data_3MQM
# 
_entry.id   3MQM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3MQM         
RCSB  RCSB058877   
WWPDB D_1000058877 
# 
_pdbx_database_status.entry_id                        3MQM 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-04-28 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Filippakopoulos, P.'                  1  
'Picaud, S.'                           2  
'Keates, T.'                           3  
'Felletar, I.'                         4  
'Vollmar, M.'                          5  
'Chaikuad, A.'                         6  
'Krojer, T.'                           7  
'Canning, P.'                          8  
'von Delft, F.'                        9  
'Arrowsmith, C.H.'                     10 
'Edwards, A.M.'                        11 
'Weigelt, J.'                          12 
'Bountra, C.'                          13 
'Knapp, S.'                            14 
'Structural Genomics Consortium (SGC)' 15 
# 
_citation.id                        primary 
_citation.title                     'Histone recognition and large-scale structural analysis of the human bromodomain family.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            149 
_citation.page_first                214 
_citation.page_last                 231 
_citation.year                      2012 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22464331 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2012.02.013 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Filippakopoulos, P.' 1  
primary 'Picaud, S.'          2  
primary 'Mangos, M.'          3  
primary 'Keates, T.'          4  
primary 'Lambert, J.P.'       5  
primary 'Barsyte-Lovejoy, D.' 6  
primary 'Felletar, I.'        7  
primary 'Volkmer, R.'         8  
primary 'Muller, S.'          9  
primary 'Pawson, T.'          10 
primary 'Gingras, A.C.'       11 
primary 'Arrowsmith, C.H.'    12 
primary 'Knapp, S.'           13 
# 
_cell.length_a           69.590 
_cell.length_b           69.590 
_cell.length_c           151.340 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           3MQM 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              12 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.entry_id                         3MQM 
_symmetry.Int_Tables_number                170 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Probable histone-lysine N-methyltransferase ASH1L' 14375.469 2  2.1.1.43 ? 
'BROMODOMAIN of human ASH1L (UNP RESIDUES 2438:2564)' ? 
2 water   nat water                                               18.015    15 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Absent small and homeotic disks protein 1 homolog, ASH1-like protein, huASH1, Lysine N-methyltransferase 2H' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMEVARAARLAQIFKEICDGIISYKDSSRQALAAPLLNLPPKKKNADYYEKISDPLDLITIEKQILTGYYKTVEAFDADM
LKVFRNAEKYYGRKSPVGRDVCRLRKAYYNARHEASAQIDEIVGET
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMEVARAARLAQIFKEICDGIISYKDSSRQALAAPLLNLPPKKKNADYYEKISDPLDLITIEKQILTGYYKTVEAFDADM
LKVFRNAEKYYGRKSPVGRDVCRLRKAYYNARHEASAQIDEIVGET
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   GLU n 
1 4   VAL n 
1 5   ALA n 
1 6   ARG n 
1 7   ALA n 
1 8   ALA n 
1 9   ARG n 
1 10  LEU n 
1 11  ALA n 
1 12  GLN n 
1 13  ILE n 
1 14  PHE n 
1 15  LYS n 
1 16  GLU n 
1 17  ILE n 
1 18  CYS n 
1 19  ASP n 
1 20  GLY n 
1 21  ILE n 
1 22  ILE n 
1 23  SER n 
1 24  TYR n 
1 25  LYS n 
1 26  ASP n 
1 27  SER n 
1 28  SER n 
1 29  ARG n 
1 30  GLN n 
1 31  ALA n 
1 32  LEU n 
1 33  ALA n 
1 34  ALA n 
1 35  PRO n 
1 36  LEU n 
1 37  LEU n 
1 38  ASN n 
1 39  LEU n 
1 40  PRO n 
1 41  PRO n 
1 42  LYS n 
1 43  LYS n 
1 44  LYS n 
1 45  ASN n 
1 46  ALA n 
1 47  ASP n 
1 48  TYR n 
1 49  TYR n 
1 50  GLU n 
1 51  LYS n 
1 52  ILE n 
1 53  SER n 
1 54  ASP n 
1 55  PRO n 
1 56  LEU n 
1 57  ASP n 
1 58  LEU n 
1 59  ILE n 
1 60  THR n 
1 61  ILE n 
1 62  GLU n 
1 63  LYS n 
1 64  GLN n 
1 65  ILE n 
1 66  LEU n 
1 67  THR n 
1 68  GLY n 
1 69  TYR n 
1 70  TYR n 
1 71  LYS n 
1 72  THR n 
1 73  VAL n 
1 74  GLU n 
1 75  ALA n 
1 76  PHE n 
1 77  ASP n 
1 78  ALA n 
1 79  ASP n 
1 80  MET n 
1 81  LEU n 
1 82  LYS n 
1 83  VAL n 
1 84  PHE n 
1 85  ARG n 
1 86  ASN n 
1 87  ALA n 
1 88  GLU n 
1 89  LYS n 
1 90  TYR n 
1 91  TYR n 
1 92  GLY n 
1 93  ARG n 
1 94  LYS n 
1 95  SER n 
1 96  PRO n 
1 97  VAL n 
1 98  GLY n 
1 99  ARG n 
1 100 ASP n 
1 101 VAL n 
1 102 CYS n 
1 103 ARG n 
1 104 LEU n 
1 105 ARG n 
1 106 LYS n 
1 107 ALA n 
1 108 TYR n 
1 109 TYR n 
1 110 ASN n 
1 111 ALA n 
1 112 ARG n 
1 113 HIS n 
1 114 GLU n 
1 115 ALA n 
1 116 SER n 
1 117 ALA n 
1 118 GLN n 
1 119 ILE n 
1 120 ASP n 
1 121 GLU n 
1 122 ILE n 
1 123 VAL n 
1 124 GLY n 
1 125 GLU n 
1 126 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ASH1L, KIAA1420, KMT2H' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-R3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC28-Bsa4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ASH1L_HUMAN 
_struct_ref.pdbx_db_accession          Q9NR48 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EVARAARLAQIFKEICDGIISYKDSSRQALAAPLLNLPPKKKNADYYEKISDPLDLITIEKQILTGYYKTVEAFDADMLK
VFRNAEKYYGRKSPVGRDVCRLRKAYYNARHEASAQIDEIVGETASE
;
_struct_ref.pdbx_align_begin           2438 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3MQM A 3 ? 126 ? Q9NR48 2438 ? 2564 ? 2433 2556 
2 1 3MQM B 3 ? 126 ? Q9NR48 2438 ? 2564 ? 2433 2556 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3MQM SER A 1 ? UNP Q9NR48 ? ? 'EXPRESSION TAG' 2431 1 
1 3MQM MET A 2 ? UNP Q9NR48 ? ? 'EXPRESSION TAG' 2432 2 
2 3MQM SER B 1 ? UNP Q9NR48 ? ? 'EXPRESSION TAG' 2431 3 
2 3MQM MET B 2 ? UNP Q9NR48 ? ? 'EXPRESSION TAG' 2432 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3MQM 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.63 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   66.10 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;0.15M NaNO3 
20% PEG3350 
10% EtGly, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2010-03-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9762 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9762 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04 
# 
_reflns.entry_id                     3MQM 
_reflns.d_resolution_high            2.54 
_reflns.d_resolution_low             47.14 
_reflns.number_all                   13731 
_reflns.number_obs                   13718 
_reflns.pdbx_Rsym_value              0.090 
_reflns.pdbx_redundancy              5.500 
_reflns.percent_possible_obs         99.900 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.pdbx_Rmerge_I_obs            0.090 
_reflns.pdbx_netI_over_sigmaI        10.8 
_reflns.B_iso_Wilson_estimate        66.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.54 
_reflns_shell.d_res_low              2.68 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.760 
_reflns_shell.meanI_over_sigI_obs    2.1 
_reflns_shell.pdbx_Rsym_value        0.760 
_reflns_shell.pdbx_redundancy        5.4 
_reflns_shell.number_unique_all      2022 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3MQM 
_refine.ls_d_res_high                            2.540 
_refine.ls_d_res_low                             47.140 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.790 
_refine.ls_number_reflns_obs                     13682 
_refine.ls_number_reflns_all                     13711 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT U VALUES: WITH TLS ADDED' 
_refine.ls_R_factor_all                          0.207 
_refine.ls_R_factor_obs                          0.207 
_refine.ls_R_factor_R_work                       0.204 
_refine.ls_wR_factor_R_work                      0.210 
_refine.ls_R_factor_R_free                       0.259 
_refine.ls_wR_factor_R_free                      0.264 
_refine.ls_percent_reflns_R_free                 6.200 
_refine.ls_number_reflns_R_free                  845 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               66.426 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            29.520 
_refine.aniso_B[2][2]                            29.520 
_refine.aniso_B[3][3]                            -59.040 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.956 
_refine.correlation_coeff_Fo_to_Fc_free          0.929 
_refine.overall_SU_R_Cruickshank_DPI             0.069 
_refine.overall_SU_R_free                        0.055 
_refine.pdbx_overall_ESU_R_Free                  0.055 
_refine.overall_SU_ML                            0.153 
_refine.overall_SU_B                             15.379 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRIES 2NXB, 2OO1, 2OSS, 2OUO, 2RFJ, 3DAI, 3D7C, 3DWY' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.801 
_refine.B_iso_max                                125.69 
_refine.B_iso_min                                29.76 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1918 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             15 
_refine_hist.number_atoms_total               1933 
_refine_hist.d_res_high                       2.540 
_refine_hist.d_res_low                        47.140 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       1952 0.014  0.022  ? 'X-RAY DIFFRACTION' ? 
r_bond_other_d         1284 0.003  0.020  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    2649 1.375  1.974  ? 'X-RAY DIFFRACTION' ? 
r_angle_other_deg      3142 0.929  3.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 250  5.398  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 85   36.719 24.588 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 316  16.874 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 10   15.333 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         300  0.078  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   2204 0.006  0.021  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_other     386  0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
'X-RAY DIFFRACTION' 1 1 'TIGHT POSITIONAL'  A 669 0.030 0.050 1 ? ? ? 
'X-RAY DIFFRACTION' 1 1 'MEDIUM POSITIONAL' A 732 0.060 0.500 2 ? ? ? 
'X-RAY DIFFRACTION' 1 1 'TIGHT THERMAL'     A 669 5.990 0.500 3 ? ? ? 
'X-RAY DIFFRACTION' 1 1 'MEDIUM THERMAL'    A 732 5.510 2.000 4 ? ? ? 
# 
_refine_ls_shell.d_res_high                       2.54 
_refine_ls_shell.d_res_low                        2.605 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               98.220 
_refine_ls_shell.number_reflns_R_work             920 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.245 
_refine_ls_shell.R_factor_R_free                  0.337 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             76 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                996 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1 2 A 2433 A 2455 ? . . . . . . . . 
1 2 1 2 B 2433 B 2455 ? . . . . . . . . 
1 1 2 2 A 2462 A 2473 ? . . . . . . . . 
1 2 2 2 B 2462 B 2473 ? . . . . . . . . 
1 1 3 2 A 2475 A 2486 ? . . . . . . . . 
1 2 3 2 B 2475 B 2486 ? . . . . . . . . 
1 1 4 2 A 2488 A 2496 ? . . . . . . . . 
1 2 4 2 B 2488 B 2496 ? . . . . . . . . 
1 1 5 2 A 2497 A 2503 ? . . . . . . . . 
1 2 5 2 B 2497 B 2503 ? . . . . . . . . 
1 1 6 2 A 2504 A 2518 ? . . . . . . . . 
1 2 6 2 B 2504 B 2518 ? . . . . . . . . 
1 1 7 2 A 2519 A 2526 ? . . . . . . . . 
1 2 7 2 B 2519 B 2526 ? . . . . . . . . 
1 1 8 2 A 2527 A 2553 ? . . . . . . . . 
1 2 8 2 B 2527 B 2553 ? . . . . . . . . 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3MQM 
_struct.title                     'Crystal Structure of the Bromodomain of human ASH1L' 
_struct.pdbx_descriptor           'Probable histone-lysine N-methyltransferase ASH1L (E.C.2.1.1.43)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3MQM 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;ASH1L, Ash1, KIAA1420, Absent small and homeotic disks protein 1 homolog, Lysine N-methyltransferase 2H, KMT2H, Structural Genomics Consortium, SGC, TRANSFERASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  MET A 2  ? TYR A 24  ? MET A 2432 TYR A 2454 1 ? 23 
HELX_P HELX_P2  2  ALA A 33 ? LEU A 37  ? ALA A 2463 LEU A 2467 5 ? 5  
HELX_P HELX_P3  3  PRO A 41 ? ASN A 45  ? PRO A 2471 ASN A 2475 5 ? 5  
HELX_P HELX_P4  4  ASP A 47 ? ILE A 52  ? ASP A 2477 ILE A 2482 1 ? 6  
HELX_P HELX_P5  5  ASP A 57 ? THR A 67  ? ASP A 2487 THR A 2497 1 ? 11 
HELX_P HELX_P6  6  THR A 72 ? GLY A 92  ? THR A 2502 GLY A 2522 1 ? 21 
HELX_P HELX_P7  7  SER A 95 ? GLY A 124 ? SER A 2525 GLY A 2554 1 ? 30 
HELX_P HELX_P8  8  MET B 2  ? TYR B 24  ? MET B 2432 TYR B 2454 1 ? 23 
HELX_P HELX_P9  9  ALA B 33 ? LEU B 37  ? ALA B 2463 LEU B 2467 5 ? 5  
HELX_P HELX_P10 10 PRO B 41 ? ASN B 45  ? PRO B 2471 ASN B 2475 5 ? 5  
HELX_P HELX_P11 11 ASP B 47 ? ILE B 52  ? ASP B 2477 ILE B 2482 1 ? 6  
HELX_P HELX_P12 12 ASP B 57 ? THR B 67  ? ASP B 2487 THR B 2497 1 ? 11 
HELX_P HELX_P13 13 THR B 72 ? GLY B 92  ? THR B 2502 GLY B 2522 1 ? 21 
HELX_P HELX_P14 14 SER B 95 ? GLY B 124 ? SER B 2525 GLY B 2554 1 ? 30 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS B 25 ? ASP B 26 ? LYS B 2455 ASP B 2456 
A 2 GLN B 30 ? ALA B 31 ? GLN B 2460 ALA B 2461 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ASP 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   B 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    26 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ASP 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    B 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     2456 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   GLN 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   B 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    30 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    GLN 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    B 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     2460 
# 
_atom_sites.entry_id                    3MQM 
_atom_sites.fract_transf_matrix[1][1]   0.014370 
_atom_sites.fract_transf_matrix[1][2]   0.008296 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016593 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006608 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 1   ? -52.546 36.651 11.587  1.00 60.98  ? 2431 SER A N   1 
ATOM   2    C CA  . SER A 1 1   ? -52.717 36.647 10.098  1.00 66.17  ? 2431 SER A CA  1 
ATOM   3    C C   . SER A 1 1   ? -53.614 35.511 9.575   1.00 68.10  ? 2431 SER A C   1 
ATOM   4    O O   . SER A 1 1   ? -54.099 34.656 10.332  1.00 61.06  ? 2431 SER A O   1 
ATOM   5    C CB  . SER A 1 1   ? -51.348 36.583 9.413   1.00 67.04  ? 2431 SER A CB  1 
ATOM   6    O OG  . SER A 1 1   ? -50.730 35.336 9.669   1.00 71.70  ? 2431 SER A OG  1 
ATOM   7    N N   . MET A 1 2   ? -53.798 35.509 8.257   1.00 68.76  ? 2432 MET A N   1 
ATOM   8    C CA  . MET A 1 2   ? -54.730 34.616 7.574   1.00 69.39  ? 2432 MET A CA  1 
ATOM   9    C C   . MET A 1 2   ? -54.014 33.340 7.169   1.00 72.46  ? 2432 MET A C   1 
ATOM   10   O O   . MET A 1 2   ? -52.887 33.397 6.646   1.00 79.09  ? 2432 MET A O   1 
ATOM   11   C CB  . MET A 1 2   ? -55.263 35.322 6.317   1.00 70.83  ? 2432 MET A CB  1 
ATOM   12   C CG  . MET A 1 2   ? -56.670 34.906 5.909   1.00 72.02  ? 2432 MET A CG  1 
ATOM   13   S SD  . MET A 1 2   ? -57.317 35.736 4.438   1.00 58.77  ? 2432 MET A SD  1 
ATOM   14   C CE  . MET A 1 2   ? -56.364 37.258 4.487   1.00 51.04  ? 2432 MET A CE  1 
ATOM   15   N N   . GLU A 1 3   ? -54.659 32.192 7.369   1.00 62.39  ? 2433 GLU A N   1 
ATOM   16   C CA  . GLU A 1 3   ? -53.944 30.938 7.238   1.00 56.62  ? 2433 GLU A CA  1 
ATOM   17   C C   . GLU A 1 3   ? -53.346 30.766 5.842   1.00 62.83  ? 2433 GLU A C   1 
ATOM   18   O O   . GLU A 1 3   ? -52.154 30.464 5.707   1.00 73.06  ? 2433 GLU A O   1 
ATOM   19   C CB  . GLU A 1 3   ? -54.809 29.730 7.573   1.00 66.27  ? 2433 GLU A CB  1 
ATOM   20   C CG  . GLU A 1 3   ? -54.119 28.408 7.180   1.00 75.65  ? 2433 GLU A CG  1 
ATOM   21   C CD  . GLU A 1 3   ? -55.073 27.245 7.079   1.00 85.48  ? 2433 GLU A CD  1 
ATOM   22   O OE1 . GLU A 1 3   ? -55.104 26.600 6.003   1.00 96.51  ? 2433 GLU A OE1 1 
ATOM   23   O OE2 . GLU A 1 3   ? -55.791 26.980 8.066   1.00 74.05  ? 2433 GLU A OE2 1 
ATOM   24   N N   . VAL A 1 4   ? -54.162 30.917 4.803   1.00 55.33  ? 2434 VAL A N   1 
ATOM   25   C CA  . VAL A 1 4   ? -53.636 30.799 3.452   1.00 48.43  ? 2434 VAL A CA  1 
ATOM   26   C C   . VAL A 1 4   ? -52.439 31.727 3.213   1.00 53.13  ? 2434 VAL A C   1 
ATOM   27   O O   . VAL A 1 4   ? -51.522 31.351 2.482   1.00 61.41  ? 2434 VAL A O   1 
ATOM   28   C CB  . VAL A 1 4   ? -54.711 31.039 2.406   1.00 51.51  ? 2434 VAL A CB  1 
ATOM   29   C CG1 . VAL A 1 4   ? -55.171 32.496 2.441   1.00 56.92  ? 2434 VAL A CG1 1 
ATOM   30   C CG2 . VAL A 1 4   ? -54.208 30.634 1.015   1.00 45.98  ? 2434 VAL A CG2 1 
ATOM   31   N N   . ALA A 1 5   ? -52.417 32.919 3.819   1.00 45.54  ? 2435 ALA A N   1 
ATOM   32   C CA  . ALA A 1 5   ? -51.238 33.796 3.692   1.00 48.94  ? 2435 ALA A CA  1 
ATOM   33   C C   . ALA A 1 5   ? -50.048 33.094 4.367   1.00 52.46  ? 2435 ALA A C   1 
ATOM   34   O O   . ALA A 1 5   ? -48.982 32.914 3.775   1.00 58.25  ? 2435 ALA A O   1 
ATOM   35   C CB  . ALA A 1 5   ? -51.478 35.171 4.340   1.00 43.67  ? 2435 ALA A CB  1 
ATOM   36   N N   . ARG A 1 6   ? -50.258 32.669 5.603   1.00 52.14  ? 2436 ARG A N   1 
ATOM   37   C CA  . ARG A 1 6   ? -49.227 31.961 6.340   1.00 55.59  ? 2436 ARG A CA  1 
ATOM   38   C C   . ARG A 1 6   ? -48.695 30.818 5.508   1.00 53.54  ? 2436 ARG A C   1 
ATOM   39   O O   . ARG A 1 6   ? -47.489 30.795 5.240   1.00 47.40  ? 2436 ARG A O   1 
ATOM   40   C CB  . ARG A 1 6   ? -49.721 31.518 7.720   1.00 54.84  ? 2436 ARG A CB  1 
ATOM   41   C CG  . ARG A 1 6   ? -49.824 32.704 8.695   1.00 57.76  ? 2436 ARG A CG  1 
ATOM   42   C CD  . ARG A 1 6   ? -50.101 32.276 10.136  1.00 66.16  ? 2436 ARG A CD  1 
ATOM   43   N NE  . ARG A 1 6   ? -51.515 32.458 10.517  1.00 70.47  ? 2436 ARG A NE  1 
ATOM   44   C CZ  . ARG A 1 6   ? -52.434 31.493 10.570  1.00 60.63  ? 2436 ARG A CZ  1 
ATOM   45   N NH1 . ARG A 1 6   ? -52.145 30.237 10.245  1.00 69.38  ? 2436 ARG A NH1 1 
ATOM   46   N NH2 . ARG A 1 6   ? -53.663 31.787 10.939  1.00 61.43  ? 2436 ARG A NH2 1 
ATOM   47   N N   . ALA A 1 7   ? -49.601 29.960 5.023   1.00 54.28  ? 2437 ALA A N   1 
ATOM   48   C CA  . ALA A 1 7   ? -49.245 28.770 4.234   1.00 51.88  ? 2437 ALA A CA  1 
ATOM   49   C C   . ALA A 1 7   ? -48.510 29.107 2.928   1.00 53.82  ? 2437 ALA A C   1 
ATOM   50   O O   . ALA A 1 7   ? -47.760 28.285 2.400   1.00 73.57  ? 2437 ALA A O   1 
ATOM   51   C CB  . ALA A 1 7   ? -50.511 27.909 3.952   1.00 52.52  ? 2437 ALA A CB  1 
ATOM   52   N N   . ALA A 1 8   ? -48.711 30.309 2.407   1.00 58.24  ? 2438 ALA A N   1 
ATOM   53   C CA  . ALA A 1 8   ? -47.977 30.765 1.218   1.00 58.23  ? 2438 ALA A CA  1 
ATOM   54   C C   . ALA A 1 8   ? -46.568 31.219 1.583   1.00 59.06  ? 2438 ALA A C   1 
ATOM   55   O O   . ALA A 1 8   ? -45.602 30.941 0.840   1.00 58.59  ? 2438 ALA A O   1 
ATOM   56   C CB  . ALA A 1 8   ? -48.723 31.907 0.503   1.00 50.11  ? 2438 ALA A CB  1 
ATOM   57   N N   . ARG A 1 9   ? -46.453 31.959 2.688   1.00 54.25  ? 2439 ARG A N   1 
ATOM   58   C CA  . ARG A 1 9   ? -45.127 32.365 3.201   1.00 51.85  ? 2439 ARG A CA  1 
ATOM   59   C C   . ARG A 1 9   ? -44.288 31.114 3.447   1.00 51.99  ? 2439 ARG A C   1 
ATOM   60   O O   . ARG A 1 9   ? -43.120 31.068 3.071   1.00 60.46  ? 2439 ARG A O   1 
ATOM   61   C CB  . ARG A 1 9   ? -45.248 33.224 4.480   1.00 50.59  ? 2439 ARG A CB  1 
ATOM   62   C CG  . ARG A 1 9   ? -46.073 34.533 4.229   1.00 44.39  ? 2439 ARG A CG  1 
ATOM   63   C CD  . ARG A 1 9   ? -45.436 35.786 4.864   1.00 39.62  ? 2439 ARG A CD  1 
ATOM   64   N NE  . ARG A 1 9   ? -45.511 35.807 6.325   1.00 33.82  ? 2439 ARG A NE  1 
ATOM   65   C CZ  . ARG A 1 9   ? -46.618 36.052 7.042   1.00 34.05  ? 2439 ARG A CZ  1 
ATOM   66   N NH1 . ARG A 1 9   ? -46.578 36.019 8.360   1.00 29.76  ? 2439 ARG A NH1 1 
ATOM   67   N NH2 . ARG A 1 9   ? -47.780 36.340 6.460   1.00 37.08  ? 2439 ARG A NH2 1 
ATOM   68   N N   . LEU A 1 10  ? -44.904 30.087 4.027   1.00 53.61  ? 2440 LEU A N   1 
ATOM   69   C CA  . LEU A 1 10  ? -44.213 28.824 4.320   1.00 59.13  ? 2440 LEU A CA  1 
ATOM   70   C C   . LEU A 1 10  ? -43.821 28.133 3.028   1.00 60.57  ? 2440 LEU A C   1 
ATOM   71   O O   . LEU A 1 10  ? -42.650 27.780 2.840   1.00 60.34  ? 2440 LEU A O   1 
ATOM   72   C CB  . LEU A 1 10  ? -45.081 27.871 5.163   1.00 58.27  ? 2440 LEU A CB  1 
ATOM   73   C CG  . LEU A 1 10  ? -45.346 28.187 6.635   1.00 55.63  ? 2440 LEU A CG  1 
ATOM   74   C CD1 . LEU A 1 10  ? -46.247 27.116 7.309   1.00 52.41  ? 2440 LEU A CD1 1 
ATOM   75   C CD2 . LEU A 1 10  ? -44.029 28.311 7.388   1.00 51.38  ? 2440 LEU A CD2 1 
ATOM   76   N N   . ALA A 1 11  ? -44.805 27.948 2.141   1.00 63.92  ? 2441 ALA A N   1 
ATOM   77   C CA  . ALA A 1 11  ? -44.557 27.417 0.786   1.00 51.50  ? 2441 ALA A CA  1 
ATOM   78   C C   . ALA A 1 11  ? -43.307 28.018 0.127   1.00 46.39  ? 2441 ALA A C   1 
ATOM   79   O O   . ALA A 1 11  ? -42.491 27.297 -0.483  1.00 57.69  ? 2441 ALA A O   1 
ATOM   80   C CB  . ALA A 1 11  ? -45.780 27.626 -0.102  1.00 47.69  ? 2441 ALA A CB  1 
ATOM   81   N N   . GLN A 1 12  ? -43.136 29.331 0.233   1.00 48.90  ? 2442 GLN A N   1 
ATOM   82   C CA  . GLN A 1 12  ? -41.987 29.991 -0.417  1.00 50.47  ? 2442 GLN A CA  1 
ATOM   83   C C   . GLN A 1 12  ? -40.680 29.494 0.205   1.00 51.80  ? 2442 GLN A C   1 
ATOM   84   O O   . GLN A 1 12  ? -39.714 29.214 -0.477  1.00 64.06  ? 2442 GLN A O   1 
ATOM   85   C CB  . GLN A 1 12  ? -42.121 31.508 -0.269  1.00 55.32  ? 2442 GLN A CB  1 
ATOM   86   C CG  . GLN A 1 12  ? -41.080 32.364 -0.988  1.00 55.92  ? 2442 GLN A CG  1 
ATOM   87   C CD  . GLN A 1 12  ? -40.864 31.968 -2.443  1.00 57.40  ? 2442 GLN A CD  1 
ATOM   88   O OE1 . GLN A 1 12  ? -41.791 31.966 -3.266  1.00 65.80  ? 2442 GLN A OE1 1 
ATOM   89   N NE2 . GLN A 1 12  ? -39.635 31.615 -2.760  1.00 52.18  ? 2442 GLN A NE2 1 
ATOM   90   N N   . ILE A 1 13  ? -40.689 29.330 1.521   1.00 66.28  ? 2443 ILE A N   1 
ATOM   91   C CA  . ILE A 1 13  ? -39.540 28.808 2.249   1.00 61.91  ? 2443 ILE A CA  1 
ATOM   92   C C   . ILE A 1 13  ? -39.286 27.349 1.862   1.00 56.29  ? 2443 ILE A C   1 
ATOM   93   O O   . ILE A 1 13  ? -38.171 26.972 1.512   1.00 47.93  ? 2443 ILE A O   1 
ATOM   94   C CB  . ILE A 1 13  ? -39.760 28.951 3.770   1.00 65.25  ? 2443 ILE A CB  1 
ATOM   95   C CG1 . ILE A 1 13  ? -39.826 30.440 4.140   1.00 65.93  ? 2443 ILE A CG1 1 
ATOM   96   C CG2 . ILE A 1 13  ? -38.645 28.267 4.532   1.00 69.32  ? 2443 ILE A CG2 1 
ATOM   97   C CD1 . ILE A 1 13  ? -40.369 30.743 5.545   1.00 67.36  ? 2443 ILE A CD1 1 
ATOM   98   N N   . PHE A 1 14  ? -40.330 26.534 1.901   1.00 49.52  ? 2444 PHE A N   1 
ATOM   99   C CA  . PHE A 1 14  ? -40.181 25.132 1.528   1.00 50.53  ? 2444 PHE A CA  1 
ATOM   100  C C   . PHE A 1 14  ? -39.633 24.967 0.104   1.00 53.00  ? 2444 PHE A C   1 
ATOM   101  O O   . PHE A 1 14  ? -38.824 24.087 -0.139  1.00 65.81  ? 2444 PHE A O   1 
ATOM   102  C CB  . PHE A 1 14  ? -41.526 24.405 1.597   1.00 58.32  ? 2444 PHE A CB  1 
ATOM   103  C CG  . PHE A 1 14  ? -42.185 24.399 2.951   1.00 50.08  ? 2444 PHE A CG  1 
ATOM   104  C CD1 . PHE A 1 14  ? -41.522 24.785 4.096   1.00 44.80  ? 2444 PHE A CD1 1 
ATOM   105  C CD2 . PHE A 1 14  ? -43.496 23.954 3.064   1.00 51.68  ? 2444 PHE A CD2 1 
ATOM   106  C CE1 . PHE A 1 14  ? -42.153 24.759 5.304   1.00 41.59  ? 2444 PHE A CE1 1 
ATOM   107  C CE2 . PHE A 1 14  ? -44.141 23.926 4.294   1.00 41.04  ? 2444 PHE A CE2 1 
ATOM   108  C CZ  . PHE A 1 14  ? -43.463 24.306 5.410   1.00 42.05  ? 2444 PHE A CZ  1 
ATOM   109  N N   . LYS A 1 15  ? -40.102 25.779 -0.846  1.00 56.52  ? 2445 LYS A N   1 
ATOM   110  C CA  . LYS A 1 15  ? -39.574 25.721 -2.216  1.00 56.30  ? 2445 LYS A CA  1 
ATOM   111  C C   . LYS A 1 15  ? -38.087 26.076 -2.294  1.00 55.23  ? 2445 LYS A C   1 
ATOM   112  O O   . LYS A 1 15  ? -37.342 25.460 -3.051  1.00 60.98  ? 2445 LYS A O   1 
ATOM   113  C CB  . LYS A 1 15  ? -40.356 26.636 -3.156  1.00 54.82  ? 2445 LYS A CB  1 
ATOM   114  C CG  . LYS A 1 15  ? -39.758 26.764 -4.559  1.00 63.26  ? 2445 LYS A CG  1 
ATOM   115  C CD  . LYS A 1 15  ? -40.734 27.418 -5.555  1.00 71.84  ? 2445 LYS A CD  1 
ATOM   116  C CE  . LYS A 1 15  ? -40.258 27.251 -7.010  1.00 74.31  ? 2445 LYS A CE  1 
ATOM   117  N NZ  . LYS A 1 15  ? -38.969 27.945 -7.244  1.00 68.73  ? 2445 LYS A NZ  1 
ATOM   118  N N   . GLU A 1 16  ? -37.661 27.098 -1.563  1.00 50.47  ? 2446 GLU A N   1 
ATOM   119  C CA  . GLU A 1 16  ? -36.229 27.460 -1.563  1.00 53.99  ? 2446 GLU A CA  1 
ATOM   120  C C   . GLU A 1 16  ? -35.356 26.308 -1.061  1.00 42.87  ? 2446 GLU A C   1 
ATOM   121  O O   . GLU A 1 16  ? -34.328 26.008 -1.636  1.00 56.95  ? 2446 GLU A O   1 
ATOM   122  C CB  . GLU A 1 16  ? -35.995 28.752 -0.760  1.00 53.71  ? 2446 GLU A CB  1 
ATOM   123  C CG  . GLU A 1 16  ? -36.540 30.016 -1.516  1.00 59.17  ? 2446 GLU A CG  1 
ATOM   124  C CD  . GLU A 1 16  ? -36.757 31.251 -0.639  1.00 67.63  ? 2446 GLU A CD  1 
ATOM   125  O OE1 . GLU A 1 16  ? -36.279 31.294 0.523   1.00 65.08  ? 2446 GLU A OE1 1 
ATOM   126  O OE2 . GLU A 1 16  ? -37.411 32.201 -1.127  1.00 76.07  ? 2446 GLU A OE2 1 
ATOM   127  N N   . ILE A 1 17  ? -35.802 25.645 -0.006  1.00 45.63  ? 2447 ILE A N   1 
ATOM   128  C CA  . ILE A 1 17  ? -35.037 24.578 0.633   1.00 45.50  ? 2447 ILE A CA  1 
ATOM   129  C C   . ILE A 1 17  ? -34.972 23.407 -0.297  1.00 43.83  ? 2447 ILE A C   1 
ATOM   130  O O   . ILE A 1 17  ? -33.883 22.928 -0.649  1.00 51.18  ? 2447 ILE A O   1 
ATOM   131  C CB  . ILE A 1 17  ? -35.671 24.179 1.977   1.00 49.52  ? 2447 ILE A CB  1 
ATOM   132  C CG1 . ILE A 1 17  ? -35.533 25.345 2.974   1.00 44.08  ? 2447 ILE A CG1 1 
ATOM   133  C CG2 . ILE A 1 17  ? -34.996 22.952 2.581   1.00 41.02  ? 2447 ILE A CG2 1 
ATOM   134  C CD1 . ILE A 1 17  ? -36.289 25.144 4.256   1.00 37.60  ? 2447 ILE A CD1 1 
ATOM   135  N N   . CYS A 1 18  ? -36.139 22.989 -0.753  1.00 38.42  ? 2448 CYS A N   1 
ATOM   136  C CA  . CYS A 1 18  ? -36.235 21.916 -1.728  1.00 39.44  ? 2448 CYS A CA  1 
ATOM   137  C C   . CYS A 1 18  ? -35.520 22.178 -3.053  1.00 41.92  ? 2448 CYS A C   1 
ATOM   138  O O   . CYS A 1 18  ? -35.019 21.242 -3.673  1.00 56.86  ? 2448 CYS A O   1 
ATOM   139  C CB  . CYS A 1 18  ? -37.692 21.579 -1.974  1.00 40.43  ? 2448 CYS A CB  1 
ATOM   140  S SG  . CYS A 1 18  ? -37.833 20.091 -2.823  1.00 39.66  ? 2448 CYS A SG  1 
ATOM   141  N N   . ASP A 1 19  ? -35.440 23.425 -3.498  1.00 45.62  ? 2449 ASP A N   1 
ATOM   142  C CA  . ASP A 1 19  ? -34.651 23.738 -4.708  1.00 47.44  ? 2449 ASP A CA  1 
ATOM   143  C C   . ASP A 1 19  ? -33.150 23.630 -4.413  1.00 51.83  ? 2449 ASP A C   1 
ATOM   144  O O   . ASP A 1 19  ? -32.355 23.310 -5.298  1.00 48.11  ? 2449 ASP A O   1 
ATOM   145  C CB  . ASP A 1 19  ? -34.929 25.147 -5.243  1.00 46.11  ? 2449 ASP A CB  1 
ATOM   146  C CG  . ASP A 1 19  ? -36.290 25.293 -5.902  1.00 59.04  ? 2449 ASP A CG  1 
ATOM   147  O OD1 . ASP A 1 19  ? -37.017 24.289 -6.123  1.00 60.76  ? 2449 ASP A OD1 1 
ATOM   148  O OD2 . ASP A 1 19  ? -36.639 26.462 -6.184  1.00 67.81  ? 2449 ASP A OD2 1 
ATOM   149  N N   . GLY A 1 20  ? -32.766 23.944 -3.180  1.00 55.66  ? 2450 GLY A N   1 
ATOM   150  C CA  . GLY A 1 20  ? -31.373 23.823 -2.761  1.00 52.86  ? 2450 GLY A CA  1 
ATOM   151  C C   . GLY A 1 20  ? -30.936 22.368 -2.809  1.00 53.23  ? 2450 GLY A C   1 
ATOM   152  O O   . GLY A 1 20  ? -29.800 22.086 -3.194  1.00 44.62  ? 2450 GLY A O   1 
ATOM   153  N N   . ILE A 1 21  ? -31.841 21.459 -2.406  1.00 49.55  ? 2451 ILE A N   1 
ATOM   154  C CA  . ILE A 1 21  ? -31.585 20.009 -2.432  1.00 41.77  ? 2451 ILE A CA  1 
ATOM   155  C C   . ILE A 1 21  ? -31.542 19.478 -3.870  1.00 43.91  ? 2451 ILE A C   1 
ATOM   156  O O   . ILE A 1 21  ? -30.631 18.736 -4.240  1.00 56.78  ? 2451 ILE A O   1 
ATOM   157  C CB  . ILE A 1 21  ? -32.659 19.211 -1.622  1.00 39.87  ? 2451 ILE A CB  1 
ATOM   158  C CG1 . ILE A 1 21  ? -32.644 19.533 -0.119  1.00 36.62  ? 2451 ILE A CG1 1 
ATOM   159  C CG2 . ILE A 1 21  ? -32.499 17.690 -1.775  1.00 38.50  ? 2451 ILE A CG2 1 
ATOM   160  C CD1 . ILE A 1 21  ? -31.329 19.349 0.533   1.00 44.21  ? 2451 ILE A CD1 1 
ATOM   161  N N   . ILE A 1 22  ? -32.521 19.854 -4.681  1.00 45.62  ? 2452 ILE A N   1 
ATOM   162  C CA  . ILE A 1 22  ? -32.571 19.434 -6.070  1.00 42.72  ? 2452 ILE A CA  1 
ATOM   163  C C   . ILE A 1 22  ? -31.375 19.928 -6.860  1.00 49.18  ? 2452 ILE A C   1 
ATOM   164  O O   . ILE A 1 22  ? -30.787 19.181 -7.650  1.00 44.72  ? 2452 ILE A O   1 
ATOM   165  C CB  . ILE A 1 22  ? -33.835 19.937 -6.760  1.00 47.44  ? 2452 ILE A CB  1 
ATOM   166  C CG1 . ILE A 1 22  ? -35.061 19.183 -6.216  1.00 43.90  ? 2452 ILE A CG1 1 
ATOM   167  C CG2 . ILE A 1 22  ? -33.724 19.780 -8.303  1.00 44.40  ? 2452 ILE A CG2 1 
ATOM   168  C CD1 . ILE A 1 22  ? -36.395 19.554 -6.910  1.00 36.85  ? 2452 ILE A CD1 1 
ATOM   169  N N   . SER A 1 23  ? -30.991 21.181 -6.642  1.00 53.74  ? 2453 SER A N   1 
ATOM   170  C CA  . SER A 1 23  ? -29.880 21.745 -7.392  1.00 58.15  ? 2453 SER A CA  1 
ATOM   171  C C   . SER A 1 23  ? -28.523 21.368 -6.811  1.00 64.29  ? 2453 SER A C   1 
ATOM   172  O O   . SER A 1 23  ? -27.505 21.545 -7.461  1.00 76.38  ? 2453 SER A O   1 
ATOM   173  C CB  . SER A 1 23  ? -30.000 23.255 -7.442  1.00 63.35  ? 2453 SER A CB  1 
ATOM   174  O OG  . SER A 1 23  ? -29.442 23.822 -6.271  1.00 78.87  ? 2453 SER A OG  1 
ATOM   175  N N   . TYR A 1 24  ? -28.502 20.875 -5.582  1.00 68.46  ? 2454 TYR A N   1 
ATOM   176  C CA  . TYR A 1 24  ? -27.249 20.662 -4.847  1.00 72.12  ? 2454 TYR A CA  1 
ATOM   177  C C   . TYR A 1 24  ? -26.199 19.935 -5.683  1.00 68.77  ? 2454 TYR A C   1 
ATOM   178  O O   . TYR A 1 24  ? -26.478 18.884 -6.278  1.00 70.48  ? 2454 TYR A O   1 
ATOM   179  C CB  . TYR A 1 24  ? -27.519 19.855 -3.569  1.00 74.21  ? 2454 TYR A CB  1 
ATOM   180  C CG  . TYR A 1 24  ? -26.395 19.904 -2.574  1.00 71.12  ? 2454 TYR A CG  1 
ATOM   181  C CD1 . TYR A 1 24  ? -26.263 20.977 -1.717  1.00 77.86  ? 2454 TYR A CD1 1 
ATOM   182  C CD2 . TYR A 1 24  ? -25.472 18.881 -2.487  1.00 73.43  ? 2454 TYR A CD2 1 
ATOM   183  C CE1 . TYR A 1 24  ? -25.242 21.041 -0.802  1.00 81.74  ? 2454 TYR A CE1 1 
ATOM   184  C CE2 . TYR A 1 24  ? -24.442 18.932 -1.562  1.00 72.04  ? 2454 TYR A CE2 1 
ATOM   185  C CZ  . TYR A 1 24  ? -24.330 20.019 -0.731  1.00 73.40  ? 2454 TYR A CZ  1 
ATOM   186  O OH  . TYR A 1 24  ? -23.325 20.109 0.199   1.00 73.39  ? 2454 TYR A OH  1 
ATOM   187  N N   . LYS A 1 25  ? -24.992 20.488 -5.717  1.00 70.38  ? 2455 LYS A N   1 
ATOM   188  C CA  . LYS A 1 25  ? -23.902 19.888 -6.493  1.00 73.96  ? 2455 LYS A CA  1 
ATOM   189  C C   . LYS A 1 25  ? -22.667 19.714 -5.619  1.00 78.35  ? 2455 LYS A C   1 
ATOM   190  O O   . LYS A 1 25  ? -22.408 20.531 -4.723  1.00 70.34  ? 2455 LYS A O   1 
ATOM   191  C CB  . LYS A 1 25  ? -23.582 20.742 -7.727  1.00 65.76  ? 2455 LYS A CB  1 
ATOM   192  C CG  . LYS A 1 25  ? -24.671 20.717 -8.779  1.00 60.57  ? 2455 LYS A CG  1 
ATOM   193  C CD  . LYS A 1 25  ? -24.320 21.559 -9.991  1.00 72.07  ? 2455 LYS A CD  1 
ATOM   194  C CE  . LYS A 1 25  ? -25.380 21.450 -11.091 1.00 68.00  ? 2455 LYS A CE  1 
ATOM   195  N NZ  . LYS A 1 25  ? -26.611 22.198 -10.686 1.00 61.35  ? 2455 LYS A NZ  1 
ATOM   196  N N   . ASP A 1 26  ? -21.932 18.627 -5.854  1.00 78.07  ? 2456 ASP A N   1 
ATOM   197  C CA  . ASP A 1 26  ? -20.627 18.450 -5.219  1.00 77.26  ? 2456 ASP A CA  1 
ATOM   198  C C   . ASP A 1 26  ? -19.644 19.352 -5.953  1.00 77.35  ? 2456 ASP A C   1 
ATOM   199  O O   . ASP A 1 26  ? -19.928 19.839 -7.059  1.00 67.40  ? 2456 ASP A O   1 
ATOM   200  C CB  . ASP A 1 26  ? -20.158 16.965 -5.191  1.00 77.78  ? 2456 ASP A CB  1 
ATOM   201  C CG  . ASP A 1 26  ? -20.182 16.260 -6.574  1.00 84.80  ? 2456 ASP A CG  1 
ATOM   202  O OD1 . ASP A 1 26  ? -19.900 15.027 -6.599  1.00 86.14  ? 2456 ASP A OD1 1 
ATOM   203  O OD2 . ASP A 1 26  ? -20.472 16.898 -7.624  1.00 76.31  ? 2456 ASP A OD2 1 
ATOM   204  N N   . SER A 1 27  ? -18.486 19.587 -5.355  1.00 83.68  ? 2457 SER A N   1 
ATOM   205  C CA  . SER A 1 27  ? -17.407 20.248 -6.089  1.00 79.70  ? 2457 SER A CA  1 
ATOM   206  C C   . SER A 1 27  ? -17.346 19.726 -7.548  1.00 88.86  ? 2457 SER A C   1 
ATOM   207  O O   . SER A 1 27  ? -17.197 20.506 -8.501  1.00 83.64  ? 2457 SER A O   1 
ATOM   208  C CB  . SER A 1 27  ? -16.104 20.037 -5.352  1.00 71.39  ? 2457 SER A CB  1 
ATOM   209  O OG  . SER A 1 27  ? -16.297 20.334 -3.984  1.00 75.30  ? 2457 SER A OG  1 
ATOM   210  N N   . SER A 1 28  ? -17.538 18.414 -7.714  1.00 92.72  ? 2458 SER A N   1 
ATOM   211  C CA  . SER A 1 28  ? -17.549 17.774 -9.041  1.00 93.92  ? 2458 SER A CA  1 
ATOM   212  C C   . SER A 1 28  ? -18.692 18.190 -9.994  1.00 94.33  ? 2458 SER A C   1 
ATOM   213  O O   . SER A 1 28  ? -18.824 17.587 -11.065 1.00 83.86  ? 2458 SER A O   1 
ATOM   214  C CB  . SER A 1 28  ? -17.571 16.240 -8.894  1.00 89.48  ? 2458 SER A CB  1 
ATOM   215  O OG  . SER A 1 28  ? -16.919 15.817 -7.706  1.00 86.19  ? 2458 SER A OG  1 
ATOM   216  N N   . ARG A 1 29  ? -19.536 19.161 -9.613  1.00 88.09  ? 2459 ARG A N   1 
ATOM   217  C CA  . ARG A 1 29  ? -20.530 19.733 -10.539 1.00 82.86  ? 2459 ARG A CA  1 
ATOM   218  C C   . ARG A 1 29  ? -21.627 18.724 -11.016 1.00 88.26  ? 2459 ARG A C   1 
ATOM   219  O O   . ARG A 1 29  ? -22.385 19.010 -11.972 1.00 72.17  ? 2459 ARG A O   1 
ATOM   220  C CB  . ARG A 1 29  ? -19.783 20.272 -11.761 1.00 79.78  ? 2459 ARG A CB  1 
ATOM   221  C CG  . ARG A 1 29  ? -20.091 21.685 -12.190 1.00 75.97  ? 2459 ARG A CG  1 
ATOM   222  C CD  . ARG A 1 29  ? -19.238 21.991 -13.405 1.00 79.31  ? 2459 ARG A CD  1 
ATOM   223  N NE  . ARG A 1 29  ? -19.503 21.070 -14.527 1.00 81.64  ? 2459 ARG A NE  1 
ATOM   224  C CZ  . ARG A 1 29  ? -18.868 19.916 -14.780 1.00 80.10  ? 2459 ARG A CZ  1 
ATOM   225  N NH1 . ARG A 1 29  ? -19.219 19.194 -15.841 1.00 75.52  ? 2459 ARG A NH1 1 
ATOM   226  N NH2 . ARG A 1 29  ? -17.893 19.462 -13.994 1.00 78.99  ? 2459 ARG A NH2 1 
ATOM   227  N N   . GLN A 1 30  ? -21.692 17.556 -10.366 1.00 80.85  ? 2460 GLN A N   1 
ATOM   228  C CA  . GLN A 1 30  ? -22.705 16.525 -10.632 1.00 74.55  ? 2460 GLN A CA  1 
ATOM   229  C C   . GLN A 1 30  ? -23.813 16.622 -9.566  1.00 72.17  ? 2460 GLN A C   1 
ATOM   230  O O   . GLN A 1 30  ? -23.545 16.868 -8.384  1.00 60.08  ? 2460 GLN A O   1 
ATOM   231  C CB  . GLN A 1 30  ? -22.034 15.132 -10.673 1.00 84.14  ? 2460 GLN A CB  1 
ATOM   232  C CG  . GLN A 1 30  ? -22.569 14.054 -9.688  1.00 80.07  ? 2460 GLN A CG  1 
ATOM   233  C CD  . GLN A 1 30  ? -23.212 12.831 -10.368 1.00 83.61  ? 2460 GLN A CD  1 
ATOM   234  O OE1 . GLN A 1 30  ? -22.749 12.367 -11.425 1.00 76.12  ? 2460 GLN A OE1 1 
ATOM   235  N NE2 . GLN A 1 30  ? -24.272 12.290 -9.742  1.00 75.80  ? 2460 GLN A NE2 1 
ATOM   236  N N   . ALA A 1 31  ? -25.060 16.438 -9.990  1.00 75.75  ? 2461 ALA A N   1 
ATOM   237  C CA  . ALA A 1 31  ? -26.213 16.692 -9.125  1.00 72.43  ? 2461 ALA A CA  1 
ATOM   238  C C   . ALA A 1 31  ? -26.525 15.488 -8.233  1.00 72.79  ? 2461 ALA A C   1 
ATOM   239  O O   . ALA A 1 31  ? -27.094 14.481 -8.687  1.00 76.53  ? 2461 ALA A O   1 
ATOM   240  C CB  . ALA A 1 31  ? -27.433 17.072 -9.964  1.00 73.49  ? 2461 ALA A CB  1 
ATOM   241  N N   . LEU A 1 32  ? -26.187 15.616 -6.953  1.00 68.04  ? 2462 LEU A N   1 
ATOM   242  C CA  . LEU A 1 32  ? -26.397 14.539 -5.986  1.00 61.17  ? 2462 LEU A CA  1 
ATOM   243  C C   . LEU A 1 32  ? -27.856 14.112 -5.831  1.00 56.93  ? 2462 LEU A C   1 
ATOM   244  O O   . LEU A 1 32  ? -28.115 12.940 -5.625  1.00 67.93  ? 2462 LEU A O   1 
ATOM   245  C CB  . LEU A 1 32  ? -25.823 14.917 -4.614  1.00 61.29  ? 2462 LEU A CB  1 
ATOM   246  C CG  . LEU A 1 32  ? -24.298 15.102 -4.499  1.00 67.70  ? 2462 LEU A CG  1 
ATOM   247  C CD1 . LEU A 1 32  ? -23.909 15.250 -3.013  1.00 64.44  ? 2462 LEU A CD1 1 
ATOM   248  C CD2 . LEU A 1 32  ? -23.531 13.949 -5.133  1.00 72.51  ? 2462 LEU A CD2 1 
ATOM   249  N N   . ALA A 1 33  ? -28.796 15.045 -5.940  1.00 55.26  ? 2463 ALA A N   1 
ATOM   250  C CA  . ALA A 1 33  ? -30.232 14.741 -5.791  1.00 51.75  ? 2463 ALA A CA  1 
ATOM   251  C C   . ALA A 1 33  ? -30.844 14.090 -7.014  1.00 51.80  ? 2463 ALA A C   1 
ATOM   252  O O   . ALA A 1 33  ? -32.066 13.848 -7.039  1.00 48.66  ? 2463 ALA A O   1 
ATOM   253  C CB  . ALA A 1 33  ? -31.024 16.017 -5.458  1.00 51.48  ? 2463 ALA A CB  1 
ATOM   254  N N   . ALA A 1 34  ? -30.027 13.844 -8.044  1.00 56.13  ? 2464 ALA A N   1 
ATOM   255  C CA  . ALA A 1 34  ? -30.527 13.340 -9.335  1.00 55.80  ? 2464 ALA A CA  1 
ATOM   256  C C   . ALA A 1 34  ? -31.323 12.053 -9.195  1.00 56.25  ? 2464 ALA A C   1 
ATOM   257  O O   . ALA A 1 34  ? -32.434 11.959 -9.731  1.00 61.28  ? 2464 ALA A O   1 
ATOM   258  C CB  . ALA A 1 34  ? -29.361 13.165 -10.363 1.00 61.78  ? 2464 ALA A CB  1 
ATOM   259  N N   . PRO A 1 35  ? -30.774 11.056 -8.473  1.00 53.14  ? 2465 PRO A N   1 
ATOM   260  C CA  . PRO A 1 35  ? -31.523 9.803  -8.263  1.00 51.48  ? 2465 PRO A CA  1 
ATOM   261  C C   . PRO A 1 35  ? -32.851 9.981  -7.528  1.00 56.05  ? 2465 PRO A C   1 
ATOM   262  O O   . PRO A 1 35  ? -33.721 9.119  -7.618  1.00 63.60  ? 2465 PRO A O   1 
ATOM   263  C CB  . PRO A 1 35  ? -30.583 8.955  -7.399  1.00 53.71  ? 2465 PRO A CB  1 
ATOM   264  C CG  . PRO A 1 35  ? -29.280 9.677  -7.305  1.00 51.89  ? 2465 PRO A CG  1 
ATOM   265  C CD  . PRO A 1 35  ? -29.508 11.089 -7.720  1.00 51.50  ? 2465 PRO A CD  1 
ATOM   266  N N   . LEU A 1 36  ? -33.006 11.077 -6.794  1.00 57.57  ? 2466 LEU A N   1 
ATOM   267  C CA  . LEU A 1 36  ? -34.188 11.287 -5.967  1.00 54.23  ? 2466 LEU A CA  1 
ATOM   268  C C   . LEU A 1 36  ? -35.324 11.985 -6.689  1.00 52.83  ? 2466 LEU A C   1 
ATOM   269  O O   . LEU A 1 36  ? -36.385 12.191 -6.103  1.00 48.57  ? 2466 LEU A O   1 
ATOM   270  C CB  . LEU A 1 36  ? -33.812 12.115 -4.738  1.00 52.68  ? 2466 LEU A CB  1 
ATOM   271  C CG  . LEU A 1 36  ? -33.151 11.464 -3.513  1.00 62.23  ? 2466 LEU A CG  1 
ATOM   272  C CD1 . LEU A 1 36  ? -32.372 10.372 -3.768  1.00 56.25  ? 2466 LEU A CD1 1 
ATOM   273  C CD2 . LEU A 1 36  ? -32.133 12.227 -2.994  1.00 64.39  ? 2466 LEU A CD2 1 
ATOM   274  N N   . LEU A 1 37  ? -35.113 12.382 -7.942  1.00 56.43  ? 2467 LEU A N   1 
ATOM   275  C CA  . LEU A 1 37  ? -36.025 13.334 -8.599  1.00 50.08  ? 2467 LEU A CA  1 
ATOM   276  C C   . LEU A 1 37  ? -37.296 12.648 -9.093  1.00 66.33  ? 2467 LEU A C   1 
ATOM   277  O O   . LEU A 1 37  ? -38.402 13.185 -8.936  1.00 75.68  ? 2467 LEU A O   1 
ATOM   278  C CB  . LEU A 1 37  ? -35.333 14.043 -9.760  1.00 55.45  ? 2467 LEU A CB  1 
ATOM   279  C CG  . LEU A 1 37  ? -34.193 15.025 -9.433  1.00 57.02  ? 2467 LEU A CG  1 
ATOM   280  C CD1 . LEU A 1 37  ? -33.582 15.481 -10.718 1.00 41.57  ? 2467 LEU A CD1 1 
ATOM   281  C CD2 . LEU A 1 37  ? -34.677 16.234 -8.632  1.00 49.72  ? 2467 LEU A CD2 1 
ATOM   282  N N   . ASN A 1 38  ? -37.127 11.476 -9.709  1.00 66.50  ? 2468 ASN A N   1 
ATOM   283  C CA  . ASN A 1 38  ? -38.233 10.733 -10.290 1.00 60.63  ? 2468 ASN A CA  1 
ATOM   284  C C   . ASN A 1 38  ? -38.313 9.325  -9.737  1.00 65.78  ? 2468 ASN A C   1 
ATOM   285  O O   . ASN A 1 38  ? -37.289 8.641  -9.621  1.00 56.44  ? 2468 ASN A O   1 
ATOM   286  C CB  . ASN A 1 38  ? -38.082 10.639 -11.804 1.00 55.89  ? 2468 ASN A CB  1 
ATOM   287  C CG  . ASN A 1 38  ? -39.373 10.190 -12.479 1.00 61.26  ? 2468 ASN A CG  1 
ATOM   288  O OD1 . ASN A 1 38  ? -40.479 10.604 -12.070 1.00 44.10  ? 2468 ASN A OD1 1 
ATOM   289  N ND2 . ASN A 1 38  ? -39.248 9.347  -13.508 1.00 53.72  ? 2468 ASN A ND2 1 
ATOM   290  N N   . LEU A 1 39  ? -39.525 8.898  -9.385  1.00 61.19  ? 2469 LEU A N   1 
ATOM   291  C CA  . LEU A 1 39  ? -39.748 7.522  -8.957  1.00 58.86  ? 2469 LEU A CA  1 
ATOM   292  C C   . LEU A 1 39  ? -39.558 6.594  -10.165 1.00 61.75  ? 2469 LEU A C   1 
ATOM   293  O O   . LEU A 1 39  ? -40.144 6.844  -11.219 1.00 59.92  ? 2469 LEU A O   1 
ATOM   294  C CB  . LEU A 1 39  ? -41.172 7.344  -8.392  1.00 56.61  ? 2469 LEU A CB  1 
ATOM   295  C CG  . LEU A 1 39  ? -41.450 7.797  -6.948  1.00 52.83  ? 2469 LEU A CG  1 
ATOM   296  C CD1 . LEU A 1 39  ? -42.968 7.824  -6.602  1.00 49.51  ? 2469 LEU A CD1 1 
ATOM   297  C CD2 . LEU A 1 39  ? -40.635 6.991  -5.920  1.00 42.97  ? 2469 LEU A CD2 1 
ATOM   298  N N   . PRO A 1 40  ? -38.773 5.507  -10.007 1.00 71.42  ? 2470 PRO A N   1 
ATOM   299  C CA  . PRO A 1 40  ? -38.527 4.547  -11.103 1.00 67.54  ? 2470 PRO A CA  1 
ATOM   300  C C   . PRO A 1 40  ? -39.838 4.062  -11.696 1.00 71.39  ? 2470 PRO A C   1 
ATOM   301  O O   . PRO A 1 40  ? -40.738 3.726  -10.927 1.00 75.69  ? 2470 PRO A O   1 
ATOM   302  C CB  . PRO A 1 40  ? -37.845 3.356  -10.402 1.00 67.34  ? 2470 PRO A CB  1 
ATOM   303  C CG  . PRO A 1 40  ? -37.394 3.865  -9.089  1.00 65.11  ? 2470 PRO A CG  1 
ATOM   304  C CD  . PRO A 1 40  ? -38.341 4.968  -8.703  1.00 68.45  ? 2470 PRO A CD  1 
ATOM   305  N N   . PRO A 1 41  ? -39.955 4.022  -13.040 1.00 69.06  ? 2471 PRO A N   1 
ATOM   306  C CA  . PRO A 1 41  ? -41.197 3.573  -13.676 1.00 77.93  ? 2471 PRO A CA  1 
ATOM   307  C C   . PRO A 1 41  ? -41.646 2.165  -13.256 1.00 79.01  ? 2471 PRO A C   1 
ATOM   308  O O   . PRO A 1 41  ? -40.876 1.204  -13.347 1.00 74.44  ? 2471 PRO A O   1 
ATOM   309  C CB  . PRO A 1 41  ? -40.856 3.626  -15.169 1.00 85.49  ? 2471 PRO A CB  1 
ATOM   310  C CG  . PRO A 1 41  ? -39.850 4.715  -15.254 1.00 80.83  ? 2471 PRO A CG  1 
ATOM   311  C CD  . PRO A 1 41  ? -38.997 4.534  -14.037 1.00 70.13  ? 2471 PRO A CD  1 
ATOM   312  N N   . LYS A 1 42  ? -42.885 2.074  -12.777 1.00 81.35  ? 2472 LYS A N   1 
ATOM   313  C CA  . LYS A 1 42  ? -43.407 0.850  -12.179 1.00 81.16  ? 2472 LYS A CA  1 
ATOM   314  C C   . LYS A 1 42  ? -43.176 -0.350 -13.095 1.00 82.75  ? 2472 LYS A C   1 
ATOM   315  O O   . LYS A 1 42  ? -42.642 -1.382 -12.664 1.00 84.54  ? 2472 LYS A O   1 
ATOM   316  C CB  . LYS A 1 42  ? -44.897 1.011  -11.848 1.00 68.55  ? 2472 LYS A CB  1 
ATOM   317  N N   . LYS A 1 43  ? -43.524 -0.194 -14.369 1.00 85.58  ? 2473 LYS A N   1 
ATOM   318  C CA  . LYS A 1 43  ? -43.478 -1.325 -15.299 1.00 88.15  ? 2473 LYS A CA  1 
ATOM   319  C C   . LYS A 1 43  ? -42.148 -2.088 -15.299 1.00 88.38  ? 2473 LYS A C   1 
ATOM   320  O O   . LYS A 1 43  ? -42.171 -3.299 -15.238 1.00 103.98 ? 2473 LYS A O   1 
ATOM   321  C CB  . LYS A 1 43  ? -43.946 -0.938 -16.714 1.00 72.63  ? 2473 LYS A CB  1 
ATOM   322  C CG  . LYS A 1 43  ? -45.471 -0.622 -16.765 1.00 69.43  ? 2473 LYS A CG  1 
ATOM   323  C CD  . LYS A 1 43  ? -46.091 -0.734 -18.164 1.00 58.62  ? 2473 LYS A CD  1 
ATOM   324  N N   . LYS A 1 44  ? -40.998 -1.430 -15.316 1.00 90.72  ? 2474 LYS A N   1 
ATOM   325  C CA  . LYS A 1 44  ? -39.742 -2.205 -15.278 1.00 89.44  ? 2474 LYS A CA  1 
ATOM   326  C C   . LYS A 1 44  ? -38.967 -2.123 -13.942 1.00 94.58  ? 2474 LYS A C   1 
ATOM   327  O O   . LYS A 1 44  ? -37.812 -2.567 -13.868 1.00 89.72  ? 2474 LYS A O   1 
ATOM   328  C CB  . LYS A 1 44  ? -38.847 -1.875 -16.485 1.00 87.75  ? 2474 LYS A CB  1 
ATOM   329  C CG  . LYS A 1 44  ? -39.224 -2.641 -17.777 1.00 83.22  ? 2474 LYS A CG  1 
ATOM   330  N N   . ASN A 1 45  ? -39.586 -1.589 -12.886 1.00 77.23  ? 2475 ASN A N   1 
ATOM   331  C CA  . ASN A 1 45  ? -38.980 -1.699 -11.554 1.00 86.22  ? 2475 ASN A CA  1 
ATOM   332  C C   . ASN A 1 45  ? -40.035 -2.167 -10.557 1.00 87.79  ? 2475 ASN A C   1 
ATOM   333  O O   . ASN A 1 45  ? -40.242 -1.531 -9.523  1.00 103.29 ? 2475 ASN A O   1 
ATOM   334  C CB  . ASN A 1 45  ? -38.303 -0.380 -11.096 1.00 79.81  ? 2475 ASN A CB  1 
ATOM   335  C CG  . ASN A 1 45  ? -37.423 0.248  -12.176 1.00 81.70  ? 2475 ASN A CG  1 
ATOM   336  O OD1 . ASN A 1 45  ? -36.208 -0.007 -12.247 1.00 70.15  ? 2475 ASN A OD1 1 
ATOM   337  N ND2 . ASN A 1 45  ? -38.040 1.075  -13.034 1.00 66.54  ? 2475 ASN A ND2 1 
ATOM   338  N N   . ALA A 1 46  ? -40.701 -3.281 -10.879 1.00 85.17  ? 2476 ALA A N   1 
ATOM   339  C CA  . ALA A 1 46  ? -41.718 -3.872 -9.989  1.00 84.61  ? 2476 ALA A CA  1 
ATOM   340  C C   . ALA A 1 46  ? -41.127 -4.254 -8.631  1.00 75.45  ? 2476 ALA A C   1 
ATOM   341  O O   . ALA A 1 46  ? -41.841 -4.268 -7.637  1.00 74.55  ? 2476 ALA A O   1 
ATOM   342  C CB  . ALA A 1 46  ? -42.380 -5.086 -10.639 1.00 71.29  ? 2476 ALA A CB  1 
ATOM   343  N N   . ASP A 1 47  ? -39.822 -4.545 -8.601  1.00 73.01  ? 2477 ASP A N   1 
ATOM   344  C CA  . ASP A 1 47  ? -39.122 -4.892 -7.358  1.00 75.09  ? 2477 ASP A CA  1 
ATOM   345  C C   . ASP A 1 47  ? -38.969 -3.731 -6.379  1.00 76.13  ? 2477 ASP A C   1 
ATOM   346  O O   . ASP A 1 47  ? -38.901 -3.948 -5.170  1.00 78.20  ? 2477 ASP A O   1 
ATOM   347  C CB  . ASP A 1 47  ? -37.749 -5.510 -7.661  1.00 78.47  ? 2477 ASP A CB  1 
ATOM   348  C CG  . ASP A 1 47  ? -36.726 -4.491 -8.109  1.00 82.71  ? 2477 ASP A CG  1 
ATOM   349  O OD1 . ASP A 1 47  ? -36.879 -3.936 -9.218  1.00 81.66  ? 2477 ASP A OD1 1 
ATOM   350  O OD2 . ASP A 1 47  ? -35.761 -4.272 -7.346  1.00 83.13  ? 2477 ASP A OD2 1 
ATOM   351  N N   . TYR A 1 48  ? -38.894 -2.508 -6.909  1.00 83.18  ? 2478 TYR A N   1 
ATOM   352  C CA  . TYR A 1 48  ? -38.892 -1.288 -6.096  1.00 81.56  ? 2478 TYR A CA  1 
ATOM   353  C C   . TYR A 1 48  ? -40.179 -1.198 -5.276  1.00 81.59  ? 2478 TYR A C   1 
ATOM   354  O O   . TYR A 1 48  ? -40.145 -1.116 -4.050  1.00 85.72  ? 2478 TYR A O   1 
ATOM   355  C CB  . TYR A 1 48  ? -38.738 -0.024 -6.984  1.00 81.74  ? 2478 TYR A CB  1 
ATOM   356  C CG  . TYR A 1 48  ? -38.581 1.264  -6.181  1.00 77.41  ? 2478 TYR A CG  1 
ATOM   357  C CD1 . TYR A 1 48  ? -37.343 1.625  -5.651  1.00 71.61  ? 2478 TYR A CD1 1 
ATOM   358  C CD2 . TYR A 1 48  ? -39.671 2.095  -5.930  1.00 67.58  ? 2478 TYR A CD2 1 
ATOM   359  C CE1 . TYR A 1 48  ? -37.193 2.760  -4.893  1.00 70.31  ? 2478 TYR A CE1 1 
ATOM   360  C CE2 . TYR A 1 48  ? -39.531 3.238  -5.172  1.00 73.57  ? 2478 TYR A CE2 1 
ATOM   361  C CZ  . TYR A 1 48  ? -38.287 3.568  -4.657  1.00 77.77  ? 2478 TYR A CZ  1 
