data_3MIB
# 
_entry.id   3MIB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3MIB         
RCSB  RCSB058580   
WWPDB D_1000058580 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1PHM 'Oxidized (Cu2+) PHM'                                                           unspecified 
PDB 3MIC 'Oxidized (Cu2+) PHM with bound azide'                                          unspecified 
PDB 3MID 'Oxidized (Cu2+) PHM with bound azide obtained by soaking (100mM NaN3)'         unspecified 
PDB 3MIE 'Oxidized (Cu2+) PHM with bound azide obtained by soaking (50mM NaN3)'          unspecified 
PDB 3MIF 'Oxidized (Cu2+) PHM with bound carbon monoxide'                                unspecified 
PDB 3MIG 'Oxidized (Cu2+) PHM with bound nitrite, obtained in the presence of substrate' unspecified 
PDB 3MIH 'Oxidized (Cu2+) PHM with bound azide, obtained in the presence of substrate'   unspecified 
PDB 3MLJ 'Reduced (Cu+) PHM with bound CO'                                               unspecified 
PDB 3MLK 'Reduced (Cu+) PHM with bound nitrite'                                          unspecified 
PDB 3MLL 'Reduced (Cu+) PHM with bound azide'                                            unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3MIB 
_pdbx_database_status.recvd_initial_deposition_date   2010-04-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chufan, E.E.' 1 
'Eipper, B.A.' 2 
'Mains, R.E.'  3 
'Amzel, L.M.'  4 
# 
_citation.id                        primary 
_citation.title                     
'Differential Reactivity Between the Two Copper Sites of Peptidylglycine alpha-Hydroxylating Monooxygenase (PHM)' 
_citation.journal_abbrev            J.Am.Chem.Soc. 
_citation.journal_volume            132 
_citation.page_first                15565 
_citation.page_last                 15572 
_citation.year                      2010 
_citation.journal_id_ASTM           JACSAT 
_citation.country                   US 
_citation.journal_id_ISSN           0002-7863 
_citation.journal_id_CSD            0004 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20958070 
_citation.pdbx_database_id_DOI      10.1021/ja103117r 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chufan, E.E.' 1 
primary 'Prigge, S.T.' 2 
primary 'Siebert, X.'  3 
primary 'Eipper, B.A.' 4 
primary 'Mains, R.E.'  5 
primary 'Amzel, L.M.'  6 
# 
_cell.entry_id           3MIB 
_cell.length_a           68.612 
_cell.length_b           68.617 
_cell.length_c           80.254 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3MIB 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Peptidyl-glycine alpha-amidating monooxygenase' 35008.133 1   1.14.17.3 ? 
'UNP residues 43-356, monooxygenase domain' ? 
2 non-polymer syn 'COPPER (II) ION'                                63.546    2   ?         ? ? ? 
3 non-polymer syn 'NICKEL (II) ION'                                58.693    1   ?         ? ? ? 
4 non-polymer syn 'NITRITE ION'                                    46.005    3   ?         ? ? ? 
5 non-polymer syn GLYCEROL                                         92.094    3   ?         ? ? ? 
6 water       nat water                                            18.015    168 ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PAM, Peptidylglycine alpha-hydroxylating monooxygenase, PHM' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;FSNECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGS
YWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIA
GMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVD
VTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIPV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;FSNECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGS
YWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIA
GMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVD
VTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIPV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PHE n 
1 2   SER n 
1 3   ASN n 
1 4   GLU n 
1 5   CYS n 
1 6   LEU n 
1 7   GLY n 
1 8   THR n 
1 9   ILE n 
1 10  GLY n 
1 11  PRO n 
1 12  VAL n 
1 13  THR n 
1 14  PRO n 
1 15  LEU n 
1 16  ASP n 
1 17  ALA n 
1 18  SER n 
1 19  ASP n 
1 20  PHE n 
1 21  ALA n 
1 22  LEU n 
1 23  ASP n 
1 24  ILE n 
1 25  ARG n 
1 26  MET n 
1 27  PRO n 
1 28  GLY n 
1 29  VAL n 
1 30  THR n 
1 31  PRO n 
1 32  LYS n 
1 33  GLU n 
1 34  SER n 
1 35  ASP n 
1 36  THR n 
1 37  TYR n 
1 38  PHE n 
1 39  CYS n 
1 40  MET n 
1 41  SER n 
1 42  MET n 
1 43  ARG n 
1 44  LEU n 
1 45  PRO n 
1 46  VAL n 
1 47  ASP n 
1 48  GLU n 
1 49  GLU n 
1 50  ALA n 
1 51  PHE n 
1 52  VAL n 
1 53  ILE n 
1 54  ASP n 
1 55  PHE n 
1 56  LYS n 
1 57  PRO n 
1 58  ARG n 
1 59  ALA n 
1 60  SER n 
1 61  MET n 
1 62  ASP n 
1 63  THR n 
1 64  VAL n 
1 65  HIS n 
1 66  HIS n 
1 67  MET n 
1 68  LEU n 
1 69  LEU n 
1 70  PHE n 
1 71  GLY n 
1 72  CYS n 
1 73  ASN n 
1 74  MET n 
1 75  PRO n 
1 76  SER n 
1 77  SER n 
1 78  THR n 
1 79  GLY n 
1 80  SER n 
1 81  TYR n 
1 82  TRP n 
1 83  PHE n 
1 84  CYS n 
1 85  ASP n 
1 86  GLU n 
1 87  GLY n 
1 88  THR n 
1 89  CYS n 
1 90  THR n 
1 91  ASP n 
1 92  LYS n 
1 93  ALA n 
1 94  ASN n 
1 95  ILE n 
1 96  LEU n 
1 97  TYR n 
1 98  ALA n 
1 99  TRP n 
1 100 ALA n 
1 101 ARG n 
1 102 ASN n 
1 103 ALA n 
1 104 PRO n 
1 105 PRO n 
1 106 THR n 
1 107 ARG n 
1 108 LEU n 
1 109 PRO n 
1 110 LYS n 
1 111 GLY n 
1 112 VAL n 
1 113 GLY n 
1 114 PHE n 
1 115 ARG n 
1 116 VAL n 
1 117 GLY n 
1 118 GLY n 
1 119 GLU n 
1 120 THR n 
1 121 GLY n 
1 122 SER n 
1 123 LYS n 
1 124 TYR n 
1 125 PHE n 
1 126 VAL n 
1 127 LEU n 
1 128 GLN n 
1 129 VAL n 
1 130 HIS n 
1 131 TYR n 
1 132 GLY n 
1 133 ASP n 
1 134 ILE n 
1 135 SER n 
1 136 ALA n 
1 137 PHE n 
1 138 ARG n 
1 139 ASP n 
1 140 ASN n 
1 141 HIS n 
1 142 LYS n 
1 143 ASP n 
1 144 CYS n 
1 145 SER n 
1 146 GLY n 
1 147 VAL n 
1 148 SER n 
1 149 VAL n 
1 150 HIS n 
1 151 LEU n 
1 152 THR n 
1 153 ARG n 
1 154 VAL n 
1 155 PRO n 
1 156 GLN n 
1 157 PRO n 
1 158 LEU n 
1 159 ILE n 
1 160 ALA n 
1 161 GLY n 
1 162 MET n 
1 163 TYR n 
1 164 LEU n 
1 165 MET n 
1 166 MET n 
1 167 SER n 
1 168 VAL n 
1 169 ASP n 
1 170 THR n 
1 171 VAL n 
1 172 ILE n 
1 173 PRO n 
1 174 PRO n 
1 175 GLY n 
1 176 GLU n 
1 177 LYS n 
1 178 VAL n 
1 179 VAL n 
1 180 ASN n 
1 181 ALA n 
1 182 ASP n 
1 183 ILE n 
1 184 SER n 
1 185 CYS n 
1 186 GLN n 
1 187 TYR n 
1 188 LYS n 
1 189 MET n 
1 190 TYR n 
1 191 PRO n 
1 192 MET n 
1 193 HIS n 
1 194 VAL n 
1 195 PHE n 
1 196 ALA n 
1 197 TYR n 
1 198 ARG n 
1 199 VAL n 
1 200 HIS n 
1 201 THR n 
1 202 HIS n 
1 203 HIS n 
1 204 LEU n 
1 205 GLY n 
1 206 LYS n 
1 207 VAL n 
1 208 VAL n 
1 209 SER n 
1 210 GLY n 
1 211 TYR n 
1 212 ARG n 
1 213 VAL n 
1 214 ARG n 
1 215 ASN n 
1 216 GLY n 
1 217 GLN n 
1 218 TRP n 
1 219 THR n 
1 220 LEU n 
1 221 ILE n 
1 222 GLY n 
1 223 ARG n 
1 224 GLN n 
1 225 ASN n 
1 226 PRO n 
1 227 GLN n 
1 228 LEU n 
1 229 PRO n 
1 230 GLN n 
1 231 ALA n 
1 232 PHE n 
1 233 TYR n 
1 234 PRO n 
1 235 VAL n 
1 236 GLU n 
1 237 HIS n 
1 238 PRO n 
1 239 VAL n 
1 240 ASP n 
1 241 VAL n 
1 242 THR n 
1 243 PHE n 
1 244 GLY n 
1 245 ASP n 
1 246 ILE n 
1 247 LEU n 
1 248 ALA n 
1 249 ALA n 
1 250 ARG n 
1 251 CYS n 
1 252 VAL n 
1 253 PHE n 
1 254 THR n 
1 255 GLY n 
1 256 GLU n 
1 257 GLY n 
1 258 ARG n 
1 259 THR n 
1 260 GLU n 
1 261 ALA n 
1 262 THR n 
1 263 HIS n 
1 264 ILE n 
1 265 GLY n 
1 266 GLY n 
1 267 THR n 
1 268 SER n 
1 269 SER n 
1 270 ASP n 
1 271 GLU n 
1 272 MET n 
1 273 CYS n 
1 274 ASN n 
1 275 LEU n 
1 276 TYR n 
1 277 ILE n 
1 278 MET n 
1 279 TYR n 
1 280 TYR n 
1 281 MET n 
1 282 GLU n 
1 283 ALA n 
1 284 LYS n 
1 285 TYR n 
1 286 ALA n 
1 287 LEU n 
1 288 SER n 
1 289 PHE n 
1 290 MET n 
1 291 THR n 
1 292 CYS n 
1 293 THR n 
1 294 LYS n 
1 295 ASN n 
1 296 VAL n 
1 297 ALA n 
1 298 PRO n 
1 299 ASP n 
1 300 MET n 
1 301 PHE n 
1 302 ARG n 
1 303 THR n 
1 304 ILE n 
1 305 PRO n 
1 306 ALA n 
1 307 GLU n 
1 308 ALA n 
1 309 ASN n 
1 310 ILE n 
1 311 PRO n 
1 312 ILE n 
1 313 PRO n 
1 314 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               rat 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 Pam 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    SPRAGUE-DAWLEY 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rattus norvegicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10116 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Cricetulus griseus' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     10029 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Cho Dg44' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          virus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pCIS 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AMD_RAT 
_struct_ref.pdbx_db_accession          P14925 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;FSNECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGS
YWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIA
GMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVD
VTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIPV
;
_struct_ref.pdbx_align_begin           43 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3MIB 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 314 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P14925 
_struct_ref_seq.db_align_beg                  43 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  356 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       43 
_struct_ref_seq.pdbx_auth_seq_align_end       356 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ?                               'C4 H7 N O4'     133.103 
CU  non-polymer         . 'COPPER (II) ION' ?                               'Cu 2'           63.546  
CYS 'L-peptide linking' y CYSTEINE          ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE         ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL          'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE         ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ?                               'C5 H11 N O2 S'  149.211 
NI  non-polymer         . 'NICKEL (II) ION' ?                               'Ni 2'           58.693  
NO2 non-polymer         . 'NITRITE ION'     ?                               'N O2 -1'        46.005  
PHE 'L-peptide linking' y PHENYLALANINE     ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3MIB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.70 
_exptl_crystal.density_percent_sol   54.41 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    
;Crystallization: 0.1-0.5mM CuSO4, 1.25mM NiCl2, 100mM sodium cacodylate pH=5.5, 3mM sodium azide and 5% glycerol. Then, soaking in mother liquor supplemented with 300mM NaNO2 for 20 hours at 293K., VAPOR DIFFUSION, HANGING DROP
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2007-01-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111) channel cut monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X6A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X6A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00 
# 
_reflns.entry_id                     3MIB 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             52 
_reflns.d_resolution_high            2.35 
_reflns.number_obs                   16345 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.046 
_reflns.pdbx_netI_over_sigmaI        49.4 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.35 
_reflns_shell.d_res_low              2.43 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.49 
_reflns_shell.meanI_over_sigI_obs    3.7 
_reflns_shell.pdbx_redundancy        6.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1607 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3MIB 
_refine.ls_number_reflns_obs                     15441 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             52 
_refine.ls_d_res_high                            2.35 
_refine.ls_percent_reflns_obs                    99.41 
_refine.ls_R_factor_obs                          0.20201 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19986 
_refine.ls_R_factor_R_free                       0.24440 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  821 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.954 
_refine.correlation_coeff_Fo_to_Fc_free          0.931 
_refine.B_iso_mean                               61.863 
_refine.aniso_B[1][1]                            0.60 
_refine.aniso_B[2][2]                            -3.28 
_refine.aniso_B[3][3]                            2.68 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1PHM' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.343 
_refine.pdbx_overall_ESU_R_Free                  0.240 
_refine.overall_SU_ML                            0.172 
_refine.overall_SU_B                             13.160 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2399 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             168 
_refine_hist.number_atoms_total               2597 
_refine_hist.d_res_high                       2.35 
_refine_hist.d_res_low                        52 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.007  0.022  ? 2500 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.056  1.956  ? 3381 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.145  5.000  ? 306  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.800 23.208 ? 106  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.856 15.000 ? 387  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.174 15.000 ? 14   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.072  0.200  ? 365  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.020  ? 1895 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.178  0.200  ? 1064 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.303  0.200  ? 1638 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.114  0.200  ? 171  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.006  0.200  ? 1    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.171  0.200  ? 52   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.104  0.200  ? 8    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.366  1.500  ? 1588 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.612  2.000  ? 2494 'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.991  3.000  ? 1043 'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.388  4.500  ? 887  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.349 
_refine_ls_shell.d_res_low                        2.410 
_refine_ls_shell.number_reflns_R_work             1122 
_refine_ls_shell.R_factor_R_work                  0.262 
_refine_ls_shell.percent_reflns_obs               98.84 
_refine_ls_shell.R_factor_R_free                  0.336 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             67 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3MIB 
_struct.title                     'Oxidized (Cu2+) peptidylglycine alpha-hydroxylating monooxygenase (PHM) with bound nitrite' 
_struct.pdbx_descriptor           'Peptidyl-glycine alpha-amidating monooxygenase (E.C.1.14.17.3)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3MIB 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'OXIDOREDUCTASE, MONOOXYGENASE, BIOACTIVE PEPTIDE ACTIVATION, ASCORBATE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LEU A 6   ? GLY A 10  ? LEU A 48  GLY A 52  5 ? 5 
HELX_P HELX_P2 2 ASP A 85  ? GLY A 87  ? ASP A 127 GLY A 129 5 ? 3 
HELX_P HELX_P3 3 ALA A 297 ? ILE A 304 ? ALA A 339 ILE A 346 5 ? 8 
HELX_P HELX_P4 4 PRO A 305 ? ASN A 309 ? PRO A 347 ASN A 351 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 5   SG  ? ? ? 1_555 A CYS 144 SG ? ? A CYS 47  A CYS 186 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf2  disulf ? ? A CYS 39  SG  ? ? ? 1_555 A CYS 84  SG ? ? A CYS 81  A CYS 126 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf3  disulf ? ? A CYS 72  SG  ? ? ? 1_555 A CYS 89  SG ? ? A CYS 114 A CYS 131 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf4  disulf ? ? A CYS 185 SG  ? ? ? 1_555 A CYS 292 SG ? ? A CYS 227 A CYS 334 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf5  disulf ? ? A CYS 251 SG  ? ? ? 1_555 A CYS 273 SG ? ? A CYS 293 A CYS 315 1_555 ? ? ? ? ? ? ? 2.017 ? 
metalc1  metalc ? ? D NI  .   NI  ? ? ? 1_555 K HOH .   O  ? ? A NI  359 A HOH 486 1_555 ? ? ? ? ? ? ? 1.905 ? 
metalc2  metalc ? ? C CU  .   CU  ? ? ? 1_555 E NO2 .   O1 ? ? A CU  358 A NO2 1   1_555 ? ? ? ? ? ? ? 1.914 ? 
metalc3  metalc ? ? D NI  .   NI  ? ? ? 1_555 F NO2 .   O2 ? ? A NI  359 A NO2 2   1_555 ? ? ? ? ? ? ? 1.943 ? 
metalc4  metalc ? ? D NI  .   NI  ? ? ? 1_555 K HOH .   O  ? ? A NI  359 A HOH 463 1_555 ? ? ? ? ? ? ? 1.995 ? 
metalc5  metalc ? ? A HIS 65  ND1 ? ? ? 1_555 B CU  .   CU ? ? A HIS 107 A CU  357 1_555 ? ? ? ? ? ? ? 1.996 ? 
metalc6  metalc ? ? A HIS 200 NE2 ? ? ? 1_555 C CU  .   CU ? ? A HIS 242 A CU  358 1_555 ? ? ? ? ? ? ? 1.999 ? 
metalc7  metalc ? ? A HIS 66  ND1 ? ? ? 1_555 B CU  .   CU ? ? A HIS 108 A CU  357 1_555 ? ? ? ? ? ? ? 2.000 ? 
metalc8  metalc ? ? A HIS 130 ND1 ? ? ? 1_555 B CU  .   CU ? ? A HIS 172 A CU  357 1_555 ? ? ? ? ? ? ? 2.004 ? 
metalc9  metalc ? ? A HIS 202 NE2 ? ? ? 1_555 C CU  .   CU ? ? A HIS 244 A CU  358 1_555 ? ? ? ? ? ? ? 2.011 ? 
metalc10 metalc ? ? A HIS 193 NE2 ? ? ? 1_555 D NI  .   NI ? ? A HIS 235 A NI  359 1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc11 metalc ? ? A MET 272 SD  ? ? ? 1_555 C CU  .   CU ? ? A MET 314 A CU  358 1_555 ? ? ? ? ? ? ? 2.519 ? 
metalc12 metalc ? ? D NI  .   NI  ? ? ? 1_555 F NO2 .   O1 ? ? A NI  359 A NO2 2   1_555 ? ? ? ? ? ? ? 2.645 ? 
metalc13 metalc ? ? C CU  .   CU  ? ? ? 1_555 E NO2 .   O2 ? ? A CU  358 A NO2 1   1_555 ? ? ? ? ? ? ? 2.669 ? 
metalc14 metalc ? ? D NI  .   NI  ? ? ? 1_555 F NO2 .   N  ? ? A NI  359 A NO2 2   1_555 ? ? ? ? ? ? ? 2.772 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 7 ? 
C ? 5 ? 
D ? 2 ? 
E ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? parallel      
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
A 8 9 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? parallel      
B 6 7 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 12  ? PRO A 14  ? VAL A 54  PRO A 56  
A 2 ASP A 19  ? ARG A 25  ? ASP A 61  ARG A 67  
A 3 GLY A 146 ? THR A 152 ? GLY A 188 THR A 194 
A 4 ALA A 50  ? ARG A 58  ? ALA A 92  ARG A 100 
A 5 VAL A 112 ? VAL A 116 ? VAL A 154 VAL A 158 
A 6 LEU A 158 ? MET A 166 ? LEU A 200 MET A 208 
A 7 ASN A 274 ? GLU A 282 ? ASN A 316 GLU A 324 
A 8 MET A 192 ? HIS A 200 ? MET A 234 HIS A 242 
A 9 TYR A 233 ? VAL A 241 ? TYR A 275 VAL A 283 
B 1 VAL A 12  ? PRO A 14  ? VAL A 54  PRO A 56  
B 2 ASP A 19  ? ARG A 25  ? ASP A 61  ARG A 67  
B 3 GLY A 146 ? THR A 152 ? GLY A 188 THR A 194 
B 4 ALA A 50  ? ARG A 58  ? ALA A 92  ARG A 100 
B 5 VAL A 112 ? VAL A 116 ? VAL A 154 VAL A 158 
B 6 LEU A 158 ? MET A 166 ? LEU A 200 MET A 208 
B 7 PHE A 289 ? CYS A 292 ? PHE A 331 CYS A 334 
C 1 TRP A 82  ? PHE A 83  ? TRP A 124 PHE A 125 
C 2 THR A 36  ? ARG A 43  ? THR A 78  ARG A 85  
C 3 TYR A 124 ? TYR A 131 ? TYR A 166 TYR A 173 
C 4 VAL A 64  ? CYS A 72  ? VAL A 106 CYS A 114 
C 5 ASN A 94  ? ALA A 100 ? ASN A 136 ALA A 142 
D 1 VAL A 171 ? ILE A 172 ? VAL A 213 ILE A 214 
D 2 THR A 262 ? HIS A 263 ? THR A 304 HIS A 305 
E 1 VAL A 179 ? GLN A 186 ? VAL A 221 GLN A 228 
E 2 ILE A 246 ? PHE A 253 ? ILE A 288 PHE A 295 
E 3 GLY A 205 ? ARG A 214 ? GLY A 247 ARG A 256 
E 4 GLN A 217 ? GLN A 224 ? GLN A 259 GLN A 266 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 13  ? N THR A 55  O ALA A 21  ? O ALA A 63  
A 2 3 N LEU A 22  ? N LEU A 64  O VAL A 149 ? O VAL A 191 
A 3 4 O THR A 152 ? O THR A 194 N PHE A 51  ? N PHE A 93  
A 4 5 N ALA A 50  ? N ALA A 92  O VAL A 116 ? O VAL A 158 
A 5 6 N GLY A 113 ? N GLY A 155 O ALA A 160 ? O ALA A 202 
A 6 7 N TYR A 163 ? N TYR A 205 O ILE A 277 ? O ILE A 319 
A 7 8 O TYR A 276 ? O TYR A 318 N ARG A 198 ? N ARG A 240 
A 8 9 N TYR A 197 ? N TYR A 239 O TYR A 233 ? O TYR A 275 
B 1 2 N THR A 13  ? N THR A 55  O ALA A 21  ? O ALA A 63  
B 2 3 N LEU A 22  ? N LEU A 64  O VAL A 149 ? O VAL A 191 
B 3 4 O THR A 152 ? O THR A 194 N PHE A 51  ? N PHE A 93  
B 4 5 N ALA A 50  ? N ALA A 92  O VAL A 116 ? O VAL A 158 
B 5 6 N GLY A 113 ? N GLY A 155 O ALA A 160 ? O ALA A 202 
B 6 7 N LEU A 164 ? N LEU A 206 O MET A 290 ? O MET A 332 
C 1 2 O TRP A 82  ? O TRP A 124 N CYS A 39  ? N CYS A 81  
C 2 3 N MET A 42  ? N MET A 84  O PHE A 125 ? O PHE A 167 
C 3 4 O GLN A 128 ? O GLN A 170 N LEU A 68  ? N LEU A 110 
C 4 5 N GLY A 71  ? N GLY A 113 O ASN A 94  ? O ASN A 136 
D 1 2 N ILE A 172 ? N ILE A 214 O THR A 262 ? O THR A 304 
E 1 2 N VAL A 179 ? N VAL A 221 O PHE A 253 ? O PHE A 295 
E 2 3 O ILE A 246 ? O ILE A 288 N VAL A 213 ? N VAL A 255 
E 3 4 N ARG A 212 ? N ARG A 254 O THR A 219 ? O THR A 261 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CU A 357'  
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CU A 358'  
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NI A 359'  
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NO2 A 1'   
AC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NO2 A 2'   
AC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NO2 A 3'   
AC7 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE GOL A 360' 
AC8 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE GOL A 361' 
AC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL A 362' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 HIS A 65  ? HIS A 107 . ? 1_555 ? 
2  AC1 3 HIS A 66  ? HIS A 108 . ? 1_555 ? 
3  AC1 3 HIS A 130 ? HIS A 172 . ? 1_555 ? 
4  AC2 4 NO2 E .   ? NO2 A 1   . ? 1_555 ? 
5  AC2 4 HIS A 200 ? HIS A 242 . ? 1_555 ? 
6  AC2 4 HIS A 202 ? HIS A 244 . ? 1_555 ? 
7  AC2 4 MET A 272 ? MET A 314 . ? 1_555 ? 
8  AC3 5 NO2 F .   ? NO2 A 2   . ? 1_555 ? 
9  AC3 5 HIS A 193 ? HIS A 235 . ? 1_555 ? 
10 AC3 5 HIS A 263 ? HIS A 305 . ? 4_556 ? 
11 AC3 5 HOH K .   ? HOH A 463 . ? 1_555 ? 
12 AC3 5 HOH K .   ? HOH A 486 . ? 1_555 ? 
13 AC4 5 HIS A 200 ? HIS A 242 . ? 1_555 ? 
14 AC4 5 HIS A 202 ? HIS A 244 . ? 1_555 ? 
15 AC4 5 GLY A 266 ? GLY A 308 . ? 1_555 ? 
16 AC4 5 MET A 272 ? MET A 314 . ? 1_555 ? 
17 AC4 5 CU  C .   ? CU  A 358 . ? 1_555 ? 
18 AC5 7 HOH K .   ? HOH A 40  . ? 1_555 ? 
19 AC5 7 HIS A 193 ? HIS A 235 . ? 1_555 ? 
20 AC5 7 ASP A 240 ? ASP A 282 . ? 1_555 ? 
21 AC5 7 ASP A 270 ? ASP A 312 . ? 4_556 ? 
22 AC5 7 NI  D .   ? NI  A 359 . ? 1_555 ? 
23 AC5 7 HOH K .   ? HOH A 463 . ? 1_555 ? 
24 AC5 7 HOH K .   ? HOH A 486 . ? 1_555 ? 
25 AC6 5 VAL A 213 ? VAL A 255 . ? 1_555 ? 
26 AC6 5 ASN A 215 ? ASN A 257 . ? 1_555 ? 
27 AC6 5 GLY A 216 ? GLY A 258 . ? 1_555 ? 
28 AC6 5 GLY A 244 ? GLY A 286 . ? 1_555 ? 
29 AC6 5 ILE A 246 ? ILE A 288 . ? 1_555 ? 
30 AC7 8 HOH K .   ? HOH A 7   . ? 1_555 ? 
31 AC7 8 HOH K .   ? HOH A 8   . ? 1_555 ? 
32 AC7 8 LEU A 96  ? LEU A 138 . ? 1_555 ? 
33 AC7 8 TYR A 97  ? TYR A 139 . ? 1_555 ? 
34 AC7 8 THR A 106 ? THR A 148 . ? 1_555 ? 
35 AC7 8 MET A 278 ? MET A 320 . ? 1_555 ? 
36 AC7 8 HOH K .   ? HOH A 378 . ? 1_555 ? 
37 AC7 8 HOH K .   ? HOH A 387 . ? 1_555 ? 
38 AC8 8 HOH K .   ? HOH A 23  . ? 1_555 ? 
39 AC8 8 ASN A 94  ? ASN A 136 . ? 1_555 ? 
40 AC8 8 PHE A 114 ? PHE A 156 . ? 1_555 ? 
41 AC8 8 ARG A 115 ? ARG A 157 . ? 1_555 ? 
42 AC8 8 GLY A 121 ? GLY A 163 . ? 1_555 ? 
43 AC8 8 SER A 122 ? SER A 164 . ? 1_555 ? 
44 AC8 8 SER A 288 ? SER A 330 . ? 1_555 ? 
45 AC8 8 HOH K .   ? HOH A 363 . ? 1_555 ? 
46 AC9 6 TYR A 163 ? TYR A 205 . ? 1_555 ? 
47 AC9 6 GLN A 186 ? GLN A 228 . ? 1_555 ? 
48 AC9 6 LYS A 188 ? LYS A 230 . ? 1_555 ? 
49 AC9 6 MET A 189 ? MET A 231 . ? 1_555 ? 
50 AC9 6 THR A 291 ? THR A 333 . ? 1_555 ? 
51 AC9 6 HOH K .   ? HOH A 388 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3MIB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3MIB 
_atom_sites.fract_transf_matrix[1][1]   0.014575 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014574 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012460 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CU 
N  
NI 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASN A 1 3   ? 43.237 45.364 31.503 1.00 71.10  ? 45  ASN A N   1 
ATOM   2    C  CA  . ASN A 1 3   ? 41.986 45.580 32.292 1.00 71.14  ? 45  ASN A CA  1 
ATOM   3    C  C   . ASN A 1 3   ? 41.153 46.774 31.807 1.00 70.73  ? 45  ASN A C   1 
ATOM   4    O  O   . ASN A 1 3   ? 39.947 46.843 32.067 1.00 70.98  ? 45  ASN A O   1 
ATOM   5    C  CB  . ASN A 1 3   ? 42.309 45.715 33.787 1.00 71.45  ? 45  ASN A CB  1 
ATOM   6    C  CG  . ASN A 1 3   ? 41.061 45.743 34.663 1.00 72.60  ? 45  ASN A CG  1 
ATOM   7    O  OD1 . ASN A 1 3   ? 40.044 45.115 34.347 1.00 73.86  ? 45  ASN A OD1 1 
ATOM   8    N  ND2 . ASN A 1 3   ? 41.138 46.472 35.772 1.00 73.36  ? 45  ASN A ND2 1 
ATOM   9    N  N   . GLU A 1 4   ? 41.796 47.704 31.102 1.00 69.97  ? 46  GLU A N   1 
ATOM   10   C  CA  . GLU A 1 4   ? 41.119 48.887 30.568 1.00 69.19  ? 46  GLU A CA  1 
ATOM   11   C  C   . GLU A 1 4   ? 40.133 48.538 29.451 1.00 68.52  ? 46  GLU A C   1 
ATOM   12   O  O   . GLU A 1 4   ? 40.362 47.603 28.677 1.00 68.46  ? 46  GLU A O   1 
ATOM   13   C  CB  . GLU A 1 4   ? 42.140 49.916 30.064 1.00 69.25  ? 46  GLU A CB  1 
ATOM   14   C  CG  . GLU A 1 4   ? 42.914 50.640 31.167 1.00 69.53  ? 46  GLU A CG  1 
ATOM   15   C  CD  . GLU A 1 4   ? 42.129 51.777 31.820 1.00 69.85  ? 46  GLU A CD  1 
ATOM   16   O  OE1 . GLU A 1 4   ? 40.934 51.964 31.500 1.00 70.06  ? 46  GLU A OE1 1 
ATOM   17   O  OE2 . GLU A 1 4   ? 42.717 52.493 32.657 1.00 69.78  ? 46  GLU A OE2 1 
ATOM   18   N  N   . CYS A 1 5   ? 39.040 49.298 29.383 1.00 67.69  ? 47  CYS A N   1 
ATOM   19   C  CA  . CYS A 1 5   ? 38.031 49.152 28.331 1.00 66.81  ? 47  CYS A CA  1 
ATOM   20   C  C   . CYS A 1 5   ? 38.664 49.383 26.957 1.00 66.40  ? 47  CYS A C   1 
ATOM   21   O  O   . CYS A 1 5   ? 39.553 50.226 26.802 1.00 66.34  ? 47  CYS A O   1 
ATOM   22   C  CB  . CYS A 1 5   ? 36.858 50.116 28.558 1.00 66.78  ? 47  CYS A CB  1 
ATOM   23   S  SG  . CYS A 1 5   ? 36.290 50.271 30.287 1.00 66.05  ? 47  CYS A SG  1 
ATOM   24   N  N   . LEU A 1 6   ? 38.203 48.626 25.967 1.00 65.87  ? 48  LEU A N   1 
ATOM   25   C  CA  . LEU A 1 6   ? 38.884 48.534 24.673 1.00 65.42  ? 48  LEU A CA  1 
ATOM   26   C  C   . LEU A 1 6   ? 38.601 49.709 23.735 1.00 64.98  ? 48  LEU A C   1 
ATOM   27   O  O   . LEU A 1 6   ? 39.512 50.209 23.066 1.00 64.98  ? 48  LEU A O   1 
ATOM   28   C  CB  . LEU A 1 6   ? 38.567 47.193 24.003 1.00 65.48  ? 48  LEU A CB  1 
ATOM   29   C  CG  . LEU A 1 6   ? 38.970 45.986 24.863 1.00 65.79  ? 48  LEU A CG  1 
ATOM   30   C  CD1 . LEU A 1 6   ? 38.004 44.826 24.673 1.00 65.71  ? 48  LEU A CD1 1 
ATOM   31   C  CD2 . LEU A 1 6   ? 40.422 45.567 24.612 1.00 65.94  ? 48  LEU A CD2 1 
ATOM   32   N  N   . GLY A 1 7   ? 37.345 50.146 23.693 1.00 64.39  ? 49  GLY A N   1 
ATOM   33   C  CA  . GLY A 1 7   ? 36.962 51.303 22.889 1.00 63.72  ? 49  GLY A CA  1 
ATOM   34   C  C   . GLY A 1 7   ? 37.029 51.056 21.394 1.00 63.12  ? 49  GLY A C   1 
ATOM   35   O  O   . GLY A 1 7   ? 36.422 50.106 20.885 1.00 63.06  ? 49  GLY A O   1 
ATOM   36   N  N   . THR A 1 8   ? 37.797 51.901 20.705 1.00 62.40  ? 50  THR A N   1 
ATOM   37   C  CA  . THR A 1 8   ? 37.821 51.949 19.240 1.00 61.88  ? 50  THR A CA  1 
ATOM   38   C  C   . THR A 1 8   ? 38.337 50.683 18.544 1.00 61.58  ? 50  THR A C   1 
ATOM   39   O  O   . THR A 1 8   ? 37.950 50.412 17.414 1.00 61.55  ? 50  THR A O   1 
ATOM   40   C  CB  . THR A 1 8   ? 38.599 53.185 18.706 1.00 61.74  ? 50  THR A CB  1 
ATOM   41   O  OG1 . THR A 1 8   ? 39.964 53.125 19.133 1.00 61.64  ? 50  THR A OG1 1 
ATOM   42   C  CG2 . THR A 1 8   ? 37.972 54.480 19.197 1.00 61.53  ? 50  THR A CG2 1 
ATOM   43   N  N   . ILE A 1 9   ? 39.204 49.919 19.205 1.00 61.38  ? 51  ILE A N   1 
ATOM   44   C  CA  . ILE A 1 9   ? 39.751 48.689 18.605 1.00 61.15  ? 51  ILE A CA  1 
ATOM   45   C  C   . ILE A 1 9   ? 38.863 47.448 18.808 1.00 60.93  ? 51  ILE A C   1 
ATOM   46   O  O   . ILE A 1 9   ? 39.025 46.438 18.113 1.00 61.06  ? 51  ILE A O   1 
ATOM   47   C  CB  . ILE A 1 9   ? 41.237 48.416 19.021 1.00 61.20  ? 51  ILE A CB  1 
ATOM   48   C  CG1 . ILE A 1 9   ? 41.374 48.199 20.528 1.00 61.24  ? 51  ILE A CG1 1 
ATOM   49   C  CG2 . ILE A 1 9   ? 42.151 49.553 18.559 1.00 61.10  ? 51  ILE A CG2 1 
ATOM   50   C  CD1 . ILE A 1 9   ? 41.441 46.741 20.935 1.00 61.91  ? 51  ILE A CD1 1 
ATOM   51   N  N   . GLY A 1 10  ? 37.931 47.525 19.755 1.00 60.59  ? 52  GLY A N   1 
ATOM   52   C  CA  . GLY A 1 10  ? 36.971 46.447 19.977 1.00 60.40  ? 52  GLY A CA  1 
ATOM   53   C  C   . GLY A 1 10  ? 37.546 45.172 20.579 1.00 60.27  ? 52  GLY A C   1 
ATOM   54   O  O   . GLY A 1 10  ? 38.707 45.140 20.973 1.00 60.32  ? 52  GLY A O   1 
ATOM   55   N  N   . PRO A 1 11  ? 36.727 44.107 20.644 1.00 60.16  ? 53  PRO A N   1 
ATOM   56   C  CA  . PRO A 1 11  ? 37.029 42.884 21.384 1.00 60.24  ? 53  PRO A CA  1 
ATOM   57   C  C   . PRO A 1 11  ? 37.849 41.798 20.655 1.00 60.50  ? 53  PRO A C   1 
ATOM   58   O  O   . PRO A 1 11  ? 38.267 40.832 21.302 1.00 60.47  ? 53  PRO A O   1 
ATOM   59   C  CB  . PRO A 1 11  ? 35.638 42.350 21.719 1.00 60.06  ? 53  PRO A CB  1 
ATOM   60   C  CG  . PRO A 1 11  ? 34.791 42.790 20.579 1.00 59.72  ? 53  PRO A CG  1 
ATOM   61   C  CD  . PRO A 1 11  ? 35.403 44.036 19.998 1.00 60.03  ? 53  PRO A CD  1 
ATOM   62   N  N   . VAL A 1 12  ? 38.078 41.945 19.348 1.00 60.49  ? 54  VAL A N   1 
ATOM   63   C  CA  . VAL A 1 12  ? 38.801 40.926 18.572 1.00 60.99  ? 54  VAL A CA  1 
ATOM   64   C  C   . VAL A 1 12  ? 40.186 41.408 18.146 1.00 61.44  ? 54  VAL A C   1 
ATOM   65   O  O   . VAL A 1 12  ? 40.306 42.368 17.378 1.00 61.69  ? 54  VAL A O   1 
ATOM   66   C  CB  . VAL A 1 12  ? 38.016 40.473 17.302 1.00 61.04  ? 54  VAL A CB  1 
ATOM   67   C  CG1 . VAL A 1 12  ? 38.814 39.441 16.504 1.00 60.87  ? 54  VAL A CG1 1 
ATOM   68   C  CG2 . VAL A 1 12  ? 36.651 39.919 17.668 1.00 60.85  ? 54  VAL A CG2 1 
ATOM   69   N  N   . THR A 1 13  ? 41.221 40.729 18.643 1.00 61.87  ? 55  THR A N   1 
ATOM   70   C  CA  . THR A 1 13  ? 42.605 41.006 18.262 1.00 62.41  ? 55  THR A CA  1 
ATOM   71   C  C   . THR A 1 13  ? 43.179 39.823 17.488 1.00 62.42  ? 55  THR A C   1 
ATOM   72   O  O   . THR A 1 13  ? 43.238 38.714 18.017 1.00 62.50  ? 55  THR A O   1 
ATOM   73   C  CB  . THR A 1 13  ? 43.508 41.269 19.494 1.00 62.41  ? 55  THR A CB  1 
ATOM   74   O  OG1 . THR A 1 13  ? 42.876 42.211 20.367 1.00 63.51  ? 55  THR A OG1 1 
ATOM   75   C  CG2 . THR A 1 13  ? 44.874 41.822 19.064 1.00 62.92  ? 55  THR A CG2 1 
ATOM   76   N  N   . PRO A 1 14  ? 43.598 40.052 16.231 1.00 62.61  ? 56  PRO A N   1 
ATOM   77   C  CA  . PRO A 1 14  ? 44.319 39.021 15.480 1.00 62.72  ? 56  PRO A CA  1 
ATOM   78   C  C   . PRO A 1 14  ? 45.657 38.691 16.144 1.00 62.76  ? 56  PRO A C   1 
ATOM   79   O  O   . PRO A 1 14  ? 46.402 39.601 16.508 1.00 62.76  ? 56  PRO A O   1 
ATOM   80   C  CB  . PRO A 1 14  ? 44.554 39.679 14.116 1.00 62.69  ? 56  PRO A CB  1 
ATOM   81   C  CG  . PRO A 1 14  ? 44.448 41.146 14.370 1.00 62.82  ? 56  PRO A CG  1 
ATOM   82   C  CD  . PRO A 1 14  ? 43.415 41.282 15.442 1.00 62.51  ? 56  PRO A CD  1 
ATOM   83   N  N   . LEU A 1 15  ? 45.943 37.403 16.322 1.00 62.85  ? 57  LEU A N   1 
ATOM   84   C  CA  . LEU A 1 15  ? 47.218 36.971 16.900 1.00 62.94  ? 57  LEU A CA  1 
ATOM   85   C  C   . LEU A 1 15  ? 48.133 36.371 15.838 1.00 63.15  ? 57  LEU A C   1 
ATOM   86   O  O   . LEU A 1 15  ? 49.349 36.591 15.848 1.00 63.22  ? 57  LEU A O   1 
ATOM   87   C  CB  . LEU A 1 15  ? 46.995 35.962 18.028 1.00 62.78  ? 57  LEU A CB  1 
ATOM   88   C  CG  . LEU A 1 15  ? 46.222 36.422 19.264 1.00 62.61  ? 57  LEU A CG  1 
ATOM   89   C  CD1 . LEU A 1 15  ? 45.918 35.234 20.156 1.00 62.64  ? 57  LEU A CD1 1 
ATOM   90   C  CD2 . LEU A 1 15  ? 46.974 37.499 20.040 1.00 62.62  ? 57  LEU A CD2 1 
ATOM   91   N  N   . ASP A 1 16  ? 47.531 35.613 14.928 1.00 63.33  ? 58  ASP A N   1 
ATOM   92   C  CA  . ASP A 1 16  ? 48.246 34.925 13.858 1.00 63.45  ? 58  ASP A CA  1 
ATOM   93   C  C   . ASP A 1 16  ? 47.243 34.637 12.742 1.00 63.34  ? 58  ASP A C   1 
ATOM   94   O  O   . ASP A 1 16  ? 46.074 35.023 12.844 1.00 63.43  ? 58  ASP A O   1 
ATOM   95   C  CB  . ASP A 1 16  ? 48.860 33.624 14.392 1.00 63.55  ? 58  ASP A CB  1 
ATOM   96   C  CG  . ASP A 1 16  ? 49.902 33.033 13.457 1.00 64.28  ? 58  ASP A CG  1 
ATOM   97   O  OD1 . ASP A 1 16  ? 50.632 33.803 12.791 1.00 65.09  ? 58  ASP A OD1 1 
ATOM   98   O  OD2 . ASP A 1 16  ? 49.997 31.788 13.395 1.00 65.04  ? 58  ASP A OD2 1 
ATOM   99   N  N   . ALA A 1 17  ? 47.699 33.970 11.684 1.00 63.14  ? 59  ALA A N   1 
ATOM   100  C  CA  . ALA A 1 17  ? 46.859 33.626 10.534 1.00 62.99  ? 59  ALA A CA  1 
ATOM   101  C  C   . ALA A 1 17  ? 45.561 32.918 10.929 1.00 62.83  ? 59  ALA A C   1 
ATOM   102  O  O   . ALA A 1 17  ? 44.494 33.214 10.384 1.00 62.86  ? 59  ALA A O   1 
ATOM   103  C  CB  . ALA A 1 17  ? 47.650 32.769 9.542  1.00 62.95  ? 59  ALA A CB  1 
ATOM   104  N  N   . SER A 1 18  ? 45.666 31.997 11.885 1.00 62.61  ? 60  SER A N   1 
ATOM   105  C  CA  . SER A 1 18  ? 44.552 31.128 12.265 1.00 62.39  ? 60  SER A CA  1 
ATOM   106  C  C   . SER A 1 18  ? 44.010 31.394 13.670 1.00 62.19  ? 60  SER A C   1 
ATOM   107  O  O   . SER A 1 18  ? 42.942 30.887 14.026 1.00 62.36  ? 60  SER A O   1 
ATOM   108  C  CB  . SER A 1 18  ? 44.957 29.654 12.123 1.00 62.47  ? 60  SER A CB  1 
ATOM   109  O  OG  . SER A 1 18  ? 46.184 29.384 12.784 1.00 62.38  ? 60  SER A OG  1 
ATOM   110  N  N   . ASP A 1 19  ? 44.744 32.189 14.454 1.00 61.72  ? 61  ASP A N   1 
ATOM   111  C  CA  . ASP A 1 19  ? 44.395 32.471 15.852 1.00 61.07  ? 61  ASP A CA  1 
ATOM   112  C  C   . ASP A 1 19  ? 43.933 33.908 16.064 1.00 60.80  ? 61  ASP A C   1 
ATOM   113  O  O   . ASP A 1 19  ? 44.275 34.805 15.286 1.00 60.62  ? 61  ASP A O   1 
ATOM   114  C  CB  . ASP A 1 19  ? 45.587 32.214 16.782 1.00 61.11  ? 61  ASP A CB  1 
ATOM   115  C  CG  . ASP A 1 19  ? 46.073 30.775 16.751 1.00 61.15  ? 61  ASP A CG  1 
ATOM   116  O  OD1 . ASP A 1 19  ? 45.740 30.035 15.802 1.00 61.45  ? 61  ASP A OD1 1 
ATOM   117  O  OD2 . ASP A 1 19  ? 46.811 30.389 17.683 1.00 60.73  ? 61  ASP A OD2 1 
