data_3MTC
# 
_entry.id   3MTC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3MTC         
RCSB  RCSB058970   
WWPDB D_1000058970 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3N9V . unspecified 
PDB 3NR8 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3MTC 
_pdbx_database_status.recvd_initial_deposition_date   2010-04-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tresaugues, L.'                       1  
'Welin, M.'                            2  
'Arrowsmith, C.H.'                     3  
'Berglund, H.'                         4  
'Bountra, C.'                          5  
'Collins, R.'                          6  
'Edwards, A.M.'                        7  
'Flodin, S.'                           8  
'Flores, A.'                           9  
'Graslund, S.'                         10 
'Hammarstrom, M.'                      11 
'Johansson, I.'                        12 
'Karlberg, T.'                         13 
'Kol, S.'                              14 
'Kotenyova, T.'                        15 
'Moche, M.'                            16 
'Nyman, T.'                            17 
'Persson, C.'                          18 
'Schuler, H.'                          19 
'Schutz, P.'                           20 
'Siponen, M.I.'                        21 
'Thorsell, A.G.'                       22 
'van der Berg, S.'                     23 
'Wahlberg, E.'                         24 
'Weigelt, J.'                          25 
'Wisniewska, M.'                       26 
'Nordlund, P.'                         27 
'Structural Genomics Consortium (SGC)' 28 
# 
_citation.id                        primary 
_citation.title                     
;Structural basis for phosphoinositide substrate recognition, catalysis, and membrane interactions in human inositol polyphosphate 5-phosphatases
;
_citation.journal_abbrev            Structure 
_citation.journal_volume            22 
_citation.page_first                744 
_citation.page_last                 755 
_citation.year                      2014 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24704254 
_citation.pdbx_database_id_DOI      10.1016/j.str.2014.01.013 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tresaugues, L.'  1 
primary 'Silvander, C.'   2 
primary 'Flodin, S.'      3 
primary 'Welin, M.'       4 
primary 'Nyman, T.'       5 
primary 'Graslund, S.'    6 
primary 'Hammarstrom, M.' 7 
primary 'Berglund, H.'    8 
primary 'Nordlund, P.'    9 
# 
_cell.entry_id           3MTC 
_cell.length_a           133.761 
_cell.length_b           133.761 
_cell.length_c           133.761 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3MTC 
_symmetry.space_group_name_H-M             'P 21 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                198 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Type II inositol-1,4,5-trisphosphate 5-phosphatase' 36201.086 1   3.1.3.36 ? 'UNP residues 339-643' ? 
2 non-polymer syn GLYCEROL 92.094    2   ?        ? ?                      ? 
3 non-polymer syn 'MAGNESIUM ION' 24.305    1   ?        ? ?                      ? 
4 non-polymer syn 
;(2R)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5S,6R)-2,3,5,6-tetrahydroxy-4-(phosphonooxy)cyclohexyl]oxy}phosphoryl]oxy}propane-1,2-diyl dioctanoate
;
666.587   1   ?        ? ?                      ? 
5 non-polymer syn 'SULFATE ION' 96.063    1   ?        ? ?                      ? 
6 non-polymer syn 'CHLORIDE ION' 35.453    1   ?        ? ?                      ? 
7 water       nat water 18.015    225 ?        ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Phosphoinositide 5-phosphatase, 5PTase, 75 kDa inositol polyphosphate-5-phosphatase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MYTYIQNFRFFAGTYNVNGQSPKECLRLWLSNGIQAPDVYCVGFQELDLSKEAFFFHDTPKEEEWFKAVSEGLHPDAKYA
KVKLIRLVGIMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSHLAAHIEEYERRNQDYKD
ICSRMQFCQPDPSLPPLTISNHDVILWLGDLNYRIEELDVEKVKKLIEEKDFQMLYAYDQLKIQVAAKTVFEGFTEGELT
FQPTYKYDTGSDDWDTSEKCRAPAWCDRILWKGKNITQLSYQSHMALKTSDHKPVSSVFDIGVRVVAHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MYTYIQNFRFFAGTYNVNGQSPKECLRLWLSNGIQAPDVYCVGFQELDLSKEAFFFHDTPKEEEWFKAVSEGLHPDAKYA
KVKLIRLVGIMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSHLAAHIEEYERRNQDYKD
ICSRMQFCQPDPSLPPLTISNHDVILWLGDLNYRIEELDVEKVKKLIEEKDFQMLYAYDQLKIQVAAKTVFEGFTEGELT
FQPTYKYDTGSDDWDTSEKCRAPAWCDRILWKGKNITQLSYQSHMALKTSDHKPVSSVFDIGVRVVAHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   TYR n 
1 3   THR n 
1 4   TYR n 
1 5   ILE n 
1 6   GLN n 
1 7   ASN n 
1 8   PHE n 
1 9   ARG n 
1 10  PHE n 
1 11  PHE n 
1 12  ALA n 
1 13  GLY n 
1 14  THR n 
1 15  TYR n 
1 16  ASN n 
1 17  VAL n 
1 18  ASN n 
1 19  GLY n 
1 20  GLN n 
1 21  SER n 
1 22  PRO n 
1 23  LYS n 
1 24  GLU n 
1 25  CYS n 
1 26  LEU n 
1 27  ARG n 
1 28  LEU n 
1 29  TRP n 
1 30  LEU n 
1 31  SER n 
1 32  ASN n 
1 33  GLY n 
1 34  ILE n 
1 35  GLN n 
1 36  ALA n 
1 37  PRO n 
1 38  ASP n 
1 39  VAL n 
1 40  TYR n 
1 41  CYS n 
1 42  VAL n 
1 43  GLY n 
1 44  PHE n 
1 45  GLN n 
1 46  GLU n 
1 47  LEU n 
1 48  ASP n 
1 49  LEU n 
1 50  SER n 
1 51  LYS n 
1 52  GLU n 
1 53  ALA n 
1 54  PHE n 
1 55  PHE n 
1 56  PHE n 
1 57  HIS n 
1 58  ASP n 
1 59  THR n 
1 60  PRO n 
1 61  LYS n 
1 62  GLU n 
1 63  GLU n 
1 64  GLU n 
1 65  TRP n 
1 66  PHE n 
1 67  LYS n 
1 68  ALA n 
1 69  VAL n 
1 70  SER n 
1 71  GLU n 
1 72  GLY n 
1 73  LEU n 
1 74  HIS n 
1 75  PRO n 
1 76  ASP n 
1 77  ALA n 
1 78  LYS n 
1 79  TYR n 
1 80  ALA n 
1 81  LYS n 
1 82  VAL n 
1 83  LYS n 
1 84  LEU n 
1 85  ILE n 
1 86  ARG n 
1 87  LEU n 
1 88  VAL n 
1 89  GLY n 
1 90  ILE n 
1 91  MET n 
1 92  LEU n 
1 93  LEU n 
1 94  LEU n 
1 95  TYR n 
1 96  VAL n 
1 97  LYS n 
1 98  GLN n 
1 99  GLU n 
1 100 HIS n 
1 101 ALA n 
1 102 ALA n 
1 103 TYR n 
1 104 ILE n 
1 105 SER n 
1 106 GLU n 
1 107 VAL n 
1 108 GLU n 
1 109 ALA n 
1 110 GLU n 
1 111 THR n 
1 112 VAL n 
1 113 GLY n 
1 114 THR n 
1 115 GLY n 
1 116 ILE n 
1 117 MET n 
1 118 GLY n 
1 119 ARG n 
1 120 MET n 
1 121 GLY n 
1 122 ASN n 
1 123 LYS n 
1 124 GLY n 
1 125 GLY n 
1 126 VAL n 
1 127 ALA n 
1 128 ILE n 
1 129 ARG n 
1 130 PHE n 
1 131 GLN n 
1 132 PHE n 
1 133 HIS n 
1 134 ASN n 
1 135 THR n 
1 136 SER n 
1 137 ILE n 
1 138 CYS n 
1 139 VAL n 
1 140 VAL n 
1 141 ASN n 
1 142 SER n 
1 143 HIS n 
1 144 LEU n 
1 145 ALA n 
1 146 ALA n 
1 147 HIS n 
1 148 ILE n 
1 149 GLU n 
1 150 GLU n 
1 151 TYR n 
1 152 GLU n 
1 153 ARG n 
1 154 ARG n 
1 155 ASN n 
1 156 GLN n 
1 157 ASP n 
1 158 TYR n 
1 159 LYS n 
1 160 ASP n 
1 161 ILE n 
1 162 CYS n 
1 163 SER n 
1 164 ARG n 
1 165 MET n 
1 166 GLN n 
1 167 PHE n 
1 168 CYS n 
1 169 GLN n 
1 170 PRO n 
1 171 ASP n 
1 172 PRO n 
1 173 SER n 
1 174 LEU n 
1 175 PRO n 
1 176 PRO n 
1 177 LEU n 
1 178 THR n 
1 179 ILE n 
1 180 SER n 
1 181 ASN n 
1 182 HIS n 
1 183 ASP n 
1 184 VAL n 
1 185 ILE n 
1 186 LEU n 
1 187 TRP n 
1 188 LEU n 
1 189 GLY n 
1 190 ASP n 
1 191 LEU n 
1 192 ASN n 
1 193 TYR n 
1 194 ARG n 
1 195 ILE n 
1 196 GLU n 
1 197 GLU n 
1 198 LEU n 
1 199 ASP n 
1 200 VAL n 
1 201 GLU n 
1 202 LYS n 
1 203 VAL n 
1 204 LYS n 
1 205 LYS n 
1 206 LEU n 
1 207 ILE n 
1 208 GLU n 
1 209 GLU n 
1 210 LYS n 
1 211 ASP n 
1 212 PHE n 
1 213 GLN n 
1 214 MET n 
1 215 LEU n 
1 216 TYR n 
1 217 ALA n 
1 218 TYR n 
1 219 ASP n 
1 220 GLN n 
1 221 LEU n 
1 222 LYS n 
1 223 ILE n 
1 224 GLN n 
1 225 VAL n 
1 226 ALA n 
1 227 ALA n 
1 228 LYS n 
1 229 THR n 
1 230 VAL n 
1 231 PHE n 
1 232 GLU n 
1 233 GLY n 
1 234 PHE n 
1 235 THR n 
1 236 GLU n 
1 237 GLY n 
1 238 GLU n 
1 239 LEU n 
1 240 THR n 
1 241 PHE n 
1 242 GLN n 
1 243 PRO n 
1 244 THR n 
1 245 TYR n 
1 246 LYS n 
1 247 TYR n 
1 248 ASP n 
1 249 THR n 
1 250 GLY n 
1 251 SER n 
1 252 ASP n 
1 253 ASP n 
1 254 TRP n 
1 255 ASP n 
1 256 THR n 
1 257 SER n 
1 258 GLU n 
1 259 LYS n 
1 260 CYS n 
1 261 ARG n 
1 262 ALA n 
1 263 PRO n 
1 264 ALA n 
1 265 TRP n 
1 266 CYS n 
1 267 ASP n 
1 268 ARG n 
1 269 ILE n 
1 270 LEU n 
1 271 TRP n 
1 272 LYS n 
1 273 GLY n 
1 274 LYS n 
1 275 ASN n 
1 276 ILE n 
1 277 THR n 
1 278 GLN n 
1 279 LEU n 
1 280 SER n 
1 281 TYR n 
1 282 GLN n 
1 283 SER n 
1 284 HIS n 
1 285 MET n 
1 286 ALA n 
1 287 LEU n 
1 288 LYS n 
1 289 THR n 
1 290 SER n 
1 291 ASP n 
1 292 HIS n 
1 293 LYS n 
1 294 PRO n 
1 295 VAL n 
1 296 SER n 
1 297 SER n 
1 298 VAL n 
1 299 PHE n 
1 300 ASP n 
1 301 ILE n 
1 302 GLY n 
1 303 VAL n 
1 304 ARG n 
1 305 VAL n 
1 306 VAL n 
1 307 ALA n 
1 308 HIS n 
1 309 HIS n 
1 310 HIS n 
1 311 HIS n 
1 312 HIS n 
1 313 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 INPP5B 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3) R3 pRARE' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC-CH2 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    I5P2_HUMAN 
_struct_ref.pdbx_db_accession          P32019 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;YTYIQNFRFFAGTYNVNGQSPKECLRLWLSNGIQAPDVYCVGFQELDLSKEAFFFHDTPKEEEWFKAVSEGLHPDAKYAK
VKLIRLVGIMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSHLAAHIEEYERRNQDYKDI
CSRMQFCQPDPSLPPLTISNHDVILWLGDLNYRIEELDVEKVKKLIEEKDFQMLYAYDQLKIQVAAKTVFEGFTEGELTF
QPTYKYDTGSDDWDTSEKCRAPAWCDRILWKGKNITQLSYQSHMALKTSDHKPVSSVFDIGVRVV
;
_struct_ref.pdbx_align_begin           339 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3MTC 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 306 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P32019 
_struct_ref_seq.db_align_beg                  339 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  643 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       259 
_struct_ref_seq.pdbx_auth_seq_align_end       563 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3MTC MET A 1   ? UNP P32019 ? ? 'EXPRESSION TAG' 258 1 
1 3MTC ALA A 307 ? UNP P32019 ? ? 'EXPRESSION TAG' 564 2 
1 3MTC HIS A 308 ? UNP P32019 ? ? 'EXPRESSION TAG' 565 3 
1 3MTC HIS A 309 ? UNP P32019 ? ? 'EXPRESSION TAG' 566 4 
1 3MTC HIS A 310 ? UNP P32019 ? ? 'EXPRESSION TAG' 567 5 
1 3MTC HIS A 311 ? UNP P32019 ? ? 'EXPRESSION TAG' 568 6 
1 3MTC HIS A 312 ? UNP P32019 ? ? 'EXPRESSION TAG' 569 7 
1 3MTC HIS A 313 ? UNP P32019 ? ? 'EXPRESSION TAG' 570 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                                                                               'C3 H7 N O2'     
89.093  
ARG 'L-peptide linking' y ARGININE ?                                                                               
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                                                                               'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                                                                               
'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION' ?                                                                               'Cl -1' 
35.453  
CYS 'L-peptide linking' y CYSTEINE ?                                                                               'C3 H7 N O2 S' 
121.158 
GLN 'L-peptide linking' y GLUTAMINE ?                                                                               'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                                                                               
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE ?                                                                               'C2 H5 N O2'     
75.067  
GOL non-polymer         . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL'                                                 'C3 H8 O3' 
92.094  
HIS 'L-peptide linking' y HISTIDINE ?                                                                               
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER ?                                                                               'H2 O'           
18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                                                                               'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE ?                                                                               'C6 H13 N O2'    
131.173 
LYS 'L-peptide linking' y LYSINE ?                                                                               'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking' y METHIONINE ?                                                                               
'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ?                                                                               'Mg 2' 
24.305  
PHE 'L-peptide linking' y PHENYLALANINE ?                                                                               
'C9 H11 N O2'    165.189 
PIF non-polymer         . 
;(2R)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5S,6R)-2,3,5,6-tetrahydroxy-4-(phosphonooxy)cyclohexyl]oxy}phosphoryl]oxy}propane-1,2-diyl dioctanoate
;
'L-ALPHA-D-MYOPHOSPHATIDYLINOSITOL 4-PHOSPHATE, D(+)SN1,2DI-O-OCTANOYLGLYCERYL' 'C25 H48 O16 P2' 666.587 
PRO 'L-peptide linking' y PROLINE ?                                                                               'C5 H9 N O2'     
115.130 
SER 'L-peptide linking' y SERINE ?                                                                               'C3 H7 N O3'     
105.093 
SO4 non-polymer         . 'SULFATE ION' ?                                                                               'O4 S -2' 
96.063  
THR 'L-peptide linking' y THREONINE ?                                                                               'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                                                                               
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE ?                                                                               'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE ?                                                                               'C5 H11 N O2'    
117.146 
# 
_exptl.entry_id          3MTC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      5.51 
_exptl_crystal.density_percent_sol   77.67 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'22% polyacrylic acid, 0.02M magnesium chloride, 0.1M hepes pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2009-12-17 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(311) monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97908 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97908 
# 
_reflns.entry_id                     3MTC 
_reflns.observed_criterion_sigma_I   . 
_reflns.observed_criterion_sigma_F   . 
_reflns.d_resolution_low             94.510 
_reflns.d_resolution_high            2.4 
_reflns.number_obs                   31380 
_reflns.number_all                   31433 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.091 
_reflns.pdbx_Rsym_value              0.091 
_reflns.pdbx_netI_over_sigmaI        11.1 
_reflns.B_iso_Wilson_estimate        54.0 
_reflns.pdbx_redundancy              4.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.53 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           0.698 
_reflns_shell.pdbx_Rsym_value        0.698 
_reflns_shell.meanI_over_sigI_obs    2.0 
_reflns_shell.pdbx_redundancy        4.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4498 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3MTC 
_refine.ls_number_reflns_obs                     29805 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.29 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    99.88 
_refine.ls_R_factor_obs                          0.17234 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.17062 
_refine.ls_R_factor_R_free                       0.20544 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1580 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.958 
_refine.correlation_coeff_Fo_to_Fc_free          0.939 
_refine.B_iso_mean                               43.796 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1I9Y' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.155 
_refine.overall_SU_ML                            0.096 
_refine.overall_SU_B                             4.057 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2510 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         62 
_refine_hist.number_atoms_solvent             225 
_refine_hist.number_atoms_total               2797 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        47.29 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       0.010  0.022  ? 2664 'X-RAY DIFFRACTION' ? 
r_bond_other_d         0.001  0.020  ? 1815 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    1.278  1.958  ? 3609 'X-RAY DIFFRACTION' ? 
r_angle_other_deg      0.806  3.000  ? 4423 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 6.384  5.000  ? 317  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 34.448 24.275 ? 131  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 13.877 15.000 ? 450  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 17.662 15.000 ? 13   'X-RAY DIFFRACTION' ? 
r_chiral_restr         0.078  0.200  ? 383  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   0.005  0.020  ? 2922 'X-RAY DIFFRACTION' ? 
r_gen_planes_other     0.001  0.020  ? 549  'X-RAY DIFFRACTION' ? 
r_mcbond_it            0.652  1.500  ? 1557 'X-RAY DIFFRACTION' ? 
r_mcbond_other         0.097  1.500  ? 631  'X-RAY DIFFRACTION' ? 
r_mcangle_it           1.281  2.000  ? 2520 'X-RAY DIFFRACTION' ? 
r_scbond_it            1.736  3.000  ? 1107 'X-RAY DIFFRACTION' ? 
r_scangle_it           2.881  4.500  ? 1086 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.400 
_refine_ls_shell.d_res_low                        2.463 
_refine_ls_shell.number_reflns_R_work             2142 
_refine_ls_shell.R_factor_R_work                  0.270 
_refine_ls_shell.percent_reflns_obs               98.65 
_refine_ls_shell.R_factor_R_free                  0.369 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             119 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3MTC 
_struct.title                     'Crystal Structure of INPP5B in complex with phosphatidylinositol 4-phosphate' 
_struct.pdbx_descriptor           'Type II inositol-1,4,5-trisphosphate 5-phosphatase (E.C.3.1.3.36)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            Y 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3MTC 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
_struct_keywords.text            
;INPP5BA, Phosphoinositide 5-phosphatase, inositol signalling, phosphatase, magnesium, structural genomics, SGC, SGC Stockholm, Structural Genomics Consortium, HYDROLASE-HYDROLASE INHIBITOR complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 2 ? 
G N N 6 ? 
H N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 26  ? SER A 31  ? LEU A 283 SER A 288 1 ? 6  
HELX_P HELX_P2  2  SER A 50  ? PHE A 55  ? SER A 307 PHE A 312 1 ? 6  
HELX_P HELX_P3  3  PRO A 60  ? LEU A 73  ? PRO A 317 LEU A 330 1 ? 14 
HELX_P HELX_P4  4  GLU A 99  ? ALA A 102 ? GLU A 356 ALA A 359 5 ? 4  
HELX_P HELX_P5  5  GLY A 115 ? ARG A 119 ? GLY A 372 ARG A 376 5 ? 5  
HELX_P HELX_P6  6  HIS A 147 ? GLU A 149 ? HIS A 404 GLU A 406 5 ? 3  
HELX_P HELX_P7  7  GLU A 150 ? MET A 165 ? GLU A 407 MET A 422 1 ? 16 
HELX_P HELX_P8  8  ASP A 199 ? GLU A 209 ? ASP A 456 GLU A 466 1 ? 11 
HELX_P HELX_P9  9  ASP A 211 ? ALA A 217 ? ASP A 468 ALA A 474 1 ? 7  
HELX_P HELX_P10 10 ASP A 219 ? ALA A 227 ? ASP A 476 ALA A 484 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? C MG  .  MG  ? ? ? 1_555 H HOH . O  ? ? A MG  571 A HOH 79  1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc2 metalc ? ? C MG  .  MG  ? ? ? 1_555 H HOH . O  ? ? A MG  571 A HOH 78  1_555 ? ? ? ? ? ? ? 2.285 ? 
metalc3 metalc ? ? C MG  .  MG  ? ? ? 1_555 H HOH . O  ? ? A MG  571 A HOH 77  1_555 ? ? ? ? ? ? ? 2.420 ? 
metalc4 metalc ? ? A GLU 46 OE1 ? ? ? 1_555 C MG  . MG ? ? A GLU 303 A MG  571 1_555 ? ? ? ? ? ? ? 2.488 ? 
metalc5 metalc ? ? A ASN 18 OD1 ? ? ? 1_555 C MG  . MG ? ? A ASN 275 A MG  571 1_555 ? ? ? ? ? ? ? 2.524 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          TYR 
_struct_mon_prot_cis.label_seq_id           245 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           TYR 
_struct_mon_prot_cis.auth_seq_id            502 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   LYS 
_struct_mon_prot_cis.pdbx_label_seq_id_2    246 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    LYS 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     503 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       2.19 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 79  ? LEU A 87  ? TYR A 336 LEU A 344 
A 2 ILE A 90  ? LYS A 97  ? ILE A 347 LYS A 354 
A 3 VAL A 39  ? GLN A 45  ? VAL A 296 GLN A 302 
A 4 THR A 3   ? ASN A 16  ? THR A 260 ASN A 273 
A 5 VAL A 295 ? VAL A 306 ? VAL A 552 VAL A 563 
A 6 ILE A 276 ? SER A 283 ? ILE A 533 SER A 540 
B 1 ILE A 104 ? GLY A 113 ? ILE A 361 GLY A 370 
B 2 GLY A 124 ? PHE A 132 ? GLY A 381 PHE A 389 
B 3 THR A 135 ? HIS A 143 ? THR A 392 HIS A 400 
B 4 VAL A 184 ? ASP A 190 ? VAL A 441 ASP A 447 
B 5 ASP A 267 ? GLY A 273 ? ASP A 524 GLY A 530 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ALA A 80  ? N ALA A 337 O VAL A 96  ? O VAL A 353 
A 2 3 O MET A 91  ? O MET A 348 N PHE A 44  ? N PHE A 301 
A 3 4 O VAL A 39  ? O VAL A 296 N PHE A 11  ? N PHE A 268 
A 4 5 N TYR A 4   ? N TYR A 261 O VAL A 305 ? O VAL A 562 
A 5 6 O VAL A 298 ? O VAL A 555 N LEU A 279 ? N LEU A 536 
B 1 2 N GLU A 108 ? N GLU A 365 O ARG A 129 ? O ARG A 386 
B 2 3 N GLY A 124 ? N GLY A 381 O HIS A 143 ? O HIS A 400 
B 3 4 N VAL A 140 ? N VAL A 397 O LEU A 188 ? O LEU A 445 
B 4 5 N TRP A 187 ? N TRP A 444 O LEU A 270 ? O LEU A 527 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL A 1'   
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 571'  
AC3 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE PIF A 572' 
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 A 573' 
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE GOL A 574' 
AC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL A 575'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  HOH H .   ? HOH A 41  . ? 5_555 ? 