ATOM   362  O OH  . TYR A 1 48  ? -38.134 4.710  -3.901  1.00 75.28  ? 2478 TYR A OH  1 
ATOM   363  N N   . TYR A 1 49  ? -41.313 -1.256 -5.961  1.00 83.84  ? 2479 TYR A N   1 
ATOM   364  C CA  . TYR A 1 49  ? -42.609 -1.043 -5.322  1.00 90.97  ? 2479 TYR A CA  1 
ATOM   365  C C   . TYR A 1 49  ? -43.050 -2.209 -4.426  1.00 100.81 ? 2479 TYR A C   1 
ATOM   366  O O   . TYR A 1 49  ? -44.089 -2.123 -3.762  1.00 106.17 ? 2479 TYR A O   1 
ATOM   367  C CB  . TYR A 1 49  ? -43.664 -0.742 -6.378  1.00 83.84  ? 2479 TYR A CB  1 
ATOM   368  C CG  . TYR A 1 49  ? -43.395 0.555  -7.106  1.00 91.45  ? 2479 TYR A CG  1 
ATOM   369  C CD1 . TYR A 1 49  ? -44.034 1.732  -6.726  1.00 92.68  ? 2479 TYR A CD1 1 
ATOM   370  C CD2 . TYR A 1 49  ? -42.490 0.611  -8.165  1.00 87.79  ? 2479 TYR A CD2 1 
ATOM   371  C CE1 . TYR A 1 49  ? -43.790 2.922  -7.385  1.00 92.02  ? 2479 TYR A CE1 1 
ATOM   372  C CE2 . TYR A 1 49  ? -42.238 1.791  -8.826  1.00 82.04  ? 2479 TYR A CE2 1 
ATOM   373  C CZ  . TYR A 1 49  ? -42.891 2.944  -8.436  1.00 88.50  ? 2479 TYR A CZ  1 
ATOM   374  O OH  . TYR A 1 49  ? -42.654 4.128  -9.087  1.00 79.67  ? 2479 TYR A OH  1 
ATOM   375  N N   . GLU A 1 50  ? -42.258 -3.284 -4.410  1.00 105.25 ? 2480 GLU A N   1 
ATOM   376  C CA  . GLU A 1 50  ? -42.397 -4.348 -3.413  1.00 100.99 ? 2480 GLU A CA  1 
ATOM   377  C C   . GLU A 1 50  ? -41.563 -4.056 -2.152  1.00 104.63 ? 2480 GLU A C   1 
ATOM   378  O O   . GLU A 1 50  ? -42.002 -4.384 -1.045  1.00 100.51 ? 2480 GLU A O   1 
ATOM   379  C CB  . GLU A 1 50  ? -42.013 -5.704 -4.011  1.00 99.72  ? 2480 GLU A CB  1 
ATOM   380  N N   . LYS A 1 51  ? -40.381 -3.441 -2.308  1.00 105.85 ? 2481 LYS A N   1 
ATOM   381  C CA  . LYS A 1 51  ? -39.541 -3.037 -1.153  1.00 101.45 ? 2481 LYS A CA  1 
ATOM   382  C C   . LYS A 1 51  ? -39.965 -1.710 -0.482  1.00 101.79 ? 2481 LYS A C   1 
ATOM   383  O O   . LYS A 1 51  ? -39.732 -1.528 0.717   1.00 97.06  ? 2481 LYS A O   1 
ATOM   384  C CB  . LYS A 1 51  ? -38.059 -2.976 -1.552  1.00 95.36  ? 2481 LYS A CB  1 
ATOM   385  N N   . ILE A 1 52  ? -40.570 -0.794 -1.250  1.00 101.67 ? 2482 ILE A N   1 
ATOM   386  C CA  . ILE A 1 52  ? -41.065 0.499  -0.719  1.00 90.42  ? 2482 ILE A CA  1 
ATOM   387  C C   . ILE A 1 52  ? -42.602 0.610  -0.754  1.00 79.18  ? 2482 ILE A C   1 
ATOM   388  O O   . ILE A 1 52  ? -43.250 0.473  -1.820  1.00 53.56  ? 2482 ILE A O   1 
ATOM   389  C CB  . ILE A 1 52  ? -40.452 1.730  -1.452  1.00 87.22  ? 2482 ILE A CB  1 
ATOM   390  C CG1 . ILE A 1 52  ? -39.072 2.070  -0.886  1.00 91.34  ? 2482 ILE A CG1 1 
ATOM   391  C CG2 . ILE A 1 52  ? -41.343 2.966  -1.279  1.00 76.40  ? 2482 ILE A CG2 1 
ATOM   392  C CD1 . ILE A 1 52  ? -38.044 0.959  -0.992  1.00 97.14  ? 2482 ILE A CD1 1 
ATOM   393  N N   . SER A 1 53  ? -43.135 0.903  0.430   1.00 72.93  ? 2483 SER A N   1 
ATOM   394  C CA  . SER A 1 53  ? -44.557 0.930  0.720   1.00 77.47  ? 2483 SER A CA  1 
ATOM   395  C C   . SER A 1 53  ? -45.138 2.265  0.385   1.00 74.11  ? 2483 SER A C   1 
ATOM   396  O O   . SER A 1 53  ? -46.254 2.359  -0.122  1.00 73.99  ? 2483 SER A O   1 
ATOM   397  C CB  . SER A 1 53  ? -44.774 0.726  2.229   1.00 79.61  ? 2483 SER A CB  1 
ATOM   398  O OG  . SER A 1 53  ? -43.849 -0.212 2.748   1.00 90.31  ? 2483 SER A OG  1 
ATOM   399  N N   . ASP A 1 54  ? -44.383 3.297  0.748   1.00 71.81  ? 2484 ASP A N   1 
ATOM   400  C CA  . ASP A 1 54  ? -44.824 4.682  0.662   1.00 79.43  ? 2484 ASP A CA  1 
ATOM   401  C C   . ASP A 1 54  ? -43.821 5.486  -0.192  1.00 89.85  ? 2484 ASP A C   1 
ATOM   402  O O   . ASP A 1 54  ? -43.023 6.272  0.340   1.00 88.47  ? 2484 ASP A O   1 
ATOM   403  C CB  . ASP A 1 54  ? -44.928 5.253  2.081   1.00 74.65  ? 2484 ASP A CB  1 
ATOM   404  C CG  . ASP A 1 54  ? -45.947 6.373  2.205   1.00 64.26  ? 2484 ASP A CG  1 
ATOM   405  O OD1 . ASP A 1 54  ? -46.587 6.756  1.203   1.00 55.04  ? 2484 ASP A OD1 1 
ATOM   406  O OD2 . ASP A 1 54  ? -46.094 6.871  3.342   1.00 58.21  ? 2484 ASP A OD2 1 
ATOM   407  N N   . PRO A 1 55  ? -43.859 5.287  -1.523  1.00 92.89  ? 2485 PRO A N   1 
ATOM   408  C CA  . PRO A 1 55  ? -42.854 5.842  -2.422  1.00 84.70  ? 2485 PRO A CA  1 
ATOM   409  C C   . PRO A 1 55  ? -43.101 7.323  -2.667  1.00 75.09  ? 2485 PRO A C   1 
ATOM   410  O O   . PRO A 1 55  ? -44.251 7.736  -2.802  1.00 82.45  ? 2485 PRO A O   1 
ATOM   411  C CB  . PRO A 1 55  ? -43.084 5.048  -3.711  1.00 88.94  ? 2485 PRO A CB  1 
ATOM   412  C CG  . PRO A 1 55  ? -44.560 4.784  -3.721  1.00 93.20  ? 2485 PRO A CG  1 
ATOM   413  C CD  . PRO A 1 55  ? -45.017 4.757  -2.270  1.00 97.42  ? 2485 PRO A CD  1 
ATOM   414  N N   . LEU A 1 56  ? -42.044 8.125  -2.716  1.00 69.94  ? 2486 LEU A N   1 
ATOM   415  C CA  . LEU A 1 56  ? -42.200 9.557  -3.034  1.00 73.42  ? 2486 LEU A CA  1 
ATOM   416  C C   . LEU A 1 56  ? -40.926 10.068 -3.692  1.00 71.45  ? 2486 LEU A C   1 
ATOM   417  O O   . LEU A 1 56  ? -39.811 9.640  -3.332  1.00 53.04  ? 2486 LEU A O   1 
ATOM   418  C CB  . LEU A 1 56  ? -42.524 10.386 -1.780  1.00 67.26  ? 2486 LEU A CB  1 
ATOM   419  C CG  . LEU A 1 56  ? -42.818 11.872 -1.997  1.00 66.00  ? 2486 LEU A CG  1 
ATOM   420  C CD1 . LEU A 1 56  ? -44.166 12.065 -2.623  1.00 61.22  ? 2486 LEU A CD1 1 
ATOM   421  C CD2 . LEU A 1 56  ? -42.740 12.621 -0.683  1.00 71.74  ? 2486 LEU A CD2 1 
ATOM   422  N N   . ASP A 1 57  ? -41.100 10.960 -4.667  1.00 65.87  ? 2487 ASP A N   1 
ATOM   423  C CA  . ASP A 1 57  ? -39.968 11.597 -5.335  1.00 60.62  ? 2487 ASP A CA  1 
ATOM   424  C C   . ASP A 1 57  ? -39.992 13.094 -5.084  1.00 52.38  ? 2487 ASP A C   1 
ATOM   425  O O   . ASP A 1 57  ? -41.031 13.610 -4.678  1.00 53.66  ? 2487 ASP A O   1 
ATOM   426  C CB  . ASP A 1 57  ? -39.931 11.253 -6.845  1.00 65.31  ? 2487 ASP A CB  1 
ATOM   427  C CG  . ASP A 1 57  ? -41.197 11.668 -7.632  1.00 65.68  ? 2487 ASP A CG  1 
ATOM   428  O OD1 . ASP A 1 57  ? -42.058 12.420 -7.147  1.00 74.11  ? 2487 ASP A OD1 1 
ATOM   429  O OD2 . ASP A 1 57  ? -41.298 11.253 -8.802  1.00 76.53  ? 2487 ASP A OD2 1 
ATOM   430  N N   . LEU A 1 58  ? -38.854 13.777 -5.307  1.00 56.49  ? 2488 LEU A N   1 
ATOM   431  C CA  . LEU A 1 58  ? -38.732 15.246 -5.114  1.00 47.53  ? 2488 LEU A CA  1 
ATOM   432  C C   . LEU A 1 58  ? -39.610 16.034 -6.074  1.00 44.74  ? 2488 LEU A C   1 
ATOM   433  O O   . LEU A 1 58  ? -40.103 17.085 -5.733  1.00 52.66  ? 2488 LEU A O   1 
ATOM   434  C CB  . LEU A 1 58  ? -37.275 15.735 -5.256  1.00 44.53  ? 2488 LEU A CB  1 
ATOM   435  C CG  . LEU A 1 58  ? -36.244 15.292 -4.182  1.00 43.91  ? 2488 LEU A CG  1 
ATOM   436  C CD1 . LEU A 1 58  ? -34.826 15.814 -4.503  1.00 35.18  ? 2488 LEU A CD1 1 
ATOM   437  C CD2 . LEU A 1 58  ? -36.606 15.643 -2.768  1.00 29.82  ? 2488 LEU A CD2 1 
ATOM   438  N N   . ILE A 1 59  ? -39.816 15.528 -7.280  1.00 50.64  ? 2489 ILE A N   1 
ATOM   439  C CA  . ILE A 1 59  ? -40.658 16.238 -8.249  1.00 50.32  ? 2489 ILE A CA  1 
ATOM   440  C C   . ILE A 1 59  ? -42.059 16.418 -7.670  1.00 48.58  ? 2489 ILE A C   1 
ATOM   441  O O   . ILE A 1 59  ? -42.612 17.524 -7.710  1.00 46.23  ? 2489 ILE A O   1 
ATOM   442  C CB  . ILE A 1 59  ? -40.664 15.506 -9.641  1.00 57.09  ? 2489 ILE A CB  1 
ATOM   443  C CG1 . ILE A 1 59  ? -39.357 15.797 -10.366 1.00 58.57  ? 2489 ILE A CG1 1 
ATOM   444  C CG2 . ILE A 1 59  ? -41.823 15.953 -10.547 1.00 51.05  ? 2489 ILE A CG2 1 
ATOM   445  C CD1 . ILE A 1 59  ? -39.335 15.282 -11.768 1.00 55.62  ? 2489 ILE A CD1 1 
ATOM   446  N N   . THR A 1 60  ? -42.610 15.338 -7.104  1.00 49.79  ? 2490 THR A N   1 
ATOM   447  C CA  . THR A 1 60  ? -43.933 15.379 -6.434  1.00 48.69  ? 2490 THR A CA  1 
ATOM   448  C C   . THR A 1 60  ? -43.970 16.379 -5.258  1.00 48.94  ? 2490 THR A C   1 
ATOM   449  O O   . THR A 1 60  ? -44.907 17.184 -5.124  1.00 51.96  ? 2490 THR A O   1 
ATOM   450  C CB  . THR A 1 60  ? -44.406 13.941 -5.983  1.00 53.54  ? 2490 THR A CB  1 
ATOM   451  O OG1 . THR A 1 60  ? -44.331 13.020 -7.091  1.00 45.31  ? 2490 THR A OG1 1 
ATOM   452  C CG2 . THR A 1 60  ? -45.843 13.971 -5.494  1.00 49.06  ? 2490 THR A CG2 1 
ATOM   453  N N   . ILE A 1 61  ? -42.944 16.354 -4.413  1.00 49.93  ? 2491 ILE A N   1 
ATOM   454  C CA  . ILE A 1 61  ? -42.875 17.303 -3.306  1.00 43.43  ? 2491 ILE A CA  1 
ATOM   455  C C   . ILE A 1 61  ? -42.880 18.718 -3.857  1.00 43.71  ? 2491 ILE A C   1 
ATOM   456  O O   . ILE A 1 61  ? -43.623 19.584 -3.396  1.00 50.89  ? 2491 ILE A O   1 
ATOM   457  C CB  . ILE A 1 61  ? -41.623 17.064 -2.440  1.00 44.62  ? 2491 ILE A CB  1 
ATOM   458  C CG1 . ILE A 1 61  ? -41.660 15.677 -1.816  1.00 45.17  ? 2491 ILE A CG1 1 
ATOM   459  C CG2 . ILE A 1 61  ? -41.506 18.064 -1.314  1.00 42.36  ? 2491 ILE A CG2 1 
ATOM   460  C CD1 . ILE A 1 61  ? -40.713 15.524 -0.652  1.00 45.94  ? 2491 ILE A CD1 1 
ATOM   461  N N   . GLU A 1 62  ? -42.030 18.957 -4.835  1.00 44.11  ? 2492 GLU A N   1 
ATOM   462  C CA  . GLU A 1 62  ? -41.903 20.267 -5.451  1.00 55.85  ? 2492 GLU A CA  1 
ATOM   463  C C   . GLU A 1 62  ? -43.271 20.749 -5.973  1.00 57.29  ? 2492 GLU A C   1 
ATOM   464  O O   . GLU A 1 62  ? -43.630 21.922 -5.866  1.00 58.59  ? 2492 GLU A O   1 
ATOM   465  C CB  . GLU A 1 62  ? -40.869 20.178 -6.595  1.00 61.86  ? 2492 GLU A CB  1 
ATOM   466  C CG  . GLU A 1 62  ? -40.337 21.524 -7.096  1.00 70.60  ? 2492 GLU A CG  1 
ATOM   467  C CD  . GLU A 1 62  ? -39.318 22.111 -6.153  1.00 72.97  ? 2492 GLU A CD  1 
ATOM   468  O OE1 . GLU A 1 62  ? -38.181 21.602 -6.130  1.00 76.83  ? 2492 GLU A OE1 1 
ATOM   469  O OE2 . GLU A 1 62  ? -39.647 23.077 -5.442  1.00 63.20  ? 2492 GLU A OE2 1 
ATOM   470  N N   . LYS A 1 63  ? -44.023 19.812 -6.542  1.00 63.52  ? 2493 LYS A N   1 
ATOM   471  C CA  . LYS A 1 63  ? -45.341 20.082 -7.121  1.00 63.27  ? 2493 LYS A CA  1 
ATOM   472  C C   . LYS A 1 63  ? -46.308 20.444 -6.015  1.00 57.49  ? 2493 LYS A C   1 
ATOM   473  O O   . LYS A 1 63  ? -46.898 21.517 -6.026  1.00 62.72  ? 2493 LYS A O   1 
ATOM   474  C CB  . LYS A 1 63  ? -45.813 18.833 -7.878  1.00 71.18  ? 2493 LYS A CB  1 
ATOM   475  C CG  . LYS A 1 63  ? -47.078 18.960 -8.707  1.00 72.33  ? 2493 LYS A CG  1 
ATOM   476  C CD  . LYS A 1 63  ? -47.537 17.564 -9.204  1.00 75.22  ? 2493 LYS A CD  1 
ATOM   477  C CE  . LYS A 1 63  ? -48.198 16.752 -8.046  1.00 76.39  ? 2493 LYS A CE  1 
ATOM   478  N NZ  . LYS A 1 63  ? -48.985 15.561 -8.468  1.00 76.43  ? 2493 LYS A NZ  1 
ATOM   479  N N   . GLN A 1 64  ? -46.427 19.567 -5.028  1.00 54.13  ? 2494 GLN A N   1 
ATOM   480  C CA  . GLN A 1 64  ? -47.329 19.819 -3.904  1.00 58.53  ? 2494 GLN A CA  1 
ATOM   481  C C   . GLN A 1 64  ? -47.019 21.119 -3.118  1.00 53.77  ? 2494 GLN A C   1 
ATOM   482  O O   . GLN A 1 64  ? -47.911 21.772 -2.617  1.00 53.34  ? 2494 GLN A O   1 
ATOM   483  C CB  . GLN A 1 64  ? -47.323 18.601 -2.981  1.00 62.21  ? 2494 GLN A CB  1 
ATOM   484  C CG  . GLN A 1 64  ? -47.978 17.336 -3.604  1.00 57.41  ? 2494 GLN A CG  1 
ATOM   485  C CD  . GLN A 1 64  ? -47.623 16.073 -2.865  1.00 53.90  ? 2494 GLN A CD  1 
ATOM   486  O OE1 . GLN A 1 64  ? -46.832 16.093 -1.926  1.00 64.00  ? 2494 GLN A OE1 1 
ATOM   487  N NE2 . GLN A 1 64  ? -48.191 14.957 -3.293  1.00 55.75  ? 2494 GLN A NE2 1 
ATOM   488  N N   . ILE A 1 65  ? -45.764 21.528 -3.034  1.00 51.74  ? 2495 ILE A N   1 
ATOM   489  C CA  . ILE A 1 65  ? -45.443 22.774 -2.320  1.00 47.00  ? 2495 ILE A CA  1 
ATOM   490  C C   . ILE A 1 65  ? -46.233 23.901 -2.919  1.00 53.25  ? 2495 ILE A C   1 
ATOM   491  O O   . ILE A 1 65  ? -46.884 24.647 -2.213  1.00 59.42  ? 2495 ILE A O   1 
ATOM   492  C CB  . ILE A 1 65  ? -43.954 23.152 -2.472  1.00 47.64  ? 2495 ILE A CB  1 
ATOM   493  C CG1 . ILE A 1 65  ? -43.103 22.269 -1.590  1.00 39.13  ? 2495 ILE A CG1 1 
ATOM   494  C CG2 . ILE A 1 65  ? -43.698 24.640 -2.150  1.00 45.89  ? 2495 ILE A CG2 1 
ATOM   495  C CD1 . ILE A 1 65  ? -41.704 22.397 -1.886  1.00 39.44  ? 2495 ILE A CD1 1 
ATOM   496  N N   . LEU A 1 66  ? -46.141 24.030 -4.243  1.00 62.14  ? 2496 LEU A N   1 
ATOM   497  C CA  . LEU A 1 66  ? -46.811 25.101 -4.995  1.00 55.41  ? 2496 LEU A CA  1 
ATOM   498  C C   . LEU A 1 66  ? -48.331 25.241 -4.718  1.00 63.61  ? 2496 LEU A C   1 
ATOM   499  O O   . LEU A 1 66  ? -48.902 26.310 -4.930  1.00 59.53  ? 2496 LEU A O   1 
ATOM   500  C CB  . LEU A 1 66  ? -46.600 24.874 -6.497  1.00 53.22  ? 2496 LEU A CB  1 
ATOM   501  C CG  . LEU A 1 66  ? -45.186 24.919 -7.102  1.00 56.01  ? 2496 LEU A CG  1 
ATOM   502  C CD1 . LEU A 1 66  ? -45.234 24.741 -8.632  1.00 46.36  ? 2496 LEU A CD1 1 
ATOM   503  C CD2 . LEU A 1 66  ? -44.465 26.224 -6.733  1.00 47.40  ? 2496 LEU A CD2 1 
ATOM   504  N N   . THR A 1 67  ? -48.952 24.146 -4.255  1.00 64.75  ? 2497 THR A N   1 
ATOM   505  C CA  . THR A 1 67  ? -50.393 24.020 -3.974  1.00 53.33  ? 2497 THR A CA  1 
ATOM   506  C C   . THR A 1 67  ? -50.747 24.582 -2.620  1.00 72.85  ? 2497 THR A C   1 
ATOM   507  O O   . THR A 1 67  ? -51.904 24.902 -2.345  1.00 90.03  ? 2497 THR A O   1 
ATOM   508  C CB  . THR A 1 67  ? -50.771 22.508 -3.977  1.00 50.91  ? 2497 THR A CB  1 
ATOM   509  O OG1 . THR A 1 67  ? -51.007 22.081 -5.331  1.00 55.31  ? 2497 THR A OG1 1 
ATOM   510  C CG2 . THR A 1 67  ? -51.957 22.177 -3.083  1.00 60.68  ? 2497 THR A CG2 1 
ATOM   511  N N   . GLY A 1 68  ? -49.743 24.693 -1.761  1.00 78.12  ? 2498 GLY A N   1 
ATOM   512  C CA  . GLY A 1 68  ? -49.975 24.902 -0.345  1.00 75.31  ? 2498 GLY A CA  1 
ATOM   513  C C   . GLY A 1 68  ? -50.351 23.602 0.342   1.00 74.98  ? 2498 GLY A C   1 
ATOM   514  O O   . GLY A 1 68  ? -50.938 23.614 1.415   1.00 82.28  ? 2498 GLY A O   1 
ATOM   515  N N   . TYR A 1 69  ? -50.012 22.473 -0.265  1.00 67.38  ? 2499 TYR A N   1 
ATOM   516  C CA  . TYR A 1 69  ? -50.280 21.155 0.338   1.00 64.63  ? 2499 TYR A CA  1 
ATOM   517  C C   . TYR A 1 69  ? -49.630 20.937 1.718   1.00 67.85  ? 2499 TYR A C   1 
ATOM   518  O O   . TYR A 1 69  ? -50.101 20.122 2.529   1.00 68.43  ? 2499 TYR A O   1 
ATOM   519  C CB  . TYR A 1 69  ? -49.773 20.102 -0.614  1.00 57.44  ? 2499 TYR A CB  1 
ATOM   520  C CG  . TYR A 1 69  ? -49.709 18.706 -0.102  1.00 58.57  ? 2499 TYR A CG  1 
ATOM   521  C CD1 . TYR A 1 69  ? -50.747 17.829 -0.317  1.00 71.34  ? 2499 TYR A CD1 1 
ATOM   522  C CD2 . TYR A 1 69  ? -48.562 18.224 0.519   1.00 65.24  ? 2499 TYR A CD2 1 
ATOM   523  C CE1 . TYR A 1 69  ? -50.665 16.504 0.116   1.00 72.40  ? 2499 TYR A CE1 1 
ATOM   524  C CE2 . TYR A 1 69  ? -48.456 16.897 0.943   1.00 59.03  ? 2499 TYR A CE2 1 
ATOM   525  C CZ  . TYR A 1 69  ? -49.516 16.055 0.745   1.00 67.47  ? 2499 TYR A CZ  1 
ATOM   526  O OH  . TYR A 1 69  ? -49.432 14.764 1.176   1.00 67.71  ? 2499 TYR A OH  1 
ATOM   527  N N   . TYR A 1 70  ? -48.537 21.644 1.973   1.00 65.39  ? 2500 TYR A N   1 
ATOM   528  C CA  . TYR A 1 70  ? -47.821 21.512 3.235   1.00 61.37  ? 2500 TYR A CA  1 
ATOM   529  C C   . TYR A 1 70  ? -48.169 22.681 4.120   1.00 61.50  ? 2500 TYR A C   1 
ATOM   530  O O   . TYR A 1 70  ? -47.719 23.802 3.890   1.00 58.37  ? 2500 TYR A O   1 
ATOM   531  C CB  . TYR A 1 70  ? -46.320 21.471 3.004   1.00 55.24  ? 2500 TYR A CB  1 
ATOM   532  C CG  . TYR A 1 70  ? -45.881 20.268 2.229   1.00 50.52  ? 2500 TYR A CG  1 
ATOM   533  C CD1 . TYR A 1 70  ? -45.811 19.020 2.824   1.00 50.25  ? 2500 TYR A CD1 1 
ATOM   534  C CD2 . TYR A 1 70  ? -45.537 20.375 0.897   1.00 54.20  ? 2500 TYR A CD2 1 
ATOM   535  C CE1 . TYR A 1 70  ? -45.393 17.911 2.102   1.00 48.35  ? 2500 TYR A CE1 1 
ATOM   536  C CE2 . TYR A 1 70  ? -45.123 19.272 0.160   1.00 51.38  ? 2500 TYR A CE2 1 
ATOM   537  C CZ  . TYR A 1 70  ? -45.047 18.047 0.757   1.00 54.22  ? 2500 TYR A CZ  1 
ATOM   538  O OH  . TYR A 1 70  ? -44.632 16.962 -0.020  1.00 51.98  ? 2500 TYR A OH  1 
ATOM   539  N N   . LYS A 1 71  ? -48.968 22.398 5.140   1.00 62.76  ? 2501 LYS A N   1 
ATOM   540  C CA  . LYS A 1 71  ? -49.605 23.429 5.948   1.00 64.90  ? 2501 LYS A CA  1 
ATOM   541  C C   . LYS A 1 71  ? -48.761 23.641 7.214   1.00 71.45  ? 2501 LYS A C   1 
ATOM   542  O O   . LYS A 1 71  ? -48.807 24.705 7.844   1.00 83.88  ? 2501 LYS A O   1 
ATOM   543  C CB  . LYS A 1 71  ? -51.057 23.018 6.246   1.00 65.42  ? 2501 LYS A CB  1 
ATOM   544  C CG  . LYS A 1 71  ? -51.199 21.578 6.802   1.00 60.15  ? 2501 LYS A CG  1 
ATOM   545  C CD  . LYS A 1 71  ? -51.141 20.476 5.753   1.00 55.49  ? 2501 LYS A CD  1 
ATOM   546  C CE  . LYS A 1 71  ? -50.176 19.277 6.151   1.00 49.17  ? 2501 LYS A CE  1 
ATOM   547  N NZ  . LYS A 1 71  ? -49.766 18.427 4.957   1.00 38.18  ? 2501 LYS A NZ  1 
ATOM   548  N N   . THR A 1 72  ? -47.975 22.619 7.558   1.00 66.61  ? 2502 THR A N   1 
ATOM   549  C CA  . THR A 1 72  ? -46.939 22.710 8.574   1.00 60.46  ? 2502 THR A CA  1 
ATOM   550  C C   . THR A 1 72  ? -45.577 22.243 8.054   1.00 55.20  ? 2502 THR A C   1 
ATOM   551  O O   . THR A 1 72  ? -45.479 21.464 7.083   1.00 51.46  ? 2502 THR A O   1 
ATOM   552  C CB  . THR A 1 72  ? -47.284 21.821 9.752   1.00 61.46  ? 2502 THR A CB  1 
ATOM   553  O OG1 . THR A 1 72  ? -47.125 20.452 9.359   1.00 59.85  ? 2502 THR A OG1 1 
ATOM   554  C CG2 . THR A 1 72  ? -48.719 22.076 10.185  1.00 68.26  ? 2502 THR A CG2 1 
ATOM   555  N N   . VAL A 1 73  ? -44.523 22.671 8.747   1.00 47.84  ? 2503 VAL A N   1 
ATOM   556  C CA  . VAL A 1 73  ? -43.176 22.218 8.412   1.00 46.46  ? 2503 VAL A CA  1 
ATOM   557  C C   . VAL A 1 73  ? -42.946 20.743 8.765   1.00 50.59  ? 2503 VAL A C   1 
ATOM   558  O O   . VAL A 1 73  ? -42.127 20.073 8.156   1.00 47.88  ? 2503 VAL A O   1 
ATOM   559  C CB  . VAL A 1 73  ? -42.149 23.065 9.095   1.00 46.08  ? 2503 VAL A CB  1 
ATOM   560  C CG1 . VAL A 1 73  ? -42.004 22.654 10.573  1.00 46.17  ? 2503 VAL A CG1 1 
ATOM   561  C CG2 . VAL A 1 73  ? -40.859 22.969 8.349   1.00 43.55  ? 2503 VAL A CG2 1 
ATOM   562  N N   . GLU A 1 74  ? -43.683 20.234 9.743   1.00 54.67  ? 2504 GLU A N   1 
ATOM   563  C CA  . GLU A 1 74  ? -43.570 18.816 10.081  1.00 62.23  ? 2504 GLU A CA  1 
ATOM   564  C C   . GLU A 1 74  ? -44.003 17.947 8.906   1.00 55.76  ? 2504 GLU A C   1 
ATOM   565  O O   . GLU A 1 74  ? -43.386 16.926 8.626   1.00 60.66  ? 2504 GLU A O   1 
ATOM   566  C CB  . GLU A 1 74  ? -44.379 18.476 11.331  1.00 66.62  ? 2504 GLU A CB  1 
ATOM   567  C CG  . GLU A 1 74  ? -43.726 18.924 12.645  1.00 67.97  ? 2504 GLU A CG  1 
ATOM   568  C CD  . GLU A 1 74  ? -43.893 20.424 12.947  1.00 76.84  ? 2504 GLU A CD  1 
ATOM   569  O OE1 . GLU A 1 74  ? -42.953 21.034 13.518  1.00 88.82  ? 2504 GLU A OE1 1 
ATOM   570  O OE2 . GLU A 1 74  ? -44.961 20.992 12.640  1.00 62.51  ? 2504 GLU A OE2 1 
ATOM   571  N N   . ALA A 1 75  ? -45.038 18.371 8.198   1.00 55.06  ? 2505 ALA A N   1 
ATOM   572  C CA  . ALA A 1 75  ? -45.554 17.581 7.073   1.00 59.77  ? 2505 ALA A CA  1 
ATOM   573  C C   . ALA A 1 75  ? -44.519 17.555 5.968   1.00 58.18  ? 2505 ALA A C   1 
ATOM   574  O O   . ALA A 1 75  ? -44.304 16.532 5.325   1.00 65.13  ? 2505 ALA A O   1 
ATOM   575  C CB  . ALA A 1 75  ? -46.858 18.166 6.558   1.00 58.31  ? 2505 ALA A CB  1 
ATOM   576  N N   . PHE A 1 76  ? -43.888 18.703 5.767   1.00 64.30  ? 2506 PHE A N   1 
ATOM   577  C CA  . PHE A 1 76  ? -42.787 18.867 4.830   1.00 62.03  ? 2506 PHE A CA  1 
ATOM   578  C C   . PHE A 1 76  ? -41.606 18.004 5.236   1.00 64.49  ? 2506 PHE A C   1 
ATOM   579  O O   . PHE A 1 76  ? -41.157 17.148 4.474   1.00 69.08  ? 2506 PHE A O   1 
ATOM   580  C CB  . PHE A 1 76  ? -42.381 20.349 4.784   1.00 66.03  ? 2506 PHE A CB  1 
ATOM   581  C CG  . PHE A 1 76  ? -41.255 20.651 3.841   1.00 62.84  ? 2506 PHE A CG  1 
ATOM   582  C CD1 . PHE A 1 76  ? -41.338 20.301 2.514   1.00 63.06  ? 2506 PHE A CD1 1 
ATOM   583  C CD2 . PHE A 1 76  ? -40.120 21.303 4.280   1.00 66.44  ? 2506 PHE A CD2 1 
ATOM   584  C CE1 . PHE A 1 76  ? -40.301 20.577 1.636   1.00 58.87  ? 2506 PHE A CE1 1 
ATOM   585  C CE2 . PHE A 1 76  ? -39.076 21.568 3.408   1.00 62.18  ? 2506 PHE A CE2 1 
ATOM   586  C CZ  . PHE A 1 76  ? -39.172 21.205 2.084   1.00 57.79  ? 2506 PHE A CZ  1 
ATOM   587  N N   . ASP A 1 77  ? -41.109 18.218 6.448   1.00 66.36  ? 2507 ASP A N   1 
ATOM   588  C CA  . ASP A 1 77  ? -40.021 17.398 6.974   1.00 51.05  ? 2507 ASP A CA  1 
ATOM   589  C C   . ASP A 1 77  ? -40.307 15.933 6.708   1.00 47.36  ? 2507 ASP A C   1 
ATOM   590  O O   . ASP A 1 77  ? -39.457 15.229 6.201   1.00 44.34  ? 2507 ASP A O   1 
ATOM   591  C CB  . ASP A 1 77  ? -39.864 17.611 8.474   1.00 49.88  ? 2507 ASP A CB  1 
ATOM   592  C CG  . ASP A 1 77  ? -39.017 18.825 8.818   1.00 53.34  ? 2507 ASP A CG  1 
ATOM   593  O OD1 . ASP A 1 77  ? -38.448 19.453 7.919   1.00 52.40  ? 2507 ASP A OD1 1 
ATOM   594  O OD2 . ASP A 1 77  ? -38.914 19.170 10.004  1.00 57.18  ? 2507 ASP A OD2 1 
ATOM   595  N N   . ALA A 1 78  ? -41.517 15.499 7.035   1.00 46.70  ? 2508 ALA A N   1 
ATOM   596  C CA  . ALA A 1 78  ? -41.898 14.093 6.968   1.00 46.61  ? 2508 ALA A CA  1 
ATOM   597  C C   . ALA A 1 78  ? -41.745 13.612 5.548   1.00 47.19  ? 2508 ALA A C   1 
ATOM   598  O O   . ALA A 1 78  ? -41.086 12.608 5.297   1.00 56.35  ? 2508 ALA A O   1 
ATOM   599  C CB  . ALA A 1 78  ? -43.354 13.913 7.498   1.00 44.79  ? 2508 ALA A CB  1 
ATOM   600  N N   . ASP A 1 79  ? -42.285 14.363 4.593   1.00 51.38  ? 2509 ASP A N   1 
ATOM   601  C CA  . ASP A 1 79  ? -42.135 13.988 3.180   1.00 53.71  ? 2509 ASP A CA  1 
ATOM   602  C C   . ASP A 1 79  ? -40.663 14.022 2.704   1.00 55.88  ? 2509 ASP A C   1 
ATOM   603  O O   . ASP A 1 79  ? -40.166 13.061 2.116   1.00 57.48  ? 2509 ASP A O   1 
ATOM   604  C CB  . ASP A 1 79  ? -43.026 14.858 2.289   1.00 53.38  ? 2509 ASP A CB  1 
ATOM   605  C CG  . ASP A 1 79  ? -44.473 14.326 2.156   1.00 47.07  ? 2509 ASP A CG  1 
ATOM   606  O OD1 . ASP A 1 79  ? -44.858 13.305 2.773   1.00 48.85  ? 2509 ASP A OD1 1 
ATOM   607  O OD2 . ASP A 1 79  ? -45.235 14.953 1.394   1.00 48.53  ? 2509 ASP A OD2 1 
ATOM   608  N N   . MET A 1 80  ? -39.951 15.110 2.963   1.00 60.82  ? 2510 MET A N   1 
ATOM   609  C CA  . MET A 1 80  ? -38.553 15.184 2.531   1.00 58.41  ? 2510 MET A CA  1 
ATOM   610  C C   . MET A 1 80  ? -37.747 14.023 3.102   1.00 62.54  ? 2510 MET A C   1 
ATOM   611  O O   . MET A 1 80  ? -37.038 13.357 2.348   1.00 65.26  ? 2510 MET A O   1 
ATOM   612  C CB  . MET A 1 80  ? -37.896 16.499 2.939   1.00 59.11  ? 2510 MET A CB  1 
ATOM   613  C CG  . MET A 1 80  ? -38.394 17.715 2.180   1.00 60.12  ? 2510 MET A CG  1 
ATOM   614  S SD  . MET A 1 80  ? -37.896 17.877 0.452   1.00 58.70  ? 2510 MET A SD  1 
ATOM   615  C CE  . MET A 1 80  ? -36.106 18.092 0.637   1.00 41.12  ? 2510 MET A CE  1 
ATOM   616  N N   . LEU A 1 81  ? -37.868 13.754 4.413   1.00 57.04  ? 2511 LEU A N   1 
ATOM   617  C CA  . LEU A 1 81  ? -37.096 12.655 5.033   1.00 52.66  ? 2511 LEU A CA  1 
ATOM   618  C C   . LEU A 1 81  ? -37.493 11.249 4.596   1.00 55.94  ? 2511 LEU A C   1 
ATOM   619  O O   . LEU A 1 81  ? -36.681 10.321 4.706   1.00 64.76  ? 2511 LEU A O   1 
ATOM   620  C CB  . LEU A 1 81  ? -37.138 12.735 6.556   1.00 56.14  ? 2511 LEU A CB  1 
ATOM   621  C CG  . LEU A 1 81  ? -36.480 13.978 7.160   1.00 56.60  ? 2511 LEU A CG  1 
ATOM   622  C CD1 . LEU A 1 81  ? -36.360 13.895 8.680   1.00 47.85  ? 2511 LEU A CD1 1 
ATOM   623  C CD2 . LEU A 1 81  ? -35.139 14.193 6.539   1.00 52.31  ? 2511 LEU A CD2 1 
ATOM   624  N N   . LYS A 1 82  ? -38.735 11.084 4.149   1.00 55.13  ? 2512 LYS A N   1 
ATOM   625  C CA  . LYS A 1 82  ? -39.237 9.798  3.623   1.00 56.76  ? 2512 LYS A CA  1 
ATOM   626  C C   . LYS A 1 82  ? -38.594 9.455  2.273   1.00 59.68  ? 2512 LYS A C   1 
ATOM   627  O O   . LYS A 1 82  ? -38.307 8.290  1.962   1.00 60.47  ? 2512 LYS A O   1 
ATOM   628  C CB  . LYS A 1 82  ? -40.763 9.883  3.479   1.00 58.53  ? 2512 LYS A CB  1 
ATOM   629  C CG  . LYS A 1 82  ? -41.438 8.655  2.879   1.00 59.87  ? 2512 LYS A CG  1 
ATOM   630  C CD  . LYS A 1 82  ? -42.976 8.683  3.112   1.00 65.60  ? 2512 LYS A CD  1 
ATOM   631  C CE  . LYS A 1 82  ? -43.702 9.619  2.143   1.00 69.00  ? 2512 LYS A CE  1 
ATOM   632  N NZ  . LYS A 1 82  ? -44.945 10.167 2.749   1.00 74.11  ? 2512 LYS A NZ  1 
ATOM   633  N N   . VAL A 1 83  ? -38.405 10.481 1.457   1.00 60.19  ? 2513 VAL A N   1 
ATOM   634  C CA  . VAL A 1 83  ? -37.686 10.360 0.182   1.00 54.19  ? 2513 VAL A CA  1 
ATOM   635  C C   . VAL A 1 83  ? -36.231 9.960  0.418   1.00 58.04  ? 2513 VAL A C   1 
ATOM   636  O O   . VAL A 1 83  ? -35.685 9.159  -0.355  1.00 68.85  ? 2513 VAL A O   1 
ATOM   637  C CB  . VAL A 1 83  ? -37.700 11.702 -0.615  1.00 57.25  ? 2513 VAL A CB  1 
ATOM   638  C CG1 . VAL A 1 83  ? -36.791 11.614 -1.831  1.00 59.38  ? 2513 VAL A CG1 1 
ATOM   639  C CG2 . VAL A 1 83  ? -39.133 12.096 -1.013  1.00 52.18  ? 2513 VAL A CG2 1 
ATOM   640  N N   . PHE A 1 84  ? -35.598 10.490 1.465   1.00 50.99  ? 2514 PHE A N   1 
ATOM   641  C CA  . PHE A 1 84  ? -34.222 10.048 1.802   1.00 59.44  ? 2514 PHE A CA  1 
ATOM   642  C C   . PHE A 1 84  ? -34.193 8.613  2.362   1.00 59.60  ? 2514 PHE A C   1 
ATOM   643  O O   . PHE A 1 84  ? -33.317 7.811  1.988   1.00 66.38  ? 2514 PHE A O   1 
ATOM   644  C CB  . PHE A 1 84  ? -33.536 10.947 2.844   1.00 63.61  ? 2514 PHE A CB  1 
ATOM   645  C CG  . PHE A 1 84  ? -33.352 12.390 2.432   1.00 63.43  ? 2514 PHE A CG  1 
ATOM   646  C CD1 . PHE A 1 84  ? -33.051 12.750 1.122   1.00 67.01  ? 2514 PHE A CD1 1 
ATOM   647  C CD2 . PHE A 1 84  ? -33.406 13.399 3.401   1.00 66.92  ? 2514 PHE A CD2 1 
ATOM   648  C CE1 . PHE A 1 84  ? -32.867 14.106 0.769   1.00 67.24  ? 2514 PHE A CE1 1 
ATOM   649  C CE2 . PHE A 1 84  ? -33.204 14.745 3.058   1.00 71.84  ? 2514 PHE A CE2 1 
ATOM   650  C CZ  . PHE A 1 84  ? -32.941 15.099 1.744   1.00 63.14  ? 2514 PHE A CZ  1 
ATOM   651  N N   . ARG A 1 85  ? -35.119 8.313  3.275   1.00 52.98  ? 2515 ARG A N   1 
ATOM   652  C CA  . ARG A 1 85  ? -35.176 6.994  3.928   1.00 56.89  ? 2515 ARG A CA  1 
ATOM   653  C C   . ARG A 1 85  ? -35.446 5.921  2.893   1.00 58.81  ? 2515 ARG A C   1 
ATOM   654  O O   . ARG A 1 85  ? -34.687 4.964  2.793   1.00 61.98  ? 2515 ARG A O   1 
ATOM   655  C CB  . ARG A 1 85  ? -36.238 6.933  5.032   1.00 50.23  ? 2515 ARG A CB  1 
ATOM   656  N N   . ASN A 1 86  ? -36.495 6.104  2.091   1.00 62.51  ? 2516 ASN A N   1 
ATOM   657  C CA  . ASN A 1 86  ? -36.775 5.184  0.980   1.00 67.53  ? 2516 ASN A CA  1 
ATOM   658  C C   . ASN A 1 86  ? -35.550 4.932  0.100   1.00 72.76  ? 2516 ASN A C   1 
ATOM   659  O O   . ASN A 1 86  ? -35.375 3.826  -0.417  1.00 85.48  ? 2516 ASN A O   1 
ATOM   660  C CB  . ASN A 1 86  ? -37.921 5.703  0.095   1.00 71.07  ? 2516 ASN A CB  1 
ATOM   661  C CG  . ASN A 1 86  ? -39.283 5.597  0.771   1.00 71.27  ? 2516 ASN A CG  1 
ATOM   662  O OD1 . ASN A 1 86  ? -39.396 5.013  1.830   1.00 71.46  ? 2516 ASN A OD1 1 
ATOM   663  N ND2 . ASN A 1 86  ? -40.318 6.154  0.150   1.00 66.31  ? 2516 ASN A ND2 1 
ATOM   664  N N   . ALA A 1 87  ? -34.698 5.943  -0.071  1.00 73.84  ? 2517 ALA A N   1 
ATOM   665  C CA  . ALA A 1 87  ? -33.537 5.795  -0.953  1.00 80.34  ? 2517 ALA A CA  1 
ATOM   666  C C   . ALA A 1 87  ? -32.504 4.880  -0.295  1.00 77.69  ? 2517 ALA A C   1 
ATOM   667  O O   . ALA A 1 87  ? -31.991 3.954  -0.927  1.00 87.95  ? 2517 ALA A O   1 
ATOM   668  C CB  . ALA A 1 87  ? -32.935 7.157  -1.313  1.00 77.65  ? 2517 ALA A CB  1 
ATOM   669  N N   . GLU A 1 88  ? -32.243 5.115  0.984   1.00 72.40  ? 2518 GLU A N   1 
ATOM   670  C CA  . GLU A 1 88  ? -31.348 4.255  1.772   1.00 72.38  ? 2518 GLU A CA  1 
ATOM   671  C C   . GLU A 1 88  ? -31.877 2.831  1.971   1.00 66.65  ? 2518 GLU A C   1 
ATOM   672  O O   . GLU A 1 88  ? -31.092 1.871  1.974   1.00 60.59  ? 2518 GLU A O   1 
ATOM   673  C CB  . GLU A 1 88  ? -31.086 4.886  3.133   1.00 73.12  ? 2518 GLU A CB  1 
ATOM   674  C CG  . GLU A 1 88  ? -30.335 6.182  3.004   1.00 74.75  ? 2518 GLU A CG  1 
ATOM   675  C CD  . GLU A 1 88  ? -30.183 6.878  4.296   1.00 69.29  ? 2518 GLU A CD  1 
ATOM   676  O OE1 . GLU A 1 88  ? -31.174 6.918  5.072   1.00 53.72  ? 2518 GLU A OE1 1 
ATOM   677  O OE2 . GLU A 1 88  ? -29.084 7.429  4.513   1.00 85.59  ? 2518 GLU A OE2 1 
ATOM   678  N N   . LYS A 1 89  ? -33.194 2.696  2.122   1.00 58.23  ? 2519 LYS A N   1 
ATOM   679  C CA  . LYS A 1 89  ? -33.799 1.386  2.267   1.00 66.38  ? 2519 LYS A CA  1 
ATOM   680  C C   . LYS A 1 89  ? -33.596 0.607  0.980   1.00 70.21  ? 2519 LYS A C   1 
ATOM   681  O O   . LYS A 1 89  ? -33.289 -0.566 1.038   1.00 72.29  ? 2519 LYS A O   1 
ATOM   682  C CB  . LYS A 1 89  ? -35.290 1.485  2.618   1.00 74.72  ? 2519 LYS A CB  1 
ATOM   683  N N   . TYR A 1 90  ? -33.725 1.264  -0.177  1.00 76.98  ? 2520 TYR A N   1 
ATOM   684  C CA  . TYR A 1 90  ? -33.606 0.574  -1.472  1.00 78.96  ? 2520 TYR A CA  1 
ATOM   685  C C   . TYR A 1 90  ? -32.188 0.382  -2.014  1.00 79.13  ? 2520 TYR A C   1 
ATOM   686  O O   . TYR A 1 90  ? -31.887 -0.662 -2.573  1.00 91.27  ? 2520 TYR A O   1 
ATOM   687  C CB  . TYR A 1 90  ? -34.426 1.275  -2.543  1.00 83.45  ? 2520 TYR A CB  1 
ATOM   688  C CG  . TYR A 1 90  ? -34.488 0.499  -3.843  1.00 88.74  ? 2520 TYR A CG  1 
ATOM   689  C CD1 . TYR A 1 90  ? -35.359 -0.574 -3.995  1.00 93.16  ? 2520 TYR A CD1 1 
ATOM   690  C CD2 . TYR A 1 90  ? -33.668 0.832  -4.917  1.00 94.76  ? 2520 TYR A CD2 1 
ATOM   691  C CE1 . TYR A 1 90  ? -35.423 -1.287 -5.191  1.00 95.33  ? 2520 TYR A CE1 1 
ATOM   692  C CE2 . TYR A 1 90  ? -33.725 0.126  -6.114  1.00 96.92  ? 2520 TYR A CE2 1 
ATOM   693  C CZ  . TYR A 1 90  ? -34.604 -0.932 -6.243  1.00 97.87  ? 2520 TYR A CZ  1 
ATOM   694  O OH  . TYR A 1 90  ? -34.667 -1.636 -7.424  1.00 99.45  ? 2520 TYR A OH  1 
ATOM   695  N N   . TYR A 1 91  ? -31.335 1.390  -1.895  1.00 78.02  ? 2521 TYR A N   1 
ATOM   696  C CA  . TYR A 1 91  ? -29.969 1.292  -2.419  1.00 79.81  ? 2521 TYR A CA  1 
ATOM   697  C C   . TYR A 1 91  ? -28.962 0.874  -1.376  1.00 81.06  ? 2521 TYR A C   1 
ATOM   698  O O   . TYR A 1 91  ? -27.934 0.322  -1.728  1.00 95.02  ? 2521 TYR A O   1 
ATOM   699  C CB  . TYR A 1 91  ? -29.522 2.622  -3.016  1.00 86.91  ? 2521 TYR A CB  1 
ATOM   700  C CG  . TYR A 1 91  ? -30.364 3.028  -4.191  1.00 90.10  ? 2521 TYR A CG  1 
ATOM   701  C CD1 . TYR A 1 91  ? -30.114 2.502  -5.445  1.00 89.82  ? 2521 TYR A CD1 1 
ATOM   702  C CD2 . TYR A 1 91  ? -31.433 3.914  -4.043  1.00 81.43  ? 2521 TYR A CD2 1 
ATOM   703  C CE1 . TYR A 1 91  ? -30.895 2.849  -6.524  1.00 91.76  ? 2521 TYR A CE1 1 
ATOM   704  C CE2 . TYR A 1 91  ? -32.217 4.264  -5.118  1.00 78.76  ? 2521 TYR A CE2 1 
ATOM   705  C CZ  . TYR A 1 91  ? -31.940 3.728  -6.353  1.00 79.98  ? 2521 TYR A CZ  1 
ATOM   706  O OH  . TYR A 1 91  ? -32.708 4.049  -7.432  1.00 74.86  ? 2521 TYR A OH  1 
ATOM   707  N N   . GLY A 1 92  ? -29.232 1.168  -0.105  1.00 75.29  ? 2522 GLY A N   1 
ATOM   708  C CA  . GLY A 1 92  ? -28.324 0.808  0.978   1.00 75.60  ? 2522 GLY A CA  1 
ATOM   709  C C   . GLY A 1 92  ? -27.484 1.992  1.385   1.00 73.75  ? 2522 GLY A C   1 
ATOM   710  O O   . GLY A 1 92  ? -26.863 2.620  0.536   1.00 73.65  ? 2522 GLY A O   1 
ATOM   711  N N   . ARG A 1 93  ? -27.446 2.279  2.689   1.00 74.62  ? 2523 ARG A N   1 
ATOM   712  C CA  . ARG A 1 93  ? -26.685 3.419  3.217   1.00 69.15  ? 2523 ARG A CA  1 
ATOM   713  C C   . ARG A 1 93  ? -25.276 3.507  2.626   1.00 65.85  ? 2523 ARG A C   1 
ATOM   714  O O   . ARG A 1 93  ? -24.695 4.581  2.545   1.00 60.59  ? 2523 ARG A O   1 
ATOM   715  C CB  . ARG A 1 93  ? -26.576 3.346  4.753   1.00 64.35  ? 2523 ARG A CB  1 
ATOM   716  C CG  . ARG A 1 93  ? -27.874 3.478  5.509   1.00 54.90  ? 2523 ARG A CG  1 
ATOM   717  C CD  . ARG A 1 93  ? -27.619 3.941  6.909   1.00 51.11  ? 2523 ARG A CD  1 
ATOM   718  N N   . LYS A 1 94  ? -24.741 2.362  2.207   1.00 78.94  ? 2524 LYS A N   1 
ATOM   719  C CA  . LYS A 1 94  ? -23.327 2.217  1.810   1.00 77.50  ? 2524 LYS A CA  1 
ATOM   720  C C   . LYS A 1 94  ? -23.099 2.366  0.293   1.00 89.83  ? 2524 LYS A C   1 
ATOM   721  O O   . LYS A 1 94  ? -21.968 2.587  -0.148  1.00 106.77 ? 2524 LYS A O   1 
ATOM   722  C CB  . LYS A 1 94  ? -22.801 0.859  2.301   1.00 70.66  ? 2524 LYS A CB  1 
ATOM   723  C CG  . LYS A 1 94  ? -23.679 -0.343 1.896   1.00 62.22  ? 2524 LYS A CG  1 
ATOM   724  C CD  . LYS A 1 94  ? -24.747 -0.705 2.930   1.00 60.27  ? 2524 LYS A CD  1 
ATOM   725  C CE  . LYS A 1 94  ? -25.947 -1.355 2.254   1.00 59.83  ? 2524 LYS A CE  1 
ATOM   726  N NZ  . LYS A 1 94  ? -27.187 -1.278 3.054   1.00 52.15  ? 2524 LYS A NZ  1 
ATOM   727  N N   . SER A 1 95  ? -24.174 2.240  -0.491  1.00 93.94  ? 2525 SER A N   1 
ATOM   728  C CA  . SER A 1 95  ? -24.132 2.410  -1.956  1.00 93.30  ? 2525 SER A CA  1 
ATOM   729  C C   . SER A 1 95  ? -23.802 3.860  -2.332  1.00 95.56  ? 2525 SER A C   1 
ATOM   730  O O   . SER A 1 95  ? -23.892 4.743  -1.481  1.00 95.11  ? 2525 SER A O   1 
ATOM   731  C CB  . SER A 1 95  ? -25.487 2.009  -2.551  1.00 88.57  ? 2525 SER A CB  1 
ATOM   732  O OG  . SER A 1 95  ? -26.542 2.724  -1.927  1.00 78.49  ? 2525 SER A OG  1 
ATOM   733  N N   . PRO A 1 96  ? -23.434 4.117  -3.605  1.00 95.99  ? 2526 PRO A N   1 
ATOM   734  C CA  . PRO A 1 96  ? -23.089 5.498  -3.967  1.00 93.61  ? 2526 PRO A CA  1 
ATOM   735  C C   . PRO A 1 96  ? -24.284 6.461  -3.844  1.00 81.99  ? 2526 PRO A C   1 
ATOM   736  O O   . PRO A 1 96  ? -24.094 7.651  -3.597  1.00 70.10  ? 2526 PRO A O   1 
ATOM   737  C CB  . PRO A 1 96  ? -22.646 5.372  -5.427  1.00 103.52 ? 2526 PRO A CB  1 
ATOM   738  C CG  . PRO A 1 96  ? -23.415 4.199  -5.941  1.00 102.52 ? 2526 PRO A CG  1 
ATOM   739  C CD  . PRO A 1 96  ? -23.478 3.241  -4.793  1.00 101.33 ? 2526 PRO A CD  1 
ATOM   740  N N   . VAL A 1 97  ? -25.499 5.934  -3.999  1.00 62.25  ? 2527 VAL A N   1 
ATOM   741  C CA  . VAL A 1 97  ? -26.721 6.716  -3.810  1.00 56.76  ? 2527 VAL A CA  1 
ATOM   742  C C   . VAL A 1 97  ? -27.025 7.027  -2.338  1.00 62.91  ? 2527 VAL A C   1 
ATOM   743  O O   . VAL A 1 97  ? -27.693 8.016  -2.039  1.00 72.88  ? 2527 VAL A O   1 
ATOM   744  C CB  . VAL A 1 97  ? -27.906 6.006  -4.474  1.00 61.10  ? 2527 VAL A CB  1 
ATOM   745  C CG1 . VAL A 1 97  ? -29.227 6.530  -3.948  1.00 58.16  ? 2527 VAL A CG1 1 
ATOM   746  C CG2 . VAL A 1 97  ? -27.816 6.175  -6.022  1.00 59.57  ? 2527 VAL A CG2 1 
ATOM   747  N N   . GLY A 1 98  ? -26.528 6.195  -1.425  1.00 58.94  ? 2528 GLY A N   1 
ATOM   748  C CA  . GLY A 1 98  ? -26.696 6.406  0.004   1.00 59.23  ? 2528 GLY A CA  1 
ATOM   749  C C   . GLY A 1 98  ? -25.647 7.354  0.545   1.00 64.86  ? 2528 GLY A C   1 
ATOM   750  O O   . GLY A 1 98  ? -25.935 8.175  1.402   1.00 67.88  ? 2528 GLY A O   1 
ATOM   751  N N   . ARG A 1 99  ? -24.422 7.226  0.049   1.00 65.06  ? 2529 ARG A N   1 
ATOM   752  C CA  . ARG A 1 99  ? -23.375 8.198  0.325   1.00 65.23  ? 2529 ARG A CA  1 
ATOM   753  C C   . ARG A 1 99  ? -23.899 9.579  -0.029  1.00 65.07  ? 2529 ARG A C   1 
ATOM   754  O O   . ARG A 1 99  ? -23.628 10.533 0.683   1.00 73.43  ? 2529 ARG A O   1 
ATOM   755  C CB  . ARG A 1 99  ? -22.098 7.883  -0.484  1.00 73.68  ? 2529 ARG A CB  1 
ATOM   756  N N   . ASP A 1 100 ? -24.658 9.672  -1.128  1.00 71.00  ? 2530 ASP A N   1 
ATOM   757  C CA  . ASP A 1 100 ? -25.205 10.951 -1.613  1.00 63.19  ? 2530 ASP A CA  1 
ATOM   758  C C   . ASP A 1 100 ? -26.322 11.422 -0.697  1.00 65.87  ? 2530 ASP A C   1 
ATOM   759  O O   . ASP A 1 100 ? -26.265 12.532 -0.147  1.00 59.55  ? 2530 ASP A O   1 
ATOM   760  C CB  . ASP A 1 100 ? -25.791 10.808 -3.026  1.00 62.32  ? 2530 ASP A CB  1 
ATOM   761  C CG  . ASP A 1 100 ? -24.740 10.690 -4.110  1.00 63.83  ? 2530 ASP A CG  1 
ATOM   762  O OD1 . ASP A 1 100 ? -23.526 10.808 -3.822  1.00 68.00  ? 2530 ASP A OD1 1 
ATOM   763  O OD2 . ASP A 1 100 ? -25.160 10.483 -5.270  1.00 57.37  ? 2530 ASP A OD2 1 
ATOM   764  N N   . VAL A 1 101 ? -27.351 10.580 -0.559  1.00 61.47  ? 2531 VAL A N   1 
ATOM   765  C CA  . VAL A 1 101 ? -28.497 10.899 0.290   1.00 60.09  ? 2531 VAL A CA  1 
ATOM   766  C C   . VAL A 1 101 ? -28.034 11.279 1.668   1.00 61.62  ? 2531 VAL A C   1 
ATOM   767  O O   . VAL A 1 101 ? -28.535 12.229 2.250   1.00 72.22  ? 2531 VAL A O   1 
ATOM   768  C CB  . VAL A 1 101 ? -29.446 9.711  0.476   1.00 64.41  ? 2531 VAL A CB  1 
ATOM   769  C CG1 . VAL A 1 101 ? -30.334 9.930  1.695   1.00 62.66  ? 2531 VAL A CG1 1 
ATOM   770  C CG2 . VAL A 1 101 ? -30.279 9.512  -0.748  1.00 60.62  ? 2531 VAL A CG2 1 
ATOM   771  N N   . CYS A 1 102 ? -27.078 10.535 2.201   1.00 65.03  ? 2532 CYS A N   1 
ATOM   772  C CA  . CYS A 1 102 ? -26.496 10.893 3.483   1.00 65.44  ? 2532 CYS A CA  1 
ATOM   773  C C   . CYS A 1 102 ? -26.074 12.355 3.484   1.00 70.75  ? 2532 CYS A C   1 
ATOM   774  O O   . CYS A 1 102 ? -26.452 13.107 4.385   1.00 89.89  ? 2532 CYS A O   1 
ATOM   775  C CB  . CYS A 1 102 ? -25.295 10.014 3.799   1.00 70.50  ? 2532 CYS A CB  1 
ATOM   776  S SG  . CYS A 1 102 ? -24.229 10.712 5.059   1.00 86.64  ? 2532 CYS A SG  1 
ATOM   777  N N   . ARG A 1 103 ? -25.300 12.755 2.476   1.00 73.96  ? 2533 ARG A N   1 
ATOM   778  C CA  . ARG A 1 103 ? -24.738 14.112 2.404   1.00 73.07  ? 2533 ARG A CA  1 
ATOM   779  C C   . ARG A 1 103 ? -25.842 15.142 2.192   1.00 68.76  ? 2533 ARG A C   1 
ATOM   780  O O   . ARG A 1 103 ? -25.807 16.250 2.752   1.00 60.02  ? 2533 ARG A O   1 
ATOM   781  C CB  . ARG A 1 103 ? -23.685 14.208 1.290   1.00 72.90  ? 2533 ARG A CB  1 
ATOM   782  C CG  . ARG A 1 103 ? -22.878 15.493 1.332   1.00 79.30  ? 2533 ARG A CG  1 
ATOM   783  C CD  . ARG A 1 103 ? -21.508 15.330 0.668   1.00 85.68  ? 2533 ARG A CD  1 
ATOM   784  N N   . LEU A 1 104 ? -26.847 14.759 1.415   1.00 58.55  ? 2534 LEU A N   1 
ATOM   785  C CA  . LEU A 1 104 ? -27.970 15.648 1.175   1.00 52.95  ? 2534 LEU A CA  1 
ATOM   786  C C   . LEU A 1 104 ? -28.737 15.957 2.452   1.00 53.15  ? 2534 LEU A C   1 
ATOM   787  O O   . LEU A 1 104 ? -29.214 17.093 2.615   1.00 50.71  ? 2534 LEU A O   1 
ATOM   788  C CB  . LEU A 1 104 ? -28.919 15.063 0.126   1.00 49.32  ? 2534 LEU A CB  1 
ATOM   789  C CG  . LEU A 1 104 ? -28.403 15.090 -1.300  1.00 42.72  ? 2534 LEU A CG  1 
ATOM   790  C CD1 . LEU A 1 104 ? -29.407 14.368 -2.264  1.00 39.68  ? 2534 LEU A CD1 1 
ATOM   791  C CD2 . LEU A 1 104 ? -28.138 16.527 -1.692  1.00 34.23  ? 2534 LEU A CD2 1 
ATOM   792  N N   . ARG A 1 105 ? -28.864 14.974 3.352   1.00 59.97  ? 2535 ARG A N   1 
ATOM   793  C CA  . ARG A 1 105 ? -29.518 15.202 4.662   1.00 56.43  ? 2535 ARG A CA  1 
ATOM   794  C C   . ARG A 1 105 ? -28.855 16.355 5.422   1.00 66.15  ? 2535 ARG A C   1 
ATOM   795  O O   . ARG A 1 105 ? -29.546 17.238 5.922   1.00 75.11  ? 2535 ARG A O   1 
ATOM   796  C CB  . ARG A 1 105 ? -29.436 13.988 5.574   1.00 66.11  ? 2535 ARG A CB  1 
ATOM   797  C CG  . ARG A 1 105 ? -29.893 12.630 5.055   1.00 74.77  ? 2535 ARG A CG  1 
ATOM   798  C CD  . ARG A 1 105 ? -29.961 11.620 6.233   1.00 70.30  ? 2535 ARG A CD  1 
ATOM   799  N NE  . ARG A 1 105 ? -31.361 11.354 6.550   1.00 68.93  ? 2535 ARG A NE  1 
ATOM   800  C CZ  . ARG A 1 105 ? -31.996 10.222 6.267   1.00 69.15  ? 2535 ARG A CZ  1 
ATOM   801  N NH1 . ARG A 1 105 ? -31.351 9.208  5.704   1.00 73.75  ? 2535 ARG A NH1 1 
ATOM   802  N NH2 . ARG A 1 105 ? -33.284 10.090 6.558   1.00 69.66  ? 2535 ARG A NH2 1 
ATOM   803  N N   . LYS A 1 106 ? -27.520 16.309 5.548   1.00 70.34  ? 2536 LYS A N   1 
ATOM   804  C CA  . LYS A 1 106 ? -26.746 17.387 6.202   1.00 69.51  ? 2536 LYS A CA  1 
ATOM   805  C C   . LYS A 1 106 ? -27.154 18.722 5.574   1.00 60.89  ? 2536 LYS A C   1 
ATOM   806  O O   . LYS A 1 106 ? -27.430 19.695 6.277   1.00 73.04  ? 2536 LYS A O   1 
ATOM   807  C CB  . LYS A 1 106 ? -25.208 17.192 6.059   1.00 65.53  ? 2536 LYS A CB  1 
ATOM   808  C CG  . LYS A 1 106 ? -24.490 16.475 7.209   1.00 71.92  ? 2536 LYS A CG  1 
ATOM   809  C CD  . LYS A 1 106 ? -22.949 16.659 7.141   1.00 75.77  ? 2536 LYS A CD  1 
ATOM   810  N N   . ALA A 1 107 ? -27.206 18.755 4.247   1.00 54.61  ? 2537 ALA A N   1 
ATOM   811  C CA  . ALA A 1 107 ? -27.588 19.986 3.534   1.00 52.22  ? 2537 ALA A CA  1 
ATOM   812  C C   . ALA A 1 107 ? -28.984 20.398 3.980   1.00 46.33  ? 2537 ALA A C   1 
ATOM   813  O O   . ALA A 1 107 ? -29.226 21.563 4.334   1.00 46.47  ? 2537 ALA A O   1 
ATOM   814  C CB  . ALA A 1 107 ? -27.546 19.771 2.046   1.00 45.98  ? 2537 ALA A CB  1 
ATOM   815  N N   . TYR A 1 108 ? -29.869 19.405 4.016   1.00 48.33  ? 2538 TYR A N   1 
ATOM   816  C CA  . TYR A 1 108 ? -31.245 19.594 4.464   1.00 48.16  ? 2538 TYR A CA  1 
ATOM   817  C C   . TYR A 1 108 ? -31.327 20.086 5.873   1.00 49.40  ? 2538 TYR A C   1 
ATOM   818  O O   . TYR A 1 108 ? -32.066 21.029 6.114   1.00 71.83  ? 2538 TYR A O   1 
ATOM   819  C CB  . TYR A 1 108 ? -32.112 18.336 4.287   1.00 52.93  ? 2538 TYR A CB  1 
ATOM   820  C CG  . TYR A 1 108 ? -33.579 18.631 4.533   1.00 54.53  ? 2538 TYR A CG  1 
ATOM   821  C CD1 . TYR A 1 108 ? -34.279 19.493 3.706   1.00 53.95  ? 2538 TYR A CD1 1 
ATOM   822  C CD2 . TYR A 1 108 ? -34.237 18.108 5.634   1.00 58.81  ? 2538 TYR A CD2 1 
ATOM   823  C CE1 . TYR A 1 108 ? -35.592 19.809 3.946   1.00 58.90  ? 2538 TYR A CE1 1 
ATOM   824  C CE2 . TYR A 1 108 ? -35.560 18.408 5.887   1.00 63.27  ? 2538 TYR A CE2 1 
ATOM   825  C CZ  . TYR A 1 108 ? -36.233 19.260 5.041   1.00 63.80  ? 2538 TYR A CZ  1 
ATOM   826  O OH  . TYR A 1 108 ? -37.547 19.563 5.286   1.00 70.00  ? 2538 TYR A OH  1 
ATOM   827  N N   . TYR A 1 109 ? -30.550 19.540 6.812   1.00 54.73  ? 2539 TYR A N   1 
ATOM   828  C CA  . TYR A 1 109 ? -30.665 20.048 8.186   1.00 52.77  ? 2539 TYR A CA  1 
ATOM   829  C C   . TYR A 1 109 ? -30.132 21.473 8.338   1.00 62.49  ? 2539 TYR A C   1 
ATOM   830  O O   . TYR A 1 109 ? -30.607 22.212 9.213   1.00 62.83  ? 2539 TYR A O   1 
ATOM   831  C CB  . TYR A 1 109 ? -30.029 19.148 9.241   1.00 51.70  ? 2539 TYR A CB  1 
ATOM   832  C CG  . TYR A 1 109 ? -30.422 17.695 9.186   1.00 53.99  ? 2539 TYR A CG  1 
ATOM   833  C CD1 . TYR A 1 109 ? -31.726 17.305 8.969   1.00 56.77  ? 2539 TYR A CD1 1 
ATOM   834  C CD2 . TYR A 1 109 ? -29.470 16.710 9.379   1.00 51.90  ? 2539 TYR A CD2 1 
ATOM   835  C CE1 . TYR A 1 109 ? -32.067 15.946 8.923   1.00 67.38  ? 2539 TYR A CE1 1 
ATOM   836  C CE2 . TYR A 1 109 ? -29.784 15.382 9.320   1.00 63.49  ? 2539 TYR A CE2 1 
ATOM   837  C CZ  . TYR A 1 109 ? -31.084 14.988 9.110   1.00 70.92  ? 2539 TYR A CZ  1 
ATOM   838  O OH  . TYR A 1 109 ? -31.374 13.633 9.075   1.00 77.06  ? 2539 TYR A OH  1 
ATOM   839  N N   . ASN A 1 110 ? -29.161 21.874 7.517   1.00 59.77  ? 2540 ASN A N   1 
ATOM   840  C CA  . ASN A 1 110 ? -28.652 23.253 7.607   1.00 60.71  ? 2540 ASN A CA  1 
ATOM   841  C C   . ASN A 1 110 ? -29.663 24.242 7.094   1.00 58.84  ? 2540 ASN A C   1 
ATOM   842  O O   . ASN A 1 110 ? -29.968 25.219 7.764   1.00 60.48  ? 2540 ASN A O   1 
ATOM   843  C CB  . ASN A 1 110 ? -27.361 23.426 6.829   1.00 62.43  ? 2540 ASN A CB  1 
ATOM   844  C CG  . ASN A 1 110 ? -26.265 22.534 7.345   1.00 67.66  ? 2540 ASN A CG  1 
ATOM   845  O OD1 . ASN A 1 110 ? -26.110 22.341 8.559   1.00 76.76  ? 2540 ASN A OD1 1 
ATOM   846  N ND2 . ASN A 1 110 ? -25.515 21.948 6.428   1.00 60.24  ? 2540 ASN A ND2 1 
ATOM   847  N N   . ALA A 1 111 ? -30.196 23.981 5.910   1.00 55.40  ? 2541 ALA A N   1 
ATOM   848  C CA  . ALA A 1 111 ? -31.199 24.872 5.344   1.00 60.61  ? 2541 ALA A CA  1 
ATOM   849  C C   . ALA A 1 111 ? -32.427 24.918 6.238   1.00 55.79  ? 2541 ALA A C   1 
ATOM   850  O O   . ALA A 1 111 ? -33.038 25.969 6.397   1.00 69.49  ? 2541 ALA A O   1 
ATOM   851  C CB  . ALA A 1 111 ? -31.572 24.450 3.923   1.00 58.34  ? 2541 ALA A CB  1 
ATOM   852  N N   . ARG A 1 112 ? -32.779 23.790 6.840   1.00 52.05  ? 2542 ARG A N   1 
ATOM   853  C CA  . ARG A 1 112 ? -33.870 23.766 7.820   1.00 49.00  ? 2542 ARG A CA  1 
ATOM   854  C C   . ARG A 1 112 ? -33.533 24.486 9.109   1.00 48.36  ? 2542 ARG A C   1 
ATOM   855  O O   . ARG A 1 112 ? -34.385 25.192 9.660   1.00 53.55  ? 2542 ARG A O   1 
ATOM   856  C CB  . ARG A 1 112 ? -34.307 22.333 8.151   1.00 44.23  ? 2542 ARG A CB  1 
ATOM   857  C CG  . ARG A 1 112 ? -35.371 21.810 7.209   1.00 48.43  ? 2542 ARG A CG  1 
ATOM   858  C CD  . ARG A 1 112 ? -36.751 22.477 7.399   1.00 51.82  ? 2542 ARG A CD  1 
ATOM   859  N NE  . ARG A 1 112 ? -37.479 21.950 8.561   1.00 56.80  ? 2542 ARG A NE  1 
ATOM   860  C CZ  . ARG A 1 112 ? -37.579 22.532 9.759   1.00 55.52  ? 2542 ARG A CZ  1 
ATOM   861  N NH1 . ARG A 1 112 ? -37.002 23.698 10.015  1.00 49.19  ? 2542 ARG A NH1 1 
ATOM   862  N NH2 . ARG A 1 112 ? -38.277 21.931 10.720  1.00 51.88  ? 2542 ARG A NH2 1 
ATOM   863  N N   . HIS A 1 113 ? -32.302 24.356 9.594   1.00 47.31  ? 2543 HIS A N   1 
ATOM   864  C CA  . HIS A 1 113 ? -31.919 25.131 10.774  1.00 54.30  ? 2543 HIS A CA  1 
ATOM   865  C C   . HIS A 1 113 ? -31.991 26.618 10.465  1.00 52.32  ? 2543 HIS A C   1 
ATOM   866  O O   . HIS A 1 113 ? -32.535 27.382 11.246  1.00 73.77  ? 2543 HIS A O   1 
ATOM   867  C CB  . HIS A 1 113 ? -30.541 24.732 11.257  1.00 60.29  ? 2543 HIS A CB  1 
ATOM   868  C CG  . HIS A 1 113 ? -30.201 25.209 12.635  1.00 61.93  ? 2543 HIS A CG  1 
ATOM   869  N ND1 . HIS A 1 113 ? -30.036 26.539 12.947  1.00 80.34  ? 2543 HIS A ND1 1 
ATOM   870  C CD2 . HIS A 1 113 ? -29.939 24.527 13.769  1.00 64.01  ? 2543 HIS A CD2 1 
ATOM   871  C CE1 . HIS A 1 113 ? -29.720 26.655 14.225  1.00 66.56  ? 2543 HIS A CE1 1 
ATOM   872  N NE2 . HIS A 1 113 ? -29.650 25.447 14.743  1.00 60.16  ? 2543 HIS A NE2 1 
ATOM   873  N N   . GLU A 1 114 ? -31.487 27.031 9.315   1.00 60.48  ? 2544 GLU A N   1 
ATOM   874  C CA  . GLU A 1 114 ? -31.435 28.469 8.988   1.00 62.45  ? 2544 GLU A CA  1 
ATOM   875  C C   . GLU A 1 114 ? -32.814 29.105 8.771   1.00 58.03  ? 2544 GLU A C   1 
ATOM   876  O O   . GLU A 1 114 ? -33.046 30.245 9.132   1.00 54.75  ? 2544 GLU A O   1 
ATOM   877  C CB  . GLU A 1 114 ? -30.592 28.687 7.756   1.00 63.12  ? 2544 GLU A CB  1 
ATOM   878  C CG  . GLU A 1 114 ? -29.111 28.619 8.001   1.00 77.53  ? 2544 GLU A CG  1 
ATOM   879  C CD  . GLU A 1 114 ? -28.354 28.491 6.688   1.00 91.73  ? 2544 GLU A CD  1 
ATOM   880  O OE1 . GLU A 1 114 ? -27.854 27.381 6.381   1.00 93.90  ? 2544 GLU A OE1 1 
ATOM   881  O OE2 . GLU A 1 114 ? -28.303 29.498 5.944   1.00 87.76  ? 2544 GLU A OE2 1 
ATOM   882  N N   . ALA A 1 115 ? -33.738 28.359 8.184   1.00 55.36  ? 2545 ALA A N   1 
