.157 1.00 82.31  ? 5    DG  I O6    1 
ATOM   7765  N  N1    . DG  I  5 79  ? -6.521  -30.378 86.009 1.00 82.36  ? 5    DG  I N1    1 
ATOM   7766  C  C2    . DG  I  5 79  ? -6.887  -30.803 84.754 1.00 82.63  ? 5    DG  I C2    1 
ATOM   7767  N  N2    . DG  I  5 79  ? -7.125  -29.829 83.860 1.00 82.34  ? 5    DG  I N2    1 
ATOM   7768  N  N3    . DG  I  5 79  ? -7.004  -32.089 84.418 1.00 82.53  ? 5    DG  I N3    1 
ATOM   7769  C  C4    . DG  I  5 79  ? -6.718  -32.918 85.457 1.00 82.20  ? 5    DG  I C4    1 
ATOM   7770  P  P     . DC  I  5 80  ? -7.384  -37.570 80.502 1.00 77.05  ? 6    DC  I P     1 
ATOM   7771  O  OP1   . DC  I  5 80  ? -8.687  -38.271 80.691 1.00 76.50  ? 6    DC  I OP1   1 
ATOM   7772  O  OP2   . DC  I  5 80  ? -6.132  -38.281 80.137 1.00 76.09  ? 6    DC  I OP2   1 
ATOM   7773  O  "O5'" . DC  I  5 80  ? -7.627  -36.479 79.367 1.00 74.59  ? 6    DC  I "O5'" 1 
ATOM   7774  C  "C5'" . DC  I  5 80  ? -8.777  -35.645 79.309 1.00 69.21  ? 6    DC  I "C5'" 1 
ATOM   7775  C  "C4'" . DC  I  5 80  ? -8.219  -34.280 79.001 1.00 65.04  ? 6    DC  I "C4'" 1 
ATOM   7776  O  "O4'" . DC  I  5 80  ? -7.463  -33.866 80.157 1.00 64.61  ? 6    DC  I "O4'" 1 
ATOM   7777  C  "C3'" . DC  I  5 80  ? -7.231  -34.211 77.838 1.00 62.73  ? 6    DC  I "C3'" 1 
ATOM   7778  O  "O3'" . DC  I  5 80  ? -7.494  -32.985 77.185 1.00 60.58  ? 6    DC  I "O3'" 1 
ATOM   7779  C  "C2'" . DC  I  5 80  ? -5.857  -34.210 78.512 1.00 63.26  ? 6    DC  I "C2'" 1 
ATOM   7780  C  "C1'" . DC  I  5 80  ? -6.210  -33.364 79.728 1.00 65.02  ? 6    DC  I "C1'" 1 
ATOM   7781  N  N1    . DC  I  5 80  ? -5.320  -33.318 80.942 1.00 65.60  ? 6    DC  I N1    1 
ATOM   7782  C  C2    . DC  I  5 80  ? -5.179  -32.089 81.611 1.00 65.32  ? 6    DC  I C2    1 
ATOM   7783  O  O2    . DC  I  5 80  ? -5.743  -31.083 81.178 1.00 65.00  ? 6    DC  I O2    1 
ATOM   7784  N  N3    . DC  I  5 80  ? -4.415  -32.026 82.725 1.00 65.34  ? 6    DC  I N3    1 
ATOM   7785  C  C4    . DC  I  5 80  ? -3.814  -33.121 83.182 1.00 65.36  ? 6    DC  I C4    1 
ATOM   7786  N  N4    . DC  I  5 80  ? -3.070  -32.986 84.278 1.00 65.39  ? 6    DC  I N4    1 
ATOM   7787  C  C5    . DC  I  5 80  ? -3.946  -34.389 82.534 1.00 65.37  ? 6    DC  I C5    1 
ATOM   7788  C  C6    . DC  I  5 80  ? -4.709  -34.445 81.431 1.00 65.66  ? 6    DC  I C6    1 
ATOM   7789  P  P     . DT  I  5 81  ? -7.463  -32.763 75.603 1.00 58.66  ? 7    DT  I P     1 
ATOM   7790  O  OP1   . DT  I  5 81  ? -8.826  -32.341 75.211 1.00 57.57  ? 7    DT  I OP1   1 
ATOM   7791  O  OP2   . DT  I  5 81  ? -6.792  -33.908 74.950 1.00 57.87  ? 7    DT  I OP2   1 
ATOM   7792  O  "O5'" . DT  I  5 81  ? -6.455  -31.532 75.464 1.00 58.42  ? 7    DT  I "O5'" 1 
ATOM   7793  C  "C5'" . DT  I  5 81  ? -6.600  -30.397 76.309 1.00 58.04  ? 7    DT  I "C5'" 1 
ATOM   7794  C  "C4'" . DT  I  5 81  ? -5.262  -29.802 76.694 1.00 57.57  ? 7    DT  I "C4'" 1 
ATOM   7795  O  "O4'" . DT  I  5 81  ? -4.729  -30.523 77.833 1.00 58.64  ? 7    DT  I "O4'" 1 
ATOM   7796  C  "C3'" . DT  I  5 81  ? -4.176  -29.760 75.615 1.00 57.08  ? 7    DT  I "C3'" 1 
ATOM   7797  O  "O3'" . DT  I  5 81  ? -3.744  -28.415 75.471 1.00 55.18  ? 7    DT  I "O3'" 1 
ATOM   7798  C  "C2'" . DT  I  5 81  ? -3.075  -30.630 76.210 1.00 58.49  ? 7    DT  I "C2'" 1 
ATOM   7799  C  "C1'" . DT  I  5 81  ? -3.324  -30.497 77.711 1.00 60.18  ? 7    DT  I "C1'" 1 
ATOM   7800  N  N1    . DT  I  5 81  ? -2.714  -31.572 78.569 1.00 60.33  ? 7    DT  I N1    1 
ATOM   7801  C  C2    . DT  I  5 81  ? -2.349  -31.286 79.863 1.00 60.56  ? 7    DT  I C2    1 
ATOM   7802  O  O2    . DT  I  5 81  ? -2.483  -30.202 80.390 1.00 60.83  ? 7    DT  I O2    1 
ATOM   7803  N  N3    . DT  I  5 81  ? -1.803  -32.334 80.542 1.00 61.19  ? 7    DT  I N3    1 
ATOM   7804  C  C4    . DT  I  5 81  ? -1.581  -33.616 80.082 1.00 61.08  ? 7    DT  I C4    1 
ATOM   7805  O  O4    . DT  I  5 81  ? -1.078  -34.480 80.794 1.00 60.63  ? 7    DT  I O4    1 
ATOM   7806  C  C5    . DT  I  5 81  ? -1.982  -33.847 78.716 1.00 61.24  ? 7    DT  I C5    1 
ATOM   7807  C  C7    . DT  I  5 81  ? -1.807  -35.191 78.071 1.00 61.13  ? 7    DT  I C7    1 
ATOM   7808  C  C6    . DT  I  5 81  ? -2.520  -32.828 78.040 1.00 60.88  ? 7    DT  I C6    1 
ATOM   7809  P  P     . DG  I  5 82  ? -2.801  -27.844 74.306 1.00 53.13  ? 8    DG  I P     1 
ATOM   7810  O  OP1   . DG  I  5 82  ? -3.640  -26.993 73.444 1.00 54.07  ? 8    DG  I OP1   1 
ATOM   7811  O  OP2   . DG  I  5 82  ? -1.892  -28.851 73.737 1.00 51.36  ? 8    DG  I OP2   1 
ATOM   7812  O  "O5'" . DG  I  5 82  ? -1.900  -26.855 75.153 1.00 54.71  ? 8    DG  I "O5'" 1 
ATOM   7813  C  "C5'" . DG  I  5 82  ? -2.453  -25.991 76.147 1.00 55.08  ? 8    DG  I "C5'" 1 
ATOM   7814  C  "C4'" . DG  I  5 82  ? -1.303  -25.420 76.957 1.00 55.05  ? 8    DG  I "C4'" 1 
ATOM   7815  O  "O4'" . DG  I  5 82  ? -0.779  -26.439 77.832 1.00 55.47  ? 8    DG  I "O4'" 1 
ATOM   7816  C  "C3'" . DG  I  5 82  ? -0.111  -24.936 76.152 1.00 54.42  ? 8    DG  I "C3'" 1 
ATOM   7817  O  "O3'" . DG  I  5 82  ? 0.408   -23.836 76.833 1.00 54.18  ? 8    DG  I "O3'" 1 
ATOM   7818  C  "C2'" . DG  I  5 82  ? 0.856   -26.116 76.161 1.00 55.50  ? 8    DG  I "C2'" 1 
ATOM   7819  C  "C1'" . DG  I  5 82  ? 0.550   -26.763 77.494 1.00 58.72  ? 8    DG  I "C1'" 1 
ATOM   7820  N  N9    . DG  I  5 82  ? 0.550   -28.212 77.511 1.00 59.93  ? 8    DG  I N9    1 
ATOM   7821  C  C8    . DG  I  5 82  ? 0.009   -29.096 76.606 1.00 61.01  ? 8    DG  I C8    1 
ATOM   7822  N  N7    . DG  I  5 82  ? 0.153   -30.358 76.928 1.00 60.57  ? 8    DG  I N7    1 
ATOM   7823  C  C5    . DG  I  5 82  ? 0.821   -30.293 78.132 1.00 60.42  ? 8    DG  I C5    1 
ATOM   7824  C  C6    . DG  I  5 82  ? 1.251   -31.336 78.970 1.00 60.58  ? 8    DG  I C6    1 
ATOM   7825  O  O6    . DG  I  5 82  ? 1.112   -32.552 78.788 1.00 60.85  ? 8    DG  I O6    1 
ATOM   7826  N  N1    . DG  I  5 82  ? 1.897   -30.848 80.108 1.00 60.84  ? 8    DG  I N1    1 
ATOM   7827  C  C2    . DG  I  5 82  ? 2.089   -29.505 80.388 1.00 60.83  ? 8    DG  I C2    1 
ATOM   7828  N  N2    . DG  I  5 82  ? 2.727   -29.208 81.526 1.00 60.84  ? 8    DG  I N2    1 
ATOM   7829  N  N3    . DG  I  5 82  ? 1.689   -28.513 79.607 1.00 60.82  ? 8    DG  I N3    1 
ATOM   7830  C  C4    . DG  I  5 82  ? 1.066   -28.987 78.505 1.00 60.50  ? 8    DG  I C4    1 
ATOM   7831  P  P     . DA  I  5 83  ? 1.652   -23.002 76.281 1.00 55.12  ? 9    DA  I P     1 
ATOM   7832  O  OP1   . DA  I  5 83  ? 1.343   -21.563 76.474 1.00 55.05  ? 9    DA  I OP1   1 
ATOM   7833  O  OP2   . DA  I  5 83  ? 2.089   -23.515 74.966 1.00 55.08  ? 9    DA  I OP2   1 
ATOM   7834  O  "O5'" . DA  I  5 83  ? 2.823   -23.474 77.247 1.00 57.08  ? 9    DA  I "O5'" 1 
ATOM   7835  C  "C5'" . DA  I  5 83  ? 2.822   -23.275 78.650 1.00 58.84  ? 9    DA  I "C5'" 1 
ATOM   7836  C  "C4'" . DA  I  5 83  ? 4.134   -23.794 79.218 1.00 60.24  ? 9    DA  I "C4'" 1 
ATOM   7837  O  "O4'" . DA  I  5 83  ? 4.145   -25.242 79.233 1.00 61.30  ? 9    DA  I "O4'" 1 
ATOM   7838  C  "C3'" . DA  I  5 83  ? 5.382   -23.375 78.449 1.00 60.56  ? 9    DA  I "C3'" 1 
ATOM   7839  O  "O3'" . DA  I  5 83  ? 6.274   -22.852 79.405 1.00 60.01  ? 9    DA  I "O3'" 1 
ATOM   7840  C  "C2'" . DA  I  5 83  ? 5.877   -24.660 77.769 1.00 61.72  ? 9    DA  I "C2'" 1 
ATOM   7841  C  "C1'" . DA  I  5 83  ? 5.369   -25.739 78.713 1.00 63.26  ? 9    DA  I "C1'" 1 
ATOM   7842  N  N9    . DA  I  5 83  ? 4.969   -27.021 78.151 1.00 63.98  ? 9    DA  I N9    1 
ATOM   7843  C  C8    . DA  I  5 83  ? 4.313   -27.244 76.973 1.00 64.86  ? 9    DA  I C8    1 
ATOM   7844  N  N7    . DA  I  5 83  ? 4.039   -28.510 76.748 1.00 65.30  ? 9    DA  I N7    1 
ATOM   7845  C  C5    . DA  I  5 83  ? 4.531   -29.161 77.867 1.00 64.83  ? 9    DA  I C5    1 
ATOM   7846  C  C6    . DA  I  5 83  ? 4.549   -30.515 78.256 1.00 64.03  ? 9    DA  I C6    1 
ATOM   7847  N  N6    . DA  I  5 83  ? 4.037   -31.487 77.509 1.00 64.39  ? 9    DA  I N6    1 
ATOM   7848  N  N1    . DA  I  5 83  ? 5.114   -30.844 79.437 1.00 64.26  ? 9    DA  I N1    1 
ATOM   7849  C  C2    . DA  I  5 83  ? 5.632   -29.872 80.194 1.00 64.78  ? 9    DA  I C2    1 
ATOM   7850  N  N3    . DA  I  5 83  ? 5.672   -28.559 79.935 1.00 65.74  ? 9    DA  I N3    1 
ATOM   7851  C  C4    . DA  I  5 83  ? 5.102   -28.260 78.746 1.00 65.11  ? 9    DA  I C4    1 
ATOM   7852  P  P     . DA  I  5 84  ? 7.744   -22.345 79.055 1.00 60.54  ? 10   DA  I P     1 
ATOM   7853  O  OP1   . DA  I  5 84  ? 8.081   -21.361 80.115 1.00 60.50  ? 10   DA  I OP1   1 
ATOM   7854  O  OP2   . DA  I  5 84  ? 7.854   -22.001 77.617 1.00 59.33  ? 10   DA  I OP2   1 
ATOM   7855  O  "O5'" . DA  I  5 84  ? 8.606   -23.671 79.267 1.00 62.87  ? 10   DA  I "O5'" 1 
ATOM   7856  C  "C5'" . DA  I  5 84  ? 8.734   -24.264 80.564 1.00 65.49  ? 10   DA  I "C5'" 1 
ATOM   7857  C  "C4'" . DA  I  5 84  ? 9.774   -25.375 80.578 1.00 67.28  ? 10   DA  I "C4'" 1 
ATOM   7858  O  "O4'" . DA  I  5 84  ? 9.201   -26.576 80.020 1.00 68.14  ? 10   DA  I "O4'" 1 
ATOM   7859  C  "C3'" . DA  I  5 84  ? 11.051  -25.148 79.778 1.00 68.41  ? 10   DA  I "C3'" 1 
ATOM   7860  O  "O3'" . DA  I  5 84  ? 12.076  -25.814 80.470 1.00 70.23  ? 10   DA  I "O3'" 1 
ATOM   7861  C  "C2'" . DA  I  5 84  ? 10.762  -25.834 78.445 1.00 68.08  ? 10   DA  I "C2'" 1 
ATOM   7862  C  "C1'" . DA  I  5 84  ? 10.034  -27.052 78.979 1.00 68.72  ? 10   DA  I "C1'" 1 
ATOM   7863  N  N9    . DA  I  5 84  ? 9.148   -27.712 78.039 1.00 69.02  ? 10   DA  I N9    1 
ATOM   7864  C  C8    . DA  I  5 84  ? 8.500   -27.155 76.982 1.00 69.33  ? 10   DA  I C8    1 
ATOM   7865  N  N7    . DA  I  5 84  ? 7.749   -28.010 76.325 1.00 69.90  ? 10   DA  I N7    1 
ATOM   7866  C  C5    . DA  I  5 84  ? 7.911   -29.201 77.006 1.00 69.35  ? 10   DA  I C5    1 
ATOM   7867  C  C6    . DA  I  5 84  ? 7.389   -30.493 76.804 1.00 69.14  ? 10   DA  I C6    1 
ATOM   7868  N  N6    . DA  I  5 84  ? 6.547   -30.809 75.819 1.00 68.83  ? 10   DA  I N6    1 
ATOM   7869  N  N1    . DA  I  5 84  ? 7.761   -31.457 77.666 1.00 69.35  ? 10   DA  I N1    1 
ATOM   7870  C  C2    . DA  I  5 84  ? 8.604   -31.144 78.657 1.00 69.23  ? 10   DA  I C2    1 
ATOM   7871  N  N3    . DA  I  5 84  ? 9.162   -29.971 78.940 1.00 68.76  ? 10   DA  I N3    1 
ATOM   7872  C  C4    . DA  I  5 84  ? 8.771   -29.033 78.069 1.00 69.06  ? 10   DA  I C4    1 
ATOM   7873  P  P     . DC  I  5 85  ? 13.617  -25.484 80.222 1.00 72.58  ? 11   DC  I P     1 
ATOM   7874  O  OP1   . DC  I  5 85  ? 14.032  -24.629 81.353 1.00 72.45  ? 11   DC  I OP1   1 
ATOM   7875  O  OP2   . DC  I  5 85  ? 13.832  -25.021 78.828 1.00 72.52  ? 11   DC  I OP2   1 
ATOM   7876  O  "O5'" . DC  I  5 85  ? 14.304  -26.923 80.351 1.00 73.38  ? 11   DC  I "O5'" 1 
ATOM   7877  C  "C5'" . DC  I  5 85  ? 13.664  -27.998 81.062 1.00 76.05  ? 11   DC  I "C5'" 1 
ATOM   7878  C  "C4'" . DC  I  5 85  ? 14.174  -29.341 80.560 1.00 77.70  ? 11   DC  I "C4'" 1 
ATOM   7879  O  "O4'" . DC  I  5 85  ? 13.205  -30.003 79.695 1.00 78.32  ? 11   DC  I "O4'" 1 
ATOM   7880  C  "C3'" . DC  I  5 85  ? 15.443  -29.227 79.730 1.00 79.23  ? 11   DC  I "C3'" 1 
ATOM   7881  O  "O3'" . DC  I  5 85  ? 16.313  -30.296 80.062 1.00 80.58  ? 11   DC  I "O3'" 1 
ATOM   7882  C  "C2'" . DC  I  5 85  ? 14.938  -29.312 78.290 1.00 79.44  ? 11   DC  I "C2'" 1 
ATOM   7883  C  "C1'" . DC  I  5 85  ? 13.806  -30.318 78.448 1.00 79.29  ? 11   DC  I "C1'" 1 
ATOM   7884  N  N1    . DC  I  5 85  ? 12.799  -30.261 77.336 1.00 79.69  ? 11   DC  I N1    1 
ATOM   7885  C  C2    . DC  I  5 85  ? 12.010  -31.386 77.042 1.00 80.13  ? 11   DC  I C2    1 
ATOM   7886  O  O2    . DC  I  5 85  ? 12.134  -32.429 77.694 1.00 80.33  ? 11   DC  I O2    1 
ATOM   7887  N  N3    . DC  I  5 85  ? 11.107  -31.308 76.034 1.00 80.12  ? 11   DC  I N3    1 
ATOM   7888  C  C4    . DC  I  5 85  ? 10.986  -30.182 75.327 1.00 79.79  ? 11   DC  I C4    1 
ATOM   7889  N  N4    . DC  I  5 85  ? 10.090  -30.177 74.343 1.00 79.78  ? 11   DC  I N4    1 
ATOM   7890  C  C5    . DC  I  5 85  ? 11.777  -29.024 75.593 1.00 79.92  ? 11   DC  I C5    1 
ATOM   7891  C  C6    . DC  I  5 85  ? 12.659  -29.112 76.597 1.00 79.90  ? 11   DC  I C6    1 
ATOM   7892  P  P     . DA  I  5 86  ? 17.839  -30.273 79.582 1.00 81.08  ? 12   DA  I P     1 
ATOM   7893  O  OP1   . DA  I  5 86  ? 18.654  -29.955 80.779 1.00 81.41  ? 12   DA  I OP1   1 
ATOM   7894  O  OP2   . DA  I  5 86  ? 18.001  -29.482 78.338 1.00 80.13  ? 12   DA  I OP2   1 
ATOM   7895  O  "O5'" . DA  I  5 86  ? 18.041  -31.807 79.211 1.00 81.55  ? 12   DA  I "O5'" 1 
ATOM   7896  C  "C5'" . DA  I  5 86  ? 17.210  -32.829 79.744 1.00 83.58  ? 12   DA  I "C5'" 1 
ATOM   7897  C  "C4'" . DA  I  5 86  ? 17.245  -33.985 78.766 1.00 85.14  ? 12   DA  I "C4'" 1 
ATOM   7898  O  "O4'" . DA  I  5 86  ? 16.205  -33.822 77.767 1.00 86.19  ? 12   DA  I "O4'" 1 
ATOM   7899  C  "C3'" . DA  I  5 86  ? 18.558  -34.058 77.997 1.00 85.86  ? 12   DA  I "C3'" 1 
ATOM   7900  O  "O3'" . DA  I  5 86  ? 18.985  -35.405 77.875 1.00 86.31  ? 12   DA  I "O3'" 1 
ATOM   7901  C  "C2'" . DA  I  5 86  ? 18.251  -33.400 76.648 1.00 86.05  ? 12   DA  I "C2'" 1 
ATOM   7902  C  "C1'" . DA  I  5 86  ? 16.769  -33.709 76.469 1.00 86.44  ? 12   DA  I "C1'" 1 
ATOM   7903  N  N9    . DA  I  5 86  ? 16.058  -32.684 75.703 1.00 86.53  ? 12   DA  I N9    1 
ATOM   7904  C  C8    . DA  I  5 86  ? 16.287  -31.332 75.702 1.00 86.86  ? 12   DA  I C8    1 
ATOM   7905  N  N7    . DA  I  5 86  ? 15.492  -30.651 74.910 1.00 86.82  ? 12   DA  I N7    1 
ATOM   7906  C  C5    . DA  I  5 86  ? 14.688  -31.628 74.349 1.00 86.61  ? 12   DA  I C5    1 
ATOM   7907  C  C6    . DA  I  5 86  ? 13.635  -31.567 73.411 1.00 86.57  ? 12   DA  I C6    1 
ATOM   7908  N  N6    . DA  I  5 86  ? 13.203  -30.428 72.870 1.00 86.42  ? 12   DA  I N6    1 
ATOM   7909  N  N1    . DA  I  5 86  ? 13.039  -32.727 73.056 1.00 86.73  ? 12   DA  I N1    1 
ATOM   7910  C  C2    . DA  I  5 86  ? 13.478  -33.869 73.606 1.00 86.79  ? 12   DA  I C2    1 
ATOM   7911  N  N3    . DA  I  5 86  ? 14.456  -34.048 74.496 1.00 86.28  ? 12   DA  I N3    1 
ATOM   7912  C  C4    . DA  I  5 86  ? 15.024  -32.883 74.827 1.00 86.20  ? 12   DA  I C4    1 
ATOM   7913  P  P     . DT  I  5 87  ? 20.399  -35.745 77.189 1.00 86.73  ? 13   DT  I P     1 
ATOM   7914  O  OP1   . DT  I  5 87  ? 21.029  -36.772 78.050 1.00 86.38  ? 13   DT  I OP1   1 
ATOM   7915  O  OP2   . DT  I  5 87  ? 21.131  -34.500 76.807 1.00 85.43  ? 13   DT  I OP2   1 
ATOM   7916  O  "O5'" . DT  I  5 87  ? 19.934  -36.457 75.832 1.00 86.40  ? 13   DT  I "O5'" 1 
ATOM   7917  C  "C5'" . DT  I  5 87  ? 18.832  -37.375 75.777 1.00 84.76  ? 13   DT  I "C5'" 1 
ATOM   7918  C  "C4'" . DT  I  5 87  ? 18.545  -37.704 74.321 1.00 83.82  ? 13   DT  I "C4'" 1 
ATOM   7919  O  "O4'" . DT  I  5 87  ? 17.692  -36.701 73.708 1.00 84.21  ? 13   DT  I "O4'" 1 
ATOM   7920  C  "C3'" . DT  I  5 87  ? 19.782  -37.820 73.433 1.00 82.83  ? 13   DT  I "C3'" 1 
ATOM   7921  O  "O3'" . DT  I  5 87  ? 19.702  -39.128 72.849 1.00 81.14  ? 13   DT  I "O3'" 1 
ATOM   7922  C  "C2'" . DT  I  5 87  ? 19.677  -36.620 72.471 1.00 83.38  ? 13   DT  I "C2'" 1 
ATOM   7923  C  "C1'" . DT  I  5 87  ? 18.169  -36.365 72.415 1.00 84.72  ? 13   DT  I "C1'" 1 
ATOM   7924  N  N1    . DT  I  5 87  ? 17.634  -34.961 72.091 1.00 85.36  ? 13   DT  I N1    1 
ATOM   7925  C  C2    . DT  I  5 87  ? 16.457  -34.827 71.351 1.00 85.03  ? 13   DT  I C2    1 
ATOM   7926  O  O2    . DT  I  5 87  ? 15.810  -35.748 70.903 1.00 85.38  ? 13   DT  I O2    1 
ATOM   7927  N  N3    . DT  I  5 87  ? 16.034  -33.548 71.126 1.00 84.51  ? 13   DT  I N3    1 
ATOM   7928  C  C4    . DT  I  5 87  ? 16.638  -32.388 71.562 1.00 85.17  ? 13   DT  I C4    1 
ATOM   7929  O  O4    . DT  I  5 87  ? 16.156  -31.292 71.296 1.00 85.48  ? 13   DT  I O4    1 
ATOM   7930  C  C5    . DT  I  5 87  ? 17.853  -32.565 72.335 1.00 85.36  ? 13   DT  I C5    1 
ATOM   7931  C  C7    . DT  I  5 87  ? 18.599  -31.373 72.865 1.00 85.03  ? 13   DT  I C7    1 
ATOM   7932  C  C6    . DT  I  5 87  ? 18.283  -33.824 72.563 1.00 85.62  ? 13   DT  I C6    1 
ATOM   7933  P  P     . DG  I  5 88  ? 20.748  -39.727 71.805 1.00 79.68  ? 14   DG  I P     1 
ATOM   7934  O  OP1   . DG  I  5 88  ? 20.712  -41.195 71.954 1.00 78.60  ? 14   DG  I OP1   1 
ATOM   7935  O  OP2   . DG  I  5 88  ? 22.006  -38.954 71.846 1.00 78.99  ? 14   DG  I OP2   1 
ATOM   7936  O  "O5'" . DG  I  5 88  ? 20.090  -39.323 70.416 1.00 81.22  ? 14   DG  I "O5'" 1 
ATOM   7937  C  "C5'" . DG  I  5 88  ? 18.783  -39.715 70.017 1.00 82.18  ? 14   DG  I "C5'" 1 
ATOM   7938  C  "C4'" . DG  I  5 88  ? 18.562  -39.176 68.614 1.00 83.55  ? 14   DG  I "C4'" 1 
ATOM   7939  O  "O4'" . DG  I  5 88  ? 18.252  -37.772 68.755 1.00 84.88  ? 14   DG  I "O4'" 1 
ATOM   7940  C  "C3'" . DG  I  5 88  ? 19.775  -39.254 67.663 1.00 83.15  ? 14   DG  I "C3'" 1 
ATOM   7941  O  "O3'" . DG  I  5 88  ? 19.428  -39.590 66.311 1.00 81.12  ? 14   DG  I "O3'" 1 
ATOM   7942  C  "C2'" . DG  I  5 88  ? 20.355  -37.849 67.701 1.00 84.43  ? 14   DG  I "C2'" 1 
ATOM   7943  C  "C1'" . DG  I  5 88  ? 19.064  -37.066 67.845 1.00 87.39  ? 14   DG  I "C1'" 1 
ATOM   7944  N  N9    . DG  I  5 88  ? 19.229  -35.725 68.362 1.00 88.34  ? 14   DG  I N9    1 
ATOM   7945  C  C8    . DG  I  5 88  ? 20.150  -35.245 69.264 1.00 88.97  ? 14   DG  I C8    1 
ATOM   7946  N  N7    . DG  I  5 88  ? 20.019  -33.973 69.517 1.00 88.92  ? 14   DG  I N7    1 
ATOM   7947  C  C5    . DG  I  5 88  ? 18.942  -33.604 68.730 1.00 88.81  ? 14   DG  I C5    1 
ATOM   7948  C  C6    . DG  I  5 88  ? 18.330  -32.349 68.586 1.00 88.78  ? 14   DG  I C6    1 
ATOM   7949  O  O6    . DG  I  5 88  ? 18.666  -31.300 69.163 1.00 88.87  ? 14   DG  I O6    1 
ATOM   7950  N  N1    . DG  I  5 88  ? 17.250  -32.405 67.684 1.00 88.98  ? 14   DG  I N1    1 
ATOM   7951  C  C2    . DG  I  5 88  ? 16.827  -33.543 67.010 1.00 89.05  ? 14   DG  I C2    1 
ATOM   7952  N  N2    . DG  I  5 88  ? 15.780  -33.438 66.176 1.00 88.81  ? 14   DG  I N2    1 
ATOM   7953  N  N3    . DG  I  5 88  ? 17.400  -34.728 67.148 1.00 89.21  ? 14   DG  I N3    1 
ATOM   7954  C  C4    . DG  I  5 88  ? 18.441  -34.670 68.017 1.00 88.87  ? 14   DG  I C4    1 
ATOM   7955  P  P     . DC  I  5 89  ? 19.095  -41.095 65.866 1.00 79.19  ? 15   DC  I P     1 
ATOM   7956  O  OP1   . DC  I  5 89  ? 18.572  -41.851 67.035 1.00 78.15  ? 15   DC  I OP1   1 
ATOM   7957  O  OP2   . DC  I  5 89  ? 20.246  -41.585 65.079 1.00 78.62  ? 15   DC  I OP2   1 
ATOM   7958  O  "O5'" . DC  I  5 89  ? 17.882  -40.868 64.860 1.00 79.06  ? 15   DC  I "O5'" 1 
ATOM   7959  C  "C5'" . DC  I  5 89  ? 16.604  -40.423 65.348 1.00 79.19  ? 15   DC  I "C5'" 1 
ATOM   7960  C  "C4'" . DC  I  5 89  ? 15.850  -39.671 64.267 1.00 78.67  ? 15   DC  I "C4'" 1 
ATOM   7961  O  "O4'" . DC  I  5 89  ? 16.234  -38.273 64.309 1.00 80.08  ? 15   DC  I "O4'" 1 
ATOM   7962  C  "C3'" . DC  I  5 89  ? 16.141  -40.097 62.840 1.00 78.12  ? 15   DC  I "C3'" 1 
ATOM   7963  O  "O3'" . DC  I  5 89  ? 15.098  -39.644 62.032 1.00 76.57  ? 15   DC  I "O3'" 1 
ATOM   7964  C  "C2'" . DC  I  5 89  ? 17.376  -39.260 62.526 1.00 79.81  ? 15   DC  I "C2'" 1 
ATOM   7965  C  "C1'" . DC  I  5 89  ? 16.927  -37.930 63.119 1.00 81.53  ? 15   DC  I "C1'" 1 
ATOM   7966  N  N1    . DC  I  5 89  ? 17.972  -36.964 63.530 1.00 82.45  ? 15   DC  I N1    1 
ATOM   7967  C  C2    . DC  I  5 89  ? 17.576  -35.631 63.744 1.00 83.38  ? 15   DC  I C2    1 
ATOM   7968  O  O2    . DC  I  5 89  ? 16.394  -35.295 63.564 1.00 83.87  ? 15   DC  I O2    1 
ATOM   7969  N  N3    . DC  I  5 89  ? 18.507  -34.729 64.141 1.00 83.56  ? 15   DC  I N3    1 
ATOM   7970  C  C4    . DC  I  5 89  ? 19.771  -35.121 64.332 1.00 83.31  ? 15   DC  I C4    1 
ATOM   7971  N  N4    . DC  I  5 89  ? 20.638  -34.185 64.726 1.00 83.42  ? 15   DC  I N4    1 
ATOM   7972  C  C5    . DC  I  5 89  ? 20.197  -36.476 64.128 1.00 83.48  ? 15   DC  I C5    1 
ATOM   7973  C  C6    . DC  I  5 89  ? 19.269  -37.359 63.734 1.00 82.73  ? 15   DC  I C6    1 
ATOM   7974  P  P     . DC  I  5 90  ? 13.979  -40.592 61.409 1.00 75.14  ? 16   DC  I P     1 
ATOM   7975  O  OP1   . DC  I  5 90  ? 12.962  -40.869 62.457 1.00 74.79  ? 16   DC  I OP1   1 
ATOM   7976  O  OP2   . DC  I  5 90  ? 14.669  -41.707 60.726 1.00 75.02  ? 16   DC  I OP2   1 
ATOM   7977  O  "O5'" . DC  I  5 90  ? 13.344  -39.655 60.263 1.00 72.94  ? 16   DC  I "O5'" 1 
ATOM   7978  C  "C5'" . DC  I  5 90  ? 12.791  -38.355 60.524 1.00 69.26  ? 16   DC  I "C5'" 1 
ATOM   7979  C  "C4'" . DC  I  5 90  ? 13.313  -37.301 59.560 1.00 67.24  ? 16   DC  I "C4'" 1 
ATOM   7980  O  "O4'" . DC  I  5 90  ? 14.620  -36.830 59.975 1.00 67.53  ? 16   DC  I "O4'" 1 
ATOM   7981  C  "C3'" . DC  I  5 90  ? 13.519  -37.752 58.118 1.00 66.47  ? 16   DC  I "C3'" 1 
ATOM   7982  O  "O3'" . DC  I  5 90  ? 13.179  -36.722 57.192 1.00 64.55  ? 16   DC  I "O3'" 1 
ATOM   7983  C  "C2'" . DC  I  5 90  ? 15.021  -37.974 58.066 1.00 66.83  ? 16   DC  I "C2'" 1 
ATOM   7984  C  "C1'" . DC  I  5 90  ? 15.419  -36.721 58.816 1.00 68.50  ? 16   DC  I "C1'" 1 
ATOM   7985  N  N1    . DC  I  5 90  ? 16.847  -36.639 59.208 1.00 69.75  ? 16   DC  I N1    1 
ATOM   7986  C  C2    . DC  I  5 90  ? 17.455  -35.397 59.494 1.00 70.23  ? 16   DC  I C2    1 
ATOM   7987  O  O2    . DC  I  5 90  ? 16.816  -34.335 59.415 1.00 69.84  ? 16   DC  I O2    1 
ATOM   7988  N  N3    . DC  I  5 90  ? 18.765  -35.399 59.864 1.00 70.81  ? 16   DC  I N3    1 
ATOM   7989  C  C4    . DC  I  5 90  ? 19.451  -36.545 59.952 1.00 69.77  ? 16   DC  I C4    1 
ATOM   7990  N  N4    . DC  I  5 90  ? 20.731  -36.499 60.318 1.00 69.57  ? 16   DC  I N4    1 
ATOM   7991  C  C5    . DC  I  5 90  ? 18.851  -37.801 59.663 1.00 69.94  ? 16   DC  I C5    1 
ATOM   7992  C  C6    . DC  I  5 90  ? 17.564  -37.802 59.303 1.00 69.99  ? 16   DC  I C6    1 
ATOM   7993  P  P     . DT  I  5 91  ? 11.697  -36.482 56.648 1.00 62.28  ? 17   DT  I P     1 
ATOM   7994  O  OP1   . DT  I  5 91  ? 10.749  -36.604 57.785 1.00 60.77  ? 17   DT  I OP1   1 
ATOM   7995  O  OP2   . DT  I  5 91  ? 11.545  -37.224 55.367 1.00 60.02  ? 17   DT  I OP2   1 
ATOM   7996  O  "O5'" . DT  I  5 91  ? 11.786  -34.930 56.299 1.00 62.01  ? 17   DT  I "O5'" 1 
ATOM   7997  C  "C5'" . DT  I  5 91  ? 11.469  -33.999 57.310 1.00 61.57  ? 17   DT  I "C5'" 1 
ATOM   7998  C  "C4'" . DT  I  5 91  ? 12.364  -32.794 57.169 1.00 61.28  ? 17   DT  I "C4'" 1 
ATOM   7999  O  "O4'" . DT  I  5 91  ? 13.728  -33.232 57.362 1.00 61.88  ? 17   DT  I "O4'" 1 
ATOM   8000  C  "C3'" . DT  I  5 91  ? 12.294  -32.109 55.805 1.00 60.04  ? 17   DT  I "C3'" 1 
ATOM   8001  O  "O3'" . DT  I  5 91  ? 12.052  -30.695 55.953 1.00 56.00  ? 17   DT  I "O3'" 1 
ATOM   8002  C  "C2'" . DT  I  5 91  ? 13.652  -32.439 55.177 1.00 62.46  ? 17   DT  I "C2'" 1 
ATOM   8003  C  "C1'" . DT  I  5 91  ? 14.535  -32.574 56.410 1.00 65.06  ? 17   DT  I "C1'" 1 
ATOM   8004  N  N1    . DT  I  5 91  ? 15.805  -33.365 56.271 1.00 66.38  ? 17   DT  I N1    1 
ATOM   8005  C  C2    . DT  I  5 91  ? 17.009  -32.791 56.635 1.00 66.85  ? 17   DT  I C2    1 
ATOM   8006  O  O2    . DT  I  5 91  ? 17.131  -31.652 57.052 1.00 67.23  ? 17   DT  I O2    1 
ATOM   8007  N  N3    . DT  I  5 91  ? 18.092  -33.616 56.487 1.00 67.03  ? 17   DT  I N3    1 
ATOM   8008  C  C4    . DT  I  5 91  ? 18.111  -34.920 56.031 1.00 66.79  ? 17   DT  I C4    1 
ATOM   8009  O  O4    . DT  I  5 91  ? 19.156  -35.560 55.933 1.00 66.85  ? 17   DT  I O4    1 
ATOM   8010  C  C5    . DT  I  5 91  ? 16.823  -35.460 55.669 1.00 67.36  ? 17   DT  I C5    1 
ATOM   8011  C  C7    . DT  I  5 91  ? 16.694  -36.865 55.150 1.00 67.14  ? 17   DT  I C7    1 
ATOM   8012  C  C6    . DT  I  5 91  ? 15.749  -34.669 55.808 1.00 67.31  ? 17   DT  I C6    1 
ATOM   8013  P  P     . DT  I  5 92  ? 11.745  -29.792 54.672 1.00 53.43  ? 18   DT  I P     1 
ATOM   8014  O  OP1   . DT  I  5 92  ? 10.623  -28.895 54.982 1.00 52.63  ? 18   DT  I OP1   1 
ATOM   8015  O  OP2   . DT  I  5 92  ? 11.761  -30.608 53.439 1.00 52.14  ? 18   DT  I OP2   1 
ATOM   8016  O  "O5'" . DT  I  5 92  ? 13.053  -28.903 54.580 1.00 56.55  ? 18   DT  I "O5'" 1 
ATOM   8017  C  "C5'" . DT  I  5 92  ? 13.779  -28.563 55.744 1.00 59.37  ? 18   DT  I "C5'" 1 
ATOM   8018  C  "C4'" . DT  I  5 92  ? 15.161  -28.128 55.327 1.00 61.20  ? 18   DT  I "C4'" 1 
ATOM   8019  O  "O4'" . DT  I  5 92  ? 15.998  -29.297 55.268 1.00 62.12  ? 18   DT  I "O4'" 1 
ATOM   8020  C  "C3'" . DT  I  5 92  ? 15.227  -27.485 53.948 1.00 63.00  ? 18   DT  I "C3'" 1 
ATOM   8021  O  "O3'" . DT  I  5 92  ? 15.838  -26.239 54.138 1.00 65.39  ? 18   DT  I "O3'" 1 
ATOM   8022  C  "C2'" . DT  I  5 92  ? 16.090  -28.426 53.107 1.00 63.96  ? 18   DT  I "C2'" 1 
ATOM   8023  C  "C1'" . DT  I  5 92  ? 16.885  -29.148 54.183 1.00 65.18  ? 18   DT  I "C1'" 1 
ATOM   8024  N  N1    . DT  I  5 92  ? 17.334  -30.520 53.848 1.00 66.35  ? 18   DT  I N1    1 
ATOM   8025  C  C2    . DT  I  5 92  ? 18.621  -30.925 54.170 1.00 66.50  ? 18   DT  I C2    1 
ATOM   8026  O  O2    . DT  I  5 92  ? 19.440  -30.205 54.703 1.00 67.06  ? 18   DT  I O2    1 