2  AC1 8  HOH H .   ? HOH A 109 . ? 1_555 ? 
3  AC1 8  ILE A 5   ? ILE A 262 . ? 5_555 ? 
4  AC1 8  GLN A 6   ? GLN A 263 . ? 1_555 ? 
5  AC1 8  HIS A 100 ? HIS A 357 . ? 1_555 ? 
6  AC1 8  TYR A 103 ? TYR A 360 . ? 1_555 ? 
7  AC1 8  HIS A 133 ? HIS A 390 . ? 1_555 ? 
8  AC1 8  ASN A 275 ? ASN A 532 . ? 5_555 ? 
9  AC2 6  HOH H .   ? HOH A 77  . ? 1_555 ? 
10 AC2 6  HOH H .   ? HOH A 78  . ? 1_555 ? 
11 AC2 6  HOH H .   ? HOH A 79  . ? 1_555 ? 
12 AC2 6  ASN A 18  ? ASN A 275 . ? 1_555 ? 
13 AC2 6  GLU A 46  ? GLU A 303 . ? 1_555 ? 
14 AC2 6  PIF D .   ? PIF A 572 . ? 1_555 ? 
15 AC3 19 HOH H .   ? HOH A 70  . ? 1_555 ? 
16 AC3 19 HOH H .   ? HOH A 73  . ? 1_555 ? 
17 AC3 19 HOH H .   ? HOH A 74  . ? 1_555 ? 
18 AC3 19 HOH H .   ? HOH A 75  . ? 1_555 ? 
19 AC3 19 HOH H .   ? HOH A 76  . ? 1_555 ? 
20 AC3 19 HOH H .   ? HOH A 78  . ? 1_555 ? 
21 AC3 19 HOH H .   ? HOH A 87  . ? 1_555 ? 
22 AC3 19 HOH H .   ? HOH A 174 . ? 1_555 ? 
23 AC3 19 GLU A 46  ? GLU A 303 . ? 1_555 ? 
24 AC3 19 LEU A 49  ? LEU A 306 . ? 1_555 ? 
25 AC3 19 ASN A 122 ? ASN A 379 . ? 1_555 ? 
26 AC3 19 LYS A 123 ? LYS A 380 . ? 1_555 ? 
27 AC3 19 HIS A 143 ? HIS A 400 . ? 1_555 ? 
28 AC3 19 HIS A 147 ? HIS A 404 . ? 1_555 ? 
29 AC3 19 TYR A 245 ? TYR A 502 . ? 1_555 ? 
30 AC3 19 LYS A 246 ? LYS A 503 . ? 1_555 ? 
31 AC3 19 LYS A 259 ? LYS A 516 . ? 1_555 ? 
32 AC3 19 ARG A 261 ? ARG A 518 . ? 1_555 ? 
33 AC3 19 MG  C .   ? MG  A 571 . ? 1_555 ? 
34 AC4 6  HOH H .   ? HOH A 93  . ? 8_645 ? 
35 AC4 6  HOH H .   ? HOH A 94  . ? 8_645 ? 
36 AC4 6  HOH H .   ? HOH A 191 . ? 1_555 ? 
37 AC4 6  SER A 50  ? SER A 307 . ? 1_555 ? 
38 AC4 6  LYS A 51  ? LYS A 308 . ? 1_555 ? 
39 AC4 6  ARG A 119 ? ARG A 376 . ? 8_645 ? 
40 AC5 5  HOH H .   ? HOH A 192 . ? 1_555 ? 
41 AC5 5  GLY A 115 ? GLY A 372 . ? 1_555 ? 
42 AC5 5  ILE A 116 ? ILE A 373 . ? 1_555 ? 
43 AC5 5  MET A 117 ? MET A 374 . ? 1_555 ? 
44 AC5 5  ARG A 153 ? ARG A 410 . ? 1_555 ? 
45 AC6 2  HIS A 284 ? HIS A 541 . ? 1_555 ? 
46 AC6 2  ALA A 286 ? ALA A 543 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3MTC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3MTC 
_atom_sites.fract_transf_matrix[1][1]   0.007476 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007476 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007476 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 1   ? 67.740 58.463 66.146 1.00 65.96 ? 258 MET A N   1 
ATOM   2    C  CA  . MET A 1 1   ? 67.138 58.029 64.862 1.00 66.20 ? 258 MET A CA  1 
ATOM   3    C  C   . MET A 1 1   ? 65.614 57.974 64.981 1.00 64.75 ? 258 MET A C   1 
ATOM   4    O  O   . MET A 1 1   ? 65.073 57.831 66.087 1.00 64.57 ? 258 MET A O   1 
ATOM   5    C  CB  . MET A 1 1   ? 67.665 56.639 64.468 1.00 67.00 ? 258 MET A CB  1 
ATOM   6    C  CG  . MET A 1 1   ? 67.060 55.485 65.275 1.00 70.17 ? 258 MET A CG  1 
ATOM   7    S  SD  . MET A 1 1   ? 67.422 53.818 64.646 1.00 77.91 ? 258 MET A SD  1 
ATOM   8    C  CE  . MET A 1 1   ? 66.613 52.810 65.899 1.00 73.66 ? 258 MET A CE  1 
ATOM   9    N  N   . TYR A 1 2   ? 64.933 58.059 63.838 1.00 62.76 ? 259 TYR A N   1 
ATOM   10   C  CA  . TYR A 1 2   ? 63.482 57.862 63.789 1.00 61.43 ? 259 TYR A CA  1 
ATOM   11   C  C   . TYR A 1 2   ? 63.113 56.685 62.895 1.00 59.52 ? 259 TYR A C   1 
ATOM   12   O  O   . TYR A 1 2   ? 63.745 56.459 61.857 1.00 59.05 ? 259 TYR A O   1 
ATOM   13   C  CB  . TYR A 1 2   ? 62.786 59.134 63.321 1.00 61.66 ? 259 TYR A CB  1 
ATOM   14   C  CG  . TYR A 1 2   ? 62.791 60.217 64.368 1.00 63.75 ? 259 TYR A CG  1 
ATOM   15   C  CD1 . TYR A 1 2   ? 63.815 61.160 64.419 1.00 66.78 ? 259 TYR A CD1 1 
ATOM   16   C  CD2 . TYR A 1 2   ? 61.781 60.293 65.319 1.00 65.96 ? 259 TYR A CD2 1 
ATOM   17   C  CE1 . TYR A 1 2   ? 63.826 62.167 65.394 1.00 68.24 ? 259 TYR A CE1 1 
ATOM   18   C  CE2 . TYR A 1 2   ? 61.780 61.284 66.292 1.00 67.37 ? 259 TYR A CE2 1 
ATOM   19   C  CZ  . TYR A 1 2   ? 62.804 62.219 66.326 1.00 68.96 ? 259 TYR A CZ  1 
ATOM   20   O  OH  . TYR A 1 2   ? 62.802 63.200 67.297 1.00 71.48 ? 259 TYR A OH  1 
ATOM   21   N  N   . THR A 1 3   ? 62.109 55.920 63.320 1.00 57.51 ? 260 THR A N   1 
ATOM   22   C  CA  . THR A 1 3   ? 61.579 54.829 62.503 1.00 55.95 ? 260 THR A CA  1 
ATOM   23   C  C   . THR A 1 3   ? 60.108 55.011 62.142 1.00 54.58 ? 260 THR A C   1 
ATOM   24   O  O   . THR A 1 3   ? 59.345 55.648 62.864 1.00 54.37 ? 260 THR A O   1 
ATOM   25   C  CB  . THR A 1 3   ? 61.753 53.467 63.170 1.00 55.69 ? 260 THR A CB  1 
ATOM   26   O  OG1 . THR A 1 3   ? 60.986 53.419 64.374 1.00 55.38 ? 260 THR A OG1 1 
ATOM   27   C  CG2 . THR A 1 3   ? 63.203 53.200 63.451 1.00 55.18 ? 260 THR A CG2 1 
ATOM   28   N  N   . TYR A 1 4   ? 59.734 54.435 61.008 1.00 53.05 ? 261 TYR A N   1 
ATOM   29   C  CA  . TYR A 1 4   ? 58.359 54.484 60.503 1.00 51.93 ? 261 TYR A CA  1 
ATOM   30   C  C   . TYR A 1 4   ? 58.013 53.121 59.904 1.00 51.35 ? 261 TYR A C   1 
ATOM   31   O  O   . TYR A 1 4   ? 58.907 52.362 59.535 1.00 50.93 ? 261 TYR A O   1 
ATOM   32   C  CB  . TYR A 1 4   ? 58.201 55.592 59.449 1.00 51.07 ? 261 TYR A CB  1 
ATOM   33   C  CG  . TYR A 1 4   ? 58.939 55.322 58.161 1.00 50.68 ? 261 TYR A CG  1 
ATOM   34   C  CD1 . TYR A 1 4   ? 58.284 54.786 57.048 1.00 49.71 ? 261 TYR A CD1 1 
ATOM   35   C  CD2 . TYR A 1 4   ? 60.303 55.587 58.054 1.00 49.85 ? 261 TYR A CD2 1 
ATOM   36   C  CE1 . TYR A 1 4   ? 58.979 54.527 55.855 1.00 49.71 ? 261 TYR A CE1 1 
ATOM   37   C  CE2 . TYR A 1 4   ? 61.006 55.331 56.883 1.00 49.81 ? 261 TYR A CE2 1 
ATOM   38   C  CZ  . TYR A 1 4   ? 60.342 54.797 55.781 1.00 50.71 ? 261 TYR A CZ  1 
ATOM   39   O  OH  . TYR A 1 4   ? 61.052 54.553 54.623 1.00 49.80 ? 261 TYR A OH  1 
ATOM   40   N  N   . ILE A 1 5   ? 56.719 52.826 59.810 1.00 51.02 ? 262 ILE A N   1 
ATOM   41   C  CA  . ILE A 1 5   ? 56.228 51.604 59.164 1.00 50.44 ? 262 ILE A CA  1 
ATOM   42   C  C   . ILE A 1 5   ? 56.173 51.736 57.646 1.00 50.22 ? 262 ILE A C   1 
ATOM   43   O  O   . ILE A 1 5   ? 55.545 52.647 57.123 1.00 50.06 ? 262 ILE A O   1 
ATOM   44   C  CB  . ILE A 1 5   ? 54.833 51.252 59.649 1.00 50.54 ? 262 ILE A CB  1 
ATOM   45   C  CG1 . ILE A 1 5   ? 54.893 50.853 61.133 1.00 50.87 ? 262 ILE A CG1 1 
ATOM   46   C  CG2 . ILE A 1 5   ? 54.223 50.134 58.778 1.00 49.65 ? 262 ILE A CG2 1 
ATOM   47   C  CD1 . ILE A 1 5   ? 55.783 49.658 61.421 1.00 49.91 ? 262 ILE A CD1 1 
ATOM   48   N  N   . GLN A 1 6   ? 56.857 50.822 56.961 1.00 49.79 ? 263 GLN A N   1 
ATOM   49   C  CA  . GLN A 1 6   ? 56.805 50.690 55.516 1.00 49.52 ? 263 GLN A CA  1 
ATOM   50   C  C   . GLN A 1 6   ? 56.342 49.250 55.196 1.00 49.88 ? 263 GLN A C   1 
ATOM   51   O  O   . GLN A 1 6   ? 56.874 48.268 55.757 1.00 48.94 ? 263 GLN A O   1 
ATOM   52   C  CB  . GLN A 1 6   ? 58.195 50.937 54.903 1.00 49.46 ? 263 GLN A CB  1 
ATOM   53   C  CG  . GLN A 1 6   ? 58.186 50.984 53.395 1.00 48.82 ? 263 GLN A CG  1 
ATOM   54   C  CD  . GLN A 1 6   ? 59.523 51.307 52.758 1.00 49.37 ? 263 GLN A CD  1 
ATOM   55   O  OE1 . GLN A 1 6   ? 60.372 52.000 53.331 1.00 50.71 ? 263 GLN A OE1 1 
ATOM   56   N  NE2 . GLN A 1 6   ? 59.709 50.817 51.534 1.00 49.62 ? 263 GLN A NE2 1 
ATOM   57   N  N   . ASN A 1 7   ? 55.368 49.134 54.293 1.00 50.10 ? 264 ASN A N   1 
ATOM   58   C  CA  . ASN A 1 7   ? 54.795 47.834 53.933 1.00 50.46 ? 264 ASN A CA  1 
ATOM   59   C  C   . ASN A 1 7   ? 55.637 47.084 52.901 1.00 49.83 ? 264 ASN A C   1 
ATOM   60   O  O   . ASN A 1 7   ? 56.056 47.658 51.896 1.00 49.36 ? 264 ASN A O   1 
ATOM   61   C  CB  . ASN A 1 7   ? 53.372 48.009 53.408 1.00 50.64 ? 264 ASN A CB  1 
ATOM   62   C  CG  . ASN A 1 7   ? 52.330 48.142 54.531 1.00 53.89 ? 264 ASN A CG  1 
ATOM   63   O  OD1 . ASN A 1 7   ? 52.604 47.906 55.719 1.00 56.04 ? 264 ASN A OD1 1 
ATOM   64   N  ND2 . ASN A 1 7   ? 51.117 48.517 54.145 1.00 58.55 ? 264 ASN A ND2 1 
ATOM   65   N  N   . PHE A 1 8   ? 55.888 45.802 53.165 1.00 49.29 ? 265 PHE A N   1 
ATOM   66   C  CA  . PHE A 1 8   ? 56.534 44.917 52.183 1.00 49.04 ? 265 PHE A CA  1 
ATOM   67   C  C   . PHE A 1 8   ? 55.696 43.658 51.910 1.00 49.05 ? 265 PHE A C   1 
ATOM   68   O  O   . PHE A 1 8   ? 54.929 43.204 52.765 1.00 48.28 ? 265 PHE A O   1 
ATOM   69   C  CB  . PHE A 1 8   ? 57.920 44.508 52.666 1.00 48.87 ? 265 PHE A CB  1 
ATOM   70   C  CG  . PHE A 1 8   ? 58.897 45.654 52.769 1.00 47.74 ? 265 PHE A CG  1 
ATOM   71   C  CD1 . PHE A 1 8   ? 59.833 45.871 51.781 1.00 47.90 ? 265 PHE A CD1 1 
ATOM   72   C  CD2 . PHE A 1 8   ? 58.886 46.496 53.869 1.00 46.94 ? 265 PHE A CD2 1 
ATOM   73   C  CE1 . PHE A 1 8   ? 60.742 46.916 51.884 1.00 48.54 ? 265 PHE A CE1 1 
ATOM   74   C  CE2 . PHE A 1 8   ? 59.785 47.533 53.980 1.00 46.29 ? 265 PHE A CE2 1 
ATOM   75   C  CZ  . PHE A 1 8   ? 60.710 47.750 52.983 1.00 47.09 ? 265 PHE A CZ  1 
ATOM   76   N  N   . ARG A 1 9   ? 55.842 43.107 50.709 1.00 49.35 ? 266 ARG A N   1 
ATOM   77   C  CA  . ARG A 1 9   ? 55.100 41.900 50.321 1.00 50.06 ? 266 ARG A CA  1 
ATOM   78   C  C   . ARG A 1 9   ? 55.926 40.647 50.555 1.00 48.78 ? 266 ARG A C   1 
ATOM   79   O  O   . ARG A 1 9   ? 57.004 40.508 49.982 1.00 48.36 ? 266 ARG A O   1 
ATOM   80   C  CB  . ARG A 1 9   ? 54.659 41.969 48.852 1.00 50.75 ? 266 ARG A CB  1 
ATOM   81   C  CG  . ARG A 1 9   ? 53.170 42.122 48.689 1.00 55.70 ? 266 ARG A CG  1 
ATOM   82   C  CD  . ARG A 1 9   ? 52.803 42.369 47.252 1.00 62.28 ? 266 ARG A CD  1 
ATOM   83   N  NE  . ARG A 1 9   ? 51.355 42.504 47.040 1.00 66.06 ? 266 ARG A NE  1 
ATOM   84   C  CZ  . ARG A 1 9   ? 50.632 43.563 47.413 1.00 69.72 ? 266 ARG A CZ  1 
ATOM   85   N  NH1 . ARG A 1 9   ? 51.195 44.596 48.046 1.00 71.65 ? 266 ARG A NH1 1 
ATOM   86   N  NH2 . ARG A 1 9   ? 49.329 43.596 47.154 1.00 71.33 ? 266 ARG A NH2 1 
ATOM   87   N  N   . PHE A 1 10  ? 55.397 39.750 51.384 1.00 48.03 ? 267 PHE A N   1 
ATOM   88   C  CA  . PHE A 1 10  ? 56.004 38.463 51.697 1.00 47.67 ? 267 PHE A CA  1 
ATOM   89   C  C   . PHE A 1 10  ? 55.165 37.340 51.113 1.00 47.29 ? 267 PHE A C   1 
ATOM   90   O  O   . PHE A 1 10  ? 53.967 37.267 51.366 1.00 47.80 ? 267 PHE A O   1 
ATOM   91   C  CB  . PHE A 1 10  ? 56.048 38.228 53.215 1.00 47.90 ? 267 PHE A CB  1 
ATOM   92   C  CG  . PHE A 1 10  ? 57.106 39.027 53.956 1.00 47.75 ? 267 PHE A CG  1 
ATOM   93   C  CD1 . PHE A 1 10  ? 58.120 38.376 54.644 1.00 47.14 ? 267 PHE A CD1 1 
ATOM   94   C  CD2 . PHE A 1 10  ? 57.048 40.417 54.014 1.00 48.35 ? 267 PHE A CD2 1 
ATOM   95   C  CE1 . PHE A 1 10  ? 59.084 39.094 55.364 1.00 49.00 ? 267 PHE A CE1 1 
ATOM   96   C  CE2 . PHE A 1 10  ? 58.011 41.151 54.739 1.00 49.34 ? 267 PHE A CE2 1 
ATOM   97   C  CZ  . PHE A 1 10  ? 59.035 40.486 55.410 1.00 48.11 ? 267 PHE A CZ  1 
ATOM   98   N  N   . PHE A 1 11  ? 55.809 36.459 50.353 1.00 46.61 ? 268 PHE A N   1 
ATOM   99   C  CA  . PHE A 1 11  ? 55.219 35.222 49.867 1.00 45.40 ? 268 PHE A CA  1 
ATOM   100  C  C   . PHE A 1 11  ? 55.708 34.092 50.772 1.00 45.16 ? 268 PHE A C   1 
ATOM   101  O  O   . PHE A 1 11  ? 56.893 34.003 51.082 1.00 44.59 ? 268 PHE A O   1 
ATOM   102  C  CB  . PHE A 1 11  ? 55.670 34.987 48.433 1.00 45.43 ? 268 PHE A CB  1 
ATOM   103  C  CG  . PHE A 1 11  ? 55.180 33.695 47.818 1.00 44.81 ? 268 PHE A CG  1 
ATOM   104  C  CD1 . PHE A 1 11  ? 54.188 33.711 46.854 1.00 44.90 ? 268 PHE A CD1 1 
ATOM   105  C  CD2 . PHE A 1 11  ? 55.760 32.482 48.146 1.00 44.83 ? 268 PHE A CD2 1 
ATOM   106  C  CE1 . PHE A 1 11  ? 53.753 32.549 46.261 1.00 44.27 ? 268 PHE A CE1 1 
ATOM   107  C  CE2 . PHE A 1 11  ? 55.326 31.317 47.562 1.00 45.29 ? 268 PHE A CE2 1 
ATOM   108  C  CZ  . PHE A 1 11  ? 54.319 31.358 46.603 1.00 45.40 ? 268 PHE A CZ  1 
ATOM   109  N  N   . ALA A 1 12  ? 54.780 33.249 51.201 1.00 44.73 ? 269 ALA A N   1 
ATOM   110  C  CA  . ALA A 1 12  ? 55.087 32.054 51.952 1.00 44.63 ? 269 ALA A CA  1 
ATOM   111  C  C   . ALA A 1 12  ? 54.494 30.862 51.194 1.00 44.88 ? 269 ALA A C   1 
ATOM   112  O  O   . ALA A 1 12  ? 53.331 30.893 50.796 1.00 44.60 ? 269 ALA A O   1 
ATOM   113  C  CB  . ALA A 1 12  ? 54.498 32.152 53.327 1.00 44.29 ? 269 ALA A CB  1 
ATOM   114  N  N   . GLY A 1 13  ? 55.304 29.826 50.988 1.00 45.23 ? 270 GLY A N   1 
ATOM   115  C  CA  . GLY A 1 13  ? 54.895 28.632 50.257 1.00 45.03 ? 270 GLY A CA  1 
ATOM   116  C  C   . GLY A 1 13  ? 55.268 27.390 51.035 1.00 45.55 ? 270 GLY A C   1 
ATOM   117  O  O   . GLY A 1 13  ? 56.313 27.359 51.693 1.00 46.27 ? 270 GLY A O   1 
ATOM   118  N  N   . THR A 1 14  ? 54.407 26.375 50.985 1.00 45.43 ? 271 THR A N   1 
ATOM   119  C  CA  . THR A 1 14  ? 54.726 25.064 51.523 1.00 45.57 ? 271 THR A CA  1 
ATOM   120  C  C   . THR A 1 14  ? 54.334 23.969 50.506 1.00 45.79 ? 271 THR A C   1 
ATOM   121  O  O   . THR A 1 14  ? 53.287 24.044 49.877 1.00 45.43 ? 271 THR A O   1 
ATOM   122  C  CB  . THR A 1 14  ? 54.037 24.839 52.896 1.00 45.72 ? 271 THR A CB  1 
ATOM   123  O  OG1 . THR A 1 14  ? 54.413 23.557 53.434 1.00 45.99 ? 271 THR A OG1 1 
ATOM   124  C  CG2 . THR A 1 14  ? 52.510 24.951 52.778 1.00 44.34 ? 271 THR A CG2 1 
ATOM   125  N  N   . TYR A 1 15  ? 55.181 22.956 50.352 1.00 46.04 ? 272 TYR A N   1 
ATOM   126  C  CA  . TYR A 1 15  ? 54.967 21.902 49.347 1.00 45.63 ? 272 TYR A CA  1 
ATOM   127  C  C   . TYR A 1 15  ? 55.602 20.604 49.827 1.00 45.99 ? 272 TYR A C   1 
ATOM   128  O  O   . TYR A 1 15  ? 56.818 20.534 49.974 1.00 46.11 ? 272 TYR A O   1 
ATOM   129  C  CB  . TYR A 1 15  ? 55.584 22.330 48.017 1.00 45.28 ? 272 TYR A CB  1 
ATOM   130  C  CG  . TYR A 1 15  ? 55.238 21.517 46.760 1.00 45.08 ? 272 TYR A CG  1 
ATOM   131  C  CD1 . TYR A 1 15  ? 54.238 20.535 46.743 1.00 44.88 ? 272 TYR A CD1 1 
ATOM   132  C  CD2 . TYR A 1 15  ? 55.892 21.782 45.570 1.00 44.27 ? 272 TYR A CD2 1 
ATOM   133  C  CE1 . TYR A 1 15  ? 53.938 19.828 45.570 1.00 44.12 ? 272 TYR A CE1 1 
ATOM   134  C  CE2 . TYR A 1 15  ? 55.582 21.100 44.401 1.00 44.57 ? 272 TYR A CE2 1 
ATOM   135  C  CZ  . TYR A 1 15  ? 54.612 20.128 44.403 1.00 44.77 ? 272 TYR A CZ  1 
ATOM   136  O  OH  . TYR A 1 15  ? 54.344 19.463 43.218 1.00 46.03 ? 272 TYR A OH  1 
ATOM   137  N  N   . ASN A 1 16  ? 54.775 19.594 50.101 1.00 46.19 ? 273 ASN A N   1 
ATOM   138  C  CA  . ASN A 1 16  ? 55.258 18.235 50.362 1.00 46.05 ? 273 ASN A CA  1 
ATOM   139  C  C   . ASN A 1 16  ? 55.435 17.562 49.002 1.00 46.12 ? 273 ASN A C   1 
ATOM   140  O  O   . ASN A 1 16  ? 54.460 17.363 48.284 1.00 45.68 ? 273 ASN A O   1 
ATOM   141  C  CB  . ASN A 1 16  ? 54.275 17.450 51.255 1.00 45.68 ? 273 ASN A CB  1 
ATOM   142  C  CG  . ASN A 1 16  ? 54.764 16.022 51.571 1.00 45.14 ? 273 ASN A CG  1 
ATOM   143  O  OD1 . ASN A 1 16  ? 55.426 15.393 50.751 1.00 43.39 ? 273 ASN A OD1 1 