ATOM   883  C CA  . ALA A 1 115 ? -35.086 28.859 8.004   1.00 48.09  ? 2545 ALA A CA  1 
ATOM   884  C C   . ALA A 1 115 ? -35.849 28.973 9.305   1.00 56.60  ? 2545 ALA A C   1 
ATOM   885  O O   . ALA A 1 115 ? -36.830 29.720 9.378   1.00 61.11  ? 2545 ALA A O   1 
ATOM   886  C CB  . ALA A 1 115 ? -35.836 27.973 7.098   1.00 48.54  ? 2545 ALA A CB  1 
ATOM   887  N N   . SER A 1 116 ? -35.417 28.240 10.330  1.00 58.92  ? 2546 SER A N   1 
ATOM   888  C CA  . SER A 1 116 ? -36.249 28.029 11.517  1.00 59.84  ? 2546 SER A CA  1 
ATOM   889  C C   . SER A 1 116 ? -36.767 29.313 12.157  1.00 61.30  ? 2546 SER A C   1 
ATOM   890  O O   . SER A 1 116 ? -37.882 29.334 12.678  1.00 51.07  ? 2546 SER A O   1 
ATOM   891  C CB  . SER A 1 116 ? -35.498 27.194 12.560  1.00 60.91  ? 2546 SER A CB  1 
ATOM   892  O OG  . SER A 1 116 ? -34.417 27.935 13.093  1.00 58.34  ? 2546 SER A OG  1 
ATOM   893  N N   . ALA A 1 117 ? -35.964 30.380 12.123  1.00 63.95  ? 2547 ALA A N   1 
ATOM   894  C CA  . ALA A 1 117 ? -36.394 31.646 12.700  1.00 63.48  ? 2547 ALA A CA  1 
ATOM   895  C C   . ALA A 1 117 ? -37.630 32.180 11.963  1.00 64.34  ? 2547 ALA A C   1 
ATOM   896  O O   . ALA A 1 117 ? -38.643 32.505 12.577  1.00 65.67  ? 2547 ALA A O   1 
ATOM   897  C CB  . ALA A 1 117 ? -35.262 32.661 12.647  1.00 67.56  ? 2547 ALA A CB  1 
ATOM   898  N N   . GLN A 1 118 ? -37.548 32.254 10.639  1.00 67.97  ? 2548 GLN A N   1 
ATOM   899  C CA  . GLN A 1 118 ? -38.668 32.778 9.842   1.00 64.23  ? 2548 GLN A CA  1 
ATOM   900  C C   . GLN A 1 118 ? -39.893 31.911 10.013  1.00 64.79  ? 2548 GLN A C   1 
ATOM   901  O O   . GLN A 1 118 ? -40.996 32.424 10.148  1.00 81.48  ? 2548 GLN A O   1 
ATOM   902  C CB  . GLN A 1 118 ? -38.319 32.877 8.366   1.00 63.06  ? 2548 GLN A CB  1 
ATOM   903  C CG  . GLN A 1 118 ? -37.059 33.688 8.053   1.00 68.01  ? 2548 GLN A CG  1 
ATOM   904  C CD  . GLN A 1 118 ? -36.605 33.513 6.611   1.00 83.64  ? 2548 GLN A CD  1 
ATOM   905  O OE1 . GLN A 1 118 ? -37.236 34.035 5.687   1.00 87.15  ? 2548 GLN A OE1 1 
ATOM   906  N NE2 . GLN A 1 118 ? -35.505 32.771 6.410   1.00 83.14  ? 2548 GLN A NE2 1 
ATOM   907  N N   . ILE A 1 119 ? -39.694 30.595 10.034  1.00 67.47  ? 2549 ILE A N   1 
ATOM   908  C CA  . ILE A 1 119 ? -40.794 29.644 10.209  1.00 61.25  ? 2549 ILE A CA  1 
ATOM   909  C C   . ILE A 1 119 ? -41.510 29.848 11.531  1.00 70.96  ? 2549 ILE A C   1 
ATOM   910  O O   . ILE A 1 119 ? -42.737 29.706 11.603  1.00 81.00  ? 2549 ILE A O   1 
ATOM   911  C CB  . ILE A 1 119 ? -40.311 28.174 10.141  1.00 61.14  ? 2549 ILE A CB  1 
ATOM   912  C CG1 . ILE A 1 119 ? -39.811 27.819 8.748   1.00 59.76  ? 2549 ILE A CG1 1 
ATOM   913  C CG2 . ILE A 1 119 ? -41.427 27.238 10.462  1.00 57.79  ? 2549 ILE A CG2 1 
ATOM   914  C CD1 . ILE A 1 119 ? -39.251 26.447 8.684   1.00 64.58  ? 2549 ILE A CD1 1 
ATOM   915  N N   . ASP A 1 120 ? -40.756 30.173 12.583  1.00 71.62  ? 2550 ASP A N   1 
ATOM   916  C CA  . ASP A 1 120 ? -41.372 30.417 13.880  1.00 69.07  ? 2550 ASP A CA  1 
ATOM   917  C C   . ASP A 1 120 ? -42.167 31.706 13.873  1.00 67.83  ? 2550 ASP A C   1 
ATOM   918  O O   . ASP A 1 120 ? -43.270 31.741 14.419  1.00 82.67  ? 2550 ASP A O   1 
ATOM   919  C CB  . ASP A 1 120 ? -40.334 30.427 15.013  1.00 75.56  ? 2550 ASP A CB  1 
ATOM   920  C CG  . ASP A 1 120 ? -39.888 29.022 15.422  1.00 75.59  ? 2550 ASP A CG  1 
ATOM   921  O OD1 . ASP A 1 120 ? -40.605 28.027 15.135  1.00 66.33  ? 2550 ASP A OD1 1 
ATOM   922  O OD2 . ASP A 1 120 ? -38.801 28.916 16.030  1.00 80.18  ? 2550 ASP A OD2 1 
ATOM   923  N N   . GLU A 1 121 ? -41.621 32.764 13.270  1.00 64.64  ? 2551 GLU A N   1 
ATOM   924  C CA  . GLU A 1 121 ? -42.330 34.050 13.200  1.00 62.33  ? 2551 GLU A CA  1 
ATOM   925  C C   . GLU A 1 121 ? -43.678 33.894 12.494  1.00 71.93  ? 2551 GLU A C   1 
ATOM   926  O O   . GLU A 1 121 ? -44.635 34.558 12.875  1.00 78.08  ? 2551 GLU A O   1 
ATOM   927  C CB  . GLU A 1 121 ? -41.485 35.124 12.497  1.00 72.36  ? 2551 GLU A CB  1 
ATOM   928  C CG  . GLU A 1 121 ? -42.212 36.465 12.289  1.00 70.91  ? 2551 GLU A CG  1 
ATOM   929  N N   . ILE A 1 122 ? -43.749 33.024 11.471  1.00 66.65  ? 2552 ILE A N   1 
ATOM   930  C CA  . ILE A 1 122 ? -45.001 32.752 10.757  1.00 61.41  ? 2552 ILE A CA  1 
ATOM   931  C C   . ILE A 1 122 ? -45.950 31.909 11.593  1.00 65.15  ? 2552 ILE A C   1 
ATOM   932  O O   . ILE A 1 122 ? -47.052 32.323 11.886  1.00 83.06  ? 2552 ILE A O   1 
ATOM   933  C CB  . ILE A 1 122 ? -44.754 32.009 9.412   1.00 65.24  ? 2552 ILE A CB  1 
ATOM   934  C CG1 . ILE A 1 122 ? -44.030 32.914 8.417   1.00 53.64  ? 2552 ILE A CG1 1 
ATOM   935  C CG2 . ILE A 1 122 ? -46.089 31.474 8.795   1.00 48.98  ? 2552 ILE A CG2 1 
ATOM   936  C CD1 . ILE A 1 122 ? -43.306 32.118 7.365   1.00 50.54  ? 2552 ILE A CD1 1 
ATOM   937  N N   . VAL A 1 123 ? -45.528 30.713 11.968  1.00 76.15  ? 2553 VAL A N   1 
ATOM   938  C CA  . VAL A 1 123 ? -46.379 29.823 12.764  1.00 77.97  ? 2553 VAL A CA  1 
ATOM   939  C C   . VAL A 1 123 ? -46.890 30.494 14.044  1.00 88.91  ? 2553 VAL A C   1 
ATOM   940  O O   . VAL A 1 123 ? -48.022 30.243 14.484  1.00 93.93  ? 2553 VAL A O   1 
ATOM   941  C CB  . VAL A 1 123 ? -45.621 28.555 13.137  1.00 74.03  ? 2553 VAL A CB  1 
ATOM   942  C CG1 . VAL A 1 123 ? -46.454 27.683 14.078  1.00 71.96  ? 2553 VAL A CG1 1 
ATOM   943  C CG2 . VAL A 1 123 ? -45.246 27.794 11.864  1.00 65.09  ? 2553 VAL A CG2 1 
ATOM   944  N N   . GLY A 1 124 ? -46.057 31.360 14.624  1.00 94.85  ? 2554 GLY A N   1 
ATOM   945  C CA  . GLY A 1 124 ? -46.380 32.038 15.881  1.00 97.74  ? 2554 GLY A CA  1 
ATOM   946  C C   . GLY A 1 124 ? -47.150 33.342 15.740  1.00 96.97  ? 2554 GLY A C   1 
ATOM   947  O O   . GLY A 1 124 ? -47.021 34.224 16.585  1.00 90.26  ? 2554 GLY A O   1 
ATOM   948  N N   . GLU A 1 125 ? -47.911 33.475 14.651  1.00 95.35  ? 2555 GLU A N   1 
ATOM   949  C CA  . GLU A 1 125 ? -48.943 34.507 14.508  1.00 86.14  ? 2555 GLU A CA  1 
ATOM   950  C C   . GLU A 1 125 ? -50.334 33.891 14.735  1.00 89.97  ? 2555 GLU A C   1 
ATOM   951  O O   . GLU A 1 125 ? -51.334 34.613 14.774  1.00 91.44  ? 2555 GLU A O   1 
ATOM   952  C CB  . GLU A 1 125 ? -48.904 35.122 13.103  1.00 84.56  ? 2555 GLU A CB  1 
ATOM   953  C CG  . GLU A 1 125 ? -47.667 35.988 12.770  1.00 82.68  ? 2555 GLU A CG  1 
ATOM   954  C CD  . GLU A 1 125 ? -47.513 36.241 11.253  1.00 80.17  ? 2555 GLU A CD  1 
ATOM   955  O OE1 . GLU A 1 125 ? -48.442 35.886 10.492  1.00 76.08  ? 2555 GLU A OE1 1 
ATOM   956  O OE2 . GLU A 1 125 ? -46.469 36.783 10.807  1.00 63.24  ? 2555 GLU A OE2 1 
ATOM   957  N N   . THR A 1 126 ? -50.390 32.562 14.875  1.00 90.26  ? 2556 THR A N   1 
ATOM   958  C CA  . THR A 1 126 ? -51.652 31.815 14.977  1.00 82.62  ? 2556 THR A CA  1 
ATOM   959  C C   . THR A 1 126 ? -52.711 32.608 15.732  1.00 72.24  ? 2556 THR A C   1 
ATOM   960  O O   . THR A 1 126 ? -52.568 32.886 16.928  1.00 68.10  ? 2556 THR A O   1 
ATOM   961  C CB  . THR A 1 126 ? -51.451 30.421 15.663  1.00 75.58  ? 2556 THR A CB  1 
ATOM   962  N N   . SER B 1 1   ? -28.539 -4.771 14.579  1.00 50.27  ? 2431 SER B N   1 
ATOM   963  C CA  . SER B 1 1   ? -28.960 -4.449 15.980  1.00 49.07  ? 2431 SER B CA  1 
ATOM   964  C C   . SER B 1 1   ? -30.433 -4.764 16.207  1.00 45.60  ? 2431 SER B C   1 
ATOM   965  O O   . SER B 1 1   ? -31.111 -5.276 15.322  1.00 50.41  ? 2431 SER B O   1 
ATOM   966  C CB  . SER B 1 1   ? -28.721 -2.956 16.304  1.00 50.70  ? 2431 SER B CB  1 
ATOM   967  O OG  . SER B 1 1   ? -29.813 -2.161 15.840  1.00 47.72  ? 2431 SER B OG  1 
ATOM   968  N N   . MET B 1 2   ? -30.900 -4.340 17.378  1.00 49.98  ? 2432 MET B N   1 
ATOM   969  C CA  . MET B 1 2   ? -32.197 -4.615 17.972  1.00 54.58  ? 2432 MET B CA  1 
ATOM   970  C C   . MET B 1 2   ? -32.885 -3.259 18.245  1.00 59.31  ? 2432 MET B C   1 
ATOM   971  O O   . MET B 1 2   ? -32.188 -2.261 18.491  1.00 60.65  ? 2432 MET B O   1 
ATOM   972  C CB  . MET B 1 2   ? -31.866 -5.338 19.295  1.00 63.45  ? 2432 MET B CB  1 
ATOM   973  C CG  . MET B 1 2   ? -32.989 -5.664 20.273  1.00 71.17  ? 2432 MET B CG  1 
ATOM   974  S SD  . MET B 1 2   ? -32.350 -6.446 21.802  1.00 64.79  ? 2432 MET B SD  1 
ATOM   975  C CE  . MET B 1 2   ? -31.311 -7.767 21.135  1.00 67.78  ? 2432 MET B CE  1 
ATOM   976  N N   . GLU B 1 3   ? -34.221 -3.204 18.243  1.00 64.97  ? 2433 GLU B N   1 
ATOM   977  C CA  . GLU B 1 3   ? -34.938 -1.925 18.429  1.00 65.08  ? 2433 GLU B CA  1 
ATOM   978  C C   . GLU B 1 3   ? -34.771 -1.294 19.813  1.00 67.63  ? 2433 GLU B C   1 
ATOM   979  O O   . GLU B 1 3   ? -34.389 -0.124 19.924  1.00 72.41  ? 2433 GLU B O   1 
ATOM   980  C CB  . GLU B 1 3   ? -36.434 -2.047 18.121  1.00 74.99  ? 2433 GLU B CB  1 
ATOM   981  C CG  . GLU B 1 3   ? -37.224 -0.772 18.524  1.00 86.14  ? 2433 GLU B CG  1 
ATOM   982  C CD  . GLU B 1 3   ? -38.710 -1.002 18.632  1.00 96.69  ? 2433 GLU B CD  1 
ATOM   983  O OE1 . GLU B 1 3   ? -39.278 -0.688 19.706  1.00 92.12  ? 2433 GLU B OE1 1 
ATOM   984  O OE2 . GLU B 1 3   ? -39.302 -1.496 17.647  1.00 98.12  ? 2433 GLU B OE2 1 
ATOM   985  N N   . VAL B 1 4   ? -35.102 -2.036 20.864  1.00 63.22  ? 2434 VAL B N   1 
ATOM   986  C CA  . VAL B 1 4   ? -34.935 -1.518 22.224  1.00 56.88  ? 2434 VAL B CA  1 
ATOM   987  C C   . VAL B 1 4   ? -33.520 -0.949 22.456  1.00 54.98  ? 2434 VAL B C   1 
ATOM   988  O O   . VAL B 1 4   ? -33.363 0.002  23.187  1.00 57.52  ? 2434 VAL B O   1 
ATOM   989  C CB  . VAL B 1 4   ? -35.260 -2.600 23.284  1.00 63.64  ? 2434 VAL B CB  1 
ATOM   990  C CG1 . VAL B 1 4   ? -34.228 -3.730 23.243  1.00 61.04  ? 2434 VAL B CG1 1 
ATOM   991  C CG2 . VAL B 1 4   ? -35.351 -1.984 24.684  1.00 63.60  ? 2434 VAL B CG2 1 
ATOM   992  N N   . ALA B 1 5   ? -32.486 -1.528 21.852  1.00 59.09  ? 2435 ALA B N   1 
ATOM   993  C CA  . ALA B 1 5   ? -31.129 -0.973 21.985  1.00 62.81  ? 2435 ALA B CA  1 
ATOM   994  C C   . ALA B 1 5   ? -31.082 0.394  21.288  1.00 72.26  ? 2435 ALA B C   1 
ATOM   995  O O   . ALA B 1 5   ? -30.614 1.398  21.854  1.00 72.83  ? 2435 ALA B O   1 
ATOM   996  C CB  . ALA B 1 5   ? -30.086 -1.921 21.386  1.00 61.18  ? 2435 ALA B CB  1 
ATOM   997  N N   . ARG B 1 6   ? -31.603 0.436  20.065  1.00 68.96  ? 2436 ARG B N   1 
ATOM   998  C CA  . ARG B 1 6   ? -31.736 1.701  19.347  1.00 67.19  ? 2436 ARG B CA  1 
ATOM   999  C C   . ARG B 1 6   ? -32.518 2.725  20.185  1.00 67.30  ? 2436 ARG B C   1 
ATOM   1000 O O   . ARG B 1 6   ? -32.041 3.852  20.406  1.00 65.44  ? 2436 ARG B O   1 
ATOM   1001 C CB  . ARG B 1 6   ? -32.353 1.484  17.949  1.00 63.55  ? 2436 ARG B CB  1 
ATOM   1002 C CG  . ARG B 1 6   ? -31.374 0.760  16.959  1.00 58.05  ? 2436 ARG B CG  1 
ATOM   1003 C CD  . ARG B 1 6   ? -31.883 0.727  15.521  1.00 57.73  ? 2436 ARG B CD  1 
ATOM   1004 N NE  . ARG B 1 6   ? -32.443 -0.574 15.140  1.00 52.98  ? 2436 ARG B NE  1 
ATOM   1005 C CZ  . ARG B 1 6   ? -33.734 -0.873 15.086  1.00 52.86  ? 2436 ARG B CZ  1 
ATOM   1006 N NH1 . ARG B 1 6   ? -34.676 0.012  15.399  1.00 65.73  ? 2436 ARG B NH1 1 
ATOM   1007 N NH2 . ARG B 1 6   ? -34.097 -2.086 14.735  1.00 60.79  ? 2436 ARG B NH2 1 
ATOM   1008 N N   . ALA B 1 7   ? -33.681 2.311  20.692  1.00 57.03  ? 2437 ALA B N   1 
ATOM   1009 C CA  . ALA B 1 7   ? -34.548 3.204  21.457  1.00 57.39  ? 2437 ALA B CA  1 
ATOM   1010 C C   . ALA B 1 7   ? -33.910 3.698  22.770  1.00 63.41  ? 2437 ALA B C   1 
ATOM   1011 O O   . ALA B 1 7   ? -34.287 4.753  23.306  1.00 69.10  ? 2437 ALA B O   1 
ATOM   1012 C CB  . ALA B 1 7   ? -35.903 2.534  21.712  1.00 49.74  ? 2437 ALA B CB  1 
ATOM   1013 N N   . ALA B 1 8   ? -32.942 2.943  23.279  1.00 65.67  ? 2438 ALA B N   1 
ATOM   1014 C CA  . ALA B 1 8   ? -32.170 3.360  24.444  1.00 64.35  ? 2438 ALA B CA  1 
ATOM   1015 C C   . ALA B 1 8   ? -31.078 4.351  24.042  1.00 64.88  ? 2438 ALA B C   1 
ATOM   1016 O O   . ALA B 1 8   ? -30.877 5.355  24.729  1.00 76.22  ? 2438 ALA B O   1 
ATOM   1017 C CB  . ALA B 1 8   ? -31.552 2.143  25.155  1.00 62.14  ? 2438 ALA B CB  1 
ATOM   1018 N N   . ARG B 1 9   ? -30.344 4.054  22.964  1.00 68.75  ? 2439 ARG B N   1 
ATOM   1019 C CA  . ARG B 1 9   ? -29.329 4.992  22.441  1.00 64.23  ? 2439 ARG B CA  1 
ATOM   1020 C C   . ARG B 1 9   ? -29.980 6.346  22.222  1.00 56.09  ? 2439 ARG B C   1 
ATOM   1021 O O   . ARG B 1 9   ? -29.417 7.347  22.631  1.00 55.56  ? 2439 ARG B O   1 
ATOM   1022 C CB  . ARG B 1 9   ? -28.701 4.506  21.127  1.00 58.77  ? 2439 ARG B CB  1 
ATOM   1023 N N   . LEU B 1 10  ? -31.182 6.352  21.630  1.00 56.18  ? 2440 LEU B N   1 
ATOM   1024 C CA  . LEU B 1 10  ? -31.941 7.595  21.347  1.00 51.99  ? 2440 LEU B CA  1 
ATOM   1025 C C   . LEU B 1 10  ? -32.320 8.260  22.642  1.00 50.77  ? 2440 LEU B C   1 
ATOM   1026 O O   . LEU B 1 10  ? -32.032 9.443  22.832  1.00 60.80  ? 2440 LEU B O   1 
ATOM   1027 C CB  . LEU B 1 10  ? -33.216 7.343  20.513  1.00 51.33  ? 2440 LEU B CB  1 
ATOM   1028 C CG  . LEU B 1 10  ? -33.085 6.951  19.028  1.00 57.47  ? 2440 LEU B CG  1 
ATOM   1029 C CD1 . LEU B 1 10  ? -34.462 6.709  18.310  1.00 51.13  ? 2440 LEU B CD1 1 
ATOM   1030 C CD2 . LEU B 1 10  ? -32.290 8.005  18.280  1.00 53.97  ? 2440 LEU B CD2 1 
ATOM   1031 N N   . ALA B 1 11  ? -32.971 7.504  23.533  1.00 51.62  ? 2441 ALA B N   1 
ATOM   1032 C CA  . ALA B 1 11  ? -33.307 7.998  24.887  1.00 46.56  ? 2441 ALA B CA  1 
ATOM   1033 C C   . ALA B 1 11  ? -32.184 8.808  25.542  1.00 46.46  ? 2441 ALA B C   1 
ATOM   1034 O O   . ALA B 1 11  ? -32.425 9.874  26.150  1.00 46.22  ? 2441 ALA B O   1 
ATOM   1035 C CB  . ALA B 1 11  ? -33.714 6.844  25.800  1.00 45.02  ? 2441 ALA B CB  1 
ATOM   1036 N N   . GLN B 1 12  ? -30.959 8.305  25.450  1.00 52.35  ? 2442 GLN B N   1 
ATOM   1037 C CA  . GLN B 1 12  ? -29.819 8.974  26.098  1.00 56.00  ? 2442 GLN B CA  1 
ATOM   1038 C C   . GLN B 1 12  ? -29.628 10.371 25.473  1.00 57.66  ? 2442 GLN B C   1 
ATOM   1039 O O   . GLN B 1 12  ? -29.429 11.373 26.161  1.00 52.48  ? 2442 GLN B O   1 
ATOM   1040 C CB  . GLN B 1 12  ? -28.567 8.097  25.952  1.00 63.62  ? 2442 GLN B CB  1 
ATOM   1041 C CG  . GLN B 1 12  ? -27.309 8.567  26.662  1.00 70.25  ? 2442 GLN B CG  1 
ATOM   1042 C CD  . GLN B 1 12  ? -27.543 8.946  28.117  1.00 80.79  ? 2442 GLN B CD  1 
ATOM   1043 O OE1 . GLN B 1 12  ? -28.015 8.140  28.928  1.00 95.07  ? 2442 GLN B OE1 1 
ATOM   1044 N NE2 . GLN B 1 12  ? -27.216 10.183 28.451  1.00 80.30  ? 2442 GLN B NE2 1 
ATOM   1045 N N   . ILE B 1 13  ? -29.754 10.431 24.150  1.00 63.99  ? 2443 ILE B N   1 
ATOM   1046 C CA  . ILE B 1 13  ? -29.635 11.688 23.414  1.00 58.41  ? 2443 ILE B CA  1 
ATOM   1047 C C   . ILE B 1 13  ? -30.789 12.626 23.815  1.00 51.94  ? 2443 ILE B C   1 
ATOM   1048 O O   . ILE B 1 13  ? -30.584 13.782 24.230  1.00 46.36  ? 2443 ILE B O   1 
ATOM   1049 C CB  . ILE B 1 13  ? -29.608 11.414 21.891  1.00 67.13  ? 2443 ILE B CB  1 
ATOM   1050 C CG1 . ILE B 1 13  ? -28.361 10.583 21.520  1.00 67.42  ? 2443 ILE B CG1 1 
ATOM   1051 C CG2 . ILE B 1 13  ? -29.607 12.716 21.120  1.00 63.99  ? 2443 ILE B CG2 1 
ATOM   1052 C CD1 . ILE B 1 13  ? -28.379 9.995  20.101  1.00 65.88  ? 2443 ILE B CD1 1 
ATOM   1053 N N   . PHE B 1 14  ? -32.007 12.117 23.760  1.00 43.89  ? 2444 PHE B N   1 
ATOM   1054 C CA  . PHE B 1 14  ? -33.141 12.935 24.158  1.00 50.48  ? 2444 PHE B CA  1 
ATOM   1055 C C   . PHE B 1 14  ? -32.995 13.492 25.587  1.00 50.18  ? 2444 PHE B C   1 
ATOM   1056 O O   . PHE B 1 14  ? -33.344 14.641 25.850  1.00 56.90  ? 2444 PHE B O   1 
ATOM   1057 C CB  . PHE B 1 14  ? -34.444 12.144 24.082  1.00 63.28  ? 2444 PHE B CB  1 
ATOM   1058 C CG  . PHE B 1 14  ? -34.761 11.571 22.732  1.00 68.21  ? 2444 PHE B CG  1 
ATOM   1059 C CD1 . PHE B 1 14  ? -34.092 11.959 21.586  1.00 71.67  ? 2444 PHE B CD1 1 
ATOM   1060 C CD2 . PHE B 1 14  ? -35.774 10.641 22.616  1.00 77.45  ? 2444 PHE B CD2 1 
ATOM   1061 C CE1 . PHE B 1 14  ? -34.422 11.408 20.361  1.00 72.69  ? 2444 PHE B CE1 1 
ATOM   1062 C CE2 . PHE B 1 14  ? -36.103 10.092 21.390  1.00 71.52  ? 2444 PHE B CE2 1 
ATOM   1063 C CZ  . PHE B 1 14  ? -35.431 10.483 20.264  1.00 66.95  ? 2444 PHE B CZ  1 
ATOM   1064 N N   . LYS B 1 15  ? -32.523 12.681 26.528  1.00 53.00  ? 2445 LYS B N   1 
ATOM   1065 C CA  . LYS B 1 15  ? -32.308 13.178 27.893  1.00 52.35  ? 2445 LYS B CA  1 
ATOM   1066 C C   . LYS B 1 15  ? -31.278 14.306 27.942  1.00 54.29  ? 2445 LYS B C   1 
ATOM   1067 O O   . LYS B 1 15  ? -31.493 15.306 28.624  1.00 56.50  ? 2445 LYS B O   1 
ATOM   1068 C CB  . LYS B 1 15  ? -31.891 12.049 28.833  1.00 54.20  ? 2445 LYS B CB  1 
ATOM   1069 C CG  . LYS B 1 15  ? -31.476 12.504 30.232  1.00 60.84  ? 2445 LYS B CG  1 
ATOM   1070 C CD  . LYS B 1 15  ? -31.394 11.322 31.221  1.00 65.15  ? 2445 LYS B CD  1 
ATOM   1071 C CE  . LYS B 1 15  ? -31.302 11.815 32.667  1.00 63.62  ? 2445 LYS B CE  1 
ATOM   1072 N NZ  . LYS B 1 15  ? -30.056 12.551 32.873  1.00 64.12  ? 2445 LYS B NZ  1 
ATOM   1073 N N   . GLU B 1 16  ? -30.156 14.148 27.239  1.00 54.41  ? 2446 GLU B N   1 
ATOM   1074 C CA  . GLU B 1 16  ? -29.112 15.188 27.245  1.00 55.74  ? 2446 GLU B CA  1 
ATOM   1075 C C   . GLU B 1 16  ? -29.652 16.517 26.745  1.00 56.97  ? 2446 GLU B C   1 
ATOM   1076 O O   . GLU B 1 16  ? -29.379 17.565 27.341  1.00 62.13  ? 2446 GLU B O   1 
ATOM   1077 C CB  . GLU B 1 16  ? -27.883 14.745 26.434  1.00 59.93  ? 2446 GLU B CB  1 
ATOM   1078 C CG  . GLU B 1 16  ? -27.039 13.657 27.178  1.00 67.41  ? 2446 GLU B CG  1 
ATOM   1079 C CD  . GLU B 1 16  ? -26.044 12.894 26.282  1.00 78.80  ? 2446 GLU B CD  1 
ATOM   1080 O OE1 . GLU B 1 16  ? -25.704 13.373 25.172  1.00 68.56  ? 2446 GLU B OE1 1 
ATOM   1081 O OE2 . GLU B 1 16  ? -25.593 11.802 26.702  1.00 88.02  ? 2446 GLU B OE2 1 
ATOM   1082 N N   . ILE B 1 17  ? -30.458 16.455 25.685  1.00 57.57  ? 2447 ILE B N   1 
ATOM   1083 C CA  . ILE B 1 17  ? -31.035 17.632 25.061  1.00 54.53  ? 2447 ILE B CA  1 
ATOM   1084 C C   . ILE B 1 17  ? -32.038 18.260 25.994  1.00 50.09  ? 2447 ILE B C   1 
ATOM   1085 O O   . ILE B 1 17  ? -31.930 19.447 26.324  1.00 60.37  ? 2447 ILE B O   1 
ATOM   1086 C CB  . ILE B 1 17  ? -31.714 17.287 23.720  1.00 58.73  ? 2447 ILE B CB  1 
ATOM   1087 C CG1 . ILE B 1 17  ? -30.659 16.866 22.695  1.00 59.55  ? 2447 ILE B CG1 1 
ATOM   1088 C CG2 . ILE B 1 17  ? -32.491 18.469 23.189  1.00 58.45  ? 2447 ILE B CG2 1 
ATOM   1089 C CD1 . ILE B 1 17  ? -31.261 16.270 21.433  1.00 56.80  ? 2447 ILE B CD1 1 
ATOM   1090 N N   . CYS B 1 18  ? -32.994 17.467 26.449  1.00 48.76  ? 2448 CYS B N   1 
ATOM   1091 C CA  . CYS B 1 18  ? -34.010 17.934 27.428  1.00 52.92  ? 2448 CYS B CA  1 
ATOM   1092 C C   . CYS B 1 18  ? -33.395 18.411 28.759  1.00 62.10  ? 2448 CYS B C   1 
ATOM   1093 O O   . CYS B 1 18  ? -33.970 19.280 29.406  1.00 74.67  ? 2448 CYS B O   1 
ATOM   1094 C CB  . CYS B 1 18  ? -35.051 16.831 27.680  1.00 57.25  ? 2448 CYS B CB  1 
ATOM   1095 S SG  . CYS B 1 18  ? -36.667 17.272 28.525  1.00 53.52  ? 2448 CYS B SG  1 
ATOM   1096 N N   . ASP B 1 19  ? -32.236 17.880 29.170  1.00 61.20  ? 2449 ASP B N   1 
ATOM   1097 C CA  . ASP B 1 19  ? -31.544 18.420 30.363  1.00 59.01  ? 2449 ASP B CA  1 
ATOM   1098 C C   . ASP B 1 19  ? -30.889 19.768 30.060  1.00 55.70  ? 2449 ASP B C   1 
ATOM   1099 O O   . ASP B 1 19  ? -30.747 20.607 30.948  1.00 68.42  ? 2449 ASP B O   1 
ATOM   1100 C CB  . ASP B 1 19  ? -30.469 17.469 30.902  1.00 55.05  ? 2449 ASP B CB  1 
ATOM   1101 C CG  . ASP B 1 19  ? -31.039 16.212 31.530  1.00 60.93  ? 2449 ASP B CG  1 
ATOM   1102 O OD1 . ASP B 1 19  ? -32.276 16.072 31.653  1.00 69.68  ? 2449 ASP B OD1 1 
ATOM   1103 O OD2 . ASP B 1 19  ? -30.228 15.346 31.900  1.00 58.18  ? 2449 ASP B OD2 1 
ATOM   1104 N N   . GLY B 1 20  ? -30.451 19.954 28.823  1.00 55.51  ? 2450 GLY B N   1 
ATOM   1105 C CA  . GLY B 1 20  ? -29.846 21.214 28.402  1.00 50.04  ? 2450 GLY B CA  1 
ATOM   1106 C C   . GLY B 1 20  ? -30.884 22.320 28.490  1.00 59.52  ? 2450 GLY B C   1 
ATOM   1107 O O   . GLY B 1 20  ? -30.585 23.419 28.967  1.00 62.03  ? 2450 GLY B O   1 
ATOM   1108 N N   . ILE B 1 21  ? -32.108 22.008 28.058  1.00 55.13  ? 2451 ILE B N   1 
ATOM   1109 C CA  . ILE B 1 21  ? -33.212 22.941 28.088  1.00 52.93  ? 2451 ILE B CA  1 
ATOM   1110 C C   . ILE B 1 21  ? -33.658 23.231 29.524  1.00 61.85  ? 2451 ILE B C   1 
ATOM   1111 O O   . ILE B 1 21  ? -33.879 24.394 29.882  1.00 73.03  ? 2451 ILE B O   1 
ATOM   1112 C CB  . ILE B 1 21  ? -34.439 22.412 27.281  1.00 46.90  ? 2451 ILE B CB  1 
ATOM   1113 C CG1 . ILE B 1 21  ? -34.118 22.252 25.799  1.00 44.16  ? 2451 ILE B CG1 1 
ATOM   1114 C CG2 . ILE B 1 21  ? -35.645 23.360 27.385  1.00 42.17  ? 2451 ILE B CG2 1 
ATOM   1115 C CD1 . ILE B 1 21  ? -33.615 23.488 25.169  1.00 44.98  ? 2451 ILE B CD1 1 
ATOM   1116 N N   . ILE B 1 22  ? -33.817 22.184 30.333  1.00 67.87  ? 2452 ILE B N   1 
ATOM   1117 C CA  . ILE B 1 22  ? -34.222 22.350 31.732  1.00 70.74  ? 2452 ILE B CA  1 
ATOM   1118 C C   . ILE B 1 22  ? -33.202 23.166 32.508  1.00 76.74  ? 2452 ILE B C   1 
ATOM   1119 O O   . ILE B 1 22  ? -33.567 24.076 33.260  1.00 77.99  ? 2452 ILE B O   1 
ATOM   1120 C CB  . ILE B 1 22  ? -34.419 20.999 32.432  1.00 72.15  ? 2452 ILE B CB  1 
ATOM   1121 C CG1 . ILE B 1 22  ? -35.699 20.337 31.905  1.00 72.06  ? 2452 ILE B CG1 1 
ATOM   1122 C CG2 . ILE B 1 22  ? -34.481 21.183 33.964  1.00 66.80  ? 2452 ILE B CG2 1 
ATOM   1123 C CD1 . ILE B 1 22  ? -36.054 19.012 32.558  1.00 67.92  ? 2452 ILE B CD1 1 
ATOM   1124 N N   . SER B 1 23  ? -31.924 22.868 32.298  1.00 71.36  ? 2453 SER B N   1 
ATOM   1125 C CA  . SER B 1 23  ? -30.878 23.549 33.047  1.00 75.74  ? 2453 SER B CA  1 
ATOM   1126 C C   . SER B 1 23  ? -30.502 24.908 32.461  1.00 71.92  ? 2453 SER B C   1 
ATOM   1127 O O   . SER B 1 23  ? -29.797 25.670 33.095  1.00 74.22  ? 2453 SER B O   1 
ATOM   1128 C CB  . SER B 1 23  ? -29.630 22.688 33.092  1.00 74.76  ? 2453 SER B CB  1 
ATOM   1129 O OG  . SER B 1 23  ? -28.869 22.915 31.920  1.00 81.48  ? 2453 SER B OG  1 
ATOM   1130 N N   . TYR B 1 24  ? -30.947 25.197 31.245  1.00 73.21  ? 2454 TYR B N   1 
ATOM   1131 C CA  . TYR B 1 24  ? -30.506 26.385 30.505  1.00 73.44  ? 2454 TYR B CA  1 
ATOM   1132 C C   . TYR B 1 24  ? -30.624 27.673 31.310  1.00 78.83  ? 2454 TYR B C   1 
ATOM   1133 O O   . TYR B 1 24  ? -31.689 27.969 31.867  1.00 76.91  ? 2454 TYR B O   1 
ATOM   1134 C CB  . TYR B 1 24  ? -31.336 26.537 29.230  1.00 78.77  ? 2454 TYR B CB  1 
ATOM   1135 C CG  . TYR B 1 24  ? -30.739 27.486 28.235  1.00 75.48  ? 2454 TYR B CG  1 
ATOM   1136 C CD1 . TYR B 1 24  ? -29.748 27.066 27.371  1.00 79.44  ? 2454 TYR B CD1 1 
ATOM   1137 C CD2 . TYR B 1 24  ? -31.176 28.791 28.145  1.00 75.93  ? 2454 TYR B CD2 1 
ATOM   1138 C CE1 . TYR B 1 24  ? -29.195 27.923 26.449  1.00 80.43  ? 2454 TYR B CE1 1 
ATOM   1139 C CE2 . TYR B 1 24  ? -30.628 29.659 27.221  1.00 78.01  ? 2454 TYR B CE2 1 
ATOM   1140 C CZ  . TYR B 1 24  ? -29.637 29.219 26.380  1.00 77.22  ? 2454 TYR B CZ  1 
ATOM   1141 O OH  . TYR B 1 24  ? -29.087 30.071 25.458  1.00 79.11  ? 2454 TYR B OH  1 
ATOM   1142 N N   . LYS B 1 25  ? -29.538 28.445 31.350  1.00 82.93  ? 2455 LYS B N   1 
ATOM   1143 C CA  . LYS B 1 25  ? -29.508 29.683 32.133  1.00 85.46  ? 2455 LYS B CA  1 
ATOM   1144 C C   . LYS B 1 25  ? -29.039 30.882 31.303  1.00 93.26  ? 2455 LYS B C   1 
ATOM   1145 O O   . LYS B 1 25  ? -28.317 30.706 30.322  1.00 89.42  ? 2455 LYS B O   1 
ATOM   1146 C CB  . LYS B 1 25  ? -28.619 29.512 33.367  1.00 87.25  ? 2455 LYS B CB  1 
ATOM   1147 C CG  . LYS B 1 25  ? -29.186 28.569 34.420  1.00 89.65  ? 2455 LYS B CG  1 
ATOM   1148 C CD  . LYS B 1 25  ? -28.270 28.445 35.630  1.00 96.66  ? 2455 LYS B CD  1 
ATOM   1149 C CE  . LYS B 1 25  ? -28.912 27.605 36.731  1.00 105.27 ? 2455 LYS B CE  1 
ATOM   1150 N N   . ASP B 1 26  ? -29.462 32.089 31.706  1.00 99.86  ? 2456 ASP B N   1 
ATOM   1151 C CA  . ASP B 1 26  ? -29.103 33.340 31.015  1.00 103.07 ? 2456 ASP B CA  1 
ATOM   1152 C C   . ASP B 1 26  ? -28.050 34.156 31.768  1.00 111.81 ? 2456 ASP B C   1 
ATOM   1153 O O   . ASP B 1 26  ? -27.504 33.720 32.789  1.00 114.02 ? 2456 ASP B O   1 
ATOM   1154 C CB  . ASP B 1 26  ? -30.365 34.197 30.696  1.00 105.17 ? 2456 ASP B CB  1 
ATOM   1155 C CG  . ASP B 1 26  ? -30.775 35.176 31.814  1.00 105.42 ? 2456 ASP B CG  1 
ATOM   1156 O OD1 . ASP B 1 26  ? -31.931 35.665 31.782  1.00 93.79  ? 2456 ASP B OD1 1 
ATOM   1157 O OD2 . ASP B 1 26  ? -29.962 35.486 32.703  1.00 110.72 ? 2456 ASP B OD2 1 
ATOM   1158 N N   . SER B 1 27  ? -27.765 35.337 31.231  1.00 105.51 ? 2457 SER B N   1 
ATOM   1159 C CA  . SER B 1 27  ? -26.901 36.316 31.870  1.00 97.77  ? 2457 SER B CA  1 
ATOM   1160 C C   . SER B 1 27  ? -27.033 36.356 33.404  1.00 95.35  ? 2457 SER B C   1 
ATOM   1161 O O   . SER B 1 27  ? -26.065 36.084 34.117  1.00 92.60  ? 2457 SER B O   1 
ATOM   1162 C CB  . SER B 1 27  ? -27.210 37.685 31.276  1.00 96.44  ? 2457 SER B CB  1 
ATOM   1163 O OG  . SER B 1 27  ? -28.596 37.786 30.999  1.00 98.90  ? 2457 SER B OG  1 
ATOM   1164 N N   . SER B 1 28  ? -28.232 36.659 33.908  1.00 93.69  ? 2458 SER B N   1 
ATOM   1165 C CA  . SER B 1 28  ? -28.475 36.799 35.365  1.00 81.39  ? 2458 SER B CA  1 
ATOM   1166 C C   . SER B 1 28  ? -28.426 35.485 36.158  1.00 77.68  ? 2458 SER B C   1 
ATOM   1167 O O   . SER B 1 28  ? -29.146 35.348 37.165  1.00 58.50  ? 2458 SER B O   1 
ATOM   1168 C CB  . SER B 1 28  ? -29.853 37.444 35.619  1.00 82.16  ? 2458 SER B CB  1 
ATOM   1169 O OG  . SER B 1 28  ? -29.846 38.829 35.359  1.00 81.69  ? 2458 SER B OG  1 
ATOM   1170 N N   . ARG B 1 29  ? -27.591 34.528 35.739  1.00 79.34  ? 2459 ARG B N   1 
ATOM   1171 C CA  . ARG B 1 29  ? -27.701 33.169 36.266  1.00 84.12  ? 2459 ARG B CA  1 
ATOM   1172 C C   . ARG B 1 29  ? -29.207 32.820 36.471  1.00 87.56  ? 2459 ARG B C   1 
ATOM   1173 O O   . ARG B 1 29  ? -29.659 32.631 37.611  1.00 76.58  ? 2459 ARG B O   1 
ATOM   1174 C CB  . ARG B 1 29  ? -26.929 33.062 37.588  1.00 77.74  ? 2459 ARG B CB  1 
ATOM   1175 N N   . GLN B 1 30  ? -29.968 32.766 35.368  1.00 81.21  ? 2460 GLN B N   1 
ATOM   1176 C CA  . GLN B 1 30  ? -31.452 32.611 35.403  1.00 77.96  ? 2460 GLN B CA  1 
ATOM   1177 C C   . GLN B 1 30  ? -31.985 31.373 34.621  1.00 72.22  ? 2460 GLN B C   1 
ATOM   1178 O O   . GLN B 1 30  ? -31.687 31.197 33.438  1.00 70.42  ? 2460 GLN B O   1 
ATOM   1179 C CB  . GLN B 1 30  ? -32.103 33.921 34.919  1.00 73.71  ? 2460 GLN B CB  1 
ATOM   1180 C CG  . GLN B 1 30  ? -33.356 33.781 34.054  1.00 79.53  ? 2460 GLN B CG  1 
ATOM   1181 C CD  . GLN B 1 30  ? -34.352 34.923 34.245  1.00 80.56  ? 2460 GLN B CD  1 
ATOM   1182 O OE1 . GLN B 1 30  ? -34.216 35.724 35.164  1.00 94.30  ? 2460 GLN B OE1 1 
ATOM   1183 N NE2 . GLN B 1 30  ? -35.370 34.981 33.390  1.00 75.94  ? 2460 GLN B NE2 1 
ATOM   1184 N N   . ALA B 1 31  ? -32.777 30.530 35.287  1.00 68.07  ? 2461 ALA B N   1 
ATOM   1185 C CA  . ALA B 1 31  ? -33.262 29.266 34.699  1.00 66.20  ? 2461 ALA B CA  1 
ATOM   1186 C C   . ALA B 1 31  ? -34.516 29.463 33.833  1.00 61.82  ? 2461 ALA B C   1 
ATOM   1187 O O   . ALA B 1 31  ? -35.656 29.287 34.277  1.00 67.08  ? 2461 ALA B O   1 
ATOM   1188 C CB  . ALA B 1 31  ? -33.523 28.231 35.791  1.00 68.42  ? 2461 ALA B CB  1 
ATOM   1189 N N   . LEU B 1 32  ? -34.283 29.772 32.570  1.00 57.72  ? 2462 LEU B N   1 
ATOM   1190 C CA  . LEU B 1 32  ? -35.345 30.133 31.639  1.00 58.96  ? 2462 LEU B CA  1 
ATOM   1191 C C   . LEU B 1 32  ? -36.453 29.095 31.481  1.00 58.14  ? 2462 LEU B C   1 
ATOM   1192 O O   . LEU B 1 32  ? -37.576 29.461 31.221  1.00 55.59  ? 2462 LEU B O   1 
ATOM   1193 C CB  . LEU B 1 32  ? -34.746 30.459 30.267  1.00 57.04  ? 2462 LEU B CB  1 
ATOM   1194 C CG  . LEU B 1 32  ? -33.823 31.684 30.173  1.00 57.82  ? 2462 LEU B CG  1 
ATOM   1195 C CD1 . LEU B 1 32  ? -33.481 31.934 28.719  1.00 57.99  ? 2462 LEU B CD1 1 
ATOM   1196 C CD2 . LEU B 1 32  ? -34.471 32.909 30.786  1.00 65.17  ? 2462 LEU B CD2 1 
ATOM   1197 N N   . ALA B 1 33  ? -36.129 27.813 31.622  1.00 64.62  ? 2463 ALA B N   1 
ATOM   1198 C CA  . ALA B 1 33  ? -37.105 26.733 31.464  1.00 58.50  ? 2463 ALA B CA  1 
ATOM   1199 C C   . ALA B 1 33  ? -37.990 26.543 32.686  1.00 57.34  ? 2463 ALA B C   1 
ATOM   1200 O O   . ALA B 1 33  ? -38.880 25.675 32.680  1.00 57.70  ? 2463 ALA B O   1 
ATOM   1201 C CB  . ALA B 1 33  ? -36.386 25.422 31.138  1.00 57.97  ? 2463 ALA B CB  1 
ATOM   1202 N N   . ALA B 1 34  ? -37.770 27.352 33.725  1.00 60.48  ? 2464 ALA B N   1 
ATOM   1203 C CA  . ALA B 1 34  ? -38.487 27.204 35.015  1.00 56.63  ? 2464 ALA B CA  1 
ATOM   1204 C C   . ALA B 1 34  ? -40.025 27.181 34.893  1.00 58.89  ? 2464 ALA B C   1 
ATOM   1205 O O   . ALA B 1 34  ? -40.686 26.307 35.474  1.00 66.42  ? 2464 ALA B O   1 
ATOM   1206 C CB  . ALA B 1 34  ? -38.039 28.308 36.001  1.00 50.62  ? 2464 ALA B CB  1 
ATOM   1207 N N   . PRO B 1 35  ? -40.605 28.136 34.142  1.00 59.11  ? 2465 PRO B N   1 
ATOM   1208 C CA  . PRO B 1 35  ? -42.059 28.115 33.927  1.00 57.82  ? 2465 PRO B CA  1 
ATOM   1209 C C   . PRO B 1 35  ? -42.574 26.902 33.149  1.00 55.75  ? 2465 PRO B C   1 
ATOM   1210 O O   . PRO B 1 35  ? -43.750 26.606 33.213  1.00 55.87  ? 2465 PRO B O   1 
ATOM   1211 C CB  . PRO B 1 35  ? -42.323 29.371 33.095  1.00 64.95  ? 2465 PRO B CB  1 
ATOM   1212 C CG  . PRO B 1 35  ? -41.032 30.126 32.993  1.00 66.48  ? 2465 PRO B CG  1 
ATOM   1213 C CD  . PRO B 1 35  ? -39.935 29.208 33.381  1.00 63.38  ? 2465 PRO B CD  1 
ATOM   1214 N N   . LEU B 1 36  ? -41.704 26.208 32.424  1.00 64.68  ? 2466 LEU B N   1 
ATOM   1215 C CA  . LEU B 1 36  ? -42.105 25.049 31.614  1.00 59.16  ? 2466 LEU B CA  1 
ATOM   1216 C C   . LEU B 1 36  ? -42.018 23.702 32.332  1.00 58.78  ? 2466 LEU B C   1 
ATOM   1217 O O   . LEU B 1 36  ? -42.289 22.679 31.710  1.00 60.77  ? 2466 LEU B O   1 
ATOM   1218 C CB  . LEU B 1 36  ? -41.219 24.957 30.384  1.00 53.95  ? 2466 LEU B CB  1 
ATOM   1219 C CG  . LEU B 1 36  ? -41.446 25.850 29.155  1.00 56.58  ? 2466 LEU B CG  1 
ATOM   1220 C CD1 . LEU B 1 36  ? -42.092 27.027 29.407  1.00 47.27  ? 2466 LEU B CD1 1 
ATOM   1221 C CD2 . LEU B 1 36  ? -40.219 26.387 28.641  1.00 49.68  ? 2466 LEU B CD2 1 
ATOM   1222 N N   . LEU B 1 37  ? -41.621 23.685 33.607  1.00 55.79  ? 2467 LEU B N   1 
ATOM   1223 C CA  . LEU B 1 37  ? -41.241 22.429 34.280  1.00 48.47  ? 2467 LEU B CA  1 
ATOM   1224 C C   . LEU B 1 37  ? -42.438 21.650 34.773  1.00 51.27  ? 2467 LEU B C   1 
ATOM   1225 O O   . LEU B 1 37  ? -42.504 20.429 34.590  1.00 60.14  ? 2467 LEU B O   1 
ATOM   1226 C CB  . LEU B 1 37  ? -40.272 22.697 35.438  1.00 51.51  ? 2467 LEU B CB  1 
ATOM   1227 C CG  . LEU B 1 37  ? -38.871 23.241 35.076  1.00 58.11  ? 2467 LEU B CG  1 
ATOM   1228 C CD1 . LEU B 1 37  ? -38.130 23.649 36.330  1.00 52.19  ? 2467 LEU B CD1 1 
ATOM   1229 C CD2 . LEU B 1 37  ? -38.035 22.247 34.277  1.00 48.69  ? 2467 LEU B CD2 1 
ATOM   1230 N N   . ASN B 1 38  ? -43.367 22.360 35.416  1.00 59.07  ? 2468 ASN B N   1 
ATOM   1231 C CA  . ASN B 1 38  ? -44.579 21.776 35.988  1.00 58.13  ? 2468 ASN B CA  1 
ATOM   1232 C C   . ASN B 1 38  ? -45.821 22.419 35.384  1.00 66.80  ? 2468 ASN B C   1 
ATOM   1233 O O   . ASN B 1 38  ? -45.863 23.643 35.191  1.00 58.51  ? 2468 ASN B O   1 
ATOM   1234 C CB  . ASN B 1 38  ? -44.598 21.995 37.502  1.00 57.93  ? 2468 ASN B CB  1 
ATOM   1235 C CG  . ASN B 1 38  ? -45.620 21.123 38.211  1.00 61.68  ? 2468 ASN B CG  1 
ATOM   1236 O OD1 . ASN B 1 38  ? -45.814 19.953 37.853  1.00 69.79  ? 2468 ASN B OD1 1 
ATOM   1237 N ND2 . ASN B 1 38  ? -46.258 21.673 39.233  1.00 56.64  ? 2468 ASN B ND2 1 
ATOM   1238 N N   . LEU B 1 39  ? -46.823 21.598 35.075  1.00 68.12  ? 2469 LEU B N   1 
ATOM   1239 C CA  . LEU B 1 39  ? -48.124 22.109 34.668  1.00 71.06  ? 2469 LEU B CA  1 
ATOM   1240 C C   . LEU B 1 39  ? -48.794 22.762 35.881  1.00 78.15  ? 2469 LEU B C   1 
ATOM   1241 O O   . LEU B 1 39  ? -48.752 22.196 36.983  1.00 78.92  ? 2469 LEU B O   1 
ATOM   1242 C CB  . LEU B 1 39  ? -49.007 20.979 34.121  1.00 77.09  ? 2469 LEU B CB  1 
ATOM   1243 C CG  . LEU B 1 39  ? -48.743 20.528 32.679  1.00 80.58  ? 2469 LEU B CG  1 
ATOM   1244 C CD1 . LEU B 1 39  ? -49.506 19.230 32.348  1.00 83.78  ? 2469 LEU B CD1 1 
ATOM   1245 C CD2 . LEU B 1 39  ? -49.057 21.658 31.685  1.00 70.44  ? 2469 LEU B CD2 1 
ATOM   1246 N N   . PRO B 1 40  ? -49.414 23.948 35.690  1.00 82.57  ? 2470 PRO B N   1 
ATOM   1247 C CA  . PRO B 1 40  ? -50.117 24.645 36.789  1.00 87.05  ? 2470 PRO B CA  1 
ATOM   1248 C C   . PRO B 1 40  ? -51.184 23.751 37.401  1.00 88.90  ? 2470 PRO B C   1 
ATOM   1249 O O   . PRO B 1 40  ? -51.935 23.127 36.653  1.00 100.09 ? 2470 PRO B O   1 
ATOM   1250 C CB  . PRO B 1 40  ? -50.795 25.839 36.095  1.00 88.19  ? 2470 PRO B CB  1 
ATOM   1251 C CG  . PRO B 1 40  ? -50.129 25.969 34.776  1.00 84.95  ? 2470 PRO B CG  1 
ATOM   1252 C CD  . PRO B 1 40  ? -49.647 24.602 34.391  1.00 82.30  ? 2470 PRO B CD  1 
ATOM   1253 N N   . PRO B 1 41  ? -51.256 23.677 38.743  1.00 93.18  ? 2471 PRO B N   1 
ATOM   1254 C CA  . PRO B 1 41  ? -52.258 22.816 39.386  1.00 95.06  ? 2471 PRO B CA  1 
ATOM   1255 C C   . PRO B 1 41  ? -53.700 23.138 38.974  1.00 88.07  ? 2471 PRO B C   1 
ATOM   1256 O O   . PRO B 1 41  ? -54.139 24.284 39.103  1.00 71.44  ? 2471 PRO B O   1 
ATOM   1257 C CB  . PRO B 1 41  ? -52.033 23.084 40.879  1.00 96.58  ? 2471 PRO B CB  1 
ATOM   1258 C CG  . PRO B 1 41  ? -50.597 23.414 40.958  1.00 88.07  ? 2471 PRO B CG  1 
ATOM   1259 C CD  . PRO B 1 41  ? -50.331 24.251 39.736  1.00 82.38  ? 2471 PRO B CD  1 
ATOM   1260 N N   . LYS B 1 42  ? -54.403 22.114 38.479  1.00 89.99  ? 2472 LYS B N   1 
ATOM   1261 C CA  . LYS B 1 42  ? -55.727 22.269 37.872  1.00 87.34  ? 2472 LYS B CA  1 
ATOM   1262 C C   . LYS B 1 42  ? -56.671 23.052 38.779  1.00 88.61  ? 2472 LYS B C   1 
ATOM   1263 O O   . LYS B 1 42  ? -57.313 24.007 38.330  1.00 95.34  ? 2472 LYS B O   1 
ATOM   1264 C CB  . LYS B 1 42  ? -56.324 20.899 37.515  1.00 73.46  ? 2472 LYS B CB  1 
ATOM   1265 N N   . LYS B 1 43  ? -56.714 22.679 40.059  1.00 87.09  ? 2473 LYS B N   1 
ATOM   1266 C CA  . LYS B 1 43  ? -57.640 23.313 41.000  1.00 85.71  ? 2473 LYS B CA  1 
ATOM   1267 C C   . LYS B 1 43  ? -57.494 24.842 40.995  1.00 75.72  ? 2473 LYS B C   1 
ATOM   1268 O O   . LYS B 1 43  ? -58.496 25.533 40.969  1.00 78.82  ? 2473 LYS B O   1 
ATOM   1269 C CB  . LYS B 1 43  ? -57.522 22.725 42.420  1.00 77.50  ? 2473 LYS B CB  1 
ATOM   1270 C CG  . LYS B 1 43  ? -58.014 21.274 42.526  1.00 81.21  ? 2473 LYS B CG  1 
ATOM   1271 N N   . LYS B 1 44  ? -56.266 25.365 40.956  1.00 65.98  ? 2474 LYS B N   1 
ATOM   1272 C CA  . LYS B 1 44  ? -56.054 26.835 41.004  1.00 62.92  ? 2474 LYS B CA  1 
ATOM   1273 C C   . LYS B 1 44  ? -55.899 27.522 39.642  1.00 70.49  ? 2474 LYS B C   1 
ATOM   1274 O O   . LYS B 1 44  ? -55.782 28.752 39.565  1.00 72.68  ? 2474 LYS B O   1 
ATOM   1275 C CB  . LYS B 1 44  ? -54.855 27.192 41.870  1.00 47.89  ? 2474 LYS B CB  1 
ATOM   1276 C CG  . LYS B 1 44  ? -55.017 26.789 43.322  1.00 52.07  ? 2474 LYS B CG  1 
ATOM   1277 C CD  . LYS B 1 44  ? -55.879 27.801 44.103  1.00 47.14  ? 2474 LYS B CD  1 
ATOM   1278 C CE  . LYS B 1 44  ? -56.223 27.290 45.427  1.00 41.88  ? 2474 LYS B CE  1 
ATOM   1279 N NZ  . LYS B 1 44  ? -57.266 28.209 46.015  1.00 49.30  ? 2474 LYS B NZ  1 
ATOM   1280 N N   . ASN B 1 45  ? -55.898 26.754 38.565  1.00 69.56  ? 2475 ASN B N   1 
ATOM   1281 C CA  . ASN B 1 45  ? -55.738 27.358 37.254  1.00 90.99  ? 2475 ASN B CA  1 
ATOM   1282 C C   . ASN B 1 45  ? -56.662 26.673 36.256  1.00 104.78 ? 2475 ASN B C   1 
ATOM   1283 O O   . ASN B 1 45  ? -56.218 26.173 35.226  1.00 123.69 ? 2475 ASN B O   1 
ATOM   1284 C CB  . ASN B 1 45  ? -54.256 27.307 36.809  1.00 92.66  ? 2475 ASN B CB  1 
ATOM   1285 C CG  . ASN B 1 45  ? -53.283 27.781 37.906  1.00 89.86  ? 2475 ASN B CG  1 
ATOM   1286 O OD1 . ASN B 1 45  ? -52.886 28.954 37.938  1.00 91.09  ? 2475 ASN B OD1 1 
ATOM   1287 N ND2 . ASN B 1 45  ? -52.920 26.872 38.823  1.00 62.19  ? 2475 ASN B ND2 1 
ATOM   1288 N N   . ALA B 1 46  ? -57.957 26.656 36.573  1.00 122.12 ? 2476 ALA B N   1 
ATOM   1289 C CA  . ALA B 1 46  ? -58.972 26.070 35.683  1.00 119.98 ? 2476 ALA B CA  1 
ATOM   1290 C C   . ALA B 1 46  ? -59.023 26.778 34.321  1.00 119.88 ? 2476 ALA B C   1 
ATOM   1291 O O   . ALA B 1 46  ? -59.425 26.168 33.326  1.00 115.82 ? 2476 ALA B O   1 
ATOM   1292 C CB  . ALA B 1 46  ? -60.350 26.092 36.347  1.00 112.08 ? 2476 ALA B CB  1 
ATOM   1293 N N   . ASP B 1 47  ? -58.614 28.054 34.287  1.00 110.75 ? 2477 ASP B N   1 
ATOM   1294 C CA  . ASP B 1 47  ? -58.580 28.848 33.048  1.00 102.16 ? 2477 ASP B CA  1 
ATOM   1295 C C   . ASP B 1 47  ? -57.494 28.402 32.063  1.00 100.34 ? 2477 ASP B C   1 
ATOM   1296 O O   . ASP B 1 47  ? -57.639 28.572 30.850  1.00 107.83 ? 2477 ASP B O   1 
ATOM   1297 C CB  . ASP B 1 47  ? -58.409 30.338 33.369  1.00 107.58 ? 2477 ASP B CB  1 
ATOM   1298 C CG  . ASP B 1 47  ? -57.002 30.684 33.825  1.00 111.82 ? 2477 ASP B CG  1 
ATOM   1299 O OD1 . ASP B 1 47  ? -56.607 30.275 34.942  1.00 107.84 ? 2477 ASP B OD1 1 
ATOM   1300 O OD2 . ASP B 1 47  ? -56.297 31.372 33.057  1.00 108.64 ? 2477 ASP B OD2 1 
ATOM   1301 N N   . TYR B 1 48  ? -56.401 27.857 32.593  1.00 102.06 ? 2478 TYR B N   1 
ATOM   1302 C CA  . TYR B 1 48  ? -55.347 27.258 31.775  1.00 91.56  ? 2478 TYR B CA  1 
ATOM   1303 C C   . TYR B 1 48  ? -55.897 26.086 30.960  1.00 88.45  ? 2478 TYR B C   1 
ATOM   1304 O O   . TYR B 1 48  ? -55.758 26.040 29.737  1.00 76.66  ? 2478 TYR B O   1 
ATOM   1305 C CB  . TYR B 1 48  ? -54.176 26.764 32.658  1.00 96.04  ? 2478 TYR B CB  1 
ATOM   1306 C CG  . TYR B 1 48  ? -52.983 26.256 31.854  1.00 88.79  ? 2478 TYR B CG  1 
ATOM   1307 C CD1 . TYR B 1 48  ? -52.053 27.153 31.318  1.00 83.78  ? 2478 TYR B CD1 1 
ATOM   1308 C CD2 . TYR B 1 48  ? -52.800 24.890 31.610  1.00 74.55  ? 2478 TYR B CD2 1 
ATOM   1309 C CE1 . TYR B 1 48  ? -50.976 26.714 30.562  1.00 80.11  ? 2478 TYR B CE1 1 
ATOM   1310 C CE2 . TYR B 1 48  ? -51.723 24.440 30.849  1.00 77.74  ? 2478 TYR B CE2 1 
ATOM   1311 C CZ  . TYR B 1 48  ? -50.812 25.358 30.329  1.00 80.82  ? 2478 TYR B CZ  1 
ATOM   1312 O OH  . TYR B 1 48  ? -49.732 24.937 29.571  1.00 73.75  ? 2478 TYR B OH  1 
ATOM   1313 N N   . TYR B 1 49  ? -56.532 25.144 31.648  1.00 90.78  ? 2479 TYR B N   1 
ATOM   1314 C CA  . TYR B 1 49  ? -56.991 23.905 31.018  1.00 93.74  ? 2479 TYR B CA  1 
ATOM   1315 C C   . TYR B 1 49  ? -58.208 24.105 30.103  1.00 96.84  ? 2479 TYR B C   1 
ATOM   1316 O O   . TYR B 1 49  ? -58.637 23.167 29.423  1.00 93.99  ? 2479 TYR B O   1 
ATOM   1317 C CB  . TYR B 1 49  ? -57.266 22.851 32.088  1.00 86.91  ? 2479 TYR B CB  1 
ATOM   1318 C CG  . TYR B 1 49  ? -56.008 22.437 32.822  1.00 86.54  ? 2479 TYR B CG  1 
ATOM   1319 C CD1 . TYR B 1 49  ? -55.302 21.299 32.436  1.00 88.13  ? 2479 TYR B CD1 1 
ATOM   1320 C CD2 . TYR B 1 49  ? -55.513 23.189 33.888  1.00 75.54  ? 2479 TYR B CD2 1 
ATOM   1321 C CE1 . TYR B 1 49  ? -54.148 20.911 33.094  1.00 88.38  ? 2479 TYR B CE1 1 
ATOM   1322 C CE2 . TYR B 1 49  ? -54.358 22.815 34.548  1.00 82.32  ? 2479 TYR B CE2 1 
ATOM   1323 C CZ  . TYR B 1 49  ? -53.680 21.670 34.149  1.00 84.92  ? 2479 TYR B CZ  1 
ATOM   1324 O OH  . TYR B 1 49  ? -52.536 21.271 34.788  1.00 70.28  ? 2479 TYR B OH  1 
ATOM   1325 N N   . GLU B 1 50  ? -58.750 25.325 30.099  1.00 91.95  ? 2480 GLU B N   1 
ATOM   1326 C CA  . GLU B 1 50  ? -59.739 25.742 29.114  1.00 89.38  ? 2480 GLU B CA  1 
ATOM   1327 C C   . GLU B 1 50  ? -59.061 26.330 27.872  1.00 90.46  ? 2480 GLU B C   1 
ATOM   1328 O O   . GLU B 1 50  ? -59.549 26.094 26.768  1.00 101.95 ? 2480 GLU B O   1 
ATOM   1329 C CB  . GLU B 1 50  ? -60.751 26.725 29.719  1.00 91.41  ? 2480 GLU B CB  1 
ATOM   1330 C CG  . GLU B 1 50  ? -61.830 26.033 30.561  1.00 88.67  ? 2480 GLU B CG  1 
ATOM   1331 C CD  . GLU B 1 50  ? -62.575 26.980 31.502  1.00 95.34  ? 2480 GLU B CD  1 
ATOM   1332 O OE1 . GLU B 1 50  ? -62.509 28.217 31.310  1.00 91.61  ? 2480 GLU B OE1 1 
ATOM   1333 O OE2 . GLU B 1 50  ? -63.236 26.478 32.441  1.00 90.68  ? 2480 GLU B OE2 1 
ATOM   1334 N N   . LYS B 1 51  ? -57.950 27.068 28.027  1.00 77.44  ? 2481 LYS B N   1 
ATOM   1335 C CA  . LYS B 1 51  ? -57.180 27.569 26.842  1.00 70.15  ? 2481 LYS B CA  1 
ATOM   1336 C C   . LYS B 1 51  ? -56.228 26.533 26.192  1.00 79.26  ? 2481 LYS B C   1 
ATOM   1337 O O   . LYS B 1 51  ? -55.920 26.645 24.997  1.00 86.65  ? 2481 LYS B O   1 
ATOM   1338 C CB  . LYS B 1 51  ? -56.394 28.850 27.163  1.00 64.20  ? 2481 LYS B CB  1 
ATOM   1339 C CG  . LYS B 1 51  ? -55.806 29.552 25.917  1.00 50.38  ? 2481 LYS B CG  1 
ATOM   1340 N N   . ILE B 1 52  ? -55.756 25.546 26.962  1.00 79.79  ? 2482 ILE B N   1 
ATOM   1341 C CA  . ILE B 1 52  ? -54.888 24.481 26.425  1.00 77.64  ? 2482 ILE B CA  1 
ATOM   1342 C C   . ILE B 1 52  ? -55.572 23.111 26.461  1.00 85.25  ? 2482 ILE B C   1 
ATOM   1343 O O   . ILE B 1 52  ? -56.063 22.652 27.510  1.00 77.21  ? 2482 ILE B O   1 
ATOM   1344 C CB  . ILE B 1 52  ? -53.518 24.392 27.154  1.00 71.13  ? 2482 ILE B CB  1 
ATOM   1345 C CG1 . ILE B 1 52  ? -52.531 25.410 26.572  1.00 70.93  ? 2482 ILE B CG1 1 
ATOM   1346 C CG2 . ILE B 1 52  ? -52.914 23.006 26.996  1.00 70.20  ? 2482 ILE B CG2 1 
ATOM   1347 C CD1 . ILE B 1 52  ? -52.990 26.864 26.654  1.00 71.21  ? 2482 ILE B CD1 1 
ATOM   1348 N N   . SER B 1 53  ? -55.560 22.478 25.288  1.00 85.20  ? 2483 SER B N   1 
ATOM   1349 C CA  . SER B 1 53  ? -56.258 21.232 24.998  1.00 81.99  ? 2483 SER B CA  1 
ATOM   1350 C C   . SER B 1 53  ? -55.385 20.060 25.304  1.00 85.10  ? 2483 SER B C   1 
ATOM   1351 O O   . SER B 1 53  ? -55.853 19.031 25.794  1.00 96.70  ? 2483 SER B O   1 
ATOM   1352 C CB  . SER B 1 53  ? -56.563 21.154 23.497  1.00 81.71  ? 2483 SER B CB  1 
ATOM   1353 O OG  . SER B 1 53  ? -56.899 22.430 22.985  1.00 86.22  ? 2483 SER B OG  1 
ATOM   1354 N N   . ASP B 1 54  ? -54.114 20.218 24.946  1.00 82.37  ? 2484 ASP B N   1 
ATOM   1355 C CA  . ASP B 1 54  ? -53.128 19.158 25.038  1.00 80.29  ? 2484 ASP B CA  1 
ATOM   1356 C C   . ASP B 1 54  ? -51.937 19.635 25.894  1.00 83.15  ? 2484 ASP B C   1 
ATOM   1357 O O   . ASP B 1 54  ? -50.853 19.936 25.368  1.00 71.02  ? 2484 ASP B O   1 
ATOM   1358 C CB  . ASP B 1 54  ? -52.690 18.769 23.627  1.00 70.98  ? 2484 ASP B CB  1 
ATOM   1359 C CG  . ASP B 1 54  ? -52.264 17.310 23.519  1.00 69.67  ? 2484 ASP B CG  1 
ATOM   1360 O OD1 . ASP B 1 54  ? -52.081 16.645 24.559  1.00 56.70  ? 2484 ASP B OD1 1 
ATOM   1361 O OD2 . ASP B 1 54  ? -52.099 16.835 22.371  1.00 70.17  ? 2484 ASP B OD2 1 
ATOM   1362 N N   . PRO B 1 55  ? -52.139 19.695 27.224  1.00 76.82  ? 2485 PRO B N   1 
ATOM   1363 C CA  . PRO B 1 55  ? -51.153 20.263 28.122  1.00 73.54  ? 2485 PRO B CA  1 
ATOM   1364 C C   . PRO B 1 55  ? -49.999 19.295 28.343  1.00 66.74  ? 2485 PRO B C   1 
ATOM   1365 O O   . PRO B 1 55  ? -50.226 18.094 28.458  1.00 69.66  ? 2485 PRO B O   1 
ATOM   1366 C CB  . PRO B 1 55  ? -51.950 20.448 29.421  1.00 68.06  ? 2485 PRO B CB  1 
ATOM   1367 C CG  . PRO B 1 55  ? -52.911 19.304 29.429  1.00 70.45  ? 2485 PRO B CG  1 
ATOM   1368 C CD  . PRO B 1 55  ? -53.164 18.933 27.970  1.00 80.37  ? 2485 PRO B CD  1 
ATOM   1369 N N   . LEU B 1 56  ? -48.770 19.805 28.404  1.00 68.07  ? 2486 LEU B N   1 
ATOM   1370 C CA  . LEU B 1 56  ? -47.602 18.943 28.709  1.00 70.39  ? 2486 LEU B CA  1 
ATOM   1371 C C   . LEU B 1 56  ? -46.492 19.768 29.347  1.00 75.52  ? 2486 LEU B C   1 
ATOM   1372 O O   . LEU B 1 56  ? -46.343 20.960 29.052  1.00 80.72  ? 2486 LEU B O   1 
ATOM   1373 C CB  . LEU B 1 56  ? -47.055 18.245 27.450  1.00 62.03  ? 2486 LEU B CB  1 
ATOM   1374 C CG  . LEU B 1 56  ? -45.893 17.250 27.662  1.00 57.11  ? 2486 LEU B CG  1 
ATOM   1375 C CD1 . LEU B 1 56  ? -46.348 15.922 28.243  1.00 44.73  ? 2486 LEU B CD1 1 
ATOM   1376 C CD2 . LEU B 1 56  ? -45.195 17.010 26.370  1.00 53.32  ? 2486 LEU B CD2 1 
ATOM   1377 N N   . ASP B 1 57  ? -45.714 19.126 30.216  1.00 67.42  ? 2487 ASP B N   1 
ATOM   1378 C CA  . ASP B 1 57  ? -44.613 19.802 30.872  1.00 56.88  ? 2487 ASP B CA  1 
ATOM   1379 C C   . ASP B 1 57  ? -43.314 19.047 30.664  1.00 57.34  ? 2487 ASP B C   1 
ATOM   1380 O O   . ASP B 1 57  ? -43.301 17.878 30.251  1.00 48.98  ? 2487 ASP B O   1 
ATOM   1381 C CB  . ASP B 1 57  ? -44.903 20.035 32.369  1.00 55.56  ? 2487 ASP B CB  1 
ATOM   1382 C CG  . ASP B 1 57  ? -45.347 18.793 33.102  1.00 50.84  ? 2487 ASP B CG  1 
ATOM   1383 O OD1 . ASP B 1 57  ? -44.731 17.730 32.962  1.00 51.42  ? 2487 ASP B OD1 1 
ATOM   1384 O OD2 . ASP B 1 57  ? -46.288 18.900 33.899  1.00 62.84  ? 2487 ASP B OD2 1 
ATOM   1385 N N   . LEU B 1 58  ? -42.212 19.731 30.953  1.00 55.01  ? 2488 LEU B N   1 
ATOM   1386 C CA  . LEU B 1 58  ? -40.898 19.130 30.788  1.00 51.75  ? 2488 LEU B CA  1 
ATOM   1387 C C   . LEU B 1 58  ? -40.610 18.007 31.753  1.00 46.39  ? 2488 LEU B C   1 
ATOM   1388 O O   . LEU B 1 58  ? -39.777 17.194 31.451  1.00 39.98  ? 2488 LEU B O   1 
ATOM   1389 C CB  . LEU B 1 58  ? -39.782 20.166 30.946  1.00 46.81  ? 2488 LEU B CB  1 
ATOM   1390 C CG  . LEU B 1 58  ? -39.713 21.217 29.842  1.00 43.30  ? 2488 LEU B CG  1 
ATOM   1391 C CD1 . LEU B 1 58  ? -38.464 22.183 30.007  1.00 32.96  ? 2488 LEU B CD1 1 
ATOM   1392 C CD2 . LEU B 1 58  ? -39.776 20.553 28.491  1.00 30.99  ? 2488 LEU B CD2 1 
ATOM   1393 N N   . ILE B 1 59  ? -41.250 18.003 32.922  1.00 53.45  ? 2489 ILE B N   1 
ATOM   1394 C CA  . ILE B 1 59  ? -41.045 16.944 33.912  1.00 51.79  ? 2489 ILE B CA  1 
ATOM   1395 C C   . ILE B 1 59  ? -41.605 15.641 33.365  1.00 57.44  ? 2489 ILE B C   1 
ATOM   1396 O O   . ILE B 1 59  ? -40.947 14.588 33.425  1.00 66.80  ? 2489 ILE B O   1 
ATOM   1397 C CB  . ILE B 1 59  ? -41.669 17.343 35.308  1.00 58.60  ? 2489 ILE B CB  1 
ATOM   1398 C CG1 . ILE B 1 59  ? -40.762 18.355 36.008  1.00 55.65  ? 2489 ILE B CG1 1 
ATOM   1399 C CG2 . ILE B 1 59  ? -41.857 16.133 36.249  1.00 51.02  ? 2489 ILE B CG2 1 
ATOM   1400 C CD1 . ILE B 1 59  ? -41.216 18.721 37.386  1.00 63.41  ? 2489 ILE B CD1 1 
ATOM   1401 N N   . THR B 1 60  ? -42.808 15.716 32.797  1.00 59.17  ? 2490 THR B N   1 
ATOM   1402 C CA  . THR B 1 60  ? -43.420 14.551 32.129  1.00 59.25  ? 2490 THR B CA  1 
ATOM   1403 C C   . THR B 1 60  ? -42.538 14.031 30.978  1.00 59.40  ? 2490 THR B C   1 