ATOM   8027  N  N3    . DT  I  5 92  ? 18.929  -32.219 53.831 1.00 66.22  ? 18   DT  I N3    1 
ATOM   8028  C  C4    . DT  I  5 92  ? 18.088  -33.138 53.222 1.00 66.70  ? 18   DT  I C4    1 
ATOM   8029  O  O4    . DT  I  5 92  ? 18.461  -34.279 52.962 1.00 66.56  ? 18   DT  I O4    1 
ATOM   8030  C  C5    . DT  I  5 92  ? 16.749  -32.657 52.917 1.00 67.59  ? 18   DT  I C5    1 
ATOM   8031  C  C7    . DT  I  5 92  ? 15.734  -33.542 52.252 1.00 66.81  ? 18   DT  I C7    1 
ATOM   8032  C  C6    . DT  I  5 92  ? 16.440  -31.389 53.244 1.00 67.52  ? 18   DT  I C6    1 
ATOM   8033  P  P     . DT  I  5 93  ? 16.067  -25.175 52.971 1.00 67.86  ? 19   DT  I P     1 
ATOM   8034  O  OP1   . DT  I  5 93  ? 15.968  -23.868 53.649 1.00 67.32  ? 19   DT  I OP1   1 
ATOM   8035  O  OP2   . DT  I  5 93  ? 15.236  -25.482 51.787 1.00 67.15  ? 19   DT  I OP2   1 
ATOM   8036  O  "O5'" . DT  I  5 93  ? 17.565  -25.453 52.508 1.00 71.17  ? 19   DT  I "O5'" 1 
ATOM   8037  C  "C5'" . DT  I  5 93  ? 18.630  -25.545 53.442 1.00 76.18  ? 19   DT  I "C5'" 1 
ATOM   8038  C  "C4'" . DT  I  5 93  ? 19.928  -25.781 52.689 1.00 80.32  ? 19   DT  I "C4'" 1 
ATOM   8039  O  "O4'" . DT  I  5 93  ? 20.171  -27.196 52.509 1.00 81.22  ? 19   DT  I "O4'" 1 
ATOM   8040  C  "C3'" . DT  I  5 93  ? 19.961  -25.190 51.285 1.00 83.20  ? 19   DT  I "C3'" 1 
ATOM   8041  O  "O3'" . DT  I  5 93  ? 21.260  -24.643 51.116 1.00 87.33  ? 19   DT  I "O3'" 1 
ATOM   8042  C  "C2'" . DT  I  5 93  ? 19.681  -26.380 50.362 1.00 82.57  ? 19   DT  I "C2'" 1 
ATOM   8043  C  "C1'" . DT  I  5 93  ? 20.392  -27.483 51.137 1.00 82.82  ? 19   DT  I "C1'" 1 
ATOM   8044  N  N1    . DT  I  5 93  ? 19.918  -28.888 50.883 1.00 83.60  ? 19   DT  I N1    1 
ATOM   8045  C  C2    . DT  I  5 93  ? 20.790  -29.957 51.067 1.00 83.57  ? 19   DT  I C2    1 
ATOM   8046  O  O2    . DT  I  5 93  ? 21.952  -29.832 51.415 1.00 83.63  ? 19   DT  I O2    1 
ATOM   8047  N  N3    . DT  I  5 93  ? 20.247  -31.200 50.821 1.00 83.10  ? 19   DT  I N3    1 
ATOM   8048  C  C4    . DT  I  5 93  ? 18.950  -31.468 50.424 1.00 82.97  ? 19   DT  I C4    1 
ATOM   8049  O  O4    . DT  I  5 93  ? 18.572  -32.613 50.230 1.00 83.02  ? 19   DT  I O4    1 
ATOM   8050  C  C5    . DT  I  5 93  ? 18.088  -30.318 50.251 1.00 83.45  ? 19   DT  I C5    1 
ATOM   8051  C  C7    . DT  I  5 93  ? 16.659  -30.462 49.820 1.00 83.50  ? 19   DT  I C7    1 
ATOM   8052  C  C6    . DT  I  5 93  ? 18.604  -29.104 50.492 1.00 84.16  ? 19   DT  I C6    1 
ATOM   8053  P  P     . DT  I  5 94  ? 21.637  -23.672 49.897 1.00 90.48  ? 20   DT  I P     1 
ATOM   8054  O  OP1   . DT  I  5 94  ? 22.071  -22.390 50.519 1.00 90.38  ? 20   DT  I OP1   1 
ATOM   8055  O  OP2   . DT  I  5 94  ? 20.586  -23.715 48.844 1.00 89.40  ? 20   DT  I OP2   1 
ATOM   8056  O  "O5'" . DT  I  5 94  ? 22.917  -24.394 49.261 1.00 92.79  ? 20   DT  I "O5'" 1 
ATOM   8057  C  "C5'" . DT  I  5 94  ? 23.795  -25.219 50.048 1.00 96.28  ? 20   DT  I "C5'" 1 
ATOM   8058  C  "C4'" . DT  I  5 94  ? 24.663  -26.031 49.101 1.00 99.24  ? 20   DT  I "C4'" 1 
ATOM   8059  O  "O4'" . DT  I  5 94  ? 24.210  -27.412 49.043 1.00 99.73  ? 20   DT  I "O4'" 1 
ATOM   8060  C  "C3'" . DT  I  5 94  ? 24.629  -25.505 47.666 1.00 101.12 ? 20   DT  I "C3'" 1 
ATOM   8061  O  "O3'" . DT  I  5 94  ? 25.958  -25.458 47.145 1.00 103.49 ? 20   DT  I "O3'" 1 
ATOM   8062  C  "C2'" . DT  I  5 94  ? 23.710  -26.478 46.927 1.00 100.74 ? 20   DT  I "C2'" 1 
ATOM   8063  C  "C1'" . DT  I  5 94  ? 23.951  -27.770 47.698 1.00 100.63 ? 20   DT  I "C1'" 1 
ATOM   8064  N  N1    . DT  I  5 94  ? 22.797  -28.717 47.621 1.00 100.93 ? 20   DT  I N1    1 
ATOM   8065  C  C2    . DT  I  5 94  ? 23.025  -30.078 47.754 1.00 101.21 ? 20   DT  I C2    1 
ATOM   8066  O  O2    . DT  I  5 94  ? 24.129  -30.559 47.945 1.00 101.17 ? 20   DT  I O2    1 
ATOM   8067  N  N3    . DT  I  5 94  ? 21.898  -30.868 47.658 1.00 101.18 ? 20   DT  I N3    1 
ATOM   8068  C  C4    . DT  I  5 94  ? 20.592  -30.445 47.443 1.00 101.03 ? 20   DT  I C4    1 
ATOM   8069  O  O4    . DT  I  5 94  ? 19.655  -31.239 47.373 1.00 100.72 ? 20   DT  I O4    1 
ATOM   8070  C  C5    . DT  I  5 94  ? 20.423  -29.010 47.312 1.00 101.33 ? 20   DT  I C5    1 
ATOM   8071  C  C7    . DT  I  5 94  ? 19.063  -28.416 47.078 1.00 101.28 ? 20   DT  I C7    1 
ATOM   8072  C  C6    . DT  I  5 94  ? 21.516  -28.228 47.404 1.00 101.31 ? 20   DT  I C6    1 
ATOM   8073  P  P     . DG  I  5 95  ? 26.272  -25.041 45.629 1.00 105.07 ? 21   DG  I P     1 
ATOM   8074  O  OP1   . DG  I  5 95  ? 27.576  -24.345 45.645 1.00 105.27 ? 21   DG  I OP1   1 
ATOM   8075  O  OP2   . DG  I  5 95  ? 25.098  -24.355 45.030 1.00 105.00 ? 21   DG  I OP2   1 
ATOM   8076  O  "O5'" . DG  I  5 95  ? 26.433  -26.467 44.911 1.00 106.36 ? 21   DG  I "O5'" 1 
ATOM   8077  C  "C5'" . DG  I  5 95  ? 27.091  -27.592 45.525 1.00 108.04 ? 21   DG  I "C5'" 1 
ATOM   8078  C  "C4'" . DG  I  5 95  ? 27.203  -28.756 44.544 1.00 109.68 ? 21   DG  I "C4'" 1 
ATOM   8079  O  "O4'" . DG  I  5 95  ? 26.135  -29.725 44.750 1.00 110.13 ? 21   DG  I "O4'" 1 
ATOM   8080  C  "C3'" . DG  I  5 95  ? 27.123  -28.364 43.068 1.00 111.15 ? 21   DG  I "C3'" 1 
ATOM   8081  O  "O3'" . DG  I  5 95  ? 28.084  -29.123 42.308 1.00 112.51 ? 21   DG  I "O3'" 1 
ATOM   8082  C  "C2'" . DG  I  5 95  ? 25.670  -28.681 42.708 1.00 110.88 ? 21   DG  I "C2'" 1 
ATOM   8083  C  "C1'" . DG  I  5 95  ? 25.440  -29.944 43.530 1.00 110.92 ? 21   DG  I "C1'" 1 
ATOM   8084  N  N9    . DG  I  5 95  ? 24.018  -30.245 43.745 1.00 111.06 ? 21   DG  I N9    1 
ATOM   8085  C  C8    . DG  I  5 95  ? 22.982  -29.339 43.838 1.00 111.26 ? 21   DG  I C8    1 
ATOM   8086  N  N7    . DG  I  5 95  ? 21.811  -29.883 44.022 1.00 111.14 ? 21   DG  I N7    1 
ATOM   8087  C  C5    . DG  I  5 95  ? 22.077  -31.245 44.052 1.00 111.11 ? 21   DG  I C5    1 
ATOM   8088  C  C6    . DG  I  5 95  ? 21.195  -32.345 44.225 1.00 111.08 ? 21   DG  I C6    1 
ATOM   8089  O  O6    . DG  I  5 95  ? 19.969  -32.333 44.391 1.00 111.25 ? 21   DG  I O6    1 
ATOM   8090  N  N1    . DG  I  5 95  ? 21.858  -33.569 44.191 1.00 111.12 ? 21   DG  I N1    1 
ATOM   8091  C  C2    . DG  I  5 95  ? 23.215  -33.711 44.010 1.00 111.27 ? 21   DG  I C2    1 
ATOM   8092  N  N2    . DG  I  5 95  ? 23.676  -34.971 44.007 1.00 111.22 ? 21   DG  I N2    1 
ATOM   8093  N  N3    . DG  I  5 95  ? 24.058  -32.688 43.853 1.00 111.27 ? 21   DG  I N3    1 
ATOM   8094  C  C4    . DG  I  5 95  ? 23.427  -31.485 43.881 1.00 111.03 ? 21   DG  I C4    1 
ATOM   8095  P  P     . DA  I  5 96  ? 28.303  -28.983 40.715 1.00 113.11 ? 22   DA  I P     1 
ATOM   8096  O  OP1   . DA  I  5 96  ? 29.736  -28.673 40.511 1.00 113.30 ? 22   DA  I OP1   1 
ATOM   8097  O  OP2   . DA  I  5 96  ? 27.272  -28.108 40.103 1.00 113.19 ? 22   DA  I OP2   1 
ATOM   8098  O  "O5'" . DA  I  5 96  ? 28.035  -30.476 40.216 1.00 112.68 ? 22   DA  I "O5'" 1 
ATOM   8099  C  "C5'" . DA  I  5 96  ? 28.367  -31.588 41.056 1.00 113.36 ? 22   DA  I "C5'" 1 
ATOM   8100  C  "C4'" . DA  I  5 96  ? 27.849  -32.857 40.409 1.00 113.90 ? 22   DA  I "C4'" 1 
ATOM   8101  O  "O4'" . DA  I  5 96  ? 26.532  -33.190 40.936 1.00 114.02 ? 22   DA  I "O4'" 1 
ATOM   8102  C  "C3'" . DA  I  5 96  ? 27.687  -32.722 38.895 1.00 114.12 ? 22   DA  I "C3'" 1 
ATOM   8103  O  "O3'" . DA  I  5 96  ? 28.066  -33.926 38.241 1.00 114.23 ? 22   DA  I "O3'" 1 
ATOM   8104  C  "C2'" . DA  I  5 96  ? 26.197  -32.431 38.731 1.00 114.33 ? 22   DA  I "C2'" 1 
ATOM   8105  C  "C1'" . DA  I  5 96  ? 25.625  -33.303 39.848 1.00 113.95 ? 22   DA  I "C1'" 1 
ATOM   8106  N  N9    . DA  I  5 96  ? 24.254  -32.932 40.216 1.00 113.73 ? 22   DA  I N9    1 
ATOM   8107  C  C8    . DA  I  5 96  ? 23.736  -31.672 40.382 1.00 113.58 ? 22   DA  I C8    1 
ATOM   8108  N  N7    . DA  I  5 96  ? 22.464  -31.652 40.700 1.00 113.61 ? 22   DA  I N7    1 
ATOM   8109  C  C5    . DA  I  5 96  ? 22.120  -32.993 40.738 1.00 113.64 ? 22   DA  I C5    1 
ATOM   8110  C  C6    . DA  I  5 96  ? 20.907  -33.654 41.018 1.00 113.45 ? 22   DA  I C6    1 
ATOM   8111  N  N6    . DA  I  5 96  ? 19.776  -33.016 41.324 1.00 113.31 ? 22   DA  I N6    1 
ATOM   8112  N  N1    . DA  I  5 96  ? 20.909  -35.005 40.969 1.00 113.65 ? 22   DA  I N1    1 
ATOM   8113  C  C2    . DA  I  5 96  ? 22.045  -35.656 40.661 1.00 113.59 ? 22   DA  I C2    1 
ATOM   8114  N  N3    . DA  I  5 96  ? 23.246  -35.148 40.382 1.00 113.27 ? 22   DA  I N3    1 
ATOM   8115  C  C4    . DA  I  5 96  ? 23.212  -33.800 40.438 1.00 113.61 ? 22   DA  I C4    1 
ATOM   8116  P  P     . DT  I  5 97  ? 28.222  -33.977 36.645 1.00 114.67 ? 23   DT  I P     1 
ATOM   8117  O  OP1   . DT  I  5 97  ? 29.626  -34.386 36.405 1.00 114.61 ? 23   DT  I OP1   1 
ATOM   8118  O  OP2   . DT  I  5 97  ? 27.685  -32.736 36.027 1.00 114.32 ? 23   DT  I OP2   1 
ATOM   8119  O  "O5'" . DT  I  5 97  ? 27.220  -35.149 36.206 1.00 113.61 ? 23   DT  I "O5'" 1 
ATOM   8120  C  "C5'" . DT  I  5 97  ? 27.192  -36.428 36.854 1.00 112.07 ? 23   DT  I "C5'" 1 
ATOM   8121  C  "C4'" . DT  I  5 97  ? 25.877  -37.140 36.557 1.00 110.99 ? 23   DT  I "C4'" 1 
ATOM   8122  O  "O4'" . DT  I  5 97  ? 24.820  -36.602 37.395 1.00 110.21 ? 23   DT  I "O4'" 1 
ATOM   8123  C  "C3'" . DT  I  5 97  ? 25.316  -36.961 35.149 1.00 110.39 ? 23   DT  I "C3'" 1 
ATOM   8124  O  "O3'" . DT  I  5 97  ? 25.952  -37.834 34.206 1.00 109.54 ? 23   DT  I "O3'" 1 
ATOM   8125  C  "C2'" . DT  I  5 97  ? 23.846  -37.320 35.350 1.00 110.07 ? 23   DT  I "C2'" 1 
ATOM   8126  C  "C1'" . DT  I  5 97  ? 23.574  -36.885 36.784 1.00 109.14 ? 23   DT  I "C1'" 1 
ATOM   8127  N  N1    . DT  I  5 97  ? 22.652  -35.715 36.841 1.00 108.54 ? 23   DT  I N1    1 
ATOM   8128  C  C2    . DT  I  5 97  ? 21.322  -35.968 37.085 1.00 108.50 ? 23   DT  I C2    1 
ATOM   8129  O  O2    . DT  I  5 97  ? 20.882  -37.093 37.259 1.00 108.46 ? 23   DT  I O2    1 
ATOM   8130  N  N3    . DT  I  5 97  ? 20.524  -34.850 37.118 1.00 108.42 ? 23   DT  I N3    1 
ATOM   8131  C  C4    . DT  I  5 97  ? 20.914  -33.534 36.933 1.00 108.48 ? 23   DT  I C4    1 
ATOM   8132  O  O4    . DT  I  5 97  ? 20.106  -32.612 36.989 1.00 108.19 ? 23   DT  I O4    1 
ATOM   8133  C  C5    . DT  I  5 97  ? 22.327  -33.340 36.675 1.00 108.53 ? 23   DT  I C5    1 
ATOM   8134  C  C7    . DT  I  5 97  ? 22.894  -31.965 36.456 1.00 108.70 ? 23   DT  I C7    1 
ATOM   8135  C  C6    . DT  I  5 97  ? 23.115  -34.427 36.638 1.00 108.45 ? 23   DT  I C6    1 
ATOM   8136  P  P     . DG  I  5 98  ? 25.620  -37.754 32.630 1.00 109.06 ? 24   DG  I P     1 
ATOM   8137  O  OP1   . DG  I  5 98  ? 26.822  -38.220 31.904 1.00 110.06 ? 24   DG  I OP1   1 
ATOM   8138  O  OP2   . DG  I  5 98  ? 25.048  -36.427 32.301 1.00 108.45 ? 24   DG  I OP2   1 
ATOM   8139  O  "O5'" . DG  I  5 98  ? 24.481  -38.866 32.441 1.00 107.83 ? 24   DG  I "O5'" 1 
ATOM   8140  C  "C5'" . DG  I  5 98  ? 24.470  -40.097 33.183 1.00 105.06 ? 24   DG  I "C5'" 1 
ATOM   8141  C  "C4'" . DG  I  5 98  ? 23.050  -40.649 33.185 1.00 103.29 ? 24   DG  I "C4'" 1 
ATOM   8142  O  "O4'" . DG  I  5 98  ? 22.102  -39.701 33.753 1.00 102.81 ? 24   DG  I "O4'" 1 
ATOM   8143  C  "C3'" . DG  I  5 98  ? 22.486  -40.989 31.812 1.00 102.08 ? 24   DG  I "C3'" 1 
ATOM   8144  O  "O3'" . DG  I  5 98  ? 21.655  -42.135 31.990 1.00 100.91 ? 24   DG  I "O3'" 1 
ATOM   8145  C  "C2'" . DG  I  5 98  ? 21.737  -39.709 31.419 1.00 101.72 ? 24   DG  I "C2'" 1 
ATOM   8146  C  "C1'" . DG  I  5 98  ? 21.179  -39.265 32.770 1.00 101.56 ? 24   DG  I "C1'" 1 
ATOM   8147  N  N9    . DG  I  5 98  ? 20.994  -37.825 32.950 1.00 101.40 ? 24   DG  I N9    1 
ATOM   8148  C  C8    . DG  I  5 98  ? 21.812  -36.798 32.544 1.00 101.32 ? 24   DG  I C8    1 
ATOM   8149  N  N7    . DG  I  5 98  ? 21.368  -35.612 32.865 1.00 101.39 ? 24   DG  I N7    1 
ATOM   8150  C  C5    . DG  I  5 98  ? 20.179  -35.863 33.535 1.00 101.36 ? 24   DG  I C5    1 
ATOM   8151  C  C6    . DG  I  5 98  ? 19.239  -34.975 34.125 1.00 101.08 ? 24   DG  I C6    1 
ATOM   8152  O  O6    . DG  I  5 98  ? 19.261  -33.743 34.181 1.00 101.20 ? 24   DG  I O6    1 
ATOM   8153  N  N1    . DG  I  5 98  ? 18.168  -35.648 34.698 1.00 101.09 ? 24   DG  I N1    1 
ATOM   8154  C  C2    . DG  I  5 98  ? 18.022  -37.014 34.700 1.00 101.31 ? 24   DG  I C2    1 
ATOM   8155  N  N2    . DG  I  5 98  ? 16.925  -37.496 35.298 1.00 101.36 ? 24   DG  I N2    1 
ATOM   8156  N  N3    . DG  I  5 98  ? 18.889  -37.859 34.157 1.00 101.52 ? 24   DG  I N3    1 
ATOM   8157  C  C4    . DG  I  5 98  ? 19.941  -37.219 33.593 1.00 101.49 ? 24   DG  I C4    1 
ATOM   8158  P  P     . DG  I  5 99  ? 20.664  -42.670 30.849 1.00 100.49 ? 25   DG  I P     1 
ATOM   8159  O  OP1   . DG  I  5 99  ? 20.337  -44.072 31.189 1.00 100.18 ? 25   DG  I OP1   1 
ATOM   8160  O  OP2   . DG  I  5 99  ? 21.204  -42.292 29.517 1.00 99.98  ? 25   DG  I OP2   1 
ATOM   8161  O  "O5'" . DG  I  5 99  ? 19.355  -41.767 31.062 1.00 100.67 ? 25   DG  I "O5'" 1 
ATOM   8162  C  "C5'" . DG  I  5 99  ? 18.161  -42.201 31.723 1.00 98.90  ? 25   DG  I "C5'" 1 
ATOM   8163  C  "C4'" . DG  I  5 99  ? 17.036  -41.304 31.239 1.00 97.79  ? 25   DG  I "C4'" 1 
ATOM   8164  O  "O4'" . DG  I  5 99  ? 17.349  -39.907 31.460 1.00 98.27  ? 25   DG  I "O4'" 1 
ATOM   8165  C  "C3'" . DG  I  5 99  ? 16.787  -41.390 29.738 1.00 97.07  ? 25   DG  I "C3'" 1 
ATOM   8166  O  "O3'" . DG  I  5 99  ? 15.427  -41.316 29.586 1.00 96.16  ? 25   DG  I "O3'" 1 
ATOM   8167  C  "C2'" . DG  I  5 99  ? 17.431  -40.159 29.125 1.00 97.48  ? 25   DG  I "C2'" 1 
ATOM   8168  C  "C1'" . DG  I  5 99  ? 17.117  -39.197 30.253 1.00 98.31  ? 25   DG  I "C1'" 1 
ATOM   8169  N  N9    . DG  I  5 99  ? 17.933  -37.998 30.270 1.00 98.38  ? 25   DG  I N9    1 
ATOM   8170  C  C8    . DG  I  5 99  ? 19.219  -37.826 29.820 1.00 98.56  ? 25   DG  I C8    1 
ATOM   8171  N  N7    . DG  I  5 99  ? 19.665  -36.614 29.996 1.00 98.54  ? 25   DG  I N7    1 
ATOM   8172  C  C5    . DG  I  5 99  ? 18.602  -35.954 30.596 1.00 98.37  ? 25   DG  I C5    1 
ATOM   8173  C  C6    . DG  I  5 99  ? 18.486  -34.616 31.022 1.00 98.50  ? 25   DG  I C6    1 
ATOM   8174  O  O6    . DG  I  5 99  ? 19.344  -33.729 30.951 1.00 98.81  ? 25   DG  I O6    1 
ATOM   8175  N  N1    . DG  I  5 99  ? 17.239  -34.348 31.588 1.00 98.57  ? 25   DG  I N1    1 
ATOM   8176  C  C2    . DG  I  5 99  ? 16.226  -35.270 31.720 1.00 98.62  ? 25   DG  I C2    1 
ATOM   8177  N  N2    . DG  I  5 99  ? 15.095  -34.844 32.291 1.00 98.46  ? 25   DG  I N2    1 
ATOM   8178  N  N3    . DG  I  5 99  ? 16.317  -36.530 31.322 1.00 98.76  ? 25   DG  I N3    1 
ATOM   8179  C  C4    . DG  I  5 99  ? 17.531  -36.793 30.773 1.00 98.49  ? 25   DG  I C4    1 
ATOM   8180  P  P     . DA  I  5 100 ? 14.698  -42.718 29.557 1.00 96.27  ? 26   DA  I P     1 
ATOM   8181  O  OP1   . DA  I  5 100 ? 15.274  -43.603 30.611 1.00 94.87  ? 26   DA  I OP1   1 
ATOM   8182  O  OP2   . DA  I  5 100 ? 14.663  -43.110 28.126 1.00 96.58  ? 26   DA  I OP2   1 
ATOM   8183  O  "O5'" . DA  I  5 100 ? 13.214  -42.340 29.988 1.00 95.35  ? 26   DA  I "O5'" 1 
ATOM   8184  C  "C5'" . DA  I  5 100 ? 12.934  -42.140 31.365 1.00 93.38  ? 26   DA  I "C5'" 1 
ATOM   8185  C  "C4'" . DA  I  5 100 ? 11.967  -40.984 31.479 1.00 91.48  ? 26   DA  I "C4'" 1 
ATOM   8186  O  "O4'" . DA  I  5 100 ? 12.620  -39.737 31.136 1.00 91.67  ? 26   DA  I "O4'" 1 
ATOM   8187  C  "C3'" . DA  I  5 100 ? 10.756  -41.101 30.565 1.00 89.83  ? 26   DA  I "C3'" 1 
ATOM   8188  O  "O3'" . DA  I  5 100 ? 9.681   -40.662 31.364 1.00 86.65  ? 26   DA  I "O3'" 1 
ATOM   8189  C  "C2'" . DA  I  5 100 ? 11.067  -40.175 29.384 1.00 90.75  ? 26   DA  I "C2'" 1 
ATOM   8190  C  "C1'" . DA  I  5 100 ? 11.946  -39.122 30.056 1.00 92.52  ? 26   DA  I "C1'" 1 
ATOM   8191  N  N9    . DA  I  5 100 ? 13.000  -38.556 29.225 1.00 93.15  ? 26   DA  I N9    1 
ATOM   8192  C  C8    . DA  I  5 100 ? 13.811  -39.201 28.329 1.00 93.35  ? 26   DA  I C8    1 
ATOM   8193  N  N7    . DA  I  5 100 ? 14.679  -38.406 27.748 1.00 93.52  ? 26   DA  I N7    1 
ATOM   8194  C  C5    . DA  I  5 100 ? 14.421  -37.159 28.304 1.00 93.33  ? 26   DA  I C5    1 
ATOM   8195  C  C6    . DA  I  5 100 ? 14.991  -35.878 28.122 1.00 93.17  ? 26   DA  I C6    1 
ATOM   8196  N  N6    . DA  I  5 100 ? 15.988  -35.639 27.274 1.00 93.44  ? 26   DA  I N6    1 
ATOM   8197  N  N1    . DA  I  5 100 ? 14.500  -34.838 28.830 1.00 93.14  ? 26   DA  I N1    1 
ATOM   8198  C  C2    . DA  I  5 100 ? 13.492  -35.073 29.678 1.00 93.39  ? 26   DA  I C2    1 
ATOM   8199  N  N3    . DA  I  5 100 ? 12.878  -36.228 29.944 1.00 93.62  ? 26   DA  I N3    1 
ATOM   8200  C  C4    . DA  I  5 100 ? 13.391  -37.239 29.219 1.00 93.41  ? 26   DA  I C4    1 
ATOM   8201  P  P     . DG  I  5 101 ? 8.157   -40.816 30.930 1.00 83.86  ? 27   DG  I P     1 
ATOM   8202  O  OP1   . DG  I  5 101 ? 7.412   -41.117 32.179 1.00 82.94  ? 27   DG  I OP1   1 
ATOM   8203  O  OP2   . DG  I  5 101 ? 8.070   -41.697 29.744 1.00 83.29  ? 27   DG  I OP2   1 
ATOM   8204  O  "O5'" . DG  I  5 101 ? 7.814   -39.335 30.406 1.00 82.65  ? 27   DG  I "O5'" 1 
ATOM   8205  C  "C5'" . DG  I  5 101 ? 8.303   -38.152 31.068 1.00 79.18  ? 27   DG  I "C5'" 1 
ATOM   8206  C  "C4'" . DG  I  5 101 ? 7.986   -36.885 30.291 1.00 76.45  ? 27   DG  I "C4'" 1 
ATOM   8207  O  "O4'" . DG  I  5 101 ? 9.125   -36.498 29.489 1.00 76.48  ? 27   DG  I "O4'" 1 
ATOM   8208  C  "C3'" . DG  I  5 101 ? 6.822   -36.961 29.318 1.00 75.00  ? 27   DG  I "C3'" 1 
ATOM   8209  O  "O3'" . DG  I  5 101 ? 6.240   -35.690 29.300 1.00 72.97  ? 27   DG  I "O3'" 1 
ATOM   8210  C  "C2'" . DG  I  5 101 ? 7.518   -37.222 27.992 1.00 75.74  ? 27   DG  I "C2'" 1 
ATOM   8211  C  "C1'" . DG  I  5 101 ? 8.721   -36.306 28.150 1.00 77.94  ? 27   DG  I "C1'" 1 
ATOM   8212  N  N9    . DG  I  5 101 ? 9.869   -36.587 27.284 1.00 78.80  ? 27   DG  I N9    1 
ATOM   8213  C  C8    . DG  I  5 101 ? 10.179  -37.779 26.665 1.00 79.26  ? 27   DG  I C8    1 
ATOM   8214  N  N7    . DG  I  5 101 ? 11.276  -37.746 25.960 1.00 79.27  ? 27   DG  I N7    1 
ATOM   8215  C  C5    . DG  I  5 101 ? 11.738  -36.449 26.124 1.00 78.91  ? 27   DG  I C5    1 
ATOM   8216  C  C6    . DG  I  5 101 ? 12.897  -35.826 25.601 1.00 78.77  ? 27   DG  I C6    1 
ATOM   8217  O  O6    . DG  I  5 101 ? 13.772  -36.303 24.867 1.00 78.89  ? 27   DG  I O6    1 
ATOM   8218  N  N1    . DG  I  5 101 ? 13.009  -34.499 26.000 1.00 78.94  ? 27   DG  I N1    1 
ATOM   8219  C  C2    . DG  I  5 101 ? 12.107  -33.857 26.808 1.00 78.92  ? 27   DG  I C2    1 
ATOM   8220  N  N2    . DG  I  5 101 ? 12.394  -32.578 27.082 1.00 78.98  ? 27   DG  I N2    1 
ATOM   8221  N  N3    . DG  I  5 101 ? 11.015  -34.429 27.313 1.00 79.03  ? 27   DG  I N3    1 
ATOM   8222  C  C4    . DG  I  5 101 ? 10.888  -35.724 26.933 1.00 78.89  ? 27   DG  I C4    1 
ATOM   8223  P  P     . DC  I  5 102 ? 4.680   -35.423 29.466 1.00 71.25  ? 28   DC  I P     1 
ATOM   8224  O  OP1   . DC  I  5 102 ? 4.321   -35.710 30.866 1.00 69.62  ? 28   DC  I OP1   1 
ATOM   8225  O  OP2   . DC  I  5 102 ? 3.926   -36.009 28.337 1.00 70.52  ? 28   DC  I OP2   1 
ATOM   8226  O  "O5'" . DC  I  5 102 ? 4.682   -33.856 29.237 1.00 73.60  ? 28   DC  I "O5'" 1 
ATOM   8227  C  "C5'" . DC  I  5 102 ? 5.690   -33.094 29.878 1.00 77.96  ? 28   DC  I "C5'" 1 
ATOM   8228  C  "C4'" . DC  I  5 102 ? 6.352   -32.113 28.929 1.00 81.10  ? 28   DC  I "C4'" 1 
ATOM   8229  O  "O4'" . DC  I  5 102 ? 7.250   -32.787 28.027 1.00 81.55  ? 28   DC  I "O4'" 1 
ATOM   8230  C  "C3'" . DC  I  5 102 ? 5.407   -31.310 28.046 1.00 83.50  ? 28   DC  I "C3'" 1 
ATOM   8231  O  "O3'" . DC  I  5 102 ? 5.667   -29.948 28.350 1.00 86.60  ? 28   DC  I "O3'" 1 
ATOM   8232  C  "C2'" . DC  I  5 102 ? 5.773   -31.713 26.609 1.00 83.22  ? 28   DC  I "C2'" 1 
ATOM   8233  C  "C1'" . DC  I  5 102 ? 7.227   -32.117 26.788 1.00 82.85  ? 28   DC  I "C1'" 1 
ATOM   8234  N  N1    . DC  I  5 102 ? 7.830   -33.074 25.823 1.00 83.27  ? 28   DC  I N1    1 
ATOM   8235  C  C2    . DC  I  5 102 ? 8.972   -32.695 25.092 1.00 84.02  ? 28   DC  I C2    1 
ATOM   8236  O  O2    . DC  I  5 102 ? 9.449   -31.556 25.224 1.00 84.08  ? 28   DC  I O2    1 
ATOM   8237  N  N3    . DC  I  5 102 ? 9.530   -33.593 24.236 1.00 84.32  ? 28   DC  I N3    1 
ATOM   8238  C  C4    . DC  I  5 102 ? 9.009   -34.818 24.106 1.00 83.86  ? 28   DC  I C4    1 
ATOM   8239  N  N4    . DC  I  5 102 ? 9.601   -35.659 23.249 1.00 83.91  ? 28   DC  I N4    1 
ATOM   8240  C  C5    . DC  I  5 102 ? 7.857   -35.223 24.848 1.00 83.77  ? 28   DC  I C5    1 
ATOM   8241  C  C6    . DC  I  5 102 ? 7.311   -34.331 25.687 1.00 83.27  ? 28   DC  I C6    1 
ATOM   8242  P  P     . DA  I  5 103 ? 4.772   -28.749 27.783 1.00 89.06  ? 29   DA  I P     1 
ATOM   8243  O  OP1   . DA  I  5 103 ? 4.879   -27.634 28.769 1.00 88.59  ? 29   DA  I OP1   1 
ATOM   8244  O  OP2   . DA  I  5 103 ? 3.455   -29.282 27.346 1.00 88.60  ? 29   DA  I OP2   1 
ATOM   8245  O  "O5'" . DA  I  5 103 ? 5.561   -28.373 26.444 1.00 90.38  ? 29   DA  I "O5'" 1 
ATOM   8246  C  "C5'" . DA  I  5 103 ? 6.861   -27.782 26.480 1.00 92.65  ? 29   DA  I "C5'" 1 
ATOM   8247  C  "C4'" . DA  I  5 103 ? 7.397   -27.691 25.066 1.00 94.29  ? 29   DA  I "C4'" 1 
ATOM   8248  O  "O4'" . DA  I  5 103 ? 7.596   -29.032 24.556 1.00 94.66  ? 29   DA  I "O4'" 1 
ATOM   8249  C  "C3'" . DA  I  5 103 ? 6.458   -27.018 24.073 1.00 95.73  ? 29   DA  I "C3'" 1 
ATOM   8250  O  "O3'" . DA  I  5 103 ? 7.200   -26.057 23.340 1.00 98.35  ? 29   DA  I "O3'" 1 
ATOM   8251  C  "C2'" . DA  I  5 103 ? 5.932   -28.167 23.198 1.00 95.00  ? 29   DA  I "C2'" 1 
ATOM   8252  C  "C1'" . DA  I  5 103 ? 7.143   -29.085 23.217 1.00 94.27  ? 29   DA  I "C1'" 1 
ATOM   8253  N  N9    . DA  I  5 103 ? 6.929   -30.486 22.856 1.00 94.01  ? 29   DA  I N9    1 
ATOM   8254  C  C8    . DA  I  5 103 ? 5.904   -31.320 23.214 1.00 94.08  ? 29   DA  I C8    1 
ATOM   8255  N  N7    . DA  I  5 103 ? 6.015   -32.538 22.732 1.00 94.04  ? 29   DA  I N7    1 
ATOM   8256  C  C5    . DA  I  5 103 ? 7.198   -32.500 22.011 1.00 93.85  ? 29   DA  I C5    1 
ATOM   8257  C  C6    . DA  I  5 103 ? 7.893   -33.467 21.251 1.00 93.86  ? 29   DA  I C6    1 
ATOM   8258  N  N6    . DA  I  5 103 ? 7.478   -34.727 21.077 1.00 93.72  ? 29   DA  I N6    1 
ATOM   8259  N  N1    . DA  I  5 103 ? 9.049   -33.087 20.665 1.00 94.12  ? 29   DA  I N1    1 
ATOM   8260  C  C2    . DA  I  5 103 ? 9.482   -31.827 20.821 1.00 93.95  ? 29   DA  I C2    1 
ATOM   8261  N  N3    . DA  I  5 103 ? 8.921   -30.834 21.507 1.00 93.51  ? 29   DA  I N3    1 
ATOM   8262  C  C4    . DA  I  5 103 ? 7.775   -31.241 22.082 1.00 93.75  ? 29   DA  I C4    1 
ATOM   8263  P  P     . DG  I  5 104 ? 6.471   -25.072 22.306 1.00 100.93 ? 30   DG  I P     1 
ATOM   8264  O  OP1   . DG  I  5 104 ? 6.643   -23.693 22.829 1.00 100.60 ? 30   DG  I OP1   1 
ATOM   8265  O  OP2   . DG  I  5 104 ? 5.155   -25.635 21.906 1.00 100.00 ? 30   DG  I OP2   1 
ATOM   8266  O  "O5'" . DG  I  5 104 ? 7.357   -25.213 20.993 1.00 103.03 ? 30   DG  I "O5'" 1 
ATOM   8267  C  "C5'" . DG  I  5 104 ? 8.730   -24.851 20.958 1.00 105.07 ? 30   DG  I "C5'" 1 
ATOM   8268  C  "C4'" . DG  I  5 104 ? 9.275   -25.388 19.653 1.00 106.17 ? 30   DG  I "C4'" 1 
ATOM   8269  O  "O4'" . DG  I  5 104 ? 9.090   -26.825 19.631 1.00 106.14 ? 30   DG  I "O4'" 1 
ATOM   8270  C  "C3'" . DG  I  5 104 ? 8.579   -24.845 18.410 1.00 107.12 ? 30   DG  I "C3'" 1 
ATOM   8271  O  "O3'" . DG  I  5 104 ? 9.575   -24.519 17.461 1.00 108.97 ? 30   DG  I "O3'" 1 
ATOM   8272  C  "C2'" . DG  I  5 104 ? 7.698   -26.003 17.943 1.00 106.84 ? 30   DG  I "C2'" 1 
ATOM   8273  C  "C1'" . DG  I  5 104 ? 8.539   -27.195 18.390 1.00 106.94 ? 30   DG  I "C1'" 1 
ATOM   8274  N  N9    . DG  I  5 104 ? 7.804   -28.436 18.588 1.00 107.09 ? 30   DG  I N9    1 
ATOM   8275  C  C8    . DG  I  5 104 ? 6.704   -28.626 19.391 1.00 107.49 ? 30   DG  I C8    1 
ATOM   8276  N  N7    . DG  I  5 104 ? 6.248   -29.849 19.377 1.00 107.46 ? 30   DG  I N7    1 
ATOM   8277  C  C5    . DG  I  5 104 ? 7.109   -30.509 18.515 1.00 107.20 ? 30   DG  I C5    1 
ATOM   8278  C  C6    . DG  I  5 104 ? 7.109   -31.861 18.107 1.00 107.21 ? 30   DG  I C6    1 
ATOM   8279  O  O6    . DG  I  5 104 ? 6.320   -32.746 18.456 1.00 107.36 ? 30   DG  I O6    1 
ATOM   8280  N  N1    . DG  I  5 104 ? 8.143   -32.149 17.212 1.00 107.28 ? 30   DG  I N1    1 
ATOM   8281  C  C2    . DG  I  5 104 ? 9.069   -31.229 16.772 1.00 107.29 ? 30   DG  I C2    1 
ATOM   8282  N  N2    . DG  I  5 104 ? 9.991   -31.684 15.914 1.00 107.21 ? 30   DG  I N2    1 
ATOM   8283  N  N3    . DG  I  5 104 ? 9.079   -29.951 17.145 1.00 107.34 ? 30   DG  I N3    1 
ATOM   8284  C  C4    . DG  I  5 104 ? 8.074   -29.660 18.017 1.00 107.24 ? 30   DG  I C4    1 
ATOM   8285  P  P     . DT  I  5 105 ? 9.305   -23.454 16.305 1.00 110.64 ? 31   DT  I P     1 
ATOM   8286  O  OP1   . DT  I  5 105 ? 10.549  -22.659 16.136 1.00 110.25 ? 31   DT  I OP1   1 
ATOM   8287  O  OP2   . DT  I  5 105 ? 8.013   -22.773 16.590 1.00 110.63 ? 31   DT  I OP2   1 
ATOM   8288  O  "O5'" . DT  I  5 105 ? 9.111   -24.408 15.030 1.00 112.08 ? 31   DT  I "O5'" 1 