ATOM   144  N  ND2 . ASN A 1 16  ? 54.441 15.522 52.769 1.00 40.75 ? 273 ASN A ND2 1 
ATOM   145  N  N   . VAL A 1 17  ? 56.675 17.217 48.654 1.00 46.20 ? 274 VAL A N   1 
ATOM   146  C  CA  . VAL A 1 17  ? 57.003 16.787 47.288 1.00 46.21 ? 274 VAL A CA  1 
ATOM   147  C  C   . VAL A 1 17  ? 57.175 15.272 47.152 1.00 47.11 ? 274 VAL A C   1 
ATOM   148  O  O   . VAL A 1 17  ? 57.675 14.780 46.132 1.00 46.17 ? 274 VAL A O   1 
ATOM   149  C  CB  . VAL A 1 17  ? 58.273 17.489 46.760 1.00 45.93 ? 274 VAL A CB  1 
ATOM   150  C  CG1 . VAL A 1 17  ? 58.036 18.988 46.668 1.00 44.03 ? 274 VAL A CG1 1 
ATOM   151  C  CG2 . VAL A 1 17  ? 59.489 17.135 47.627 1.00 44.23 ? 274 VAL A CG2 1 
ATOM   152  N  N   . ASN A 1 18  ? 56.767 14.545 48.191 1.00 48.16 ? 275 ASN A N   1 
ATOM   153  C  CA  . ASN A 1 18  ? 56.742 13.084 48.170 1.00 49.15 ? 275 ASN A CA  1 
ATOM   154  C  C   . ASN A 1 18  ? 58.003 12.422 47.608 1.00 49.78 ? 275 ASN A C   1 
ATOM   155  O  O   . ASN A 1 18  ? 57.910 11.447 46.867 1.00 50.62 ? 275 ASN A O   1 
ATOM   156  C  CB  . ASN A 1 18  ? 55.537 12.606 47.366 1.00 49.30 ? 275 ASN A CB  1 
ATOM   157  C  CG  . ASN A 1 18  ? 55.268 11.130 47.549 1.00 50.12 ? 275 ASN A CG  1 
ATOM   158  O  OD1 . ASN A 1 18  ? 55.254 10.609 48.687 1.00 52.55 ? 275 ASN A OD1 1 
ATOM   159  N  ND2 . ASN A 1 18  ? 55.046 10.442 46.440 1.00 48.08 ? 275 ASN A ND2 1 
ATOM   160  N  N   . GLY A 1 19  ? 59.169 12.973 47.928 1.00 50.15 ? 276 GLY A N   1 
ATOM   161  C  CA  . GLY A 1 19  ? 60.437 12.347 47.580 1.00 50.53 ? 276 GLY A CA  1 
ATOM   162  C  C   . GLY A 1 19  ? 60.841 12.455 46.133 1.00 50.93 ? 276 GLY A C   1 
ATOM   163  O  O   . GLY A 1 19  ? 61.846 11.856 45.737 1.00 51.03 ? 276 GLY A O   1 
ATOM   164  N  N   . GLN A 1 20  ? 60.083 13.229 45.353 1.00 51.20 ? 277 GLN A N   1 
ATOM   165  C  CA  . GLN A 1 20  ? 60.324 13.367 43.920 1.00 51.62 ? 277 GLN A CA  1 
ATOM   166  C  C   . GLN A 1 20  ? 61.330 14.462 43.594 1.00 51.83 ? 277 GLN A C   1 
ATOM   167  O  O   . GLN A 1 20  ? 61.558 15.383 44.380 1.00 51.41 ? 277 GLN A O   1 
ATOM   168  C  CB  . GLN A 1 20  ? 59.022 13.706 43.179 1.00 51.67 ? 277 GLN A CB  1 
ATOM   169  C  CG  . GLN A 1 20  ? 57.857 12.777 43.444 1.00 52.53 ? 277 GLN A CG  1 
ATOM   170  C  CD  . GLN A 1 20  ? 58.117 11.345 43.003 1.00 53.85 ? 277 GLN A CD  1 
ATOM   171  O  OE1 . GLN A 1 20  ? 58.699 11.091 41.956 1.00 54.09 ? 277 GLN A OE1 1 
ATOM   172  N  NE2 . GLN A 1 20  ? 57.684 10.410 43.814 1.00 56.36 ? 277 GLN A NE2 1 
ATOM   173  N  N   . SER A 1 21  ? 61.927 14.337 42.415 1.00 52.38 ? 278 SER A N   1 
ATOM   174  C  CA  . SER A 1 21  ? 62.651 15.434 41.773 1.00 52.96 ? 278 SER A CA  1 
ATOM   175  C  C   . SER A 1 21  ? 61.624 16.357 41.107 1.00 52.96 ? 278 SER A C   1 
ATOM   176  O  O   . SER A 1 21  ? 60.542 15.903 40.729 1.00 52.82 ? 278 SER A O   1 
ATOM   177  C  CB  . SER A 1 21  ? 63.608 14.886 40.708 1.00 52.86 ? 278 SER A CB  1 
ATOM   178  O  OG  . SER A 1 21  ? 64.637 14.115 41.300 1.00 54.51 ? 278 SER A OG  1 
ATOM   179  N  N   . PRO A 1 22  ? 61.949 17.651 40.970 1.00 53.32 ? 279 PRO A N   1 
ATOM   180  C  CA  . PRO A 1 22  ? 61.030 18.567 40.314 1.00 54.23 ? 279 PRO A CA  1 
ATOM   181  C  C   . PRO A 1 22  ? 60.894 18.246 38.819 1.00 55.18 ? 279 PRO A C   1 
ATOM   182  O  O   . PRO A 1 22  ? 61.901 18.053 38.150 1.00 55.72 ? 279 PRO A O   1 
ATOM   183  C  CB  . PRO A 1 22  ? 61.691 19.935 40.524 1.00 53.74 ? 279 PRO A CB  1 
ATOM   184  C  CG  . PRO A 1 22  ? 63.115 19.648 40.626 1.00 53.55 ? 279 PRO A CG  1 
ATOM   185  C  CD  . PRO A 1 22  ? 63.231 18.302 41.282 1.00 53.30 ? 279 PRO A CD  1 
ATOM   186  N  N   . LYS A 1 23  ? 59.663 18.148 38.330 1.00 56.43 ? 280 LYS A N   1 
ATOM   187  C  CA  . LYS A 1 23  ? 59.392 17.876 36.912 1.00 57.88 ? 280 LYS A CA  1 
ATOM   188  C  C   . LYS A 1 23  ? 58.660 19.026 36.215 1.00 57.97 ? 280 LYS A C   1 
ATOM   189  O  O   . LYS A 1 23  ? 58.638 19.087 34.991 1.00 58.82 ? 280 LYS A O   1 
ATOM   190  C  CB  . LYS A 1 23  ? 58.538 16.617 36.769 1.00 58.26 ? 280 LYS A CB  1 
ATOM   191  C  CG  . LYS A 1 23  ? 59.242 15.330 37.182 1.00 61.20 ? 280 LYS A CG  1 
ATOM   192  C  CD  . LYS A 1 23  ? 58.222 14.243 37.561 1.00 64.68 ? 280 LYS A CD  1 
ATOM   193  C  CE  . LYS A 1 23  ? 58.915 12.959 38.038 1.00 66.45 ? 280 LYS A CE  1 
ATOM   194  N  NZ  . LYS A 1 23  ? 59.482 13.110 39.410 1.00 67.88 ? 280 LYS A NZ  1 
ATOM   195  N  N   . GLU A 1 24  ? 58.057 19.924 36.987 1.00 57.60 ? 281 GLU A N   1 
ATOM   196  C  CA  . GLU A 1 24  ? 57.235 20.994 36.441 1.00 57.12 ? 281 GLU A CA  1 
ATOM   197  C  C   . GLU A 1 24  ? 57.839 22.360 36.756 1.00 56.51 ? 281 GLU A C   1 
ATOM   198  O  O   . GLU A 1 24  ? 58.562 22.521 37.745 1.00 56.64 ? 281 GLU A O   1 
ATOM   199  C  CB  . GLU A 1 24  ? 55.832 20.899 37.036 1.00 57.22 ? 281 GLU A CB  1 
ATOM   200  C  CG  . GLU A 1 24  ? 55.151 19.580 36.744 1.00 57.73 ? 281 GLU A CG  1 
ATOM   201  C  CD  . GLU A 1 24  ? 54.055 19.263 37.724 1.00 58.69 ? 281 GLU A CD  1 
ATOM   202  O  OE1 . GLU A 1 24  ? 54.353 18.991 38.909 1.00 58.52 ? 281 GLU A OE1 1 
ATOM   203  O  OE2 . GLU A 1 24  ? 52.883 19.269 37.311 1.00 60.50 ? 281 GLU A OE2 1 
ATOM   204  N  N   . CYS A 1 25  ? 57.535 23.334 35.909 1.00 55.38 ? 282 CYS A N   1 
ATOM   205  C  CA  . CYS A 1 25  ? 57.893 24.717 36.162 1.00 54.86 ? 282 CYS A CA  1 
ATOM   206  C  C   . CYS A 1 25  ? 57.159 25.166 37.425 1.00 53.11 ? 282 CYS A C   1 
ATOM   207  O  O   . CYS A 1 25  ? 55.972 24.896 37.567 1.00 53.25 ? 282 CYS A O   1 
ATOM   208  C  CB  . CYS A 1 25  ? 57.470 25.589 34.968 1.00 54.83 ? 282 CYS A CB  1 
ATOM   209  S  SG  . CYS A 1 25  ? 58.022 27.309 35.076 1.00 58.81 ? 282 CYS A SG  1 
ATOM   210  N  N   . LEU A 1 26  ? 57.847 25.851 38.334 1.00 51.18 ? 283 LEU A N   1 
ATOM   211  C  CA  . LEU A 1 26  ? 57.227 26.253 39.599 1.00 50.01 ? 283 LEU A CA  1 
ATOM   212  C  C   . LEU A 1 26  ? 56.576 27.644 39.581 1.00 49.81 ? 283 LEU A C   1 
ATOM   213  O  O   . LEU A 1 26  ? 56.037 28.080 40.597 1.00 49.02 ? 283 LEU A O   1 
ATOM   214  C  CB  . LEU A 1 26  ? 58.228 26.135 40.753 1.00 49.25 ? 283 LEU A CB  1 
ATOM   215  C  CG  . LEU A 1 26  ? 58.768 24.728 40.995 1.00 47.81 ? 283 LEU A CG  1 
ATOM   216  C  CD1 . LEU A 1 26  ? 59.670 24.681 42.241 1.00 44.86 ? 283 LEU A CD1 1 
ATOM   217  C  CD2 . LEU A 1 26  ? 57.610 23.738 41.122 1.00 44.11 ? 283 LEU A CD2 1 
ATOM   218  N  N   . ARG A 1 27  ? 56.599 28.332 38.438 1.00 49.87 ? 284 ARG A N   1 
ATOM   219  C  CA  . ARG A 1 27  ? 55.840 29.586 38.296 1.00 49.91 ? 284 ARG A CA  1 
ATOM   220  C  C   . ARG A 1 27  ? 54.384 29.431 38.678 1.00 49.72 ? 284 ARG A C   1 
ATOM   221  O  O   . ARG A 1 27  ? 53.812 30.323 39.289 1.00 49.30 ? 284 ARG A O   1 
ATOM   222  C  CB  . ARG A 1 27  ? 55.919 30.134 36.884 1.00 50.05 ? 284 ARG A CB  1 
ATOM   223  C  CG  . ARG A 1 27  ? 57.292 30.675 36.516 1.00 51.86 ? 284 ARG A CG  1 
ATOM   224  C  CD  . ARG A 1 27  ? 57.179 31.803 35.532 1.00 54.54 ? 284 ARG A CD  1 
ATOM   225  N  NE  . ARG A 1 27  ? 56.430 32.921 36.120 1.00 58.23 ? 284 ARG A NE  1 
ATOM   226  C  CZ  . ARG A 1 27  ? 56.019 34.004 35.457 1.00 57.61 ? 284 ARG A CZ  1 
ATOM   227  N  NH1 . ARG A 1 27  ? 56.284 34.150 34.162 1.00 56.67 ? 284 ARG A NH1 1 
ATOM   228  N  NH2 . ARG A 1 27  ? 55.337 34.945 36.105 1.00 57.24 ? 284 ARG A NH2 1 
ATOM   229  N  N   . LEU A 1 28  ? 53.783 28.290 38.349 1.00 50.12 ? 285 LEU A N   1 
ATOM   230  C  CA  . LEU A 1 28  ? 52.385 28.046 38.698 1.00 50.29 ? 285 LEU A CA  1 
ATOM   231  C  C   . LEU A 1 28  ? 52.154 28.109 40.209 1.00 49.56 ? 285 LEU A C   1 
ATOM   232  O  O   . LEU A 1 28  ? 51.024 28.328 40.667 1.00 50.06 ? 285 LEU A O   1 
ATOM   233  C  CB  . LEU A 1 28  ? 51.905 26.701 38.130 1.00 51.04 ? 285 LEU A CB  1 
ATOM   234  C  CG  . LEU A 1 28  ? 51.815 26.577 36.593 1.00 53.32 ? 285 LEU A CG  1 
ATOM   235  C  CD1 . LEU A 1 28  ? 51.657 25.103 36.158 1.00 55.53 ? 285 LEU A CD1 1 
ATOM   236  C  CD2 . LEU A 1 28  ? 50.680 27.420 36.011 1.00 54.26 ? 285 LEU A CD2 1 
ATOM   237  N  N   . TRP A 1 29  ? 53.225 27.928 40.981 1.00 48.48 ? 286 TRP A N   1 
ATOM   238  C  CA  . TRP A 1 29  ? 53.172 28.051 42.432 1.00 47.48 ? 286 TRP A CA  1 
ATOM   239  C  C   . TRP A 1 29  ? 53.653 29.424 42.917 1.00 47.00 ? 286 TRP A C   1 
ATOM   240  O  O   . TRP A 1 29  ? 52.992 30.082 43.731 1.00 46.42 ? 286 TRP A O   1 
ATOM   241  C  CB  . TRP A 1 29  ? 54.035 26.942 43.037 1.00 47.58 ? 286 TRP A CB  1 
ATOM   242  C  CG  . TRP A 1 29  ? 54.184 26.941 44.543 1.00 46.91 ? 286 TRP A CG  1 
ATOM   243  C  CD1 . TRP A 1 29  ? 53.303 27.424 45.471 1.00 45.24 ? 286 TRP A CD1 1 
ATOM   244  C  CD2 . TRP A 1 29  ? 55.269 26.375 45.279 1.00 46.07 ? 286 TRP A CD2 1 
ATOM   245  N  NE1 . TRP A 1 29  ? 53.789 27.205 46.736 1.00 45.73 ? 286 TRP A NE1 1 
ATOM   246  C  CE2 . TRP A 1 29  ? 54.989 26.554 46.643 1.00 45.09 ? 286 TRP A CE2 1 
ATOM   247  C  CE3 . TRP A 1 29  ? 56.455 25.737 44.912 1.00 46.13 ? 286 TRP A CE3 1 
ATOM   248  C  CZ2 . TRP A 1 29  ? 55.854 26.136 47.636 1.00 44.06 ? 286 TRP A CZ2 1 
ATOM   249  C  CZ3 . TRP A 1 29  ? 57.310 25.312 45.911 1.00 45.20 ? 286 TRP A CZ3 1 
ATOM   250  C  CH2 . TRP A 1 29  ? 57.003 25.514 47.251 1.00 43.93 ? 286 TRP A CH2 1 
ATOM   251  N  N   . LEU A 1 30  ? 54.805 29.842 42.411 1.00 46.69 ? 287 LEU A N   1 
ATOM   252  C  CA  . LEU A 1 30  ? 55.580 30.927 43.015 1.00 47.01 ? 287 LEU A CA  1 
ATOM   253  C  C   . LEU A 1 30  ? 55.337 32.312 42.416 1.00 47.61 ? 287 LEU A C   1 
ATOM   254  O  O   . LEU A 1 30  ? 55.657 33.319 43.046 1.00 46.99 ? 287 LEU A O   1 
ATOM   255  C  CB  . LEU A 1 30  ? 57.072 30.596 42.903 1.00 46.57 ? 287 LEU A CB  1 
ATOM   256  C  CG  . LEU A 1 30  ? 57.526 29.325 43.619 1.00 46.05 ? 287 LEU A CG  1 
ATOM   257  C  CD1 . LEU A 1 30  ? 58.989 29.045 43.310 1.00 44.46 ? 287 LEU A CD1 1 
ATOM   258  C  CD2 . LEU A 1 30  ? 57.286 29.415 45.126 1.00 45.43 ? 287 LEU A CD2 1 
ATOM   259  N  N   . SER A 1 31  ? 54.824 32.366 41.189 1.00 48.72 ? 288 SER A N   1 
ATOM   260  C  CA  . SER A 1 31  ? 54.558 33.645 40.523 1.00 49.63 ? 288 SER A CA  1 
ATOM   261  C  C   . SER A 1 31  ? 53.464 33.459 39.475 1.00 51.16 ? 288 SER A C   1 
ATOM   262  O  O   . SER A 1 31  ? 53.682 33.573 38.279 1.00 50.71 ? 288 SER A O   1 
ATOM   263  C  CB  . SER A 1 31  ? 55.844 34.217 39.914 1.00 49.20 ? 288 SER A CB  1 
ATOM   264  O  OG  . SER A 1 31  ? 56.478 33.301 39.036 1.00 48.49 ? 288 SER A OG  1 
ATOM   265  N  N   . ASN A 1 32  ? 52.278 33.130 39.953 1.00 53.68 ? 289 ASN A N   1 
ATOM   266  C  CA  . ASN A 1 32  ? 51.152 32.818 39.085 1.00 55.47 ? 289 ASN A CA  1 
ATOM   267  C  C   . ASN A 1 32  ? 50.172 33.957 39.181 1.00 56.13 ? 289 ASN A C   1 
ATOM   268  O  O   . ASN A 1 32  ? 49.332 33.968 40.085 1.00 57.01 ? 289 ASN A O   1 
ATOM   269  C  CB  . ASN A 1 32  ? 50.488 31.524 39.559 1.00 56.28 ? 289 ASN A CB  1 
ATOM   270  C  CG  . ASN A 1 32  ? 49.436 31.004 38.582 1.00 58.40 ? 289 ASN A CG  1 
ATOM   271  O  OD1 . ASN A 1 32  ? 49.616 31.057 37.371 1.00 63.94 ? 289 ASN A OD1 1 
ATOM   272  N  ND2 . ASN A 1 32  ? 48.360 30.460 39.113 1.00 60.60 ? 289 ASN A ND2 1 
ATOM   273  N  N   . GLY A 1 33  ? 50.324 34.949 38.304 1.00 56.42 ? 290 GLY A N   1 
ATOM   274  C  CA  . GLY A 1 33  ? 49.444 36.120 38.312 1.00 56.36 ? 290 GLY A CA  1 
ATOM   275  C  C   . GLY A 1 33  ? 49.474 36.965 39.581 1.00 56.07 ? 290 GLY A C   1 
ATOM   276  O  O   . GLY A 1 33  ? 48.426 37.426 40.046 1.00 57.14 ? 290 GLY A O   1 
ATOM   277  N  N   . ILE A 1 34  ? 50.658 37.163 40.157 1.00 55.26 ? 291 ILE A N   1 
ATOM   278  C  CA  . ILE A 1 34  ? 50.813 38.046 41.317 1.00 53.95 ? 291 ILE A CA  1 
ATOM   279  C  C   . ILE A 1 34  ? 51.876 39.096 41.056 1.00 53.41 ? 291 ILE A C   1 
ATOM   280  O  O   . ILE A 1 34  ? 52.723 38.930 40.189 1.00 52.64 ? 291 ILE A O   1 
ATOM   281  C  CB  . ILE A 1 34  ? 51.166 37.268 42.624 1.00 54.21 ? 291 ILE A CB  1 
ATOM   282  C  CG1 . ILE A 1 34  ? 52.489 36.498 42.494 1.00 53.85 ? 291 ILE A CG1 1 
ATOM   283  C  CG2 . ILE A 1 34  ? 50.035 36.324 43.027 1.00 53.13 ? 291 ILE A CG2 1 
ATOM   284  C  CD1 . ILE A 1 34  ? 52.913 35.819 43.778 1.00 53.71 ? 291 ILE A CD1 1 
ATOM   285  N  N   . GLN A 1 35  ? 51.817 40.185 41.823 1.00 53.53 ? 292 GLN A N   1 
ATOM   286  C  CA  . GLN A 1 35  ? 52.895 41.188 41.864 1.00 53.19 ? 292 GLN A CA  1 
ATOM   287  C  C   . GLN A 1 35  ? 54.174 40.548 42.374 1.00 51.57 ? 292 GLN A C   1 
ATOM   288  O  O   . GLN A 1 35  ? 54.111 39.632 43.182 1.00 51.66 ? 292 GLN A O   1 
ATOM   289  C  CB  . GLN A 1 35  ? 52.582 42.293 42.862 1.00 53.66 ? 292 GLN A CB  1 
ATOM   290  C  CG  . GLN A 1 35  ? 51.319 43.051 42.643 1.00 56.13 ? 292 GLN A CG  1 
ATOM   291  C  CD  . GLN A 1 35  ? 51.136 44.125 43.701 1.00 58.35 ? 292 GLN A CD  1 
ATOM   292  O  OE1 . GLN A 1 35  ? 52.115 44.654 44.257 1.00 60.21 ? 292 GLN A OE1 1 
ATOM   293  N  NE2 . GLN A 1 35  ? 49.879 44.468 43.977 1.00 60.87 ? 292 GLN A NE2 1 
ATOM   294  N  N   . ALA A 1 36  ? 55.316 41.075 41.952 1.00 50.12 ? 293 ALA A N   1 
ATOM   295  C  CA  . ALA A 1 36  ? 56.608 40.609 42.430 1.00 49.62 ? 293 ALA A CA  1 
ATOM   296  C  C   . ALA A 1 36  ? 56.672 40.778 43.944 1.00 49.14 ? 293 ALA A C   1 
ATOM   297  O  O   . ALA A 1 36  ? 56.574 41.899 44.424 1.00 49.66 ? 293 ALA A O   1 
ATOM   298  C  CB  . ALA A 1 36  ? 57.734 41.395 41.775 1.00 49.33 ? 293 ALA A CB  1 
ATOM   299  N  N   . PRO A 1 37  ? 56.822 39.673 44.698 1.00 48.05 ? 294 PRO A N   1 
ATOM   300  C  CA  . PRO A 1 37  ? 57.009 39.835 46.132 1.00 47.79 ? 294 PRO A CA  1 
ATOM   301  C  C   . PRO A 1 37  ? 58.351 40.469 46.489 1.00 47.00 ? 294 PRO A C   1 
ATOM   302  O  O   . PRO A 1 37  ? 59.306 40.352 45.729 1.00 46.78 ? 294 PRO A O   1 
ATOM   303  C  CB  . PRO A 1 37  ? 56.947 38.399 46.670 1.00 47.82 ? 294 PRO A CB  1 
ATOM   304  C  CG  . PRO A 1 37  ? 56.294 37.608 45.600 1.00 48.55 ? 294 PRO A CG  1 
ATOM   305  C  CD  . PRO A 1 37  ? 56.707 38.257 44.324 1.00 48.06 ? 294 PRO A CD  1 
ATOM   306  N  N   . ASP A 1 38  ? 58.404 41.122 47.646 1.00 46.28 ? 295 ASP A N   1 
ATOM   307  C  CA  . ASP A 1 38  ? 59.654 41.653 48.183 1.00 45.98 ? 295 ASP A CA  1 
ATOM   308  C  C   . ASP A 1 38  ? 60.502 40.567 48.836 1.00 45.72 ? 295 ASP A C   1 
ATOM   309  O  O   . ASP A 1 38  ? 61.738 40.606 48.757 1.00 46.11 ? 295 ASP A O   1 
ATOM   310  C  CB  . ASP A 1 38  ? 59.354 42.743 49.205 1.00 45.97 ? 295 ASP A CB  1 
ATOM   311  C  CG  . ASP A 1 38  ? 58.758 43.974 48.568 1.00 46.54 ? 295 ASP A CG  1 
ATOM   312  O  OD1 . ASP A 1 38  ? 59.432 44.547 47.677 1.00 47.87 ? 295 ASP A OD1 1 