ATOM   118  N  N   . PHE A 1 20  ? 43.161 34.110 17.131 1.00 60.26  ? 62  PHE A N   1 
ATOM   119  C  CA  . PHE A 1 20  ? 42.773 35.441 17.585 1.00 60.11  ? 62  PHE A CA  1 
ATOM   120  C  C   . PHE A 1 20  ? 42.405 35.457 19.073 1.00 59.99  ? 62  PHE A C   1 
ATOM   121  O  O   . PHE A 1 20  ? 42.048 34.428 19.649 1.00 60.10  ? 62  PHE A O   1 
ATOM   122  C  CB  . PHE A 1 20  ? 41.642 36.033 16.717 1.00 60.04  ? 62  PHE A CB  1 
ATOM   123  C  CG  . PHE A 1 20  ? 40.327 35.294 16.813 1.00 60.06  ? 62  PHE A CG  1 
ATOM   124  C  CD1 . PHE A 1 20  ? 39.364 35.678 17.742 1.00 60.05  ? 62  PHE A CD1 1 
ATOM   125  C  CD2 . PHE A 1 20  ? 40.042 34.235 15.954 1.00 60.42  ? 62  PHE A CD2 1 
ATOM   126  C  CE1 . PHE A 1 20  ? 38.142 35.012 17.832 1.00 60.26  ? 62  PHE A CE1 1 
ATOM   127  C  CE2 . PHE A 1 20  ? 38.821 33.554 16.035 1.00 60.77  ? 62  PHE A CE2 1 
ATOM   128  C  CZ  . PHE A 1 20  ? 37.868 33.946 16.978 1.00 60.64  ? 62  PHE A CZ  1 
ATOM   129  N  N   . ALA A 1 21  ? 42.518 36.628 19.689 1.00 60.02  ? 63  ALA A N   1 
ATOM   130  C  CA  . ALA A 1 21  ? 42.073 36.828 21.060 1.00 60.08  ? 63  ALA A CA  1 
ATOM   131  C  C   . ALA A 1 21  ? 40.698 37.483 21.057 1.00 60.31  ? 63  ALA A C   1 
ATOM   132  O  O   . ALA A 1 21  ? 40.448 38.427 20.298 1.00 60.58  ? 63  ALA A O   1 
ATOM   133  C  CB  . ALA A 1 21  ? 43.073 37.680 21.835 1.00 59.75  ? 63  ALA A CB  1 
ATOM   134  N  N   . LEU A 1 22  ? 39.810 36.964 21.899 1.00 60.52  ? 64  LEU A N   1 
ATOM   135  C  CA  . LEU A 1 22  ? 38.491 37.544 22.118 1.00 60.33  ? 64  LEU A CA  1 
ATOM   136  C  C   . LEU A 1 22  ? 38.408 38.068 23.543 1.00 60.47  ? 64  LEU A C   1 
ATOM   137  O  O   . LEU A 1 22  ? 38.535 37.306 24.499 1.00 60.34  ? 64  LEU A O   1 
ATOM   138  C  CB  . LEU A 1 22  ? 37.391 36.506 21.888 1.00 60.50  ? 64  LEU A CB  1 
ATOM   139  C  CG  . LEU A 1 22  ? 35.939 36.949 22.098 1.00 60.33  ? 64  LEU A CG  1 
ATOM   140  C  CD1 . LEU A 1 22  ? 35.557 38.047 21.112 1.00 60.53  ? 64  LEU A CD1 1 
ATOM   141  C  CD2 . LEU A 1 22  ? 35.007 35.769 21.968 1.00 59.89  ? 64  LEU A CD2 1 
ATOM   142  N  N   . ASP A 1 23  ? 38.190 39.370 23.676 1.00 60.36  ? 65  ASP A N   1 
ATOM   143  C  CA  . ASP A 1 23  ? 38.020 39.979 24.982 1.00 60.50  ? 65  ASP A CA  1 
ATOM   144  C  C   . ASP A 1 23  ? 36.563 40.094 25.368 1.00 60.52  ? 65  ASP A C   1 
ATOM   145  O  O   . ASP A 1 23  ? 35.768 40.746 24.684 1.00 60.62  ? 65  ASP A O   1 
ATOM   146  C  CB  . ASP A 1 23  ? 38.710 41.336 25.053 1.00 60.48  ? 65  ASP A CB  1 
ATOM   147  C  CG  . ASP A 1 23  ? 40.130 41.222 25.516 1.00 61.04  ? 65  ASP A CG  1 
ATOM   148  O  OD1 . ASP A 1 23  ? 40.992 40.813 24.706 1.00 62.20  ? 65  ASP A OD1 1 
ATOM   149  O  OD2 . ASP A 1 23  ? 40.379 41.517 26.700 1.00 61.76  ? 65  ASP A OD2 1 
ATOM   150  N  N   . ILE A 1 24  ? 36.234 39.427 26.467 1.00 60.63  ? 66  ILE A N   1 
ATOM   151  C  CA  . ILE A 1 24  ? 34.889 39.378 27.010 1.00 61.17  ? 66  ILE A CA  1 
ATOM   152  C  C   . ILE A 1 24  ? 34.930 40.180 28.310 1.00 61.20  ? 66  ILE A C   1 
ATOM   153  O  O   . ILE A 1 24  ? 35.452 39.711 29.327 1.00 61.16  ? 66  ILE A O   1 
ATOM   154  C  CB  . ILE A 1 24  ? 34.430 37.915 27.243 1.00 61.46  ? 66  ILE A CB  1 
ATOM   155  C  CG1 . ILE A 1 24  ? 34.696 37.074 25.987 1.00 62.36  ? 66  ILE A CG1 1 
ATOM   156  C  CG2 . ILE A 1 24  ? 32.947 37.861 27.622 1.00 61.59  ? 66  ILE A CG2 1 
ATOM   157  C  CD1 . ILE A 1 24  ? 34.728 35.580 26.222 1.00 63.06  ? 66  ILE A CD1 1 
ATOM   158  N  N   . ARG A 1 25  ? 34.414 41.406 28.244 1.00 61.19  ? 67  ARG A N   1 
ATOM   159  C  CA  . ARG A 1 25  ? 34.513 42.374 29.333 1.00 61.45  ? 67  ARG A CA  1 
ATOM   160  C  C   . ARG A 1 25  ? 33.140 42.899 29.718 1.00 61.46  ? 67  ARG A C   1 
ATOM   161  O  O   . ARG A 1 25  ? 32.224 42.892 28.901 1.00 61.85  ? 67  ARG A O   1 
ATOM   162  C  CB  . ARG A 1 25  ? 35.361 43.573 28.894 1.00 61.56  ? 67  ARG A CB  1 
ATOM   163  C  CG  . ARG A 1 25  ? 36.625 43.232 28.126 1.00 61.76  ? 67  ARG A CG  1 
ATOM   164  C  CD  . ARG A 1 25  ? 37.637 42.524 28.999 1.00 61.99  ? 67  ARG A CD  1 
ATOM   165  N  NE  . ARG A 1 25  ? 38.985 42.783 28.521 1.00 63.04  ? 67  ARG A NE  1 
ATOM   166  C  CZ  . ARG A 1 25  ? 39.710 43.845 28.860 1.00 62.92  ? 67  ARG A CZ  1 
ATOM   167  N  NH1 . ARG A 1 25  ? 39.225 44.751 29.700 1.00 62.77  ? 67  ARG A NH1 1 
ATOM   168  N  NH2 . ARG A 1 25  ? 40.928 43.993 28.362 1.00 63.12  ? 67  ARG A NH2 1 
ATOM   169  N  N   . MET A 1 26  ? 33.010 43.380 30.952 1.00 61.22  ? 68  MET A N   1 
ATOM   170  C  CA  . MET A 1 26  ? 31.798 44.071 31.384 1.00 60.91  ? 68  MET A CA  1 
ATOM   171  C  C   . MET A 1 26  ? 31.668 45.420 30.671 1.00 60.76  ? 68  MET A C   1 
ATOM   172  O  O   . MET A 1 26  ? 32.665 46.120 30.498 1.00 60.80  ? 68  MET A O   1 
ATOM   173  C  CB  . MET A 1 26  ? 31.790 44.240 32.905 1.00 60.99  ? 68  MET A CB  1 
ATOM   174  C  CG  . MET A 1 26  ? 31.419 42.962 33.653 1.00 60.84  ? 68  MET A CG  1 
ATOM   175  S  SD  . MET A 1 26  ? 29.701 42.497 33.358 1.00 60.47  ? 68  MET A SD  1 
ATOM   176  C  CE  . MET A 1 26  ? 29.746 40.741 33.702 1.00 60.43  ? 68  MET A CE  1 
ATOM   177  N  N   . PRO A 1 27  ? 30.441 45.786 30.241 1.00 60.63  ? 69  PRO A N   1 
ATOM   178  C  CA  . PRO A 1 27  ? 30.254 46.981 29.405 1.00 60.45  ? 69  PRO A CA  1 
ATOM   179  C  C   . PRO A 1 27  ? 30.344 48.311 30.166 1.00 60.37  ? 69  PRO A C   1 
ATOM   180  O  O   . PRO A 1 27  ? 29.481 49.176 29.999 1.00 60.38  ? 69  PRO A O   1 
ATOM   181  C  CB  . PRO A 1 27  ? 28.847 46.780 28.832 1.00 60.31  ? 69  PRO A CB  1 
ATOM   182  C  CG  . PRO A 1 27  ? 28.133 46.019 29.888 1.00 60.36  ? 69  PRO A CG  1 
ATOM   183  C  CD  . PRO A 1 27  ? 29.160 45.099 30.503 1.00 60.55  ? 69  PRO A CD  1 
ATOM   184  N  N   . GLY A 1 28  ? 31.393 48.473 30.971 1.00 60.33  ? 70  GLY A N   1 
ATOM   185  C  CA  . GLY A 1 28  ? 31.566 49.666 31.796 1.00 60.39  ? 70  GLY A CA  1 
ATOM   186  C  C   . GLY A 1 28  ? 30.477 49.764 32.844 1.00 60.46  ? 70  GLY A C   1 
ATOM   187  O  O   . GLY A 1 28  ? 29.642 50.666 32.798 1.00 60.47  ? 70  GLY A O   1 
ATOM   188  N  N   . VAL A 1 29  ? 30.482 48.819 33.780 1.00 60.68  ? 71  VAL A N   1 
ATOM   189  C  CA  . VAL A 1 29  ? 29.444 48.730 34.808 1.00 60.71  ? 71  VAL A CA  1 
ATOM   190  C  C   . VAL A 1 29  ? 29.873 49.378 36.121 1.00 60.86  ? 71  VAL A C   1 
ATOM   191  O  O   . VAL A 1 29  ? 31.067 49.457 36.430 1.00 60.73  ? 71  VAL A O   1 
ATOM   192  C  CB  . VAL A 1 29  ? 28.996 47.264 35.071 1.00 60.66  ? 71  VAL A CB  1 
ATOM   193  C  CG1 . VAL A 1 29  ? 28.297 46.688 33.849 1.00 60.71  ? 71  VAL A CG1 1 
ATOM   194  C  CG2 . VAL A 1 29  ? 30.176 46.387 35.494 1.00 60.44  ? 71  VAL A CG2 1 
ATOM   195  N  N   . THR A 1 30  ? 28.886 49.847 36.881 1.00 61.07  ? 72  THR A N   1 
ATOM   196  C  CA  . THR A 1 30  ? 29.132 50.432 38.193 1.00 61.34  ? 72  THR A CA  1 
ATOM   197  C  C   . THR A 1 30  ? 28.144 49.848 39.210 1.00 61.58  ? 72  THR A C   1 
ATOM   198  O  O   . THR A 1 30  ? 27.054 50.395 39.404 1.00 61.67  ? 72  THR A O   1 
ATOM   199  C  CB  . THR A 1 30  ? 29.055 51.980 38.155 1.00 61.34  ? 72  THR A CB  1 
ATOM   200  O  OG1 . THR A 1 30  ? 29.820 52.472 37.046 1.00 61.23  ? 72  THR A OG1 1 
ATOM   201  C  CG2 . THR A 1 30  ? 29.598 52.584 39.446 1.00 61.24  ? 72  THR A CG2 1 
ATOM   202  N  N   . PRO A 1 31  ? 28.520 48.717 39.844 1.00 61.76  ? 73  PRO A N   1 
ATOM   203  C  CA  . PRO A 1 31  ? 27.701 48.050 40.863 1.00 61.90  ? 73  PRO A CA  1 
ATOM   204  C  C   . PRO A 1 31  ? 27.378 48.960 42.043 1.00 62.10  ? 73  PRO A C   1 
ATOM   205  O  O   . PRO A 1 31  ? 28.209 49.784 42.435 1.00 62.15  ? 73  PRO A O   1 
ATOM   206  C  CB  . PRO A 1 31  ? 28.579 46.876 41.318 1.00 61.90  ? 73  PRO A CB  1 
ATOM   207  C  CG  . PRO A 1 31  ? 29.951 47.191 40.836 1.00 61.81  ? 73  PRO A CG  1 
ATOM   208  C  CD  . PRO A 1 31  ? 29.777 47.989 39.596 1.00 61.76  ? 73  PRO A CD  1 
ATOM   209  N  N   . LYS A 1 32  ? 26.180 48.799 42.599 1.00 62.26  ? 74  LYS A N   1 
ATOM   210  C  CA  . LYS A 1 32  ? 25.673 49.695 43.636 1.00 62.34  ? 74  LYS A CA  1 
ATOM   211  C  C   . LYS A 1 32  ? 25.653 49.069 45.033 1.00 62.40  ? 74  LYS A C   1 
ATOM   212  O  O   . LYS A 1 32  ? 25.638 49.785 46.039 1.00 62.44  ? 74  LYS A O   1 
ATOM   213  C  CB  . LYS A 1 32  ? 24.277 50.207 43.258 1.00 62.40  ? 74  LYS A CB  1 
ATOM   214  C  CG  . LYS A 1 32  ? 24.204 50.910 41.898 1.00 62.53  ? 74  LYS A CG  1 
ATOM   215  C  CD  . LYS A 1 32  ? 24.871 52.284 41.919 1.00 62.72  ? 74  LYS A CD  1 
ATOM   216  C  CE  . LYS A 1 32  ? 24.966 52.874 40.520 1.00 62.70  ? 74  LYS A CE  1 
ATOM   217  N  NZ  . LYS A 1 32  ? 25.630 54.207 40.515 1.00 62.71  ? 74  LYS A NZ  1 
ATOM   218  N  N   . GLU A 1 33  ? 25.652 47.739 45.084 1.00 62.44  ? 75  GLU A N   1 
ATOM   219  C  CA  . GLU A 1 33  ? 25.664 46.992 46.344 1.00 62.48  ? 75  GLU A CA  1 
ATOM   220  C  C   . GLU A 1 33  ? 26.835 46.010 46.406 1.00 62.46  ? 75  GLU A C   1 
ATOM   221  O  O   . GLU A 1 33  ? 27.469 45.720 45.388 1.00 62.44  ? 75  GLU A O   1 
ATOM   222  C  CB  . GLU A 1 33  ? 24.350 46.226 46.528 1.00 62.48  ? 75  GLU A CB  1 
ATOM   223  C  CG  . GLU A 1 33  ? 23.156 47.077 46.945 1.00 62.54  ? 75  GLU A CG  1 
ATOM   224  C  CD  . GLU A 1 33  ? 21.906 46.246 47.206 1.00 62.55  ? 75  GLU A CD  1 
ATOM   225  O  OE1 . GLU A 1 33  ? 21.718 45.213 46.522 1.00 62.42  ? 75  GLU A OE1 1 
ATOM   226  O  OE2 . GLU A 1 33  ? 21.111 46.629 48.093 1.00 61.98  ? 75  GLU A OE2 1 
ATOM   227  N  N   . SER A 1 34  ? 27.115 45.505 47.607 1.00 62.46  ? 76  SER A N   1 
ATOM   228  C  CA  . SER A 1 34  ? 28.126 44.466 47.803 1.00 62.43  ? 76  SER A CA  1 
ATOM   229  C  C   . SER A 1 34  ? 27.590 43.103 47.371 1.00 62.39  ? 76  SER A C   1 
ATOM   230  O  O   . SER A 1 34  ? 26.376 42.876 47.384 1.00 62.39  ? 76  SER A O   1 
ATOM   231  C  CB  . SER A 1 34  ? 28.584 44.422 49.263 1.00 62.42  ? 76  SER A CB  1 
ATOM   232  O  OG  . SER A 1 34  ? 29.365 45.559 49.583 1.00 62.53  ? 76  SER A OG  1 
ATOM   233  N  N   . ASP A 1 35  ? 28.503 42.207 46.994 1.00 62.33  ? 77  ASP A N   1 
ATOM   234  C  CA  . ASP A 1 35  ? 28.166 40.877 46.466 1.00 62.24  ? 77  ASP A CA  1 
ATOM   235  C  C   . ASP A 1 35  ? 27.228 40.916 45.257 1.00 62.12  ? 77  ASP A C   1 
ATOM   236  O  O   . ASP A 1 35  ? 26.300 40.109 45.150 1.00 62.28  ? 77  ASP A O   1 
ATOM   237  C  CB  . ASP A 1 35  ? 27.618 39.950 47.562 1.00 62.33  ? 77  ASP A CB  1 
ATOM   238  C  CG  . ASP A 1 35  ? 28.658 38.968 48.066 1.00 62.72  ? 77  ASP A CG  1 
ATOM   239  O  OD1 . ASP A 1 35  ? 29.588 39.396 48.785 1.00 63.06  ? 77  ASP A OD1 1 
ATOM   240  O  OD2 . ASP A 1 35  ? 28.543 37.765 47.743 1.00 63.23  ? 77  ASP A OD2 1 
ATOM   241  N  N   . THR A 1 36  ? 27.483 41.853 44.347 1.00 61.87  ? 78  THR A N   1 
ATOM   242  C  CA  . THR A 1 36  ? 26.721 41.952 43.106 1.00 61.60  ? 78  THR A CA  1 
ATOM   243  C  C   . THR A 1 36  ? 27.240 40.927 42.102 1.00 61.48  ? 78  THR A C   1 
ATOM   244  O  O   . THR A 1 36  ? 28.452 40.747 41.956 1.00 61.57  ? 78  THR A O   1 
ATOM   245  C  CB  . THR A 1 36  ? 26.787 43.377 42.504 1.00 61.57  ? 78  THR A CB  1 
ATOM   246  O  OG1 . THR A 1 36  ? 26.433 44.338 43.504 1.00 61.62  ? 78  THR A OG1 1 
ATOM   247  C  CG2 . THR A 1 36  ? 25.828 43.521 41.327 1.00 61.40  ? 78  THR A CG2 1 
ATOM   248  N  N   . TYR A 1 37  ? 26.313 40.247 41.432 1.00 61.31  ? 79  TYR A N   1 
ATOM   249  C  CA  . TYR A 1 37  ? 26.642 39.303 40.366 1.00 61.03  ? 79  TYR A CA  1 
ATOM   250  C  C   . TYR A 1 37  ? 26.187 39.854 39.020 1.00 60.93  ? 79  TYR A C   1 
ATOM   251  O  O   . TYR A 1 37  ? 24.985 39.953 38.760 1.00 60.91  ? 79  TYR A O   1 
ATOM   252  C  CB  . TYR A 1 37  ? 25.979 37.944 40.620 1.00 61.00  ? 79  TYR A CB  1 
ATOM   253  C  CG  . TYR A 1 37  ? 26.646 37.104 41.685 1.00 60.87  ? 79  TYR A CG  1 
ATOM   254  C  CD1 . TYR A 1 37  ? 26.295 37.237 43.028 1.00 61.23  ? 79  TYR A CD1 1 
ATOM   255  C  CD2 . TYR A 1 37  ? 27.620 36.167 41.348 1.00 61.01  ? 79  TYR A CD2 1 
ATOM   256  C  CE1 . TYR A 1 37  ? 26.904 36.461 44.011 1.00 61.35  ? 79  TYR A CE1 1 
ATOM   257  C  CE2 . TYR A 1 37  ? 28.235 35.384 42.323 1.00 61.07  ? 79  TYR A CE2 1 
ATOM   258  C  CZ  . TYR A 1 37  ? 27.873 35.538 43.651 1.00 61.19  ? 79  TYR A CZ  1 
ATOM   259  O  OH  . TYR A 1 37  ? 28.476 34.768 44.619 1.00 61.32  ? 79  TYR A OH  1 
ATOM   260  N  N   . PHE A 1 38  ? 27.149 40.224 38.176 1.00 60.78  ? 80  PHE A N   1 
ATOM   261  C  CA  . PHE A 1 38  ? 26.851 40.684 36.821 1.00 60.72  ? 80  PHE A CA  1 
ATOM   262  C  C   . PHE A 1 38  ? 27.162 39.605 35.786 1.00 60.77  ? 80  PHE A C   1 
ATOM   263  O  O   . PHE A 1 38  ? 28.107 38.832 35.945 1.00 60.48  ? 80  PHE A O   1 
ATOM   264  C  CB  . PHE A 1 38  ? 27.627 41.966 36.482 1.00 60.74  ? 80  PHE A CB  1 
ATOM   265  C  CG  . PHE A 1 38  ? 27.035 43.225 37.069 1.00 60.53  ? 80  PHE A CG  1 
ATOM   266  C  CD1 . PHE A 1 38  ? 25.737 43.617 36.763 1.00 60.35  ? 80  PHE A CD1 1 
ATOM   267  C  CD2 . PHE A 1 38  ? 27.797 44.041 37.899 1.00 60.56  ? 80  PHE A CD2 1 
ATOM   268  C  CE1 . PHE A 1 38  ? 25.199 44.792 37.300 1.00 61.15  ? 80  PHE A CE1 1 
ATOM   269  C  CE2 . PHE A 1 38  ? 27.270 45.220 38.437 1.00 60.69  ? 80  PHE A CE2 1 
ATOM   270  C  CZ  . PHE A 1 38  ? 25.969 45.595 38.139 1.00 60.63  ? 80  PHE A CZ  1 
ATOM   271  N  N   . CYS A 1 39  ? 26.347 39.561 34.735 1.00 61.00  ? 81  CYS A N   1 
ATOM   272  C  CA  . CYS A 1 39  ? 26.544 38.656 33.607 1.00 61.29  ? 81  CYS A CA  1 
ATOM   273  C  C   . CYS A 1 39  ? 26.446 39.400 32.280 1.00 61.67  ? 81  CYS A C   1 
ATOM   274  O  O   . CYS A 1 39  ? 25.778 40.426 32.186 1.00 61.56  ? 81  CYS A O   1 
ATOM   275  C  CB  . CYS A 1 39  ? 25.508 37.528 33.619 1.00 61.30  ? 81  CYS A CB  1 
ATOM   276  S  SG  . CYS A 1 39  ? 25.854 36.146 34.716 1.00 60.93  ? 81  CYS A SG  1 
ATOM   277  N  N   . MET A 1 40  ? 27.119 38.874 31.260 1.00 62.18  ? 82  MET A N   1 
ATOM   278  C  CA  . MET A 1 40  ? 26.954 39.350 29.885 1.00 62.96  ? 82  MET A CA  1 
ATOM   279  C  C   . MET A 1 40  ? 27.337 38.266 28.881 1.00 62.80  ? 82  MET A C   1 
ATOM   280  O  O   . MET A 1 40  ? 28.019 37.300 29.233 1.00 63.14  ? 82  MET A O   1 
ATOM   281  C  CB  . MET A 1 40  ? 27.714 40.663 29.635 1.00 63.40  ? 82  MET A CB  1 
ATOM   282  C  CG  . MET A 1 40  ? 29.172 40.672 30.066 1.00 65.27  ? 82  MET A CG  1 
ATOM   283  S  SD  . MET A 1 40  ? 30.276 40.042 28.794 1.00 71.10  ? 82  MET A SD  1 
ATOM   284  C  CE  . MET A 1 40  ? 30.012 41.232 27.476 1.00 67.72  ? 82  MET A CE  1 
ATOM   285  N  N   . SER A 1 41  ? 26.878 38.416 27.642 1.00 62.51  ? 83  SER A N   1 
ATOM   286  C  CA  . SER A 1 41  ? 27.170 37.434 26.604 1.00 62.43  ? 83  SER A CA  1 
ATOM   287  C  C   . SER A 1 41  ? 27.883 38.043 25.401 1.00 62.49  ? 83  SER A C   1 
ATOM   288  O  O   . SER A 1 41  ? 27.703 39.217 25.088 1.00 62.49  ? 83  SER A O   1 
ATOM   289  C  CB  . SER A 1 41  ? 25.893 36.711 26.158 1.00 62.24  ? 83  SER A CB  1 
ATOM   290  O  OG  . SER A 1 41  ? 25.026 37.578 25.446 1.00 62.64  ? 83  SER A OG  1 
ATOM   291  N  N   . MET A 1 42  ? 28.718 37.231 24.760 1.00 62.77  ? 84  MET A N   1 
ATOM   292  C  CA  . MET A 1 42  ? 29.277 37.530 23.453 1.00 63.18  ? 84  MET A CA  1 
ATOM   293  C  C   . MET A 1 42  ? 28.954 36.339 22.561 1.00 63.23  ? 84  MET A C   1 
ATOM   294  O  O   . MET A 1 42  ? 29.252 35.195 22.905 1.00 63.35  ? 84  MET A O   1 
ATOM   295  C  CB  . MET A 1 42  ? 30.804 37.690 23.505 1.00 63.49  ? 84  MET A CB  1 
ATOM   296  C  CG  . MET A 1 42  ? 31.351 38.749 24.446 1.00 64.39  ? 84  MET A CG  1 
ATOM   297  S  SD  . MET A 1 42  ? 31.346 40.405 23.770 1.00 68.68  ? 84  MET A SD  1 
ATOM   298  C  CE  . MET A 1 42  ? 32.617 40.306 22.506 1.00 67.99  ? 84  MET A CE  1 
ATOM   299  N  N   . ARG A 1 43  ? 28.333 36.611 21.423 1.00 63.44  ? 85  ARG A N   1 
ATOM   300  C  CA  . ARG A 1 43  ? 28.225 35.633 20.355 1.00 63.77  ? 85  ARG A CA  1 
ATOM   301  C  C   . ARG A 1 43  ? 29.638 35.416 19.829 1.00 63.61  ? 85  ARG A C   1 
ATOM   302  O  O   . ARG A 1 43  ? 30.413 36.359 19.756 1.00 63.70  ? 85  ARG A O   1 
ATOM   303  C  CB  . ARG A 1 43  ? 27.319 36.188 19.251 1.00 63.84  ? 85  ARG A CB  1 
ATOM   304  C  CG  . ARG A 1 43  ? 27.194 35.330 18.005 1.00 65.23  ? 85  ARG A CG  1 
ATOM   305  C  CD  . ARG A 1 43  ? 25.922 34.509 17.998 1.00 67.49  ? 85  ARG A CD  1 
ATOM   306  N  NE  . ARG A 1 43  ? 25.945 33.516 16.923 1.00 69.44  ? 85  ARG A NE  1 
ATOM   307  C  CZ  . ARG A 1 43  ? 24.906 32.774 16.547 1.00 70.32  ? 85  ARG A CZ  1 
ATOM   308  N  NH1 . ARG A 1 43  ? 23.725 32.904 17.146 1.00 70.47  ? 85  ARG A NH1 1 
ATOM   309  N  NH2 . ARG A 1 43  ? 25.047 31.903 15.555 1.00 70.99  ? 85  ARG A NH2 1 
ATOM   310  N  N   . LEU A 1 44  ? 29.986 34.176 19.497 1.00 63.52  ? 86  LEU A N   1 
ATOM   311  C  CA  . LEU A 1 44  ? 31.260 33.899 18.833 1.00 63.49  ? 86  LEU A CA  1 
ATOM   312  C  C   . LEU A 1 44  ? 31.337 34.629 17.496 1.00 63.12  ? 86  LEU A C   1 
ATOM   313  O  O   . LEU A 1 44  ? 30.342 34.685 16.772 1.00 63.33  ? 86  LEU A O   1 
ATOM   314  C  CB  . LEU A 1 44  ? 31.457 32.399 18.619 1.00 63.51  ? 86  LEU A CB  1 
ATOM   315  C  CG  . LEU A 1 44  ? 32.325 31.664 19.637 1.00 64.49  ? 86  LEU A CG  1 
ATOM   316  C  CD1 . LEU A 1 44  ? 31.538 31.322 20.901 1.00 65.02  ? 86  LEU A CD1 1 
ATOM   317  C  CD2 . LEU A 1 44  ? 32.898 30.401 19.008 1.00 65.66  ? 86  LEU A CD2 1 
ATOM   318  N  N   . PRO A 1 45  ? 32.508 35.212 17.172 1.00 62.86  ? 87  PRO A N   1 
ATOM   319  C  CA  . PRO A 1 45  ? 32.615 35.925 15.890 1.00 62.77  ? 87  PRO A CA  1 
ATOM   320  C  C   . PRO A 1 45  ? 32.668 34.991 14.683 1.00 62.70  ? 87  PRO A C   1 
ATOM   321  O  O   . PRO A 1 45  ? 32.313 35.403 13.578 1.00 63.10  ? 87  PRO A O   1 
ATOM   322  C  CB  . PRO A 1 45  ? 33.925 36.708 16.027 1.00 62.78  ? 87  PRO A CB  1 
ATOM   323  C  CG  . PRO A 1 45  ? 34.729 35.944 17.011 1.00 62.63  ? 87  PRO A CG  1 
ATOM   324  C  CD  . PRO A 1 45  ? 33.760 35.270 17.950 1.00 62.66  ? 87  PRO A CD  1 
ATOM   325  N  N   . VAL A 1 46  ? 33.109 33.754 14.902 1.00 62.67  ? 88  VAL A N   1 
ATOM   326  C  CA  . VAL A 1 46  ? 33.183 32.733 13.852 1.00 62.61  ? 88  VAL A CA  1 
ATOM   327  C  C   . VAL A 1 46  ? 32.036 31.737 13.963 1.00 62.43  ? 88  VAL A C   1 
ATOM   328  O  O   . VAL A 1 46  ? 31.692 31.294 15.060 1.00 62.25  ? 88  VAL A O   1 
ATOM   329  C  CB  . VAL A 1 46  ? 34.526 31.947 13.877 1.00 62.70  ? 88  VAL A CB  1 
ATOM   330  C  CG1 . VAL A 1 46  ? 35.656 32.832 13.454 1.00 63.12  ? 88  VAL A CG1 1 
ATOM   331  C  CG2 . VAL A 1 46  ? 34.813 31.365 15.255 1.00 62.53  ? 88  VAL A CG2 1 
ATOM   332  N  N   . ASP A 1 47  ? 31.456 31.383 12.822 1.00 62.37  ? 89  ASP A N   1 
ATOM   333  C  CA  . ASP A 1 47  ? 30.385 30.396 12.784 1.00 62.42  ? 89  ASP A CA  1 
ATOM   334  C  C   . ASP A 1 47  ? 30.963 28.980 12.831 1.00 62.28  ? 89  ASP A C   1 
ATOM   335  O  O   . ASP A 1 47  ? 30.415 28.100 13.495 1.00 62.11  ? 89  ASP A O   1 
ATOM   336  C  CB  . ASP A 1 47  ? 29.523 30.584 11.534 1.00 62.59  ? 89  ASP A CB  1 
ATOM   337  C  CG  . ASP A 1 47  ? 28.039 30.672 11.852 1.00 63.28  ? 89  ASP A CG  1 
ATOM   338  O  OD1 . ASP A 1 47  ? 27.646 30.398 13.008 1.00 63.79  ? 89  ASP A OD1 1 
ATOM   339  O  OD2 . ASP A 1 47  ? 27.259 31.028 10.938 1.00 64.89  ? 89  ASP A OD2 1 
ATOM   340  N  N   . GLU A 1 48  ? 32.080 28.778 12.133 1.00 62.14  ? 90  GLU A N   1 
ATOM   341  C  CA  . GLU A 1 48  ? 32.731 27.475 12.051 1.00 62.21  ? 90  GLU A CA  1 
ATOM   342  C  C   . GLU A 1 48  ? 33.342 27.050 13.392 1.00 61.98  ? 90  GLU A C   1 
ATOM   343  O  O   . GLU A 1 48  ? 33.391 27.835 14.344 1.00 61.80  ? 90  GLU A O   1 
ATOM   344  C  CB  . GLU A 1 48  ? 33.793 27.472 10.945 1.00 62.46  ? 90  GLU A CB  1 
ATOM   345  C  CG  . GLU A 1 48  ? 35.067 28.233 11.293 1.00 63.97  ? 90  GLU A CG  1 
ATOM   346  C  CD  . GLU A 1 48  ? 36.256 27.817 10.445 1.00 65.27  ? 90  GLU A CD  1 
ATOM   347  O  OE1 . GLU A 1 48  ? 36.328 28.242 9.277  1.00 64.72  ? 90  GLU A OE1 1 
ATOM   348  O  OE2 . GLU A 1 48  ? 37.127 27.074 10.960 1.00 66.80  ? 90  GLU A OE2 1 
ATOM   349  N  N   . GLU A 1 49  ? 33.796 25.800 13.451 1.00 61.62  ? 91  GLU A N   1 
ATOM   350  C  CA  . GLU A 1 49  ? 34.385 25.235 14.658 1.00 61.23  ? 91  GLU A CA  1 
ATOM   351  C  C   . GLU A 1 49  ? 35.706 25.910 15.019 1.00 60.64  ? 91  GLU A C   1 
ATOM   352  O  O   . GLU A 1 49  ? 36.537 26.165 14.146 1.00 60.60  ? 91  GLU A O   1 
ATOM   353  C  CB  . GLU A 1 49  ? 34.601 23.733 14.481 1.00 61.45  ? 91  GLU A CB  1 
ATOM   354  C  CG  . GLU A 1 49  ? 35.210 23.042 15.704 1.00 62.68  ? 91  GLU A CG  1 
ATOM   355  C  CD  . GLU A 1 49  ? 35.065 21.542 15.640 1.00 64.45  ? 91  GLU A CD  1 
ATOM   356  O  OE1 . GLU A 1 49  ? 35.741 20.906 14.803 1.00 64.76  ? 91  GLU A OE1 1 
ATOM   357  O  OE2 . GLU A 1 49  ? 34.268 21.002 16.431 1.00 66.39  ? 91  GLU A OE2 1 
ATOM   358  N  N   . ALA A 1 50  ? 35.882 26.187 16.308 1.00 59.93  ? 92  ALA A N   1 
ATOM   359  C  CA  . ALA A 1 50  ? 37.123 26.754 16.826 1.00 59.55  ? 92  ALA A CA  1 
ATOM   360  C  C   . ALA A 1 50  ? 37.485 26.136 18.173 1.00 59.28  ? 92  ALA A C   1 
ATOM   361  O  O   . ALA A 1 50  ? 36.667 25.444 18.798 1.00 59.26  ? 92  ALA A O   1 
ATOM   362  C  CB  . ALA A 1 50  ? 37.013 28.272 16.938 1.00 59.34  ? 92  ALA A CB  1 
ATOM   363  N  N   . PHE A 1 51  ? 38.713 26.382 18.625 1.00 58.94  ? 93  PHE A N   1 
ATOM   364  C  CA  . PHE A 1 51  ? 39.194 25.796 19.878 1.00 58.56  ? 93  PHE A CA  1 
ATOM   365  C  C   . PHE A 1 51  ? 39.707 26.872 20.817 1.00 58.57  ? 93  PHE A C   1 
ATOM   366  O  O   . PHE A 1 51  ? 40.443 27.768 20.400 1.00 58.56  ? 93  PHE A O   1 
ATOM   367  C  CB  . PHE A 1 51  ? 40.268 24.731 19.602 1.00 58.68  ? 93  PHE A CB  1 
ATOM   368  C  CG  . PHE A 1 51  ? 39.815 23.648 18.651 1.00 58.26  ? 93  PHE A CG  1 
ATOM   369  C  CD1 . PHE A 1 51  ? 39.862 23.848 17.277 1.00 59.00  ? 93  PHE A CD1 1 
ATOM   370  C  CD2 . PHE A 1 51  ? 39.317 22.443 19.135 1.00 58.62  ? 93  PHE A CD2 1 
ATOM   371  C  CE1 . PHE A 1 51  ? 39.424 22.863 16.394 1.00 59.99  ? 93  PHE A CE1 1 
ATOM   372  C  CE2 . PHE A 1 51  ? 38.884 21.449 18.270 1.00 58.55  ? 93  PHE A CE2 1 
ATOM   373  C  CZ  . PHE A 1 51  ? 38.939 21.657 16.895 1.00 59.70  ? 93  PHE A CZ  1 
ATOM   374  N  N   . VAL A 1 52  ? 39.288 26.789 22.075 1.00 58.37  ? 94  VAL A N   1 
ATOM   375  C  CA  . VAL A 1 52  ? 39.726 27.706 23.118 1.00 58.45  ? 94  VAL A CA  1 
ATOM   376  C  C   . VAL A 1 52  ? 40.947 27.093 23.782 1.00 58.43  ? 94  VAL A C   1 
ATOM   377  O  O   . VAL A 1 52  ? 40.838 26.095 24.492 1.00 58.23  ? 94  VAL A O   1 
ATOM   378  C  CB  . VAL A 1 52  ? 38.628 27.924 24.191 1.00 58.49  ? 94  VAL A CB  1 
ATOM   379  C  CG1 . VAL A 1 52  ? 39.132 28.826 25.287 1.00 58.33  ? 94  VAL A CG1 1 
ATOM   380  C  CG2 . VAL A 1 52  ? 37.357 28.505 23.573 1.00 58.45  ? 94  VAL A CG2 1 
ATOM   381  N  N   . ILE A 1 53  ? 42.110 27.695 23.559 1.00 58.40  ? 95  ILE A N   1 
ATOM   382  C  CA  . ILE A 1 53  ? 43.360 27.103 24.047 1.00 57.86  ? 95  ILE A CA  1 
ATOM   383  C  C   . ILE A 1 53  ? 44.026 27.845 25.212 1.00 58.09  ? 95  ILE A C   1 
ATOM   384  O  O   . ILE A 1 53  ? 44.980 27.335 25.819 1.00 57.96  ? 95  ILE A O   1 
ATOM   385  C  CB  . ILE A 1 53  ? 44.367 26.850 22.895 1.00 58.04  ? 95  ILE A CB  1 
ATOM   386  C  CG1 . ILE A 1 53  ? 44.651 28.138 22.104 1.00 56.83  ? 95  ILE A CG1 1 
ATOM   387  C  CG2 . ILE A 1 53  ? 43.840 25.746 21.984 1.00 57.75  ? 95  ILE A CG2 1 
ATOM   388  C  CD1 . ILE A 1 53  ? 45.839 28.032 21.154 1.00 57.04  ? 95  ILE A CD1 1 
ATOM   389  N  N   . ASP A 1 54  ? 43.518 29.032 25.533 1.00 58.17  ? 96  ASP A N   1 
ATOM   390  C  CA  . ASP A 1 54  ? 44.057 29.816 26.649 1.00 58.45  ? 96  ASP A CA  1 
ATOM   391  C  C   . ASP A 1 54  ? 43.052 30.835 27.187 1.00 58.59  ? 96  ASP A C   1 
ATOM   392  O  O   . ASP A 1 54  ? 42.105 31.201 26.499 1.00 58.48  ? 96  ASP A O   1 
ATOM   393  C  CB  . ASP A 1 54  ? 45.358 30.510 26.232 1.00 58.15  ? 96  ASP A CB  1 
ATOM   394  C  CG  . ASP A 1 54  ? 46.290 30.763 27.399 1.00 58.41  ? 96  ASP A CG  1 
ATOM   395  O  OD1 . ASP A 1 54  ? 45.941 30.403 28.549 1.00 57.20  ? 96  ASP A OD1 1 
ATOM   396  O  OD2 . ASP A 1 54  ? 47.383 31.323 27.158 1.00 58.62  ? 96  ASP A OD2 1 
ATOM   397  N  N   . PHE A 1 55  ? 43.265 31.263 28.430 1.00 59.35  ? 97  PHE A N   1 
ATOM   398  C  CA  . PHE A 1 55  ? 42.442 32.280 29.089 1.00 60.01  ? 97  PHE A CA  1 
ATOM   399  C  C   . PHE A 1 55  ? 43.349 33.219 29.858 1.00 60.60  ? 97  PHE A C   1 
ATOM   400  O  O   . PHE A 1 55  ? 44.229 32.775 30.599 1.00 60.78  ? 97  PHE A O   1 
ATOM   401  C  CB  . PHE A 1 55  ? 41.468 31.672 30.098 1.00 59.76  ? 97  PHE A CB  1 
ATOM   402  C  CG  . PHE A 1 55  ? 40.556 30.631 29.535 1.00 60.23  ? 97  PHE A CG  1 
ATOM   403  C  CD1 . PHE A 1 55  ? 40.925 29.290 29.543 1.00 60.15  ? 97  PHE A CD1 1 
ATOM   404  C  CD2 . PHE A 1 55  ? 39.305 30.982 29.036 1.00 59.91  ? 97  PHE A CD2 1 
ATOM   405  C  CE1 . PHE A 1 55  ? 40.074 28.316 29.035 1.00 60.23  ? 97  PHE A CE1 1 
ATOM   406  C  CE2 . PHE A 1 55  ? 38.450 30.024 28.529 1.00 59.82  ? 97  PHE A CE2 1 
ATOM   407  C  CZ  . PHE A 1 55  ? 38.831 28.681 28.532 1.00 60.14  ? 97  PHE A CZ  1 
ATOM   408  N  N   . LYS A 1 56  ? 43.119 34.517 29.703 1.00 61.12  ? 98  LYS A N   1 
ATOM   409  C  CA  . LYS A 1 56  ? 43.868 35.511 30.441 1.00 61.97  ? 98  LYS A CA  1 
ATOM   410  C  C   . LYS A 1 56  ? 42.906 36.401 31.208 1.00 61.99  ? 98  LYS A C   1 
ATOM   411  O  O   . LYS A 1 56  ? 42.079 37.078 30.599 1.00 62.08  ? 98  LYS A O   1 
ATOM   412  C  CB  . LYS A 1 56  ? 44.761 36.338 29.508 1.00 62.26  ? 98  LYS A CB  1 
ATOM   413  C  CG  . LYS A 1 56  ? 45.815 35.525 28.741 1.00 64.49  ? 98  LYS A CG  1 
ATOM   414  C  CD  . LYS A 1 56  ? 46.722 34.710 29.680 1.00 67.53  ? 98  LYS A CD  1 
ATOM   415  C  CE  . LYS A 1 56  ? 48.049 34.353 29.019 1.00 68.71  ? 98  LYS A CE  1 
ATOM   416  N  NZ  . LYS A 1 56  ? 49.126 34.182 30.046 1.00 69.96  ? 98  LYS A NZ  1 
ATOM   417  N  N   . PRO A 1 57  ? 43.009 36.401 32.550 1.00 62.18  ? 99  PRO A N   1 
ATOM   418  C  CA  . PRO A 1 57  ? 42.103 37.215 33.354 1.00 62.46  ? 99  PRO A CA  1 
ATOM   419  C  C   . PRO A 1 57  ? 42.435 38.700 33.219 1.00 62.81  ? 99  PRO A C   1 
ATOM   420  O  O   . PRO A 1 57  ? 43.612 39.083 33.218 1.00 62.51  ? 99  PRO A O   1 
ATOM   421  C  CB  . PRO A 1 57  ? 42.370 36.732 34.780 1.00 62.32  ? 99  PRO A CB  1 
ATOM   422  C  CG  . PRO A 1 57  ? 43.783 36.255 34.751 1.00 62.18  ? 99  PRO A CG  1 
ATOM   423  C  CD  . PRO A 1 57  ? 43.985 35.673 33.383 1.00 62.04  ? 99  PRO A CD  1 
ATOM   424  N  N   . ARG A 1 58  ? 41.398 39.514 33.072 1.00 63.41  ? 100 ARG A N   1 
ATOM   425  C  CA  . ARG A 1 58  ? 41.546 40.964 33.005 1.00 64.20  ? 100 ARG A CA  1 
ATOM   426  C  C   . ARG A 1 58  ? 40.633 41.577 34.059 1.00 64.22  ? 100 ARG A C   1 
ATOM   427  O  O   . ARG A 1 58  ? 39.593 42.152 33.740 1.00 64.12  ? 100 ARG A O   1 
ATOM   428  C  CB  . ARG A 1 58  ? 41.206 41.485 31.600 1.00 64.51  ? 100 ARG A CB  1 
ATOM   429  C  CG  . ARG A 1 58  ? 42.029 40.874 30.465 1.00 65.86  ? 100 ARG A CG  1 
ATOM   430  C  CD  . ARG A 1 58  ? 43.495 41.268 30.561 1.00 69.68  ? 100 ARG A CD  1 
ATOM   431  N  NE  . ARG A 1 58  ? 44.310 40.644 29.519 1.00 72.59  ? 100 ARG A NE  1 
ATOM   432  C  CZ  . ARG A 1 58  ? 44.439 41.111 28.278 1.00 74.11  ? 100 ARG A CZ  1 
ATOM   433  N  NH1 . ARG A 1 58  ? 43.799 42.214 27.900 1.00 74.37  ? 100 ARG A NH1 1 
ATOM   434  N  NH2 . ARG A 1 58  ? 45.210 40.470 27.408 1.00 74.79  ? 100 ARG A NH2 1 
ATOM   435  N  N   . ALA A 1 59  ? 41.031 41.430 35.320 1.00 64.50  ? 101 ALA A N   1 
ATOM   436  C  CA  . ALA A 1 59  ? 40.196 41.824 36.449 1.00 64.81  ? 101 ALA A CA  1 
ATOM   437  C  C   . ALA A 1 59  ? 40.847 42.881 37.336 1.00 65.09  ? 101 ALA A C   1 
ATOM   438  O  O   . ALA A 1 59  ? 42.054 42.837 37.598 1.00 65.05  ? 101 ALA A O   1 
ATOM   439  C  CB  . ALA A 1 59  ? 39.820 40.599 37.276 1.00 64.65  ? 101 ALA A CB  1 
ATOM   440  N  N   . SER A 1 60  ? 40.032 43.828 37.792 1.00 65.49  ? 102 SER A N   1 
ATOM   441  C  CA  . SER A 1 60  ? 40.442 44.797 38.802 1.00 65.95  ? 102 SER A CA  1 
ATOM   442  C  C   . SER A 1 60  ? 40.622 44.061 40.128 1.00 66.14  ? 102 SER A C   1 
ATOM   443  O  O   . SER A 1 60  ? 39.666 43.502 40.671 1.00 66.25  ? 102 SER A O   1 
ATOM   444  C  CB  . SER A 1 60  ? 39.394 45.902 38.939 1.00 65.98  ? 102 SER A CB  1 
ATOM   445  O  OG  . SER A 1 60  ? 39.068 46.454 37.674 1.00 66.37  ? 102 SER A OG  1 
ATOM   446  N  N   . MET A 1 61  ? 41.853 44.060 40.635 1.00 66.38  ? 103 MET A N   1 
ATOM   447  C  CA  . MET A 1 61  ? 42.217 43.260 41.810 1.00 66.56  ? 103 MET A CA  1 
ATOM   448  C  C   . MET A 1 61  ? 41.542 43.707 43.106 1.00 66.49  ? 103 MET A C   1 
ATOM   449  O  O   . MET A 1 61  ? 41.453 42.938 44.067 1.00 66.59  ? 103 MET A O   1 
ATOM   450  C  CB  . MET A 1 61  ? 43.740 43.212 41.986 1.00 66.75  ? 103 MET A CB  1 
ATOM   451  C  CG  . MET A 1 61  ? 44.448 42.257 41.024 1.00 66.96  ? 103 MET A CG  1 
ATOM   452  S  SD  . MET A 1 61  ? 43.878 40.548 41.163 1.00 67.85  ? 103 MET A SD  1 
ATOM   453  C  CE  . MET A 1 61  ? 44.657 40.022 42.688 1.00 67.82  ? 103 MET A CE  1 
ATOM   454  N  N   . ASP A 1 62  ? 41.066 44.948 43.120 1.00 66.37  ? 104 ASP A N   1 
ATOM   455  C  CA  . ASP A 1 62  ? 40.403 45.508 44.289 1.00 66.19  ? 104 ASP A CA  1 
ATOM   456  C  C   . ASP A 1 62  ? 38.968 45.007 44.454 1.00 65.98  ? 104 ASP A C   1 
ATOM   457  O  O   . ASP A 1 62  ? 38.552 44.675 45.566 1.00 66.04  ? 104 ASP A O   1 
ATOM   458  C  CB  . ASP A 1 62  ? 40.417 47.039 44.225 1.00 66.29  ? 104 ASP A CB  1 
ATOM   459  C  CG  . ASP A 1 62  ? 41.807 47.630 44.445 1.00 66.58  ? 104 ASP A CG  1 
ATOM   460  O  OD1 . ASP A 1 62  ? 42.816 46.910 44.268 1.00 67.11  ? 104 ASP A OD1 1 
ATOM   461  O  OD2 . ASP A 1 62  ? 41.887 48.827 44.794 1.00 66.31  ? 104 ASP A OD2 1 
ATOM   462  N  N   . THR A 1 63  ? 38.228 44.933 43.348 1.00 65.54  ? 105 THR A N   1 
ATOM   463  C  CA  . THR A 1 63  ? 36.771 44.759 43.403 1.00 65.13  ? 105 THR A CA  1 
ATOM   464  C  C   . THR A 1 63  ? 36.234 43.371 43.014 1.00 64.74  ? 105 THR A C   1 
ATOM   465  O  O   . THR A 1 63  ? 35.185 42.953 43.510 1.00 64.69  ? 105 THR A O   1 
ATOM   466  C  CB  . THR A 1 63  ? 36.036 45.872 42.593 1.00 65.26  ? 105 THR A CB  1 
ATOM   467  O  OG1 . THR A 1 63  ? 34.628 45.814 42.851 1.00 65.49  ? 105 THR A OG1 1 
ATOM   468  C  CG2 . THR A 1 63  ? 36.292 45.739 41.086 1.00 65.23  ? 105 THR A CG2 1 
ATOM   469  N  N   . VAL A 1 64  ? 36.945 42.664 42.141 1.00 64.16  ? 106 VAL A N   1 
ATOM   470  C  CA  . VAL A 1 64  ? 36.467 41.376 41.637 1.00 63.65  ? 106 VAL A CA  1 
ATOM   471  C  C   . VAL A 1 64  ? 36.811 40.225 42.591 1.00 63.48  ? 106 VAL A C   1 
ATOM   472  O  O   . VAL A 1 64  ? 37.981 39.990 42.903 1.00 63.49  ? 106 VAL A O   1 
ATOM   473  C  CB  . VAL A 1 64  ? 36.989 41.088 40.203 1.00 63.62  ? 106 VAL A CB  1 
ATOM   474  C  CG1 . VAL A 1 64  ? 36.440 39.771 39.687 1.00 63.13  ? 106 VAL A CG1 1 
ATOM   475  C  CG2 . VAL A 1 64  ? 36.611 42.225 39.256 1.00 63.08  ? 106 VAL A CG2 1 
ATOM   476  N  N   . HIS A 1 65  ? 35.772 39.528 43.052 1.00 63.14  ? 107 HIS A N   1 
ATOM   477  C  CA  . HIS A 1 65  ? 35.914 38.377 43.944 1.00 62.98  ? 107 HIS A CA  1 
ATOM   478  C  C   . HIS A 1 65  ? 36.186 37.106 43.137 1.00 62.61  ? 107 HIS A C   1 
ATOM   479  O  O   . HIS A 1 65  ? 37.168 36.405 43.381 1.00 62.58  ? 107 HIS A O   1 
ATOM   480  C  CB  . HIS A 1 65  ? 34.653 38.217 44.798 1.00 63.23  ? 107 HIS A CB  1 
ATOM   481  C  CG  . HIS A 1 65  ? 34.784 37.209 45.899 1.00 64.18  ? 107 HIS A CG  1 
ATOM   482  N  ND1 . HIS A 1 65  ? 34.575 35.860 45.704 1.00 66.27  ? 107 HIS A ND1 1 
ATOM   483  C  CD2 . HIS A 1 65  ? 35.085 37.356 47.211 1.00 64.63  ? 107 HIS A CD2 1 
ATOM   484  C  CE1 . HIS A 1 65  ? 34.750 35.220 46.846 1.00 65.02  ? 107 HIS A CE1 1 
ATOM   485  N  NE2 . HIS A 1 65  ? 35.061 36.104 47.776 1.00 64.70  ? 107 HIS A NE2 1 
ATOM   486  N  N   . HIS A 1 66  ? 35.307 36.812 42.181 1.00 62.13  ? 108 HIS A N   1 
ATOM   487  C  CA  . HIS A 1 66  ? 35.533 35.727 41.230 1.00 61.65  ? 108 HIS A CA  1 
ATOM   488  C  C   . HIS A 1 66  ? 34.936 36.025 39.856 1.00 61.10  ? 108 HIS A C   1 
ATOM   489  O  O   . HIS A 1 66  ? 34.078 36.899 39.712 1.00 60.78  ? 108 HIS A O   1 
ATOM   490  C  CB  . HIS A 1 66  ? 35.053 34.369 41.780 1.00 61.77  ? 108 HIS A CB  1 
ATOM   491  C  CG  . HIS A 1 66  ? 33.578 34.129 41.651 1.00 62.90  ? 108 HIS A CG  1 
ATOM   492  N  ND1 . HIS A 1 66  ? 32.699 34.314 42.697 1.00 65.41  ? 108 HIS A ND1 1 
ATOM   493  C  CD2 . HIS A 1 66  ? 32.835 33.681 40.610 1.00 63.76  ? 108 HIS A CD2 1 
ATOM   494  C  CE1 . HIS A 1 66  ? 31.476 34.006 42.302 1.00 64.24  ? 108 HIS A CE1 1 
ATOM   495  N  NE2 . HIS A 1 66  ? 31.531 33.623 41.038 1.00 64.77  ? 108 HIS A NE2 1 
ATOM   496  N  N   . MET A 1 67  ? 35.421 35.295 38.853 1.00 60.58  ? 109 MET A N   1 
ATOM   497  C  CA  . MET A 1 67  ? 34.860 35.324 37.507 1.00 60.16  ? 109 MET A CA  1 
ATOM   498  C  C   . MET A 1 67  ? 34.617 33.903 37.015 1.00 59.79  ? 109 MET A C   1 
ATOM   499  O  O   . MET A 1 67  ? 35.391 32.987 37.309 1.00 59.94  ? 109 MET A O   1 
ATOM   500  C  CB  . MET A 1 67  ? 35.782 36.061 36.527 1.00 60.07  ? 109 MET A CB  1 
ATOM   501  C  CG  . MET A 1 67  ? 35.970 37.541 36.823 1.00 59.99  ? 109 MET A CG  1 
ATOM   502  S  SD  . MET A 1 67  ? 37.028 38.397 35.636 1.00 60.48  ? 109 MET A SD  1 
ATOM   503  C  CE  . MET A 1 67  ? 38.572 37.492 35.805 1.00 59.17  ? 109 MET A CE  1 
ATOM   504  N  N   . LEU A 1 68  ? 33.531 33.723 36.275 1.00 59.17  ? 110 LEU A N   1 
ATOM   505  C  CA  . LEU A 1 68  ? 33.255 32.451 35.627 1.00 58.69  ? 110 LEU A CA  1 
ATOM   506  C  C   . LEU A 1 68  ? 32.954 32.703 34.160 1.00 58.73  ? 110 LEU A C   1 
ATOM   507  O  O   . LEU A 1 68  ? 32.287 33.679 33.812 1.00 58.58  ? 110 LEU A O   1 
ATOM   508  C  CB  . LEU A 1 68  ? 32.085 31.714 36.301 1.00 58.28  ? 110 LEU A CB  1 
ATOM   509  C  CG  . LEU A 1 68  ? 32.192 31.280 37.768 1.00 57.15  ? 110 LEU A CG  1 
ATOM   510  C  CD1 . LEU A 1 68  ? 30.899 30.625 38.229 1.00 55.64  ? 110 LEU A CD1 1 