ATOM   1404 O O   . THR B 1 60  ? -42.262 12.833 30.888  1.00 57.61  ? 2490 THR B O   1 
ATOM   1405 C CB  . THR B 1 60  ? -44.854 14.866 31.621  1.00 53.46  ? 2490 THR B CB  1 
ATOM   1406 O OG1 . THR B 1 60  ? -45.619 15.421 32.692  1.00 63.78  ? 2490 THR B OG1 1 
ATOM   1407 C CG2 . THR B 1 60  ? -45.548 13.609 31.154  1.00 58.79  ? 2490 THR B CG2 1 
ATOM   1408 N N   . ILE B 1 61  ? -42.078 14.930 30.109  1.00 52.46  ? 2491 ILE B N   1 
ATOM   1409 C CA  . ILE B 1 61  ? -41.228 14.513 28.996  1.00 46.76  ? 2491 ILE B CA  1 
ATOM   1410 C C   . ILE B 1 61  ? -40.030 13.776 29.582  1.00 53.82  ? 2491 ILE B C   1 
ATOM   1411 O O   . ILE B 1 61  ? -39.775 12.609 29.262  1.00 66.82  ? 2491 ILE B O   1 
ATOM   1412 C CB  . ILE B 1 61  ? -40.784 15.719 28.121  1.00 47.48  ? 2491 ILE B CB  1 
ATOM   1413 C CG1 . ILE B 1 61  ? -42.012 16.403 27.491  1.00 49.50  ? 2491 ILE B CG1 1 
ATOM   1414 C CG2 . ILE B 1 61  ? -39.845 15.295 27.013  1.00 37.17  ? 2491 ILE B CG2 1 
ATOM   1415 C CD1 . ILE B 1 61  ? -41.658 17.378 26.403  1.00 42.42  ? 2491 ILE B CD1 1 
ATOM   1416 N N   . GLU B 1 62  ? -39.330 14.446 30.480  1.00 47.60  ? 2492 GLU B N   1 
ATOM   1417 C CA  . GLU B 1 62  ? -38.153 13.879 31.130  1.00 60.72  ? 2492 GLU B CA  1 
ATOM   1418 C C   . GLU B 1 62  ? -38.425 12.445 31.653  1.00 58.69  ? 2492 GLU B C   1 
ATOM   1419 O O   . GLU B 1 62  ? -37.602 11.550 31.519  1.00 60.87  ? 2492 GLU B O   1 
ATOM   1420 C CB  . GLU B 1 62  ? -37.734 14.807 32.287  1.00 66.59  ? 2492 GLU B CB  1 
ATOM   1421 C CG  . GLU B 1 62  ? -36.304 14.620 32.772  1.00 75.70  ? 2492 GLU B CG  1 
ATOM   1422 C CD  . GLU B 1 62  ? -35.309 15.223 31.800  1.00 79.79  ? 2492 GLU B CD  1 
ATOM   1423 O OE1 . GLU B 1 62  ? -35.222 16.474 31.732  1.00 69.12  ? 2492 GLU B OE1 1 
ATOM   1424 O OE2 . GLU B 1 62  ? -34.630 14.444 31.095  1.00 65.99  ? 2492 GLU B OE2 1 
ATOM   1425 N N   . LYS B 1 63  ? -39.599 12.259 32.239  1.00 56.23  ? 2493 LYS B N   1 
ATOM   1426 C CA  . LYS B 1 63  ? -40.024 10.979 32.811  1.00 61.21  ? 2493 LYS B CA  1 
ATOM   1427 C C   . LYS B 1 63  ? -40.199 9.955  31.705  1.00 55.79  ? 2493 LYS B C   1 
ATOM   1428 O O   . LYS B 1 63  ? -39.574 8.900  31.701  1.00 55.12  ? 2493 LYS B O   1 
ATOM   1429 C CB  . LYS B 1 63  ? -41.348 11.205 33.571  1.00 67.30  ? 2493 LYS B CB  1 
ATOM   1430 C CG  . LYS B 1 63  ? -41.875 10.064 34.409  1.00 71.66  ? 2493 LYS B CG  1 
ATOM   1431 C CD  . LYS B 1 63  ? -43.303 10.382 34.939  1.00 72.36  ? 2493 LYS B CD  1 
ATOM   1432 C CE  . LYS B 1 63  ? -44.375 10.229 33.837  1.00 82.84  ? 2493 LYS B CE  1 
ATOM   1433 N N   . GLN B 1 64  ? -41.028 10.294 30.729  1.00 62.78  ? 2494 GLN B N   1 
ATOM   1434 C CA  . GLN B 1 64  ? -41.284 9.401  29.600  1.00 58.82  ? 2494 GLN B CA  1 
ATOM   1435 C C   . GLN B 1 64  ? -40.026 9.023  28.813  1.00 53.10  ? 2494 GLN B C   1 
ATOM   1436 O O   . GLN B 1 64  ? -39.922 7.923  28.304  1.00 64.01  ? 2494 GLN B O   1 
ATOM   1437 C CB  . GLN B 1 64  ? -42.329 10.029 28.692  1.00 59.22  ? 2494 GLN B CB  1 
ATOM   1438 C CG  . GLN B 1 64  ? -43.740 10.119 29.329  1.00 57.66  ? 2494 GLN B CG  1 
ATOM   1439 C CD  . GLN B 1 64  ? -44.647 11.068 28.582  1.00 59.31  ? 2494 GLN B CD  1 
ATOM   1440 O OE1 . GLN B 1 64  ? -44.212 11.734 27.635  1.00 63.89  ? 2494 GLN B OE1 1 
ATOM   1441 N NE2 . GLN B 1 64  ? -45.907 11.146 28.994  1.00 46.73  ? 2494 GLN B NE2 1 
ATOM   1442 N N   . ILE B 1 65  ? -39.041 9.900  28.739  1.00 60.00  ? 2495 ILE B N   1 
ATOM   1443 C CA  . ILE B 1 65  ? -37.805 9.546  28.030  1.00 55.71  ? 2495 ILE B CA  1 
ATOM   1444 C C   . ILE B 1 65  ? -37.254 8.298  28.651  1.00 52.40  ? 2495 ILE B C   1 
ATOM   1445 O O   . ILE B 1 65  ? -36.967 7.341  27.981  1.00 51.68  ? 2495 ILE B O   1 
ATOM   1446 C CB  . ILE B 1 65  ? -36.720 10.626 28.165  1.00 55.18  ? 2495 ILE B CB  1 
ATOM   1447 C CG1 . ILE B 1 65  ? -37.057 11.831 27.322  1.00 50.87  ? 2495 ILE B CG1 1 
ATOM   1448 C CG2 . ILE B 1 65  ? -35.330 10.080 27.751  1.00 53.94  ? 2495 ILE B CG2 1 
ATOM   1449 C CD1 . ILE B 1 65  ? -36.145 12.951 27.620  1.00 47.40  ? 2495 ILE B CD1 1 
ATOM   1450 N N   . LEU B 1 66  ? -37.079 8.337  29.965  1.00 62.94  ? 2496 LEU B N   1 
ATOM   1451 C CA  . LEU B 1 66  ? -36.477 7.212  30.705  1.00 58.82  ? 2496 LEU B CA  1 
ATOM   1452 C C   . LEU B 1 66  ? -37.119 5.828  30.429  1.00 60.75  ? 2496 LEU B C   1 
ATOM   1453 O O   . LEU B 1 66  ? -36.490 4.790  30.654  1.00 67.56  ? 2496 LEU B O   1 
ATOM   1454 C CB  . LEU B 1 66  ? -36.545 7.509  32.200  1.00 57.26  ? 2496 LEU B CB  1 
ATOM   1455 C CG  . LEU B 1 66  ? -35.821 8.743  32.776  1.00 62.42  ? 2496 LEU B CG  1 
ATOM   1456 C CD1 . LEU B 1 66  ? -36.038 8.834  34.300  1.00 55.67  ? 2496 LEU B CD1 1 
ATOM   1457 C CD2 . LEU B 1 66  ? -34.300 8.742  32.438  1.00 49.47  ? 2496 LEU B CD2 1 
ATOM   1458 N N   . THR B 1 67  ? -38.358 5.838  29.936  1.00 57.23  ? 2497 THR B N   1 
ATOM   1459 C CA  . THR B 1 67  ? -39.173 4.634  29.655  1.00 50.17  ? 2497 THR B CA  1 
ATOM   1460 C C   . THR B 1 67  ? -38.868 4.039  28.295  1.00 55.67  ? 2497 THR B C   1 
ATOM   1461 O O   . THR B 1 67  ? -39.218 2.887  27.998  1.00 42.26  ? 2497 THR B O   1 
ATOM   1462 C CB  . THR B 1 67  ? -40.670 5.035  29.679  1.00 47.03  ? 2497 THR B CB  1 
ATOM   1463 O OG1 . THR B 1 67  ? -41.138 4.963  31.034  1.00 48.46  ? 2497 THR B OG1 1 
ATOM   1464 C CG2 . THR B 1 67  ? -41.552 4.191  28.749  1.00 54.95  ? 2497 THR B CG2 1 
ATOM   1465 N N   . GLY B 1 68  ? -38.245 4.851  27.451  1.00 51.98  ? 2498 GLY B N   1 
ATOM   1466 C CA  . GLY B 1 68  ? -38.197 4.574  26.042  1.00 47.91  ? 2498 GLY B CA  1 
ATOM   1467 C C   . GLY B 1 68  ? -39.520 4.906  25.378  1.00 47.90  ? 2498 GLY B C   1 
ATOM   1468 O O   . GLY B 1 68  ? -39.810 4.426  24.289  1.00 45.47  ? 2498 GLY B O   1 
ATOM   1469 N N   . TYR B 1 69  ? -40.329 5.742  26.011  1.00 43.51  ? 2499 TYR B N   1 
ATOM   1470 C CA  . TYR B 1 69  ? -41.588 6.168  25.396  1.00 49.41  ? 2499 TYR B CA  1 
ATOM   1471 C C   . TYR B 1 69  ? -41.451 6.809  23.997  1.00 56.79  ? 2499 TYR B C   1 
ATOM   1472 O O   . TYR B 1 69  ? -42.395 6.781  23.203  1.00 60.64  ? 2499 TYR B O   1 
ATOM   1473 C CB  . TYR B 1 69  ? -42.245 7.143  26.330  1.00 50.13  ? 2499 TYR B CB  1 
ATOM   1474 C CG  . TYR B 1 69  ? -43.442 7.880  25.817  1.00 56.80  ? 2499 TYR B CG  1 
ATOM   1475 C CD1 . TYR B 1 69  ? -44.726 7.406  26.030  1.00 60.64  ? 2499 TYR B CD1 1 
ATOM   1476 C CD2 . TYR B 1 69  ? -43.296 9.105  25.197  1.00 65.48  ? 2499 TYR B CD2 1 
ATOM   1477 C CE1 . TYR B 1 69  ? -45.839 8.127  25.589  1.00 57.87  ? 2499 TYR B CE1 1 
ATOM   1478 C CE2 . TYR B 1 69  ? -44.401 9.838  24.766  1.00 68.98  ? 2499 TYR B CE2 1 
ATOM   1479 C CZ  . TYR B 1 69  ? -45.663 9.337  24.959  1.00 62.21  ? 2499 TYR B CZ  1 
ATOM   1480 O OH  . TYR B 1 69  ? -46.733 10.064 24.510  1.00 67.64  ? 2499 TYR B OH  1 
ATOM   1481 N N   . TYR B 1 70  ? -40.302 7.419  23.715  1.00 61.75  ? 2500 TYR B N   1 
ATOM   1482 C CA  . TYR B 1 70  ? -40.078 8.103  22.441  1.00 58.12  ? 2500 TYR B CA  1 
ATOM   1483 C C   . TYR B 1 70  ? -39.264 7.211  21.505  1.00 61.20  ? 2500 TYR B C   1 
ATOM   1484 O O   . TYR B 1 70  ? -38.052 7.069  21.655  1.00 52.72  ? 2500 TYR B O   1 
ATOM   1485 C CB  . TYR B 1 70  ? -39.352 9.431  22.674  1.00 61.37  ? 2500 TYR B CB  1 
ATOM   1486 C CG  . TYR B 1 70  ? -40.160 10.447 23.444  1.00 59.19  ? 2500 TYR B CG  1 
ATOM   1487 C CD1 . TYR B 1 70  ? -41.189 11.148 22.838  1.00 60.64  ? 2500 TYR B CD1 1 
ATOM   1488 C CD2 . TYR B 1 70  ? -39.893 10.703 24.783  1.00 61.29  ? 2500 TYR B CD2 1 
ATOM   1489 C CE1 . TYR B 1 70  ? -41.929 12.092 23.554  1.00 59.83  ? 2500 TYR B CE1 1 
ATOM   1490 C CE2 . TYR B 1 70  ? -40.623 11.633 25.507  1.00 54.67  ? 2500 TYR B CE2 1 
ATOM   1491 C CZ  . TYR B 1 70  ? -41.634 12.330 24.891  1.00 58.61  ? 2500 TYR B CZ  1 
ATOM   1492 O OH  . TYR B 1 70  ? -42.367 13.257 25.610  1.00 54.15  ? 2500 TYR B OH  1 
ATOM   1493 N N   . LYS B 1 71  ? -39.938 6.609  20.532  1.00 65.19  ? 2501 LYS B N   1 
ATOM   1494 C CA  . LYS B 1 71  ? -39.310 5.582  19.705  1.00 64.56  ? 2501 LYS B CA  1 
ATOM   1495 C C   . LYS B 1 71  ? -38.680 6.253  18.479  1.00 59.52  ? 2501 LYS B C   1 
ATOM   1496 O O   . LYS B 1 71  ? -37.705 5.747  17.908  1.00 50.80  ? 2501 LYS B O   1 
ATOM   1497 C CB  . LYS B 1 71  ? -40.316 4.487  19.336  1.00 67.65  ? 2501 LYS B CB  1 
ATOM   1498 N N   . THR B 1 72  ? -39.214 7.424  18.126  1.00 54.79  ? 2502 THR B N   1 
ATOM   1499 C CA  . THR B 1 72  ? -38.625 8.297  17.120  1.00 57.24  ? 2502 THR B CA  1 
ATOM   1500 C C   . THR B 1 72  ? -38.391 9.727  17.630  1.00 57.67  ? 2502 THR B C   1 
ATOM   1501 O O   . THR B 1 72  ? -39.086 10.226 18.545  1.00 51.75  ? 2502 THR B O   1 
ATOM   1502 C CB  . THR B 1 72  ? -39.523 8.415  15.900  1.00 56.68  ? 2502 THR B CB  1 
ATOM   1503 O OG1 . THR B 1 72  ? -40.632 9.276  16.213  1.00 59.61  ? 2502 THR B OG1 1 
ATOM   1504 C CG2 . THR B 1 72  ? -39.997 7.024  15.462  1.00 54.70  ? 2502 THR B CG2 1 
ATOM   1505 N N   . VAL B 1 73  ? -37.454 10.410 16.973  1.00 58.30  ? 2503 VAL B N   1 
ATOM   1506 C CA  . VAL B 1 73  ? -37.165 11.804 17.295  1.00 52.60  ? 2503 VAL B CA  1 
ATOM   1507 C C   . VAL B 1 73  ? -38.300 12.743 16.914  1.00 57.35  ? 2503 VAL B C   1 
ATOM   1508 O O   . VAL B 1 73  ? -38.463 13.814 17.504  1.00 68.03  ? 2503 VAL B O   1 
ATOM   1509 C CB  . VAL B 1 73  ? -35.918 12.260 16.602  1.00 51.18  ? 2503 VAL B CB  1 
ATOM   1510 C CG1 . VAL B 1 73  ? -36.217 12.626 15.130  1.00 45.71  ? 2503 VAL B CG1 1 
ATOM   1511 C CG2 . VAL B 1 73  ? -35.351 13.406 17.363  1.00 43.81  ? 2503 VAL B CG2 1 
ATOM   1512 N N   . GLU B 1 74  ? -39.099 12.347 15.938  1.00 58.36  ? 2504 GLU B N   1 
ATOM   1513 C CA  . GLU B 1 74  ? -40.285 13.141 15.594  1.00 69.68  ? 2504 GLU B CA  1 
ATOM   1514 C C   . GLU B 1 74  ? -41.273 13.206 16.739  1.00 55.44  ? 2504 GLU B C   1 
ATOM   1515 O O   . GLU B 1 74  ? -41.914 14.222 16.926  1.00 57.78  ? 2504 GLU B O   1 
ATOM   1516 C CB  . GLU B 1 74  ? -40.991 12.596 14.348  1.00 77.56  ? 2504 GLU B CB  1 
ATOM   1517 C CG  . GLU B 1 74  ? -40.285 12.935 13.027  1.00 78.69  ? 2504 GLU B CG  1 
ATOM   1518 C CD  . GLU B 1 74  ? -39.060 12.065 12.736  1.00 87.02  ? 2504 GLU B CD  1 
ATOM   1519 O OE1 . GLU B 1 74  ? -38.102 12.578 12.102  1.00 95.46  ? 2504 GLU B OE1 1 
ATOM   1520 O OE2 . GLU B 1 74  ? -39.050 10.875 13.130  1.00 89.75  ? 2504 GLU B OE2 1 
ATOM   1521 N N   . ALA B 1 75  ? -41.409 12.113 17.479  1.00 57.65  ? 2505 ALA B N   1 
ATOM   1522 C CA  . ALA B 1 75  ? -42.355 12.046 18.598  1.00 58.87  ? 2505 ALA B CA  1 
ATOM   1523 C C   . ALA B 1 75  ? -41.851 12.970 19.698  1.00 59.58  ? 2505 ALA B C   1 
ATOM   1524 O O   . ALA B 1 75  ? -42.611 13.739 20.283  1.00 61.60  ? 2505 ALA B O   1 
ATOM   1525 C CB  . ALA B 1 75  ? -42.491 10.606 19.104  1.00 52.90  ? 2505 ALA B CB  1 
ATOM   1526 N N   . PHE B 1 76  ? -40.544 12.910 19.928  1.00 62.49  ? 2506 PHE B N   1 
ATOM   1527 C CA  . PHE B 1 76  ? -39.845 13.797 20.865  1.00 54.25  ? 2506 PHE B CA  1 
ATOM   1528 C C   . PHE B 1 76  ? -39.977 15.259 20.473  1.00 51.06  ? 2506 PHE B C   1 
ATOM   1529 O O   . PHE B 1 76  ? -40.356 16.075 21.278  1.00 48.93  ? 2506 PHE B O   1 
ATOM   1530 C CB  . PHE B 1 76  ? -38.365 13.418 20.902  1.00 53.55  ? 2506 PHE B CB  1 
ATOM   1531 C CG  . PHE B 1 76  ? -37.544 14.246 21.831  1.00 54.52  ? 2506 PHE B CG  1 
ATOM   1532 C CD1 . PHE B 1 76  ? -37.876 14.346 23.163  1.00 52.76  ? 2506 PHE B CD1 1 
ATOM   1533 C CD2 . PHE B 1 76  ? -36.422 14.908 21.385  1.00 53.88  ? 2506 PHE B CD2 1 
ATOM   1534 C CE1 . PHE B 1 76  ? -37.131 15.104 24.015  1.00 47.54  ? 2506 PHE B CE1 1 
ATOM   1535 C CE2 . PHE B 1 76  ? -35.680 15.671 22.257  1.00 49.37  ? 2506 PHE B CE2 1 
ATOM   1536 C CZ  . PHE B 1 76  ? -36.036 15.759 23.567  1.00 45.30  ? 2506 PHE B CZ  1 
ATOM   1537 N N   . ASP B 1 77  ? -39.615 15.586 19.240  1.00 54.16  ? 2507 ASP B N   1 
ATOM   1538 C CA  . ASP B 1 77  ? -39.808 16.931 18.724  1.00 47.87  ? 2507 ASP B CA  1 
ATOM   1539 C C   . ASP B 1 77  ? -41.230 17.414 18.970  1.00 51.59  ? 2507 ASP B C   1 
ATOM   1540 O O   . ASP B 1 77  ? -41.441 18.536 19.403  1.00 57.36  ? 2507 ASP B O   1 
ATOM   1541 C CB  . ASP B 1 77  ? -39.514 16.962 17.225  1.00 51.24  ? 2507 ASP B CB  1 
ATOM   1542 C CG  . ASP B 1 77  ? -38.042 17.048 16.932  1.00 59.03  ? 2507 ASP B CG  1 
ATOM   1543 O OD1 . ASP B 1 77  ? -37.261 17.203 17.893  1.00 56.24  ? 2507 ASP B OD1 1 
ATOM   1544 O OD2 . ASP B 1 77  ? -37.660 16.971 15.751  1.00 70.25  ? 2507 ASP B OD2 1 
ATOM   1545 N N   . ALA B 1 78  ? -42.214 16.573 18.681  1.00 60.21  ? 2508 ALA B N   1 
ATOM   1546 C CA  . ALA B 1 78  ? -43.626 16.985 18.766  1.00 59.76  ? 2508 ALA B CA  1 
ATOM   1547 C C   . ALA B 1 78  ? -43.950 17.367 20.198  1.00 62.57  ? 2508 ALA B C   1 
ATOM   1548 O O   . ALA B 1 78  ? -44.497 18.453 20.462  1.00 63.81  ? 2508 ALA B O   1 
ATOM   1549 C CB  . ALA B 1 78  ? -44.556 15.863 18.278  1.00 61.07  ? 2508 ALA B CB  1 
ATOM   1550 N N   . ASP B 1 79  ? -43.567 16.500 21.137  1.00 55.53  ? 2509 ASP B N   1 
ATOM   1551 C CA  . ASP B 1 79  ? -43.786 16.791 22.553  1.00 52.79  ? 2509 ASP B CA  1 
ATOM   1552 C C   . ASP B 1 79  ? -43.005 18.030 23.030  1.00 55.12  ? 2509 ASP B C   1 
ATOM   1553 O O   . ASP B 1 79  ? -43.578 18.918 23.718  1.00 44.79  ? 2509 ASP B O   1 
ATOM   1554 C CB  . ASP B 1 79  ? -43.459 15.582 23.432  1.00 56.78  ? 2509 ASP B CB  1 
ATOM   1555 C CG  . ASP B 1 79  ? -44.634 14.603 23.585  1.00 62.27  ? 2509 ASP B CG  1 
ATOM   1556 O OD1 . ASP B 1 79  ? -45.677 14.751 22.902  1.00 70.61  ? 2509 ASP B OD1 1 
ATOM   1557 O OD2 . ASP B 1 79  ? -44.507 13.669 24.420  1.00 62.08  ? 2509 ASP B OD2 1 
ATOM   1558 N N   . MET B 1 80  ? -41.714 18.115 22.698  1.00 47.32  ? 2510 MET B N   1 
ATOM   1559 C CA  . MET B 1 80  ? -40.953 19.299 23.129  1.00 49.34  ? 2510 MET B CA  1 
ATOM   1560 C C   . MET B 1 80  ? -41.634 20.547 22.591  1.00 46.41  ? 2510 MET B C   1 
ATOM   1561 O O   . MET B 1 80  ? -42.029 21.378 23.385  1.00 39.83  ? 2510 MET B O   1 
ATOM   1562 C CB  . MET B 1 80  ? -39.473 19.261 22.727  1.00 49.62  ? 2510 MET B CB  1 
ATOM   1563 C CG  . MET B 1 80  ? -38.648 18.264 23.541  1.00 53.54  ? 2510 MET B CG  1 
ATOM   1564 S SD  . MET B 1 80  ? -38.396 18.713 25.272  1.00 58.93  ? 2510 MET B SD  1 
ATOM   1565 C CE  . MET B 1 80  ? -36.987 19.850 25.125  1.00 50.78  ? 2510 MET B CE  1 
ATOM   1566 N N   . LEU B 1 81  ? -41.839 20.640 21.270  1.00 44.31  ? 2511 LEU B N   1 
ATOM   1567 C CA  . LEU B 1 81  ? -42.392 21.860 20.667  1.00 48.99  ? 2511 LEU B CA  1 
ATOM   1568 C C   . LEU B 1 81  ? -43.798 22.216 21.149  1.00 53.80  ? 2511 LEU B C   1 
ATOM   1569 O O   . LEU B 1 81  ? -44.158 23.390 21.164  1.00 53.60  ? 2511 LEU B O   1 
ATOM   1570 C CB  . LEU B 1 81  ? -42.364 21.782 19.145  1.00 55.10  ? 2511 LEU B CB  1 
ATOM   1571 C CG  . LEU B 1 81  ? -40.967 21.710 18.508  1.00 55.42  ? 2511 LEU B CG  1 
ATOM   1572 C CD1 . LEU B 1 81  ? -41.048 21.832 17.002  1.00 44.10  ? 2511 LEU B CD1 1 
ATOM   1573 C CD2 . LEU B 1 81  ? -40.036 22.768 19.081  1.00 55.23  ? 2511 LEU B CD2 1 
ATOM   1574 N N   . LYS B 1 82  ? -44.575 21.208 21.541  1.00 55.70  ? 2512 LYS B N   1 
ATOM   1575 C CA  . LYS B 1 82  ? -45.927 21.407 22.085  1.00 57.39  ? 2512 LYS B CA  1 
ATOM   1576 C C   . LYS B 1 82  ? -45.889 22.131 23.436  1.00 65.47  ? 2512 LYS B C   1 
ATOM   1577 O O   . LYS B 1 82  ? -46.745 22.985 23.744  1.00 72.87  ? 2512 LYS B O   1 
ATOM   1578 C CB  . LYS B 1 82  ? -46.618 20.046 22.237  1.00 64.30  ? 2512 LYS B CB  1 
ATOM   1579 C CG  . LYS B 1 82  ? -48.018 20.070 22.829  1.00 69.17  ? 2512 LYS B CG  1 
ATOM   1580 C CD  . LYS B 1 82  ? -48.770 18.725 22.593  1.00 78.05  ? 2512 LYS B CD  1 
ATOM   1581 C CE  . LYS B 1 82  ? -48.322 17.622 23.569  1.00 85.48  ? 2512 LYS B CE  1 
ATOM   1582 N NZ  . LYS B 1 82  ? -48.492 16.246 23.030  1.00 87.76  ? 2512 LYS B NZ  1 
ATOM   1583 N N   . VAL B 1 83  ? -44.914 21.764 24.258  1.00 51.30  ? 2513 VAL B N   1 
ATOM   1584 C CA  . VAL B 1 83  ? -44.651 22.468 25.498  1.00 50.04  ? 2513 VAL B CA  1 
ATOM   1585 C C   . VAL B 1 83  ? -44.301 23.945 25.223  1.00 58.23  ? 2513 VAL B C   1 
ATOM   1586 O O   . VAL B 1 83  ? -44.807 24.845 25.905  1.00 64.53  ? 2513 VAL B O   1 
ATOM   1587 C CB  . VAL B 1 83  ? -43.495 21.817 26.309  1.00 55.04  ? 2513 VAL B CB  1 
ATOM   1588 C CG1 . VAL B 1 83  ? -43.167 22.670 27.525  1.00 45.58  ? 2513 VAL B CG1 1 
ATOM   1589 C CG2 . VAL B 1 83  ? -43.857 20.368 26.727  1.00 55.62  ? 2513 VAL B CG2 1 
ATOM   1590 N N   . PHE B 1 84  ? -43.469 24.218 24.225  1.00 57.04  ? 2514 PHE B N   1 
ATOM   1591 C CA  . PHE B 1 84  ? -43.179 25.630 23.904  1.00 63.53  ? 2514 PHE B CA  1 
ATOM   1592 C C   . PHE B 1 84  ? -44.426 26.359 23.370  1.00 69.44  ? 2514 PHE B C   1 
ATOM   1593 O O   . PHE B 1 84  ? -44.737 27.479 23.809  1.00 70.23  ? 2514 PHE B O   1 
ATOM   1594 C CB  . PHE B 1 84  ? -42.074 25.779 22.860  1.00 63.06  ? 2514 PHE B CB  1 
ATOM   1595 C CG  . PHE B 1 84  ? -40.728 25.224 23.266  1.00 60.48  ? 2514 PHE B CG  1 
ATOM   1596 C CD1 . PHE B 1 84  ? -40.265 25.301 24.575  1.00 61.62  ? 2514 PHE B CD1 1 
ATOM   1597 C CD2 . PHE B 1 84  ? -39.874 24.687 22.286  1.00 66.28  ? 2514 PHE B CD2 1 
ATOM   1598 C CE1 . PHE B 1 84  ? -38.984 24.801 24.928  1.00 53.23  ? 2514 PHE B CE1 1 
ATOM   1599 C CE2 . PHE B 1 84  ? -38.591 24.204 22.617  1.00 56.53  ? 2514 PHE B CE2 1 
ATOM   1600 C CZ  . PHE B 1 84  ? -38.153 24.252 23.941  1.00 58.42  ? 2514 PHE B CZ  1 
ATOM   1601 N N   . ARG B 1 85  ? -45.124 25.721 22.425  1.00 66.82  ? 2515 ARG B N   1 
ATOM   1602 C CA  . ARG B 1 85  ? -46.290 26.323 21.761  1.00 69.40  ? 2515 ARG B CA  1 
ATOM   1603 C C   . ARG B 1 85  ? -47.382 26.641 22.782  1.00 72.02  ? 2515 ARG B C   1 
ATOM   1604 O O   . ARG B 1 85  ? -47.855 27.770 22.834  1.00 95.46  ? 2515 ARG B O   1 
ATOM   1605 C CB  . ARG B 1 85  ? -46.829 25.382 20.688  1.00 69.41  ? 2515 ARG B CB  1 
ATOM   1606 C CG  . ARG B 1 85  ? -47.441 26.029 19.487  1.00 60.62  ? 2515 ARG B CG  1 
ATOM   1607 C CD  . ARG B 1 85  ? -48.536 25.130 18.887  1.00 65.84  ? 2515 ARG B CD  1 
ATOM   1608 N NE  . ARG B 1 85  ? -48.381 23.685 19.152  1.00 62.97  ? 2515 ARG B NE  1 
ATOM   1609 C CZ  . ARG B 1 85  ? -47.412 22.899 18.666  1.00 58.00  ? 2515 ARG B CZ  1 
ATOM   1610 N NH1 . ARG B 1 85  ? -46.449 23.381 17.891  1.00 62.03  ? 2515 ARG B NH1 1 
ATOM   1611 N NH2 . ARG B 1 85  ? -47.386 21.608 18.980  1.00 58.90  ? 2515 ARG B NH2 1 
ATOM   1612 N N   . ASN B 1 86  ? -47.751 25.660 23.609  1.00 70.18  ? 2516 ASN B N   1 
ATOM   1613 C CA  . ASN B 1 86  ? -48.698 25.872 24.720  1.00 61.65  ? 2516 ASN B CA  1 
ATOM   1614 C C   . ASN B 1 86  ? -48.303 27.037 25.624  1.00 63.60  ? 2516 ASN B C   1 
ATOM   1615 O O   . ASN B 1 86  ? -49.173 27.710 26.204  1.00 60.82  ? 2516 ASN B O   1 
ATOM   1616 C CB  . ASN B 1 86  ? -48.829 24.616 25.590  1.00 64.88  ? 2516 ASN B CB  1 
ATOM   1617 C CG  . ASN B 1 86  ? -49.618 23.503 24.914  1.00 67.80  ? 2516 ASN B CG  1 
ATOM   1618 O OD1 . ASN B 1 86  ? -50.177 23.694 23.849  1.00 69.57  ? 2516 ASN B OD1 1 
ATOM   1619 N ND2 . ASN B 1 86  ? -49.662 22.335 25.539  1.00 74.47  ? 2516 ASN B ND2 1 
ATOM   1620 N N   . ALA B 1 87  ? -47.001 27.283 25.758  1.00 61.79  ? 2517 ALA B N   1 
ATOM   1621 C CA  . ALA B 1 87  ? -46.545 28.362 26.648  1.00 63.71  ? 2517 ALA B CA  1 
ATOM   1622 C C   . ALA B 1 87  ? -46.812 29.708 25.981  1.00 60.30  ? 2517 ALA B C   1 
ATOM   1623 O O   . ALA B 1 87  ? -47.339 30.616 26.603  1.00 61.57  ? 2517 ALA B O   1 
ATOM   1624 C CB  . ALA B 1 87  ? -45.078 28.203 27.009  1.00 58.63  ? 2517 ALA B CB  1 
ATOM   1625 N N   . GLU B 1 88  ? -46.491 29.811 24.700  1.00 69.71  ? 2518 GLU B N   1 
ATOM   1626 C CA  . GLU B 1 88  ? -46.785 31.013 23.924  1.00 76.65  ? 2518 GLU B CA  1 
ATOM   1627 C C   . GLU B 1 88  ? -48.287 31.254 23.756  1.00 84.07  ? 2518 GLU B C   1 
ATOM   1628 O O   . GLU B 1 88  ? -48.741 32.405 23.811  1.00 81.34  ? 2518 GLU B O   1 
ATOM   1629 C CB  . GLU B 1 88  ? -46.114 30.924 22.564  1.00 82.00  ? 2518 GLU B CB  1 
ATOM   1630 C CG  . GLU B 1 88  ? -44.612 30.927 22.685  1.00 87.87  ? 2518 GLU B CG  1 
ATOM   1631 C CD  . GLU B 1 88  ? -43.935 30.721 21.380  1.00 86.38  ? 2518 GLU B CD  1 
ATOM   1632 O OE1 . GLU B 1 88  ? -44.432 29.891 20.584  1.00 83.80  ? 2518 GLU B OE1 1 
ATOM   1633 O OE2 . GLU B 1 88  ? -42.886 31.364 21.161  1.00 97.88  ? 2518 GLU B OE2 1 
ATOM   1634 N N   . LYS B 1 89  ? -49.054 30.177 23.573  1.00 79.58  ? 2519 LYS B N   1 
ATOM   1635 C CA  . LYS B 1 89  ? -50.503 30.301 23.426  1.00 83.11  ? 2519 LYS B CA  1 
ATOM   1636 C C   . LYS B 1 89  ? -51.087 30.873 24.715  1.00 91.10  ? 2519 LYS B C   1 
ATOM   1637 O O   . LYS B 1 89  ? -51.973 31.715 24.649  1.00 107.51 ? 2519 LYS B O   1 
ATOM   1638 C CB  . LYS B 1 89  ? -51.168 28.957 23.064  1.00 77.67  ? 2519 LYS B CB  1 
ATOM   1639 C CG  . LYS B 1 89  ? -52.541 29.087 22.379  1.00 56.48  ? 2519 LYS B CG  1 
ATOM   1640 N N   . TYR B 1 90  ? -50.572 30.453 25.875  1.00 87.86  ? 2520 TYR B N   1 
ATOM   1641 C CA  . TYR B 1 90  ? -51.115 30.901 27.172  1.00 79.92  ? 2520 TYR B CA  1 
ATOM   1642 C C   . TYR B 1 90  ? -50.567 32.219 27.724  1.00 78.69  ? 2520 TYR B C   1 
ATOM   1643 O O   . TYR B 1 90  ? -51.319 32.995 28.298  1.00 97.60  ? 2520 TYR B O   1 
ATOM   1644 C CB  . TYR B 1 90  ? -50.913 29.838 28.240  1.00 81.21  ? 2520 TYR B CB  1 
ATOM   1645 C CG  . TYR B 1 90  ? -51.605 30.176 29.540  1.00 87.60  ? 2520 TYR B CG  1 
ATOM   1646 C CD1 . TYR B 1 90  ? -52.968 29.961 29.698  1.00 91.55  ? 2520 TYR B CD1 1 
ATOM   1647 C CD2 . TYR B 1 90  ? -50.902 30.723 30.608  1.00 87.08  ? 2520 TYR B CD2 1 
ATOM   1648 C CE1 . TYR B 1 90  ? -53.610 30.265 30.895  1.00 91.55  ? 2520 TYR B CE1 1 
ATOM   1649 C CE2 . TYR B 1 90  ? -51.534 31.032 31.804  1.00 92.22  ? 2520 TYR B CE2 1 
ATOM   1650 C CZ  . TYR B 1 90  ? -52.887 30.799 31.940  1.00 94.60  ? 2520 TYR B CZ  1 
ATOM   1651 O OH  . TYR B 1 90  ? -53.515 31.107 33.122  1.00 92.31  ? 2520 TYR B OH  1 
ATOM   1652 N N   . TYR B 1 91  ? -49.271 32.459 27.598  1.00 76.17  ? 2521 TYR B N   1 
ATOM   1653 C CA  . TYR B 1 91  ? -48.668 33.691 28.116  1.00 78.66  ? 2521 TYR B CA  1 
ATOM   1654 C C   . TYR B 1 91  ? -48.535 34.773 27.056  1.00 81.70  ? 2521 TYR B C   1 
ATOM   1655 O O   . TYR B 1 91  ? -48.519 35.942 27.392  1.00 81.61  ? 2521 TYR B O   1 
ATOM   1656 C CB  . TYR B 1 91  ? -47.287 33.404 28.714  1.00 84.93  ? 2521 TYR B CB  1 
ATOM   1657 C CG  . TYR B 1 91  ? -47.365 32.467 29.886  1.00 80.45  ? 2521 TYR B CG  1 
ATOM   1658 C CD1 . TYR B 1 91  ? -47.696 32.944 31.137  1.00 76.74  ? 2521 TYR B CD1 1 
ATOM   1659 C CD2 . TYR B 1 91  ? -47.153 31.097 29.731  1.00 75.41  ? 2521 TYR B CD2 1 
ATOM   1660 C CE1 . TYR B 1 91  ? -47.801 32.093 32.211  1.00 83.55  ? 2521 TYR B CE1 1 
ATOM   1661 C CE2 . TYR B 1 91  ? -47.253 30.234 30.799  1.00 69.77  ? 2521 TYR B CE2 1 
ATOM   1662 C CZ  . TYR B 1 91  ? -47.576 30.738 32.035  1.00 77.43  ? 2521 TYR B CZ  1 
ATOM   1663 O OH  . TYR B 1 91  ? -47.698 29.907 33.109  1.00 69.07  ? 2521 TYR B OH  1 
ATOM   1664 N N   . GLY B 1 92  ? -48.407 34.382 25.789  1.00 86.84  ? 2522 GLY B N   1 
ATOM   1665 C CA  . GLY B 1 92  ? -48.257 35.341 24.696  1.00 88.18  ? 2522 GLY B CA  1 
ATOM   1666 C C   . GLY B 1 92  ? -46.811 35.473 24.290  1.00 83.43  ? 2522 GLY B C   1 
ATOM   1667 O O   . GLY B 1 92  ? -45.951 35.688 25.137  1.00 83.56  ? 2522 GLY B O   1 
ATOM   1668 N N   . ARG B 1 93  ? -46.550 35.374 22.989  1.00 91.30  ? 2523 ARG B N   1 
ATOM   1669 C CA  . ARG B 1 93  ? -45.194 35.477 22.454  1.00 90.45  ? 2523 ARG B CA  1 
ATOM   1670 C C   . ARG B 1 93  ? -44.416 36.666 23.041  1.00 93.20  ? 2523 ARG B C   1 
ATOM   1671 O O   . ARG B 1 93  ? -43.188 36.615 23.149  1.00 91.42  ? 2523 ARG B O   1 
ATOM   1672 C CB  . ARG B 1 93  ? -45.238 35.572 20.920  1.00 86.05  ? 2523 ARG B CB  1 
ATOM   1673 N N   . LYS B 1 94  ? -45.137 37.715 23.444  1.00 102.82 ? 2524 LYS B N   1 
ATOM   1674 C CA  . LYS B 1 94  ? -44.534 38.987 23.867  1.00 100.99 ? 2524 LYS B CA  1 
ATOM   1675 C C   . LYS B 1 94  ? -44.290 39.094 25.378  1.00 105.95 ? 2524 LYS B C   1 
ATOM   1676 O O   . LYS B 1 94  ? -43.518 39.948 25.819  1.00 125.40 ? 2524 LYS B O   1 
ATOM   1677 C CB  . LYS B 1 94  ? -45.413 40.153 23.406  1.00 91.36  ? 2524 LYS B CB  1 
ATOM   1678 N N   . SER B 1 95  ? -44.947 38.237 26.161  1.00 96.55  ? 2525 SER B N   1 
ATOM   1679 C CA  . SER B 1 95  ? -44.768 38.183 27.625  1.00 99.31  ? 2525 SER B CA  1 
ATOM   1680 C C   . SER B 1 95  ? -43.343 37.743 28.014  1.00 97.21  ? 2525 SER B C   1 
ATOM   1681 O O   . SER B 1 95  ? -42.620 37.201 27.179  1.00 90.88  ? 2525 SER B O   1 
ATOM   1682 C CB  . SER B 1 95  ? -45.800 37.214 28.224  1.00 94.72  ? 2525 SER B CB  1 
ATOM   1683 O OG  . SER B 1 95  ? -45.740 35.948 27.586  1.00 79.70  ? 2525 SER B OG  1 
ATOM   1684 N N   . PRO B 1 96  ? -42.936 37.954 29.284  1.00 91.06  ? 2526 PRO B N   1 
ATOM   1685 C CA  . PRO B 1 96  ? -41.571 37.555 29.645  1.00 92.52  ? 2526 PRO B CA  1 
ATOM   1686 C C   . PRO B 1 96  ? -41.336 36.039 29.525  1.00 82.52  ? 2526 PRO B C   1 
ATOM   1687 O O   . PRO B 1 96  ? -40.215 35.609 29.276  1.00 84.18  ? 2526 PRO B O   1 
ATOM   1688 C CB  . PRO B 1 96  ? -41.456 38.000 31.106  1.00 95.96  ? 2526 PRO B CB  1 
ATOM   1689 C CG  . PRO B 1 96  ? -42.850 37.915 31.621  1.00 92.98  ? 2526 PRO B CG  1 
ATOM   1690 C CD  . PRO B 1 96  ? -43.716 38.347 30.473  1.00 91.32  ? 2526 PRO B CD  1 
ATOM   1691 N N   . VAL B 1 97  ? -42.391 35.249 29.696  1.00 71.44  ? 2527 VAL B N   1 
ATOM   1692 C CA  . VAL B 1 97  ? -42.316 33.801 29.512  1.00 62.37  ? 2527 VAL B CA  1 
ATOM   1693 C C   . VAL B 1 97  ? -42.198 33.385 28.036  1.00 70.48  ? 2527 VAL B C   1 
ATOM   1694 O O   . VAL B 1 97  ? -41.684 32.307 27.743  1.00 71.48  ? 2527 VAL B O   1 
ATOM   1695 C CB  . VAL B 1 97  ? -43.527 33.128 30.174  1.00 65.30  ? 2527 VAL B CB  1 
ATOM   1696 C CG1 . VAL B 1 97  ? -43.738 31.731 29.654  1.00 69.77  ? 2527 VAL B CG1 1 
ATOM   1697 C CG2 . VAL B 1 97  ? -43.345 33.126 31.709  1.00 64.61  ? 2527 VAL B CG2 1 
ATOM   1698 N N   . GLY B 1 98  ? -42.677 34.229 27.122  1.00 71.22  ? 2528 GLY B N   1 
ATOM   1699 C CA  . GLY B 1 98  ? -42.568 33.979 25.682  1.00 80.64  ? 2528 GLY B CA  1 
ATOM   1700 C C   . GLY B 1 98  ? -41.210 34.408 25.154  1.00 83.07  ? 2528 GLY B C   1 
ATOM   1701 O O   . GLY B 1 98  ? -40.604 33.735 24.322  1.00 71.86  ? 2528 GLY B O   1 
ATOM   1702 N N   . ARG B 1 99  ? -40.735 35.547 25.645  1.00 89.68  ? 2529 ARG B N   1 
ATOM   1703 C CA  . ARG B 1 99  ? -39.372 35.991 25.390  1.00 87.71  ? 2529 ARG B CA  1 
ATOM   1704 C C   . ARG B 1 99  ? -38.418 34.843 25.730  1.00 80.02  ? 2529 ARG B C   1 
ATOM   1705 O O   . ARG B 1 99  ? -37.455 34.612 25.007  1.00 85.00  ? 2529 ARG B O   1 
ATOM   1706 C CB  . ARG B 1 99  ? -39.035 37.252 26.232  1.00 86.09  ? 2529 ARG B CB  1 
ATOM   1707 C CG  . ARG B 1 99  ? -39.776 38.558 25.819  1.00 76.63  ? 2529 ARG B CG  1 
ATOM   1708 C CD  . ARG B 1 99  ? -39.890 39.570 26.976  1.00 72.34  ? 2529 ARG B CD  1 
ATOM   1709 N N   . ASP B 1 100 ? -38.718 34.123 26.818  1.00 72.13  ? 2530 ASP B N   1 
ATOM   1710 C CA  . ASP B 1 100 ? -37.896 33.003 27.293  1.00 65.03  ? 2530 ASP B CA  1 
ATOM   1711 C C   . ASP B 1 100 ? -38.047 31.785 26.384  1.00 68.51  ? 2530 ASP B C   1 
ATOM   1712 O O   . ASP B 1 100 ? -37.059 31.264 25.842  1.00 71.58  ? 2530 ASP B O   1 
ATOM   1713 C CB  . ASP B 1 100 ? -38.306 32.581 28.711  1.00 72.56  ? 2530 ASP B CB  1 
ATOM   1714 C CG  . ASP B 1 100 ? -37.847 33.563 29.808  1.00 81.22  ? 2530 ASP B CG  1 
ATOM   1715 O OD1 . ASP B 1 100 ? -37.168 34.578 29.505  1.00 82.00  ? 2530 ASP B OD1 1 
ATOM   1716 O OD2 . ASP B 1 100 ? -38.173 33.291 30.997  1.00 70.96  ? 2530 ASP B OD2 1 
ATOM   1717 N N   . VAL B 1 101 ? -39.286 31.318 26.238  1.00 60.52  ? 2531 VAL B N   1 
ATOM   1718 C CA  . VAL B 1 101 ? -39.582 30.175 25.384  1.00 57.08  ? 2531 VAL B CA  1 
ATOM   1719 C C   . VAL B 1 101 ? -39.023 30.372 24.002  1.00 58.86  ? 2531 VAL B C   1 
ATOM   1720 O O   . VAL B 1 101 ? -38.442 29.457 23.428  1.00 63.24  ? 2531 VAL B O   1 
ATOM   1721 C CB  . VAL B 1 101 ? -41.076 29.945 25.211  1.00 52.61  ? 2531 VAL B CB  1 
ATOM   1722 C CG1 . VAL B 1 101 ? -41.327 29.027 24.020  1.00 54.04  ? 2531 VAL B CG1 1 
ATOM   1723 C CG2 . VAL B 1 101 ? -41.636 29.362 26.468  1.00 55.39  ? 2531 VAL B CG2 1 
ATOM   1724 N N   . CYS B 1 102 ? -39.208 31.564 23.457  1.00 60.54  ? 2532 CYS B N   1 
ATOM   1725 C CA  . CYS B 1 102 ? -38.619 31.876 22.172  1.00 60.68  ? 2532 CYS B CA  1 
ATOM   1726 C C   . CYS B 1 102 ? -37.138 31.524 22.172  1.00 61.14  ? 2532 CYS B C   1 
ATOM   1727 O O   . CYS B 1 102 ? -36.674 30.829 21.266  1.00 72.95  ? 2532 CYS B O   1 
ATOM   1728 C CB  . CYS B 1 102 ? -38.788 33.356 21.829  1.00 73.85  ? 2532 CYS B CB  1 
ATOM   1729 S SG  . CYS B 1 102 ? -37.720 33.859 20.457  1.00 72.36  ? 2532 CYS B SG  1 
ATOM   1730 N N   . ARG B 1 103 ? -36.403 31.999 23.184  1.00 57.70  ? 2533 ARG B N   1 
ATOM   1731 C CA  . ARG B 1 103 ? -34.951 31.812 23.255  1.00 58.44  ? 2533 ARG B CA  1 
ATOM   1732 C C   . ARG B 1 103 ? -34.594 30.345 23.501  1.00 55.91  ? 2533 ARG B C   1 
ATOM   1733 O O   . ARG B 1 103 ? -33.574 29.840 23.006  1.00 59.54  ? 2533 ARG B O   1 
ATOM   1734 C CB  . ARG B 1 103 ? -34.340 32.699 24.347  1.00 65.18  ? 2533 ARG B CB  1 
ATOM   1735 C CG  . ARG B 1 103 ? -32.814 32.735 24.315  1.00 69.27  ? 2533 ARG B CG  1 
ATOM   1736 C CD  . ARG B 1 103 ? -32.223 34.024 24.948  1.00 66.83  ? 2533 ARG B CD  1 
ATOM   1737 N NE  . ARG B 1 103 ? -30.908 33.799 25.566  1.00 52.78  ? 2533 ARG B NE  1 
ATOM   1738 C CZ  . ARG B 1 103 ? -30.646 33.897 26.880  1.00 63.48  ? 2533 ARG B CZ  1 
ATOM   1739 N NH1 . ARG B 1 103 ? -29.414 33.682 27.342  1.00 68.55  ? 2533 ARG B NH1 1 
ATOM   1740 N NH2 . ARG B 1 103 ? -31.589 34.237 27.750  1.00 60.34  ? 2533 ARG B NH2 1 
ATOM   1741 N N   . LEU B 1 104 ? -35.448 29.658 24.247  1.00 47.37  ? 2534 LEU B N   1 
ATOM   1742 C CA  . LEU B 1 104 ? -35.250 28.238 24.487  1.00 50.42  ? 2534 LEU B CA  1 
ATOM   1743 C C   . LEU B 1 104 ? -35.388 27.406 23.224  1.00 47.86  ? 2534 LEU B C   1 
ATOM   1744 O O   . LEU B 1 104 ? -34.698 26.390 23.095  1.00 48.35  ? 2534 LEU B O   1 
ATOM   1745 C CB  . LEU B 1 104 ? -36.227 27.702 25.542  1.00 51.85  ? 2534 LEU B CB  1 
ATOM   1746 C CG  . LEU B 1 104 ? -35.915 28.079 26.987  1.00 50.00  ? 2534 LEU B CG  1 
ATOM   1747 C CD1 . LEU B 1 104 ? -36.974 27.531 27.953  1.00 48.81  ? 2534 LEU B CD1 1 
ATOM   1748 C CD2 . LEU B 1 104 ? -34.570 27.559 27.355  1.00 51.22  ? 2534 LEU B CD2 1 
ATOM   1749 N N   . ARG B 1 105 ? -36.277 27.806 22.305  1.00 52.70  ? 2535 ARG B N   1 
ATOM   1750 C CA  . ARG B 1 105 ? -36.405 27.117 20.996  1.00 47.06  ? 2535 ARG B CA  1 
ATOM   1751 C C   . ARG B 1 105 ? -35.077 27.129 20.213  1.00 57.24  ? 2535 ARG B C   1 
ATOM   1752 O O   . ARG B 1 105 ? -34.662 26.098 19.688  1.00 57.99  ? 2535 ARG B O   1 
ATOM   1753 C CB  . ARG B 1 105 ? -37.417 27.788 20.091  1.00 50.27  ? 2535 ARG B CB  1 
ATOM   1754 C CG  . ARG B 1 105 ? -38.813 28.095 20.613  1.00 56.43  ? 2535 ARG B CG  1 
ATOM   1755 C CD  . ARG B 1 105 ? -39.720 28.562 19.423  1.00 51.98  ? 2535 ARG B CD  1 
ATOM   1756 N NE  . ARG B 1 105 ? -40.651 27.485 19.111  1.00 56.79  ? 2535 ARG B NE  1 
ATOM   1757 C CZ  . ARG B 1 105 ? -41.946 27.498 19.400  1.00 54.93  ? 2535 ARG B CZ  1 
ATOM   1758 N NH1 . ARG B 1 105 ? -42.508 28.572 19.936  1.00 55.81  ? 2535 ARG B NH1 1 
ATOM   1759 N NH2 . ARG B 1 105 ? -42.701 26.437 19.127  1.00 62.07  ? 2535 ARG B NH2 1 
ATOM   1760 N N   . LYS B 1 106 ? -34.447 28.309 20.098  1.00 60.29  ? 2536 LYS B N   1 
ATOM   1761 C CA  . LYS B 1 106 ? -33.132 28.443 19.451  1.00 64.10  ? 2536 LYS B CA  1 
ATOM   1762 C C   . LYS B 1 106 ? -32.170 27.441 20.091  1.00 63.33  ? 2536 LYS B C   1 
ATOM   1763 O O   . LYS B 1 106 ? -31.447 26.734 19.395  1.00 68.80  ? 2536 LYS B O   1 
ATOM   1764 C CB  . LYS B 1 106 ? -32.547 29.871 19.602  1.00 71.39  ? 2536 LYS B CB  1 
ATOM   1765 C CG  . LYS B 1 106 ? -32.805 30.846 18.446  1.00 75.94  ? 2536 LYS B CG  1 
ATOM   1766 C CD  . LYS B 1 106 ? -31.882 32.085 18.525  1.00 78.02  ? 2536 LYS B CD  1 
ATOM   1767 N N   . ALA B 1 107 ? -32.173 27.374 21.422  1.00 65.67  ? 2537 ALA B N   1 
ATOM   1768 C CA  . ALA B 1 107 ? -31.311 26.419 22.135  1.00 66.67  ? 2537 ALA B CA  1 
ATOM   1769 C C   . ALA B 1 107 ? -31.640 25.013 21.684  1.00 58.68  ? 2537 ALA B C   1 
ATOM   1770 O O   . ALA B 1 107 ? -30.748 24.230 21.319  1.00 69.05  ? 2537 ALA B O   1 
ATOM   1771 C CB  . ALA B 1 107 ? -31.497 26.538 23.632  1.00 71.53  ? 2537 ALA B CB  1 
ATOM   1772 N N   . TYR B 1 108 ? -32.936 24.724 21.673  1.00 52.67  ? 2538 TYR B N   1 
ATOM   1773 C CA  . TYR B 1 108 ? -33.434 23.435 21.214  1.00 55.78  ? 2538 TYR B CA  1 
ATOM   1774 C C   . TYR B 1 108 ? -33.007 23.137 19.794  1.00 56.33  ? 2538 TYR B C   1 
ATOM   1775 O O   . TYR B 1 108 ? -32.510 22.047 19.553  1.00 69.10  ? 2538 TYR B O   1 
ATOM   1776 C CB  . TYR B 1 108 ? -34.960 23.307 21.361  1.00 56.54  ? 2538 TYR B CB  1 
ATOM   1777 C CG  . TYR B 1 108 ? -35.436 21.888 21.109  1.00 55.98  ? 2538 TYR B CG  1 
ATOM   1778 C CD1 . TYR B 1 108 ? -35.056 20.853 21.945  1.00 53.00  ? 2538 TYR B CD1 1 
ATOM   1779 C CD2 . TYR B 1 108 ? -36.220 21.580 20.004  1.00 54.28  ? 2538 TYR B CD2 1 
ATOM   1780 C CE1 . TYR B 1 108 ? -35.465 19.551 21.702  1.00 56.41  ? 2538 TYR B CE1 1 
ATOM   1781 C CE2 . TYR B 1 108 ? -36.637 20.299 19.749  1.00 47.70  ? 2538 TYR B CE2 1 
ATOM   1782 C CZ  . TYR B 1 108 ? -36.263 19.287 20.595  1.00 54.91  ? 2538 TYR B CZ  1 
ATOM   1783 O OH  . TYR B 1 108 ? -36.688 18.013 20.314  1.00 53.81  ? 2538 TYR B OH  1 
ATOM   1784 N N   . TYR B 1 109 ? -33.123 24.083 18.854  1.00 57.82  ? 2539 TYR B N   1 
ATOM   1785 C CA  . TYR B 1 109 ? -32.767 23.728 17.474  1.00 57.88  ? 2539 TYR B CA  1 
ATOM   1786 C C   . TYR B 1 109 ? -31.270 23.474 17.307  1.00 60.30  ? 2539 TYR B C   1 
ATOM   1787 O O   . TYR B 1 109 ? -30.866 22.691 16.432  1.00 58.47  ? 2539 TYR B O   1 
ATOM   1788 C CB  . TYR B 1 109 ? -33.230 24.729 16.430  1.00 61.53  ? 2539 TYR B CB  1 
ATOM   1789 C CG  . TYR B 1 109 ? -34.690 25.123 16.494  1.00 66.11  ? 2539 TYR B CG  1 
ATOM   1790 C CD1 . TYR B 1 109 ? -35.692 24.186 16.702  1.00 58.38  ? 2539 TYR B CD1 1 
ATOM   1791 C CD2 . TYR B 1 109 ? -35.060 26.450 16.306  1.00 65.28  ? 2539 TYR B CD2 1 
ATOM   1792 C CE1 . TYR B 1 109 ? -37.027 24.569 16.745  1.00 61.55  ? 2539 TYR B CE1 1 
ATOM   1793 C CE2 . TYR B 1 109 ? -36.380 26.842 16.358  1.00 74.71  ? 2539 TYR B CE2 1 
ATOM   1794 C CZ  . TYR B 1 109 ? -37.366 25.905 16.566  1.00 69.68  ? 2539 TYR B CZ  1 
ATOM   1795 O OH  . TYR B 1 109 ? -38.676 26.342 16.608  1.00 73.22  ? 2539 TYR B OH  1 
ATOM   1796 N N   . ASN B 1 110 ? -30.441 24.112 18.128  1.00 52.84  ? 2540 ASN B N   1 
ATOM   1797 C CA  . ASN B 1 110 ? -28.998 23.845 18.030  1.00 60.44  ? 2540 ASN B CA  1 
ATOM   1798 C C   . ASN B 1 110 ? -28.683 22.452 18.514  1.00 61.69  ? 2540 ASN B C   1 
ATOM   1799 O O   . ASN B 1 110 ? -28.080 21.670 17.782  1.00 68.40  ? 2540 ASN B O   1 
ATOM   1800 C CB  . ASN B 1 110 ? -28.178 24.854 18.814  1.00 65.59  ? 2540 ASN B CB  1 
ATOM   1801 C CG  . ASN B 1 110 ? -28.332 26.249 18.280  1.00 60.49  ? 2540 ASN B CG  1 
ATOM   1802 O OD1 . ASN B 1 110 ? -28.436 26.466 17.070  1.00 59.21  ? 2540 ASN B OD1 1 
ATOM   1803 N ND2 . ASN B 1 110 ? -28.380 27.204 19.179  1.00 54.35  ? 2540 ASN B ND2 1 
ATOM   1804 N N   . ALA B 1 111 ? -29.127 22.125 19.720  1.00 55.30  ? 2541 ALA B N   1 
ATOM   1805 C CA  . ALA B 1 111 ? -28.847 20.809 20.285  1.00 58.59  ? 2541 ALA B CA  1 
ATOM   1806 C C   . ALA B 1 111 ? -29.408 19.705 19.378  1.00 63.39  ? 2541 ALA B C   1 
ATOM   1807 O O   . ALA B 1 111 ? -28.774 18.664 19.165  1.00 55.82  ? 2541 ALA B O   1 
ATOM   1808 C CB  . ALA B 1 111 ? -29.412 20.694 21.693  1.00 53.52  ? 2541 ALA B CB  1 
ATOM   1809 N N   . ARG B 1 112 ? -30.590 19.942 18.826  1.00 61.39  ? 2542 ARG B N   1 
ATOM   1810 C CA  . ARG B 1 112 ? -31.152 19.021 17.849  1.00 56.12  ? 2542 ARG B CA  1 
ATOM   1811 C C   . ARG B 1 112 ? -30.338 18.981 16.554  1.00 56.86  ? 2542 ARG B C   1 
ATOM   1812 O O   . ARG B 1 112 ? -30.152 17.918 15.986  1.00 58.32  ? 2542 ARG B O   1 
ATOM   1813 C CB  . ARG B 1 112 ? -32.613 19.378 17.508  1.00 59.30  ? 2542 ARG B CB  1 
ATOM   1814 C CG  . ARG B 1 112 ? -33.629 18.728 18.436  1.00 54.47  ? 2542 ARG B CG  1 
ATOM   1815 C CD  . ARG B 1 112 ? -33.714 17.191 18.262  1.00 55.04  ? 2542 ARG B CD  1 
ATOM   1816 N NE  . ARG B 1 112 ? -34.520 16.811 17.108  1.00 56.34  ? 2542 ARG B NE  1 
ATOM   1817 C CZ  . ARG B 1 112 ? -34.071 16.467 15.899  1.00 59.74  ? 2542 ARG B CZ  1 
ATOM   1818 N NH1 . ARG B 1 112 ? -32.773 16.404 15.616  1.00 58.19  ? 2542 ARG B NH1 1 
ATOM   1819 N NH2 . ARG B 1 112 ? -34.949 16.169 14.950  1.00 53.19  ? 2542 ARG B NH2 1 
ATOM   1820 N N   . HIS B 1 113 ? -29.848 20.120 16.068  1.00 56.68  ? 2543 HIS B N   1 
ATOM   1821 C CA  . HIS B 1 113 ? -29.012 20.066 14.868  1.00 55.49  ? 2543 HIS B CA  1 
ATOM   1822 C C   . HIS B 1 113 ? -27.735 19.280 15.146  1.00 55.81  ? 2543 HIS B C   1 
ATOM   1823 O O   . HIS B 1 113 ? -27.319 18.478 14.327  1.00 65.83  ? 2543 HIS B O   1 
ATOM   1824 C CB  . HIS B 1 113 ? -28.694 21.456 14.372  1.00 54.13  ? 2543 HIS B CB  1 
ATOM   1825 C CG  . HIS B 1 113 ? -28.108 21.499 12.994  1.00 53.20  ? 2543 HIS B CG  1 
ATOM   1826 N ND1 . HIS B 1 113 ? -26.877 20.972 12.686  1.00 64.34  ? 2543 HIS B ND1 1 
ATOM   1827 C CD2 . HIS B 1 113 ? -28.562 22.060 11.857  1.00 58.17  ? 2543 HIS B CD2 1 
ATOM   1828 C CE1 . HIS B 1 113 ? -26.613 21.180 11.409  1.00 54.47  ? 2543 HIS B CE1 1 
ATOM   1829 N NE2 . HIS B 1 113 ? -27.625 21.834 10.883  1.00 54.13  ? 2543 HIS B NE2 1 
ATOM   1830 N N   . GLU B 1 114 ? -27.128 19.499 16.308  1.00 67.49  ? 2544 GLU B N   1 
ATOM   1831 C CA  . GLU B 1 114 ? -25.869 18.836 16.650  1.00 73.63  ? 2544 GLU B CA  1 
ATOM   1832 C C   . GLU B 1 114 ? -26.018 17.330 16.843  1.00 72.69  ? 2544 GLU B C   1 
ATOM   1833 O O   . GLU B 1 114 ? -25.179 16.552 16.404  1.00 79.69  ? 2544 GLU B O   1 
ATOM   1834 C CB  . GLU B 1 114 ? -25.266 19.456 17.898  1.00 84.73  ? 2544 GLU B CB  1 
ATOM   1835 C CG  . GLU B 1 114 ? -24.573 20.776 17.637  1.00 96.83  ? 2544 GLU B CG  1 
ATOM   1836 C CD  . GLU B 1 114 ? -24.303 21.525 18.920  1.00 113.80 ? 2544 GLU B CD  1 
ATOM   1837 O OE1 . GLU B 1 114 ? -24.996 22.534 19.177  1.00 125.69 ? 2544 GLU B OE1 1 
ATOM   1838 O OE2 . GLU B 1 114 ? -23.415 21.083 19.683  1.00 119.13 ? 2544 GLU B OE2 1 
ATOM   1839 N N   . ALA B 1 115 ? -27.108 16.913 17.466  1.00 71.25  ? 2545 ALA B N   1 
ATOM   1840 C CA  . ALA B 1 115 ? -27.349 15.494 17.660  1.00 60.79  ? 2545 ALA B CA  1 
ATOM   1841 C C   . ALA B 1 115 ? -27.617 14.768 16.353  1.00 62.95  ? 2545 ALA B C   1 
ATOM   1842 O O   . ALA B 1 115 ? -27.393 13.562 16.258  1.00 65.83  ? 2545 ALA B O   1 
ATOM   1843 C CB  . ALA B 1 115 ? -28.499 15.299 18.589  1.00 55.30  ? 2545 ALA B CB  1 
ATOM   1844 N N   . SER B 1 116 ? -28.068 15.500 15.340  1.00 57.37  ? 2546 SER B N   1 
ATOM   1845 C CA  . SER B 1 116 ? -28.671 14.882 14.161  1.00 59.05  ? 2546 SER B CA  1 
ATOM   1846 C C   . SER B 1 116 ? -27.821 13.788 13.519  1.00 56.20  ? 2546 SER B C   1 
ATOM   1847 O O   . SER B 1 116 ? -28.362 12.808 12.997  1.00 62.15  ? 2546 SER B O   1 
ATOM   1848 C CB  . SER B 1 116 ? -29.024 15.958 13.127  1.00 52.31  ? 2546 SER B CB  1 
ATOM   1849 O OG  . SER B 1 116 ? -27.845 16.569 12.680  1.00 62.38  ? 2546 SER B OG  1 
ATOM   1850 N N   . ALA B 1 117 ? -26.502 13.957 13.539  1.00 56.90  ? 2547 ALA B N   1 
ATOM   1851 C CA  . ALA B 1 117 ? -25.622 12.953 12.958  1.00 61.64  ? 2547 ALA B CA  1 
ATOM   1852 C C   . ALA B 1 117 ? -25.808 11.629 13.696  1.00 57.65  ? 2547 ALA B C   1 
ATOM   1853 O O   . ALA B 1 117 ? -26.103 10.624 13.081  1.00 51.24  ? 2547 ALA B O   1 
ATOM   1854 C CB  . ALA B 1 117 ? -24.166 13.405 13.027  1.00 63.32  ? 2547 ALA B CB  1 
ATOM   1855 N N   . GLN B 1 118 ? -25.667 11.655 15.021  1.00 61.91  ? 2548 GLN B N   1 
ATOM   1856 C CA  . GLN B 1 118 ? -25.761 10.424 15.823  1.00 69.24  ? 2548 GLN B CA  1 
ATOM   1857 C C   . GLN B 1 118 ? -27.128 9.788  15.696  1.00 64.14  ? 2548 GLN B C   1 
ATOM   1858 O O   . GLN B 1 118 ? -27.240 8.565  15.667  1.00 60.95  ? 2548 GLN B O   1 
ATOM   1859 C CB  . GLN B 1 118 ? -25.485 10.675 17.300  1.00 73.35  ? 2548 GLN B CB  1 
ATOM   1860 C CG  . GLN B 1 118 ? -24.164 11.365 17.614  1.00 79.59  ? 2548 GLN B CG  1 
ATOM   1861 C CD  . GLN B 1 118 ? -24.102 11.832 19.066  1.00 93.62  ? 2548 GLN B CD  1 
ATOM   1862 O OE1 . GLN B 1 118 ? -23.934 11.019 19.988  1.00 89.93  ? 2548 GLN B OE1 1 
ATOM   1863 N NE2 . GLN B 1 118 ? -24.248 13.149 19.279  1.00 79.82  ? 2548 GLN B NE2 1 
ATOM   1864 N N   . ILE B 1 119 ? -28.161 10.624 15.631  1.00 62.41  ? 2549 ILE B N   1 
ATOM   1865 C CA  . ILE B 1 119 ? -29.539 10.156 15.468  1.00 61.11  ? 2549 ILE B CA  1 
ATOM   1866 C C   . ILE B 1 119 ? -29.730 9.447  14.140  1.00 62.04  ? 2549 ILE B C   1 
ATOM   1867 O O   . ILE B 1 119 ? -30.488 8.470  14.064  1.00 67.87  ? 2549 ILE B O   1 
ATOM   1868 C CB  . ILE B 1 119 ? -30.566 11.320 15.558  1.00 58.34  ? 2549 ILE B CB  1 
ATOM   1869 C CG1 . ILE B 1 119 ? -30.600 11.913 16.949  1.00 54.81  ? 2549 ILE B CG1 1 
ATOM   1870 C CG2 . ILE B 1 119 ? -31.957 10.848 15.240  1.00 52.71  ? 2549 ILE B CG2 1 
ATOM   1871 C CD1 . ILE B 1 119 ? -31.500 13.079 17.056  1.00 63.53  ? 2549 ILE B CD1 1 
ATOM   1872 N N   . ASP B 1 120 ? -29.065 9.937  13.093  1.00 63.82  ? 2550 ASP B N   1 
ATOM   1873 C CA  . ASP B 1 120 ? -29.150 9.282  11.786  1.00 65.31  ? 2550 ASP B CA  1 
ATOM   1874 C C   . ASP B 1 120 ? -28.426 7.949  11.777  1.00 63.98  ? 2550 ASP B C   1 
ATOM   1875 O O   . ASP B 1 120 ? -28.937 6.986  11.202  1.00 73.57  ? 2550 ASP B O   1 
ATOM   1876 C CB  . ASP B 1 120 ? -28.614 10.177 10.668  1.00 70.76  ? 2550 ASP B CB  1 
ATOM   1877 C CG  . ASP B 1 120 ? -29.591 11.279 10.277  1.00 81.20  ? 2550 ASP B CG  1 
ATOM   1878 O OD1 . ASP B 1 120 ? -30.814 11.122 10.512  1.00 84.28  ? 2550 ASP B OD1 1 
ATOM   1879 O OD2 . ASP B 1 120 ? -29.129 12.307 9.731   1.00 78.87  ? 2550 ASP B OD2 1 
ATOM   1880 N N   . GLU B 1 121 ? -27.247 7.886  12.402  1.00 62.88  ? 2551 GLU B N   1 
ATOM   1881 C CA  . GLU B 1 121 ? -26.489 6.620  12.484  1.00 68.80  ? 2551 GLU B CA  1 
ATOM   1882 C C   . GLU B 1 121 ? -27.300 5.523  13.179  1.00 69.74  ? 2551 GLU B C   1 
ATOM   1883 O O   . GLU B 1 121 ? -27.227 4.370  12.766  1.00 83.23  ? 2551 GLU B O   1 
ATOM   1884 C CB  . GLU B 1 121 ? -25.142 6.817  13.195  1.00 76.84  ? 2551 GLU B CB  1 
ATOM   1885 C CG  . GLU B 1 121 ? -24.358 5.521  13.438  1.00 81.89  ? 2551 GLU B CG  1 
ATOM   1886 N N   . ILE B 1 122 ? -28.072 5.887  14.213  1.00 63.07  ? 2552 ILE B N   1 
ATOM   1887 C CA  . ILE B 1 122 ? -28.939 4.947  14.921  1.00 60.24  ? 2552 ILE B CA  1 
ATOM   1888 C C   . ILE B 1 122 ? -30.132 4.558  14.063  1.00 67.07  ? 2552 ILE B C   1 
ATOM   1889 O O   . ILE B 1 122 ? -30.299 3.393  13.736  1.00 88.40  ? 2552 ILE B O   1 
ATOM   1890 C CB  . ILE B 1 122 ? -29.467 5.533  16.275  1.00 69.73  ? 2552 ILE B CB  1 
ATOM   1891 C CG1 . ILE B 1 122 ? -28.337 5.704  17.284  1.00 58.33  ? 2552 ILE B CG1 1 
ATOM   1892 C CG2 . ILE B 1 122 ? -30.553 4.630  16.917  1.00 58.24  ? 2552 ILE B CG2 1 
ATOM   1893 C CD1 . ILE B 1 122 ? -28.670 6.687  18.354  1.00 53.39  ? 2552 ILE B CD1 1 
ATOM   1894 N N   . VAL B 1 123 ? -30.968 5.523  13.700  1.00 61.72  ? 2553 VAL B N   1 
ATOM   1895 C CA  . VAL B 1 123 ? -32.170 5.239  12.900  1.00 64.88  ? 2553 VAL B CA  1 
ATOM   1896 C C   . VAL B 1 123 ? -31.863 4.480  11.618  1.00 75.86  ? 2553 VAL B C   1 
ATOM   1897 O O   . VAL B 1 123 ? -32.658 3.636  11.177  1.00 81.76  ? 2553 VAL B O   1 
ATOM   1898 C CB  . VAL B 1 123 ? -32.876 6.540  12.513  1.00 61.40  ? 2553 VAL B CB  1 
ATOM   1899 C CG1 . VAL B 1 123 ? -34.014 6.277  11.521  1.00 57.34  ? 2553 VAL B CG1 1 
ATOM   1900 C CG2 . VAL B 1 123 ? -33.377 7.238  13.770  1.00 54.76  ? 2553 VAL B CG2 1 
ATOM   1901 N N   . GLY B 1 124 ? -30.709 4.798  11.028  1.00 89.14  ? 2554 GLY B N   1 
ATOM   1902 C CA  . GLY B 1 124 ? -30.214 4.150  9.808   1.00 95.00  ? 2554 GLY B CA  1 
ATOM   1903 C C   . GLY B 1 124 ? -29.286 2.960  10.036  1.00 97.62  ? 2554 GLY B C   1 
ATOM   1904 O O   . GLY B 1 124 ? -28.297 2.789  9.319   1.00 99.84  ? 2554 GLY B O   1 
ATOM   1905 N N   . GLU B 1 125 ? -29.572 2.184  11.080  1.00 92.84  ? 2555 GLU B N   1 
ATOM   1906 C CA  . GLU B 1 125 ? -29.207 0.767  11.152  1.00 82.47  ? 2555 GLU B CA  1 
ATOM   1907 C C   . GLU B 1 125 ? -30.467 -0.048 10.798  1.00 88.24  ? 2555 GLU B C   1 
ATOM   1908 O O   . GLU B 1 125 ? -30.403 -1.265 10.561  1.00 92.68  ? 2555 GLU B O   1 
ATOM   1909 C CB  . GLU B 1 125 ? -28.720 0.402  12.559  1.00 77.92  ? 2555 GLU B CB  1 
ATOM   1910 C CG  . GLU B 1 125 ? -27.400 1.066  12.999  1.00 73.20  ? 2555 GLU B CG  1 
ATOM   1911 C CD  . GLU B 1 125 ? -27.177 1.008  14.522  1.00 74.72  ? 2555 GLU B CD  1 
ATOM   1912 O OE1 . GLU B 1 125 ? -27.917 0.262  15.212  1.00 74.80  ? 2555 GLU B OE1 1 
ATOM   1913 O OE2 . GLU B 1 125 ? -26.266 1.707  15.035  1.00 58.39  ? 2555 GLU B OE2 1 
ATOM   1914 N N   . THR B 1 126 ? -31.613 0.640  10.785  1.00 77.87  ? 2556 THR B N   1 
ATOM   1915 C CA  . THR B 1 126 ? -32.892 0.062  10.390  1.00 69.18  ? 2556 THR B CA  1 
ATOM   1916 C C   . THR B 1 126 ? -32.953 0.053  8.862   1.00 56.21  ? 2556 THR B C   1 
ATOM   1917 O O   . THR B 1 126 ? -33.973 -0.280 8.277   1.00 56.70  ? 2556 THR B O   1 
ATOM   1918 C CB  . THR B 1 126 ? -34.099 0.870  11.004  1.00 54.55  ? 2556 THR B CB  1 
HETATM 1919 O O   . HOH C 2 .   ? -46.703 10.082 -0.361  1.00 47.97  ? 1    HOH A O   1 
HETATM 1920 O O   . HOH C 2 .   ? -31.194 23.903 0.661   1.00 35.97  ? 5    HOH A O   1 
HETATM 1921 O O   . HOH C 2 .   ? -27.943 23.833 3.311   1.00 39.94  ? 6    HOH A O   1 
HETATM 1922 O O   . HOH C 2 .   ? -24.181 23.079 -3.943  1.00 40.81  ? 7    HOH A O   1 
HETATM 1923 O O   . HOH C 2 .   ? -28.735 29.310 12.424  1.00 38.79  ? 8    HOH A O   1 
HETATM 1924 O O   . HOH C 2 .   ? -35.297 18.405 10.319  1.00 45.24  ? 10   HOH A O   1 