ATOM   313  O  OD2 . ASP A 1 38  ? 57.622 44.352 48.941 1.00 45.15 ? 295 ASP A OD2 1 
ATOM   314  N  N   . VAL A 1 39  ? 59.827 39.616 49.482 1.00 45.05 ? 296 VAL A N   1 
ATOM   315  C  CA  . VAL A 1 39  ? 60.456 38.512 50.173 1.00 44.62 ? 296 VAL A CA  1 
ATOM   316  C  C   . VAL A 1 39  ? 59.743 37.185 49.853 1.00 44.67 ? 296 VAL A C   1 
ATOM   317  O  O   . VAL A 1 39  ? 58.500 37.109 49.870 1.00 44.10 ? 296 VAL A O   1 
ATOM   318  C  CB  . VAL A 1 39  ? 60.450 38.734 51.700 1.00 45.05 ? 296 VAL A CB  1 
ATOM   319  C  CG1 . VAL A 1 39  ? 61.146 37.575 52.416 1.00 43.89 ? 296 VAL A CG1 1 
ATOM   320  C  CG2 . VAL A 1 39  ? 61.104 40.097 52.073 1.00 45.24 ? 296 VAL A CG2 1 
ATOM   321  N  N   . TYR A 1 40  ? 60.546 36.154 49.575 1.00 44.07 ? 297 TYR A N   1 
ATOM   322  C  CA  . TYR A 1 40  ? 60.065 34.801 49.331 1.00 44.35 ? 297 TYR A CA  1 
ATOM   323  C  C   . TYR A 1 40  ? 60.514 33.880 50.450 1.00 44.70 ? 297 TYR A C   1 
ATOM   324  O  O   . TYR A 1 40  ? 61.703 33.814 50.754 1.00 45.60 ? 297 TYR A O   1 
ATOM   325  C  CB  . TYR A 1 40  ? 60.636 34.259 48.027 1.00 44.14 ? 297 TYR A CB  1 
ATOM   326  C  CG  . TYR A 1 40  ? 59.805 34.512 46.793 1.00 44.02 ? 297 TYR A CG  1 
ATOM   327  C  CD1 . TYR A 1 40  ? 58.710 33.722 46.511 1.00 43.78 ? 297 TYR A CD1 1 
ATOM   328  C  CD2 . TYR A 1 40  ? 60.140 35.525 45.892 1.00 43.84 ? 297 TYR A CD2 1 
ATOM   329  C  CE1 . TYR A 1 40  ? 57.952 33.921 45.382 1.00 45.36 ? 297 TYR A CE1 1 
ATOM   330  C  CE2 . TYR A 1 40  ? 59.389 35.746 44.759 1.00 44.92 ? 297 TYR A CE2 1 
ATOM   331  C  CZ  . TYR A 1 40  ? 58.294 34.933 44.494 1.00 45.74 ? 297 TYR A CZ  1 
ATOM   332  O  OH  . TYR A 1 40  ? 57.535 35.122 43.353 1.00 44.99 ? 297 TYR A OH  1 
ATOM   333  N  N   . CYS A 1 41  ? 59.567 33.158 51.041 1.00 44.89 ? 298 CYS A N   1 
ATOM   334  C  CA  . CYS A 1 41  ? 59.842 32.143 52.047 1.00 44.71 ? 298 CYS A CA  1 
ATOM   335  C  C   . CYS A 1 41  ? 59.238 30.846 51.518 1.00 44.59 ? 298 CYS A C   1 
ATOM   336  O  O   . CYS A 1 41  ? 58.007 30.711 51.457 1.00 44.94 ? 298 CYS A O   1 
ATOM   337  C  CB  . CYS A 1 41  ? 59.180 32.519 53.369 1.00 44.89 ? 298 CYS A CB  1 
ATOM   338  S  SG  . CYS A 1 41  ? 59.479 34.208 53.911 1.00 46.83 ? 298 CYS A SG  1 
ATOM   339  N  N   . VAL A 1 42  ? 60.091 29.906 51.110 1.00 44.11 ? 299 VAL A N   1 
ATOM   340  C  CA  . VAL A 1 42  ? 59.648 28.707 50.405 1.00 43.75 ? 299 VAL A CA  1 
ATOM   341  C  C   . VAL A 1 42  ? 60.103 27.426 51.116 1.00 44.08 ? 299 VAL A C   1 
ATOM   342  O  O   . VAL A 1 42  ? 61.306 27.178 51.286 1.00 44.39 ? 299 VAL A O   1 
ATOM   343  C  CB  . VAL A 1 42  ? 60.138 28.708 48.937 1.00 44.08 ? 299 VAL A CB  1 
ATOM   344  C  CG1 . VAL A 1 42  ? 59.555 27.520 48.163 1.00 41.72 ? 299 VAL A CG1 1 
ATOM   345  C  CG2 . VAL A 1 42  ? 59.758 30.037 48.243 1.00 43.42 ? 299 VAL A CG2 1 
ATOM   346  N  N   . GLY A 1 43  ? 59.119 26.619 51.518 1.00 43.78 ? 300 GLY A N   1 
ATOM   347  C  CA  . GLY A 1 43  ? 59.341 25.439 52.337 1.00 43.56 ? 300 GLY A CA  1 
ATOM   348  C  C   . GLY A 1 43  ? 58.863 24.148 51.691 1.00 43.52 ? 300 GLY A C   1 
ATOM   349  O  O   . GLY A 1 43  ? 57.831 24.104 51.022 1.00 43.56 ? 300 GLY A O   1 
ATOM   350  N  N   . PHE A 1 44  ? 59.638 23.096 51.909 1.00 43.51 ? 301 PHE A N   1 
ATOM   351  C  CA  . PHE A 1 44  ? 59.355 21.782 51.402 1.00 43.58 ? 301 PHE A CA  1 
ATOM   352  C  C   . PHE A 1 44  ? 59.327 20.777 52.533 1.00 44.03 ? 301 PHE A C   1 
ATOM   353  O  O   . PHE A 1 44  ? 59.991 20.962 53.561 1.00 44.04 ? 301 PHE A O   1 
ATOM   354  C  CB  . PHE A 1 44  ? 60.464 21.349 50.466 1.00 43.25 ? 301 PHE A CB  1 
ATOM   355  C  CG  . PHE A 1 44  ? 60.550 22.157 49.237 1.00 43.11 ? 301 PHE A CG  1 
ATOM   356  C  CD1 . PHE A 1 44  ? 59.706 21.888 48.164 1.00 43.43 ? 301 PHE A CD1 1 
ATOM   357  C  CD2 . PHE A 1 44  ? 61.465 23.180 49.137 1.00 42.21 ? 301 PHE A CD2 1 
ATOM   358  C  CE1 . PHE A 1 44  ? 59.774 22.628 47.016 1.00 43.25 ? 301 PHE A CE1 1 
ATOM   359  C  CE2 . PHE A 1 44  ? 61.536 23.941 48.002 1.00 42.99 ? 301 PHE A CE2 1 
ATOM   360  C  CZ  . PHE A 1 44  ? 60.691 23.657 46.923 1.00 44.32 ? 301 PHE A CZ  1 
ATOM   361  N  N   . GLN A 1 45  ? 58.575 19.705 52.308 1.00 44.12 ? 302 GLN A N   1 
ATOM   362  C  CA  . GLN A 1 45  ? 58.703 18.486 53.077 1.00 44.30 ? 302 GLN A CA  1 
ATOM   363  C  C   . GLN A 1 45  ? 58.924 17.300 52.139 1.00 44.86 ? 302 GLN A C   1 
ATOM   364  O  O   . GLN A 1 45  ? 58.583 17.346 50.955 1.00 44.80 ? 302 GLN A O   1 
ATOM   365  C  CB  . GLN A 1 45  ? 57.483 18.258 53.953 1.00 43.97 ? 302 GLN A CB  1 
ATOM   366  C  CG  . GLN A 1 45  ? 57.123 19.467 54.799 1.00 43.77 ? 302 GLN A CG  1 
ATOM   367  C  CD  . GLN A 1 45  ? 56.357 20.507 54.018 1.00 43.68 ? 302 GLN A CD  1 
ATOM   368  O  OE1 . GLN A 1 45  ? 55.523 20.158 53.174 1.00 43.83 ? 302 GLN A OE1 1 
ATOM   369  N  NE2 . GLN A 1 45  ? 56.638 21.798 54.280 1.00 41.21 ? 302 GLN A NE2 1 
ATOM   370  N  N   . GLU A 1 46  ? 59.541 16.259 52.688 1.00 45.22 ? 303 GLU A N   1 
ATOM   371  C  CA  . GLU A 1 46  ? 59.839 15.042 51.965 1.00 45.61 ? 303 GLU A CA  1 
ATOM   372  C  C   . GLU A 1 46  ? 60.637 15.283 50.707 1.00 45.45 ? 303 GLU A C   1 
ATOM   373  O  O   . GLU A 1 46  ? 60.389 14.666 49.670 1.00 46.55 ? 303 GLU A O   1 
ATOM   374  C  CB  . GLU A 1 46  ? 58.558 14.255 51.671 1.00 45.82 ? 303 GLU A CB  1 
ATOM   375  C  CG  . GLU A 1 46  ? 57.790 13.907 52.941 1.00 47.37 ? 303 GLU A CG  1 
ATOM   376  C  CD  . GLU A 1 46  ? 56.705 12.901 52.715 1.00 48.54 ? 303 GLU A CD  1 
ATOM   377  O  OE1 . GLU A 1 46  ? 56.783 12.214 51.693 1.00 50.30 ? 303 GLU A OE1 1 
ATOM   378  O  OE2 . GLU A 1 46  ? 55.784 12.776 53.559 1.00 51.46 ? 303 GLU A OE2 1 
ATOM   379  N  N   . LEU A 1 47  ? 61.624 16.160 50.800 1.00 45.31 ? 304 LEU A N   1 
ATOM   380  C  CA  . LEU A 1 47  ? 62.537 16.404 49.678 1.00 45.16 ? 304 LEU A CA  1 
ATOM   381  C  C   . LEU A 1 47  ? 63.242 15.129 49.206 1.00 45.77 ? 304 LEU A C   1 
ATOM   382  O  O   . LEU A 1 47  ? 63.531 14.995 48.034 1.00 46.64 ? 304 LEU A O   1 
ATOM   383  C  CB  . LEU A 1 47  ? 63.600 17.421 50.068 1.00 44.65 ? 304 LEU A CB  1 
ATOM   384  C  CG  . LEU A 1 47  ? 63.915 18.398 48.941 1.00 45.05 ? 304 LEU A CG  1 
ATOM   385  C  CD1 . LEU A 1 47  ? 62.802 19.445 48.813 1.00 40.76 ? 304 LEU A CD1 1 
ATOM   386  C  CD2 . LEU A 1 47  ? 65.310 19.046 49.145 1.00 42.49 ? 304 LEU A CD2 1 
ATOM   387  N  N   . ASP A 1 48  ? 63.544 14.217 50.133 1.00 46.23 ? 305 ASP A N   1 
ATOM   388  C  CA  . ASP A 1 48  ? 64.303 13.000 49.842 1.00 46.30 ? 305 ASP A CA  1 
ATOM   389  C  C   . ASP A 1 48  ? 63.919 11.939 50.869 1.00 46.65 ? 305 ASP A C   1 
ATOM   390  O  O   . ASP A 1 48  ? 64.171 12.104 52.068 1.00 46.19 ? 305 ASP A O   1 
ATOM   391  C  CB  . ASP A 1 48  ? 65.805 13.289 49.924 1.00 46.43 ? 305 ASP A CB  1 
ATOM   392  C  CG  . ASP A 1 48  ? 66.668 12.119 49.449 1.00 46.61 ? 305 ASP A CG  1 
ATOM   393  O  OD1 . ASP A 1 48  ? 66.316 10.945 49.724 1.00 47.40 ? 305 ASP A OD1 1 
ATOM   394  O  OD2 . ASP A 1 48  ? 67.708 12.384 48.807 1.00 46.53 ? 305 ASP A OD2 1 
ATOM   395  N  N   . LEU A 1 49  ? 63.302 10.856 50.401 1.00 46.86 ? 306 LEU A N   1 
ATOM   396  C  CA  . LEU A 1 49  ? 62.797 9.815  51.308 1.00 47.01 ? 306 LEU A CA  1 
ATOM   397  C  C   . LEU A 1 49  ? 63.776 8.658  51.479 1.00 46.88 ? 306 LEU A C   1 
ATOM   398  O  O   . LEU A 1 49  ? 63.414 7.657  52.085 1.00 46.29 ? 306 LEU A O   1 
ATOM   399  C  CB  . LEU A 1 49  ? 61.433 9.290  50.831 1.00 47.00 ? 306 LEU A CB  1 
ATOM   400  C  CG  . LEU A 1 49  ? 60.265 10.287 50.960 1.00 47.70 ? 306 LEU A CG  1 
ATOM   401  C  CD1 . LEU A 1 49  ? 59.043 9.784  50.197 1.00 46.77 ? 306 LEU A CD1 1 
ATOM   402  C  CD2 . LEU A 1 49  ? 59.919 10.591 52.438 1.00 44.93 ? 306 LEU A CD2 1 
ATOM   403  N  N   . SER A 1 50  ? 65.010 8.802  50.967 1.00 46.82 ? 307 SER A N   1 
ATOM   404  C  CA  . SER A 1 50  ? 66.002 7.717  51.031 1.00 46.54 ? 307 SER A CA  1 
ATOM   405  C  C   . SER A 1 50  ? 66.568 7.486  52.444 1.00 46.43 ? 307 SER A C   1 
ATOM   406  O  O   . SER A 1 50  ? 66.569 8.381  53.298 1.00 46.22 ? 307 SER A O   1 
ATOM   407  C  CB  . SER A 1 50  ? 67.151 7.980  50.059 1.00 46.39 ? 307 SER A CB  1 
ATOM   408  O  OG  . SER A 1 50  ? 68.044 8.983  50.531 1.00 47.06 ? 307 SER A OG  1 
ATOM   409  N  N   . LYS A 1 51  ? 67.036 6.267  52.685 1.00 46.24 ? 308 LYS A N   1 
ATOM   410  C  CA  . LYS A 1 51  ? 67.740 5.938  53.919 1.00 45.90 ? 308 LYS A CA  1 
ATOM   411  C  C   . LYS A 1 51  ? 69.017 6.781  54.096 1.00 46.17 ? 308 LYS A C   1 
ATOM   412  O  O   . LYS A 1 51  ? 69.363 7.162  55.213 1.00 45.45 ? 308 LYS A O   1 
ATOM   413  C  CB  . LYS A 1 51  ? 68.065 4.442  53.964 1.00 45.94 ? 308 LYS A CB  1 
ATOM   414  C  CG  . LYS A 1 51  ? 69.047 3.926  52.887 1.00 45.37 ? 308 LYS A CG  1 
ATOM   415  C  CD  . LYS A 1 51  ? 68.865 2.410  52.669 1.00 44.63 ? 308 LYS A CD  1 
ATOM   416  C  CE  . LYS A 1 51  ? 69.641 1.865  51.440 1.00 45.32 ? 308 LYS A CE  1 
ATOM   417  N  NZ  . LYS A 1 51  ? 69.411 2.601  50.131 1.00 42.78 ? 308 LYS A NZ  1 
ATOM   418  N  N   . GLU A 1 52  ? 69.692 7.094  52.989 1.00 46.01 ? 309 GLU A N   1 
ATOM   419  C  CA  . GLU A 1 52  ? 70.910 7.887  53.052 1.00 46.30 ? 309 GLU A CA  1 
ATOM   420  C  C   . GLU A 1 52  ? 70.611 9.288  53.588 1.00 46.38 ? 309 GLU A C   1 
ATOM   421  O  O   . GLU A 1 52  ? 71.348 9.783  54.429 1.00 46.36 ? 309 GLU A O   1 
ATOM   422  C  CB  . GLU A 1 52  ? 71.606 7.962  51.682 1.00 46.61 ? 309 GLU A CB  1 
ATOM   423  C  CG  . GLU A 1 52  ? 72.204 6.616  51.176 1.00 46.72 ? 309 GLU A CG  1 
ATOM   424  C  CD  . GLU A 1 52  ? 71.187 5.724  50.475 1.00 48.97 ? 309 GLU A CD  1 
ATOM   425  O  OE1 . GLU A 1 52  ? 70.052 6.198  50.206 1.00 48.48 ? 309 GLU A OE1 1 
ATOM   426  O  OE2 . GLU A 1 52  ? 71.523 4.551  50.184 1.00 48.53 ? 309 GLU A OE2 1 
ATOM   427  N  N   . ALA A 1 53  ? 69.521 9.906  53.125 1.00 46.30 ? 310 ALA A N   1 
ATOM   428  C  CA  . ALA A 1 53  ? 69.128 11.248 53.589 1.00 46.45 ? 310 ALA A CA  1 
ATOM   429  C  C   . ALA A 1 53  ? 68.687 11.226 55.056 1.00 46.34 ? 310 ALA A C   1 
ATOM   430  O  O   . ALA A 1 53  ? 68.973 12.147 55.819 1.00 46.21 ? 310 ALA A O   1 
ATOM   431  C  CB  . ALA A 1 53  ? 68.025 11.826 52.708 1.00 45.98 ? 310 ALA A CB  1 
ATOM   432  N  N   . PHE A 1 54  ? 68.016 10.150 55.438 1.00 46.45 ? 311 PHE A N   1 
ATOM   433  C  CA  . PHE A 1 54  ? 67.608 9.910  56.815 1.00 46.37 ? 311 PHE A CA  1 
ATOM   434  C  C   . PHE A 1 54  ? 68.809 9.886  57.778 1.00 46.45 ? 311 PHE A C   1 
ATOM   435  O  O   . PHE A 1 54  ? 68.718 10.413 58.887 1.00 46.73 ? 311 PHE A O   1 
ATOM   436  C  CB  . PHE A 1 54  ? 66.812 8.605  56.862 1.00 46.31 ? 311 PHE A CB  1 
ATOM   437  C  CG  . PHE A 1 54  ? 66.303 8.228  58.227 1.00 47.18 ? 311 PHE A CG  1 
ATOM   438  C  CD1 . PHE A 1 54  ? 65.124 8.774  58.723 1.00 46.36 ? 311 PHE A CD1 1 
ATOM   439  C  CD2 . PHE A 1 54  ? 66.988 7.288  59.004 1.00 47.79 ? 311 PHE A CD2 1 
ATOM   440  C  CE1 . PHE A 1 54  ? 64.651 8.410  59.979 1.00 47.15 ? 311 PHE A CE1 1 
ATOM   441  C  CE2 . PHE A 1 54  ? 66.515 6.914  60.264 1.00 47.04 ? 311 PHE A CE2 1 
ATOM   442  C  CZ  . PHE A 1 54  ? 65.351 7.467  60.749 1.00 46.93 ? 311 PHE A CZ  1 
ATOM   443  N  N   . PHE A 1 55  ? 69.935 9.312  57.355 1.00 46.49 ? 312 PHE A N   1 
ATOM   444  C  CA  . PHE A 1 55  ? 71.153 9.326  58.186 1.00 46.65 ? 312 PHE A CA  1 
ATOM   445  C  C   . PHE A 1 55  ? 72.048 10.537 57.874 1.00 47.16 ? 312 PHE A C   1 
ATOM   446  O  O   . PHE A 1 55  ? 73.265 10.502 58.119 1.00 47.72 ? 312 PHE A O   1 
ATOM   447  C  CB  . PHE A 1 55  ? 71.922 7.993  58.108 1.00 46.21 ? 312 PHE A CB  1 
ATOM   448  C  CG  . PHE A 1 55  ? 71.152 6.835  58.664 1.00 44.42 ? 312 PHE A CG  1 
ATOM   449  C  CD1 . PHE A 1 55  ? 70.952 6.719  60.026 1.00 45.44 ? 312 PHE A CD1 1 
ATOM   450  C  CD2 . PHE A 1 55  ? 70.586 5.898  57.830 1.00 43.28 ? 312 PHE A CD2 1 
ATOM   451  C  CE1 . PHE A 1 55  ? 70.197 5.670  60.553 1.00 45.20 ? 312 PHE A CE1 1 
ATOM   452  C  CE2 . PHE A 1 55  ? 69.841 4.839  58.331 1.00 44.04 ? 312 PHE A CE2 1 
ATOM   453  C  CZ  . PHE A 1 55  ? 69.644 4.720  59.696 1.00 44.76 ? 312 PHE A CZ  1 
ATOM   454  N  N   . PHE A 1 56  ? 71.411 11.596 57.362 1.00 46.83 ? 313 PHE A N   1 
ATOM   455  C  CA  . PHE A 1 56  ? 71.932 12.966 57.347 1.00 46.82 ? 313 PHE A CA  1 
ATOM   456  C  C   . PHE A 1 56  ? 72.993 13.258 56.279 1.00 47.27 ? 313 PHE A C   1 
ATOM   457  O  O   . PHE A 1 56  ? 73.696 14.268 56.353 1.00 47.30 ? 313 PHE A O   1 
ATOM   458  C  CB  . PHE A 1 56  ? 72.368 13.395 58.754 1.00 46.63 ? 313 PHE A CB  1 
ATOM   459  C  CG  . PHE A 1 56  ? 71.347 13.056 59.809 1.00 46.71 ? 313 PHE A CG  1 
ATOM   460  C  CD1 . PHE A 1 56  ? 70.124 13.700 59.827 1.00 45.55 ? 313 PHE A CD1 1 
ATOM   461  C  CD2 . PHE A 1 56  ? 71.598 12.061 60.761 1.00 46.79 ? 313 PHE A CD2 1 
ATOM   462  C  CE1 . PHE A 1 56  ? 69.159 13.365 60.768 1.00 46.45 ? 313 PHE A CE1 1 
ATOM   463  C  CE2 . PHE A 1 56  ? 70.650 11.726 61.710 1.00 46.56 ? 313 PHE A CE2 1 
ATOM   464  C  CZ  . PHE A 1 56  ? 69.421 12.375 61.712 1.00 47.76 ? 313 PHE A CZ  1 
ATOM   465  N  N   . HIS A 1 57  ? 73.054 12.407 55.256 1.00 47.47 ? 314 HIS A N   1 
ATOM   466  C  CA  . HIS A 1 57  ? 73.900 12.668 54.097 1.00 47.80 ? 314 HIS A CA  1 
ATOM   467  C  C   . HIS A 1 57  ? 73.349 13.783 53.196 1.00 48.37 ? 314 HIS A C   1 
ATOM   468  O  O   . HIS A 1 57  ? 72.145 14.051 53.166 1.00 47.55 ? 314 HIS A O   1 
ATOM   469  C  CB  . HIS A 1 57  ? 74.122 11.385 53.283 1.00 47.30 ? 314 HIS A CB  1 
ATOM   470  C  CG  . HIS A 1 57  ? 74.965 10.377 53.988 1.00 47.19 ? 314 HIS A CG  1 
ATOM   471  N  ND1 . HIS A 1 57  ? 76.340 10.403 53.942 1.00 47.53 ? 314 HIS A ND1 1 
ATOM   472  C  CD2 . HIS A 1 57  ? 74.635 9.340  54.796 1.00 46.50 ? 314 HIS A CD2 1 
ATOM   473  C  CE1 . HIS A 1 57  ? 76.819 9.410  54.673 1.00 47.39 ? 314 HIS A CE1 1 
ATOM   474  N  NE2 . HIS A 1 57  ? 75.805 8.749  55.199 1.00 45.66 ? 314 HIS A NE2 1 
ATOM   475  N  N   . ASP A 1 58  ? 74.264 14.426 52.473 1.00 48.86 ? 315 ASP A N   1 
ATOM   476  C  CA  . ASP A 1 58  ? 73.913 15.359 51.433 1.00 49.65 ? 315 ASP A CA  1 
ATOM   477  C  C   . ASP A 1 58  ? 73.095 14.651 50.361 1.00 49.68 ? 315 ASP A C   1 
ATOM   478  O  O   . ASP A 1 58  ? 73.235 13.449 50.153 1.00 50.26 ? 315 ASP A O   1 
ATOM   479  C  CB  . ASP A 1 58  ? 75.177 15.990 50.841 1.00 49.92 ? 315 ASP A CB  1 
ATOM   480  C  CG  . ASP A 1 58  ? 75.864 16.942 51.823 1.00 53.17 ? 315 ASP A CG  1 
ATOM   481  O  OD1 . ASP A 1 58  ? 75.320 17.159 52.936 1.00 56.69 ? 315 ASP A OD1 1 
ATOM   482  O  OD2 . ASP A 1 58  ? 76.945 17.479 51.495 1.00 58.58 ? 315 ASP A OD2 1 