ATOM   511  C  CD2 . LEU A 1 68  ? 33.371 30.347 38.011 1.00 54.78  ? 110 LEU A CD2 1 
ATOM   512  N  N   . LEU A 1 69  ? 33.467 31.830 33.303 1.00 58.68  ? 111 LEU A N   1 
ATOM   513  C  CA  . LEU A 1 69  ? 33.155 31.890 31.886 1.00 58.71  ? 111 LEU A CA  1 
ATOM   514  C  C   . LEU A 1 69  ? 32.488 30.581 31.467 1.00 58.78  ? 111 LEU A C   1 
ATOM   515  O  O   . LEU A 1 69  ? 32.970 29.497 31.805 1.00 58.36  ? 111 LEU A O   1 
ATOM   516  C  CB  . LEU A 1 69  ? 34.414 32.170 31.056 1.00 58.48  ? 111 LEU A CB  1 
ATOM   517  C  CG  . LEU A 1 69  ? 34.220 32.433 29.557 1.00 59.14  ? 111 LEU A CG  1 
ATOM   518  C  CD1 . LEU A 1 69  ? 33.516 33.772 29.297 1.00 57.50  ? 111 LEU A CD1 1 
ATOM   519  C  CD2 . LEU A 1 69  ? 35.569 32.384 28.836 1.00 58.72  ? 111 LEU A CD2 1 
ATOM   520  N  N   . PHE A 1 70  ? 31.367 30.710 30.752 1.00 58.79  ? 112 PHE A N   1 
ATOM   521  C  CA  . PHE A 1 70  ? 30.577 29.581 30.272 1.00 58.75  ? 112 PHE A CA  1 
ATOM   522  C  C   . PHE A 1 70  ? 30.458 29.624 28.748 1.00 59.06  ? 112 PHE A C   1 
ATOM   523  O  O   . PHE A 1 70  ? 30.524 30.691 28.139 1.00 58.75  ? 112 PHE A O   1 
ATOM   524  C  CB  . PHE A 1 70  ? 29.157 29.608 30.863 1.00 58.24  ? 112 PHE A CB  1 
ATOM   525  C  CG  . PHE A 1 70  ? 29.111 29.596 32.364 1.00 58.59  ? 112 PHE A CG  1 
ATOM   526  C  CD1 . PHE A 1 70  ? 29.083 30.787 33.084 1.00 58.10  ? 112 PHE A CD1 1 
ATOM   527  C  CD2 . PHE A 1 70  ? 29.084 28.389 33.066 1.00 58.71  ? 112 PHE A CD2 1 
ATOM   528  C  CE1 . PHE A 1 70  ? 29.038 30.776 34.472 1.00 57.54  ? 112 PHE A CE1 1 
ATOM   529  C  CE2 . PHE A 1 70  ? 29.041 28.373 34.455 1.00 58.04  ? 112 PHE A CE2 1 
ATOM   530  C  CZ  . PHE A 1 70  ? 29.018 29.572 35.157 1.00 57.40  ? 112 PHE A CZ  1 
ATOM   531  N  N   . GLY A 1 71  ? 30.264 28.453 28.148 1.00 59.53  ? 113 GLY A N   1 
ATOM   532  C  CA  . GLY A 1 71  ? 29.811 28.346 26.769 1.00 60.12  ? 113 GLY A CA  1 
ATOM   533  C  C   . GLY A 1 71  ? 28.395 27.800 26.782 1.00 60.90  ? 113 GLY A C   1 
ATOM   534  O  O   . GLY A 1 71  ? 28.084 26.887 27.556 1.00 60.91  ? 113 GLY A O   1 
ATOM   535  N  N   . CYS A 1 72  ? 27.529 28.373 25.948 1.00 61.44  ? 114 CYS A N   1 
ATOM   536  C  CA  . CYS A 1 72  ? 26.155 27.884 25.781 1.00 62.20  ? 114 CYS A CA  1 
ATOM   537  C  C   . CYS A 1 72  ? 25.521 28.431 24.497 1.00 62.32  ? 114 CYS A C   1 
ATOM   538  O  O   . CYS A 1 72  ? 26.119 29.262 23.807 1.00 62.39  ? 114 CYS A O   1 
ATOM   539  C  CB  . CYS A 1 72  ? 25.294 28.213 27.012 1.00 62.57  ? 114 CYS A CB  1 
ATOM   540  S  SG  . CYS A 1 72  ? 24.949 29.965 27.279 1.00 64.29  ? 114 CYS A SG  1 
ATOM   541  N  N   . ASN A 1 73  ? 24.322 27.958 24.170 1.00 62.42  ? 115 ASN A N   1 
ATOM   542  C  CA  . ASN A 1 73  ? 23.637 28.406 22.961 1.00 62.58  ? 115 ASN A CA  1 
ATOM   543  C  C   . ASN A 1 73  ? 22.499 29.393 23.223 1.00 62.65  ? 115 ASN A C   1 
ATOM   544  O  O   . ASN A 1 73  ? 22.081 30.114 22.319 1.00 62.54  ? 115 ASN A O   1 
ATOM   545  C  CB  . ASN A 1 73  ? 23.160 27.206 22.130 1.00 62.60  ? 115 ASN A CB  1 
ATOM   546  C  CG  . ASN A 1 73  ? 24.319 26.359 21.600 1.00 62.93  ? 115 ASN A CG  1 
ATOM   547  O  OD1 . ASN A 1 73  ? 25.442 26.841 21.440 1.00 62.15  ? 115 ASN A OD1 1 
ATOM   548  N  ND2 . ASN A 1 73  ? 24.042 25.090 21.326 1.00 63.69  ? 115 ASN A ND2 1 
ATOM   549  N  N   . MET A 1 74  ? 22.013 29.427 24.461 1.00 63.04  ? 116 MET A N   1 
ATOM   550  C  CA  . MET A 1 74  ? 20.918 30.321 24.846 1.00 63.68  ? 116 MET A CA  1 
ATOM   551  C  C   . MET A 1 74  ? 21.231 31.083 26.139 1.00 63.72  ? 116 MET A C   1 
ATOM   552  O  O   . MET A 1 74  ? 20.847 30.632 27.224 1.00 63.63  ? 116 MET A O   1 
ATOM   553  C  CB  . MET A 1 74  ? 19.603 29.541 25.027 1.00 63.56  ? 116 MET A CB  1 
ATOM   554  C  CG  . MET A 1 74  ? 19.196 28.631 23.872 1.00 63.83  ? 116 MET A CG  1 
ATOM   555  S  SD  . MET A 1 74  ? 17.755 27.613 24.282 1.00 64.50  ? 116 MET A SD  1 
ATOM   556  C  CE  . MET A 1 74  ? 16.426 28.819 24.190 1.00 64.40  ? 116 MET A CE  1 
ATOM   557  N  N   . PRO A 1 75  ? 21.917 32.244 26.035 1.00 63.96  ? 117 PRO A N   1 
ATOM   558  C  CA  . PRO A 1 75  ? 22.152 33.077 27.221 1.00 64.26  ? 117 PRO A CA  1 
ATOM   559  C  C   . PRO A 1 75  ? 20.830 33.540 27.828 1.00 64.61  ? 117 PRO A C   1 
ATOM   560  O  O   . PRO A 1 75  ? 19.879 33.813 27.090 1.00 64.62  ? 117 PRO A O   1 
ATOM   561  C  CB  . PRO A 1 75  ? 22.928 34.278 26.670 1.00 64.12  ? 117 PRO A CB  1 
ATOM   562  C  CG  . PRO A 1 75  ? 23.487 33.822 25.380 1.00 64.00  ? 117 PRO A CG  1 
ATOM   563  C  CD  . PRO A 1 75  ? 22.501 32.845 24.823 1.00 63.96  ? 117 PRO A CD  1 
ATOM   564  N  N   . SER A 1 76  ? 20.782 33.625 29.157 1.00 65.08  ? 118 SER A N   1 
ATOM   565  C  CA  . SER A 1 76  ? 19.542 33.904 29.888 1.00 65.68  ? 118 SER A CA  1 
ATOM   566  C  C   . SER A 1 76  ? 18.865 35.206 29.486 1.00 66.04  ? 118 SER A C   1 
ATOM   567  O  O   . SER A 1 76  ? 17.639 35.311 29.523 1.00 66.08  ? 118 SER A O   1 
ATOM   568  C  CB  . SER A 1 76  ? 19.789 33.897 31.395 1.00 65.69  ? 118 SER A CB  1 
ATOM   569  O  OG  . SER A 1 76  ? 19.752 32.576 31.906 1.00 66.13  ? 118 SER A OG  1 
ATOM   570  N  N   . SER A 1 77  ? 19.667 36.191 29.101 1.00 66.56  ? 119 SER A N   1 
ATOM   571  C  CA  . SER A 1 77  ? 19.138 37.487 28.717 1.00 67.06  ? 119 SER A CA  1 
ATOM   572  C  C   . SER A 1 77  ? 19.787 38.006 27.439 1.00 67.30  ? 119 SER A C   1 
ATOM   573  O  O   . SER A 1 77  ? 20.893 37.598 27.072 1.00 67.41  ? 119 SER A O   1 
ATOM   574  C  CB  . SER A 1 77  ? 19.305 38.492 29.863 1.00 67.04  ? 119 SER A CB  1 
ATOM   575  O  OG  . SER A 1 77  ? 18.862 39.786 29.490 1.00 67.50  ? 119 SER A OG  1 
ATOM   576  N  N   . THR A 1 78  ? 19.066 38.893 26.760 1.00 67.60  ? 120 THR A N   1 
ATOM   577  C  CA  . THR A 1 78  ? 19.594 39.617 25.614 1.00 67.90  ? 120 THR A CA  1 
ATOM   578  C  C   . THR A 1 78  ? 20.154 40.964 26.087 1.00 67.92  ? 120 THR A C   1 
ATOM   579  O  O   . THR A 1 78  ? 20.192 41.241 27.292 1.00 68.04  ? 120 THR A O   1 
ATOM   580  C  CB  . THR A 1 78  ? 18.506 39.835 24.527 1.00 67.91  ? 120 THR A CB  1 
ATOM   581  O  OG1 . THR A 1 78  ? 17.417 40.591 25.072 1.00 68.14  ? 120 THR A OG1 1 
ATOM   582  C  CG2 . THR A 1 78  ? 17.983 38.495 24.005 1.00 68.11  ? 120 THR A CG2 1 
ATOM   583  N  N   . GLY A 1 79  ? 20.598 41.787 25.140 1.00 67.82  ? 121 GLY A N   1 
ATOM   584  C  CA  . GLY A 1 79  ? 21.065 43.135 25.443 1.00 67.46  ? 121 GLY A CA  1 
ATOM   585  C  C   . GLY A 1 79  ? 22.485 43.218 25.971 1.00 67.18  ? 121 GLY A C   1 
ATOM   586  O  O   . GLY A 1 79  ? 23.355 42.432 25.587 1.00 67.18  ? 121 GLY A O   1 
ATOM   587  N  N   . SER A 1 80  ? 22.695 44.175 26.871 1.00 66.91  ? 122 SER A N   1 
ATOM   588  C  CA  . SER A 1 80  ? 24.022 44.598 27.317 1.00 66.52  ? 122 SER A CA  1 
ATOM   589  C  C   . SER A 1 80  ? 24.576 43.732 28.447 1.00 66.00  ? 122 SER A C   1 
ATOM   590  O  O   . SER A 1 80  ? 25.636 43.121 28.305 1.00 66.32  ? 122 SER A O   1 
ATOM   591  C  CB  . SER A 1 80  ? 23.966 46.077 27.744 1.00 66.63  ? 122 SER A CB  1 
ATOM   592  O  OG  . SER A 1 80  ? 25.208 46.531 28.252 1.00 67.04  ? 122 SER A OG  1 
ATOM   593  N  N   . TYR A 1 81  ? 23.857 43.695 29.565 1.00 65.36  ? 123 TYR A N   1 
ATOM   594  C  CA  . TYR A 1 81  ? 24.260 42.941 30.750 1.00 64.71  ? 123 TYR A CA  1 
ATOM   595  C  C   . TYR A 1 81  ? 23.050 42.713 31.658 1.00 64.38  ? 123 TYR A C   1 
ATOM   596  O  O   . TYR A 1 81  ? 22.023 43.382 31.514 1.00 64.31  ? 123 TYR A O   1 
ATOM   597  C  CB  . TYR A 1 81  ? 25.390 43.664 31.505 1.00 64.58  ? 123 TYR A CB  1 
ATOM   598  C  CG  . TYR A 1 81  ? 24.970 44.928 32.231 1.00 64.57  ? 123 TYR A CG  1 
ATOM   599  C  CD1 . TYR A 1 81  ? 24.855 46.146 31.554 1.00 64.41  ? 123 TYR A CD1 1 
ATOM   600  C  CD2 . TYR A 1 81  ? 24.695 44.908 33.599 1.00 64.37  ? 123 TYR A CD2 1 
ATOM   601  C  CE1 . TYR A 1 81  ? 24.469 47.308 32.220 1.00 64.11  ? 123 TYR A CE1 1 
ATOM   602  C  CE2 . TYR A 1 81  ? 24.305 46.065 34.272 1.00 64.43  ? 123 TYR A CE2 1 
ATOM   603  C  CZ  . TYR A 1 81  ? 24.198 47.257 33.578 1.00 64.27  ? 123 TYR A CZ  1 
ATOM   604  O  OH  . TYR A 1 81  ? 23.819 48.396 34.248 1.00 64.78  ? 123 TYR A OH  1 
ATOM   605  N  N   . TRP A 1 82  ? 23.172 41.769 32.587 1.00 63.93  ? 124 TRP A N   1 
ATOM   606  C  CA  . TRP A 1 82  ? 22.092 41.468 33.524 1.00 63.56  ? 124 TRP A CA  1 
ATOM   607  C  C   . TRP A 1 82  ? 22.622 40.949 34.858 1.00 63.57  ? 124 TRP A C   1 
ATOM   608  O  O   . TRP A 1 82  ? 23.800 40.611 34.976 1.00 63.45  ? 124 TRP A O   1 
ATOM   609  C  CB  . TRP A 1 82  ? 21.097 40.474 32.903 1.00 63.22  ? 124 TRP A CB  1 
ATOM   610  C  CG  . TRP A 1 82  ? 21.636 39.076 32.679 1.00 63.07  ? 124 TRP A CG  1 
ATOM   611  C  CD1 . TRP A 1 82  ? 21.488 38.000 33.508 1.00 62.62  ? 124 TRP A CD1 1 
ATOM   612  C  CD2 . TRP A 1 82  ? 22.387 38.608 31.548 1.00 62.64  ? 124 TRP A CD2 1 
ATOM   613  N  NE1 . TRP A 1 82  ? 22.101 36.897 32.971 1.00 62.47  ? 124 TRP A NE1 1 
ATOM   614  C  CE2 . TRP A 1 82  ? 22.657 37.238 31.766 1.00 62.93  ? 124 TRP A CE2 1 
ATOM   615  C  CE3 . TRP A 1 82  ? 22.852 39.210 30.371 1.00 62.41  ? 124 TRP A CE3 1 
ATOM   616  C  CZ2 . TRP A 1 82  ? 23.385 36.460 30.855 1.00 62.61  ? 124 TRP A CZ2 1 
ATOM   617  C  CZ3 . TRP A 1 82  ? 23.567 38.435 29.463 1.00 62.53  ? 124 TRP A CZ3 1 
ATOM   618  C  CH2 . TRP A 1 82  ? 23.830 37.075 29.714 1.00 62.54  ? 124 TRP A CH2 1 
ATOM   619  N  N   . PHE A 1 83  ? 21.752 40.913 35.864 1.00 63.74  ? 125 PHE A N   1 
ATOM   620  C  CA  . PHE A 1 83  ? 22.067 40.252 37.124 1.00 63.99  ? 125 PHE A CA  1 
ATOM   621  C  C   . PHE A 1 83  ? 21.884 38.751 36.929 1.00 64.10  ? 125 PHE A C   1 
ATOM   622  O  O   . PHE A 1 83  ? 20.857 38.311 36.411 1.00 64.11  ? 125 PHE A O   1 
ATOM   623  C  CB  . PHE A 1 83  ? 21.161 40.748 38.254 1.00 64.09  ? 125 PHE A CB  1 
ATOM   624  C  CG  . PHE A 1 83  ? 21.216 42.236 38.480 1.00 64.38  ? 125 PHE A CG  1 
ATOM   625  C  CD1 . PHE A 1 83  ? 20.096 43.026 38.239 1.00 64.62  ? 125 PHE A CD1 1 
ATOM   626  C  CD2 . PHE A 1 83  ? 22.378 42.846 38.944 1.00 64.52  ? 125 PHE A CD2 1 
ATOM   627  C  CE1 . PHE A 1 83  ? 20.131 44.404 38.451 1.00 64.70  ? 125 PHE A CE1 1 
ATOM   628  C  CE2 . PHE A 1 83  ? 22.423 44.222 39.159 1.00 64.79  ? 125 PHE A CE2 1 
ATOM   629  C  CZ  . PHE A 1 83  ? 21.297 45.003 38.911 1.00 64.61  ? 125 PHE A CZ  1 
ATOM   630  N  N   . CYS A 1 84  ? 22.878 37.969 37.342 1.00 64.30  ? 126 CYS A N   1 
ATOM   631  C  CA  . CYS A 1 84  ? 22.850 36.516 37.146 1.00 64.44  ? 126 CYS A CA  1 
ATOM   632  C  C   . CYS A 1 84  ? 21.857 35.822 38.082 1.00 64.91  ? 126 CYS A C   1 
ATOM   633  O  O   . CYS A 1 84  ? 21.801 34.587 38.139 1.00 65.05  ? 126 CYS A O   1 
ATOM   634  C  CB  . CYS A 1 84  ? 24.248 35.922 37.302 1.00 64.20  ? 126 CYS A CB  1 
ATOM   635  S  SG  . CYS A 1 84  ? 25.552 36.926 36.568 1.00 63.29  ? 126 CYS A SG  1 
ATOM   636  N  N   . ASP A 1 85  ? 21.085 36.631 38.811 1.00 65.27  ? 127 ASP A N   1 
ATOM   637  C  CA  . ASP A 1 85  ? 19.931 36.168 39.584 1.00 65.75  ? 127 ASP A CA  1 
ATOM   638  C  C   . ASP A 1 85  ? 18.819 35.714 38.636 1.00 65.99  ? 127 ASP A C   1 
ATOM   639  O  O   . ASP A 1 85  ? 17.967 34.901 39.002 1.00 66.06  ? 127 ASP A O   1 
ATOM   640  C  CB  . ASP A 1 85  ? 19.400 37.290 40.492 1.00 65.82  ? 127 ASP A CB  1 
ATOM   641  C  CG  . ASP A 1 85  ? 20.427 37.772 41.514 1.00 66.07  ? 127 ASP A CG  1 
ATOM   642  O  OD1 . ASP A 1 85  ? 21.639 37.803 41.203 1.00 66.54  ? 127 ASP A OD1 1 
ATOM   643  O  OD2 . ASP A 1 85  ? 20.013 38.139 42.634 1.00 66.20  ? 127 ASP A OD2 1 
ATOM   644  N  N   . GLU A 1 86  ? 18.834 36.267 37.422 1.00 66.23  ? 128 GLU A N   1 
ATOM   645  C  CA  . GLU A 1 86  ? 17.890 35.907 36.362 1.00 66.50  ? 128 GLU A CA  1 
ATOM   646  C  C   . GLU A 1 86  ? 18.406 34.714 35.549 1.00 66.56  ? 128 GLU A C   1 
ATOM   647  O  O   . GLU A 1 86  ? 17.751 34.260 34.605 1.00 66.68  ? 128 GLU A O   1 
ATOM   648  C  CB  . GLU A 1 86  ? 17.630 37.110 35.447 1.00 66.47  ? 128 GLU A CB  1 
ATOM   649  C  CG  . GLU A 1 86  ? 17.036 38.326 36.159 1.00 66.71  ? 128 GLU A CG  1 
ATOM   650  C  CD  . GLU A 1 86  ? 16.884 39.542 35.255 1.00 66.71  ? 128 GLU A CD  1 
ATOM   651  O  OE1 . GLU A 1 86  ? 17.730 39.744 34.353 1.00 66.50  ? 128 GLU A OE1 1 
ATOM   652  O  OE2 . GLU A 1 86  ? 15.914 40.306 35.459 1.00 66.99  ? 128 GLU A OE2 1 
ATOM   653  N  N   . GLY A 1 87  ? 19.582 34.215 35.926 1.00 66.56  ? 129 GLY A N   1 
ATOM   654  C  CA  . GLY A 1 87  ? 20.171 33.034 35.308 1.00 66.51  ? 129 GLY A CA  1 
ATOM   655  C  C   . GLY A 1 87  ? 21.399 33.346 34.480 1.00 66.45  ? 129 GLY A C   1 
ATOM   656  O  O   . GLY A 1 87  ? 21.668 34.507 34.164 1.00 66.52  ? 129 GLY A O   1 
ATOM   657  N  N   . THR A 1 88  ? 22.142 32.298 34.131 1.00 66.36  ? 130 THR A N   1 
ATOM   658  C  CA  . THR A 1 88  ? 23.303 32.415 33.251 1.00 66.16  ? 130 THR A CA  1 
ATOM   659  C  C   . THR A 1 88  ? 22.923 32.043 31.814 1.00 65.78  ? 130 THR A C   1 
ATOM   660  O  O   . THR A 1 88  ? 22.990 32.885 30.916 1.00 65.76  ? 130 THR A O   1 
ATOM   661  C  CB  . THR A 1 88  ? 24.502 31.590 33.792 1.00 66.38  ? 130 THR A CB  1 
ATOM   662  O  OG1 . THR A 1 88  ? 25.076 32.278 34.914 1.00 67.06  ? 130 THR A OG1 1 
ATOM   663  C  CG2 . THR A 1 88  ? 25.580 31.395 32.733 1.00 66.29  ? 130 THR A CG2 1 
ATOM   664  N  N   . CYS A 1 89  ? 22.516 30.791 31.607 1.00 65.39  ? 131 CYS A N   1 
ATOM   665  C  CA  . CYS A 1 89  ? 22.003 30.337 30.313 1.00 64.93  ? 131 CYS A CA  1 
ATOM   666  C  C   . CYS A 1 89  ? 20.670 29.617 30.502 1.00 64.59  ? 131 CYS A C   1 
ATOM   667  O  O   . CYS A 1 89  ? 20.452 28.970 31.530 1.00 64.59  ? 131 CYS A O   1 
ATOM   668  C  CB  . CYS A 1 89  ? 23.012 29.418 29.602 1.00 64.86  ? 131 CYS A CB  1 
ATOM   669  S  SG  . CYS A 1 89  ? 24.653 30.146 29.292 1.00 65.21  ? 131 CYS A SG  1 
ATOM   670  N  N   . THR A 1 90  ? 19.779 29.749 29.518 1.00 64.14  ? 132 THR A N   1 
ATOM   671  C  CA  . THR A 1 90  ? 18.504 29.025 29.510 1.00 63.57  ? 132 THR A CA  1 
ATOM   672  C  C   . THR A 1 90  ? 18.752 27.532 29.265 1.00 63.30  ? 132 THR A C   1 
ATOM   673  O  O   . THR A 1 90  ? 18.119 26.678 29.894 1.00 63.17  ? 132 THR A O   1 
ATOM   674  C  CB  . THR A 1 90  ? 17.519 29.599 28.455 1.00 63.67  ? 132 THR A CB  1 
ATOM   675  O  OG1 . THR A 1 90  ? 17.332 31.002 28.681 1.00 63.72  ? 132 THR A OG1 1 
ATOM   676  C  CG2 . THR A 1 90  ? 16.162 28.907 28.533 1.00 63.37  ? 132 THR A CG2 1 
ATOM   677  N  N   . ASP A 1 91  ? 19.678 27.235 28.351 1.00 62.87  ? 133 ASP A N   1 
ATOM   678  C  CA  . ASP A 1 91  ? 20.169 25.873 28.132 1.00 62.43  ? 133 ASP A CA  1 
ATOM   679  C  C   . ASP A 1 91  ? 21.317 25.569 29.106 1.00 62.08  ? 133 ASP A C   1 
ATOM   680  O  O   . ASP A 1 91  ? 21.554 26.337 30.043 1.00 61.82  ? 133 ASP A O   1 
ATOM   681  C  CB  . ASP A 1 91  ? 20.595 25.676 26.666 1.00 62.43  ? 133 ASP A CB  1 
ATOM   682  C  CG  . ASP A 1 91  ? 21.748 26.586 26.253 1.00 62.75  ? 133 ASP A CG  1 
ATOM   683  O  OD1 . ASP A 1 91  ? 21.871 27.703 26.796 1.00 62.70  ? 133 ASP A OD1 1 
ATOM   684  O  OD2 . ASP A 1 91  ? 22.536 26.180 25.372 1.00 63.52  ? 133 ASP A OD2 1 
ATOM   685  N  N   . LYS A 1 92  ? 22.018 24.455 28.891 1.00 61.87  ? 134 LYS A N   1 
ATOM   686  C  CA  . LYS A 1 92  ? 23.110 24.046 29.782 1.00 61.97  ? 134 LYS A CA  1 
ATOM   687  C  C   . LYS A 1 92  ? 24.338 24.929 29.641 1.00 61.74  ? 134 LYS A C   1 
ATOM   688  O  O   . LYS A 1 92  ? 24.930 25.024 28.563 1.00 61.80  ? 134 LYS A O   1 
ATOM   689  C  CB  . LYS A 1 92  ? 23.493 22.573 29.572 1.00 61.96  ? 134 LYS A CB  1 
ATOM   690  C  CG  . LYS A 1 92  ? 22.623 21.585 30.346 1.00 63.69  ? 134 LYS A CG  1 
ATOM   691  C  CD  . LYS A 1 92  ? 21.342 21.232 29.591 1.00 65.03  ? 134 LYS A CD  1 
ATOM   692  C  CE  . LYS A 1 92  ? 20.219 20.882 30.543 1.00 66.34  ? 134 LYS A CE  1 
ATOM   693  N  NZ  . LYS A 1 92  ? 19.757 22.082 31.297 1.00 67.65  ? 134 LYS A NZ  1 
ATOM   694  N  N   . ALA A 1 93  ? 24.705 25.580 30.741 1.00 61.52  ? 135 ALA A N   1 
ATOM   695  C  CA  . ALA A 1 93  ? 25.899 26.409 30.794 1.00 61.31  ? 135 ALA A CA  1 
ATOM   696  C  C   . ALA A 1 93  ? 27.124 25.521 30.986 1.00 61.24  ? 135 ALA A C   1 
ATOM   697  O  O   . ALA A 1 93  ? 27.277 24.876 32.023 1.00 61.80  ? 135 ALA A O   1 
ATOM   698  C  CB  . ALA A 1 93  ? 25.784 27.436 31.919 1.00 61.19  ? 135 ALA A CB  1 
ATOM   699  N  N   . ASN A 1 94  ? 27.975 25.468 29.967 1.00 60.89  ? 136 ASN A N   1 
ATOM   700  C  CA  . ASN A 1 94  ? 29.203 24.684 30.015 1.00 60.51  ? 136 ASN A CA  1 
ATOM   701  C  C   . ASN A 1 94  ? 30.366 25.522 30.528 1.00 60.15  ? 136 ASN A C   1 
ATOM   702  O  O   . ASN A 1 94  ? 30.861 26.390 29.821 1.00 59.55  ? 136 ASN A O   1 
ATOM   703  C  CB  . ASN A 1 94  ? 29.527 24.116 28.633 1.00 60.27  ? 136 ASN A CB  1 
ATOM   704  C  CG  . ASN A 1 94  ? 28.476 23.138 28.151 1.00 61.13  ? 136 ASN A CG  1 
ATOM   705  O  OD1 . ASN A 1 94  ? 28.187 22.137 28.814 1.00 60.75  ? 136 ASN A OD1 1 
ATOM   706  N  ND2 . ASN A 1 94  ? 27.897 23.421 26.989 1.00 61.85  ? 136 ASN A ND2 1 
ATOM   707  N  N   . ILE A 1 95  ? 30.788 25.263 31.765 1.00 59.89  ? 137 ILE A N   1 
ATOM   708  C  CA  . ILE A 1 95  ? 31.857 26.042 32.386 1.00 59.72  ? 137 ILE A CA  1 
ATOM   709  C  C   . ILE A 1 95  ? 33.191 25.775 31.692 1.00 59.49  ? 137 ILE A C   1 
ATOM   710  O  O   . ILE A 1 95  ? 33.546 24.626 31.429 1.00 59.67  ? 137 ILE A O   1 
ATOM   711  C  CB  . ILE A 1 95  ? 31.941 25.798 33.917 1.00 59.84  ? 137 ILE A CB  1 
ATOM   712  C  CG1 . ILE A 1 95  ? 32.769 26.895 34.604 1.00 60.10  ? 137 ILE A CG1 1 
ATOM   713  C  CG2 . ILE A 1 95  ? 32.452 24.384 34.228 1.00 60.29  ? 137 ILE A CG2 1 
ATOM   714  C  CD1 . ILE A 1 95  ? 32.674 26.874 36.139 1.00 59.76  ? 137 ILE A CD1 1 
ATOM   715  N  N   . LEU A 1 96  ? 33.897 26.855 31.374 1.00 58.99  ? 138 LEU A N   1 
ATOM   716  C  CA  . LEU A 1 96  ? 35.174 26.794 30.683 1.00 58.82  ? 138 LEU A CA  1 
ATOM   717  C  C   . LEU A 1 96  ? 36.319 27.245 31.571 1.00 58.55  ? 138 LEU A C   1 
ATOM   718  O  O   . LEU A 1 96  ? 37.441 26.757 31.436 1.00 58.35  ? 138 LEU A O   1 
ATOM   719  C  CB  . LEU A 1 96  ? 35.145 27.690 29.431 1.00 58.95  ? 138 LEU A CB  1 
ATOM   720  C  CG  . LEU A 1 96  ? 34.072 27.393 28.378 1.00 59.57  ? 138 LEU A CG  1 
ATOM   721  C  CD1 . LEU A 1 96  ? 34.107 28.405 27.258 1.00 59.47  ? 138 LEU A CD1 1 
ATOM   722  C  CD2 . LEU A 1 96  ? 34.242 25.982 27.831 1.00 60.91  ? 138 LEU A CD2 1 
ATOM   723  N  N   . TYR A 1 97  ? 36.028 28.180 32.477 1.00 58.39  ? 139 TYR A N   1 
ATOM   724  C  CA  . TYR A 1 97  ? 37.062 28.918 33.202 1.00 58.02  ? 139 TYR A CA  1 
ATOM   725  C  C   . TYR A 1 97  ? 36.509 29.509 34.493 1.00 57.93  ? 139 TYR A C   1 
ATOM   726  O  O   . TYR A 1 97  ? 35.403 30.056 34.518 1.00 57.87  ? 139 TYR A O   1 
ATOM   727  C  CB  . TYR A 1 97  ? 37.620 30.035 32.299 1.00 58.07  ? 139 TYR A CB  1 
ATOM   728  C  CG  . TYR A 1 97  ? 38.713 30.892 32.907 1.00 57.71  ? 139 TYR A CG  1 
ATOM   729  C  CD1 . TYR A 1 97  ? 40.014 30.405 33.057 1.00 57.92  ? 139 TYR A CD1 1 
ATOM   730  C  CD2 . TYR A 1 97  ? 38.453 32.196 33.313 1.00 57.29  ? 139 TYR A CD2 1 
ATOM   731  C  CE1 . TYR A 1 97  ? 41.027 31.194 33.612 1.00 57.34  ? 139 TYR A CE1 1 
ATOM   732  C  CE2 . TYR A 1 97  ? 39.463 32.996 33.869 1.00 58.03  ? 139 TYR A CE2 1 
ATOM   733  C  CZ  . TYR A 1 97  ? 40.742 32.486 34.015 1.00 57.63  ? 139 TYR A CZ  1 
ATOM   734  O  OH  . TYR A 1 97  ? 41.735 33.271 34.566 1.00 58.39  ? 139 TYR A OH  1 
ATOM   735  N  N   . ALA A 1 98  ? 37.289 29.384 35.561 1.00 57.52  ? 140 ALA A N   1 
ATOM   736  C  CA  . ALA A 1 98  ? 37.013 30.060 36.812 1.00 57.52  ? 140 ALA A CA  1 
ATOM   737  C  C   . ALA A 1 98  ? 38.231 30.889 37.224 1.00 57.54  ? 140 ALA A C   1 
ATOM   738  O  O   . ALA A 1 98  ? 39.365 30.424 37.131 1.00 57.57  ? 140 ALA A O   1 
ATOM   739  C  CB  . ALA A 1 98  ? 36.669 29.054 37.895 1.00 57.32  ? 140 ALA A CB  1 
ATOM   740  N  N   . TRP A 1 99  ? 37.991 32.119 37.664 1.00 57.46  ? 141 TRP A N   1 
ATOM   741  C  CA  . TRP A 1 99  ? 39.045 32.937 38.240 1.00 57.25  ? 141 TRP A CA  1 
ATOM   742  C  C   . TRP A 1 99  ? 38.674 33.307 39.662 1.00 57.61  ? 141 TRP A C   1 
ATOM   743  O  O   . TRP A 1 99  ? 37.686 34.000 39.886 1.00 57.36  ? 141 TRP A O   1 
ATOM   744  C  CB  . TRP A 1 99  ? 39.288 34.202 37.407 1.00 56.98  ? 141 TRP A CB  1 
ATOM   745  C  CG  . TRP A 1 99  ? 40.448 35.026 37.908 1.00 56.10  ? 141 TRP A CG  1 
ATOM   746  C  CD1 . TRP A 1 99  ? 41.770 34.834 37.625 1.00 55.44  ? 141 TRP A CD1 1 
ATOM   747  C  CD2 . TRP A 1 99  ? 40.387 36.154 38.795 1.00 55.51  ? 141 TRP A CD2 1 
ATOM   748  N  NE1 . TRP A 1 99  ? 42.534 35.778 38.266 1.00 55.73  ? 141 TRP A NE1 1 
ATOM   749  C  CE2 . TRP A 1 99  ? 41.712 36.600 38.992 1.00 55.62  ? 141 TRP A CE2 1 
ATOM   750  C  CE3 . TRP A 1 99  ? 39.341 36.832 39.436 1.00 55.34  ? 141 TRP A CE3 1 
ATOM   751  C  CZ2 . TRP A 1 99  ? 42.024 37.697 39.809 1.00 56.31  ? 141 TRP A CZ2 1 
ATOM   752  C  CZ3 . TRP A 1 99  ? 39.650 37.927 40.250 1.00 56.13  ? 141 TRP A CZ3 1 
ATOM   753  C  CH2 . TRP A 1 99  ? 40.982 38.346 40.428 1.00 56.05  ? 141 TRP A CH2 1 
ATOM   754  N  N   . ALA A 1 100 ? 39.463 32.828 40.619 1.00 58.32  ? 142 ALA A N   1 
ATOM   755  C  CA  . ALA A 1 100 ? 39.311 33.228 42.018 1.00 58.98  ? 142 ALA A CA  1 
ATOM   756  C  C   . ALA A 1 100 ? 40.464 34.131 42.426 1.00 59.54  ? 142 ALA A C   1 
ATOM   757  O  O   . ALA A 1 100 ? 41.607 33.932 41.998 1.00 59.73  ? 142 ALA A O   1 
ATOM   758  C  CB  . ALA A 1 100 ? 39.229 32.018 42.925 1.00 58.87  ? 142 ALA A CB  1 
ATOM   759  N  N   . ARG A 1 101 ? 40.141 35.129 43.244 1.00 60.19  ? 143 ARG A N   1 
ATOM   760  C  CA  . ARG A 1 101 ? 41.091 36.126 43.722 1.00 60.77  ? 143 ARG A CA  1 
ATOM   761  C  C   . ARG A 1 101 ? 42.231 35.480 44.517 1.00 61.06  ? 143 ARG A C   1 
ATOM   762  O  O   . ARG A 1 101 ? 43.408 35.665 44.190 1.00 61.09  ? 143 ARG A O   1 
ATOM   763  C  CB  . ARG A 1 101 ? 40.350 37.160 44.582 1.00 60.76  ? 143 ARG A CB  1 
ATOM   764  C  CG  . ARG A 1 101 ? 41.176 38.372 45.008 1.00 61.04  ? 143 ARG A CG  1 
ATOM   765  C  CD  . ARG A 1 101 ? 40.535 39.100 46.194 1.00 61.28  ? 143 ARG A CD  1 
ATOM   766  N  NE  . ARG A 1 101 ? 39.222 39.661 45.868 1.00 62.31  ? 143 ARG A NE  1 
ATOM   767  C  CZ  . ARG A 1 101 ? 38.463 40.361 46.710 1.00 62.77  ? 143 ARG A CZ  1 
ATOM   768  N  NH1 . ARG A 1 101 ? 38.871 40.604 47.952 1.00 62.83  ? 143 ARG A NH1 1 
ATOM   769  N  NH2 . ARG A 1 101 ? 37.286 40.824 46.307 1.00 62.98  ? 143 ARG A NH2 1 
ATOM   770  N  N   . ASN A 1 102 ? 41.872 34.715 45.547 1.00 61.31  ? 144 ASN A N   1 
ATOM   771  C  CA  . ASN A 1 102 ? 42.854 34.090 46.431 1.00 61.65  ? 144 ASN A CA  1 
ATOM   772  C  C   . ASN A 1 102 ? 43.352 32.723 45.947 1.00 61.87  ? 144 ASN A C   1 
ATOM   773  O  O   . ASN A 1 102 ? 44.077 32.027 46.664 1.00 61.91  ? 144 ASN A O   1 
ATOM   774  C  CB  . ASN A 1 102 ? 42.303 33.993 47.862 1.00 61.66  ? 144 ASN A CB  1 
ATOM   775  C  CG  . ASN A 1 102 ? 42.100 35.357 48.507 1.00 61.74  ? 144 ASN A CG  1 
ATOM   776  O  OD1 . ASN A 1 102 ? 42.965 35.842 49.238 1.00 61.86  ? 144 ASN A OD1 1 
ATOM   777  N  ND2 . ASN A 1 102 ? 40.955 35.983 48.237 1.00 61.30  ? 144 ASN A ND2 1 
ATOM   778  N  N   . ALA A 1 103 ? 42.964 32.349 44.731 1.00 62.23  ? 145 ALA A N   1 
ATOM   779  C  CA  . ALA A 1 103 ? 43.395 31.091 44.124 1.00 62.58  ? 145 ALA A CA  1 
ATOM   780  C  C   . ALA A 1 103 ? 43.613 31.272 42.625 1.00 62.88  ? 145 ALA A C   1 
ATOM   781  O  O   . ALA A 1 103 ? 42.693 31.038 41.837 1.00 62.98  ? 145 ALA A O   1 
ATOM   782  C  CB  . ALA A 1 103 ? 42.374 29.988 44.392 1.00 62.58  ? 145 ALA A CB  1 
ATOM   783  N  N   . PRO A 1 104 ? 44.826 31.710 42.226 1.00 63.08  ? 146 PRO A N   1 
ATOM   784  C  CA  . PRO A 1 104 ? 45.147 31.965 40.814 1.00 63.12  ? 146 PRO A CA  1 
ATOM   785  C  C   . PRO A 1 104 ? 45.000 30.721 39.931 1.00 63.22  ? 146 PRO A C   1 
ATOM   786  O  O   . PRO A 1 104 ? 45.367 29.618 40.354 1.00 63.04  ? 146 PRO A O   1 
ATOM   787  C  CB  . PRO A 1 104 ? 46.610 32.425 40.864 1.00 63.13  ? 146 PRO A CB  1 
ATOM   788  C  CG  . PRO A 1 104 ? 46.799 32.932 42.258 1.00 63.24  ? 146 PRO A CG  1 
ATOM   789  C  CD  . PRO A 1 104 ? 45.970 32.019 43.103 1.00 63.09  ? 146 PRO A CD  1 
ATOM   790  N  N   . PRO A 1 105 ? 44.470 30.897 38.702 1.00 63.34  ? 147 PRO A N   1 
ATOM   791  C  CA  . PRO A 1 105 ? 44.137 29.764 37.839 1.00 63.39  ? 147 PRO A CA  1 
ATOM   792  C  C   . PRO A 1 105 ? 45.362 29.002 37.339 1.00 63.49  ? 147 PRO A C   1 
ATOM   793  O  O   . PRO A 1 105 ? 46.470 29.544 37.318 1.00 63.60  ? 147 PRO A O   1 
ATOM   794  C  CB  . PRO A 1 105 ? 43.406 30.423 36.667 1.00 63.43  ? 147 PRO A CB  1 
ATOM   795  C  CG  . PRO A 1 105 ? 43.951 31.796 36.617 1.00 63.44  ? 147 PRO A CG  1 
ATOM   796  C  CD  . PRO A 1 105 ? 44.162 32.184 38.052 1.00 63.32  ? 147 PRO A CD  1 
ATOM   797  N  N   . THR A 1 106 ? 45.146 27.746 36.966 1.00 63.45  ? 148 THR A N   1 
ATOM   798  C  CA  . THR A 1 106 ? 46.174 26.912 36.366 1.00 63.32  ? 148 THR A CA  1 
ATOM   799  C  C   . THR A 1 106 ? 45.890 26.858 34.869 1.00 63.32  ? 148 THR A C   1 
ATOM   800  O  O   . THR A 1 106 ? 44.734 26.856 34.453 1.00 63.57  ? 148 THR A O   1 
ATOM   801  C  CB  . THR A 1 106 ? 46.176 25.493 36.998 1.00 63.49  ? 148 THR A CB  1 
ATOM   802  O  OG1 . THR A 1 106 ? 46.447 25.596 38.405 1.00 62.98  ? 148 THR A OG1 1 
ATOM   803  C  CG2 . THR A 1 106 ? 47.225 24.583 36.347 1.00 62.99  ? 148 THR A CG2 1 
ATOM   804  N  N   . ARG A 1 107 ? 46.945 26.843 34.061 1.00 63.20  ? 149 ARG A N   1 
ATOM   805  C  CA  . ARG A 1 107 ? 46.807 26.871 32.603 1.00 62.97  ? 149 ARG A CA  1 
ATOM   806  C  C   . ARG A 1 107 ? 46.284 25.538 32.050 1.00 61.92  ? 149 ARG A C   1 
ATOM   807  O  O   . ARG A 1 107 ? 46.439 24.492 32.679 1.00 61.83  ? 149 ARG A O   1 
ATOM   808  C  CB  . ARG A 1 107 ? 48.158 27.212 31.965 1.00 63.43  ? 149 ARG A CB  1 
ATOM   809  C  CG  . ARG A 1 107 ? 48.048 28.014 30.682 1.00 66.19  ? 149 ARG A CG  1 
ATOM   810  C  CD  . ARG A 1 107 ? 49.352 28.006 29.892 1.00 70.22  ? 149 ARG A CD  1 
ATOM   811  N  NE  . ARG A 1 107 ? 49.335 28.987 28.802 1.00 72.70  ? 149 ARG A NE  1 
ATOM   812  C  CZ  . ARG A 1 107 ? 50.213 29.979 28.667 1.00 74.03  ? 149 ARG A CZ  1 
ATOM   813  N  NH1 . ARG A 1 107 ? 51.200 30.125 29.543 1.00 74.56  ? 149 ARG A NH1 1 
ATOM   814  N  NH2 . ARG A 1 107 ? 50.114 30.820 27.644 1.00 74.49  ? 149 ARG A NH2 1 
ATOM   815  N  N   . LEU A 1 108 ? 45.650 25.587 30.881 1.00 60.96  ? 150 LEU A N   1 
ATOM   816  C  CA  . LEU A 1 108 ? 45.352 24.373 30.127 1.00 59.81  ? 150 LEU A CA  1 
ATOM   817  C  C   . LEU A 1 108 ? 46.663 23.711 29.714 1.00 59.38  ? 150 LEU A C   1 
ATOM   818  O  O   . LEU A 1 108 ? 47.616 24.408 29.341 1.00 59.18  ? 150 LEU A O   1 
ATOM   819  C  CB  . LEU A 1 108 ? 44.529 24.686 28.878 1.00 59.52  ? 150 LEU A CB  1 
ATOM   820  C  CG  . LEU A 1 108 ? 43.034 24.999 29.006 1.00 58.47  ? 150 LEU A CG  1 
ATOM   821  C  CD1 . LEU A 1 108 ? 42.512 25.507 27.676 1.00 56.88  ? 150 LEU A CD1 1 
ATOM   822  C  CD2 . LEU A 1 108 ? 42.225 23.796 29.476 1.00 56.82  ? 150 LEU A CD2 1 
ATOM   823  N  N   . PRO A 1 109 ? 46.731 22.366 29.800 1.00 58.73  ? 151 PRO A N   1 
ATOM   824  C  CA  . PRO A 1 109 ? 47.905 21.677 29.261 1.00 58.48  ? 151 PRO A CA  1 
ATOM   825  C  C   . PRO A 1 109 ? 48.046 21.981 27.773 1.00 58.52  ? 151 PRO A C   1 
ATOM   826  O  O   . PRO A 1 109 ? 47.037 22.131 27.080 1.00 58.34  ? 151 PRO A O   1 
ATOM   827  C  CB  . PRO A 1 109 ? 47.588 20.198 29.496 1.00 58.38  ? 151 PRO A CB  1 
ATOM   828  C  CG  . PRO A 1 109 ? 46.590 20.193 30.626 1.00 58.37  ? 151 PRO A CG  1 
ATOM   829  C  CD  . PRO A 1 109 ? 45.766 21.429 30.406 1.00 58.59  ? 151 PRO A CD  1 
ATOM   830  N  N   . LYS A 1 110 ? 49.279 22.116 27.290 1.00 58.45  ? 152 LYS A N   1 
ATOM   831  C  CA  . LYS A 1 110 ? 49.491 22.405 25.875 1.00 58.63  ? 152 LYS A CA  1 
ATOM   832  C  C   . LYS A 1 110 ? 48.938 21.261 25.022 1.00 58.20  ? 152 LYS A C   1 
ATOM   833  O  O   . LYS A 1 110 ? 49.051 20.092 25.396 1.00 58.21  ? 152 LYS A O   1 
ATOM   834  C  CB  . LYS A 1 110 ? 50.970 22.656 25.558 1.00 58.97  ? 152 LYS A CB  1 
ATOM   835  C  CG  . LYS A 1 110 ? 51.182 23.463 24.269 1.00 60.11  ? 152 LYS A CG  1 
ATOM   836  C  CD  . LYS A 1 110 ? 52.604 23.302 23.721 1.00 62.00  ? 152 LYS A CD  1 
ATOM   837  C  CE  . LYS A 1 110 ? 52.752 23.974 22.356 1.00 62.49  ? 152 LYS A CE  1 
ATOM   838  N  NZ  . LYS A 1 110 ? 54.030 23.590 21.681 1.00 63.09  ? 152 LYS A NZ  1 
ATOM   839  N  N   . GLY A 1 111 ? 48.323 21.616 23.896 1.00 57.58  ? 153 GLY A N   1 
ATOM   840  C  CA  . GLY A 1 111 ? 47.653 20.647 23.036 1.00 57.11  ? 153 GLY A CA  1 
ATOM   841  C  C   . GLY A 1 111 ? 46.209 20.375 23.428 1.00 56.73  ? 153 GLY A C   1 
ATOM   842  O  O   . GLY A 1 111 ? 45.511 19.641 22.733 1.00 56.59  ? 153 GLY A O   1 
ATOM   843  N  N   . VAL A 1 112 ? 45.769 20.949 24.550 1.00 56.51  ? 154 VAL A N   1 
ATOM   844  C  CA  . VAL A 1 112 ? 44.385 20.813 25.012 1.00 56.35  ? 154 VAL A CA  1 
ATOM   845  C  C   . VAL A 1 112 ? 43.573 22.069 24.686 1.00 56.68  ? 154 VAL A C   1 
ATOM   846  O  O   . VAL A 1 112 ? 43.997 23.193 24.977 1.00 56.72  ? 154 VAL A O   1 
ATOM   847  C  CB  . VAL A 1 112 ? 44.295 20.497 26.541 1.00 56.30  ? 154 VAL A CB  1 
ATOM   848  C  CG1 . VAL A 1 112 ? 42.849 20.421 27.001 1.00 55.92  ? 154 VAL A CG1 1 
ATOM   849  C  CG2 . VAL A 1 112 ? 45.008 19.193 26.883 1.00 55.47  ? 154 VAL A CG2 1 
ATOM   850  N  N   . GLY A 1 113 ? 42.409 21.871 24.070 1.00 56.92  ? 155 GLY A N   1 
ATOM   851  C  CA  . GLY A 1 113 ? 41.452 22.957 23.850 1.00 56.79  ? 155 GLY A CA  1 
ATOM   852  C  C   . GLY A 1 113 ? 40.008 22.513 23.993 1.00 56.96  ? 155 GLY A C   1 
ATOM   853  O  O   . GLY A 1 113 ? 39.699 21.340 23.799 1.00 56.52  ? 155 GLY A O   1 
ATOM   854  N  N   . PHE A 1 114 ? 39.132 23.450 24.357 1.00 57.31  ? 156 PHE A N   1 
ATOM   855  C  CA  . PHE A 1 114 ? 37.684 23.242 24.299 1.00 57.99  ? 156 PHE A CA  1 
ATOM   856  C  C   . PHE A 1 114 ? 37.241 23.478 22.878 1.00 58.52  ? 156 PHE A C   1 
ATOM   857  O  O   . PHE A 1 114 ? 37.674 24.441 22.259 1.00 58.59  ? 156 PHE A O   1 
ATOM   858  C  CB  . PHE A 1 114 ? 36.927 24.252 25.170 1.00 57.53  ? 156 PHE A CB  1 
ATOM   859  C  CG  . PHE A 1 114 ? 37.090 24.040 26.646 1.00 58.06  ? 156 PHE A CG  1 
ATOM   860  C  CD1 . PHE A 1 114 ? 36.260 23.149 27.330 1.00 57.47  ? 156 PHE A CD1 1 
ATOM   861  C  CD2 . PHE A 1 114 ? 38.056 24.748 27.359 1.00 57.03  ? 156 PHE A CD2 1 
ATOM   862  C  CE1 . PHE A 1 114 ? 36.400 22.955 28.707 1.00 57.75  ? 156 PHE A CE1 1 
ATOM   863  C  CE2 . PHE A 1 114 ? 38.200 24.563 28.734 1.00 57.92  ? 156 PHE A CE2 1 
ATOM   864  C  CZ  . PHE A 1 114 ? 37.372 23.662 29.407 1.00 57.85  ? 156 PHE A CZ  1 
ATOM   865  N  N   . ARG A 1 115 ? 36.356 22.628 22.367 1.00 59.25  ? 157 ARG A N   1 
ATOM   866  C  CA  . ARG A 1 115 ? 35.769 22.880 21.058 1.00 60.25  ? 157 ARG A CA  1 
ATOM   867  C  C   . ARG A 1 115 ? 34.490 23.720 21.186 1.00 59.75  ? 157 ARG A C   1 
ATOM   868  O  O   . ARG A 1 115 ? 33.612 23.424 21.999 1.00 59.66  ? 157 ARG A O   1 
ATOM   869  C  CB  . ARG A 1 115 ? 35.563 21.577 20.265 1.00 60.20  ? 157 ARG A CB  1 
ATOM   870  C  CG  . ARG A 1 115 ? 34.236 20.870 20.456 1.00 61.73  ? 157 ARG A CG  1 
ATOM   871  C  CD  . ARG A 1 115 ? 34.253 19.459 19.828 1.00 62.12  ? 157 ARG A CD  1 
ATOM   872  N  NE  . ARG A 1 115 ? 35.010 19.418 18.578 1.00 64.83  ? 157 ARG A NE  1 
ATOM   873  C  CZ  . ARG A 1 115 ? 35.776 18.399 18.184 1.00 65.68  ? 157 ARG A CZ  1 
ATOM   874  N  NH1 . ARG A 1 115 ? 35.899 17.309 18.937 1.00 64.59  ? 157 ARG A NH1 1 
ATOM   875  N  NH2 . ARG A 1 115 ? 36.427 18.476 17.027 1.00 65.67  ? 157 ARG A NH2 1 
ATOM   876  N  N   . VAL A 1 116 ? 34.424 24.789 20.394 1.00 59.65  ? 158 VAL A N   1 
ATOM   877  C  CA  . VAL A 1 116 ? 33.292 25.717 20.399 1.00 59.23  ? 158 VAL A CA  1 
ATOM   878  C  C   . VAL A 1 116 ? 32.844 25.992 18.966 1.00 58.93  ? 158 VAL A C   1 
ATOM   879  O  O   . VAL A 1 116 ? 33.526 25.605 18.017 1.00 58.89  ? 158 VAL A O   1 
ATOM   880  C  CB  . VAL A 1 116 ? 33.634 27.055 21.137 1.00 59.44  ? 158 VAL A CB  1 
ATOM   881  C  CG1 . VAL A 1 116 ? 33.705 26.848 22.653 1.00 59.35  ? 158 VAL A CG1 1 
ATOM   882  C  CG2 . VAL A 1 116 ? 34.926 27.655 20.620 1.00 59.06  ? 158 VAL A CG2 1 
ATOM   883  N  N   . GLY A 1 117 ? 31.695 26.647 18.810 1.00 58.84  ? 159 GLY A N   1 
ATOM   884  C  CA  . GLY A 1 117 ? 31.177 27.003 17.484 1.00 58.57  ? 159 GLY A CA  1 
ATOM   885  C  C   . GLY A 1 117 ? 30.835 25.802 16.618 1.00 58.47  ? 159 GLY A C   1 
ATOM   886  O  O   . GLY A 1 117 ? 30.674 24.692 17.119 1.00 58.48  ? 159 GLY A O   1 
ATOM   887  N  N   . GLY A 1 118 ? 30.730 26.021 15.313 1.00 58.48  ? 160 GLY A N   1 
ATOM   888  C  CA  . GLY A 1 118 ? 30.349 24.960 14.385 1.00 58.60  ? 160 GLY A CA  1 
ATOM   889  C  C   . GLY A 1 118 ? 28.921 24.472 14.577 1.00 58.83  ? 160 GLY A C   1 
ATOM   890  O  O   . GLY A 1 118 ? 28.076 25.188 15.119 1.00 58.45  ? 160 GLY A O   1 
ATOM   891  N  N   . GLU A 1 119 ? 28.673 23.241 14.130 1.00 59.24  ? 161 GLU A N   1 
ATOM   892  C  CA  . GLU A 1 119 ? 27.361 22.592 14.207 1.00 59.74  ? 161 GLU A CA  1 
ATOM   893  C  C   . GLU A 1 119 ? 26.888 22.333 15.640 1.00 59.65  ? 161 GLU A C   1 
ATOM   894  O  O   . GLU A 1 119 ? 25.699 22.476 15.934 1.00 59.92  ? 161 GLU A O   1 
ATOM   895  C  CB  . GLU A 1 119 ? 27.384 21.252 13.455 1.00 59.66  ? 161 GLU A CB  1 
ATOM   896  C  CG  . GLU A 1 119 ? 27.549 21.336 11.940 1.00 60.51  ? 161 GLU A CG  1 
ATOM   897  C  CD  . GLU A 1 119 ? 27.602 19.958 11.278 1.00 60.70  ? 161 GLU A CD  1 
ATOM   898  O  OE1 . GLU A 1 119 ? 28.586 19.213 11.512 1.00 62.56  ? 161 GLU A OE1 1 
ATOM   899  O  OE2 . GLU A 1 119 ? 26.659 19.618 10.527 1.00 60.82  ? 161 GLU A OE2 1 
ATOM   900  N  N   . THR A 1 120 ? 27.814 21.944 16.518 1.00 59.51  ? 162 THR A N   1 
ATOM   901  C  CA  . THR A 1 120 ? 27.461 21.407 17.837 1.00 59.33  ? 162 THR A CA  1 
ATOM   902  C  C   . THR A 1 120 ? 28.092 22.147 19.017 1.00 59.24  ? 162 THR A C   1 
ATOM   903  O  O   . THR A 1 120 ? 27.682 21.955 20.167 1.00 59.52  ? 162 THR A O   1 