ATOM   8289  C  "C5'" . DT  I  5 105 ? 10.214  -25.164 14.518 1.00 114.75 ? 31   DT  I "C5'" 1 
ATOM   8290  C  "C4'" . DT  I  5 105 ? 9.777   -26.383 13.708 1.00 116.98 ? 31   DT  I "C4'" 1 
ATOM   8291  O  "O4'" . DT  I  5 105 ? 9.072   -27.341 14.536 1.00 117.40 ? 31   DT  I "O4'" 1 
ATOM   8292  C  "C3'" . DT  I  5 105 ? 8.854   -26.131 12.514 1.00 118.17 ? 31   DT  I "C3'" 1 
ATOM   8293  O  "O3'" . DT  I  5 105 ? 9.633   -26.153 11.315 1.00 119.76 ? 31   DT  I "O3'" 1 
ATOM   8294  C  "C2'" . DT  I  5 105 ? 7.860   -27.301 12.533 1.00 118.14 ? 31   DT  I "C2'" 1 
ATOM   8295  C  "C1'" . DT  I  5 105 ? 8.373   -28.206 13.661 1.00 118.06 ? 31   DT  I "C1'" 1 
ATOM   8296  N  N1    . DT  I  5 105 ? 7.289   -28.901 14.438 1.00 118.40 ? 31   DT  I N1    1 
ATOM   8297  C  C2    . DT  I  5 105 ? 7.168   -30.285 14.391 1.00 118.39 ? 31   DT  I C2    1 
ATOM   8298  O  O2    . DT  I  5 105 ? 7.900   -31.022 13.749 1.00 118.34 ? 31   DT  I O2    1 
ATOM   8299  N  N3    . DT  I  5 105 ? 6.134   -30.790 15.151 1.00 118.49 ? 31   DT  I N3    1 
ATOM   8300  C  C4    . DT  I  5 105 ? 5.229   -30.070 15.927 1.00 118.45 ? 31   DT  I C4    1 
ATOM   8301  O  O4    . DT  I  5 105 ? 4.340   -30.616 16.575 1.00 118.60 ? 31   DT  I O4    1 
ATOM   8302  C  C5    . DT  I  5 105 ? 5.409   -28.635 15.934 1.00 118.39 ? 31   DT  I C5    1 
ATOM   8303  C  C7    . DT  I  5 105 ? 4.494   -27.750 16.736 1.00 118.17 ? 31   DT  I C7    1 
ATOM   8304  C  C6    . DT  I  5 105 ? 6.414   -28.133 15.198 1.00 118.52 ? 31   DT  I C6    1 
ATOM   8305  P  P     . DT  I  5 106 ? 9.218   -25.373 9.974  1.00 120.64 ? 32   DT  I P     1 
ATOM   8306  O  OP1   . DT  I  5 106 ? 10.446  -24.714 9.470  1.00 120.54 ? 32   DT  I OP1   1 
ATOM   8307  O  OP2   . DT  I  5 106 ? 8.002   -24.562 10.229 1.00 120.52 ? 32   DT  I OP2   1 
ATOM   8308  O  "O5'" . DT  I  5 106 ? 8.828   -26.562 8.974  1.00 120.80 ? 32   DT  I "O5'" 1 
ATOM   8309  C  "C5'" . DT  I  5 106 ? 9.573   -27.777 8.979  1.00 121.73 ? 32   DT  I "C5'" 1 
ATOM   8310  C  "C4'" . DT  I  5 106 ? 8.710   -28.950 8.553  1.00 122.60 ? 32   DT  I "C4'" 1 
ATOM   8311  O  "O4'" . DT  I  5 106 ? 7.903   -29.430 9.661  1.00 122.88 ? 32   DT  I "O4'" 1 
ATOM   8312  C  "C3'" . DT  I  5 106 ? 7.743   -28.664 7.404  1.00 123.06 ? 32   DT  I "C3'" 1 
ATOM   8313  O  "O3'" . DT  I  5 106 ? 8.066   -29.558 6.338  1.00 123.85 ? 32   DT  I "O3'" 1 
ATOM   8314  C  "C2'" . DT  I  5 106 ? 6.360   -28.908 8.014  1.00 123.06 ? 32   DT  I "C2'" 1 
ATOM   8315  C  "C1'" . DT  I  5 106 ? 6.688   -29.909 9.116  1.00 122.95 ? 32   DT  I "C1'" 1 
ATOM   8316  N  N1    . DT  I  5 106 ? 5.663   -30.031 10.205 1.00 122.95 ? 32   DT  I N1    1 
ATOM   8317  C  C2    . DT  I  5 106 ? 5.233   -31.287 10.605 1.00 123.02 ? 32   DT  I C2    1 
ATOM   8318  O  O2    . DT  I  5 106 ? 5.631   -32.334 10.122 1.00 122.97 ? 32   DT  I O2    1 
ATOM   8319  N  N3    . DT  I  5 106 ? 4.298   -31.276 11.612 1.00 123.01 ? 32   DT  I N3    1 
ATOM   8320  C  C4    . DT  I  5 106 ? 3.763   -30.167 12.247 1.00 122.93 ? 32   DT  I C4    1 
ATOM   8321  O  O4    . DT  I  5 106 ? 2.931   -30.283 13.140 1.00 122.97 ? 32   DT  I O4    1 
ATOM   8322  C  C5    . DT  I  5 106 ? 4.253   -28.884 11.784 1.00 122.93 ? 32   DT  I C5    1 
ATOM   8323  C  C7    . DT  I  5 106 ? 3.762   -27.595 12.380 1.00 122.92 ? 32   DT  I C7    1 
ATOM   8324  C  C6    . DT  I  5 106 ? 5.165   -28.884 10.801 1.00 122.97 ? 32   DT  I C6    1 
ATOM   8325  P  P     . DT  I  5 107 ? 7.163   -29.742 5.027  1.00 124.23 ? 33   DT  I P     1 
ATOM   8326  O  OP1   . DT  I  5 107 ? 8.052   -30.148 3.915  1.00 124.46 ? 33   DT  I OP1   1 
ATOM   8327  O  OP2   . DT  I  5 107 ? 6.303   -28.547 4.877  1.00 124.00 ? 33   DT  I OP2   1 
ATOM   8328  O  "O5'" . DT  I  5 107 ? 6.256   -31.003 5.409  1.00 125.09 ? 33   DT  I "O5'" 1 
ATOM   8329  C  "C5'" . DT  I  5 107 ? 6.853   -32.263 5.752  1.00 126.56 ? 33   DT  I "C5'" 1 
ATOM   8330  C  "C4'" . DT  I  5 107 ? 5.822   -33.384 5.730  1.00 127.82 ? 33   DT  I "C4'" 1 
ATOM   8331  O  "O4'" . DT  I  5 107 ? 4.992   -33.348 6.928  1.00 128.59 ? 33   DT  I "O4'" 1 
ATOM   8332  C  "C3'" . DT  I  5 107 ? 4.860   -33.338 4.547  1.00 127.98 ? 33   DT  I "C3'" 1 
ATOM   8333  O  "O3'" . DT  I  5 107 ? 4.685   -34.650 4.030  1.00 127.40 ? 33   DT  I "O3'" 1 
ATOM   8334  C  "C2'" . DT  I  5 107 ? 3.575   -32.763 5.148  1.00 128.50 ? 33   DT  I "C2'" 1 
ATOM   8335  C  "C1'" . DT  I  5 107 ? 3.622   -33.309 6.573  1.00 128.77 ? 33   DT  I "C1'" 1 
ATOM   8336  N  N1    . DT  I  5 107 ? 2.865   -32.484 7.575  1.00 128.92 ? 33   DT  I N1    1 
ATOM   8337  C  C2    . DT  I  5 107 ? 2.104   -33.123 8.543  1.00 129.03 ? 33   DT  I C2    1 
ATOM   8338  O  O2    . DT  I  5 107 ? 2.005   -34.340 8.640  1.00 128.91 ? 33   DT  I O2    1 
ATOM   8339  N  N3    . DT  I  5 107 ? 1.453   -32.264 9.405  1.00 129.15 ? 33   DT  I N3    1 
ATOM   8340  C  C4    . DT  I  5 107 ? 1.484   -30.874 9.396  1.00 128.99 ? 33   DT  I C4    1 
ATOM   8341  O  O4    . DT  I  5 107 ? 0.862   -30.206 10.217 1.00 128.86 ? 33   DT  I O4    1 
ATOM   8342  C  C5    . DT  I  5 107 ? 2.297   -30.274 8.357  1.00 129.02 ? 33   DT  I C5    1 
ATOM   8343  C  C7    . DT  I  5 107 ? 2.419   -28.780 8.234  1.00 128.84 ? 33   DT  I C7    1 
ATOM   8344  C  C6    . DT  I  5 107 ? 2.938   -31.098 7.512  1.00 128.90 ? 33   DT  I C6    1 
ATOM   8345  P  P     . DC  I  5 108 ? 3.723   -34.909 2.774  1.00 127.05 ? 34   DC  I P     1 
ATOM   8346  O  OP1   . DC  I  5 108 ? 4.234   -36.133 2.108  1.00 127.14 ? 34   DC  I OP1   1 
ATOM   8347  O  OP2   . DC  I  5 108 ? 3.592   -33.648 2.000  1.00 126.46 ? 34   DC  I OP2   1 
ATOM   8348  O  "O5'" . DC  I  5 108 ? 2.285   -35.217 3.434  1.00 125.76 ? 34   DC  I "O5'" 1 
ATOM   8349  C  "C5'" . DC  I  5 108 ? 2.091   -36.021 4.618  1.00 123.04 ? 34   DC  I "C5'" 1 
ATOM   8350  C  "C4'" . DC  I  5 108 ? 0.617   -36.048 5.008  1.00 121.14 ? 34   DC  I "C4'" 1 
ATOM   8351  O  "O4'" . DC  I  5 108 ? 0.230   -34.894 5.803  1.00 120.69 ? 34   DC  I "O4'" 1 
ATOM   8352  C  "C3'" . DC  I  5 108 ? -0.352  -36.056 3.832  1.00 120.00 ? 34   DC  I "C3'" 1 
ATOM   8353  O  "O3'" . DC  I  5 108 ? -1.354  -36.972 4.128  1.00 118.62 ? 34   DC  I "O3'" 1 
ATOM   8354  C  "C2'" . DC  I  5 108 ? -0.940  -34.652 3.779  1.00 120.03 ? 34   DC  I "C2'" 1 
ATOM   8355  C  "C1'" . DC  I  5 108 ? -0.952  -34.319 5.265  1.00 120.06 ? 34   DC  I "C1'" 1 
ATOM   8356  N  N1    . DC  I  5 108 ? -0.940  -32.865 5.601  1.00 119.95 ? 34   DC  I N1    1 
ATOM   8357  C  C2    . DC  I  5 108 ? -1.380  -32.473 6.873  1.00 119.91 ? 34   DC  I C2    1 
ATOM   8358  O  O2    . DC  I  5 108 ? -1.775  -33.340 7.666  1.00 119.69 ? 34   DC  I O2    1 
ATOM   8359  N  N3    . DC  I  5 108 ? -1.359  -31.148 7.191  1.00 119.89 ? 34   DC  I N3    1 
ATOM   8360  C  C4    . DC  I  5 108 ? -0.923  -30.243 6.303  1.00 119.73 ? 34   DC  I C4    1 
ATOM   8361  N  N4    . DC  I  5 108 ? -0.924  -28.958 6.669  1.00 119.43 ? 34   DC  I N4    1 
ATOM   8362  C  C5    . DC  I  5 108 ? -0.467  -30.621 5.000  1.00 119.72 ? 34   DC  I C5    1 
ATOM   8363  C  C6    . DC  I  5 108 ? -0.490  -31.929 4.700  1.00 119.96 ? 34   DC  I C6    1 
ATOM   8364  P  P     . DC  I  5 109 ? -1.792  -37.954 2.969  1.00 117.41 ? 35   DC  I P     1 
ATOM   8365  O  OP1   . DC  I  5 109 ? -0.960  -39.171 3.111  1.00 117.08 ? 35   DC  I OP1   1 
ATOM   8366  O  OP2   . DC  I  5 109 ? -1.764  -37.166 1.712  1.00 117.16 ? 35   DC  I OP2   1 
ATOM   8367  O  "O5'" . DC  I  5 109 ? -3.320  -38.284 3.347  1.00 116.82 ? 35   DC  I "O5'" 1 
ATOM   8368  C  "C5'" . DC  I  5 109 ? -3.681  -38.867 4.616  1.00 115.39 ? 35   DC  I "C5'" 1 
ATOM   8369  C  "C4'" . DC  I  5 109 ? -4.873  -38.161 5.250  1.00 114.46 ? 35   DC  I "C4'" 1 
ATOM   8370  O  "O4'" . DC  I  5 109 ? -4.537  -36.772 5.498  1.00 114.28 ? 35   DC  I "O4'" 1 
ATOM   8371  C  "C3'" . DC  I  5 109 ? -6.172  -38.143 4.428  1.00 114.03 ? 35   DC  I "C3'" 1 
ATOM   8372  O  "O3'" . DC  I  5 109 ? -7.282  -38.643 5.186  1.00 113.22 ? 35   DC  I "O3'" 1 
ATOM   8373  C  "C2'" . DC  I  5 109 ? -6.384  -36.670 4.093  1.00 113.87 ? 35   DC  I "C2'" 1 
ATOM   8374  C  "C1'" . DC  I  5 109 ? -5.714  -36.024 5.300  1.00 113.87 ? 35   DC  I "C1'" 1 
ATOM   8375  N  N1    . DC  I  5 109 ? -5.385  -34.573 5.157  1.00 113.87 ? 35   DC  I N1    1 
ATOM   8376  C  C2    . DC  I  5 109 ? -5.557  -33.733 6.262  1.00 113.97 ? 35   DC  I C2    1 
ATOM   8377  O  O2    . DC  I  5 109 ? -5.968  -34.219 7.321  1.00 114.13 ? 35   DC  I O2    1 
ATOM   8378  N  N3    . DC  I  5 109 ? -5.268  -32.411 6.143  1.00 113.95 ? 35   DC  I N3    1 
ATOM   8379  C  C4    . DC  I  5 109 ? -4.828  -31.924 4.983  1.00 113.72 ? 35   DC  I C4    1 
ATOM   8380  N  N4    . DC  I  5 109 ? -4.560  -30.619 4.913  1.00 113.67 ? 35   DC  I N4    1 
ATOM   8381  C  C5    . DC  I  5 109 ? -4.646  -32.761 3.843  1.00 113.95 ? 35   DC  I C5    1 
ATOM   8382  C  C6    . DC  I  5 109 ? -4.931  -34.064 3.973  1.00 114.02 ? 35   DC  I C6    1 
ATOM   8383  P  P     . DA  I  5 110 ? -7.688  -40.195 5.147  1.00 112.49 ? 36   DA  I P     1 
ATOM   8384  O  OP1   . DA  I  5 110 ? -6.466  -41.006 5.408  1.00 111.96 ? 36   DA  I OP1   1 
ATOM   8385  O  OP2   . DA  I  5 110 ? -8.506  -40.398 3.930  1.00 111.89 ? 36   DA  I OP2   1 
ATOM   8386  O  "O5'" . DA  I  5 110 ? -8.666  -40.345 6.404  1.00 111.80 ? 36   DA  I "O5'" 1 
ATOM   8387  C  "C5'" . DA  I  5 110 ? -8.157  -40.310 7.746  1.00 110.22 ? 36   DA  I "C5'" 1 
ATOM   8388  C  "C4'" . DA  I  5 110 ? -9.025  -39.430 8.635  1.00 108.97 ? 36   DA  I "C4'" 1 
ATOM   8389  O  "O4'" . DA  I  5 110 ? -8.885  -38.037 8.248  1.00 108.73 ? 36   DA  I "O4'" 1 
ATOM   8390  C  "C3'" . DA  I  5 110 ? -10.524 -39.723 8.600  1.00 108.21 ? 36   DA  I "C3'" 1 
ATOM   8391  O  "O3'" . DA  I  5 110 ? -11.036 -39.655 9.949  1.00 106.84 ? 36   DA  I "O3'" 1 
ATOM   8392  C  "C2'" . DA  I  5 110 ? -11.073 -38.652 7.647  1.00 108.31 ? 36   DA  I "C2'" 1 
ATOM   8393  C  "C1'" . DA  I  5 110 ? -10.155 -37.475 7.958  1.00 108.57 ? 36   DA  I "C1'" 1 
ATOM   8394  N  N9    . DA  I  5 110 ? -9.947  -36.523 6.869  1.00 108.46 ? 36   DA  I N9    1 
ATOM   8395  C  C8    . DA  I  5 110 ? -10.015 -36.762 5.527  1.00 108.49 ? 36   DA  I C8    1 
ATOM   8396  N  N7    . DA  I  5 110 ? -9.755  -35.707 4.794  1.00 108.64 ? 36   DA  I N7    1 
ATOM   8397  C  C5    . DA  I  5 110 ? -9.490  -34.704 5.712  1.00 108.60 ? 36   DA  I C5    1 
ATOM   8398  C  C6    . DA  I  5 110 ? -9.139  -33.335 5.577  1.00 108.79 ? 36   DA  I C6    1 
ATOM   8399  N  N6    . DA  I  5 110 ? -8.997  -32.708 4.401  1.00 108.47 ? 36   DA  I N6    1 
ATOM   8400  N  N1    . DA  I  5 110 ? -8.945  -32.619 6.711  1.00 108.67 ? 36   DA  I N1    1 
ATOM   8401  C  C2    . DA  I  5 110 ? -9.091  -33.232 7.895  1.00 108.49 ? 36   DA  I C2    1 
ATOM   8402  N  N3    . DA  I  5 110 ? -9.411  -34.505 8.142  1.00 108.43 ? 36   DA  I N3    1 
ATOM   8403  C  C4    . DA  I  5 110 ? -9.602  -35.195 7.001  1.00 108.47 ? 36   DA  I C4    1 
ATOM   8404  P  P     . DA  I  5 111 ? -12.600 -39.503 10.296 1.00 105.96 ? 37   DA  I P     1 
ATOM   8405  O  OP1   . DA  I  5 111 ? -12.836 -40.016 11.670 1.00 105.92 ? 37   DA  I OP1   1 
ATOM   8406  O  OP2   . DA  I  5 111 ? -13.396 -40.049 9.165  1.00 105.23 ? 37   DA  I OP2   1 
ATOM   8407  O  "O5'" . DA  I  5 111 ? -12.776 -37.906 10.310 1.00 104.22 ? 37   DA  I "O5'" 1 
ATOM   8408  C  "C5'" . DA  I  5 111 ? -12.207 -37.057 11.322 1.00 100.72 ? 37   DA  I "C5'" 1 
ATOM   8409  C  "C4'" . DA  I  5 111 ? -12.810 -35.661 11.230 1.00 98.35  ? 37   DA  I "C4'" 1 
ATOM   8410  O  "O4'" . DA  I  5 111 ? -12.444 -35.057 9.961  1.00 97.73  ? 37   DA  I "O4'" 1 
ATOM   8411  C  "C3'" . DA  I  5 111 ? -14.338 -35.591 11.283 1.00 97.03  ? 37   DA  I "C3'" 1 
ATOM   8412  O  "O3'" . DA  I  5 111 ? -14.735 -34.466 12.066 1.00 95.68  ? 37   DA  I "O3'" 1 
ATOM   8413  C  "C2'" . DA  I  5 111 ? -14.725 -35.416 9.814  1.00 96.76  ? 37   DA  I "C2'" 1 
ATOM   8414  C  "C1'" . DA  I  5 111 ? -13.602 -34.492 9.384  1.00 96.59  ? 37   DA  I "C1'" 1 
ATOM   8415  N  N9    . DA  I  5 111 ? -13.442 -34.354 7.944  1.00 96.23  ? 37   DA  I N9    1 
ATOM   8416  C  C8    . DA  I  5 111 ? -13.819 -35.238 6.981  1.00 96.21  ? 37   DA  I C8    1 
ATOM   8417  N  N7    . DA  I  5 111 ? -13.543 -34.823 5.771  1.00 96.50  ? 37   DA  I N7    1 
ATOM   8418  C  C5    . DA  I  5 111 ? -12.948 -33.585 5.942  1.00 96.25  ? 37   DA  I C5    1 
ATOM   8419  C  C6    . DA  I  5 111 ? -12.422 -32.620 5.042  1.00 96.51  ? 37   DA  I C6    1 
ATOM   8420  N  N6    . DA  I  5 111 ? -12.408 -32.758 3.709  1.00 96.28  ? 37   DA  I N6    1 
ATOM   8421  N  N1    . DA  I  5 111 ? -11.899 -31.486 5.562  1.00 96.52  ? 37   DA  I N1    1 
ATOM   8422  C  C2    . DA  I  5 111 ? -11.901 -31.330 6.893  1.00 96.47  ? 37   DA  I C2    1 
ATOM   8423  N  N3    . DA  I  5 111 ? -12.366 -32.164 7.827  1.00 96.46  ? 37   DA  I N3    1 
ATOM   8424  C  C4    . DA  I  5 111 ? -12.881 -33.283 7.286  1.00 96.21  ? 37   DA  I C4    1 
ATOM   8425  P  P     . DA  I  5 112 ? -16.275 -34.179 12.413 1.00 94.80  ? 38   DA  I P     1 
ATOM   8426  O  OP1   . DA  I  5 112 ? -16.477 -34.720 13.771 1.00 94.82  ? 38   DA  I OP1   1 
ATOM   8427  O  OP2   . DA  I  5 112 ? -17.172 -34.620 11.323 1.00 94.36  ? 38   DA  I OP2   1 
ATOM   8428  O  "O5'" . DA  I  5 112 ? -16.357 -32.578 12.420 1.00 94.25  ? 38   DA  I "O5'" 1 
ATOM   8429  C  "C5'" . DA  I  5 112 ? -15.267 -31.763 12.858 1.00 93.20  ? 38   DA  I "C5'" 1 
ATOM   8430  C  "C4'" . DA  I  5 112 ? -15.208 -30.461 12.076 1.00 92.69  ? 38   DA  I "C4'" 1 
ATOM   8431  O  "O4'" . DA  I  5 112 ? -14.587 -30.743 10.799 1.00 92.94  ? 38   DA  I "O4'" 1 
ATOM   8432  C  "C3'" . DA  I  5 112 ? -16.554 -29.809 11.769 1.00 92.39  ? 38   DA  I "C3'" 1 
ATOM   8433  O  "O3'" . DA  I  5 112 ? -16.761 -28.650 12.550 1.00 91.63  ? 38   DA  I "O3'" 1 
ATOM   8434  C  "C2'" . DA  I  5 112 ? -16.477 -29.396 10.304 1.00 92.99  ? 38   DA  I "C2'" 1 
ATOM   8435  C  "C1'" . DA  I  5 112 ? -15.170 -29.961 9.781  1.00 93.48  ? 38   DA  I "C1'" 1 
ATOM   8436  N  N9    . DA  I  5 112 ? -15.454 -30.791 8.620  1.00 93.70  ? 38   DA  I N9    1 
ATOM   8437  C  C8    . DA  I  5 112 ? -16.055 -32.022 8.626  1.00 94.03  ? 38   DA  I C8    1 
ATOM   8438  N  N7    . DA  I  5 112 ? -16.212 -32.556 7.437  1.00 93.98  ? 38   DA  I N7    1 
ATOM   8439  C  C5    . DA  I  5 112 ? -15.689 -31.599 6.599  1.00 93.61  ? 38   DA  I C5    1 
ATOM   8440  C  C6    . DA  I  5 112 ? -15.564 -31.566 5.208  1.00 93.81  ? 38   DA  I C6    1 
ATOM   8441  N  N6    . DA  I  5 112 ? -15.985 -32.570 4.435  1.00 93.71  ? 38   DA  I N6    1 
ATOM   8442  N  N1    . DA  I  5 112 ? -14.992 -30.469 4.659  1.00 94.23  ? 38   DA  I N1    1 
ATOM   8443  C  C2    . DA  I  5 112 ? -14.584 -29.471 5.461  1.00 93.79  ? 38   DA  I C2    1 
ATOM   8444  N  N3    . DA  I  5 112 ? -14.655 -29.394 6.791  1.00 93.31  ? 38   DA  I N3    1 
ATOM   8445  C  C4    . DA  I  5 112 ? -15.222 -30.500 7.300  1.00 93.52  ? 38   DA  I C4    1 
ATOM   8446  P  P     . DT  I  5 113 ? -18.126 -27.829 12.421 1.00 91.39  ? 39   DT  I P     1 
ATOM   8447  O  OP1   . DT  I  5 113 ? -18.266 -27.005 13.638 1.00 91.18  ? 39   DT  I OP1   1 
ATOM   8448  O  OP2   . DT  I  5 113 ? -19.207 -28.743 12.006 1.00 91.03  ? 39   DT  I OP2   1 
ATOM   8449  O  "O5'" . DT  I  5 113 ? -17.865 -26.872 11.183 1.00 95.01  ? 39   DT  I "O5'" 1 
ATOM   8450  C  "C5'" . DT  I  5 113 ? -16.846 -25.880 11.239 1.00 99.98  ? 39   DT  I "C5'" 1 
ATOM   8451  C  "C4'" . DT  I  5 113 ? -16.759 -25.125 9.922  1.00 103.31 ? 39   DT  I "C4'" 1 
ATOM   8452  O  "O4'" . DT  I  5 113 ? -16.581 -26.056 8.822  1.00 104.31 ? 39   DT  I "O4'" 1 
ATOM   8453  C  "C3'" . DT  I  5 113 ? -17.964 -24.266 9.554  1.00 105.17 ? 39   DT  I "C3'" 1 
ATOM   8454  O  "O3'" . DT  I  5 113 ? -17.430 -23.060 9.029  1.00 108.07 ? 39   DT  I "O3'" 1 
ATOM   8455  C  "C2'" . DT  I  5 113 ? -18.711 -25.101 8.508  1.00 105.13 ? 39   DT  I "C2'" 1 
ATOM   8456  C  "C1'" . DT  I  5 113 ? -17.552 -25.820 7.816  1.00 105.17 ? 39   DT  I "C1'" 1 
ATOM   8457  N  N1    . DT  I  5 113 ? -17.835 -27.148 7.144  1.00 105.55 ? 39   DT  I N1    1 
ATOM   8458  C  C2    . DT  I  5 113 ? -17.446 -27.327 5.823  1.00 105.54 ? 39   DT  I C2    1 
ATOM   8459  O  O2    . DT  I  5 113 ? -16.903 -26.462 5.155  1.00 105.75 ? 39   DT  I O2    1 
ATOM   8460  N  N3    . DT  I  5 113 ? -17.725 -28.567 5.298  1.00 105.22 ? 39   DT  I N3    1 
ATOM   8461  C  C4    . DT  I  5 113 ? -18.333 -29.626 5.948  1.00 105.38 ? 39   DT  I C4    1 
ATOM   8462  O  O4    . DT  I  5 113 ? -18.530 -30.693 5.380  1.00 105.71 ? 39   DT  I O4    1 
ATOM   8463  C  C5    . DT  I  5 113 ? -18.713 -29.389 7.326  1.00 105.56 ? 39   DT  I C5    1 
ATOM   8464  C  C7    . DT  I  5 113 ? -19.385 -30.464 8.136  1.00 105.36 ? 39   DT  I C7    1 
ATOM   8465  C  C6    . DT  I  5 113 ? -18.447 -28.179 7.848  1.00 105.59 ? 39   DT  I C6    1 
ATOM   8466  P  P     . DA  I  5 114 ? -18.324 -21.814 8.574  1.00 110.19 ? 40   DA  I P     1 
ATOM   8467  O  OP1   . DA  I  5 114 ? -17.457 -20.608 8.613  1.00 110.07 ? 40   DA  I OP1   1 
ATOM   8468  O  OP2   . DA  I  5 114 ? -19.629 -21.858 9.288  1.00 109.48 ? 40   DA  I OP2   1 
ATOM   8469  O  "O5'" . DA  I  5 114 ? -18.589 -22.173 7.044  1.00 111.99 ? 40   DA  I "O5'" 1 
ATOM   8470  C  "C5'" . DA  I  5 114 ? -17.586 -22.112 6.027  1.00 113.92 ? 40   DA  I "C5'" 1 
ATOM   8471  C  "C4'" . DA  I  5 114 ? -18.296 -22.331 4.703  1.00 115.69 ? 40   DA  I "C4'" 1 
ATOM   8472  O  "O4'" . DA  I  5 114 ? -18.534 -23.754 4.507  1.00 115.23 ? 40   DA  I "O4'" 1 
ATOM   8473  C  "C3'" . DA  I  5 114 ? -19.673 -21.655 4.637  1.00 117.44 ? 40   DA  I "C3'" 1 
ATOM   8474  O  "O3'" . DA  I  5 114 ? -19.868 -20.975 3.375  1.00 120.44 ? 40   DA  I "O3'" 1 
ATOM   8475  C  "C2'" . DA  I  5 114 ? -20.640 -22.827 4.831  1.00 116.71 ? 40   DA  I "C2'" 1 
ATOM   8476  C  "C1'" . DA  I  5 114 ? -19.874 -23.905 4.071  1.00 115.66 ? 40   DA  I "C1'" 1 
ATOM   8477  N  N9    . DA  I  5 114 ? -20.355 -25.275 4.259  1.00 115.43 ? 40   DA  I N9    1 
ATOM   8478  C  C8    . DA  I  5 114 ? -20.724 -25.888 5.426  1.00 115.38 ? 40   DA  I C8    1 
ATOM   8479  N  N7    . DA  I  5 114 ? -21.116 -27.132 5.277  1.00 115.22 ? 40   DA  I N7    1 
ATOM   8480  C  C5    . DA  I  5 114 ? -21.002 -27.354 3.918  1.00 115.21 ? 40   DA  I C5    1 
ATOM   8481  C  C6    . DA  I  5 114 ? -21.265 -28.484 3.115  1.00 115.30 ? 40   DA  I C6    1 
ATOM   8482  N  N6    . DA  I  5 114 ? -21.718 -29.645 3.597  1.00 115.02 ? 40   DA  I N6    1 
ATOM   8483  N  N1    . DA  I  5 114 ? -21.043 -28.368 1.784  1.00 115.71 ? 40   DA  I N1    1 
ATOM   8484  C  C2    . DA  I  5 114 ? -20.591 -27.198 1.290  1.00 115.56 ? 40   DA  I C2    1 
ATOM   8485  N  N3    . DA  I  5 114 ? -20.304 -26.071 1.946  1.00 115.25 ? 40   DA  I N3    1 
ATOM   8486  C  C4    . DA  I  5 114 ? -20.536 -26.217 3.269  1.00 115.38 ? 40   DA  I C4    1 
ATOM   8487  P  P     . DC  I  5 115 ? -20.867 -19.722 3.159  1.00 122.41 ? 41   DC  I P     1 
ATOM   8488  O  OP1   . DC  I  5 115 ? -20.148 -18.798 2.249  1.00 122.69 ? 41   DC  I OP1   1 
ATOM   8489  O  OP2   . DC  I  5 115 ? -21.355 -19.223 4.473  1.00 121.97 ? 41   DC  I OP2   1 
ATOM   8490  O  "O5'" . DC  I  5 115 ? -22.114 -20.337 2.356  1.00 122.67 ? 41   DC  I "O5'" 1 
ATOM   8491  C  "C5'" . DC  I  5 115 ? -22.112 -21.709 2.020  1.00 123.70 ? 41   DC  I "C5'" 1 
ATOM   8492  C  "C4'" . DC  I  5 115 ? -22.834 -22.001 0.730  1.00 124.68 ? 41   DC  I "C4'" 1 
ATOM   8493  O  "O4'" . DC  I  5 115 ? -22.976 -23.439 0.622  1.00 124.53 ? 41   DC  I "O4'" 1 
ATOM   8494  C  "C3'" . DC  I  5 115 ? -24.234 -21.411 0.633  1.00 125.53 ? 41   DC  I "C3'" 1 
ATOM   8495  O  "O3'" . DC  I  5 115 ? -24.449 -21.011 -0.725 1.00 127.00 ? 41   DC  I "O3'" 1 
ATOM   8496  C  "C2'" . DC  I  5 115 ? -25.139 -22.554 1.102  1.00 125.05 ? 41   DC  I "C2'" 1 
ATOM   8497  C  "C1'" . DC  I  5 115 ? -24.339 -23.807 0.738  1.00 124.59 ? 41   DC  I "C1'" 1 
ATOM   8498  N  N1    . DC  I  5 115 ? -24.441 -24.937 1.729  1.00 124.49 ? 41   DC  I N1    1 
ATOM   8499  C  C2    . DC  I  5 115 ? -24.320 -26.268 1.287  1.00 124.32 ? 41   DC  I C2    1 
ATOM   8500  O  O2    . DC  I  5 115 ? -24.133 -26.513 0.088  1.00 123.98 ? 41   DC  I O2    1 
ATOM   8501  N  N3    . DC  I  5 115 ? -24.416 -27.272 2.200  1.00 124.34 ? 41   DC  I N3    1 
ATOM   8502  C  C4    . DC  I  5 115 ? -24.621 -26.996 3.492  1.00 124.16 ? 41   DC  I C4    1 
ATOM   8503  N  N4    . DC  I  5 115 ? -24.707 -28.024 4.337  1.00 124.08 ? 41   DC  I N4    1 
ATOM   8504  C  C5    . DC  I  5 115 ? -24.747 -25.655 3.966  1.00 124.15 ? 41   DC  I C5    1 
ATOM   8505  C  C6    . DC  I  5 115 ? -24.650 -24.671 3.060  1.00 124.50 ? 41   DC  I C6    1 
ATOM   8506  P  P     . DA  I  5 116 ? -25.851 -20.456 -1.262 1.00 128.01 ? 42   DA  I P     1 
ATOM   8507  O  OP1   . DA  I  5 116 ? -25.570 -19.655 -2.472 1.00 127.87 ? 42   DA  I OP1   1 
ATOM   8508  O  OP2   . DA  I  5 116 ? -26.574 -19.829 -0.134 1.00 127.53 ? 42   DA  I OP2   1 
ATOM   8509  O  "O5'" . DA  I  5 116 ? -26.627 -21.798 -1.679 1.00 129.46 ? 42   DA  I "O5'" 1 
ATOM   8510  C  "C5'" . DA  I  5 116 ? -26.087 -22.706 -2.646 1.00 131.62 ? 42   DA  I "C5'" 1 
ATOM   8511  C  "C4'" . DA  I  5 116 ? -26.961 -23.941 -2.828 1.00 133.69 ? 42   DA  I "C4'" 1 
ATOM   8512  O  "O4'" . DA  I  5 116 ? -26.726 -24.882 -1.742 1.00 134.63 ? 42   DA  I "O4'" 1 
ATOM   8513  C  "C3'" . DA  I  5 116 ? -28.477 -23.712 -2.868 1.00 134.86 ? 42   DA  I "C3'" 1 
ATOM   8514  O  "O3'" . DA  I  5 116 ? -29.053 -24.459 -3.951 1.00 136.01 ? 42   DA  I "O3'" 1 
ATOM   8515  C  "C2'" . DA  I  5 116 ? -28.938 -24.239 -1.509 1.00 135.12 ? 42   DA  I "C2'" 1 
ATOM   8516  C  "C1'" . DA  I  5 116 ? -27.977 -25.410 -1.333 1.00 135.36 ? 42   DA  I "C1'" 1 
ATOM   8517  N  N9    . DA  I  5 116 ? -27.925 -25.965 0.029  1.00 135.50 ? 42   DA  I N9    1 
ATOM   8518  C  C8    . DA  I  5 116 ? -27.801 -25.268 1.205  1.00 135.41 ? 42   DA  I C8    1 
ATOM   8519  N  N7    . DA  I  5 116 ? -27.788 -26.024 2.278  1.00 135.35 ? 42   DA  I N7    1 
ATOM   8520  C  C5    . DA  I  5 116 ? -27.917 -27.308 1.775  1.00 135.51 ? 42   DA  I C5    1 
ATOM   8521  C  C6    . DA  I  5 116 ? -27.970 -28.573 2.402  1.00 135.56 ? 42   DA  I C6    1 
ATOM   8522  N  N6    . DA  I  5 116 ? -27.895 -28.721 3.729  1.00 135.43 ? 42   DA  I N6    1 
ATOM   8523  N  N1    . DA  I  5 116 ? -28.100 -29.672 1.617  1.00 135.54 ? 42   DA  I N1    1 
ATOM   8524  C  C2    . DA  I  5 116 ? -28.176 -29.516 0.286  1.00 135.37 ? 42   DA  I C2    1 
ATOM   8525  N  N3    . DA  I  5 116 ? -28.136 -28.378 -0.415 1.00 135.47 ? 42   DA  I N3    1 
ATOM   8526  C  C4    . DA  I  5 116 ? -28.004 -27.298 0.390  1.00 135.49 ? 42   DA  I C4    1 
ATOM   8527  P  P     . DC  I  5 117 ? -30.582 -24.300 -4.438 1.00 136.62 ? 43   DC  I P     1 
ATOM   8528  O  OP1   . DC  I  5 117 ? -30.634 -23.154 -5.378 1.00 136.45 ? 43   DC  I OP1   1 
ATOM   8529  O  OP2   . DC  I  5 117 ? -31.485 -24.309 -3.260 1.00 136.26 ? 43   DC  I OP2   1 
ATOM   8530  O  "O5'" . DC  I  5 117 ? -30.826 -25.667 -5.256 1.00 136.76 ? 43   DC  I "O5'" 1 
ATOM   8531  C  "C5'" . DC  I  5 117 ? -30.185 -26.917 -4.900 1.00 136.63 ? 43   DC  I "C5'" 1 
ATOM   8532  C  "C4'" . DC  I  5 117 ? -31.091 -27.897 -4.149 1.00 136.58 ? 43   DC  I "C4'" 1 
ATOM   8533  O  "O4'" . DC  I  5 117 ? -30.704 -27.959 -2.741 1.00 136.88 ? 43   DC  I "O4'" 1 
ATOM   8534  C  "C3'" . DC  I  5 117 ? -32.606 -27.624 -4.168 1.00 136.07 ? 43   DC  I "C3'" 1 
ATOM   8535  O  "O3'" . DC  I  5 117 ? -33.334 -28.801 -4.575 1.00 134.89 ? 43   DC  I "O3'" 1 
ATOM   8536  C  "C2'" . DC  I  5 117 ? -32.905 -27.221 -2.724 1.00 136.27 ? 43   DC  I "C2'" 1 
ATOM   8537  C  "C1'" . DC  I  5 117 ? -31.892 -28.080 -1.977 1.00 136.53 ? 43   DC  I "C1'" 1 
ATOM   8538  N  N1    . DC  I  5 117 ? -31.700 -27.706 -0.523 1.00 136.61 ? 43   DC  I N1    1 
ATOM   8539  C  C2    . DC  I  5 117 ? -31.421 -28.708 0.432  1.00 136.47 ? 43   DC  I C2    1 
ATOM   8540  O  O2    . DC  I  5 117 ? -31.314 -29.893 0.071  1.00 136.17 ? 43   DC  I O2    1 
ATOM   8541  N  N3    . DC  I  5 117 ? -31.265 -28.342 1.738  1.00 136.27 ? 43   DC  I N3    1 
ATOM   8542  C  C4    . DC  I  5 117 ? -31.383 -27.057 2.100  1.00 136.25 ? 43   DC  I C4    1 
ATOM   8543  N  N4    . DC  I  5 117 ? -31.222 -26.744 3.387  1.00 136.08 ? 43   DC  I N4    1 
ATOM   8544  C  C5    . DC  I  5 117 ? -31.673 -26.029 1.151  1.00 136.36 ? 43   DC  I C5    1 
ATOM   8545  C  C6    . DC  I  5 117 ? -31.823 -26.395 -0.131 1.00 136.61 ? 43   DC  I C6    1 
ATOM   8546  P  P     . DT  I  5 118 ? -34.909 -29.032 -4.314 1.00 134.05 ? 44   DT  I P     1 
ATOM   8547  O  OP1   . DT  I  5 118 ? -35.403 -29.832 -5.459 1.00 134.26 ? 44   DT  I OP1   1 
ATOM   8548  O  OP2   . DT  I  5 118 ? -35.569 -27.746 -3.978 1.00 133.70 ? 44   DT  I OP2   1 
ATOM   8549  O  "O5'" . DT  I  5 118 ? -34.945 -29.953 -3.005 1.00 132.60 ? 44   DT  I "O5'" 1 