ATOM   483  N  N   . THR A 1 59  ? 72.214 15.405 49.714 1.00 49.71 ? 316 THR A N   1 
ATOM   484  C  CA  . THR A 1 59  ? 71.323 14.872 48.689 1.00 49.61 ? 316 THR A CA  1 
ATOM   485  C  C   . THR A 1 59  ? 71.293 15.823 47.502 1.00 49.52 ? 316 THR A C   1 
ATOM   486  O  O   . THR A 1 59  ? 71.286 17.037 47.681 1.00 49.46 ? 316 THR A O   1 
ATOM   487  C  CB  . THR A 1 59  ? 69.870 14.664 49.219 1.00 49.81 ? 316 THR A CB  1 
ATOM   488  O  OG1 . THR A 1 59  ? 68.976 14.472 48.116 1.00 49.26 ? 316 THR A OG1 1 
ATOM   489  C  CG2 . THR A 1 59  ? 69.399 15.848 50.040 1.00 49.03 ? 316 THR A CG2 1 
ATOM   490  N  N   . PRO A 1 60  ? 71.292 15.276 46.280 1.00 49.59 ? 317 PRO A N   1 
ATOM   491  C  CA  . PRO A 1 60  ? 71.180 16.151 45.116 1.00 49.72 ? 317 PRO A CA  1 
ATOM   492  C  C   . PRO A 1 60  ? 69.796 16.808 44.998 1.00 49.37 ? 317 PRO A C   1 
ATOM   493  O  O   . PRO A 1 60  ? 69.637 17.787 44.263 1.00 49.16 ? 317 PRO A O   1 
ATOM   494  C  CB  . PRO A 1 60  ? 71.468 15.208 43.931 1.00 49.61 ? 317 PRO A CB  1 
ATOM   495  C  CG  . PRO A 1 60  ? 71.182 13.837 44.452 1.00 49.92 ? 317 PRO A CG  1 
ATOM   496  C  CD  . PRO A 1 60  ? 71.542 13.873 45.898 1.00 49.71 ? 317 PRO A CD  1 
ATOM   497  N  N   . LYS A 1 61  ? 68.819 16.282 45.733 1.00 49.17 ? 318 LYS A N   1 
ATOM   498  C  CA  . LYS A 1 61  ? 67.487 16.886 45.804 1.00 49.34 ? 318 LYS A CA  1 
ATOM   499  C  C   . LYS A 1 61  ? 67.505 18.331 46.292 1.00 49.18 ? 318 LYS A C   1 
ATOM   500  O  O   . LYS A 1 61  ? 66.677 19.123 45.882 1.00 49.06 ? 318 LYS A O   1 
ATOM   501  C  CB  . LYS A 1 61  ? 66.560 16.054 46.694 1.00 49.61 ? 318 LYS A CB  1 
ATOM   502  C  CG  . LYS A 1 61  ? 66.250 14.660 46.142 1.00 50.65 ? 318 LYS A CG  1 
ATOM   503  C  CD  . LYS A 1 61  ? 65.213 14.694 45.031 1.00 51.73 ? 318 LYS A CD  1 
ATOM   504  C  CE  . LYS A 1 61  ? 64.781 13.278 44.611 1.00 51.98 ? 318 LYS A CE  1 
ATOM   505  N  NZ  . LYS A 1 61  ? 65.916 12.490 44.041 1.00 52.22 ? 318 LYS A NZ  1 
ATOM   506  N  N   . GLU A 1 62  ? 68.453 18.664 47.160 1.00 49.52 ? 319 GLU A N   1 
ATOM   507  C  CA  . GLU A 1 62  ? 68.602 20.016 47.670 1.00 49.88 ? 319 GLU A CA  1 
ATOM   508  C  C   . GLU A 1 62  ? 68.793 21.007 46.534 1.00 50.66 ? 319 GLU A C   1 
ATOM   509  O  O   . GLU A 1 62  ? 67.998 21.931 46.391 1.00 50.28 ? 319 GLU A O   1 
ATOM   510  C  CB  . GLU A 1 62  ? 69.783 20.087 48.643 1.00 49.98 ? 319 GLU A CB  1 
ATOM   511  C  CG  . GLU A 1 62  ? 69.995 21.453 49.248 1.00 50.70 ? 319 GLU A CG  1 
ATOM   512  C  CD  . GLU A 1 62  ? 71.071 21.484 50.313 1.00 52.31 ? 319 GLU A CD  1 
ATOM   513  O  OE1 . GLU A 1 62  ? 70.924 20.822 51.361 1.00 53.28 ? 319 GLU A OE1 1 
ATOM   514  O  OE2 . GLU A 1 62  ? 72.058 22.215 50.105 1.00 55.30 ? 319 GLU A OE2 1 
ATOM   515  N  N   . GLU A 1 63  ? 69.843 20.811 45.735 1.00 51.55 ? 320 GLU A N   1 
ATOM   516  C  CA  . GLU A 1 63  ? 70.129 21.678 44.592 1.00 52.86 ? 320 GLU A CA  1 
ATOM   517  C  C   . GLU A 1 63  ? 69.026 21.603 43.519 1.00 52.71 ? 320 GLU A C   1 
ATOM   518  O  O   . GLU A 1 63  ? 68.620 22.642 43.005 1.00 53.03 ? 320 GLU A O   1 
ATOM   519  C  CB  . GLU A 1 63  ? 71.508 21.359 43.990 1.00 53.70 ? 320 GLU A CB  1 
ATOM   520  C  CG  . GLU A 1 63  ? 72.072 22.407 42.998 1.00 58.36 ? 320 GLU A CG  1 
ATOM   521  C  CD  . GLU A 1 63  ? 71.591 22.241 41.524 1.00 66.20 ? 320 GLU A CD  1 
ATOM   522  O  OE1 . GLU A 1 63  ? 71.031 21.159 41.147 1.00 69.48 ? 320 GLU A OE1 1 
ATOM   523  O  OE2 . GLU A 1 63  ? 71.781 23.214 40.728 1.00 70.55 ? 320 GLU A OE2 1 
ATOM   524  N  N   . GLU A 1 64  ? 68.517 20.406 43.196 1.00 52.21 ? 321 GLU A N   1 
ATOM   525  C  CA  . GLU A 1 64  ? 67.448 20.295 42.185 1.00 52.09 ? 321 GLU A CA  1 
ATOM   526  C  C   . GLU A 1 64  ? 66.266 21.208 42.526 1.00 51.69 ? 321 GLU A C   1 
ATOM   527  O  O   . GLU A 1 64  ? 65.825 22.008 41.694 1.00 51.70 ? 321 GLU A O   1 
ATOM   528  C  CB  . GLU A 1 64  ? 66.939 18.858 42.034 1.00 52.27 ? 321 GLU A CB  1 
ATOM   529  C  CG  . GLU A 1 64  ? 67.865 17.916 41.270 1.00 53.62 ? 321 GLU A CG  1 
ATOM   530  C  CD  . GLU A 1 64  ? 67.461 16.452 41.397 1.00 55.28 ? 321 GLU A CD  1 
ATOM   531  O  OE1 . GLU A 1 64  ? 66.342 16.156 41.849 1.00 54.58 ? 321 GLU A OE1 1 
ATOM   532  O  OE2 . GLU A 1 64  ? 68.282 15.583 41.044 1.00 59.25 ? 321 GLU A OE2 1 
ATOM   533  N  N   . TRP A 1 65  ? 65.766 21.101 43.755 1.00 50.97 ? 322 TRP A N   1 
ATOM   534  C  CA  . TRP A 1 65  ? 64.614 21.896 44.163 1.00 50.60 ? 322 TRP A CA  1 
ATOM   535  C  C   . TRP A 1 65  ? 64.958 23.369 44.353 1.00 50.62 ? 322 TRP A C   1 
ATOM   536  O  O   . TRP A 1 65  ? 64.176 24.226 43.987 1.00 50.85 ? 322 TRP A O   1 
ATOM   537  C  CB  . TRP A 1 65  ? 63.946 21.302 45.401 1.00 50.35 ? 322 TRP A CB  1 
ATOM   538  C  CG  . TRP A 1 65  ? 63.090 20.131 45.058 1.00 49.67 ? 322 TRP A CG  1 
ATOM   539  C  CD1 . TRP A 1 65  ? 63.389 18.830 45.244 1.00 50.34 ? 322 TRP A CD1 1 
ATOM   540  C  CD2 . TRP A 1 65  ? 61.802 20.163 44.440 1.00 48.45 ? 322 TRP A CD2 1 
ATOM   541  N  NE1 . TRP A 1 65  ? 62.368 18.041 44.803 1.00 50.15 ? 322 TRP A NE1 1 
ATOM   542  C  CE2 . TRP A 1 65  ? 61.374 18.836 44.309 1.00 49.00 ? 322 TRP A CE2 1 
ATOM   543  C  CE3 . TRP A 1 65  ? 60.958 21.190 44.009 1.00 48.00 ? 322 TRP A CE3 1 
ATOM   544  C  CZ2 . TRP A 1 65  ? 60.136 18.494 43.746 1.00 49.41 ? 322 TRP A CZ2 1 
ATOM   545  C  CZ3 . TRP A 1 65  ? 59.735 20.857 43.449 1.00 49.11 ? 322 TRP A CZ3 1 
ATOM   546  C  CH2 . TRP A 1 65  ? 59.333 19.518 43.323 1.00 48.68 ? 322 TRP A CH2 1 
ATOM   547  N  N   . PHE A 1 66  ? 66.130 23.667 44.889 1.00 50.85 ? 323 PHE A N   1 
ATOM   548  C  CA  . PHE A 1 66  ? 66.582 25.051 44.995 1.00 51.89 ? 323 PHE A CA  1 
ATOM   549  C  C   . PHE A 1 66  ? 66.655 25.756 43.615 1.00 51.33 ? 323 PHE A C   1 
ATOM   550  O  O   . PHE A 1 66  ? 66.207 26.889 43.450 1.00 50.96 ? 323 PHE A O   1 
ATOM   551  C  CB  . PHE A 1 66  ? 67.938 25.104 45.714 1.00 52.60 ? 323 PHE A CB  1 
ATOM   552  C  CG  . PHE A 1 66  ? 68.562 26.455 45.724 1.00 56.58 ? 323 PHE A CG  1 
ATOM   553  C  CD1 . PHE A 1 66  ? 68.034 27.467 46.538 1.00 61.81 ? 323 PHE A CD1 1 
ATOM   554  C  CD2 . PHE A 1 66  ? 69.670 26.734 44.919 1.00 62.08 ? 323 PHE A CD2 1 
ATOM   555  C  CE1 . PHE A 1 66  ? 68.600 28.749 46.578 1.00 63.12 ? 323 PHE A CE1 1 
ATOM   556  C  CE2 . PHE A 1 66  ? 70.254 28.023 44.925 1.00 65.42 ? 323 PHE A CE2 1 
ATOM   557  C  CZ  . PHE A 1 66  ? 69.707 29.036 45.772 1.00 65.67 ? 323 PHE A CZ  1 
ATOM   558  N  N   . LYS A 1 67  ? 67.222 25.077 42.632 1.00 51.14 ? 324 LYS A N   1 
ATOM   559  C  CA  . LYS A 1 67  ? 67.279 25.597 41.268 1.00 51.08 ? 324 LYS A CA  1 
ATOM   560  C  C   . LYS A 1 67  ? 65.857 25.800 40.739 1.00 49.96 ? 324 LYS A C   1 
ATOM   561  O  O   . LYS A 1 67  ? 65.558 26.833 40.166 1.00 50.38 ? 324 LYS A O   1 
ATOM   562  C  CB  . LYS A 1 67  ? 68.075 24.640 40.374 1.00 51.48 ? 324 LYS A CB  1 
ATOM   563  C  CG  . LYS A 1 67  ? 68.519 25.204 39.027 1.00 54.82 ? 324 LYS A CG  1 
ATOM   564  N  N   . ALA A 1 68  ? 64.974 24.839 40.970 1.00 48.86 ? 325 ALA A N   1 
ATOM   565  C  CA  . ALA A 1 68  ? 63.606 24.926 40.473 1.00 48.39 ? 325 ALA A CA  1 
ATOM   566  C  C   . ALA A 1 68  ? 62.847 26.136 41.073 1.00 48.50 ? 325 ALA A C   1 
ATOM   567  O  O   . ALA A 1 68  ? 62.078 26.824 40.361 1.00 47.79 ? 325 ALA A O   1 
ATOM   568  C  CB  . ALA A 1 68  ? 62.863 23.629 40.773 1.00 47.88 ? 325 ALA A CB  1 
ATOM   569  N  N   . VAL A 1 69  ? 63.053 26.391 42.372 1.00 48.21 ? 326 VAL A N   1 
ATOM   570  C  CA  . VAL A 1 69  ? 62.440 27.567 43.015 1.00 48.24 ? 326 VAL A CA  1 
ATOM   571  C  C   . VAL A 1 69  ? 63.012 28.844 42.395 1.00 48.01 ? 326 VAL A C   1 
ATOM   572  O  O   . VAL A 1 69  ? 62.269 29.738 41.992 1.00 47.40 ? 326 VAL A O   1 
ATOM   573  C  CB  . VAL A 1 69  ? 62.617 27.585 44.553 1.00 48.12 ? 326 VAL A CB  1 
ATOM   574  C  CG1 . VAL A 1 69  ? 62.124 28.913 45.143 1.00 46.94 ? 326 VAL A CG1 1 
ATOM   575  C  CG2 . VAL A 1 69  ? 61.880 26.403 45.193 1.00 47.43 ? 326 VAL A CG2 1 
ATOM   576  N  N   . SER A 1 70  ? 64.329 28.899 42.284 1.00 48.09 ? 327 SER A N   1 
ATOM   577  C  CA  . SER A 1 70  ? 64.988 30.076 41.746 1.00 48.67 ? 327 SER A CA  1 
ATOM   578  C  C   . SER A 1 70  ? 64.435 30.447 40.367 1.00 49.05 ? 327 SER A C   1 
ATOM   579  O  O   . SER A 1 70  ? 64.271 31.627 40.070 1.00 48.38 ? 327 SER A O   1 
ATOM   580  C  CB  . SER A 1 70  ? 66.509 29.880 41.706 1.00 48.48 ? 327 SER A CB  1 
ATOM   581  O  OG  . SER A 1 70  ? 67.055 29.931 43.024 1.00 48.81 ? 327 SER A OG  1 
ATOM   582  N  N   . GLU A 1 71  ? 64.124 29.431 39.555 1.00 49.62 ? 328 GLU A N   1 
ATOM   583  C  CA  . GLU A 1 71  ? 63.632 29.637 38.182 1.00 50.05 ? 328 GLU A CA  1 
ATOM   584  C  C   . GLU A 1 71  ? 62.151 30.024 38.161 1.00 49.24 ? 328 GLU A C   1 
ATOM   585  O  O   . GLU A 1 71  ? 61.677 30.615 37.195 1.00 49.49 ? 328 GLU A O   1 
ATOM   586  C  CB  . GLU A 1 71  ? 63.860 28.384 37.314 1.00 50.33 ? 328 GLU A CB  1 
ATOM   587  C  CG  . GLU A 1 71  ? 65.336 28.115 36.943 1.00 53.68 ? 328 GLU A CG  1 
ATOM   588  C  CD  . GLU A 1 71  ? 65.612 26.666 36.433 1.00 58.58 ? 328 GLU A CD  1 
ATOM   589  O  OE1 . GLU A 1 71  ? 64.711 25.794 36.497 1.00 62.07 ? 328 GLU A OE1 1 
ATOM   590  O  OE2 . GLU A 1 71  ? 66.747 26.391 35.977 1.00 62.00 ? 328 GLU A OE2 1 
ATOM   591  N  N   . GLY A 1 72  ? 61.431 29.685 39.223 1.00 48.27 ? 329 GLY A N   1 
ATOM   592  C  CA  . GLY A 1 72  ? 60.012 29.996 39.342 1.00 47.64 ? 329 GLY A CA  1 
ATOM   593  C  C   . GLY A 1 72  ? 59.674 31.297 40.043 1.00 46.93 ? 329 GLY A C   1 
ATOM   594  O  O   . GLY A 1 72  ? 58.518 31.679 40.092 1.00 46.59 ? 329 GLY A O   1 
ATOM   595  N  N   . LEU A 1 73  ? 60.665 31.980 40.595 1.00 46.92 ? 330 LEU A N   1 
ATOM   596  C  CA  . LEU A 1 73  ? 60.414 33.280 41.235 1.00 47.23 ? 330 LEU A CA  1 
ATOM   597  C  C   . LEU A 1 73  ? 59.963 34.310 40.203 1.00 47.67 ? 330 LEU A C   1 
ATOM   598  O  O   . LEU A 1 73  ? 60.179 34.140 39.006 1.00 47.84 ? 330 LEU A O   1 
ATOM   599  C  CB  . LEU A 1 73  ? 61.649 33.779 41.974 1.00 46.57 ? 330 LEU A CB  1 
ATOM   600  C  CG  . LEU A 1 73  ? 62.148 32.840 43.069 1.00 46.55 ? 330 LEU A CG  1 
ATOM   601  C  CD1 . LEU A 1 73  ? 63.330 33.479 43.819 1.00 44.74 ? 330 LEU A CD1 1 
ATOM   602  C  CD2 . LEU A 1 73  ? 61.002 32.434 44.021 1.00 43.79 ? 330 LEU A CD2 1 
ATOM   603  N  N   . HIS A 1 74  ? 59.313 35.364 40.672 1.00 48.32 ? 331 HIS A N   1 
ATOM   604  C  CA  . HIS A 1 74  ? 58.757 36.371 39.770 1.00 48.80 ? 331 HIS A CA  1 
ATOM   605  C  C   . HIS A 1 74  ? 59.841 36.936 38.847 1.00 49.59 ? 331 HIS A C   1 
ATOM   606  O  O   . HIS A 1 74  ? 60.920 37.291 39.313 1.00 48.80 ? 331 HIS A O   1 
ATOM   607  C  CB  . HIS A 1 74  ? 58.123 37.509 40.562 1.00 48.58 ? 331 HIS A CB  1 
ATOM   608  C  CG  . HIS A 1 74  ? 57.103 38.269 39.791 1.00 48.50 ? 331 HIS A CG  1 
ATOM   609  N  ND1 . HIS A 1 74  ? 57.430 39.109 38.749 1.00 48.00 ? 331 HIS A ND1 1 
ATOM   610  C  CD2 . HIS A 1 74  ? 55.753 38.302 39.898 1.00 46.70 ? 331 HIS A CD2 1 
ATOM   611  C  CE1 . HIS A 1 74  ? 56.323 39.618 38.247 1.00 47.41 ? 331 HIS A CE1 1 
ATOM   612  N  NE2 . HIS A 1 74  ? 55.293 39.144 38.926 1.00 45.75 ? 331 HIS A NE2 1 
ATOM   613  N  N   . PRO A 1 75  ? 59.561 37.006 37.529 1.00 50.65 ? 332 PRO A N   1 
ATOM   614  C  CA  . PRO A 1 75  ? 60.566 37.472 36.563 1.00 51.20 ? 332 PRO A CA  1 
ATOM   615  C  C   . PRO A 1 75  ? 60.959 38.951 36.639 1.00 51.73 ? 332 PRO A C   1 
ATOM   616  O  O   . PRO A 1 75  ? 62.026 39.284 36.154 1.00 52.37 ? 332 PRO A O   1 
ATOM   617  C  CB  . PRO A 1 75  ? 59.920 37.179 35.208 1.00 51.15 ? 332 PRO A CB  1 
ATOM   618  C  CG  . PRO A 1 75  ? 58.459 37.097 35.495 1.00 51.24 ? 332 PRO A CG  1 
ATOM   619  C  CD  . PRO A 1 75  ? 58.340 36.531 36.859 1.00 50.60 ? 332 PRO A CD  1 
ATOM   620  N  N   . ASP A 1 76  ? 60.149 39.819 37.251 1.00 52.25 ? 333 ASP A N   1 
ATOM   621  C  CA  . ASP A 1 76  ? 60.451 41.260 37.281 1.00 52.96 ? 333 ASP A CA  1 
ATOM   622  C  C   . ASP A 1 76  ? 61.563 41.704 38.237 1.00 53.38 ? 333 ASP A C   1 
ATOM   623  O  O   . ASP A 1 76  ? 62.014 42.833 38.155 1.00 54.29 ? 333 ASP A O   1 
ATOM   624  C  CB  . ASP A 1 76  ? 59.220 42.073 37.658 1.00 53.29 ? 333 ASP A CB  1 
ATOM   625  C  CG  . ASP A 1 76  ? 58.136 42.012 36.629 1.00 54.01 ? 333 ASP A CG  1 
ATOM   626  O  OD1 . ASP A 1 76  ? 58.339 41.401 35.542 1.00 53.47 ? 333 ASP A OD1 1 
ATOM   627  O  OD2 . ASP A 1 76  ? 57.066 42.595 36.932 1.00 55.07 ? 333 ASP A OD2 1 
ATOM   628  N  N   . ALA A 1 77  ? 61.986 40.858 39.157 1.00 53.62 ? 334 ALA A N   1 
ATOM   629  C  CA  . ALA A 1 77  ? 63.042 41.239 40.075 1.00 53.74 ? 334 ALA A CA  1 
ATOM   630  C  C   . ALA A 1 77  ? 64.136 40.206 40.061 1.00 53.72 ? 334 ALA A C   1 
ATOM   631  O  O   . ALA A 1 77  ? 63.873 39.023 39.872 1.00 54.13 ? 334 ALA A O   1 
ATOM   632  C  CB  . ALA A 1 77  ? 62.483 41.401 41.502 1.00 53.82 ? 334 ALA A CB  1 
ATOM   633  N  N   . LYS A 1 78  ? 65.369 40.666 40.242 1.00 53.79 ? 335 LYS A N   1 
ATOM   634  C  CA  . LYS A 1 78  ? 66.458 39.796 40.620 1.00 53.74 ? 335 LYS A CA  1 
ATOM   635  C  C   . LYS A 1 78  ? 66.318 39.505 42.111 1.00 52.65 ? 335 LYS A C   1 
ATOM   636  O  O   . LYS A 1 78  ? 66.236 40.424 42.919 1.00 52.00 ? 335 LYS A O   1 
ATOM   637  C  CB  . LYS A 1 78  ? 67.805 40.461 40.330 1.00 54.71 ? 335 LYS A CB  1 
ATOM   638  C  CG  . LYS A 1 78  ? 68.997 39.488 40.360 1.00 56.72 ? 335 LYS A CG  1 
ATOM   639  C  CD  . LYS A 1 78  ? 70.266 40.121 39.763 1.00 60.38 ? 335 LYS A CD  1 
ATOM   640  N  N   . TYR A 1 79  ? 66.272 38.226 42.474 1.00 51.54 ? 336 TYR A N   1 
ATOM   641  C  CA  . TYR A 1 79  ? 66.168 37.844 43.879 1.00 50.75 ? 336 TYR A CA  1 
ATOM   642  C  C   . TYR A 1 79  ? 67.518 37.374 44.401 1.00 50.33 ? 336 TYR A C   1 
ATOM   643  O  O   . TYR A 1 79  ? 68.215 36.626 43.721 1.00 50.76 ? 336 TYR A O   1 
ATOM   644  C  CB  . TYR A 1 79  ? 65.074 36.781 44.073 1.00 50.23 ? 336 TYR A CB  1 
ATOM   645  C  CG  . TYR A 1 79  ? 63.702 37.378 43.954 1.00 49.24 ? 336 TYR A CG  1 
ATOM   646  C  CD1 . TYR A 1 79  ? 63.099 38.001 45.041 1.00 46.99 ? 336 TYR A CD1 1 
ATOM   647  C  CD2 . TYR A 1 79  ? 63.025 37.375 42.740 1.00 48.71 ? 336 TYR A CD2 1 
ATOM   648  C  CE1 . TYR A 1 79  ? 61.853 38.587 44.927 1.00 46.71 ? 336 TYR A CE1 1 
ATOM   649  C  CE2 . TYR A 1 79  ? 61.779 37.952 42.621 1.00 48.41 ? 336 TYR A CE2 1 
ATOM   650  C  CZ  . TYR A 1 79  ? 61.201 38.561 43.716 1.00 48.33 ? 336 TYR A CZ  1 
ATOM   651  O  OH  . TYR A 1 79  ? 59.954 39.121 43.581 1.00 48.81 ? 336 TYR A OH  1 
ATOM   652  N  N   . ALA A 1 80  ? 67.891 37.849 45.584 1.00 49.81 ? 337 ALA A N   1 