ATOM   904  C  CB  . THR A 1 120 ? 27.856 19.913 17.960 1.00 59.37  ? 162 THR A CB  1 
ATOM   905  O  OG1 . THR A 1 120 ? 29.283 19.788 17.879 1.00 59.41  ? 162 THR A OG1 1 
ATOM   906  C  CG2 . THR A 1 120 ? 27.204 19.075 16.866 1.00 59.12  ? 162 THR A CG2 1 
ATOM   907  N  N   . GLY A 1 121 ? 29.091 22.979 18.743 1.00 58.74  ? 163 GLY A N   1 
ATOM   908  C  CA  . GLY A 1 121 ? 29.773 23.714 19.802 1.00 58.44  ? 163 GLY A CA  1 
ATOM   909  C  C   . GLY A 1 121 ? 28.953 24.874 20.334 1.00 58.12  ? 163 GLY A C   1 
ATOM   910  O  O   . GLY A 1 121 ? 27.938 25.240 19.749 1.00 57.98  ? 163 GLY A O   1 
ATOM   911  N  N   . SER A 1 122 ? 29.389 25.443 21.456 1.00 57.88  ? 164 SER A N   1 
ATOM   912  C  CA  . SER A 1 122 ? 28.762 26.640 22.011 1.00 57.95  ? 164 SER A CA  1 
ATOM   913  C  C   . SER A 1 122 ? 28.842 27.799 21.032 1.00 57.76  ? 164 SER A C   1 
ATOM   914  O  O   . SER A 1 122 ? 29.872 28.010 20.391 1.00 57.66  ? 164 SER A O   1 
ATOM   915  C  CB  . SER A 1 122 ? 29.429 27.043 23.313 1.00 57.57  ? 164 SER A CB  1 
ATOM   916  O  OG  . SER A 1 122 ? 29.198 26.056 24.288 1.00 59.66  ? 164 SER A OG  1 
ATOM   917  N  N   . LYS A 1 123 ? 27.747 28.541 20.925 1.00 57.68  ? 165 LYS A N   1 
ATOM   918  C  CA  . LYS A 1 123 ? 27.682 29.690 20.029 1.00 57.74  ? 165 LYS A CA  1 
ATOM   919  C  C   . LYS A 1 123 ? 27.921 31.012 20.768 1.00 57.37  ? 165 LYS A C   1 
ATOM   920  O  O   . LYS A 1 123 ? 28.188 32.036 20.136 1.00 57.45  ? 165 LYS A O   1 
ATOM   921  C  CB  . LYS A 1 123 ? 26.343 29.715 19.284 1.00 57.59  ? 165 LYS A CB  1 
ATOM   922  C  CG  . LYS A 1 123 ? 25.960 28.393 18.584 1.00 58.97  ? 165 LYS A CG  1 
ATOM   923  C  CD  . LYS A 1 123 ? 27.013 27.901 17.567 1.00 59.66  ? 165 LYS A CD  1 
ATOM   924  C  CE  . LYS A 1 123 ? 26.823 28.536 16.188 1.00 60.48  ? 165 LYS A CE  1 
ATOM   925  N  NZ  . LYS A 1 123 ? 27.811 28.007 15.200 1.00 60.46  ? 165 LYS A NZ  1 
ATOM   926  N  N   . TYR A 1 124 ? 27.823 30.976 22.097 1.00 56.84  ? 166 TYR A N   1 
ATOM   927  C  CA  . TYR A 1 124 ? 27.958 32.168 22.940 1.00 56.58  ? 166 TYR A CA  1 
ATOM   928  C  C   . TYR A 1 124 ? 28.911 31.915 24.096 1.00 56.66  ? 166 TYR A C   1 
ATOM   929  O  O   . TYR A 1 124 ? 29.005 30.799 24.587 1.00 56.65  ? 166 TYR A O   1 
ATOM   930  C  CB  . TYR A 1 124 ? 26.610 32.571 23.548 1.00 56.09  ? 166 TYR A CB  1 
ATOM   931  C  CG  . TYR A 1 124 ? 25.588 33.110 22.580 1.00 55.87  ? 166 TYR A CG  1 
ATOM   932  C  CD1 . TYR A 1 124 ? 24.733 32.250 21.887 1.00 55.76  ? 166 TYR A CD1 1 
ATOM   933  C  CD2 . TYR A 1 124 ? 25.446 34.484 22.383 1.00 54.96  ? 166 TYR A CD2 1 
ATOM   934  C  CE1 . TYR A 1 124 ? 23.775 32.748 20.998 1.00 55.47  ? 166 TYR A CE1 1 
ATOM   935  C  CE2 . TYR A 1 124 ? 24.496 34.992 21.500 1.00 55.15  ? 166 TYR A CE2 1 
ATOM   936  C  CZ  . TYR A 1 124 ? 23.665 34.120 20.809 1.00 55.58  ? 166 TYR A CZ  1 
ATOM   937  O  OH  . TYR A 1 124 ? 22.720 34.622 19.936 1.00 55.89  ? 166 TYR A OH  1 
ATOM   938  N  N   . PHE A 1 125 ? 29.600 32.967 24.528 1.00 56.69  ? 167 PHE A N   1 
ATOM   939  C  CA  . PHE A 1 125 ? 30.258 32.975 25.824 1.00 56.66  ? 167 PHE A CA  1 
ATOM   940  C  C   . PHE A 1 125 ? 29.409 33.777 26.791 1.00 56.64  ? 167 PHE A C   1 
ATOM   941  O  O   . PHE A 1 125 ? 28.812 34.782 26.416 1.00 56.23  ? 167 PHE A O   1 
ATOM   942  C  CB  . PHE A 1 125 ? 31.650 33.603 25.748 1.00 56.99  ? 167 PHE A CB  1 
ATOM   943  C  CG  . PHE A 1 125 ? 32.660 32.766 25.017 1.00 57.34  ? 167 PHE A CG  1 
ATOM   944  C  CD1 . PHE A 1 125 ? 32.991 31.496 25.468 1.00 58.05  ? 167 PHE A CD1 1 
ATOM   945  C  CD2 . PHE A 1 125 ? 33.282 33.252 23.883 1.00 57.64  ? 167 PHE A CD2 1 
ATOM   946  C  CE1 . PHE A 1 125 ? 33.932 30.722 24.786 1.00 58.77  ? 167 PHE A CE1 1 
ATOM   947  C  CE2 . PHE A 1 125 ? 34.226 32.492 23.208 1.00 59.58  ? 167 PHE A CE2 1 
ATOM   948  C  CZ  . PHE A 1 125 ? 34.553 31.222 23.664 1.00 58.69  ? 167 PHE A CZ  1 
ATOM   949  N  N   . VAL A 1 126 ? 29.343 33.311 28.033 1.00 56.79  ? 168 VAL A N   1 
ATOM   950  C  CA  . VAL A 1 126 ? 28.686 34.052 29.096 1.00 56.69  ? 168 VAL A CA  1 
ATOM   951  C  C   . VAL A 1 126 ? 29.683 34.251 30.226 1.00 56.69  ? 168 VAL A C   1 
ATOM   952  O  O   . VAL A 1 126 ? 30.233 33.285 30.774 1.00 56.66  ? 168 VAL A O   1 
ATOM   953  C  CB  . VAL A 1 126 ? 27.394 33.363 29.600 1.00 56.83  ? 168 VAL A CB  1 
ATOM   954  C  CG1 . VAL A 1 126 ? 26.785 34.145 30.762 1.00 56.33  ? 168 VAL A CG1 1 
ATOM   955  C  CG2 . VAL A 1 126 ? 26.382 33.232 28.468 1.00 57.01  ? 168 VAL A CG2 1 
ATOM   956  N  N   . LEU A 1 127 ? 29.922 35.519 30.543 1.00 56.63  ? 169 LEU A N   1 
ATOM   957  C  CA  . LEU A 1 127 ? 30.841 35.906 31.590 1.00 56.33  ? 169 LEU A CA  1 
ATOM   958  C  C   . LEU A 1 127 ? 30.067 36.312 32.833 1.00 56.75  ? 169 LEU A C   1 
ATOM   959  O  O   . LEU A 1 127 ? 29.184 37.161 32.773 1.00 56.58  ? 169 LEU A O   1 
ATOM   960  C  CB  . LEU A 1 127 ? 31.717 37.070 31.117 1.00 56.37  ? 169 LEU A CB  1 
ATOM   961  C  CG  . LEU A 1 127 ? 32.550 37.811 32.169 1.00 55.63  ? 169 LEU A CG  1 
ATOM   962  C  CD1 . LEU A 1 127 ? 33.706 36.949 32.666 1.00 53.92  ? 169 LEU A CD1 1 
ATOM   963  C  CD2 . LEU A 1 127 ? 33.038 39.151 31.625 1.00 55.66  ? 169 LEU A CD2 1 
ATOM   964  N  N   . GLN A 1 128 ? 30.414 35.696 33.955 1.00 56.99  ? 170 GLN A N   1 
ATOM   965  C  CA  . GLN A 1 128 ? 29.856 36.058 35.242 1.00 57.34  ? 170 GLN A CA  1 
ATOM   966  C  C   . GLN A 1 128 ? 30.938 36.707 36.099 1.00 57.41  ? 170 GLN A C   1 
ATOM   967  O  O   . GLN A 1 128 ? 31.983 36.103 36.351 1.00 57.32  ? 170 GLN A O   1 
ATOM   968  C  CB  . GLN A 1 128 ? 29.297 34.820 35.937 1.00 57.35  ? 170 GLN A CB  1 
ATOM   969  C  CG  . GLN A 1 128 ? 28.510 35.123 37.193 1.00 58.34  ? 170 GLN A CG  1 
ATOM   970  C  CD  . GLN A 1 128 ? 27.983 33.871 37.850 1.00 59.83  ? 170 GLN A CD  1 
ATOM   971  O  OE1 . GLN A 1 128 ? 28.731 33.128 38.485 1.00 60.88  ? 170 GLN A OE1 1 
ATOM   972  N  NE2 . GLN A 1 128 ? 26.685 33.627 37.703 1.00 59.78  ? 170 GLN A NE2 1 
ATOM   973  N  N   . VAL A 1 129 ? 30.688 37.940 36.537 1.00 57.55  ? 171 VAL A N   1 
ATOM   974  C  CA  . VAL A 1 129 ? 31.632 38.653 37.397 1.00 57.66  ? 171 VAL A CA  1 
ATOM   975  C  C   . VAL A 1 129 ? 31.011 38.949 38.759 1.00 57.98  ? 171 VAL A C   1 
ATOM   976  O  O   . VAL A 1 129 ? 29.990 39.636 38.865 1.00 57.85  ? 171 VAL A O   1 
ATOM   977  C  CB  . VAL A 1 129 ? 32.179 39.960 36.749 1.00 57.60  ? 171 VAL A CB  1 
ATOM   978  C  CG1 . VAL A 1 129 ? 33.220 40.611 37.657 1.00 57.05  ? 171 VAL A CG1 1 
ATOM   979  C  CG2 . VAL A 1 129 ? 32.792 39.677 35.386 1.00 57.17  ? 171 VAL A CG2 1 
ATOM   980  N  N   . HIS A 1 130 ? 31.647 38.412 39.794 1.00 58.50  ? 172 HIS A N   1 
ATOM   981  C  CA  . HIS A 1 130 ? 31.216 38.600 41.169 1.00 59.22  ? 172 HIS A CA  1 
ATOM   982  C  C   . HIS A 1 130 ? 32.029 39.718 41.817 1.00 59.24  ? 172 HIS A C   1 
ATOM   983  O  O   . HIS A 1 130 ? 33.236 39.584 42.029 1.00 59.12  ? 172 HIS A O   1 
ATOM   984  C  CB  . HIS A 1 130 ? 31.350 37.275 41.931 1.00 59.50  ? 172 HIS A CB  1 
ATOM   985  C  CG  . HIS A 1 130 ? 31.032 37.362 43.394 1.00 60.97  ? 172 HIS A CG  1 
ATOM   986  N  ND1 . HIS A 1 130 ? 31.697 36.611 44.340 1.00 63.74  ? 172 HIS A ND1 1 
ATOM   987  C  CD2 . HIS A 1 130 ? 30.126 38.107 44.072 1.00 61.63  ? 172 HIS A CD2 1 
ATOM   988  C  CE1 . HIS A 1 130 ? 31.212 36.890 45.538 1.00 62.64  ? 172 HIS A CE1 1 
ATOM   989  N  NE2 . HIS A 1 130 ? 30.260 37.795 45.403 1.00 62.23  ? 172 HIS A NE2 1 
ATOM   990  N  N   . TYR A 1 131 ? 31.359 40.830 42.107 1.00 59.56  ? 173 TYR A N   1 
ATOM   991  C  CA  . TYR A 1 131 ? 31.996 41.970 42.762 1.00 59.90  ? 173 TYR A CA  1 
ATOM   992  C  C   . TYR A 1 131 ? 31.867 41.862 44.276 1.00 60.32  ? 173 TYR A C   1 
ATOM   993  O  O   . TYR A 1 131 ? 30.778 41.629 44.800 1.00 60.37  ? 173 TYR A O   1 
ATOM   994  C  CB  . TYR A 1 131 ? 31.406 43.287 42.255 1.00 59.73  ? 173 TYR A CB  1 
ATOM   995  C  CG  . TYR A 1 131 ? 31.708 43.556 40.801 1.00 59.56  ? 173 TYR A CG  1 
ATOM   996  C  CD1 . TYR A 1 131 ? 32.891 44.189 40.421 1.00 59.52  ? 173 TYR A CD1 1 
ATOM   997  C  CD2 . TYR A 1 131 ? 30.818 43.165 39.800 1.00 59.22  ? 173 TYR A CD2 1 
ATOM   998  C  CE1 . TYR A 1 131 ? 33.179 44.428 39.079 1.00 59.41  ? 173 TYR A CE1 1 
ATOM   999  C  CE2 . TYR A 1 131 ? 31.096 43.402 38.458 1.00 59.20  ? 173 TYR A CE2 1 
ATOM   1000 C  CZ  . TYR A 1 131 ? 32.276 44.033 38.105 1.00 59.37  ? 173 TYR A CZ  1 
ATOM   1001 O  OH  . TYR A 1 131 ? 32.551 44.262 36.778 1.00 59.77  ? 173 TYR A OH  1 
ATOM   1002 N  N   . GLY A 1 132 ? 32.990 42.025 44.969 1.00 60.88  ? 174 GLY A N   1 
ATOM   1003 C  CA  . GLY A 1 132 ? 33.039 41.860 46.418 1.00 61.51  ? 174 GLY A CA  1 
ATOM   1004 C  C   . GLY A 1 132 ? 32.869 43.144 47.203 1.00 61.93  ? 174 GLY A C   1 
ATOM   1005 O  O   . GLY A 1 132 ? 31.879 43.312 47.918 1.00 62.05  ? 174 GLY A O   1 
ATOM   1006 N  N   . ASP A 1 133 ? 33.833 44.052 47.062 1.00 62.36  ? 175 ASP A N   1 
ATOM   1007 C  CA  . ASP A 1 133 ? 33.898 45.259 47.891 1.00 62.75  ? 175 ASP A CA  1 
ATOM   1008 C  C   . ASP A 1 133 ? 33.155 46.479 47.347 1.00 63.00  ? 175 ASP A C   1 
ATOM   1009 O  O   . ASP A 1 133 ? 32.586 47.250 48.127 1.00 63.06  ? 175 ASP A O   1 
ATOM   1010 C  CB  . ASP A 1 133 ? 35.355 45.630 48.191 1.00 62.85  ? 175 ASP A CB  1 
ATOM   1011 C  CG  . ASP A 1 133 ? 35.917 44.877 49.383 1.00 62.99  ? 175 ASP A CG  1 
ATOM   1012 O  OD1 . ASP A 1 133 ? 36.146 45.516 50.435 1.00 62.30  ? 175 ASP A OD1 1 
ATOM   1013 O  OD2 . ASP A 1 133 ? 36.121 43.646 49.271 1.00 63.06  ? 175 ASP A OD2 1 
ATOM   1014 N  N   . ILE A 1 134 ? 33.189 46.661 46.024 1.00 63.24  ? 176 ILE A N   1 
ATOM   1015 C  CA  . ILE A 1 134 ? 32.582 47.821 45.328 1.00 63.56  ? 176 ILE A CA  1 
ATOM   1016 C  C   . ILE A 1 134 ? 32.887 49.193 45.969 1.00 63.81  ? 176 ILE A C   1 
ATOM   1017 O  O   . ILE A 1 134 ? 32.186 50.179 45.731 1.00 63.76  ? 176 ILE A O   1 
ATOM   1018 C  CB  . ILE A 1 134 ? 31.045 47.619 45.033 1.00 63.53  ? 176 ILE A CB  1 
ATOM   1019 C  CG1 . ILE A 1 134 ? 30.193 47.578 46.312 1.00 63.51  ? 176 ILE A CG1 1 
ATOM   1020 C  CG2 . ILE A 1 134 ? 30.817 46.358 44.218 1.00 63.49  ? 176 ILE A CG2 1 
ATOM   1021 C  CD1 . ILE A 1 134 ? 29.411 48.847 46.596 1.00 63.13  ? 176 ILE A CD1 1 
ATOM   1022 N  N   . SER A 1 135 ? 33.969 49.241 46.744 1.00 64.16  ? 177 SER A N   1 
ATOM   1023 C  CA  . SER A 1 135 ? 34.327 50.408 47.553 1.00 64.59  ? 177 SER A CA  1 
ATOM   1024 C  C   . SER A 1 135 ? 35.050 51.518 46.782 1.00 64.77  ? 177 SER A C   1 
ATOM   1025 O  O   . SER A 1 135 ? 35.352 52.570 47.351 1.00 64.70  ? 177 SER A O   1 
ATOM   1026 C  CB  . SER A 1 135 ? 35.172 49.965 48.754 1.00 64.60  ? 177 SER A CB  1 
ATOM   1027 O  OG  . SER A 1 135 ? 36.107 48.965 48.372 1.00 64.88  ? 177 SER A OG  1 
ATOM   1028 N  N   . ALA A 1 136 ? 35.316 51.290 45.495 1.00 65.02  ? 178 ALA A N   1 
ATOM   1029 C  CA  . ALA A 1 136 ? 36.053 52.256 44.674 1.00 65.30  ? 178 ALA A CA  1 
ATOM   1030 C  C   . ALA A 1 136 ? 35.237 53.516 44.348 1.00 65.49  ? 178 ALA A C   1 
ATOM   1031 O  O   . ALA A 1 136 ? 34.152 53.429 43.764 1.00 65.69  ? 178 ALA A O   1 
ATOM   1032 C  CB  . ALA A 1 136 ? 36.562 51.596 43.406 1.00 65.25  ? 178 ALA A CB  1 
ATOM   1033 N  N   . PHE A 1 137 ? 35.784 54.674 44.729 1.00 65.53  ? 179 PHE A N   1 
ATOM   1034 C  CA  . PHE A 1 137 ? 35.136 55.991 44.584 1.00 65.58  ? 179 PHE A CA  1 
ATOM   1035 C  C   . PHE A 1 137 ? 33.732 56.036 45.186 1.00 65.53  ? 179 PHE A C   1 
ATOM   1036 O  O   . PHE A 1 137 ? 33.580 56.593 46.352 1.00 65.39  ? 179 PHE A O   1 
ATOM   1037 C  CB  . PHE A 1 137 ? 35.109 56.458 43.119 1.00 65.66  ? 179 PHE A CB  1 
ATOM   1038 C  CG  . PHE A 1 137 ? 36.472 56.637 42.507 1.00 65.85  ? 179 PHE A CG  1 
ATOM   1039 C  CD1 . PHE A 1 137 ? 37.026 55.640 41.707 1.00 66.15  ? 179 PHE A CD1 1 
ATOM   1040 C  CD2 . PHE A 1 137 ? 37.200 57.805 42.721 1.00 66.08  ? 179 PHE A CD2 1 
ATOM   1041 C  CE1 . PHE A 1 137 ? 38.287 55.800 41.133 1.00 66.23  ? 179 PHE A CE1 1 
ATOM   1042 C  CE2 . PHE A 1 137 ? 38.462 57.976 42.153 1.00 66.18  ? 179 PHE A CE2 1 
ATOM   1043 C  CZ  . PHE A 1 137 ? 39.006 56.972 41.358 1.00 66.00  ? 179 PHE A CZ  1 
ATOM   1044 N  N   . ASN A 1 140 ? 32.411 54.734 42.051 1.00 64.52  ? 182 ASN A N   1 
ATOM   1045 C  CA  . ASN A 1 140 ? 31.577 55.473 41.109 1.00 64.52  ? 182 ASN A CA  1 
ATOM   1046 C  C   . ASN A 1 140 ? 32.160 55.502 39.690 1.00 64.47  ? 182 ASN A C   1 
ATOM   1047 O  O   . ASN A 1 140 ? 31.643 56.194 38.809 1.00 64.51  ? 182 ASN A O   1 
ATOM   1048 C  CB  . ASN A 1 140 ? 31.322 56.895 41.624 1.00 64.51  ? 182 ASN A CB  1 
ATOM   1049 C  CG  . ASN A 1 140 ? 29.979 57.455 41.169 1.00 64.62  ? 182 ASN A CG  1 
ATOM   1050 O  OD1 . ASN A 1 140 ? 29.259 56.832 40.386 1.00 64.71  ? 182 ASN A OD1 1 
ATOM   1051 N  ND2 . ASN A 1 140 ? 29.638 58.639 41.665 1.00 64.83  ? 182 ASN A ND2 1 
ATOM   1052 N  N   . HIS A 1 141 ? 33.233 54.743 39.478 1.00 64.41  ? 183 HIS A N   1 
ATOM   1053 C  CA  . HIS A 1 141 ? 33.867 54.632 38.164 1.00 64.31  ? 183 HIS A CA  1 
ATOM   1054 C  C   . HIS A 1 141 ? 33.341 53.415 37.389 1.00 64.23  ? 183 HIS A C   1 
ATOM   1055 O  O   . HIS A 1 141 ? 32.715 52.522 37.966 1.00 64.15  ? 183 HIS A O   1 
ATOM   1056 C  CB  . HIS A 1 141 ? 35.395 54.576 38.308 1.00 64.31  ? 183 HIS A CB  1 
ATOM   1057 C  CG  . HIS A 1 141 ? 35.920 53.235 38.722 1.00 64.31  ? 183 HIS A CG  1 
ATOM   1058 N  ND1 . HIS A 1 141 ? 35.779 52.741 40.001 1.00 64.36  ? 183 HIS A ND1 1 
ATOM   1059 C  CD2 . HIS A 1 141 ? 36.588 52.287 38.024 1.00 64.33  ? 183 HIS A CD2 1 
ATOM   1060 C  CE1 . HIS A 1 141 ? 36.333 51.543 40.071 1.00 64.23  ? 183 HIS A CE1 1 
ATOM   1061 N  NE2 . HIS A 1 141 ? 36.833 51.245 38.885 1.00 64.30  ? 183 HIS A NE2 1 
ATOM   1062 N  N   . LYS A 1 142 ? 33.596 53.397 36.081 1.00 64.13  ? 184 LYS A N   1 
ATOM   1063 C  CA  . LYS A 1 142 ? 33.168 52.302 35.210 1.00 64.02  ? 184 LYS A CA  1 
ATOM   1064 C  C   . LYS A 1 142 ? 34.163 51.144 35.258 1.00 63.89  ? 184 LYS A C   1 
ATOM   1065 O  O   . LYS A 1 142 ? 35.376 51.363 35.285 1.00 63.86  ? 184 LYS A O   1 
ATOM   1066 C  CB  . LYS A 1 142 ? 33.011 52.792 33.766 1.00 64.07  ? 184 LYS A CB  1 
ATOM   1067 C  CG  . LYS A 1 142 ? 32.009 53.925 33.581 1.00 64.03  ? 184 LYS A CG  1 
ATOM   1068 C  CD  . LYS A 1 142 ? 31.880 54.312 32.114 1.00 64.03  ? 184 LYS A CD  1 
ATOM   1069 C  CE  . LYS A 1 142 ? 31.019 55.552 31.932 1.00 64.35  ? 184 LYS A CE  1 
ATOM   1070 N  NZ  . LYS A 1 142 ? 29.610 55.359 32.383 1.00 64.38  ? 184 LYS A NZ  1 
ATOM   1071 N  N   . ASP A 1 143 ? 33.645 49.918 35.261 1.00 63.76  ? 185 ASP A N   1 
ATOM   1072 C  CA  . ASP A 1 143 ? 34.488 48.719 35.316 1.00 63.65  ? 185 ASP A CA  1 
ATOM   1073 C  C   . ASP A 1 143 ? 34.316 47.829 34.082 1.00 63.46  ? 185 ASP A C   1 
ATOM   1074 O  O   . ASP A 1 143 ? 33.193 47.522 33.681 1.00 63.32  ? 185 ASP A O   1 
ATOM   1075 C  CB  . ASP A 1 143 ? 34.210 47.919 36.594 1.00 63.73  ? 185 ASP A CB  1 
ATOM   1076 C  CG  . ASP A 1 143 ? 35.217 46.800 36.816 1.00 63.79  ? 185 ASP A CG  1 
ATOM   1077 O  OD1 . ASP A 1 143 ? 34.835 45.624 36.670 1.00 63.98  ? 185 ASP A OD1 1 
ATOM   1078 O  OD2 . ASP A 1 143 ? 36.390 47.093 37.129 1.00 64.37  ? 185 ASP A OD2 1 
ATOM   1079 N  N   . CYS A 1 144 ? 35.442 47.418 33.498 1.00 63.36  ? 186 CYS A N   1 
ATOM   1080 C  CA  . CYS A 1 144 ? 35.453 46.571 32.302 1.00 63.18  ? 186 CYS A CA  1 
ATOM   1081 C  C   . CYS A 1 144 ? 36.206 45.255 32.526 1.00 62.74  ? 186 CYS A C   1 
ATOM   1082 O  O   . CYS A 1 144 ? 36.899 44.756 31.629 1.00 62.95  ? 186 CYS A O   1 
ATOM   1083 C  CB  . CYS A 1 144 ? 36.028 47.338 31.104 1.00 63.44  ? 186 CYS A CB  1 
ATOM   1084 S  SG  . CYS A 1 144 ? 34.993 48.722 30.544 1.00 64.93  ? 186 CYS A SG  1 
ATOM   1085 N  N   . SER A 1 145 ? 36.056 44.694 33.724 1.00 61.89  ? 187 SER A N   1 
ATOM   1086 C  CA  . SER A 1 145 ? 36.695 43.433 34.078 1.00 61.26  ? 187 SER A CA  1 
ATOM   1087 C  C   . SER A 1 145 ? 36.139 42.282 33.252 1.00 60.66  ? 187 SER A C   1 
ATOM   1088 O  O   . SER A 1 145 ? 34.962 42.284 32.872 1.00 60.64  ? 187 SER A O   1 
ATOM   1089 C  CB  . SER A 1 145 ? 36.510 43.122 35.565 1.00 61.28  ? 187 SER A CB  1 
ATOM   1090 O  OG  . SER A 1 145 ? 37.149 44.090 36.375 1.00 62.18  ? 187 SER A OG  1 
ATOM   1091 N  N   . GLY A 1 146 ? 36.995 41.301 32.984 1.00 59.68  ? 188 GLY A N   1 
ATOM   1092 C  CA  . GLY A 1 146 ? 36.606 40.138 32.211 1.00 58.60  ? 188 GLY A CA  1 
ATOM   1093 C  C   . GLY A 1 146 ? 37.767 39.228 31.876 1.00 57.92  ? 188 GLY A C   1 
ATOM   1094 O  O   . GLY A 1 146 ? 38.725 39.106 32.638 1.00 57.65  ? 188 GLY A O   1 
ATOM   1095 N  N   . VAL A 1 147 ? 37.674 38.580 30.724 1.00 57.34  ? 189 VAL A N   1 
ATOM   1096 C  CA  . VAL A 1 147 ? 38.625 37.546 30.357 1.00 57.02  ? 189 VAL A CA  1 
ATOM   1097 C  C   . VAL A 1 147 ? 39.008 37.712 28.896 1.00 56.76  ? 189 VAL A C   1 
ATOM   1098 O  O   . VAL A 1 147 ? 38.164 38.035 28.063 1.00 56.67  ? 189 VAL A O   1 
ATOM   1099 C  CB  . VAL A 1 147 ? 38.035 36.116 30.592 1.00 56.82  ? 189 VAL A CB  1 
ATOM   1100 C  CG1 . VAL A 1 147 ? 39.095 35.039 30.396 1.00 57.12  ? 189 VAL A CG1 1 
ATOM   1101 C  CG2 . VAL A 1 147 ? 37.429 35.991 31.979 1.00 57.08  ? 189 VAL A CG2 1 
ATOM   1102 N  N   . SER A 1 148 ? 40.287 37.500 28.603 1.00 56.61  ? 190 SER A N   1 
ATOM   1103 C  CA  . SER A 1 148 ? 40.771 37.419 27.236 1.00 56.79  ? 190 SER A CA  1 
ATOM   1104 C  C   . SER A 1 148 ? 40.928 35.949 26.858 1.00 56.77  ? 190 SER A C   1 
ATOM   1105 O  O   . SER A 1 148 ? 41.669 35.204 27.504 1.00 56.98  ? 190 SER A O   1 
ATOM   1106 C  CB  . SER A 1 148 ? 42.098 38.152 27.099 1.00 56.80  ? 190 SER A CB  1 
ATOM   1107 O  OG  . SER A 1 148 ? 42.480 38.250 25.741 1.00 58.36  ? 190 SER A OG  1 
ATOM   1108 N  N   . VAL A 1 149 ? 40.211 35.533 25.819 1.00 56.48  ? 191 VAL A N   1 
ATOM   1109 C  CA  . VAL A 1 149 ? 40.160 34.135 25.421 1.00 55.97  ? 191 VAL A CA  1 
ATOM   1110 C  C   . VAL A 1 149 ? 40.951 33.938 24.135 1.00 56.19  ? 191 VAL A C   1 
ATOM   1111 O  O   . VAL A 1 149 ? 40.748 34.659 23.164 1.00 55.77  ? 191 VAL A O   1 
ATOM   1112 C  CB  . VAL A 1 149 ? 38.688 33.672 25.230 1.00 56.07  ? 191 VAL A CB  1 
ATOM   1113 C  CG1 . VAL A 1 149 ? 38.608 32.177 25.030 1.00 55.04  ? 191 VAL A CG1 1 
ATOM   1114 C  CG2 . VAL A 1 149 ? 37.838 34.079 26.430 1.00 55.41  ? 191 VAL A CG2 1 
ATOM   1115 N  N   . HIS A 1 150 ? 41.859 32.963 24.136 1.00 56.72  ? 192 HIS A N   1 
ATOM   1116 C  CA  . HIS A 1 150 ? 42.653 32.631 22.942 1.00 57.04  ? 192 HIS A CA  1 
ATOM   1117 C  C   . HIS A 1 150 ? 41.931 31.551 22.132 1.00 57.09  ? 192 HIS A C   1 
ATOM   1118 O  O   . HIS A 1 150 ? 41.753 30.430 22.597 1.00 57.02  ? 192 HIS A O   1 
ATOM   1119 C  CB  . HIS A 1 150 ? 44.055 32.150 23.347 1.00 57.01  ? 192 HIS A CB  1 
ATOM   1120 C  CG  . HIS A 1 150 ? 45.019 31.995 22.207 1.00 57.61  ? 192 HIS A CG  1 
ATOM   1121 N  ND1 . HIS A 1 150 ? 46.369 32.238 22.343 1.00 58.55  ? 192 HIS A ND1 1 
ATOM   1122 C  CD2 . HIS A 1 150 ? 44.837 31.613 20.918 1.00 57.87  ? 192 HIS A CD2 1 
ATOM   1123 C  CE1 . HIS A 1 150 ? 46.974 32.016 21.189 1.00 58.57  ? 192 HIS A CE1 1 
ATOM   1124 N  NE2 . HIS A 1 150 ? 46.067 31.637 20.308 1.00 57.73  ? 192 HIS A NE2 1 
ATOM   1125 N  N   . LEU A 1 151 ? 41.518 31.910 20.919 1.00 57.75  ? 193 LEU A N   1 
ATOM   1126 C  CA  . LEU A 1 151 ? 40.821 30.997 20.010 1.00 58.01  ? 193 LEU A CA  1 
ATOM   1127 C  C   . LEU A 1 151 ? 41.711 30.662 18.824 1.00 58.15  ? 193 LEU A C   1 
ATOM   1128 O  O   . LEU A 1 151 ? 42.434 31.516 18.322 1.00 58.26  ? 193 LEU A O   1 
ATOM   1129 C  CB  . LEU A 1 151 ? 39.525 31.627 19.480 1.00 58.11  ? 193 LEU A CB  1 
ATOM   1130 C  CG  . LEU A 1 151 ? 38.219 31.792 20.275 1.00 58.13  ? 193 LEU A CG  1 
ATOM   1131 C  CD1 . LEU A 1 151 ? 37.562 30.461 20.570 1.00 57.64  ? 193 LEU A CD1 1 
ATOM   1132 C  CD2 . LEU A 1 151 ? 38.391 32.621 21.534 1.00 57.95  ? 193 LEU A CD2 1 
ATOM   1133 N  N   . THR A 1 152 ? 41.643 29.415 18.381 1.00 58.42  ? 194 THR A N   1 
ATOM   1134 C  CA  . THR A 1 152 ? 42.363 28.963 17.201 1.00 58.55  ? 194 THR A CA  1 
ATOM   1135 C  C   . THR A 1 152 ? 41.437 28.059 16.401 1.00 59.30  ? 194 THR A C   1 
ATOM   1136 O  O   . THR A 1 152 ? 40.515 27.471 16.948 1.00 59.52  ? 194 THR A O   1 
ATOM   1137 C  CB  . THR A 1 152 ? 43.665 28.198 17.570 1.00 58.43  ? 194 THR A CB  1 
ATOM   1138 O  OG1 . THR A 1 152 ? 44.388 27.875 16.375 1.00 57.86  ? 194 THR A OG1 1 
ATOM   1139 C  CG2 . THR A 1 152 ? 43.367 26.913 18.343 1.00 57.12  ? 194 THR A CG2 1 
ATOM   1140 N  N   . ARG A 1 153 ? 41.677 27.959 15.104 1.00 60.40  ? 195 ARG A N   1 
ATOM   1141 C  CA  . ARG A 1 153 ? 40.888 27.074 14.261 1.00 61.32  ? 195 ARG A CA  1 
ATOM   1142 C  C   . ARG A 1 153 ? 41.703 25.847 13.863 1.00 61.28  ? 195 ARG A C   1 
ATOM   1143 O  O   . ARG A 1 153 ? 41.206 24.956 13.170 1.00 61.53  ? 195 ARG A O   1 
ATOM   1144 C  CB  . ARG A 1 153 ? 40.316 27.838 13.060 1.00 61.79  ? 195 ARG A CB  1 
ATOM   1145 C  CG  . ARG A 1 153 ? 38.968 28.499 13.385 1.00 63.48  ? 195 ARG A CG  1 
ATOM   1146 C  CD  . ARG A 1 153 ? 38.803 29.894 12.787 1.00 65.97  ? 195 ARG A CD  1 
ATOM   1147 N  NE  . ARG A 1 153 ? 38.676 29.874 11.332 1.00 67.86  ? 195 ARG A NE  1 
ATOM   1148 C  CZ  . ARG A 1 153 ? 39.539 30.435 10.490 1.00 68.93  ? 195 ARG A CZ  1 
ATOM   1149 N  NH1 . ARG A 1 153 ? 40.603 31.088 10.945 1.00 69.53  ? 195 ARG A NH1 1 
ATOM   1150 N  NH2 . ARG A 1 153 ? 39.331 30.351 9.184  1.00 69.00  ? 195 ARG A NH2 1 
ATOM   1151 N  N   . VAL A 1 154 ? 42.951 25.811 14.329 1.00 61.11  ? 196 VAL A N   1 
ATOM   1152 C  CA  . VAL A 1 154 ? 43.803 24.627 14.240 1.00 61.22  ? 196 VAL A CA  1 
ATOM   1153 C  C   . VAL A 1 154 ? 43.286 23.570 15.228 1.00 61.18  ? 196 VAL A C   1 
ATOM   1154 O  O   . VAL A 1 154 ? 43.254 23.819 16.431 1.00 61.35  ? 196 VAL A O   1 
ATOM   1155 C  CB  . VAL A 1 154 ? 45.287 24.965 14.560 1.00 61.26  ? 196 VAL A CB  1 
ATOM   1156 C  CG1 . VAL A 1 154 ? 46.143 23.702 14.576 1.00 61.30  ? 196 VAL A CG1 1 
ATOM   1157 C  CG2 . VAL A 1 154 ? 45.846 25.968 13.555 1.00 61.14  ? 196 VAL A CG2 1 
ATOM   1158 N  N   . PRO A 1 155 ? 42.859 22.397 14.722 1.00 61.26  ? 197 PRO A N   1 
ATOM   1159 C  CA  . PRO A 1 155 ? 42.343 21.355 15.609 1.00 61.18  ? 197 PRO A CA  1 
ATOM   1160 C  C   . PRO A 1 155 ? 43.382 20.908 16.626 1.00 61.13  ? 197 PRO A C   1 
ATOM   1161 O  O   . PRO A 1 155 ? 44.567 20.805 16.309 1.00 61.90  ? 197 PRO A O   1 
ATOM   1162 C  CB  . PRO A 1 155 ? 41.988 20.211 14.645 1.00 61.41  ? 197 PRO A CB  1 
ATOM   1163 C  CG  . PRO A 1 155 ? 41.759 20.888 13.334 1.00 61.30  ? 197 PRO A CG  1 
ATOM   1164 C  CD  . PRO A 1 155 ? 42.801 21.979 13.309 1.00 61.32  ? 197 PRO A CD  1 
ATOM   1165 N  N   . GLN A 1 156 ? 42.937 20.682 17.852 1.00 60.55  ? 198 GLN A N   1 
ATOM   1166 C  CA  . GLN A 1 156 ? 43.831 20.323 18.932 1.00 60.08  ? 198 GLN A CA  1 
ATOM   1167 C  C   . GLN A 1 156 ? 43.834 18.809 19.090 1.00 59.84  ? 198 GLN A C   1 
ATOM   1168 O  O   . GLN A 1 156 ? 42.780 18.168 18.964 1.00 59.68  ? 198 GLN A O   1 
ATOM   1169 C  CB  . GLN A 1 156 ? 43.406 21.019 20.230 1.00 60.09  ? 198 GLN A CB  1 
ATOM   1170 C  CG  . GLN A 1 156 ? 43.431 22.549 20.155 1.00 59.98  ? 198 GLN A CG  1 
ATOM   1171 C  CD  . GLN A 1 156 ? 44.821 23.101 19.869 1.00 60.18  ? 198 GLN A CD  1 
ATOM   1172 O  OE1 . GLN A 1 156 ? 45.732 22.967 20.688 1.00 59.59  ? 198 GLN A OE1 1 
ATOM   1173 N  NE2 . GLN A 1 156 ? 44.986 23.727 18.699 1.00 58.58  ? 198 GLN A NE2 1 
ATOM   1174 N  N   . PRO A 1 157 ? 45.019 18.228 19.363 1.00 59.59  ? 199 PRO A N   1 
ATOM   1175 C  CA  . PRO A 1 157 ? 45.127 16.773 19.529 1.00 59.28  ? 199 PRO A CA  1 
ATOM   1176 C  C   . PRO A 1 157 ? 44.329 16.274 20.735 1.00 58.91  ? 199 PRO A C   1 
ATOM   1177 O  O   . PRO A 1 157 ? 43.908 15.123 20.758 1.00 59.11  ? 199 PRO A O   1 
ATOM   1178 C  CB  . PRO A 1 157 ? 46.623 16.554 19.743 1.00 59.12  ? 199 PRO A CB  1 
ATOM   1179 C  CG  . PRO A 1 157 ? 47.132 17.871 20.249 1.00 59.51  ? 199 PRO A CG  1 
ATOM   1180 C  CD  . PRO A 1 157 ? 46.319 18.903 19.546 1.00 59.39  ? 199 PRO A CD  1 
ATOM   1181 N  N   . LEU A 1 158 ? 44.106 17.145 21.713 1.00 58.54  ? 200 LEU A N   1 
ATOM   1182 C  CA  . LEU A 1 158 ? 43.360 16.772 22.914 1.00 58.31  ? 200 LEU A CA  1 
ATOM   1183 C  C   . LEU A 1 158 ? 42.240 17.759 23.168 1.00 58.30  ? 200 LEU A C   1 
ATOM   1184 O  O   . LEU A 1 158 ? 42.446 18.970 23.114 1.00 58.24  ? 200 LEU A O   1 
ATOM   1185 C  CB  . LEU A 1 158 ? 44.282 16.699 24.131 1.00 57.81  ? 200 LEU A CB  1 
ATOM   1186 C  CG  . LEU A 1 158 ? 45.489 15.761 24.026 1.00 57.86  ? 200 LEU A CG  1 
ATOM   1187 C  CD1 . LEU A 1 158 ? 46.509 16.091 25.111 1.00 56.85  ? 200 LEU A CD1 1 
ATOM   1188 C  CD2 . LEU A 1 158 ? 45.067 14.300 24.082 1.00 56.23  ? 200 LEU A CD2 1 
ATOM   1189 N  N   . ILE A 1 159 ? 41.055 17.228 23.439 1.00 58.35  ? 201 ILE A N   1 
ATOM   1190 C  CA  . ILE A 1 159 ? 39.865 18.046 23.620 1.00 58.47  ? 201 ILE A CA  1 
ATOM   1191 C  C   . ILE A 1 159 ? 39.486 18.085 25.091 1.00 58.65  ? 201 ILE A C   1 
ATOM   1192 O  O   . ILE A 1 159 ? 39.285 17.035 25.709 1.00 59.02  ? 201 ILE A O   1 
ATOM   1193 C  CB  . ILE A 1 159 ? 38.666 17.520 22.766 1.00 58.18  ? 201 ILE A CB  1 
ATOM   1194 C  CG1 . ILE A 1 159 ? 39.021 17.446 21.264 1.00 58.49  ? 201 ILE A CG1 1 
ATOM   1195 C  CG2 . ILE A 1 159 ? 37.397 18.356 22.993 1.00 57.61  ? 201 ILE A CG2 1 
ATOM   1196 C  CD1 . ILE A 1 159 ? 39.541 18.745 20.631 1.00 56.60  ? 201 ILE A CD1 1 
ATOM   1197 N  N   . ALA A 1 160 ? 39.391 19.297 25.639 1.00 58.68  ? 202 ALA A N   1 
ATOM   1198 C  CA  . ALA A 1 160 ? 38.942 19.504 27.013 1.00 58.65  ? 202 ALA A CA  1 
ATOM   1199 C  C   . ALA A 1 160 ? 37.423 19.385 27.135 1.00 59.02  ? 202 ALA A C   1 
ATOM   1200 O  O   . ALA A 1 160 ? 36.669 19.754 26.228 1.00 58.47  ? 202 ALA A O   1 
ATOM   1201 C  CB  . ALA A 1 160 ? 39.407 20.848 27.546 1.00 58.53  ? 202 ALA A CB  1 
ATOM   1202 N  N   . GLY A 1 161 ? 36.986 18.866 28.275 1.00 59.28  ? 203 GLY A N   1 
ATOM   1203 C  CA  . GLY A 1 161 ? 35.574 18.737 28.555 1.00 59.80  ? 203 GLY A CA  1 
ATOM   1204 C  C   . GLY A 1 161 ? 35.279 18.859 30.032 1.00 60.31  ? 203 GLY A C   1 
ATOM   1205 O  O   . GLY A 1 161 ? 36.173 19.120 30.842 1.00 60.51  ? 203 GLY A O   1 
ATOM   1206 N  N   . MET A 1 162 ? 34.012 18.668 30.374 1.00 60.93  ? 204 MET A N   1 
ATOM   1207 C  CA  . MET A 1 162 ? 33.542 18.821 31.735 1.00 61.28  ? 204 MET A CA  1 
ATOM   1208 C  C   . MET A 1 162 ? 32.638 17.649 32.080 1.00 61.53  ? 204 MET A C   1 
ATOM   1209 O  O   . MET A 1 162 ? 31.663 17.380 31.370 1.00 61.47  ? 204 MET A O   1 
ATOM   1210 C  CB  . MET A 1 162 ? 32.761 20.131 31.872 1.00 61.74  ? 204 MET A CB  1 
ATOM   1211 C  CG  . MET A 1 162 ? 32.484 20.564 33.312 1.00 62.05  ? 204 MET A CG  1 
ATOM   1212 S  SD  . MET A 1 162 ? 33.984 20.774 34.294 1.00 65.02  ? 204 MET A SD  1 
ATOM   1213 C  CE  . MET A 1 162 ? 34.967 21.890 33.293 1.00 64.33  ? 204 MET A CE  1 
ATOM   1214 N  N   . TYR A 1 163 ? 32.980 16.938 33.151 1.00 61.35  ? 205 TYR A N   1 
ATOM   1215 C  CA  . TYR A 1 163 ? 32.068 15.967 33.722 1.00 61.35  ? 205 TYR A CA  1 
ATOM   1216 C  C   . TYR A 1 163 ? 31.460 16.595 34.969 1.00 61.68  ? 205 TYR A C   1 
ATOM   1217 O  O   . TYR A 1 163 ? 32.140 16.755 35.986 1.00 61.97  ? 205 TYR A O   1 
ATOM   1218 C  CB  . TYR A 1 163 ? 32.781 14.647 34.046 1.00 61.09  ? 205 TYR A CB  1 
ATOM   1219 C  CG  . TYR A 1 163 ? 31.840 13.499 34.337 1.00 60.93  ? 205 TYR A CG  1 
ATOM   1220 C  CD1 . TYR A 1 163 ? 31.094 13.468 35.515 1.00 60.64  ? 205 TYR A CD1 1 
ATOM   1221 C  CD2 . TYR A 1 163 ? 31.697 12.438 33.439 1.00 61.14  ? 205 TYR A CD2 1 
ATOM   1222 C  CE1 . TYR A 1 163 ? 30.233 12.427 35.794 1.00 60.89  ? 205 TYR A CE1 1 
ATOM   1223 C  CE2 . TYR A 1 163 ? 30.828 11.382 33.709 1.00 60.07  ? 205 TYR A CE2 1 
ATOM   1224 C  CZ  . TYR A 1 163 ? 30.098 11.386 34.892 1.00 61.10  ? 205 TYR A CZ  1 
ATOM   1225 O  OH  . TYR A 1 163 ? 29.232 10.353 35.200 1.00 61.00  ? 205 TYR A OH  1 
ATOM   1226 N  N   . LEU A 1 164 ? 30.186 16.962 34.881 1.00 62.04  ? 206 LEU A N   1 
ATOM   1227 C  CA  . LEU A 1 164 ? 29.501 17.621 35.987 1.00 62.50  ? 206 LEU A CA  1 
ATOM   1228 C  C   . LEU A 1 164 ? 28.703 16.644 36.841 1.00 63.10  ? 206 LEU A C   1 
ATOM   1229 O  O   . LEU A 1 164 ? 27.833 15.932 36.345 1.00 63.30  ? 206 LEU A O   1 
ATOM   1230 C  CB  . LEU A 1 164 ? 28.587 18.735 35.473 1.00 62.54  ? 206 LEU A CB  1 
ATOM   1231 C  CG  . LEU A 1 164 ? 27.606 19.382 36.463 1.00 62.72  ? 206 LEU A CG  1 
ATOM   1232 C  CD1 . LEU A 1 164 ? 28.325 20.027 37.666 1.00 61.70  ? 206 LEU A CD1 1 
ATOM   1233 C  CD2 . LEU A 1 164 ? 26.724 20.389 35.742 1.00 62.49  ? 206 LEU A CD2 1 
ATOM   1234 N  N   . MET A 1 165 ? 29.015 16.613 38.129 1.00 63.57  ? 207 MET A N   1 
ATOM   1235 C  CA  . MET A 1 165 ? 28.252 15.823 39.080 1.00 64.30  ? 207 MET A CA  1 
ATOM   1236 C  C   . MET A 1 165 ? 27.445 16.766 39.972 1.00 64.78  ? 207 MET A C   1 
ATOM   1237 O  O   . MET A 1 165 ? 28.006 17.639 40.633 1.00 64.32  ? 207 MET A O   1 
ATOM   1238 C  CB  . MET A 1 165 ? 29.191 14.942 39.905 1.00 64.17  ? 207 MET A CB  1 
ATOM   1239 C  CG  . MET A 1 165 ? 30.044 14.023 39.039 1.00 64.31  ? 207 MET A CG  1 
ATOM   1240 S  SD  . MET A 1 165 ? 30.992 12.816 39.957 1.00 64.79  ? 207 MET A SD  1 
ATOM   1241 C  CE  . MET A 1 165 ? 29.701 11.728 40.560 1.00 63.97  ? 207 MET A CE  1 
ATOM   1242 N  N   . MET A 1 166 ? 26.127 16.603 39.967 1.00 65.52  ? 208 MET A N   1 
ATOM   1243 C  CA  . MET A 1 166 ? 25.274 17.453 40.782 1.00 66.87  ? 208 MET A CA  1 
ATOM   1244 C  C   . MET A 1 166 ? 24.080 16.753 41.407 1.00 66.31  ? 208 MET A C   1 
ATOM   1245 O  O   . MET A 1 166 ? 23.419 15.933 40.769 1.00 66.40  ? 208 MET A O   1 
ATOM   1246 C  CB  . MET A 1 166 ? 24.826 18.693 40.010 1.00 66.60  ? 208 MET A CB  1 
ATOM   1247 C  CG  . MET A 1 166 ? 24.036 18.448 38.751 1.00 68.39  ? 208 MET A CG  1 
ATOM   1248 S  SD  . MET A 1 166 ? 23.619 19.999 37.911 1.00 70.78  ? 208 MET A SD  1 
ATOM   1249 C  CE  . MET A 1 166 ? 22.636 20.825 39.157 1.00 69.99  ? 208 MET A CE  1 
ATOM   1250 N  N   . SER A 1 167 ? 23.826 17.085 42.669 1.00 65.83  ? 209 SER A N   1 
ATOM   1251 C  CA  . SER A 1 167 ? 22.644 16.628 43.370 1.00 65.60  ? 209 SER A CA  1 
ATOM   1252 C  C   . SER A 1 167 ? 21.450 17.429 42.910 1.00 65.13  ? 209 SER A C   1 
ATOM   1253 O  O   . SER A 1 167 ? 21.571 18.618 42.589 1.00 65.29  ? 209 SER A O   1 
ATOM   1254 C  CB  . SER A 1 167 ? 22.807 16.813 44.873 1.00 65.67  ? 209 SER A CB  1 
ATOM   1255 O  OG  . SER A 1 167 ? 24.091 16.395 45.294 1.00 67.66  ? 209 SER A OG  1 
ATOM   1256 N  N   . VAL A 1 168 ? 20.296 16.774 42.893 1.00 64.38  ? 210 VAL A N   1 
ATOM   1257 C  CA  . VAL A 1 168 ? 19.052 17.419 42.515 1.00 63.93  ? 210 VAL A CA  1 
ATOM   1258 C  C   . VAL A 1 168 ? 17.985 17.269 43.605 1.00 63.48  ? 210 VAL A C   1 
ATOM   1259 O  O   . VAL A 1 168 ? 17.112 18.123 43.737 1.00 63.89  ? 210 VAL A O   1 
ATOM   1260 C  CB  . VAL A 1 168 ? 18.527 16.907 41.130 1.00 63.95  ? 210 VAL A CB  1 
ATOM   1261 C  CG1 . VAL A 1 168 ? 19.529 17.225 40.028 1.00 63.67  ? 210 VAL A CG1 1 
ATOM   1262 C  CG2 . VAL A 1 168 ? 18.237 15.407 41.155 1.00 64.02  ? 210 VAL A CG2 1 
ATOM   1263 N  N   . ASP A 1 169 ? 18.081 16.203 44.396 1.00 62.83  ? 211 ASP A N   1 
ATOM   1264 C  CA  . ASP A 1 169 ? 17.017 15.834 45.333 1.00 62.37  ? 211 ASP A CA  1 
ATOM   1265 C  C   . ASP A 1 169 ? 17.355 16.013 46.814 1.00 61.20  ? 211 ASP A C   1 
ATOM   1266 O  O   . ASP A 1 169 ? 16.549 15.663 47.679 1.00 60.98  ? 211 ASP A O   1 
ATOM   1267 C  CB  . ASP A 1 169 ? 16.541 14.392 45.067 1.00 62.96  ? 211 ASP A CB  1 
ATOM   1268 C  CG  . ASP A 1 169 ? 17.614 13.332 45.363 1.00 64.75  ? 211 ASP A CG  1 
ATOM   1269 O  OD1 . ASP A 1 169 ? 18.561 13.587 46.143 1.00 66.11  ? 211 ASP A OD1 1 
ATOM   1270 O  OD2 . ASP A 1 169 ? 17.488 12.210 44.822 1.00 68.18  ? 211 ASP A OD2 1 
ATOM   1271 N  N   . THR A 1 170 ? 18.538 16.552 47.100 1.00 60.04  ? 212 THR A N   1 
ATOM   1272 C  CA  . THR A 1 170 ? 18.983 16.735 48.482 1.00 58.89  ? 212 THR A CA  1 
ATOM   1273 C  C   . THR A 1 170 ? 18.016 17.597 49.284 1.00 58.05  ? 212 THR A C   1 
ATOM   1274 O  O   . THR A 1 170 ? 17.535 18.627 48.808 1.00 57.79  ? 212 THR A O   1 
ATOM   1275 C  CB  . THR A 1 170 ? 20.383 17.362 48.559 1.00 59.05  ? 212 THR A CB  1 
ATOM   1276 O  OG1 . THR A 1 170 ? 21.238 16.736 47.598 1.00 59.36  ? 212 THR A OG1 1 
ATOM   1277 C  CG2 . THR A 1 170 ? 20.974 17.201 49.965 1.00 58.46  ? 212 THR A CG2 1 
ATOM   1278 N  N   . VAL A 1 171 ? 17.716 17.137 50.492 1.00 57.07  ? 213 VAL A N   1 
ATOM   1279 C  CA  . VAL A 1 171 ? 16.944 17.908 51.447 1.00 56.12  ? 213 VAL A CA  1 
ATOM   1280 C  C   . VAL A 1 171 ? 17.718 17.927 52.760 1.00 55.87  ? 213 VAL A C   1 
ATOM   1281 O  O   . VAL A 1 171 ? 18.085 16.879 53.297 1.00 55.64  ? 213 VAL A O   1 
ATOM   1282 C  CB  . VAL A 1 171 ? 15.516 17.334 51.642 1.00 55.91  ? 213 VAL A CB  1 
ATOM   1283 C  CG1 . VAL A 1 171 ? 14.769 18.121 52.698 1.00 55.50  ? 213 VAL A CG1 1 
ATOM   1284 C  CG2 . VAL A 1 171 ? 14.740 17.370 50.332 1.00 55.39  ? 213 VAL A CG2 1 
ATOM   1285 N  N   . ILE A 1 172 ? 17.981 19.132 53.250 1.00 55.59  ? 214 ILE A N   1 
ATOM   1286 C  CA  . ILE A 1 172 ? 18.694 19.332 54.499 1.00 55.44  ? 214 ILE A CA  1 
ATOM   1287 C  C   . ILE A 1 172 ? 17.701 19.856 55.530 1.00 55.68  ? 214 ILE A C   1 
ATOM   1288 O  O   . ILE A 1 172 ? 17.315 21.026 55.476 1.00 55.62  ? 214 ILE A O   1 
ATOM   1289 C  CB  . ILE A 1 172 ? 19.873 20.336 54.338 1.00 55.47  ? 214 ILE A CB  1 
ATOM   1290 C  CG1 . ILE A 1 172 ? 20.786 19.939 53.171 1.00 54.69  ? 214 ILE A CG1 1 
ATOM   1291 C  CG2 . ILE A 1 172 ? 20.668 20.453 55.644 1.00 55.30  ? 214 ILE A CG2 1 
ATOM   1292 C  CD1 . ILE A 1 172 ? 21.557 21.104 52.578 1.00 55.30  ? 214 ILE A CD1 1 
ATOM   1293 N  N   . PRO A 1 173 ? 17.275 18.991 56.470 1.00 56.01  ? 215 PRO A N   1 
ATOM   1294 C  CA  . PRO A 1 173 ? 16.345 19.417 57.515 1.00 56.50  ? 215 PRO A CA  1 
ATOM   1295 C  C   . PRO A 1 173 ? 16.993 20.441 58.451 1.00 57.07  ? 215 PRO A C   1 
ATOM   1296 O  O   . PRO A 1 173 ? 18.213 20.415 58.630 1.00 57.20  ? 215 PRO A O   1 
ATOM   1297 C  CB  . PRO A 1 173 ? 16.033 18.112 58.264 1.00 56.31  ? 215 PRO A CB  1 