ATOM   8550  C  "C5'" . DT  I  5 118 ? -34.589 -31.335 -3.093 1.00 130.65 ? 44   DT  I "C5'" 1 
ATOM   8551  C  "C4'" . DT  I  5 118 ? -35.370 -32.193 -2.108 1.00 129.28 ? 44   DT  I "C4'" 1 
ATOM   8552  O  "O4'" . DT  I  5 118 ? -34.976 -31.894 -0.741 1.00 129.44 ? 44   DT  I "O4'" 1 
ATOM   8553  C  "C3'" . DT  I  5 118 ? -36.889 -32.058 -2.161 1.00 128.16 ? 44   DT  I "C3'" 1 
ATOM   8554  O  "O3'" . DT  I  5 118 ? -37.436 -33.396 -2.110 1.00 126.56 ? 44   DT  I "O3'" 1 
ATOM   8555  C  "C2'" . DT  I  5 118 ? -37.215 -31.129 -0.984 1.00 128.49 ? 44   DT  I "C2'" 1 
ATOM   8556  C  "C1'" . DT  I  5 118 ? -36.071 -31.382 0.006  1.00 129.03 ? 44   DT  I "C1'" 1 
ATOM   8557  N  N1    . DT  I  5 118 ? -35.621 -30.195 0.849  1.00 129.10 ? 44   DT  I N1    1 
ATOM   8558  C  C2    . DT  I  5 118 ? -35.139 -30.397 2.140  1.00 128.59 ? 44   DT  I C2    1 
ATOM   8559  O  O2    . DT  I  5 118 ? -35.042 -31.485 2.676  1.00 128.46 ? 44   DT  I O2    1 
ATOM   8560  N  N3    . DT  I  5 118 ? -34.760 -29.256 2.803  1.00 128.52 ? 44   DT  I N3    1 
ATOM   8561  C  C4    . DT  I  5 118 ? -34.810 -27.957 2.323  1.00 128.88 ? 44   DT  I C4    1 
ATOM   8562  O  O4    . DT  I  5 118 ? -34.442 -27.009 3.009  1.00 128.87 ? 44   DT  I O4    1 
ATOM   8563  C  C5    . DT  I  5 118 ? -35.321 -27.808 0.973  1.00 128.84 ? 44   DT  I C5    1 
ATOM   8564  C  C7    . DT  I  5 118 ? -35.433 -26.460 0.322  1.00 128.62 ? 44   DT  I C7    1 
ATOM   8565  C  C6    . DT  I  5 118 ? -35.692 -28.916 0.313  1.00 129.05 ? 44   DT  I C6    1 
ATOM   8566  P  P     . DT  I  5 119 ? -38.644 -33.918 -1.183 1.00 125.20 ? 45   DT  I P     1 
ATOM   8567  O  OP1   . DT  I  5 119 ? -38.818 -35.371 -1.449 1.00 124.39 ? 45   DT  I OP1   1 
ATOM   8568  O  OP2   . DT  I  5 119 ? -39.803 -32.999 -1.315 1.00 125.07 ? 45   DT  I OP2   1 
ATOM   8569  O  "O5'" . DT  I  5 119 ? -38.054 -33.717 0.291  1.00 123.36 ? 45   DT  I "O5'" 1 
ATOM   8570  C  "C5'" . DT  I  5 119 ? -37.141 -34.640 0.885  1.00 120.01 ? 45   DT  I "C5'" 1 
ATOM   8571  C  "C4'" . DT  I  5 119 ? -37.543 -34.825 2.337  1.00 117.18 ? 45   DT  I "C4'" 1 
ATOM   8572  O  "O4'" . DT  I  5 119 ? -37.257 -33.616 3.084  1.00 116.70 ? 45   DT  I "O4'" 1 
ATOM   8573  C  "C3'" . DT  I  5 119 ? -39.027 -35.114 2.541  1.00 115.27 ? 45   DT  I "C3'" 1 
ATOM   8574  O  "O3'" . DT  I  5 119 ? -39.107 -36.253 3.394  1.00 112.76 ? 45   DT  I "O3'" 1 
ATOM   8575  C  "C2'" . DT  I  5 119 ? -39.605 -33.812 3.110  1.00 115.47 ? 45   DT  I "C2'" 1 
ATOM   8576  C  "C1'" . DT  I  5 119 ? -38.399 -33.185 3.801  1.00 115.99 ? 45   DT  I "C1'" 1 
ATOM   8577  N  N1    . DT  I  5 119 ? -38.368 -31.684 3.827  1.00 115.87 ? 45   DT  I N1    1 
ATOM   8578  C  C2    . DT  I  5 119 ? -37.970 -31.023 4.980  1.00 115.93 ? 45   DT  I C2    1 
ATOM   8579  O  O2    . DT  I  5 119 ? -37.650 -31.580 6.016  1.00 115.85 ? 45   DT  I O2    1 
ATOM   8580  N  N3    . DT  I  5 119 ? -37.967 -29.653 4.888  1.00 115.91 ? 45   DT  I N3    1 
ATOM   8581  C  C4    . DT  I  5 119 ? -38.307 -28.887 3.787  1.00 115.85 ? 45   DT  I C4    1 
ATOM   8582  O  O4    . DT  I  5 119 ? -38.268 -27.662 3.817  1.00 115.65 ? 45   DT  I O4    1 
ATOM   8583  C  C5    . DT  I  5 119 ? -38.708 -29.636 2.617  1.00 115.99 ? 45   DT  I C5    1 
ATOM   8584  C  C7    . DT  I  5 119 ? -39.105 -28.926 1.356  1.00 116.09 ? 45   DT  I C7    1 
ATOM   8585  C  C6    . DT  I  5 119 ? -38.716 -30.976 2.690  1.00 116.01 ? 45   DT  I C6    1 
ATOM   8586  P  P     . DT  I  5 120 ? -40.368 -36.615 4.312  1.00 110.91 ? 46   DT  I P     1 
ATOM   8587  O  OP1   . DT  I  5 120 ? -40.291 -38.061 4.633  1.00 110.72 ? 46   DT  I OP1   1 
ATOM   8588  O  OP2   . DT  I  5 120 ? -41.609 -36.033 3.757  1.00 110.56 ? 46   DT  I OP2   1 
ATOM   8589  O  "O5'" . DT  I  5 120 ? -40.018 -35.789 5.629  1.00 110.47 ? 46   DT  I "O5'" 1 
ATOM   8590  C  "C5'" . DT  I  5 120 ? -38.828 -36.110 6.344  1.00 107.99 ? 46   DT  I "C5'" 1 
ATOM   8591  C  "C4'" . DT  I  5 120 ? -38.781 -35.342 7.642  1.00 105.47 ? 46   DT  I "C4'" 1 
ATOM   8592  O  "O4'" . DT  I  5 120 ? -38.849 -33.931 7.345  1.00 104.83 ? 46   DT  I "O4'" 1 
ATOM   8593  C  "C3'" . DT  I  5 120 ? -39.894 -35.659 8.629  1.00 103.91 ? 46   DT  I "C3'" 1 
ATOM   8594  O  "O3'" . DT  I  5 120 ? -39.231 -35.969 9.825  1.00 102.30 ? 46   DT  I "O3'" 1 
ATOM   8595  C  "C2'" . DT  I  5 120 ? -40.698 -34.365 8.724  1.00 103.91 ? 46   DT  I "C2'" 1 
ATOM   8596  C  "C1'" . DT  I  5 120 ? -39.668 -33.317 8.305  1.00 105.06 ? 46   DT  I "C1'" 1 
ATOM   8597  N  N1    . DT  I  5 120 ? -40.214 -32.085 7.670  1.00 105.52 ? 46   DT  I N1    1 
ATOM   8598  C  C2    . DT  I  5 120 ? -40.114 -30.879 8.344  1.00 105.59 ? 46   DT  I C2    1 
ATOM   8599  O  O2    . DT  I  5 120 ? -39.607 -30.750 9.447  1.00 105.55 ? 46   DT  I O2    1 
ATOM   8600  N  N3    . DT  I  5 120 ? -40.647 -29.807 7.670  1.00 105.69 ? 46   DT  I N3    1 
ATOM   8601  C  C4    . DT  I  5 120 ? -41.252 -29.819 6.421  1.00 105.59 ? 46   DT  I C4    1 
ATOM   8602  O  O4    . DT  I  5 120 ? -41.696 -28.796 5.910  1.00 105.50 ? 46   DT  I O4    1 
ATOM   8603  C  C5    . DT  I  5 120 ? -41.322 -31.108 5.767  1.00 105.81 ? 46   DT  I C5    1 
ATOM   8604  C  C7    . DT  I  5 120 ? -41.953 -31.239 4.409  1.00 105.55 ? 46   DT  I C7    1 
ATOM   8605  C  C6    . DT  I  5 120 ? -40.805 -32.166 6.415  1.00 105.87 ? 46   DT  I C6    1 
ATOM   8606  P  P     . DT  I  5 121 ? -39.890 -36.835 10.990 1.00 100.97 ? 47   DT  I P     1 
ATOM   8607  O  OP1   . DT  I  5 121 ? -38.941 -37.932 11.291 1.00 100.07 ? 47   DT  I OP1   1 
ATOM   8608  O  OP2   . DT  I  5 121 ? -41.310 -37.111 10.672 1.00 100.85 ? 47   DT  I OP2   1 
ATOM   8609  O  "O5'" . DT  I  5 121 ? -39.894 -35.805 12.216 1.00 99.73  ? 47   DT  I "O5'" 1 
ATOM   8610  C  "C5'" . DT  I  5 121 ? -38.979 -34.708 12.293 1.00 97.27  ? 47   DT  I "C5'" 1 
ATOM   8611  C  "C4'" . DT  I  5 121 ? -39.561 -33.598 13.149 1.00 95.73  ? 47   DT  I "C4'" 1 
ATOM   8612  O  "O4'" . DT  I  5 121 ? -40.065 -32.548 12.289 1.00 95.72  ? 47   DT  I "O4'" 1 
ATOM   8613  C  "C3'" . DT  I  5 121 ? -40.729 -33.984 14.062 1.00 94.83  ? 47   DT  I "C3'" 1 
ATOM   8614  O  "O3'" . DT  I  5 121 ? -40.577 -33.328 15.305 1.00 92.80  ? 47   DT  I "O3'" 1 
ATOM   8615  C  "C2'" . DT  I  5 121 ? -41.953 -33.439 13.331 1.00 95.15  ? 47   DT  I "C2'" 1 
ATOM   8616  C  "C1'" . DT  I  5 121 ? -41.344 -32.165 12.759 1.00 96.12  ? 47   DT  I "C1'" 1 
ATOM   8617  N  N1    . DT  I  5 121 ? -42.085 -31.532 11.628 1.00 96.54  ? 47   DT  I N1    1 
ATOM   8618  C  C2    . DT  I  5 121 ? -42.042 -30.158 11.502 1.00 96.41  ? 47   DT  I C2    1 
ATOM   8619  O  O2    . DT  I  5 121 ? -41.444 -29.432 12.272 1.00 96.55  ? 47   DT  I O2    1 
ATOM   8620  N  N3    . DT  I  5 121 ? -42.741 -29.658 10.431 1.00 96.53  ? 47   DT  I N3    1 
ATOM   8621  C  C4    . DT  I  5 121 ? -43.463 -30.383 9.493  1.00 96.65  ? 47   DT  I C4    1 
ATOM   8622  O  O4    . DT  I  5 121 ? -44.057 -29.827 8.575  1.00 96.68  ? 47   DT  I O4    1 
ATOM   8623  C  C5    . DT  I  5 121 ? -43.466 -31.820 9.678  1.00 96.69  ? 47   DT  I C5    1 
ATOM   8624  C  C7    . DT  I  5 121 ? -44.206 -32.723 8.732  1.00 96.45  ? 47   DT  I C7    1 
ATOM   8625  C  C6    . DT  I  5 121 ? -42.785 -32.317 10.722 1.00 96.93  ? 47   DT  I C6    1 
ATOM   8626  P  P     . DG  I  5 122 ? -40.285 -34.125 16.652 1.00 90.94  ? 48   DG  I P     1 
ATOM   8627  O  OP1   . DG  I  5 122 ? -39.048 -34.931 16.522 1.00 90.46  ? 48   DG  I OP1   1 
ATOM   8628  O  OP2   . DG  I  5 122 ? -41.563 -34.737 17.063 1.00 90.76  ? 48   DG  I OP2   1 
ATOM   8629  O  "O5'" . DG  I  5 122 ? -39.985 -32.931 17.659 1.00 91.12  ? 48   DG  I "O5'" 1 
ATOM   8630  C  "C5'" . DG  I  5 122 ? -39.191 -31.826 17.244 1.00 90.80  ? 48   DG  I "C5'" 1 
ATOM   8631  C  "C4'" . DG  I  5 122 ? -39.820 -30.506 17.662 1.00 90.83  ? 48   DG  I "C4'" 1 
ATOM   8632  O  "O4'" . DG  I  5 122 ? -40.786 -30.067 16.677 1.00 91.97  ? 48   DG  I "O4'" 1 
ATOM   8633  C  "C3'" . DG  I  5 122 ? -40.581 -30.462 18.980 1.00 90.14  ? 48   DG  I "C3'" 1 
ATOM   8634  O  "O3'" . DG  I  5 122 ? -40.444 -29.143 19.453 1.00 88.33  ? 48   DG  I "O3'" 1 
ATOM   8635  C  "C2'" . DG  I  5 122 ? -42.022 -30.733 18.560 1.00 91.24  ? 48   DG  I "C2'" 1 
ATOM   8636  C  "C1'" . DG  I  5 122 ? -42.070 -29.923 17.270 1.00 93.22  ? 48   DG  I "C1'" 1 
ATOM   8637  N  N9    . DG  I  5 122 ? -43.039 -30.350 16.258 1.00 94.04  ? 48   DG  I N9    1 
ATOM   8638  C  C8    . DG  I  5 122 ? -43.528 -31.617 16.026 1.00 94.13  ? 48   DG  I C8    1 
ATOM   8639  N  N7    . DG  I  5 122 ? -44.366 -31.680 15.027 1.00 94.17  ? 48   DG  I N7    1 
ATOM   8640  C  C5    . DG  I  5 122 ? -44.432 -30.376 14.557 1.00 94.24  ? 48   DG  I C5    1 
ATOM   8641  C  C6    . DG  I  5 122 ? -45.176 -29.830 13.486 1.00 93.98  ? 48   DG  I C6    1 
ATOM   8642  O  O6    . DG  I  5 122 ? -45.949 -30.429 12.726 1.00 93.98  ? 48   DG  I O6    1 
ATOM   8643  N  N1    . DG  I  5 122 ? -44.964 -28.452 13.347 1.00 93.96  ? 48   DG  I N1    1 
ATOM   8644  C  C2    . DG  I  5 122 ? -44.127 -27.696 14.139 1.00 93.89  ? 48   DG  I C2    1 
ATOM   8645  N  N2    . DG  I  5 122 ? -44.034 -26.385 13.866 1.00 93.80  ? 48   DG  I N2    1 
ATOM   8646  N  N3    . DG  I  5 122 ? -43.420 -28.202 15.141 1.00 94.33  ? 48   DG  I N3    1 
ATOM   8647  C  C4    . DG  I  5 122 ? -43.617 -29.543 15.296 1.00 94.50  ? 48   DG  I C4    1 
ATOM   8648  P  P     . DG  I  5 123 ? -40.722 -28.747 20.968 1.00 86.53  ? 49   DG  I P     1 
ATOM   8649  O  OP1   . DG  I  5 123 ? -39.425 -28.269 21.490 1.00 86.62  ? 49   DG  I OP1   1 
ATOM   8650  O  OP2   . DG  I  5 123 ? -41.452 -29.841 21.638 1.00 86.52  ? 49   DG  I OP2   1 
ATOM   8651  O  "O5'" . DG  I  5 123 ? -41.743 -27.527 20.861 1.00 86.74  ? 49   DG  I "O5'" 1 
ATOM   8652  C  "C5'" . DG  I  5 123 ? -41.349 -26.320 20.223 1.00 87.93  ? 49   DG  I "C5'" 1 
ATOM   8653  C  "C4'" . DG  I  5 123 ? -42.542 -25.569 19.653 1.00 88.72  ? 49   DG  I "C4'" 1 
ATOM   8654  O  "O4'" . DG  I  5 123 ? -43.202 -26.322 18.604 1.00 88.60  ? 49   DG  I "O4'" 1 
ATOM   8655  C  "C3'" . DG  I  5 123 ? -43.624 -25.215 20.659 1.00 89.00  ? 49   DG  I "C3'" 1 
ATOM   8656  O  "O3'" . DG  I  5 123 ? -43.740 -23.829 20.603 1.00 91.04  ? 49   DG  I "O3'" 1 
ATOM   8657  C  "C2'" . DG  I  5 123 ? -44.888 -25.897 20.151 1.00 88.40  ? 49   DG  I "C2'" 1 
ATOM   8658  C  "C1'" . DG  I  5 123 ? -44.585 -26.063 18.670 1.00 88.37  ? 49   DG  I "C1'" 1 
ATOM   8659  N  N9    . DG  I  5 123 ? -45.263 -27.180 18.016 1.00 88.52  ? 49   DG  I N9    1 
ATOM   8660  C  C8    . DG  I  5 123 ? -45.174 -28.519 18.323 1.00 88.66  ? 49   DG  I C8    1 
ATOM   8661  N  N7    . DG  I  5 123 ? -45.886 -29.296 17.556 1.00 88.42  ? 49   DG  I N7    1 
ATOM   8662  C  C5    . DG  I  5 123 ? -46.484 -28.409 16.678 1.00 88.31  ? 49   DG  I C5    1 
ATOM   8663  C  C6    . DG  I  5 123 ? -47.369 -28.656 15.614 1.00 88.30  ? 49   DG  I C6    1 
ATOM   8664  O  O6    . DG  I  5 123 ? -47.806 -29.746 15.231 1.00 88.73  ? 49   DG  I O6    1 
ATOM   8665  N  N1    . DG  I  5 123 ? -47.744 -27.487 14.961 1.00 88.56  ? 49   DG  I N1    1 
ATOM   8666  C  C2    . DG  I  5 123 ? -47.316 -26.226 15.296 1.00 88.56  ? 49   DG  I C2    1 
ATOM   8667  N  N2    . DG  I  5 123 ? -47.780 -25.212 14.555 1.00 88.46  ? 49   DG  I N2    1 
ATOM   8668  N  N3    . DG  I  5 123 ? -46.487 -25.978 16.297 1.00 88.88  ? 49   DG  I N3    1 
ATOM   8669  C  C4    . DG  I  5 123 ? -46.112 -27.111 16.941 1.00 88.59  ? 49   DG  I C4    1 
ATOM   8670  P  P     . DT  I  5 124 ? -44.606 -23.044 21.677 1.00 93.14  ? 50   DT  I P     1 
ATOM   8671  O  OP1   . DT  I  5 124 ? -43.871 -21.795 22.001 1.00 93.04  ? 50   DT  I OP1   1 
ATOM   8672  O  OP2   . DT  I  5 124 ? -45.035 -23.985 22.736 1.00 92.33  ? 50   DT  I OP2   1 
ATOM   8673  O  "O5'" . DT  I  5 124 ? -45.912 -22.682 20.832 1.00 96.33  ? 50   DT  I "O5'" 1 
ATOM   8674  C  "C5'" . DT  I  5 124 ? -45.836 -21.937 19.615 1.00 100.16 ? 50   DT  I "C5'" 1 
ATOM   8675  C  "C4'" . DT  I  5 124 ? -47.183 -21.958 18.914 1.00 103.12 ? 50   DT  I "C4'" 1 
ATOM   8676  O  "O4'" . DT  I  5 124 ? -47.446 -23.299 18.430 1.00 103.13 ? 50   DT  I "O4'" 1 
ATOM   8677  C  "C3'" . DT  I  5 124 ? -48.381 -21.562 19.782 1.00 105.35 ? 50   DT  I "C3'" 1 
ATOM   8678  O  "O3'" . DT  I  5 124 ? -49.071 -20.477 19.140 1.00 109.14 ? 50   DT  I "O3'" 1 
ATOM   8679  C  "C2'" . DT  I  5 124 ? -49.217 -22.844 19.886 1.00 104.40 ? 50   DT  I "C2'" 1 
ATOM   8680  C  "C1'" . DT  I  5 124 ? -48.812 -23.589 18.616 1.00 103.62 ? 50   DT  I "C1'" 1 
ATOM   8681  N  N1    . DT  I  5 124 ? -48.969 -25.082 18.619 1.00 103.60 ? 50   DT  I N1    1 
ATOM   8682  C  C2    . DT  I  5 124 ? -49.669 -25.691 17.587 1.00 103.60 ? 50   DT  I C2    1 
ATOM   8683  O  O2    . DT  I  5 124 ? -50.184 -25.083 16.669 1.00 103.90 ? 50   DT  I O2    1 
ATOM   8684  N  N3    . DT  I  5 124 ? -49.762 -27.058 17.652 1.00 103.17 ? 50   DT  I N3    1 
ATOM   8685  C  C4    . DT  I  5 124 ? -49.230 -27.865 18.634 1.00 103.51 ? 50   DT  I C4    1 
ATOM   8686  O  O4    . DT  I  5 124 ? -49.369 -29.082 18.610 1.00 103.66 ? 50   DT  I O4    1 
ATOM   8687  C  C5    . DT  I  5 124 ? -48.506 -27.177 19.683 1.00 103.70 ? 50   DT  I C5    1 
ATOM   8688  C  C7    . DT  I  5 124 ? -47.890 -27.958 20.803 1.00 103.76 ? 50   DT  I C7    1 
ATOM   8689  C  C6    . DT  I  5 124 ? -48.407 -25.838 19.631 1.00 103.50 ? 50   DT  I C6    1 
ATOM   8690  P  P     . DA  I  5 125 ? -49.964 -19.378 19.909 1.00 112.01 ? 51   DA  I P     1 
ATOM   8691  O  OP1   . DA  I  5 125 ? -49.402 -18.051 19.546 1.00 111.66 ? 51   DA  I OP1   1 
ATOM   8692  O  OP2   . DA  I  5 125 ? -50.117 -19.771 21.334 1.00 111.53 ? 51   DA  I OP2   1 
ATOM   8693  O  "O5'" . DA  I  5 125 ? -51.411 -19.524 19.220 1.00 113.30 ? 51   DA  I "O5'" 1 
ATOM   8694  C  "C5'" . DA  I  5 125 ? -51.561 -20.330 18.049 1.00 115.69 ? 51   DA  I "C5'" 1 
ATOM   8695  C  "C4'" . DA  I  5 125 ? -52.887 -21.074 17.956 1.00 117.45 ? 51   DA  I "C4'" 1 
ATOM   8696  O  "O4'" . DA  I  5 125 ? -52.666 -22.512 17.959 1.00 117.52 ? 51   DA  I "O4'" 1 
ATOM   8697  C  "C3'" . DA  I  5 125 ? -53.947 -20.811 19.024 1.00 118.81 ? 51   DA  I "C3'" 1 
ATOM   8698  O  "O3'" . DA  I  5 125 ? -55.108 -20.420 18.289 1.00 120.74 ? 51   DA  I "O3'" 1 
ATOM   8699  C  "C2'" . DA  I  5 125 ? -54.089 -22.168 19.733 1.00 118.17 ? 51   DA  I "C2'" 1 
ATOM   8700  C  "C1'" . DA  I  5 125 ? -53.770 -23.122 18.590 1.00 117.06 ? 51   DA  I "C1'" 1 
ATOM   8701  N  N9    . DA  I  5 125 ? -53.348 -24.475 18.937 1.00 116.72 ? 51   DA  I N9    1 
ATOM   8702  C  C8    . DA  I  5 125 ? -52.607 -24.878 20.013 1.00 116.57 ? 51   DA  I C8    1 
ATOM   8703  N  N7    . DA  I  5 125 ? -52.376 -26.169 20.037 1.00 116.53 ? 51   DA  I N7    1 
ATOM   8704  C  C5    . DA  I  5 125 ? -52.999 -26.644 18.896 1.00 116.51 ? 51   DA  I C5    1 
ATOM   8705  C  C6    . DA  I  5 125 ? -53.121 -27.932 18.335 1.00 116.60 ? 51   DA  I C6    1 
ATOM   8706  N  N6    . DA  I  5 125 ? -52.596 -29.027 18.885 1.00 116.60 ? 51   DA  I N6    1 
ATOM   8707  N  N1    . DA  I  5 125 ? -53.814 -28.060 17.182 1.00 116.67 ? 51   DA  I N1    1 
ATOM   8708  C  C2    . DA  I  5 125 ? -54.348 -26.964 16.624 1.00 116.58 ? 51   DA  I C2    1 
ATOM   8709  N  N3    . DA  I  5 125 ? -54.292 -25.703 17.052 1.00 116.44 ? 51   DA  I N3    1 
ATOM   8710  C  C4    . DA  I  5 125 ? -53.600 -25.609 18.202 1.00 116.57 ? 51   DA  I C4    1 
ATOM   8711  P  P     . DG  I  5 126 ? -56.503 -19.971 18.937 1.00 122.06 ? 52   DG  I P     1 
ATOM   8712  O  OP1   . DG  I  5 126 ? -56.477 -18.484 19.053 1.00 121.60 ? 52   DG  I OP1   1 
ATOM   8713  O  OP2   . DG  I  5 126 ? -56.810 -20.797 20.138 1.00 122.03 ? 52   DG  I OP2   1 
ATOM   8714  O  "O5'" . DG  I  5 126 ? -57.529 -20.437 17.786 1.00 122.12 ? 52   DG  I "O5'" 1 
ATOM   8715  C  "C5'" . DG  I  5 126 ? -57.306 -21.658 17.069 1.00 122.66 ? 52   DG  I "C5'" 1 
ATOM   8716  C  "C4'" . DG  I  5 126 ? -58.491 -22.607 17.181 1.00 123.70 ? 52   DG  I "C4'" 1 
ATOM   8717  O  "O4'" . DG  I  5 126 ? -57.994 -23.967 17.315 1.00 123.83 ? 52   DG  I "O4'" 1 
ATOM   8718  C  "C3'" . DG  I  5 126 ? -59.436 -22.365 18.363 1.00 124.55 ? 52   DG  I "C3'" 1 
ATOM   8719  O  "O3'" . DG  I  5 126 ? -60.816 -22.462 17.939 1.00 125.50 ? 52   DG  I "O3'" 1 
ATOM   8720  C  "C2'" . DG  I  5 126 ? -59.043 -23.460 19.355 1.00 124.57 ? 52   DG  I "C2'" 1 
ATOM   8721  C  "C1'" . DG  I  5 126 ? -58.584 -24.591 18.440 1.00 123.81 ? 52   DG  I "C1'" 1 
ATOM   8722  N  N9    . DG  I  5 126 ? -57.612 -25.439 19.119 1.00 123.62 ? 52   DG  I N9    1 
ATOM   8723  C  C8    . DG  I  5 126 ? -56.679 -25.014 20.036 1.00 123.61 ? 52   DG  I C8    1 
ATOM   8724  N  N7    . DG  I  5 126 ? -55.935 -25.968 20.506 1.00 123.64 ? 52   DG  I N7    1 
ATOM   8725  C  C5    . DG  I  5 126 ? -56.407 -27.104 19.864 1.00 123.60 ? 52   DG  I C5    1 
ATOM   8726  C  C6    . DG  I  5 126 ? -55.979 -28.446 19.984 1.00 123.65 ? 52   DG  I C6    1 
ATOM   8727  O  O6    . DG  I  5 126 ? -55.073 -28.889 20.698 1.00 123.56 ? 52   DG  I O6    1 
ATOM   8728  N  N1    . DG  I  5 126 ? -56.708 -29.309 19.167 1.00 123.76 ? 52   DG  I N1    1 
ATOM   8729  C  C2    . DG  I  5 126 ? -57.732 -28.918 18.337 1.00 123.66 ? 52   DG  I C2    1 
ATOM   8730  N  N2    . DG  I  5 126 ? -58.311 -29.899 17.631 1.00 123.56 ? 52   DG  I N2    1 
ATOM   8731  N  N3    . DG  I  5 126 ? -58.148 -27.656 18.216 1.00 123.53 ? 52   DG  I N3    1 
ATOM   8732  C  C4    . DG  I  5 126 ? -57.444 -26.802 19.007 1.00 123.52 ? 52   DG  I C4    1 
ATOM   8733  P  P     . DT  I  5 127 ? -62.069 -22.593 18.948 1.00 125.76 ? 53   DT  I P     1 
ATOM   8734  O  OP1   . DT  I  5 127 ? -63.257 -22.101 18.217 1.00 125.93 ? 53   DT  I OP1   1 
ATOM   8735  O  OP2   . DT  I  5 127 ? -61.728 -21.979 20.254 1.00 125.15 ? 53   DT  I OP2   1 
ATOM   8736  O  "O5'" . DT  I  5 127 ? -62.215 -24.179 19.136 1.00 126.09 ? 53   DT  I "O5'" 1 
ATOM   8737  C  "C5'" . DT  I  5 127 ? -62.443 -25.047 18.011 1.00 127.32 ? 53   DT  I "C5'" 1 
ATOM   8738  C  "C4'" . DT  I  5 127 ? -62.885 -26.436 18.458 1.00 128.58 ? 53   DT  I "C4'" 1 
ATOM   8739  O  "O4'" . DT  I  5 127 ? -61.732 -27.224 18.880 1.00 129.38 ? 53   DT  I "O4'" 1 
ATOM   8740  C  "C3'" . DT  I  5 127 ? -63.877 -26.469 19.624 1.00 128.86 ? 53   DT  I "C3'" 1 
ATOM   8741  O  "O3'" . DT  I  5 127 ? -64.910 -27.432 19.370 1.00 128.65 ? 53   DT  I "O3'" 1 
ATOM   8742  C  "C2'" . DT  I  5 127 ? -62.993 -26.834 20.819 1.00 129.31 ? 53   DT  I "C2'" 1 
ATOM   8743  C  "C1'" . DT  I  5 127 ? -61.954 -27.753 20.179 1.00 129.58 ? 53   DT  I "C1'" 1 
ATOM   8744  N  N1    . DT  I  5 127 ? -60.668 -27.862 20.984 1.00 129.79 ? 53   DT  I N1    1 
ATOM   8745  C  C2    . DT  I  5 127 ? -59.920 -29.036 20.973 1.00 129.68 ? 53   DT  I C2    1 
ATOM   8746  O  O2    . DT  I  5 127 ? -60.206 -30.039 20.335 1.00 129.50 ? 53   DT  I O2    1 
ATOM   8747  N  N3    . DT  I  5 127 ? -58.787 -28.995 21.753 1.00 129.78 ? 53   DT  I N3    1 
ATOM   8748  C  C4    . DT  I  5 127 ? -58.336 -27.938 22.531 1.00 129.58 ? 53   DT  I C4    1 
ATOM   8749  O  O4    . DT  I  5 127 ? -57.303 -28.030 23.185 1.00 129.63 ? 53   DT  I O4    1 
ATOM   8750  C  C5    . DT  I  5 127 ? -59.159 -26.744 22.507 1.00 129.48 ? 53   DT  I C5    1 
ATOM   8751  C  C7    . DT  I  5 127 ? -58.798 -25.517 23.294 1.00 129.37 ? 53   DT  I C7    1 
ATOM   8752  C  C6    . DT  I  5 127 ? -60.264 -26.771 21.749 1.00 129.67 ? 53   DT  I C6    1 
ATOM   8753  P  P     . DA  I  5 128 ? -65.768 -28.121 20.541 1.00 128.32 ? 54   DA  I P     1 
ATOM   8754  O  OP1   . DA  I  5 128 ? -66.973 -28.728 19.936 1.00 128.89 ? 54   DA  I OP1   1 
ATOM   8755  O  OP2   . DA  I  5 128 ? -65.938 -27.146 21.643 1.00 128.00 ? 54   DA  I OP2   1 
ATOM   8756  O  "O5'" . DA  I  5 128 ? -64.805 -29.309 21.011 1.00 128.22 ? 54   DA  I "O5'" 1 
ATOM   8757  C  "C5'" . DA  I  5 128 ? -64.564 -30.461 20.190 1.00 127.99 ? 54   DA  I "C5'" 1 
ATOM   8758  C  "C4'" . DA  I  5 128 ? -64.562 -31.719 21.047 1.00 128.19 ? 54   DA  I "C4'" 1 
ATOM   8759  O  "O4'" . DA  I  5 128 ? -63.277 -31.895 21.712 1.00 128.24 ? 54   DA  I "O4'" 1 
ATOM   8760  C  "C3'" . DA  I  5 128 ? -65.613 -31.732 22.153 1.00 128.56 ? 54   DA  I "C3'" 1 
ATOM   8761  O  "O3'" . DA  I  5 128 ? -66.218 -33.036 22.207 1.00 129.45 ? 54   DA  I "O3'" 1 
ATOM   8762  C  "C2'" . DA  I  5 128 ? -64.822 -31.340 23.406 1.00 128.16 ? 54   DA  I "C2'" 1 
ATOM   8763  C  "C1'" . DA  I  5 128 ? -63.439 -31.923 23.124 1.00 127.46 ? 54   DA  I "C1'" 1 
ATOM   8764  N  N9    . DA  I  5 128 ? -62.362 -31.173 23.782 1.00 127.16 ? 54   DA  I N9    1 
ATOM   8765  C  C8    . DA  I  5 128 ? -62.304 -29.817 23.977 1.00 126.99 ? 54   DA  I C8    1 
ATOM   8766  N  N7    . DA  I  5 128 ? -61.227 -29.403 24.600 1.00 126.95 ? 54   DA  I N7    1 
ATOM   8767  C  C5    . DA  I  5 128 ? -60.525 -30.570 24.838 1.00 126.97 ? 54   DA  I C5    1 
ATOM   8768  C  C6    . DA  I  5 128 ? -59.289 -30.812 25.467 1.00 126.97 ? 54   DA  I C6    1 
ATOM   8769  N  N6    . DA  I  5 128 ? -58.533 -29.840 25.984 1.00 126.84 ? 54   DA  I N6    1 
ATOM   8770  N  N1    . DA  I  5 128 ? -58.864 -32.094 25.542 1.00 127.10 ? 54   DA  I N1    1 
ATOM   8771  C  C2    . DA  I  5 128 ? -59.627 -33.065 25.020 1.00 126.97 ? 54   DA  I C2    1 
ATOM   8772  N  N3    . DA  I  5 128 ? -60.806 -32.959 24.404 1.00 126.84 ? 54   DA  I N3    1 
ATOM   8773  C  C4    . DA  I  5 128 ? -61.206 -31.673 24.344 1.00 126.98 ? 54   DA  I C4    1 
ATOM   8774  P  P     . DT  I  5 129 ? -66.789 -33.715 23.554 1.00 129.67 ? 55   DT  I P     1 
ATOM   8775  O  OP1   . DT  I  5 129 ? -67.749 -34.783 23.183 1.00 130.00 ? 55   DT  I OP1   1 
ATOM   8776  O  OP2   . DT  I  5 129 ? -67.233 -32.642 24.479 1.00 129.55 ? 55   DT  I OP2   1 
ATOM   8777  O  "O5'" . DT  I  5 129 ? -65.468 -34.422 24.133 1.00 128.81 ? 55   DT  I "O5'" 1 
ATOM   8778  C  "C5'" . DT  I  5 129 ? -64.864 -35.534 23.461 1.00 126.88 ? 55   DT  I "C5'" 1 
ATOM   8779  C  "C4'" . DT  I  5 129 ? -64.138 -36.388 24.484 1.00 125.71 ? 55   DT  I "C4'" 1 
ATOM   8780  O  "O4'" . DT  I  5 129 ? -63.080 -35.605 25.102 1.00 125.49 ? 55   DT  I "O4'" 1 
ATOM   8781  C  "C3'" . DT  I  5 129 ? -65.015 -36.896 25.625 1.00 125.03 ? 55   DT  I "C3'" 1 
ATOM   8782  O  "O3'" . DT  I  5 129 ? -64.667 -38.267 25.857 1.00 124.70 ? 55   DT  I "O3'" 1 
ATOM   8783  C  "C2'" . DT  I  5 129 ? -64.713 -35.932 26.781 1.00 124.74 ? 55   DT  I "C2'" 1 
ATOM   8784  C  "C1'" . DT  I  5 129 ? -63.252 -35.563 26.513 1.00 124.69 ? 55   DT  I "C1'" 1 
ATOM   8785  N  N1    . DT  I  5 129 ? -62.801 -34.211 27.046 1.00 124.50 ? 55   DT  I N1    1 
ATOM   8786  C  C2    . DT  I  5 129 ? -61.484 -34.030 27.459 1.00 124.17 ? 55   DT  I C2    1 
ATOM   8787  O  O2    . DT  I  5 129 ? -60.623 -34.897 27.430 1.00 123.89 ? 55   DT  I O2    1 
ATOM   8788  N  N3    . DT  I  5 129 ? -61.196 -32.767 27.916 1.00 124.03 ? 55   DT  I N3    1 
ATOM   8789  C  C4    . DT  I  5 129 ? -62.062 -31.689 28.002 1.00 124.10 ? 55   DT  I C4    1 
ATOM   8790  O  O4    . DT  I  5 129 ? -61.690 -30.602 28.429 1.00 124.00 ? 55   DT  I O4    1 
ATOM   8791  C  C5    . DT  I  5 129 ? -63.418 -31.939 27.561 1.00 124.11 ? 55   DT  I C5    1 
ATOM   8792  C  C7    . DT  I  5 129 ? -64.459 -30.856 27.605 1.00 124.16 ? 55   DT  I C7    1 
ATOM   8793  C  C6    . DT  I  5 129 ? -63.715 -33.168 27.112 1.00 124.21 ? 55   DT  I C6    1 
ATOM   8794  P  P     . DC  I  5 130 ? -64.765 -39.016 27.280 1.00 124.65 ? 56   DC  I P     1 
ATOM   8795  O  OP1   . DC  I  5 130 ? -64.714 -40.479 27.017 1.00 124.45 ? 56   DC  I OP1   1 
ATOM   8796  O  OP2   . DC  I  5 130 ? -65.870 -38.433 28.080 1.00 124.41 ? 56   DC  I OP2   1 
ATOM   8797  O  "O5'" . DC  I  5 130 ? -63.399 -38.585 27.990 1.00 123.56 ? 56   DC  I "O5'" 1 
ATOM   8798  C  "C5'" . DC  I  5 130 ? -62.130 -39.044 27.501 1.00 120.99 ? 56   DC  I "C5'" 1 
ATOM   8799  C  "C4'" . DC  I  5 130 ? -61.084 -39.044 28.608 1.00 118.55 ? 56   DC  I "C4'" 1 
ATOM   8800  O  "O4'" . DC  I  5 130 ? -60.861 -37.704 29.122 1.00 118.67 ? 56   DC  I "O4'" 1 
ATOM   8801  C  "C3'" . DC  I  5 130 ? -61.393 -39.883 29.840 1.00 116.63 ? 56   DC  I "C3'" 1 
ATOM   8802  O  "O3'" . DC  I  5 130 ? -60.137 -40.370 30.264 1.00 113.77 ? 56   DC  I "O3'" 1 
ATOM   8803  C  "C2'" . DC  I  5 130 ? -62.002 -38.882 30.828 1.00 117.01 ? 56   DC  I "C2'" 1 
ATOM   8804  C  "C1'" . DC  I  5 130 ? -61.152 -37.650 30.514 1.00 118.19 ? 56   DC  I "C1'" 1 
ATOM   8805  N  N1    . DC  I  5 130 ? -61.706 -36.273 30.818 1.00 118.21 ? 56   DC  I N1    1 
ATOM   8806  C  C2    . DC  I  5 130 ? -61.068 -35.473 31.783 1.00 118.51 ? 56   DC  I C2    1 
ATOM   8807  O  O2    . DC  I  5 130 ? -60.085 -35.914 32.395 1.00 118.61 ? 56   DC  I O2    1 
ATOM   8808  N  N3    . DC  I  5 130 ? -61.551 -34.229 32.038 1.00 118.60 ? 56   DC  I N3    1 
ATOM   8809  C  C4    . DC  I  5 130 ? -62.611 -33.773 31.369 1.00 118.41 ? 56   DC  I C4    1 
ATOM   8810  N  N4    . DC  I  5 130 ? -63.044 -32.544 31.662 1.00 118.34 ? 56   DC  I N4    1 
ATOM   8811  C  C5    . DC  I  5 130 ? -63.272 -34.560 30.376 1.00 118.37 ? 56   DC  I C5    1 