ATOM   653  C  CA  . ALA A 1 80  ? 69.110 37.399 46.275 1.00 50.01 ? 337 ALA A CA  1 
ATOM   654  C  C   . ALA A 1 80  ? 68.763 36.230 47.193 1.00 50.25 ? 337 ALA A C   1 
ATOM   655  O  O   . ALA A 1 80  ? 67.764 36.261 47.909 1.00 49.13 ? 337 ALA A O   1 
ATOM   656  C  CB  . ALA A 1 80  ? 69.733 38.542 47.109 1.00 49.30 ? 337 ALA A CB  1 
ATOM   657  N  N   . LYS A 1 81  ? 69.601 35.204 47.148 1.00 51.08 ? 338 LYS A N   1 
ATOM   658  C  CA  A LYS A 1 81  ? 69.470 34.044 48.002 0.50 51.27 ? 338 LYS A CA  1 
ATOM   659  C  CA  B LYS A 1 81  ? 69.452 34.045 48.026 0.50 51.29 ? 338 LYS A CA  1 
ATOM   660  C  C   . LYS A 1 81  ? 70.001 34.459 49.368 1.00 51.19 ? 338 LYS A C   1 
ATOM   661  O  O   . LYS A 1 81  ? 71.178 34.786 49.488 1.00 51.74 ? 338 LYS A O   1 
ATOM   662  C  CB  A LYS A 1 81  ? 70.307 32.905 47.416 0.50 51.55 ? 338 LYS A CB  1 
ATOM   663  C  CB  B LYS A 1 81  ? 70.238 32.832 47.522 0.50 51.59 ? 338 LYS A CB  1 
ATOM   664  C  CG  A LYS A 1 81  ? 69.991 32.591 45.948 0.50 52.56 ? 338 LYS A CG  1 
ATOM   665  C  CG  B LYS A 1 81  ? 70.120 31.596 48.450 0.50 52.75 ? 338 LYS A CG  1 
ATOM   666  C  CD  A LYS A 1 81  ? 71.211 32.059 45.201 0.50 54.21 ? 338 LYS A CD  1 
ATOM   667  C  CD  B LYS A 1 81  ? 71.390 30.752 48.451 0.50 53.48 ? 338 LYS A CD  1 
ATOM   668  C  CE  A LYS A 1 81  ? 70.862 31.705 43.758 0.50 55.09 ? 338 LYS A CE  1 
ATOM   669  C  CE  B LYS A 1 81  ? 71.326 29.664 49.506 0.50 53.47 ? 338 LYS A CE  1 
ATOM   670  N  NZ  A LYS A 1 81  ? 72.019 31.058 43.069 0.50 55.87 ? 338 LYS A NZ  1 
ATOM   671  N  NZ  B LYS A 1 81  ? 72.436 28.686 49.321 0.50 53.47 ? 338 LYS A NZ  1 
ATOM   672  N  N   . VAL A 1 82  ? 69.148 34.474 50.386 1.00 50.65 ? 339 VAL A N   1 
ATOM   673  C  CA  . VAL A 1 82  ? 69.608 34.889 51.707 1.00 49.95 ? 339 VAL A CA  1 
ATOM   674  C  C   . VAL A 1 82  ? 70.056 33.690 52.540 1.00 49.83 ? 339 VAL A C   1 
ATOM   675  O  O   . VAL A 1 82  ? 71.118 33.732 53.158 1.00 49.66 ? 339 VAL A O   1 
ATOM   676  C  CB  . VAL A 1 82  ? 68.558 35.708 52.463 1.00 49.91 ? 339 VAL A CB  1 
ATOM   677  C  CG1 . VAL A 1 82  ? 69.043 36.005 53.894 1.00 47.83 ? 339 VAL A CG1 1 
ATOM   678  C  CG2 . VAL A 1 82  ? 68.254 37.015 51.696 1.00 48.63 ? 339 VAL A CG2 1 
ATOM   679  N  N   . LYS A 1 83  ? 69.260 32.624 52.549 1.00 49.13 ? 340 LYS A N   1 
ATOM   680  C  CA  . LYS A 1 83  ? 69.548 31.492 53.406 1.00 48.84 ? 340 LYS A CA  1 
ATOM   681  C  C   . LYS A 1 83  ? 68.785 30.240 52.995 1.00 48.27 ? 340 LYS A C   1 
ATOM   682  O  O   . LYS A 1 83  ? 67.642 30.315 52.572 1.00 47.43 ? 340 LYS A O   1 
ATOM   683  C  CB  . LYS A 1 83  ? 69.209 31.827 54.867 1.00 49.03 ? 340 LYS A CB  1 
ATOM   684  C  CG  . LYS A 1 83  ? 69.776 30.808 55.892 1.00 50.09 ? 340 LYS A CG  1 
ATOM   685  C  CD  . LYS A 1 83  ? 71.288 30.947 56.051 1.00 51.80 ? 340 LYS A CD  1 
ATOM   686  C  CE  . LYS A 1 83  ? 71.856 29.844 56.939 1.00 54.12 ? 340 LYS A CE  1 
ATOM   687  N  NZ  . LYS A 1 83  ? 73.271 30.107 57.348 1.00 54.49 ? 340 LYS A NZ  1 
ATOM   688  N  N   . LEU A 1 84  ? 69.460 29.104 53.143 1.00 47.70 ? 341 LEU A N   1 
ATOM   689  C  CA  . LEU A 1 84  ? 68.905 27.790 52.930 1.00 47.27 ? 341 LEU A CA  1 
ATOM   690  C  C   . LEU A 1 84  ? 69.187 26.971 54.187 1.00 46.96 ? 341 LEU A C   1 
ATOM   691  O  O   . LEU A 1 84  ? 70.273 27.045 54.739 1.00 46.54 ? 341 LEU A O   1 
ATOM   692  C  CB  . LEU A 1 84  ? 69.579 27.141 51.723 1.00 47.42 ? 341 LEU A CB  1 
ATOM   693  C  CG  . LEU A 1 84  ? 69.224 25.685 51.402 1.00 47.37 ? 341 LEU A CG  1 
ATOM   694  C  CD1 . LEU A 1 84  ? 69.524 25.428 49.936 1.00 46.16 ? 341 LEU A CD1 1 
ATOM   695  C  CD2 . LEU A 1 84  ? 69.963 24.686 52.333 1.00 45.72 ? 341 LEU A CD2 1 
ATOM   696  N  N   . ILE A 1 85  ? 68.201 26.201 54.645 1.00 46.69 ? 342 ILE A N   1 
ATOM   697  C  CA  . ILE A 1 85  ? 68.397 25.295 55.774 1.00 45.64 ? 342 ILE A CA  1 
ATOM   698  C  C   . ILE A 1 85  ? 67.572 24.028 55.522 1.00 45.79 ? 342 ILE A C   1 
ATOM   699  O  O   . ILE A 1 85  ? 66.434 24.087 55.053 1.00 44.81 ? 342 ILE A O   1 
ATOM   700  C  CB  . ILE A 1 85  ? 68.013 25.960 57.102 1.00 45.77 ? 342 ILE A CB  1 
ATOM   701  C  CG1 . ILE A 1 85  ? 68.368 25.059 58.310 1.00 46.25 ? 342 ILE A CG1 1 
ATOM   702  C  CG2 . ILE A 1 85  ? 66.534 26.327 57.122 1.00 44.43 ? 342 ILE A CG2 1 
ATOM   703  C  CD1 . ILE A 1 85  ? 69.889 24.920 58.583 1.00 43.51 ? 342 ILE A CD1 1 
ATOM   704  N  N   . ARG A 1 86  ? 68.175 22.881 55.816 1.00 45.53 ? 343 ARG A N   1 
ATOM   705  C  CA  . ARG A 1 86  ? 67.558 21.605 55.562 1.00 44.80 ? 343 ARG A CA  1 
ATOM   706  C  C   . ARG A 1 86  ? 67.883 20.638 56.685 1.00 44.45 ? 343 ARG A C   1 
ATOM   707  O  O   . ARG A 1 86  ? 69.024 20.571 57.126 1.00 44.77 ? 343 ARG A O   1 
ATOM   708  C  CB  . ARG A 1 86  ? 68.060 21.032 54.232 1.00 44.72 ? 343 ARG A CB  1 
ATOM   709  C  CG  . ARG A 1 86  ? 67.430 19.676 53.874 1.00 44.71 ? 343 ARG A CG  1 
ATOM   710  C  CD  . ARG A 1 86  ? 67.885 19.169 52.513 1.00 45.41 ? 343 ARG A CD  1 
ATOM   711  N  NE  . ARG A 1 86  ? 69.299 18.799 52.510 1.00 44.97 ? 343 ARG A NE  1 
ATOM   712  C  CZ  . ARG A 1 86  ? 69.788 17.698 53.075 1.00 45.58 ? 343 ARG A CZ  1 
ATOM   713  N  NH1 . ARG A 1 86  ? 68.983 16.843 53.702 1.00 46.16 ? 343 ARG A NH1 1 
ATOM   714  N  NH2 . ARG A 1 86  ? 71.091 17.448 53.024 1.00 46.30 ? 343 ARG A NH2 1 
ATOM   715  N  N   . LEU A 1 87  ? 66.870 19.905 57.141 1.00 44.19 ? 344 LEU A N   1 
ATOM   716  C  CA  . LEU A 1 87  ? 67.033 18.703 57.955 1.00 43.87 ? 344 LEU A CA  1 
ATOM   717  C  C   . LEU A 1 87  ? 66.329 17.551 57.209 1.00 44.09 ? 344 LEU A C   1 
ATOM   718  O  O   . LEU A 1 87  ? 65.107 17.543 57.110 1.00 44.00 ? 344 LEU A O   1 
ATOM   719  C  CB  . LEU A 1 87  ? 66.403 18.904 59.331 1.00 43.95 ? 344 LEU A CB  1 
ATOM   720  C  CG  . LEU A 1 87  ? 66.339 17.682 60.253 1.00 44.65 ? 344 LEU A CG  1 
ATOM   721  C  CD1 . LEU A 1 87  ? 67.745 17.120 60.543 1.00 42.88 ? 344 LEU A CD1 1 
ATOM   722  C  CD2 . LEU A 1 87  ? 65.589 18.013 61.540 1.00 44.86 ? 344 LEU A CD2 1 
ATOM   723  N  N   . VAL A 1 88  ? 67.111 16.609 56.669 1.00 44.06 ? 345 VAL A N   1 
ATOM   724  C  CA  . VAL A 1 88  ? 66.609 15.470 55.904 1.00 43.51 ? 345 VAL A CA  1 
ATOM   725  C  C   . VAL A 1 88  ? 65.718 15.992 54.766 1.00 43.89 ? 345 VAL A C   1 
ATOM   726  O  O   . VAL A 1 88  ? 66.233 16.602 53.825 1.00 44.11 ? 345 VAL A O   1 
ATOM   727  C  CB  . VAL A 1 88  ? 65.952 14.415 56.849 1.00 43.95 ? 345 VAL A CB  1 
ATOM   728  C  CG1 . VAL A 1 88  ? 65.552 13.131 56.105 1.00 42.22 ? 345 VAL A CG1 1 
ATOM   729  C  CG2 . VAL A 1 88  ? 66.909 14.093 57.999 1.00 42.04 ? 345 VAL A CG2 1 
ATOM   730  N  N   . GLY A 1 89  ? 64.404 15.811 54.841 1.00 43.85 ? 346 GLY A N   1 
ATOM   731  C  CA  . GLY A 1 89  ? 63.534 16.268 53.763 1.00 43.71 ? 346 GLY A CA  1 
ATOM   732  C  C   . GLY A 1 89  ? 62.852 17.606 53.996 1.00 43.81 ? 346 GLY A C   1 
ATOM   733  O  O   . GLY A 1 89  ? 62.066 18.049 53.152 1.00 43.42 ? 346 GLY A O   1 
ATOM   734  N  N   . ILE A 1 90  ? 63.144 18.243 55.132 1.00 43.79 ? 347 ILE A N   1 
ATOM   735  C  CA  . ILE A 1 90  ? 62.525 19.512 55.503 1.00 43.89 ? 347 ILE A CA  1 
ATOM   736  C  C   . ILE A 1 90  ? 63.491 20.634 55.134 1.00 44.34 ? 347 ILE A C   1 
ATOM   737  O  O   . ILE A 1 90  ? 64.573 20.729 55.710 1.00 44.67 ? 347 ILE A O   1 
ATOM   738  C  CB  . ILE A 1 90  ? 62.187 19.565 57.015 1.00 43.68 ? 347 ILE A CB  1 
ATOM   739  C  CG1 . ILE A 1 90  ? 61.473 18.279 57.456 1.00 43.50 ? 347 ILE A CG1 1 
ATOM   740  C  CG2 . ILE A 1 90  ? 61.291 20.761 57.315 1.00 43.46 ? 347 ILE A CG2 1 
ATOM   741  C  CD1 . ILE A 1 90  ? 61.249 18.161 58.940 1.00 43.17 ? 347 ILE A CD1 1 
ATOM   742  N  N   . MET A 1 91  ? 63.108 21.468 54.165 1.00 44.54 ? 348 MET A N   1 
ATOM   743  C  CA  . MET A 1 91  ? 63.984 22.515 53.641 1.00 44.32 ? 348 MET A CA  1 
ATOM   744  C  C   . MET A 1 91  ? 63.239 23.841 53.587 1.00 44.49 ? 348 MET A C   1 
ATOM   745  O  O   . MET A 1 91  ? 62.078 23.884 53.185 1.00 44.95 ? 348 MET A O   1 
ATOM   746  C  CB  . MET A 1 91  ? 64.506 22.163 52.253 1.00 44.28 ? 348 MET A CB  1 
ATOM   747  C  CG  . MET A 1 91  ? 65.519 23.175 51.719 1.00 45.43 ? 348 MET A CG  1 
ATOM   748  S  SD  . MET A 1 91  ? 66.489 22.622 50.286 1.00 46.76 ? 348 MET A SD  1 
ATOM   749  C  CE  . MET A 1 91  ? 65.301 22.925 48.961 1.00 43.77 ? 348 MET A CE  1 
ATOM   750  N  N   . LEU A 1 92  ? 63.909 24.914 54.014 1.00 44.00 ? 349 LEU A N   1 
ATOM   751  C  CA  . LEU A 1 92  ? 63.360 26.244 53.948 1.00 43.67 ? 349 LEU A CA  1 
ATOM   752  C  C   . LEU A 1 92  ? 64.344 27.178 53.229 1.00 43.98 ? 349 LEU A C   1 
ATOM   753  O  O   . LEU A 1 92  ? 65.541 27.157 53.510 1.00 44.07 ? 349 LEU A O   1 
ATOM   754  C  CB  . LEU A 1 92  ? 63.030 26.740 55.343 1.00 43.06 ? 349 LEU A CB  1 
ATOM   755  C  CG  . LEU A 1 92  ? 62.385 28.128 55.419 1.00 43.35 ? 349 LEU A CG  1 
ATOM   756  C  CD1 . LEU A 1 92  ? 61.030 28.205 54.696 1.00 42.01 ? 349 LEU A CD1 1 
ATOM   757  C  CD2 . LEU A 1 92  ? 62.265 28.593 56.857 1.00 40.38 ? 349 LEU A CD2 1 
ATOM   758  N  N   . LEU A 1 93  ? 63.822 27.982 52.296 1.00 44.10 ? 350 LEU A N   1 
ATOM   759  C  CA  . LEU A 1 93  ? 64.625 28.926 51.516 1.00 43.94 ? 350 LEU A CA  1 
ATOM   760  C  C   . LEU A 1 93  ? 64.126 30.324 51.755 1.00 44.30 ? 350 LEU A C   1 
ATOM   761  O  O   . LEU A 1 93  ? 62.918 30.544 51.749 1.00 44.19 ? 350 LEU A O   1 
ATOM   762  C  CB  . LEU A 1 93  ? 64.501 28.637 50.019 1.00 44.09 ? 350 LEU A CB  1 
ATOM   763  C  CG  . LEU A 1 93  ? 64.785 27.201 49.576 1.00 43.95 ? 350 LEU A CG  1 
ATOM   764  C  CD1 . LEU A 1 93  ? 64.366 27.005 48.135 1.00 43.70 ? 350 LEU A CD1 1 
ATOM   765  C  CD2 . LEU A 1 93  ? 66.272 26.880 49.793 1.00 43.35 ? 350 LEU A CD2 1 
ATOM   766  N  N   . LEU A 1 94  ? 65.046 31.275 51.951 1.00 44.76 ? 351 LEU A N   1 
ATOM   767  C  CA  . LEU A 1 94  ? 64.690 32.685 52.070 1.00 45.02 ? 351 LEU A CA  1 
ATOM   768  C  C   . LEU A 1 94  ? 65.382 33.480 50.953 1.00 45.52 ? 351 LEU A C   1 
ATOM   769  O  O   . LEU A 1 94  ? 66.592 33.400 50.790 1.00 45.96 ? 351 LEU A O   1 
ATOM   770  C  CB  . LEU A 1 94  ? 65.082 33.215 53.442 1.00 44.70 ? 351 LEU A CB  1 
ATOM   771  C  CG  . LEU A 1 94  ? 64.857 34.708 53.696 1.00 45.36 ? 351 LEU A CG  1 
ATOM   772  C  CD1 . LEU A 1 94  ? 63.367 35.017 53.715 1.00 42.40 ? 351 LEU A CD1 1 
ATOM   773  C  CD2 . LEU A 1 94  ? 65.540 35.185 54.992 1.00 43.38 ? 351 LEU A CD2 1 
ATOM   774  N  N   . TYR A 1 95  ? 64.598 34.212 50.163 1.00 45.89 ? 352 TYR A N   1 
ATOM   775  C  CA  . TYR A 1 95  ? 65.129 35.126 49.148 1.00 45.61 ? 352 TYR A CA  1 
ATOM   776  C  C   . TYR A 1 95  ? 64.558 36.523 49.394 1.00 46.00 ? 352 TYR A C   1 
ATOM   777  O  O   . TYR A 1 95  ? 63.438 36.645 49.897 1.00 46.28 ? 352 TYR A O   1 
ATOM   778  C  CB  . TYR A 1 95  ? 64.675 34.747 47.750 1.00 45.28 ? 352 TYR A CB  1 
ATOM   779  C  CG  . TYR A 1 95  ? 64.982 33.370 47.204 1.00 44.39 ? 352 TYR A CG  1 
ATOM   780  C  CD1 . TYR A 1 95  ? 65.952 33.194 46.224 1.00 43.69 ? 352 TYR A CD1 1 
ATOM   781  C  CD2 . TYR A 1 95  ? 64.231 32.269 47.579 1.00 45.10 ? 352 TYR A CD2 1 
ATOM   782  C  CE1 . TYR A 1 95  ? 66.198 31.960 45.680 1.00 44.13 ? 352 TYR A CE1 1 
ATOM   783  C  CE2 . TYR A 1 95  ? 64.470 31.018 47.029 1.00 45.23 ? 352 TYR A CE2 1 
ATOM   784  C  CZ  . TYR A 1 95  ? 65.449 30.874 46.077 1.00 44.96 ? 352 TYR A CZ  1 
ATOM   785  O  OH  . TYR A 1 95  ? 65.680 29.636 45.523 1.00 45.27 ? 352 TYR A OH  1 
ATOM   786  N  N   . VAL A 1 96  ? 65.307 37.563 49.033 1.00 46.15 ? 353 VAL A N   1 
ATOM   787  C  CA  . VAL A 1 96  ? 64.778 38.938 49.051 1.00 46.69 ? 353 VAL A CA  1 
ATOM   788  C  C   . VAL A 1 96  ? 65.139 39.607 47.735 1.00 46.75 ? 353 VAL A C   1 
ATOM   789  O  O   . VAL A 1 96  ? 66.160 39.269 47.145 1.00 46.65 ? 353 VAL A O   1 
ATOM   790  C  CB  . VAL A 1 96  ? 65.327 39.781 50.268 1.00 47.13 ? 353 VAL A CB  1 
ATOM   791  C  CG1 . VAL A 1 96  ? 65.191 38.995 51.579 1.00 47.27 ? 353 VAL A CG1 1 
ATOM   792  C  CG2 . VAL A 1 96  ? 66.764 40.185 50.052 1.00 46.33 ? 353 VAL A CG2 1 
ATOM   793  N  N   . LYS A 1 97  ? 64.307 40.527 47.246 1.00 47.49 ? 354 LYS A N   1 
ATOM   794  C  CA  . LYS A 1 97  ? 64.713 41.324 46.064 1.00 48.06 ? 354 LYS A CA  1 
ATOM   795  C  C   . LYS A 1 97  ? 66.100 41.897 46.326 1.00 48.13 ? 354 LYS A C   1 
ATOM   796  O  O   . LYS A 1 97  ? 66.405 42.287 47.444 1.00 47.32 ? 354 LYS A O   1 
ATOM   797  C  CB  . LYS A 1 97  ? 63.788 42.511 45.801 1.00 48.26 ? 354 LYS A CB  1 
ATOM   798  C  CG  . LYS A 1 97  ? 62.401 42.224 45.307 1.00 48.81 ? 354 LYS A CG  1 
ATOM   799  C  CD  . LYS A 1 97  ? 61.681 43.552 45.034 1.00 50.65 ? 354 LYS A CD  1 
ATOM   800  C  CE  . LYS A 1 97  ? 60.308 43.366 44.382 1.00 52.74 ? 354 LYS A CE  1 
ATOM   801  N  NZ  . LYS A 1 97  ? 59.394 44.537 44.615 1.00 54.67 ? 354 LYS A NZ  1 
ATOM   802  N  N   . GLN A 1 98  ? 66.922 41.952 45.288 1.00 49.26 ? 355 GLN A N   1 
ATOM   803  C  CA  . GLN A 1 98  ? 68.299 42.451 45.407 1.00 50.17 ? 355 GLN A CA  1 
ATOM   804  C  C   . GLN A 1 98  ? 68.375 43.825 46.106 1.00 50.07 ? 355 GLN A C   1 
ATOM   805  O  O   . GLN A 1 98  ? 69.170 44.010 47.037 1.00 49.80 ? 355 GLN A O   1 
ATOM   806  C  CB  . GLN A 1 98  ? 68.973 42.517 44.024 1.00 50.61 ? 355 GLN A CB  1 
ATOM   807  C  CG  . GLN A 1 98  ? 70.486 42.701 44.066 1.00 52.32 ? 355 GLN A CG  1 
ATOM   808  C  CD  . GLN A 1 98  ? 71.190 41.629 44.893 1.00 55.35 ? 355 GLN A CD  1 
ATOM   809  O  OE1 . GLN A 1 98  ? 71.137 40.435 44.564 1.00 57.48 ? 355 GLN A OE1 1 
ATOM   810  N  NE2 . GLN A 1 98  ? 71.840 42.048 45.983 1.00 54.98 ? 355 GLN A NE2 1 
ATOM   811  N  N   . GLU A 1 99  ? 67.530 44.762 45.683 1.00 49.85 ? 356 GLU A N   1 
ATOM   812  C  CA  . GLU A 1 99  ? 67.504 46.097 46.295 1.00 50.23 ? 356 GLU A CA  1 
ATOM   813  C  C   . GLU A 1 99  ? 67.268 46.094 47.814 1.00 50.18 ? 356 GLU A C   1 
ATOM   814  O  O   . GLU A 1 99  ? 67.673 47.028 48.480 1.00 50.97 ? 356 GLU A O   1 
ATOM   815  C  CB  . GLU A 1 99  ? 66.496 47.021 45.594 1.00 49.89 ? 356 GLU A CB  1 
ATOM   816  C  CG  . GLU A 1 99  ? 65.036 46.620 45.759 1.00 51.35 ? 356 GLU A CG  1 
ATOM   817  C  CD  . GLU A 1 99  ? 64.095 47.435 44.885 1.00 51.20 ? 356 GLU A CD  1 
ATOM   818  O  OE1 . GLU A 1 99  ? 63.661 46.927 43.833 1.00 53.76 ? 356 GLU A OE1 1 
ATOM   819  O  OE2 . GLU A 1 99  ? 63.815 48.591 45.234 1.00 51.37 ? 356 GLU A OE2 1 
ATOM   820  N  N   . HIS A 1 100 ? 66.645 45.051 48.366 1.00 50.28 ? 357 HIS A N   1 
ATOM   821  C  CA  . HIS A 1 100 ? 66.405 44.979 49.813 1.00 50.11 ? 357 HIS A CA  1 