ATOM   1298 C  CG  . PRO A 1 173 ? 16.440 17.020 57.331 1.00 55.99  ? 215 PRO A CG  1 
ATOM   1299 C  CD  . PRO A 1 173 ? 17.622 17.567 56.607 1.00 55.90  ? 215 PRO A CD  1 
ATOM   1300 N  N   . PRO A 1 174 ? 16.186 21.346 59.038 1.00 57.74  ? 216 PRO A N   1 
ATOM   1301 C  CA  . PRO A 1 174 ? 16.750 22.403 59.879 1.00 58.38  ? 216 PRO A CA  1 
ATOM   1302 C  C   . PRO A 1 174 ? 17.425 21.859 61.142 1.00 59.05  ? 216 PRO A C   1 
ATOM   1303 O  O   . PRO A 1 174 ? 16.835 21.058 61.872 1.00 58.92  ? 216 PRO A O   1 
ATOM   1304 C  CB  . PRO A 1 174 ? 15.528 23.262 60.241 1.00 58.29  ? 216 PRO A CB  1 
ATOM   1305 C  CG  . PRO A 1 174 ? 14.359 22.384 60.042 1.00 57.93  ? 216 PRO A CG  1 
ATOM   1306 C  CD  . PRO A 1 174 ? 14.715 21.432 58.951 1.00 57.73  ? 216 PRO A CD  1 
ATOM   1307 N  N   . GLY A 1 175 ? 18.666 22.279 61.372 1.00 59.90  ? 217 GLY A N   1 
ATOM   1308 C  CA  . GLY A 1 175 ? 19.410 21.884 62.568 1.00 60.90  ? 217 GLY A CA  1 
ATOM   1309 C  C   . GLY A 1 175 ? 20.103 20.533 62.497 1.00 61.62  ? 217 GLY A C   1 
ATOM   1310 O  O   . GLY A 1 175 ? 20.881 20.192 63.388 1.00 61.79  ? 217 GLY A O   1 
ATOM   1311 N  N   . GLU A 1 176 ? 19.824 19.764 61.444 1.00 62.30  ? 218 GLU A N   1 
ATOM   1312 C  CA  . GLU A 1 176 ? 20.415 18.434 61.270 1.00 62.91  ? 218 GLU A CA  1 
ATOM   1313 C  C   . GLU A 1 176 ? 21.935 18.543 61.145 1.00 62.96  ? 218 GLU A C   1 
ATOM   1314 O  O   . GLU A 1 176 ? 22.441 19.289 60.301 1.00 63.11  ? 218 GLU A O   1 
ATOM   1315 C  CB  . GLU A 1 176 ? 19.803 17.728 60.049 1.00 63.23  ? 218 GLU A CB  1 
ATOM   1316 C  CG  . GLU A 1 176 ? 20.283 16.288 59.809 1.00 64.35  ? 218 GLU A CG  1 
ATOM   1317 C  CD  . GLU A 1 176 ? 19.756 15.290 60.822 1.00 66.52  ? 218 GLU A CD  1 
ATOM   1318 O  OE1 . GLU A 1 176 ? 18.623 15.475 61.329 1.00 67.79  ? 218 GLU A OE1 1 
ATOM   1319 O  OE2 . GLU A 1 176 ? 20.479 14.308 61.108 1.00 67.36  ? 218 GLU A OE2 1 
ATOM   1320 N  N   . LYS A 1 177 ? 22.648 17.798 61.991 1.00 62.95  ? 219 LYS A N   1 
ATOM   1321 C  CA  . LYS A 1 177 ? 24.107 17.905 62.097 1.00 63.12  ? 219 LYS A CA  1 
ATOM   1322 C  C   . LYS A 1 177 ? 24.847 17.598 60.790 1.00 62.85  ? 219 LYS A C   1 
ATOM   1323 O  O   . LYS A 1 177 ? 25.663 18.400 60.334 1.00 63.09  ? 219 LYS A O   1 
ATOM   1324 C  CB  . LYS A 1 177 ? 24.643 17.029 63.240 1.00 63.14  ? 219 LYS A CB  1 
ATOM   1325 C  CG  . LYS A 1 177 ? 26.150 17.170 63.463 1.00 63.47  ? 219 LYS A CG  1 
ATOM   1326 C  CD  . LYS A 1 177 ? 26.656 16.302 64.609 1.00 63.65  ? 219 LYS A CD  1 
ATOM   1327 C  CE  . LYS A 1 177 ? 28.185 16.282 64.639 1.00 64.16  ? 219 LYS A CE  1 
ATOM   1328 N  NZ  . LYS A 1 177 ? 28.720 15.645 65.881 1.00 64.80  ? 219 LYS A NZ  1 
ATOM   1329 N  N   . VAL A 1 178 ? 24.569 16.437 60.201 1.00 62.53  ? 220 VAL A N   1 
ATOM   1330 C  CA  . VAL A 1 178 ? 25.226 16.022 58.964 1.00 62.09  ? 220 VAL A CA  1 
ATOM   1331 C  C   . VAL A 1 178 ? 24.206 15.490 57.964 1.00 61.76  ? 220 VAL A C   1 
ATOM   1332 O  O   . VAL A 1 178 ? 23.439 14.576 58.266 1.00 61.70  ? 220 VAL A O   1 
ATOM   1333 C  CB  . VAL A 1 178 ? 26.327 14.948 59.210 1.00 62.28  ? 220 VAL A CB  1 
ATOM   1334 C  CG1 . VAL A 1 178 ? 26.954 14.501 57.891 1.00 62.01  ? 220 VAL A CG1 1 
ATOM   1335 C  CG2 . VAL A 1 178 ? 27.408 15.466 60.164 1.00 62.33  ? 220 VAL A CG2 1 
ATOM   1336 N  N   . VAL A 1 179 ? 24.202 16.089 56.778 1.00 61.31  ? 221 VAL A N   1 
ATOM   1337 C  CA  . VAL A 1 179 ? 23.435 15.589 55.649 1.00 60.74  ? 221 VAL A CA  1 
ATOM   1338 C  C   . VAL A 1 179 ? 24.411 15.317 54.508 1.00 60.42  ? 221 VAL A C   1 
ATOM   1339 O  O   . VAL A 1 179 ? 25.139 16.213 54.070 1.00 60.38  ? 221 VAL A O   1 
ATOM   1340 C  CB  . VAL A 1 179 ? 22.349 16.600 55.198 1.00 60.80  ? 221 VAL A CB  1 
ATOM   1341 C  CG1 . VAL A 1 179 ? 21.590 16.081 53.986 1.00 60.18  ? 221 VAL A CG1 1 
ATOM   1342 C  CG2 . VAL A 1 179 ? 21.388 16.891 56.338 1.00 60.90  ? 221 VAL A CG2 1 
ATOM   1343 N  N   . ASN A 1 180 ? 24.435 14.068 54.049 1.00 60.02  ? 222 ASN A N   1 
ATOM   1344 C  CA  . ASN A 1 180 ? 25.241 13.684 52.901 1.00 59.65  ? 222 ASN A CA  1 
ATOM   1345 C  C   . ASN A 1 180 ? 24.414 13.732 51.627 1.00 59.45  ? 222 ASN A C   1 
ATOM   1346 O  O   . ASN A 1 180 ? 23.276 13.259 51.602 1.00 59.38  ? 222 ASN A O   1 
ATOM   1347 C  CB  . ASN A 1 180 ? 25.827 12.277 53.070 1.00 59.52  ? 222 ASN A CB  1 
ATOM   1348 C  CG  . ASN A 1 180 ? 26.862 12.191 54.183 1.00 59.47  ? 222 ASN A CG  1 
ATOM   1349 O  OD1 . ASN A 1 180 ? 26.926 11.190 54.898 1.00 59.08  ? 222 ASN A OD1 1 
ATOM   1350 N  ND2 . ASN A 1 180 ? 27.677 13.229 54.330 1.00 59.24  ? 222 ASN A ND2 1 
ATOM   1351 N  N   . ALA A 1 181 ? 24.990 14.331 50.589 1.00 59.03  ? 223 ALA A N   1 
ATOM   1352 C  CA  . ALA A 1 181 ? 24.462 14.255 49.239 1.00 58.90  ? 223 ALA A CA  1 
ATOM   1353 C  C   . ALA A 1 181 ? 25.436 13.425 48.416 1.00 58.92  ? 223 ALA A C   1 
ATOM   1354 O  O   . ALA A 1 181 ? 26.566 13.850 48.157 1.00 59.12  ? 223 ALA A O   1 
ATOM   1355 C  CB  . ALA A 1 181 ? 24.303 15.647 48.643 1.00 58.94  ? 223 ALA A CB  1 
ATOM   1356 N  N   . ASP A 1 182 ? 24.999 12.229 48.035 1.00 58.78  ? 224 ASP A N   1 
ATOM   1357 C  CA  . ASP A 1 182 ? 25.827 11.296 47.284 1.00 58.94  ? 224 ASP A CA  1 
ATOM   1358 C  C   . ASP A 1 182 ? 25.404 11.263 45.825 1.00 58.99  ? 224 ASP A C   1 
ATOM   1359 O  O   . ASP A 1 182 ? 24.211 11.281 45.516 1.00 58.79  ? 224 ASP A O   1 
ATOM   1360 C  CB  . ASP A 1 182 ? 25.754 9.885  47.889 1.00 58.98  ? 224 ASP A CB  1 
ATOM   1361 C  CG  . ASP A 1 182 ? 26.301 9.819  49.309 1.00 59.01  ? 224 ASP A CG  1 
ATOM   1362 O  OD1 . ASP A 1 182 ? 27.000 10.764 49.732 1.00 58.74  ? 224 ASP A OD1 1 
ATOM   1363 O  OD2 . ASP A 1 182 ? 26.029 8.814  50.007 1.00 60.41  ? 224 ASP A OD2 1 
ATOM   1364 N  N   . ILE A 1 183 ? 26.396 11.218 44.939 1.00 58.98  ? 225 ILE A N   1 
ATOM   1365 C  CA  . ILE A 1 183 ? 26.180 11.206 43.495 1.00 59.32  ? 225 ILE A CA  1 
ATOM   1366 C  C   . ILE A 1 183 ? 27.058 10.102 42.904 1.00 59.67  ? 225 ILE A C   1 
ATOM   1367 O  O   . ILE A 1 183 ? 28.236 9.999  43.247 1.00 59.76  ? 225 ILE A O   1 
ATOM   1368 C  CB  . ILE A 1 183 ? 26.561 12.579 42.852 1.00 59.53  ? 225 ILE A CB  1 
ATOM   1369 C  CG1 . ILE A 1 183 ? 26.039 13.755 43.688 1.00 58.97  ? 225 ILE A CG1 1 
ATOM   1370 C  CG2 . ILE A 1 183 ? 26.060 12.676 41.411 1.00 59.29  ? 225 ILE A CG2 1 
ATOM   1371 C  CD1 . ILE A 1 183 ? 26.711 15.071 43.374 1.00 59.37  ? 225 ILE A CD1 1 
ATOM   1372 N  N   . SER A 1 184 ? 26.488 9.260  42.042 1.00 59.96  ? 226 SER A N   1 
ATOM   1373 C  CA  . SER A 1 184 ? 27.262 8.194  41.400 1.00 60.25  ? 226 SER A CA  1 
ATOM   1374 C  C   . SER A 1 184 ? 26.716 7.780  40.037 1.00 60.53  ? 226 SER A C   1 
ATOM   1375 O  O   . SER A 1 184 ? 25.510 7.591  39.871 1.00 60.65  ? 226 SER A O   1 
ATOM   1376 C  CB  . SER A 1 184 ? 27.393 6.971  42.314 1.00 60.17  ? 226 SER A CB  1 
ATOM   1377 O  OG  . SER A 1 184 ? 26.160 6.292  42.448 1.00 60.92  ? 226 SER A OG  1 
ATOM   1378 N  N   . CYS A 1 185 ? 27.620 7.654  39.068 1.00 60.81  ? 227 CYS A N   1 
ATOM   1379 C  CA  . CYS A 1 185 ? 27.292 7.153  37.732 1.00 61.25  ? 227 CYS A CA  1 
ATOM   1380 C  C   . CYS A 1 185 ? 28.380 6.238  37.197 1.00 61.13  ? 227 CYS A C   1 
ATOM   1381 O  O   . CYS A 1 185 ? 29.566 6.415  37.493 1.00 61.14  ? 227 CYS A O   1 
ATOM   1382 C  CB  . CYS A 1 185 ? 27.085 8.296  36.738 1.00 61.21  ? 227 CYS A CB  1 
ATOM   1383 S  SG  . CYS A 1 185 ? 25.566 9.219  36.956 1.00 62.97  ? 227 CYS A SG  1 
ATOM   1384 N  N   . GLN A 1 186 ? 27.964 5.264  36.398 1.00 61.14  ? 228 GLN A N   1 
ATOM   1385 C  CA  . GLN A 1 186 ? 28.904 4.423  35.674 1.00 61.04  ? 228 GLN A CA  1 
ATOM   1386 C  C   . GLN A 1 186 ? 29.401 5.180  34.454 1.00 60.66  ? 228 GLN A C   1 
ATOM   1387 O  O   . GLN A 1 186 ? 28.622 5.818  33.735 1.00 60.55  ? 228 GLN A O   1 
ATOM   1388 C  CB  . GLN A 1 186 ? 28.250 3.104  35.264 1.00 61.34  ? 228 GLN A CB  1 
ATOM   1389 C  CG  . GLN A 1 186 ? 29.238 1.971  35.016 1.00 62.52  ? 228 GLN A CG  1 
ATOM   1390 C  CD  . GLN A 1 186 ? 28.627 0.610  35.261 1.00 64.86  ? 228 GLN A CD  1 
ATOM   1391 O  OE1 . GLN A 1 186 ? 27.406 0.480  35.413 1.00 66.64  ? 228 GLN A OE1 1 
ATOM   1392 N  NE2 . GLN A 1 186 ? 29.472 -0.419 35.309 1.00 65.02  ? 228 GLN A NE2 1 
ATOM   1393 N  N   . TYR A 1 187 ? 30.706 5.124  34.238 1.00 60.10  ? 229 TYR A N   1 
ATOM   1394 C  CA  . TYR A 1 187 ? 31.309 5.777  33.095 1.00 59.66  ? 229 TYR A CA  1 
ATOM   1395 C  C   . TYR A 1 187 ? 31.263 4.829  31.901 1.00 59.61  ? 229 TYR A C   1 
ATOM   1396 O  O   . TYR A 1 187 ? 31.695 3.679  31.996 1.00 59.46  ? 229 TYR A O   1 
ATOM   1397 C  CB  . TYR A 1 187 ? 32.743 6.181  33.423 1.00 59.49  ? 229 TYR A CB  1 
ATOM   1398 C  CG  . TYR A 1 187 ? 33.378 7.042  32.373 1.00 59.28  ? 229 TYR A CG  1 
ATOM   1399 C  CD1 . TYR A 1 187 ? 33.150 8.415  32.345 1.00 58.40  ? 229 TYR A CD1 1 
ATOM   1400 C  CD2 . TYR A 1 187 ? 34.206 6.485  31.401 1.00 58.87  ? 229 TYR A CD2 1 
ATOM   1401 C  CE1 . TYR A 1 187 ? 33.733 9.211  31.381 1.00 57.89  ? 229 TYR A CE1 1 
ATOM   1402 C  CE2 . TYR A 1 187 ? 34.792 7.270  30.434 1.00 58.92  ? 229 TYR A CE2 1 
ATOM   1403 C  CZ  . TYR A 1 187 ? 34.552 8.636  30.428 1.00 58.78  ? 229 TYR A CZ  1 
ATOM   1404 O  OH  . TYR A 1 187 ? 35.135 9.425  29.465 1.00 59.05  ? 229 TYR A OH  1 
ATOM   1405 N  N   . LYS A 1 188 ? 30.730 5.317  30.786 1.00 59.46  ? 230 LYS A N   1 
ATOM   1406 C  CA  . LYS A 1 188 ? 30.497 4.478  29.619 1.00 59.70  ? 230 LYS A CA  1 
ATOM   1407 C  C   . LYS A 1 188 ? 31.002 5.081  28.311 1.00 59.44  ? 230 LYS A C   1 
ATOM   1408 O  O   . LYS A 1 188 ? 30.515 4.736  27.236 1.00 59.60  ? 230 LYS A O   1 
ATOM   1409 C  CB  . LYS A 1 188 ? 29.014 4.116  29.513 1.00 59.92  ? 230 LYS A CB  1 
ATOM   1410 C  CG  . LYS A 1 188 ? 28.597 2.988  30.441 1.00 61.60  ? 230 LYS A CG  1 
ATOM   1411 C  CD  . LYS A 1 188 ? 27.101 2.732  30.391 1.00 64.07  ? 230 LYS A CD  1 
ATOM   1412 C  CE  . LYS A 1 188 ? 26.768 1.326  30.892 1.00 66.04  ? 230 LYS A CE  1 
ATOM   1413 N  NZ  . LYS A 1 188 ? 27.107 1.128  32.337 1.00 67.46  ? 230 LYS A NZ  1 
ATOM   1414 N  N   . MET A 1 189 ? 31.991 5.965  28.405 1.00 59.10  ? 231 MET A N   1 
ATOM   1415 C  CA  . MET A 1 189 ? 32.594 6.571  27.227 1.00 58.72  ? 231 MET A CA  1 
ATOM   1416 C  C   . MET A 1 189 ? 34.040 6.100  27.044 1.00 58.39  ? 231 MET A C   1 
ATOM   1417 O  O   . MET A 1 189 ? 34.514 5.212  27.759 1.00 58.02  ? 231 MET A O   1 
ATOM   1418 C  CB  . MET A 1 189 ? 32.513 8.108  27.320 1.00 59.27  ? 231 MET A CB  1 
ATOM   1419 C  CG  . MET A 1 189 ? 31.081 8.662  27.363 1.00 59.53  ? 231 MET A CG  1 
ATOM   1420 S  SD  . MET A 1 189 ? 30.180 8.317  25.841 1.00 61.00  ? 231 MET A SD  1 
ATOM   1421 C  CE  . MET A 1 189 ? 28.514 8.804  26.267 1.00 59.74  ? 231 MET A CE  1 
ATOM   1422 N  N   . TYR A 1 190 ? 34.732 6.684  26.070 1.00 58.18  ? 232 TYR A N   1 
ATOM   1423 C  CA  . TYR A 1 190 ? 36.166 6.476  25.923 1.00 57.89  ? 232 TYR A CA  1 
ATOM   1424 C  C   . TYR A 1 190 ? 36.911 7.082  27.117 1.00 58.06  ? 232 TYR A C   1 
ATOM   1425 O  O   . TYR A 1 190 ? 36.340 7.911  27.841 1.00 57.63  ? 232 TYR A O   1 
ATOM   1426 C  CB  . TYR A 1 190 ? 36.657 7.098  24.616 1.00 57.76  ? 232 TYR A CB  1 
ATOM   1427 C  CG  . TYR A 1 190 ? 36.534 6.188  23.423 1.00 57.52  ? 232 TYR A CG  1 
ATOM   1428 C  CD1 . TYR A 1 190 ? 37.445 5.150  23.219 1.00 56.79  ? 232 TYR A CD1 1 
ATOM   1429 C  CD2 . TYR A 1 190 ? 35.506 6.361  22.496 1.00 57.11  ? 232 TYR A CD2 1 
ATOM   1430 C  CE1 . TYR A 1 190 ? 37.330 4.304  22.125 1.00 56.43  ? 232 TYR A CE1 1 
ATOM   1431 C  CE2 . TYR A 1 190 ? 35.388 5.517  21.392 1.00 56.90  ? 232 TYR A CE2 1 
ATOM   1432 C  CZ  . TYR A 1 190 ? 36.302 4.497  21.216 1.00 56.53  ? 232 TYR A CZ  1 
ATOM   1433 O  OH  . TYR A 1 190 ? 36.189 3.674  20.126 1.00 57.16  ? 232 TYR A OH  1 
ATOM   1434 N  N   . PRO A 1 191 ? 38.179 6.665  27.340 1.00 58.17  ? 233 PRO A N   1 
ATOM   1435 C  CA  . PRO A 1 191 ? 38.934 7.209  28.473 1.00 58.38  ? 233 PRO A CA  1 
ATOM   1436 C  C   . PRO A 1 191 ? 39.022 8.735  28.485 1.00 58.32  ? 233 PRO A C   1 
ATOM   1437 O  O   . PRO A 1 191 ? 39.314 9.362  27.453 1.00 58.31  ? 233 PRO A O   1 
ATOM   1438 C  CB  . PRO A 1 191 ? 40.335 6.596  28.296 1.00 58.48  ? 233 PRO A CB  1 
ATOM   1439 C  CG  . PRO A 1 191 ? 40.099 5.333  27.532 1.00 58.23  ? 233 PRO A CG  1 
ATOM   1440 C  CD  . PRO A 1 191 ? 38.974 5.674  26.585 1.00 58.37  ? 233 PRO A CD  1 
ATOM   1441 N  N   . MET A 1 192 ? 38.745 9.312  29.651 1.00 58.26  ? 234 MET A N   1 
ATOM   1442 C  CA  . MET A 1 192 ? 39.012 10.726 29.916 1.00 58.55  ? 234 MET A CA  1 
ATOM   1443 C  C   . MET A 1 192 ? 40.132 10.829 30.950 1.00 57.99  ? 234 MET A C   1 
ATOM   1444 O  O   . MET A 1 192 ? 40.296 9.939  31.777 1.00 57.86  ? 234 MET A O   1 
ATOM   1445 C  CB  . MET A 1 192 ? 37.746 11.443 30.416 1.00 58.41  ? 234 MET A CB  1 
ATOM   1446 C  CG  . MET A 1 192 ? 37.312 11.096 31.852 1.00 58.50  ? 234 MET A CG  1 
ATOM   1447 S  SD  . MET A 1 192 ? 35.962 12.152 32.422 1.00 60.78  ? 234 MET A SD  1 
ATOM   1448 C  CE  . MET A 1 192 ? 35.544 11.458 34.013 1.00 60.21  ? 234 MET A CE  1 
ATOM   1449 N  N   . HIS A 1 193 ? 40.904 11.909 30.892 1.00 57.95  ? 235 HIS A N   1 
ATOM   1450 C  CA  . HIS A 1 193 ? 41.918 12.188 31.894 1.00 57.67  ? 235 HIS A CA  1 
ATOM   1451 C  C   . HIS A 1 193 ? 41.589 13.473 32.634 1.00 58.07  ? 235 HIS A C   1 
ATOM   1452 O  O   . HIS A 1 193 ? 41.533 14.552 32.041 1.00 58.11  ? 235 HIS A O   1 
ATOM   1453 C  CB  . HIS A 1 193 ? 43.306 12.272 31.270 1.00 57.22  ? 235 HIS A CB  1 
ATOM   1454 C  CG  . HIS A 1 193 ? 43.953 10.941 31.065 1.00 56.86  ? 235 HIS A CG  1 
ATOM   1455 N  ND1 . HIS A 1 193 ? 43.719 10.161 29.953 1.00 55.59  ? 235 HIS A ND1 1 
ATOM   1456 C  CD2 . HIS A 1 193 ? 44.819 10.245 31.838 1.00 55.65  ? 235 HIS A CD2 1 
ATOM   1457 C  CE1 . HIS A 1 193 ? 44.423 9.049  30.044 1.00 55.02  ? 235 HIS A CE1 1 
ATOM   1458 N  NE2 . HIS A 1 193 ? 45.100 9.075  31.177 1.00 54.77  ? 235 HIS A NE2 1 
ATOM   1459 N  N   . VAL A 1 194 ? 41.369 13.338 33.937 1.00 58.16  ? 236 VAL A N   1 
ATOM   1460 C  CA  . VAL A 1 194 ? 41.032 14.462 34.794 1.00 58.27  ? 236 VAL A CA  1 
ATOM   1461 C  C   . VAL A 1 194 ? 42.290 15.242 35.139 1.00 58.36  ? 236 VAL A C   1 
ATOM   1462 O  O   . VAL A 1 194 ? 43.240 14.684 35.693 1.00 58.42  ? 236 VAL A O   1 
ATOM   1463 C  CB  . VAL A 1 194 ? 40.382 13.978 36.098 1.00 58.38  ? 236 VAL A CB  1 
ATOM   1464 C  CG1 . VAL A 1 194 ? 40.020 15.165 36.992 1.00 59.00  ? 236 VAL A CG1 1 
ATOM   1465 C  CG2 . VAL A 1 194 ? 39.169 13.117 35.798 1.00 57.08  ? 236 VAL A CG2 1 
ATOM   1466 N  N   . PHE A 1 195 ? 42.297 16.535 34.825 1.00 58.37  ? 237 PHE A N   1 
ATOM   1467 C  CA  . PHE A 1 195 ? 43.439 17.384 35.190 1.00 58.17  ? 237 PHE A CA  1 
ATOM   1468 C  C   . PHE A 1 195 ? 43.102 18.528 36.137 1.00 57.81  ? 237 PHE A C   1 
ATOM   1469 O  O   . PHE A 1 195 ? 44.004 19.149 36.684 1.00 58.21  ? 237 PHE A O   1 
ATOM   1470 C  CB  . PHE A 1 195 ? 44.175 17.909 33.948 1.00 58.06  ? 237 PHE A CB  1 
ATOM   1471 C  CG  . PHE A 1 195 ? 43.342 18.792 33.045 1.00 58.30  ? 237 PHE A CG  1 
ATOM   1472 C  CD1 . PHE A 1 195 ? 43.340 20.180 33.210 1.00 59.35  ? 237 PHE A CD1 1 
ATOM   1473 C  CD2 . PHE A 1 195 ? 42.621 18.247 31.992 1.00 57.32  ? 237 PHE A CD2 1 
ATOM   1474 C  CE1 . PHE A 1 195 ? 42.608 21.001 32.363 1.00 58.12  ? 237 PHE A CE1 1 
ATOM   1475 C  CE2 . PHE A 1 195 ? 41.882 19.059 31.133 1.00 57.79  ? 237 PHE A CE2 1 
ATOM   1476 C  CZ  . PHE A 1 195 ? 41.878 20.434 31.319 1.00 59.15  ? 237 PHE A CZ  1 
ATOM   1477 N  N   . ALA A 1 196 ? 41.815 18.817 36.311 1.00 57.66  ? 238 ALA A N   1 
ATOM   1478 C  CA  . ALA A 1 196 ? 41.377 19.886 37.213 1.00 57.56  ? 238 ALA A CA  1 
ATOM   1479 C  C   . ALA A 1 196 ? 39.977 19.607 37.725 1.00 57.45  ? 238 ALA A C   1 
ATOM   1480 O  O   . ALA A 1 196 ? 39.234 18.832 37.128 1.00 57.91  ? 238 ALA A O   1 
ATOM   1481 C  CB  . ALA A 1 196 ? 41.429 21.260 36.516 1.00 57.34  ? 238 ALA A CB  1 
ATOM   1482 N  N   . TYR A 1 197 ? 39.614 20.256 38.825 1.00 57.29  ? 239 TYR A N   1 
ATOM   1483 C  CA  . TYR A 1 197 ? 38.290 20.104 39.415 1.00 57.28  ? 239 TYR A CA  1 
ATOM   1484 C  C   . TYR A 1 197 ? 37.910 21.366 40.186 1.00 57.06  ? 239 TYR A C   1 
ATOM   1485 O  O   . TYR A 1 197 ? 38.776 22.078 40.705 1.00 56.70  ? 239 TYR A O   1 
ATOM   1486 C  CB  . TYR A 1 197 ? 38.249 18.886 40.356 1.00 57.75  ? 239 TYR A CB  1 
ATOM   1487 C  CG  . TYR A 1 197 ? 38.985 19.127 41.651 1.00 57.91  ? 239 TYR A CG  1 
ATOM   1488 C  CD1 . TYR A 1 197 ? 40.361 18.908 41.742 1.00 58.22  ? 239 TYR A CD1 1 
ATOM   1489 C  CD2 . TYR A 1 197 ? 38.316 19.618 42.776 1.00 58.30  ? 239 TYR A CD2 1 
ATOM   1490 C  CE1 . TYR A 1 197 ? 41.053 19.154 42.935 1.00 58.86  ? 239 TYR A CE1 1 
ATOM   1491 C  CE2 . TYR A 1 197 ? 39.000 19.870 43.971 1.00 57.57  ? 239 TYR A CE2 1 
ATOM   1492 C  CZ  . TYR A 1 197 ? 40.362 19.632 44.038 1.00 58.31  ? 239 TYR A CZ  1 
ATOM   1493 O  OH  . TYR A 1 197 ? 41.044 19.871 45.212 1.00 60.04  ? 239 TYR A OH  1 
ATOM   1494 N  N   . ARG A 1 198 ? 36.610 21.611 40.257 1.00 57.05  ? 240 ARG A N   1 
ATOM   1495 C  CA  . ARG A 1 198 ? 36.028 22.724 40.996 1.00 57.36  ? 240 ARG A CA  1 
ATOM   1496 C  C   . ARG A 1 198 ? 34.836 22.188 41.788 1.00 57.00  ? 240 ARG A C   1 
ATOM   1497 O  O   . ARG A 1 198 ? 34.050 21.379 41.279 1.00 56.82  ? 240 ARG A O   1 
ATOM   1498 C  CB  . ARG A 1 198 ? 35.546 23.809 40.026 1.00 57.51  ? 240 ARG A CB  1 
ATOM   1499 C  CG  . ARG A 1 198 ? 34.944 25.034 40.693 1.00 58.09  ? 240 ARG A CG  1 
ATOM   1500 C  CD  . ARG A 1 198 ? 34.511 26.079 39.669 1.00 58.48  ? 240 ARG A CD  1 
ATOM   1501 N  NE  . ARG A 1 198 ? 33.802 27.181 40.323 1.00 61.49  ? 240 ARG A NE  1 
ATOM   1502 C  CZ  . ARG A 1 198 ? 32.475 27.302 40.348 1.00 61.75  ? 240 ARG A CZ  1 
ATOM   1503 N  NH1 . ARG A 1 198 ? 31.718 26.410 39.737 1.00 61.34  ? 240 ARG A NH1 1 
ATOM   1504 N  NH2 . ARG A 1 198 ? 31.904 28.323 40.972 1.00 62.68  ? 240 ARG A NH2 1 
ATOM   1505 N  N   . VAL A 1 199 ? 34.703 22.642 43.028 1.00 56.56  ? 241 VAL A N   1 
ATOM   1506 C  CA  . VAL A 1 199 ? 33.561 22.274 43.849 1.00 56.40  ? 241 VAL A CA  1 
ATOM   1507 C  C   . VAL A 1 199 ? 32.671 23.494 44.034 1.00 56.24  ? 241 VAL A C   1 
ATOM   1508 O  O   . VAL A 1 199 ? 33.149 24.626 44.043 1.00 56.27  ? 241 VAL A O   1 
ATOM   1509 C  CB  . VAL A 1 199 ? 33.982 21.667 45.220 1.00 56.19  ? 241 VAL A CB  1 
ATOM   1510 C  CG1 . VAL A 1 199 ? 35.043 20.594 45.024 1.00 56.00  ? 241 VAL A CG1 1 
ATOM   1511 C  CG2 . VAL A 1 199 ? 34.490 22.747 46.181 1.00 56.15  ? 241 VAL A CG2 1 
ATOM   1512 N  N   . HIS A 1 200 ? 31.372 23.264 44.151 1.00 56.25  ? 242 HIS A N   1 
ATOM   1513 C  CA  . HIS A 1 200 ? 30.446 24.358 44.379 1.00 56.03  ? 242 HIS A CA  1 
ATOM   1514 C  C   . HIS A 1 200 ? 29.323 23.947 45.301 1.00 56.23  ? 242 HIS A C   1 
ATOM   1515 O  O   . HIS A 1 200 ? 28.636 22.950 45.082 1.00 56.45  ? 242 HIS A O   1 
ATOM   1516 C  CB  . HIS A 1 200 ? 29.886 24.943 43.076 1.00 55.38  ? 242 HIS A CB  1 
ATOM   1517 C  CG  . HIS A 1 200 ? 28.839 25.996 43.295 1.00 54.85  ? 242 HIS A CG  1 
ATOM   1518 N  ND1 . HIS A 1 200 ? 29.119 27.219 43.869 1.00 54.18  ? 242 HIS A ND1 1 
ATOM   1519 C  CD2 . HIS A 1 200 ? 27.509 25.999 43.035 1.00 54.25  ? 242 HIS A CD2 1 
ATOM   1520 C  CE1 . HIS A 1 200 ? 28.009 27.933 43.944 1.00 54.40  ? 242 HIS A CE1 1 
ATOM   1521 N  NE2 . HIS A 1 200 ? 27.016 27.214 43.448 1.00 54.95  ? 242 HIS A NE2 1 
ATOM   1522 N  N   . THR A 1 201 ? 29.142 24.779 46.313 1.00 56.44  ? 243 THR A N   1 
ATOM   1523 C  CA  . THR A 1 201 ? 28.176 24.599 47.361 1.00 56.48  ? 243 THR A CA  1 
ATOM   1524 C  C   . THR A 1 201 ? 27.787 26.022 47.756 1.00 56.84  ? 243 THR A C   1 
ATOM   1525 O  O   . THR A 1 201 ? 28.485 26.968 47.391 1.00 57.00  ? 243 THR A O   1 
ATOM   1526 C  CB  . THR A 1 201 ? 28.870 23.845 48.521 1.00 56.50  ? 243 THR A CB  1 
ATOM   1527 O  OG1 . THR A 1 201 ? 28.397 22.495 48.578 1.00 57.21  ? 243 THR A OG1 1 
ATOM   1528 C  CG2 . THR A 1 201 ? 28.664 24.514 49.823 1.00 54.50  ? 243 THR A CG2 1 
ATOM   1529 N  N   . HIS A 1 202 ? 26.677 26.189 48.471 1.00 57.14  ? 244 HIS A N   1 
ATOM   1530 C  CA  . HIS A 1 202 ? 26.383 27.483 49.093 1.00 57.24  ? 244 HIS A CA  1 
ATOM   1531 C  C   . HIS A 1 202 ? 26.868 27.482 50.561 1.00 57.76  ? 244 HIS A C   1 
ATOM   1532 O  O   . HIS A 1 202 ? 27.840 26.788 50.875 1.00 57.68  ? 244 HIS A O   1 
ATOM   1533 C  CB  . HIS A 1 202 ? 24.911 27.889 48.898 1.00 57.05  ? 244 HIS A CB  1 
ATOM   1534 C  CG  . HIS A 1 202 ? 24.489 27.957 47.456 1.00 56.76  ? 244 HIS A CG  1 
ATOM   1535 N  ND1 . HIS A 1 202 ? 23.169 28.010 47.066 1.00 56.80  ? 244 HIS A ND1 1 
ATOM   1536 C  CD2 . HIS A 1 202 ? 25.216 27.957 46.313 1.00 56.28  ? 244 HIS A CD2 1 
ATOM   1537 C  CE1 . HIS A 1 202 ? 23.100 28.054 45.747 1.00 56.36  ? 244 HIS A CE1 1 
ATOM   1538 N  NE2 . HIS A 1 202 ? 24.329 28.021 45.264 1.00 57.25  ? 244 HIS A NE2 1 
ATOM   1539 N  N   . HIS A 1 203 ? 26.233 28.240 51.453 1.00 57.91  ? 245 HIS A N   1 
ATOM   1540 C  CA  . HIS A 1 203 ? 26.805 28.444 52.792 1.00 58.53  ? 245 HIS A CA  1 
ATOM   1541 C  C   . HIS A 1 203 ? 26.786 27.252 53.756 1.00 58.21  ? 245 HIS A C   1 
ATOM   1542 O  O   . HIS A 1 203 ? 27.497 27.265 54.762 1.00 58.16  ? 245 HIS A O   1 
ATOM   1543 C  CB  . HIS A 1 203 ? 26.218 29.696 53.464 1.00 59.00  ? 245 HIS A CB  1 
ATOM   1544 C  CG  . HIS A 1 203 ? 26.750 30.984 52.907 1.00 61.67  ? 245 HIS A CG  1 
ATOM   1545 N  ND1 . HIS A 1 203 ? 25.959 32.097 52.711 1.00 63.92  ? 245 HIS A ND1 1 
ATOM   1546 C  CD2 . HIS A 1 203 ? 27.994 31.330 52.491 1.00 63.25  ? 245 HIS A CD2 1 
ATOM   1547 C  CE1 . HIS A 1 203 ? 26.694 33.075 52.209 1.00 64.38  ? 245 HIS A CE1 1 
ATOM   1548 N  NE2 . HIS A 1 203 ? 27.932 32.635 52.064 1.00 64.16  ? 245 HIS A NE2 1 
ATOM   1549 N  N   . LEU A 1 204 ? 26.004 26.220 53.438 1.00 57.95  ? 246 LEU A N   1 
ATOM   1550 C  CA  . LEU A 1 204 ? 25.864 25.039 54.307 1.00 57.64  ? 246 LEU A CA  1 
ATOM   1551 C  C   . LEU A 1 204 ? 26.875 23.911 54.037 1.00 57.68  ? 246 LEU A C   1 
ATOM   1552 O  O   . LEU A 1 204 ? 27.024 22.997 54.851 1.00 57.65  ? 246 LEU A O   1 
ATOM   1553 C  CB  . LEU A 1 204 ? 24.431 24.488 54.244 1.00 57.37  ? 246 LEU A CB  1 
ATOM   1554 C  CG  . LEU A 1 204 ? 23.279 25.411 54.665 1.00 57.12  ? 246 LEU A CG  1 
ATOM   1555 C  CD1 . LEU A 1 204 ? 21.951 24.680 54.573 1.00 55.99  ? 246 LEU A CD1 1 
ATOM   1556 C  CD2 . LEU A 1 204 ? 23.484 25.985 56.079 1.00 55.97  ? 246 LEU A CD2 1 
ATOM   1557 N  N   . GLY A 1 205 ? 27.575 23.972 52.910 1.00 57.31  ? 247 GLY A N   1 
ATOM   1558 C  CA  . GLY A 1 205 ? 28.542 22.933 52.579 1.00 57.64  ? 247 GLY A CA  1 
ATOM   1559 C  C   . GLY A 1 205 ? 29.843 23.047 53.347 1.00 57.99  ? 247 GLY A C   1 
ATOM   1560 O  O   . GLY A 1 205 ? 30.382 24.146 53.527 1.00 58.07  ? 247 GLY A O   1 
ATOM   1561 N  N   . LYS A 1 206 ? 30.355 21.908 53.799 1.00 58.18  ? 248 LYS A N   1 
ATOM   1562 C  CA  . LYS A 1 206 ? 31.594 21.902 54.565 1.00 58.73  ? 248 LYS A CA  1 
ATOM   1563 C  C   . LYS A 1 206 ? 32.751 21.215 53.844 1.00 58.76  ? 248 LYS A C   1 
ATOM   1564 O  O   . LYS A 1 206 ? 33.894 21.673 53.930 1.00 59.08  ? 248 LYS A O   1 
ATOM   1565 C  CB  . LYS A 1 206 ? 31.375 21.347 55.982 1.00 58.69  ? 248 LYS A CB  1 
ATOM   1566 C  CG  . LYS A 1 206 ? 30.967 19.888 56.090 1.00 59.00  ? 248 LYS A CG  1 
ATOM   1567 C  CD  . LYS A 1 206 ? 30.496 19.585 57.514 1.00 59.41  ? 248 LYS A CD  1 
ATOM   1568 C  CE  . LYS A 1 206 ? 31.170 18.338 58.074 1.00 60.65  ? 248 LYS A CE  1 
ATOM   1569 N  NZ  . LYS A 1 206 ? 30.815 18.080 59.502 1.00 60.97  ? 248 LYS A NZ  1 
ATOM   1570 N  N   . VAL A 1 207 ? 32.455 20.133 53.129 1.00 58.63  ? 249 VAL A N   1 
ATOM   1571 C  CA  . VAL A 1 207 ? 33.464 19.427 52.345 1.00 58.69  ? 249 VAL A CA  1 
ATOM   1572 C  C   . VAL A 1 207 ? 32.821 18.763 51.125 1.00 58.67  ? 249 VAL A C   1 
ATOM   1573 O  O   . VAL A 1 207 ? 31.697 18.263 51.197 1.00 58.91  ? 249 VAL A O   1 
ATOM   1574 C  CB  . VAL A 1 207 ? 34.303 18.430 53.225 1.00 58.81  ? 249 VAL A CB  1 
ATOM   1575 C  CG1 . VAL A 1 207 ? 33.408 17.469 53.987 1.00 59.09  ? 249 VAL A CG1 1 
ATOM   1576 C  CG2 . VAL A 1 207 ? 35.352 17.679 52.399 1.00 58.77  ? 249 VAL A CG2 1 
ATOM   1577 N  N   . VAL A 1 208 ? 33.516 18.809 49.993 1.00 58.61  ? 250 VAL A N   1 
ATOM   1578 C  CA  . VAL A 1 208 ? 33.051 18.146 48.774 1.00 58.56  ? 250 VAL A CA  1 
ATOM   1579 C  C   . VAL A 1 208 ? 34.166 17.243 48.281 1.00 58.70  ? 250 VAL A C   1 
ATOM   1580 O  O   . VAL A 1 208 ? 35.319 17.666 48.215 1.00 58.78  ? 250 VAL A O   1 
ATOM   1581 C  CB  . VAL A 1 208 ? 32.654 19.165 47.677 1.00 58.55  ? 250 VAL A CB  1 
ATOM   1582 C  CG1 . VAL A 1 208 ? 32.254 18.459 46.376 1.00 58.25  ? 250 VAL A CG1 1 
ATOM   1583 C  CG2 . VAL A 1 208 ? 31.528 20.068 48.163 1.00 58.49  ? 250 VAL A CG2 1 
ATOM   1584 N  N   . SER A 1 209 ? 33.824 15.999 47.949 1.00 58.84  ? 251 SER A N   1 
ATOM   1585 C  CA  . SER A 1 209 ? 34.814 15.023 47.489 1.00 59.13  ? 251 SER A CA  1 
ATOM   1586 C  C   . SER A 1 209 ? 34.314 14.230 46.290 1.00 59.15  ? 251 SER A C   1 
ATOM   1587 O  O   . SER A 1 209 ? 33.132 13.894 46.205 1.00 59.28  ? 251 SER A O   1 
ATOM   1588 C  CB  . SER A 1 209 ? 35.184 14.057 48.615 1.00 59.24  ? 251 SER A CB  1 
ATOM   1589 O  OG  . SER A 1 209 ? 35.429 14.746 49.832 1.00 60.23  ? 251 SER A OG  1 
ATOM   1590 N  N   . GLY A 1 210 ? 35.230 13.927 45.375 1.00 58.98  ? 252 GLY A N   1 
ATOM   1591 C  CA  . GLY A 1 210 ? 34.934 13.116 44.203 1.00 58.70  ? 252 GLY A CA  1 
ATOM   1592 C  C   . GLY A 1 210 ? 35.984 12.041 44.015 1.00 58.63  ? 252 GLY A C   1 
ATOM   1593 O  O   . GLY A 1 210 ? 37.161 12.260 44.295 1.00 58.67  ? 252 GLY A O   1 
ATOM   1594 N  N   . TYR A 1 211 ? 35.555 10.879 43.539 1.00 58.47  ? 253 TYR A N   1 
ATOM   1595 C  CA  . TYR A 1 211 ? 36.431 9.721  43.405 1.00 58.56  ? 253 TYR A CA  1 
ATOM   1596 C  C   . TYR A 1 211 ? 36.156 8.985  42.110 1.00 58.71  ? 253 TYR A C   1 
ATOM   1597 O  O   . TYR A 1 211 ? 35.055 9.072  41.561 1.00 58.72  ? 253 TYR A O   1 
ATOM   1598 C  CB  . TYR A 1 211 ? 36.206 8.740  44.566 1.00 58.57  ? 253 TYR A CB  1 
ATOM   1599 C  CG  . TYR A 1 211 ? 36.544 9.283  45.934 1.00 58.39  ? 253 TYR A CG  1 
ATOM   1600 C  CD1 . TYR A 1 211 ? 35.615 10.023 46.663 1.00 57.67  ? 253 TYR A CD1 1 
ATOM   1601 C  CD2 . TYR A 1 211 ? 37.794 9.049  46.503 1.00 58.61  ? 253 TYR A CD2 1 
ATOM   1602 C  CE1 . TYR A 1 211 ? 35.927 10.531 47.916 1.00 58.35  ? 253 TYR A CE1 1 
ATOM   1603 C  CE2 . TYR A 1 211 ? 38.115 9.546  47.761 1.00 58.83  ? 253 TYR A CE2 1 
ATOM   1604 C  CZ  . TYR A 1 211 ? 37.178 10.284 48.460 1.00 58.69  ? 253 TYR A CZ  1 
ATOM   1605 O  OH  . TYR A 1 211 ? 37.495 10.775 49.701 1.00 59.22  ? 253 TYR A OH  1 
ATOM   1606 N  N   . ARG A 1 212 ? 37.167 8.268  41.626 1.00 58.94  ? 254 ARG A N   1 
ATOM   1607 C  CA  . ARG A 1 212 ? 36.964 7.205  40.653 1.00 59.12  ? 254 ARG A CA  1 
ATOM   1608 C  C   . ARG A 1 212 ? 36.998 5.897  41.427 1.00 59.23  ? 254 ARG A C   1 
ATOM   1609 O  O   . ARG A 1 212 ? 37.908 5.666  42.222 1.00 59.44  ? 254 ARG A O   1 
ATOM   1610 C  CB  . ARG A 1 212 ? 38.052 7.217  39.578 1.00 59.38  ? 254 ARG A CB  1 
ATOM   1611 C  CG  . ARG A 1 212 ? 38.013 6.012  38.628 1.00 59.40  ? 254 ARG A CG  1 
ATOM   1612 C  CD  . ARG A 1 212 ? 39.363 5.790  37.962 1.00 58.52  ? 254 ARG A CD  1 
ATOM   1613 N  NE  . ARG A 1 212 ? 40.332 5.194  38.873 1.00 57.84  ? 254 ARG A NE  1 
ATOM   1614 C  CZ  . ARG A 1 212 ? 41.651 5.180  38.691 1.00 57.29  ? 254 ARG A CZ  1 
ATOM   1615 N  NH1 . ARG A 1 212 ? 42.204 5.753  37.626 1.00 55.69  ? 254 ARG A NH1 1 
ATOM   1616 N  NH2 . ARG A 1 212 ? 42.424 4.592  39.594 1.00 56.33  ? 254 ARG A NH2 1 
ATOM   1617 N  N   . VAL A 1 213 ? 35.982 5.065  41.218 1.00 59.25  ? 255 VAL A N   1 
ATOM   1618 C  CA  . VAL A 1 213 ? 35.906 3.755  41.847 1.00 59.14  ? 255 VAL A CA  1 
ATOM   1619 C  C   . VAL A 1 213 ? 36.113 2.693  40.774 1.00 59.24  ? 255 VAL A C   1 
ATOM   1620 O  O   . VAL A 1 213 ? 35.352 2.616  39.804 1.00 59.15  ? 255 VAL A O   1 
ATOM   1621 C  CB  . VAL A 1 213 ? 34.554 3.533  42.585 1.00 59.16  ? 255 VAL A CB  1 
ATOM   1622 C  CG1 . VAL A 1 213 ? 34.648 2.337  43.504 1.00 58.31  ? 255 VAL A CG1 1 
ATOM   1623 C  CG2 . VAL A 1 213 ? 34.150 4.781  43.384 1.00 58.81  ? 255 VAL A CG2 1 
ATOM   1624 N  N   . ARG A 1 214 ? 37.162 1.896  40.943 1.00 59.42  ? 256 ARG A N   1 
ATOM   1625 C  CA  . ARG A 1 214 ? 37.505 0.850  39.988 1.00 59.64  ? 256 ARG A CA  1 
ATOM   1626 C  C   . ARG A 1 214 ? 37.715 -0.452 40.735 1.00 60.40  ? 256 ARG A C   1 
ATOM   1627 O  O   . ARG A 1 214 ? 38.706 -0.609 41.455 1.00 60.55  ? 256 ARG A O   1 
ATOM   1628 C  CB  . ARG A 1 214 ? 38.764 1.230  39.202 1.00 59.68  ? 256 ARG A CB  1 
ATOM   1629 C  CG  . ARG A 1 214 ? 39.195 0.209  38.151 1.00 58.99  ? 256 ARG A CG  1 
ATOM   1630 C  CD  . ARG A 1 214 ? 40.411 0.698  37.381 1.00 58.67  ? 256 ARG A CD  1 
ATOM   1631 N  NE  . ARG A 1 214 ? 40.100 1.856  36.546 1.00 55.72  ? 256 ARG A NE  1 
ATOM   1632 C  CZ  . ARG A 1 214 ? 41.003 2.671  36.004 1.00 55.56  ? 256 ARG A CZ  1 
ATOM   1633 N  NH1 . ARG A 1 214 ? 42.300 2.470  36.203 1.00 54.36  ? 256 ARG A NH1 1 
ATOM   1634 N  NH2 . ARG A 1 214 ? 40.604 3.701  35.257 1.00 54.64  ? 256 ARG A NH2 1 
ATOM   1635 N  N   . ASN A 1 215 ? 36.772 -1.376 40.558 1.00 61.12  ? 257 ASN A N   1 
ATOM   1636 C  CA  . ASN A 1 215 ? 36.761 -2.657 41.272 1.00 61.79  ? 257 ASN A CA  1 
ATOM   1637 C  C   . ASN A 1 215 ? 36.793 -2.497 42.797 1.00 61.96  ? 257 ASN A C   1 
ATOM   1638 O  O   . ASN A 1 215 ? 37.549 -3.179 43.492 1.00 62.00  ? 257 ASN A O   1 
ATOM   1639 C  CB  . ASN A 1 215 ? 37.887 -3.574 40.771 1.00 62.03  ? 257 ASN A CB  1 
ATOM   1640 C  CG  . ASN A 1 215 ? 37.728 -3.943 39.302 1.00 63.07  ? 257 ASN A CG  1 
ATOM   1641 O  OD1 . ASN A 1 215 ? 36.701 -4.497 38.898 1.00 64.48  ? 257 ASN A OD1 1 
ATOM   1642 N  ND2 . ASN A 1 215 ? 38.745 -3.640 38.498 1.00 63.33  ? 257 ASN A ND2 1 
ATOM   1643 N  N   . GLY A 1 216 ? 35.972 -1.574 43.299 1.00 62.21  ? 258 GLY A N   1 
ATOM   1644 C  CA  . GLY A 1 216 ? 35.836 -1.336 44.736 1.00 62.53  ? 258 GLY A CA  1 
ATOM   1645 C  C   . GLY A 1 216 ? 36.862 -0.407 45.364 1.00 62.82  ? 258 GLY A C   1 
ATOM   1646 O  O   . GLY A 1 216 ? 36.752 -0.071 46.544 1.00 62.94  ? 258 GLY A O   1 
ATOM   1647 N  N   . GLN A 1 217 ? 37.857 0.011  44.581 1.00 62.98  ? 259 GLN A N   1 
ATOM   1648 C  CA  . GLN A 1 217 ? 38.933 0.873  45.078 1.00 63.19  ? 259 GLN A CA  1 
ATOM   1649 C  C   . GLN A 1 217 ? 38.680 2.351  44.763 1.00 62.83  ? 259 GLN A C   1 
ATOM   1650 O  O   . GLN A 1 217 ? 38.441 2.719  43.611 1.00 63.01  ? 259 GLN A O   1 
ATOM   1651 C  CB  . GLN A 1 217 ? 40.289 0.419  44.521 1.00 63.23  ? 259 GLN A CB  1 
ATOM   1652 C  CG  . GLN A 1 217 ? 41.470 1.297  44.934 1.00 63.76  ? 259 GLN A CG  1 
ATOM   1653 C  CD  . GLN A 1 217 ? 42.792 0.822  44.357 1.00 63.91  ? 259 GLN A CD  1 
ATOM   1654 O  OE1 . GLN A 1 217 ? 43.315 -0.227 44.745 1.00 64.43  ? 259 GLN A OE1 1 
ATOM   1655 N  NE2 . GLN A 1 217 ? 43.349 1.605  43.437 1.00 64.17  ? 259 GLN A NE2 1 
ATOM   1656 N  N   . TRP A 1 218 ? 38.747 3.184  45.800 1.00 62.50  ? 260 TRP A N   1 
ATOM   1657 C  CA  . TRP A 1 218 ? 38.476 4.613  45.692 1.00 62.21  ? 260 TRP A CA  1 
ATOM   1658 C  C   . TRP A 1 218 ? 39.753 5.415  45.431 1.00 62.09  ? 260 TRP A C   1 
ATOM   1659 O  O   . TRP A 1 218 ? 40.619 5.523  46.305 1.00 61.99  ? 260 TRP A O   1 
ATOM   1660 C  CB  . TRP A 1 218 ? 37.793 5.133  46.963 1.00 62.16  ? 260 TRP A CB  1 
ATOM   1661 C  CG  . TRP A 1 218 ? 36.440 4.541  47.255 1.00 62.11  ? 260 TRP A CG  1 
ATOM   1662 C  CD1 . TRP A 1 218 ? 36.178 3.288  47.738 1.00 62.09  ? 260 TRP A CD1 1 
ATOM   1663 C  CD2 . TRP A 1 218 ? 35.169 5.188  47.114 1.00 61.85  ? 260 TRP A CD2 1 
ATOM   1664 N  NE1 . TRP A 1 218 ? 34.822 3.112  47.893 1.00 61.89  ? 260 TRP A NE1 1 
ATOM   1665 C  CE2 . TRP A 1 218 ? 34.179 4.261  47.517 1.00 61.97  ? 260 TRP A CE2 1 
ATOM   1666 C  CE3 . TRP A 1 218 ? 34.768 6.457  46.679 1.00 61.84  ? 260 TRP A CE3 1 
ATOM   1667 C  CZ2 . TRP A 1 218 ? 32.813 4.564  47.497 1.00 61.90  ? 260 TRP A CZ2 1 
ATOM   1668 C  CZ3 . TRP A 1 218 ? 33.410 6.761  46.661 1.00 62.12  ? 260 TRP A CZ3 1 
ATOM   1669 C  CH2 . TRP A 1 218 ? 32.447 5.815  47.070 1.00 62.16  ? 260 TRP A CH2 1 
ATOM   1670 N  N   . THR A 1 219 ? 39.854 5.971  44.225 1.00 61.80  ? 261 THR A N   1 
ATOM   1671 C  CA  . THR A 1 219 ? 40.957 6.853  43.845 1.00 61.65  ? 261 THR A CA  1 
ATOM   1672 C  C   . THR A 1 219 ? 40.472 8.304  43.896 1.00 61.59  ? 261 THR A C   1 
ATOM   1673 O  O   . THR A 1 219 ? 39.511 8.664  43.216 1.00 61.55  ? 261 THR A O   1 
ATOM   1674 C  CB  . THR A 1 219 ? 41.482 6.515  42.420 1.00 61.77  ? 261 THR A CB  1 
ATOM   1675 O  OG1 . THR A 1 219 ? 41.806 5.120  42.344 1.00 61.82  ? 261 THR A OG1 1 
ATOM   1676 C  CG2 . THR A 1 219 ? 42.719 7.342  42.067 1.00 61.39  ? 261 THR A CG2 1 
ATOM   1677 N  N   . LEU A 1 220 ? 41.135 9.130  44.702 1.00 61.45  ? 262 LEU A N   1 
ATOM   1678 C  CA  . LEU A 1 220 ? 40.731 10.520 44.879 1.00 61.64  ? 262 LEU A CA  1 
ATOM   1679 C  C   . LEU A 1 220 ? 40.979 11.375 43.631 1.00 61.82  ? 262 LEU A C   1 
ATOM   1680 O  O   . LEU A 1 220 ? 42.084 11.397 43.080 1.00 61.78  ? 262 LEU A O   1 
ATOM   1681 C  CB  . LEU A 1 220 ? 41.410 11.147 46.106 1.00 61.53  ? 262 LEU A CB  1 
ATOM   1682 C  CG  . LEU A 1 220 ? 41.060 12.616 46.405 1.00 61.84  ? 262 LEU A CG  1 
ATOM   1683 C  CD1 . LEU A 1 220 ? 39.626 12.761 46.906 1.00 61.78  ? 262 LEU A CD1 1 
ATOM   1684 C  CD2 . LEU A 1 220 ? 42.036 13.239 47.398 1.00 61.57  ? 262 LEU A CD2 1 
ATOM   1685 N  N   . ILE A 1 221 ? 39.933 12.064 43.187 1.00 61.84  ? 263 ILE A N   1 
ATOM   1686 C  CA  . ILE A 1 221 ? 40.054 13.038 42.106 1.00 61.82  ? 263 ILE A CA  1 
ATOM   1687 C  C   . ILE A 1 221 ? 40.281 14.416 42.727 1.00 62.03  ? 263 ILE A C   1 
ATOM   1688 O  O   . ILE A 1 221 ? 41.243 15.111 42.393 1.00 62.20  ? 263 ILE A O   1 
ATOM   1689 C  CB  . ILE A 1 221 ? 38.806 13.046 41.186 1.00 62.02  ? 263 ILE A CB  1 
ATOM   1690 C  CG1 . ILE A 1 221 ? 38.694 11.723 40.417 1.00 61.40  ? 263 ILE A CG1 1 