ATOM   8812  C  C6    . DC  I  5 130 ? -62.788 -35.786 30.134 1.00 118.14 ? 56   DC  I C6    1 
ATOM   8813  P  P     . DT  I  5 131 ? -60.006 -41.634 31.228 1.00 111.74 ? 57   DT  I P     1 
ATOM   8814  O  OP1   . DT  I  5 131 ? -58.970 -42.538 30.667 1.00 111.21 ? 57   DT  I OP1   1 
ATOM   8815  O  OP2   . DT  I  5 131 ? -61.371 -42.136 31.521 1.00 111.78 ? 57   DT  I OP2   1 
ATOM   8816  O  "O5'" . DT  I  5 131 ? -59.458 -40.967 32.580 1.00 108.74 ? 57   DT  I "O5'" 1 
ATOM   8817  C  "C5'" . DT  I  5 131 ? -58.134 -40.449 32.715 1.00 102.92 ? 57   DT  I "C5'" 1 
ATOM   8818  C  "C4'" . DT  I  5 131 ? -57.949 -39.912 34.122 1.00 98.71  ? 57   DT  I "C4'" 1 
ATOM   8819  O  "O4'" . DT  I  5 131 ? -58.566 -38.612 34.262 1.00 98.01  ? 57   DT  I "O4'" 1 
ATOM   8820  C  "C3'" . DT  I  5 131 ? -58.538 -40.757 35.244 1.00 96.15  ? 57   DT  I "C3'" 1 
ATOM   8821  O  "O3'" . DT  I  5 131 ? -57.644 -40.712 36.307 1.00 92.75  ? 57   DT  I "O3'" 1 
ATOM   8822  C  "C2'" . DT  I  5 131 ? -59.798 -40.003 35.637 1.00 96.84  ? 57   DT  I "C2'" 1 
ATOM   8823  C  "C1'" . DT  I  5 131 ? -59.273 -38.584 35.479 1.00 97.76  ? 57   DT  I "C1'" 1 
ATOM   8824  N  N1    . DT  I  5 131 ? -60.293 -37.532 35.347 1.00 97.98  ? 57   DT  I N1    1 
ATOM   8825  C  C2    . DT  I  5 131 ? -60.050 -36.289 35.891 1.00 98.18  ? 57   DT  I C2    1 
ATOM   8826  O  O2    . DT  I  5 131 ? -59.039 -36.002 36.502 1.00 97.99  ? 57   DT  I O2    1 
ATOM   8827  N  N3    . DT  I  5 131 ? -61.063 -35.382 35.697 1.00 98.85  ? 57   DT  I N3    1 
ATOM   8828  C  C4    . DT  I  5 131 ? -62.258 -35.590 35.018 1.00 98.44  ? 57   DT  I C4    1 
ATOM   8829  O  O4    . DT  I  5 131 ? -63.095 -34.702 34.906 1.00 98.20  ? 57   DT  I O4    1 
ATOM   8830  C  C5    . DT  I  5 131 ? -62.446 -36.915 34.470 1.00 98.34  ? 57   DT  I C5    1 
ATOM   8831  C  C7    . DT  I  5 131 ? -63.691 -37.278 33.716 1.00 98.14  ? 57   DT  I C7    1 
ATOM   8832  C  C6    . DT  I  5 131 ? -61.462 -37.805 34.657 1.00 98.47  ? 57   DT  I C6    1 
ATOM   8833  P  P     . DG  I  5 132 ? -56.448 -41.758 36.402 1.00 90.27  ? 58   DG  I P     1 
ATOM   8834  O  OP1   . DG  I  5 132 ? -55.815 -41.922 35.071 1.00 89.56  ? 58   DG  I OP1   1 
ATOM   8835  O  OP2   . DG  I  5 132 ? -56.980 -42.941 37.110 1.00 90.73  ? 58   DG  I OP2   1 
ATOM   8836  O  "O5'" . DG  I  5 132 ? -55.457 -41.012 37.421 1.00 89.20  ? 58   DG  I "O5'" 1 
ATOM   8837  C  "C5'" . DG  I  5 132 ? -54.777 -39.815 37.036 1.00 86.62  ? 58   DG  I "C5'" 1 
ATOM   8838  C  "C4'" . DG  I  5 132 ? -54.252 -38.992 38.206 1.00 84.37  ? 58   DG  I "C4'" 1 
ATOM   8839  O  "O4'" . DG  I  5 132 ? -55.224 -37.983 38.564 1.00 83.54  ? 58   DG  I "O4'" 1 
ATOM   8840  C  "C3'" . DG  I  5 132 ? -53.882 -39.659 39.525 1.00 83.58  ? 58   DG  I "C3'" 1 
ATOM   8841  O  "O3'" . DG  I  5 132 ? -52.846 -38.850 40.117 1.00 82.67  ? 58   DG  I "O3'" 1 
ATOM   8842  C  "C2'" . DG  I  5 132 ? -55.207 -39.609 40.286 1.00 83.88  ? 58   DG  I "C2'" 1 
ATOM   8843  C  "C1'" . DG  I  5 132 ? -55.870 -38.332 39.767 1.00 83.65  ? 58   DG  I "C1'" 1 
ATOM   8844  N  N9    . DG  I  5 132 ? -57.271 -38.448 39.388 1.00 83.71  ? 58   DG  I N9    1 
ATOM   8845  C  C8    . DG  I  5 132 ? -57.912 -39.550 38.879 1.00 83.76  ? 58   DG  I C8    1 
ATOM   8846  N  N7    . DG  I  5 132 ? -59.169 -39.350 38.614 1.00 83.68  ? 58   DG  I N7    1 
ATOM   8847  C  C5    . DG  I  5 132 ? -59.374 -38.023 38.954 1.00 83.66  ? 58   DG  I C5    1 
ATOM   8848  C  C6    . DG  I  5 132 ? -60.549 -37.241 38.884 1.00 83.62  ? 58   DG  I C6    1 
ATOM   8849  O  O6    . DG  I  5 132 ? -61.665 -37.578 38.481 1.00 83.81  ? 58   DG  I O6    1 
ATOM   8850  N  N1    . DG  I  5 132 ? -60.338 -35.942 39.324 1.00 83.51  ? 58   DG  I N1    1 
ATOM   8851  C  C2    . DG  I  5 132 ? -59.134 -35.463 39.782 1.00 83.70  ? 58   DG  I C2    1 
ATOM   8852  N  N2    . DG  I  5 132 ? -59.123 -34.183 40.165 1.00 83.76  ? 58   DG  I N2    1 
ATOM   8853  N  N3    . DG  I  5 132 ? -58.019 -36.182 39.861 1.00 83.65  ? 58   DG  I N3    1 
ATOM   8854  C  C4    . DG  I  5 132 ? -58.215 -37.452 39.432 1.00 83.66  ? 58   DG  I C4    1 
ATOM   8855  P  P     . DC  I  5 133 ? -52.290 -38.967 41.618 1.00 81.82  ? 59   DC  I P     1 
ATOM   8856  O  OP1   . DC  I  5 133 ? -50.971 -38.294 41.635 1.00 81.99  ? 59   DC  I OP1   1 
ATOM   8857  O  OP2   . DC  I  5 133 ? -52.359 -40.382 42.052 1.00 81.82  ? 59   DC  I OP2   1 
ATOM   8858  O  "O5'" . DC  I  5 133 ? -53.345 -38.108 42.461 1.00 81.68  ? 59   DC  I "O5'" 1 
ATOM   8859  C  "C5'" . DC  I  5 133 ? -53.540 -36.725 42.190 1.00 82.91  ? 59   DC  I "C5'" 1 
ATOM   8860  C  "C4'" . DC  I  5 133 ? -54.379 -36.038 43.257 1.00 84.59  ? 59   DC  I "C4'" 1 
ATOM   8861  O  "O4'" . DC  I  5 133 ? -55.783 -36.109 42.917 1.00 85.88  ? 59   DC  I "O4'" 1 
ATOM   8862  C  "C3'" . DC  I  5 133 ? -54.326 -36.589 44.676 1.00 85.19  ? 59   DC  I "C3'" 1 
ATOM   8863  O  "O3'" . DC  I  5 133 ? -54.666 -35.531 45.547 1.00 85.35  ? 59   DC  I "O3'" 1 
ATOM   8864  C  "C2'" . DC  I  5 133 ? -55.444 -37.624 44.672 1.00 86.28  ? 59   DC  I "C2'" 1 
ATOM   8865  C  "C1'" . DC  I  5 133 ? -56.495 -36.794 43.938 1.00 87.17  ? 59   DC  I "C1'" 1 
ATOM   8866  N  N1    . DC  I  5 133 ? -57.646 -37.526 43.287 1.00 88.13  ? 59   DC  I N1    1 
ATOM   8867  C  C2    . DC  I  5 133 ? -58.834 -36.814 43.037 1.00 88.06  ? 59   DC  I C2    1 
ATOM   8868  O  O2    . DC  I  5 133 ? -58.918 -35.625 43.369 1.00 87.68  ? 59   DC  I O2    1 
ATOM   8869  N  N3    . DC  I  5 133 ? -59.870 -37.452 42.434 1.00 88.17  ? 59   DC  I N3    1 
ATOM   8870  C  C4    . DC  I  5 133 ? -59.753 -38.737 42.089 1.00 87.82  ? 59   DC  I C4    1 
ATOM   8871  N  N4    . DC  I  5 133 ? -60.809 -39.301 41.503 1.00 87.87  ? 59   DC  I N4    1 
ATOM   8872  C  C5    . DC  I  5 133 ? -58.559 -39.488 42.325 1.00 87.88  ? 59   DC  I C5    1 
ATOM   8873  C  C6    . DC  I  5 133 ? -57.540 -38.849 42.921 1.00 88.26  ? 59   DC  I C6    1 
ATOM   8874  P  P     . DA  I  5 134 ? -53.553 -34.767 46.401 1.00 85.58  ? 60   DA  I P     1 
ATOM   8875  O  OP1   . DA  I  5 134 ? -52.379 -34.662 45.508 1.00 86.06  ? 60   DA  I OP1   1 
ATOM   8876  O  OP2   . DA  I  5 134 ? -53.445 -35.400 47.743 1.00 84.23  ? 60   DA  I OP2   1 
ATOM   8877  O  "O5'" . DA  I  5 134 ? -54.151 -33.299 46.622 1.00 85.95  ? 60   DA  I "O5'" 1 
ATOM   8878  C  "C5'" . DA  I  5 134 ? -54.747 -32.548 45.579 1.00 87.70  ? 60   DA  I "C5'" 1 
ATOM   8879  C  "C4'" . DA  I  5 134 ? -55.860 -31.650 46.119 1.00 90.16  ? 60   DA  I "C4'" 1 
ATOM   8880  O  "O4'" . DA  I  5 134 ? -57.167 -32.266 45.964 1.00 91.14  ? 60   DA  I "O4'" 1 
ATOM   8881  C  "C3'" . DA  I  5 134 ? -55.830 -31.242 47.591 1.00 91.12  ? 60   DA  I "C3'" 1 
ATOM   8882  O  "O3'" . DA  I  5 134 ? -56.491 -29.982 47.691 1.00 92.05  ? 60   DA  I "O3'" 1 
ATOM   8883  C  "C2'" . DA  I  5 134 ? -56.619 -32.363 48.270 1.00 91.55  ? 60   DA  I "C2'" 1 
ATOM   8884  C  "C1'" . DA  I  5 134 ? -57.672 -32.711 47.215 1.00 91.87  ? 60   DA  I "C1'" 1 
ATOM   8885  N  N9    . DA  I  5 134 ? -57.975 -34.129 47.019 1.00 91.98  ? 60   DA  I N9    1 
ATOM   8886  C  C8    . DA  I  5 134 ? -57.159 -35.209 47.222 1.00 92.25  ? 60   DA  I C8    1 
ATOM   8887  N  N7    . DA  I  5 134 ? -57.710 -36.363 46.938 1.00 92.39  ? 60   DA  I N7    1 
ATOM   8888  C  C5    . DA  I  5 134 ? -58.978 -36.015 46.501 1.00 92.36  ? 60   DA  I C5    1 
ATOM   8889  C  C6    . DA  I  5 134 ? -60.076 -36.776 46.049 1.00 92.25  ? 60   DA  I C6    1 
ATOM   8890  N  N6    . DA  I  5 134 ? -60.054 -38.104 45.949 1.00 92.38  ? 60   DA  I N6    1 
ATOM   8891  N  N1    . DA  I  5 134 ? -61.202 -36.124 45.696 1.00 92.23  ? 60   DA  I N1    1 
ATOM   8892  C  C2    . DA  I  5 134 ? -61.230 -34.788 45.795 1.00 92.16  ? 60   DA  I C2    1 
ATOM   8893  N  N3    . DA  I  5 134 ? -60.267 -33.964 46.203 1.00 92.04  ? 60   DA  I N3    1 
ATOM   8894  C  C4    . DA  I  5 134 ? -59.158 -34.644 46.545 1.00 92.13  ? 60   DA  I C4    1 
ATOM   8895  P  P     . DG  I  5 135 ? -56.576 -29.122 49.040 1.00 92.84  ? 61   DG  I P     1 
ATOM   8896  O  OP1   . DG  I  5 135 ? -56.465 -27.704 48.642 1.00 93.16  ? 61   DG  I OP1   1 
ATOM   8897  O  OP2   . DG  I  5 135 ? -55.691 -29.681 50.083 1.00 92.21  ? 61   DG  I OP2   1 
ATOM   8898  O  "O5'" . DG  I  5 135 ? -58.074 -29.368 49.520 1.00 94.20  ? 61   DG  I "O5'" 1 
ATOM   8899  C  "C5'" . DG  I  5 135 ? -59.142 -29.528 48.582 1.00 95.49  ? 61   DG  I "C5'" 1 
ATOM   8900  C  "C4'" . DG  I  5 135 ? -60.407 -29.965 49.308 1.00 96.33  ? 61   DG  I "C4'" 1 
ATOM   8901  O  "O4'" . DG  I  5 135 ? -60.647 -31.389 49.143 1.00 96.05  ? 61   DG  I "O4'" 1 
ATOM   8902  C  "C3'" . DG  I  5 135 ? -60.430 -29.753 50.815 1.00 97.28  ? 61   DG  I "C3'" 1 
ATOM   8903  O  "O3'" . DG  I  5 135 ? -61.790 -29.629 51.169 1.00 100.14 ? 61   DG  I "O3'" 1 
ATOM   8904  C  "C2'" . DG  I  5 135 ? -59.841 -31.069 51.313 1.00 96.31  ? 61   DG  I "C2'" 1 
ATOM   8905  C  "C1'" . DG  I  5 135 ? -60.638 -32.012 50.417 1.00 95.10  ? 61   DG  I "C1'" 1 
ATOM   8906  N  N9    . DG  I  5 135 ? -60.123 -33.371 50.267 1.00 94.68  ? 61   DG  I N9    1 
ATOM   8907  C  C8    . DG  I  5 135 ? -58.869 -33.856 50.572 1.00 94.44  ? 61   DG  I C8    1 
ATOM   8908  N  N7    . DG  I  5 135 ? -58.726 -35.124 50.315 1.00 94.34  ? 61   DG  I N7    1 
ATOM   8909  C  C5    . DG  I  5 135 ? -59.964 -35.500 49.810 1.00 94.43  ? 61   DG  I C5    1 
ATOM   8910  C  C6    . DG  I  5 135 ? -60.415 -36.757 49.357 1.00 94.33  ? 61   DG  I C6    1 
ATOM   8911  O  O6    . DG  I  5 135 ? -59.776 -37.810 49.315 1.00 94.48  ? 61   DG  I O6    1 
ATOM   8912  N  N1    . DG  I  5 135 ? -61.739 -36.717 48.918 1.00 94.53  ? 61   DG  I N1    1 
ATOM   8913  C  C2    . DG  I  5 135 ? -62.536 -35.592 48.924 1.00 94.63  ? 61   DG  I C2    1 
ATOM   8914  N  N2    . DG  I  5 135 ? -63.791 -35.737 48.468 1.00 94.72  ? 61   DG  I N2    1 
ATOM   8915  N  N3    . DG  I  5 135 ? -62.126 -34.403 49.351 1.00 94.29  ? 61   DG  I N3    1 
ATOM   8916  C  C4    . DG  I  5 135 ? -60.836 -34.434 49.774 1.00 94.42  ? 61   DG  I C4    1 
ATOM   8917  P  P     . DG  I  5 136 ? -62.250 -29.250 52.654 1.00 102.80 ? 62   DG  I P     1 
ATOM   8918  O  OP1   . DG  I  5 136 ? -61.807 -27.851 52.884 1.00 102.39 ? 62   DG  I OP1   1 
ATOM   8919  O  OP2   . DG  I  5 136 ? -61.808 -30.316 53.592 1.00 102.45 ? 62   DG  I OP2   1 
ATOM   8920  O  "O5'" . DG  I  5 136 ? -63.862 -29.320 52.561 1.00 103.93 ? 62   DG  I "O5'" 1 
ATOM   8921  C  "C5'" . DG  I  5 136 ? -64.558 -30.217 51.668 1.00 105.28 ? 62   DG  I "C5'" 1 
ATOM   8922  C  "C4'" . DG  I  5 136 ? -65.390 -31.304 52.348 1.00 106.40 ? 62   DG  I "C4'" 1 
ATOM   8923  O  "O4'" . DG  I  5 136 ? -64.864 -32.595 51.929 1.00 106.64 ? 62   DG  I "O4'" 1 
ATOM   8924  C  "C3'" . DG  I  5 136 ? -65.449 -31.356 53.881 1.00 107.45 ? 62   DG  I "C3'" 1 
ATOM   8925  O  "O3'" . DG  I  5 136 ? -66.802 -31.601 54.325 1.00 110.21 ? 62   DG  I "O3'" 1 
ATOM   8926  C  "C2'" . DG  I  5 136 ? -64.530 -32.523 54.220 1.00 106.73 ? 62   DG  I "C2'" 1 
ATOM   8927  C  "C1'" . DG  I  5 136 ? -64.786 -33.455 53.045 1.00 105.99 ? 62   DG  I "C1'" 1 
ATOM   8928  N  N9    . DG  I  5 136 ? -63.701 -34.414 52.874 1.00 105.68 ? 62   DG  I N9    1 
ATOM   8929  C  C8    . DG  I  5 136 ? -62.375 -34.142 53.089 1.00 105.56 ? 62   DG  I C8    1 
ATOM   8930  N  N7    . DG  I  5 136 ? -61.590 -35.153 52.891 1.00 105.53 ? 62   DG  I N7    1 
ATOM   8931  C  C5    . DG  I  5 136 ? -62.451 -36.168 52.521 1.00 105.49 ? 62   DG  I C5    1 
ATOM   8932  C  C6    . DG  I  5 136 ? -62.140 -37.502 52.184 1.00 105.57 ? 62   DG  I C6    1 
ATOM   8933  O  O6    . DG  I  5 136 ? -61.019 -38.024 52.154 1.00 105.54 ? 62   DG  I O6    1 
ATOM   8934  N  N1    . DG  I  5 136 ? -63.280 -38.237 51.865 1.00 105.59 ? 62   DG  I N1    1 
ATOM   8935  C  C2    . DG  I  5 136 ? -64.558 -37.729 51.876 1.00 105.61 ? 62   DG  I C2    1 
ATOM   8936  N  N2    . DG  I  5 136 ? -65.511 -38.604 51.535 1.00 105.67 ? 62   DG  I N2    1 
ATOM   8937  N  N3    . DG  I  5 136 ? -64.869 -36.469 52.193 1.00 105.43 ? 62   DG  I N3    1 
ATOM   8938  C  C4    . DG  I  5 136 ? -63.762 -35.741 52.505 1.00 105.49 ? 62   DG  I C4    1 
ATOM   8939  P  P     . DT  I  5 137 ? -67.222 -32.010 55.832 1.00 111.63 ? 63   DT  I P     1 
ATOM   8940  O  OP1   . DT  I  5 137 ? -68.546 -31.402 56.111 1.00 111.53 ? 63   DT  I OP1   1 
ATOM   8941  O  OP2   . DT  I  5 137 ? -66.091 -31.741 56.747 1.00 111.29 ? 63   DT  I OP2   1 
ATOM   8942  O  "O5'" . DT  I  5 137 ? -67.388 -33.601 55.738 1.00 112.10 ? 63   DT  I "O5'" 1 
ATOM   8943  C  "C5'" . DT  I  5 137 ? -68.462 -34.191 55.001 1.00 113.25 ? 63   DT  I "C5'" 1 
ATOM   8944  C  "C4'" . DT  I  5 137 ? -68.556 -35.668 55.333 1.00 114.33 ? 63   DT  I "C4'" 1 
ATOM   8945  O  "O4'" . DT  I  5 137 ? -67.426 -36.352 54.745 1.00 114.26 ? 63   DT  I "O4'" 1 
ATOM   8946  C  "C3'" . DT  I  5 137 ? -68.519 -35.986 56.829 1.00 115.09 ? 63   DT  I "C3'" 1 
ATOM   8947  O  "O3'" . DT  I  5 137 ? -69.823 -36.360 57.275 1.00 116.82 ? 63   DT  I "O3'" 1 
ATOM   8948  C  "C2'" . DT  I  5 137 ? -67.549 -37.155 56.976 1.00 114.66 ? 63   DT  I "C2'" 1 
ATOM   8949  C  "C1'" . DT  I  5 137 ? -67.081 -37.451 55.559 1.00 114.51 ? 63   DT  I "C1'" 1 
ATOM   8950  N  N1    . DT  I  5 137 ? -65.620 -37.583 55.568 1.00 114.52 ? 63   DT  I N1    1 
ATOM   8951  C  C2    . DT  I  5 137 ? -65.026 -38.772 55.195 1.00 114.49 ? 63   DT  I C2    1 
ATOM   8952  O  O2    . DT  I  5 137 ? -65.632 -39.758 54.822 1.00 114.73 ? 63   DT  I O2    1 
ATOM   8953  N  N3    . DT  I  5 137 ? -63.660 -38.761 55.267 1.00 114.54 ? 63   DT  I N3    1 
ATOM   8954  C  C4    . DT  I  5 137 ? -62.854 -37.710 55.668 1.00 114.79 ? 63   DT  I C4    1 
ATOM   8955  O  O4    . DT  I  5 137 ? -61.634 -37.826 55.685 1.00 114.78 ? 63   DT  I O4    1 
ATOM   8956  C  C5    . DT  I  5 137 ? -63.549 -36.495 56.054 1.00 114.71 ? 63   DT  I C5    1 
ATOM   8957  C  C7    . DT  I  5 137 ? -62.821 -35.268 56.512 1.00 114.57 ? 63   DT  I C7    1 
ATOM   8958  C  C6    . DT  I  5 137 ? -64.880 -36.495 55.989 1.00 114.61 ? 63   DT  I C6    1 
ATOM   8959  P  P     . DG  I  5 138 ? -70.171 -36.652 58.822 1.00 117.15 ? 64   DG  I P     1 
ATOM   8960  O  OP1   . DG  I  5 138 ? -71.640 -36.498 58.962 1.00 117.73 ? 64   DG  I OP1   1 
ATOM   8961  O  OP2   . DG  I  5 138 ? -69.253 -35.876 59.696 1.00 116.86 ? 64   DG  I OP2   1 
ATOM   8962  O  "O5'" . DG  I  5 138 ? -69.811 -38.198 58.996 1.00 115.48 ? 64   DG  I "O5'" 1 
ATOM   8963  C  "C5'" . DG  I  5 138 ? -70.195 -39.196 58.049 1.00 113.36 ? 64   DG  I "C5'" 1 
ATOM   8964  C  "C4'" . DG  I  5 138 ? -69.467 -40.460 58.462 1.00 111.81 ? 64   DG  I "C4'" 1 
ATOM   8965  O  "O4'" . DG  I  5 138 ? -68.068 -40.360 58.075 1.00 111.39 ? 64   DG  I "O4'" 1 
ATOM   8966  C  "C3'" . DG  I  5 138 ? -69.482 -40.655 59.979 1.00 110.88 ? 64   DG  I "C3'" 1 
ATOM   8967  O  "O3'" . DG  I  5 138 ? -69.709 -42.022 60.305 1.00 109.42 ? 64   DG  I "O3'" 1 
ATOM   8968  C  "C2'" . DG  I  5 138 ? -68.092 -40.189 60.416 1.00 110.96 ? 64   DG  I "C2'" 1 
ATOM   8969  C  "C1'" . DG  I  5 138 ? -67.273 -40.660 59.217 1.00 110.62 ? 64   DG  I "C1'" 1 
ATOM   8970  N  N9    . DG  I  5 138 ? -65.915 -40.098 59.138 1.00 110.52 ? 64   DG  I N9    1 
ATOM   8971  C  C8    . DG  I  5 138 ? -65.489 -38.810 59.412 1.00 110.25 ? 64   DG  I C8    1 
ATOM   8972  N  N7    . DG  I  5 138 ? -64.206 -38.638 59.254 1.00 109.85 ? 64   DG  I N7    1 
ATOM   8973  C  C5    . DG  I  5 138 ? -63.754 -39.891 58.857 1.00 109.91 ? 64   DG  I C5    1 
ATOM   8974  C  C6    . DG  I  5 138 ? -62.453 -40.334 58.538 1.00 110.04 ? 64   DG  I C6    1 
ATOM   8975  O  O6    . DG  I  5 138 ? -61.413 -39.672 58.547 1.00 110.17 ? 64   DG  I O6    1 
ATOM   8976  N  N1    . DG  I  5 138 ? -62.416 -41.685 58.185 1.00 110.08 ? 64   DG  I N1    1 
ATOM   8977  C  C2    . DG  I  5 138 ? -63.512 -42.514 58.147 1.00 109.97 ? 64   DG  I C2    1 
ATOM   8978  N  N2    . DG  I  5 138 ? -63.300 -43.787 57.782 1.00 110.11 ? 64   DG  I N2    1 
ATOM   8979  N  N3    . DG  I  5 138 ? -64.740 -42.112 58.441 1.00 109.92 ? 64   DG  I N3    1 
ATOM   8980  C  C4    . DG  I  5 138 ? -64.785 -40.799 58.785 1.00 110.05 ? 64   DG  I C4    1 
ATOM   8981  P  P     . DG  I  5 139 ? -70.309 -42.461 61.730 1.00 107.91 ? 65   DG  I P     1 
ATOM   8982  O  OP1   . DG  I  5 139 ? -71.780 -42.559 61.531 1.00 108.32 ? 65   DG  I OP1   1 
ATOM   8983  O  OP2   . DG  I  5 139 ? -69.768 -41.579 62.811 1.00 106.97 ? 65   DG  I OP2   1 
ATOM   8984  O  "O5'" . DG  I  5 139 ? -69.746 -43.967 61.896 1.00 105.51 ? 65   DG  I "O5'" 1 
ATOM   8985  C  "C5'" . DG  I  5 139 ? -68.908 -44.565 60.896 1.00 101.79 ? 65   DG  I "C5'" 1 
ATOM   8986  C  "C4'" . DG  I  5 139 ? -67.576 -44.953 61.514 1.00 99.53  ? 65   DG  I "C4'" 1 
ATOM   8987  O  "O4'" . DG  I  5 139 ? -66.557 -43.925 61.318 1.00 98.96  ? 65   DG  I "O4'" 1 
ATOM   8988  C  "C3'" . DG  I  5 139 ? -67.645 -45.178 63.017 1.00 98.10  ? 65   DG  I "C3'" 1 
ATOM   8989  O  "O3'" . DG  I  5 139 ? -66.981 -46.402 63.259 1.00 96.95  ? 65   DG  I "O3'" 1 
ATOM   8990  C  "C2'" . DG  I  5 139 ? -66.935 -43.943 63.594 1.00 97.75  ? 65   DG  I "C2'" 1 
ATOM   8991  C  "C1'" . DG  I  5 139 ? -65.856 -43.720 62.538 1.00 96.84  ? 65   DG  I "C1'" 1 
ATOM   8992  N  N9    . DG  I  5 139 ? -65.178 -42.408 62.550 1.00 96.43  ? 65   DG  I N9    1 
ATOM   8993  C  C8    . DG  I  5 139 ? -65.707 -41.171 62.875 1.00 95.98  ? 65   DG  I C8    1 
ATOM   8994  N  N7    . DG  I  5 139 ? -64.859 -40.179 62.788 1.00 95.72  ? 65   DG  I N7    1 
ATOM   8995  C  C5    . DG  I  5 139 ? -63.683 -40.798 62.378 1.00 96.02  ? 65   DG  I C5    1 
ATOM   8996  C  C6    . DG  I  5 139 ? -62.411 -40.242 62.111 1.00 95.98  ? 65   DG  I C6    1 
ATOM   8997  O  O6    . DG  I  5 139 ? -62.078 -39.055 62.192 1.00 96.10  ? 65   DG  I O6    1 
ATOM   8998  N  N1    . DG  I  5 139 ? -61.483 -41.204 61.721 1.00 95.64  ? 65   DG  I N1    1 
ATOM   8999  C  C2    . DG  I  5 139 ? -61.755 -42.541 61.600 1.00 95.45  ? 65   DG  I C2    1 
ATOM   9000  N  N2    . DG  I  5 139 ? -60.742 -43.313 61.213 1.00 95.73  ? 65   DG  I N2    1 
ATOM   9001  N  N3    . DG  I  5 139 ? -62.937 -43.086 61.842 1.00 95.52  ? 65   DG  I N3    1 
ATOM   9002  C  C4    . DG  I  5 139 ? -63.857 -42.162 62.227 1.00 96.12  ? 65   DG  I C4    1 
ATOM   9003  P  P     . DA  I  5 140 ? -66.496 -46.838 64.725 1.00 96.64  ? 66   DA  I P     1 
ATOM   9004  O  OP1   . DA  I  5 140 ? -67.207 -48.099 65.047 1.00 97.13  ? 66   DA  I OP1   1 
ATOM   9005  O  OP2   . DA  I  5 140 ? -66.553 -45.705 65.680 1.00 96.20  ? 66   DA  I OP2   1 
ATOM   9006  O  "O5'" . DA  I  5 140 ? -64.944 -47.133 64.494 1.00 95.06  ? 66   DA  I "O5'" 1 
ATOM   9007  C  "C5'" . DA  I  5 140 ? -64.501 -48.043 63.516 1.00 93.10  ? 66   DA  I "C5'" 1 
ATOM   9008  C  "C4'" . DA  I  5 140 ? -62.991 -48.111 63.607 1.00 92.13  ? 66   DA  I "C4'" 1 
ATOM   9009  O  "O4'" . DA  I  5 140 ? -62.416 -46.792 63.455 1.00 91.77  ? 66   DA  I "O4'" 1 
ATOM   9010  C  "C3'" . DA  I  5 140 ? -62.423 -48.653 64.911 1.00 91.75  ? 66   DA  I "C3'" 1 
ATOM   9011  O  "O3'" . DA  I  5 140 ? -61.278 -49.412 64.527 1.00 92.09  ? 66   DA  I "O3'" 1 
ATOM   9012  C  "C2'" . DA  I  5 140 ? -62.082 -47.395 65.716 1.00 91.65  ? 66   DA  I "C2'" 1 
ATOM   9013  C  "C1'" . DA  I  5 140 ? -61.649 -46.450 64.597 1.00 91.68  ? 66   DA  I "C1'" 1 
ATOM   9014  N  N9    . DA  I  5 140 ? -61.885 -45.026 64.820 1.00 91.75  ? 66   DA  I N9    1 
ATOM   9015  C  C8    . DA  I  5 140 ? -63.072 -44.421 65.138 1.00 91.57  ? 66   DA  I C8    1 
ATOM   9016  N  N7    . DA  I  5 140 ? -63.001 -43.118 65.259 1.00 91.27  ? 66   DA  I N7    1 
ATOM   9017  C  C5    . DA  I  5 140 ? -61.673 -42.848 64.988 1.00 91.74  ? 66   DA  I C5    1 
ATOM   9018  C  C6    . DA  I  5 140 ? -60.951 -41.641 64.951 1.00 91.60  ? 66   DA  I C6    1 
ATOM   9019  N  N6    . DA  I  5 140 ? -61.522 -40.460 65.204 1.00 91.52  ? 66   DA  I N6    1 
ATOM   9020  N  N1    . DA  I  5 140 ? -59.632 -41.707 64.654 1.00 91.44  ? 66   DA  I N1    1 
ATOM   9021  C  C2    . DA  I  5 140 ? -59.074 -42.903 64.402 1.00 91.32  ? 66   DA  I C2    1 
ATOM   9022  N  N3    . DA  I  5 140 ? -59.651 -44.107 64.404 1.00 91.34  ? 66   DA  I N3    1 
ATOM   9023  C  C4    . DA  I  5 140 ? -60.963 -44.009 64.709 1.00 91.85  ? 66   DA  I C4    1 
ATOM   9024  P  P     . DT  I  5 141 ? -60.384 -50.239 65.569 1.00 92.56  ? 67   DT  I P     1 
ATOM   9025  O  OP1   . DT  I  5 141 ? -59.718 -51.361 64.849 1.00 92.25  ? 67   DT  I OP1   1 
ATOM   9026  O  OP2   . DT  I  5 141 ? -61.213 -50.478 66.779 1.00 91.75  ? 67   DT  I OP2   1 
ATOM   9027  O  "O5'" . DT  I  5 141 ? -59.289 -49.139 65.982 1.00 92.02  ? 67   DT  I "O5'" 1 
ATOM   9028  C  "C5'" . DT  I  5 141 ? -58.055 -48.890 65.283 1.00 89.23  ? 67   DT  I "C5'" 1 
ATOM   9029  C  "C4'" . DT  I  5 141 ? -57.244 -47.920 66.124 1.00 87.10  ? 67   DT  I "C4'" 1 
ATOM   9030  O  "O4'" . DT  I  5 141 ? -57.912 -46.637 66.140 1.00 86.67  ? 67   DT  I "O4'" 1 
ATOM   9031  C  "C3'" . DT  I  5 141 ? -57.090 -48.318 67.603 1.00 86.23  ? 67   DT  I "C3'" 1 
ATOM   9032  O  "O3'" . DT  I  5 141 ? -55.791 -48.091 68.088 1.00 85.04  ? 67   DT  I "O3'" 1 
ATOM   9033  C  "C2'" . DT  I  5 141 ? -58.003 -47.347 68.330 1.00 86.06  ? 67   DT  I "C2'" 1 
ATOM   9034  C  "C1'" . DT  I  5 141 ? -57.715 -46.151 67.444 1.00 85.55  ? 67   DT  I "C1'" 1 
ATOM   9035  N  N1    . DT  I  5 141 ? -58.538 -44.963 67.707 1.00 85.51  ? 67   DT  I N1    1 
ATOM   9036  C  C2    . DT  I  5 141 ? -57.915 -43.748 67.536 1.00 85.53  ? 67   DT  I C2    1 
ATOM   9037  O  O2    . DT  I  5 141 ? -56.748 -43.629 67.175 1.00 85.50  ? 67   DT  I O2    1 
ATOM   9038  N  N3    . DT  I  5 141 ? -58.719 -42.676 67.809 1.00 85.02  ? 67   DT  I N3    1 
ATOM   9039  C  C4    . DT  I  5 141 ? -60.031 -42.711 68.218 1.00 84.91  ? 67   DT  I C4    1 
ATOM   9040  O  O4    . DT  I  5 141 ? -60.627 -41.672 68.426 1.00 85.42  ? 67   DT  I O4    1 
ATOM   9041  C  C5    . DT  I  5 141 ? -60.626 -44.018 68.378 1.00 85.05  ? 67   DT  I C5    1 
ATOM   9042  C  C7    . DT  I  5 141 ? -62.049 -44.183 68.820 1.00 85.27  ? 67   DT  I C7    1 
ATOM   9043  C  C6    . DT  I  5 141 ? -59.856 -45.078 68.115 1.00 85.16  ? 67   DT  I C6    1 
ATOM   9044  P  P     . DA  I  5 142 ? -54.512 -48.893 67.573 1.00 84.57  ? 68   DA  I P     1 
ATOM   9045  O  OP1   . DA  I  5 142 ? -54.766 -49.480 66.230 1.00 84.67  ? 68   DA  I OP1   1 
ATOM   9046  O  OP2   . DA  I  5 142 ? -54.090 -49.739 68.715 1.00 84.37  ? 68   DA  I OP2   1 
ATOM   9047  O  "O5'" . DA  I  5 142 ? -53.436 -47.719 67.377 1.00 83.30  ? 68   DA  I "O5'" 1 
ATOM   9048  C  "C5'" . DA  I  5 142 ? -53.841 -46.461 66.798 1.00 80.51  ? 68   DA  I "C5'" 1 
ATOM   9049  C  "C4'" . DA  I  5 142 ? -52.957 -45.296 67.221 1.00 77.69  ? 68   DA  I "C4'" 1 
ATOM   9050  O  "O4'" . DA  I  5 142 ? -53.766 -44.198 67.704 1.00 76.21  ? 68   DA  I "O4'" 1 
ATOM   9051  C  "C3'" . DA  I  5 142 ? -51.951 -45.545 68.333 1.00 76.87  ? 68   DA  I "C3'" 1 
ATOM   9052  O  "O3'" . DA  I  5 142 ? -50.824 -44.734 68.011 1.00 76.61  ? 68   DA  I "O3'" 1 
ATOM   9053  C  "C2'" . DA  I  5 142 ? -52.693 -45.103 69.595 1.00 75.76  ? 68   DA  I "C2'" 1 
ATOM   9054  C  "C1'" . DA  I  5 142 ? -53.504 -43.935 69.067 1.00 75.02  ? 68   DA  I "C1'" 1 
ATOM   9055  N  N9    . DA  I  5 142 ? -54.825 -43.782 69.648 1.00 74.80  ? 68   DA  I N9    1 
ATOM   9056  C  C8    . DA  I  5 142 ? -55.723 -44.764 69.945 1.00 74.61  ? 68   DA  I C8    1 
ATOM   9057  N  N7    . DA  I  5 142 ? -56.846 -44.307 70.439 1.00 74.50  ? 68   DA  I N7    1 
ATOM   9058  C  C5    . DA  I  5 142 ? -56.674 -42.935 70.455 1.00 74.28  ? 68   DA  I C5    1 
ATOM   9059  C  C6    . DA  I  5 142 ? -57.497 -41.869 70.862 1.00 74.54  ? 68   DA  I C6    1 
ATOM   9060  N  N6    . DA  I  5 142 ? -58.723 -42.030 71.353 1.00 74.96  ? 68   DA  I N6    1 
ATOM   9061  N  N1    . DA  I  5 142 ? -57.020 -40.620 70.749 1.00 74.69  ? 68   DA  I N1    1 
ATOM   9062  C  C2    . DA  I  5 142 ? -55.793 -40.441 70.255 1.00 74.51  ? 68   DA  I C2    1 
ATOM   9063  N  N3    . DA  I  5 142 ? -54.929 -41.357 69.839 1.00 74.35  ? 68   DA  I N3    1 
ATOM   9064  C  C4    . DA  I  5 142 ? -55.435 -42.594 69.965 1.00 74.37  ? 68   DA  I C4    1 
ATOM   9065  P  P     . DT  I  5 143 ? -49.509 -44.629 68.919 1.00 75.27  ? 69   DT  I P     1 
ATOM   9066  O  OP1   . DT  I  5 143 ? -48.354 -44.447 68.004 1.00 75.19  ? 69   DT  I OP1   1 
ATOM   9067  O  OP2   . DT  I  5 143 ? -49.503 -45.713 69.933 1.00 73.80  ? 69   DT  I OP2   1 
ATOM   9068  O  "O5'" . DT  I  5 143 ? -49.799 -43.230 69.622 1.00 73.42  ? 69   DT  I "O5'" 1 
ATOM   9069  C  "C5'" . DT  I  5 143 ? -49.780 -42.084 68.802 1.00 71.50  ? 69   DT  I "C5'" 1 
ATOM   9070  C  "C4'" . DT  I  5 143 ? -49.964 -40.863 69.667 1.00 70.69  ? 69   DT  I "C4'" 1 
ATOM   9071  O  "O4'" . DT  I  5 143 ? -51.280 -40.903 70.262 1.00 71.27  ? 69   DT  I "O4'" 1 
ATOM   9072  C  "C3'" . DT  I  5 143 ? -48.982 -40.716 70.815 1.00 69.89  ? 69   DT  I "C3'" 1 
ATOM   9073  O  "O3'" . DT  I  5 143 ? -48.493 -39.406 70.682 1.00 69.52  ? 69   DT  I "O3'" 1 