HETATM 1925 O O   . HOH C 2 .   ? -32.103 20.543 12.429  1.00 43.38  ? 12   HOH A O   1 
HETATM 1926 O O   . HOH C 2 .   ? -26.696 -2.219 -1.119  1.00 38.02  ? 14   HOH A O   1 
HETATM 1927 O O   . HOH D 2 .   ? -54.202 31.416 36.860  1.00 51.09  ? 2    HOH B O   1 
HETATM 1928 O O   . HOH D 2 .   ? -49.943 14.494 25.425  1.00 76.25  ? 3    HOH B O   1 
HETATM 1929 O O   . HOH D 2 .   ? -30.386 20.600 25.039  1.00 40.34  ? 4    HOH B O   1 
HETATM 1930 O O   . HOH D 2 .   ? -42.370 16.279 15.082  1.00 32.66  ? 9    HOH B O   1 
HETATM 1931 O O   . HOH D 2 .   ? -35.859 20.467 14.965  1.00 50.05  ? 11   HOH B O   1 
HETATM 1932 O O   . HOH D 2 .   ? -32.443 15.142 12.786  1.00 33.41  ? 13   HOH B O   1 
HETATM 1933 O O   . HOH D 2 .   ? -51.041 36.338 22.103  1.00 41.66  ? 15   HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 1   ? 0.7966 0.8331 0.6869 0.1286  -0.0312 -0.0111 2431 SER A N   
2    C CA  . SER A 1   ? 0.8597 0.8987 0.7555 0.1235  -0.0303 -0.0107 2431 SER A CA  
3    C C   . SER A 1   ? 0.8765 0.9317 0.7792 0.1175  -0.0243 -0.0090 2431 SER A C   
4    O O   . SER A 1   ? 0.7837 0.8484 0.6877 0.1163  -0.0201 -0.0078 2431 SER A O   
5    C CB  . SER A 1   ? 0.8742 0.8988 0.7740 0.1169  -0.0321 -0.0101 2431 SER A CB  
6    O OG  . SER A 1   ? 0.9314 0.9562 0.8366 0.1098  -0.0286 -0.0081 2431 SER A OG  
7    N N   . MET A 2   ? 0.8826 0.9403 0.7896 0.1136  -0.0238 -0.0090 2432 MET A N   
8    C CA  . MET A 2   ? 0.8832 0.9565 0.7967 0.1083  -0.0192 -0.0084 2432 MET A CA  
9    C C   . MET A 2   ? 0.9209 0.9910 0.8411 0.0979  -0.0156 -0.0062 2432 MET A C   
10   O O   . MET A 2   ? 1.0090 1.0658 0.9302 0.0944  -0.0174 -0.0055 2432 MET A O   
11   C CB  . MET A 2   ? 0.9004 0.9769 0.8138 0.1105  -0.0213 -0.0099 2432 MET A CB  
12   C CG  . MET A 2   ? 0.9073 1.0042 0.8247 0.1102  -0.0182 -0.0108 2432 MET A CG  
13   S SD  . MET A 2   ? 0.7385 0.8396 0.6547 0.1141  -0.0211 -0.0130 2432 MET A SD  
14   C CE  . MET A 2   ? 0.6514 0.7306 0.5573 0.1217  -0.0271 -0.0135 2432 MET A CE  
15   N N   . GLU A 3   ? 0.7878 0.8699 0.7127 0.0927  -0.0103 -0.0051 2433 GLU A N   
16   C CA  . GLU A 3   ? 0.7149 0.7921 0.6441 0.0836  -0.0067 -0.0029 2433 GLU A CA  
17   C C   . GLU A 3   ? 0.7943 0.8653 0.7277 0.0778  -0.0075 -0.0026 2433 GLU A C   
18   O O   . GLU A 3   ? 0.9278 0.9861 0.8618 0.0741  -0.0080 -0.0013 2433 GLU A O   
19   C CB  . GLU A 3   ? 0.8314 0.9217 0.7645 0.0783  -0.0005 -0.0017 2433 GLU A CB  
20   C CG  . GLU A 3   ? 0.9510 1.0353 0.8881 0.0685  0.0031  0.0003  2433 GLU A CG  
21   C CD  . GLU A 3   ? 1.0695 1.1667 1.0115 0.0615  0.0091  0.0010  2433 GLU A CD  
22   O OE1 . GLU A 3   ? 1.2071 1.3057 1.1540 0.0544  0.0106  0.0009  2433 GLU A OE1 
23   O OE2 . GLU A 3   ? 0.9223 1.0280 0.8630 0.0631  0.0125  0.0016  2433 GLU A OE2 
24   N N   . VAL A 4   ? 0.6952 0.7755 0.6313 0.0771  -0.0074 -0.0040 2434 VAL A N   
25   C CA  . VAL A 4   ? 0.6089 0.6832 0.5478 0.0724  -0.0082 -0.0038 2434 VAL A CA  
26   C C   . VAL A 4   ? 0.6753 0.7327 0.6106 0.0754  -0.0124 -0.0035 2434 VAL A C   
27   O O   . VAL A 4   ? 0.7824 0.8307 0.7202 0.0702  -0.0120 -0.0023 2434 VAL A O   
28   C CB  . VAL A 4   ? 0.6433 0.7297 0.5841 0.0733  -0.0085 -0.0058 2434 VAL A CB  
29   C CG1 . VAL A 4   ? 0.7135 0.8006 0.6484 0.0834  -0.0129 -0.0077 2434 VAL A CG1 
30   C CG2 . VAL A 4   ? 0.5741 0.6549 0.5178 0.0675  -0.0083 -0.0053 2434 VAL A CG2 
31   N N   . ALA A 5   ? 0.5826 0.6355 0.5121 0.0834  -0.0162 -0.0047 2435 ALA A N   
32   C CA  . ALA A 5   ? 0.6322 0.6685 0.5588 0.0853  -0.0201 -0.0046 2435 ALA A CA  
33   C C   . ALA A 5   ? 0.6789 0.7064 0.6079 0.0808  -0.0192 -0.0030 2435 ALA A C   
34   O O   . ALA A 5   ? 0.7546 0.7723 0.6864 0.0763  -0.0193 -0.0019 2435 ALA A O   
35   C CB  . ALA A 5   ? 0.5691 0.6016 0.4883 0.0948  -0.0245 -0.0065 2435 ALA A CB  
36   N N   . ARG A 6   ? 0.6739 0.7055 0.6015 0.0824  -0.0180 -0.0029 2436 ARG A N   
37   C CA  . ARG A 6   ? 0.7198 0.7439 0.6484 0.0793  -0.0172 -0.0016 2436 ARG A CA  
38   C C   . ARG A 6   ? 0.6924 0.7150 0.6267 0.0708  -0.0137 0.0003  2436 ARG A C   
39   O O   . ARG A 6   ? 0.6176 0.6296 0.5538 0.0683  -0.0150 0.0009  2436 ARG A O   
40   C CB  . ARG A 6   ? 0.7094 0.7394 0.6348 0.0824  -0.0154 -0.0014 2436 ARG A CB  
41   C CG  . ARG A 6   ? 0.7496 0.7766 0.6684 0.0915  -0.0200 -0.0034 2436 ARG A CG  
42   C CD  . ARG A 6   ? 0.8561 0.8867 0.7707 0.0952  -0.0184 -0.0030 2436 ARG A CD  
43   N NE  . ARG A 6   ? 0.9071 0.9512 0.8190 0.0998  -0.0164 -0.0035 2436 ARG A NE  
44   C CZ  . ARG A 6   ? 0.7773 0.8340 0.6920 0.0962  -0.0107 -0.0021 2436 ARG A CZ  
45   N NH1 . ARG A 6   ? 0.8867 0.9434 0.8060 0.0878  -0.0062 0.0000  2436 ARG A NH1 
46   N NH2 . ARG A 6   ? 0.7839 0.8534 0.6966 0.1009  -0.0092 -0.0028 2436 ARG A NH2 
47   N N   . ALA A 7   ? 0.6974 0.7306 0.6344 0.0666  -0.0095 0.0009  2437 ALA A N   
48   C CA  . ALA A 7   ? 0.6658 0.6980 0.6072 0.0584  -0.0059 0.0026  2437 ALA A CA  
49   C C   . ALA A 7   ? 0.6922 0.7167 0.6360 0.0560  -0.0075 0.0027  2437 ALA A C   
50   O O   . ALA A 7   ? 0.9432 0.9623 0.8897 0.0504  -0.0055 0.0042  2437 ALA A O   
51   C CB  . ALA A 7   ? 0.6686 0.7145 0.6124 0.0544  -0.0015 0.0025  2437 ALA A CB  
52   N N   . ALA A 8   ? 0.7492 0.7725 0.6911 0.0606  -0.0109 0.0013  2438 ALA A N   
53   C CA  . ALA A 8   ? 0.7516 0.7662 0.6946 0.0591  -0.0123 0.0017  2438 ALA A CA  
54   C C   . ALA A 8   ? 0.7664 0.7678 0.7097 0.0595  -0.0147 0.0023  2438 ALA A C   
55   O O   . ALA A 8   ? 0.7619 0.7560 0.7082 0.0553  -0.0138 0.0036  2438 ALA A O   
56   C CB  . ALA A 8   ? 0.6491 0.6660 0.5888 0.0642  -0.0148 0.0002  2438 ALA A CB  
57   N N   . ARG A 9   ? 0.7074 0.7061 0.6475 0.0648  -0.0178 0.0010  2439 ARG A N   
58   C CA  . ARG A 9   ? 0.6806 0.6680 0.6215 0.0651  -0.0205 0.0009  2439 ARG A CA  
59   C C   . ARG A 9   ? 0.6815 0.6674 0.6264 0.0599  -0.0179 0.0025  2439 ARG A C   
60   O O   . ARG A 9   ? 0.7901 0.7684 0.7386 0.0570  -0.0184 0.0032  2439 ARG A O   
61   C CB  . ARG A 9   ? 0.6667 0.6524 0.6029 0.0718  -0.0245 -0.0010 2439 ARG A CB  
62   C CG  . ARG A 9   ? 0.5900 0.5758 0.5207 0.0779  -0.0273 -0.0027 2439 ARG A CG  
63   C CD  . ARG A 9   ? 0.5344 0.5094 0.4614 0.0828  -0.0324 -0.0047 2439 ARG A CD  
64   N NE  . ARG A 9   ? 0.4617 0.4380 0.3853 0.0873  -0.0345 -0.0062 2439 ARG A NE  
65   C CZ  . ARG A 9   ? 0.4640 0.4478 0.3819 0.0935  -0.0349 -0.0072 2439 ARG A CZ  
66   N NH1 . ARG A 9   ? 0.4107 0.3948 0.3252 0.0977  -0.0366 -0.0083 2439 ARG A NH1 
67   N NH2 . ARG A 9   ? 0.5005 0.4921 0.4159 0.0961  -0.0337 -0.0073 2439 ARG A NH2 
68   N N   . LEU A 10  ? 0.6998 0.6931 0.6439 0.0587  -0.0148 0.0033  2440 LEU A N   
69   C CA  . LEU A 10  ? 0.7697 0.7611 0.7159 0.0544  -0.0119 0.0049  2440 LEU A CA  
70   C C   . LEU A 10  ? 0.7873 0.7767 0.7374 0.0483  -0.0091 0.0065  2440 LEU A C   
71   O O   . LEU A 10  ? 0.7857 0.7682 0.7385 0.0459  -0.0090 0.0074  2440 LEU A O   
72   C CB  . LEU A 10  ? 0.7572 0.7561 0.7005 0.0542  -0.0085 0.0056  2440 LEU A CB  
73   C CG  . LEU A 10  ? 0.7250 0.7253 0.6634 0.0602  -0.0101 0.0047  2440 LEU A CG  
74   C CD1 . LEU A 10  ? 0.6825 0.6903 0.6183 0.0589  -0.0052 0.0060  2440 LEU A CD1 
75   C CD2 . LEU A 10  ? 0.6744 0.6653 0.6124 0.0624  -0.0132 0.0042  2440 LEU A CD2 
76   N N   . ALA A 11  ? 0.8274 0.8234 0.7776 0.0462  -0.0069 0.0066  2441 ALA A N   
77   C CA  . ALA A 11  ? 0.6698 0.6641 0.6228 0.0411  -0.0046 0.0078  2441 ALA A CA  
78   C C   . ALA A 11  ? 0.6075 0.5920 0.5630 0.0408  -0.0065 0.0083  2441 ALA A C   
79   O O   . ALA A 11  ? 0.7512 0.7313 0.7092 0.0368  -0.0044 0.0098  2441 ALA A O   
80   C CB  . ALA A 11  ? 0.6189 0.6214 0.5714 0.0410  -0.0040 0.0069  2441 ALA A CB  
81   N N   . GLN A 12  ? 0.6408 0.6216 0.5953 0.0450  -0.0101 0.0071  2442 GLN A N   
82   C CA  . GLN A 12  ? 0.6629 0.6344 0.6201 0.0443  -0.0115 0.0077  2442 GLN A CA  
83   C C   . GLN A 12  ? 0.6801 0.6467 0.6411 0.0425  -0.0117 0.0082  2442 GLN A C   
84   O O   . GLN A 12  ? 0.8357 0.7976 0.8005 0.0392  -0.0103 0.0095  2442 GLN A O   
85   C CB  . GLN A 12  ? 0.7264 0.6941 0.6811 0.0491  -0.0154 0.0061  2442 GLN A CB  
86   C CG  . GLN A 12  ? 0.7367 0.6943 0.6936 0.0481  -0.0164 0.0066  2442 GLN A CG  
87   C CD  . GLN A 12  ? 0.7555 0.7114 0.7140 0.0443  -0.0130 0.0087  2442 GLN A CD  
88   O OE1 . GLN A 12  ? 0.8617 0.8214 0.8169 0.0450  -0.0117 0.0089  2442 GLN A OE1 
89   N NE2 . GLN A 12  ? 0.6894 0.6402 0.6530 0.0405  -0.0116 0.0101  2442 GLN A NE2 
90   N N   . ILE A 13  ? 0.8635 0.8318 0.8230 0.0450  -0.0133 0.0072  2443 ILE A N   
91   C CA  . ILE A 13  ? 0.8085 0.7731 0.7707 0.0444  -0.0139 0.0073  2443 ILE A CA  
92   C C   . ILE A 13  ? 0.7366 0.7022 0.6998 0.0402  -0.0096 0.0094  2443 ILE A C   
93   O O   . ILE A 13  ? 0.6309 0.5923 0.5978 0.0379  -0.0089 0.0103  2443 ILE A O   
94   C CB  . ILE A 13  ? 0.8514 0.8177 0.8100 0.0492  -0.0166 0.0056  2443 ILE A CB  
95   C CG1 . ILE A 13  ? 0.8615 0.8248 0.8187 0.0536  -0.0214 0.0032  2443 ILE A CG1 
96   C CG2 . ILE A 13  ? 0.9034 0.8666 0.8637 0.0492  -0.0172 0.0056  2443 ILE A CG2 
97   C CD1 . ILE A 13  ? 0.8805 0.8462 0.8324 0.0593  -0.0241 0.0013  2443 ILE A CD1 
98   N N   . PHE A 14  ? 0.6502 0.6212 0.6098 0.0389  -0.0065 0.0101  2444 PHE A N   
99   C CA  . PHE A 14  ? 0.6633 0.6339 0.6226 0.0347  -0.0023 0.0120  2444 PHE A CA  
100  C C   . PHE A 14  ? 0.6946 0.6619 0.6572 0.0310  -0.0006 0.0132  2444 PHE A C   
101  O O   . PHE A 14  ? 0.8578 0.8213 0.8214 0.0287  0.0013  0.0146  2444 PHE A O   
102  C CB  . PHE A 14  ? 0.7610 0.7382 0.7166 0.0329  0.0008  0.0123  2444 PHE A CB  
103  C CG  . PHE A 14  ? 0.6565 0.6377 0.6083 0.0362  0.0004  0.0116  2444 PHE A CG  
104  C CD1 . PHE A 14  ? 0.5912 0.5691 0.5418 0.0407  -0.0024 0.0108  2444 PHE A CD1 
105  C CD2 . PHE A 14  ? 0.6750 0.6639 0.6245 0.0348  0.0032  0.0116  2444 PHE A CD2 
106  C CE1 . PHE A 14  ? 0.5510 0.5322 0.4971 0.0443  -0.0025 0.0103  2444 PHE A CE1 
107  C CE2 . PHE A 14  ? 0.5401 0.5331 0.4858 0.0379  0.0036  0.0113  2444 PHE A CE2 
108  C CZ  . PHE A 14  ? 0.5551 0.5438 0.4986 0.0429  0.0008  0.0108  2444 PHE A CZ  
109  N N   . LYS A 15  ? 0.7386 0.7070 0.7019 0.0309  -0.0013 0.0129  2445 LYS A N   
110  C CA  . LYS A 15  ? 0.7362 0.7009 0.7018 0.0281  0.0003  0.0142  2445 LYS A CA  
111  C C   . LYS A 15  ? 0.7233 0.6815 0.6935 0.0281  -0.0006 0.0148  2445 LYS A C   
112  O O   . LYS A 15  ? 0.7965 0.7516 0.7687 0.0255  0.0017  0.0163  2445 LYS A O   
113  C CB  . LYS A 15  ? 0.7174 0.6838 0.6817 0.0291  -0.0003 0.0136  2445 LYS A CB  
114  C CG  . LYS A 15  ? 0.8254 0.7867 0.7912 0.0272  0.0012  0.0150  2445 LYS A CG  
115  C CD  . LYS A 15  ? 0.9345 0.8980 0.8971 0.0286  0.0010  0.0145  2445 LYS A CD  
116  C CE  . LYS A 15  ? 0.9673 0.9261 0.9299 0.0266  0.0035  0.0162  2445 LYS A CE  
117  N NZ  . LYS A 15  ? 0.8982 0.8491 0.8641 0.0267  0.0034  0.0176  2445 LYS A NZ  
118  N N   . GLU A 16  ? 0.6629 0.6194 0.6350 0.0310  -0.0043 0.0134  2446 GLU A N   
119  C CA  . GLU A 16  ? 0.7072 0.6589 0.6851 0.0305  -0.0055 0.0135  2446 GLU A CA  
120  C C   . GLU A 16  ? 0.5659 0.5175 0.5455 0.0297  -0.0043 0.0141  2446 GLU A C   
121  O O   . GLU A 16  ? 0.7435 0.6928 0.7275 0.0278  -0.0028 0.0152  2446 GLU A O   
122  C CB  . GLU A 16  ? 0.7039 0.6536 0.6832 0.0336  -0.0101 0.0112  2446 GLU A CB  
123  C CG  . GLU A 16  ? 0.7745 0.7214 0.7522 0.0344  -0.0110 0.0110  2446 GLU A CG  
124  C CD  . GLU A 16  ? 0.8829 0.8277 0.8588 0.0383  -0.0156 0.0085  2446 GLU A CD  
125  O OE1 . GLU A 16  ? 0.8501 0.7951 0.8274 0.0401  -0.0187 0.0066  2446 GLU A OE1 
126  O OE2 . GLU A 16  ? 0.9917 0.9343 0.9641 0.0400  -0.0164 0.0082  2446 GLU A OE2 
127  N N   . ILE A 17  ? 0.6012 0.5553 0.5769 0.0314  -0.0046 0.0135  2447 ILE A N   
128  C CA  . ILE A 17  ? 0.6000 0.5532 0.5755 0.0318  -0.0037 0.0140  2447 ILE A CA  
129  C C   . ILE A 17  ? 0.5798 0.5315 0.5538 0.0284  0.0008  0.0162  2447 ILE A C   
130  O O   . ILE A 17  ? 0.6728 0.6220 0.6498 0.0277  0.0019  0.0172  2447 ILE A O   
131  C CB  . ILE A 17  ? 0.6521 0.6072 0.6219 0.0349  -0.0046 0.0131  2447 ILE A CB  
132  C CG1 . ILE A 17  ? 0.5827 0.5383 0.5537 0.0390  -0.0097 0.0105  2447 ILE A CG1 
133  C CG2 . ILE A 17  ? 0.5461 0.4990 0.5134 0.0357  -0.0030 0.0139  2447 ILE A CG2 
134  C CD1 . ILE A 17  ? 0.5020 0.4598 0.4667 0.0428  -0.0106 0.0096  2447 ILE A CD1 
135  N N   . CYS A 18  ? 0.5122 0.4658 0.4817 0.0264  0.0033  0.0169  2448 CYS A N   
136  C CA  . CYS A 18  ? 0.5265 0.4782 0.4937 0.0229  0.0074  0.0187  2448 CYS A CA  
137  C C   . CYS A 18  ? 0.5574 0.5065 0.5286 0.0212  0.0085  0.0198  2448 CYS A C   
138  O O   . CYS A 18  ? 0.7480 0.6939 0.7182 0.0195  0.0114  0.0213  2448 CYS A O   
139  C CB  . CYS A 18  ? 0.5392 0.4946 0.5020 0.0208  0.0092  0.0185  2448 CYS A CB  
140  S SG  . CYS A 18  ? 0.5319 0.4842 0.4907 0.0165  0.0138  0.0201  2448 CYS A SG  
141  N N   . ASP A 19  ? 0.6029 0.5523 0.5779 0.0219  0.0065  0.0193  2449 ASP A N   
142  C CA  . ASP A 19  ? 0.6259 0.5721 0.6045 0.0205  0.0080  0.0206  2449 ASP A CA  
143  C C   . ASP A 19  ? 0.6801 0.6245 0.6645 0.0211  0.0077  0.0210  2449 ASP A C   
144  O O   . ASP A 19  ? 0.6329 0.5752 0.6197 0.0198  0.0103  0.0226  2449 ASP A O   
145  C CB  . ASP A 19  ? 0.6086 0.5542 0.5889 0.0212  0.0064  0.0202  2449 ASP A CB  
146  C CG  . ASP A 19  ? 0.7734 0.7212 0.7485 0.0211  0.0070  0.0199  2449 ASP A CG  
147  O OD1 . ASP A 19  ? 0.7957 0.7458 0.7668 0.0195  0.0090  0.0201  2449 ASP A OD1 
148  O OD2 . ASP A 19  ? 0.8848 0.8319 0.8596 0.0227  0.0053  0.0193  2449 ASP A OD2 
149  N N   . GLY A 20  ? 0.7274 0.6733 0.7141 0.0233  0.0044  0.0193  2450 GLY A N   
150  C CA  . GLY A 20  ? 0.6899 0.6357 0.6825 0.0243  0.0034  0.0190  2450 GLY A CA  
151  C C   . GLY A 20  ? 0.6960 0.6408 0.6856 0.0244  0.0063  0.0204  2450 GLY A C   
152  O O   . GLY A 20  ? 0.5856 0.5300 0.5797 0.0244  0.0075  0.0212  2450 GLY A O   
153  N N   . ILE A 21  ? 0.6523 0.5963 0.6340 0.0246  0.0076  0.0207  2451 ILE A N   
154  C CA  . ILE A 21  ? 0.5565 0.4974 0.5331 0.0247  0.0107  0.0221  2451 ILE A CA  
155  C C   . ILE A 21  ? 0.5850 0.5231 0.5603 0.0219  0.0146  0.0241  2451 ILE A C   
156  O O   . ILE A 21  ? 0.7486 0.6843 0.7241 0.0225  0.0166  0.0252  2451 ILE A O   
157  C CB  . ILE A 21  ? 0.5355 0.4754 0.5036 0.0248  0.0116  0.0220  2451 ILE A CB  
158  C CG1 . ILE A 21  ? 0.4941 0.4358 0.4614 0.0286  0.0082  0.0203  2451 ILE A CG1 
159  C CG2 . ILE A 21  ? 0.5223 0.4568 0.4834 0.0243  0.0153  0.0236  2451 ILE A CG2 
160  C CD1 . ILE A 21  ? 0.5894 0.5306 0.5595 0.0323  0.0063  0.0196  2451 ILE A CD1 
161  N N   . ILE A 22  ? 0.6070 0.5455 0.5806 0.0194  0.0155  0.0243  2452 ILE A N   
162  C CA  . ILE A 22  ? 0.5718 0.5076 0.5435 0.0171  0.0188  0.0258  2452 ILE A CA  
163  C C   . ILE A 22  ? 0.6518 0.5869 0.6298 0.0177  0.0196  0.0270  2452 ILE A C   
164  O O   . ILE A 22  ? 0.5968 0.5289 0.5734 0.0174  0.0226  0.0286  2452 ILE A O   
165  C CB  . ILE A 22  ? 0.6318 0.5692 0.6011 0.0152  0.0188  0.0253  2452 ILE A CB  
166  C CG1 . ILE A 22  ? 0.5887 0.5273 0.5517 0.0137  0.0192  0.0244  2452 ILE A CG1 
167  C CG2 . ILE A 22  ? 0.5949 0.5293 0.5628 0.0138  0.0216  0.0268  2452 ILE A CG2 
168  C CD1 . ILE A 22  ? 0.4990 0.4410 0.4598 0.0118  0.0192  0.0234  2452 ILE A CD1 
169  N N   . SER A 23  ? 0.7065 0.6441 0.6913 0.0183  0.0171  0.0262  2453 SER A N   
170  C CA  . SER A 23  ? 0.7601 0.6974 0.7518 0.0181  0.0183  0.0274  2453 SER A CA  
171  C C   . SER A 23  ? 0.8353 0.7746 0.8327 0.0197  0.0179  0.0272  2453 SER A C   
172  O O   . SER A 23  ? 0.9862 0.9262 0.9895 0.0194  0.0198  0.0284  2453 SER A O   
173  C CB  . SER A 23  ? 0.8240 0.7622 0.8205 0.0176  0.0162  0.0266  2453 SER A CB  
174  O OG  . SER A 23  ? 1.0178 0.9587 1.0200 0.0188  0.0125  0.0246  2453 SER A OG  
175  N N   . TYR A 24  ? 0.8882 0.8289 0.8839 0.0218  0.0155  0.0257  2454 TYR A N   
176  C CA  . TYR A 24  ? 0.9317 0.8754 0.9331 0.0244  0.0140  0.0248  2454 TYR A CA  
177  C C   . TYR A 24  ? 0.8887 0.8321 0.8921 0.0249  0.0175  0.0266  2454 TYR A C   
178  O O   . TYR A 24  ? 0.9143 0.8534 0.9101 0.0249  0.0208  0.0283  2454 TYR A O   
179  C CB  . TYR A 24  ? 0.9604 0.9035 0.9556 0.0273  0.0121  0.0235  2454 TYR A CB  
180  C CG  . TYR A 24  ? 0.9180 0.8651 0.9189 0.0308  0.0089  0.0216  2454 TYR A CG  
181  C CD1 . TYR A 24  ? 1.0002 0.9510 1.0070 0.0315  0.0042  0.0190  2454 TYR A CD1 
182  C CD2 . TYR A 24  ? 0.9477 0.8947 0.9474 0.0338  0.0102  0.0222  2454 TYR A CD2 
183  C CE1 . TYR A 24  ? 1.0461 1.0011 1.0583 0.0348  0.0007  0.0167  2454 TYR A CE1 
184  C CE2 . TYR A 24  ? 0.9268 0.8785 0.9318 0.0376  0.0068  0.0200  2454 TYR A CE2 
185  C CZ  . TYR A 24  ? 0.9404 0.8964 0.9520 0.0379  0.0020  0.0171  2454 TYR A CZ  
186  O OH  . TYR A 24  ? 0.9367 0.8980 0.9538 0.0418  -0.0019 0.0144  2454 TYR A OH  
187  N N   . LYS A 25  ? 0.9042 0.8522 0.9177 0.0252  0.0168  0.0261  2455 LYS A N   
188  C CA  . LYS A 25  ? 0.9479 0.8973 0.9646 0.0261  0.0203  0.0279  2455 LYS A CA  
189  C C   . LYS A 25  ? 0.9990 0.9548 1.0230 0.0294  0.0178  0.0260  2455 LYS A C   
190  O O   . LYS A 25  ? 0.8938 0.8540 0.9246 0.0295  0.0135  0.0233  2455 LYS A O   
191  C CB  . LYS A 25  ? 0.8419 0.7917 0.8648 0.0230  0.0233  0.0297  2455 LYS A CB  
192  C CG  . LYS A 25  ? 0.7810 0.7246 0.7957 0.0210  0.0262  0.0317  2455 LYS A CG  
193  C CD  . LYS A 25  ? 0.9252 0.8682 0.9448 0.0187  0.0294  0.0337  2455 LYS A CD  
194  C CE  . LYS A 25  ? 0.8789 0.8157 0.8892 0.0177  0.0321  0.0355  2455 LYS A CE  
195  N NZ  . LYS A 25  ? 0.7963 0.7314 0.8031 0.0165  0.0290  0.0340  2455 LYS A NZ  
196  N N   . ASP A 26  ? 0.9962 0.9522 1.0179 0.0325  0.0202  0.0271  2456 ASP A N   
197  C CA  . ASP A 26  ? 0.9808 0.9443 1.0102 0.0361  0.0182  0.0253  2456 ASP A CA  
198  C C   . ASP A 26  ? 0.9751 0.9456 1.0182 0.0334  0.0197  0.0256  2456 ASP A C   
199  O O   . ASP A 26  ? 0.8496 0.8174 0.8936 0.0296  0.0232  0.0279  2456 ASP A O   
200  C CB  . ASP A 26  ? 0.9909 0.9520 1.0123 0.0413  0.0203  0.0264  2456 ASP A CB  
201  C CG  . ASP A 26  ? 1.0833 1.0394 1.0991 0.0407  0.0260  0.0297  2456 ASP A CG  
202  O OD1 . ASP A 26  ? 1.1045 1.0566 1.1118 0.0450  0.0278  0.0306  2456 ASP A OD1 
203  O OD2 . ASP A 26  ? 0.9752 0.9302 0.9937 0.0366  0.0287  0.0314  2456 ASP A OD2 
204  N N   . SER A 27  ? 1.0486 1.0284 1.1025 0.0352  0.0170  0.0232  2457 SER A N   
205  C CA  . SER A 27  ? 0.9910 0.9786 1.0586 0.0326  0.0193  0.0237  2457 SER A CA  
206  C C   . SER A 27  ? 1.1096 1.0934 1.1732 0.0320  0.0261  0.0279  2457 SER A C   
207  O O   . SER A 27  ? 1.0413 1.0255 1.1110 0.0278  0.0295  0.0297  2457 SER A O   
208  C CB  . SER A 27  ? 0.8787 0.8774 0.9562 0.0363  0.0165  0.0208  2457 SER A CB  
209  O OG  . SER A 27  ? 0.9277 0.9280 1.0054 0.0380  0.0100  0.0169  2457 SER A OG  
210  N N   . SER A 28  ? 1.1640 1.1428 1.2161 0.0363  0.0281  0.0294  2458 SER A N   
211  C CA  . SER A 28  ? 1.1829 1.1569 1.2288 0.0366  0.0341  0.0330  2458 SER A CA  
212  C C   . SER A 28  ? 1.1933 1.1585 1.2323 0.0324  0.0367  0.0354  2458 SER A C   
213  O O   . SER A 28  ? 1.0648 1.0247 1.0967 0.0331  0.0412  0.0381  2458 SER A O   
214  C CB  . SER A 28  ? 1.1325 1.1013 1.1659 0.0423  0.0350  0.0337  2458 SER A CB  
215  O OG  . SER A 28  ? 1.0884 1.0626 1.1238 0.0471  0.0311  0.0309  2458 SER A OG  
216  N N   . ARG A 29  ? 1.1146 1.0777 1.1546 0.0287  0.0339  0.0341  2459 ARG A N   
217  C CA  . ARG A 29  ? 1.0523 1.0085 1.0872 0.0251  0.0361  0.0361  2459 ARG A CA  
218  C C   . ARG A 29  ? 1.1288 1.0760 1.1486 0.0262  0.0377  0.0374  2459 ARG A C   
219  O O   . ARG A 29  ? 0.9284 0.8703 0.9431 0.0241  0.0400  0.0390  2459 ARG A O   
220  C CB  . ARG A 29  ? 1.0104 0.9687 1.0522 0.0233  0.0410  0.0387  2459 ARG A CB  
221  C CG  . ARG A 29  ? 0.9609 0.9177 1.0076 0.0188  0.0415  0.0393  2459 ARG A CG  
222  C CD  . ARG A 29  ? 1.0009 0.9592 1.0532 0.0177  0.0474  0.0424  2459 ARG A CD  
223  N NE  . ARG A 29  ? 1.0359 0.9884 1.0775 0.0203  0.0520  0.0453  2459 ARG A NE  
224  C CZ  . ARG A 29  ? 1.0166 0.9709 1.0556 0.0241  0.0543  0.0462  2459 ARG A CZ  
225  N NH1 . ARG A 29  ? 0.9645 0.9121 0.9928 0.0262  0.0581  0.0486  2459 ARG A NH1 
226  N NH2 . ARG A 29  ? 0.9975 0.9600 1.0437 0.0265  0.0526  0.0445  2459 ARG A NH2 
227  N N   . GLN A 30  ? 1.0381 0.9832 1.0506 0.0295  0.0366  0.0366  2460 GLN A N   
228  C CA  . GLN A 30  ? 0.9658 0.9022 0.9644 0.0299  0.0378  0.0373  2460 GLN A CA  
229  C C   . GLN A 30  ? 0.9378 0.8722 0.9319 0.0287  0.0338  0.0352  2460 GLN A C   
230  O O   . GLN A 30  ? 0.7819 0.7205 0.7803 0.0300  0.0303  0.0332  2460 GLN A O   
231  C CB  . GLN A 30  ? 1.0902 1.0241 1.0825 0.0344  0.0398  0.0380  2460 GLN A CB  
232  C CG  . GLN A 30  ? 1.0440 0.9722 1.0258 0.0366  0.0379  0.0368  2460 GLN A CG  
233  C CD  . GLN A 30  ? 1.0971 1.0148 1.0648 0.0368  0.0409  0.0381  2460 GLN A CD  
234  O OE1 . GLN A 30  ? 1.0041 0.9191 0.9690 0.0383  0.0444  0.0399  2460 GLN A OE1 
235  N NE2 . GLN A 30  ? 1.0033 0.9148 0.9618 0.0353  0.0396  0.0372  2460 GLN A NE2 
236  N N   . ALA A 31  ? 0.9880 0.9166 0.9735 0.0263  0.0345  0.0355  2461 ALA A N   
237  C CA  . ALA A 31  ? 0.9472 0.8752 0.9295 0.0246  0.0314  0.0337  2461 ALA A CA  
238  C C   . ALA A 31  ? 0.9560 0.8799 0.9295 0.0264  0.0309  0.0330  2461 ALA A C   
239  O O   . ALA A 31  ? 1.0089 0.9261 0.9726 0.0257  0.0332  0.0338  2461 ALA A O   
240  C CB  . ALA A 31  ? 0.9631 0.8882 0.9409 0.0213  0.0322  0.0341  2461 ALA A CB  
241  N N   . LEU A 32  ? 0.8939 0.8211 0.8702 0.0286  0.0277  0.0315  2462 LEU A N   
242  C CA  . LEU A 32  ? 0.8113 0.7340 0.7788 0.0310  0.0274  0.0310  2462 LEU A CA  
243  C C   . LEU A 32  ? 0.7623 0.6799 0.7207 0.0279  0.0281  0.0309  2462 LEU A C   
244  O O   . LEU A 32  ? 0.9073 0.8179 0.8558 0.0285  0.0300  0.0315  2462 LEU A O   
245  C CB  . LEU A 32  ? 0.8094 0.7372 0.7818 0.0345  0.0234  0.0291  2462 LEU A CB  
246  C CG  . LEU A 32  ? 0.8856 0.8195 0.8669 0.0382  0.0223  0.0285  2462 LEU A CG  
247  C CD1 . LEU A 32  ? 0.8425 0.7800 0.8256 0.0422  0.0179  0.0261  2462 LEU A CD1 
248  C CD2 . LEU A 32  ? 0.9495 0.8796 0.9259 0.0411  0.0258  0.0302  2462 LEU A CD2 
249  N N   . ALA A 33  ? 0.7392 0.6599 0.7005 0.0247  0.0267  0.0301  2463 ALA A N   
250  C CA  . ALA A 33  ? 0.6979 0.6161 0.6522 0.0215  0.0272  0.0297  2463 ALA A CA  
251  C C   . ALA A 33  ? 0.7021 0.6155 0.6504 0.0183  0.0303  0.0306  2463 ALA A C   
252  O O   . ALA A 33  ? 0.6642 0.5766 0.6077 0.0150  0.0308  0.0299  2463 ALA A O   
253  C CB  . ALA A 33  ? 0.6907 0.6150 0.6502 0.0200  0.0242  0.0282  2463 ALA A CB  
254  N N   . ALA A 34  ? 0.7575 0.6686 0.7065 0.0193  0.0324  0.0319  2464 ALA A N   
255  C CA  . ALA A 34  ? 0.7567 0.6632 0.7001 0.0168  0.0350  0.0326  2464 ALA A CA  
256  C C   . ALA A 34  ? 0.7683 0.6676 0.7010 0.0146  0.0368  0.0322  2464 ALA A C   
257  O O   . ALA A 34  ? 0.8333 0.7320 0.7627 0.0107  0.0372  0.0313  2464 ALA A O   
258  C CB  . ALA A 34  ? 0.8326 0.7372 0.7774 0.0193  0.0374  0.0343  2464 ALA A CB  
259  N N   . PRO A 35  ? 0.7328 0.6264 0.6598 0.0170  0.0378  0.0328  2465 PRO A N   
260  C CA  . PRO A 35  ? 0.7183 0.6032 0.6342 0.0144  0.0399  0.0327  2465 PRO A CA  
261  C C   . PRO A 35  ? 0.7754 0.6632 0.6906 0.0103  0.0390  0.0313  2465 PRO A C   
262  O O   . PRO A 35  ? 0.8754 0.7576 0.7831 0.0064  0.0410  0.0308  2465 PRO A O   
263  C CB  . PRO A 35  ? 0.7503 0.6293 0.6610 0.0191  0.0408  0.0336  2465 PRO A CB  
264  C CG  . PRO A 35  ? 0.7222 0.6077 0.6417 0.0241  0.0391  0.0341  2465 PRO A CG  
265  C CD  . PRO A 35  ? 0.7103 0.6054 0.6408 0.0221  0.0369  0.0334  2465 PRO A CD  
266  N N   . LEU A 36  ? 0.7893 0.6857 0.7122 0.0113  0.0362  0.0306  2466 LEU A N   
267  C CA  . LEU A 36  ? 0.7459 0.6459 0.6683 0.0084  0.0355  0.0294  2466 LEU A CA  
268  C C   . LEU A 36  ? 0.7249 0.6313 0.6509 0.0044  0.0345  0.0280  2466 LEU A C   
269  O O   . LEU A 36  ? 0.6694 0.5803 0.5956 0.0020  0.0340  0.0268  2466 LEU A O   
270  C CB  . LEU A 36  ? 0.7227 0.6284 0.6504 0.0122  0.0326  0.0291  2466 LEU A CB  
271  C CG  . LEU A 36  ? 0.8468 0.7477 0.7696 0.0163  0.0328  0.0297  2466 LEU A CG  
272  C CD1 . LEU A 36  ? 0.7763 0.6686 0.6924 0.0182  0.0352  0.0310  2466 LEU A CD1 
273  C CD2 . LEU A 36  ? 0.8705 0.7760 0.8000 0.0211  0.0298  0.0294  2466 LEU A CD2 
274  N N   . LEU A 37  ? 0.7693 0.6767 0.6980 0.0042  0.0344  0.0280  2467 LEU A N   
275  C CA  . LEU A 37  ? 0.6849 0.5995 0.6180 0.0023  0.0327  0.0266  2467 LEU A CA  
276  C C   . LEU A 37  ? 0.8927 0.8068 0.8207 -0.0027 0.0339  0.0250  2467 LEU A C   
277  O O   . LEU A 37  ? 1.0078 0.9293 0.9383 -0.0047 0.0325  0.0234  2467 LEU A O   
278  C CB  . LEU A 37  ? 0.7515 0.6666 0.6885 0.0043  0.0324  0.0274  2467 LEU A CB  
279  C CG  . LEU A 37  ? 0.7680 0.6858 0.7124 0.0083  0.0309  0.0285  2467 LEU A CG  
280  C CD1 . LEU A 37  ? 0.5719 0.4887 0.5186 0.0094  0.0319  0.0296  2467 LEU A CD1 
281  C CD2 . LEU A 37  ? 0.6713 0.5963 0.6215 0.0089  0.0277  0.0273  2467 LEU A CD2 
282  N N   . ASN A 38  ? 0.9000 0.8057 0.8210 -0.0045 0.0364  0.0254  2468 ASN A N   
283  C CA  . ASN A 38  ? 0.8277 0.7320 0.7439 -0.0097 0.0375  0.0235  2468 ASN A CA  
284  C C   . ASN A 38  ? 0.8987 0.7937 0.8067 -0.0127 0.0404  0.0239  2468 ASN A C   
285  O O   . ASN A 38  ? 0.7851 0.6710 0.6881 -0.0099 0.0421  0.0257  2468 ASN A O   
286  C CB  . ASN A 38  ? 0.7693 0.6706 0.6834 -0.0096 0.0376  0.0231  2468 ASN A CB  
287  C CG  . ASN A 38  ? 0.8377 0.7409 0.7489 -0.0149 0.0374  0.0202  2468 ASN A CG  
288  O OD1 . ASN A 38  ? 0.6162 0.5282 0.5310 -0.0177 0.0360  0.0183  2468 ASN A OD1 
289  N ND2 . ASN A 38  ? 0.7471 0.6424 0.6517 -0.0162 0.0386  0.0197  2468 ASN A ND2 
290  N N   . LEU A 39  ? 0.8404 0.7377 0.7468 -0.0181 0.0412  0.0222  2469 LEU A N   
291  C CA  . LEU A 39  ? 0.8171 0.7043 0.7147 -0.0221 0.0445  0.0224  2469 LEU A CA  
292  C C   . LEU A 39  ? 0.8593 0.7368 0.7499 -0.0241 0.0458  0.0217  2469 LEU A C   
293  O O   . LEU A 39  ? 0.8339 0.7158 0.7266 -0.0263 0.0442  0.0195  2469 LEU A O   
294  C CB  . LEU A 39  ? 0.7863 0.6796 0.6850 -0.0284 0.0454  0.0205  2469 LEU A CB  
295  C CG  . LEU A 39  ? 0.7354 0.6346 0.6372 -0.0272 0.0457  0.0215  2469 LEU A CG  
296  C CD1 . LEU A 39  ? 0.6891 0.5978 0.5940 -0.0334 0.0464  0.0193  2469 LEU A CD1 
297  C CD2 . LEU A 39  ? 0.6169 0.5046 0.5110 -0.0247 0.0484  0.0242  2469 LEU A CD2 
298  N N   . PRO A 40  ? 0.9894 0.8532 0.8709 -0.0228 0.0484  0.0234  2470 PRO A N   
299  C CA  . PRO A 40  ? 0.9467 0.7994 0.8198 -0.0240 0.0497  0.0229  2470 PRO A CA  
300  C C   . PRO A 40  ? 0.9958 0.8493 0.8672 -0.0319 0.0498  0.0196  2470 PRO A C   
301  O O   . PRO A 40  ? 1.0498 0.9048 0.9211 -0.0374 0.0512  0.0187  2470 PRO A O   
302  C CB  . PRO A 40  ? 0.9528 0.7907 0.8151 -0.0226 0.0530  0.0249  2470 PRO A CB  
303  C CG  . PRO A 40  ? 0.9219 0.7640 0.7880 -0.0185 0.0528  0.0270  2470 PRO A CG  
304  C CD  . PRO A 40  ? 0.9557 0.8129 0.8322 -0.0210 0.0506  0.0256  2470 PRO A CD  
305  N N   . PRO A 41  ? 0.9669 0.8197 0.8371 -0.0325 0.0483  0.0176  2471 PRO A N   
306  C CA  . PRO A 41  ? 1.0791 0.9335 0.9482 -0.0399 0.0477  0.0138  2471 PRO A CA  
307  C C   . PRO A 41  ? 1.0999 0.9420 0.9598 -0.0466 0.0510  0.0130  2471 PRO A C   
308  O O   . PRO A 41  ? 1.0507 0.8773 0.9002 -0.0449 0.0532  0.0145  2471 PRO A O   
309  C CB  . PRO A 41  ? 1.1768 1.0284 1.0431 -0.0371 0.0459  0.0126  2471 PRO A CB  
310  C CG  . PRO A 41  ? 1.1140 0.9710 0.9859 -0.0291 0.0448  0.0154  2471 PRO A CG  
311  C CD  . PRO A 41  ? 0.9804 0.8328 0.8514 -0.0261 0.0470  0.0187  2471 PRO A CD  
312  N N   . LYS A 42  ? 1.1260 0.9752 0.9898 -0.0540 0.0514  0.0107  2472 LYS A N   
313  C CA  . LYS A 42  ? 1.1294 0.9682 0.9858 -0.0613 0.0552  0.0103  2472 LYS A CA  
314  C C   . LYS A 42  ? 1.1591 0.9812 1.0038 -0.0638 0.0562  0.0089  2472 LYS A C   
315  O O   . LYS A 42  ? 1.1910 0.9964 1.0246 -0.0639 0.0596  0.0109  2472 LYS A O   
316  C CB  . LYS A 42  ? 0.9629 0.8145 0.8270 -0.0697 0.0551  0.0072  2472 LYS A CB  
317  N N   . LYS A 43  ? 1.1930 1.0190 1.0394 -0.0648 0.0530  0.0055  2473 LYS A N   
318  C CA  . LYS A 43  ? 1.2342 1.0452 1.0696 -0.0679 0.0534  0.0032  2473 LYS A CA  
319  C C   . LYS A 43  ? 1.2477 1.0397 1.0704 -0.0618 0.0559  0.0067  2473 LYS A C   
320  O O   . LYS A 43  ? 1.4545 1.2302 1.2659 -0.0658 0.0585  0.0063  2473 LYS A O   
321  C CB  . LYS A 43  ? 1.0342 0.8527 0.8727 -0.0681 0.0490  -0.0009 2473 LYS A CB  
322  C CG  . LYS A 43  ? 0.9851 0.8194 0.8333 -0.0764 0.0469  -0.0056 2473 LYS A CG  
323  C CD  . LYS A 43  ? 0.8476 0.6846 0.6951 -0.0788 0.0429  -0.0109 2473 LYS A CD  
324  N N   . LYS A 44  ? 1.2763 1.0700 1.1005 -0.0522 0.0552  0.0101  2474 LYS A N   
325  C CA  . LYS A 44  ? 1.2696 1.0464 1.0820 -0.0460 0.0577  0.0132  2474 LYS A CA  
326  C C   . LYS A 44  ? 1.3356 1.1103 1.1475 -0.0412 0.0602  0.0174  2474 LYS A C   
327  O O   . LYS A 44  ? 1.2803 1.0442 1.0843 -0.0344 0.0617  0.0201  2474 LYS A O   
328  C CB  . LYS A 44  ? 1.2490 1.0250 1.0599 -0.0385 0.0557  0.0136  2474 LYS A CB  
329  C CG  . LYS A 44  ? 1.1978 0.9643 0.9999 -0.0415 0.0546  0.0099  2474 LYS A CG  
330  N N   . ASN A 45  ? 1.1096 0.8948 0.9297 -0.0443 0.0605  0.0178  2475 ASN A N   
331  C CA  . ASN A 45  ? 1.2257 1.0068 1.0432 -0.0404 0.0630  0.0214  2475 ASN A CA  
332  C C   . ASN A 45  ? 1.2465 1.0263 1.0627 -0.0484 0.0658  0.0209  2475 ASN A C   
333  O O   . ASN A 45  ? 1.4373 1.2266 1.2603 -0.0477 0.0661  0.0223  2475 ASN A O   
334  C CB  . ASN A 45  ? 1.1360 0.9315 0.9647 -0.0330 0.0606  0.0235  2475 ASN A CB  
335  C CG  . ASN A 45  ? 1.1574 0.9570 0.9898 -0.0265 0.0581  0.0237  2475 ASN A CG  
336  O OD1 . ASN A 45  ? 1.0152 0.8076 0.8426 -0.0194 0.0588  0.0260  2475 ASN A OD1 
337  N ND2 . ASN A 45  ? 0.9584 0.7700 0.7995 -0.0287 0.0552  0.0214  2475 ASN A ND2 
338  N N   . ALA A 46  ? 1.2203 0.9880 1.0276 -0.0561 0.0681  0.0189  2476 ALA A N   
339  C CA  . ALA A 46  ? 1.2150 0.9796 1.0202 -0.0648 0.0717  0.0185  2476 ALA A CA  
340  C C   . ALA A 46  ? 1.1048 0.8595 0.9021 -0.0606 0.0756  0.0227  2476 ALA A C   
341  O O   . ALA A 46  ? 1.0917 0.8496 0.8910 -0.0651 0.0783  0.0234  2476 ALA A O   
342  C CB  . ALA A 46  ? 1.0540 0.8046 0.8498 -0.0738 0.0737  0.0156  2476 ALA A CB  
343  N N   . ASP A 47  ? 1.0805 0.8241 0.8692 -0.0514 0.0758  0.0254  2477 ASP A N   
344  C CA  . ASP A 47  ? 1.1128 0.8469 0.8931 -0.0456 0.0788  0.0292  2477 ASP A CA  
345  C C   . ASP A 47  ? 1.1169 0.8672 0.9084 -0.0406 0.0770  0.0308  2477 ASP A C   
346  O O   . ASP A 47  ? 1.1463 0.8920 0.9328 -0.0387 0.0798  0.0333  2477 ASP A O   
347  C CB  . ASP A 47  ? 1.1646 0.8837 0.9330 -0.0364 0.0790  0.0312  2477 ASP A CB  
348  C CG  . ASP A 47  ? 1.2110 0.9427 0.9888 -0.0273 0.0747  0.0317  2477 ASP A CG  
349  O OD1 . ASP A 47  ? 1.1919 0.9329 0.9778 -0.0286 0.0717  0.0295  2477 ASP A OD1 
350  O OD2 . ASP A 47  ? 1.2166 0.9484 0.9933 -0.0187 0.0745  0.0343  2477 ASP A OD2 
351  N N   . TYR A 48  ? 1.1955 0.9638 1.0012 -0.0382 0.0725  0.0295  2478 TYR A N   
352  C CA  . TYR A 48  ? 1.1656 0.9504 0.9830 -0.0345 0.0703  0.0303  2478 TYR A CA  
353  C C   . TYR A 48  ? 1.1625 0.9538 0.9835 -0.0419 0.0724  0.0297  2478 TYR A C   
354  O O   . TYR A 48  ? 1.2155 1.0066 1.0348 -0.0394 0.0742  0.0318  2478 TYR A O   
355  C CB  . TYR A 48  ? 1.1577 0.9591 0.9888 -0.0319 0.0653  0.0287  2478 TYR A CB  
356  C CG  . TYR A 48  ? 1.0941 0.9107 0.9364 -0.0272 0.0627  0.0295  2478 TYR A CG  
357  C CD1 . TYR A 48  ? 1.0207 0.8369 0.8631 -0.0183 0.0613  0.0316  2478 TYR A CD1 
358  C CD2 . TYR A 48  ? 0.9613 0.7926 0.8137 -0.0317 0.0614  0.0278  2478 TYR A CD2 
359  C CE1 . TYR A 48  ? 0.9968 0.8257 0.8488 -0.0143 0.0587  0.0320  2478 TYR A CE1 
360  C CE2 . TYR A 48  ? 1.0301 0.8738 0.8913 -0.0271 0.0589  0.0285  2478 TYR A CE2 
361  C CZ  . TYR A 48  ? 1.0840 0.9259 0.9448 -0.0187 0.0575  0.0305  2478 TYR A CZ  
362  O OH  . TYR A 48  ? 1.0458 0.8992 0.9151 -0.0144 0.0547  0.0307  2478 TYR A OH  
363  N N   . TYR A 49  ? 1.1875 0.9845 1.0132 -0.0507 0.0723  0.0267  2479 TYR A N   
364  C CA  . TYR A 49  ? 1.2725 1.0795 1.1043 -0.0581 0.0741  0.0256  2479 TYR A CA  
365  C C   . TYR A 49  ? 1.4057 1.1983 1.2262 -0.0635 0.0802  0.0273  2479 TYR A C   
366  O O   . TYR A 49  ? 1.4697 1.2698 1.2944 -0.0696 0.0827  0.0269  2479 TYR A O   
367  C CB  . TYR A 49  ? 1.1752 0.9941 1.0162 -0.0655 0.0717  0.0214  2479 TYR A CB  
368  C CG  . TYR A 49  ? 1.2626 1.0969 1.1150 -0.0602 0.0661  0.0201  2479 TYR A CG  
369  C CD1 . TYR A 49  ? 1.2680 1.1209 1.1325 -0.0597 0.0638  0.0192  2479 TYR A CD1 
370  C CD2 . TYR A 49  ? 1.2185 1.0480 1.0688 -0.0552 0.0635  0.0198  2479 TYR A CD2 
371  C CE1 . TYR A 49  ? 1.2523 1.1177 1.1261 -0.0547 0.0590  0.0181  2479 TYR A CE1 
372  C CE2 . TYR A 49  ? 1.1382 0.9806 0.9982 -0.0505 0.0591  0.0190  2479 TYR A CE2 
373  C CZ  . TYR A 49  ? 1.2105 1.0702 1.0819 -0.0503 0.0568  0.0181  2479 TYR A CZ  
374  O OH  . TYR A 49  ? 1.0920 0.9631 0.9719 -0.0456 0.0526  0.0173  2479 TYR A OH  
375  N N   . GLU A 50  ? 1.4737 1.2457 1.2795 -0.0610 0.0829  0.0292  2480 GLU A N   
376  C CA  . GLU A 50  ? 1.4298 1.1850 1.2221 -0.0635 0.0890  0.0318  2480 GLU A CA  
377  C C   . GLU A 50  ? 1.4781 1.2312 1.2662 -0.0536 0.0897  0.0356  2480 GLU A C   
378  O O   . GLU A 50  ? 1.4291 1.1777 1.2118 -0.0554 0.0941  0.0377  2480 GLU A O   
379  C CB  . GLU A 50  ? 1.4266 1.1589 1.2033 -0.0656 0.0917  0.0319  2480 GLU A CB  
380  N N   . LYS A 51  ? 1.4916 1.2482 1.2821 -0.0433 0.0854  0.0364  2481 LYS A N   
381  C CA  . LYS A 51  ? 1.4363 1.1934 1.2246 -0.0333 0.0848  0.0392  2481 LYS A CA  
382  C C   . LYS A 51  ? 1.4292 1.2067 1.2315 -0.0317 0.0820  0.0387  2481 LYS A C   
383  O O   . LYS A 51  ? 1.3705 1.1476 1.1697 -0.0264 0.0830  0.0408  2481 LYS A O   
384  C CB  . LYS A 51  ? 1.3617 1.1143 1.1470 -0.0230 0.0815  0.0399  2481 LYS A CB  
385  N N   . ILE A 52  ? 1.4173 1.2117 1.2339 -0.0357 0.0785  0.0359  2482 ILE A N   
386  C CA  . ILE A 52  ? 1.2640 1.0776 1.0936 -0.0345 0.0756  0.0351  2482 ILE A CA  
387  C C   . ILE A 52  ? 1.1161 0.9399 0.9524 -0.0443 0.0776  0.0332  2482 ILE A C   
388  O O   . ILE A 52  ? 0.7889 0.6164 0.6296 -0.0514 0.0769  0.0305  2482 ILE A O   
389  C CB  . ILE A 52  ? 1.2149 1.0421 1.0567 -0.0292 0.0693  0.0335  2482 ILE A CB  
390  C CG1 . ILE A 52  ? 1.2687 1.0932 1.1085 -0.0185 0.0669  0.0354  2482 ILE A CG1 
391  C CG2 . ILE A 52  ? 1.0670 0.9136 0.9221 -0.0310 0.0667  0.0318  2482 ILE A CG2 
392  C CD1 . ILE A 52  ? 1.3524 1.1591 1.1791 -0.0144 0.0690  0.0372  2482 ILE A CD1 
393  N N   . SER A 53  ? 1.0348 0.8640 0.8720 -0.0440 0.0797  0.0345  2483 SER A N   
394  C CA  . SER A 53  ? 1.0874 0.9261 0.9297 -0.0524 0.0827  0.0334  2483 SER A CA  
395  C C   . SER A 53  ? 1.0326 0.8929 0.8901 -0.0521 0.0779  0.0308  2483 SER A C   
396  O O   . SER A 53  ? 1.0252 0.8959 0.8900 -0.0598 0.0783  0.0281  2483 SER A O   
397  C CB  . SER A 53  ? 1.1181 0.9529 0.9537 -0.0504 0.0872  0.0364  2483 SER A CB  
398  O OG  . SER A 53  ? 1.2654 1.0801 1.0858 -0.0458 0.0902  0.0395  2483 SER A OG  
399  N N   . ASP A 54  ? 1.0000 0.8667 0.8618 -0.0430 0.0735  0.0314  2484 ASP A N   
400  C CA  . ASP A 54  ? 1.0858 0.9716 0.9605 -0.0408 0.0690  0.0294  2484 ASP A CA  
401  C C   . ASP A 54  ? 1.2151 1.1036 1.0951 -0.0347 0.0631  0.0284  2484 ASP A C   
402  O O   . ASP A 54  ? 1.1961 1.0870 1.0780 -0.0267 0.0600  0.0293  2484 ASP A O   
403  C CB  . ASP A 54  ? 1.0236 0.9144 0.8981 -0.0356 0.0696  0.0311  2484 ASP A CB  
404  C CG  . ASP A 54  ? 0.8820 0.7920 0.7677 -0.0364 0.0674  0.0290  2484 ASP A CG  
405  O OD1 . ASP A 54  ? 0.7589 0.6793 0.6529 -0.0407 0.0652  0.0262  2484 ASP A OD1 
406  O OD2 . ASP A 54  ? 0.8039 0.7184 0.6893 -0.0320 0.0678  0.0302  2484 ASP A OD2 
407  N N   . PRO A 55  ? 1.2530 1.1411 1.1352 -0.0385 0.0618  0.0265  2485 PRO A N   
408  C CA  . PRO A 55  ? 1.1483 1.0362 1.0337 -0.0333 0.0575  0.0260  2485 PRO A CA  
409  C C   . PRO A 55  ? 1.0173 0.9214 0.9143 -0.0302 0.0527  0.0243  2485 PRO A C   
410  O O   . PRO A 55  ? 1.1047 1.0203 1.0076 -0.0344 0.0523  0.0223  2485 PRO A O   
411  C CB  . PRO A 55  ? 1.2048 1.0869 1.0875 -0.0392 0.0584  0.0244  2485 PRO A CB  
412  C CG  . PRO A 55  ? 1.2554 1.1448 1.1410 -0.0479 0.0605  0.0222  2485 PRO A CG  
413  C CD  . PRO A 55  ? 1.3087 1.2000 1.1928 -0.0480 0.0637  0.0240  2485 PRO A CD  
414  N N   . LEU A 56  ? 0.9508 0.8557 0.8508 -0.0231 0.0492  0.0251  2486 LEU A N   
415  C CA  . LEU A 56  ? 0.9872 0.9052 0.8971 -0.0201 0.0447  0.0235  2486 LEU A CA  
416  C C   . LEU A 56  ? 0.9625 0.8775 0.8747 -0.0147 0.0418  0.0242  2486 LEU A C   
417  O O   . LEU A 56  ? 0.7337 0.6399 0.6415 -0.0108 0.0424  0.0260  2486 LEU A O   
418  C CB  . LEU A 56  ? 0.9054 0.8315 0.8185 -0.0166 0.0435  0.0238  2486 LEU A CB  
419  C CG  . LEU A 56  ? 0.8822 0.8210 0.8043 -0.0135 0.0391  0.0221  2486 LEU A CG  
420  C CD1 . LEU A 56  ? 0.8168 0.7660 0.7431 -0.0186 0.0392  0.0197  2486 LEU A CD1 
421  C CD2 . LEU A 56  ? 0.9531 0.8961 0.8764 -0.0083 0.0376  0.0227  2486 LEU A CD2 
422  N N   . ASP A 57  ? 0.8871 0.8097 0.8059 -0.0145 0.0389  0.0226  2487 ASP A N   
423  C CA  . ASP A 57  ? 0.8200 0.7412 0.7420 -0.0098 0.0365  0.0233  2487 ASP A CA  
424  C C   . ASP A 57  ? 0.7098 0.6407 0.6397 -0.0060 0.0327  0.0226  2487 ASP A C   
425  O O   . ASP A 57  ? 0.7223 0.6616 0.6548 -0.0071 0.0319  0.0213  2487 ASP A O   
426  C CB  . ASP A 57  ? 0.8809 0.7989 0.8017 -0.0122 0.0368  0.0226  2487 ASP A CB  
427  C CG  . ASP A 57  ? 0.8814 0.8083 0.8055 -0.0160 0.0356  0.0200  2487 ASP A CG  
428  O OD1 . ASP A 57  ? 0.9834 0.9203 0.9120 -0.0162 0.0341  0.0188  2487 ASP A OD1 
429  O OD2 . ASP A 57  ? 1.0206 0.9446 0.9425 -0.0182 0.0360  0.0191  2487 ASP A OD2 
430  N N   . LEU A 58  ? 0.7611 0.6907 0.6945 -0.0014 0.0307  0.0235  2488 LEU A N   
431  C CA  . LEU A 58  ? 0.6429 0.5797 0.5833 0.0021  0.0271  0.0229  2488 LEU A CA  
432  C C   . LEU A 58  ? 0.6042 0.5477 0.5478 0.0007  0.0257  0.0213  2488 LEU A C   
433  O O   . LEU A 58  ? 0.7011 0.6514 0.6483 0.0026  0.0232  0.0203  2488 LEU A O   
434  C CB  . LEU A 58  ? 0.6048 0.5383 0.5488 0.0062  0.0257  0.0240  2488 LEU A CB  
435  C CG  . LEU A 58  ? 0.5988 0.5279 0.5414 0.0095  0.0257  0.0251  2488 LEU A CG  
436  C CD1 . LEU A 58  ? 0.4868 0.4148 0.4348 0.0130  0.0243  0.0258  2488 LEU A CD1 
437  C CD2 . LEU A 58  ? 0.4193 0.3518 0.3617 0.0116  0.0241  0.0244  2488 LEU A CD2 
438  N N   . ILE A 59  ? 0.6805 0.6217 0.6219 -0.0020 0.0270  0.0210  2489 ILE A N   
439  C CA  . ILE A 59  ? 0.6736 0.6211 0.6170 -0.0026 0.0255  0.0194  2489 ILE A CA  
440  C C   . ILE A 59  ? 0.6482 0.6049 0.5925 -0.0045 0.0247  0.0173  2489 ILE A C   
441  O O   . ILE A 59  ? 0.6149 0.5790 0.5625 -0.0021 0.0222  0.0161  2489 ILE A O   
442  C CB  . ILE A 59  ? 0.7621 0.7050 0.7018 -0.0051 0.0270  0.0191  2489 ILE A CB  
443  C CG1 . ILE A 59  ? 0.7827 0.7193 0.7231 -0.0018 0.0273  0.0211  2489 ILE A CG1 
444  C CG2 . ILE A 59  ? 0.6831 0.6332 0.6233 -0.0063 0.0255  0.0167  2489 ILE A CG2 
445  C CD1 . ILE A 59  ? 0.7482 0.6805 0.6846 -0.0029 0.0286  0.0210  2489 ILE A CD1 
446  N N   . THR A 60  ? 0.6648 0.6209 0.6059 -0.0087 0.0272  0.0170  2490 THR A N   
447  C CA  . THR A 60  ? 0.6474 0.6129 0.5897 -0.0111 0.0273  0.0152  2490 THR A CA  
448  C C   . THR A 60  ? 0.6478 0.6186 0.5931 -0.0066 0.0254  0.0155  2490 THR A C   
449  O O   . THR A 60  ? 0.6816 0.6625 0.6299 -0.0054 0.0235  0.0138  2490 THR A O   
450  C CB  . THR A 60  ? 0.7115 0.6733 0.6493 -0.0170 0.0313  0.0153  2490 THR A CB  
451  O OG1 . THR A 60  ? 0.6105 0.5661 0.5449 -0.0210 0.0327  0.0147  2490 THR A OG1 
452  C CG2 . THR A 60  ? 0.6501 0.6233 0.5903 -0.0203 0.0319  0.0133  2490 THR A CG2 
453  N N   . ILE A 61  ? 0.6628 0.6271 0.6069 -0.0035 0.0255  0.0174  2491 ILE A N   
454  C CA  . ILE A 61  ? 0.5785 0.5467 0.5248 0.0010  0.0232  0.0174  2491 ILE A CA  
455  C C   . ILE A 61  ? 0.5791 0.5519 0.5297 0.0047  0.0194  0.0164  2491 ILE A C   
456  O O   . ILE A 61  ? 0.6670 0.6473 0.6193 0.0071  0.0174  0.0150  2491 ILE A O   
457  C CB  . ILE A 61  ? 0.5968 0.5570 0.5413 0.0042  0.0232  0.0192  2491 ILE A CB  
458  C CG1 . ILE A 61  ? 0.6077 0.5620 0.5462 0.0014  0.0271  0.0205  2491 ILE A CG1 
459  C CG2 . ILE A 61  ? 0.5664 0.5300 0.5128 0.0093  0.0202  0.0188  2491 ILE A CG2 
460  C CD1 . ILE A 61  ? 0.6204 0.5689 0.5561 0.0057  0.0268  0.0218  2491 ILE A CD1 
461  N N   . GLU A 62  ? 0.5855 0.5531 0.5373 0.0055  0.0188  0.0171  2492 GLU A N   
462  C CA  . GLU A 62  ? 0.7325 0.7020 0.6874 0.0088  0.0158  0.0165  2492 GLU A CA  
463  C C   . GLU A 62  ? 0.7478 0.7261 0.7027 0.0085  0.0148  0.0144  2492 GLU A C   
464  O O   . GLU A 62  ? 0.7624 0.7450 0.7186 0.0123  0.0120  0.0134  2492 GLU A O   
465  C CB  . GLU A 62  ? 0.8109 0.7731 0.7662 0.0086  0.0166  0.0179  2492 GLU A CB  
466  C CG  . GLU A 62  ? 0.9211 0.8821 0.8793 0.0121  0.0143  0.0182  2492 GLU A CG  
467  C CD  . GLU A 62  ? 0.9509 0.9090 0.9125 0.0148  0.0126  0.0189  2492 GLU A CD  
468  O OE1 . GLU A 62  ? 1.0012 0.9540 0.9640 0.0144  0.0139  0.0203  2492 GLU A OE1 
469  O OE2 . GLU A 62  ? 0.8257 0.7870 0.7885 0.0176  0.0099  0.0177  2492 GLU A OE2 
470  N N   . LYS A 63  ? 0.8263 0.8074 0.7795 0.0042  0.0168  0.0135  2493 LYS A N   
471  C CA  . LYS A 63  ? 0.8198 0.8106 0.7734 0.0035  0.0158  0.0110  2493 LYS A CA  
472  C C   . LYS A 63  ? 0.7429 0.7433 0.6979 0.0046  0.0151  0.0097  2493 LYS A C   
473  O O   . LYS A 63  ? 0.8066 0.8136 0.7627 0.0087  0.0124  0.0083  2493 LYS A O   
474  C CB  . LYS A 63  ? 0.9206 0.9114 0.8724 -0.0023 0.0182  0.0101  2493 LYS A CB  
475  C CG  . LYS A 63  ? 0.9315 0.9324 0.8841 -0.0035 0.0169  0.0070  2493 LYS A CG  
476  C CD  . LYS A 63  ? 0.9688 0.9692 0.9198 -0.0104 0.0194  0.0057  2493 LYS A CD  
477  C CE  . LYS A 63  ? 0.9818 0.9867 0.9338 -0.0152 0.0222  0.0054  2493 LYS A CE  
478  N NZ  . LYS A 63  ? 0.9817 0.9890 0.9331 -0.0225 0.0243  0.0033  2493 LYS A NZ  
479  N N   . GLN A 64  ? 0.7006 0.7009 0.6548 0.0017  0.0176  0.0104  2494 GLN A N   
480  C CA  . GLN A 64  ? 0.7532 0.7624 0.7083 0.0028  0.0177  0.0095  2494 GLN A CA  
481  C C   . GLN A 64  ? 0.6925 0.7022 0.6481 0.0097  0.0145  0.0097  2494 GLN A C   
482  O O   . GLN A 64  ? 0.6837 0.7026 0.6402 0.0124  0.0132  0.0083  2494 GLN A O   
483  C CB  . GLN A 64  ? 0.8015 0.8077 0.7542 -0.0013 0.0217  0.0108  2494 GLN A CB  
484  C CG  . GLN A 64  ? 0.7406 0.7480 0.6927 -0.0088 0.0250  0.0099  2494 GLN A CG  
485  C CD  . GLN A 64  ? 0.7002 0.6994 0.6481 -0.0128 0.0293  0.0119  2494 GLN A CD  
486  O OE1 . GLN A 64  ? 0.8314 0.8238 0.7766 -0.0095 0.0296  0.0140  2494 GLN A OE1 
487  N NE2 . GLN A 64  ? 0.7242 0.7231 0.6709 -0.0198 0.0324  0.0112  2494 GLN A NE2 
488  N N   . ILE A 65  ? 0.6701 0.6703 0.6254 0.0125  0.0130  0.0112  2495 ILE A N   
489  C CA  . ILE A 65  ? 0.6101 0.6098 0.5658 0.0185  0.0096  0.0110  2495 ILE A CA  
490  C C   . ILE A 65  ? 0.6869 0.6931 0.6432 0.0219  0.0069  0.0092  2495 ILE A C   
491  O O   . ILE A 65  ? 0.7632 0.7754 0.7189 0.0259  0.0050  0.0080  2495 ILE A O   
492  C CB  . ILE A 65  ? 0.6214 0.6105 0.5780 0.0203  0.0081  0.0124  2495 ILE A CB  
493  C CG1 . ILE A 65  ? 0.5160 0.4992 0.4715 0.0192  0.0098  0.0139  2495 ILE A CG1 
494  C CG2 . ILE A 65  ? 0.5993 0.5875 0.5568 0.0259  0.0041  0.0116  2495 ILE A CG2 
495  C CD1 . ILE A 65  ? 0.5221 0.4969 0.4795 0.0200  0.0089  0.0151  2495 ILE A CD1 
496  N N   . LEU A 66  ? 0.8000 0.8043 0.7565 0.0209  0.0066  0.0090  2496 LEU A N   
497  C CA  . LEU A 66  ? 0.7135 0.7223 0.6693 0.0247  0.0040  0.0074  2496 LEU A CA  
498  C C   . LEU A 66  ? 0.8127 0.8353 0.7686 0.0260  0.0035  0.0050  2496 LEU A C   
499  O O   . LEU A 66  ? 0.7602 0.7869 0.7146 0.0312  0.0007  0.0035  2496 LEU A O   
500  C CB  . LEU A 66  ? 0.6872 0.6925 0.6424 0.0227  0.0047  0.0077  2496 LEU A CB  
501  C CG  . LEU A 66  ? 0.7266 0.7195 0.6818 0.0222  0.0054  0.0100  2496 LEU A CG  
502  C CD1 . LEU A 66  ? 0.6057 0.5967 0.5591 0.0212  0.0062  0.0100  2496 LEU A CD1 
503  C CD2 . LEU A 66  ? 0.6196 0.6064 0.5749 0.0269  0.0029  0.0107  2496 LEU A CD2 
504  N N   . THR A 67  ? 0.8245 0.8538 0.7819 0.0213  0.0063  0.0046  2497 THR A N   
505  C CA  . THR A 67  ? 0.6744 0.7183 0.6333 0.0209  0.0068  0.0023  2497 THR A CA  
506  C C   . THR A 67  ? 0.9204 0.9689 0.8786 0.0252  0.0061  0.0022  2497 THR A C   
507  O O   . THR A 67  ? 1.1334 1.1947 1.0926 0.0273  0.0057  0.0002  2497 THR A O   
508  C CB  . THR A 67  ? 0.6422 0.6893 0.6029 0.0128  0.0109  0.0023  2497 THR A CB  
509  O OG1 . THR A 67  ? 0.6973 0.7455 0.6587 0.0094  0.0109  0.0009  2497 THR A OG1 
510  C CG2 . THR A 67  ? 0.7608 0.8209 0.7236 0.0112  0.0129  0.0010  2497 THR A CG2 
511  N N   . GLY A 68  ? 0.9909 1.0297 0.9475 0.0268  0.0060  0.0042  2498 GLY A N   
512  C CA  . GLY A 68  ? 0.9548 0.9965 0.9100 0.0300  0.0061  0.0044  2498 GLY A CA  
513  C C   . GLY A 68  ? 0.9493 0.9946 0.9050 0.0246  0.0107  0.0053  2498 GLY A C   
514  O O   . GLY A 68  ? 1.0400 1.0915 0.9947 0.0265  0.0119  0.0052  2498 GLY A O   
515  N N   . TYR A 69  ? 0.8543 0.8950 0.8108 0.0179  0.0136  0.0062  2499 TYR A N   
516  C CA  . TYR A 69  ? 0.8195 0.8606 0.7753 0.0121  0.0185  0.0074  2499 TYR A CA  
517  C C   . TYR A 69  ? 0.8640 0.8980 0.8159 0.0146  0.0197  0.0095  2499 TYR A C   
518  O O   . TYR A 69  ? 0.8712 0.9075 0.8214 0.0118  0.0238  0.0105  2499 TYR A O   
519  C CB  . TYR A 69  ? 0.7310 0.7646 0.6868 0.0057  0.0206  0.0081  2499 TYR A CB  
520  C CG  . TYR A 69  ? 0.7477 0.7766 0.7011 -0.0001 0.0255  0.0098  2499 TYR A CG  
521  C CD1 . TYR A 69  ? 0.9064 0.9427 0.8614 -0.0068 0.0290  0.0087  2499 TYR A CD1 
522  C CD2 . TYR A 69  ? 0.8379 0.8539 0.7869 0.0007  0.0266  0.0123  2499 TYR A CD2 
523  C CE1 . TYR A 69  ? 0.9230 0.9528 0.8748 -0.0127 0.0340  0.0104  2499 TYR A CE1 
524  C CE2 . TYR A 69  ? 0.7626 0.7722 0.7078 -0.0042 0.0314  0.0140  2499 TYR A CE2 
525  C CZ  . TYR A 69  ? 0.8672 0.8829 0.8133 -0.0110 0.0352  0.0132  2499 TYR A CZ  
526  O OH  . TYR A 69  ? 0.8744 0.8823 0.8158 -0.0162 0.0402  0.0150  2499 TYR A OH  
527  N N   . TYR A 70  ? 0.8363 0.8614 0.7866 0.0197  0.0164  0.0102  2500 TYR A N   
528  C CA  . TYR A 70  ? 0.7891 0.8071 0.7355 0.0229  0.0166  0.0118  2500 TYR A CA  
529  C C   . TYR A 70  ? 0.7895 0.8124 0.7348 0.0301  0.0134  0.0106  2500 TYR A C   