ATOM   1691 C  CG2 . ILE A 1 221 ? 38.842 14.256 40.226 1.00 61.84  ? 263 ILE A CG2 1 
ATOM   1692 C  CD1 . ILE A 1 221 ? 37.344 11.499 39.732 1.00 61.40  ? 263 ILE A CD1 1 
ATOM   1693 N  N   . GLY A 1 222 ? 39.398 14.790 43.647 1.00 62.14  ? 264 GLY A N   1 
ATOM   1694 C  CA  . GLY A 1 222 ? 39.496 16.065 44.340 1.00 62.44  ? 264 GLY A CA  1 
ATOM   1695 C  C   . GLY A 1 222 ? 38.625 16.107 45.577 1.00 62.61  ? 264 GLY A C   1 
ATOM   1696 O  O   . GLY A 1 222 ? 37.585 15.459 45.641 1.00 62.80  ? 264 GLY A O   1 
ATOM   1697 N  N   . ARG A 1 223 ? 39.060 16.891 46.553 1.00 63.02  ? 265 ARG A N   1 
ATOM   1698 C  CA  . ARG A 1 223 ? 38.396 17.021 47.839 1.00 63.55  ? 265 ARG A CA  1 
ATOM   1699 C  C   . ARG A 1 223 ? 38.716 18.420 48.339 1.00 63.67  ? 265 ARG A C   1 
ATOM   1700 O  O   . ARG A 1 223 ? 39.882 18.782 48.474 1.00 63.75  ? 265 ARG A O   1 
ATOM   1701 C  CB  . ARG A 1 223 ? 38.914 15.948 48.799 1.00 63.39  ? 265 ARG A CB  1 
ATOM   1702 C  CG  . ARG A 1 223 ? 38.462 16.076 50.241 1.00 64.24  ? 265 ARG A CG  1 
ATOM   1703 C  CD  . ARG A 1 223 ? 39.054 14.946 51.079 1.00 64.06  ? 265 ARG A CD  1 
ATOM   1704 N  NE  . ARG A 1 223 ? 38.963 15.207 52.512 1.00 65.10  ? 265 ARG A NE  1 
ATOM   1705 C  CZ  . ARG A 1 223 ? 39.957 15.692 53.254 1.00 65.56  ? 265 ARG A CZ  1 
ATOM   1706 N  NH1 . ARG A 1 223 ? 41.133 15.982 52.705 1.00 65.44  ? 265 ARG A NH1 1 
ATOM   1707 N  NH2 . ARG A 1 223 ? 39.773 15.888 54.555 1.00 65.55  ? 265 ARG A NH2 1 
ATOM   1708 N  N   . GLN A 1 224 ? 37.685 19.216 48.583 1.00 64.04  ? 266 GLN A N   1 
ATOM   1709 C  CA  . GLN A 1 224 ? 37.886 20.631 48.876 1.00 64.42  ? 266 GLN A CA  1 
ATOM   1710 C  C   . GLN A 1 224 ? 36.806 21.176 49.810 1.00 64.33  ? 266 GLN A C   1 
ATOM   1711 O  O   . GLN A 1 224 ? 35.667 20.705 49.804 1.00 64.17  ? 266 GLN A O   1 
ATOM   1712 C  CB  . GLN A 1 224 ? 37.953 21.439 47.564 1.00 64.73  ? 266 GLN A CB  1 
ATOM   1713 C  CG  . GLN A 1 224 ? 38.369 22.920 47.682 1.00 66.30  ? 266 GLN A CG  1 
ATOM   1714 C  CD  . GLN A 1 224 ? 39.813 23.118 48.160 1.00 68.61  ? 266 GLN A CD  1 
ATOM   1715 O  OE1 . GLN A 1 224 ? 40.707 23.441 47.367 1.00 69.30  ? 266 GLN A OE1 1 
ATOM   1716 N  NE2 . GLN A 1 224 ? 40.042 22.927 49.456 1.00 68.83  ? 266 GLN A NE2 1 
ATOM   1717 N  N   . ASN A 1 225 ? 37.206 22.138 50.640 1.00 64.13  ? 267 ASN A N   1 
ATOM   1718 C  CA  . ASN A 1 225 ? 36.292 22.973 51.391 1.00 64.03  ? 267 ASN A CA  1 
ATOM   1719 C  C   . ASN A 1 225 ? 35.662 23.956 50.412 1.00 63.89  ? 267 ASN A C   1 
ATOM   1720 O  O   . ASN A 1 225 ? 36.362 24.803 49.847 1.00 64.15  ? 267 ASN A O   1 
ATOM   1721 C  CB  . ASN A 1 225 ? 37.054 23.716 52.493 1.00 64.23  ? 267 ASN A CB  1 
ATOM   1722 C  CG  . ASN A 1 225 ? 36.151 24.545 53.404 1.00 64.73  ? 267 ASN A CG  1 
ATOM   1723 O  OD1 . ASN A 1 225 ? 34.953 24.716 53.160 1.00 65.23  ? 267 ASN A OD1 1 
ATOM   1724 N  ND2 . ASN A 1 225 ? 36.740 25.069 54.471 1.00 65.71  ? 267 ASN A ND2 1 
ATOM   1725 N  N   . PRO A 1 226 ? 34.339 23.843 50.193 1.00 63.43  ? 268 PRO A N   1 
ATOM   1726 C  CA  . PRO A 1 226 ? 33.651 24.702 49.232 1.00 63.27  ? 268 PRO A CA  1 
ATOM   1727 C  C   . PRO A 1 226 ? 33.519 26.160 49.687 1.00 63.11  ? 268 PRO A C   1 
ATOM   1728 O  O   . PRO A 1 226 ? 33.129 27.019 48.890 1.00 63.06  ? 268 PRO A O   1 
ATOM   1729 C  CB  . PRO A 1 226 ? 32.279 24.044 49.107 1.00 63.17  ? 268 PRO A CB  1 
ATOM   1730 C  CG  . PRO A 1 226 ? 32.071 23.387 50.422 1.00 63.24  ? 268 PRO A CG  1 
ATOM   1731 C  CD  . PRO A 1 226 ? 33.415 22.892 50.836 1.00 63.38  ? 268 PRO A CD  1 
ATOM   1732 N  N   . GLN A 1 227 ? 33.849 26.428 50.951 1.00 62.88  ? 269 GLN A N   1 
ATOM   1733 C  CA  . GLN A 1 227 ? 33.868 27.793 51.491 1.00 62.83  ? 269 GLN A CA  1 
ATOM   1734 C  C   . GLN A 1 227 ? 35.173 28.529 51.160 1.00 62.86  ? 269 GLN A C   1 
ATOM   1735 O  O   . GLN A 1 227 ? 35.271 29.748 51.321 1.00 62.74  ? 269 GLN A O   1 
ATOM   1736 C  CB  . GLN A 1 227 ? 33.609 27.789 53.006 1.00 62.44  ? 269 GLN A CB  1 
ATOM   1737 C  CG  . GLN A 1 227 ? 32.314 27.076 53.426 1.00 62.29  ? 269 GLN A CG  1 
ATOM   1738 C  CD  . GLN A 1 227 ? 31.103 27.485 52.592 1.00 61.60  ? 269 GLN A CD  1 
ATOM   1739 O  OE1 . GLN A 1 227 ? 30.928 28.657 52.257 1.00 61.98  ? 269 GLN A OE1 1 
ATOM   1740 N  NE2 . GLN A 1 227 ? 30.264 26.515 52.255 1.00 60.23  ? 269 GLN A NE2 1 
ATOM   1741 N  N   . LEU A 1 228 ? 36.169 27.769 50.713 1.00 62.90  ? 270 LEU A N   1 
ATOM   1742 C  CA  . LEU A 1 228 ? 37.400 28.322 50.175 1.00 63.17  ? 270 LEU A CA  1 
ATOM   1743 C  C   . LEU A 1 228 ? 37.117 28.735 48.732 1.00 62.88  ? 270 LEU A C   1 
ATOM   1744 O  O   . LEU A 1 228 ? 36.186 28.202 48.121 1.00 62.99  ? 270 LEU A O   1 
ATOM   1745 C  CB  . LEU A 1 228 ? 38.497 27.258 50.213 1.00 63.05  ? 270 LEU A CB  1 
ATOM   1746 C  CG  . LEU A 1 228 ? 39.498 27.145 51.370 1.00 64.17  ? 270 LEU A CG  1 
ATOM   1747 C  CD1 . LEU A 1 228 ? 38.960 27.575 52.735 1.00 64.47  ? 270 LEU A CD1 1 
ATOM   1748 C  CD2 . LEU A 1 228 ? 40.031 25.722 51.424 1.00 63.89  ? 270 LEU A CD2 1 
ATOM   1749 N  N   . PRO A 1 229 ? 37.894 29.694 48.184 1.00 62.79  ? 271 PRO A N   1 
ATOM   1750 C  CA  . PRO A 1 229 ? 37.729 30.116 46.784 1.00 62.58  ? 271 PRO A CA  1 
ATOM   1751 C  C   . PRO A 1 229 ? 37.404 28.950 45.838 1.00 62.73  ? 271 PRO A C   1 
ATOM   1752 O  O   . PRO A 1 229 ? 38.080 27.918 45.877 1.00 62.88  ? 271 PRO A O   1 
ATOM   1753 C  CB  . PRO A 1 229 ? 39.092 30.708 46.446 1.00 62.68  ? 271 PRO A CB  1 
ATOM   1754 C  CG  . PRO A 1 229 ? 39.575 31.293 47.757 1.00 62.38  ? 271 PRO A CG  1 
ATOM   1755 C  CD  . PRO A 1 229 ? 38.970 30.452 48.859 1.00 62.70  ? 271 PRO A CD  1 
ATOM   1756 N  N   . GLN A 1 230 ? 36.374 29.121 45.010 1.00 62.43  ? 272 GLN A N   1 
ATOM   1757 C  CA  . GLN A 1 230 ? 35.895 28.053 44.128 1.00 62.58  ? 272 GLN A CA  1 
ATOM   1758 C  C   . GLN A 1 230 ? 36.497 28.143 42.725 1.00 62.65  ? 272 GLN A C   1 
ATOM   1759 O  O   . GLN A 1 230 ? 35.793 28.311 41.718 1.00 62.81  ? 272 GLN A O   1 
ATOM   1760 C  CB  . GLN A 1 230 ? 34.358 28.001 44.107 1.00 62.49  ? 272 GLN A CB  1 
ATOM   1761 C  CG  . GLN A 1 230 ? 33.768 27.552 45.447 1.00 62.59  ? 272 GLN A CG  1 
ATOM   1762 C  CD  . GLN A 1 230 ? 32.256 27.688 45.534 1.00 62.55  ? 272 GLN A CD  1 
ATOM   1763 O  OE1 . GLN A 1 230 ? 31.601 28.131 44.594 1.00 63.54  ? 272 GLN A OE1 1 
ATOM   1764 N  NE2 . GLN A 1 230 ? 31.697 27.298 46.671 1.00 61.39  ? 272 GLN A NE2 1 
ATOM   1765 N  N   . ALA A 1 231 ? 37.822 28.035 42.690 1.00 62.44  ? 273 ALA A N   1 
ATOM   1766 C  CA  . ALA A 1 231 ? 38.581 27.988 41.456 1.00 62.17  ? 273 ALA A CA  1 
ATOM   1767 C  C   . ALA A 1 231 ? 38.696 26.540 41.002 1.00 62.19  ? 273 ALA A C   1 
ATOM   1768 O  O   . ALA A 1 231 ? 38.364 25.618 41.749 1.00 62.18  ? 273 ALA A O   1 
ATOM   1769 C  CB  . ALA A 1 231 ? 39.973 28.577 41.680 1.00 61.70  ? 273 ALA A CB  1 
ATOM   1770 N  N   . PHE A 1 232 ? 39.161 26.344 39.776 1.00 62.05  ? 274 PHE A N   1 
ATOM   1771 C  CA  . PHE A 1 232 ? 39.618 25.035 39.353 1.00 62.26  ? 274 PHE A CA  1 
ATOM   1772 C  C   . PHE A 1 232 ? 41.000 24.771 39.952 1.00 62.73  ? 274 PHE A C   1 
ATOM   1773 O  O   . PHE A 1 232 ? 41.954 25.512 39.707 1.00 62.84  ? 274 PHE A O   1 
ATOM   1774 C  CB  . PHE A 1 232 ? 39.618 24.916 37.821 1.00 61.62  ? 274 PHE A CB  1 
ATOM   1775 C  CG  . PHE A 1 232 ? 38.280 24.551 37.252 1.00 61.33  ? 274 PHE A CG  1 
ATOM   1776 C  CD1 . PHE A 1 232 ? 37.842 23.225 37.268 1.00 60.30  ? 274 PHE A CD1 1 
ATOM   1777 C  CD2 . PHE A 1 232 ? 37.443 25.530 36.718 1.00 60.53  ? 274 PHE A CD2 1 
ATOM   1778 C  CE1 . PHE A 1 232 ? 36.597 22.878 36.752 1.00 59.88  ? 274 PHE A CE1 1 
ATOM   1779 C  CE2 . PHE A 1 232 ? 36.200 25.200 36.202 1.00 59.39  ? 274 PHE A CE2 1 
ATOM   1780 C  CZ  . PHE A 1 232 ? 35.769 23.868 36.215 1.00 59.85  ? 274 PHE A CZ  1 
ATOM   1781 N  N   . TYR A 1 233 ? 41.078 23.736 40.779 1.00 63.32  ? 275 TYR A N   1 
ATOM   1782 C  CA  . TYR A 1 233 ? 42.332 23.309 41.382 1.00 63.62  ? 275 TYR A CA  1 
ATOM   1783 C  C   . TYR A 1 233 ? 42.847 22.127 40.573 1.00 64.29  ? 275 TYR A C   1 
ATOM   1784 O  O   . TYR A 1 233 ? 42.049 21.307 40.127 1.00 63.63  ? 275 TYR A O   1 
ATOM   1785 C  CB  . TYR A 1 233 ? 42.122 22.913 42.847 1.00 63.39  ? 275 TYR A CB  1 
ATOM   1786 C  CG  . TYR A 1 233 ? 41.748 24.083 43.734 1.00 63.63  ? 275 TYR A CG  1 
ATOM   1787 C  CD1 . TYR A 1 233 ? 42.732 24.928 44.268 1.00 63.25  ? 275 TYR A CD1 1 
ATOM   1788 C  CD2 . TYR A 1 233 ? 40.417 24.356 44.029 1.00 63.32  ? 275 TYR A CD2 1 
ATOM   1789 C  CE1 . TYR A 1 233 ? 42.390 26.013 45.072 1.00 63.03  ? 275 TYR A CE1 1 
ATOM   1790 C  CE2 . TYR A 1 233 ? 40.066 25.439 44.835 1.00 63.49  ? 275 TYR A CE2 1 
ATOM   1791 C  CZ  . TYR A 1 233 ? 41.054 26.260 45.352 1.00 63.37  ? 275 TYR A CZ  1 
ATOM   1792 O  OH  . TYR A 1 233 ? 40.701 27.325 46.150 1.00 63.46  ? 275 TYR A OH  1 
ATOM   1793 N  N   . PRO A 1 234 ? 44.182 22.049 40.360 1.00 65.24  ? 276 PRO A N   1 
ATOM   1794 C  CA  . PRO A 1 234 ? 44.743 20.933 39.598 1.00 65.95  ? 276 PRO A CA  1 
ATOM   1795 C  C   . PRO A 1 234 ? 44.620 19.634 40.381 1.00 66.77  ? 276 PRO A C   1 
ATOM   1796 O  O   . PRO A 1 234 ? 44.541 19.661 41.605 1.00 66.86  ? 276 PRO A O   1 
ATOM   1797 C  CB  . PRO A 1 234 ? 46.215 21.325 39.425 1.00 66.01  ? 276 PRO A CB  1 
ATOM   1798 C  CG  . PRO A 1 234 ? 46.506 22.236 40.574 1.00 65.55  ? 276 PRO A CG  1 
ATOM   1799 C  CD  . PRO A 1 234 ? 45.228 22.982 40.828 1.00 65.14  ? 276 PRO A CD  1 
ATOM   1800 N  N   . VAL A 1 235 ? 44.582 18.508 39.680 1.00 68.00  ? 277 VAL A N   1 
ATOM   1801 C  CA  . VAL A 1 235 ? 44.543 17.209 40.345 1.00 69.22  ? 277 VAL A CA  1 
ATOM   1802 C  C   . VAL A 1 235 ? 45.976 16.839 40.759 1.00 70.13  ? 277 VAL A C   1 
ATOM   1803 O  O   . VAL A 1 235 ? 46.936 17.179 40.057 1.00 70.42  ? 277 VAL A O   1 
ATOM   1804 C  CB  . VAL A 1 235 ? 43.839 16.140 39.450 1.00 69.22  ? 277 VAL A CB  1 
ATOM   1805 C  CG1 . VAL A 1 235 ? 43.893 14.764 40.060 1.00 69.81  ? 277 VAL A CG1 1 
ATOM   1806 C  CG2 . VAL A 1 235 ? 42.390 16.514 39.254 1.00 68.72  ? 277 VAL A CG2 1 
ATOM   1807 N  N   . GLU A 1 236 ? 46.122 16.191 41.916 1.00 71.14  ? 278 GLU A N   1 
ATOM   1808 C  CA  . GLU A 1 236 ? 47.445 15.809 42.430 1.00 72.02  ? 278 GLU A CA  1 
ATOM   1809 C  C   . GLU A 1 236 ? 48.142 14.803 41.505 1.00 72.20  ? 278 GLU A C   1 
ATOM   1810 O  O   . GLU A 1 236 ? 49.349 14.893 41.280 1.00 72.49  ? 278 GLU A O   1 
ATOM   1811 C  CB  . GLU A 1 236 ? 47.344 15.259 43.857 1.00 71.95  ? 278 GLU A CB  1 
ATOM   1812 C  CG  . GLU A 1 236 ? 48.679 15.203 44.614 1.00 72.68  ? 278 GLU A CG  1 
ATOM   1813 C  CD  . GLU A 1 236 ? 48.540 14.713 46.052 1.00 72.96  ? 278 GLU A CD  1 
ATOM   1814 O  OE1 . GLU A 1 236 ? 47.392 14.577 46.537 1.00 74.90  ? 278 GLU A OE1 1 
ATOM   1815 O  OE2 . GLU A 1 236 ? 49.585 14.465 46.703 1.00 74.08  ? 278 GLU A OE2 1 
ATOM   1816 N  N   . HIS A 1 237 ? 47.369 13.861 40.969 1.00 72.43  ? 279 HIS A N   1 
ATOM   1817 C  CA  . HIS A 1 237 ? 47.862 12.875 40.008 1.00 72.32  ? 279 HIS A CA  1 
ATOM   1818 C  C   . HIS A 1 237 ? 46.828 12.748 38.888 1.00 71.94  ? 279 HIS A C   1 
ATOM   1819 O  O   . HIS A 1 237 ? 45.659 12.509 39.176 1.00 71.76  ? 279 HIS A O   1 
ATOM   1820 C  CB  . HIS A 1 237 ? 48.040 11.507 40.682 1.00 72.54  ? 279 HIS A CB  1 
ATOM   1821 C  CG  . HIS A 1 237 ? 48.945 11.519 41.880 1.00 73.43  ? 279 HIS A CG  1 
ATOM   1822 N  ND1 . HIS A 1 237 ? 48.498 11.821 43.149 1.00 73.94  ? 279 HIS A ND1 1 
ATOM   1823 C  CD2 . HIS A 1 237 ? 50.265 11.238 42.005 1.00 74.04  ? 279 HIS A CD2 1 
ATOM   1824 C  CE1 . HIS A 1 237 ? 49.506 11.740 44.000 1.00 74.22  ? 279 HIS A CE1 1 
ATOM   1825 N  NE2 . HIS A 1 237 ? 50.590 11.388 43.332 1.00 74.17  ? 279 HIS A NE2 1 
ATOM   1826 N  N   . PRO A 1 238 ? 47.247 12.894 37.610 1.00 71.49  ? 280 PRO A N   1 
ATOM   1827 C  CA  . PRO A 1 238 ? 46.258 12.825 36.529 1.00 71.05  ? 280 PRO A CA  1 
ATOM   1828 C  C   . PRO A 1 238 ? 45.527 11.479 36.566 1.00 70.40  ? 280 PRO A C   1 
ATOM   1829 O  O   . PRO A 1 238 ? 46.163 10.424 36.482 1.00 70.52  ? 280 PRO A O   1 
ATOM   1830 C  CB  . PRO A 1 238 ? 47.105 12.959 35.257 1.00 71.36  ? 280 PRO A CB  1 
ATOM   1831 C  CG  . PRO A 1 238 ? 48.371 13.584 35.689 1.00 71.28  ? 280 PRO A CG  1 
ATOM   1832 C  CD  . PRO A 1 238 ? 48.613 13.085 37.090 1.00 71.83  ? 280 PRO A CD  1 
ATOM   1833 N  N   . VAL A 1 239 ? 44.206 11.531 36.729 1.00 69.25  ? 281 VAL A N   1 
ATOM   1834 C  CA  . VAL A 1 239 ? 43.396 10.337 36.957 1.00 67.91  ? 281 VAL A CA  1 
ATOM   1835 C  C   . VAL A 1 239 ? 42.604 10.014 35.704 1.00 66.98  ? 281 VAL A C   1 
ATOM   1836 O  O   . VAL A 1 239 ? 41.788 10.823 35.250 1.00 66.80  ? 281 VAL A O   1 
ATOM   1837 C  CB  . VAL A 1 239 ? 42.404 10.515 38.159 1.00 68.08  ? 281 VAL A CB  1 
ATOM   1838 C  CG1 . VAL A 1 239 ? 41.502 9.295  38.313 1.00 67.42  ? 281 VAL A CG1 1 
ATOM   1839 C  CG2 . VAL A 1 239 ? 43.151 10.773 39.454 1.00 67.82  ? 281 VAL A CG2 1 
ATOM   1840 N  N   . ASP A 1 240 ? 42.847 8.834  35.147 1.00 65.70  ? 282 ASP A N   1 
ATOM   1841 C  CA  . ASP A 1 240 ? 42.073 8.366  34.011 1.00 64.84  ? 282 ASP A CA  1 
ATOM   1842 C  C   . ASP A 1 240 ? 40.801 7.678  34.492 1.00 64.26  ? 282 ASP A C   1 
ATOM   1843 O  O   . ASP A 1 240 ? 40.810 6.951  35.486 1.00 63.72  ? 282 ASP A O   1 
ATOM   1844 C  CB  . ASP A 1 240 ? 42.888 7.416  33.133 1.00 64.89  ? 282 ASP A CB  1 
ATOM   1845 C  CG  . ASP A 1 240 ? 43.224 6.121  33.838 1.00 65.42  ? 282 ASP A CG  1 
ATOM   1846 O  OD1 . ASP A 1 240 ? 44.131 6.128  34.696 1.00 66.25  ? 282 ASP A OD1 1 
ATOM   1847 O  OD2 . ASP A 1 240 ? 42.572 5.099  33.542 1.00 66.02  ? 282 ASP A OD2 1 
ATOM   1848 N  N   . VAL A 1 241 ? 39.708 7.936  33.782 1.00 63.61  ? 283 VAL A N   1 
ATOM   1849 C  CA  . VAL A 1 241 ? 38.448 7.247  34.007 1.00 62.95  ? 283 VAL A CA  1 
ATOM   1850 C  C   . VAL A 1 241 ? 38.086 6.524  32.713 1.00 62.63  ? 283 VAL A C   1 
ATOM   1851 O  O   . VAL A 1 241 ? 38.059 7.128  31.641 1.00 62.44  ? 283 VAL A O   1 
ATOM   1852 C  CB  . VAL A 1 241 ? 37.330 8.222  34.438 1.00 62.98  ? 283 VAL A CB  1 
ATOM   1853 C  CG1 . VAL A 1 241 ? 36.062 7.461  34.820 1.00 62.71  ? 283 VAL A CG1 1 
ATOM   1854 C  CG2 . VAL A 1 241 ? 37.800 9.081  35.604 1.00 62.74  ? 283 VAL A CG2 1 
ATOM   1855 N  N   . THR A 1 242 ? 37.815 5.229  32.829 1.00 62.22  ? 284 THR A N   1 
ATOM   1856 C  CA  . THR A 1 242 ? 37.609 4.363  31.673 1.00 62.08  ? 284 THR A CA  1 
ATOM   1857 C  C   . THR A 1 242 ? 36.273 3.622  31.788 1.00 61.78  ? 284 THR A C   1 
ATOM   1858 O  O   . THR A 1 242 ? 35.737 3.478  32.886 1.00 61.53  ? 284 THR A O   1 
ATOM   1859 C  CB  . THR A 1 242 ? 38.798 3.361  31.535 1.00 62.16  ? 284 THR A CB  1 
ATOM   1860 O  OG1 . THR A 1 242 ? 40.035 4.088  31.456 1.00 62.19  ? 284 THR A OG1 1 
ATOM   1861 C  CG2 . THR A 1 242 ? 38.664 2.494  30.295 1.00 62.74  ? 284 THR A CG2 1 
ATOM   1862 N  N   . PHE A 1 243 ? 35.744 3.173  30.648 1.00 61.57  ? 285 PHE A N   1 
ATOM   1863 C  CA  . PHE A 1 243 ? 34.523 2.364  30.578 1.00 61.28  ? 285 PHE A CA  1 
ATOM   1864 C  C   . PHE A 1 243 ? 34.428 1.333  31.706 1.00 61.04  ? 285 PHE A C   1 
ATOM   1865 O  O   . PHE A 1 243 ? 35.328 0.506  31.891 1.00 60.91  ? 285 PHE A O   1 
ATOM   1866 C  CB  . PHE A 1 243 ? 34.438 1.653  29.221 1.00 61.56  ? 285 PHE A CB  1 
ATOM   1867 C  CG  . PHE A 1 243 ? 33.031 1.330  28.781 1.00 62.26  ? 285 PHE A CG  1 
ATOM   1868 C  CD1 . PHE A 1 243 ? 32.279 0.352  29.439 1.00 62.83  ? 285 PHE A CD1 1 
ATOM   1869 C  CD2 . PHE A 1 243 ? 32.463 1.990  27.691 1.00 62.66  ? 285 PHE A CD2 1 
ATOM   1870 C  CE1 . PHE A 1 243 ? 30.976 0.049  29.030 1.00 62.97  ? 285 PHE A CE1 1 
ATOM   1871 C  CE2 . PHE A 1 243 ? 31.160 1.690  27.270 1.00 62.76  ? 285 PHE A CE2 1 
ATOM   1872 C  CZ  . PHE A 1 243 ? 30.416 0.720  27.944 1.00 62.71  ? 285 PHE A CZ  1 
ATOM   1873 N  N   . GLY A 1 244 ? 33.330 1.390  32.455 1.00 60.64  ? 286 GLY A N   1 
ATOM   1874 C  CA  . GLY A 1 244 ? 33.109 0.470  33.567 1.00 60.22  ? 286 GLY A CA  1 
ATOM   1875 C  C   . GLY A 1 244 ? 33.480 1.028  34.930 1.00 59.90  ? 286 GLY A C   1 
ATOM   1876 O  O   . GLY A 1 244 ? 33.109 0.453  35.956 1.00 59.99  ? 286 GLY A O   1 
ATOM   1877 N  N   . ASP A 1 245 ? 34.225 2.134  34.947 1.00 59.49  ? 287 ASP A N   1 
ATOM   1878 C  CA  . ASP A 1 245 ? 34.542 2.825  36.196 1.00 59.19  ? 287 ASP A CA  1 
ATOM   1879 C  C   . ASP A 1 245 ? 33.287 3.500  36.733 1.00 59.13  ? 287 ASP A C   1 
ATOM   1880 O  O   . ASP A 1 245 ? 32.360 3.790  35.973 1.00 59.38  ? 287 ASP A O   1 
ATOM   1881 C  CB  . ASP A 1 245 ? 35.645 3.870  35.994 1.00 58.79  ? 287 ASP A CB  1 
ATOM   1882 C  CG  . ASP A 1 245 ? 37.032 3.257  35.825 1.00 58.66  ? 287 ASP A CG  1 
ATOM   1883 O  OD1 . ASP A 1 245 ? 37.210 2.034  36.030 1.00 58.82  ? 287 ASP A OD1 1 
ATOM   1884 O  OD2 . ASP A 1 245 ? 37.964 4.016  35.486 1.00 57.83  ? 287 ASP A OD2 1 
ATOM   1885 N  N   . ILE A 1 246 ? 33.255 3.740  38.040 1.00 58.99  ? 288 ILE A N   1 
ATOM   1886 C  CA  . ILE A 1 246 ? 32.161 4.485  38.654 1.00 58.95  ? 288 ILE A CA  1 
ATOM   1887 C  C   . ILE A 1 246 ? 32.692 5.808  39.189 1.00 59.11  ? 288 ILE A C   1 
ATOM   1888 O  O   . ILE A 1 246 ? 33.700 5.848  39.901 1.00 59.01  ? 288 ILE A O   1 
ATOM   1889 C  CB  . ILE A 1 246 ? 31.456 3.672  39.779 1.00 59.08  ? 288 ILE A CB  1 
ATOM   1890 C  CG1 . ILE A 1 246 ? 30.670 2.501  39.180 1.00 58.76  ? 288 ILE A CG1 1 
ATOM   1891 C  CG2 . ILE A 1 246 ? 30.520 4.557  40.610 1.00 59.11  ? 288 ILE A CG2 1 
ATOM   1892 C  CD1 . ILE A 1 246 ? 30.276 1.456  40.188 1.00 59.44  ? 288 ILE A CD1 1 
ATOM   1893 N  N   . LEU A 1 247 ? 32.018 6.889  38.815 1.00 59.19  ? 289 LEU A N   1 
ATOM   1894 C  CA  . LEU A 1 247 ? 32.299 8.201  39.374 1.00 59.37  ? 289 LEU A CA  1 
ATOM   1895 C  C   . LEU A 1 247 ? 31.380 8.433  40.555 1.00 59.23  ? 289 LEU A C   1 
ATOM   1896 O  O   . LEU A 1 247 ? 30.171 8.267  40.444 1.00 59.53  ? 289 LEU A O   1 
ATOM   1897 C  CB  . LEU A 1 247 ? 32.141 9.293  38.316 1.00 59.28  ? 289 LEU A CB  1 
ATOM   1898 C  CG  . LEU A 1 247 ? 33.264 9.256  37.278 1.00 59.53  ? 289 LEU A CG  1 
ATOM   1899 C  CD1 . LEU A 1 247 ? 32.813 9.878  35.994 1.00 60.18  ? 289 LEU A CD1 1 
ATOM   1900 C  CD2 . LEU A 1 247 ? 34.528 9.929  37.787 1.00 59.88  ? 289 LEU A CD2 1 
ATOM   1901 N  N   . ALA A 1 248 ? 31.972 8.789  41.688 1.00 59.06  ? 290 ALA A N   1 
ATOM   1902 C  CA  . ALA A 1 248 ? 31.243 8.938  42.934 1.00 58.75  ? 290 ALA A CA  1 
ATOM   1903 C  C   . ALA A 1 248 ? 31.644 10.237 43.618 1.00 58.86  ? 290 ALA A C   1 
ATOM   1904 O  O   . ALA A 1 248 ? 32.828 10.577 43.687 1.00 58.79  ? 290 ALA A O   1 
ATOM   1905 C  CB  . ALA A 1 248 ? 31.515 7.762  43.834 1.00 58.71  ? 290 ALA A CB  1 
ATOM   1906 N  N   . ALA A 1 249 ? 30.648 10.965 44.113 1.00 58.85  ? 291 ALA A N   1 
ATOM   1907 C  CA  . ALA A 1 249 ? 30.888 12.232 44.789 1.00 58.86  ? 291 ALA A CA  1 
ATOM   1908 C  C   . ALA A 1 249 ? 30.022 12.358 46.022 1.00 58.84  ? 291 ALA A C   1 
ATOM   1909 O  O   . ALA A 1 249 ? 28.888 11.879 46.041 1.00 58.79  ? 291 ALA A O   1 
ATOM   1910 C  CB  . ALA A 1 249 ? 30.639 13.402 43.852 1.00 58.70  ? 291 ALA A CB  1 
ATOM   1911 N  N   . ARG A 1 250 ? 30.569 13.002 47.051 1.00 58.84  ? 292 ARG A N   1 
ATOM   1912 C  CA  . ARG A 1 250 ? 29.811 13.320 48.256 1.00 58.77  ? 292 ARG A CA  1 
ATOM   1913 C  C   . ARG A 1 250 ? 30.037 14.765 48.669 1.00 58.86  ? 292 ARG A C   1 
ATOM   1914 O  O   . ARG A 1 250 ? 31.178 15.210 48.790 1.00 58.80  ? 292 ARG A O   1 
ATOM   1915 C  CB  . ARG A 1 250 ? 30.182 12.378 49.411 1.00 58.64  ? 292 ARG A CB  1 
ATOM   1916 C  CG  . ARG A 1 250 ? 29.581 12.770 50.769 1.00 58.52  ? 292 ARG A CG  1 
ATOM   1917 C  CD  . ARG A 1 250 ? 29.822 11.712 51.846 1.00 58.18  ? 292 ARG A CD  1 
ATOM   1918 N  NE  . ARG A 1 250 ? 28.875 10.604 51.746 1.00 56.86  ? 292 ARG A NE  1 
ATOM   1919 C  CZ  . ARG A 1 250 ? 28.875 9.529  52.535 1.00 56.54  ? 292 ARG A CZ  1 
ATOM   1920 N  NH1 . ARG A 1 250 ? 29.783 9.395  53.498 1.00 55.53  ? 292 ARG A NH1 1 
ATOM   1921 N  NH2 . ARG A 1 250 ? 27.964 8.580  52.356 1.00 55.46  ? 292 ARG A NH2 1 
ATOM   1922 N  N   . CYS A 1 251 ? 28.942 15.491 48.867 1.00 59.06  ? 293 CYS A N   1 
ATOM   1923 C  CA  . CYS A 1 251 ? 28.988 16.763 49.575 1.00 59.40  ? 293 CYS A CA  1 
ATOM   1924 C  C   . CYS A 1 251 ? 28.489 16.507 50.980 1.00 59.32  ? 293 CYS A C   1 
ATOM   1925 O  O   . CYS A 1 251 ? 27.568 15.706 51.188 1.00 59.30  ? 293 CYS A O   1 
ATOM   1926 C  CB  . CYS A 1 251 ? 28.112 17.823 48.904 1.00 59.56  ? 293 CYS A CB  1 
ATOM   1927 S  SG  . CYS A 1 251 ? 28.570 18.238 47.208 1.00 60.50  ? 293 CYS A SG  1 
ATOM   1928 N  N   . VAL A 1 252 ? 29.107 17.174 51.945 1.00 59.29  ? 294 VAL A N   1 
ATOM   1929 C  CA  . VAL A 1 252 ? 28.647 17.107 53.324 1.00 59.23  ? 294 VAL A CA  1 
ATOM   1930 C  C   . VAL A 1 252 ? 28.063 18.460 53.708 1.00 59.29  ? 294 VAL A C   1 
ATOM   1931 O  O   . VAL A 1 252 ? 28.721 19.492 53.579 1.00 59.14  ? 294 VAL A O   1 
ATOM   1932 C  CB  . VAL A 1 252 ? 29.767 16.676 54.299 1.00 59.25  ? 294 VAL A CB  1 
ATOM   1933 C  CG1 . VAL A 1 252 ? 29.208 16.483 55.698 1.00 59.05  ? 294 VAL A CG1 1 
ATOM   1934 C  CG2 . VAL A 1 252 ? 30.414 15.381 53.826 1.00 59.28  ? 294 VAL A CG2 1 
ATOM   1935 N  N   . PHE A 1 253 ? 26.812 18.439 54.154 1.00 59.52  ? 295 PHE A N   1 
ATOM   1936 C  CA  . PHE A 1 253 ? 26.103 19.650 54.539 1.00 59.76  ? 295 PHE A CA  1 
ATOM   1937 C  C   . PHE A 1 253 ? 25.761 19.649 56.019 1.00 60.29  ? 295 PHE A C   1 
ATOM   1938 O  O   . PHE A 1 253 ? 25.639 18.591 56.642 1.00 60.29  ? 295 PHE A O   1 
ATOM   1939 C  CB  . PHE A 1 253 ? 24.803 19.784 53.745 1.00 59.23  ? 295 PHE A CB  1 
ATOM   1940 C  CG  . PHE A 1 253 ? 25.000 20.023 52.274 1.00 58.73  ? 295 PHE A CG  1 
ATOM   1941 C  CD1 . PHE A 1 253 ? 25.376 21.276 51.800 1.00 58.14  ? 295 PHE A CD1 1 
ATOM   1942 C  CD2 . PHE A 1 253 ? 24.774 19.003 51.359 1.00 58.44  ? 295 PHE A CD2 1 
ATOM   1943 C  CE1 . PHE A 1 253 ? 25.539 21.503 50.440 1.00 57.90  ? 295 PHE A CE1 1 
ATOM   1944 C  CE2 . PHE A 1 253 ? 24.930 19.221 49.995 1.00 58.22  ? 295 PHE A CE2 1 
ATOM   1945 C  CZ  . PHE A 1 253 ? 25.312 20.473 49.534 1.00 57.95  ? 295 PHE A CZ  1 
ATOM   1946 N  N   . THR A 1 254 ? 25.602 20.849 56.567 1.00 61.01  ? 296 THR A N   1 
ATOM   1947 C  CA  . THR A 1 254 ? 25.007 21.037 57.883 1.00 61.87  ? 296 THR A CA  1 
ATOM   1948 C  C   . THR A 1 254 ? 23.681 21.754 57.676 1.00 62.21  ? 296 THR A C   1 
ATOM   1949 O  O   . THR A 1 254 ? 23.528 22.519 56.723 1.00 62.32  ? 296 THR A O   1 
ATOM   1950 C  CB  . THR A 1 254 ? 25.883 21.920 58.793 1.00 61.81  ? 296 THR A CB  1 
ATOM   1951 O  OG1 . THR A 1 254 ? 27.261 21.792 58.421 1.00 63.26  ? 296 THR A OG1 1 
ATOM   1952 C  CG2 . THR A 1 254 ? 25.712 21.537 60.248 1.00 61.59  ? 296 THR A CG2 1 
ATOM   1953 N  N   . GLY A 1 255 ? 22.725 21.504 58.563 1.00 62.64  ? 297 GLY A N   1 
ATOM   1954 C  CA  . GLY A 1 255 ? 21.485 22.271 58.586 1.00 63.25  ? 297 GLY A CA  1 
ATOM   1955 C  C   . GLY A 1 255 ? 21.475 23.248 59.744 1.00 63.68  ? 297 GLY A C   1 
ATOM   1956 O  O   . GLY A 1 255 ? 20.529 24.024 59.909 1.00 63.94  ? 297 GLY A O   1 
ATOM   1957 N  N   . GLU A 1 256 ? 22.537 23.209 60.546 1.00 63.89  ? 298 GLU A N   1 
ATOM   1958 C  CA  . GLU A 1 256 ? 22.631 24.033 61.747 1.00 64.01  ? 298 GLU A CA  1 
ATOM   1959 C  C   . GLU A 1 256 ? 22.724 25.512 61.398 1.00 63.71  ? 298 GLU A C   1 
ATOM   1960 O  O   . GLU A 1 256 ? 23.511 25.909 60.540 1.00 63.65  ? 298 GLU A O   1 
ATOM   1961 C  CB  . GLU A 1 256 ? 23.797 23.577 62.632 1.00 64.00  ? 298 GLU A CB  1 
ATOM   1962 C  CG  . GLU A 1 256 ? 23.522 22.244 63.338 1.00 64.51  ? 298 GLU A CG  1 
ATOM   1963 C  CD  . GLU A 1 256 ? 24.695 21.723 64.152 1.00 64.67  ? 298 GLU A CD  1 
ATOM   1964 O  OE1 . GLU A 1 256 ? 25.846 21.794 63.669 1.00 66.02  ? 298 GLU A OE1 1 
ATOM   1965 O  OE2 . GLU A 1 256 ? 24.460 21.224 65.275 1.00 65.96  ? 298 GLU A OE2 1 
ATOM   1966 N  N   . GLY A 1 257 ? 21.889 26.311 62.058 1.00 63.62  ? 299 GLY A N   1 
ATOM   1967 C  CA  . GLY A 1 257 ? 21.774 27.736 61.764 1.00 63.32  ? 299 GLY A CA  1 
ATOM   1968 C  C   . GLY A 1 257 ? 20.512 28.083 60.993 1.00 63.12  ? 299 GLY A C   1 
ATOM   1969 O  O   . GLY A 1 257 ? 20.116 29.251 60.940 1.00 63.20  ? 299 GLY A O   1 
ATOM   1970 N  N   . ARG A 1 258 ? 19.881 27.067 60.402 1.00 62.76  ? 300 ARG A N   1 
ATOM   1971 C  CA  . ARG A 1 258 ? 18.682 27.250 59.575 1.00 62.16  ? 300 ARG A CA  1 
ATOM   1972 C  C   . ARG A 1 258 ? 17.405 26.900 60.331 1.00 61.78  ? 300 ARG A C   1 
ATOM   1973 O  O   . ARG A 1 258 ? 17.357 25.905 61.057 1.00 61.78  ? 300 ARG A O   1 
ATOM   1974 C  CB  . ARG A 1 258 ? 18.778 26.416 58.291 1.00 62.12  ? 300 ARG A CB  1 
ATOM   1975 C  CG  . ARG A 1 258 ? 19.900 26.838 57.338 1.00 62.01  ? 300 ARG A CG  1 
ATOM   1976 C  CD  . ARG A 1 258 ? 19.547 28.101 56.556 1.00 61.90  ? 300 ARG A CD  1 
ATOM   1977 N  NE  . ARG A 1 258 ? 20.715 28.668 55.884 1.00 61.75  ? 300 ARG A NE  1 
ATOM   1978 C  CZ  . ARG A 1 258 ? 20.980 28.549 54.584 1.00 61.69  ? 300 ARG A CZ  1 
ATOM   1979 N  NH1 . ARG A 1 258 ? 20.155 27.883 53.781 1.00 61.91  ? 300 ARG A NH1 1 
ATOM   1980 N  NH2 . ARG A 1 258 ? 22.076 29.105 54.081 1.00 61.02  ? 300 ARG A NH2 1 
ATOM   1981 N  N   . THR A 1 259 ? 16.374 27.725 60.153 1.00 61.31  ? 301 THR A N   1 
ATOM   1982 C  CA  . THR A 1 259 ? 15.076 27.502 60.804 1.00 60.88  ? 301 THR A CA  1 
ATOM   1983 C  C   . THR A 1 259 ? 14.184 26.539 60.009 1.00 60.39  ? 301 THR A C   1 
ATOM   1984 O  O   . THR A 1 259 ? 13.333 25.849 60.580 1.00 60.22  ? 301 THR A O   1 
ATOM   1985 C  CB  . THR A 1 259 ? 14.318 28.834 61.089 1.00 60.81  ? 301 THR A CB  1 
ATOM   1986 O  OG1 . THR A 1 259 ? 13.051 28.547 61.692 1.00 61.73  ? 301 THR A OG1 1 
ATOM   1987 C  CG2 . THR A 1 259 ? 14.078 29.632 59.818 1.00 60.89  ? 301 THR A CG2 1 
ATOM   1988 N  N   . GLU A 1 260 ? 14.394 26.502 58.695 1.00 59.62  ? 302 GLU A N   1 
ATOM   1989 C  CA  . GLU A 1 260 ? 13.593 25.683 57.793 1.00 59.08  ? 302 GLU A CA  1 
ATOM   1990 C  C   . GLU A 1 260 ? 14.481 24.759 56.955 1.00 58.42  ? 302 GLU A C   1 
ATOM   1991 O  O   . GLU A 1 260 ? 15.709 24.882 56.970 1.00 58.12  ? 302 GLU A O   1 
ATOM   1992 C  CB  . GLU A 1 260 ? 12.721 26.574 56.902 1.00 58.90  ? 302 GLU A CB  1 
ATOM   1993 C  CG  . GLU A 1 260 ? 11.800 27.500 57.694 1.00 59.58  ? 302 GLU A CG  1 
ATOM   1994 C  CD  . GLU A 1 260 ? 10.836 28.292 56.833 1.00 59.78  ? 302 GLU A CD  1 
ATOM   1995 O  OE1 . GLU A 1 260 ? 11.208 28.676 55.700 1.00 61.01  ? 302 GLU A OE1 1 
ATOM   1996 O  OE2 . GLU A 1 260 ? 9.703  28.544 57.305 1.00 60.79  ? 302 GLU A OE2 1 
ATOM   1997 N  N   . ALA A 1 261 ? 13.854 23.826 56.243 1.00 57.86  ? 303 ALA A N   1 
ATOM   1998 C  CA  . ALA A 1 261 ? 14.578 22.866 55.415 1.00 57.30  ? 303 ALA A CA  1 
ATOM   1999 C  C   . ALA A 1 261 ? 15.195 23.548 54.209 1.00 56.98  ? 303 ALA A C   1 
ATOM   2000 O  O   . ALA A 1 261 ? 14.627 24.487 53.656 1.00 56.96  ? 303 ALA A O   1 
ATOM   2001 C  CB  . ALA A 1 261 ? 13.666 21.731 54.976 1.00 57.19  ? 303 ALA A CB  1 
ATOM   2002 N  N   . THR A 1 262 ? 16.368 23.065 53.815 1.00 56.60  ? 304 THR A N   1 
ATOM   2003 C  CA  . THR A 1 262 ? 17.082 23.596 52.666 1.00 56.28  ? 304 THR A CA  1 
ATOM   2004 C  C   . THR A 1 262 ? 17.179 22.506 51.603 1.00 56.10  ? 304 THR A C   1 
ATOM   2005 O  O   . THR A 1 262 ? 17.582 21.383 51.891 1.00 56.12  ? 304 THR A O   1 
ATOM   2006 C  CB  . THR A 1 262 ? 18.490 24.082 53.067 1.00 56.27  ? 304 THR A CB  1 
ATOM   2007 O  OG1 . THR A 1 262 ? 18.388 24.959 54.197 1.00 56.28  ? 304 THR A OG1 1 
ATOM   2008 C  CG2 . THR A 1 262 ? 19.160 24.812 51.912 1.00 56.04  ? 304 THR A CG2 1 
ATOM   2009 N  N   . HIS A 1 263 ? 16.786 22.847 50.380 1.00 55.70  ? 305 HIS A N   1 
ATOM   2010 C  CA  . HIS A 1 263 ? 16.834 21.921 49.265 1.00 55.37  ? 305 HIS A CA  1 
ATOM   2011 C  C   . HIS A 1 263 ? 17.727 22.478 48.159 1.00 55.62  ? 305 HIS A C   1 
ATOM   2012 O  O   . HIS A 1 263 ? 18.243 23.592 48.270 1.00 55.30  ? 305 HIS A O   1 
ATOM   2013 C  CB  . HIS A 1 263 ? 15.424 21.669 48.728 1.00 55.08  ? 305 HIS A CB  1 
ATOM   2014 C  CG  . HIS A 1 263 ? 14.741 22.904 48.241 1.00 54.40  ? 305 HIS A CG  1 
ATOM   2015 N  ND1 . HIS A 1 263 ? 14.962 23.431 46.987 1.00 53.78  ? 305 HIS A ND1 1 
ATOM   2016 C  CD2 . HIS A 1 263 ? 13.855 23.730 48.845 1.00 53.74  ? 305 HIS A CD2 1 
ATOM   2017 C  CE1 . HIS A 1 263 ? 14.232 24.521 46.834 1.00 52.85  ? 305 HIS A CE1 1 
ATOM   2018 N  NE2 . HIS A 1 263 ? 13.558 24.730 47.950 1.00 53.18  ? 305 HIS A NE2 1 
ATOM   2019 N  N   . ILE A 1 264 ? 17.894 21.701 47.090 1.00 55.87  ? 306 ILE A N   1 
ATOM   2020 C  CA  . ILE A 1 264 ? 18.645 22.159 45.928 1.00 56.28  ? 306 ILE A CA  1 
ATOM   2021 C  C   . ILE A 1 264 ? 17.873 23.245 45.171 1.00 56.64  ? 306 ILE A C   1 
ATOM   2022 O  O   . ILE A 1 264 ? 16.662 23.130 44.951 1.00 56.38  ? 306 ILE A O   1 
ATOM   2023 C  CB  . ILE A 1 264 ? 19.019 20.989 44.979 1.00 56.34  ? 306 ILE A CB  1 
ATOM   2024 C  CG1 . ILE A 1 264 ? 19.775 19.883 45.738 1.00 55.76  ? 306 ILE A CG1 1 
ATOM   2025 C  CG2 . ILE A 1 264 ? 19.815 21.499 43.759 1.00 56.00  ? 306 ILE A CG2 1 
ATOM   2026 C  CD1 . ILE A 1 264 ? 21.125 20.280 46.286 1.00 55.60  ? 306 ILE A CD1 1 
ATOM   2027 N  N   . GLY A 1 265 ? 18.588 24.301 44.795 1.00 57.09  ? 307 GLY A N   1 
ATOM   2028 C  CA  . GLY A 1 265 ? 18.024 25.379 43.987 1.00 58.44  ? 307 GLY A CA  1 
ATOM   2029 C  C   . GLY A 1 265 ? 19.046 26.458 43.689 1.00 59.34  ? 307 GLY A C   1 
ATOM   2030 O  O   . GLY A 1 265 ? 20.198 26.361 44.108 1.00 58.92  ? 307 GLY A O   1 
ATOM   2031 N  N   . GLY A 1 266 ? 18.603 27.504 42.993 1.00 60.50  ? 308 GLY A N   1 
ATOM   2032 C  CA  . GLY A 1 266 ? 19.499 28.535 42.466 1.00 61.68  ? 308 GLY A CA  1 
ATOM   2033 C  C   . GLY A 1 266 ? 19.810 29.743 43.338 1.00 62.55  ? 308 GLY A C   1 
ATOM   2034 O  O   . GLY A 1 266 ? 20.734 30.501 43.032 1.00 62.99  ? 308 GLY A O   1 
ATOM   2035 N  N   . THR A 1 267 ? 19.058 29.937 44.419 1.00 63.01  ? 309 THR A N   1 
ATOM   2036 C  CA  . THR A 1 267 ? 19.277 31.102 45.284 1.00 63.50  ? 309 THR A CA  1 
ATOM   2037 C  C   . THR A 1 267 ? 20.209 30.798 46.468 1.00 64.05  ? 309 THR A C   1 
ATOM   2038 O  O   . THR A 1 267 ? 20.494 29.634 46.764 1.00 64.12  ? 309 THR A O   1 
ATOM   2039 C  CB  . THR A 1 267 ? 17.944 31.708 45.811 1.00 63.37  ? 309 THR A CB  1 
ATOM   2040 O  OG1 . THR A 1 267 ? 17.492 30.967 46.948 1.00 63.31  ? 309 THR A OG1 1 
ATOM   2041 C  CG2 . THR A 1 267 ? 16.864 31.719 44.721 1.00 62.94  ? 309 THR A CG2 1 
ATOM   2042 N  N   . SER A 1 268 ? 20.664 31.857 47.145 1.00 64.47  ? 310 SER A N   1 
ATOM   2043 C  CA  . SER A 1 268 ? 21.576 31.751 48.290 1.00 64.71  ? 310 SER A CA  1 
ATOM   2044 C  C   . SER A 1 268 ? 20.998 30.933 49.444 1.00 64.81  ? 310 SER A C   1 
ATOM   2045 O  O   . SER A 1 268 ? 21.733 30.235 50.152 1.00 65.13  ? 310 SER A O   1 
ATOM   2046 C  CB  . SER A 1 268 ? 21.967 33.148 48.792 1.00 64.91  ? 310 SER A CB  1 
ATOM   2047 O  OG  . SER A 1 268 ? 20.900 33.757 49.509 1.00 65.14  ? 310 SER A OG  1 
ATOM   2048 N  N   . SER A 1 269 ? 19.682 31.029 49.626 1.00 64.62  ? 311 SER A N   1 
ATOM   2049 C  CA  . SER A 1 269 ? 18.966 30.286 50.663 1.00 64.37  ? 311 SER A CA  1 
ATOM   2050 C  C   . SER A 1 269 ? 18.761 28.808 50.303 1.00 63.87  ? 311 SER A C   1 
ATOM   2051 O  O   . SER A 1 269 ? 18.310 28.005 51.132 1.00 64.10  ? 311 SER A O   1 
ATOM   2052 C  CB  . SER A 1 269 ? 17.621 30.963 50.964 1.00 64.69  ? 311 SER A CB  1 
ATOM   2053 O  OG  . SER A 1 269 ? 17.054 31.527 49.788 1.00 65.61  ? 311 SER A OG  1 
ATOM   2054 N  N   . ASP A 1 270 ? 19.078 28.456 49.063 1.00 62.96  ? 312 ASP A N   1 
ATOM   2055 C  CA  . ASP A 1 270 ? 19.029 27.070 48.629 1.00 62.08  ? 312 ASP A CA  1 
ATOM   2056 C  C   . ASP A 1 270 ? 20.427 26.478 48.712 1.00 61.58  ? 312 ASP A C   1 
ATOM   2057 O  O   . ASP A 1 270 ? 21.377 27.163 49.106 1.00 61.43  ? 312 ASP A O   1 
ATOM   2058 C  CB  . ASP A 1 270 ? 18.480 26.977 47.204 1.00 61.93  ? 312 ASP A CB  1 
ATOM   2059 C  CG  . ASP A 1 270 ? 17.054 27.476 47.097 1.00 61.98  ? 312 ASP A CG  1 
ATOM   2060 O  OD1 . ASP A 1 270 ? 16.255 27.219 48.020 1.00 62.87  ? 312 ASP A OD1 1 
ATOM   2061 O  OD2 . ASP A 1 270 ? 16.724 28.130 46.090 1.00 62.88  ? 312 ASP A OD2 1 
ATOM   2062 N  N   . GLU A 1 271 ? 20.555 25.207 48.351 1.00 60.83  ? 313 GLU A N   1 
ATOM   2063 C  CA  . GLU A 1 271 ? 21.869 24.595 48.278 1.00 60.26  ? 313 GLU A CA  1 
ATOM   2064 C  C   . GLU A 1 271 ? 22.184 24.015 46.917 1.00 59.96  ? 313 GLU A C   1 
ATOM   2065 O  O   . GLU A 1 271 ? 21.315 23.877 46.068 1.00 59.67  ? 313 GLU A O   1 
ATOM   2066 C  CB  . GLU A 1 271 ? 22.061 23.542 49.374 1.00 60.23  ? 313 GLU A CB  1 
ATOM   2067 C  CG  . GLU A 1 271 ? 22.660 24.108 50.664 1.00 60.09  ? 313 GLU A CG  1 
ATOM   2068 C  CD  . GLU A 1 271 ? 23.977 24.839 50.448 1.00 60.72  ? 313 GLU A CD  1 
ATOM   2069 O  OE1 . GLU A 1 271 ? 24.718 24.507 49.494 1.00 61.11  ? 313 GLU A OE1 1 
ATOM   2070 O  OE2 . GLU A 1 271 ? 24.274 25.758 51.239 1.00 61.41  ? 313 GLU A OE2 1 
ATOM   2071 N  N   . MET A 1 272 ? 23.457 23.709 46.716 1.00 59.74  ? 314 MET A N   1 
ATOM   2072 C  CA  . MET A 1 272 ? 23.896 22.988 45.545 1.00 59.92  ? 314 MET A CA  1 
ATOM   2073 C  C   . MET A 1 272 ? 24.995 22.033 45.967 1.00 59.73  ? 314 MET A C   1 
ATOM   2074 O  O   . MET A 1 272 ? 25.747 22.308 46.897 1.00 59.54  ? 314 MET A O   1 
ATOM   2075 C  CB  . MET A 1 272 ? 24.388 23.948 44.455 1.00 59.57  ? 314 MET A CB  1 
ATOM   2076 C  CG  . MET A 1 272 ? 23.270 24.510 43.570 1.00 59.79  ? 314 MET A CG  1 
ATOM   2077 S  SD  . MET A 1 272 ? 23.846 25.732 42.377 1.00 60.98  ? 314 MET A SD  1 
ATOM   2078 C  CE  . MET A 1 272 ? 22.336 26.114 41.476 1.00 59.34  ? 314 MET A CE  1 
ATOM   2079 N  N   . CYS A 1 273 ? 25.056 20.890 45.306 1.00 60.05  ? 315 CYS A N   1 
ATOM   2080 C  CA  . CYS A 1 273 ? 26.195 20.012 45.449 1.00 60.16  ? 315 CYS A CA  1 
ATOM   2081 C  C   . CYS A 1 273 ? 26.745 19.777 44.050 1.00 59.94  ? 315 CYS A C   1 
ATOM   2082 O  O   . CYS A 1 273 ? 26.286 18.889 43.327 1.00 59.55  ? 315 CYS A O   1 
ATOM   2083 C  CB  . CYS A 1 273 ? 25.798 18.711 46.148 1.00 60.18  ? 315 CYS A CB  1 