ATOM   9074  C  "C2'" . DT  I  5 143 ? -49.825 -40.919 72.080 1.00 70.28  ? 69   DT  I "C2'" 1 
ATOM   9075  C  "C1'" . DT  I  5 143 ? -51.206 -40.483 71.607 1.00 70.14  ? 69   DT  I "C1'" 1 
ATOM   9076  N  N1    . DT  I  5 143 ? -52.418 -41.080 72.253 1.00 70.18  ? 69   DT  I N1    1 
ATOM   9077  C  C2    . DT  I  5 143 ? -53.467 -40.231 72.562 1.00 70.01  ? 69   DT  I C2    1 
ATOM   9078  O  O2    . DT  I  5 143 ? -53.457 -39.028 72.374 1.00 69.73  ? 69   DT  I O2    1 
ATOM   9079  N  N3    . DT  I  5 143 ? -54.554 -40.848 73.126 1.00 70.09  ? 69   DT  I N3    1 
ATOM   9080  C  C4    . DT  I  5 143 ? -54.699 -42.193 73.401 1.00 69.95  ? 69   DT  I C4    1 
ATOM   9081  O  O4    . DT  I  5 143 ? -55.725 -42.613 73.911 1.00 70.17  ? 69   DT  I O4    1 
ATOM   9082  C  C5    . DT  I  5 143 ? -53.580 -43.038 73.047 1.00 69.58  ? 69   DT  I C5    1 
ATOM   9083  C  C7    . DT  I  5 143 ? -53.640 -44.513 73.297 1.00 69.41  ? 69   DT  I C7    1 
ATOM   9084  C  C6    . DT  I  5 143 ? -52.507 -42.450 72.488 1.00 69.90  ? 69   DT  I C6    1 
ATOM   9085  P  P     . DT  I  5 144 ? -47.247 -38.846 71.514 1.00 69.52  ? 70   DT  I P     1 
ATOM   9086  O  OP1   . DT  I  5 144 ? -46.568 -37.875 70.634 1.00 69.47  ? 70   DT  I OP1   1 
ATOM   9087  O  OP2   . DT  I  5 144 ? -46.523 -39.983 72.135 1.00 68.45  ? 70   DT  I OP2   1 
ATOM   9088  O  "O5'" . DT  I  5 144 ? -47.977 -37.997 72.658 1.00 69.92  ? 70   DT  I "O5'" 1 
ATOM   9089  C  "C5'" . DT  I  5 144 ? -49.022 -37.078 72.303 1.00 69.29  ? 70   DT  I "C5'" 1 
ATOM   9090  C  "C4'" . DT  I  5 144 ? -49.732 -36.543 73.536 1.00 69.52  ? 70   DT  I "C4'" 1 
ATOM   9091  O  "O4'" . DT  I  5 144 ? -50.755 -37.472 73.979 1.00 69.67  ? 70   DT  I "O4'" 1 
ATOM   9092  C  "C3'" . DT  I  5 144 ? -48.846 -36.314 74.752 1.00 69.50  ? 70   DT  I "C3'" 1 
ATOM   9093  O  "O3'" . DT  I  5 144 ? -49.216 -35.059 75.282 1.00 69.88  ? 70   DT  I "O3'" 1 
ATOM   9094  C  "C2'" . DT  I  5 144 ? -49.181 -37.489 75.673 1.00 69.33  ? 70   DT  I "C2'" 1 
ATOM   9095  C  "C1'" . DT  I  5 144 ? -50.668 -37.644 75.381 1.00 68.73  ? 70   DT  I "C1'" 1 
ATOM   9096  N  N1    . DT  I  5 144 ? -51.324 -38.955 75.657 1.00 68.07  ? 70   DT  I N1    1 
ATOM   9097  C  C2    . DT  I  5 144 ? -52.652 -38.961 76.043 1.00 68.05  ? 70   DT  I C2    1 
ATOM   9098  O  O2    . DT  I  5 144 ? -53.316 -37.956 76.203 1.00 68.10  ? 70   DT  I O2    1 
ATOM   9099  N  N3    . DT  I  5 144 ? -53.193 -40.204 76.246 1.00 67.96  ? 70   DT  I N3    1 
ATOM   9100  C  C4    . DT  I  5 144 ? -52.549 -41.417 76.090 1.00 68.27  ? 70   DT  I C4    1 
ATOM   9101  O  O4    . DT  I  5 144 ? -53.121 -42.479 76.296 1.00 68.23  ? 70   DT  I O4    1 
ATOM   9102  C  C5    . DT  I  5 144 ? -51.165 -41.347 75.675 1.00 68.26  ? 70   DT  I C5    1 
ATOM   9103  C  C7    . DT  I  5 144 ? -50.365 -42.605 75.484 1.00 68.38  ? 70   DT  I C7    1 
ATOM   9104  C  C6    . DT  I  5 144 ? -50.629 -40.133 75.472 1.00 68.03  ? 70   DT  I C6    1 
ATOM   9105  P  P     . DG  I  5 145 ? -48.278 -34.291 76.319 1.00 70.68  ? 71   DG  I P     1 
ATOM   9106  O  OP1   . DG  I  5 145 ? -48.134 -32.894 75.840 1.00 69.92  ? 71   DG  I OP1   1 
ATOM   9107  O  OP2   . DG  I  5 145 ? -47.107 -35.129 76.660 1.00 69.99  ? 71   DG  I OP2   1 
ATOM   9108  O  "O5'" . DG  I  5 145 ? -49.199 -34.300 77.613 1.00 72.99  ? 71   DG  I "O5'" 1 
ATOM   9109  C  "C5'" . DG  I  5 145 ? -50.500 -33.694 77.601 1.00 76.30  ? 71   DG  I "C5'" 1 
ATOM   9110  C  "C4'" . DG  I  5 145 ? -51.234 -34.116 78.858 1.00 78.25  ? 71   DG  I "C4'" 1 
ATOM   9111  O  "O4'" . DG  I  5 145 ? -51.682 -35.486 78.686 1.00 78.17  ? 71   DG  I "O4'" 1 
ATOM   9112  C  "C3'" . DG  I  5 145 ? -50.343 -34.077 80.100 1.00 80.10  ? 71   DG  I "C3'" 1 
ATOM   9113  O  "O3'" . DG  I  5 145 ? -51.029 -33.391 81.158 1.00 84.05  ? 71   DG  I "O3'" 1 
ATOM   9114  C  "C2'" . DG  I  5 145 ? -50.022 -35.550 80.368 1.00 78.81  ? 71   DG  I "C2'" 1 
ATOM   9115  C  "C1'" . DG  I  5 145 ? -51.276 -36.233 79.819 1.00 77.82  ? 71   DG  I "C1'" 1 
ATOM   9116  N  N9    . DG  I  5 145 ? -51.147 -37.679 79.543 1.00 77.42  ? 71   DG  I N9    1 
ATOM   9117  C  C8    . DG  I  5 145 ? -50.049 -38.392 79.108 1.00 77.32  ? 71   DG  I C8    1 
ATOM   9118  N  N7    . DG  I  5 145 ? -50.264 -39.673 78.981 1.00 77.21  ? 71   DG  I N7    1 
ATOM   9119  C  C5    . DG  I  5 145 ? -51.588 -39.832 79.365 1.00 76.92  ? 71   DG  I C5    1 
ATOM   9120  C  C6    . DG  I  5 145 ? -52.389 -41.002 79.444 1.00 76.87  ? 71   DG  I C6    1 
ATOM   9121  O  O6    . DG  I  5 145 ? -52.078 -42.173 79.174 1.00 76.78  ? 71   DG  I O6    1 
ATOM   9122  N  N1    . DG  I  5 145 ? -53.680 -40.705 79.889 1.00 77.38  ? 71   DG  I N1    1 
ATOM   9123  C  C2    . DG  I  5 145 ? -54.137 -39.439 80.216 1.00 77.46  ? 71   DG  I C2    1 
ATOM   9124  N  N2    . DG  I  5 145 ? -55.409 -39.325 80.625 1.00 77.57  ? 71   DG  I N2    1 
ATOM   9125  N  N3    . DG  I  5 145 ? -53.397 -38.345 80.148 1.00 76.86  ? 71   DG  I N3    1 
ATOM   9126  C  C4    . DG  I  5 145 ? -52.139 -38.616 79.717 1.00 76.88  ? 71   DG  I C4    1 
ATOM   9127  P  P     . DA  I  5 146 ? -50.370 -33.103 82.610 1.00 87.43  ? 72   DA  I P     1 
ATOM   9128  O  OP1   . DA  I  5 146 ? -49.836 -31.727 82.638 1.00 86.62  ? 72   DA  I OP1   1 
ATOM   9129  O  OP2   . DA  I  5 146 ? -49.495 -34.236 83.014 1.00 86.86  ? 72   DA  I OP2   1 
ATOM   9130  O  "O5'" . DA  I  5 146 ? -51.673 -33.081 83.548 1.00 88.67  ? 72   DA  I "O5'" 1 
ATOM   9131  C  "C5'" . DA  I  5 146 ? -52.997 -32.851 83.005 1.00 89.94  ? 72   DA  I "C5'" 1 
ATOM   9132  C  "C4'" . DA  I  5 146 ? -53.977 -33.766 83.710 1.00 90.68  ? 72   DA  I "C4'" 1 
ATOM   9133  O  "O4'" . DA  I  5 146 ? -53.943 -35.048 83.041 1.00 89.38  ? 72   DA  I "O4'" 1 
ATOM   9134  C  "C3'" . DA  I  5 146 ? -53.612 -34.019 85.177 1.00 92.22  ? 72   DA  I "C3'" 1 
ATOM   9135  O  "O3'" . DA  I  5 146 ? -54.560 -33.427 86.084 1.00 95.91  ? 72   DA  I "O3'" 1 
ATOM   9136  C  "C2'" . DA  I  5 146 ? -53.607 -35.527 85.340 1.00 90.62  ? 72   DA  I "C2'" 1 
ATOM   9137  C  "C1'" . DA  I  5 146 ? -54.097 -36.055 84.005 1.00 88.78  ? 72   DA  I "C1'" 1 
ATOM   9138  N  N9    . DA  I  5 146 ? -53.231 -37.154 83.667 1.00 88.21  ? 72   DA  I N9    1 
ATOM   9139  C  C8    . DA  I  5 146 ? -51.905 -37.080 83.377 1.00 88.00  ? 72   DA  I C8    1 
ATOM   9140  N  N7    . DA  I  5 146 ? -51.361 -38.243 83.137 1.00 88.09  ? 72   DA  I N7    1 
ATOM   9141  C  C5    . DA  I  5 146 ? -52.403 -39.128 83.295 1.00 87.76  ? 72   DA  I C5    1 
ATOM   9142  C  C6    . DA  I  5 146 ? -52.473 -40.521 83.173 1.00 88.01  ? 72   DA  I C6    1 
ATOM   9143  N  N6    . DA  I  5 146 ? -51.412 -41.267 82.854 1.00 88.06  ? 72   DA  I N6    1 
ATOM   9144  N  N1    . DA  I  5 146 ? -53.672 -41.106 83.398 1.00 88.40  ? 72   DA  I N1    1 
ATOM   9145  C  C2    . DA  I  5 146 ? -54.728 -40.347 83.726 1.00 88.25  ? 72   DA  I C2    1 
ATOM   9146  N  N3    . DA  I  5 146 ? -54.777 -39.023 83.868 1.00 88.17  ? 72   DA  I N3    1 
ATOM   9147  C  C4    . DA  I  5 146 ? -53.569 -38.477 83.634 1.00 88.07  ? 72   DA  I C4    1 
ATOM   9148  P  P     . DT  I  5 147 ? -54.327 -33.389 87.683 1.00 97.91  ? 73   DT  I P     1 
ATOM   9149  O  OP1   . DT  I  5 147 ? -54.940 -32.106 88.106 1.00 96.76  ? 73   DT  I OP1   1 
ATOM   9150  O  OP2   . DT  I  5 147 ? -52.897 -33.672 88.003 1.00 97.46  ? 73   DT  I OP2   1 
ATOM   9151  O  "O5'" . DT  I  5 147 ? -55.226 -34.622 88.210 1.00 98.48  ? 73   DT  I "O5'" 1 
ATOM   9152  C  "C5'" . DT  I  5 147 ? -54.685 -35.703 88.975 1.00 99.28  ? 73   DT  I "C5'" 1 
ATOM   9153  C  "C4'" . DT  I  5 147 ? -55.492 -36.971 88.739 1.00 100.47 ? 73   DT  I "C4'" 1 
ATOM   9154  O  "O4'" . DT  I  5 147 ? -54.986 -37.679 87.571 1.00 100.62 ? 73   DT  I "O4'" 1 
ATOM   9155  C  "C3'" . DT  I  5 147 ? -55.465 -37.973 89.895 1.00 101.22 ? 73   DT  I "C3'" 1 
ATOM   9156  O  "O3'" . DT  I  5 147 ? -56.727 -38.640 90.048 1.00 101.77 ? 73   DT  I "O3'" 1 
ATOM   9157  C  "C2'" . DT  I  5 147 ? -54.381 -38.961 89.476 1.00 101.23 ? 73   DT  I "C2'" 1 
ATOM   9158  C  "C1'" . DT  I  5 147 ? -54.533 -38.967 87.955 1.00 100.58 ? 73   DT  I "C1'" 1 
ATOM   9159  N  N1    . DT  I  5 147 ? -53.242 -39.343 87.303 1.00 100.14 ? 73   DT  I N1    1 
ATOM   9160  C  C2    . DT  I  5 147 ? -53.091 -40.648 86.888 1.00 100.32 ? 73   DT  I C2    1 
ATOM   9161  O  O2    . DT  I  5 147 ? -53.959 -41.493 87.004 1.00 100.53 ? 73   DT  I O2    1 
ATOM   9162  N  N3    . DT  I  5 147 ? -51.879 -40.937 86.315 1.00 100.52 ? 73   DT  I N3    1 
ATOM   9163  C  C4    . DT  I  5 147 ? -50.816 -40.074 86.122 1.00 100.46 ? 73   DT  I C4    1 
ATOM   9164  O  O4    . DT  I  5 147 ? -49.776 -40.462 85.592 1.00 100.41 ? 73   DT  I O4    1 
ATOM   9165  C  C5    . DT  I  5 147 ? -51.035 -38.715 86.587 1.00 100.22 ? 73   DT  I C5    1 
ATOM   9166  C  C7    . DT  I  5 147 ? -49.971 -37.662 86.453 1.00 100.33 ? 73   DT  I C7    1 
ATOM   9167  C  C6    . DT  I  5 147 ? -52.218 -38.425 87.152 1.00 100.05 ? 73   DT  I C6    1 
ATOM   9168  O  "O5'" . DA  J  6 1   ? -50.542 -51.037 84.278 1.00 108.31 ? -73  DA  J "O5'" 1 
ATOM   9169  C  "C5'" . DA  J  6 1   ? -51.368 -51.773 85.173 1.00 108.40 ? -73  DA  J "C5'" 1 
ATOM   9170  C  "C4'" . DA  J  6 1   ? -52.225 -50.860 86.035 1.00 108.34 ? -73  DA  J "C4'" 1 
ATOM   9171  O  "O4'" . DA  J  6 1   ? -51.411 -49.870 86.705 1.00 108.27 ? -73  DA  J "O4'" 1 
ATOM   9172  C  "C3'" . DA  J  6 1   ? -53.247 -50.026 85.285 1.00 108.76 ? -73  DA  J "C3'" 1 
ATOM   9173  O  "O3'" . DA  J  6 1   ? -54.393 -50.814 85.044 1.00 110.17 ? -73  DA  J "O3'" 1 
ATOM   9174  C  "C2'" . DA  J  6 1   ? -53.551 -48.919 86.285 1.00 108.03 ? -73  DA  J "C2'" 1 
ATOM   9175  C  "C1'" . DA  J  6 1   ? -52.181 -48.694 86.908 1.00 107.49 ? -73  DA  J "C1'" 1 
ATOM   9176  N  N9    . DA  J  6 1   ? -51.470 -47.531 86.365 1.00 107.49 ? -73  DA  J N9    1 
ATOM   9177  C  C8    . DA  J  6 1   ? -50.360 -47.518 85.556 1.00 107.22 ? -73  DA  J C8    1 
ATOM   9178  N  N7    . DA  J  6 1   ? -49.944 -46.312 85.240 1.00 107.07 ? -73  DA  J N7    1 
ATOM   9179  C  C5    . DA  J  6 1   ? -50.837 -45.473 85.888 1.00 107.06 ? -73  DA  J C5    1 
ATOM   9180  C  C6    . DA  J  6 1   ? -50.951 -44.067 85.962 1.00 106.85 ? -73  DA  J C6    1 
ATOM   9181  N  N6    . DA  J  6 1   ? -50.123 -43.218 85.350 1.00 107.03 ? -73  DA  J N6    1 
ATOM   9182  N  N1    . DA  J  6 1   ? -51.961 -43.560 86.697 1.00 106.79 ? -73  DA  J N1    1 
ATOM   9183  C  C2    . DA  J  6 1   ? -52.805 -44.394 87.317 1.00 107.00 ? -73  DA  J C2    1 
ATOM   9184  N  N3    . DA  J  6 1   ? -52.804 -45.727 87.325 1.00 107.05 ? -73  DA  J N3    1 
ATOM   9185  C  C4    . DA  J  6 1   ? -51.785 -46.208 86.586 1.00 107.28 ? -73  DA  J C4    1 
ATOM   9186  P  P     . DT  J  6 2   ? -55.350 -50.526 83.792 1.00 111.16 ? -72  DT  J P     1 
ATOM   9187  O  OP1   . DT  J  6 2   ? -56.145 -51.755 83.567 1.00 111.58 ? -72  DT  J OP1   1 
ATOM   9188  O  OP2   . DT  J  6 2   ? -54.513 -49.995 82.692 1.00 111.58 ? -72  DT  J OP2   1 
ATOM   9189  O  "O5'" . DT  J  6 2   ? -56.318 -49.349 84.284 1.00 110.31 ? -72  DT  J "O5'" 1 
ATOM   9190  C  "C5'" . DT  J  6 2   ? -56.973 -49.408 85.538 1.00 110.25 ? -72  DT  J "C5'" 1 
ATOM   9191  C  "C4'" . DT  J  6 2   ? -57.578 -48.050 85.786 1.00 110.76 ? -72  DT  J "C4'" 1 
ATOM   9192  O  "O4'" . DT  J  6 2   ? -56.521 -47.068 85.922 1.00 110.87 ? -72  DT  J "O4'" 1 
ATOM   9193  C  "C3'" . DT  J  6 2   ? -58.423 -47.616 84.605 1.00 111.33 ? -72  DT  J "C3'" 1 
ATOM   9194  O  "O3'" . DT  J  6 2   ? -59.713 -47.302 85.031 1.00 112.73 ? -72  DT  J "O3'" 1 
ATOM   9195  C  "C2'" . DT  J  6 2   ? -57.753 -46.371 84.046 1.00 111.16 ? -72  DT  J "C2'" 1 
ATOM   9196  C  "C1'" . DT  J  6 2   ? -56.816 -45.920 85.148 1.00 110.46 ? -72  DT  J "C1'" 1 
ATOM   9197  N  N1    . DT  J  6 2   ? -55.594 -45.372 84.496 1.00 110.19 ? -72  DT  J N1    1 
ATOM   9198  C  C2    . DT  J  6 2   ? -55.449 -44.006 84.339 1.00 109.55 ? -72  DT  J C2    1 
ATOM   9199  O  O2    . DT  J  6 2   ? -56.256 -43.179 84.729 1.00 109.36 ? -72  DT  J O2    1 
ATOM   9200  N  N3    . DT  J  6 2   ? -54.288 -43.647 83.704 1.00 109.46 ? -72  DT  J N3    1 
ATOM   9201  C  C4    . DT  J  6 2   ? -53.294 -44.481 83.212 1.00 109.70 ? -72  DT  J C4    1 
ATOM   9202  O  O4    . DT  J  6 2   ? -52.291 -44.054 82.657 1.00 109.93 ? -72  DT  J O4    1 
ATOM   9203  C  C5    . DT  J  6 2   ? -53.513 -45.891 83.398 1.00 109.75 ? -72  DT  J C5    1 
ATOM   9204  C  C7    . DT  J  6 2   ? -52.510 -46.896 82.910 1.00 109.75 ? -72  DT  J C7    1 
ATOM   9205  C  C6    . DT  J  6 2   ? -54.642 -46.259 84.017 1.00 110.20 ? -72  DT  J C6    1 
ATOM   9206  P  P     . DC  J  6 3   ? -60.869 -47.204 83.927 1.00 113.95 ? -71  DC  J P     1 
ATOM   9207  O  OP1   . DC  J  6 3   ? -61.952 -48.104 84.383 1.00 114.17 ? -71  DC  J OP1   1 
ATOM   9208  O  OP2   . DC  J  6 3   ? -60.291 -47.440 82.580 1.00 113.48 ? -71  DC  J OP2   1 
ATOM   9209  O  "O5'" . DC  J  6 3   ? -61.379 -45.674 84.049 1.00 114.15 ? -71  DC  J "O5'" 1 
ATOM   9210  C  "C5'" . DC  J  6 3   ? -60.587 -44.590 84.589 1.00 113.99 ? -71  DC  J "C5'" 1 
ATOM   9211  C  "C4'" . DC  J  6 3   ? -60.423 -43.451 83.586 1.00 114.13 ? -71  DC  J "C4'" 1 
ATOM   9212  O  "O4'" . DC  J  6 3   ? -59.064 -43.366 83.060 1.00 114.42 ? -71  DC  J "O4'" 1 
ATOM   9213  C  "C3'" . DC  J  6 3   ? -61.319 -43.514 82.349 1.00 113.95 ? -71  DC  J "C3'" 1 
ATOM   9214  O  "O3'" . DC  J  6 3   ? -61.806 -42.202 82.105 1.00 113.30 ? -71  DC  J "O3'" 1 
ATOM   9215  C  "C2'" . DC  J  6 3   ? -60.371 -43.961 81.235 1.00 114.17 ? -71  DC  J "C2'" 1 
ATOM   9216  C  "C1'" . DC  J  6 3   ? -59.139 -43.159 81.652 1.00 114.36 ? -71  DC  J "C1'" 1 
ATOM   9217  N  N1    . DC  J  6 3   ? -57.826 -43.533 81.012 1.00 114.34 ? -71  DC  J N1    1 
ATOM   9218  C  C2    . DC  J  6 3   ? -56.750 -42.626 81.074 1.00 114.20 ? -71  DC  J C2    1 
ATOM   9219  O  O2    . DC  J  6 3   ? -56.898 -41.532 81.639 1.00 113.64 ? -71  DC  J O2    1 
ATOM   9220  N  N3    . DC  J  6 3   ? -55.564 -42.986 80.503 1.00 114.29 ? -71  DC  J N3    1 
ATOM   9221  C  C4    . DC  J  6 3   ? -55.433 -44.179 79.897 1.00 114.30 ? -71  DC  J C4    1 
ATOM   9222  N  N4    . DC  J  6 3   ? -54.250 -44.487 79.353 1.00 114.03 ? -71  DC  J N4    1 
ATOM   9223  C  C5    . DC  J  6 3   ? -56.514 -45.112 79.821 1.00 114.06 ? -71  DC  J C5    1 
ATOM   9224  C  C6    . DC  J  6 3   ? -57.675 -44.748 80.387 1.00 114.34 ? -71  DC  J C6    1 
ATOM   9225  P  P     . DA  J  6 4   ? -63.196 -41.984 81.343 1.00 112.61 ? -70  DA  J P     1 
ATOM   9226  O  OP1   . DA  J  6 4   ? -64.225 -42.476 82.288 1.00 113.26 ? -70  DA  J OP1   1 
ATOM   9227  O  OP2   . DA  J  6 4   ? -63.088 -42.593 79.987 1.00 112.38 ? -70  DA  J OP2   1 
ATOM   9228  O  "O5'" . DA  J  6 4   ? -63.373 -40.385 81.201 1.00 109.71 ? -70  DA  J "O5'" 1 
ATOM   9229  C  "C5'" . DA  J  6 4   ? -62.547 -39.431 81.891 1.00 105.60 ? -70  DA  J "C5'" 1 
ATOM   9230  C  "C4'" . DA  J  6 4   ? -61.727 -38.546 80.944 1.00 102.90 ? -70  DA  J "C4'" 1 
ATOM   9231  O  "O4'" . DA  J  6 4   ? -60.456 -39.155 80.566 1.00 101.56 ? -70  DA  J "O4'" 1 
ATOM   9232  C  "C3'" . DA  J  6 4   ? -62.384 -38.103 79.634 1.00 101.09 ? -70  DA  J "C3'" 1 
ATOM   9233  O  "O3'" . DA  J  6 4   ? -62.085 -36.733 79.429 1.00 99.40  ? -70  DA  J "O3'" 1 
ATOM   9234  C  "C2'" . DA  J  6 4   ? -61.686 -38.967 78.583 1.00 100.52 ? -70  DA  J "C2'" 1 
ATOM   9235  C  "C1'" . DA  J  6 4   ? -60.279 -38.972 79.172 1.00 99.84  ? -70  DA  J "C1'" 1 
ATOM   9236  N  N9    . DA  J  6 4   ? -59.374 -40.003 78.680 1.00 99.38  ? -70  DA  J N9    1 
ATOM   9237  C  C8    . DA  J  6 4   ? -59.576 -41.354 78.598 1.00 99.26  ? -70  DA  J C8    1 
ATOM   9238  N  N7    . DA  J  6 4   ? -58.552 -42.019 78.121 1.00 99.03  ? -70  DA  J N7    1 
ATOM   9239  C  C5    . DA  J  6 4   ? -57.621 -41.027 77.876 1.00 98.93  ? -70  DA  J C5    1 
ATOM   9240  C  C6    . DA  J  6 4   ? -56.316 -41.057 77.363 1.00 98.93  ? -70  DA  J C6    1 
ATOM   9241  N  N6    . DA  J  6 4   ? -55.719 -42.183 76.993 1.00 99.21  ? -70  DA  J N6    1 
ATOM   9242  N  N1    . DA  J  6 4   ? -55.647 -39.892 77.243 1.00 99.04  ? -70  DA  J N1    1 
ATOM   9243  C  C2    . DA  J  6 4   ? -56.249 -38.756 77.616 1.00 99.15  ? -70  DA  J C2    1 
ATOM   9244  N  N3    . DA  J  6 4   ? -57.474 -38.597 78.113 1.00 99.05  ? -70  DA  J N3    1 
ATOM   9245  C  C4    . DA  J  6 4   ? -58.107 -39.781 78.216 1.00 99.14  ? -70  DA  J C4    1 
ATOM   9246  P  P     . DA  J  6 5   ? -63.187 -35.722 78.865 1.00 98.84  ? -69  DA  J P     1 
ATOM   9247  O  OP1   . DA  J  6 5   ? -63.781 -35.060 80.049 1.00 98.71  ? -69  DA  J OP1   1 
ATOM   9248  O  OP2   . DA  J  6 5   ? -64.011 -36.475 77.892 1.00 98.36  ? -69  DA  J OP2   1 
ATOM   9249  O  "O5'" . DA  J  6 5   ? -62.391 -34.604 78.018 1.00 98.72  ? -69  DA  J "O5'" 1 
ATOM   9250  C  "C5'" . DA  J  6 5   ? -61.071 -34.092 78.385 1.00 96.91  ? -69  DA  J "C5'" 1 
ATOM   9251  C  "C4'" . DA  J  6 5   ? -60.062 -34.015 77.224 1.00 94.81  ? -69  DA  J "C4'" 1 
ATOM   9252  O  "O4'" . DA  J  6 5   ? -59.374 -35.274 76.936 1.00 93.55  ? -69  DA  J "O4'" 1 
ATOM   9253  C  "C3'" . DA  J  6 5   ? -60.614 -33.501 75.895 1.00 93.37  ? -69  DA  J "C3'" 1 
ATOM   9254  O  "O3'" . DA  J  6 5   ? -59.817 -32.365 75.524 1.00 92.22  ? -69  DA  J "O3'" 1 
ATOM   9255  C  "C2'" . DA  J  6 5   ? -60.504 -34.706 74.950 1.00 92.35  ? -69  DA  J "C2'" 1 
ATOM   9256  C  "C1'" . DA  J  6 5   ? -59.323 -35.476 75.540 1.00 92.30  ? -69  DA  J "C1'" 1 
ATOM   9257  N  N9    . DA  J  6 5   ? -59.315 -36.921 75.308 1.00 92.24  ? -69  DA  J N9    1 
ATOM   9258  C  C8    . DA  J  6 5   ? -60.345 -37.809 75.471 1.00 92.35  ? -69  DA  J C8    1 
ATOM   9259  N  N7    . DA  J  6 5   ? -60.035 -39.056 75.188 1.00 92.34  ? -69  DA  J N7    1 
ATOM   9260  C  C5    . DA  J  6 5   ? -58.703 -38.985 74.817 1.00 92.10  ? -69  DA  J C5    1 
ATOM   9261  C  C6    . DA  J  6 5   ? -57.771 -39.956 74.393 1.00 91.89  ? -69  DA  J C6    1 
ATOM   9262  N  N6    . DA  J  6 5   ? -58.054 -41.248 74.276 1.00 91.88  ? -69  DA  J N6    1 
ATOM   9263  N  N1    . DA  J  6 5   ? -56.520 -39.555 74.091 1.00 92.20  ? -69  DA  J N1    1 
ATOM   9264  C  C2    . DA  J  6 5   ? -56.213 -38.256 74.204 1.00 92.25  ? -69  DA  J C2    1 
ATOM   9265  N  N3    . DA  J  6 5   ? -57.004 -37.252 74.588 1.00 92.25  ? -69  DA  J N3    1 
ATOM   9266  C  C4    . DA  J  6 5   ? -58.246 -37.680 74.885 1.00 92.27  ? -69  DA  J C4    1 
ATOM   9267  P  P     . DT  J  6 6   ? -60.359 -31.131 74.646 1.00 91.36  ? -68  DT  J P     1 
ATOM   9268  O  OP1   . DT  J  6 6   ? -60.153 -29.881 75.414 1.00 91.69  ? -68  DT  J OP1   1 
ATOM   9269  O  OP2   . DT  J  6 6   ? -61.680 -31.456 74.050 1.00 90.96  ? -68  DT  J OP2   1 
ATOM   9270  O  "O5'" . DT  J  6 6   ? -59.313 -31.169 73.451 1.00 89.57  ? -68  DT  J "O5'" 1 
ATOM   9271  C  "C5'" . DT  J  6 6   ? -59.258 -32.389 72.744 1.00 86.96  ? -68  DT  J "C5'" 1 
ATOM   9272  C  "C4'" . DT  J  6 6   ? -57.883 -32.641 72.188 1.00 84.23  ? -68  DT  J "C4'" 1 
ATOM   9273  O  "O4'" . DT  J  6 6   ? -57.519 -34.013 72.474 1.00 83.60  ? -68  DT  J "O4'" 1 
ATOM   9274  C  "C3'" . DT  J  6 6   ? -57.935 -32.485 70.683 1.00 82.74  ? -68  DT  J "C3'" 1 
ATOM   9275  O  "O3'" . DT  J  6 6   ? -56.797 -31.782 70.224 1.00 80.90  ? -68  DT  J "O3'" 1 
ATOM   9276  C  "C2'" . DT  J  6 6   ? -58.040 -33.913 70.156 1.00 82.51  ? -68  DT  J "C2'" 1 
ATOM   9277  C  "C1'" . DT  J  6 6   ? -57.453 -34.761 71.276 1.00 82.84  ? -68  DT  J "C1'" 1 
ATOM   9278  N  N1    . DT  J  6 6   ? -58.150 -36.082 71.400 1.00 82.83  ? -68  DT  J N1    1 
ATOM   9279  C  C2    . DT  J  6 6   ? -57.402 -37.223 71.173 1.00 82.69  ? -68  DT  J C2    1 
ATOM   9280  O  O2    . DT  J  6 6   ? -56.215 -37.213 70.899 1.00 82.55  ? -68  DT  J O2    1 
ATOM   9281  N  N3    . DT  J  6 6   ? -58.100 -38.399 71.287 1.00 82.71  ? -68  DT  J N3    1 
ATOM   9282  C  C4    . DT  J  6 6   ? -59.437 -38.551 71.586 1.00 82.60  ? -68  DT  J C4    1 
ATOM   9283  O  O4    . DT  J  6 6   ? -59.933 -39.664 71.656 1.00 82.62  ? -68  DT  J O4    1 
ATOM   9284  C  C5    . DT  J  6 6   ? -60.177 -37.327 71.807 1.00 82.73  ? -68  DT  J C5    1 
ATOM   9285  C  C7    . DT  J  6 6   ? -61.642 -37.373 72.144 1.00 82.57  ? -68  DT  J C7    1 
ATOM   9286  C  C6    . DT  J  6 6   ? -59.507 -36.160 71.701 1.00 82.91  ? -68  DT  J C6    1 
ATOM   9287  P  P     . DA  J  6 7   ? -56.680 -31.362 68.684 1.00 79.22  ? -67  DA  J P     1 
ATOM   9288  O  OP1   . DA  J  6 7   ? -55.885 -30.114 68.642 1.00 79.17  ? -67  DA  J OP1   1 
ATOM   9289  O  OP2   . DA  J  6 7   ? -58.007 -31.415 68.031 1.00 78.71  ? -67  DA  J OP2   1 
ATOM   9290  O  "O5'" . DA  J  6 7   ? -55.813 -32.574 68.110 1.00 78.13  ? -67  DA  J "O5'" 1 
ATOM   9291  C  "C5'" . DA  J  6 7   ? -54.592 -32.866 68.774 1.00 76.54  ? -67  DA  J "C5'" 1 
ATOM   9292  C  "C4'" . DA  J  6 7   ? -53.911 -34.090 68.200 1.00 75.32  ? -67  DA  J "C4'" 1 
ATOM   9293  O  "O4'" . DA  J  6 7   ? -54.676 -35.288 68.471 1.00 74.93  ? -67  DA  J "O4'" 1 
ATOM   9294  C  "C3'" . DA  J  6 7   ? -53.676 -34.071 66.700 1.00 74.57  ? -67  DA  J "C3'" 1 
ATOM   9295  O  "O3'" . DA  J  6 7   ? -52.424 -34.707 66.549 1.00 74.31  ? -67  DA  J "O3'" 1 
ATOM   9296  C  "C2'" . DA  J  6 7   ? -54.846 -34.888 66.154 1.00 74.20  ? -67  DA  J "C2'" 1 
ATOM   9297  C  "C1'" . DA  J  6 7   ? -55.023 -35.931 67.255 1.00 74.04  ? -67  DA  J "C1'" 1 
ATOM   9298  N  N9    . DA  J  6 7   ? -56.373 -36.460 67.453 1.00 74.10  ? -67  DA  J N9    1 
ATOM   9299  C  C8    . DA  J  6 7   ? -57.502 -35.732 67.704 1.00 73.71  ? -67  DA  J C8    1 
ATOM   9300  N  N7    . DA  J  6 7   ? -58.584 -36.453 67.867 1.00 73.33  ? -67  DA  J N7    1 
ATOM   9301  C  C5    . DA  J  6 7   ? -58.134 -37.748 67.721 1.00 73.51  ? -67  DA  J C5    1 
ATOM   9302  C  C6    . DA  J  6 7   ? -58.807 -38.978 67.784 1.00 73.72  ? -67  DA  J C6    1 
ATOM   9303  N  N6    . DA  J  6 7   ? -60.117 -39.071 68.019 1.00 73.41  ? -67  DA  J N6    1 
ATOM   9304  N  N1    . DA  J  6 7   ? -58.072 -40.097 67.590 1.00 74.00  ? -67  DA  J N1    1 
ATOM   9305  C  C2    . DA  J  6 7   ? -56.753 -39.985 67.350 1.00 73.36  ? -67  DA  J C2    1 
ATOM   9306  N  N3    . DA  J  6 7   ? -56.010 -38.883 67.275 1.00 72.93  ? -67  DA  J N3    1 
ATOM   9307  C  C4    . DA  J  6 7   ? -56.769 -37.784 67.471 1.00 73.65  ? -67  DA  J C4    1 
ATOM   9308  P  P     . DT  J  6 8   ? -51.631 -34.763 65.173 1.00 74.04  ? -66  DT  J P     1 
ATOM   9309  O  OP1   . DT  J  6 8   ? -50.222 -34.917 65.590 1.00 73.90  ? -66  DT  J OP1   1 
ATOM   9310  O  OP2   . DT  J  6 8   ? -52.104 -33.696 64.254 1.00 72.41  ? -66  DT  J OP2   1 
ATOM   9311  O  "O5'" . DT  J  6 8   ? -52.072 -36.156 64.534 1.00 75.36  ? -66  DT  J "O5'" 1 
ATOM   9312  C  "C5'" . DT  J  6 8   ? -51.635 -37.395 65.102 1.00 76.75  ? -66  DT  J "C5'" 1 
ATOM   9313  C  "C4'" . DT  J  6 8   ? -52.210 -38.570 64.330 1.00 77.84  ? -66  DT  J "C4'" 1 
ATOM   9314  O  "O4'" . DT  J  6 8   ? -53.581 -38.845 64.723 1.00 78.35  ? -66  DT  J "O4'" 1 
ATOM   9315  C  "C3'" . DT  J  6 8   ? -52.275 -38.407 62.817 1.00 78.47  ? -66  DT  J "C3'" 1 
ATOM   9316  O  "O3'" . DT  J  6 8   ? -52.097 -39.687 62.317 1.00 79.93  ? -66  DT  J "O3'" 1 
ATOM   9317  C  "C2'" . DT  J  6 8   ? -53.716 -38.004 62.562 1.00 78.32  ? -66  DT  J "C2'" 1 
ATOM   9318  C  "C1'" . DT  J  6 8   ? -54.341 -38.995 63.535 1.00 79.16  ? -66  DT  J "C1'" 1 
ATOM   9319  N  N1    . DT  J  6 8   ? -55.786 -38.788 63.825 1.00 79.61  ? -66  DT  J N1    1 
ATOM   9320  C  C2    . DT  J  6 8   ? -56.603 -39.885 64.023 1.00 79.14  ? -66  DT  J C2    1 
ATOM   9321  O  O2    . DT  J  6 8   ? -56.213 -41.039 63.968 1.00 79.39  ? -66  DT  J O2    1 
ATOM   9322  N  N3    . DT  J  6 8   ? -57.911 -39.563 64.288 1.00 79.12  ? -66  DT  J N3    1 
ATOM   9323  C  C4    . DT  J  6 8   ? -58.464 -38.288 64.377 1.00 79.69  ? -66  DT  J C4    1 
ATOM   9324  O  O4    . DT  J  6 8   ? -59.657 -38.102 64.622 1.00 79.99  ? -66  DT  J O4    1 
ATOM   9325  C  C5    . DT  J  6 8   ? -57.547 -37.190 64.160 1.00 79.68  ? -66  DT  J C5    1 
ATOM   9326  C  C7    . DT  J  6 8   ? -58.003 -35.762 64.227 1.00 79.17  ? -66  DT  J C7    1 
ATOM   9327  C  C6    . DT  J  6 8   ? -56.271 -37.492 63.897 1.00 79.89  ? -66  DT  J C6    1 
ATOM   9328  P  P     . DC  J  6 9   ? -51.364 -39.933 60.931 1.00 81.16  ? -65  DC  J P     1 
ATOM   9329  O  OP1   . DC  J  6 9   ? -49.916 -39.949 61.271 1.00 80.77  ? -65  DC  J OP1   1 
ATOM   9330  O  OP2   . DC  J  6 9   ? -51.972 -39.015 59.927 1.00 79.64  ? -65  DC  J OP2   1 
ATOM   9331  O  "O5'" . DC  J  6 9   ? -51.769 -41.438 60.531 1.00 80.73  ? -65  DC  J "O5'" 1 
ATOM   9332  C  "C5'" . DC  J  6 9   ? -52.118 -42.430 61.515 1.00 79.65  ? -65  DC  J "C5'" 1 
ATOM   9333  C  "C4'" . DC  J  6 9   ? -53.351 -43.184 61.057 1.00 78.94  ? -65  DC  J "C4'" 1 
ATOM   9334  O  "O4'" . DC  J  6 9   ? -54.537 -42.542 61.591 1.00 78.01  ? -65  DC  J "O4'" 1 
ATOM   9335  C  "C3'" . DC  J  6 9   ? -53.504 -43.207 59.536 1.00 79.05  ? -65  DC  J "C3'" 1 