ATOM   822  C  C   . HIS A 1 100 ? 67.484 44.226 50.589 1.00 49.88 ? 357 HIS A C   1 
ATOM   823  O  O   . HIS A 1 100 ? 67.460 44.246 51.815 1.00 49.40 ? 357 HIS A O   1 
ATOM   824  C  CB  . HIS A 1 100 ? 65.065 44.303 50.126 1.00 50.36 ? 357 HIS A CB  1 
ATOM   825  C  CG  . HIS A 1 100 ? 63.877 44.958 49.493 1.00 51.83 ? 357 HIS A CG  1 
ATOM   826  N  ND1 . HIS A 1 100 ? 63.770 46.320 49.328 1.00 51.25 ? 357 HIS A ND1 1 
ATOM   827  C  CD2 . HIS A 1 100 ? 62.732 44.426 48.996 1.00 53.11 ? 357 HIS A CD2 1 
ATOM   828  C  CE1 . HIS A 1 100 ? 62.615 46.600 48.750 1.00 52.70 ? 357 HIS A CE1 1 
ATOM   829  N  NE2 . HIS A 1 100 ? 61.964 45.467 48.542 1.00 52.72 ? 357 HIS A NE2 1 
ATOM   830  N  N   . ALA A 1 101 ? 68.407 43.556 49.897 1.00 49.86 ? 358 ALA A N   1 
ATOM   831  C  CA  . ALA A 1 101 ? 69.381 42.660 50.558 1.00 50.21 ? 358 ALA A CA  1 
ATOM   832  C  C   . ALA A 1 101 ? 70.290 43.357 51.582 1.00 50.08 ? 358 ALA A C   1 
ATOM   833  O  O   . ALA A 1 101 ? 70.587 42.800 52.618 1.00 50.75 ? 358 ALA A O   1 
ATOM   834  C  CB  . ALA A 1 101 ? 70.240 41.904 49.503 1.00 49.68 ? 358 ALA A CB  1 
ATOM   835  N  N   . ALA A 1 102 ? 70.717 44.575 51.301 1.00 50.64 ? 359 ALA A N   1 
ATOM   836  C  CA  . ALA A 1 102 ? 71.568 45.336 52.237 1.00 51.09 ? 359 ALA A CA  1 
ATOM   837  C  C   . ALA A 1 102 ? 70.897 45.618 53.597 1.00 51.48 ? 359 ALA A C   1 
ATOM   838  O  O   . ALA A 1 102 ? 71.588 45.939 54.562 1.00 52.10 ? 359 ALA A O   1 
ATOM   839  C  CB  . ALA A 1 102 ? 72.037 46.657 51.596 1.00 50.36 ? 359 ALA A CB  1 
ATOM   840  N  N   . TYR A 1 103 ? 69.574 45.489 53.681 1.00 51.37 ? 360 TYR A N   1 
ATOM   841  C  CA  . TYR A 1 103 ? 68.862 45.717 54.931 1.00 51.73 ? 360 TYR A CA  1 
ATOM   842  C  C   . TYR A 1 103 ? 68.488 44.429 55.664 1.00 51.54 ? 360 TYR A C   1 
ATOM   843  O  O   . TYR A 1 103 ? 67.682 44.447 56.598 1.00 51.93 ? 360 TYR A O   1 
ATOM   844  C  CB  . TYR A 1 103 ? 67.631 46.587 54.658 1.00 52.28 ? 360 TYR A CB  1 
ATOM   845  C  CG  . TYR A 1 103 ? 68.022 47.884 54.007 1.00 53.87 ? 360 TYR A CG  1 
ATOM   846  C  CD1 . TYR A 1 103 ? 68.499 48.949 54.773 1.00 56.86 ? 360 TYR A CD1 1 
ATOM   847  C  CD2 . TYR A 1 103 ? 67.984 48.032 52.633 1.00 55.38 ? 360 TYR A CD2 1 
ATOM   848  C  CE1 . TYR A 1 103 ? 68.900 50.140 54.181 1.00 57.24 ? 360 TYR A CE1 1 
ATOM   849  C  CE2 . TYR A 1 103 ? 68.385 49.216 52.027 1.00 56.99 ? 360 TYR A CE2 1 
ATOM   850  C  CZ  . TYR A 1 103 ? 68.843 50.265 52.812 1.00 58.59 ? 360 TYR A CZ  1 
ATOM   851  O  OH  . TYR A 1 103 ? 69.229 51.445 52.229 1.00 61.45 ? 360 TYR A OH  1 
ATOM   852  N  N   . ILE A 1 104 ? 69.079 43.318 55.243 1.00 51.32 ? 361 ILE A N   1 
ATOM   853  C  CA  . ILE A 1 104 ? 68.929 42.039 55.923 1.00 51.38 ? 361 ILE A CA  1 
ATOM   854  C  C   . ILE A 1 104 ? 70.150 41.841 56.838 1.00 51.08 ? 361 ILE A C   1 
ATOM   855  O  O   . ILE A 1 104 ? 71.268 41.943 56.388 1.00 51.05 ? 361 ILE A O   1 
ATOM   856  C  CB  . ILE A 1 104 ? 68.861 40.865 54.896 1.00 51.47 ? 361 ILE A CB  1 
ATOM   857  C  CG1 . ILE A 1 104 ? 67.578 40.933 54.062 1.00 51.66 ? 361 ILE A CG1 1 
ATOM   858  C  CG2 . ILE A 1 104 ? 68.923 39.521 55.605 1.00 50.85 ? 361 ILE A CG2 1 
ATOM   859  C  CD1 . ILE A 1 104 ? 66.327 40.527 54.832 1.00 51.60 ? 361 ILE A CD1 1 
ATOM   860  N  N   . SER A 1 105 ? 69.938 41.567 58.116 1.00 50.93 ? 362 SER A N   1 
ATOM   861  C  CA  . SER A 1 105 ? 71.043 41.249 59.018 1.00 50.78 ? 362 SER A CA  1 
ATOM   862  C  C   . SER A 1 105 ? 70.632 40.176 60.026 1.00 51.01 ? 362 SER A C   1 
ATOM   863  O  O   . SER A 1 105 ? 69.456 39.783 60.085 1.00 50.33 ? 362 SER A O   1 
ATOM   864  C  CB  . SER A 1 105 ? 71.541 42.511 59.733 1.00 50.56 ? 362 SER A CB  1 
ATOM   865  O  OG  . SER A 1 105 ? 70.510 43.114 60.498 1.00 50.73 ? 362 SER A OG  1 
ATOM   866  N  N   . GLU A 1 106 ? 71.618 39.691 60.789 1.00 51.27 ? 363 GLU A N   1 
ATOM   867  C  CA  . GLU A 1 106 ? 71.397 38.706 61.870 1.00 51.92 ? 363 GLU A CA  1 
ATOM   868  C  C   . GLU A 1 106 ? 70.637 37.455 61.413 1.00 51.04 ? 363 GLU A C   1 
ATOM   869  O  O   . GLU A 1 106 ? 69.691 37.008 62.070 1.00 50.32 ? 363 GLU A O   1 
ATOM   870  C  CB  . GLU A 1 106 ? 70.662 39.357 63.050 1.00 52.26 ? 363 GLU A CB  1 
ATOM   871  C  CG  . GLU A 1 106 ? 71.353 40.596 63.591 1.00 56.31 ? 363 GLU A CG  1 
ATOM   872  C  CD  . GLU A 1 106 ? 70.591 41.230 64.748 1.00 61.84 ? 363 GLU A CD  1 
ATOM   873  O  OE1 . GLU A 1 106 ? 69.446 40.785 65.038 1.00 63.95 ? 363 GLU A OE1 1 
ATOM   874  O  OE2 . GLU A 1 106 ? 71.147 42.166 65.371 1.00 66.01 ? 363 GLU A OE2 1 
ATOM   875  N  N   . VAL A 1 107 ? 71.069 36.907 60.281 1.00 50.76 ? 364 VAL A N   1 
ATOM   876  C  CA  . VAL A 1 107 ? 70.499 35.686 59.731 1.00 50.23 ? 364 VAL A CA  1 
ATOM   877  C  C   . VAL A 1 107 ? 70.999 34.494 60.521 1.00 50.37 ? 364 VAL A C   1 
ATOM   878  O  O   . VAL A 1 107 ? 72.198 34.257 60.590 1.00 50.49 ? 364 VAL A O   1 
ATOM   879  C  CB  . VAL A 1 107 ? 70.881 35.495 58.254 1.00 50.15 ? 364 VAL A CB  1 
ATOM   880  C  CG1 . VAL A 1 107 ? 70.287 34.197 57.720 1.00 49.17 ? 364 VAL A CG1 1 
ATOM   881  C  CG2 . VAL A 1 107 ? 70.417 36.700 57.412 1.00 49.04 ? 364 VAL A CG2 1 
ATOM   882  N  N   . GLU A 1 108 ? 70.079 33.757 61.125 1.00 50.41 ? 365 GLU A N   1 
ATOM   883  C  CA  . GLU A 1 108 ? 70.414 32.519 61.809 1.00 51.00 ? 365 GLU A CA  1 
ATOM   884  C  C   . GLU A 1 108 ? 69.437 31.436 61.361 1.00 51.03 ? 365 GLU A C   1 
ATOM   885  O  O   . GLU A 1 108 ? 68.271 31.735 61.110 1.00 51.66 ? 365 GLU A O   1 
ATOM   886  C  CB  . GLU A 1 108 ? 70.317 32.711 63.319 1.00 51.32 ? 365 GLU A CB  1 
ATOM   887  C  CG  . GLU A 1 108 ? 71.211 33.807 63.885 1.00 53.24 ? 365 GLU A CG  1 
ATOM   888  C  CD  . GLU A 1 108 ? 72.698 33.496 63.741 1.00 56.07 ? 365 GLU A CD  1 
ATOM   889  O  OE1 . GLU A 1 108 ? 73.057 32.294 63.702 1.00 56.11 ? 365 GLU A OE1 1 
ATOM   890  O  OE2 . GLU A 1 108 ? 73.494 34.464 63.648 1.00 57.60 ? 365 GLU A OE2 1 
ATOM   891  N  N   . ALA A 1 109 ? 69.898 30.188 61.272 1.00 50.67 ? 366 ALA A N   1 
ATOM   892  C  CA  . ALA A 1 109 ? 69.020 29.073 60.926 1.00 50.55 ? 366 ALA A CA  1 
ATOM   893  C  C   . ALA A 1 109 ? 69.284 27.871 61.818 1.00 50.60 ? 366 ALA A C   1 
ATOM   894  O  O   . ALA A 1 109 ? 70.424 27.579 62.133 1.00 51.39 ? 366 ALA A O   1 
ATOM   895  C  CB  . ALA A 1 109 ? 69.196 28.694 59.459 1.00 50.46 ? 366 ALA A CB  1 
ATOM   896  N  N   . GLU A 1 110 ? 68.234 27.164 62.218 1.00 50.48 ? 367 GLU A N   1 
ATOM   897  C  CA  . GLU A 1 110 ? 68.380 25.999 63.084 1.00 50.90 ? 367 GLU A CA  1 
ATOM   898  C  C   . GLU A 1 110 ? 67.335 24.945 62.742 1.00 49.48 ? 367 GLU A C   1 
ATOM   899  O  O   . GLU A 1 110 ? 66.395 25.233 62.019 1.00 48.93 ? 367 GLU A O   1 
ATOM   900  C  CB  . GLU A 1 110 ? 68.219 26.402 64.552 1.00 51.84 ? 367 GLU A CB  1 
ATOM   901  C  CG  . GLU A 1 110 ? 69.306 27.311 65.112 1.00 56.07 ? 367 GLU A CG  1 
ATOM   902  C  CD  . GLU A 1 110 ? 70.620 26.596 65.440 1.00 60.47 ? 367 GLU A CD  1 
ATOM   903  O  OE1 . GLU A 1 110 ? 70.588 25.394 65.798 1.00 62.18 ? 367 GLU A OE1 1 
ATOM   904  O  OE2 . GLU A 1 110 ? 71.680 27.265 65.347 1.00 63.49 ? 367 GLU A OE2 1 
ATOM   905  N  N   . THR A 1 111 ? 67.498 23.744 63.298 1.00 48.30 ? 368 THR A N   1 
ATOM   906  C  CA  . THR A 1 111 ? 66.608 22.595 63.024 1.00 47.66 ? 368 THR A CA  1 
ATOM   907  C  C   . THR A 1 111 ? 66.327 21.807 64.311 1.00 47.33 ? 368 THR A C   1 
ATOM   908  O  O   . THR A 1 111 ? 67.140 21.802 65.222 1.00 47.06 ? 368 THR A O   1 
ATOM   909  C  CB  . THR A 1 111 ? 67.228 21.612 61.960 1.00 47.61 ? 368 THR A CB  1 
ATOM   910  O  OG1 . THR A 1 111 ? 68.289 20.852 62.553 1.00 47.50 ? 368 THR A OG1 1 
ATOM   911  C  CG2 . THR A 1 111 ? 67.783 22.370 60.741 1.00 45.25 ? 368 THR A CG2 1 
ATOM   912  N  N   . VAL A 1 112 ? 65.173 21.151 64.374 1.00 47.04 ? 369 VAL A N   1 
ATOM   913  C  CA  . VAL A 1 112 ? 64.813 20.298 65.497 1.00 46.98 ? 369 VAL A CA  1 
ATOM   914  C  C   . VAL A 1 112 ? 64.126 19.049 64.946 1.00 47.62 ? 369 VAL A C   1 
ATOM   915  O  O   . VAL A 1 112 ? 63.061 19.151 64.343 1.00 48.03 ? 369 VAL A O   1 
ATOM   916  C  CB  . VAL A 1 112 ? 63.835 21.004 66.474 1.00 47.06 ? 369 VAL A CB  1 
ATOM   917  C  CG1 . VAL A 1 112 ? 63.304 20.035 67.506 1.00 46.74 ? 369 VAL A CG1 1 
ATOM   918  C  CG2 . VAL A 1 112 ? 64.496 22.192 67.166 1.00 46.46 ? 369 VAL A CG2 1 
ATOM   919  N  N   . GLY A 1 113 ? 64.729 17.878 65.133 1.00 47.75 ? 370 GLY A N   1 
ATOM   920  C  CA  . GLY A 1 113 ? 64.103 16.638 64.706 1.00 48.19 ? 370 GLY A CA  1 
ATOM   921  C  C   . GLY A 1 113 ? 63.183 16.121 65.785 1.00 48.75 ? 370 GLY A C   1 
ATOM   922  O  O   . GLY A 1 113 ? 63.537 16.149 66.965 1.00 49.48 ? 370 GLY A O   1 
ATOM   923  N  N   . THR A 1 114 ? 62.002 15.654 65.391 1.00 49.08 ? 371 THR A N   1 
ATOM   924  C  CA  . THR A 1 114 ? 60.978 15.178 66.333 1.00 48.97 ? 371 THR A CA  1 
ATOM   925  C  C   . THR A 1 114 ? 60.352 13.884 65.845 1.00 49.38 ? 371 THR A C   1 
ATOM   926  O  O   . THR A 1 114 ? 59.206 13.586 66.193 1.00 48.97 ? 371 THR A O   1 
ATOM   927  C  CB  . THR A 1 114 ? 59.810 16.201 66.485 1.00 49.02 ? 371 THR A CB  1 
ATOM   928  O  OG1 . THR A 1 114 ? 58.994 16.195 65.303 1.00 49.30 ? 371 THR A OG1 1 
ATOM   929  C  CG2 . THR A 1 114 ? 60.333 17.586 66.721 1.00 47.82 ? 371 THR A CG2 1 
ATOM   930  N  N   . GLY A 1 115 ? 61.091 13.143 65.014 1.00 49.92 ? 372 GLY A N   1 
ATOM   931  C  CA  . GLY A 1 115 ? 60.608 11.896 64.423 1.00 50.07 ? 372 GLY A CA  1 
ATOM   932  C  C   . GLY A 1 115 ? 61.062 10.704 65.247 1.00 50.43 ? 372 GLY A C   1 
ATOM   933  O  O   . GLY A 1 115 ? 60.815 10.657 66.448 1.00 49.97 ? 372 GLY A O   1 
ATOM   934  N  N   . ILE A 1 116 ? 61.759 9.761  64.612 1.00 51.16 ? 373 ILE A N   1 
ATOM   935  C  CA  . ILE A 1 116 ? 62.109 8.500  65.255 1.00 51.61 ? 373 ILE A CA  1 
ATOM   936  C  C   . ILE A 1 116 ? 62.883 8.727  66.552 1.00 52.44 ? 373 ILE A C   1 
ATOM   937  O  O   . ILE A 1 116 ? 63.836 9.500  66.591 1.00 52.04 ? 373 ILE A O   1 
ATOM   938  C  CB  . ILE A 1 116 ? 62.885 7.553  64.326 1.00 51.61 ? 373 ILE A CB  1 
ATOM   939  C  CG1 . ILE A 1 116 ? 62.020 7.121  63.131 1.00 51.20 ? 373 ILE A CG1 1 
ATOM   940  C  CG2 . ILE A 1 116 ? 63.345 6.297  65.101 1.00 51.58 ? 373 ILE A CG2 1 
ATOM   941  C  CD1 . ILE A 1 116 ? 60.797 6.291  63.487 1.00 49.48 ? 373 ILE A CD1 1 
ATOM   942  N  N   . MET A 1 117 ? 62.415 8.064  67.612 1.00 53.77 ? 374 MET A N   1 
ATOM   943  C  CA  . MET A 1 117 ? 62.906 8.230  68.983 1.00 54.96 ? 374 MET A CA  1 
ATOM   944  C  C   . MET A 1 117 ? 62.834 9.666  69.492 1.00 54.68 ? 374 MET A C   1 
ATOM   945  O  O   . MET A 1 117 ? 63.590 10.074 70.371 1.00 54.87 ? 374 MET A O   1 
ATOM   946  C  CB  . MET A 1 117 ? 64.301 7.638  69.112 1.00 56.11 ? 374 MET A CB  1 
ATOM   947  C  CG  . MET A 1 117 ? 64.275 6.140  68.820 1.00 60.63 ? 374 MET A CG  1 
ATOM   948  S  SD  . MET A 1 117 ? 65.883 5.350  68.943 1.00 71.64 ? 374 MET A SD  1 
ATOM   949  C  CE  . MET A 1 117 ? 65.522 3.777  68.115 1.00 71.57 ? 374 MET A CE  1 
ATOM   950  N  N   . GLY A 1 118 ? 61.888 10.423 68.942 1.00 54.19 ? 375 GLY A N   1 
ATOM   951  C  CA  . GLY A 1 118 ? 61.687 11.813 69.308 1.00 53.46 ? 375 GLY A CA  1 
ATOM   952  C  C   . GLY A 1 118 ? 62.797 12.747 68.877 1.00 52.94 ? 375 GLY A C   1 
ATOM   953  O  O   . GLY A 1 118 ? 62.806 13.898 69.303 1.00 52.57 ? 375 GLY A O   1 
ATOM   954  N  N   . ARG A 1 119 ? 63.715 12.288 68.019 1.00 52.36 ? 376 ARG A N   1 
ATOM   955  C  CA  A ARG A 1 119 ? 64.946 13.042 67.719 0.50 52.09 ? 376 ARG A CA  1 
ATOM   956  C  CA  B ARG A 1 119 ? 64.882 13.108 67.701 0.50 52.17 ? 376 ARG A CA  1 
ATOM   957  C  C   . ARG A 1 119 ? 65.355 13.059 66.246 1.00 51.50 ? 376 ARG A C   1 
ATOM   958  O  O   . ARG A 1 119 ? 65.969 14.006 65.787 1.00 51.32 ? 376 ARG A O   1 
ATOM   959  C  CB  A ARG A 1 119 ? 66.109 12.478 68.549 0.50 52.30 ? 376 ARG A CB  1 
ATOM   960  C  CB  B ARG A 1 119 ? 66.024 12.786 68.674 0.50 52.45 ? 376 ARG A CB  1 
ATOM   961  C  CG  A ARG A 1 119 ? 65.985 12.742 70.044 0.50 53.07 ? 376 ARG A CG  1 
ATOM   962  C  CG  B ARG A 1 119 ? 66.772 14.035 69.133 0.50 53.57 ? 376 ARG A CG  1 
ATOM   963  C  CD  A ARG A 1 119 ? 67.211 12.258 70.814 0.50 54.49 ? 376 ARG A CD  1 
ATOM   964  C  CD  B ARG A 1 119 ? 67.255 13.943 70.573 0.50 53.87 ? 376 ARG A CD  1 
ATOM   965  N  NE  A ARG A 1 119 ? 68.392 13.094 70.597 0.50 55.08 ? 376 ARG A NE  1 
ATOM   966  N  NE  B ARG A 1 119 ? 66.234 14.368 71.523 0.50 54.58 ? 376 ARG A NE  1 
ATOM   967  C  CZ  A ARG A 1 119 ? 69.453 13.101 71.400 0.50 55.19 ? 376 ARG A CZ  1 
ATOM   968  C  CZ  B ARG A 1 119 ? 66.309 15.474 72.255 0.50 54.98 ? 376 ARG A CZ  1 
ATOM   969  N  NH1 A ARG A 1 119 ? 69.469 12.320 72.471 0.50 55.01 ? 376 ARG A NH1 1 
ATOM   970  N  NH1 B ARG A 1 119 ? 67.364 16.276 72.150 0.50 55.02 ? 376 ARG A NH1 1 
ATOM   971  N  NH2 A ARG A 1 119 ? 70.494 13.881 71.135 0.50 54.53 ? 376 ARG A NH2 1 
ATOM   972  N  NH2 B ARG A 1 119 ? 65.330 15.774 73.096 0.50 54.80 ? 376 ARG A NH2 1 
ATOM   973  N  N   . MET A 1 120 ? 65.046 11.992 65.508 1.00 50.58 ? 377 MET A N   1 
ATOM   974  C  CA  . MET A 1 120 ? 65.452 11.920 64.102 1.00 49.77 ? 377 MET A CA  1 
ATOM   975  C  C   . MET A 1 120 ? 64.653 12.903 63.192 1.00 49.23 ? 377 MET A C   1 
ATOM   976  O  O   . MET A 1 120 ? 63.639 13.478 63.593 1.00 48.65 ? 377 MET A O   1 
ATOM   977  C  CB  . MET A 1 120 ? 65.378 10.483 63.585 1.00 49.69 ? 377 MET A CB  1 
ATOM   978  C  CG  . MET A 1 120 ? 66.302 9.501  64.337 1.00 50.27 ? 377 MET A CG  1 
ATOM   979  S  SD  . MET A 1 120 ? 68.071 9.800  64.065 1.00 51.73 ? 377 MET A SD  1 
ATOM   980  C  CE  . MET A 1 120 ? 68.281 8.925  62.516 1.00 47.69 ? 377 MET A CE  1 
ATOM   981  N  N   . GLY A 1 121 ? 65.146 13.092 61.973 1.00 48.34 ? 378 GLY A N   1 
ATOM   982  C  CA  . GLY A 1 121 ? 64.686 14.152 61.101 1.00 47.74 ? 378 GLY A CA  1 
ATOM   983  C  C   . GLY A 1 121 ? 63.635 13.780 60.080 1.00 47.27 ? 378 GLY A C   1 
ATOM   984  O  O   . GLY A 1 121 ? 63.324 14.586 59.212 1.00 47.02 ? 378 GLY A O   1 
ATOM   985  N  N   . ASN A 1 122 ? 63.078 12.574 60.175 1.00 47.25 ? 379 ASN A N   1 
ATOM   986  C  CA  . ASN A 1 122 ? 61.939 12.188 59.334 1.00 47.05 ? 379 ASN A CA  1 
ATOM   987  C  C   . ASN A 1 122 ? 60.698 13.064 59.531 1.00 47.18 ? 379 ASN A C   1 
ATOM   988  O  O   . ASN A 1 122 ? 59.852 13.159 58.640 1.00 47.38 ? 379 ASN A O   1 
ATOM   989  C  CB  . ASN A 1 122 ? 61.582 10.716 59.537 1.00 47.45 ? 379 ASN A CB  1 
ATOM   990  C  CG  . ASN A 1 122 ? 61.253 10.360 60.982 1.00 47.83 ? 379 ASN A CG  1 
ATOM   991  O  OD1 . ASN A 1 122 ? 62.096 10.496 61.871 1.00 47.00 ? 379 ASN A OD1 1 