ATOM   2084 S  SG  . CYS A 1 273 ? 27.066 17.431 46.133 1.00 61.59  ? 315 CYS A SG  1 
ATOM   2085 N  N   . ASN A 1 274 ? 27.689 20.624 43.648 1.00 59.45  ? 316 ASN A N   1 
ATOM   2086 C  CA  . ASN A 1 274 ? 28.275 20.515 42.318 1.00 59.27  ? 316 ASN A CA  1 
ATOM   2087 C  C   . ASN A 1 274 ? 29.752 20.140 42.379 1.00 59.40  ? 316 ASN A C   1 
ATOM   2088 O  O   . ASN A 1 274 ? 30.513 20.673 43.201 1.00 59.67  ? 316 ASN A O   1 
ATOM   2089 C  CB  . ASN A 1 274 ? 28.102 21.817 41.533 1.00 59.23  ? 316 ASN A CB  1 
ATOM   2090 C  CG  . ASN A 1 274 ? 26.649 22.105 41.138 1.00 59.57  ? 316 ASN A CG  1 
ATOM   2091 O  OD1 . ASN A 1 274 ? 26.387 23.034 40.375 1.00 61.53  ? 316 ASN A OD1 1 
ATOM   2092 N  ND2 . ASN A 1 274 ? 25.712 21.333 41.659 1.00 58.96  ? 316 ASN A ND2 1 
ATOM   2093 N  N   . LEU A 1 275 ? 30.149 19.207 41.521 1.00 59.11  ? 317 LEU A N   1 
ATOM   2094 C  CA  . LEU A 1 275 ? 31.555 18.889 41.333 1.00 59.29  ? 317 LEU A CA  1 
ATOM   2095 C  C   . LEU A 1 275 ? 31.856 18.888 39.845 1.00 59.54  ? 317 LEU A C   1 
ATOM   2096 O  O   . LEU A 1 275 ? 31.339 18.051 39.091 1.00 59.97  ? 317 LEU A O   1 
ATOM   2097 C  CB  . LEU A 1 275 ? 31.927 17.550 41.978 1.00 58.96  ? 317 LEU A CB  1 
ATOM   2098 C  CG  . LEU A 1 275 ? 33.330 16.973 41.729 1.00 59.27  ? 317 LEU A CG  1 
ATOM   2099 C  CD1 . LEU A 1 275 ? 34.455 17.794 42.386 1.00 58.33  ? 317 LEU A CD1 1 
ATOM   2100 C  CD2 . LEU A 1 275 ? 33.382 15.541 42.212 1.00 59.42  ? 317 LEU A CD2 1 
ATOM   2101 N  N   . TYR A 1 276 ? 32.680 19.847 39.439 1.00 59.32  ? 318 TYR A N   1 
ATOM   2102 C  CA  . TYR A 1 276 ? 33.091 20.014 38.064 1.00 59.66  ? 318 TYR A CA  1 
ATOM   2103 C  C   . TYR A 1 276 ? 34.429 19.336 37.861 1.00 59.75  ? 318 TYR A C   1 
ATOM   2104 O  O   . TYR A 1 276 ? 35.437 19.751 38.423 1.00 59.87  ? 318 TYR A O   1 
ATOM   2105 C  CB  . TYR A 1 276 ? 33.217 21.501 37.721 1.00 60.03  ? 318 TYR A CB  1 
ATOM   2106 C  CG  . TYR A 1 276 ? 31.931 22.278 37.876 1.00 60.56  ? 318 TYR A CG  1 
ATOM   2107 C  CD1 . TYR A 1 276 ? 31.568 22.831 39.107 1.00 59.86  ? 318 TYR A CD1 1 
ATOM   2108 C  CD2 . TYR A 1 276 ? 31.076 22.460 36.791 1.00 60.52  ? 318 TYR A CD2 1 
ATOM   2109 C  CE1 . TYR A 1 276 ? 30.382 23.538 39.244 1.00 61.51  ? 318 TYR A CE1 1 
ATOM   2110 C  CE2 . TYR A 1 276 ? 29.897 23.172 36.913 1.00 59.62  ? 318 TYR A CE2 1 
ATOM   2111 C  CZ  . TYR A 1 276 ? 29.556 23.704 38.133 1.00 61.11  ? 318 TYR A CZ  1 
ATOM   2112 O  OH  . TYR A 1 276 ? 28.383 24.402 38.247 1.00 62.96  ? 318 TYR A OH  1 
ATOM   2113 N  N   . ILE A 1 277 ? 34.425 18.287 37.052 1.00 59.88  ? 319 ILE A N   1 
ATOM   2114 C  CA  . ILE A 1 277 ? 35.621 17.511 36.783 1.00 60.05  ? 319 ILE A CA  1 
ATOM   2115 C  C   . ILE A 1 277 ? 36.092 17.854 35.371 1.00 59.84  ? 319 ILE A C   1 
ATOM   2116 O  O   . ILE A 1 277 ? 35.477 17.440 34.390 1.00 60.05  ? 319 ILE A O   1 
ATOM   2117 C  CB  . ILE A 1 277 ? 35.341 15.988 36.926 1.00 59.90  ? 319 ILE A CB  1 
ATOM   2118 C  CG1 . ILE A 1 277 ? 34.905 15.639 38.356 1.00 60.44  ? 319 ILE A CG1 1 
ATOM   2119 C  CG2 . ILE A 1 277 ? 36.562 15.176 36.563 1.00 60.75  ? 319 ILE A CG2 1 
ATOM   2120 C  CD1 . ILE A 1 277 ? 34.318 14.221 38.511 1.00 59.52  ? 319 ILE A CD1 1 
ATOM   2121 N  N   . MET A 1 278 ? 37.174 18.622 35.277 1.00 59.79  ? 320 MET A N   1 
ATOM   2122 C  CA  . MET A 1 278 ? 37.708 19.030 33.983 1.00 59.69  ? 320 MET A CA  1 
ATOM   2123 C  C   . MET A 1 278 ? 38.671 17.973 33.458 1.00 58.95  ? 320 MET A C   1 
ATOM   2124 O  O   . MET A 1 278 ? 39.626 17.596 34.123 1.00 58.88  ? 320 MET A O   1 
ATOM   2125 C  CB  . MET A 1 278 ? 38.389 20.403 34.057 1.00 59.64  ? 320 MET A CB  1 
ATOM   2126 C  CG  . MET A 1 278 ? 38.575 21.046 32.679 1.00 59.90  ? 320 MET A CG  1 
ATOM   2127 S  SD  . MET A 1 278 ? 39.367 22.663 32.681 1.00 61.52  ? 320 MET A SD  1 
ATOM   2128 C  CE  . MET A 1 278 ? 38.053 23.729 33.266 1.00 62.42  ? 320 MET A CE  1 
ATOM   2129 N  N   . TYR A 1 279 ? 38.393 17.491 32.258 1.00 58.46  ? 321 TYR A N   1 
ATOM   2130 C  CA  . TYR A 1 279 ? 39.145 16.406 31.674 1.00 57.97  ? 321 TYR A CA  1 
ATOM   2131 C  C   . TYR A 1 279 ? 39.629 16.750 30.266 1.00 58.02  ? 321 TYR A C   1 
ATOM   2132 O  O   . TYR A 1 279 ? 39.159 17.719 29.664 1.00 57.94  ? 321 TYR A O   1 
ATOM   2133 C  CB  . TYR A 1 279 ? 38.271 15.147 31.635 1.00 57.60  ? 321 TYR A CB  1 
ATOM   2134 C  CG  . TYR A 1 279 ? 37.021 15.266 30.775 1.00 57.58  ? 321 TYR A CG  1 
ATOM   2135 C  CD1 . TYR A 1 279 ? 37.106 15.206 29.381 1.00 56.87  ? 321 TYR A CD1 1 
ATOM   2136 C  CD2 . TYR A 1 279 ? 35.758 15.420 31.351 1.00 56.04  ? 321 TYR A CD2 1 
ATOM   2137 C  CE1 . TYR A 1 279 ? 35.990 15.305 28.591 1.00 56.94  ? 321 TYR A CE1 1 
ATOM   2138 C  CE2 . TYR A 1 279 ? 34.622 15.514 30.558 1.00 56.96  ? 321 TYR A CE2 1 
ATOM   2139 C  CZ  . TYR A 1 279 ? 34.750 15.457 29.173 1.00 57.56  ? 321 TYR A CZ  1 
ATOM   2140 O  OH  . TYR A 1 279 ? 33.650 15.546 28.354 1.00 57.23  ? 321 TYR A OH  1 
ATOM   2141 N  N   . TYR A 1 280 ? 40.581 15.965 29.761 1.00 58.01  ? 322 TYR A N   1 
ATOM   2142 C  CA  . TYR A 1 280 ? 40.868 15.922 28.336 1.00 58.37  ? 322 TYR A CA  1 
ATOM   2143 C  C   . TYR A 1 280 ? 40.654 14.512 27.799 1.00 58.84  ? 322 TYR A C   1 
ATOM   2144 O  O   . TYR A 1 280 ? 40.725 13.522 28.544 1.00 58.77  ? 322 TYR A O   1 
ATOM   2145 C  CB  . TYR A 1 280 ? 42.271 16.458 27.989 1.00 58.51  ? 322 TYR A CB  1 
ATOM   2146 C  CG  . TYR A 1 280 ? 43.438 15.620 28.468 1.00 58.82  ? 322 TYR A CG  1 
ATOM   2147 C  CD1 . TYR A 1 280 ? 43.734 14.388 27.881 1.00 59.22  ? 322 TYR A CD1 1 
ATOM   2148 C  CD2 . TYR A 1 280 ? 44.265 16.075 29.488 1.00 59.28  ? 322 TYR A CD2 1 
ATOM   2149 C  CE1 . TYR A 1 280 ? 44.806 13.623 28.309 1.00 58.92  ? 322 TYR A CE1 1 
ATOM   2150 C  CE2 . TYR A 1 280 ? 45.340 15.307 29.933 1.00 60.02  ? 322 TYR A CE2 1 
ATOM   2151 C  CZ  . TYR A 1 280 ? 45.601 14.088 29.335 1.00 59.21  ? 322 TYR A CZ  1 
ATOM   2152 O  OH  . TYR A 1 280 ? 46.662 13.338 29.764 1.00 59.33  ? 322 TYR A OH  1 
ATOM   2153 N  N   . MET A 1 281 ? 40.360 14.431 26.505 1.00 58.85  ? 323 MET A N   1 
ATOM   2154 C  CA  . MET A 1 281 ? 40.248 13.155 25.811 1.00 58.77  ? 323 MET A CA  1 
ATOM   2155 C  C   . MET A 1 281 ? 40.957 13.280 24.479 1.00 58.99  ? 323 MET A C   1 
ATOM   2156 O  O   . MET A 1 281 ? 41.068 14.379 23.930 1.00 58.71  ? 323 MET A O   1 
ATOM   2157 C  CB  . MET A 1 281 ? 38.785 12.796 25.567 1.00 58.77  ? 323 MET A CB  1 
ATOM   2158 C  CG  . MET A 1 281 ? 37.959 12.626 26.828 1.00 58.85  ? 323 MET A CG  1 
ATOM   2159 S  SD  . MET A 1 281 ? 36.228 12.274 26.527 1.00 59.40  ? 323 MET A SD  1 
ATOM   2160 C  CE  . MET A 1 281 ? 36.319 10.628 25.818 1.00 57.49  ? 323 MET A CE  1 
ATOM   2161 N  N   . GLU A 1 282 ? 41.440 12.158 23.960 1.00 59.33  ? 324 GLU A N   1 
ATOM   2162 C  CA  . GLU A 1 282 ? 41.927 12.110 22.585 1.00 59.93  ? 324 GLU A CA  1 
ATOM   2163 C  C   . GLU A 1 282 ? 40.840 12.671 21.683 1.00 59.69  ? 324 GLU A C   1 
ATOM   2164 O  O   . GLU A 1 282 ? 39.666 12.350 21.852 1.00 59.96  ? 324 GLU A O   1 
ATOM   2165 C  CB  . GLU A 1 282 ? 42.288 10.676 22.178 1.00 60.04  ? 324 GLU A CB  1 
ATOM   2166 C  CG  . GLU A 1 282 ? 43.348 10.011 23.066 1.00 61.24  ? 324 GLU A CG  1 
ATOM   2167 C  CD  . GLU A 1 282 ? 44.722 10.654 22.951 1.00 63.67  ? 324 GLU A CD  1 
ATOM   2168 O  OE1 . GLU A 1 282 ? 45.138 11.014 21.828 1.00 65.16  ? 324 GLU A OE1 1 
ATOM   2169 O  OE2 . GLU A 1 282 ? 45.405 10.788 23.989 1.00 65.25  ? 324 GLU A OE2 1 
ATOM   2170 N  N   . ALA A 1 283 ? 41.231 13.530 20.750 1.00 59.73  ? 325 ALA A N   1 
ATOM   2171 C  CA  . ALA A 1 283 ? 40.273 14.247 19.902 1.00 59.83  ? 325 ALA A CA  1 
ATOM   2172 C  C   . ALA A 1 283 ? 39.283 13.339 19.157 1.00 60.11  ? 325 ALA A C   1 
ATOM   2173 O  O   . ALA A 1 283 ? 38.088 13.638 19.110 1.00 60.25  ? 325 ALA A O   1 
ATOM   2174 C  CB  . ALA A 1 283 ? 40.997 15.167 18.935 1.00 59.62  ? 325 ALA A CB  1 
ATOM   2175 N  N   . LYS A 1 284 ? 39.764 12.228 18.596 1.00 60.12  ? 326 LYS A N   1 
ATOM   2176 C  CA  . LYS A 1 284 ? 38.867 11.323 17.849 1.00 60.18  ? 326 LYS A CA  1 
ATOM   2177 C  C   . LYS A 1 284 ? 37.882 10.546 18.742 1.00 59.72  ? 326 LYS A C   1 
ATOM   2178 O  O   . LYS A 1 284 ? 36.901 10.000 18.257 1.00 60.02  ? 326 LYS A O   1 
ATOM   2179 C  CB  . LYS A 1 284 ? 39.644 10.394 16.898 1.00 59.89  ? 326 LYS A CB  1 
ATOM   2180 C  CG  . LYS A 1 284 ? 40.491 9.312  17.555 1.00 60.39  ? 326 LYS A CG  1 
ATOM   2181 C  CD  . LYS A 1 284 ? 40.945 8.293  16.516 1.00 60.69  ? 326 LYS A CD  1 
ATOM   2182 C  CE  . LYS A 1 284 ? 41.975 7.326  17.085 1.00 61.81  ? 326 LYS A CE  1 
ATOM   2183 N  NZ  . LYS A 1 284 ? 42.729 6.614  16.006 1.00 62.00  ? 326 LYS A NZ  1 
ATOM   2184 N  N   . TYR A 1 285 ? 38.141 10.527 20.045 1.00 59.34  ? 327 TYR A N   1 
ATOM   2185 C  CA  . TYR A 1 285 ? 37.264 9.855  21.009 1.00 58.82  ? 327 TYR A CA  1 
ATOM   2186 C  C   . TYR A 1 285 ? 36.410 10.845 21.803 1.00 58.58  ? 327 TYR A C   1 
ATOM   2187 O  O   . TYR A 1 285 ? 35.425 10.460 22.452 1.00 58.05  ? 327 TYR A O   1 
ATOM   2188 C  CB  . TYR A 1 285 ? 38.107 9.018  21.978 1.00 58.57  ? 327 TYR A CB  1 
ATOM   2189 C  CG  . TYR A 1 285 ? 38.933 7.944  21.301 1.00 58.58  ? 327 TYR A CG  1 
ATOM   2190 C  CD1 . TYR A 1 285 ? 38.381 7.132  20.307 1.00 58.29  ? 327 TYR A CD1 1 
ATOM   2191 C  CD2 . TYR A 1 285 ? 40.262 7.733  21.659 1.00 58.35  ? 327 TYR A CD2 1 
ATOM   2192 C  CE1 . TYR A 1 285 ? 39.133 6.148  19.680 1.00 58.55  ? 327 TYR A CE1 1 
ATOM   2193 C  CE2 . TYR A 1 285 ? 41.026 6.746  21.036 1.00 58.51  ? 327 TYR A CE2 1 
ATOM   2194 C  CZ  . TYR A 1 285 ? 40.452 5.953  20.053 1.00 58.74  ? 327 TYR A CZ  1 
ATOM   2195 O  OH  . TYR A 1 285 ? 41.195 4.973  19.430 1.00 58.38  ? 327 TYR A OH  1 
ATOM   2196 N  N   . ALA A 1 286 ? 36.794 12.119 21.727 1.00 58.25  ? 328 ALA A N   1 
ATOM   2197 C  CA  . ALA A 1 286 ? 36.315 13.152 22.642 1.00 58.37  ? 328 ALA A CA  1 
ATOM   2198 C  C   . ALA A 1 286 ? 34.823 13.429 22.587 1.00 58.36  ? 328 ALA A C   1 
ATOM   2199 O  O   . ALA A 1 286 ? 34.215 13.411 21.525 1.00 58.20  ? 328 ALA A O   1 
ATOM   2200 C  CB  . ALA A 1 286 ? 37.074 14.445 22.414 1.00 57.95  ? 328 ALA A CB  1 
ATOM   2201 N  N   . LEU A 1 287 ? 34.257 13.699 23.756 1.00 58.53  ? 329 LEU A N   1 
ATOM   2202 C  CA  . LEU A 1 287 ? 32.991 14.406 23.853 1.00 59.05  ? 329 LEU A CA  1 
ATOM   2203 C  C   . LEU A 1 287 ? 33.162 15.530 24.879 1.00 59.49  ? 329 LEU A C   1 
ATOM   2204 O  O   . LEU A 1 287 ? 33.934 15.384 25.835 1.00 60.20  ? 329 LEU A O   1 
ATOM   2205 C  CB  . LEU A 1 287 ? 31.835 13.455 24.189 1.00 58.79  ? 329 LEU A CB  1 
ATOM   2206 C  CG  . LEU A 1 287 ? 31.571 12.970 25.612 1.00 58.56  ? 329 LEU A CG  1 
ATOM   2207 C  CD1 . LEU A 1 287 ? 30.141 12.462 25.708 1.00 57.54  ? 329 LEU A CD1 1 
ATOM   2208 C  CD2 . LEU A 1 287 ? 32.569 11.906 26.046 1.00 58.16  ? 329 LEU A CD2 1 
ATOM   2209 N  N   . SER A 1 288 ? 32.467 16.646 24.664 1.00 59.78  ? 330 SER A N   1 
ATOM   2210 C  CA  . SER A 1 288 ? 32.740 17.912 25.371 1.00 60.46  ? 330 SER A CA  1 
ATOM   2211 C  C   . SER A 1 288 ? 32.109 18.070 26.764 1.00 60.96  ? 330 SER A C   1 
ATOM   2212 O  O   . SER A 1 288 ? 32.543 18.910 27.553 1.00 61.05  ? 330 SER A O   1 
ATOM   2213 C  CB  . SER A 1 288 ? 32.338 19.108 24.496 1.00 60.12  ? 330 SER A CB  1 
ATOM   2214 O  OG  . SER A 1 288 ? 33.203 19.243 23.379 1.00 60.80  ? 330 SER A OG  1 
ATOM   2215 N  N   . PHE A 1 289 ? 31.076 17.289 27.057 1.00 61.50  ? 331 PHE A N   1 
ATOM   2216 C  CA  . PHE A 1 289 ? 30.378 17.411 28.333 1.00 61.99  ? 331 PHE A CA  1 
ATOM   2217 C  C   . PHE A 1 289 ? 29.658 16.130 28.711 1.00 62.18  ? 331 PHE A C   1 
ATOM   2218 O  O   . PHE A 1 289 ? 29.106 15.442 27.860 1.00 62.19  ? 331 PHE A O   1 
ATOM   2219 C  CB  . PHE A 1 289 ? 29.396 18.603 28.343 1.00 62.32  ? 331 PHE A CB  1 
ATOM   2220 C  CG  . PHE A 1 289 ? 28.736 18.874 27.013 1.00 63.43  ? 331 PHE A CG  1 
ATOM   2221 C  CD1 . PHE A 1 289 ? 27.592 18.176 26.629 1.00 64.66  ? 331 PHE A CD1 1 
ATOM   2222 C  CD2 . PHE A 1 289 ? 29.258 19.833 26.140 1.00 63.70  ? 331 PHE A CD2 1 
ATOM   2223 C  CE1 . PHE A 1 289 ? 26.985 18.423 25.394 1.00 64.69  ? 331 PHE A CE1 1 
ATOM   2224 C  CE2 . PHE A 1 289 ? 28.660 20.083 24.901 1.00 63.87  ? 331 PHE A CE2 1 
ATOM   2225 C  CZ  . PHE A 1 289 ? 27.526 19.379 24.529 1.00 64.24  ? 331 PHE A CZ  1 
ATOM   2226 N  N   . MET A 1 290 ? 29.694 15.818 29.999 1.00 62.24  ? 332 MET A N   1 
ATOM   2227 C  CA  . MET A 1 290 ? 28.940 14.718 30.573 1.00 62.24  ? 332 MET A CA  1 
ATOM   2228 C  C   . MET A 1 290 ? 28.404 15.199 31.914 1.00 62.72  ? 332 MET A C   1 
ATOM   2229 O  O   . MET A 1 290 ? 28.981 16.098 32.542 1.00 62.74  ? 332 MET A O   1 
ATOM   2230 C  CB  . MET A 1 290 ? 29.836 13.493 30.781 1.00 62.15  ? 332 MET A CB  1 
ATOM   2231 C  CG  . MET A 1 290 ? 30.167 12.722 29.508 1.00 62.09  ? 332 MET A CG  1 
ATOM   2232 S  SD  . MET A 1 290 ? 31.453 11.474 29.718 1.00 61.69  ? 332 MET A SD  1 
ATOM   2233 C  CE  . MET A 1 290 ? 32.939 12.468 29.690 1.00 61.79  ? 332 MET A CE  1 
ATOM   2234 N  N   . THR A 1 291 ? 27.303 14.600 32.353 1.00 62.81  ? 333 THR A N   1 
ATOM   2235 C  CA  . THR A 1 291 ? 26.685 14.965 33.614 1.00 63.30  ? 333 THR A CA  1 
ATOM   2236 C  C   . THR A 1 291 ? 26.207 13.714 34.335 1.00 63.25  ? 333 THR A C   1 
ATOM   2237 O  O   . THR A 1 291 ? 25.774 12.746 33.710 1.00 63.23  ? 333 THR A O   1 
ATOM   2238 C  CB  . THR A 1 291 ? 25.508 15.972 33.412 1.00 63.77  ? 333 THR A CB  1 
ATOM   2239 O  OG1 . THR A 1 291 ? 25.959 17.109 32.650 1.00 65.13  ? 333 THR A OG1 1 
ATOM   2240 C  CG2 . THR A 1 291 ? 24.974 16.470 34.748 1.00 63.48  ? 333 THR A CG2 1 
ATOM   2241 N  N   . CYS A 1 292 ? 26.323 13.741 35.657 1.00 63.24  ? 334 CYS A N   1 
ATOM   2242 C  CA  . CYS A 1 292 ? 25.739 12.734 36.512 1.00 63.13  ? 334 CYS A CA  1 
ATOM   2243 C  C   . CYS A 1 292 ? 24.866 13.421 37.542 1.00 63.33  ? 334 CYS A C   1 
ATOM   2244 O  O   . CYS A 1 292 ? 25.364 14.161 38.391 1.00 63.35  ? 334 CYS A O   1 
ATOM   2245 C  CB  . CYS A 1 292 ? 26.816 11.925 37.229 1.00 62.91  ? 334 CYS A CB  1 
ATOM   2246 S  SG  . CYS A 1 292 ? 26.102 10.652 38.290 1.00 63.14  ? 334 CYS A SG  1 
ATOM   2247 N  N   . THR A 1 293 ? 23.564 13.166 37.467 1.00 63.56  ? 335 THR A N   1 
ATOM   2248 C  CA  . THR A 1 293 ? 22.621 13.695 38.442 1.00 63.78  ? 335 THR A CA  1 
ATOM   2249 C  C   . THR A 1 293 ? 21.958 12.562 39.216 1.00 64.10  ? 335 THR A C   1 
ATOM   2250 O  O   . THR A 1 293 ? 20.911 12.751 39.829 1.00 64.47  ? 335 THR A O   1 
ATOM   2251 C  CB  . THR A 1 293 ? 21.542 14.591 37.780 1.00 63.83  ? 335 THR A CB  1 
ATOM   2252 O  OG1 . THR A 1 293 ? 20.788 13.829 36.828 1.00 63.77  ? 335 THR A OG1 1 
ATOM   2253 C  CG2 . THR A 1 293 ? 22.178 15.777 37.089 1.00 63.03  ? 335 THR A CG2 1 
ATOM   2254 N  N   . LYS A 1 294 ? 22.585 11.388 39.197 1.00 64.33  ? 336 LYS A N   1 
ATOM   2255 C  CA  . LYS A 1 294 ? 21.996 10.181 39.784 1.00 64.37  ? 336 LYS A CA  1 
ATOM   2256 C  C   . LYS A 1 294 ? 22.859 9.595  40.899 1.00 64.16  ? 336 LYS A C   1 
ATOM   2257 O  O   . LYS A 1 294 ? 23.947 10.096 41.193 1.00 64.10  ? 336 LYS A O   1 
ATOM   2258 C  CB  . LYS A 1 294 ? 21.767 9.116  38.702 1.00 64.21  ? 336 LYS A CB  1 
ATOM   2259 C  CG  . LYS A 1 294 ? 20.790 9.518  37.605 1.00 64.61  ? 336 LYS A CG  1 
ATOM   2260 C  CD  . LYS A 1 294 ? 20.628 8.419  36.562 1.00 65.07  ? 336 LYS A CD  1 
ATOM   2261 C  CE  . LYS A 1 294 ? 21.806 8.372  35.597 1.00 66.70  ? 336 LYS A CE  1 
ATOM   2262 N  NZ  . LYS A 1 294 ? 21.571 7.365  34.524 1.00 67.86  ? 336 LYS A NZ  1 
ATOM   2263 N  N   . ASN A 1 295 ? 22.352 8.533  41.517 1.00 64.03  ? 337 ASN A N   1 
ATOM   2264 C  CA  . ASN A 1 295 ? 23.099 7.761  42.497 1.00 64.04  ? 337 ASN A CA  1 
ATOM   2265 C  C   . ASN A 1 295 ? 22.869 6.270  42.236 1.00 64.04  ? 337 ASN A C   1 
ATOM   2266 O  O   . ASN A 1 295 ? 22.082 5.616  42.926 1.00 64.28  ? 337 ASN A O   1 
ATOM   2267 C  CB  . ASN A 1 295 ? 22.696 8.172  43.921 1.00 63.86  ? 337 ASN A CB  1 
ATOM   2268 C  CG  . ASN A 1 295 ? 23.625 7.609  44.984 1.00 63.96  ? 337 ASN A CG  1 
ATOM   2269 O  OD1 . ASN A 1 295 ? 24.681 7.044  44.681 1.00 64.33  ? 337 ASN A OD1 1 
ATOM   2270 N  ND2 . ASN A 1 295 ? 23.234 7.764  46.244 1.00 63.17  ? 337 ASN A ND2 1 
ATOM   2271 N  N   . VAL A 1 296 ? 23.560 5.746  41.225 1.00 64.11  ? 338 VAL A N   1 
ATOM   2272 C  CA  . VAL A 1 296 ? 23.331 4.381  40.728 1.00 64.15  ? 338 VAL A CA  1 
ATOM   2273 C  C   . VAL A 1 296 ? 23.837 3.277  41.666 1.00 64.22  ? 338 VAL A C   1 
ATOM   2274 O  O   . VAL A 1 296 ? 23.323 2.152  41.643 1.00 64.25  ? 338 VAL A O   1 
ATOM   2275 C  CB  . VAL A 1 296 ? 23.906 4.165  39.292 1.00 64.23  ? 338 VAL A CB  1 
ATOM   2276 C  CG1 . VAL A 1 296 ? 23.295 5.164  38.304 1.00 64.28  ? 338 VAL A CG1 1 
ATOM   2277 C  CG2 . VAL A 1 296 ? 25.437 4.246  39.281 1.00 63.97  ? 338 VAL A CG2 1 
ATOM   2278 N  N   . ALA A 1 297 ? 24.838 3.599  42.482 1.00 64.24  ? 339 ALA A N   1 
ATOM   2279 C  CA  . ALA A 1 297 ? 25.386 2.645  43.442 1.00 64.26  ? 339 ALA A CA  1 
ATOM   2280 C  C   . ALA A 1 297 ? 25.411 3.238  44.853 1.00 64.23  ? 339 ALA A C   1 
ATOM   2281 O  O   . ALA A 1 297 ? 26.481 3.573  45.364 1.00 64.21  ? 339 ALA A O   1 
ATOM   2282 C  CB  . ALA A 1 297 ? 26.783 2.197  43.007 1.00 64.35  ? 339 ALA A CB  1 
ATOM   2283 N  N   . PRO A 1 298 ? 24.229 3.360  45.492 1.00 64.29  ? 340 PRO A N   1 
ATOM   2284 C  CA  . PRO A 1 298 ? 24.139 4.050  46.783 1.00 64.35  ? 340 PRO A CA  1 
ATOM   2285 C  C   . PRO A 1 298 ? 24.800 3.284  47.931 1.00 64.53  ? 340 PRO A C   1 
ATOM   2286 O  O   . PRO A 1 298 ? 25.325 3.906  48.858 1.00 64.54  ? 340 PRO A O   1 
ATOM   2287 C  CB  . PRO A 1 298 ? 22.626 4.171  47.024 1.00 64.41  ? 340 PRO A CB  1 
ATOM   2288 C  CG  . PRO A 1 298 ? 21.967 3.764  45.741 1.00 64.50  ? 340 PRO A CG  1 
ATOM   2289 C  CD  . PRO A 1 298 ? 22.918 2.844  45.063 1.00 64.34  ? 340 PRO A CD  1 
ATOM   2290 N  N   . ASP A 1 299 ? 24.775 1.952  47.861 1.00 64.58  ? 341 ASP A N   1 
ATOM   2291 C  CA  . ASP A 1 299 ? 25.380 1.105  48.889 1.00 64.75  ? 341 ASP A CA  1 
ATOM   2292 C  C   . ASP A 1 299 ? 26.899 0.987  48.751 1.00 64.74  ? 341 ASP A C   1 
ATOM   2293 O  O   . ASP A 1 299 ? 27.571 0.456  49.639 1.00 64.81  ? 341 ASP A O   1 
ATOM   2294 C  CB  . ASP A 1 299 ? 24.734 -0.288 48.896 1.00 64.85  ? 341 ASP A CB  1 
ATOM   2295 C  CG  . ASP A 1 299 ? 23.347 -0.291 49.515 1.00 65.08  ? 341 ASP A CG  1 
ATOM   2296 O  OD1 . ASP A 1 299 ? 22.954 0.724  50.131 1.00 65.38  ? 341 ASP A OD1 1 
ATOM   2297 O  OD2 . ASP A 1 299 ? 22.649 -1.320 49.394 1.00 66.04  ? 341 ASP A OD2 1 
ATOM   2298 N  N   . MET A 1 300 ? 27.431 1.480  47.636 1.00 64.78  ? 342 MET A N   1 
ATOM   2299 C  CA  . MET A 1 300 ? 28.873 1.532  47.408 1.00 64.84  ? 342 MET A CA  1 
ATOM   2300 C  C   . MET A 1 300 ? 29.532 2.552  48.340 1.00 64.47  ? 342 MET A C   1 
ATOM   2301 O  O   . MET A 1 300 ? 30.696 2.398  48.718 1.00 64.56  ? 342 MET A O   1 
ATOM   2302 C  CB  . MET A 1 300 ? 29.152 1.872  45.944 1.00 64.85  ? 342 MET A CB  1 
ATOM   2303 C  CG  . MET A 1 300 ? 30.614 2.048  45.574 1.00 64.87  ? 342 MET A CG  1 
ATOM   2304 S  SD  . MET A 1 300 ? 30.793 2.954  44.029 1.00 65.94  ? 342 MET A SD  1 
ATOM   2305 C  CE  . MET A 1 300 ? 29.968 4.493  44.425 1.00 65.68  ? 342 MET A CE  1 
ATOM   2306 N  N   . PHE A 1 301 ? 28.769 3.574  48.723 1.00 64.02  ? 343 PHE A N   1 
ATOM   2307 C  CA  . PHE A 1 301 ? 29.246 4.639  49.610 1.00 63.65  ? 343 PHE A CA  1 
ATOM   2308 C  C   . PHE A 1 301 ? 29.497 4.178  51.048 1.00 63.66  ? 343 PHE A C   1 
ATOM   2309 O  O   . PHE A 1 301 ? 29.880 4.975  51.905 1.00 63.61  ? 343 PHE A O   1 
ATOM   2310 C  CB  . PHE A 1 301 ? 28.276 5.829  49.584 1.00 63.25  ? 343 PHE A CB  1 
ATOM   2311 C  CG  . PHE A 1 301 ? 28.367 6.655  48.331 1.00 62.71  ? 343 PHE A CG  1 
ATOM   2312 C  CD1 . PHE A 1 301 ? 27.732 6.247  47.163 1.00 62.02  ? 343 PHE A CD1 1 
ATOM   2313 C  CD2 . PHE A 1 301 ? 29.090 7.843  48.318 1.00 61.83  ? 343 PHE A CD2 1 
ATOM   2314 C  CE1 . PHE A 1 301 ? 27.819 7.009  46.003 1.00 61.56  ? 343 PHE A CE1 1 
ATOM   2315 C  CE2 . PHE A 1 301 ? 29.181 8.603  47.168 1.00 60.84  ? 343 PHE A CE2 1 
ATOM   2316 C  CZ  . PHE A 1 301 ? 28.545 8.185  46.008 1.00 61.26  ? 343 PHE A CZ  1 
ATOM   2317 N  N   . ARG A 1 302 ? 29.281 2.890  51.304 1.00 63.86  ? 344 ARG A N   1 
ATOM   2318 C  CA  . ARG A 1 302 ? 29.593 2.285  52.600 1.00 64.01  ? 344 ARG A CA  1 
ATOM   2319 C  C   . ARG A 1 302 ? 31.103 2.229  52.839 1.00 63.94  ? 344 ARG A C   1 
ATOM   2320 O  O   . ARG A 1 302 ? 31.558 2.293  53.983 1.00 63.91  ? 344 ARG A O   1 
ATOM   2321 C  CB  . ARG A 1 302 ? 29.002 0.877  52.691 1.00 64.10  ? 344 ARG A CB  1 
ATOM   2322 C  CG  . ARG A 1 302 ? 27.509 0.831  52.993 1.00 64.76  ? 344 ARG A CG  1 
ATOM   2323 C  CD  . ARG A 1 302 ? 26.966 -0.575 52.781 1.00 65.72  ? 344 ARG A CD  1 
ATOM   2324 N  NE  . ARG A 1 302 ? 25.588 -0.720 53.247 1.00 66.79  ? 344 ARG A NE  1 
ATOM   2325 C  CZ  . ARG A 1 302 ? 24.864 -1.831 53.128 1.00 67.19  ? 344 ARG A CZ  1 
ATOM   2326 N  NH1 . ARG A 1 302 ? 25.375 -2.910 52.546 1.00 67.28  ? 344 ARG A NH1 1 
ATOM   2327 N  NH2 . ARG A 1 302 ? 23.621 -1.865 53.589 1.00 67.34  ? 344 ARG A NH2 1 
ATOM   2328 N  N   . THR A 1 303 ? 31.867 2.118  51.752 1.00 63.84  ? 345 THR A N   1 
ATOM   2329 C  CA  . THR A 1 303 ? 33.322 2.003  51.825 1.00 63.74  ? 345 THR A CA  1 
ATOM   2330 C  C   . THR A 1 303 ? 34.043 3.288  51.397 1.00 63.83  ? 345 THR A C   1 
ATOM   2331 O  O   . THR A 1 303 ? 35.253 3.269  51.142 1.00 63.97  ? 345 THR A O   1 
ATOM   2332 C  CB  . THR A 1 303 ? 33.842 0.807  50.988 1.00 63.71  ? 345 THR A CB  1 
ATOM   2333 O  OG1 . THR A 1 303 ? 33.481 0.982  49.612 1.00 63.91  ? 345 THR A OG1 1 
ATOM   2334 C  CG2 . THR A 1 303 ? 33.266 -0.509 51.497 1.00 63.72  ? 345 THR A CG2 1 
ATOM   2335 N  N   . ILE A 1 304 ? 33.301 4.396  51.319 1.00 63.72  ? 346 ILE A N   1 
ATOM   2336 C  CA  . ILE A 1 304 ? 33.878 5.706  50.991 1.00 63.60  ? 346 ILE A CA  1 
ATOM   2337 C  C   . ILE A 1 304 ? 34.947 6.087  52.030 1.00 63.71  ? 346 ILE A C   1 
ATOM   2338 O  O   . ILE A 1 304 ? 34.730 5.908  53.233 1.00 63.76  ? 346 ILE A O   1 
ATOM   2339 C  CB  . ILE A 1 304 ? 32.778 6.816  50.848 1.00 63.58  ? 346 ILE A CB  1 
ATOM   2340 C  CG1 . ILE A 1 304 ? 33.329 8.052  50.125 1.00 63.17  ? 346 ILE A CG1 1 
ATOM   2341 C  CG2 . ILE A 1 304 ? 32.167 7.187  52.208 1.00 63.42  ? 346 ILE A CG2 1 
ATOM   2342 C  CD1 . ILE A 1 304 ? 32.285 9.097  49.763 1.00 63.47  ? 346 ILE A CD1 1 
ATOM   2343 N  N   . PRO A 1 305 ? 36.121 6.571  51.569 1.00 63.75  ? 347 PRO A N   1 
ATOM   2344 C  CA  . PRO A 1 305 ? 37.197 6.957  52.492 1.00 63.86  ? 347 PRO A CA  1 
ATOM   2345 C  C   . PRO A 1 305 ? 36.752 7.965  53.549 1.00 64.05  ? 347 PRO A C   1 
ATOM   2346 O  O   . PRO A 1 305 ? 35.897 8.815  53.279 1.00 63.96  ? 347 PRO A O   1 
ATOM   2347 C  CB  . PRO A 1 305 ? 38.241 7.583  51.563 1.00 63.80  ? 347 PRO A CB  1 
ATOM   2348 C  CG  . PRO A 1 305 ? 38.006 6.931  50.261 1.00 63.58  ? 347 PRO A CG  1 
ATOM   2349 C  CD  . PRO A 1 305 ? 36.525 6.752  50.163 1.00 63.52  ? 347 PRO A CD  1 
ATOM   2350 N  N   . ALA A 1 306 ? 37.342 7.860  54.736 1.00 64.36  ? 348 ALA A N   1 
ATOM   2351 C  CA  . ALA A 1 306 ? 36.977 8.681  55.895 1.00 64.73  ? 348 ALA A CA  1 
ATOM   2352 C  C   . ALA A 1 306 ? 37.198 10.175 55.673 1.00 65.07  ? 348 ALA A C   1 
ATOM   2353 O  O   . ALA A 1 306 ? 36.468 10.999 56.225 1.00 65.04  ? 348 ALA A O   1 
ATOM   2354 C  CB  . ALA A 1 306 ? 37.737 8.209  57.136 1.00 64.75  ? 348 ALA A CB  1 
ATOM   2355 N  N   . GLU A 1 307 ? 38.202 10.512 54.863 1.00 65.57  ? 349 GLU A N   1 
ATOM   2356 C  CA  . GLU A 1 307 ? 38.519 11.902 54.516 1.00 66.18  ? 349 GLU A CA  1 
ATOM   2357 C  C   . GLU A 1 307 ? 37.310 12.669 53.961 1.00 66.29  ? 349 GLU A C   1 
ATOM   2358 O  O   . GLU A 1 307 ? 37.196 13.881 54.151 1.00 66.28  ? 349 GLU A O   1 
ATOM   2359 C  CB  . GLU A 1 307 ? 39.697 11.962 53.527 1.00 66.12  ? 349 GLU A CB  1 
ATOM   2360 C  CG  . GLU A 1 307 ? 39.535 11.072 52.290 1.00 66.77  ? 349 GLU A CG  1 
ATOM   2361 C  CD  . GLU A 1 307 ? 40.584 11.305 51.204 1.00 66.68  ? 349 GLU A CD  1 
ATOM   2362 O  OE1 . GLU A 1 307 ? 41.612 11.968 51.464 1.00 67.69  ? 349 GLU A OE1 1 
ATOM   2363 O  OE2 . GLU A 1 307 ? 40.376 10.808 50.078 1.00 67.08  ? 349 GLU A OE2 1 
ATOM   2364 N  N   . ALA A 1 308 ? 36.409 11.945 53.295 1.00 66.59  ? 350 ALA A N   1 
ATOM   2365 C  CA  . ALA A 1 308 ? 35.216 12.522 52.674 1.00 66.86  ? 350 ALA A CA  1 
ATOM   2366 C  C   . ALA A 1 308 ? 34.188 13.042 53.684 1.00 67.31  ? 350 ALA A C   1 
ATOM   2367 O  O   . ALA A 1 308 ? 33.288 13.800 53.317 1.00 67.17  ? 350 ALA A O   1 
ATOM   2368 C  CB  . ALA A 1 308 ? 34.572 11.508 51.738 1.00 66.61  ? 350 ALA A CB  1 
ATOM   2369 N  N   . ASN A 1 309 ? 34.331 12.638 54.948 1.00 67.91  ? 351 ASN A N   1 
ATOM   2370 C  CA  . ASN A 1 309 ? 33.387 13.001 56.011 1.00 68.59  ? 351 ASN A CA  1 
ATOM   2371 C  C   . ASN A 1 309 ? 33.912 14.051 57.000 1.00 69.17  ? 351 ASN A C   1 
ATOM   2372 O  O   . ASN A 1 309 ? 33.139 14.639 57.764 1.00 69.14  ? 351 ASN A O   1 
ATOM   2373 C  CB  . ASN A 1 309 ? 32.937 11.747 56.775 1.00 68.51  ? 351 ASN A CB  1 
ATOM   2374 C  CG  . ASN A 1 309 ? 32.175 10.763 55.898 1.00 68.40  ? 351 ASN A CG  1 
ATOM   2375 O  OD1 . ASN A 1 309 ? 31.333 11.151 55.082 1.00 67.09  ? 351 ASN A OD1 1 
ATOM   2376 N  ND2 . ASN A 1 309 ? 32.457 9.477  56.079 1.00 68.00  ? 351 ASN A ND2 1 
ATOM   2377 N  N   . ILE A 1 310 ? 35.224 14.272 56.994 1.00 69.96  ? 352 ILE A N   1 
ATOM   2378 C  CA  . ILE A 1 310 ? 35.848 15.284 57.853 1.00 70.66  ? 352 ILE A CA  1 
ATOM   2379 C  C   . ILE A 1 310 ? 36.287 16.512 57.044 1.00 71.15  ? 352 ILE A C   1 
ATOM   2380 O  O   . ILE A 1 310 ? 36.776 16.368 55.921 1.00 71.01  ? 352 ILE A O   1 
ATOM   2381 C  CB  . ILE A 1 310 ? 37.028 14.711 58.689 1.00 70.61  ? 352 ILE A CB  1 
ATOM   2382 C  CG1 . ILE A 1 310 ? 37.834 13.686 57.880 1.00 70.66  ? 352 ILE A CG1 1 
ATOM   2383 C  CG2 . ILE A 1 310 ? 36.506 14.100 59.989 1.00 71.00  ? 352 ILE A CG2 1 
ATOM   2384 C  CD1 . ILE A 1 310 ? 39.160 13.283 58.517 1.00 70.55  ? 352 ILE A CD1 1 
ATOM   2385 N  N   . PRO A 1 311 ? 36.110 17.724 57.615 1.00 71.75  ? 353 PRO A N   1 
ATOM   2386 C  CA  . PRO A 1 311 ? 36.354 18.980 56.897 1.00 72.18  ? 353 PRO A CA  1 
ATOM   2387 C  C   . PRO A 1 311 ? 37.838 19.313 56.684 1.00 72.50  ? 353 PRO A C   1 
ATOM   2388 O  O   . PRO A 1 311 ? 38.688 18.910 57.481 1.00 72.59  ? 353 PRO A O   1 
ATOM   2389 C  CB  . PRO A 1 311 ? 35.700 20.026 57.804 1.00 72.18  ? 353 PRO A CB  1 
ATOM   2390 C  CG  . PRO A 1 311 ? 35.825 19.455 59.173 1.00 72.19  ? 353 PRO A CG  1 
ATOM   2391 C  CD  . PRO A 1 311 ? 35.665 17.968 59.003 1.00 71.91  ? 353 PRO A CD  1 
ATOM   2392 N  N   . ILE A 1 312 ? 38.127 20.046 55.608 1.00 72.92  ? 354 ILE A N   1 
ATOM   2393 C  CA  . ILE A 1 312 ? 39.490 20.489 55.288 1.00 73.19  ? 354 ILE A CA  1 
ATOM   2394 C  C   . ILE A 1 312 ? 39.582 22.015 55.197 1.00 73.30  ? 354 ILE A C   1 
ATOM   2395 O  O   . ILE A 1 312 ? 39.717 22.700 56.215 1.00 73.28  ? 354 ILE A O   1 
ATOM   2396 C  CB  . ILE A 1 312 ? 40.039 19.823 53.979 1.00 73.27  ? 354 ILE A CB  1 
ATOM   2397 C  CG1 . ILE A 1 312 ? 41.500 20.223 53.714 1.00 73.46  ? 354 ILE A CG1 1 
ATOM   2398 C  CG2 . ILE A 1 312 ? 39.152 20.133 52.771 1.00 73.08  ? 354 ILE A CG2 1 
ATOM   2399 C  CD1 . ILE A 1 312 ? 42.520 19.555 54.639 1.00 74.23  ? 354 ILE A CD1 1 
HETATM 2400 CU CU  . CU  B 2 .   ? 33.208 35.295 44.364 1.00 71.25  ? 357 CU  A CU  1 
HETATM 2401 CU CU  . CU  C 2 .   ? 25.069 27.667 43.428 1.00 55.40  ? 358 CU  A CU  1 
HETATM 2402 NI NI  . NI  D 3 .   ? 46.635 7.921  31.831 1.00 51.01  ? 359 NI  A NI  1 
HETATM 2403 N  N   . NO2 E 4 .   ? 24.251 30.250 43.284 1.00 64.52  ? 1   NO2 A N   1 
HETATM 2404 O  O1  . NO2 E 4 .   ? 25.499 29.531 43.485 1.00 63.43  ? 1   NO2 A O1  1 
HETATM 2405 O  O2  . NO2 E 4 .   ? 23.394 29.475 42.405 1.00 65.04  ? 1   NO2 A O2  1 
HETATM 2406 N  N   . NO2 F 4 .   ? 46.679 5.150  31.786 1.00 59.22  ? 2   NO2 A N   1 
HETATM 2407 O  O1  . NO2 F 4 .   ? 47.950 5.672  32.286 1.00 59.34  ? 2   NO2 A O1  1 
HETATM 2408 O  O2  . NO2 F 4 .   ? 45.762 6.231  31.436 1.00 57.86  ? 2   NO2 A O2  1 
HETATM 2409 N  N   . NO2 G 4 .   ? 33.229 -0.227 40.347 1.00 78.07  ? 3   NO2 A N   1 
HETATM 2410 O  O1  . NO2 G 4 .   ? 33.938 -0.766 41.494 1.00 77.73  ? 3   NO2 A O1  1 
HETATM 2411 O  O2  . NO2 G 4 .   ? 33.762 -0.787 39.116 1.00 78.23  ? 3   NO2 A O2  1 
HETATM 2412 C  C1  . GOL H 5 .   ? 40.770 26.177 32.145 1.00 49.93  ? 360 GOL A C1  1 
HETATM 2413 O  O1  . GOL H 5 .   ? 39.641 26.729 32.777 1.00 49.08  ? 360 GOL A O1  1 
HETATM 2414 C  C2  . GOL H 5 .   ? 41.863 25.953 33.181 1.00 51.72  ? 360 GOL A C2  1 
HETATM 2415 O  O2  . GOL H 5 .   ? 42.347 27.214 33.583 1.00 52.41  ? 360 GOL A O2  1 
HETATM 2416 C  C3  . GOL H 5 .   ? 41.324 25.184 34.392 1.00 52.00  ? 360 GOL A C3  1 
HETATM 2417 O  O3  . GOL H 5 .   ? 42.385 24.747 35.215 1.00 52.12  ? 360 GOL A O3  1 
HETATM 2418 C  C1  . GOL I 5 .   ? 32.998 23.467 25.339 1.00 51.19  ? 361 GOL A C1  1 
HETATM 2419 O  O1  . GOL I 5 .   ? 33.388 22.125 25.538 1.00 50.72  ? 361 GOL A O1  1 
HETATM 2420 C  C2  . GOL I 5 .   ? 31.483 23.603 25.409 1.00 51.81  ? 361 GOL A C2  1 
HETATM 2421 O  O2  . GOL I 5 .   ? 31.161 24.964 25.566 1.00 53.37  ? 361 GOL A O2  1 
HETATM 2422 C  C3  . GOL I 5 .   ? 30.797 23.057 24.155 1.00 51.71  ? 361 GOL A C3  1 
HETATM 2423 O  O3  . GOL I 5 .   ? 31.063 23.864 23.025 1.00 50.04  ? 361 GOL A O3  1 
HETATM 2424 C  C1  . GOL J 5 .   ? 28.883 8.950  30.831 1.00 60.44  ? 362 GOL A C1  1 
HETATM 2425 O  O1  . GOL J 5 .   ? 29.105 7.661  30.301 1.00 60.84  ? 362 GOL A O1  1 
HETATM 2426 C  C2  . GOL J 5 .   ? 28.073 8.839  32.118 1.00 60.23  ? 362 GOL A C2  1 
HETATM 2427 O  O2  . GOL J 5 .   ? 28.944 8.678  33.219 1.00 58.67  ? 362 GOL A O2  1 
HETATM 2428 C  C3  . GOL J 5 .   ? 27.225 10.093 32.291 1.00 61.00  ? 362 GOL A C3  1 
HETATM 2429 O  O3  . GOL J 5 .   ? 26.202 9.860  33.237 1.00 62.63  ? 362 GOL A O3  1 
HETATM 2430 O  O   . HOH K 6 .   ? 36.890 24.665 43.808 1.00 41.68  ? 4   HOH A O   1 
HETATM 2431 O  O   . HOH K 6 .   ? 23.247 20.644 42.950 1.00 43.84  ? 5   HOH A O   1 
HETATM 2432 O  O   . HOH K 6 .   ? 37.521 44.047 17.367 1.00 45.19  ? 6   HOH A O   1 
HETATM 2433 O  O   . HOH K 6 .   ? 42.304 26.930 37.340 1.00 45.66  ? 7   HOH A O   1 
HETATM 2434 O  O   . HOH K 6 .   ? 39.840 27.869 35.387 1.00 48.47  ? 8   HOH A O   1 
HETATM 2435 O  O   . HOH K 6 .   ? 16.396 19.037 46.497 1.00 45.47  ? 9   HOH A O   1 
HETATM 2436 O  O   . HOH K 6 .   ? 31.983 22.727 29.914 1.00 41.73  ? 10  HOH A O   1 
HETATM 2437 O  O   . HOH K 6 .   ? 44.725 28.206 30.012 1.00 44.48  ? 11  HOH A O   1 
HETATM 2438 O  O   . HOH K 6 .   ? 15.829 28.746 57.124 1.00 68.57  ? 12  HOH A O   1 
HETATM 2439 O  O   . HOH K 6 .   ? 42.263 10.910 27.816 1.00 53.33  ? 13  HOH A O   1 
HETATM 2440 O  O   . HOH K 6 .   ? 40.981 44.947 16.933 1.00 59.26  ? 14  HOH A O   1 
HETATM 2441 O  O   . HOH K 6 .   ? 33.659 8.823  23.820 1.00 42.81  ? 15  HOH A O   1 
HETATM 2442 O  O   . HOH K 6 .   ? 29.671 12.674 56.361 1.00 59.95  ? 16  HOH A O   1 
HETATM 2443 O  O   . HOH K 6 .   ? 44.084 34.621 26.009 1.00 60.40  ? 17  HOH A O   1 
HETATM 2444 O  O   . HOH K 6 .   ? 32.986 14.813 50.783 1.00 51.75  ? 18  HOH A O   1 
HETATM 2445 O  O   . HOH K 6 .   ? 27.260 4.867  26.453 1.00 77.61  ? 19  HOH A O   1 
HETATM 2446 O  O   . HOH K 6 .   ? 50.882 10.817 39.018 1.00 77.34  ? 20  HOH A O   1 
HETATM 2447 O  O   . HOH K 6 .   ? 51.049 24.242 29.829 1.00 78.24  ? 21  HOH A O   1 
HETATM 2448 O  O   . HOH K 6 .   ? 20.900 13.279 43.254 1.00 61.89  ? 22  HOH A O   1 
HETATM 2449 O  O   . HOH K 6 .   ? 32.999 21.323 28.084 1.00 47.41  ? 23  HOH A O   1 
HETATM 2450 O  O   . HOH K 6 .   ? 25.815 2.828  27.276 1.00 70.53  ? 24  HOH A O   1 
HETATM 2451 O  O   . HOH K 6 .   ? 40.433 28.516 38.264 1.00 49.71  ? 25  HOH A O   1 
HETATM 2452 O  O   . HOH K 6 .   ? 7.694  27.239 55.222 1.00 54.48  ? 27  HOH A O   1 
HETATM 2453 O  O   . HOH K 6 .   ? 21.893 22.650 41.322 1.00 63.60  ? 28  HOH A O   1 
HETATM 2454 O  O   . HOH K 6 .   ? 22.674 11.590 35.044 1.00 52.92  ? 29  HOH A O   1 
HETATM 2455 O  O   . HOH K 6 .   ? 34.197 16.736 21.401 1.00 66.60  ? 30  HOH A O   1 
HETATM 2456 O  O   . HOH K 6 .   ? 29.829 29.885 16.473 1.00 54.84  ? 31  HOH A O   1 
HETATM 2457 O  O   . HOH K 6 .   ? 48.451 22.853 33.315 1.00 55.38  ? 32  HOH A O   1 
HETATM 2458 O  O   . HOH K 6 .   ? 28.122 43.863 26.897 1.00 76.85  ? 33  HOH A O   1 
HETATM 2459 O  O   . HOH K 6 .   ? 28.951 -1.199 41.778 1.00 72.72  ? 34  HOH A O   1 
HETATM 2460 O  O   . HOH K 6 .   ? 44.454 10.112 26.218 1.00 49.58  ? 35  HOH A O   1 
HETATM 2461 O  O   . HOH K 6 .   ? 33.775 30.906 42.010 1.00 71.85  ? 36  HOH A O   1 
HETATM 2462 O  O   . HOH K 6 .   ? 41.115 40.924 21.992 1.00 53.39  ? 37  HOH A O   1 
HETATM 2463 O  O   . HOH K 6 .   ? 28.738 27.434 39.737 1.00 63.70  ? 38  HOH A O   1 
HETATM 2464 O  O   . HOH K 6 .   ? 35.886 22.373 55.445 1.00 87.02  ? 39  HOH A O   1 
HETATM 2465 O  O   . HOH K 6 .   ? 43.681 5.539  29.520 1.00 64.64  ? 40  HOH A O   1 
HETATM 2466 O  O   . HOH K 6 .   ? 40.770 18.133 17.172 1.00 55.91  ? 41  HOH A O   1 
HETATM 2467 O  O   . HOH K 6 .   ? 15.968 25.754 50.098 1.00 47.62  ? 42  HOH A O   1 
HETATM 2468 O  O   . HOH K 6 .   ? 35.232 20.746 24.286 1.00 36.14  ? 363 HOH A O   1 
HETATM 2469 O  O   . HOH K 6 .   ? 36.814 3.649  28.022 1.00 54.32  ? 364 HOH A O   1 
HETATM 2470 O  O   . HOH K 6 .   ? 29.507 22.655 33.296 1.00 51.82  ? 365 HOH A O   1 
HETATM 2471 O  O   . HOH K 6 .   ? 16.859 30.590 58.505 1.00 78.47  ? 366 HOH A O   1 
HETATM 2472 O  O   . HOH K 6 .   ? 40.024 3.480  41.353 1.00 55.58  ? 367 HOH A O   1 
HETATM 2473 O  O   . HOH K 6 .   ? 23.975 33.127 40.610 1.00 65.82  ? 368 HOH A O   1 
HETATM 2474 O  O   . HOH K 6 .   ? 30.632 14.302 58.295 1.00 69.00  ? 369 HOH A O   1 
HETATM 2475 O  O   . HOH K 6 .   ? 19.634 25.503 64.103 1.00 68.12  ? 370 HOH A O   1 
HETATM 2476 O  O   . HOH K 6 .   ? 44.358 9.131  19.632 1.00 58.92  ? 371 HOH A O   1 
HETATM 2477 O  O   . HOH K 6 .   ? 21.746 37.374 24.261 1.00 82.18  ? 372 HOH A O   1 