ATOM   9336  O  "O3'" . DC  J  6 9   ? -53.511 -44.535 59.044 1.00 80.21  ? -65  DC  J "O3'" 1 
ATOM   9337  C  "C2'" . DC  J  6 9   ? -54.825 -42.508 59.262 1.00 78.06  ? -65  DC  J "C2'" 1 
ATOM   9338  C  "C1'" . DC  J  6 9   ? -55.537 -42.600 60.603 1.00 76.90  ? -65  DC  J "C1'" 1 
ATOM   9339  N  N1    . DC  J  6 9   ? -56.482 -41.481 60.775 1.00 76.01  ? -65  DC  J N1    1 
ATOM   9340  C  C2    . DC  J  6 9   ? -57.819 -41.761 61.026 1.00 75.83  ? -65  DC  J C2    1 
ATOM   9341  O  O2    . DC  J  6 9   ? -58.169 -42.945 61.117 1.00 75.94  ? -65  DC  J O2    1 
ATOM   9342  N  N3    . DC  J  6 9   ? -58.681 -40.718 61.164 1.00 76.06  ? -65  DC  J N3    1 
ATOM   9343  C  C4    . DC  J  6 9   ? -58.249 -39.457 61.055 1.00 75.86  ? -65  DC  J C4    1 
ATOM   9344  N  N4    . DC  J  6 9   ? -59.125 -38.467 61.198 1.00 75.75  ? -65  DC  J N4    1 
ATOM   9345  C  C5    . DC  J  6 9   ? -56.890 -39.153 60.786 1.00 76.24  ? -65  DC  J C5    1 
ATOM   9346  C  C6    . DC  J  6 9   ? -56.055 -40.191 60.652 1.00 76.72  ? -65  DC  J C6    1 
ATOM   9347  P  P     . DC  J  6 10  ? -53.131 -44.828 57.514 1.00 80.97  ? -64  DC  J P     1 
ATOM   9348  O  OP1   . DC  J  6 10  ? -51.750 -45.351 57.455 1.00 80.92  ? -64  DC  J OP1   1 
ATOM   9349  O  OP2   . DC  J  6 10  ? -53.541 -43.659 56.693 1.00 80.03  ? -64  DC  J OP2   1 
ATOM   9350  O  "O5'" . DC  J  6 10  ? -54.081 -46.072 57.182 1.00 83.12  ? -64  DC  J "O5'" 1 
ATOM   9351  C  "C5'" . DC  J  6 10  ? -55.008 -46.573 58.170 1.00 85.02  ? -64  DC  J "C5'" 1 
ATOM   9352  C  "C4'" . DC  J  6 10  ? -56.413 -46.708 57.601 1.00 85.50  ? -64  DC  J "C4'" 1 
ATOM   9353  O  "O4'" . DC  J  6 10  ? -57.251 -45.589 57.994 1.00 85.12  ? -64  DC  J "O4'" 1 
ATOM   9354  C  "C3'" . DC  J  6 10  ? -56.486 -46.809 56.079 1.00 86.00  ? -64  DC  J "C3'" 1 
ATOM   9355  O  "O3'" . DC  J  6 10  ? -57.256 -47.961 55.773 1.00 87.26  ? -64  DC  J "O3'" 1 
ATOM   9356  C  "C2'" . DC  J  6 10  ? -57.150 -45.506 55.631 1.00 85.31  ? -64  DC  J "C2'" 1 
ATOM   9357  C  "C1'" . DC  J  6 10  ? -57.971 -45.142 56.865 1.00 84.88  ? -64  DC  J "C1'" 1 
ATOM   9358  N  N1    . DC  J  6 10  ? -58.183 -43.690 57.067 1.00 84.80  ? -64  DC  J N1    1 
ATOM   9359  C  C2    . DC  J  6 10  ? -59.394 -43.245 57.609 1.00 84.65  ? -64  DC  J C2    1 
ATOM   9360  O  O2    . DC  J  6 10  ? -60.270 -44.070 57.900 1.00 84.95  ? -64  DC  J O2    1 
ATOM   9361  N  N3    . DC  J  6 10  ? -59.571 -41.912 57.793 1.00 84.18  ? -64  DC  J N3    1 
ATOM   9362  C  C4    . DC  J  6 10  ? -58.600 -41.059 57.470 1.00 84.03  ? -64  DC  J C4    1 
ATOM   9363  N  N4    . DC  J  6 10  ? -58.815 -39.766 57.676 1.00 84.52  ? -64  DC  J N4    1 
ATOM   9364  C  C5    . DC  J  6 10  ? -57.361 -41.486 56.918 1.00 84.61  ? -64  DC  J C5    1 
ATOM   9365  C  C6    . DC  J  6 10  ? -57.197 -42.802 56.738 1.00 85.04  ? -64  DC  J C6    1 
ATOM   9366  P  P     . DA  J  6 11  ? -57.383 -48.573 54.292 1.00 88.07  ? -63  DA  J P     1 
ATOM   9367  O  OP1   . DA  J  6 11  ? -57.190 -50.042 54.458 1.00 86.90  ? -63  DA  J OP1   1 
ATOM   9368  O  OP2   . DA  J  6 11  ? -56.571 -47.793 53.321 1.00 87.05  ? -63  DA  J OP2   1 
ATOM   9369  O  "O5'" . DA  J  6 11  ? -58.914 -48.242 53.944 1.00 87.90  ? -63  DA  J "O5'" 1 
ATOM   9370  C  "C5'" . DA  J  6 11  ? -59.948 -48.602 54.860 1.00 87.77  ? -63  DA  J "C5'" 1 
ATOM   9371  C  "C4'" . DA  J  6 11  ? -61.280 -48.179 54.285 1.00 87.41  ? -63  DA  J "C4'" 1 
ATOM   9372  O  "O4'" . DA  J  6 11  ? -61.549 -46.842 54.762 1.00 87.16  ? -63  DA  J "O4'" 1 
ATOM   9373  C  "C3'" . DA  J  6 11  ? -61.302 -48.153 52.759 1.00 87.44  ? -63  DA  J "C3'" 1 
ATOM   9374  O  "O3'" . DA  J  6 11  ? -62.362 -48.999 52.284 1.00 88.07  ? -63  DA  J "O3'" 1 
ATOM   9375  C  "C2'" . DA  J  6 11  ? -61.469 -46.676 52.400 1.00 87.33  ? -63  DA  J "C2'" 1 
ATOM   9376  C  "C1'" . DA  J  6 11  ? -61.927 -46.012 53.692 1.00 87.16  ? -63  DA  J "C1'" 1 
ATOM   9377  N  N9    . DA  J  6 11  ? -61.304 -44.713 53.925 1.00 87.44  ? -63  DA  J N9    1 
ATOM   9378  C  C8    . DA  J  6 11  ? -59.973 -44.364 53.835 1.00 87.44  ? -63  DA  J C8    1 
ATOM   9379  N  N7    . DA  J  6 11  ? -59.722 -43.100 54.110 1.00 86.85  ? -63  DA  J N7    1 
ATOM   9380  C  C5    . DA  J  6 11  ? -60.978 -42.589 54.400 1.00 87.01  ? -63  DA  J C5    1 
ATOM   9381  C  C6    . DA  J  6 11  ? -61.423 -41.303 54.770 1.00 87.09  ? -63  DA  J C6    1 
ATOM   9382  N  N6    . DA  J  6 11  ? -60.607 -40.257 54.913 1.00 87.02  ? -63  DA  J N6    1 
ATOM   9383  N  N1    . DA  J  6 11  ? -62.750 -41.134 54.987 1.00 87.41  ? -63  DA  J N1    1 
ATOM   9384  C  C2    . DA  J  6 11  ? -63.579 -42.179 54.838 1.00 87.27  ? -63  DA  J C2    1 
ATOM   9385  N  N3    . DA  J  6 11  ? -63.284 -43.435 54.500 1.00 86.98  ? -63  DA  J N3    1 
ATOM   9386  C  C4    . DA  J  6 11  ? -61.961 -43.568 54.293 1.00 87.21  ? -63  DA  J C4    1 
ATOM   9387  P  P     . DC  J  6 12  ? -62.785 -49.139 50.735 1.00 88.31  ? -62  DC  J P     1 
ATOM   9388  O  OP1   . DC  J  6 12  ? -63.452 -50.454 50.573 1.00 88.35  ? -62  DC  J OP1   1 
ATOM   9389  O  OP2   . DC  J  6 12  ? -61.618 -48.799 49.883 1.00 87.43  ? -62  DC  J OP2   1 
ATOM   9390  O  "O5'" . DC  J  6 12  ? -63.900 -48.000 50.569 1.00 88.19  ? -62  DC  J "O5'" 1 
ATOM   9391  C  "C5'" . DC  J  6 12  ? -64.789 -47.677 51.650 1.00 88.96  ? -62  DC  J "C5'" 1 
ATOM   9392  C  "C4'" . DC  J  6 12  ? -65.494 -46.376 51.342 1.00 89.87  ? -62  DC  J "C4'" 1 
ATOM   9393  O  "O4'" . DC  J  6 12  ? -64.708 -45.272 51.870 1.00 90.78  ? -62  DC  J "O4'" 1 
ATOM   9394  C  "C3'" . DC  J  6 12  ? -65.671 -46.117 49.839 1.00 90.33  ? -62  DC  J "C3'" 1 
ATOM   9395  O  "O3'" . DC  J  6 12  ? -67.054 -45.858 49.520 1.00 90.46  ? -62  DC  J "O3'" 1 
ATOM   9396  C  "C2'" . DC  J  6 12  ? -64.785 -44.902 49.582 1.00 90.94  ? -62  DC  J "C2'" 1 
ATOM   9397  C  "C1'" . DC  J  6 12  ? -64.803 -44.205 50.939 1.00 90.89  ? -62  DC  J "C1'" 1 
ATOM   9398  N  N1    . DC  J  6 12  ? -63.681 -43.198 51.049 1.00 90.93  ? -62  DC  J N1    1 
ATOM   9399  C  C2    . DC  J  6 12  ? -63.926 -41.841 51.371 1.00 90.81  ? -62  DC  J C2    1 
ATOM   9400  O  O2    . DC  J  6 12  ? -65.073 -41.440 51.603 1.00 90.98  ? -62  DC  J O2    1 
ATOM   9401  N  N3    . DC  J  6 12  ? -62.872 -40.984 51.432 1.00 90.46  ? -62  DC  J N3    1 
ATOM   9402  C  C4    . DC  J  6 12  ? -61.635 -41.425 51.184 1.00 90.45  ? -62  DC  J C4    1 
ATOM   9403  N  N4    . DC  J  6 12  ? -60.627 -40.559 51.259 1.00 90.76  ? -62  DC  J N4    1 
ATOM   9404  C  C5    . DC  J  6 12  ? -61.362 -42.782 50.850 1.00 90.77  ? -62  DC  J C5    1 
ATOM   9405  C  C6    . DC  J  6 12  ? -62.403 -43.620 50.791 1.00 90.86  ? -62  DC  J C6    1 
ATOM   9406  P  P     . DC  J  6 13  ? -67.599 -45.431 48.067 1.00 89.59  ? -61  DC  J P     1 
ATOM   9407  O  OP1   . DC  J  6 13  ? -68.979 -45.957 47.970 1.00 89.28  ? -61  DC  J OP1   1 
ATOM   9408  O  OP2   . DC  J  6 13  ? -66.591 -45.800 47.050 1.00 88.83  ? -61  DC  J OP2   1 
ATOM   9409  O  "O5'" . DC  J  6 13  ? -67.668 -43.830 48.122 1.00 90.87  ? -61  DC  J "O5'" 1 
ATOM   9410  C  "C5'" . DC  J  6 13  ? -68.615 -43.118 48.929 1.00 92.94  ? -61  DC  J "C5'" 1 
ATOM   9411  C  "C4'" . DC  J  6 13  ? -68.615 -41.645 48.542 1.00 95.11  ? -61  DC  J "C4'" 1 
ATOM   9412  O  "O4'" . DC  J  6 13  ? -67.358 -41.035 48.957 1.00 95.67  ? -61  DC  J "O4'" 1 
ATOM   9413  C  "C3'" . DC  J  6 13  ? -68.764 -41.367 47.041 1.00 96.25  ? -61  DC  J "C3'" 1 
ATOM   9414  O  "O3'" . DC  J  6 13  ? -69.758 -40.372 46.784 1.00 97.94  ? -61  DC  J "O3'" 1 
ATOM   9415  C  "C2'" . DC  J  6 13  ? -67.389 -40.865 46.605 1.00 96.27  ? -61  DC  J "C2'" 1 
ATOM   9416  C  "C1'" . DC  J  6 13  ? -66.814 -40.276 47.891 1.00 95.58  ? -61  DC  J "C1'" 1 
ATOM   9417  N  N1    . DC  J  6 13  ? -65.306 -40.319 47.905 1.00 95.37  ? -61  DC  J N1    1 
ATOM   9418  C  C2    . DC  J  6 13  ? -64.555 -39.169 48.230 1.00 95.37  ? -61  DC  J C2    1 
ATOM   9419  O  O2    . DC  J  6 13  ? -65.136 -38.108 48.523 1.00 94.83  ? -61  DC  J O2    1 
ATOM   9420  N  N3    . DC  J  6 13  ? -63.192 -39.267 48.212 1.00 95.12  ? -61  DC  J N3    1 
ATOM   9421  C  C4    . DC  J  6 13  ? -62.594 -40.423 47.892 1.00 94.73  ? -61  DC  J C4    1 
ATOM   9422  N  N4    . DC  J  6 13  ? -61.265 -40.475 47.893 1.00 94.58  ? -61  DC  J N4    1 
ATOM   9423  C  C5    . DC  J  6 13  ? -63.334 -41.591 47.555 1.00 94.82  ? -61  DC  J C5    1 
ATOM   9424  C  C6    . DC  J  6 13  ? -64.669 -41.490 47.575 1.00 95.19  ? -61  DC  J C6    1 
ATOM   9425  P  P     . DT  J  6 14  ? -70.389 -40.192 45.314 1.00 99.02  ? -60  DT  J P     1 
ATOM   9426  O  OP1   . DT  J  6 14  ? -71.775 -40.719 45.373 1.00 98.74  ? -60  DT  J OP1   1 
ATOM   9427  O  OP2   . DT  J  6 14  ? -69.437 -40.713 44.293 1.00 97.70  ? -60  DT  J OP2   1 
ATOM   9428  O  "O5'" . DT  J  6 14  ? -70.504 -38.601 45.171 1.00 100.28 ? -60  DT  J "O5'" 1 
ATOM   9429  C  "C5'" . DT  J  6 14  ? -69.920 -37.723 46.134 1.00 102.98 ? -60  DT  J "C5'" 1 
ATOM   9430  C  "C4'" . DT  J  6 14  ? -69.028 -36.702 45.445 1.00 104.89 ? -60  DT  J "C4'" 1 
ATOM   9431  O  "O4'" . DT  J  6 14  ? -67.622 -37.023 45.641 1.00 105.36 ? -60  DT  J "O4'" 1 
ATOM   9432  C  "C3'" . DT  J  6 14  ? -69.223 -36.578 43.933 1.00 106.02 ? -60  DT  J "C3'" 1 
ATOM   9433  O  "O3'" . DT  J  6 14  ? -69.236 -35.203 43.582 1.00 107.71 ? -60  DT  J "O3'" 1 
ATOM   9434  C  "C2'" . DT  J  6 14  ? -67.990 -37.277 43.365 1.00 105.99 ? -60  DT  J "C2'" 1 
ATOM   9435  C  "C1'" . DT  J  6 14  ? -66.969 -36.814 44.398 1.00 105.78 ? -60  DT  J "C1'" 1 
ATOM   9436  N  N1    . DT  J  6 14  ? -65.652 -37.524 44.362 1.00 105.73 ? -60  DT  J N1    1 
ATOM   9437  C  C2    . DT  J  6 14  ? -64.502 -36.843 44.732 1.00 105.37 ? -60  DT  J C2    1 
ATOM   9438  O  O2    . DT  J  6 14  ? -64.477 -35.678 45.094 1.00 105.31 ? -60  DT  J O2    1 
ATOM   9439  N  N3    . DT  J  6 14  ? -63.359 -37.592 44.665 1.00 105.15 ? -60  DT  J N3    1 
ATOM   9440  C  C4    . DT  J  6 14  ? -63.256 -38.916 44.277 1.00 105.57 ? -60  DT  J C4    1 
ATOM   9441  O  O4    . DT  J  6 14  ? -62.173 -39.486 44.257 1.00 105.61 ? -60  DT  J O4    1 
ATOM   9442  C  C5    . DT  J  6 14  ? -64.495 -39.569 43.901 1.00 105.58 ? -60  DT  J C5    1 
ATOM   9443  C  C7    . DT  J  6 14  ? -64.527 -41.003 43.459 1.00 105.49 ? -60  DT  J C7    1 
ATOM   9444  C  C6    . DT  J  6 14  ? -65.619 -38.849 43.962 1.00 105.58 ? -60  DT  J C6    1 
ATOM   9445  P  P     . DG  J  6 15  ? -69.828 -34.697 42.179 1.00 109.25 ? -59  DG  J P     1 
ATOM   9446  O  OP1   . DG  J  6 15  ? -71.302 -34.760 42.318 1.00 109.49 ? -59  DG  J OP1   1 
ATOM   9447  O  OP2   . DG  J  6 15  ? -69.188 -35.419 41.048 1.00 109.28 ? -59  DG  J OP2   1 
ATOM   9448  O  "O5'" . DG  J  6 15  ? -69.331 -33.168 42.120 1.00 108.75 ? -59  DG  J "O5'" 1 
ATOM   9449  C  "C5'" . DG  J  6 15  ? -68.963 -32.421 43.299 1.00 107.79 ? -59  DG  J "C5'" 1 
ATOM   9450  C  "C4'" . DG  J  6 15  ? -67.742 -31.540 43.055 1.00 106.75 ? -59  DG  J "C4'" 1 
ATOM   9451  O  "O4'" . DG  J  6 15  ? -66.529 -32.338 43.041 1.00 106.07 ? -59  DG  J "O4'" 1 
ATOM   9452  C  "C3'" . DG  J  6 15  ? -67.751 -30.764 41.741 1.00 106.68 ? -59  DG  J "C3'" 1 
ATOM   9453  O  "O3'" . DG  J  6 15  ? -67.231 -29.443 41.955 1.00 107.20 ? -59  DG  J "O3'" 1 
ATOM   9454  C  "C2'" . DG  J  6 15  ? -66.881 -31.616 40.811 1.00 106.29 ? -59  DG  J "C2'" 1 
ATOM   9455  C  "C1'" . DG  J  6 15  ? -65.901 -32.291 41.770 1.00 105.64 ? -59  DG  J "C1'" 1 
ATOM   9456  N  N9    . DG  J  6 15  ? -65.521 -33.662 41.418 1.00 105.41 ? -59  DG  J N9    1 
ATOM   9457  C  C8    . DG  J  6 15  ? -66.305 -34.624 40.827 1.00 105.42 ? -59  DG  J C8    1 
ATOM   9458  N  N7    . DG  J  6 15  ? -65.704 -35.767 40.645 1.00 105.34 ? -59  DG  J N7    1 
ATOM   9459  C  C5    . DG  J  6 15  ? -64.432 -35.559 41.149 1.00 105.31 ? -59  DG  J C5    1 
ATOM   9460  C  C6    . DG  J  6 15  ? -63.329 -36.448 41.225 1.00 105.35 ? -59  DG  J C6    1 
ATOM   9461  O  O6    . DG  J  6 15  ? -63.262 -37.627 40.849 1.00 105.19 ? -59  DG  J O6    1 
ATOM   9462  N  N1    . DG  J  6 15  ? -62.220 -35.839 41.810 1.00 105.48 ? -59  DG  J N1    1 
ATOM   9463  C  C2    . DG  J  6 15  ? -62.193 -34.535 42.263 1.00 105.49 ? -59  DG  J C2    1 
ATOM   9464  N  N2    . DG  J  6 15  ? -61.042 -34.112 42.797 1.00 105.43 ? -59  DG  J N2    1 
ATOM   9465  N  N3    . DG  J  6 15  ? -63.220 -33.694 42.199 1.00 105.34 ? -59  DG  J N3    1 
ATOM   9466  C  C4    . DG  J  6 15  ? -64.306 -34.270 41.630 1.00 105.24 ? -59  DG  J C4    1 
ATOM   9467  P  P     . DC  J  6 16  ? -67.324 -28.274 40.846 1.00 107.87 ? -58  DC  J P     1 
ATOM   9468  O  OP1   . DC  J  6 16  ? -67.608 -27.019 41.587 1.00 106.93 ? -58  DC  J OP1   1 
ATOM   9469  O  OP2   . DC  J  6 16  ? -68.197 -28.732 39.733 1.00 107.23 ? -58  DC  J OP2   1 
ATOM   9470  O  "O5'" . DC  J  6 16  ? -65.849 -28.186 40.219 1.00 107.01 ? -58  DC  J "O5'" 1 
ATOM   9471  C  "C5'" . DC  J  6 16  ? -64.688 -28.094 41.038 1.00 106.10 ? -58  DC  J "C5'" 1 
ATOM   9472  C  "C4'" . DC  J  6 16  ? -63.475 -28.617 40.292 1.00 105.75 ? -58  DC  J "C4'" 1 
ATOM   9473  O  "O4'" . DC  J  6 16  ? -63.477 -30.066 40.201 1.00 104.86 ? -58  DC  J "O4'" 1 
ATOM   9474  C  "C3'" . DC  J  6 16  ? -63.363 -28.122 38.850 1.00 106.26 ? -58  DC  J "C3'" 1 
ATOM   9475  O  "O3'" . DC  J  6 16  ? -62.072 -27.598 38.671 1.00 107.43 ? -58  DC  J "O3'" 1 
ATOM   9476  C  "C2'" . DC  J  6 16  ? -63.524 -29.381 38.011 1.00 105.49 ? -58  DC  J "C2'" 1 
ATOM   9477  C  "C1'" . DC  J  6 16  ? -62.861 -30.357 38.968 1.00 104.58 ? -58  DC  J "C1'" 1 
ATOM   9478  N  N1    . DC  J  6 16  ? -63.024 -31.782 38.642 1.00 104.21 ? -58  DC  J N1    1 
ATOM   9479  C  C2    . DC  J  6 16  ? -61.988 -32.658 38.970 1.00 104.36 ? -58  DC  J C2    1 
ATOM   9480  O  O2    . DC  J  6 16  ? -60.972 -32.212 39.520 1.00 103.93 ? -58  DC  J O2    1 
ATOM   9481  N  N3    . DC  J  6 16  ? -62.138 -33.977 38.669 1.00 104.64 ? -58  DC  J N3    1 
ATOM   9482  C  C4    . DC  J  6 16  ? -63.259 -34.411 38.077 1.00 104.40 ? -58  DC  J C4    1 
ATOM   9483  N  N4    . DC  J  6 16  ? -63.368 -35.714 37.803 1.00 104.32 ? -58  DC  J N4    1 
ATOM   9484  C  C5    . DC  J  6 16  ? -64.325 -33.528 37.739 1.00 104.03 ? -58  DC  J C5    1 
ATOM   9485  C  C6    . DC  J  6 16  ? -64.162 -32.235 38.039 1.00 104.19 ? -58  DC  J C6    1 
ATOM   9486  P  P     . DA  J  6 17  ? -61.867 -26.026 38.637 1.00 108.20 ? -57  DA  J P     1 
ATOM   9487  O  OP1   . DA  J  6 17  ? -62.335 -25.438 39.918 1.00 107.78 ? -57  DA  J OP1   1 
ATOM   9488  O  OP2   . DA  J  6 17  ? -62.436 -25.578 37.345 1.00 108.54 ? -57  DA  J OP2   1 
ATOM   9489  O  "O5'" . DA  J  6 17  ? -60.272 -25.927 38.571 1.00 109.23 ? -57  DA  J "O5'" 1 
ATOM   9490  C  "C5'" . DA  J  6 17  ? -59.488 -26.169 39.745 1.00 110.53 ? -57  DA  J "C5'" 1 
ATOM   9491  C  "C4'" . DA  J  6 17  ? -58.261 -27.025 39.454 1.00 111.01 ? -57  DA  J "C4'" 1 
ATOM   9492  O  "O4'" . DA  J  6 17  ? -58.633 -28.311 38.898 1.00 111.25 ? -57  DA  J "O4'" 1 
ATOM   9493  C  "C3'" . DA  J  6 17  ? -57.256 -26.455 38.459 1.00 111.39 ? -57  DA  J "C3'" 1 
ATOM   9494  O  "O3'" . DA  J  6 17  ? -55.975 -26.942 38.862 1.00 111.29 ? -57  DA  J "O3'" 1 
ATOM   9495  C  "C2'" . DA  J  6 17  ? -57.704 -27.041 37.115 1.00 111.30 ? -57  DA  J "C2'" 1 
ATOM   9496  C  "C1'" . DA  J  6 17  ? -58.191 -28.420 37.555 1.00 111.59 ? -57  DA  J "C1'" 1 
ATOM   9497  N  N9    . DA  J  6 17  ? -59.317 -28.960 36.803 1.00 111.92 ? -57  DA  J N9    1 
ATOM   9498  C  C8    . DA  J  6 17  ? -60.326 -28.271 36.186 1.00 111.94 ? -57  DA  J C8    1 
ATOM   9499  N  N7    . DA  J  6 17  ? -61.204 -29.052 35.599 1.00 112.22 ? -57  DA  J N7    1 
ATOM   9500  C  C5    . DA  J  6 17  ? -60.751 -30.338 35.856 1.00 112.05 ? -57  DA  J C5    1 
ATOM   9501  C  C6    . DA  J  6 17  ? -61.235 -31.623 35.513 1.00 111.69 ? -57  DA  J C6    1 
ATOM   9502  N  N6    . DA  J  6 17  ? -62.339 -31.830 34.797 1.00 111.72 ? -57  DA  J N6    1 
ATOM   9503  N  N1    . DA  J  6 17  ? -60.536 -32.701 35.923 1.00 111.69 ? -57  DA  J N1    1 
ATOM   9504  C  C2    . DA  J  6 17  ? -59.421 -32.509 36.640 1.00 111.99 ? -57  DA  J C2    1 
ATOM   9505  N  N3    . DA  J  6 17  ? -58.867 -31.356 37.028 1.00 112.07 ? -57  DA  J N3    1 
ATOM   9506  C  C4    . DA  J  6 17  ? -59.585 -30.298 36.601 1.00 112.17 ? -57  DA  J C4    1 
ATOM   9507  P  P     . DG  J  6 18  ? -54.593 -26.447 38.220 1.00 110.27 ? -56  DG  J P     1 
ATOM   9508  O  OP1   . DG  J  6 18  ? -53.616 -26.362 39.332 1.00 110.11 ? -56  DG  J OP1   1 
ATOM   9509  O  OP2   . DG  J  6 18  ? -54.852 -25.288 37.333 1.00 110.40 ? -56  DG  J OP2   1 
ATOM   9510  O  "O5'" . DG  J  6 18  ? -54.188 -27.668 37.291 1.00 108.66 ? -56  DG  J "O5'" 1 
ATOM   9511  C  "C5'" . DG  J  6 18  ? -54.069 -28.950 37.852 1.00 108.29 ? -56  DG  J "C5'" 1 
ATOM   9512  C  "C4'" . DG  J  6 18  ? -54.155 -29.915 36.701 1.00 108.45 ? -56  DG  J "C4'" 1 
ATOM   9513  O  "O4'" . DG  J  6 18  ? -55.520 -29.991 36.218 1.00 109.71 ? -56  DG  J "O4'" 1 
ATOM   9514  C  "C3'" . DG  J  6 18  ? -53.330 -29.490 35.493 1.00 107.57 ? -56  DG  J "C3'" 1 
ATOM   9515  O  "O3'" . DG  J  6 18  ? -52.747 -30.645 35.002 1.00 105.75 ? -56  DG  J "O3'" 1 
ATOM   9516  C  "C2'" . DG  J  6 18  ? -54.367 -29.009 34.483 1.00 108.57 ? -56  DG  J "C2'" 1 
ATOM   9517  C  "C1'" . DG  J  6 18  ? -55.439 -30.040 34.805 1.00 109.92 ? -56  DG  J "C1'" 1 
ATOM   9518  N  N9    . DG  J  6 18  ? -56.733 -29.819 34.155 1.00 110.45 ? -56  DG  J N9    1 
ATOM   9519  C  C8    . DG  J  6 18  ? -57.314 -28.623 33.788 1.00 110.56 ? -56  DG  J C8    1 
ATOM   9520  N  N7    . DG  J  6 18  ? -58.479 -28.770 33.212 1.00 110.61 ? -56  DG  J N7    1 
ATOM   9521  C  C5    . DG  J  6 18  ? -58.681 -30.145 33.192 1.00 110.33 ? -56  DG  J C5    1 
ATOM   9522  C  C6    . DG  J  6 18  ? -59.765 -30.907 32.695 1.00 110.20 ? -56  DG  J C6    1 
ATOM   9523  O  O6    . DG  J  6 18  ? -60.799 -30.504 32.157 1.00 110.48 ? -56  DG  J O6    1 
ATOM   9524  N  N1    . DG  J  6 18  ? -59.580 -32.275 32.872 1.00 110.14 ? -56  DG  J N1    1 
ATOM   9525  C  C2    . DG  J  6 18  ? -58.475 -32.834 33.462 1.00 110.20 ? -56  DG  J C2    1 
ATOM   9526  N  N2    . DG  J  6 18  ? -58.465 -34.166 33.555 1.00 110.33 ? -56  DG  J N2    1 
ATOM   9527  N  N3    . DG  J  6 18  ? -57.450 -32.139 33.937 1.00 110.34 ? -56  DG  J N3    1 
ATOM   9528  C  C4    . DG  J  6 18  ? -57.617 -30.802 33.769 1.00 110.42 ? -56  DG  J C4    1 
ATOM   9529  P  P     . DA  J  6 19  ? -51.168 -30.695 34.926 1.00 103.87 ? -55  DA  J P     1 
ATOM   9530  O  OP1   . DA  J  6 19  ? -50.648 -30.923 36.300 1.00 103.95 ? -55  DA  J OP1   1 
ATOM   9531  O  OP2   . DA  J  6 19  ? -50.734 -29.539 34.114 1.00 103.99 ? -55  DA  J OP2   1 
ATOM   9532  O  "O5'" . DA  J  6 19  ? -50.950 -32.008 34.058 1.00 104.00 ? -55  DA  J "O5'" 1 
ATOM   9533  C  "C5'" . DA  J  6 19  ? -51.359 -33.241 34.615 1.00 104.44 ? -55  DA  J "C5'" 1 
ATOM   9534  C  "C4'" . DA  J  6 19  ? -52.382 -33.914 33.728 1.00 104.80 ? -55  DA  J "C4'" 1 
ATOM   9535  O  "O4'" . DA  J  6 19  ? -53.477 -33.015 33.432 1.00 104.91 ? -55  DA  J "O4'" 1 
ATOM   9536  C  "C3'" . DA  J  6 19  ? -51.820 -34.351 32.385 1.00 104.98 ? -55  DA  J "C3'" 1 
ATOM   9537  O  "O3'" . DA  J  6 19  ? -51.834 -35.760 32.277 1.00 105.50 ? -55  DA  J "O3'" 1 
ATOM   9538  C  "C2'" . DA  J  6 19  ? -52.730 -33.676 31.361 1.00 105.31 ? -55  DA  J "C2'" 1 
ATOM   9539  C  "C1'" . DA  J  6 19  ? -53.982 -33.452 32.194 1.00 105.42 ? -55  DA  J "C1'" 1 
ATOM   9540  N  N9    . DA  J  6 19  ? -54.922 -32.479 31.639 1.00 105.49 ? -55  DA  J N9    1 
ATOM   9541  C  C8    . DA  J  6 19  ? -54.833 -31.116 31.673 1.00 105.46 ? -55  DA  J C8    1 
ATOM   9542  N  N7    . DA  J  6 19  ? -55.838 -30.505 31.092 1.00 105.28 ? -55  DA  J N7    1 
ATOM   9543  C  C5    . DA  J  6 19  ? -56.637 -31.539 30.640 1.00 105.45 ? -55  DA  J C5    1 
ATOM   9544  C  C6    . DA  J  6 19  ? -57.860 -31.564 29.939 1.00 105.64 ? -55  DA  J C6    1 
ATOM   9545  N  N6    . DA  J  6 19  ? -58.497 -30.455 29.560 1.00 105.73 ? -55  DA  J N6    1 
ATOM   9546  N  N1    . DA  J  6 19  ? -58.402 -32.767 29.636 1.00 105.54 ? -55  DA  J N1    1 
ATOM   9547  C  C2    . DA  J  6 19  ? -57.758 -33.876 30.021 1.00 105.41 ? -55  DA  J C2    1 
ATOM   9548  N  N3    . DA  J  6 19  ? -56.604 -33.978 30.682 1.00 105.31 ? -55  DA  J N3    1 
ATOM   9549  C  C4    . DA  J  6 19  ? -56.090 -32.765 30.966 1.00 105.41 ? -55  DA  J C4    1 
ATOM   9550  P  P     . DT  J  6 20  ? -50.963 -36.397 31.098 1.00 106.94 ? -54  DT  J P     1 
ATOM   9551  O  OP1   . DT  J  6 20  ? -50.360 -37.674 31.534 1.00 106.99 ? -54  DT  J OP1   1 
ATOM   9552  O  OP2   . DT  J  6 20  ? -50.077 -35.327 30.604 1.00 106.74 ? -54  DT  J OP2   1 
ATOM   9553  O  "O5'" . DT  J  6 20  ? -52.059 -36.704 29.972 1.00 108.12 ? -54  DT  J "O5'" 1 
ATOM   9554  C  "C5'" . DT  J  6 20  ? -53.214 -37.493 30.266 1.00 109.51 ? -54  DT  J "C5'" 1 
ATOM   9555  C  "C4'" . DT  J  6 20  ? -54.188 -37.542 29.096 1.00 110.69 ? -54  DT  J "C4'" 1 
ATOM   9556  O  "O4'" . DT  J  6 20  ? -54.964 -36.319 29.011 1.00 110.56 ? -54  DT  J "O4'" 1 
ATOM   9557  C  "C3'" . DT  J  6 20  ? -53.584 -37.784 27.712 1.00 111.56 ? -54  DT  J "C3'" 1 
ATOM   9558  O  "O3'" . DT  J  6 20  ? -54.260 -38.884 27.111 1.00 113.60 ? -54  DT  J "O3'" 1 
ATOM   9559  C  "C2'" . DT  J  6 20  ? -53.837 -36.476 26.963 1.00 111.01 ? -54  DT  J "C2'" 1 
ATOM   9560  C  "C1'" . DT  J  6 20  ? -55.101 -35.960 27.650 1.00 110.44 ? -54  DT  J "C1'" 1 
ATOM   9561  N  N1    . DT  J  6 20  ? -55.353 -34.473 27.560 1.00 110.22 ? -54  DT  J N1    1 
ATOM   9562  C  C2    . DT  J  6 20  ? -56.575 -34.005 27.094 1.00 110.13 ? -54  DT  J C2    1 
ATOM   9563  O  O2    . DT  J  6 20  ? -57.503 -34.713 26.729 1.00 110.03 ? -54  DT  J O2    1 
ATOM   9564  N  N3    . DT  J  6 20  ? -56.682 -32.637 27.069 1.00 110.07 ? -54  DT  J N3    1 
ATOM   9565  C  C4    . DT  J  6 20  ? -55.727 -31.710 27.444 1.00 110.04 ? -54  DT  J C4    1 
ATOM   9566  O  O4    . DT  J  6 20  ? -55.940 -30.508 27.377 1.00 110.07 ? -54  DT  J O4    1 
ATOM   9567  C  C5    . DT  J  6 20  ? -54.482 -32.256 27.925 1.00 110.00 ? -54  DT  J C5    1 
ATOM   9568  C  C7    . DT  J  6 20  ? -53.369 -31.350 28.367 1.00 109.99 ? -54  DT  J C7    1 
ATOM   9569  C  C6    . DT  J  6 20  ? -54.359 -33.592 27.957 1.00 110.08 ? -54  DT  J C6    1 
ATOM   9570  P  P     . DA  J  6 21  ? -53.564 -39.868 26.054 1.00 115.24 ? -53  DA  J P     1 
ATOM   9571  O  OP1   . DA  J  6 21  ? -53.531 -41.237 26.612 1.00 114.87 ? -53  DA  J OP1   1 
ATOM   9572  O  OP2   . DA  J  6 21  ? -52.319 -39.243 25.567 1.00 115.46 ? -53  DA  J OP2   1 
ATOM   9573  O  "O5'" . DA  J  6 21  ? -54.617 -39.850 24.856 1.00 117.70 ? -53  DA  J "O5'" 1 
ATOM   9574  C  "C5'" . DA  J  6 21  ? -55.983 -39.487 25.091 1.00 120.85 ? -53  DA  J "C5'" 1 
ATOM   9575  C  "C4'" . DA  J  6 21  ? -56.515 -38.605 23.974 1.00 122.96 ? -53  DA  J "C4'" 1 
ATOM   9576  O  "O4'" . DA  J  6 21  ? -56.508 -37.207 24.369 1.00 123.03 ? -53  DA  J "O4'" 1 
ATOM   9577  C  "C3'" . DA  J  6 21  ? -55.739 -38.680 22.658 1.00 124.49 ? -53  DA  J "C3'" 1 
ATOM   9578  O  "O3'" . DA  J  6 21  ? -56.651 -38.992 21.599 1.00 127.14 ? -53  DA  J "O3'" 1 
ATOM   9579  C  "C2'" . DA  J  6 21  ? -55.131 -37.281 22.530 1.00 123.97 ? -53  DA  J "C2'" 1 
ATOM   9580  C  "C1'" . DA  J  6 21  ? -56.235 -36.471 23.197 1.00 123.47 ? -53  DA  J "C1'" 1 
ATOM   9581  N  N9    . DA  J  6 21  ? -55.912 -35.077 23.515 1.00 123.54 ? -53  DA  J N9    1 
ATOM   9582  C  C8    . DA  J  6 21  ? -54.845 -34.604 24.231 1.00 123.42 ? -53  DA  J C8    1 
ATOM   9583  N  N7    . DA  J  6 21  ? -54.821 -33.297 24.355 1.00 123.24 ? -53  DA  J N7    1 
ATOM   9584  C  C5    . DA  J  6 21  ? -55.950 -32.880 23.669 1.00 123.33 ? -53  DA  J C5    1 
ATOM   9585  C  C6    . DA  J  6 21  ? -56.499 -31.603 23.423 1.00 123.31 ? -53  DA  J C6    1 
ATOM   9586  N  N6    . DA  J  6 21  ? -55.946 -30.471 23.867 1.00 123.30 ? -53  DA  J N6    1 
ATOM   9587  N  N1    . DA  J  6 21  ? -57.641 -31.531 22.700 1.00 123.42 ? -53  DA  J N1    1 
ATOM   9588  C  C2    . DA  J  6 21  ? -58.198 -32.665 22.249 1.00 123.36 ? -53  DA  J C2    1 
ATOM   9589  N  N3    . DA  J  6 21  ? -57.775 -33.920 22.420 1.00 123.39 ? -53  DA  J N3    1 
ATOM   9590  C  C4    . DA  J  6 21  ? -56.637 -33.963 23.143 1.00 123.46 ? -53  DA  J C4    1 
ATOM   9591  P  P     . DC  J  6 22  ? -56.194 -39.700 20.229 1.00 129.21 ? -52  DC  J P     1 
ATOM   9592  O  OP1   . DC  J  6 22  ? -56.806 -41.048 20.189 1.00 129.52 ? -52  DC  J OP1   1 
ATOM   9593  O  OP2   . DC  J  6 22  ? -54.728 -39.558 20.066 1.00 129.32 ? -52  DC  J OP2   1 
ATOM   9594  O  "O5'" . DC  J  6 22  ? -56.915 -38.799 19.124 1.00 130.17 ? -52  DC  J "O5'" 1 
ATOM   9595  C  "C5'" . DC  J  6 22  ? -58.269 -38.401 19.316 1.00 132.25 ? -52  DC  J "C5'" 1 
ATOM   9596  C  "C4'" . DC  J  6 22  ? -58.553 -37.188 18.459 1.00 134.03 ? -52  DC  J "C4'" 1 
ATOM   9597  O  "O4'" . DC  J  6 22  ? -58.141 -35.988 19.164 1.00 134.54 ? -52  DC  J "O4'" 1 