530  O O   . TYR A 70  ? 0.7504 0.7708 0.6964 0.0347  0.0089  0.0095  2500 TYR A O   
531  C CB  . TYR A 70  ? 0.7158 0.7213 0.6617 0.0237  0.0147  0.0129  2500 TYR A CB  
532  C CG  . TYR A 70  ? 0.6582 0.6575 0.6039 0.0175  0.0180  0.0142  2500 TYR A CG  
533  C CD1 . TYR A 70  ? 0.6576 0.6524 0.5992 0.0144  0.0223  0.0159  2500 TYR A CD1 
534  C CD2 . TYR A 70  ? 0.7045 0.7017 0.6531 0.0153  0.0169  0.0138  2500 TYR A CD2 
535  C CE1 . TYR A 70  ? 0.6363 0.6242 0.5766 0.0091  0.0251  0.0171  2500 TYR A CE1 
536  C CE2 . TYR A 70  ? 0.6711 0.6621 0.6187 0.0101  0.0197  0.0149  2500 TYR A CE2 
537  C CZ  . TYR A 70  ? 0.7100 0.6963 0.6535 0.0070  0.0237  0.0164  2500 TYR A CZ  
538  O OH  . TYR A 70  ? 0.6848 0.6638 0.6263 0.0023  0.0264  0.0174  2500 TYR A OH  
539  N N   . LYS A 71  ? 0.8042 0.8334 0.7470 0.0310  0.0161  0.0109  2501 LYS A N   
540  C CA  . LYS A 71  ? 0.8294 0.8657 0.7707 0.0379  0.0138  0.0096  2501 LYS A CA  
541  C C   . LYS A 71  ? 0.9169 0.9446 0.8530 0.0435  0.0121  0.0104  2501 LYS A C   
542  O O   . LYS A 71  ? 1.0747 1.1035 1.0087 0.0505  0.0083  0.0091  2501 LYS A O   
543  C CB  . LYS A 71  ? 0.8311 0.8811 0.7733 0.0357  0.0180  0.0093  2501 LYS A CB  
544  C CG  . LYS A 71  ? 0.7658 0.8139 0.7058 0.0298  0.0244  0.0116  2501 LYS A CG  
545  C CD  . LYS A 71  ? 0.7066 0.7522 0.6495 0.0209  0.0275  0.0121  2501 LYS A CD  
546  C CE  . LYS A 71  ? 0.6329 0.6645 0.5708 0.0176  0.0309  0.0149  2501 LYS A CE  
547  N NZ  . LYS A 71  ? 0.4951 0.5206 0.4349 0.0105  0.0321  0.0151  2501 LYS A NZ  
548  N N   . THR A 72  ? 0.8595 0.8783 0.7930 0.0408  0.0146  0.0124  2502 THR A N   
549  C CA  . THR A 72  ? 0.7863 0.7957 0.7152 0.0458  0.0125  0.0129  2502 THR A CA  
550  C C   . THR A 72  ? 0.7228 0.7213 0.6529 0.0435  0.0114  0.0137  2502 THR A C   
551  O O   . THR A 72  ? 0.6752 0.6721 0.6078 0.0372  0.0141  0.0147  2502 THR A O   
552  C CB  . THR A 72  ? 0.8012 0.8102 0.7238 0.0464  0.0171  0.0149  2502 THR A CB  
553  O OG1 . THR A 72  ? 0.7827 0.7869 0.7045 0.0395  0.0222  0.0170  2502 THR A OG1 
554  C CG2 . THR A 72  ? 0.8833 0.9046 0.8055 0.0475  0.0197  0.0145  2502 THR A CG2 
555  N N   . VAL A 73  ? 0.6327 0.6240 0.5608 0.0487  0.0075  0.0131  2503 VAL A N   
556  C CA  . VAL A 73  ? 0.6180 0.6001 0.5473 0.0473  0.0064  0.0137  2503 VAL A CA  
557  C C   . VAL A 73  ? 0.6737 0.6503 0.5979 0.0446  0.0115  0.0162  2503 VAL A C   
558  O O   . VAL A 73  ? 0.6411 0.6115 0.5664 0.0416  0.0124  0.0172  2503 VAL A O   
559  C CB  . VAL A 73  ? 0.6147 0.5920 0.5440 0.0535  0.0007  0.0120  2503 VAL A CB  
560  C CG1 . VAL A 73  ? 0.6194 0.5937 0.5411 0.0588  0.0011  0.0124  2503 VAL A CG1 
561  C CG2 . VAL A 73  ? 0.5832 0.5543 0.5172 0.0514  -0.0010 0.0119  2503 VAL A CG2 
562  N N   . GLU A 74  ? 0.7269 0.7052 0.6449 0.0460  0.0150  0.0174  2504 GLU A N   
563  C CA  . GLU A 74  ? 0.8269 0.7987 0.7386 0.0432  0.0205  0.0200  2504 GLU A CA  
564  C C   . GLU A 74  ? 0.7438 0.7162 0.6584 0.0346  0.0249  0.0211  2504 GLU A C   
565  O O   . GLU A 74  ? 0.8097 0.7737 0.7213 0.0317  0.0274  0.0227  2504 GLU A O   
566  C CB  . GLU A 74  ? 0.8845 0.8580 0.7887 0.0459  0.0242  0.0213  2504 GLU A CB  
567  C CG  . GLU A 74  ? 0.9050 0.8741 0.8032 0.0550  0.0207  0.0207  2504 GLU A CG  
568  C CD  . GLU A 74  ? 1.0141 0.9897 0.9156 0.0608  0.0146  0.0178  2504 GLU A CD  
569  O OE1 . GLU A 74  ? 1.1678 1.1388 1.0681 0.0670  0.0091  0.0160  2504 GLU A OE1 
570  O OE2 . GLU A 74  ? 0.8284 0.8133 0.7333 0.0594  0.0152  0.0171  2504 GLU A OE2 
571  N N   . ALA A 75  ? 0.7300 0.7121 0.6498 0.0310  0.0254  0.0200  2505 ALA A N   
572  C CA  . ALA A 75  ? 0.7882 0.7719 0.7108 0.0228  0.0291  0.0205  2505 ALA A CA  
573  C C   . ALA A 75  ? 0.7690 0.7464 0.6950 0.0212  0.0266  0.0202  2505 ALA A C   
574  O O   . ALA A 75  ? 0.8594 0.8311 0.7840 0.0160  0.0297  0.0214  2505 ALA A O   
575  C CB  . ALA A 75  ? 0.7634 0.7604 0.6915 0.0204  0.0292  0.0188  2505 ALA A CB  
576  N N   . PHE A 76  ? 0.8448 0.8230 0.7751 0.0256  0.0211  0.0187  2506 PHE A N   
577  C CA  . PHE A 76  ? 0.8167 0.7893 0.7506 0.0251  0.0186  0.0184  2506 PHE A CA  
578  C C   . PHE A 76  ? 0.8527 0.8150 0.7824 0.0264  0.0195  0.0200  2506 PHE A C   
579  O O   . PHE A 76  ? 0.9129 0.8697 0.8420 0.0226  0.0218  0.0211  2506 PHE A O   
580  C CB  . PHE A 76  ? 0.8650 0.8401 0.8037 0.0300  0.0128  0.0165  2506 PHE A CB  
581  C CG  . PHE A 76  ? 0.8247 0.7949 0.7680 0.0294  0.0104  0.0164  2506 PHE A CG  
582  C CD1 . PHE A 76  ? 0.8267 0.7967 0.7725 0.0245  0.0123  0.0169  2506 PHE A CD1 
583  C CD2 . PHE A 76  ? 0.8710 0.8372 0.8162 0.0337  0.0064  0.0156  2506 PHE A CD2 
584  C CE1 . PHE A 76  ? 0.7738 0.7393 0.7235 0.0242  0.0107  0.0170  2506 PHE A CE1 
585  C CE2 . PHE A 76  ? 0.8166 0.7791 0.7667 0.0328  0.0048  0.0156  2506 PHE A CE2 
586  C CZ  . PHE A 76  ? 0.7604 0.7225 0.7126 0.0281  0.0073  0.0165  2506 PHE A CZ  
587  N N   . ASP A 77  ? 0.8784 0.8382 0.8047 0.0322  0.0176  0.0199  2507 ASP A N   
588  C CA  . ASP A 77  ? 0.6893 0.6398 0.6106 0.0347  0.0182  0.0211  2507 ASP A CA  
589  C C   . ASP A 77  ? 0.6464 0.5911 0.5617 0.0297  0.0243  0.0234  2507 ASP A C   
590  O O   . ASP A 77  ? 0.6110 0.5486 0.5250 0.0286  0.0252  0.0243  2507 ASP A O   
591  C CB  . ASP A 77  ? 0.6767 0.6260 0.5925 0.0415  0.0165  0.0208  2507 ASP A CB  
592  C CG  . ASP A 77  ? 0.7185 0.6693 0.6389 0.0472  0.0098  0.0183  2507 ASP A CG  
593  O OD1 . ASP A 77  ? 0.7036 0.6556 0.6316 0.0457  0.0069  0.0171  2507 ASP A OD1 
594  O OD2 . ASP A 77  ? 0.7685 0.7190 0.6849 0.0532  0.0074  0.0173  2507 ASP A OD2 
595  N N   . ALA A 78  ? 0.6382 0.5860 0.5499 0.0265  0.0285  0.0243  2508 ALA A N   
596  C CA  . ALA A 78  ? 0.6415 0.5828 0.5465 0.0214  0.0347  0.0265  2508 ALA A CA  
597  C C   . ALA A 78  ? 0.6485 0.5876 0.5568 0.0154  0.0357  0.0264  2508 ALA A C   
598  O O   . ALA A 78  ? 0.7696 0.6986 0.6728 0.0142  0.0380  0.0278  2508 ALA A O   
599  C CB  . ALA A 78  ? 0.6170 0.5647 0.5199 0.0181  0.0389  0.0270  2508 ALA A CB  
600  N N   . ASP A 79  ? 0.6960 0.6439 0.6123 0.0125  0.0337  0.0246  2509 ASP A N   
601  C CA  . ASP A 79  ? 0.7251 0.6710 0.6443 0.0075  0.0342  0.0243  2509 ASP A CA  
602  C C   . ASP A 79  ? 0.7547 0.6934 0.6748 0.0107  0.0316  0.0247  2509 ASP A C   
603  O O   . ASP A 79  ? 0.7788 0.7095 0.6954 0.0083  0.0340  0.0258  2509 ASP A O   
604  C CB  . ASP A 79  ? 0.7147 0.6717 0.6415 0.0049  0.0322  0.0223  2509 ASP A CB  
605  C CG  . ASP A 79  ? 0.6328 0.5962 0.5592 -0.0013 0.0361  0.0217  2509 ASP A CG  
606  O OD1 . ASP A 79  ? 0.6587 0.6180 0.5793 -0.0044 0.0407  0.0231  2509 ASP A OD1 
607  O OD2 . ASP A 79  ? 0.6462 0.6192 0.5784 -0.0032 0.0344  0.0198  2509 ASP A OD2 
608  N N   . MET A 80  ? 0.8148 0.7564 0.7397 0.0161  0.0269  0.0237  2510 MET A N   
609  C CA  . MET A 80  ? 0.7852 0.7217 0.7124 0.0188  0.0247  0.0239  2510 MET A CA  
610  C C   . MET A 80  ? 0.8434 0.7700 0.7628 0.0209  0.0270  0.0256  2510 MET A C   
611  O O   . MET A 80  ? 0.8802 0.8009 0.7985 0.0197  0.0283  0.0264  2510 MET A O   
612  C CB  . MET A 80  ? 0.7906 0.7314 0.7239 0.0241  0.0193  0.0223  2510 MET A CB  
613  C CG  . MET A 80  ? 0.7985 0.7467 0.7390 0.0228  0.0167  0.0208  2510 MET A CG  
614  S SD  . MET A 80  ? 0.7791 0.7262 0.7250 0.0195  0.0168  0.0211  2510 MET A SD  
615  C CE  . MET A 80  ? 0.5567 0.4993 0.5063 0.0237  0.0142  0.0212  2510 MET A CE  
616  N N   . LEU A 81  ? 0.7764 0.7008 0.6897 0.0244  0.0277  0.0261  2511 LEU A N   
617  C CA  . LEU A 81  ? 0.7274 0.6414 0.6317 0.0275  0.0299  0.0278  2511 LEU A CA  
618  C C   . LEU A 81  ? 0.7747 0.6799 0.6708 0.0223  0.0357  0.0298  2511 LEU A C   
619  O O   . LEU A 81  ? 0.8920 0.7873 0.7810 0.0247  0.0373  0.0311  2511 LEU A O   
620  C CB  . LEU A 81  ? 0.7738 0.6868 0.6722 0.0332  0.0292  0.0279  2511 LEU A CB  
621  C CG  . LEU A 81  ? 0.7755 0.6947 0.6801 0.0395  0.0229  0.0257  2511 LEU A CG  
622  C CD1 . LEU A 81  ? 0.6683 0.5847 0.5651 0.0463  0.0221  0.0257  2511 LEU A CD1 
623  C CD2 . LEU A 81  ? 0.7195 0.6380 0.6300 0.0416  0.0196  0.0248  2511 LEU A CD2 
624  N N   . LYS A 82  ? 0.7631 0.6717 0.6598 0.0157  0.0386  0.0297  2512 LYS A N   
625  C CA  . LYS A 82  ? 0.7886 0.6893 0.6786 0.0093  0.0440  0.0311  2512 LYS A CA  
626  C C   . LYS A 82  ? 0.8263 0.7229 0.7182 0.0071  0.0436  0.0308  2512 LYS A C   
627  O O   . LYS A 82  ? 0.8427 0.7282 0.7266 0.0053  0.0470  0.0321  2512 LYS A O   
628  C CB  . LYS A 82  ? 0.8076 0.7159 0.7002 0.0026  0.0465  0.0303  2512 LYS A CB  
629  C CG  . LYS A 82  ? 0.8286 0.7303 0.7158 -0.0053 0.0517  0.0310  2512 LYS A CG  
630  C CD  . LYS A 82  ? 0.8975 0.8080 0.7870 -0.0114 0.0546  0.0303  2512 LYS A CD  
631  C CE  . LYS A 82  ? 0.9322 0.8566 0.8327 -0.0145 0.0514  0.0275  2512 LYS A CE  
632  N NZ  . LYS A 82  ? 0.9914 0.9282 0.8960 -0.0161 0.0522  0.0266  2512 LYS A NZ  
633  N N   . VAL A 83  ? 0.8267 0.7316 0.7283 0.0075  0.0397  0.0292  2513 VAL A N   
634  C CA  . VAL A 83  ? 0.7507 0.6530 0.6550 0.0066  0.0390  0.0291  2513 VAL A CA  
635  C C   . VAL A 83  ? 0.8032 0.6979 0.7041 0.0125  0.0383  0.0302  2513 VAL A C   
636  O O   . VAL A 83  ? 0.9440 0.8310 0.8409 0.0117  0.0401  0.0310  2513 VAL A O   
637  C CB  . VAL A 83  ? 0.7824 0.6950 0.6976 0.0068  0.0349  0.0274  2513 VAL A CB  
638  C CG1 . VAL A 83  ? 0.8097 0.7191 0.7271 0.0071  0.0345  0.0277  2513 VAL A CG1 
639  C CG2 . VAL A 83  ? 0.7143 0.6353 0.6329 0.0017  0.0353  0.0260  2513 VAL A CG2 
640  N N   . PHE A 84  ? 0.7128 0.6096 0.6149 0.0186  0.0355  0.0301  2514 PHE A N   
641  C CA  . PHE A 84  ? 0.8230 0.7136 0.7217 0.0248  0.0346  0.0308  2514 PHE A CA  
642  C C   . PHE A 84  ? 0.8338 0.7116 0.7188 0.0257  0.0389  0.0327  2514 PHE A C   
643  O O   . PHE A 84  ? 0.9242 0.7939 0.8040 0.0281  0.0401  0.0337  2514 PHE A O   
644  C CB  . PHE A 84  ? 0.8725 0.7687 0.7757 0.0315  0.0301  0.0296  2514 PHE A CB  
645  C CG  . PHE A 84  ? 0.8623 0.7693 0.7783 0.0315  0.0256  0.0277  2514 PHE A CG  
646  C CD1 . PHE A 84  ? 0.9044 0.8141 0.8274 0.0286  0.0253  0.0275  2514 PHE A CD1 
647  C CD2 . PHE A 84  ? 0.9030 0.8164 0.8230 0.0350  0.0217  0.0261  2514 PHE A CD2 
648  C CE1 . PHE A 84  ? 0.9010 0.8191 0.8347 0.0287  0.0215  0.0260  2514 PHE A CE1 
649  C CE2 . PHE A 84  ? 0.9590 0.8807 0.8898 0.0350  0.0175  0.0242  2514 PHE A CE2 
650  C CZ  . PHE A 84  ? 0.8459 0.7696 0.7835 0.0317  0.0176  0.0243  2514 PHE A CZ  
651  N N   . ARG A 85  ? 0.7528 0.6285 0.6315 0.0243  0.0414  0.0334  2515 ARG A N   
652  C CA  . ARG A 85  ? 0.8116 0.6738 0.6760 0.0251  0.0460  0.0355  2515 ARG A CA  
653  C C   . ARG A 85  ? 0.8409 0.6939 0.6996 0.0190  0.0502  0.0364  2515 ARG A C   
654  O O   . ARG A 85  ? 0.8880 0.7294 0.7376 0.0219  0.0520  0.0377  2515 ARG A O   
655  C CB  . ARG A 85  ? 0.7289 0.5913 0.5882 0.0237  0.0486  0.0363  2515 ARG A CB  
656  N N   . ASN A 86  ? 0.8843 0.7426 0.7482 0.0112  0.0513  0.0355  2516 ASN A N   
657  C CA  . ASN A 86  ? 0.9519 0.8024 0.8115 0.0051  0.0544  0.0357  2516 ASN A CA  
658  C C   . ASN A 86  ? 1.0200 0.8655 0.8790 0.0089  0.0530  0.0358  2516 ASN A C   
659  O O   . ASN A 86  ? 1.1882 1.0216 1.0380 0.0072  0.0561  0.0367  2516 ASN A O   
660  C CB  . ASN A 86  ? 0.9905 0.8510 0.8586 -0.0025 0.0541  0.0338  2516 ASN A CB  
661  C CG  . ASN A 86  ? 0.9922 0.8561 0.8593 -0.0080 0.0570  0.0337  2516 ASN A CG  
662  O OD1 . ASN A 86  ? 0.9998 0.8567 0.8584 -0.0069 0.0601  0.0354  2516 ASN A OD1 
663  N ND2 . ASN A 86  ? 0.9230 0.7980 0.7984 -0.0138 0.0562  0.0317  2516 ASN A ND2 
664  N N   . ALA A 87  ? 1.0274 0.8820 0.8961 0.0139  0.0485  0.0349  2517 ALA A N   
665  C CA  . ALA A 87  ? 1.1102 0.9622 0.9800 0.0174  0.0474  0.0351  2517 ALA A CA  
666  C C   . ALA A 87  ? 1.0837 0.9248 0.9431 0.0242  0.0486  0.0366  2517 ALA A C   
667  O O   . ALA A 87  ? 1.2195 1.0506 1.0714 0.0251  0.0507  0.0375  2517 ALA A O   
668  C CB  . ALA A 87  ? 1.0672 0.9323 0.9508 0.0201  0.0428  0.0338  2517 ALA A CB  
669  N N   . GLU A 88  ? 1.0167 0.8592 0.8746 0.0295  0.0472  0.0368  2518 GLU A N   
670  C CA  . GLU A 88  ? 1.0237 0.8559 0.8704 0.0369  0.0481  0.0381  2518 GLU A CA  
671  C C   . GLU A 88  ? 0.9623 0.7775 0.7924 0.0345  0.0537  0.0401  2518 GLU A C   
672  O O   . GLU A 88  ? 0.8931 0.6964 0.7123 0.0394  0.0554  0.0413  2518 GLU A O   
673  C CB  . GLU A 88  ? 1.0306 0.8685 0.8791 0.0431  0.0451  0.0375  2518 GLU A CB  
674  C CG  . GLU A 88  ? 1.0415 0.8938 0.9049 0.0463  0.0394  0.0354  2518 GLU A CG  
675  C CD  . GLU A 88  ? 0.9696 0.8279 0.8352 0.0516  0.0359  0.0343  2518 GLU A CD  
676  O OE1 . GLU A 88  ? 0.7742 0.6313 0.6354 0.0496  0.0374  0.0347  2518 GLU A OE1 
677  O OE2 . GLU A 88  ? 1.1716 1.0364 1.0439 0.0576  0.0315  0.0327  2518 GLU A OE2 
678  N N   . LYS A 89  ? 0.7741 0.6995 0.7387 -0.0220 0.0426  0.0048  2519 LYS A N   
679  C CA  . LYS A 89  ? 0.8850 0.7995 0.8373 -0.0364 0.0252  0.0167  2519 LYS A CA  
680  C C   . LYS A 89  ? 0.9753 0.8171 0.8753 -0.0243 0.0048  0.0249  2519 LYS A C   
681  O O   . LYS A 89  ? 1.0186 0.8348 0.8932 -0.0271 -0.0030 0.0340  2519 LYS A O   
682  C CB  . LYS A 89  ? 0.9608 0.9099 0.9683 -0.0540 0.0200  0.0133  2519 LYS A CB  
683  N N   . TYR A 90  ? 1.0834 0.8822 0.9593 -0.0145 -0.0039 0.0212  2520 TYR A N   
684  C CA  . TYR A 90  ? 1.1655 0.8735 0.9608 -0.0119 -0.0199 0.0249  2520 TYR A CA  
685  C C   . TYR A 90  ? 1.2006 0.8629 0.9431 0.0048  0.0158  0.0173  2520 TYR A C   
686  O O   . TYR A 90  ? 1.3937 0.9920 1.0822 0.0067  0.0192  0.0147  2520 TYR A O   
687  C CB  . TYR A 90  ? 1.2464 0.9067 1.0174 -0.0207 -0.0537 0.0292  2520 TYR A CB  
688  C CG  . TYR A 90  ? 1.3885 0.9352 1.0478 -0.0306 -0.0773 0.0332  2520 TYR A CG  
689  C CD1 . TYR A 90  ? 1.4622 0.9724 1.1049 -0.0462 -0.1177 0.0434  2520 TYR A CD1 
690  C CD2 . TYR A 90  ? 1.5239 0.9916 1.0847 -0.0289 -0.0566 0.0257  2520 TYR A CD2 
691  C CE1 . TYR A 90  ? 1.5703 0.9596 1.0920 -0.0601 -0.1423 0.0440  2520 TYR A CE1 
692  C CE2 . TYR A 90  ? 1.6353 0.9804 1.0667 -0.0452 -0.0712 0.0238  2520 TYR A CE2 
693  C CZ  . TYR A 90  ? 1.6692 0.9719 1.0774 -0.0607 -0.1165 0.0319  2520 TYR A CZ  
694  O OH  . TYR A 90  ? 1.7831 0.9491 1.0463 -0.0812 -0.1339 0.0273  2520 TYR A OH  
695  N N   . TYR A 91  ? 1.1695 0.8601 0.9345 0.0166  0.0451  0.0126  2521 TYR A N   
696  C CA  . TYR A 91  ? 1.2127 0.8669 0.9526 0.0323  0.0872  0.0069  2521 TYR A CA  
697  C C   . TYR A 91  ? 1.1872 0.8920 1.0006 0.0424  0.1057  0.0121  2521 TYR A C   
698  O O   . TYR A 91  ? 1.3722 1.0450 1.1928 0.0560  0.1372  0.0092  2521 TYR A O   
699  C CB  . TYR A 91  ? 1.3093 0.9570 1.0357 0.0360  0.1057  0.0047  2521 TYR A CB  
700  C CG  . TYR A 91  ? 1.4011 0.9783 1.0441 0.0195  0.0789  0.0060  2521 TYR A CG  
701  C CD1 . TYR A 91  ? 1.4708 0.9423 0.9995 0.0108  0.0945  -0.0001 2521 TYR A CD1 
702  C CD2 . TYR A 91  ? 1.2692 0.8761 0.9483 0.0084  0.0355  0.0137  2521 TYR A CD2 
703  C CE1 . TYR A 91  ? 1.5551 0.9440 0.9873 -0.0147 0.0569  0.0067  2521 TYR A CE1 
704  C CE2 . TYR A 91  ? 1.2808 0.8160 0.8955 -0.0118 -0.0052 0.0230  2521 TYR A CE2 
705  C CZ  . TYR A 91  ? 1.3782 0.8007 0.8597 -0.0265 0.0003  0.0222  2521 TYR A CZ  
706  O OH  . TYR A 91  ? 1.3717 0.7048 0.7677 -0.0566 -0.0515 0.0366  2521 TYR A OH  
707  N N   . GLY A 92  ? 1.0716 0.8478 0.9410 0.0325  0.0871  0.0200  2522 GLY A N   
708  C CA  . GLY A 92  ? 1.0436 0.8570 0.9717 0.0311  0.0876  0.0325  2522 GLY A CA  
709  C C   . GLY A 92  ? 0.9940 0.8440 0.9639 0.0356  0.1008  0.0352  2522 GLY A C   
710  O O   . GLY A 92  ? 0.9998 0.8296 0.9688 0.0515  0.1280  0.0303  2522 GLY A O   
711  N N   . ARG A 93  ? 0.9809 0.8763 0.9777 0.0168  0.0815  0.0438  2523 ARG A N   
712  C CA  . ARG A 93  ? 0.8912 0.8147 0.9214 0.0154  0.0843  0.0473  2523 ARG A CA  
713  C C   . ARG A 93  ? 0.8360 0.7446 0.9211 0.0366  0.1041  0.0591  2523 ARG A C   
714  O O   . ARG A 93  ? 0.7562 0.6786 0.8672 0.0424  0.1139  0.0603  2523 ARG A O   
715  C CB  . ARG A 93  ? 0.8213 0.7693 0.8544 -0.0165 0.0553  0.0599  2523 ARG A CB  
716  C CG  . ARG A 93  ? 0.7118 0.6784 0.6957 -0.0431 0.0524  0.0441  2523 ARG A CG  
717  C CD  . ARG A 93  ? 0.6683 0.6447 0.6288 -0.0786 0.0373  0.0480  2523 ARG A CD  
718  N N   . LYS A 94  ? 1.0022 0.8819 1.1151 0.0481  0.1134  0.0668  2524 LYS A N   
719  C CA  . LYS A 94  ? 0.9588 0.8279 1.1577 0.0673  0.1393  0.0789  2524 LYS A CA  
720  C C   . LYS A 94  ? 1.1387 0.9644 1.3098 0.0902  0.1984  0.0592  2524 LYS A C   
721  O O   . LYS A 94  ? 1.3313 1.1526 1.5727 0.1053  0.2372  0.0643  2524 LYS A O   
722  C CB  . LYS A 94  ? 0.8529 0.7110 1.1207 0.0654  0.1182  0.0975  2524 LYS A CB  
723  C CG  . LYS A 94  ? 0.7782 0.5987 0.9869 0.0658  0.1166  0.0839  2524 LYS A CG  
724  C CD  . LYS A 94  ? 0.7648 0.6049 0.9199 0.0343  0.0656  0.0928  2524 LYS A CD  
725  C CE  . LYS A 94  ? 0.7968 0.6049 0.8714 0.0348  0.0698  0.0739  2524 LYS A CE  
726  N NZ  . LYS A 94  ? 0.7078 0.5445 0.7291 0.0055  0.0388  0.0760  2524 LYS A NZ  
727  N N   . SER A 95  ? 1.2381 1.0257 1.3052 0.0876  0.2043  0.0389  2525 SER A N   
728  C CA  . SER A 95  ? 1.2748 0.9992 1.2706 0.0959  0.2522  0.0206  2525 SER A CA  
729  C C   . SER A 95  ? 1.3005 1.0387 1.2915 0.0949  0.2688  0.0236  2525 SER A C   
730  O O   . SER A 95  ? 1.2627 1.0573 1.2938 0.0889  0.2367  0.0345  2525 SER A O   
731  C CB  . SER A 95  ? 1.2692 0.9446 1.1511 0.0833  0.2297  0.0069  2525 SER A CB  
732  O OG  . SER A 95  ? 1.1300 0.8500 1.0021 0.0692  0.1829  0.0121  2525 SER A OG  
733  N N   . PRO A 96  ? 1.3456 1.0240 1.2773 0.0963  0.3197  0.0131  2526 PRO A N   
734  C CA  . PRO A 96  ? 1.3128 1.0023 1.2413 0.0912  0.3317  0.0210  2526 PRO A CA  
735  C C   . PRO A 96  ? 1.1793 0.8821 1.0538 0.0757  0.2758  0.0231  2526 PRO A C   
736  O O   . PRO A 96  ? 1.0046 0.7434 0.9152 0.0734  0.2633  0.0329  2526 PRO A O   
737  C CB  . PRO A 96  ? 1.4964 1.0991 1.3377 0.0859  0.3988  0.0077  2526 PRO A CB  
738  C CG  . PRO A 96  ? 1.5405 1.0717 1.2828 0.0797  0.3954  -0.0114 2526 PRO A CG  
739  C CD  . PRO A 96  ? 1.4752 1.0611 1.3137 0.0949  0.3640  -0.0077 2526 PRO A CD  
740  N N   . VAL A 97  ? 0.8152 0.7884 0.7615 0.0553  0.0240  0.0163  2527 VAL A N   
741  C CA  . VAL A 97  ? 0.7482 0.7177 0.6905 0.0508  0.0207  0.0179  2527 VAL A CA  
742  C C   . VAL A 97  ? 0.8233 0.7957 0.7712 0.0495  0.0164  0.0190  2527 VAL A C   
743  O O   . VAL A 97  ? 0.9494 0.9220 0.8977 0.0460  0.0149  0.0202  2527 VAL A O   
744  C CB  . VAL A 97  ? 0.8107 0.7690 0.7418 0.0506  0.0188  0.0176  2527 VAL A CB  
745  C CG1 . VAL A 97  ? 0.7745 0.7300 0.7051 0.0469  0.0146  0.0190  2527 VAL A CG1 
746  C CG2 . VAL A 97  ? 0.7961 0.7488 0.7184 0.0500  0.0225  0.0171  2527 VAL A CG2 
747  N N   . GLY A 98  ? 0.7716 0.7450 0.7228 0.0525  0.0144  0.0183  2528 GLY A N   
748  C CA  . GLY A 98  ? 0.7742 0.7480 0.7283 0.0514  0.0105  0.0192  2528 GLY A CA  
749  C C   . GLY A 98  ? 0.8396 0.8218 0.8028 0.0506  0.0103  0.0199  2528 GLY A C   
750  O O   . GLY A 98  ? 0.8774 0.8599 0.8415 0.0478  0.0080  0.0211  2528 GLY A O   
751  N N   . ARG A 99  ? 0.8375 0.8265 0.8080 0.0531  0.0127  0.0191  2529 ARG A N   
752  C CA  . ARG A 99  ? 0.8329 0.8313 0.8140 0.0518  0.0129  0.0199  2529 ARG A CA  
753  C C   . ARG A 99  ? 0.8314 0.8305 0.8103 0.0468  0.0143  0.0215  2529 ARG A C   
754  O O   . ARG A 99  ? 0.9348 0.9372 0.9181 0.0442  0.0120  0.0228  2529 ARG A O   
755  C CB  . ARG A 99  ? 0.9342 0.9406 0.9244 0.0549  0.0173  0.0186  2529 ARG A CB  
756  N N   . ASP A 100 ? 0.9106 0.9053 0.8817 0.0456  0.0174  0.0213  2530 ASP A N   
757  C CA  . ASP A 100 ? 0.8130 0.8068 0.7809 0.0411  0.0183  0.0226  2530 ASP A CA  
758  C C   . ASP A 100 ? 0.8497 0.8388 0.8143 0.0390  0.0140  0.0235  2530 ASP A C   
759  O O   . ASP A 100 ? 0.7680 0.7592 0.7352 0.0363  0.0124  0.0246  2530 ASP A O   
760  C CB  . ASP A 100 ? 0.8071 0.7947 0.7659 0.0405  0.0214  0.0221  2530 ASP A CB  
761  C CG  . ASP A 100 ? 0.8249 0.8158 0.7846 0.0414  0.0273  0.0213  2530 ASP A CG  
762  O OD1 . ASP A 100 ? 0.8711 0.8711 0.8412 0.0422  0.0295  0.0211  2530 ASP A OD1 
763  O OD2 . ASP A 100 ? 0.7486 0.7323 0.6986 0.0411  0.0299  0.0208  2530 ASP A OD2 
764  N N   . VAL A 101 ? 0.7980 0.7804 0.7569 0.0402  0.0126  0.0228  2531 VAL A N   
765  C CA  . VAL A 101 ? 0.7828 0.7609 0.7394 0.0384  0.0099  0.0232  2531 VAL A CA  
766  C C   . VAL A 101 ? 0.8004 0.7803 0.7604 0.0380  0.0077  0.0238  2531 VAL A C   
767  O O   . VAL A 101 ? 0.9352 0.9139 0.8948 0.0356  0.0066  0.0245  2531 VAL A O   
768  C CB  . VAL A 101 ? 0.8411 0.8128 0.7931 0.0398  0.0090  0.0224  2531 VAL A CB  
769  C CG1 . VAL A 101 ? 0.8203 0.7887 0.7718 0.0381  0.0074  0.0227  2531 VAL A CG1 
770  C CG2 . VAL A 101 ? 0.7960 0.7634 0.7436 0.0392  0.0095  0.0221  2531 VAL A CG2 
771  N N   . CYS A 102 ? 0.8420 0.8239 0.8048 0.0405  0.0066  0.0235  2532 CYS A N   
772  C CA  . CYS A 102 ? 0.8463 0.8285 0.8114 0.0400  0.0033  0.0241  2532 CYS A CA  
773  C C   . CYS A 102 ? 0.9108 0.8975 0.8798 0.0370  0.0030  0.0254  2532 CYS A C   
774  O O   . CYS A 102 ? 1.1554 1.1384 1.1216 0.0349  0.0010  0.0261  2532 CYS A O   
775  C CB  . CYS A 102 ? 0.9079 0.8928 0.8779 0.0434  0.0013  0.0236  2532 CYS A CB  
776  S SG  . CYS A 102 ? 1.1099 1.0967 1.0851 0.0424  -0.0038 0.0248  2532 CYS A SG  
777  N N   . ARG A 103 ? 0.9472 0.9409 0.9219 0.0366  0.0055  0.0256  2533 ARG A N   
778  C CA  . ARG A 103 ? 0.9331 0.9313 0.9119 0.0333  0.0052  0.0270  2533 ARG A CA  
779  C C   . ARG A 103 ? 0.8821 0.8755 0.8547 0.0303  0.0054  0.0275  2533 ARG A C   
780  O O   . ARG A 103 ? 0.7718 0.7644 0.7442 0.0277  0.0032  0.0286  2533 ARG A O   
781  C CB  . ARG A 103 ? 0.9259 0.9322 0.9117 0.0332  0.0091  0.0270  2533 ARG A CB  
782  C CG  . ARG A 103 ? 1.0032 1.0149 0.9949 0.0294  0.0085  0.0286  2533 ARG A CG  
783  C CD  . ARG A 103 ? 1.0770 1.0987 1.0797 0.0298  0.0121  0.0284  2533 ARG A CD  
784  N N   . LEU A 104 ? 0.7558 0.7453 0.7233 0.0309  0.0074  0.0267  2534 LEU A N   
785  C CA  . LEU A 104 ? 0.6880 0.6728 0.6511 0.0286  0.0068  0.0270  2534 LEU A CA  
786  C C   . LEU A 104 ? 0.6925 0.6729 0.6538 0.0283  0.0046  0.0268  2534 LEU A C   
787  O O   . LEU A 104 ? 0.6628 0.6409 0.6227 0.0263  0.0035  0.0272  2534 LEU A O   
788  C CB  . LEU A 104 ? 0.6447 0.6256 0.6036 0.0294  0.0081  0.0261  2534 LEU A CB  
789  C CG  . LEU A 104 ? 0.5614 0.5432 0.5182 0.0288  0.0107  0.0263  2534 LEU A CG  
790  C CD1 . LEU A 104 ? 0.5272 0.5024 0.4779 0.0298  0.0107  0.0254  2534 LEU A CD1 
791  C CD2 . LEU A 104 ? 0.4541 0.4363 0.4102 0.0253  0.0104  0.0275  2534 LEU A CD2 
792  N N   . ARG A 105 ? 0.7802 0.7581 0.7403 0.0303  0.0042  0.0262  2535 ARG A N   
793  C CA  . ARG A 105 ? 0.7384 0.7106 0.6949 0.0297  0.0031  0.0259  2535 ARG A CA  
794  C C   . ARG A 105 ? 0.8617 0.8335 0.8179 0.0279  0.0007  0.0269  2535 ARG A C   
795  O O   . ARG A 105 ? 0.9777 0.9451 0.9308 0.0265  0.0006  0.0268  2535 ARG A O   
796  C CB  . ARG A 105 ? 0.8634 0.8316 0.8167 0.0315  0.0026  0.0254  2535 ARG A CB  
797  C CG  . ARG A 105 ? 0.9736 0.9409 0.9261 0.0334  0.0041  0.0245  2535 ARG A CG  
798  C CD  . ARG A 105 ? 0.9211 0.8817 0.8682 0.0343  0.0032  0.0241  2535 ARG A CD  
799  N NE  . ARG A 105 ? 0.9067 0.8619 0.8502 0.0330  0.0058  0.0234  2535 ARG A NE  
800  C CZ  . ARG A 105 ? 0.9109 0.8636 0.8529 0.0337  0.0069  0.0228  2535 ARG A CZ  
801  N NH1 . ARG A 105 ? 0.9688 0.9225 0.9107 0.0359  0.0055  0.0227  2535 ARG A NH1 
802  N NH2 . ARG A 105 ? 0.9188 0.8678 0.8598 0.0320  0.0095  0.0222  2535 ARG A NH2 
803  N N   . LYS A 106 ? 0.9122 0.8882 0.8720 0.0279  -0.0013 0.0279  2536 LYS A N   
804  C CA  . LYS A 106 ? 0.9016 0.8774 0.8620 0.0257  -0.0047 0.0291  2536 LYS A CA  
805  C C   . LYS A 106 ? 0.7924 0.7685 0.7523 0.0232  -0.0039 0.0297  2536 LYS A C   
806  O O   . LYS A 106 ? 0.9496 0.9204 0.9052 0.0216  -0.0058 0.0300  2536 LYS A O   
807  C CB  . LYS A 106 ? 0.8459 0.8291 0.8145 0.0259  -0.0069 0.0301  2536 LYS A CB  
808  C CG  . LYS A 106 ? 0.9278 0.9081 0.8964 0.0274  -0.0113 0.0302  2536 LYS A CG  
809  C CD  . LYS A 106 ? 0.9702 0.9587 0.9499 0.0269  -0.0146 0.0313  2536 LYS A CD  
810  N N   . ALA A 107 ? 0.7104 0.6912 0.6732 0.0228  -0.0015 0.0297  2537 ALA A N   
811  C CA  . ALA A 107 ? 0.6810 0.6607 0.6421 0.0203  -0.0014 0.0303  2537 ALA A CA  
812  C C   . ALA A 107 ? 0.6104 0.5830 0.5668 0.0208  -0.0017 0.0291  2537 ALA A C   
813  O O   . ALA A 107 ? 0.6144 0.5830 0.5680 0.0192  -0.0035 0.0295  2537 ALA A O   
814  C CB  . ALA A 107 ? 0.6006 0.5835 0.5627 0.0199  0.0012  0.0303  2537 ALA A CB  
815  N N   . TYR A 108 ? 0.6364 0.6075 0.5925 0.0231  0.0002  0.0278  2538 TYR A N   
816  C CA  . TYR A 108 ? 0.6366 0.6024 0.5909 0.0239  0.0010  0.0264  2538 TYR A CA  
817  C C   . TYR A 108 ? 0.6555 0.6158 0.6057 0.0237  0.0005  0.0261  2538 TYR A C   
818  O O   . TYR A 108 ? 0.9413 0.8975 0.8901 0.0233  0.0005  0.0254  2538 TYR A O   
819  C CB  . TYR A 108 ? 0.6965 0.6621 0.6522 0.0258  0.0033  0.0251  2538 TYR A CB  
820  C CG  . TYR A 108 ? 0.7175 0.6795 0.6747 0.0262  0.0046  0.0237  2538 TYR A CG  
821  C CD1 . TYR A 108 ? 0.7094 0.6710 0.6692 0.0259  0.0030  0.0233  2538 TYR A CD1 
822  C CD2 . TYR A 108 ? 0.7732 0.7317 0.7292 0.0269  0.0073  0.0225  2538 TYR A CD2 
823  C CE1 . TYR A 108 ? 0.7716 0.7308 0.7353 0.0267  0.0039  0.0218  2538 TYR A CE1 
824  C CE2 . TYR A 108 ? 0.8294 0.7857 0.7888 0.0273  0.0094  0.0209  2538 TYR A CE2 
825  C CZ  . TYR A 108 ? 0.8340 0.7914 0.7985 0.0274  0.0076  0.0205  2538 TYR A CZ  
826  O OH  . TYR A 108 ? 0.9108 0.8671 0.8814 0.0282  0.0095  0.0186  2538 TYR A OH  
827  N N   . TYR A 109 ? 0.7244 0.6832 0.6719 0.0239  -0.0002 0.0266  2539 TYR A N   
828  C CA  . TYR A 109 ? 0.7045 0.6552 0.6451 0.0234  -0.0009 0.0263  2539 TYR A CA  
829  C C   . TYR A 109 ? 0.8291 0.7777 0.7675 0.0213  -0.0042 0.0274  2539 TYR A C   
830  O O   . TYR A 109 ? 0.8382 0.7787 0.7702 0.0210  -0.0041 0.0267  2539 TYR A O   
831  C CB  . TYR A 109 ? 0.6941 0.6405 0.6297 0.0238  -0.0021 0.0266  2539 TYR A CB  
832  C CG  . TYR A 109 ? 0.7226 0.6696 0.6588 0.0255  0.0003  0.0257  2539 TYR A CG  
833  C CD1 . TYR A 109 ? 0.7578 0.7040 0.6950 0.0262  0.0046  0.0243  2539 TYR A CD1 
834  C CD2 . TYR A 109 ? 0.6959 0.6439 0.6322 0.0265  -0.0022 0.0264  2539 TYR A CD2 
835  C CE1 . TYR A 109 ? 0.8923 0.8382 0.8294 0.0273  0.0065  0.0237  2539 TYR A CE1 
836  C CE2 . TYR A 109 ? 0.8431 0.7904 0.7787 0.0280  -0.0005 0.0257  2539 TYR A CE2 
837  C CZ  . TYR A 109 ? 0.9378 0.8836 0.8730 0.0282  0.0039  0.0244  2539 TYR A CZ  
838  O OH  . TYR A 109 ? 1.0164 0.9608 0.9504 0.0293  0.0051  0.0239  2539 TYR A OH  
839  N N   . ASN A 110 ? 0.7910 0.7459 0.7340 0.0197  -0.0066 0.0290  2540 ASN A N   
840  C CA  . ASN A 110 ? 0.8043 0.7570 0.7452 0.0171  -0.0101 0.0302  2540 ASN A CA  
841  C C   . ASN A 110 ? 0.7822 0.7318 0.7216 0.0169  -0.0092 0.0294  2540 ASN A C   
842  O O   . ASN A 110 ? 0.8073 0.7495 0.7411 0.0164  -0.0107 0.0290  2540 ASN A O   
843  C CB  . ASN A 110 ? 0.8214 0.7820 0.7685 0.0148  -0.0121 0.0322  2540 ASN A CB  
844  C CG  . ASN A 110 ? 0.8851 0.8495 0.8360 0.0152  -0.0139 0.0329  2540 ASN A CG  
845  O OD1 . ASN A 110 ? 1.0042 0.9620 0.9502 0.0157  -0.0166 0.0329  2540 ASN A OD1 
846  N ND2 . ASN A 110 ? 0.7852 0.7591 0.7445 0.0153  -0.0125 0.0335  2540 ASN A ND2 
847  N N   . ALA A 111 ? 0.7356 0.6898 0.6795 0.0176  -0.0073 0.0289  2541 ALA A N   
848  C CA  . ALA A 111 ? 0.8030 0.7537 0.7463 0.0178  -0.0077 0.0280  2541 ALA A CA  
849  C C   . ALA A 111 ? 0.7443 0.6892 0.6862 0.0203  -0.0055 0.0257  2541 ALA A C   
850  O O   . ALA A 111 ? 0.9202 0.8598 0.8601 0.0206  -0.0066 0.0248  2541 ALA A O   
851  C CB  . ALA A 111 ? 0.7715 0.7264 0.7188 0.0180  -0.0069 0.0279  2541 ALA A CB  
852  N N   . ARG A 112 ? 0.6964 0.6419 0.6391 0.0220  -0.0022 0.0247  2542 ARG A N   
853  C CA  . ARG A 112 ? 0.6602 0.6000 0.6013 0.0239  0.0013  0.0225  2542 ARG A CA  
854  C C   . ARG A 112 ? 0.6582 0.5891 0.5900 0.0233  0.0008  0.0224  2542 ARG A C   
855  O O   . ARG A 112 ? 0.7268 0.6515 0.6563 0.0245  0.0029  0.0205  2542 ARG A O   
856  C CB  . ARG A 112 ? 0.5986 0.5401 0.5416 0.0251  0.0053  0.0216  2542 ARG A CB  
857  C CG  . ARG A 112 ? 0.6473 0.5937 0.5991 0.0263  0.0070  0.0204  2542 ARG A CG  
858  C CD  . ARG A 112 ? 0.6894 0.6333 0.6460 0.0279  0.0094  0.0181  2542 ARG A CD  
859  N NE  . ARG A 112 ? 0.7542 0.6942 0.7095 0.0286  0.0153  0.0163  2542 ARG A NE  
860  C CZ  . ARG A 112 ? 0.7429 0.6752 0.6911 0.0288  0.0183  0.0152  2542 ARG A CZ  
861  N NH1 . ARG A 112 ? 0.6666 0.5939 0.6082 0.0285  0.0151  0.0157  2542 ARG A NH1 
862  N NH2 . ARG A 112 ? 0.6989 0.6272 0.6452 0.0290  0.0247  0.0136  2542 ARG A NH2 
863  N N   . HIS A 113 ? 0.6471 0.5767 0.5738 0.0215  -0.0022 0.0242  2543 HIS A N   
864  C CA  . HIS A 113 ? 0.7425 0.6617 0.6588 0.0206  -0.0042 0.0244  2543 HIS A CA  
865  C C   . HIS A 113 ? 0.7190 0.6351 0.6338 0.0197  -0.0071 0.0246  2543 HIS A C   
866  O O   . HIS A 113 ? 0.9962 0.9027 0.9038 0.0206  -0.0061 0.0231  2543 HIS A O   
867  C CB  . HIS A 113 ? 0.8197 0.7384 0.7325 0.0187  -0.0086 0.0266  2543 HIS A CB  
868  C CG  . HIS A 113 ? 0.8490 0.7547 0.7491 0.0177  -0.0110 0.0267  2543 HIS A CG  
869  N ND1 . HIS A 113 ? 1.0868 0.9850 0.9805 0.0163  -0.0143 0.0271  2543 HIS A ND1 
870  C CD2 . HIS A 113 ? 0.8813 0.7782 0.7722 0.0177  -0.0114 0.0267  2543 HIS A CD2 
871  C CE1 . HIS A 113 ? 0.9209 0.8062 0.8018 0.0156  -0.0165 0.0272  2543 HIS A CE1 
872  N NE2 . HIS A 113 ? 0.8409 0.7249 0.7196 0.0163  -0.0149 0.0270  2543 HIS A NE2 
873  N N   . GLU A 114 ? 0.8182 0.7411 0.7386 0.0181  -0.0103 0.0262  2544 GLU A N   
874  C CA  . GLU A 114 ? 0.8455 0.7642 0.7630 0.0166  -0.0140 0.0267  2544 GLU A CA  
875  C C   . GLU A 114 ? 0.7903 0.7052 0.7091 0.0194  -0.0120 0.0242  2544 GLU A C   
876  O O   . GLU A 114 ? 0.7534 0.6602 0.6665 0.0195  -0.0140 0.0235  2544 GLU A O   
877  C CB  . GLU A 114 ? 0.8497 0.7760 0.7722 0.0136  -0.0171 0.0291  2544 GLU A CB  
878  C CG  . GLU A 114 ? 1.0315 0.9606 0.9537 0.0103  -0.0204 0.0317  2544 GLU A CG  
879  C CD  . GLU A 114 ? 1.2058 1.1444 1.1350 0.0077  -0.0208 0.0335  2544 GLU A CD  
880  O OE1 . GLU A 114 ? 1.2284 1.1752 1.1639 0.0082  -0.0186 0.0339  2544 GLU A OE1 
881  O OE2 . GLU A 114 ? 1.1566 1.0935 1.0841 0.0053  -0.0229 0.0345  2544 GLU A OE2 
882  N N   . ALA A 115 ? 0.7518 0.6726 0.6789 0.0216  -0.0085 0.0227  2545 ALA A N   
883  C CA  . ALA A 115 ? 0.6592 0.5775 0.5904 0.0246  -0.0068 0.0200  2545 ALA A CA  
884  C C   . ALA A 115 ? 0.7706 0.6816 0.6981 0.0271  -0.0020 0.0174  2545 ALA A C   
885  O O   . ALA A 115 ? 0.8282 0.7352 0.7582 0.0297  -0.0009 0.0150  2545 ALA A O   
886  C CB  . ALA A 115 ? 0.6588 0.5849 0.6004 0.0260  -0.0050 0.0193  2545 ALA A CB  
887  N N   . SER A 116 ? 0.8030 0.7112 0.7242 0.0265  0.0009  0.0177  2546 SER A N   
888  C CA  . SER A 116 ? 0.8185 0.7195 0.7356 0.0286  0.0074  0.0150  2546 SER A CA  
889  C C   . SER A 116 ? 0.8425 0.7331 0.7534 0.0304  0.0082  0.0129  2546 SER A C   
890  O O   . SER A 116 ? 0.7130 0.6007 0.6264 0.0332  0.0147  0.0097  2546 SER A O   
891  C CB  . SER A 116 ? 0.8371 0.7331 0.7440 0.0268  0.0087  0.0161  2546 SER A CB  
892  O OG  . SER A 116 ? 0.8110 0.6989 0.7065 0.0247  0.0032  0.0179  2546 SER A OG  
893  N N   . ALA A 117 ? 0.8806 0.7654 0.7836 0.0287  0.0019  0.0145  2547 ALA A N   
894  C CA  . ALA A 117 ? 0.8809 0.7543 0.7765 0.0305  0.0018  0.0125  2547 ALA A CA  
895  C C   . ALA A 117 ? 0.8865 0.7637 0.7941 0.0342  0.0031  0.0098  2547 ALA A C   
896  O O   . ALA A 117 ? 0.9047 0.7769 0.8134 0.0378  0.0087  0.0063  2547 ALA A O   
897  C CB  . ALA A 117 ? 0.9381 0.8051 0.8238 0.0274  -0.0063 0.0152  2547 ALA A CB  
898  N N   . GLN A 118 ? 0.9266 0.8124 0.8434 0.0333  -0.0019 0.0113  2548 GLN A N   
899  C CA  . GLN A 118 ? 0.8745 0.7630 0.8028 0.0367  -0.0029 0.0090  2548 GLN A CA  
900  C C   . GLN A 118 ? 0.8752 0.7700 0.8162 0.0399  0.0044  0.0060  2548 GLN A C   
901  O O   . GLN A 118 ? 1.0846 0.9779 1.0333 0.0439  0.0070  0.0027  2548 GLN A O   
902  C CB  . GLN A 118 ? 0.8560 0.7506 0.7893 0.0346  -0.0099 0.0115  2548 GLN A CB  
903  C CG  . GLN A 118 ? 0.9240 0.8138 0.8462 0.0304  -0.0168 0.0148  2548 GLN A CG  
904  C CD  . GLN A 118 ? 1.1186 1.0147 1.0444 0.0274  -0.0217 0.0174  2548 GLN A CD  
905  O OE1 . GLN A 118 ? 1.1620 1.0570 1.0921 0.0286  -0.0256 0.0167  2548 GLN A OE1 
906  N NE2 . GLN A 118 ? 1.1110 1.0130 1.0348 0.0236  -0.0215 0.0202  2548 GLN A NE2 
907  N N   . ILE A 119 ? 0.9059 0.8078 0.8498 0.0382  0.0079  0.0072  2549 ILE A N   
908  C CA  . ILE A 119 ? 0.8210 0.7292 0.7769 0.0402  0.0150  0.0048  2549 ILE A CA  
909  C C   . ILE A 119 ? 0.9474 0.8483 0.9001 0.0426  0.0236  0.0014  2549 ILE A C   
910  O O   . ILE A 119 ? 1.0690 0.9738 1.0348 0.0456  0.0293  -0.0016 2549 ILE A O   
911  C CB  . ILE A 119 ? 0.8174 0.7321 0.7734 0.0375  0.0170  0.0069  2549 ILE A CB  
912  C CG1 . ILE A 119 ? 0.7957 0.7182 0.7567 0.0357  0.0103  0.0095  2549 ILE A CG1 
913  C CG2 . ILE A 119 ? 0.7699 0.6893 0.7365 0.0389  0.0247  0.0045  2549 ILE A CG2 
914  C CD1 . ILE A 119 ? 0.8553 0.7830 0.8153 0.0335  0.0118  0.0114  2549 ILE A CD1 
915  N N   . ASP A 120 ? 0.9653 0.8552 0.9008 0.0413  0.0248  0.0020  2550 ASP A N   
916  C CA  . ASP A 120 ? 0.9386 0.8185 0.8672 0.0433  0.0335  -0.0011 2550 ASP A CA  
917  C C   . ASP A 120 ? 0.9229 0.7983 0.8558 0.0476  0.0337  -0.0043 2550 ASP A C   
918  O O   . ASP A 120 ? 1.1089 0.9834 1.0488 0.0509  0.0424  -0.0082 2550 ASP A O   
919  C CB  . ASP A 120 ? 1.0325 0.8992 0.9390 0.0406  0.0335  0.0004  2550 ASP A CB  
920  C CG  . ASP A 120 ? 1.0338 0.9022 0.9358 0.0375  0.0364  0.0022  2550 ASP A CG  
921  O OD1 . ASP A 120 ? 0.9093 0.7870 0.8236 0.0378  0.0415  0.0013  2550 ASP A OD1 
922  O OD2 . ASP A 120 ? 1.1001 0.9599 0.9863 0.0348  0.0328  0.0045  2550 ASP A OD2 
923  N N   . GLU A 121 ? 0.8849 0.7571 0.8139 0.0475  0.0246  -0.0029 2551 GLU A N   
924  C CA  . GLU A 121 ? 0.8564 0.7230 0.7886 0.0518  0.0233  -0.0059 2551 GLU A CA  
925  C C   . GLU A 121 ? 0.9667 0.8442 0.9221 0.0558  0.0256  -0.0089 2551 GLU A C   
926  O O   . GLU A 121 ? 1.0436 0.9176 1.0054 0.0605  0.0300  -0.0130 2551 GLU A O   
927  C CB  . GLU A 121 ? 0.9877 0.8494 0.9121 0.0502  0.0119  -0.0033 2551 GLU A CB  
928  C CG  . GLU A 121 ? 0.9703 0.8256 0.8981 0.0548  0.0089  -0.0063 2551 GLU A CG  
929  N N   . ILE A 122 ? 0.8914 0.7814 0.8595 0.0541  0.0224  -0.0070 2552 ILE A N   
930  C CA  . ILE A 122 ? 0.8140 0.7144 0.8048 0.0572  0.0232  -0.0095 2552 ILE A CA  
931  C C   . ILE A 122 ? 0.8566 0.7615 0.8573 0.0587  0.0354  -0.0125 2552 ILE A C   
932  O O   . ILE A 122 ? 1.0787 0.9847 1.0923 0.0630  0.0407  -0.0167 2552 ILE A O   
933  C CB  . ILE A 122 ? 0.8565 0.7669 0.8553 0.0544  0.0158  -0.0063 2552 ILE A CB  
934  C CG1 . ILE A 122 ? 0.7135 0.6195 0.7049 0.0531  0.0043  -0.0037 2552 ILE A CG1 
935  C CG2 . ILE A 122 ? 0.6390 0.5601 0.6616 0.0571  0.0170  -0.0087 2552 ILE A CG2 
936  C CD1 . ILE A 122 ? 0.6726 0.5847 0.6627 0.0489  -0.0011 0.0001  2552 ILE A CD1 
937  N N   . VAL A 123 ? 0.9967 0.9044 0.9921 0.0549  0.0400  -0.0106 2553 VAL A N   
938  C CA  . VAL A 123 ? 1.0161 0.9272 1.0190 0.0552  0.0520  -0.0131 2553 VAL A CA  
939  C C   . VAL A 123 ? 1.1602 1.0611 1.1568 0.0581  0.0621  -0.0171 2553 VAL A C   
940  O O   . VAL A 123 ? 1.2178 1.1228 1.2282 0.0603  0.0721  -0.0207 2553 VAL A O   
941  C CB  . VAL A 123 ? 0.9700 0.8811 0.9616 0.0503  0.0546  -0.0101 2553 VAL A CB  
942  C CG1 . VAL A 123 ? 0.9421 0.8539 0.9379 0.0498  0.0675  -0.0125 2553 VAL A CG1 
943  C CG2 . VAL A 123 ? 0.8508 0.7722 0.8501 0.0480  0.0462  -0.0068 2553 VAL A CG2 
944  N N   . GLY A 124 ? 1.2468 1.1341 1.2227 0.0580  0.0595  -0.0164 2554 GLY A N   
945  C CA  . GLY A 124 ? 1.2916 1.1656 1.2562 0.0605  0.0685  -0.0199 2554 GLY A CA  
946  C C   . GLY A 124 ? 1.2797 1.1512 1.2535 0.0664  0.0679  -0.0238 2554 GLY A C   
947  O O   . GLY A 124 ? 1.2046 1.0617 1.1631 0.0685  0.0708  -0.0258 2554 GLY A O   
948  N N   . GLU A 125 ? 1.2470 1.1312 1.2445 0.0692  0.0629  -0.0249 2555 GLU A N   
949  C CA  . GLU A 125 ? 1.1251 1.0097 1.1379 0.0757  0.0636  -0.0295 2555 GLU A CA  
950  C C   . GLU A 125 ? 1.1617 1.0575 1.1992 0.0785  0.0751  -0.0336 2555 GLU A C   
951  O O   . GLU A 125 ? 1.1743 1.0718 1.2280 0.0843  0.0783  -0.0383 2555 GLU A O   
952  C CB  . GLU A 125 ? 1.0998 0.9896 1.1232 0.0771  0.0490  -0.0279 2555 GLU A CB  
953  C CG  . GLU A 125 ? 1.0869 0.9656 1.0889 0.0749  0.0374  -0.0243 2555 GLU A CG  
954  C CD  . GLU A 125 ? 1.0502 0.9349 1.0608 0.0741  0.0234  -0.0217 2555 GLU A CD  
955  O OE1 . GLU A 125 ? 0.9872 0.8830 1.0202 0.0763  0.0217  -0.0231 2555 GLU A OE1 
956  O OE2 . GLU A 125 ? 0.8434 0.7211 0.8382 0.0711  0.0140  -0.0181 2555 GLU A OE2 
957  N N   . THR A 126 ? 1.1615 1.0651 1.2027 0.0742  0.0811  -0.0321 2556 THR A N   
958  C CA  . THR A 126 ? 1.0522 0.9683 1.1184 0.0753  0.0913  -0.0352 2556 THR A CA  
959  C C   . THR A 126 ? 0.9181 0.8315 0.9950 0.0813  0.1023  -0.0414 2556 THR A C   
960  O O   . THR A 126 ? 0.8762 0.7764 0.9349 0.0816  0.1129  -0.0434 2556 THR A O   
961  C CB  . THR A 126 ? 0.9657 0.8824 1.0234 0.0695  0.1010  -0.0334 2556 THR A CB  
962  N N   . SER B 1   ? 0.6987 0.5556 0.6556 0.0193  0.0323  -0.0805 2431 SER B N   
963  C CA  . SER B 1   ? 0.6897 0.5409 0.6337 0.0205  0.0215  -0.0690 2431 SER B CA  
964  C C   . SER B 1   ? 0.6581 0.5007 0.5738 0.0163  0.0191  -0.0530 2431 SER B C   
965  O O   . SER B 1   ? 0.7227 0.5627 0.6297 0.0138  0.0240  -0.0502 2431 SER B O   
966  C CB  . SER B 1   ? 0.7073 0.5677 0.6514 0.0187  0.0309  -0.0693 2431 SER B CB  
967  O OG  . SER B 1   ? 0.6763 0.5378 0.5991 0.0131  0.0423  -0.0599 2431 SER B OG  
968  N N   . MET B 2   ? 0.7189 0.5588 0.6211 0.0148  0.0131  -0.0440 2432 MET B N   
969  C CA  . MET B 2   ? 0.7877 0.6212 0.6647 0.0096  0.0091  -0.0310 2432 MET B CA  
970  C C   . MET B 2   ? 0.8478 0.6911 0.7146 0.0063  0.0193  -0.0265 2432 MET B C   
971  O O   . MET B 2   ? 0.8587 0.7092 0.7362 0.0085  0.0231  -0.0314 2432 MET B O   
972  C CB  . MET B 2   ? 0.9058 0.7266 0.7784 0.0099  -0.0093 -0.0278 2432 MET B CB  
973  C CG  . MET B 2   ? 1.0156 0.8279 0.8605 0.0018  -0.0159 -0.0157 2432 MET B CG  
974  S SD  . MET B 2   ? 0.9443 0.7363 0.7811 0.0004  -0.0395 -0.0129 2432 MET B SD  
975  C CE  . MET B 2   ? 0.9796 0.7587 0.8368 0.0089  -0.0538 -0.0215 2432 MET B CE  
976  N N   . GLU B 3   ? 0.9254 0.7695 0.7737 0.0011  0.0227  -0.0186 2433 GLU B N   
977  C CA  . GLU B 3   ? 0.9256 0.7796 0.7673 -0.0010 0.0310  -0.0166 2433 GLU B CA  
978  C C   . GLU B 3   ? 0.9573 0.8150 0.7970 -0.0021 0.0263  -0.0156 2433 GLU B C   
979  O O   . GLU B 3   ? 1.0127 0.8781 0.8602 0.0001  0.0315  -0.0192 2433 GLU B O   
980  C CB  . GLU B 3   ? 1.0558 0.9117 0.8819 -0.0057 0.0348  -0.0112 2433 GLU B CB  
981  C CG  . GLU B 3   ? 1.1946 1.0614 1.0166 -0.0073 0.0401  -0.0114 2433 GLU B CG  
982  C CD  . GLU B 3   ? 1.3311 1.2021 1.1402 -0.0127 0.0410  -0.0083 2433 GLU B CD  
983  O OE1 . GLU B 3   ? 1.2728 1.1513 1.0760 -0.0173 0.0396  -0.0083 2433 GLU B OE1 
984  O OE2 . GLU B 3   ? 1.3515 1.2192 1.1571 -0.0129 0.0434  -0.0072 2433 GLU B OE2 
985  N N   . VAL B 4   ? 0.9080 0.7590 0.7349 -0.0069 0.0166  -0.0105 2434 VAL B N   
986  C CA  . VAL B 4   ? 0.8289 0.6814 0.6509 -0.0097 0.0116  -0.0096 2434 VAL B CA  
987  C C   . VAL B 4   ? 0.7984 0.6515 0.6388 -0.0027 0.0088  -0.0156 2434 VAL B C   
988  O O   . VAL B 4   ? 0.8280 0.6878 0.6697 -0.0028 0.0102  -0.0168 2434 VAL B O   
989  C CB  . VAL B 4   ? 0.9255 0.7646 0.7277 -0.0179 -0.0007 -0.0033 2434 VAL B CB  
990  C CG1 . VAL B 4   ? 0.8965 0.7183 0.7045 -0.0138 -0.0147 -0.0038 2434 VAL B CG1 
991  C CG2 . VAL B 4   ? 0.9278 0.7692 0.7194 -0.0239 -0.0037 -0.0020 2434 VAL B CG2 
992  N N   . ALA B 5   ? 0.8472 0.6945 0.7033 0.0031  0.0049  -0.0208 2435 ALA B N   
993  C CA  . ALA B 5   ? 0.8862 0.7367 0.7633 0.0095  0.0034  -0.0292 2435 ALA B CA  
994  C C   . ALA B 5   ? 0.9986 0.8627 0.8840 0.0108  0.0186  -0.0334 2435 ALA B C   
995  O O   . ALA B 5   ? 1.0017 0.8721 0.8933 0.0122  0.0202  -0.0360 2435 ALA B O   
996  C CB  . ALA B 5   ? 0.8615 0.7057 0.7571 0.0151  -0.0031 -0.0372 2435 ALA B CB  
997  N N   . ARG B 6   ? 0.9567 0.8233 0.8400 0.0096  0.0287  -0.0336 2436 ARG B N   
998  C CA  . ARG B 6   ? 0.9313 0.8056 0.8159 0.0090  0.0411  -0.0359 2436 ARG B CA  
999  C C   . ARG B 6   ? 0.9341 0.8142 0.8086 0.0072  0.0417  -0.0315 2436 ARG B C   
1000 O O   . ARG B 6   ? 0.9065 0.7920 0.7876 0.0087  0.0451  -0.0349 2436 ARG B O   
1001 C CB  . ARG B 6   ? 0.8883 0.7599 0.7664 0.0066  0.0492  -0.0353 2436 ARG B CB  
1002 C CG  . ARG B 6   ? 0.8149 0.6840 0.7066 0.0077  0.0521  -0.0434 2436 ARG B CG  
1003 C CD  . ARG B 6   ? 0.8146 0.6804 0.6982 0.0039  0.0616  -0.0434 2436 ARG B CD  
1004 N NE  . ARG B 6   ? 0.7582 0.6182 0.6364 0.0037  0.0575  -0.0401 2436 ARG B NE  
1005 C CZ  . ARG B 6   ? 0.7634 0.6199 0.6252 0.0018  0.0558  -0.0316 2436 ARG B CZ  
1006 N NH1 . ARG B 6   ? 0.9292 0.7884 0.7796 0.0003  0.0573  -0.0264 2436 ARG B NH1 
1007 N NH2 . ARG B 6   ? 0.8668 0.7178 0.7252 0.0015  0.0520  -0.0294 2436 ARG B NH2 
1008 N N   . ALA B 7   ? 0.8091 0.6890 0.6688 0.0036  0.0383  -0.0252 2437 ALA B N   
1009 C CA  . ALA B 7   ? 0.8134 0.7016 0.6653 0.0012  0.0395  -0.0235 2437 ALA B CA  
1010 C C   . ALA B 7   ? 0.8875 0.7787 0.7429 0.0015  0.0344  -0.0248 2437 ALA B C   
1011 O O   . ALA B 7   ? 0.9569 0.8568 0.8116 0.0011  0.0370  -0.0263 2437 ALA B O   
1012 C CB  . ALA B 7   ? 0.7212 0.6104 0.5580 -0.0045 0.0380  -0.0191 2437 ALA B CB  
1013 N N   . ALA B 8   ? 0.9172 0.8006 0.7771 0.0028  0.0261  -0.0250 2438 ALA B N   
1014 C CA  . ALA B 8   ? 0.8991 0.7827 0.7631 0.0038  0.0197  -0.0266 2438 ALA B CA  
1015 C C   . ALA B 8   ? 0.8977 0.7867 0.7808 0.0098  0.0247  -0.0336 2438 ALA B C   
1016 O O   . ALA B 8   ? 1.0383 0.9334 0.9241 0.0105  0.0255  -0.0352 2438 ALA B O   
1017 C CB  . ALA B 8   ? 0.8768 0.7464 0.7376 0.0030  0.0055  -0.0246 2438 ALA B CB  
1018 N N   . ARG B 9   ? 0.9431 0.8300 0.8391 0.0131  0.0284  -0.0386 2439 ARG B N   
1019 C CA  . ARG B 9   ? 0.8784 0.7709 0.7911 0.0160  0.0355  -0.0466 2439 ARG B CA  
1020 C C   . ARG B 9   ? 0.7756 0.6741 0.6813 0.0142  0.0440  -0.0450 2439 ARG B C   
1021 O O   . ARG B 9   ? 0.7650 0.6681 0.6778 0.0156  0.0455  -0.0484 2439 ARG B O   
1022 C CB  . ARG B 9   ? 0.8059 0.6969 0.7299 0.0165  0.0416  -0.0533 2439 ARG B CB  
1023 N N   . LEU B 10  ? 0.7816 0.6791 0.6738 0.0115  0.0478  -0.0403 2440 LEU B N   
1024 C CA  . LEU B 10  ? 0.7296 0.6305 0.6152 0.0106  0.0529  -0.0396 2440 LEU B CA  
1025 C C   . LEU B 10  ? 0.7121 0.6207 0.5960 0.0111  0.0487  -0.0388 2440 LEU B C   
1026 O O   . LEU B 10  ? 0.8365 0.7485 0.7250 0.0126  0.0504  -0.0418 2440 LEU B O   
1027 C CB  . LEU B 10  ? 0.7263 0.6242 0.5995 0.0084  0.0551  -0.0360 2440 LEU B CB  
1028 C CG  . LEU B 10  ? 0.8079 0.6970 0.6785 0.0066  0.0607  -0.0366 2440 LEU B CG  
1029 C CD1 . LEU B 10  ? 0.7332 0.6186 0.5909 0.0049  0.0608  -0.0326 2440 LEU B CD1 
1030 C CD2 . LEU B 10  ? 0.7640 0.6489 0.6375 0.0050  0.0669  -0.0410 2440 LEU B CD2 
1031 N N   . ALA B 11  ? 0.7248 0.6354 0.6007 0.0087  0.0433  -0.0353 2441 ALA B N   
1032 C CA  . ALA B 11  ? 0.6594 0.5777 0.5318 0.0069  0.0396  -0.0356 2441 ALA B CA  
1033 C C   . ALA B 11  ? 0.6539 0.5741 0.5370 0.0102  0.0379  -0.0390 2441 ALA B C   
1034 O O   . ALA B 11  ? 0.6479 0.5760 0.5322 0.0106  0.0387  -0.0414 2441 ALA B O   
1035 C CB  . ALA B 11  ? 0.6449 0.5604 0.5051 0.0011  0.0333  -0.0315 2441 ALA B CB  
1036 N N   . GLN B 12  ? 0.7275 0.6413 0.6201 0.0127  0.0350  -0.0404 2442 GLN B N   
1037 C CA  . GLN B 12  ? 0.7691 0.6848 0.6737 0.0160  0.0325  -0.0446 2442 GLN B CA  
1038 C C   . GLN B 12  ? 0.7861 0.7068 0.6978 0.0178  0.0405  -0.0486 2442 GLN B C   
1039 O O   . GLN B 12  ? 0.7175 0.6435 0.6327 0.0191  0.0400  -0.0506 2442 GLN B O   
1040 C CB  . GLN B 12  ? 0.8637 0.7724 0.7810 0.0189  0.0273  -0.0481 2442 GLN B CB  
1041 C CG  . GLN B 12  ? 0.9422 0.8524 0.8746 0.0227  0.0226  -0.0538 2442 GLN B CG  
1042 C CD  . GLN B 12  ? 1.0784 0.9895 1.0018 0.0213  0.0154  -0.0505 2442 GLN B CD  
1043 O OE1 . GLN B 12  ? 1.2664 1.1706 1.1753 0.0175  0.0068  -0.0453 2442 GLN B OE1 
1044 N NE2 . GLN B 12  ? 1.0673 0.9859 0.9975 0.0230  0.0190  -0.0538 2442 GLN B NE2 
1045 N N   . ILE B 13  ? 0.8676 0.7846 0.7788 0.0170  0.0474  -0.0494 2443 ILE B N   
1046 C CA  . ILE B 13  ? 0.7969 0.7131 0.7091 0.0165  0.0537  -0.0522 2443 ILE B CA  
1047 C C   . ILE B 13  ? 0.7163 0.6368 0.6202 0.0170  0.0519  -0.0504 2443 ILE B C   
1048 O O   . ILE B 13  ? 0.6434 0.5669 0.5509 0.0185  0.0514  -0.0530 2443 ILE B O   
1049 C CB  . ILE B 13  ? 0.9115 0.8195 0.8197 0.0133  0.0605  -0.0528 2443 ILE B CB  
1050 C CG1 . ILE B 13  ? 0.9110 0.8182 0.8322 0.0128  0.0631  -0.0583 2443 ILE B CG1 
1051 C CG2 . ILE B 13  ? 0.8754 0.7776 0.7781 0.0105  0.0653  -0.0544 2443 ILE B CG2 
1052 C CD1 . ILE B 13  ? 0.8952 0.7957 0.8122 0.0086  0.0699  -0.0597 2443 ILE B CD1 
1053 N N   . PHE B 14  ? 0.6170 0.5388 0.5115 0.0159  0.0504  -0.0473 2444 PHE B N   
1054 C CA  . PHE B 14  ? 0.6995 0.6282 0.5904 0.0166  0.0481  -0.0487 2444 PHE B CA  
1055 C C   . PHE B 14  ? 0.6905 0.6297 0.5863 0.0175  0.0449  -0.0515 2444 PHE B C   
1056 O O   . PHE B 14  ? 0.7729 0.7171 0.6718 0.0196  0.0436  -0.0554 2444 PHE B O   
1057 C CB  . PHE B 14  ? 0.8631 0.7952 0.7459 0.0144  0.0472  -0.0471 2444 PHE B CB  
1058 C CG  . PHE B 14  ? 0.9309 0.8530 0.8077 0.0135  0.0496  -0.0443 2444 PHE B CG  
1059 C CD1 . PHE B 14  ? 0.9789 0.8891 0.8550 0.0135  0.0528  -0.0441 2444 PHE B CD1 
1060 C CD2 . PHE B 14  ? 1.0494 0.9737 0.9195 0.0111  0.0490  -0.0424 2444 PHE B CD2 
1061 C CE1 . PHE B 14  ? 0.9977 0.8980 0.8660 0.0115  0.0551  -0.0418 2444 PHE B CE1 
1062 C CE2 . PHE B 14  ? 0.9793 0.8943 0.8435 0.0103  0.0509  -0.0399 2444 PHE B CE2 
1063 C CZ  . PHE B 14  ? 0.9259 0.8287 0.7889 0.0106  0.0538  -0.0395 2444 PHE B CZ  
1064 N N   . LYS B 15  ? 0.7257 0.6669 0.6211 0.0156  0.0423  -0.0496 2445 LYS B N   
1065 C CA  . LYS B 15  ? 0.7141 0.6631 0.6117 0.0153  0.0389  -0.0519 2445 LYS B CA  
1066 C C   . LYS B 15  ? 0.7352 0.6836 0.6438 0.0195  0.0393  -0.0551 2445 LYS B C   
1067 O O   . LYS B 15  ? 0.7597 0.7158 0.6712 0.0207  0.0382  -0.0588 2445 LYS B O   
1068 C CB  . LYS B 15  ? 0.7408 0.6862 0.6323 0.0115  0.0336  -0.0485 2445 LYS B CB  