HETATM 2478 O  O   . HOH K 6 .   ? 46.161 24.881 25.231 1.00 39.66  ? 373 HOH A O   1 
HETATM 2479 O  O   . HOH K 6 .   ? 25.368 4.939  35.326 1.00 72.05  ? 374 HOH A O   1 
HETATM 2480 O  O   . HOH K 6 .   ? 42.766 11.641 18.375 1.00 63.00  ? 375 HOH A O   1 
HETATM 2481 O  O   . HOH K 6 .   ? 43.878 4.832  19.972 1.00 60.32  ? 376 HOH A O   1 
HETATM 2482 O  O   . HOH K 6 .   ? 12.994 18.834 47.058 1.00 85.44  ? 377 HOH A O   1 
HETATM 2483 O  O   . HOH K 6 .   ? 44.461 23.466 34.118 1.00 53.24  ? 378 HOH A O   1 
HETATM 2484 O  O   . HOH K 6 .   ? 22.633 13.294 45.719 1.00 58.10  ? 379 HOH A O   1 
HETATM 2485 O  O   . HOH K 6 .   ? 25.681 24.303 18.701 1.00 61.92  ? 380 HOH A O   1 
HETATM 2486 O  O   . HOH K 6 .   ? 49.053 15.782 38.810 1.00 78.28  ? 381 HOH A O   1 
HETATM 2487 O  O   . HOH K 6 .   ? 47.118 24.080 22.835 1.00 46.28  ? 382 HOH A O   1 
HETATM 2488 O  O   . HOH K 6 .   ? 47.878 32.368 24.880 1.00 66.44  ? 383 HOH A O   1 
HETATM 2489 O  O   . HOH K 6 .   ? 34.761 31.384 45.236 1.00 67.56  ? 384 HOH A O   1 
HETATM 2490 O  O   . HOH K 6 .   ? 45.954 45.475 31.013 1.00 87.54  ? 385 HOH A O   1 
HETATM 2491 O  O   . HOH K 6 .   ? 19.882 34.422 45.598 1.00 68.82  ? 386 HOH A O   1 
HETATM 2492 O  O   . HOH K 6 .   ? 43.514 29.092 32.070 1.00 46.97  ? 387 HOH A O   1 
HETATM 2493 O  O   . HOH K 6 .   ? 26.759 7.175  28.726 1.00 62.43  ? 388 HOH A O   1 
HETATM 2494 O  O   . HOH K 6 .   ? 23.052 37.232 19.190 1.00 69.66  ? 389 HOH A O   1 
HETATM 2495 O  O   . HOH K 6 .   ? 17.739 30.536 61.042 1.00 78.38  ? 390 HOH A O   1 
HETATM 2496 O  O   . HOH K 6 .   ? 13.219 13.685 45.425 1.00 75.04  ? 391 HOH A O   1 
HETATM 2497 O  O   . HOH K 6 .   ? 42.975 16.494 15.396 1.00 66.28  ? 392 HOH A O   1 
HETATM 2498 O  O   . HOH K 6 .   ? 40.529 9.536  24.900 1.00 52.29  ? 393 HOH A O   1 
HETATM 2499 O  O   . HOH K 6 .   ? 26.726 24.868 24.271 1.00 54.89  ? 394 HOH A O   1 
HETATM 2500 O  O   . HOH K 6 .   ? 45.494 21.644 36.152 1.00 69.66  ? 395 HOH A O   1 
HETATM 2501 O  O   . HOH K 6 .   ? 47.503 27.794 17.603 1.00 59.53  ? 396 HOH A O   1 
HETATM 2502 O  O   . HOH K 6 .   ? 41.403 31.118 39.768 1.00 57.71  ? 397 HOH A O   1 
HETATM 2503 O  O   . HOH K 6 .   ? 13.632 15.808 46.949 1.00 60.02  ? 398 HOH A O   1 
HETATM 2504 O  O   . HOH K 6 .   ? 24.654 24.591 25.994 1.00 54.91  ? 399 HOH A O   1 
HETATM 2505 O  O   . HOH K 6 .   ? 43.305 40.180 36.351 1.00 69.45  ? 400 HOH A O   1 
HETATM 2506 O  O   . HOH K 6 .   ? 29.639 21.239 31.110 1.00 50.37  ? 401 HOH A O   1 
HETATM 2507 O  O   . HOH K 6 .   ? 24.568 6.627  48.987 1.00 70.84  ? 402 HOH A O   1 
HETATM 2508 O  O   . HOH K 6 .   ? 37.961 21.380 13.088 1.00 61.66  ? 403 HOH A O   1 
HETATM 2509 O  O   . HOH K 6 .   ? 26.162 5.483  32.618 1.00 68.18  ? 404 HOH A O   1 
HETATM 2510 O  O   . HOH K 6 .   ? 34.631 48.632 22.350 1.00 66.59  ? 405 HOH A O   1 
HETATM 2511 O  O   . HOH K 6 .   ? 28.207 31.799 17.395 1.00 57.31  ? 406 HOH A O   1 
HETATM 2512 O  O   . HOH K 6 .   ? 32.631 23.593 11.622 1.00 57.37  ? 407 HOH A O   1 
HETATM 2513 O  O   . HOH K 6 .   ? 24.194 48.611 38.804 1.00 75.32  ? 408 HOH A O   1 
HETATM 2514 O  O   . HOH K 6 .   ? 36.855 33.181 45.636 1.00 87.29  ? 409 HOH A O   1 
HETATM 2515 O  O   . HOH K 6 .   ? 48.122 22.122 19.530 1.00 55.81  ? 410 HOH A O   1 
HETATM 2516 O  O   . HOH K 6 .   ? 28.797 18.787 31.728 1.00 49.88  ? 411 HOH A O   1 
HETATM 2517 O  O   . HOH K 6 .   ? 40.652 8.935  54.600 1.00 82.39  ? 412 HOH A O   1 
HETATM 2518 O  O   . HOH K 6 .   ? 29.860 30.000 41.787 1.00 69.71  ? 413 HOH A O   1 
HETATM 2519 O  O   . HOH K 6 .   ? 22.256 27.454 51.694 1.00 48.07  ? 414 HOH A O   1 
HETATM 2520 O  O   . HOH K 6 .   ? 34.477 -0.664 47.938 1.00 79.19  ? 415 HOH A O   1 
HETATM 2521 O  O   . HOH K 6 .   ? 46.962 39.150 29.696 1.00 84.72  ? 416 HOH A O   1 
HETATM 2522 O  O   . HOH K 6 .   ? 29.554 49.253 25.110 1.00 71.27  ? 417 HOH A O   1 
HETATM 2523 O  O   . HOH K 6 .   ? 24.354 6.874  34.179 1.00 73.13  ? 418 HOH A O   1 
HETATM 2524 O  O   . HOH K 6 .   ? 47.732 21.149 17.111 1.00 56.38  ? 419 HOH A O   1 
HETATM 2525 O  O   . HOH K 6 .   ? 42.238 49.722 24.177 1.00 68.47  ? 420 HOH A O   1 
HETATM 2526 O  O   . HOH K 6 .   ? 23.147 40.213 41.994 1.00 90.19  ? 421 HOH A O   1 
HETATM 2527 O  O   . HOH K 6 .   ? 47.945 25.334 26.879 1.00 51.73  ? 422 HOH A O   1 
HETATM 2528 O  O   . HOH K 6 .   ? 19.351 7.820  41.093 1.00 68.22  ? 423 HOH A O   1 
HETATM 2529 O  O   . HOH K 6 .   ? 35.301 50.749 25.666 1.00 71.82  ? 424 HOH A O   1 
HETATM 2530 O  O   . HOH K 6 .   ? 22.025 10.609 48.516 1.00 67.69  ? 425 HOH A O   1 
HETATM 2531 O  O   . HOH K 6 .   ? 18.228 23.615 56.464 1.00 51.05  ? 426 HOH A O   1 
HETATM 2532 O  O   . HOH K 6 .   ? 25.595 -0.377 45.661 1.00 68.59  ? 427 HOH A O   1 
HETATM 2533 O  O   . HOH K 6 .   ? 45.687 28.700 43.043 1.00 80.16  ? 428 HOH A O   1 
HETATM 2534 O  O   . HOH K 6 .   ? 43.543 40.669 45.781 1.00 101.59 ? 429 HOH A O   1 
HETATM 2535 O  O   . HOH K 6 .   ? 35.281 46.393 23.509 1.00 83.91  ? 430 HOH A O   1 
HETATM 2536 O  O   . HOH K 6 .   ? 33.222 49.485 40.239 1.00 83.93  ? 431 HOH A O   1 
HETATM 2537 O  O   . HOH K 6 .   ? 45.834 26.160 42.791 1.00 67.16  ? 432 HOH A O   1 
HETATM 2538 O  O   . HOH K 6 .   ? 45.234 12.887 20.027 1.00 59.05  ? 433 HOH A O   1 
HETATM 2539 O  O   . HOH K 6 .   ? 27.009 17.784 13.448 1.00 81.51  ? 434 HOH A O   1 
HETATM 2540 O  O   . HOH K 6 .   ? 46.246 11.585 52.282 1.00 80.08  ? 435 HOH A O   1 
HETATM 2541 O  O   . HOH K 6 .   ? 46.640 34.799 7.239  1.00 81.00  ? 436 HOH A O   1 
HETATM 2542 O  O   . HOH K 6 .   ? 33.367 51.550 42.267 1.00 94.75  ? 437 HOH A O   1 
HETATM 2543 O  O   . HOH K 6 .   ? 25.721 24.105 11.684 1.00 93.95  ? 438 HOH A O   1 
HETATM 2544 O  O   . HOH K 6 .   ? 21.021 14.011 47.699 1.00 61.99  ? 439 HOH A O   1 
HETATM 2545 O  O   . HOH K 6 .   ? 37.895 18.361 14.699 1.00 78.66  ? 440 HOH A O   1 
HETATM 2546 O  O   . HOH K 6 .   ? 18.904 14.443 51.380 1.00 47.53  ? 441 HOH A O   1 
HETATM 2547 O  O   . HOH K 6 .   ? 44.338 26.766 40.606 1.00 66.13  ? 442 HOH A O   1 
HETATM 2548 O  O   . HOH K 6 .   ? 36.601 -0.446 35.159 1.00 74.47  ? 443 HOH A O   1 
HETATM 2549 O  O   . HOH K 6 .   ? 33.811 42.267 25.574 1.00 53.04  ? 444 HOH A O   1 
HETATM 2550 O  O   . HOH K 6 .   ? 14.850 19.316 61.828 1.00 64.56  ? 445 HOH A O   1 
HETATM 2551 O  O   . HOH K 6 .   ? 25.454 9.363  27.684 1.00 68.30  ? 446 HOH A O   1 
HETATM 2552 O  O   . HOH K 6 .   ? 30.738 20.869 15.925 1.00 61.09  ? 447 HOH A O   1 
HETATM 2553 O  O   . HOH K 6 .   ? 34.417 23.109 57.608 1.00 74.16  ? 448 HOH A O   1 
HETATM 2554 O  O   . HOH K 6 .   ? 22.494 12.051 55.005 1.00 59.52  ? 449 HOH A O   1 
HETATM 2555 O  O   . HOH K 6 .   ? 33.587 30.268 48.022 1.00 64.87  ? 450 HOH A O   1 
HETATM 2556 O  O   . HOH K 6 .   ? 17.215 13.453 49.951 1.00 58.71  ? 451 HOH A O   1 
HETATM 2557 O  O   . HOH K 6 .   ? 26.661 22.830 22.563 1.00 62.93  ? 452 HOH A O   1 
HETATM 2558 O  O   . HOH K 6 .   ? 28.875 36.899 15.337 1.00 60.41  ? 453 HOH A O   1 
HETATM 2559 O  O   . HOH K 6 .   ? 25.908 12.962 30.050 1.00 56.97  ? 454 HOH A O   1 
HETATM 2560 O  O   . HOH K 6 .   ? 21.922 23.569 23.503 1.00 56.51  ? 455 HOH A O   1 
HETATM 2561 O  O   . HOH K 6 .   ? 42.279 23.350 51.909 1.00 95.74  ? 456 HOH A O   1 
HETATM 2562 O  O   . HOH K 6 .   ? 47.520 31.372 31.289 1.00 74.74  ? 457 HOH A O   1 
HETATM 2563 O  O   . HOH K 6 .   ? 45.247 35.891 38.279 1.00 68.66  ? 458 HOH A O   1 
HETATM 2564 O  O   . HOH K 6 .   ? 27.453 6.773  54.690 1.00 72.46  ? 459 HOH A O   1 
HETATM 2565 O  O   . HOH K 6 .   ? 18.844 31.419 54.129 1.00 76.59  ? 460 HOH A O   1 
HETATM 2566 O  O   . HOH K 6 .   ? 32.049 19.690 13.583 1.00 76.12  ? 461 HOH A O   1 
HETATM 2567 O  O   . HOH K 6 .   ? 49.312 33.273 18.458 1.00 82.30  ? 462 HOH A O   1 
HETATM 2568 O  O   . HOH K 6 .   ? 47.399 7.840  29.990 1.00 49.19  ? 463 HOH A O   1 
HETATM 2569 O  O   . HOH K 6 .   ? 44.233 32.410 33.370 1.00 64.08  ? 464 HOH A O   1 
HETATM 2570 O  O   . HOH K 6 .   ? 16.836 27.574 53.986 1.00 75.16  ? 465 HOH A O   1 
HETATM 2571 O  O   . HOH K 6 .   ? 29.761 29.645 49.100 1.00 63.04  ? 466 HOH A O   1 
HETATM 2572 O  O   . HOH K 6 .   ? 35.458 10.694 15.634 1.00 78.32  ? 467 HOH A O   1 
HETATM 2573 O  O   . HOH K 6 .   ? 12.551 21.089 62.525 1.00 54.27  ? 468 HOH A O   1 
HETATM 2574 O  O   . HOH K 6 .   ? 25.670 21.941 25.510 1.00 78.97  ? 469 HOH A O   1 
HETATM 2575 O  O   . HOH K 6 .   ? 45.303 38.945 37.331 1.00 70.43  ? 470 HOH A O   1 
HETATM 2576 O  O   . HOH K 6 .   ? 25.318 24.074 35.832 1.00 72.67  ? 471 HOH A O   1 
HETATM 2577 O  O   . HOH K 6 .   ? 36.765 25.753 46.905 1.00 61.29  ? 472 HOH A O   1 
HETATM 2578 O  O   . HOH K 6 .   ? 30.993 21.895 12.871 1.00 74.59  ? 473 HOH A O   1 
HETATM 2579 O  O   . HOH K 6 .   ? 16.958 31.498 31.321 1.00 65.29  ? 474 HOH A O   1 
HETATM 2580 O  O   . HOH K 6 .   ? 20.228 26.223 38.674 1.00 73.91  ? 475 HOH A O   1 
HETATM 2581 O  O   . HOH K 6 .   ? 7.211  30.036 56.368 1.00 77.99  ? 476 HOH A O   1 
HETATM 2582 O  O   . HOH K 6 .   ? 48.688 28.543 24.673 1.00 68.51  ? 477 HOH A O   1 
HETATM 2583 O  O   . HOH K 6 .   ? 44.842 11.162 48.549 1.00 72.42  ? 478 HOH A O   1 
HETATM 2584 O  O   . HOH K 6 .   ? 23.986 8.713  51.883 1.00 67.93  ? 479 HOH A O   1 
HETATM 2585 O  O   . HOH K 6 .   ? 43.067 16.755 50.365 1.00 73.70  ? 480 HOH A O   1 
HETATM 2586 O  O   . HOH K 6 .   ? 44.857 3.871  35.541 1.00 61.15  ? 481 HOH A O   1 
HETATM 2587 O  O   . HOH K 6 .   ? 47.731 43.547 30.314 1.00 73.93  ? 482 HOH A O   1 
HETATM 2588 O  O   . HOH K 6 .   ? 49.885 8.379  39.746 1.00 81.06  ? 483 HOH A O   1 
HETATM 2589 O  O   . HOH K 6 .   ? 23.325 25.346 33.150 1.00 72.82  ? 484 HOH A O   1 
HETATM 2590 O  O   . HOH K 6 .   ? 47.120 27.513 27.514 1.00 73.29  ? 485 HOH A O   1 
HETATM 2591 O  O   . HOH K 6 .   ? 46.012 7.789  33.626 1.00 54.83  ? 486 HOH A O   1 
HETATM 2592 O  O   . HOH K 6 .   ? 47.385 38.548 11.948 1.00 70.90  ? 487 HOH A O   1 
HETATM 2593 O  O   . HOH K 6 .   ? 45.491 16.736 16.038 1.00 61.50  ? 488 HOH A O   1 
HETATM 2594 O  O   . HOH K 6 .   ? 23.389 -5.253 57.127 1.00 76.25  ? 489 HOH A O   1 
HETATM 2595 O  O   . HOH K 6 .   ? 44.624 13.626 43.033 1.00 77.61  ? 490 HOH A O   1 
HETATM 2596 O  O   . HOH K 6 .   ? 22.857 35.231 41.616 1.00 77.87  ? 491 HOH A O   1 
HETATM 2597 O  O   . HOH K 6 .   ? 27.766 30.946 47.913 1.00 77.48  ? 492 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PHE 1   43  ?   ?   ?   A . n 
A 1 2   SER 2   44  ?   ?   ?   A . n 
A 1 3   ASN 3   45  45  ASN ASN A . n 
A 1 4   GLU 4   46  46  GLU GLU A . n 
A 1 5   CYS 5   47  47  CYS CYS A . n 
A 1 6   LEU 6   48  48  LEU LEU A . n 
A 1 7   GLY 7   49  49  GLY GLY A . n 
A 1 8   THR 8   50  50  THR THR A . n 
A 1 9   ILE 9   51  51  ILE ILE A . n 
A 1 10  GLY 10  52  52  GLY GLY A . n 
A 1 11  PRO 11  53  53  PRO PRO A . n 
A 1 12  VAL 12  54  54  VAL VAL A . n 
A 1 13  THR 13  55  55  THR THR A . n 
A 1 14  PRO 14  56  56  PRO PRO A . n 
A 1 15  LEU 15  57  57  LEU LEU A . n 
A 1 16  ASP 16  58  58  ASP ASP A . n 
A 1 17  ALA 17  59  59  ALA ALA A . n 
A 1 18  SER 18  60  60  SER SER A . n 
A 1 19  ASP 19  61  61  ASP ASP A . n 
A 1 20  PHE 20  62  62  PHE PHE A . n 
A 1 21  ALA 21  63  63  ALA ALA A . n 
A 1 22  LEU 22  64  64  LEU LEU A . n 
A 1 23  ASP 23  65  65  ASP ASP A . n 
A 1 24  ILE 24  66  66  ILE ILE A . n 
A 1 25  ARG 25  67  67  ARG ARG A . n 
A 1 26  MET 26  68  68  MET MET A . n 
A 1 27  PRO 27  69  69  PRO PRO A . n 
A 1 28  GLY 28  70  70  GLY GLY A . n 
A 1 29  VAL 29  71  71  VAL VAL A . n 
A 1 30  THR 30  72  72  THR THR A . n 
A 1 31  PRO 31  73  73  PRO PRO A . n 
A 1 32  LYS 32  74  74  LYS LYS A . n 
A 1 33  GLU 33  75  75  GLU GLU A . n 
A 1 34  SER 34  76  76  SER SER A . n 
A 1 35  ASP 35  77  77  ASP ASP A . n 
A 1 36  THR 36  78  78  THR THR A . n 
A 1 37  TYR 37  79  79  TYR TYR A . n 
A 1 38  PHE 38  80  80  PHE PHE A . n 
A 1 39  CYS 39  81  81  CYS CYS A . n 
A 1 40  MET 40  82  82  MET MET A . n 
A 1 41  SER 41  83  83  SER SER A . n 
A 1 42  MET 42  84  84  MET MET A . n 
A 1 43  ARG 43  85  85  ARG ARG A . n 
A 1 44  LEU 44  86  86  LEU LEU A . n 
A 1 45  PRO 45  87  87  PRO PRO A . n 
A 1 46  VAL 46  88  88  VAL VAL A . n 
A 1 47  ASP 47  89  89  ASP ASP A . n 
A 1 48  GLU 48  90  90  GLU GLU A . n 
A 1 49  GLU 49  91  91  GLU GLU A . n 
A 1 50  ALA 50  92  92  ALA ALA A . n 
A 1 51  PHE 51  93  93  PHE PHE A . n 
A 1 52  VAL 52  94  94  VAL VAL A . n 
A 1 53  ILE 53  95  95  ILE ILE A . n 
A 1 54  ASP 54  96  96  ASP ASP A . n 
A 1 55  PHE 55  97  97  PHE PHE A . n 
A 1 56  LYS 56  98  98  LYS LYS A . n 
A 1 57  PRO 57  99  99  PRO PRO A . n 
A 1 58  ARG 58  100 100 ARG ARG A . n 
A 1 59  ALA 59  101 101 ALA ALA A . n 
A 1 60  SER 60  102 102 SER SER A . n 
A 1 61  MET 61  103 103 MET MET A . n 
A 1 62  ASP 62  104 104 ASP ASP A . n 
A 1 63  THR 63  105 105 THR THR A . n 
A 1 64  VAL 64  106 106 VAL VAL A . n 
A 1 65  HIS 65  107 107 HIS HIS A . n 
A 1 66  HIS 66  108 108 HIS HIS A . n 
A 1 67  MET 67  109 109 MET MET A . n 
A 1 68  LEU 68  110 110 LEU LEU A . n 
A 1 69  LEU 69  111 111 LEU LEU A . n 
A 1 70  PHE 70  112 112 PHE PHE A . n 
A 1 71  GLY 71  113 113 GLY GLY A . n 
A 1 72  CYS 72  114 114 CYS CYS A . n 
A 1 73  ASN 73  115 115 ASN ASN A . n 
A 1 74  MET 74  116 116 MET MET A . n 
A 1 75  PRO 75  117 117 PRO PRO A . n 
A 1 76  SER 76  118 118 SER SER A . n 
A 1 77  SER 77  119 119 SER SER A . n 
A 1 78  THR 78  120 120 THR THR A . n 
A 1 79  GLY 79  121 121 GLY GLY A . n 
A 1 80  SER 80  122 122 SER SER A . n 
A 1 81  TYR 81  123 123 TYR TYR A . n 
A 1 82  TRP 82  124 124 TRP TRP A . n 
A 1 83  PHE 83  125 125 PHE PHE A . n 
A 1 84  CYS 84  126 126 CYS CYS A . n 
A 1 85  ASP 85  127 127 ASP ASP A . n 
A 1 86  GLU 86  128 128 GLU GLU A . n 
A 1 87  GLY 87  129 129 GLY GLY A . n 
A 1 88  THR 88  130 130 THR THR A . n 
A 1 89  CYS 89  131 131 CYS CYS A . n 
A 1 90  THR 90  132 132 THR THR A . n 
A 1 91  ASP 91  133 133 ASP ASP A . n 
A 1 92  LYS 92  134 134 LYS LYS A . n 
A 1 93  ALA 93  135 135 ALA ALA A . n 
A 1 94  ASN 94  136 136 ASN ASN A . n 
A 1 95  ILE 95  137 137 ILE ILE A . n 
A 1 96  LEU 96  138 138 LEU LEU A . n 
A 1 97  TYR 97  139 139 TYR TYR A . n 
A 1 98  ALA 98  140 140 ALA ALA A . n 
A 1 99  TRP 99  141 141 TRP TRP A . n 
A 1 100 ALA 100 142 142 ALA ALA A . n 
A 1 101 ARG 101 143 143 ARG ARG A . n 
A 1 102 ASN 102 144 144 ASN ASN A . n 
A 1 103 ALA 103 145 145 ALA ALA A . n 
A 1 104 PRO 104 146 146 PRO PRO A . n 
A 1 105 PRO 105 147 147 PRO PRO A . n 
A 1 106 THR 106 148 148 THR THR A . n 
A 1 107 ARG 107 149 149 ARG ARG A . n 
A 1 108 LEU 108 150 150 LEU LEU A . n 
A 1 109 PRO 109 151 151 PRO PRO A . n 
A 1 110 LYS 110 152 152 LYS LYS A . n 
A 1 111 GLY 111 153 153 GLY GLY A . n 
A 1 112 VAL 112 154 154 VAL VAL A . n 
A 1 113 GLY 113 155 155 GLY GLY A . n 
A 1 114 PHE 114 156 156 PHE PHE A . n 
A 1 115 ARG 115 157 157 ARG ARG A . n 
A 1 116 VAL 116 158 158 VAL VAL A . n 
A 1 117 GLY 117 159 159 GLY GLY A . n 
A 1 118 GLY 118 160 160 GLY GLY A . n 
A 1 119 GLU 119 161 161 GLU GLU A . n 
A 1 120 THR 120 162 162 THR THR A . n 
A 1 121 GLY 121 163 163 GLY GLY A . n 
A 1 122 SER 122 164 164 SER SER A . n 
A 1 123 LYS 123 165 165 LYS LYS A . n 
A 1 124 TYR 124 166 166 TYR TYR A . n 
A 1 125 PHE 125 167 167 PHE PHE A . n 
A 1 126 VAL 126 168 168 VAL VAL A . n 
A 1 127 LEU 127 169 169 LEU LEU A . n 
A 1 128 GLN 128 170 170 GLN GLN A . n 
A 1 129 VAL 129 171 171 VAL VAL A . n 
A 1 130 HIS 130 172 172 HIS HIS A . n 
A 1 131 TYR 131 173 173 TYR TYR A . n 
A 1 132 GLY 132 174 174 GLY GLY A . n 
A 1 133 ASP 133 175 175 ASP ASP A . n 
A 1 134 ILE 134 176 176 ILE ILE A . n 
A 1 135 SER 135 177 177 SER SER A . n 
A 1 136 ALA 136 178 178 ALA ALA A . n 
A 1 137 PHE 137 179 179 PHE PHE A . n 
A 1 138 ARG 138 180 ?   ?   ?   A . n 
A 1 139 ASP 139 181 ?   ?   ?   A . n 
A 1 140 ASN 140 182 182 ASN ASN A . n 
A 1 141 HIS 141 183 183 HIS HIS A . n 
A 1 142 LYS 142 184 184 LYS LYS A . n 
A 1 143 ASP 143 185 185 ASP ASP A . n 
A 1 144 CYS 144 186 186 CYS CYS A . n 
A 1 145 SER 145 187 187 SER SER A . n 
A 1 146 GLY 146 188 188 GLY GLY A . n 
A 1 147 VAL 147 189 189 VAL VAL A . n 
A 1 148 SER 148 190 190 SER SER A . n 
A 1 149 VAL 149 191 191 VAL VAL A . n 
A 1 150 HIS 150 192 192 HIS HIS A . n 
A 1 151 LEU 151 193 193 LEU LEU A . n 
A 1 152 THR 152 194 194 THR THR A . n 
A 1 153 ARG 153 195 195 ARG ARG A . n 
A 1 154 VAL 154 196 196 VAL VAL A . n 
A 1 155 PRO 155 197 197 PRO PRO A . n 
A 1 156 GLN 156 198 198 GLN GLN A . n 
A 1 157 PRO 157 199 199 PRO PRO A . n 
A 1 158 LEU 158 200 200 LEU LEU A . n 
A 1 159 ILE 159 201 201 ILE ILE A . n 
A 1 160 ALA 160 202 202 ALA ALA A . n 
A 1 161 GLY 161 203 203 GLY GLY A . n 
A 1 162 MET 162 204 204 MET MET A . n 
A 1 163 TYR 163 205 205 TYR TYR A . n 
A 1 164 LEU 164 206 206 LEU LEU A . n 
A 1 165 MET 165 207 207 MET MET A . n 
A 1 166 MET 166 208 208 MET MET A . n 
A 1 167 SER 167 209 209 SER SER A . n 
A 1 168 VAL 168 210 210 VAL VAL A . n 
A 1 169 ASP 169 211 211 ASP ASP A . n 
A 1 170 THR 170 212 212 THR THR A . n 
A 1 171 VAL 171 213 213 VAL VAL A . n 
A 1 172 ILE 172 214 214 ILE ILE A . n 
A 1 173 PRO 173 215 215 PRO PRO A . n 
A 1 174 PRO 174 216 216 PRO PRO A . n 
A 1 175 GLY 175 217 217 GLY GLY A . n 
A 1 176 GLU 176 218 218 GLU GLU A . n 
A 1 177 LYS 177 219 219 LYS LYS A . n 
A 1 178 VAL 178 220 220 VAL VAL A . n 
A 1 179 VAL 179 221 221 VAL VAL A . n 
A 1 180 ASN 180 222 222 ASN ASN A . n 
A 1 181 ALA 181 223 223 ALA ALA A . n 
A 1 182 ASP 182 224 224 ASP ASP A . n 
A 1 183 ILE 183 225 225 ILE ILE A . n 
A 1 184 SER 184 226 226 SER SER A . n 
A 1 185 CYS 185 227 227 CYS CYS A . n 
A 1 186 GLN 186 228 228 GLN GLN A . n 
A 1 187 TYR 187 229 229 TYR TYR A . n 
A 1 188 LYS 188 230 230 LYS LYS A . n 
A 1 189 MET 189 231 231 MET MET A . n 
A 1 190 TYR 190 232 232 TYR TYR A . n 
A 1 191 PRO 191 233 233 PRO PRO A . n 
A 1 192 MET 192 234 234 MET MET A . n 
A 1 193 HIS 193 235 235 HIS HIS A . n 
A 1 194 VAL 194 236 236 VAL VAL A . n 
A 1 195 PHE 195 237 237 PHE PHE A . n 
A 1 196 ALA 196 238 238 ALA ALA A . n 
A 1 197 TYR 197 239 239 TYR TYR A . n 
A 1 198 ARG 198 240 240 ARG ARG A . n 
A 1 199 VAL 199 241 241 VAL VAL A . n 
A 1 200 HIS 200 242 242 HIS HIS A . n 
A 1 201 THR 201 243 243 THR THR A . n 
A 1 202 HIS 202 244 244 HIS HIS A . n 
A 1 203 HIS 203 245 245 HIS HIS A . n 
A 1 204 LEU 204 246 246 LEU LEU A . n 
A 1 205 GLY 205 247 247 GLY GLY A . n 
A 1 206 LYS 206 248 248 LYS LYS A . n 
A 1 207 VAL 207 249 249 VAL VAL A . n 
A 1 208 VAL 208 250 250 VAL VAL A . n 
A 1 209 SER 209 251 251 SER SER A . n 
A 1 210 GLY 210 252 252 GLY GLY A . n 
A 1 211 TYR 211 253 253 TYR TYR A . n 
A 1 212 ARG 212 254 254 ARG ARG A . n 
A 1 213 VAL 213 255 255 VAL VAL A . n 
A 1 214 ARG 214 256 256 ARG ARG A . n 
A 1 215 ASN 215 257 257 ASN ASN A . n 
A 1 216 GLY 216 258 258 GLY GLY A . n 
A 1 217 GLN 217 259 259 GLN GLN A . n 
A 1 218 TRP 218 260 260 TRP TRP A . n 
A 1 219 THR 219 261 261 THR THR A . n 
A 1 220 LEU 220 262 262 LEU LEU A . n 
A 1 221 ILE 221 263 263 ILE ILE A . n 
A 1 222 GLY 222 264 264 GLY GLY A . n 
A 1 223 ARG 223 265 265 ARG ARG A . n 
A 1 224 GLN 224 266 266 GLN GLN A . n 
A 1 225 ASN 225 267 267 ASN ASN A . n 
A 1 226 PRO 226 268 268 PRO PRO A . n 
A 1 227 GLN 227 269 269 GLN GLN A . n 
A 1 228 LEU 228 270 270 LEU LEU A . n 
A 1 229 PRO 229 271 271 PRO PRO A . n 
A 1 230 GLN 230 272 272 GLN GLN A . n 
A 1 231 ALA 231 273 273 ALA ALA A . n 
A 1 232 PHE 232 274 274 PHE PHE A . n 
A 1 233 TYR 233 275 275 TYR TYR A . n 
A 1 234 PRO 234 276 276 PRO PRO A . n 
A 1 235 VAL 235 277 277 VAL VAL A . n 
A 1 236 GLU 236 278 278 GLU GLU A . n 
A 1 237 HIS 237 279 279 HIS HIS A . n 
A 1 238 PRO 238 280 280 PRO PRO A . n 
A 1 239 VAL 239 281 281 VAL VAL A . n 
A 1 240 ASP 240 282 282 ASP ASP A . n 
A 1 241 VAL 241 283 283 VAL VAL A . n 
A 1 242 THR 242 284 284 THR THR A . n 
A 1 243 PHE 243 285 285 PHE PHE A . n 
A 1 244 GLY 244 286 286 GLY GLY A . n 
A 1 245 ASP 245 287 287 ASP ASP A . n 
A 1 246 ILE 246 288 288 ILE ILE A . n 
A 1 247 LEU 247 289 289 LEU LEU A . n 
A 1 248 ALA 248 290 290 ALA ALA A . n 
A 1 249 ALA 249 291 291 ALA ALA A . n 
A 1 250 ARG 250 292 292 ARG ARG A . n 
A 1 251 CYS 251 293 293 CYS CYS A . n 
A 1 252 VAL 252 294 294 VAL VAL A . n 
A 1 253 PHE 253 295 295 PHE PHE A . n 
A 1 254 THR 254 296 296 THR THR A . n 
A 1 255 GLY 255 297 297 GLY GLY A . n 
A 1 256 GLU 256 298 298 GLU GLU A . n 
A 1 257 GLY 257 299 299 GLY GLY A . n 
A 1 258 ARG 258 300 300 ARG ARG A . n 
A 1 259 THR 259 301 301 THR THR A . n 
A 1 260 GLU 260 302 302 GLU GLU A . n 
A 1 261 ALA 261 303 303 ALA ALA A . n 
A 1 262 THR 262 304 304 THR THR A . n 
A 1 263 HIS 263 305 305 HIS HIS A . n 
A 1 264 ILE 264 306 306 ILE ILE A . n 
A 1 265 GLY 265 307 307 GLY GLY A . n 
A 1 266 GLY 266 308 308 GLY GLY A . n 
A 1 267 THR 267 309 309 THR THR A . n 
A 1 268 SER 268 310 310 SER SER A . n 
A 1 269 SER 269 311 311 SER SER A . n 
A 1 270 ASP 270 312 312 ASP ASP A . n 
A 1 271 GLU 271 313 313 GLU GLU A . n 
A 1 272 MET 272 314 314 MET MET A . n 
A 1 273 CYS 273 315 315 CYS CYS A . n 
A 1 274 ASN 274 316 316 ASN ASN A . n 
A 1 275 LEU 275 317 317 LEU LEU A . n 
A 1 276 TYR 276 318 318 TYR TYR A . n 
A 1 277 ILE 277 319 319 ILE ILE A . n 
A 1 278 MET 278 320 320 MET MET A . n 
A 1 279 TYR 279 321 321 TYR TYR A . n 
A 1 280 TYR 280 322 322 TYR TYR A . n 
A 1 281 MET 281 323 323 MET MET A . n 
A 1 282 GLU 282 324 324 GLU GLU A . n 
A 1 283 ALA 283 325 325 ALA ALA A . n 
A 1 284 LYS 284 326 326 LYS LYS A . n 
A 1 285 TYR 285 327 327 TYR TYR A . n 
A 1 286 ALA 286 328 328 ALA ALA A . n 
A 1 287 LEU 287 329 329 LEU LEU A . n 
A 1 288 SER 288 330 330 SER SER A . n 
A 1 289 PHE 289 331 331 PHE PHE A . n 
A 1 290 MET 290 332 332 MET MET A . n 
A 1 291 THR 291 333 333 THR THR A . n 
A 1 292 CYS 292 334 334 CYS CYS A . n 
A 1 293 THR 293 335 335 THR THR A . n 
A 1 294 LYS 294 336 336 LYS LYS A . n 
A 1 295 ASN 295 337 337 ASN ASN A . n 
A 1 296 VAL 296 338 338 VAL VAL A . n 
A 1 297 ALA 297 339 339 ALA ALA A . n 
A 1 298 PRO 298 340 340 PRO PRO A . n 
A 1 299 ASP 299 341 341 ASP ASP A . n 
A 1 300 MET 300 342 342 MET MET A . n 
A 1 301 PHE 301 343 343 PHE PHE A . n 
A 1 302 ARG 302 344 344 ARG ARG A . n 
A 1 303 THR 303 345 345 THR THR A . n 
A 1 304 ILE 304 346 346 ILE ILE A . n 
A 1 305 PRO 305 347 347 PRO PRO A . n 
A 1 306 ALA 306 348 348 ALA ALA A . n 
A 1 307 GLU 307 349 349 GLU GLU A . n 
A 1 308 ALA 308 350 350 ALA ALA A . n 
A 1 309 ASN 309 351 351 ASN ASN A . n 
A 1 310 ILE 310 352 352 ILE ILE A . n 
A 1 311 PRO 311 353 353 PRO PRO A . n 
A 1 312 ILE 312 354 354 ILE ILE A . n 
A 1 313 PRO 313 355 ?   ?   ?   A . n 
A 1 314 VAL 314 356 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? K HOH .   ? A HOH 486 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 O2  ? F NO2 .   ? A NO2 2   ? 1_555 89.1  ? 
2  O   ? K HOH .   ? A HOH 486 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 O   ? K HOH .   ? A HOH 463 ? 1_555 172.8 ? 
3  O2  ? F NO2 .   ? A NO2 2   ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 O   ? K HOH .   ? A HOH 463 ? 1_555 87.1  ? 
4  O   ? K HOH .   ? A HOH 486 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 NE2 ? A HIS 193 ? A HIS 235 ? 1_555 95.5  ? 
5  O2  ? F NO2 .   ? A NO2 2   ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 NE2 ? A HIS 193 ? A HIS 235 ? 1_555 95.1  ? 
6  O   ? K HOH .   ? A HOH 463 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 NE2 ? A HIS 193 ? A HIS 235 ? 1_555 90.9  ? 
7  O   ? K HOH .   ? A HOH 486 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 O1  ? F NO2 .   ? A NO2 2   ? 1_555 86.6  ? 
8  O2  ? F NO2 .   ? A NO2 2   ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 O1  ? F NO2 .   ? A NO2 2   ? 1_555 61.2  ? 
9  O   ? K HOH .   ? A HOH 463 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 O1  ? F NO2 .   ? A NO2 2   ? 1_555 86.2  ? 
10 NE2 ? A HIS 193 ? A HIS 235 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 O1  ? F NO2 .   ? A NO2 2   ? 1_555 156.3 ? 
11 O   ? K HOH .   ? A HOH 486 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 N   ? F NO2 .   ? A NO2 2   ? 1_555 87.2  ? 
12 O2  ? F NO2 .   ? A NO2 2   ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 N   ? F NO2 .   ? A NO2 2   ? 1_555 30.0  ? 
13 O   ? K HOH .   ? A HOH 463 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 N   ? F NO2 .   ? A NO2 2   ? 1_555 86.5  ? 
14 NE2 ? A HIS 193 ? A HIS 235 ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 N   ? F NO2 .   ? A NO2 2   ? 1_555 125.1 ? 
15 O1  ? F NO2 .   ? A NO2 2   ? 1_555 NI ? D NI . ? A NI 359 ? 1_555 N   ? F NO2 .   ? A NO2 2   ? 1_555 31.2  ? 
16 O1  ? E NO2 .   ? A NO2 1   ? 1_555 CU ? C CU . ? A CU 358 ? 1_555 NE2 ? A HIS 200 ? A HIS 242 ? 1_555 90.1  ? 
17 O1  ? E NO2 .   ? A NO2 1   ? 1_555 CU ? C CU . ? A CU 358 ? 1_555 NE2 ? A HIS 202 ? A HIS 244 ? 1_555 83.3  ? 
18 NE2 ? A HIS 200 ? A HIS 242 ? 1_555 CU ? C CU . ? A CU 358 ? 1_555 NE2 ? A HIS 202 ? A HIS 244 ? 1_555 112.9 ? 
19 O1  ? E NO2 .   ? A NO2 1   ? 1_555 CU ? C CU . ? A CU 358 ? 1_555 SD  ? A MET 272 ? A MET 314 ? 1_555 150.4 ? 
20 NE2 ? A HIS 200 ? A HIS 242 ? 1_555 CU ? C CU . ? A CU 358 ? 1_555 SD  ? A MET 272 ? A MET 314 ? 1_555 107.6 ? 
21 NE2 ? A HIS 202 ? A HIS 244 ? 1_555 CU ? C CU . ? A CU 358 ? 1_555 SD  ? A MET 272 ? A MET 314 ? 1_555 109.7 ? 
22 O1  ? E NO2 .   ? A NO2 1   ? 1_555 CU ? C CU . ? A CU 358 ? 1_555 O2  ? E NO2 .   ? A NO2 1   ? 1_555 59.5  ? 
23 NE2 ? A HIS 200 ? A HIS 242 ? 1_555 CU ? C CU . ? A CU 358 ? 1_555 O2  ? E NO2 .   ? A NO2 1   ? 1_555 140.2 ? 
24 NE2 ? A HIS 202 ? A HIS 244 ? 1_555 CU ? C CU . ? A CU 358 ? 1_555 O2  ? E NO2 .   ? A NO2 1   ? 1_555 90.0  ? 
25 SD  ? A MET 272 ? A MET 314 ? 1_555 CU ? C CU . ? A CU 358 ? 1_555 O2  ? E NO2 .   ? A NO2 1   ? 1_555 93.2  ? 
26 ND1 ? A HIS 65  ? A HIS 107 ? 1_555 CU ? B CU . ? A CU 357 ? 1_555 ND1 ? A HIS 66  ? A HIS 108 ? 1_555 150.8 ? 
27 ND1 ? A HIS 65  ? A HIS 107 ? 1_555 CU ? B CU . ? A CU 357 ? 1_555 ND1 ? A HIS 130 ? A HIS 172 ? 1_555 109.8 ? 
28 ND1 ? A HIS 66  ? A HIS 108 ? 1_555 CU ? B CU . ? A CU 357 ? 1_555 ND1 ? A HIS 130 ? A HIS 172 ? 1_555 96.9  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-11-24 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 41.3905 40.9985 19.8248 -0.1152 -0.1181 -0.0175 -0.0583 -0.0383 0.1695 6.9451 26.9126 6.3594 
-0.1986 1.9187  -3.4581 0.1269  0.5045  0.9012  -0.5920 -0.0547 -1.2721 -0.5433 0.5779  -0.0722 
'X-RAY DIFFRACTION' 2 ? refined 32.5068 35.5737 31.9795 -0.0550 -0.2273 -0.0785 -0.0362 0.0593  0.0131 5.9078 8.0447  5.6982 
-1.0303 -0.4923 0.6241  0.1025  -0.4070 0.8800  0.7910  -0.0550 0.6260  -0.6612 -0.3819 -0.0476 
'X-RAY DIFFRACTION' 3 ? refined 33.4531 17.1912 41.3761 -0.2329 -0.1874 -0.2245 -0.0624 -0.0753 0.0794 4.5534 1.7956  4.2361 
-0.1394 -3.2031 0.4506  -0.1177 -0.6701 -0.4542 0.2979  -0.0687 0.1171  0.2149  0.3937  0.1865  
'X-RAY DIFFRACTION' 4 ? refined 29.9211 14.8033 41.0802 -0.1868 -0.2548 -0.1740 -0.1033 -0.0738 0.0744 6.6845 1.9659  6.6130 
-1.4545 -5.8537 1.7127  -0.2735 -0.3966 -0.5695 0.3317  -0.1308 0.2554  0.5465  0.0547  0.4043  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 46  ? ? A 65  ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 66  ? ? A 185 ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 A 186 ? ? A 302 ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 A 303 ? ? A 354 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE    phasing          .        ? 1 
REFMAC   refinement       5.2.0019 ? 2 
HKL-2000 'data reduction' .        ? 3 
HKL-2000 'data scaling'   .        ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PRO A 69  ? ? -75.83 49.06   
2 1 THR A 130 ? ? -98.09 -62.95  
3 1 ILE A 176 ? ? 46.20  21.80   
4 1 HIS A 244 ? ? -95.42 -150.79 
5 1 PRO A 271 ? ? -38.03 130.94  
6 1 PHE A 285 ? ? -39.13 124.30  
7 1 PHE A 343 ? ? -69.03 1.24    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A PHE 43  ? A PHE 1   
2 1 Y 1 A SER 44  ? A SER 2   
3 1 Y 1 A ARG 180 ? A ARG 138 
4 1 Y 1 A ASP 181 ? A ASP 139 
5 1 Y 1 A PRO 355 ? A PRO 313 
6 1 Y 1 A VAL 356 ? A VAL 314 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'COPPER (II) ION' CU  
3 'NICKEL (II) ION' NI  
4 'NITRITE ION'     NO2 
5 GLYCEROL          GOL 
6 water             HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CU  1   357 357 CU  CU  A . 
C 2 CU  1   358 358 CU  CU  A . 
D 3 NI  1   359 359 NI  NI  A . 
E 4 NO2 1   1   1   NO2 NO2 A . 
F 4 NO2 1   2   2   NO2 NO2 A . 
G 4 NO2 1   3   3   NO2 NO2 A . 
H 5 GOL 1   360 1   GOL GOL A . 
I 5 GOL 1   361 2   GOL GOL A . 
J 5 GOL 1   362 3   GOL GOL A . 
K 6 HOH 1   4   4   HOH HOH A . 
K 6 HOH 2   5   5   HOH HOH A . 
K 6 HOH 3   6   6   HOH HOH A . 
K 6 HOH 4   7   7   HOH HOH A . 
K 6 HOH 5   8   8   HOH HOH A . 
K 6 HOH 6   9   9   HOH HOH A . 
K 6 HOH 7   10  10  HOH HOH A . 
K 6 HOH 8   11  11  HOH HOH A . 
K 6 HOH 9   12  12  HOH HOH A . 
K 6 HOH 10  13  13  HOH HOH A . 
K 6 HOH 11  14  14  HOH HOH A . 
K 6 HOH 12  15  15  HOH HOH A . 
K 6 HOH 13  16  16  HOH HOH A . 
K 6 HOH 14  17  17  HOH HOH A . 
K 6 HOH 15  18  18  HOH HOH A . 
K 6 HOH 16  19  19  HOH HOH A . 
K 6 HOH 17  20  20  HOH HOH A . 
K 6 HOH 18  21  21  HOH HOH A . 
K 6 HOH 19  22  22  HOH HOH A . 
K 6 HOH 20  23  23  HOH HOH A . 
K 6 HOH 21  24  24  HOH HOH A . 
K 6 HOH 22  25  25  HOH HOH A . 
K 6 HOH 23  27  27  HOH HOH A . 
K 6 HOH 24  28  28  HOH HOH A . 
K 6 HOH 25  29  29  HOH HOH A . 
K 6 HOH 26  30  30  HOH HOH A . 
K 6 HOH 27  31  31  HOH HOH A . 
K 6 HOH 28  32  32  HOH HOH A . 
K 6 HOH 29  33  33  HOH HOH A . 
K 6 HOH 30  34  34  HOH HOH A . 
K 6 HOH 31  35  35  HOH HOH A . 
K 6 HOH 32  36  36  HOH HOH A . 
K 6 HOH 33  37  37  HOH HOH A . 
K 6 HOH 34  38  38  HOH HOH A . 
K 6 HOH 35  39  39  HOH HOH A . 
K 6 HOH 36  40  40  HOH HOH A . 
K 6 HOH 37  41  41  HOH HOH A . 
K 6 HOH 38  42  42  HOH HOH A . 
K 6 HOH 39  363 1   HOH HOH A . 
K 6 HOH 40  364 2   HOH HOH A . 
K 6 HOH 41  365 3   HOH HOH A . 
K 6 HOH 42  366 43  HOH HOH A . 
K 6 HOH 43  367 44  HOH HOH A . 
K 6 HOH 44  368 45  HOH HOH A . 
K 6 HOH 45  369 46  HOH HOH A . 
K 6 HOH 46  370 47  HOH HOH A . 
K 6 HOH 47  371 48  HOH HOH A . 
K 6 HOH 48  372 49  HOH HOH A . 
K 6 HOH 49  373 50  HOH HOH A . 
K 6 HOH 50  374 51  HOH HOH A . 
K 6 HOH 51  375 52  HOH HOH A . 
K 6 HOH 52  376 53  HOH HOH A . 
K 6 HOH 53  377 54  HOH HOH A . 
K 6 HOH 54  378 55  HOH HOH A . 
K 6 HOH 55  379 56  HOH HOH A . 
K 6 HOH 56  380 57  HOH HOH A . 
K 6 HOH 57  381 58  HOH HOH A . 
K 6 HOH 58  382 59  HOH HOH A . 
K 6 HOH 59  383 60  HOH HOH A . 
K 6 HOH 60  384 61  HOH HOH A . 
K 6 HOH 61  385 62  HOH HOH A . 
K 6 HOH 62  386 63  HOH HOH A . 
K 6 HOH 63  387 64  HOH HOH A . 
K 6 HOH 64  388 65  HOH HOH A . 
K 6 HOH 65  389 67  HOH HOH A . 
K 6 HOH 66  390 69  HOH HOH A . 
K 6 HOH 67  391 70  HOH HOH A . 
K 6 HOH 68  392 71  HOH HOH A . 
K 6 HOH 69  393 72  HOH HOH A . 
K 6 HOH 70  394 73  HOH HOH A . 
K 6 HOH 71  395 74  HOH HOH A . 
K 6 HOH 72  396 75  HOH HOH A . 
K 6 HOH 73  397 76  HOH HOH A . 
K 6 HOH 74  398 77  HOH HOH A . 
K 6 HOH 75  399 78  HOH HOH A . 
K 6 HOH 76  400 79  HOH HOH A . 
K 6 HOH 77  401 80  HOH HOH A . 
K 6 HOH 78  402 81  HOH HOH A . 
K 6 HOH 79  403 82  HOH HOH A . 
K 6 HOH 80  404 83  HOH HOH A . 
K 6 HOH 81  405 84  HOH HOH A . 
K 6 HOH 82  406 85  HOH HOH A . 
K 6 HOH 83  407 86  HOH HOH A . 
K 6 HOH 84  408 87  HOH HOH A . 
K 6 HOH 85  409 88  HOH HOH A . 
K 6 HOH 86  410 89  HOH HOH A . 
K 6 HOH 87  411 90  HOH HOH A . 
K 6 HOH 88  412 91  HOH HOH A . 
K 6 HOH 89  413 92  HOH HOH A . 
K 6 HOH 90  414 93  HOH HOH A . 
K 6 HOH 91  415 95  HOH HOH A . 
K 6 HOH 92  416 96  HOH HOH A . 
K 6 HOH 93  417 97  HOH HOH A . 
K 6 HOH 94  418 98  HOH HOH A . 
K 6 HOH 95  419 99  HOH HOH A . 
K 6 HOH 96  420 100 HOH HOH A . 
K 6 HOH 97  421 101 HOH HOH A . 
K 6 HOH 98  422 102 HOH HOH A . 
K 6 HOH 99  423 103 HOH HOH A . 
K 6 HOH 100 424 104 HOH HOH A . 
K 6 HOH 101 425 105 HOH HOH A . 
K 6 HOH 102 426 106 HOH HOH A . 
K 6 HOH 103 427 107 HOH HOH A . 
K 6 HOH 104 428 108 HOH HOH A . 
K 6 HOH 105 429 109 HOH HOH A . 
K 6 HOH 106 430 110 HOH HOH A . 
K 6 HOH 107 431 111 HOH HOH A . 
K 6 HOH 108 432 112 HOH HOH A . 
K 6 HOH 109 433 113 HOH HOH A . 
K 6 HOH 110 434 114 HOH HOH A . 
K 6 HOH 111 435 115 HOH HOH A . 
K 6 HOH 112 436 116 HOH HOH A . 
K 6 HOH 113 437 117 HOH HOH A . 
K 6 HOH 114 438 118 HOH HOH A . 
K 6 HOH 115 439 119 HOH HOH A . 
K 6 HOH 116 440 120 HOH HOH A . 
K 6 HOH 117 441 121 HOH HOH A . 
K 6 HOH 118 442 122 HOH HOH A . 
K 6 HOH 119 443 123 HOH HOH A . 
K 6 HOH 120 444 124 HOH HOH A . 
K 6 HOH 121 445 125 HOH HOH A . 
K 6 HOH 122 446 126 HOH HOH A . 
K 6 HOH 123 447 127 HOH HOH A . 
K 6 HOH 124 448 128 HOH HOH A . 
K 6 HOH 125 449 129 HOH HOH A . 
K 6 HOH 126 450 130 HOH HOH A . 
K 6 HOH 127 451 131 HOH HOH A . 
K 6 HOH 128 452 132 HOH HOH A . 
K 6 HOH 129 453 133 HOH HOH A . 
K 6 HOH 130 454 134 HOH HOH A . 
K 6 HOH 131 455 135 HOH HOH A . 
K 6 HOH 132 456 136 HOH HOH A . 
K 6 HOH 133 457 137 HOH HOH A . 
K 6 HOH 134 458 138 HOH HOH A . 
K 6 HOH 135 459 139 HOH HOH A . 
K 6 HOH 136 460 140 HOH HOH A . 
K 6 HOH 137 461 141 HOH HOH A . 
K 6 HOH 138 462 142 HOH HOH A . 
K 6 HOH 139 463 143 HOH HOH A . 
K 6 HOH 140 464 144 HOH HOH A . 
K 6 HOH 141 465 145 HOH HOH A . 
K 6 HOH 142 466 146 HOH HOH A . 
K 6 HOH 143 467 147 HOH HOH A . 
K 6 HOH 144 468 148 HOH HOH A . 
K 6 HOH 145 469 150 HOH HOH A . 
K 6 HOH 146 470 151 HOH HOH A . 
K 6 HOH 147 471 152 HOH HOH A . 
K 6 HOH 148 472 154 HOH HOH A . 
K 6 HOH 149 473 155 HOH HOH A . 
K 6 HOH 150 474 156 HOH HOH A . 
K 6 HOH 151 475 157 HOH HOH A . 
K 6 HOH 152 476 158 HOH HOH A . 
K 6 HOH 153 477 159 HOH HOH A . 
K 6 HOH 154 478 160 HOH HOH A . 
K 6 HOH 155 479 161 HOH HOH A . 
K 6 HOH 156 480 162 HOH HOH A . 
K 6 HOH 157 481 163 HOH HOH A . 
K 6 HOH 158 482 165 HOH HOH A . 
K 6 HOH 159 483 167 HOH HOH A . 
K 6 HOH 160 484 168 HOH HOH A . 
K 6 HOH 161 485 169 HOH HOH A . 
K 6 HOH 162 486 170 HOH HOH A . 
K 6 HOH 163 487 171 HOH HOH A . 
K 6 HOH 164 488 172 HOH HOH A . 
K 6 HOH 165 489 173 HOH HOH A . 
K 6 HOH 166 490 174 HOH HOH A . 
K 6 HOH 167 491 175 HOH HOH A . 
K 6 HOH 168 492 176 HOH HOH A . 
#