ATOM   9598  C  "C3'" . DC  J  6 22  ? -57.799 -37.192 17.128 1.00 134.93 ? -52  DC  J "C3'" 1 
ATOM   9599  O  "O3'" . DC  J  6 22  ? -58.728 -37.075 16.051 1.00 135.87 ? -52  DC  J "O3'" 1 
ATOM   9600  C  "C2'" . DC  J  6 22  ? -56.854 -35.993 17.226 1.00 135.04 ? -52  DC  J "C2'" 1 
ATOM   9601  C  "C1'" . DC  J  6 22  ? -57.611 -35.097 18.203 1.00 134.92 ? -52  DC  J "C1'" 1 
ATOM   9602  N  N1    . DC  J  6 22  ? -56.764 -34.058 18.872 1.00 134.90 ? -52  DC  J N1    1 
ATOM   9603  C  C2    . DC  J  6 22  ? -57.220 -32.730 18.989 1.00 134.69 ? -52  DC  J C2    1 
ATOM   9604  O  O2    . DC  J  6 22  ? -58.330 -32.406 18.548 1.00 134.52 ? -52  DC  J O2    1 
ATOM   9605  N  N3    . DC  J  6 22  ? -56.416 -31.823 19.602 1.00 134.70 ? -52  DC  J N3    1 
ATOM   9606  C  C4    . DC  J  6 22  ? -55.220 -32.191 20.076 1.00 134.83 ? -52  DC  J C4    1 
ATOM   9607  N  N4    . DC  J  6 22  ? -54.463 -31.269 20.671 1.00 134.67 ? -52  DC  J N4    1 
ATOM   9608  C  C5    . DC  J  6 22  ? -54.738 -33.531 19.965 1.00 134.94 ? -52  DC  J C5    1 
ATOM   9609  C  C6    . DC  J  6 22  ? -55.535 -34.420 19.360 1.00 135.08 ? -52  DC  J C6    1 
ATOM   9610  P  P     . DT  J  6 23  ? -58.257 -37.167 14.522 1.00 136.46 ? -51  DT  J P     1 
ATOM   9611  O  OP1   . DT  J  6 23  ? -59.373 -37.754 13.744 1.00 136.35 ? -51  DT  J OP1   1 
ATOM   9612  O  OP2   . DT  J  6 23  ? -56.898 -37.761 14.461 1.00 136.24 ? -51  DT  J OP2   1 
ATOM   9613  O  "O5'" . DT  J  6 23  ? -58.132 -35.633 14.121 1.00 136.28 ? -51  DT  J "O5'" 1 
ATOM   9614  C  "C5'" . DT  J  6 23  ? -59.224 -34.747 14.304 1.00 136.79 ? -51  DT  J "C5'" 1 
ATOM   9615  C  "C4'" . DT  J  6 23  ? -58.826 -33.399 13.743 1.00 137.44 ? -51  DT  J "C4'" 1 
ATOM   9616  O  "O4'" . DT  J  6 23  ? -58.033 -32.689 14.730 1.00 137.71 ? -51  DT  J "O4'" 1 
ATOM   9617  C  "C3'" . DT  J  6 23  ? -57.981 -33.496 12.474 1.00 137.81 ? -51  DT  J "C3'" 1 
ATOM   9618  O  "O3'" . DT  J  6 23  ? -58.597 -32.710 11.446 1.00 138.03 ? -51  DT  J "O3'" 1 
ATOM   9619  C  "C2'" . DT  J  6 23  ? -56.588 -33.014 12.899 1.00 137.83 ? -51  DT  J "C2'" 1 
ATOM   9620  C  "C1'" . DT  J  6 23  ? -56.884 -32.138 14.115 1.00 137.40 ? -51  DT  J "C1'" 1 
ATOM   9621  N  N1    . DT  J  6 23  ? -55.772 -32.069 15.125 1.00 137.22 ? -51  DT  J N1    1 
ATOM   9622  C  C2    . DT  J  6 23  ? -55.569 -30.892 15.823 1.00 136.96 ? -51  DT  J C2    1 
ATOM   9623  O  O2    . DT  J  6 23  ? -56.241 -29.887 15.672 1.00 136.83 ? -51  DT  J O2    1 
ATOM   9624  N  N3    . DT  J  6 23  ? -54.530 -30.935 16.719 1.00 137.10 ? -51  DT  J N3    1 
ATOM   9625  C  C4    . DT  J  6 23  ? -53.696 -32.010 16.981 1.00 137.14 ? -51  DT  J C4    1 
ATOM   9626  O  O4    . DT  J  6 23  ? -52.794 -31.933 17.806 1.00 137.23 ? -51  DT  J O4    1 
ATOM   9627  C  C5    . DT  J  6 23  ? -53.957 -33.212 16.221 1.00 136.98 ? -51  DT  J C5    1 
ATOM   9628  C  C7    . DT  J  6 23  ? -53.126 -34.447 16.413 1.00 136.86 ? -51  DT  J C7    1 
ATOM   9629  C  C6    . DT  J  6 23  ? -54.970 -33.181 15.343 1.00 137.19 ? -51  DT  J C6    1 
ATOM   9630  P  P     . DA  J  6 24  ? -57.913 -32.393 10.028 1.00 138.07 ? -50  DA  J P     1 
ATOM   9631  O  OP1   . DA  J  6 24  ? -59.014 -32.086 9.088  1.00 138.19 ? -50  DA  J OP1   1 
ATOM   9632  O  OP2   . DA  J  6 24  ? -56.920 -33.448 9.690  1.00 137.79 ? -50  DA  J OP2   1 
ATOM   9633  O  "O5'" . DA  J  6 24  ? -57.132 -31.029 10.337 1.00 137.97 ? -50  DA  J "O5'" 1 
ATOM   9634  C  "C5'" . DA  J  6 24  ? -57.763 -29.955 11.062 1.00 137.63 ? -50  DA  J "C5'" 1 
ATOM   9635  C  "C4'" . DA  J  6 24  ? -57.098 -28.614 10.774 1.00 137.17 ? -50  DA  J "C4'" 1 
ATOM   9636  O  "O4'" . DA  J  6 24  ? -56.154 -28.245 11.818 1.00 137.03 ? -50  DA  J "O4'" 1 
ATOM   9637  C  "C3'" . DA  J  6 24  ? -56.320 -28.557 9.467  1.00 136.91 ? -50  DA  J "C3'" 1 
ATOM   9638  O  "O3'" . DA  J  6 24  ? -56.607 -27.299 8.854  1.00 136.40 ? -50  DA  J "O3'" 1 
ATOM   9639  C  "C2'" . DA  J  6 24  ? -54.859 -28.767 9.894  1.00 136.81 ? -50  DA  J "C2'" 1 
ATOM   9640  C  "C1'" . DA  J  6 24  ? -54.818 -28.278 11.343 1.00 136.60 ? -50  DA  J "C1'" 1 
ATOM   9641  N  N9    . DA  J  6 24  ? -54.041 -29.134 12.243 1.00 136.50 ? -50  DA  J N9    1 
ATOM   9642  C  C8    . DA  J  6 24  ? -54.068 -30.503 12.301 1.00 136.47 ? -50  DA  J C8    1 
ATOM   9643  N  N7    . DA  J  6 24  ? -53.277 -31.023 13.208 1.00 136.48 ? -50  DA  J N7    1 
ATOM   9644  C  C5    . DA  J  6 24  ? -52.685 -29.918 13.795 1.00 136.44 ? -50  DA  J C5    1 
ATOM   9645  C  C6    . DA  J  6 24  ? -51.740 -29.794 14.836 1.00 136.31 ? -50  DA  J C6    1 
ATOM   9646  N  N6    . DA  J  6 24  ? -51.217 -30.843 15.476 1.00 136.22 ? -50  DA  J N6    1 
ATOM   9647  N  N1    . DA  J  6 24  ? -51.354 -28.548 15.190 1.00 136.42 ? -50  DA  J N1    1 
ATOM   9648  C  C2    . DA  J  6 24  ? -51.880 -27.499 14.536 1.00 136.47 ? -50  DA  J C2    1 
ATOM   9649  N  N3    . DA  J  6 24  ? -52.779 -27.489 13.546 1.00 136.32 ? -50  DA  J N3    1 
ATOM   9650  C  C4    . DA  J  6 24  ? -53.145 -28.743 13.215 1.00 136.46 ? -50  DA  J C4    1 
ATOM   9651  P  P     . DC  J  6 25  ? -55.622 -26.630 7.787  1.00 136.07 ? -49  DC  J P     1 
ATOM   9652  O  OP1   . DC  J  6 25  ? -56.295 -25.429 7.240  1.00 136.12 ? -49  DC  J OP1   1 
ATOM   9653  O  OP2   . DC  J  6 25  ? -55.102 -27.692 6.887  1.00 135.83 ? -49  DC  J OP2   1 
ATOM   9654  O  "O5'" . DC  J  6 25  ? -54.418 -26.137 8.711  1.00 134.92 ? -49  DC  J "O5'" 1 
ATOM   9655  C  "C5'" . DC  J  6 25  ? -54.528 -24.975 9.527  1.00 132.80 ? -49  DC  J "C5'" 1 
ATOM   9656  C  "C4'" . DC  J  6 25  ? -53.136 -24.401 9.698  1.00 131.21 ? -49  DC  J "C4'" 1 
ATOM   9657  O  "O4'" . DC  J  6 25  ? -52.391 -25.224 10.633 1.00 130.87 ? -49  DC  J "O4'" 1 
ATOM   9658  C  "C3'" . DC  J  6 25  ? -52.329 -24.373 8.401  1.00 129.90 ? -49  DC  J "C3'" 1 
ATOM   9659  O  "O3'" . DC  J  6 25  ? -51.841 -23.053 8.204  1.00 127.84 ? -49  DC  J "O3'" 1 
ATOM   9660  C  "C2'" . DC  J  6 25  ? -51.229 -25.427 8.590  1.00 130.01 ? -49  DC  J "C2'" 1 
ATOM   9661  C  "C1'" . DC  J  6 25  ? -51.105 -25.503 10.110 1.00 130.01 ? -49  DC  J "C1'" 1 
ATOM   9662  N  N1    . DC  J  6 25  ? -50.661 -26.830 10.657 1.00 129.58 ? -49  DC  J N1    1 
ATOM   9663  C  C2    . DC  J  6 25  ? -49.748 -26.871 11.728 1.00 129.09 ? -49  DC  J C2    1 
ATOM   9664  O  O2    . DC  J  6 25  ? -49.303 -25.824 12.214 1.00 128.89 ? -49  DC  J O2    1 
ATOM   9665  N  N3    . DC  J  6 25  ? -49.364 -28.077 12.213 1.00 128.88 ? -49  DC  J N3    1 
ATOM   9666  C  C4    . DC  J  6 25  ? -49.854 -29.198 11.680 1.00 129.22 ? -49  DC  J C4    1 
ATOM   9667  N  N4    . DC  J  6 25  ? -49.439 -30.354 12.202 1.00 129.22 ? -49  DC  J N4    1 
ATOM   9668  C  C5    . DC  J  6 25  ? -50.784 -29.184 10.594 1.00 129.18 ? -49  DC  J C5    1 
ATOM   9669  C  C6    . DC  J  6 25  ? -51.159 -27.989 10.119 1.00 129.36 ? -49  DC  J C6    1 
ATOM   9670  P  P     . DC  J  6 26  ? -50.852 -22.705 7.001  1.00 126.20 ? -48  DC  J P     1 
ATOM   9671  O  OP1   . DC  J  6 26  ? -51.132 -21.321 6.567  1.00 126.76 ? -48  DC  J OP1   1 
ATOM   9672  O  OP2   . DC  J  6 26  ? -50.880 -23.802 6.008  1.00 126.12 ? -48  DC  J OP2   1 
ATOM   9673  O  "O5'" . DC  J  6 26  ? -49.448 -22.724 7.757  1.00 125.43 ? -48  DC  J "O5'" 1 
ATOM   9674  C  "C5'" . DC  J  6 26  ? -49.152 -21.766 8.782  1.00 123.75 ? -48  DC  J "C5'" 1 
ATOM   9675  C  "C4'" . DC  J  6 26  ? -47.722 -21.947 9.262  1.00 122.29 ? -48  DC  J "C4'" 1 
ATOM   9676  O  "O4'" . DC  J  6 26  ? -47.610 -23.244 9.906  1.00 121.99 ? -48  DC  J "O4'" 1 
ATOM   9677  C  "C3'" . DC  J  6 26  ? -46.690 -21.946 8.136  1.00 121.23 ? -48  DC  J "C3'" 1 
ATOM   9678  O  "O3'" . DC  J  6 26  ? -45.539 -21.210 8.498  1.00 119.88 ? -48  DC  J "O3'" 1 
ATOM   9679  C  "C2'" . DC  J  6 26  ? -46.346 -23.419 7.950  1.00 121.19 ? -48  DC  J "C2'" 1 
ATOM   9680  C  "C1'" . DC  J  6 26  ? -46.471 -23.896 9.390  1.00 121.48 ? -48  DC  J "C1'" 1 
ATOM   9681  N  N1    . DC  J  6 26  ? -46.597 -25.370 9.539  1.00 121.34 ? -48  DC  J N1    1 
ATOM   9682  C  C2    . DC  J  6 26  ? -46.138 -25.982 10.715 1.00 121.48 ? -48  DC  J C2    1 
ATOM   9683  O  O2    . DC  J  6 26  ? -45.644 -25.292 11.619 1.00 121.47 ? -48  DC  J O2    1 
ATOM   9684  N  N3    . DC  J  6 26  ? -46.246 -27.330 10.834 1.00 121.51 ? -48  DC  J N3    1 
ATOM   9685  C  C4    . DC  J  6 26  ? -46.780 -28.052 9.848  1.00 121.38 ? -48  DC  J C4    1 
ATOM   9686  N  N4    . DC  J  6 26  ? -46.865 -29.374 10.016 1.00 121.41 ? -48  DC  J N4    1 
ATOM   9687  C  C5    . DC  J  6 26  ? -47.253 -27.447 8.647  1.00 121.59 ? -48  DC  J C5    1 
ATOM   9688  C  C6    . DC  J  6 26  ? -47.142 -26.117 8.535  1.00 121.40 ? -48  DC  J C6    1 
ATOM   9689  P  P     . DA  J  6 27  ? -44.825 -20.318 7.381  1.00 118.74 ? -47  DA  J P     1 
ATOM   9690  O  OP1   . DA  J  6 27  ? -45.644 -19.094 7.237  1.00 119.11 ? -47  DA  J OP1   1 
ATOM   9691  O  OP2   . DA  J  6 27  ? -44.493 -21.154 6.204  1.00 117.94 ? -47  DA  J OP2   1 
ATOM   9692  O  "O5'" . DA  J  6 27  ? -43.461 -19.909 8.091  1.00 117.77 ? -47  DA  J "O5'" 1 
ATOM   9693  C  "C5'" . DA  J  6 27  ? -43.510 -19.182 9.310  1.00 115.76 ? -47  DA  J "C5'" 1 
ATOM   9694  C  "C4'" . DA  J  6 27  ? -42.616 -19.826 10.350 1.00 114.07 ? -47  DA  J "C4'" 1 
ATOM   9695  O  "O4'" . DA  J  6 27  ? -42.907 -21.242 10.447 1.00 113.13 ? -47  DA  J "O4'" 1 
ATOM   9696  C  "C3'" . DA  J  6 27  ? -41.133 -19.734 10.045 1.00 113.43 ? -47  DA  J "C3'" 1 
ATOM   9697  O  "O3'" . DA  J  6 27  ? -40.435 -19.636 11.270 1.00 113.03 ? -47  DA  J "O3'" 1 
ATOM   9698  C  "C2'" . DA  J  6 27  ? -40.850 -21.047 9.316  1.00 112.81 ? -47  DA  J "C2'" 1 
ATOM   9699  C  "C1'" . DA  J  6 27  ? -41.798 -22.011 10.023 1.00 112.21 ? -47  DA  J "C1'" 1 
ATOM   9700  N  N9    . DA  J  6 27  ? -42.340 -23.079 9.193  1.00 111.79 ? -47  DA  J N9    1 
ATOM   9701  C  C8    . DA  J  6 27  ? -42.740 -22.985 7.894  1.00 111.73 ? -47  DA  J C8    1 
ATOM   9702  N  N7    . DA  J  6 27  ? -43.203 -24.104 7.395  1.00 111.82 ? -47  DA  J N7    1 
ATOM   9703  C  C5    . DA  J  6 27  ? -43.108 -25.000 8.441  1.00 111.67 ? -47  DA  J C5    1 
ATOM   9704  C  C6    . DA  J  6 27  ? -43.443 -26.365 8.558  1.00 111.72 ? -47  DA  J C6    1 
ATOM   9705  N  N6    . DA  J  6 27  ? -43.959 -27.081 7.562  1.00 111.66 ? -47  DA  J N6    1 
ATOM   9706  N  N1    . DA  J  6 27  ? -43.225 -26.972 9.742  1.00 111.81 ? -47  DA  J N1    1 
ATOM   9707  C  C2    . DA  J  6 27  ? -42.705 -26.249 10.744 1.00 111.82 ? -47  DA  J C2    1 
ATOM   9708  N  N3    . DA  J  6 27  ? -42.353 -24.961 10.752 1.00 111.61 ? -47  DA  J N3    1 
ATOM   9709  C  C4    . DA  J  6 27  ? -42.580 -24.384 9.560  1.00 111.66 ? -47  DA  J C4    1 
ATOM   9710  P  P     . DA  J  6 28  ? -39.020 -18.895 11.326 1.00 112.83 ? -46  DA  J P     1 
ATOM   9711  O  OP1   . DA  J  6 28  ? -39.294 -17.441 11.399 1.00 112.73 ? -46  DA  J OP1   1 
ATOM   9712  O  OP2   . DA  J  6 28  ? -38.164 -19.446 10.246 1.00 112.23 ? -46  DA  J OP2   1 
ATOM   9713  O  "O5'" . DA  J  6 28  ? -38.413 -19.377 12.733 1.00 112.30 ? -46  DA  J "O5'" 1 
ATOM   9714  C  "C5'" . DA  J  6 28  ? -38.976 -20.469 13.470 1.00 110.70 ? -46  DA  J "C5'" 1 
ATOM   9715  C  "C4'" . DA  J  6 28  ? -38.291 -21.807 13.196 1.00 109.37 ? -46  DA  J "C4'" 1 
ATOM   9716  O  "O4'" . DA  J  6 28  ? -38.875 -22.479 12.050 1.00 108.64 ? -46  DA  J "O4'" 1 
ATOM   9717  C  "C3'" . DA  J  6 28  ? -36.787 -21.819 12.937 1.00 108.91 ? -46  DA  J "C3'" 1 
ATOM   9718  O  "O3'" . DA  J  6 28  ? -36.322 -22.871 13.749 1.00 109.43 ? -46  DA  J "O3'" 1 
ATOM   9719  C  "C2'" . DA  J  6 28  ? -36.681 -22.214 11.462 1.00 108.09 ? -46  DA  J "C2'" 1 
ATOM   9720  C  "C1'" . DA  J  6 28  ? -37.838 -23.202 11.424 1.00 107.11 ? -46  DA  J "C1'" 1 
ATOM   9721  N  N9    . DA  J  6 28  ? -38.320 -23.665 10.127 1.00 106.66 ? -46  DA  J N9    1 
ATOM   9722  C  C8    . DA  J  6 28  ? -38.400 -22.961 8.962  1.00 106.53 ? -46  DA  J C8    1 
ATOM   9723  N  N7    . DA  J  6 28  ? -38.896 -23.652 7.965  1.00 106.50 ? -46  DA  J N7    1 
ATOM   9724  C  C5    . DA  J  6 28  ? -39.160 -24.893 8.513  1.00 106.32 ? -46  DA  J C5    1 
ATOM   9725  C  C6    . DA  J  6 28  ? -39.693 -26.082 7.978  1.00 106.40 ? -46  DA  J C6    1 
ATOM   9726  N  N6    . DA  J  6 28  ? -40.069 -26.207 6.706  1.00 106.49 ? -46  DA  J N6    1 
ATOM   9727  N  N1    . DA  J  6 28  ? -39.820 -27.148 8.793  1.00 106.49 ? -46  DA  J N1    1 
ATOM   9728  C  C2    . DA  J  6 28  ? -39.444 -27.028 10.069 1.00 106.37 ? -46  DA  J C2    1 
ATOM   9729  N  N3    . DA  J  6 28  ? -38.933 -25.962 10.684 1.00 106.35 ? -46  DA  J N3    1 
ATOM   9730  C  C4    . DA  J  6 28  ? -38.815 -24.918 9.847  1.00 106.36 ? -46  DA  J C4    1 
ATOM   9731  P  P     . DA  J  6 29  ? -34.827 -22.997 14.292 1.00 109.66 ? -45  DA  J P     1 
ATOM   9732  O  OP1   . DA  J  6 29  ? -34.769 -22.071 15.441 1.00 109.76 ? -45  DA  J OP1   1 
ATOM   9733  O  OP2   . DA  J  6 29  ? -33.853 -22.898 13.172 1.00 109.01 ? -45  DA  J OP2   1 
ATOM   9734  O  "O5'" . DA  J  6 29  ? -34.771 -24.501 14.844 1.00 109.37 ? -45  DA  J "O5'" 1 
ATOM   9735  C  "C5'" . DA  J  6 29  ? -35.932 -25.342 14.928 1.00 109.12 ? -45  DA  J "C5'" 1 
ATOM   9736  C  "C4'" . DA  J  6 29  ? -35.685 -26.700 14.288 1.00 108.89 ? -45  DA  J "C4'" 1 
ATOM   9737  O  "O4'" . DA  J  6 29  ? -36.249 -26.709 12.954 1.00 108.90 ? -45  DA  J "O4'" 1 
ATOM   9738  C  "C3'" . DA  J  6 29  ? -34.221 -27.100 14.114 1.00 108.99 ? -45  DA  J "C3'" 1 
ATOM   9739  O  "O3'" . DA  J  6 29  ? -34.090 -28.503 14.243 1.00 109.61 ? -45  DA  J "O3'" 1 
ATOM   9740  C  "C2'" . DA  J  6 29  ? -33.928 -26.680 12.683 1.00 108.88 ? -45  DA  J "C2'" 1 
ATOM   9741  C  "C1'" . DA  J  6 29  ? -35.242 -27.112 12.045 1.00 109.14 ? -45  DA  J "C1'" 1 
ATOM   9742  N  N9    . DA  J  6 29  ? -35.488 -26.584 10.696 1.00 109.65 ? -45  DA  J N9    1 
ATOM   9743  C  C8    . DA  J  6 29  ? -35.219 -25.327 10.208 1.00 109.43 ? -45  DA  J C8    1 
ATOM   9744  N  N7    . DA  J  6 29  ? -35.555 -25.165 8.946  1.00 109.31 ? -45  DA  J N7    1 
ATOM   9745  C  C5    . DA  J  6 29  ? -36.074 -26.398 8.581  1.00 109.24 ? -45  DA  J C5    1 
ATOM   9746  C  C6    . DA  J  6 29  ? -36.611 -26.893 7.378  1.00 109.10 ? -45  DA  J C6    1 
ATOM   9747  N  N6    . DA  J  6 29  ? -36.709 -26.158 6.271  1.00 109.41 ? -45  DA  J N6    1 
ATOM   9748  N  N1    . DA  J  6 29  ? -37.047 -28.169 7.344  1.00 109.14 ? -45  DA  J N1    1 
ATOM   9749  C  C2    . DA  J  6 29  ? -36.952 -28.914 8.446  1.00 109.05 ? -45  DA  J C2    1 
ATOM   9750  N  N3    . DA  J  6 29  ? -36.469 -28.561 9.634  1.00 109.18 ? -45  DA  J N3    1 
ATOM   9751  C  C4    . DA  J  6 29  ? -36.044 -27.283 9.641  1.00 109.43 ? -45  DA  J C4    1 
ATOM   9752  P  P     . DA  J  6 30  ? -33.093 -29.145 15.315 1.00 110.24 ? -44  DA  J P     1 
ATOM   9753  O  OP1   . DA  J  6 30  ? -33.878 -29.360 16.552 1.00 109.92 ? -44  DA  J OP1   1 
ATOM   9754  O  OP2   . DA  J  6 30  ? -31.843 -28.346 15.351 1.00 109.52 ? -44  DA  J OP2   1 
ATOM   9755  O  "O5'" . DA  J  6 30  ? -32.734 -30.565 14.661 1.00 110.27 ? -44  DA  J "O5'" 1 
ATOM   9756  C  "C5'" . DA  J  6 30  ? -33.752 -31.468 14.250 1.00 110.92 ? -44  DA  J "C5'" 1 
ATOM   9757  C  "C4'" . DA  J  6 30  ? -33.585 -31.853 12.789 1.00 111.74 ? -44  DA  J "C4'" 1 
ATOM   9758  O  "O4'" . DA  J  6 30  ? -33.849 -30.720 11.923 1.00 112.49 ? -44  DA  J "O4'" 1 
ATOM   9759  C  "C3'" . DA  J  6 30  ? -32.196 -32.345 12.386 1.00 112.15 ? -44  DA  J "C3'" 1 
ATOM   9760  O  "O3'" . DA  J  6 30  ? -32.233 -33.726 12.065 1.00 112.65 ? -44  DA  J "O3'" 1 
ATOM   9761  C  "C2'" . DA  J  6 30  ? -31.836 -31.516 11.152 1.00 112.78 ? -44  DA  J "C2'" 1 
ATOM   9762  C  "C1'" . DA  J  6 30  ? -33.203 -31.020 10.697 1.00 113.36 ? -44  DA  J "C1'" 1 
ATOM   9763  N  N9    . DA  J  6 30  ? -33.184 -29.865 9.780  1.00 113.58 ? -44  DA  J N9    1 
ATOM   9764  C  C8    . DA  J  6 30  ? -32.792 -28.586 10.073 1.00 113.68 ? -44  DA  J C8    1 
ATOM   9765  N  N7    . DA  J  6 30  ? -32.876 -27.742 9.070  1.00 113.73 ? -44  DA  J N7    1 
ATOM   9766  C  C5    . DA  J  6 30  ? -33.355 -28.518 8.031  1.00 113.61 ? -44  DA  J C5    1 
ATOM   9767  C  C6    . DA  J  6 30  ? -33.661 -28.214 6.688  1.00 113.54 ? -44  DA  J C6    1 
ATOM   9768  N  N6    . DA  J  6 30  ? -33.518 -26.994 6.163  1.00 113.40 ? -44  DA  J N6    1 
ATOM   9769  N  N1    . DA  J  6 30  ? -34.122 -29.211 5.903  1.00 113.65 ? -44  DA  J N1    1 
ATOM   9770  C  C2    . DA  J  6 30  ? -34.268 -30.433 6.438  1.00 113.62 ? -44  DA  J C2    1 
ATOM   9771  N  N3    . DA  J  6 30  ? -34.004 -30.838 7.682  1.00 113.42 ? -44  DA  J N3    1 
ATOM   9772  C  C4    . DA  J  6 30  ? -33.551 -29.827 8.446  1.00 113.56 ? -44  DA  J C4    1 
ATOM   9773  P  P     . DG  J  6 31  ? -30.886 -34.593 12.101 1.00 114.02 ? -43  DG  J P     1 
ATOM   9774  O  OP1   . DG  J  6 31  ? -31.002 -35.643 13.139 1.00 113.80 ? -43  DG  J OP1   1 
ATOM   9775  O  OP2   . DG  J  6 31  ? -29.737 -33.661 12.133 1.00 113.82 ? -43  DG  J OP2   1 
ATOM   9776  O  "O5'" . DG  J  6 31  ? -30.879 -35.308 10.674 1.00 115.79 ? -43  DG  J "O5'" 1 
ATOM   9777  C  "C5'" . DG  J  6 31  ? -32.050 -35.931 10.157 1.00 117.99 ? -43  DG  J "C5'" 1 
ATOM   9778  C  "C4'" . DG  J  6 31  ? -32.021 -35.880 8.643  1.00 119.56 ? -43  DG  J "C4'" 1 
ATOM   9779  O  "O4'" . DG  J  6 31  ? -32.236 -34.520 8.190  1.00 119.63 ? -43  DG  J "O4'" 1 
ATOM   9780  C  "C3'" . DG  J  6 31  ? -30.711 -36.336 8.016  1.00 120.92 ? -43  DG  J "C3'" 1 
ATOM   9781  O  "O3'" . DG  J  6 31  ? -30.995 -37.425 7.152  1.00 123.49 ? -43  DG  J "O3'" 1 
ATOM   9782  C  "C2'" . DG  J  6 31  ? -30.201 -35.106 7.261  1.00 120.48 ? -43  DG  J "C2'" 1 
ATOM   9783  C  "C1'" . DG  J  6 31  ? -31.478 -34.315 7.021  1.00 119.97 ? -43  DG  J "C1'" 1 
ATOM   9784  N  N9    . DG  J  6 31  ? -31.256 -32.880 6.840  1.00 119.93 ? -43  DG  J N9    1 
ATOM   9785  C  C8    . DG  J  6 31  ? -30.840 -31.983 7.792  1.00 119.84 ? -43  DG  J C8    1 
ATOM   9786  N  N7    . DG  J  6 31  ? -30.725 -30.765 7.352  1.00 119.66 ? -43  DG  J N7    1 
ATOM   9787  C  C5    . DG  J  6 31  ? -31.084 -30.852 6.018  1.00 119.76 ? -43  DG  J C5    1 
ATOM   9788  C  C6    . DG  J  6 31  ? -31.152 -29.844 5.023  1.00 119.87 ? -43  DG  J C6    1 
ATOM   9789  O  O6    . DG  J  6 31  ? -30.900 -28.641 5.140  1.00 119.99 ? -43  DG  J O6    1 
ATOM   9790  N  N1    . DG  J  6 31  ? -31.568 -30.341 3.787  1.00 120.04 ? -43  DG  J N1    1 
ATOM   9791  C  C2    . DG  J  6 31  ? -31.879 -31.662 3.542  1.00 120.06 ? -43  DG  J C2    1 
ATOM   9792  N  N2    . DG  J  6 31  ? -32.259 -31.961 2.290  1.00 119.91 ? -43  DG  J N2    1 
ATOM   9793  N  N3    . DG  J  6 31  ? -31.816 -32.620 4.468  1.00 120.17 ? -43  DG  J N3    1 
ATOM   9794  C  C4    . DG  J  6 31  ? -31.415 -32.148 5.682  1.00 120.00 ? -43  DG  J C4    1 
ATOM   9795  P  P     . DT  J  6 32  ? -29.840 -38.332 6.504  1.00 125.71 ? -42  DT  J P     1 
ATOM   9796  O  OP1   . DT  J  6 32  ? -29.997 -39.705 7.040  1.00 125.63 ? -42  DT  J OP1   1 
ATOM   9797  O  OP2   . DT  J  6 32  ? -28.525 -37.653 6.636  1.00 125.30 ? -42  DT  J OP2   1 
ATOM   9798  O  "O5'" . DT  J  6 32  ? -30.246 -38.334 4.949  1.00 127.28 ? -42  DT  J "O5'" 1 
ATOM   9799  C  "C5'" . DT  J  6 32  ? -31.059 -37.298 4.369  1.00 129.20 ? -42  DT  J "C5'" 1 
ATOM   9800  C  "C4'" . DT  J  6 32  ? -30.523 -36.773 3.040  1.00 130.62 ? -42  DT  J "C4'" 1 
ATOM   9801  O  "O4'" . DT  J  6 32  ? -30.244 -35.353 3.155  1.00 130.80 ? -42  DT  J "O4'" 1 
ATOM   9802  C  "C3'" . DT  J  6 32  ? -29.247 -37.427 2.512  1.00 131.65 ? -42  DT  J "C3'" 1 
ATOM   9803  O  "O3'" . DT  J  6 32  ? -29.411 -37.748 1.128  1.00 133.38 ? -42  DT  J "O3'" 1 
ATOM   9804  C  "C2'" . DT  J  6 32  ? -28.167 -36.375 2.748  1.00 131.53 ? -42  DT  J "C2'" 1 
ATOM   9805  C  "C1'" . DT  J  6 32  ? -28.953 -35.075 2.654  1.00 131.58 ? -42  DT  J "C1'" 1 
ATOM   9806  N  N1    . DT  J  6 32  ? -28.371 -33.982 3.482  1.00 131.82 ? -42  DT  J N1    1 
ATOM   9807  C  C2    . DT  J  6 32  ? -28.547 -32.661 3.105  1.00 131.71 ? -42  DT  J C2    1 
ATOM   9808  O  O2    . DT  J  6 32  ? -29.163 -32.313 2.113  1.00 131.71 ? -42  DT  J O2    1 
ATOM   9809  N  N3    . DT  J  6 32  ? -27.963 -31.749 3.952  1.00 131.79 ? -42  DT  J N3    1 
ATOM   9810  C  C4    . DT  J  6 32  ? -27.239 -32.022 5.109  1.00 131.90 ? -42  DT  J C4    1 
ATOM   9811  O  O4    . DT  J  6 32  ? -26.755 -31.130 5.799  1.00 131.84 ? -42  DT  J O4    1 
ATOM   9812  C  C5    . DT  J  6 32  ? -27.092 -33.423 5.445  1.00 131.95 ? -42  DT  J C5    1 
ATOM   9813  C  C7    . DT  J  6 32  ? -26.332 -33.855 6.668  1.00 131.70 ? -42  DT  J C7    1 
ATOM   9814  C  C6    . DT  J  6 32  ? -27.659 -34.320 4.625  1.00 132.00 ? -42  DT  J C6    1 
ATOM   9815  P  P     . DG  J  6 33  ? -28.200 -38.269 0.209  1.00 134.55 ? -41  DG  J P     1 
ATOM   9816  O  OP1   . DG  J  6 33  ? -28.749 -39.196 -0.808 1.00 134.55 ? -41  DG  J OP1   1 
ATOM   9817  O  OP2   . DG  J  6 33  ? -27.073 -38.710 1.068  1.00 134.68 ? -41  DG  J OP2   1 
ATOM   9818  O  "O5'" . DG  J  6 33  ? -27.769 -36.914 -0.507 1.00 135.32 ? -41  DG  J "O5'" 1 
ATOM   9819  C  "C5'" . DG  J  6 33  ? -28.356 -36.550 -1.744 1.00 137.14 ? -41  DG  J "C5'" 1 
ATOM   9820  C  "C4'" . DG  J  6 33  ? -27.420 -35.593 -2.449 1.00 138.63 ? -41  DG  J "C4'" 1 
ATOM   9821  O  "O4'" . DG  J  6 33  ? -27.239 -34.431 -1.595 1.00 139.13 ? -41  DG  J "O4'" 1 
ATOM   9822  C  "C3'" . DG  J  6 33  ? -26.030 -36.163 -2.738 1.00 139.26 ? -41  DG  J "C3'" 1 
ATOM   9823  O  "O3'" . DG  J  6 33  ? -25.684 -35.843 -4.101 1.00 140.18 ? -41  DG  J "O3'" 1 
ATOM   9824  C  "C2'" . DG  J  6 33  ? -25.154 -35.519 -1.655 1.00 139.35 ? -41  DG  J "C2'" 1 
ATOM   9825  C  "C1'" . DG  J  6 33  ? -25.857 -34.183 -1.416 1.00 139.08 ? -41  DG  J "C1'" 1 
ATOM   9826  N  N9    . DG  J  6 33  ? -25.618 -33.588 -0.096 1.00 138.92 ? -41  DG  J N9    1 
ATOM   9827  C  C8    . DG  J  6 33  ? -25.561 -34.240 1.114  1.00 138.82 ? -41  DG  J C8    1 
ATOM   9828  N  N7    . DG  J  6 33  ? -25.329 -33.448 2.121  1.00 138.84 ? -41  DG  J N7    1 
ATOM   9829  C  C5    . DG  J  6 33  ? -25.224 -32.186 1.550  1.00 138.88 ? -41  DG  J C5    1 
ATOM   9830  C  C6    . DG  J  6 33  ? -24.976 -30.923 2.150  1.00 138.94 ? -41  DG  J C6    1 
ATOM   9831  O  O6    . DG  J  6 33  ? -24.793 -30.659 3.346  1.00 138.82 ? -41  DG  J O6    1 
ATOM   9832  N  N1    . DG  J  6 33  ? -24.948 -29.891 1.214  1.00 138.92 ? -41  DG  J N1    1 
ATOM   9833  C  C2    . DG  J  6 33  ? -25.132 -30.060 -0.136 1.00 138.85 ? -41  DG  J C2    1 
ATOM   9834  N  N2    . DG  J  6 33  ? -25.074 -28.949 -0.880 1.00 138.89 ? -41  DG  J N2    1 
ATOM   9835  N  N3    . DG  J  6 33  ? -25.369 -31.235 -0.711 1.00 138.79 ? -41  DG  J N3    1 
ATOM   9836  C  C4    . DG  J  6 33  ? -25.400 -32.255 0.185  1.00 138.82 ? -41  DG  J C4    1 
ATOM   9837  P  P     . DT  J  6 34  ? -24.228 -35.387 -4.614 1.00 140.98 ? -40  DT  J P     1 
ATOM   9838  O  OP1   . DT  J  6 34  ? -24.219 -35.571 -6.081 1.00 141.06 ? -40  DT  J OP1   1 
ATOM   9839  O  OP2   . DT  J  6 34  ? -23.200 -36.084 -3.800 1.00 140.90 ? -40  DT  J OP2   1 
ATOM   9840  O  "O5'" . DT  J  6 34  ? -24.189 -33.809 -4.288 1.00 140.91 ? -40  DT  J "O5'" 1 
ATOM   9841  C  "C5'" . DT  J  6 34  ? -24.204 -32.789 -5.302 1.00 140.57 ? -40  DT  J "C5'" 1 
ATOM   9842  C  "C4'" . DT  J  6 34  ? -23.138 -31.732 -5.036 1.00 140.58 ? -40  DT  J "C4'" 1 
ATOM   9843  O  "O4'" . DT  J  6 34  ? -23.088 -31.398 -3.617 1.00 140.41 ? -40  DT  J "O4'" 1 
ATOM   9844  C  "C3'" . DT  J  6 34  ? -21.711 -32.132 -5.425 1.00 140.67 ? -40  DT  J "C3'" 1 
ATOM   9845  O  "O3'" . DT  J  6 34  ? -21.014 -30.997 -5.965 1.00 140.77 ? -40  DT  J "O3'" 1 
ATOM   9846  C  "C2'" . DT  J  6 34  ? -21.130 -32.575 -4.087 1.00 140.49 ? -40  DT  J "C2'" 1 
ATOM   9847  C  "C1'" . DT  J  6 34  ? -21.740 -31.502 -3.190 1.00 140.54 ? -40  DT  J "C1'" 1 
ATOM   9848  N  N1    . DT  J  6 34  ? -21.596 -31.752 -1.701 1.00 140.69 ? -40  DT  J N1    1 
ATOM   9849  C  C2    . DT  J  6 34  ? -21.267 -30.691 -0.870 1.00 140.55 ? -40  DT  J C2    1 
ATOM   9850  O  O2    . DT  J  6 34  ? -21.096 -29.550 -1.266 1.00 140.45 ? -40  DT  J O2    1 
ATOM   9851  N  N3    . DT  J  6 34  ? -21.141 -31.016 0.462  1.00 140.44 ? -40  DT  J N3    1 
ATOM   9852  C  C4    . DT  J  6 34  ? -21.306 -32.266 1.037  1.00 140.47 ? -40  DT  J C4    1 
ATOM   9853  O  O4    . DT  J  6 34  ? -21.173 -32.445 2.243  1.00 140.50 ? -40  DT  J O4    1 
ATOM   9854  C  C5    . DT  J  6 34  ? -21.644 -33.334 0.121  1.00 140.48 ? -40  DT  J C5    1 
ATOM   9855  C  C7    . DT  J  6 34  ? -21.851 -34.736 0.618  1.00 140.44 ? -40  DT  J C7    1 
ATOM   9856  C  C6    . DT  J  6 34  ? -21.767 -33.030 -1.182 1.00 140.68 ? -40  DT  J C6    1 
ATOM   9857  P  P     . DA  J  6 35  ? -19.475 -31.035 -6.448 1.00 140.64 ? -39  DA  J P     1 
ATOM   9858  O  OP1   . DA  J  6 35  ? -19.443 -31.736 -7.750 1.00 140.87 ? -39  DA  J OP1   1 
ATOM   9859  O  OP2   . DA  J  6 35  ? -18.604 -31.523 -5.351 1.00 140.69 ? -39  DA  J OP2   1 
ATOM   9860  O  "O5'" . DA