1069 C CG  . LYS B 15  ? 0.8235 0.7732 0.7149 0.0103  0.0291  -0.0502 2445 LYS B CG  
1070 C CD  . LYS B 15  ? 0.8850 0.8274 0.7628 0.0038  0.0217  -0.0460 2445 LYS B CD  
1071 C CE  . LYS B 15  ? 0.8661 0.8128 0.7381 -0.0002 0.0177  -0.0478 2445 LYS B CE  
1072 N NZ  . LYS B 15  ? 0.8683 0.8133 0.7547 0.0066  0.0149  -0.0502 2445 LYS B NZ  
1073 N N   . GLU B 16  ? 0.7369 0.6775 0.6527 0.0212  0.0413  -0.0551 2446 GLU B N   
1074 C CA  . GLU B 16  ? 0.7504 0.6906 0.6767 0.0236  0.0427  -0.0590 2446 GLU B CA  
1075 C C   . GLU B 16  ? 0.7668 0.7067 0.6909 0.0244  0.0448  -0.0610 2446 GLU B C   
1076 O O   . GLU B 16  ? 0.8292 0.7730 0.7584 0.0263  0.0431  -0.0640 2446 GLU B O   
1077 C CB  . GLU B 16  ? 0.8026 0.7363 0.7379 0.0235  0.0463  -0.0613 2446 GLU B CB  
1078 C CG  . GLU B 16  ? 0.8948 0.8282 0.8380 0.0250  0.0403  -0.0621 2446 GLU B CG  
1079 C CD  . GLU B 16  ? 1.0367 0.9659 0.9914 0.0250  0.0431  -0.0666 2446 GLU B CD  
1080 O OE1 . GLU B 16  ? 0.9064 0.8341 0.8642 0.0226  0.0517  -0.0704 2446 GLU B OE1 
1081 O OE2 . GLU B 16  ? 1.1525 1.0790 1.1126 0.0268  0.0359  -0.0673 2446 GLU B OE2 
1082 N N   . ILE B 17  ? 0.7792 0.7130 0.6951 0.0230  0.0468  -0.0593 2447 ILE B N   
1083 C CA  . ILE B 17  ? 0.7439 0.6723 0.6555 0.0237  0.0456  -0.0610 2447 ILE B CA  
1084 C C   . ILE B 17  ? 0.6833 0.6228 0.5970 0.0267  0.0402  -0.0645 2447 ILE B C   
1085 O O   . ILE B 17  ? 0.8117 0.7523 0.7297 0.0292  0.0372  -0.0682 2447 ILE B O   
1086 C CB  . ILE B 17  ? 0.8044 0.7214 0.7053 0.0213  0.0469  -0.0584 2447 ILE B CB  
1087 C CG1 . ILE B 17  ? 0.8193 0.7253 0.7179 0.0167  0.0537  -0.0571 2447 ILE B CG1 
1088 C CG2 . ILE B 17  ? 0.8057 0.7144 0.7005 0.0226  0.0416  -0.0602 2447 ILE B CG2 
1089 C CD1 . ILE B 17  ? 0.7920 0.6871 0.6788 0.0133  0.0557  -0.0541 2447 ILE B CD1 
1090 N N   . CYS B 18  ? 0.6642 0.6129 0.5753 0.0259  0.0394  -0.0645 2448 CYS B N   
1091 C CA  . CYS B 18  ? 0.7107 0.6743 0.6254 0.0269  0.0360  -0.0706 2448 CYS B CA  
1092 C C   . CYS B 18  ? 0.8219 0.7949 0.7427 0.0272  0.0350  -0.0734 2448 CYS B C   
1093 O O   . CYS B 18  ? 0.9757 0.9593 0.9021 0.0289  0.0323  -0.0804 2448 CYS B O   
1094 C CB  . CYS B 18  ? 0.7646 0.7367 0.6738 0.0229  0.0372  -0.0706 2448 CYS B CB  
1095 S SG  . CYS B 18  ? 0.7086 0.7019 0.6231 0.0218  0.0352  -0.0823 2448 CYS B SG  
1096 N N   . ASP B 19  ? 0.8116 0.7809 0.7326 0.0258  0.0363  -0.0691 2449 ASP B N   
1097 C CA  . ASP B 19  ? 0.7800 0.7554 0.7064 0.0265  0.0342  -0.0715 2449 ASP B CA  
1098 C C   . ASP B 19  ? 0.7367 0.7082 0.6714 0.0309  0.0335  -0.0744 2449 ASP B C   
1099 O O   . ASP B 19  ? 0.8935 0.8724 0.8338 0.0326  0.0310  -0.0786 2449 ASP B O   
1100 C CB  . ASP B 19  ? 0.7319 0.7024 0.6572 0.0245  0.0329  -0.0672 2449 ASP B CB  
1101 C CG  . ASP B 19  ? 0.8098 0.7817 0.7235 0.0187  0.0311  -0.0641 2449 ASP B CG  
1102 O OD1 . ASP B 19  ? 0.9203 0.9001 0.8271 0.0149  0.0327  -0.0661 2449 ASP B OD1 
1103 O OD2 . ASP B 19  ? 0.7784 0.7425 0.6897 0.0173  0.0273  -0.0604 2449 ASP B OD2 
1104 N N   . GLY B 20  ? 0.7386 0.6976 0.6726 0.0314  0.0357  -0.0722 2450 GLY B N   
1105 C CA  . GLY B 20  ? 0.6706 0.6222 0.6082 0.0330  0.0351  -0.0743 2450 GLY B CA  
1106 C C   . GLY B 20  ? 0.7897 0.7439 0.7276 0.0362  0.0293  -0.0792 2450 GLY B C   
1107 O O   . GLY B 20  ? 0.8192 0.7749 0.7627 0.0387  0.0260  -0.0829 2450 GLY B O   
1108 N N   . ILE B 21  ? 0.7352 0.6906 0.6687 0.0366  0.0273  -0.0802 2451 ILE B N   
1109 C CA  . ILE B 21  ? 0.7049 0.6638 0.6420 0.0406  0.0200  -0.0873 2451 ILE B CA  
1110 C C   . ILE B 21  ? 0.8076 0.7875 0.7548 0.0422  0.0186  -0.0952 2451 ILE B C   
1111 O O   . ILE B 21  ? 0.9454 0.9288 0.9006 0.0464  0.0127  -0.1024 2451 ILE B O   
1112 C CB  . ILE B 21  ? 0.6310 0.5876 0.5633 0.0406  0.0178  -0.0882 2451 ILE B CB  
1113 C CG1 . ILE B 21  ? 0.6080 0.5420 0.5279 0.0381  0.0182  -0.0812 2451 ILE B CG1 
1114 C CG2 . ILE B 21  ? 0.5663 0.5288 0.5070 0.0459  0.0083  -0.0987 2451 ILE B CG2 
1115 C CD1 . ILE B 21  ? 0.6261 0.5416 0.5411 0.0385  0.0128  -0.0809 2451 ILE B CD1 
1116 N N   . ILE B 22  ? 0.8802 0.8727 0.8256 0.0380  0.0235  -0.0944 2452 ILE B N   
1117 C CA  . ILE B 22  ? 0.9083 0.9200 0.8591 0.0363  0.0236  -0.1020 2452 ILE B CA  
1118 C C   . ILE B 22  ? 0.9825 0.9947 0.9386 0.0383  0.0223  -0.1025 2452 ILE B C   
1119 O O   . ILE B 22  ? 0.9915 1.0154 0.9561 0.0404  0.0193  -0.1115 2452 ILE B O   
1120 C CB  . ILE B 22  ? 0.9268 0.9461 0.8684 0.0285  0.0286  -0.0989 2452 ILE B CB  
1121 C CG1 . ILE B 22  ? 0.9249 0.9494 0.8635 0.0259  0.0300  -0.1019 2452 ILE B CG1 
1122 C CG2 . ILE B 22  ? 0.8537 0.8884 0.7958 0.0239  0.0294  -0.1051 2452 ILE B CG2 
1123 C CD1 . ILE B 22  ? 0.8744 0.9052 0.8010 0.0163  0.0346  -0.0994 2452 ILE B CD1 
1124 N N   . SER B 23  ? 0.9195 0.9196 0.8723 0.0378  0.0242  -0.0943 2453 SER B N   
1125 C CA  . SER B 23  ? 0.9728 0.9734 0.9313 0.0394  0.0230  -0.0949 2453 SER B CA  
1126 C C   . SER B 23  ? 0.9253 0.9173 0.8900 0.0442  0.0195  -0.0971 2453 SER B C   
1127 O O   . SER B 23  ? 0.9518 0.9455 0.9225 0.0460  0.0179  -0.0992 2453 SER B O   
1128 C CB  . SER B 23  ? 0.9641 0.9564 0.9200 0.0372  0.0254  -0.0876 2453 SER B CB  
1129 O OG  . SER B 23  ? 1.0531 1.0319 1.0108 0.0386  0.0274  -0.0845 2453 SER B OG  
1130 N N   . TYR B 24  ? 0.9467 0.9270 0.9078 0.0454  0.0176  -0.0963 2454 TYR B N   
1131 C CA  . TYR B 24  ? 0.9548 0.9200 0.9156 0.0474  0.0134  -0.0965 2454 TYR B CA  
1132 C C   . TYR B 24  ? 1.0177 0.9895 0.9878 0.0520  0.0068  -0.1041 2454 TYR B C   
1133 O O   . TYR B 24  ? 0.9866 0.9718 0.9637 0.0553  0.0022  -0.1125 2454 TYR B O   
1134 C CB  . TYR B 24  ? 1.0298 0.9807 0.9824 0.0476  0.0089  -0.0958 2454 TYR B CB  
1135 C CG  . TYR B 24  ? 0.9986 0.9264 0.9427 0.0458  0.0053  -0.0930 2454 TYR B CG  
1136 C CD1 . TYR B 24  ? 1.0566 0.9706 0.9910 0.0391  0.0126  -0.0863 2454 TYR B CD1 
1137 C CD2 . TYR B 24  ? 1.0068 0.9261 0.9518 0.0496  -0.0058 -0.0981 2454 TYR B CD2 
1138 C CE1 . TYR B 24  ? 1.0804 0.9721 1.0033 0.0341  0.0105  -0.0842 2454 TYR B CE1 
1139 C CE2 . TYR B 24  ? 1.0458 0.9398 0.9782 0.0457  -0.0102 -0.0947 2454 TYR B CE2 
1140 C CZ  . TYR B 24  ? 1.0445 0.9248 0.9644 0.0369  -0.0011 -0.0875 2454 TYR B CZ  
1141 O OH  . TYR B 24  ? 1.0825 0.9367 0.9864 0.0299  -0.0042 -0.0846 2454 TYR B OH  
1142 N N   . LYS B 25  ? 1.0719 1.0355 1.0434 0.0518  0.0066  -0.1026 2455 LYS B N   
1143 C CA  . LYS B 25  ? 1.0992 1.0681 1.0796 0.0562  0.0002  -0.1094 2455 LYS B CA  
1144 C C   . LYS B 25  ? 1.2068 1.1545 1.1820 0.0560  -0.0057 -0.1083 2455 LYS B C   
1145 O O   . LYS B 25  ? 1.1675 1.0981 1.1320 0.0502  -0.0016 -0.1017 2455 LYS B O   
1146 C CB  . LYS B 25  ? 1.1152 1.0971 1.1028 0.0556  0.0046  -0.1096 2455 LYS B CB  
1147 C CG  . LYS B 25  ? 1.1387 1.1395 1.1281 0.0544  0.0077  -0.1120 2455 LYS B CG  
1148 C CD  . LYS B 25  ? 1.2235 1.2322 1.2165 0.0532  0.0097  -0.1116 2455 LYS B CD  
1149 C CE  . LYS B 25  ? 1.3287 1.3528 1.3181 0.0493  0.0115  -0.1141 2455 LYS B CE  
1150 N N   . ASP B 26  ? 1.2880 1.2363 1.2699 0.0612  -0.0157 -0.1156 2456 ASP B N   
1151 C CA  . ASP B 26  ? 1.3387 1.2640 1.3135 0.0607  -0.0244 -0.1149 2456 ASP B CA  
1152 C C   . ASP B 26  ? 1.4465 1.3741 1.4276 0.0607  -0.0236 -0.1161 2456 ASP B C   
1153 O O   . ASP B 26  ? 1.4651 1.4111 1.4560 0.0613  -0.0163 -0.1169 2456 ASP B O   
1154 C CB  . ASP B 26  ? 1.3671 1.2849 1.3438 0.0670  -0.0402 -0.1226 2456 ASP B CB  
1155 C CG  . ASP B 26  ? 1.3592 1.2924 1.3536 0.0751  -0.0488 -0.1344 2456 ASP B CG  
1156 O OD1 . ASP B 26  ? 1.2083 1.1438 1.2113 0.0818  -0.0611 -0.1445 2456 ASP B OD1 
1157 O OD2 . ASP B 26  ? 1.4209 1.3640 1.4220 0.0750  -0.0442 -0.1350 2456 ASP B OD2 
1158 N N   . SER B 27  ? 1.3126 1.2636 1.4326 0.0077  0.1411  -0.0800 2457 SER B N   
1159 C CA  . SER B 27  ? 1.2123 1.1606 1.3418 -0.0021 0.1453  -0.0836 2457 SER B CA  
1160 C C   . SER B 27  ? 1.1810 1.1319 1.3099 -0.0125 0.1395  -0.0918 2457 SER B C   
1161 O O   . SER B 27  ? 1.1410 1.1001 1.2769 -0.0211 0.1347  -0.0944 2457 SER B O   
1162 C CB  . SER B 27  ? 1.1999 1.1342 1.3299 0.0007  0.1564  -0.0819 2457 SER B CB  
1163 O OG  . SER B 27  ? 1.2367 1.1644 1.3564 0.0083  0.1577  -0.0811 2457 SER B OG  
1164 N N   . SER B 28  ? 1.1650 1.1093 1.2853 -0.0115 0.1397  -0.0954 2458 SER B N   
1165 C CA  . SER B 28  ? 1.0102 0.9542 1.1277 -0.0206 0.1356  -0.1033 2458 SER B CA  
1166 C C   . SER B 28  ? 0.9598 0.9169 1.0748 -0.0233 0.1243  -0.1058 2458 SER B C   
1167 O O   . SER B 28  ? 0.7193 0.6756 0.8276 -0.0264 0.1205  -0.1109 2458 SER B O   
1168 C CB  . SER B 28  ? 1.0268 0.9595 1.1354 -0.0172 0.1400  -0.1055 2458 SER B CB  
1169 O OG  . SER B 28  ? 1.0247 0.9439 1.1352 -0.0181 0.1505  -0.1056 2458 SER B OG  
1170 N N   . ARG B 29  ? 0.9752 0.9438 1.0954 -0.0221 0.1194  -0.1020 2459 ARG B N   
1171 C CA  . ARG B 29  ? 1.0328 1.0134 1.1497 -0.0220 0.1095  -0.1028 2459 ARG B CA  
1172 C C   . ARG B 29  ? 1.0811 1.0584 1.1871 -0.0163 0.1074  -0.1041 2459 ARG B C   
1173 O O   . ARG B 29  ? 0.9430 0.9218 1.0446 -0.0211 0.1029  -0.1094 2459 ARG B O   
1174 C CB  . ARG B 29  ? 0.9484 0.9360 1.0694 -0.0336 0.1035  -0.1085 2459 ARG B CB  
1175 N N   . GLN B 30  ? 1.0036 0.9763 1.1054 -0.0062 0.1107  -0.0990 2460 GLN B N   
1176 C CA  . GLN B 30  ? 0.9667 0.9355 1.0598 -0.0003 0.1098  -0.0990 2460 GLN B CA  
1177 C C   . GLN B 30  ? 0.8935 0.8686 0.9818 0.0083  0.1042  -0.0942 2460 GLN B C   
1178 O O   . GLN B 30  ? 0.8708 0.8452 0.9593 0.0145  0.1062  -0.0887 2460 GLN B O   
1179 C CB  . GLN B 30  ? 0.9177 0.8732 1.0095 0.0031  0.1196  -0.0977 2460 GLN B CB  
1180 C CG  . GLN B 30  ? 0.9947 0.9466 1.0804 0.0136  0.1208  -0.0927 2460 GLN B CG  
1181 C CD  . GLN B 30  ? 1.0123 0.9529 1.0955 0.0152  0.1282  -0.0935 2460 GLN B CD  
1182 O OE1 . GLN B 30  ? 1.1880 1.1226 1.2722 0.0082  0.1320  -0.0987 2460 GLN B OE1 
1183 N NE2 . GLN B 30  ? 0.9561 0.8934 1.0356 0.0244  0.1302  -0.0881 2460 GLN B NE2 
1184 N N   . ALA B 31  ? 0.8409 0.8212 0.9243 0.0085  0.0973  -0.0962 2461 ALA B N   
1185 C CA  . ALA B 31  ? 0.8167 0.8031 0.8954 0.0152  0.0909  -0.0925 2461 ALA B CA  
1186 C C   . ALA B 31  ? 0.7651 0.7453 0.8384 0.0240  0.0930  -0.0883 2461 ALA B C   
1187 O O   . ALA B 31  ? 0.8329 0.8130 0.9027 0.0255  0.0905  -0.0892 2461 ALA B O   
1188 C CB  . ALA B 31  ? 0.8425 0.8378 0.9193 0.0115  0.0825  -0.0962 2461 ALA B CB  
1189 N N   . LEU B 32  ? 0.7150 0.6903 0.7877 0.0299  0.0974  -0.0833 2462 LEU B N   
1190 C CA  . LEU B 32  ? 0.7344 0.7032 0.8024 0.0382  0.1002  -0.0787 2462 LEU B CA  
1191 C C   . LEU B 32  ? 0.7246 0.6978 0.7866 0.0430  0.0924  -0.0768 2462 LEU B C   
1192 O O   . LEU B 32  ? 0.6943 0.6637 0.7539 0.0475  0.0936  -0.0744 2462 LEU B O   
1193 C CB  . LEU B 32  ? 0.7120 0.6757 0.7793 0.0439  0.1053  -0.0732 2462 LEU B CB  
1194 C CG  . LEU B 32  ? 0.7219 0.6792 0.7957 0.0407  0.1147  -0.0735 2462 LEU B CG  
1195 C CD1 . LEU B 32  ? 0.7266 0.6782 0.7982 0.0483  0.1199  -0.0672 2462 LEU B CD1 
1196 C CD2 . LEU B 32  ? 0.8168 0.7667 0.8927 0.0382  0.1210  -0.0761 2462 LEU B CD2 
1197 N N   . ALA B 33  ? 0.8046 0.7858 0.8646 0.0421  0.0846  -0.0775 2463 ALA B N   
1198 C CA  . ALA B 33  ? 0.7276 0.7130 0.7821 0.0460  0.0767  -0.0759 2463 ALA B CA  
1199 C C   . ALA B 33  ? 0.7109 0.7004 0.7670 0.0423  0.0731  -0.0795 2463 ALA B C   
1200 O O   . ALA B 33  ? 0.7153 0.7088 0.7682 0.0449  0.0666  -0.0783 2463 ALA B O   
1201 C CB  . ALA B 33  ? 0.7199 0.7112 0.7713 0.0465  0.0706  -0.0752 2463 ALA B CB  
1202 N N   . ALA B 34  ? 0.7498 0.7378 0.8103 0.0362  0.0775  -0.0839 2464 ALA B N   
1203 C CA  . ALA B 34  ? 0.6997 0.6907 0.7609 0.0322  0.0750  -0.0879 2464 ALA B CA  
1204 C C   . ALA B 34  ? 0.7294 0.7191 0.7888 0.0375  0.0739  -0.0848 2464 ALA B C   
1205 O O   . ALA B 34  ? 0.8230 0.8188 0.8818 0.0371  0.0678  -0.0855 2464 ALA B O   
1206 C CB  . ALA B 34  ? 0.6242 0.6103 0.6885 0.0254  0.0814  -0.0929 2464 ALA B CB  
1207 N N   . PRO B 35  ? 0.7346 0.7169 0.7942 0.0425  0.0799  -0.0809 2465 PRO B N   
1208 C CA  . PRO B 35  ? 0.7184 0.7006 0.7776 0.0480  0.0786  -0.0768 2465 PRO B CA  
1209 C C   . PRO B 35  ? 0.6913 0.6795 0.7473 0.0526  0.0696  -0.0728 2465 PRO B C   
1210 O O   . PRO B 35  ? 0.6916 0.6825 0.7485 0.0555  0.0662  -0.0701 2465 PRO B O   
1211 C CB  . PRO B 35  ? 0.8114 0.7848 0.8714 0.0528  0.0870  -0.0727 2465 PRO B CB  
1212 C CG  . PRO B 35  ? 0.8323 0.8002 0.8932 0.0492  0.0934  -0.0754 2465 PRO B CG  
1213 C CD  . PRO B 35  ? 0.7909 0.7655 0.8515 0.0439  0.0878  -0.0793 2465 PRO B CD  
1214 N N   . LEU B 36  ? 0.8050 0.7950 0.8573 0.0533  0.0659  -0.0723 2466 LEU B N   
1215 C CA  . LEU B 36  ? 0.7356 0.7292 0.7828 0.0575  0.0576  -0.0689 2466 LEU B CA  
1216 C C   . LEU B 36  ? 0.7283 0.7301 0.7750 0.0538  0.0495  -0.0720 2466 LEU B C   
1217 O O   . LEU B 36  ? 0.7543 0.7584 0.7963 0.0566  0.0425  -0.0697 2466 LEU B O   
1218 C CB  . LEU B 36  ? 0.6727 0.6623 0.7146 0.0609  0.0585  -0.0664 2466 LEU B CB  
1219 C CG  . LEU B 36  ? 0.7096 0.6914 0.7486 0.0673  0.0636  -0.0612 2466 LEU B CG  
1220 C CD1 . LEU B 36  ? 0.5913 0.5693 0.6350 0.0681  0.0701  -0.0601 2466 LEU B CD1 
1221 C CD2 . LEU B 36  ? 0.6241 0.6008 0.6624 0.0673  0.0700  -0.0612 2466 LEU B CD2 
1222 N N   . LEU B 37  ? 0.6879 0.6933 0.7385 0.0476  0.0504  -0.0770 2467 LEU B N   
1223 C CA  . LEU B 37  ? 0.5929 0.6059 0.6427 0.0440  0.0436  -0.0799 2467 LEU B CA  
1224 C C   . LEU B 37  ? 0.6264 0.6444 0.6770 0.0446  0.0376  -0.0792 2467 LEU B C   
1225 O O   . LEU B 37  ? 0.7382 0.7607 0.7860 0.0453  0.0304  -0.0786 2467 LEU B O   
1226 C CB  . LEU B 37  ? 0.6294 0.6447 0.6827 0.0370  0.0465  -0.0853 2467 LEU B CB  
1227 C CG  . LEU B 37  ? 0.7136 0.7263 0.7678 0.0349  0.0512  -0.0863 2467 LEU B CG  
1228 C CD1 . LEU B 37  ? 0.6366 0.6514 0.6946 0.0273  0.0535  -0.0916 2467 LEU B CD1 
1229 C CD2 . LEU B 37  ? 0.5944 0.6099 0.6454 0.0369  0.0473  -0.0842 2467 LEU B CD2 
1230 N N   . ASN B 38  ? 0.7243 0.7410 0.7789 0.0445  0.0409  -0.0792 2468 ASN B N   
1231 C CA  . ASN B 38  ? 0.7099 0.7314 0.7671 0.0451  0.0366  -0.0780 2468 ASN B CA  
1232 C C   . ASN B 38  ? 0.8200 0.8384 0.8797 0.0504  0.0384  -0.0726 2468 ASN B C   
1233 O O   . ASN B 38  ? 0.7166 0.7288 0.7777 0.0519  0.0460  -0.0715 2468 ASN B O   
1234 C CB  . ASN B 38  ? 0.7058 0.7290 0.7660 0.0401  0.0394  -0.0825 2468 ASN B CB  
1235 C CG  . ASN B 38  ? 0.7505 0.7797 0.8132 0.0402  0.0344  -0.0817 2468 ASN B CG  
1236 O OD1 . ASN B 38  ? 0.8518 0.8863 0.9136 0.0413  0.0268  -0.0800 2468 ASN B OD1 
1237 N ND2 . ASN B 38  ? 0.6860 0.7140 0.7518 0.0389  0.0389  -0.0828 2468 ASN B ND2 
1238 N N   . LEU B 39  ? 0.8348 0.8577 0.8955 0.0531  0.0315  -0.0688 2469 LEU B N   
1239 C CA  . LEU B 39  ? 0.8708 0.8931 0.9358 0.0578  0.0323  -0.0631 2469 LEU B CA  
1240 C C   . LEU B 39  ? 0.9585 0.9809 1.0299 0.0563  0.0383  -0.0640 2469 LEU B C   
1241 O O   . LEU B 39  ? 0.9666 0.9929 1.0392 0.0524  0.0368  -0.0676 2469 LEU B O   
1242 C CB  . LEU B 39  ? 0.9453 0.9733 1.0105 0.0600  0.0224  -0.0590 2469 LEU B CB  
1243 C CG  . LEU B 39  ? 0.9926 1.0183 1.0504 0.0632  0.0168  -0.0563 2469 LEU B CG  
1244 C CD1 . LEU B 39  ? 1.0316 1.0626 1.0887 0.0636  0.0060  -0.0539 2469 LEU B CD1 
1245 C CD2 . LEU B 39  ? 0.8663 0.8863 0.9236 0.0684  0.0214  -0.0514 2469 LEU B CD2 
1246 N N   . PRO B 40  ? 1.0149 1.0324 1.0898 0.0598  0.0455  -0.0604 2470 PRO B N   
1247 C CA  . PRO B 40  ? 1.0704 1.0862 1.1506 0.0593  0.0524  -0.0606 2470 PRO B CA  
1248 C C   . PRO B 40  ? 1.0894 1.1130 1.1751 0.0595  0.0470  -0.0582 2470 PRO B C   
1249 O O   . PRO B 40  ? 1.2284 1.2573 1.3170 0.0627  0.0400  -0.0529 2470 PRO B O   
1250 C CB  . PRO B 40  ? 1.0857 1.0960 1.1691 0.0648  0.0592  -0.0548 2470 PRO B CB  
1251 C CG  . PRO B 40  ? 1.0472 1.0548 1.1256 0.0671  0.0574  -0.0533 2470 PRO B CG  
1252 C CD  . PRO B 40  ? 1.0132 1.0266 1.0871 0.0652  0.0470  -0.0550 2470 PRO B CD  
1253 N N   . PRO B 41  ? 1.1431 1.1671 1.2300 0.0561  0.0500  -0.0620 2471 PRO B N   
1254 C CA  . PRO B 41  ? 1.1625 1.1939 1.2553 0.0565  0.0456  -0.0595 2471 PRO B CA  
1255 C C   . PRO B 41  ? 1.0702 1.1039 1.1719 0.0621  0.0465  -0.0510 2471 PRO B C   
1256 O O   . PRO B 41  ? 0.8606 0.8886 0.9651 0.0649  0.0554  -0.0485 2471 PRO B O   
1257 C CB  . PRO B 41  ? 1.1835 1.2116 1.2745 0.0526  0.0519  -0.0649 2471 PRO B CB  
1258 C CG  . PRO B 41  ? 1.0799 1.1030 1.1630 0.0482  0.0539  -0.0717 2471 PRO B CG  
1259 C CD  . PRO B 41  ? 1.0100 1.0280 1.0921 0.0513  0.0567  -0.0691 2471 PRO B CD  
1260 N N   . LYS B 42  ? 1.0903 1.1323 1.1966 0.0635  0.0371  -0.0466 2472 LYS B N   
1261 C CA  . LYS B 42  ? 1.0522 1.0985 1.1678 0.0685  0.0353  -0.0377 2472 LYS B CA  
1262 C C   . LYS B 42  ? 1.0661 1.1110 1.1898 0.0710  0.0445  -0.0342 2472 LYS B C   
1263 O O   . LYS B 42  ? 1.1504 1.1929 1.2790 0.0757  0.0500  -0.0283 2472 LYS B O   
1264 C CB  . LYS B 42  ? 0.8720 0.9276 0.9915 0.0679  0.0233  -0.0345 2472 LYS B CB  
1265 N N   . LYS B 43  ? 1.0462 1.0919 1.1706 0.0681  0.0469  -0.0377 2473 LYS B N   
1266 C CA  . LYS B 43  ? 1.0271 1.0710 1.1585 0.0707  0.0560  -0.0343 2473 LYS B CA  
1267 C C   . LYS B 43  ? 0.9051 0.9382 1.0338 0.0732  0.0680  -0.0343 2473 LYS B C   
1268 O O   . LYS B 43  ? 0.9419 0.9743 1.0786 0.0782  0.0741  -0.0273 2473 LYS B O   
1269 C CB  . LYS B 43  ? 0.9236 0.9680 1.0531 0.0670  0.0575  -0.0392 2473 LYS B CB  
1270 C CG  . LYS B 43  ? 0.9650 1.0202 1.1003 0.0657  0.0473  -0.0371 2473 LYS B CG  
1271 N N   . LYS B 44  ? 0.7879 0.8129 0.9062 0.0700  0.0713  -0.0415 2474 LYS B N   
1272 C CA  . LYS B 44  ? 0.7541 0.7674 0.8691 0.0717  0.0832  -0.0423 2474 LYS B CA  
1273 C C   . LYS B 44  ? 0.8507 0.8617 0.9659 0.0752  0.0836  -0.0384 2474 LYS B C   
1274 O O   . LYS B 44  ? 0.8822 0.8836 0.9955 0.0772  0.0936  -0.0381 2474 LYS B O   
1275 C CB  . LYS B 44  ? 0.5702 0.5747 0.6744 0.0658  0.0881  -0.0522 2474 LYS B CB  
1276 C CG  . LYS B 44  ? 0.6240 0.6280 0.7263 0.0627  0.0902  -0.0561 2474 LYS B CG  
1277 C CD  . LYS B 44  ? 0.5638 0.5592 0.6681 0.0662  0.1026  -0.0533 2474 LYS B CD  
1278 C CE  . LYS B 44  ? 0.4974 0.4932 0.6004 0.0645  0.1041  -0.0555 2474 LYS B CE  
1279 N NZ  . LYS B 44  ? 0.5928 0.5809 0.6994 0.0695  0.1163  -0.0507 2474 LYS B NZ  
1280 N N   . ASN B 45  ? 0.8359 0.8546 0.9523 0.0762  0.0732  -0.0354 2475 ASN B N   
1281 C CA  . ASN B 45  ? 1.1086 1.1248 1.2238 0.0799  0.0733  -0.0316 2475 ASN B CA  
1282 C C   . ASN B 45  ? 1.2777 1.3037 1.3996 0.0838  0.0635  -0.0234 2475 ASN B C   
1283 O O   . ASN B 45  ? 1.5182 1.5463 1.6352 0.0838  0.0555  -0.0233 2475 ASN B O   
1284 C CB  . ASN B 45  ? 1.1348 1.1464 1.2395 0.0760  0.0715  -0.0387 2475 ASN B CB  
1285 C CG  . ASN B 45  ? 1.1040 1.1076 1.2024 0.0705  0.0789  -0.0474 2475 ASN B CG  
1286 O OD1 . ASN B 45  ? 1.1238 1.1176 1.2196 0.0708  0.0885  -0.0490 2475 ASN B OD1 
1287 N ND2 . ASN B 45  ? 0.7530 0.7605 0.8490 0.0655  0.0743  -0.0529 2475 ASN B ND2 
1288 N N   . ALA B 46  ? 1.4918 1.5234 1.6246 0.0872  0.0642  -0.0163 2476 ALA B N   
1289 C CA  . ALA B 46  ? 1.4587 1.5004 1.5996 0.0906  0.0547  -0.0076 2476 ALA B CA  
1290 C C   . ALA B 46  ? 1.4585 1.4980 1.5981 0.0955  0.0546  -0.0021 2476 ALA B C   
1291 O O   . ALA B 46  ? 1.4046 1.4507 1.5454 0.0970  0.0442  0.0026  2476 ALA B O   
1292 C CB  . ALA B 46  ? 1.3519 1.3998 1.5066 0.0936  0.0573  -0.0002 2476 ALA B CB  
1293 N N   . ASP B 47  ? 1.3473 1.3769 1.4836 0.0978  0.0661  -0.0028 2477 ASP B N   
1294 C CA  . ASP B 47  ? 1.2403 1.2665 1.3747 0.1028  0.0678  0.0022  2477 ASP B CA  
1295 C C   . ASP B 47  ? 1.2220 1.2458 1.3446 0.1009  0.0608  -0.0022 2477 ASP B C   
1296 O O   . ASP B 47  ? 1.3173 1.3416 1.4378 0.1049  0.0571  0.0030  2477 ASP B O   
1297 C CB  . ASP B 47  ? 1.3127 1.3279 1.4469 0.1056  0.0831  0.0022  2477 ASP B CB  
1298 C CG  . ASP B 47  ? 1.3735 1.3782 1.4967 0.1005  0.0890  -0.0081 2477 ASP B CG  
1299 O OD1 . ASP B 47  ? 1.3242 1.3279 1.4451 0.0951  0.0898  -0.0152 2477 ASP B OD1 
1300 O OD2 . ASP B 47  ? 1.3376 1.3353 1.4549 0.1019  0.0928  -0.0088 2477 ASP B OD2 
1301 N N   . TYR B 48  ? 1.2474 1.2683 1.3620 0.0949  0.0595  -0.0115 2478 TYR B N   
1302 C CA  . TYR B 48  ? 1.1186 1.1379 1.2224 0.0928  0.0527  -0.0158 2478 TYR B CA  
1303 C C   . TYR B 48  ? 1.0765 1.1042 1.1800 0.0935  0.0389  -0.0119 2478 TYR B C   
1304 O O   . TYR B 48  ? 0.9295 0.9559 1.0270 0.0964  0.0341  -0.0089 2478 TYR B O   
1305 C CB  . TYR B 48  ? 1.1782 1.1949 1.2758 0.0860  0.0532  -0.0259 2478 TYR B CB  
1306 C CG  . TYR B 48  ? 1.0909 1.1049 1.1778 0.0842  0.0483  -0.0301 2478 TYR B CG  
1307 C CD1 . TYR B 48  ? 1.0321 1.0375 1.1133 0.0853  0.0554  -0.0317 2478 TYR B CD1 
1308 C CD2 . TYR B 48  ? 0.9100 0.9297 0.9928 0.0817  0.0371  -0.0319 2478 TYR B CD2 
1309 C CE1 . TYR B 48  ? 0.9896 0.9925 1.0617 0.0842  0.0518  -0.0347 2478 TYR B CE1 
1310 C CE2 . TYR B 48  ? 0.9549 0.9712 1.0276 0.0808  0.0335  -0.0351 2478 TYR B CE2 
1311 C CZ  . TYR B 48  ? 0.9983 1.0064 1.0659 0.0822  0.0410  -0.0363 2478 TYR B CZ  
1312 O OH  . TYR B 48  ? 0.9130 0.9176 0.9712 0.0817  0.0384  -0.0389 2478 TYR B OH  
1313 N N   . TYR B 49  ? 1.1012 1.1369 1.2108 0.0908  0.0326  -0.0118 2479 TYR B N   
1314 C CA  . TYR B 49  ? 1.1364 1.1796 1.2454 0.0900  0.0189  -0.0093 2479 TYR B CA  
1315 C C   . TYR B 49  ? 1.1716 1.2202 1.2874 0.0951  0.0140  0.0007  2479 TYR B C   
1316 O O   . TYR B 49  ? 1.1342 1.1881 1.2487 0.0946  0.0020  0.0034  2479 TYR B O   
1317 C CB  . TYR B 49  ? 1.0461 1.0958 1.1601 0.0853  0.0144  -0.0125 2479 TYR B CB  
1318 C CG  . TYR B 49  ? 1.0454 1.0911 1.1513 0.0801  0.0165  -0.0222 2479 TYR B CG  
1319 C CD1 . TYR B 49  ? 1.0684 1.1146 1.1656 0.0769  0.0078  -0.0265 2479 TYR B CD1 
1320 C CD2 . TYR B 49  ? 0.9075 0.9483 1.0140 0.0783  0.0273  -0.0269 2479 TYR B CD2 
1321 C CE1 . TYR B 49  ? 1.0745 1.1180 1.1653 0.0724  0.0097  -0.0345 2479 TYR B CE1 
1322 C CE2 . TYR B 49  ? 0.9967 1.0346 1.0962 0.0733  0.0284  -0.0353 2479 TYR B CE2 
1323 C CZ  . TYR B 49  ? 1.0313 1.0713 1.1237 0.0705  0.0196  -0.0387 2479 TYR B CZ  
1324 O OH  . TYR B 49  ? 0.8485 0.8867 0.9349 0.0658  0.0206  -0.0462 2479 TYR B OH  
1325 N N   . GLU B 50  ? 1.1081 1.1549 1.2308 0.0999  0.0231  0.0065  2480 GLU B N   
1326 C CA  . GLU B 50  ? 1.0723 1.1232 1.2005 0.1056  0.0199  0.0166  2480 GLU B CA  
1327 C C   . GLU B 50  ? 1.0923 1.1356 1.2092 0.1092  0.0210  0.0173  2480 GLU B C   
1328 O O   . GLU B 50  ? 1.2374 1.2839 1.3522 0.1121  0.0124  0.0232  2480 GLU B O   
1329 C CB  . GLU B 50  ? 1.0924 1.1459 1.2349 0.1098  0.0295  0.0237  2480 GLU B CB  
1330 C CG  . GLU B 50  ? 1.0497 1.1136 1.2057 0.1082  0.0254  0.0273  2480 GLU B CG  
1331 C CD  . GLU B 50  ? 1.1300 1.1939 1.2984 0.1115  0.0379  0.0320  2480 GLU B CD  
1332 O OE1 . GLU B 50  ? 1.0852 1.1422 1.2534 0.1161  0.0486  0.0347  2480 GLU B OE1 
1333 O OE2 . GLU B 50  ? 1.0656 1.1357 1.2438 0.1098  0.0374  0.0331  2480 GLU B OE2 
1334 N N   . LYS B 51  ? 0.9333 0.9665 1.0426 0.1088  0.0311  0.0114  2481 LYS B N   
1335 C CA  . LYS B 51  ? 0.8474 0.8726 0.9453 0.1120  0.0326  0.0116  2481 LYS B CA  
1336 C C   . LYS B 51  ? 0.9683 0.9909 1.0523 0.1089  0.0236  0.0059  2481 LYS B C   
1337 O O   . LYS B 51  ? 1.0665 1.0847 1.1410 0.1124  0.0210  0.0082  2481 LYS B O   
1338 C CB  . LYS B 51  ? 0.7759 0.7910 0.8722 0.1132  0.0473  0.0085  2481 LYS B CB  
1339 C CG  . LYS B 51  ? 0.6065 0.6138 0.6937 0.1179  0.0506  0.0109  2481 LYS B CG  
1340 N N   . ILE B 52  ? 0.9748 0.9995 1.0571 0.1029  0.0195  -0.0012 2482 ILE B N   
1341 C CA  . ILE B 52  ? 0.9526 0.9749 1.0223 0.1000  0.0114  -0.0063 2482 ILE B CA  
1342 C C   . ILE B 52  ? 1.0459 1.0761 1.1169 0.0970  -0.0016 -0.0057 2482 ILE B C   
1343 O O   . ILE B 52  ? 0.9388 0.9756 1.0191 0.0936  -0.0028 -0.0070 2482 ILE B O   
1344 C CB  . ILE B 52  ? 0.8736 0.8907 0.9383 0.0954  0.0174  -0.0155 2482 ILE B CB  
1345 C CG1 . ILE B 52  ? 0.8765 0.8839 0.9344 0.0981  0.0267  -0.0165 2482 ILE B CG1 
1346 C CG2 . ILE B 52  ? 0.8646 0.8824 0.9203 0.0916  0.0081  -0.0204 2482 ILE B CG2 
1347 C CD1 . ILE B 52  ? 0.8786 0.8830 0.9439 0.1022  0.0374  -0.0119 2482 ILE B CD1 
1348 N N   . SER B 53  ? 1.0339 1.1648 1.0382 0.0463  -0.0474 -0.0609 2483 SER B N   
1349 C CA  . SER B 53  ? 0.9841 1.1302 1.0008 0.0367  -0.0446 -0.0671 2483 SER B CA  
1350 C C   . SER B 53  ? 1.0278 1.1601 1.0455 0.0262  -0.0382 -0.0653 2483 SER B C   
1351 O O   . SER B 53  ? 1.1690 1.3084 1.1964 0.0176  -0.0326 -0.0684 2483 SER B O   
1352 C CB  . SER B 53  ? 0.9779 1.1329 0.9937 0.0373  -0.0504 -0.0720 2483 SER B CB  
1353 O OG  . SER B 53  ? 1.0361 1.1952 1.0444 0.0495  -0.0571 -0.0714 2483 SER B OG  
1354 N N   . ASP B 54  ? 1.0032 1.1158 1.0105 0.0269  -0.0388 -0.0605 2484 ASP B N   
1355 C CA  . ASP B 54  ? 0.9822 1.0802 0.9883 0.0185  -0.0333 -0.0583 2484 ASP B CA  
1356 C C   . ASP B 54  ? 1.0273 1.1063 1.0256 0.0215  -0.0315 -0.0507 2484 ASP B C   
1357 O O   . ASP B 54  ? 0.8810 0.9461 0.8713 0.0233  -0.0332 -0.0467 2484 ASP B O   
1358 C CB  . ASP B 54  ? 0.8671 0.9611 0.8687 0.0161  -0.0357 -0.0601 2484 ASP B CB  
1359 C CG  . ASP B 54  ? 0.8519 0.9391 0.8560 0.0056  -0.0297 -0.0614 2484 ASP B CG  
1360 O OD1 . ASP B 54  ? 0.6881 0.7702 0.6957 0.0006  -0.0232 -0.0596 2484 ASP B OD1 
1361 O OD2 . ASP B 54  ? 0.8597 0.9454 0.8608 0.0029  -0.0312 -0.0642 2484 ASP B OD2 
1362 N N   . PRO B 55  ? 0.9462 1.0252 0.9472 0.0221  -0.0281 -0.0489 2485 PRO B N   
1363 C CA  . PRO B 55  ? 0.9123 0.9756 0.9060 0.0259  -0.0276 -0.0427 2485 PRO B CA  
1364 C C   . PRO B 55  ? 0.8316 0.8805 0.8235 0.0196  -0.0226 -0.0393 2485 PRO B C   
1365 O O   . PRO B 55  ? 0.8660 0.9173 0.8632 0.0124  -0.0170 -0.0416 2485 PRO B O   
1366 C CB  . PRO B 55  ? 0.8394 0.9096 0.8369 0.0283  -0.0250 -0.0430 2485 PRO B CB  
1367 C CG  . PRO B 55  ? 0.8614 0.9455 0.8698 0.0208  -0.0199 -0.0481 2485 PRO B CG  
1368 C CD  . PRO B 55  ? 0.9835 1.0753 0.9946 0.0172  -0.0229 -0.0527 2485 PRO B CD  
1369 N N   . LEU B 56  ? 0.8558 0.8901 0.8404 0.0223  -0.0244 -0.0341 2486 LEU B N   
1370 C CA  . LEU B 56  ? 0.8900 0.9115 0.8728 0.0177  -0.0199 -0.0303 2486 LEU B CA  
1371 C C   . LEU B 56  ? 0.9611 0.9703 0.9378 0.0221  -0.0223 -0.0247 2486 LEU B C   
1372 O O   . LEU B 56  ? 1.0291 1.0362 1.0015 0.0274  -0.0277 -0.0235 2486 LEU B O   
1373 C CB  . LEU B 56  ? 0.7856 0.8035 0.7676 0.0134  -0.0190 -0.0308 2486 LEU B CB  
1374 C CG  . LEU B 56  ? 0.7281 0.7336 0.7081 0.0092  -0.0137 -0.0271 2486 LEU B CG  
1375 C CD1 . LEU B 56  ? 0.5697 0.5764 0.5535 0.0031  -0.0066 -0.0294 2486 LEU B CD1 
1376 C CD2 . LEU B 56  ? 0.6829 0.6832 0.6596 0.0078  -0.0144 -0.0264 2486 LEU B CD2 
1377 N N   . ASP B 57  ? 0.8617 0.8624 0.8376 0.0200  -0.0183 -0.0216 2487 ASP B N   
1378 C CA  . ASP B 57  ? 0.7332 0.7234 0.7043 0.0233  -0.0209 -0.0168 2487 ASP B CA  
1379 C C   . ASP B 57  ? 0.7422 0.7235 0.7126 0.0201  -0.0181 -0.0131 2487 ASP B C   
1380 O O   . ASP B 57  ? 0.6357 0.6171 0.6080 0.0156  -0.0131 -0.0141 2487 ASP B O   
1381 C CB  . ASP B 57  ? 0.7175 0.7067 0.6869 0.0265  -0.0201 -0.0162 2487 ASP B CB  
1382 C CG  . ASP B 57  ? 0.6560 0.6472 0.6282 0.0230  -0.0129 -0.0172 2487 ASP B CG  
1383 O OD1 . ASP B 57  ? 0.6649 0.6510 0.6376 0.0188  -0.0083 -0.0158 2487 ASP B OD1 
1384 O OD2 . ASP B 57  ? 0.8059 0.8025 0.7790 0.0249  -0.0113 -0.0190 2487 ASP B OD2 
1385 N N   . LEU B 58  ? 0.7163 0.6898 0.6837 0.0226  -0.0214 -0.0091 2488 LEU B N   
1386 C CA  . LEU B 58  ? 0.6773 0.6440 0.6448 0.0205  -0.0193 -0.0052 2488 LEU B CA  
1387 C C   . LEU B 58  ? 0.6105 0.5740 0.5778 0.0192  -0.0139 -0.0039 2488 LEU B C   
1388 O O   . LEU B 58  ? 0.5307 0.4901 0.4982 0.0173  -0.0105 -0.0015 2488 LEU B O   
1389 C CB  . LEU B 58  ? 0.6173 0.5780 0.5832 0.0229  -0.0243 -0.0015 2488 LEU B CB  
1390 C CG  . LEU B 58  ? 0.5734 0.5335 0.5380 0.0239  -0.0285 -0.0014 2488 LEU B CG  
1391 C CD1 . LEU B 58  ? 0.4450 0.3982 0.4089 0.0247  -0.0326 0.0025  2488 LEU B CD1 
1392 C CD2 . LEU B 58  ? 0.4165 0.3786 0.3823 0.0213  -0.0255 -0.0021 2488 LEU B CD2 
1393 N N   . ILE B 59  ? 0.6999 0.6647 0.6660 0.0211  -0.0129 -0.0050 2489 ILE B N   
1394 C CA  . ILE B 59  ? 0.6809 0.6415 0.6452 0.0208  -0.0072 -0.0036 2489 ILE B CA  
1395 C C   . ILE B 59  ? 0.7514 0.7132 0.7175 0.0158  0.0000  -0.0058 2489 ILE B C   
1396 O O   . ILE B 59  ? 0.8728 0.8282 0.8369 0.0143  0.0052  -0.0035 2489 ILE B O   
1397 C CB  . ILE B 59  ? 0.7681 0.7290 0.7293 0.0248  -0.0076 -0.0043 2489 ILE B CB  
1398 C CG1 . ILE B 59  ? 0.7336 0.6896 0.6911 0.0293  -0.0142 -0.0016 2489 ILE B CG1 
1399 C CG2 . ILE B 59  ? 0.6742 0.6313 0.6328 0.0243  0.0000  -0.0036 2489 ILE B CG2 
1400 C CD1 . ILE B 59  ? 0.8341 0.7884 0.7867 0.0339  -0.0148 -0.0020 2489 ILE B CD1 
1401 N N   . THR B 60  ? 0.7695 0.7395 0.7391 0.0133  0.0002  -0.0103 2490 THR B N   
1402 C CA  . THR B 60  ? 0.7690 0.7411 0.7411 0.0073  0.0062  -0.0135 2490 THR B CA  
1403 C C   . THR B 60  ? 0.7731 0.7399 0.7439 0.0048  0.0070  -0.0121 2490 THR B C   
1404 O O   . THR B 60  ? 0.7533 0.7137 0.7220 0.0015  0.0134  -0.0117 2490 THR B O   
1405 C CB  . THR B 60  ? 0.6897 0.6743 0.6671 0.0052  0.0047  -0.0192 2490 THR B CB  
1406 O OG1 . THR B 60  ? 0.8184 0.8080 0.7967 0.0084  0.0042  -0.0200 2490 THR B OG1 
1407 C CG2 . THR B 60  ? 0.7554 0.7423 0.7358 -0.0019 0.0112  -0.0232 2490 THR B CG2 
1408 N N   . ILE B 61  ? 0.6846 0.6528 0.6556 0.0069  0.0010  -0.0112 2491 ILE B N   
1409 C CA  . ILE B 61  ? 0.6147 0.5779 0.5840 0.0054  0.0019  -0.0095 2491 ILE B CA  
1410 C C   . ILE B 61  ? 0.7082 0.6621 0.6746 0.0064  0.0062  -0.0046 2491 ILE B C   
1411 O O   . ILE B 61  ? 0.8755 0.8237 0.8395 0.0037  0.0122  -0.0043 2491 ILE B O   
1412 C CB  . ILE B 61  ? 0.6233 0.5880 0.5926 0.0083  -0.0046 -0.0082 2491 ILE B CB  
1413 C CG1 . ILE B 61  ? 0.6453 0.6192 0.6160 0.0086  -0.0086 -0.0131 2491 ILE B CG1 
1414 C CG2 . ILE B 61  ? 0.4953 0.4545 0.4625 0.0074  -0.0028 -0.0058 2491 ILE B CG2 
1415 C CD1 . ILE B 61  ? 0.5565 0.5300 0.5251 0.0114  -0.0136 -0.0120 2491 ILE B CD1 
1416 N N   . GLU B 62  ? 0.6300 0.5823 0.5961 0.0105  0.0029  -0.0010 2492 GLU B N   
1417 C CA  . GLU B 62  ? 0.7992 0.7447 0.7630 0.0127  0.0057  0.0037  2492 GLU B CA  
1418 C C   . GLU B 62  ? 0.7766 0.7164 0.7366 0.0110  0.0141  0.0033  2492 GLU B C   
1419 O O   . GLU B 62  ? 0.8076 0.7406 0.7644 0.0115  0.0187  0.0062  2492 GLU B O   
1420 C CB  . GLU B 62  ? 0.8733 0.8195 0.8371 0.0171  0.0005  0.0058  2492 GLU B CB  
1421 C CG  . GLU B 62  ? 0.9902 0.9324 0.9533 0.0203  0.0002  0.0108  2492 GLU B CG  
1422 C CD  . GLU B 62  ? 1.0404 0.9839 1.0072 0.0200  -0.0033 0.0134  2492 GLU B CD  
1423 O OE1 . GLU B 62  ? 0.9034 0.8498 0.8727 0.0205  -0.0098 0.0132  2492 GLU B OE1 
1424 O OE2 . GLU B 62  ? 0.8665 0.8075 0.8332 0.0193  0.0008  0.0157  2492 GLU B OE2 
1425 N N   . LYS B 63  ? 0.7446 0.6869 0.7047 0.0092  0.0165  -0.0002 2493 LYS B N   
1426 C CA  . LYS B 63  ? 0.8110 0.7471 0.7673 0.0069  0.0251  -0.0009 2493 LYS B CA  
1427 C C   . LYS B 63  ? 0.7440 0.6765 0.6993 0.0014  0.0304  -0.0031 2493 LYS B C   
1428 O O   . LYS B 63  ? 0.7405 0.6631 0.6904 0.0013  0.0366  -0.0007 2493 LYS B O   
1429 C CB  . LYS B 63  ? 0.8856 0.8275 0.8441 0.0056  0.0260  -0.0045 2493 LYS B CB  
1430 C CG  . LYS B 63  ? 0.9441 0.8797 0.8988 0.0035  0.0353  -0.0049 2493 LYS B CG  
1431 C CD  . LYS B 63  ? 0.9487 0.8929 0.9078 0.0015  0.0362  -0.0090 2493 LYS B CD  
1432 C CE  . LYS B 63  ? 1.0760 1.0295 1.0421 -0.0056 0.0364  -0.0151 2493 LYS B CE  
1433 N N   . GLN B 64  ? 0.8284 0.7685 0.7882 -0.0026 0.0276  -0.0079 2494 GLN B N   
1434 C CA  . GLN B 64  ? 0.7797 0.7169 0.7381 -0.0081 0.0315  -0.0111 2494 GLN B CA  
1435 C C   . GLN B 64  ? 0.7116 0.6404 0.6654 -0.0061 0.0325  -0.0072 2494 GLN B C   
1436 O O   . GLN B 64  ? 0.8541 0.7747 0.8031 -0.0093 0.0385  -0.0081 2494 GLN B O   
1437 C CB  . GLN B 64  ? 0.7790 0.7278 0.7430 -0.0112 0.0263  -0.0168 2494 GLN B CB  
1438 C CG  . GLN B 64  ? 0.7543 0.7127 0.7238 -0.0143 0.0271  -0.0216 2494 GLN B CG  
1439 C CD  . GLN B 64  ? 0.7686 0.7408 0.7439 -0.0146 0.0200  -0.0262 2494 GLN B CD  
1440 O OE1 . GLN B 64  ? 0.8266 0.8002 0.8008 -0.0119 0.0144  -0.0256 2494 GLN B OE1 
1441 N NE2 . GLN B 64  ? 0.6037 0.5866 0.5850 -0.0171 0.0205  -0.0307 2494 GLN B NE2 
1442 N N   . ILE B 65  ? 0.7981 0.7285 0.7529 -0.0010 0.0271  -0.0029 2495 ILE B N   
1443 C CA  . ILE B 65  ? 0.7472 0.6709 0.6986 0.0012  0.0287  0.0012  2495 ILE B CA  
1444 C C   . ILE B 65  ? 0.7110 0.6239 0.6561 0.0023  0.0366  0.0041  2495 ILE B C   
1445 O O   . ILE B 65  ? 0.7064 0.6111 0.6461 0.0008  0.0421  0.0043  2495 ILE B O   
1446 C CB  . ILE B 65  ? 0.7382 0.6655 0.6929 0.0064  0.0227  0.0062  2495 ILE B CB  
1447 C CG1 . ILE B 65  ? 0.6798 0.6146 0.6384 0.0061  0.0158  0.0042  2495 ILE B CG1 
1448 C CG2 . ILE B 65  ? 0.7255 0.6464 0.6773 0.0095  0.0260  0.0115  2495 ILE B CG2 
1449 C CD1 . ILE B 65  ? 0.6337 0.5714 0.5958 0.0100  0.0102  0.0084  2495 ILE B CD1 
1450 N N   . LEU B 66  ? 0.8449 0.7569 0.7895 0.0056  0.0373  0.0067  2496 LEU B N   
1451 C CA  . LEU B 66  ? 0.7988 0.7000 0.7361 0.0085  0.0447  0.0103  2496 LEU B CA  
1452 C C   . LEU B 66  ? 0.8291 0.7195 0.7595 0.0034  0.0541  0.0073  2496 LEU B C   
1453 O O   . LEU B 66  ? 0.9220 0.8007 0.8443 0.0059  0.0611  0.0105  2496 LEU B O   
1454 C CB  . LEU B 66  ? 0.7788 0.6811 0.7156 0.0124  0.0438  0.0120  2496 LEU B CB  
1455 C CG  . LEU B 66  ? 0.8399 0.7502 0.7816 0.0177  0.0352  0.0150  2496 LEU B CG  
1456 C CD1 . LEU B 66  ? 0.7557 0.6650 0.6943 0.0216  0.0353  0.0159  2496 LEU B CD1 
1457 C CD2 . LEU B 66  ? 0.6759 0.5856 0.6178 0.0224  0.0337  0.0203  2496 LEU B CD2 
1458 N N   . THR B 67  ? 0.7820 0.6766 0.7156 -0.0035 0.0540  0.0011  2497 THR B N   
1459 C CA  . THR B 67  ? 0.6970 0.5832 0.6260 -0.0105 0.0621  -0.0032 2497 THR B CA  
1460 C C   . THR B 67  ? 0.7702 0.6500 0.6948 -0.0132 0.0639  -0.0047 2497 THR B C   
1461 O O   . THR B 67  ? 0.6062 0.4750 0.5242 -0.0182 0.0714  -0.0075 2497 THR B O   
1462 C CB  . THR B 67  ? 0.6510 0.5480 0.5876 -0.0171 0.0598  -0.0099 2497 THR B CB  
1463 O OG1 . THR B 67  ? 0.6692 0.5660 0.6061 -0.0162 0.0632  -0.0090 2497 THR B OG1 
1464 C CG2 . THR B 67  ? 0.7524 0.6469 0.6883 -0.0260 0.0639  -0.0165 2497 THR B CG2 
1465 N N   . GLY B 68  ? 0.7203 0.6064 0.6480 -0.0100 0.0573  -0.0032 2498 GLY B N   
1466 C CA  . GLY B 68  ? 0.6707 0.5540 0.5954 -0.0126 0.0571  -0.0057 2498 GLY B CA  
1467 C C   . GLY B 68  ? 0.6657 0.5584 0.5957 -0.0195 0.0531  -0.0135 2498 GLY B C   
1468 O O   . GLY B 68  ? 0.6373 0.5266 0.5636 -0.0235 0.0540  -0.0176 2498 GLY B O   
1469 N N   . TYR B 69  ? 0.6033 0.5083 0.5415 -0.0203 0.0484  -0.0156 2499 TYR B N   
1470 C CA  . TYR B 69  ? 0.6720 0.5888 0.6164 -0.0256 0.0437  -0.0228 2499 TYR B CA  
1471 C C   . TYR B 69  ? 0.7639 0.6856 0.7080 -0.0242 0.0373  -0.0245 2499 TYR B C   
1472 O O   . TYR B 69  ? 0.8100 0.7381 0.7560 -0.0288 0.0347  -0.0311 2499 TYR B O   
1473 C CB  . TYR B 69  ? 0.6743 0.6035 0.6268 -0.0240 0.0392  -0.0232 2499 TYR B CB  
1474 C CG  . TYR B 69  ? 0.7512 0.6956 0.7111 -0.0268 0.0330  -0.0294 2499 TYR B CG  
1475 C CD1 . TYR B 69  ? 0.7961 0.7470 0.7609 -0.0336 0.0355  -0.0357 2499 TYR B CD1 
1476 C CD2 . TYR B 69  ? 0.8577 0.8103 0.8199 -0.0220 0.0246  -0.0287 2499 TYR B CD2 
1477 C CE1 . TYR B 69  ? 0.7529 0.7202 0.7254 -0.0352 0.0293  -0.0414 2499 TYR B CE1 
1478 C CE2 . TYR B 69  ? 0.8953 0.8622 0.8634 -0.0230 0.0186  -0.0341 2499 TYR B CE2 
1479 C CZ  . TYR B 69  ? 0.8051 0.7800 0.7786 -0.0293 0.0207  -0.0405 2499 TYR B CZ  
1480 O OH  . TYR B 69  ? 0.8665 0.8573 0.8462 -0.0294 0.0145  -0.0458 2499 TYR B OH  
1481 N N   . TYR B 70  ? 0.8281 0.7476 0.7704 -0.0177 0.0345  -0.0185 2500 TYR B N   
1482 C CA  . TYR B 70  ? 0.7814 0.7042 0.7225 -0.0154 0.0291  -0.0189 2500 TYR B CA  
1483 C C   . TYR B 70  ? 0.8276 0.7378 0.7596 -0.0149 0.0340  -0.0173 2500 TYR B C   
1484 O O   . TYR B 70  ? 0.7237 0.6266 0.6526 -0.0103 0.0370  -0.0108 2500 TYR B O   
1485 C CB  . TYR B 70  ? 0.8195 0.7477 0.7646 -0.0089 0.0234  -0.0134 2500 TYR B CB  
1486 C CG  . TYR B 70  ? 0.7856 0.7254 0.7380 -0.0084 0.0179  -0.0152 2500 TYR B CG  
1487 C CD1 . TYR B 70  ? 0.7997 0.7496 0.7548 -0.0092 0.0122  -0.0204 2500 TYR B CD1 
1488 C CD2 . TYR B 70  ? 0.8109 0.7512 0.7664 -0.0062 0.0183  -0.0118 2500 TYR B CD2 
1489 C CE1 . TYR B 70  ? 0.7840 0.7441 0.7449 -0.0077 0.0075  -0.0217 2500 TYR B CE1 
1490 C CE2 . TYR B 70  ? 0.7223 0.6718 0.6831 -0.0051 0.0136  -0.0133 2500 TYR B CE2 
1491 C CZ  . TYR B 70  ? 0.7679 0.7272 0.7314 -0.0057 0.0084  -0.0181 2500 TYR B CZ  
1492 O OH  . TYR B 70  ? 0.7070 0.6752 0.6750 -0.0037 0.0041  -0.0195 2500 TYR B OH  
1493 N N   . LYS B 71  ? 0.8804 0.7884 0.8079 -0.0196 0.0347  -0.0235 2501 LYS B N   
1494 C CA  . LYS B 71  ? 0.8806 0.7745 0.7976 -0.0198 0.0403  -0.0230 2501 LYS B CA  
1495 C C   . LYS B 71  ? 0.8180 0.7122 0.7312 -0.0146 0.0363  -0.0207 2501 LYS B C   
1496 O O   . LYS B 71  ? 0.7139 0.5971 0.6191 -0.0113 0.0407  -0.0167 2501 LYS B O   
1497 C CB  . LYS B 71  ? 0.9227 0.8119 0.8356 -0.0281 0.0436  -0.0311 2501 LYS B CB  
1498 N N   . THR B 72  ? 0.7522 0.6588 0.6708 -0.0131 0.0286  -0.0226 2502 THR B N   
1499 C CA  . THR B 72  ? 0.7839 0.6913 0.6995 -0.0074 0.0247  -0.0195 2502 THR B CA  
1500 C C   . THR B 72  ? 0.7835 0.7005 0.7071 -0.0030 0.0192  -0.0152 2502 THR B C   
1501 O O   . THR B 72  ? 0.7030 0.6290 0.6342 -0.0045 0.0159  -0.0170 2502 THR B O   
1502 C CB  . THR B 72  ? 0.7771 0.6882 0.6882 -0.0088 0.0201  -0.0265 2502 THR B CB  
1503 O OG1 . THR B 72  ? 0.8068 0.7324 0.7257 -0.0099 0.0133  -0.0309 2502 THR B OG1 
1504 C CG2 . THR B 72  ? 0.7573 0.6599 0.6611 -0.0148 0.0245  -0.0327 2502 THR B CG2 
1505 N N   . VAL B 73  ? 0.7931 0.7076 0.7142 0.0023  0.0183  -0.0097 2503 VAL B N   
1506 C CA  . VAL B 73  ? 0.7168 0.6380 0.6439 0.0061  0.0134  -0.0057 2503 VAL B CA  
1507 C C   . VAL B 73  ? 0.7736 0.7039 0.7016 0.0066  0.0063  -0.0108 2503 VAL B C   
1508 O O   . VAL B 73  ? 0.9048 0.8415 0.8383 0.0085  0.0019  -0.0094 2503 VAL B O   
1509 C CB  . VAL B 73  ? 0.7015 0.6173 0.6258 0.0110  0.0151  0.0010  2503 VAL B CB  
1510 C CG1 . VAL B 73  ? 0.6356 0.5495 0.5516 0.0136  0.0129  -0.0011 2503 VAL B CG1 
1511 C CG2 . VAL B 73  ? 0.6039 0.5245 0.5360 0.0132  0.0121  0.0060  2503 VAL B CG2 
1512 N N   . GLU B 74  ? 0.7880 0.7190 0.7102 0.0053  0.0049  -0.0169 2504 GLU B N   
1513 C CA  . GLU B 74  ? 0.9276 0.8690 0.8507 0.0062  -0.0021 -0.0224 2504 GLU B CA  
1514 C C   . GLU B 74  ? 0.7408 0.6927 0.6729 0.0026  -0.0043 -0.0263 2504 GLU B C   
1515 O O   . GLU B 74  ? 0.7663 0.7272 0.7018 0.0054  -0.0098 -0.0276 2504 GLU B O   
1516 C CB  . GLU B 74  ? 1.0299 0.9714 0.9453 0.0052  -0.0036 -0.0291 2504 GLU B CB  
1517 C CG  . GLU B 74  ? 1.0506 0.9839 0.9553 0.0110  -0.0035 -0.0259 2504 GLU B CG  
1518 C CD  . GLU B 74  ? 1.1625 1.0821 1.0615 0.0111  0.0039  -0.0209 2504 GLU B CD  
1519 O OE1 . GLU B 74  ? 1.2732 1.1863 1.1673 0.0164  0.0056  -0.0147 2504 GLU B OE1 
1520 O OE2 . GLU B 74  ? 1.1985 1.1136 1.0977 0.0060  0.0086  -0.0229 2504 GLU B OE2 
1521 N N   . ALA B 75  ? 0.7684 0.7183 0.7036 -0.0029 0.0005  -0.0280 2505 ALA B N   
1522 C CA  . ALA B 75  ? 0.7781 0.7371 0.7215 -0.0067 -0.0001 -0.0316 2505 ALA B CA  
1523 C C   . ALA B 75  ? 0.7849 0.7454 0.7334 -0.0029 -0.0014 -0.0258 2505 ALA B C   
1524 O O   . ALA B 75  ? 0.8055 0.7756 0.7592 -0.0018 -0.0055 -0.0276 2505 ALA B O   
1525 C CB  . ALA B 75  ? 0.7043 0.6577 0.6479 -0.0135 0.0067  -0.0340 2505 ALA B CB  
1526 N N   . PHE B 76  ? 0.8256 0.7766 0.7721 -0.0007 0.0019  -0.0189 2506 PHE B N   
1527 C CA  . PHE B 76  ? 0.7198 0.6709 0.6704 0.0027  0.0003  -0.0131 2506 PHE B CA  
1528 C C   . PHE B 76  ? 0.6779 0.6336 0.6285 0.0073  -0.0060 -0.0122 2506 PHE B C   
1529 O O   . PHE B 76  ? 0.6478 0.6087 0.6023 0.0089  -0.0096 -0.0122 2506 PHE B O   
1530 C CB  . PHE B 76  ? 0.7147 0.6563 0.6634 0.0043  0.0048  -0.0064 2506 PHE B CB  
1531 C CG  . PHE B 76  ? 0.7254 0.6674 0.6786 0.0072  0.0030  -0.0009 2506 PHE B CG  
1532 C CD1 . PHE B 76  ? 0.7005 0.6460 0.6581 0.0066  0.0021  -0.0013 2506 PHE B CD1 
1533 C CD2 . PHE B 76  ? 0.7184 0.6572 0.6714 0.0103  0.0023  0.0046  2506 PHE B CD2 
1534 C CE1 . PHE B 76  ? 0.6331 0.5788 0.5942 0.0092  -0.0001 0.0030  2506 PHE B CE1 
1535 C CE2 . PHE B 76  ? 0.6593 0.5991 0.6173 0.0121  0.0001  0.0089  2506 PHE B CE2 
1536 C CZ  . PHE B 76  ? 0.6054 0.5485 0.5670 0.0115  -0.0014 0.0079  2506 PHE B CZ  
1537 N N   . ASP B 77  ? 0.7202 0.6723 0.6651 0.0100  -0.0070 -0.0111 2507 ASP B N   
1538 C CA  . ASP B 77  ? 0.6404 0.5950 0.5832 0.0148  -0.0125 -0.0104 2507 ASP B CA  
1539 C C   . ASP B 77  ? 0.6832 0.6487 0.6281 0.0154  -0.0176 -0.0163 2507 ASP B C   
1540 O O   . ASP B 77  ? 0.7551 0.7232 0.7010 0.0190  -0.0216 -0.0152 2507 ASP B O   
1541 C CB  . ASP B 77  ? 0.6876 0.6371 0.6222 0.0175  -0.0121 -0.0099 2507 ASP B CB  
1542 C CG  . ASP B 77  ? 0.7900 0.7299 0.7228 0.0190  -0.0081 -0.0026 2507 ASP B CG  
1543 O OD1 . ASP B 77  ? 0.7531 0.6918 0.6919 0.0181  -0.0067 0.0018  2507 ASP B OD1 
1544 O OD2 . ASP B 77  ? 0.9363 0.8706 0.8620 0.0213  -0.0064 -0.0013 2507 ASP B OD2 
1545 N N   . ALA B 78  ? 0.7901 0.7618 0.7355 0.0120  -0.0173 -0.0228 2508 ALA B N   
1546 C CA  . ALA B 78  ? 0.7791 0.7637 0.7275 0.0128  -0.0222 -0.0289 2508 ALA B CA  
1547 C C   . ALA B 78  ? 0.8107 0.8003 0.7661 0.0125  -0.0226 -0.0282 2508 ALA B C   
1548 O O   . ALA B 78  ? 0.8243 0.8197 0.7802 0.0171  -0.0273 -0.0285 2508 ALA B O   
1549 C CB  . ALA B 78  ? 0.7931 0.7843 0.7427 0.0074  -0.0213 -0.0364 2508 ALA B CB  
1550 N N   . ASP B 79  ? 0.7215 0.7073 0.6808 0.0079  -0.0175 -0.0267 2509 ASP B N   
1551 C CA  . ASP B 79  ? 0.6841 0.6730 0.6486 0.0081  -0.0172 -0.0255 2509 ASP B CA  
1552 C C   . ASP B 79  ? 0.7159 0.6995 0.6787 0.0133  -0.0204 -0.0199 2509 ASP B C   
1553 O O   . ASP B 79  ? 0.5830 0.5716 0.5472 0.0166  -0.0239 -0.0205 2509 ASP B O   
1554 C CB  . ASP B 79  ? 0.7353 0.7194 0.7024 0.0029  -0.0106 -0.0246 2509 ASP B CB  
1555 C CG  . ASP B 79  ? 0.8010 0.7927 0.7723 -0.0027 -0.0077 -0.0311 2509 ASP B CG  
1556 O OD1 . ASP B 79  ? 0.9024 0.9045 0.8756 -0.0034 -0.0110 -0.0368 2509 ASP B OD1 
1557 O OD2 . ASP B 79  ? 0.7996 0.7868 0.7723 -0.0067 -0.0017 -0.0304 2509 ASP B OD2 
1558 N N   . MET B 80  ? 0.6214 0.5951 0.5811 0.0141  -0.0189 -0.0145 2510 MET B N   
1559 C CA  . MET B 80  ? 0.6489 0.6177 0.6077 0.0179  -0.0219 -0.0096 2510 MET B CA  
1560 C C   . MET B 80  ? 0.6121 0.5841 0.5672 0.0228  -0.0274 -0.0112 2510 MET B C   
1561 O O   . MET B 80  ? 0.5278 0.5018 0.4834 0.0255  -0.0305 -0.0114 2510 MET B O   
1562 C CB  . MET B 80  ? 0.6561 0.6156 0.6135 0.0177  -0.0196 -0.0038 2510 MET B CB  
1563 C CG  . MET B 80  ? 0.7056 0.6618 0.6665 0.0148  -0.0148 -0.0010 2510 MET B CG  
1564 S SD  . MET B 80  ? 0.7725 0.7291 0.7373 0.0156  -0.0167 0.0008  2510 MET B SD  
1565 C CE  . MET B 80  ? 0.6711 0.6218 0.6364 0.0175  -0.0195 0.0068  2510 MET B CE  
1566 N N   . LEU B 81  ? 0.5871 0.5592 0.5373 0.0246  -0.0284 -0.0126 2511 LEU B N   
1567 C CA  . LEU B 81  ? 0.6478 0.6212 0.5924 0.0306  -0.0333 -0.0135 2511 LEU B CA  
1568 C C   . LEU B 81  ? 0.7042 0.6891 0.6508 0.0332  -0.0370 -0.0186 2511 LEU B C   
1569 O O   . LEU B 81  ? 0.7031 0.6877 0.6454 0.0390  -0.0410 -0.0182 2511 LEU B O   
1570 C CB  . LEU B 81  ? 0.7281 0.6993 0.6659 0.0327  -0.0335 -0.0142 2511 LEU B CB  
1571 C CG  . LEU B 81  ? 0.7372 0.6967 0.6717 0.0320  -0.0298 -0.0083 2511 LEU B CG  
1572 C CD1 . LEU B 81  ? 0.5978 0.5543 0.5234 0.0357  -0.0302 -0.0089 2511 LEU B CD1 
1573 C CD2 . LEU B 81  ? 0.7375 0.6888 0.6722 0.0333  -0.0302 -0.0024 2511 LEU B CD2 
1574 N N   . LYS B 82  ? 0.7229 0.7174 0.6758 0.0289  -0.0353 -0.0232 2512 LYS B N   
1575 C CA  . LYS B 82  ? 0.7386 0.7462 0.6955 0.0306  -0.0378 -0.0282 2512 LYS B CA  
1576 C C   . LYS B 82  ? 0.8412 0.8468 0.7995 0.0329  -0.0385 -0.0256 2512 LYS B C   
1577 O O   . LYS B 82  ? 0.9331 0.9450 0.8904 0.0382  -0.0420 -0.0274 2512 LYS B O   
1578 C CB  . LYS B 82  ? 0.8207 0.8375 0.7849 0.0238  -0.0343 -0.0333 2512 LYS B CB  
1579 C CG  . LYS B 82  ? 0.8749 0.9072 0.8457 0.0241  -0.0357 -0.0385 2512 LYS B CG  
1580 C CD  . LYS B 82  ? 0.9819 1.0239 0.9596 0.0165  -0.0326 -0.0446 2512 LYS B CD  
1581 C CE  . LYS B 82  ? 1.0768 1.1124 1.0586 0.0094  -0.0255 -0.0430 2512 LYS B CE  
1582 N NZ  . LYS B 82  ? 1.1046 1.1409 1.0888 0.0014  -0.0213 -0.0471 2512 LYS B NZ  
1583 N N   . VAL B 83  ? 0.6640 0.6610 0.6240 0.0295  -0.0352 -0.0217 2513 VAL B N   
1584 C CA  . VAL B 83  ? 0.6496 0.6422 0.6092 0.0318  -0.0362 -0.0189 2513 VAL B CA  
1585 C C   . VAL B 83  ? 0.7584 0.7433 0.7108 0.0377  -0.0407 -0.0161 2513 VAL B C   
1586 O O   . VAL B 83  ? 0.8388 0.8243 0.7887 0.0423  -0.0436 -0.0165 2513 VAL B O   
1587 C CB  . VAL B 83  ? 0.7150 0.6992 0.6769 0.0276  -0.0324 -0.0150 2513 VAL B CB  
1588 C CG1 . VAL B 83  ? 0.5976 0.5765 0.5576 0.0305  -0.0347 -0.0124 2513 VAL B CG1 
1589 C CG2 . VAL B 83  ? 0.7190 0.7081 0.6862 0.0222  -0.0270 -0.0174 2513 VAL B CG2 
1590 N N   . PHE B 84  ? 0.7473 0.7243 0.6955 0.0379  -0.0409 -0.0131 2514 PHE B N   
1591 C CA  . PHE B 84  ? 0.8350 0.8033 0.7754 0.0432  -0.0444 -0.0104 2514 PHE B CA  
1592 C C   . PHE B 84  ? 0.9094 0.8844 0.8445 0.0501  -0.0481 -0.0140 2514 PHE B C   
1593 O O   . PHE B 84  ? 0.9224 0.8937 0.8522 0.0556  -0.0511 -0.0135 2514 PHE B O   
1594 C CB  . PHE B 84  ? 0.8334 0.7920 0.7703 0.0422  -0.0430 -0.0063 2514 PHE B CB  
1595 C CG  . PHE B 84  ? 0.8011 0.7536 0.7430 0.0365  -0.0396 -0.0022 2514 PHE B CG  
1596 C CD1 . PHE B 84  ? 0.8151 0.7654 0.7608 0.0345  -0.0400 -0.0008 2514 PHE B CD1 
1597 C CD2 . PHE B 84  ? 0.8759 0.8245 0.8178 0.0341  -0.0363 0.0004  2514 PHE B CD2 
1598 C CE1 . PHE B 84  ? 0.7086 0.6546 0.6591 0.0301  -0.0374 0.0029  2514 PHE B CE1 
1599 C CE2 . PHE B 84  ? 0.7522 0.6963 0.6991 0.0298  -0.0331 0.0045  2514 PHE B CE2 
1600 C CZ  . PHE B 84  ? 0.7749 0.7184 0.7264 0.0278  -0.0339 0.0057  2514 PHE B CZ  
1601 N N   . ARG B 85  ? 0.8727 0.8572 0.8089 0.0502  -0.0480 -0.0177 2515 ARG B N   
1602 C CA  . ARG B 85  ? 0.9041 0.8970 0.8356 0.0573  -0.0519 -0.0214 2515 ARG B CA  
1603 C C   . ARG B 85  ? 0.9328 0.9359 0.8676 0.0605  -0.0538 -0.0245 2515 ARG B C   
1604 O O   . ARG B 85  ? 1.2324 1.2340 1.1603 0.0683  -0.0571 -0.0242 2515 ARG B O   
1605 C CB  . ARG B 85  ? 0.9000 0.9032 0.8338 0.0554  -0.0518 -0.0258 2515 ARG B CB  
1606 C CG  . ARG B 85  ? 0.7906 0.7968 0.7159 0.0630  -0.0557 -0.0277 2515 ARG B CG  
1607 C CD  . ARG B 85  ? 0.8490 0.8727 0.7796 0.0616  -0.0573 -0.0347 2515 ARG B CD  
1608 N NE  . ARG B 85  ? 0.8081 0.8362 0.7483 0.0516  -0.0533 -0.0371 2515 ARG B NE  
1609 C CZ  . ARG B 85  ? 0.7487 0.7672 0.6878 0.0461  -0.0496 -0.0349 2515 ARG B CZ  
1610 N NH1 . ARG B 85  ? 0.8072 0.8121 0.7374 0.0490  -0.0491 -0.0302 2515 ARG B NH1 
1611 N NH2 . ARG B 85  ? 0.7564 0.7783 0.7031 0.0378  -0.0457 -0.0373 2515 ARG B NH2 
1612 N N   . ASN B 86  ? 0.9032 0.9155 0.8477 0.0550  -0.0512 -0.0270 2516 ASN B N   
1613 C CA  . ASN B 86  ? 0.7908 0.8122 0.7391 0.0575  -0.0516 -0.0293 2516 ASN B CA  
1614 C C   . ASN B 86  ? 0.8218 0.8314 0.7632 0.0624  -0.0532 -0.0255 2516 ASN B C   
1615 O O   . ASN B 86  ? 0.7854 0.8004 0.7250 0.0686  -0.0551 -0.0271 2516 ASN B O   
1616 C CB  . ASN B 86  ? 0.8261 0.8540 0.7847 0.0498  -0.0470 -0.0310 2516 ASN B CB  
1617 C CG  . ASN B 86  ? 0.8558 0.8982 0.8220 0.0450  -0.0454 -0.0364 2516 ASN B CG  
1618 O OD1 . ASN B 86  ? 0.8762 0.9262 0.8408 0.0480  -0.0487 -0.0395 2516 ASN B OD1 
1619 N ND2 . ASN B 86  ? 0.9367 0.9823 0.9106 0.0375  -0.0404 -0.0378 2516 ASN B ND2 
1620 N N   . ALA B 87  ? 0.8053 0.7993 0.7430 0.0598  -0.0525 -0.0208 2517 ALA B N   
1621 C CA  . ALA B 87  ? 0.8359 0.8176 0.7670 0.0632  -0.0543 -0.0178 2517 ALA B CA  
1622 C C   . ALA B 87  ? 0.7986 0.7736 0.7186 0.0714  -0.0579 -0.0170 2517 ALA B C   
1623 O O   . ALA B 87  ? 0.8175 0.7901 0.7316 0.0777  -0.0601 -0.0173 2517 ALA B O   
1624 C CB  . ALA B 87  ? 0.7756 0.7443 0.7074 0.0573  -0.0527 -0.0135 2517 ALA B CB  
1625 N N   . GLU B 88  ? 0.9203 0.8919 0.8364 0.0720  -0.0582 -0.0159 2518 GLU B N   
1626 C CA  . GLU B 88  ? 1.0144 0.9793 0.9186 0.0805  -0.0610 -0.0150 2518 GLU B CA  
1627 C C   . GLU B 88  ? 1.1040 1.0834 1.0067 0.0887  -0.0637 -0.0194 2518 GLU B C   
1628 O O   . GLU B 88  ? 1.0746 1.0486 0.9671 0.0976  -0.0661 -0.0189 2518 GLU B O   
1629 C CB  . GLU B 88  ? 1.0855 1.0440 0.9859 0.0793  -0.0599 -0.0128 2518 GLU B CB  
1630 C CG  . GLU B 88  ? 1.1645 1.1085 1.0657 0.0725  -0.0573 -0.0079 2518 GLU B CG  
1631 C CD  . GLU B 88  ? 1.1484 1.0870 1.0467 0.0711  -0.0552 -0.0055 2518 GLU B CD  
1632 O OE1 . GLU B 88  ? 1.1112 1.0605 1.0121 0.0711  -0.0549 -0.0084 2518 GLU B OE1 
1633 O OE2 . GLU B 88  ? 1.3005 1.2241 1.1941 0.0697  -0.0537 -0.0009 2518 GLU B OE2 
1634 N N   . LYS B 89  ? 1.0375 1.0354 0.9504 0.0859  -0.0631 -0.0238 2519 LYS B N   
1635 C CA  . LYS B 89  ? 1.0760 1.0914 0.9903 0.0929  -0.0657 -0.0285 2519 LYS B CA  
1636 C C   . LYS B 89  ? 1.1766 1.1939 1.0907 0.0973  -0.0660 -0.0288 2519 LYS B C   
1637 O O   . LYS B 89  ? 1.3850 1.4070 1.2928 0.1072  -0.0687 -0.0300 2519 LYS B O   
1638 C CB  . LYS B 89  ? 0.9962 1.0315 0.9233 0.0869  -0.0647 -0.0337 2519 LYS B CB  
1639 C CG  . LYS B 89  ? 0.7210 0.7757 0.6492 0.0941  -0.0685 -0.0389 2519 LYS B CG  
1640 N N   . TYR B 90  ? 1.1354 1.1480 1.0547 0.0910  -0.0632 -0.0273 2520 TYR B N   
1641 C CA  . TYR B 90  ? 1.0347 1.0485 0.9533 0.0951  -0.0630 -0.0276 2520 TYR B CA  
1642 C C   . TYR B 90  ? 1.0303 1.0241 0.9354 0.1006  -0.0647 -0.0239 2520 TYR B C   
1643 O O   . TYR B 90  ? 1.2714 1.2662 1.1706 0.1089  -0.0660 -0.0246 2520 TYR B O   
1644 C CB  . TYR B 90  ? 1.0462 1.0641 0.9752 0.0868  -0.0590 -0.0281 2520 TYR B CB  
1645 C CG  . TYR B 90  ? 1.1262 1.1474 1.0547 0.0914  -0.0582 -0.0287 2520 TYR B CG  
1646 C CD1 . TYR B 90  ? 1.1675 1.2084 1.1026 0.0954  -0.0574 -0.0326 2520 TYR B CD1 
1647 C CD2 . TYR B 90  ? 1.1273 1.1324 1.0488 0.0920  -0.0582 -0.0257 2520 TYR B CD2 
1648 C CE1 . TYR B 90  ? 1.1667 1.2107 1.1011 0.1002  -0.0559 -0.0329 2520 TYR B CE1 
1649 C CE2 . TYR B 90  ? 1.1925 1.1995 1.1119 0.0969  -0.0572 -0.0263 2520 TYR B CE2 
1650 C CZ  . TYR B 90  ? 1.2141 1.2403 1.1398 0.1012  -0.0558 -0.0296 2520 TYR B CZ  
1651 O OH  . TYR B 90  ? 1.1852 1.2132 1.1086 0.1066  -0.0541 -0.0298 2520 TYR B OH  
1652 N N   . TYR B 91  ? 1.0058 0.9818 0.9063 0.0960  -0.0646 -0.0202 2521 TYR B N   
1653 C CA  . TYR B 91  ? 1.0483 1.0041 0.9363 0.0996  -0.0662 -0.0171 2521 TYR B CA  
1654 C C   . TYR B 91  ? 1.0950 1.0389 0.9703 0.1058  -0.0681 -0.0151 2521 TYR B C   
1655 O O   . TYR B 91  ? 1.1027 1.0323 0.9656 0.1119  -0.0697 -0.0137 2521 TYR B O   
1656 C CB  . TYR B 91  ? 1.1308 1.0741 1.0217 0.0904  -0.0651 -0.0142 2521 TYR B CB  
1657 C CG  . TYR B 91  ? 1.0681 1.0198 0.9685 0.0858  -0.0631 -0.0156 2521 TYR B CG  
1658 C CD1 . TYR B 91  ? 1.0241 0.9720 0.9197 0.0897  -0.0639 -0.0161 2521 TYR B CD1 
1659 C CD2 . TYR B 91  ? 0.9967 0.9591 0.9092 0.0781  -0.0600 -0.0163 2521 TYR B CD2 
1660 C CE1 . TYR B 91  ? 1.1056 1.0603 1.0084 0.0864  -0.0615 -0.0171 2521 TYR B CE1 
1661 C CE2 . TYR B 91  ? 0.9208 0.8894 0.8404 0.0744  -0.0574 -0.0172 2521 TYR B CE2 
1662 C CZ  . TYR B 91  ? 1.0207 0.9856 0.9355 0.0787  -0.0581 -0.0175 2521 TYR B CZ  
1663 O OH  . TYR B 91  ? 0.9113 0.8813 0.8317 0.0759  -0.0551 -0.0182 2521 TYR B OH  
1664 N N   . GLY B 92  ? 1.1580 1.1062 1.0352 0.1044  -0.0677 -0.0150 2522 GLY B N   
1665 C CA  . GLY B 92  ? 1.1833 1.1195 1.0474 0.1107  -0.0688 -0.0128 2522 GLY B CA  
1666 C C   . GLY B 92  ? 1.1297 1.0485 0.9917 0.1035  -0.0668 -0.0084 2522 GLY B C   
1667 O O   . GLY B 92  ? 1.1348 1.0422 0.9975 0.0980  -0.0663 -0.0064 2522 GLY B O   
1668 N N   . ARG B 93  ? 1.2309 1.1480 1.0899 0.1039  -0.0659 -0.0071 2523 ARG B N   
1669 C CA  . ARG B 93  ? 1.2257 1.1277 1.0832 0.0975  -0.0632 -0.0026 2523 ARG B CA  
1670 C C   . ARG B 93  ? 1.2708 1.1511 1.1192 0.0969  -0.0630 0.0007  2523 ARG B C   
1671 O O   . ARG B 93  ? 1.2501 1.1207 1.1024 0.0886  -0.0610 0.0038  2523 ARG B O   
1672 C CB  . ARG B 93  ? 1.1731 1.0731 1.0232 0.1019  -0.0622 -0.0014 2523 ARG B CB  
1673 N N   . LYS B 94  ? 1.3989 1.2722 1.2355 0.1057  -0.0652 0.0000  2524 LYS B N   
1674 C CA  . LYS B 94  ? 1.3875 1.2376 1.2120 0.1064  -0.0651 0.0027  2524 LYS B CA  
1675 C C   . LYS B 94  ? 1.4502 1.2971 1.2783 0.1021  -0.0668 0.0014  2524 LYS B C   
1676 O O   . LYS B 94  ? 1.7051 1.5330 1.5264 0.0990  -0.0669 0.0034  2524 LYS B O   
1677 C CB  . LYS B 94  ? 1.2747 1.1154 1.0810 0.1194  -0.0661 0.0029  2524 LYS B CB  
1678 N N   . SER B 95  ? 1.3217 1.1864 1.1600 0.1017  -0.0681 -0.0018 2525 SER B N   
1679 C CA  . SER B 95  ? 1.3560 1.2194 1.1979 0.0982  -0.0696 -0.0032 2525 SER B CA  
1680 C C   . SER B 95  ? 1.3281 1.1860 1.1791 0.0864  -0.0688 -0.0012 2525 SER B C   
1681 O O   . SER B 95  ? 1.2450 1.1051 1.1028 0.0805  -0.0666 0.0008  2525 SER B O   
1682 C CB  . SER B 95  ? 1.2874 1.1725 1.1390 0.1003  -0.0699 -0.0068 2525 SER B CB  
1683 O OG  . SER B 95  ? 1.0875 0.9885 0.9523 0.0948  -0.0679 -0.0074 2525 SER B OG  
1684 N N   . PRO B 96  ? 1.2524 1.1040 1.1034 0.0833  -0.0708 -0.0020 2526 PRO B N   
1685 C CA  . PRO B 96  ? 1.2690 1.1170 1.1290 0.0726  -0.0707 -0.0003 2526 PRO B CA  
1686 C C   . PRO B 96  ? 1.1311 0.9972 1.0070 0.0668  -0.0685 -0.0004 2526 PRO B C   
1687 O O   . PRO B 96  ? 1.1496 1.0151 1.0336 0.0590  -0.0672 0.0018  2526 PRO B O   
1688 C CB  . PRO B 96  ? 1.3166 1.1570 1.1724 0.0725  -0.0740 -0.0022 2526 PRO B CB  
1689 C CG  . PRO B 96  ? 1.2773 1.1266 1.1289 0.0816  -0.0745 -0.0051 2526 PRO B CG  
1690 C CD  . PRO B 96  ? 1.2581 1.1087 1.1027 0.0893  -0.0731 -0.0047 2526 PRO B CD  
1691 N N   . VAL B 97  ? 0.9841 0.8658 0.8643 0.0707  -0.0678 -0.0030 2527 VAL B N   
1692 C CA  . VAL B 97  ? 0.8596 0.7571 0.7531 0.0657  -0.0651 -0.0033 2527 VAL B CA  
1693 C C   . VAL B 97  ? 0.9598 0.8618 0.8563 0.0644  -0.0625 -0.0019 2527 VAL B C   
1694 O O   . VAL B 97  ? 0.9666 0.8761 0.8728 0.0586  -0.0600 -0.0012 2527 VAL B O   
1695 C CB  . VAL B 97  ? 0.8906 0.8027 0.7875 0.0696  -0.0645 -0.0068 2527 VAL B CB  
1696 C CG1 . VAL B 97  ? 0.9383 0.8659 0.8466 0.0656  -0.0612 -0.0077 2527 VAL B CG1 
1697 C CG2 . VAL B 97  ? 0.8831 0.7919 0.7797 0.0688  -0.0659 -0.0075 2527 VAL B CG2 
1698 N N   . GLY B 98  ? 0.9743 0.8707 0.8610 0.0705  -0.0630 -0.0016 2528 GLY B N   
1699 C CA  . GLY B 98  ? 1.0930 0.9913 0.9797 0.0706  -0.0609 -0.0002 2528 GLY B CA  
1700 C C   . GLY B 98  ? 1.1289 1.0131 1.0143 0.0652  -0.0591 0.0041  2528 GLY B C   
1701 O O   . GLY B 98  ? 0.9841 0.8712 0.8750 0.0610  -0.0563 0.0061  2528 GLY B O   
1702 N N   . ARG B 99  ? 1.2205 1.0888 1.0982 0.0653  -0.0606 0.0057  2529 ARG B N   
1703 C CA  . ARG B 99  ? 1.1995 1.0549 1.0781 0.0586  -0.0590 0.0096  2529 ARG B CA  
1704 C C   . ARG B 99  ? 1.0939 0.9588 0.9875 0.0498  -0.0576 0.0105  2529 ARG B C   
1705 O O   . ARG B 99  ? 1.1560 1.0189 1.0545 0.0448  -0.0545 0.0138  2529 ARG B O   
1706 C CB  . ARG B 99  ? 1.1874 1.0259 1.0575 0.0583  -0.0616 0.0097  2529 ARG B CB  
1707 C CG  . ARG B 99  ? 1.0784 0.9023 0.9309 0.0671  -0.0622 0.0098  2529 ARG B CG  
1708 C CD  . ARG B 99  ? 1.0316 0.8422 0.8748 0.0688  -0.0656 0.0081  2529 ARG B CD  
1709 N N   . ASP B 100 ? 0.9883 0.8634 0.8886 0.0488  -0.0594 0.0078  2530 ASP B N   
1710 C CA  . ASP B 100 ? 0.8912 0.7751 0.8043 0.0419  -0.0581 0.0085  2530 ASP B CA  
1711 C C   . ASP B 100 ? 0.9292 0.8249 0.8489 0.0410  -0.0543 0.0088  2530 ASP B C   
1712 O O   . ASP B 100 ? 0.9657 0.8621 0.8919 0.0361  -0.0513 0.0118  2530 ASP B O   
1713 C CB  . ASP B 100 ? 0.9835 0.8737 0.8994 0.0424  -0.0606 0.0056  2530 ASP B CB  
1714 C CG  . ASP B 100 ? 1.0986 0.9774 1.0097 0.0415  -0.0647 0.0051  2530 ASP B CG  
1715 O OD1 . ASP B 100 ? 1.1143 0.9802 1.0209 0.0394  -0.0656 0.0070  2530 ASP B OD1 
1716 O OD2 . ASP B 100 ? 0.9674 0.8498 0.8789 0.0428  -0.0667 0.0028  2530 ASP B OD2 
1717 N N   . VAL B 101 ? 0.8253 0.7305 0.7434 0.0458  -0.0543 0.0056  2531 VAL B N   
1718 C CA  . VAL B 101 ? 0.7765 0.6924 0.6996 0.0450  -0.0512 0.0048  2531 VAL B CA  
1719 C C   . VAL B 101 ? 0.8020 0.7122 0.7220 0.0447  -0.0487 0.0078  2531 VAL B C   
1720 O O   . VAL B 101 ? 0.8543 0.7682 0.7800 0.0409  -0.0454 0.0094  2531 VAL B O   
1721 C CB  . VAL B 101 ? 0.7174 0.6435 0.6379 0.0505  -0.0522 0.0004  2531 VAL B CB  
1722 C CG1 . VAL B 101 ? 0.7320 0.6661 0.6550 0.0498  -0.0496 -0.0004 2531 VAL B CG1 
1723 C CG2 . VAL B 101 ? 0.7481 0.6826 0.6738 0.0498  -0.0527 -0.0023 2531 VAL B CG2 
1724 N N   . CYS B 102 ? 0.8302 0.7302 0.7399 0.0493  -0.0500 0.0089  2532 CYS B N   
1725 C CA  . CYS B 102 ? 0.8360 0.7281 0.7412 0.0495  -0.0470 0.0124  2532 CYS B CA  
1726 C C   . CYS B 102 ? 0.8401 0.7289 0.7537 0.0419  -0.0438 0.0166  2532 CYS B C   
1727 O O   . CYS B 102 ? 0.9880 0.8792 0.9044 0.0401  -0.0400 0.0186  2532 CYS B O   
1728 C CB  . CYS B 102 ? 1.0120 0.8896 0.9041 0.0548  -0.0482 0.0139  2532 CYS B CB  
1729 S SG  . CYS B 102 ? 0.9995 0.8635 0.8864 0.0535  -0.0433 0.0197  2532 CYS B SG  
1730 N N   . ARG B 103 ? 0.7970 0.6806 0.7144 0.0375  -0.0454 0.0177  2533 ARG B N   
1731 C CA  . ARG B 103 ? 0.8042 0.6857 0.7306 0.0303  -0.0430 0.0216  2533 ARG B CA  
1732 C C   . ARG B 103 ? 0.7641 0.6584 0.7016 0.0269  -0.0410 0.0215  2533 ARG B C   
1733 O O   . ARG B 103 ? 0.8074 0.7031 0.7515 0.0230  -0.0372 0.0250  2533 ARG B O   
1734 C CB  . ARG B 103 ? 0.8915 0.7656 0.8192 0.0266  -0.0464 0.0218  2533 ARG B CB  
1735 C CG  . ARG B 103 ? 0.9409 0.8130 0.8781 0.0191  -0.0442 0.0258  2533 ARG B CG  
1736 C CD  . ARG B 103 ? 0.9147 0.7746 0.8497 0.0153  -0.0471 0.0262  2533 ARG B CD  
1737 N NE  . ARG B 103 ? 0.7309 0.5954 0.6789 0.0075  -0.0477 0.0278  2533 ARG B NE  
1738 C CZ  . ARG B 103 ? 0.8644 0.7311 0.8163 0.0048  -0.0528 0.0252  2533 ARG B CZ  
1739 N NH1 . ARG B 103 ? 0.9226 0.7950 0.8868 -0.0018 -0.0536 0.0266  2533 ARG B NH1 
1740 N NH2 . ARG B 103 ? 0.8285 0.6919 0.7721 0.0091  -0.0574 0.0212  2533 ARG B NH2 
1741 N N   . LEU B 104 ? 0.6526 0.5557 0.5916 0.0287  -0.0430 0.0176  2534 LEU B N   
1742 C CA  . LEU B 104 ? 0.6850 0.5984 0.6323 0.0261  -0.0405 0.0172  2534 LEU B CA  
1743 C C   . LEU B 104 ? 0.6515 0.5684 0.5982 0.0269  -0.0363 0.0177  2534 LEU B C   
1744 O O   . LEU B 104 ? 0.6543 0.5754 0.6073 0.0239  -0.0327 0.0195  2534 LEU B O   
1745 C CB  . LEU B 104 ? 0.7003 0.6211 0.6483 0.0278  -0.0427 0.0129  2534 LEU B CB  
1746 C CG  . LEU B 104 ? 0.6768 0.5960 0.6269 0.0266  -0.0462 0.0124  2534 LEU B CG  
1747 C CD1 . LEU B 104 ? 0.6596 0.5856 0.6092 0.0291  -0.0473 0.0085  2534 LEU B CD1 
1748 C CD2 . LEU B 104 ? 0.6890 0.6095 0.6475 0.0218  -0.0449 0.0155  2534 LEU B CD2 
1749 N N   . ARG B 105 ? 0.7163 0.6315 0.6546 0.0315  -0.0367 0.0160  2535 ARG B N   
1750 C CA  . ARG B 105 ? 0.6451 0.5622 0.5807 0.0328  -0.0332 0.0162  2535 ARG B CA  
1751 C C   . ARG B 105 ? 0.7755 0.6863 0.7130 0.0301  -0.0287 0.0218  2535 ARG B C   
1752 O O   . ARG B 105 ? 0.7828 0.6970 0.7233 0.0285  -0.0248 0.0229  2535 ARG B O   
1753 C CB  . ARG B 105 ? 0.6900 0.6049 0.6150 0.0390  -0.0351 0.0141  2535 ARG B CB  
1754 C CG  . ARG B 105 ? 0.7671 0.6880 0.6887 0.0434  -0.0395 0.0090  2535 ARG B CG  
1755 C CD  . ARG B 105 ? 0.7144 0.6349 0.6254 0.0505  -0.0409 0.0072  2535 ARG B CD  
1756 N NE  . ARG B 105 ? 0.7702 0.7035 0.6839 0.0507  -0.0413 0.0022  2535 ARG B NE  
1757 C CZ  . ARG B 105 ? 0.7434 0.6868 0.6567 0.0543  -0.0448 -0.0028 2535 ARG B CZ  
1758 N NH1 . ARG B 105 ? 0.7567 0.6982 0.6654 0.0593  -0.0482 -0.0034 2535 ARG B NH1 
1759 N NH2 . ARG B 105 ? 0.8285 0.7840 0.7459 0.0528  -0.0448 -0.0076 2535 ARG B NH2 
1760 N N   . LYS B 106 ? 0.8182 0.7193 0.7531 0.0299  -0.0289 0.0252  2536 LYS B N   
1761 C CA  . LYS B 106 ? 0.8673 0.7629 0.8053 0.0267  -0.0242 0.0309  2536 LYS B CA  
1762 C C   . LYS B 106 ? 0.8508 0.7541 0.8012 0.0216  -0.0222 0.0326  2536 LYS B C   
1763 O O   . LYS B 106 ? 0.9185 0.8233 0.8720 0.0206  -0.0173 0.0357  2536 LYS B O   
1764 C CB  . LYS B 106 ? 0.9640 0.8485 0.8999 0.0251  -0.0250 0.0338  2536 LYS B CB  
1765 C CG  . LYS B 106 ? 1.0298 0.9023 0.9532 0.0297  -0.0230 0.0358  2536 LYS B CG  
1766 C CD  . LYS B 106 ? 1.0603 0.9205 0.9835 0.0259  -0.0216 0.0399  2536 LYS B CD  
1767 N N   . ALA B 107 ? 0.8770 0.7848 0.8333 0.0193  -0.0260 0.0306  2537 ALA B N   
1768 C CA  . ALA B 107 ? 0.8836 0.7990 0.8506 0.0157  -0.0246 0.0320  2537 ALA B CA  
1769 C C   . ALA B 107 ? 0.7805 0.7017 0.7473 0.0171  -0.0209 0.0308  2537 ALA B C   
1770 O O   . ALA B 107 ? 0.9094 0.8330 0.8810 0.0157  -0.0163 0.0341  2537 ALA B O   
1771 C CB  . ALA B 107 ? 0.9428 0.8616 0.9133 0.0145  -0.0295 0.0292  2537 ALA B CB  
1772 N N   . TYR B 108 ? 0.7057 0.6289 0.6664 0.0199  -0.0227 0.0261  2538 TYR B N   
1773 C CA  . TYR B 108 ? 0.7442 0.6718 0.7034 0.0207  -0.0195 0.0239  2538 TYR B CA  
1774 C C   . TYR B 108 ? 0.7536 0.6775 0.7090 0.0218  -0.0149 0.0265  2538 TYR B C   
1775 O O   . TYR B 108 ? 0.9140 0.8397 0.8717 0.0208  -0.0105 0.0279  2538 TYR B O   
1776 C CB  . TYR B 108 ? 0.7541 0.6855 0.7083 0.0230  -0.0225 0.0179  2538 TYR B CB  
1777 C CG  . TYR B 108 ? 0.7455 0.6817 0.6998 0.0220  -0.0193 0.0150  2538 TYR B CG  
1778 C CD1 . TYR B 108 ? 0.7049 0.6439 0.6647 0.0194  -0.0167 0.0154  2538 TYR B CD1 
1779 C CD2 . TYR B 108 ? 0.7258 0.6627 0.6738 0.0238  -0.0187 0.0119  2538 TYR B CD2 
1780 C CE1 . TYR B 108 ? 0.7478 0.6888 0.7065 0.0181  -0.0131 0.0128  2538 TYR B CE1 
1781 C CE2 . TYR B 108 ? 0.6415 0.5815 0.5891 0.0221  -0.0158 0.0088  2538 TYR B CE2 
1782 C CZ  . TYR B 108 ? 0.7306 0.6720 0.6834 0.0189  -0.0127 0.0093  2538 TYR B CZ  
1783 O OH  . TYR B 108 ? 0.7170 0.6594 0.6682 0.0168  -0.0092 0.0061  2538 TYR B OH  
1784 N N   . TYR B 109 ? 0.7768 0.6945 0.7253 0.0244  -0.0152 0.0278  2539 TYR B N   
1785 C CA  . TYR B 109 ? 0.7808 0.6943 0.7240 0.0263  -0.0104 0.0302  2539 TYR B CA  
1786 C C   . TYR B 109 ? 0.8096 0.7218 0.7596 0.0238  -0.0051 0.0364  2539 TYR B C   
1787 O O   . TYR B 109 ? 0.7876 0.6985 0.7353 0.0249  0.0000  0.0383  2539 TYR B O   
1788 C CB  . TYR B 109 ? 0.8329 0.7392 0.7655 0.0307  -0.0112 0.0304  2539 TYR B CB  
1789 C CG  . TYR B 109 ? 0.8925 0.8011 0.8181 0.0344  -0.0166 0.0247  2539 TYR B CG  
1790 C CD1 . TYR B 109 ? 0.7916 0.7087 0.7177 0.0345  -0.0185 0.0189  2539 TYR B CD1 
1791 C CD2 . TYR B 109 ? 0.8865 0.7887 0.8050 0.0381  -0.0194 0.0251  2539 TYR B CD2 
1792 C CE1 . TYR B 109 ? 0.8319 0.7533 0.7530 0.0380  -0.0234 0.0137  2539 TYR B CE1 
1793 C CE2 . TYR B 109 ? 1.0070 0.9123 0.9191 0.0427  -0.0243 0.0201  2539 TYR B CE2 
1794 C CZ  . TYR B 109 ? 0.9391 0.8551 0.8532 0.0427  -0.0265 0.0144  2539 TYR B CZ  
1795 O OH  . TYR B 109 ? 0.9839 0.9050 0.8930 0.0474  -0.0313 0.0095  2539 TYR B OH  
1796 N N   . ASN B 110 ? 0.7121 0.6249 0.6705 0.0205  -0.0062 0.0393  2540 ASN B N   
1797 C CA  . ASN B 110 ? 0.8050 0.7194 0.7720 0.0180  -0.0014 0.0450  2540 ASN B CA  
1798 C C   . ASN B 110 ? 0.8167 0.7381 0.7890 0.0174  0.0008  0.0448  2540 ASN B C   
1799 O O   . ASN B 110 ? 0.9018 0.8231 0.8739 0.0186  0.0065  0.0478  2540 ASN B O   
1800 C CB  . ASN B 110 ? 0.8672 0.7819 0.8428 0.0139  -0.0037 0.0476  2540 ASN B CB  
1801 C CG  . ASN B 110 ? 0.8078 0.7130 0.7773 0.0142  -0.0046 0.0487  2540 ASN B CG  
1802 O OD1 . ASN B 110 ? 0.7967 0.6949 0.7579 0.0171  -0.0008 0.0506  2540 ASN B OD1 
1803 N ND2 . ASN B 110 ? 0.7299 0.6332 0.7017 0.0116  -0.0095 0.0473  2540 ASN B ND2 
1804 N N   . ALA B 111 ? 0.7329 0.6594 0.7087 0.0163  -0.0031 0.0413  2541 ALA B N   
1805 C CA  . ALA B 111 ? 0.7716 0.7033 0.7511 0.0162  -0.0007 0.0412  2541 ALA B CA  
1806 C C   . ALA B 111 ? 0.8360 0.7650 0.8075 0.0185  0.0035  0.0393  2541 ALA B C   
1807 O O   . ALA B 111 ? 0.7396 0.6691 0.7120 0.0193  0.0086  0.0417  2541 ALA B O   
1808 C CB  . ALA B 111 ? 0.7052 0.6409 0.6872 0.0153  -0.0055 0.0374  2541 ALA B CB  
1809 N N   . ARG B 112 ? 0.8144 0.7404 0.7775 0.0197  0.0013  0.0349  2542 ARG B N   
1810 C CA  . ARG B 112 ? 0.7515 0.6745 0.7062 0.0214  0.0045  0.0324  2542 ARG B CA  
1811 C C   . ARG B 112 ? 0.7640 0.6817 0.7147 0.0236  0.0099  0.0370  2542 ARG B C   
1812 O O   . ARG B 112 ? 0.7846 0.6998 0.7312 0.0248  0.0146  0.0372  2542 ARG B O   
1813 C CB  . ARG B 112 ? 0.7942 0.7172 0.7415 0.0226  0.0001  0.0263  2542 ARG B CB  
1814 C CG  . ARG B 112 ? 0.7307 0.6590 0.6796 0.0206  -0.0022 0.0207  2542 ARG B CG  
1815 C CD  . ARG B 112 ? 0.7391 0.6664 0.6856 0.0192  0.0025  0.0187  2542 ARG B CD  
1816 N NE  . ARG B 112 ? 0.7592 0.6844 0.6970 0.0201  0.0028  0.0145  2542 ARG B NE  
1817 C CZ  . ARG B 112 ? 0.8065 0.7258 0.7376 0.0222  0.0065  0.0162  2542 ARG B CZ  
1818 N NH1 . ARG B 112 ? 0.7878 0.7027 0.7201 0.0236  0.0112  0.0227  2542 ARG B NH1 
1819 N NH2 . ARG B 112 ? 0.7267 0.6448 0.6494 0.0230  0.0054  0.0111  2542 ARG B NH2 
1820 N N   . HIS B 113 ? 0.7626 0.6773 0.7136 0.0244  0.0097  0.0407  2543 HIS B N   
1821 C CA  . HIS B 113 ? 0.7505 0.6598 0.6978 0.0268  0.0158  0.0457  2543 HIS B CA  
1822 C C   . HIS B 113 ? 0.7506 0.6634 0.7062 0.0259  0.0212  0.0507  2543 HIS B C   
1823 O O   . HIS B 113 ? 0.8802 0.7897 0.8311 0.0285  0.0271  0.0528  2543 HIS B O   
1824 C CB  . HIS B 113 ? 0.7352 0.6399 0.6815 0.0273  0.0155  0.0492  2543 HIS B CB  
1825 C CG  . HIS B 113 ? 0.7281 0.6257 0.6674 0.0307  0.0219  0.0537  2543 HIS B CG  
1826 N ND1 . HIS B 113 ? 0.8671 0.7656 0.8117 0.0307  0.0287  0.0595  2543 HIS B ND1 
1827 C CD2 . HIS B 113 ? 0.7979 0.6872 0.7251 0.0347  0.0226  0.0537  2543 HIS B CD2 
1828 C CE1 . HIS B 113 ? 0.7476 0.6384 0.6835 0.0344  0.0338  0.0628  2543 HIS B CE1 
1829 N NE2 . HIS B 113 ? 0.7490 0.6337 0.6737 0.0370  0.0302  0.0593  2543 HIS B NE2 
1830 N N   . GLU B 114 ? 0.8925 0.8120 0.8597 0.0230  0.0192  0.0524  2544 GLU B N   
1831 C CA  . GLU B 114 ? 0.9654 0.8903 0.9416 0.0228  0.0236  0.0572  2544 GLU B CA  
1832 C C   . GLU B 114 ? 0.9547 0.8797 0.9272 0.0248  0.0267  0.0555  2544 GLU B C   
1833 O O   . GLU B 114 ? 1.0434 0.9682 1.0162 0.0273  0.0330  0.0595  2544 GLU B O   
1834 C CB  . GLU B 114 ? 1.0990 1.0319 1.0881 0.0194  0.0194  0.0585  2544 GLU B CB  
1835 C CG  . GLU B 114 ? 1.2502 1.1831 1.2455 0.0168  0.0190  0.0623  2544 GLU B CG  
1836 C CD  . GLU B 114 ? 1.4598 1.3988 1.4652 0.0127  0.0128  0.0614  2544 GLU B CD  
1837 O OE1 . GLU B 114 ? 1.6129 1.5475 1.6150 0.0110  0.0077  0.0584  2544 GLU B OE1 
1838 O OE2 . GLU B 114 ? 1.5209 1.4688 1.5366 0.0119  0.0129  0.0635  2544 GLU B OE2 
1839 N N   . ALA B 115 ? 0.9379 0.8625 0.9064 0.0238  0.0230  0.0497  2545 ALA B N   
1840 C CA  . ALA B 115 ? 0.8078 0.7304 0.7715 0.0250  0.0263  0.0476  2545 ALA B CA  
1841 C C   . ALA B 115 ? 0.8417 0.7561 0.7939 0.0274  0.0313  0.0467  2545 ALA B C   
1842 O O   . ALA B 115 ? 0.8809 0.7916 0.8287 0.0290  0.0363  0.0470  2545 ALA B O   
1843 C CB  . ALA B 115 ? 0.7383 0.6621 0.7006 0.0227  0.0217  0.0415  2545 ALA B CB  
1844 N N   . SER B 116 ? 0.7744 0.6850 0.7205 0.0281  0.0299  0.0456  2546 SER B N   
1845 C CA  . SER B 116 ? 0.8025 0.7053 0.7357 0.0302  0.0325  0.0425  2546 SER B CA  
1846 C C   . SER B 116 ? 0.7700 0.6671 0.6981 0.0333  0.0404  0.0461  2546 SER B C   
1847 O O   . SER B 116 ? 0.8511 0.7414 0.7688 0.0340  0.0426  0.0422  2546 SER B O   
1848 C CB  . SER B 116 ? 0.7202 0.6197 0.6474 0.0320  0.0303  0.0424  2546 SER B CB  
1849 O OG  . SER B 116 ? 0.8467 0.7454 0.7777 0.0339  0.0344  0.0496  2546 SER B OG  
1850 N N   . ALA B 117 ? 0.7754 0.6754 0.7108 0.0353  0.0447  0.0534  2547 ALA B N   
1851 C CA  . ALA B 117 ? 0.8386 0.7338 0.7695 0.0393  0.0528  0.0575  2547 ALA B CA  
1852 C C   . ALA B 117 ? 0.7895 0.6827 0.7179 0.0391  0.0546  0.0549  2547 ALA B C   
1853 O O   . ALA B 117 ? 0.7154 0.5993 0.6320 0.0408  0.0586  0.0526  2547 ALA B O   
1854 C CB  . ALA B 117 ? 0.8539 0.7559 0.7961 0.0411  0.0568  0.0658  2547 ALA B CB  
1855 N N   . GLN B 118 ? 0.8375 0.7385 0.7761 0.0370  0.0517  0.0551  2548 GLN B N   
1856 C CA  . GLN B 118 ? 0.9322 0.8305 0.8681 0.0374  0.0542  0.0535  2548 GLN B CA  
1857 C C   . GLN B 118 ? 0.8737 0.7641 0.7990 0.0343  0.0528  0.0457  2548 GLN B C   
1858 O O   . GLN B 118 ? 0.8390 0.7209 0.7557 0.0352  0.0577  0.0441  2548 GLN B O   
1859 C CB  . GLN B 118 ? 0.9771 0.8849 0.9247 0.0360  0.0505  0.0546  2548 GLN B CB  
1860 C CG  . GLN B 118 ? 1.0484 0.9667 1.0090 0.0378  0.0504  0.0614  2548 GLN B CG  
1861 C CD  . GLN B 118 ? 1.2194 1.1471 1.1906 0.0357  0.0445  0.0609  2548 GLN B CD  
1862 O OE1 . GLN B 118 ? 1.1724 1.1008 1.1435 0.0377  0.0457  0.0611  2548 GLN B OE1 
1863 N NE2 . GLN B 118 ? 1.0400 0.9737 1.0189 0.0321  0.0382  0.0602  2548 GLN B NE2 
1864 N N   . ILE B 119 ? 0.8506 0.7438 0.7766 0.0307  0.0462  0.0407  2549 ILE B N   
1865 C CA  . ILE B 119 ? 0.8383 0.7270 0.7563 0.0271  0.0440  0.0327  2549 ILE B CA  
1866 C C   . ILE B 119 ? 0.8581 0.7364 0.7627 0.0287  0.0480  0.0305  2549 ILE B C   
1867 O O   . ILE B 119 ? 0.9368 0.8084 0.8334 0.0262  0.0494  0.0249  2549 ILE B O   
1868 C CB  . ILE B 119 ? 0.7998 0.6953 0.7215 0.0242  0.0360  0.0283  2549 ILE B CB  
1869 C CG1 . ILE B 119 ? 0.7485 0.6526 0.6812 0.0222  0.0317  0.0290  2549 ILE B CG1 
1870 C CG2 . ILE B 119 ? 0.7318 0.6248 0.6462 0.0209  0.0337  0.0200  2549 ILE B CG2 
1871 C CD1 . ILE B 119 ? 0.8560 0.7659 0.7917 0.0205  0.0245  0.0254  2549 ILE B CD1 
1872 N N   . ASP B 120 ? 0.8824 0.7586 0.7839 0.0328  0.0499  0.0347  2550 ASP B N   
1873 C CA  . ASP B 120 ? 0.9095 0.7748 0.7968 0.0353  0.0539  0.0331  2550 ASP B CA  
1874 C C   . ASP B 120 ? 0.8980 0.7542 0.7787 0.0380  0.0621  0.0357  2550 ASP B C   
1875 O O   . ASP B 120 ? 1.0272 0.8727 0.8953 0.0374  0.0646  0.0309  2550 ASP B O   
1876 C CB  . ASP B 120 ? 0.9798 0.8443 0.8643 0.0397  0.0547  0.0374  2550 ASP B CB  
1877 C CG  . ASP B 120 ? 1.1110 0.9794 0.9947 0.0383  0.0473  0.0331  2550 ASP B CG  
1878 O OD1 . ASP B 120 ? 1.1500 1.0202 1.0317 0.0345  0.0420  0.0255  2550 ASP B OD1 
1879 O OD2 . ASP B 120 ? 1.0806 0.9503 0.9656 0.0413  0.0471  0.0376  2550 ASP B OD2 
1880 N N   . GLU B 121 ? 0.8800 0.7403 0.7689 0.0411  0.0661  0.0430  2551 GLU B N   
1881 C CA  . GLU B 121 ? 0.9598 0.8118 0.8425 0.0450  0.0742  0.0462  2551 GLU B CA  
1882 C C   . GLU B 121 ? 0.9761 0.8209 0.8527 0.0412  0.0749  0.0403  2551 GLU B C   
1883 O O   . GLU B 121 ? 1.1555 0.9872 1.0194 0.0431  0.0810  0.0393  2551 GLU B O   
1884 C CB  . GLU B 121 ? 1.0546 0.9156 0.9493 0.0491  0.0771  0.0547  2551 GLU B CB  
1885 C CG  . GLU B 121 ? 1.1229 0.9767 1.0115 0.0543  0.0852  0.0583  2551 GLU B CG  
1886 N N   . ILE B 122 ? 0.8863 0.7386 0.7712 0.0359  0.0691  0.0365  2552 ILE B N   
1887 C CA  . ILE B 122 ? 0.8541 0.7002 0.7344 0.0314  0.0699  0.0307  2552 ILE B CA  
1888 C C   . ILE B 122 ? 0.9467 0.7850 0.8164 0.0267  0.0684  0.0223  2552 ILE B C   
1889 O O   . ILE B 122 ? 1.2254 1.0504 1.0830 0.0260  0.0738  0.0194  2552 ILE B O   
1890 C CB  . ILE B 122 ? 0.9666 0.8238 0.8591 0.0274  0.0642  0.0291  2552 ILE B CB  
1891 C CG1 . ILE B 122 ? 0.8168 0.6808 0.7186 0.0318  0.0656  0.0364  2552 ILE B CG1 
1892 C CG2 . ILE B 122 ? 0.8247 0.6756 0.7123 0.0218  0.0653  0.0225  2552 ILE B CG2 
1893 C CD1 . ILE B 122 ? 0.7460 0.6223 0.6601 0.0290  0.0585  0.0358  2552 ILE B CD1 
1894 N N   . VAL B 123 ? 0.8749 0.7213 0.7485 0.0236  0.0611  0.0180  2553 VAL B N   
1895 C CA  . VAL B 123 ? 0.9194 0.7614 0.7843 0.0191  0.0583  0.0092  2553 VAL B CA  
1896 C C   . VAL B 123 ? 1.0682 0.8964 0.9176 0.0221  0.0632  0.0085  2553 VAL B C   
1897 O O   . VAL B 123 ? 1.1491 0.9686 0.9886 0.0180  0.0638  0.0012  2553 VAL B O   
1898 C CB  . VAL B 123 ? 0.8695 0.7231 0.7401 0.0182  0.0497  0.0063  2553 VAL B CB  
1899 C CG1 . VAL B 123 ? 0.8224 0.6728 0.6835 0.0150  0.0463  -0.0024 2553 VAL B CG1 
1900 C CG2 . VAL B 123 ? 0.7768 0.6428 0.6609 0.0148  0.0446  0.0056  2553 VAL B CG2 
1901 N N   . GLY B 124 ? 1.2376 1.0640 1.0853 0.0292  0.0666  0.0160  2554 GLY B N   
1902 C CA  . GLY B 124 ? 1.3214 1.1343 1.1539 0.0340  0.0723  0.0171  2554 GLY B CA  
1903 C C   . GLY B 124 ? 1.3609 1.1619 1.1863 0.0378  0.0817  0.0216  2554 GLY B C   
1904 O O   . GLY B 124 ? 1.3933 1.1881 1.2120 0.0448  0.0874  0.0275  2554 GLY B O   
1905 N N   . GLU B 125 ? 1.3008 1.0989 1.1278 0.0339  0.0837  0.0196  2555 GLU B N   
1906 C CA  . GLU B 125 ? 1.1793 0.9606 0.9935 0.0357  0.0923  0.0201  2555 GLU B CA  
1907 C C   . GLU B 125 ? 1.2599 1.0299 1.0628 0.0280  0.0914  0.0095  2555 GLU B C   
1908 O O   . GLU B 125 ? 1.3269 1.0792 1.1152 0.0281  0.0982  0.0076  2555 GLU B O   
1909 C CB  . GLU B 125 ? 1.1181 0.9022 0.9401 0.0367  0.0957  0.0246  2555 GLU B CB  
1910 C CG  . GLU B 125 ? 1.0506 0.8464 0.8843 0.0441  0.0968  0.0347  2555 GLU B CG  
1911 C CD  . GLU B 125 ? 1.0639 0.8669 0.9080 0.0440  0.0966  0.0376  2555 GLU B CD  
1912 O OE1 . GLU B 125 ? 1.0689 0.8645 0.9085 0.0393  0.0980  0.0329  2555 GLU B OE1 
1913 O OE2 . GLU B 125 ? 0.8486 0.6646 0.7051 0.0483  0.0952  0.0444  2555 GLU B OE2 
1914 N N   . THR B 126 ? 1.1227 0.9033 0.9326 0.0212  0.0830  0.0026  2556 THR B N   
1915 C CA  . THR B 126 ? 1.0171 0.7916 0.8195 0.0131  0.0804  -0.0081 2556 THR B CA  
1916 C C   . THR B 126 ? 0.8600 0.6269 0.6486 0.0158  0.0791  -0.0113 2556 THR B C   
1917 O O   . THR B 126 ? 0.8697 0.6330 0.6514 0.0099  0.0755  -0.0206 2556 THR B O   
1918 C CB  . THR B 126 ? 0.8214 0.6130 0.6381 0.0056  0.0715  -0.0140 2556 THR B CB  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   2431 2431 SER SER A . n 
A 1 2   MET 2   2432 2432 MET MET A . n 
A 1 3   GLU 3   2433 2433 GLU GLU A . n 
A 1 4   VAL 4   2434 2434 VAL VAL A . n 
A 1 5   ALA 5   2435 2435 ALA ALA A . n 
A 1 6   ARG 6   2436 2436 ARG ARG A . n 
A 1 7   ALA 7   2437 2437 ALA ALA A . n 
A 1 8   ALA 8   2438 2438 ALA ALA A . n 
A 1 9   ARG 9   2439 2439 ARG ARG A . n 
A 1 10  LEU 10  2440 2440 LEU LEU A . n 
A 1 11  ALA 11  2441 2441 ALA ALA A . n 
A 1 12  GLN 12  2442 2442 GLN GLN A . n 
A 1 13  ILE 13  2443 2443 ILE ILE A . n 
A 1 14  PHE 14  2444 2444 PHE PHE A . n 
A 1 15  LYS 15  2445 2445 LYS LYS A . n 
A 1 16  GLU 16  2446 2446 GLU GLU A . n 
A 1 17  ILE 17  2447 2447 ILE ILE A . n 
A 1 18  CYS 18  2448 2448 CYS CYS A . n 
A 1 19  ASP 19  2449 2449 ASP ASP A . n 
A 1 20  GLY 20  2450 2450 GLY GLY A . n 
A 1 21  ILE 21  2451 2451 ILE ILE A . n 
A 1 22  ILE 22  2452 2452 ILE ILE A . n 
A 1 23  SER 23  2453 2453 SER SER A . n 
A 1 24  TYR 24  2454 2454 TYR TYR A . n 
A 1 25  LYS 25  2455 2455 LYS LYS A . n 
A 1 26  ASP 26  2456 2456 ASP ASP A . n 
A 1 27  SER 27  2457 2457 SER SER A . n 
A 1 28  SER 28  2458 2458 SER SER A . n 
A 1 29  ARG 29  2459 2459 ARG ARG A . n 
A 1 30  GLN 30  2460 2460 GLN GLN A . n 
A 1 31  ALA 31  2461 2461 ALA ALA A . n 
A 1 32  LEU 32  2462 2462 LEU LEU A . n 
A 1 33  ALA 33  2463 2463 ALA ALA A . n 
A 1 34  ALA 34  2464 2464 ALA ALA A . n 
A 1 35  PRO 35  2465 2465 PRO PRO A . n 
A 1 36  LEU 36  2466 2466 LEU LEU A . n 
A 1 37  LEU 37  2467 2467 LEU LEU A . n 
A 1 38  ASN 38  2468 2468 ASN ASN A . n 
A 1 39  LEU 39  2469 2469 LEU LEU A . n 
A 1 40  PRO 40  2470 2470 PRO PRO A . n 
A 1 41  PRO 41  2471 2471 PRO PRO A . n 
A 1 42  LYS 42  2472 2472 LYS LYS A . n 
A 1 43  LYS 43  2473 2473 LYS LYS A . n 
A 1 44  LYS 44  2474 2474 LYS LYS A . n 
A 1 45  ASN 45  2475 2475 ASN ASN A . n 
A 1 46  ALA 46  2476 2476 ALA ALA A . n 
A 1 47  ASP 47  2477 2477 ASP ASP A . n 
A 1 48  TYR 48  2478 2478 TYR TYR A . n 
A 1 49  TYR 49  2479 2479 TYR TYR A . n 
A 1 50  GLU 50  2480 2480 GLU GLU A . n 
A 1 51  LYS 51  2481 2481 LYS LYS A . n 
A 1 52  ILE 52  2482 2482 ILE ILE A . n 
A 1 53  SER 53  2483 2483 SER SER A . n 
A 1 54  ASP 54  2484 2484 ASP ASP A . n 
A 1 55  PRO 55  2485 2485 PRO PRO A . n 
A 1 56  LEU 56  2486 2486 LEU LEU A . n 
A 1 57  ASP 57  2487 2487 ASP ASP A . n 
A 1 58  LEU 58  2488 2488 LEU LEU A . n 
A 1 59  ILE 59  2489 2489 ILE ILE A . n 
A 1 60  THR 60  2490 2490 THR THR A . n 
A 1 61  ILE 61  2491 2491 ILE ILE A . n 
A 1 62  GLU 62  2492 2492 GLU GLU A . n 
A 1 63  LYS 63  2493 2493 LYS LYS A . n 
A 1 64  GLN 64  2494 2494 GLN GLN A . n 
A 1 65  ILE 65  2495 2495 ILE ILE A . n 
A 1 66  LEU 66  2496 2496 LEU LEU A . n 
A 1 67  THR 67  2497 2497 THR THR A . n 
A 1 68  GLY 68  2498 2498 GLY GLY A . n 
A 1 69  TYR 69  2499 2499 TYR TYR A . n 
A 1 70  TYR 70  2500 2500 TYR TYR A . n 
A 1 71  LYS 71  2501 2501 LYS LYS A . n 
A 1 72  THR 72  2502 2502 THR THR A . n 
A 1 73  VAL 73  2503 2503 VAL VAL A . n 
A 1 74  GLU 74  2504 2504 GLU GLU A . n 
A 1 75  ALA 75  2505 2505 ALA ALA A . n 
A 1 76  PHE 76  2506 2506 PHE PHE A . n 
A 1 77  ASP 77  2507 2507 ASP ASP A . n 
A 1 78  ALA 78  2508 2508 ALA ALA A . n 
A 1 79  ASP 79  2509 2509 ASP ASP A . n 
A 1 80  MET 80  2510 2510 MET MET A . n 
A 1 81  LEU 81  2511 2511 LEU LEU A . n 
A 1 82  LYS 82  2512 2512 LYS LYS A . n 
A 1 83  VAL 83  2513 2513 VAL VAL A . n 
A 1 84  PHE 84  2514 2514 PHE PHE A . n 
A 1 85  ARG 85  2515 2515 ARG ARG A . n 
A 1 86  ASN 86  2516 2516 ASN ASN A . n 
A 1 87  ALA 87  2517 2517 ALA ALA A . n 
A 1 88  GLU 88  2518 2518 GLU GLU A . n 
A 1 89  LYS 89  2519 2519 LYS LYS A . n 
A 1 90  TYR 90  2520 2520 TYR TYR A . n 
A 1 91  TYR 91  2521 2521 TYR TYR A . n 
A 1 92  GLY 92  2522 2522 GLY GLY A . n 
A 1 93  ARG 93  2523 2523 ARG ARG A . n 
A 1 94  LYS 94  2524 2524 LYS LYS A . n 
A 1 95  SER 95  2525 2525 SER SER A . n 
A 1 96  PRO 96  2526 2526 PRO PRO A . n 
A 1 97  VAL 97  2527 2527 VAL VAL A . n 
A 1 98  GLY 98  2528 2528 GLY GLY A . n 
A 1 99  ARG 99  2529 2529 ARG ARG A . n 
A 1 100 ASP 100 2530 2530 ASP ASP A . n 
A 1 101 VAL 101 2531 2531 VAL VAL A . n 
A 1 102 CYS 102 2532 2532 CYS CYS A . n 
A 1 103 ARG 103 2533 2533 ARG ARG A . n 
A 1 104 LEU 104 2534 2534 LEU LEU A . n 
A 1 105 ARG 105 2535 2535 ARG ARG A . n 
A 1 106 LYS 106 2536 2536 LYS LYS A . n 
A 1 107 ALA 107 2537 2537 ALA ALA A . n 
A 1 108 TYR 108 2538 2538 TYR TYR A . n 
A 1 109 TYR 109 2539 2539 TYR TYR A . n 
A 1 110 ASN 110 2540 2540 ASN ASN A . n 
A 1 111 ALA 111 2541 2541 ALA ALA A . n 
A 1 112 ARG 112 2542 2542 ARG ARG A . n 
A 1 113 HIS 113 2543 2543 HIS HIS A . n 
A 1 114 GLU 114 2544 2544 GLU GLU A . n 
A 1 115 ALA 115 2545 2545 ALA ALA A . n 
A 1 116 SER 116 2546 2546 SER SER A . n 
A 1 117 ALA 117 2547 2547 ALA ALA A . n 
A 1 118 GLN 118 2548 2548 GLN GLN A . n 
A 1 119 ILE 119 2549 2549 ILE ILE A . n 
A 1 120 ASP 120 2550 2550 ASP ASP A . n 
A 1 121 GLU 121 2551 2551 GLU GLU A . n 
A 1 122 ILE 122 2552 2552 ILE ILE A . n 
A 1 123 VAL 123 2553 2553 VAL VAL A . n 
A 1 124 GLY 124 2554 2554 GLY GLY A . n 
A 1 125 GLU 125 2555 2555 GLU GLU A . n 
A 1 126 THR 126 2556 2556 THR THR A . n 
B 1 1   SER 1   2431 2431 SER SER B . n 
B 1 2   MET 2   2432 2432 MET MET B . n 
B 1 3   GLU 3   2433 2433 GLU GLU B . n 
B 1 4   VAL 4   2434 2434 VAL VAL B . n 
B 1 5   ALA 5   2435 2435 ALA ALA B . n 
B 1 6   ARG 6   2436 2436 ARG ARG B . n 
B 1 7   ALA 7   2437 2437 ALA ALA B . n 
B 1 8   ALA 8   2438 2438 ALA ALA B . n 
B 1 9   ARG 9   2439 2439 ARG ARG B . n 
B 1 10  LEU 10  2440 2440 LEU LEU B . n 
B 1 11  ALA 11  2441 2441 ALA ALA B . n 
B 1 12  GLN 12  2442 2442 GLN GLN B . n 
B 1 13  ILE 13  2443 2443 ILE ILE B . n 
B 1 14  PHE 14  2444 2444 PHE PHE B . n 
B 1 15  LYS 15  2445 2445 LYS LYS B . n 
B 1 16  GLU 16  2446 2446 GLU GLU B . n 
B 1 17  ILE 17  2447 2447 ILE ILE B . n 
B 1 18  CYS 18  2448 2448 CYS CYS B . n 
B 1 19  ASP 19  2449 2449 ASP ASP B . n 
B 1 20  GLY 20  2450 2450 GLY GLY B . n 
B 1 21  ILE 21  2451 2451 ILE ILE B . n 
B 1 22  ILE 22  2452 2452 ILE ILE B . n 
B 1 23  SER 23  2453 2453 SER SER B . n 
B 1 24  TYR 24  2454 2454 TYR TYR B . n 
B 1 25  LYS 25  2455 2455 LYS LYS B . n 
B 1 26  ASP 26  2456 2456 ASP ASP B . n 
B 1 27  SER 27  2457 2457 SER SER B . n 
B 1 28  SER 28  2458 2458 SER SER B . n 
B 1 29  ARG 29  2459 2459 ARG ARG B . n 
B 1 30  GLN 30  2460 2460 GLN GLN B . n 
B 1 31  ALA 31  2461 2461 ALA ALA B . n 
B 1 32  LEU 32  2462 2462 LEU LEU B . n 
B 1 33  ALA 33  2463 2463 ALA ALA B . n 
B 1 34  ALA 34  2464 2464 ALA ALA B . n 
B 1 35  PRO 35  2465 2465 PRO PRO B . n 
B 1 36  LEU 36  2466 2466 LEU LEU B . n 
B 1 37  LEU 37  2467 2467 LEU LEU B . n 
B 1 38  ASN 38  2468 2468 ASN ASN B . n 
B 1 39  LEU 39  2469 2469 LEU LEU B . n 
B 1 40  PRO 40  2470 2470 PRO PRO B . n 
B 1 41  PRO 41  2471 2471 PRO PRO B . n 
B 1 42  LYS 42  2472 2472 LYS LYS B . n 
B 1 43  LYS 43  2473 2473 LYS LYS B . n 
B 1 44  LYS 44  2474 2474 LYS LYS B . n 
B 1 45  ASN 45  2475 2475 ASN ASN B . n 
B 1 46  ALA 46  2476 2476 ALA ALA B . n 
B 1 47  ASP 47  2477 2477 ASP ASP B . n 
B 1 48  TYR 48  2478 2478 TYR TYR B . n 
B 1 49  TYR 49  2479 2479 TYR TYR B . n 
B 1 50  GLU 50  2480 2480 GLU GLU B . n 
B 1 51  LYS 51  2481 2481 LYS LYS B . n 
B 1 52  ILE 52  2482 2482 ILE ILE B . n 
B 1 53  SER 53  2483 2483 SER SER B . n 
B 1 54  ASP 54  2484 2484 ASP ASP B . n 
B 1 55  PRO 55  2485 2485 PRO PRO B . n 
B 1 56  LEU 56  2486 2486 LEU LEU B . n 
B 1 57  ASP 57  2487 2487 ASP ASP B . n 
B 1 58  LEU 58  2488 2488 LEU LEU B . n 
B 1 59  ILE 59  2489 2489 ILE ILE B . n 
B 1 60  THR 60  2490 2490 THR THR B . n 
B 1 61  ILE 61  2491 2491 ILE ILE B . n 
B 1 62  GLU 62  2492 2492 GLU GLU B . n 
B 1 63  LYS 63  2493 2493 LYS LYS B . n 
B 1 64  GLN 64  2494 2494 GLN GLN B . n 
B 1 65  ILE 65  2495 2495 ILE ILE B . n 
B 1 66  LEU 66  2496 2496 LEU LEU B . n 
B 1 67  THR 67  2497 2497 THR THR B . n 
B 1 68  GLY 68  2498 2498 GLY GLY B . n 
B 1 69  TYR 69  2499 2499 TYR TYR B . n 
B 1 70  TYR 70  2500 2500 TYR TYR B . n 
B 1 71  LYS 71  2501 2501 LYS LYS B . n 
B 1 72  THR 72  2502 2502 THR THR B . n 
B 1 73  VAL 73  2503 2503 VAL VAL B . n 
B 1 74  GLU 74  2504 2504 GLU GLU B . n 
B 1 75  ALA 75  2505 2505 ALA ALA B . n 
B 1 76  PHE 76  2506 2506 PHE PHE B . n 
B 1 77  ASP 77  2507 2507 ASP ASP B . n 
B 1 78  ALA 78  2508 2508 ALA ALA B . n 
B 1 79  ASP 79  2509 2509 ASP ASP B . n 
B 1 80  MET 80  2510 2510 MET MET B . n 
B 1 81  LEU 81  2511 2511 LEU LEU B . n 
B 1 82  LYS 82  2512 2512 LYS LYS B . n 
B 1 83  VAL 83  2513 2513 VAL VAL B . n 
B 1 84  PHE 84  2514 2514 PHE PHE B . n 
B 1 85  ARG 85  2515 2515 ARG ARG B . n 
B 1 86  ASN 86  2516 2516 ASN ASN B . n 
B 1 87  ALA 87  2517 2517 ALA ALA B . n 
B 1 88  GLU 88  2518 2518 GLU GLU B . n 
B 1 89  LYS 89  2519 2519 LYS LYS B . n 
B 1 90  TYR 90  2520 2520 TYR TYR B . n 
B 1 91  TYR 91  2521 2521 TYR TYR B . n 
B 1 92  GLY 92  2522 2522 GLY GLY B . n 
B 1 93  ARG 93  2523 2523 ARG ARG B . n 
B 1 94  LYS 94  2524 2524 LYS LYS B . n 
B 1 95  SER 95  2525 2525 SER SER B . n 
B 1 96  PRO 96  2526 2526 PRO PRO B . n 
B 1 97  VAL 97  2527 2527 VAL VAL B . n 
B 1 98  GLY 98  2528 2528 GLY GLY B . n 
B 1 99  ARG 99  2529 2529 ARG ARG B . n 
B 1 100 ASP 100 2530 2530 ASP ASP B . n 
B 1 101 VAL 101 2531 2531 VAL VAL B . n 
B 1 102 CYS 102 2532 2532 CYS CYS B . n 
B 1 103 ARG 103 2533 2533 ARG ARG B . n 
B 1 104 LEU 104 2534 2534 LEU LEU B . n 
B 1 105 ARG 105 2535 2535 ARG ARG B . n 
B 1 106 LYS 106 2536 2536 LYS LYS B . n 
B 1 107 ALA 107 2537 2537 ALA ALA B . n 
B 1 108 TYR 108 2538 2538 TYR TYR B . n 
B 1 109 TYR 109 2539 2539 TYR TYR B . n 
B 1 110 ASN 110 2540 2540 ASN ASN B . n 
B 1 111 ALA 111 2541 2541 ALA ALA B . n 
B 1 112 ARG 112 2542 2542 ARG ARG B . n 
B 1 113 HIS 113 2543 2543 HIS HIS B . n 
B 1 114 GLU 114 2544 2544 GLU GLU B . n 
B 1 115 ALA 115 2545 2545 ALA ALA B . n 
B 1 116 SER 116 2546 2546 SER SER B . n 
B 1 117 ALA 117 2547 2547 ALA ALA B . n 
B 1 118 GLN 118 2548 2548 GLN GLN B . n 
B 1 119 ILE 119 2549 2549 ILE ILE B . n 
B 1 120 ASP 120 2550 2550 ASP ASP B . n 
B 1 121 GLU 121 2551 2551 GLU GLU B . n 
B 1 122 ILE 122 2552 2552 ILE ILE B . n 
B 1 123 VAL 123 2553 2553 VAL VAL B . n 
B 1 124 GLY 124 2554 2554 GLY GLY B . n 
B 1 125 GLU 125 2555 2555 GLU GLU B . n 
B 1 126 THR 126 2556 2556 THR THR B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    monomeric 1 
2 author_defined_assembly   ?    monomeric 1 
3 software_defined_assembly PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C 
2 1 B,D 
3 1 A,C 
3 2 B,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
3 'ABSA (A^2)' 920   ? 
3 MORE         -11   ? 
3 'SSA (A^2)'  13490 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000 0.0000000000  0.0000000000 0.0000000000   0.0000000000 
1.0000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000   
2 'crystal symmetry operation' 6_564 x-y,x+1,z-1/6 0.5000000000 -0.8660254038 0.0000000000 -34.7950000000 0.8660254038 
0.5000000000 0.0000000000 60.2667078494 0.0000000000 0.0000000000 1.0000000000 -25.2233333333 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-05-19 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2012-04-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined -39.4534 16.7122 -2.0186 0.1040 0.0519 0.0475 0.0086 0.0227  0.0215  0.2906 0.5261  0.8904 -0.3548 
-0.0623 0.1416  -0.0880 0.0221  0.0659  -0.0470 -0.0039 -0.0202 0.0386  0.1221  -0.1259 
'X-RAY DIFFRACTION' 2 ? refined -28.2650 1.9246  -1.1574 0.3078 0.0474 0.1582 0.0494 0.1241  0.0135  5.8386 15.5883 2.1958 5.5133  
2.1700  -1.7486 0.1203  -0.1111 -0.0091 -0.0435 -0.3842 -0.7562 -1.4242 0.6141  0.0077  
'X-RAY DIFFRACTION' 3 ? refined -33.8079 22.1124 7.2425  0.1183 0.0651 0.0645 0.0246 0.0033  0.0228  0.1158 1.4794  0.6515 0.1540  
0.2583  0.0649  -0.0333 -0.0253 0.0586  0.0038  0.0262  0.0740  0.1245  -0.0643 0.0299  
'X-RAY DIFFRACTION' 4 ? refined -31.7515 12.3305 25.1483 0.2035 0.1333 0.1022 0.0168 0.0462  -0.0485 0.7768 1.8068  1.1952 0.9899  
0.9324  1.3687  0.0198  0.0187  -0.0384 -0.1383 0.0149  -0.1897 -0.0219 0.0617  -0.0826 
'X-RAY DIFFRACTION' 5 ? refined -47.3087 26.8939 34.2523 0.1381 0.1337 0.2056 0.0618 0.0658  -0.0623 0.3788 0.8383  0.5126 -0.1058 
-0.2770 -0.4170 0.2090  0.0010  -0.2100 0.0281  0.2019  0.0904  -0.0510 -0.1673 -0.0536 
'X-RAY DIFFRACTION' 6 ? refined -39.1680 19.8735 22.7711 0.1044 0.0620 0.0613 0.0193 -0.0212 -0.0019 0.3798 0.7957  1.1750 -0.4056 
-0.2901 0.0478  -0.0520 -0.0903 0.1422  0.0576  -0.0156 -0.0149 -0.0904 -0.0242 -0.1517 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 2431 A 2518 ? . . . . ? 
'X-RAY DIFFRACTION' 2 2 A 2519 A 2526 ? . . . . ? 
'X-RAY DIFFRACTION' 3 3 A 2527 A 2556 ? . . . . ? 
'X-RAY DIFFRACTION' 4 4 B 2431 B 2456 ? . . . . ? 
'X-RAY DIFFRACTION' 5 5 B 2457 B 2482 ? . . . . ? 
'X-RAY DIFFRACTION' 6 6 B 2483 B 2556 ? . . . . ? 
# 
_pdbx_phasing_MR.entry_id                     3MQM 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     36.660 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.540 
_pdbx_phasing_MR.d_res_low_rotation           38.680 
_pdbx_phasing_MR.d_res_high_translation       2.540 
_pdbx_phasing_MR.d_res_low_translation        38.680 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 SCALA       3.3.16 2010/01/06                 other   'Phil R. Evans'      pre@mrc-lmb.cam.ac.uk       'data scaling'    
http://www.ccp4.ac.uk/dist/html/scala.html   Fortran_77 ? 
2 PHASER      2.1.4  'Wed Jun 24 14:00:05 2009' program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/  ?          ? 
3 REFMAC      .      ?                          program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
4 PDB_EXTRACT 3.100  'Jan. 22, 2010'            package PDB                  help@deposit.rcsb.org       'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
5 GDA         .      ?                          ?       ?                    ?                           'data collection' ? ? ? 
6 MOSFLM      .      ?                          ?       ?                    ?                           'data reduction'  ? ? ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 2458 ? ? -64.82  4.83  
2 1 SER B 2458 ? ? -70.51  32.43 
3 1 ARG B 2459 ? ? 37.14   64.48 
4 1 ASN B 2475 ? ? -140.06 55.80 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LYS 2472 ? CG  ? A LYS 42  CG  
2   1 Y 1 A LYS 2472 ? CD  ? A LYS 42  CD  
3   1 Y 1 A LYS 2472 ? CE  ? A LYS 42  CE  
4   1 Y 1 A LYS 2472 ? NZ  ? A LYS 42  NZ  
5   1 Y 1 A LYS 2473 ? CE  ? A LYS 43  CE  
6   1 Y 1 A LYS 2473 ? NZ  ? A LYS 43  NZ  
7   1 Y 1 A LYS 2474 ? CD  ? A LYS 44  CD  
8   1 Y 1 A LYS 2474 ? CE  ? A LYS 44  CE  
9   1 Y 1 A LYS 2474 ? NZ  ? A LYS 44  NZ  
10  1 Y 1 A GLU 2480 ? CG  ? A GLU 50  CG  
11  1 Y 1 A GLU 2480 ? CD  ? A GLU 50  CD  
12  1 Y 1 A GLU 2480 ? OE1 ? A GLU 50  OE1 
13  1 Y 1 A GLU 2480 ? OE2 ? A GLU 50  OE2 
14  1 Y 1 A LYS 2481 ? CG  ? A LYS 51  CG  
15  1 Y 1 A LYS 2481 ? CD  ? A LYS 51  CD  
16  1 Y 1 A LYS 2481 ? CE  ? A LYS 51  CE  
17  1 Y 1 A LYS 2481 ? NZ  ? A LYS 51  NZ  
18  1 Y 1 A ARG 2515 ? CG  ? A ARG 85  CG  
19  1 Y 1 A ARG 2515 ? CD  ? A ARG 85  CD  
20  1 Y 1 A ARG 2515 ? NE  ? A ARG 85  NE  
21  1 Y 1 A ARG 2515 ? CZ  ? A ARG 85  CZ  
22  1 Y 1 A ARG 2515 ? NH1 ? A ARG 85  NH1 
23  1 Y 1 A ARG 2515 ? NH2 ? A ARG 85  NH2 
24  1 Y 1 A LYS 2519 ? CG  ? A LYS 89  CG  
25  1 Y 1 A LYS 2519 ? CD  ? A LYS 89  CD  
26  1 Y 1 A LYS 2519 ? CE  ? A LYS 89  CE  
27  1 Y 1 A LYS 2519 ? NZ  ? A LYS 89  NZ  
28  1 Y 1 A ARG 2523 ? NE  ? A ARG 93  NE  
29  1 Y 1 A ARG 2523 ? CZ  ? A ARG 93  CZ  
30  1 Y 1 A ARG 2523 ? NH1 ? A ARG 93  NH1 
31  1 Y 1 A ARG 2523 ? NH2 ? A ARG 93  NH2 
32  1 Y 1 A ARG 2529 ? CG  ? A ARG 99  CG  
33  1 Y 1 A ARG 2529 ? CD  ? A ARG 99  CD  
34  1 Y 1 A ARG 2529 ? NE  ? A ARG 99  NE  
35  1 Y 1 A ARG 2529 ? CZ  ? A ARG 99  CZ  
36  1 Y 1 A ARG 2529 ? NH1 ? A ARG 99  NH1 
37  1 Y 1 A ARG 2529 ? NH2 ? A ARG 99  NH2 
38  1 Y 1 A ARG 2533 ? NE  ? A ARG 103 NE  
39  1 Y 1 A ARG 2533 ? CZ  ? A ARG 103 CZ  
40  1 Y 1 A ARG 2533 ? NH1 ? A ARG 103 NH1 
41  1 Y 1 A ARG 2533 ? NH2 ? A ARG 103 NH2 
42  1 Y 1 A LYS 2536 ? CE  ? A LYS 106 CE  
43  1 Y 1 A LYS 2536 ? NZ  ? A LYS 106 NZ  
44  1 Y 1 A GLU 2551 ? CD  ? A GLU 121 CD  
45  1 Y 1 A GLU 2551 ? OE1 ? A GLU 121 OE1 
46  1 Y 1 A GLU 2551 ? OE2 ? A GLU 121 OE2 
47  1 Y 1 A THR 2556 ? OG1 ? A THR 126 OG1 
48  1 Y 1 A THR 2556 ? CG2 ? A THR 126 CG2 
49  1 Y 1 B ARG 2439 ? CG  ? B ARG 9   CG  
50  1 Y 1 B ARG 2439 ? CD  ? B ARG 9   CD  
51  1 Y 1 B ARG 2439 ? NE  ? B ARG 9   NE  
52  1 Y 1 B ARG 2439 ? CZ  ? B ARG 9   CZ  
53  1 Y 1 B ARG 2439 ? NH1 ? B ARG 9   NH1 
54  1 Y 1 B ARG 2439 ? NH2 ? B ARG 9   NH2 
55  1 Y 1 B LYS 2455 ? NZ  ? B LYS 25  NZ  
56  1 Y 1 B ARG 2459 ? CG  ? B ARG 29  CG  
57  1 Y 1 B ARG 2459 ? CD  ? B ARG 29  CD  
58  1 Y 1 B ARG 2459 ? NE  ? B ARG 29  NE  
59  1 Y 1 B ARG 2459 ? CZ  ? B ARG 29  CZ  
60  1 Y 1 B ARG 2459 ? NH1 ? B ARG 29  NH1 
61  1 Y 1 B ARG 2459 ? NH2 ? B ARG 29  NH2 
62  1 Y 1 B LYS 2472 ? CG  ? B LYS 42  CG  
63  1 Y 1 B LYS 2472 ? CD  ? B LYS 42  CD  
64  1 Y 1 B LYS 2472 ? CE  ? B LYS 42  CE  
65  1 Y 1 B LYS 2472 ? NZ  ? B LYS 42  NZ  
66  1 Y 1 B LYS 2473 ? CD  ? B LYS 43  CD  
67  1 Y 1 B LYS 2473 ? CE  ? B LYS 43  CE  
68  1 Y 1 B LYS 2473 ? NZ  ? B LYS 43  NZ  
69  1 Y 1 B LYS 2481 ? CD  ? B LYS 51  CD  
70  1 Y 1 B LYS 2481 ? CE  ? B LYS 51  CE  
71  1 Y 1 B LYS 2481 ? NZ  ? B LYS 51  NZ  
72  1 Y 1 B LYS 2493 ? NZ  ? B LYS 63  NZ  
73  1 Y 1 B LYS 2501 ? CG  ? B LYS 71  CG  
74  1 Y 1 B LYS 2501 ? CD  ? B LYS 71  CD  
75  1 Y 1 B LYS 2501 ? CE  ? B LYS 71  CE  
76  1 Y 1 B LYS 2501 ? NZ  ? B LYS 71  NZ  
77  1 Y 1 B LYS 2519 ? CD  ? B LYS 89  CD  
78  1 Y 1 B LYS 2519 ? CE  ? B LYS 89  CE  
79  1 Y 1 B LYS 2519 ? NZ  ? B LYS 89  NZ  
80  1 Y 1 B ARG 2523 ? CG  ? B ARG 93  CG  
81  1 Y 1 B ARG 2523 ? CD  ? B ARG 93  CD  
82  1 Y 1 B ARG 2523 ? NE  ? B ARG 93  NE  
83  1 Y 1 B ARG 2523 ? CZ  ? B ARG 93  CZ  
84  1 Y 1 B ARG 2523 ? NH1 ? B ARG 93  NH1 
85  1 Y 1 B ARG 2523 ? NH2 ? B ARG 93  NH2 
86  1 Y 1 B LYS 2524 ? CG  ? B LYS 94  CG  
87  1 Y 1 B LYS 2524 ? CD  ? B LYS 94  CD  
88  1 Y 1 B LYS 2524 ? CE  ? B LYS 94  CE  
89  1 Y 1 B LYS 2524 ? NZ  ? B LYS 94  NZ  
90  1 Y 1 B ARG 2529 ? NE  ? B ARG 99  NE  
91  1 Y 1 B ARG 2529 ? CZ  ? B ARG 99  CZ  
92  1 Y 1 B ARG 2529 ? NH1 ? B ARG 99  NH1 
93  1 Y 1 B ARG 2529 ? NH2 ? B ARG 99  NH2 
94  1 Y 1 B LYS 2536 ? CE  ? B LYS 106 CE  
95  1 Y 1 B LYS 2536 ? NZ  ? B LYS 106 NZ  
96  1 Y 1 B GLU 2551 ? CD  ? B GLU 121 CD  
97  1 Y 1 B GLU 2551 ? OE1 ? B GLU 121 OE1 
98  1 Y 1 B GLU 2551 ? OE2 ? B GLU 121 OE2 
99  1 Y 1 B THR 2556 ? OG1 ? B THR 126 OG1 
100 1 Y 1 B THR 2556 ? CG2 ? B THR 126 CG2 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_reflns_twin.domain_id 
_pdbx_reflns_twin.crystal_id 
_pdbx_reflns_twin.diffrn_id 
_pdbx_reflns_twin.fraction 
_pdbx_reflns_twin.operator 
_pdbx_reflns_twin.type 
_pdbx_reflns_twin.mean_F_square_over_mean_F2 
_pdbx_reflns_twin.mean_I2_over_mean_I_square 
1 1 1 0.503 'H,  K,  L'    ? ? ? 
2 1 1 0.497 '-H-K,  K, -L' ? ? ? 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1 1  1  HOH HOH A . 
C 2 HOH 2 5  5  HOH HOH A . 
C 2 HOH 3 6  6  HOH HOH A . 
C 2 HOH 4 7  7  HOH HOH A . 
C 2 HOH 5 8  8  HOH HOH A . 
C 2 HOH 6 10 10 HOH HOH A . 
C 2 HOH 7 12 12 HOH HOH A . 
C 2 HOH 8 14 14 HOH HOH A . 
D 2 HOH 1 2  2  HOH HOH B . 
D 2 HOH 2 3  3  HOH HOH B . 
D 2 HOH 3 4  4  HOH HOH B . 
D 2 HOH 4 9  9  HOH HOH B . 
D 2 HOH 5 11 11 HOH HOH B . 
D 2 HOH 6 13 13 HOH HOH B . 
D 2 HOH 7 15 15 HOH HOH B . 
#