ATOM   992  N  ND2 . ASN A 1 122 ? 60.038 9.838  61.207 1.00 46.87 ? 379 ASN A ND2 1 
ATOM   993  N  N   . LYS A 1 123 ? 60.594 13.673 60.713 1.00 47.08 ? 380 LYS A N   1 
ATOM   994  C  CA  . LYS A 1 123 ? 59.605 14.705 61.030 1.00 46.93 ? 380 LYS A CA  1 
ATOM   995  C  C   . LYS A 1 123 ? 60.336 15.732 61.897 1.00 47.19 ? 380 LYS A C   1 
ATOM   996  O  O   . LYS A 1 123 ? 61.408 15.446 62.419 1.00 46.82 ? 380 LYS A O   1 
ATOM   997  C  CB  . LYS A 1 123 ? 58.423 14.121 61.821 1.00 46.93 ? 380 LYS A CB  1 
ATOM   998  C  CG  . LYS A 1 123 ? 57.589 13.075 61.079 1.00 46.71 ? 380 LYS A CG  1 
ATOM   999  C  CD  . LYS A 1 123 ? 56.664 13.740 60.072 1.00 47.29 ? 380 LYS A CD  1 
ATOM   1000 C  CE  . LYS A 1 123 ? 56.088 12.765 59.039 1.00 46.76 ? 380 LYS A CE  1 
ATOM   1001 N  NZ  . LYS A 1 123 ? 57.143 12.274 58.112 1.00 46.07 ? 380 LYS A NZ  1 
ATOM   1002 N  N   . GLY A 1 124 ? 59.770 16.930 62.040 1.00 47.16 ? 381 GLY A N   1 
ATOM   1003 C  CA  . GLY A 1 124 ? 60.387 17.981 62.859 1.00 46.89 ? 381 GLY A CA  1 
ATOM   1004 C  C   . GLY A 1 124 ? 60.176 19.341 62.237 1.00 46.71 ? 381 GLY A C   1 
ATOM   1005 O  O   . GLY A 1 124 ? 59.206 19.542 61.511 1.00 46.75 ? 381 GLY A O   1 
ATOM   1006 N  N   . GLY A 1 125 ? 61.090 20.270 62.511 1.00 46.35 ? 382 GLY A N   1 
ATOM   1007 C  CA  . GLY A 1 125 ? 61.020 21.611 61.943 1.00 46.32 ? 382 GLY A CA  1 
ATOM   1008 C  C   . GLY A 1 125 ? 62.365 22.254 61.653 1.00 46.04 ? 382 GLY A C   1 
ATOM   1009 O  O   . GLY A 1 125 ? 63.373 21.921 62.264 1.00 46.79 ? 382 GLY A O   1 
ATOM   1010 N  N   . VAL A 1 126 ? 62.379 23.174 60.697 1.00 45.50 ? 383 VAL A N   1 
ATOM   1011 C  CA  . VAL A 1 126 ? 63.548 24.014 60.444 1.00 44.83 ? 383 VAL A CA  1 
ATOM   1012 C  C   . VAL A 1 126 ? 63.072 25.459 60.486 1.00 44.97 ? 383 VAL A C   1 
ATOM   1013 O  O   . VAL A 1 126 ? 61.880 25.722 60.309 1.00 44.98 ? 383 VAL A O   1 
ATOM   1014 C  CB  . VAL A 1 126 ? 64.186 23.708 59.094 1.00 44.72 ? 383 VAL A CB  1 
ATOM   1015 C  CG1 . VAL A 1 126 ? 64.537 22.221 58.994 1.00 43.08 ? 383 VAL A CG1 1 
ATOM   1016 C  CG2 . VAL A 1 126 ? 63.259 24.149 57.936 1.00 43.67 ? 383 VAL A CG2 1 
ATOM   1017 N  N   . ALA A 1 127 ? 63.990 26.389 60.733 1.00 44.97 ? 384 ALA A N   1 
ATOM   1018 C  CA  . ALA A 1 127 ? 63.634 27.801 60.833 1.00 45.03 ? 384 ALA A CA  1 
ATOM   1019 C  C   . ALA A 1 127 ? 64.782 28.718 60.440 1.00 45.16 ? 384 ALA A C   1 
ATOM   1020 O  O   . ALA A 1 127 ? 65.936 28.417 60.689 1.00 45.32 ? 384 ALA A O   1 
ATOM   1021 C  CB  . ALA A 1 127 ? 63.169 28.121 62.220 1.00 44.51 ? 384 ALA A CB  1 
ATOM   1022 N  N   . ILE A 1 128 ? 64.441 29.828 59.794 1.00 45.67 ? 385 ILE A N   1 
ATOM   1023 C  CA  . ILE A 1 128 ? 65.382 30.893 59.498 1.00 45.54 ? 385 ILE A CA  1 
ATOM   1024 C  C   . ILE A 1 128 ? 64.836 32.114 60.211 1.00 46.00 ? 385 ILE A C   1 
ATOM   1025 O  O   . ILE A 1 128 ? 63.660 32.445 60.039 1.00 45.94 ? 385 ILE A O   1 
ATOM   1026 C  CB  . ILE A 1 128 ? 65.483 31.169 57.989 1.00 45.41 ? 385 ILE A CB  1 
ATOM   1027 C  CG1 . ILE A 1 128 ? 66.044 29.952 57.252 1.00 45.83 ? 385 ILE A CG1 1 
ATOM   1028 C  CG2 . ILE A 1 128 ? 66.407 32.345 57.713 1.00 44.81 ? 385 ILE A CG2 1 
ATOM   1029 C  CD1 . ILE A 1 128 ? 65.966 30.060 55.723 1.00 44.38 ? 385 ILE A CD1 1 
ATOM   1030 N  N   . ARG A 1 129 ? 65.661 32.764 61.038 1.00 46.21 ? 386 ARG A N   1 
ATOM   1031 C  CA  . ARG A 1 129 ? 65.279 34.050 61.631 1.00 46.74 ? 386 ARG A CA  1 
ATOM   1032 C  C   . ARG A 1 129 ? 66.219 35.119 61.108 1.00 46.98 ? 386 ARG A C   1 
ATOM   1033 O  O   . ARG A 1 129 ? 67.330 34.825 60.675 1.00 47.30 ? 386 ARG A O   1 
ATOM   1034 C  CB  . ARG A 1 129 ? 65.253 33.999 63.170 1.00 47.07 ? 386 ARG A CB  1 
ATOM   1035 C  CG  . ARG A 1 129 ? 66.633 33.923 63.888 1.00 47.91 ? 386 ARG A CG  1 
ATOM   1036 C  CD  . ARG A 1 129 ? 67.373 35.273 63.943 1.00 47.14 ? 386 ARG A CD  1 
ATOM   1037 N  NE  . ARG A 1 129 ? 66.646 36.241 64.759 1.00 47.05 ? 386 ARG A NE  1 
ATOM   1038 C  CZ  . ARG A 1 129 ? 66.867 37.556 64.757 1.00 46.81 ? 386 ARG A CZ  1 
ATOM   1039 N  NH1 . ARG A 1 129 ? 67.801 38.085 63.978 1.00 46.52 ? 386 ARG A NH1 1 
ATOM   1040 N  NH2 . ARG A 1 129 ? 66.139 38.350 65.541 1.00 45.93 ? 386 ARG A NH2 1 
ATOM   1041 N  N   . PHE A 1 130 ? 65.758 36.360 61.110 1.00 47.19 ? 387 PHE A N   1 
ATOM   1042 C  CA  . PHE A 1 130 ? 66.550 37.458 60.584 1.00 47.14 ? 387 PHE A CA  1 
ATOM   1043 C  C   . PHE A 1 130 ? 65.961 38.802 60.978 1.00 47.87 ? 387 PHE A C   1 
ATOM   1044 O  O   . PHE A 1 130 ? 64.863 38.891 61.525 1.00 48.06 ? 387 PHE A O   1 
ATOM   1045 C  CB  . PHE A 1 130 ? 66.695 37.349 59.062 1.00 47.18 ? 387 PHE A CB  1 
ATOM   1046 C  CG  . PHE A 1 130 ? 65.393 37.367 58.306 1.00 46.75 ? 387 PHE A CG  1 
ATOM   1047 C  CD1 . PHE A 1 130 ? 64.998 38.505 57.605 1.00 48.33 ? 387 PHE A CD1 1 
ATOM   1048 C  CD2 . PHE A 1 130 ? 64.577 36.253 58.269 1.00 46.78 ? 387 PHE A CD2 1 
ATOM   1049 C  CE1 . PHE A 1 130 ? 63.791 38.532 56.884 1.00 48.79 ? 387 PHE A CE1 1 
ATOM   1050 C  CE2 . PHE A 1 130 ? 63.358 36.272 57.551 1.00 48.16 ? 387 PHE A CE2 1 
ATOM   1051 C  CZ  . PHE A 1 130 ? 62.967 37.407 56.867 1.00 47.68 ? 387 PHE A CZ  1 
ATOM   1052 N  N   . GLN A 1 131 ? 66.714 39.851 60.713 1.00 48.53 ? 388 GLN A N   1 
ATOM   1053 C  CA  . GLN A 1 131 ? 66.228 41.199 60.899 1.00 49.00 ? 388 GLN A CA  1 
ATOM   1054 C  C   . GLN A 1 131 ? 66.158 41.859 59.538 1.00 48.11 ? 388 GLN A C   1 
ATOM   1055 O  O   . GLN A 1 131 ? 67.100 41.792 58.762 1.00 47.78 ? 388 GLN A O   1 
ATOM   1056 C  CB  . GLN A 1 131 ? 67.174 41.967 61.812 1.00 49.92 ? 388 GLN A CB  1 
ATOM   1057 C  CG  . GLN A 1 131 ? 66.538 43.135 62.529 1.00 52.97 ? 388 GLN A CG  1 
ATOM   1058 C  CD  . GLN A 1 131 ? 67.546 43.889 63.386 1.00 56.33 ? 388 GLN A CD  1 
ATOM   1059 O  OE1 . GLN A 1 131 ? 68.236 43.279 64.198 1.00 61.49 ? 388 GLN A OE1 1 
ATOM   1060 N  NE2 . GLN A 1 131 ? 67.645 45.205 63.200 1.00 54.76 ? 388 GLN A NE2 1 
ATOM   1061 N  N   . PHE A 1 132 ? 65.021 42.470 59.248 1.00 47.74 ? 389 PHE A N   1 
ATOM   1062 C  CA  . PHE A 1 132 ? 64.823 43.213 58.015 1.00 47.61 ? 389 PHE A CA  1 
ATOM   1063 C  C   . PHE A 1 132 ? 64.559 44.634 58.457 1.00 47.72 ? 389 PHE A C   1 
ATOM   1064 O  O   . PHE A 1 132 ? 63.605 44.875 59.199 1.00 47.21 ? 389 PHE A O   1 
ATOM   1065 C  CB  . PHE A 1 132 ? 63.643 42.631 57.223 1.00 47.59 ? 389 PHE A CB  1 
ATOM   1066 C  CG  . PHE A 1 132 ? 63.463 43.226 55.861 1.00 47.49 ? 389 PHE A CG  1 
ATOM   1067 C  CD1 . PHE A 1 132 ? 64.551 43.556 55.070 1.00 49.09 ? 389 PHE A CD1 1 
ATOM   1068 C  CD2 . PHE A 1 132 ? 62.198 43.425 55.347 1.00 48.70 ? 389 PHE A CD2 1 
ATOM   1069 C  CE1 . PHE A 1 132 ? 64.373 44.100 53.812 1.00 48.68 ? 389 PHE A CE1 1 
ATOM   1070 C  CE2 . PHE A 1 132 ? 62.017 43.968 54.083 1.00 47.97 ? 389 PHE A CE2 1 
ATOM   1071 C  CZ  . PHE A 1 132 ? 63.101 44.309 53.323 1.00 47.93 ? 389 PHE A CZ  1 
ATOM   1072 N  N   . HIS A 1 133 ? 65.424 45.559 58.038 1.00 48.14 ? 390 HIS A N   1 
ATOM   1073 C  CA  . HIS A 1 133 ? 65.509 46.884 58.664 1.00 48.83 ? 390 HIS A CA  1 
ATOM   1074 C  C   . HIS A 1 133 ? 65.581 46.726 60.194 1.00 48.97 ? 390 HIS A C   1 
ATOM   1075 O  O   . HIS A 1 133 ? 66.488 46.051 60.676 1.00 49.26 ? 390 HIS A O   1 
ATOM   1076 C  CB  . HIS A 1 133 ? 64.361 47.775 58.170 1.00 49.02 ? 390 HIS A CB  1 
ATOM   1077 C  CG  . HIS A 1 133 ? 64.443 48.060 56.706 1.00 48.82 ? 390 HIS A CG  1 
ATOM   1078 N  ND1 . HIS A 1 133 ? 65.195 49.093 56.196 1.00 48.25 ? 390 HIS A ND1 1 
ATOM   1079 C  CD2 . HIS A 1 133 ? 63.940 47.398 55.640 1.00 48.62 ? 390 HIS A CD2 1 
ATOM   1080 C  CE1 . HIS A 1 133 ? 65.119 49.080 54.878 1.00 48.43 ? 390 HIS A CE1 1 
ATOM   1081 N  NE2 . HIS A 1 133 ? 64.362 48.061 54.514 1.00 47.79 ? 390 HIS A NE2 1 
ATOM   1082 N  N   . ASN A 1 134 ? 64.625 47.273 60.942 1.00 49.26 ? 391 ASN A N   1 
ATOM   1083 C  CA  . ASN A 1 134 ? 64.585 47.099 62.401 1.00 49.73 ? 391 ASN A CA  1 
ATOM   1084 C  C   . ASN A 1 134 ? 63.515 46.127 62.908 1.00 49.30 ? 391 ASN A C   1 
ATOM   1085 O  O   . ASN A 1 134 ? 63.195 46.117 64.100 1.00 49.18 ? 391 ASN A O   1 
ATOM   1086 C  CB  . ASN A 1 134 ? 64.380 48.449 63.082 1.00 50.33 ? 391 ASN A CB  1 
ATOM   1087 C  CG  . ASN A 1 134 ? 65.660 49.263 63.196 1.00 53.22 ? 391 ASN A CG  1 
ATOM   1088 O  OD1 . ASN A 1 134 ? 66.597 49.145 62.381 1.00 56.47 ? 391 ASN A OD1 1 
ATOM   1089 N  ND2 . ASN A 1 134 ? 65.690 50.132 64.200 1.00 57.58 ? 391 ASN A ND2 1 
ATOM   1090 N  N   . THR A 1 135 ? 62.966 45.295 62.020 1.00 49.04 ? 392 THR A N   1 
ATOM   1091 C  CA  . THR A 1 135 ? 61.944 44.317 62.414 1.00 48.02 ? 392 THR A CA  1 
ATOM   1092 C  C   . THR A 1 135 ? 62.525 42.919 62.433 1.00 47.48 ? 392 THR A C   1 
ATOM   1093 O  O   . THR A 1 135 ? 63.164 42.499 61.474 1.00 47.30 ? 392 THR A O   1 
ATOM   1094 C  CB  . THR A 1 135 ? 60.740 44.389 61.462 1.00 48.27 ? 392 THR A CB  1 
ATOM   1095 O  OG1 . THR A 1 135 ? 60.139 45.683 61.581 1.00 48.02 ? 392 THR A OG1 1 
ATOM   1096 C  CG2 . THR A 1 135 ? 59.699 43.309 61.782 1.00 47.87 ? 392 THR A CG2 1 
ATOM   1097 N  N   . SER A 1 136 ? 62.299 42.196 63.526 1.00 47.05 ? 393 SER A N   1 
ATOM   1098 C  CA  . SER A 1 136 ? 62.737 40.803 63.625 1.00 46.85 ? 393 SER A CA  1 
ATOM   1099 C  C   . SER A 1 136 ? 61.659 39.847 63.096 1.00 46.70 ? 393 SER A C   1 
ATOM   1100 O  O   . SER A 1 136 ? 60.476 40.038 63.344 1.00 45.97 ? 393 SER A O   1 
ATOM   1101 C  CB  . SER A 1 136 ? 63.073 40.456 65.066 1.00 46.89 ? 393 SER A CB  1 
ATOM   1102 O  OG  . SER A 1 136 ? 61.955 40.679 65.899 1.00 47.54 ? 393 SER A OG  1 
ATOM   1103 N  N   . ILE A 1 137 ? 62.097 38.811 62.379 1.00 46.73 ? 394 ILE A N   1 
ATOM   1104 C  CA  . ILE A 1 137 ? 61.214 37.901 61.648 1.00 46.29 ? 394 ILE A CA  1 
ATOM   1105 C  C   . ILE A 1 137 ? 61.721 36.467 61.795 1.00 46.08 ? 394 ILE A C   1 
ATOM   1106 O  O   . ILE A 1 137 ? 62.901 36.219 61.596 1.00 46.63 ? 394 ILE A O   1 
ATOM   1107 C  CB  . ILE A 1 137 ? 61.175 38.256 60.149 1.00 46.16 ? 394 ILE A CB  1 
ATOM   1108 C  CG1 . ILE A 1 137 ? 60.795 39.729 59.958 1.00 46.89 ? 394 ILE A CG1 1 
ATOM   1109 C  CG2 . ILE A 1 137 ? 60.213 37.335 59.398 1.00 45.38 ? 394 ILE A CG2 1 
ATOM   1110 C  CD1 . ILE A 1 137 ? 60.794 40.207 58.508 1.00 46.69 ? 394 ILE A CD1 1 
ATOM   1111 N  N   . CYS A 1 138 ? 60.838 35.533 62.147 1.00 45.84 ? 395 CYS A N   1 
ATOM   1112 C  CA  . CYS A 1 138 ? 61.181 34.128 62.185 1.00 46.18 ? 395 CYS A CA  1 
ATOM   1113 C  C   . CYS A 1 138 ? 60.208 33.336 61.332 1.00 46.23 ? 395 CYS A C   1 
ATOM   1114 O  O   . CYS A 1 138 ? 58.997 33.431 61.504 1.00 46.47 ? 395 CYS A O   1 
ATOM   1115 C  CB  . CYS A 1 138 ? 61.160 33.602 63.607 1.00 46.28 ? 395 CYS A CB  1 
ATOM   1116 S  SG  . CYS A 1 138 ? 61.657 31.850 63.766 1.00 48.90 ? 395 CYS A SG  1 
ATOM   1117 N  N   . VAL A 1 139 ? 60.753 32.566 60.397 1.00 46.29 ? 396 VAL A N   1 
ATOM   1118 C  CA  . VAL A 1 139 ? 59.966 31.700 59.529 1.00 46.03 ? 396 VAL A CA  1 
ATOM   1119 C  C   . VAL A 1 139 ? 60.274 30.263 59.883 1.00 45.91 ? 396 VAL A C   1 
ATOM   1120 O  O   . VAL A 1 139 ? 61.432 29.872 59.860 1.00 45.27 ? 396 VAL A O   1 
ATOM   1121 C  CB  . VAL A 1 139 ? 60.298 31.920 58.045 1.00 46.12 ? 396 VAL A CB  1 
ATOM   1122 C  CG1 . VAL A 1 139 ? 59.383 31.041 57.166 1.00 47.30 ? 396 VAL A CG1 1 
ATOM   1123 C  CG2 . VAL A 1 139 ? 60.150 33.379 57.681 1.00 44.92 ? 396 VAL A CG2 1 
ATOM   1124 N  N   . VAL A 1 140 ? 59.230 29.497 60.217 1.00 46.21 ? 397 VAL A N   1 
ATOM   1125 C  CA  . VAL A 1 140 ? 59.338 28.095 60.595 1.00 45.99 ? 397 VAL A CA  1 
ATOM   1126 C  C   . VAL A 1 140 ? 58.636 27.208 59.550 1.00 46.20 ? 397 VAL A C   1 
ATOM   1127 O  O   . VAL A 1 140 ? 57.540 27.545 59.099 1.00 46.09 ? 397 VAL A O   1 
ATOM   1128 C  CB  . VAL A 1 140 ? 58.673 27.849 61.956 1.00 46.32 ? 397 VAL A CB  1 
ATOM   1129 C  CG1 . VAL A 1 140 ? 58.835 26.385 62.382 1.00 46.12 ? 397 VAL A CG1 1 
ATOM   1130 C  CG2 . VAL A 1 140 ? 59.219 28.795 63.023 1.00 44.75 ? 397 VAL A CG2 1 
ATOM   1131 N  N   . ASN A 1 141 ? 59.282 26.088 59.193 1.00 45.79 ? 398 ASN A N   1 
ATOM   1132 C  CA  . ASN A 1 141 ? 58.753 25.050 58.308 1.00 45.39 ? 398 ASN A CA  1 
ATOM   1133 C  C   . ASN A 1 141 ? 58.739 23.750 59.101 1.00 45.78 ? 398 ASN A C   1 
ATOM   1134 O  O   . ASN A 1 141 ? 59.792 23.292 59.533 1.00 46.17 ? 398 ASN A O   1 
ATOM   1135 C  CB  . ASN A 1 141 ? 59.664 24.906 57.073 1.00 45.46 ? 398 ASN A CB  1 
ATOM   1136 C  CG  . ASN A 1 141 ? 59.261 23.760 56.144 1.00 44.38 ? 398 ASN A CG  1 
ATOM   1137 O  OD1 . ASN A 1 141 ? 58.221 23.137 56.309 1.00 43.63 ? 398 ASN A OD1 1 
ATOM   1138 N  ND2 . ASN A 1 141 ? 60.102 23.483 55.158 1.00 43.65 ? 398 ASN A ND2 1 
ATOM   1139 N  N   . SER A 1 142 ? 57.561 23.166 59.317 1.00 45.96 ? 399 SER A N   1 
ATOM   1140 C  CA  . SER A 1 142 ? 57.445 21.935 60.094 1.00 45.96 ? 399 SER A CA  1 
ATOM   1141 C  C   . SER A 1 142 ? 56.762 20.828 59.315 1.00 46.09 ? 399 SER A C   1 
ATOM   1142 O  O   . SER A 1 142 ? 55.814 21.085 58.545 1.00 46.60 ? 399 SER A O   1 
ATOM   1143 C  CB  . SER A 1 142 ? 56.667 22.179 61.393 1.00 46.52 ? 399 SER A CB  1 
ATOM   1144 O  OG  . SER A 1 142 ? 55.283 22.392 61.158 1.00 46.84 ? 399 SER A OG  1 
ATOM   1145 N  N   . HIS A 1 143 ? 57.254 19.605 59.515 1.00 45.24 ? 400 HIS A N   1 
ATOM   1146 C  CA  . HIS A 1 143 ? 56.562 18.404 59.107 1.00 44.91 ? 400 HIS A CA  1 
ATOM   1147 C  C   . HIS A 1 143 ? 56.232 17.603 60.360 1.00 45.10 ? 400 HIS A C   1 
ATOM   1148 O  O   . HIS A 1 143 ? 57.117 17.021 60.975 1.00 44.41 ? 400 HIS A O   1 
ATOM   1149 C  CB  . HIS A 1 143 ? 57.430 17.600 58.157 1.00 45.14 ? 400 HIS A CB  1 
ATOM   1150 C  CG  . HIS A 1 143 ? 56.690 16.530 57.419 1.00 46.05 ? 400 HIS A CG  1 
ATOM   1151 N  ND1 . HIS A 1 143 ? 57.333 15.544 56.702 1.00 46.87 ? 400 HIS A ND1 1 
ATOM   1152 C  CD2 . HIS A 1 143 ? 55.364 16.287 57.293 1.00 45.36 ? 400 HIS A CD2 1 
ATOM   1153 C  CE1 . HIS A 1 143 ? 56.432 14.747 56.161 1.00 46.76 ? 400 HIS A CE1 1 
ATOM   1154 N  NE2 . HIS A 1 143 ? 55.231 15.168 56.516 1.00 45.37 ? 400 HIS A NE2 1 
ATOM   1155 N  N   . LEU A 1 144 ? 54.954 17.631 60.756 1.00 45.33 ? 401 LEU A N   1 
ATOM   1156 C  CA  . LEU A 1 144 ? 54.467 16.994 61.985 1.00 45.21 ? 401 LEU A CA  1 
ATOM   1157 C  C   . LEU A 1 144 ? 53.928 15.576 61.698 1.00 45.30 ? 401 LEU A C   1 
ATOM   1158 O  O   . LEU A 1 144 ? 53.658 15.228 60.549 1.00 44.94 ? 401 LEU A O   1 
ATOM   1159 C  CB  . LEU A 1 144 ? 53.366 17.846 62.631 1.00 44.90 ? 401 LEU A CB  1 
ATOM   1160 C  CG  . LEU A 1 144 ? 53.667 19.337 62.907 1.00 45.14 ? 401 LEU A CG  1 
ATOM   1161 C  CD1 . LEU A 1 144 ? 52.506 20.000 63.640 1.00 44.30 ? 401 LEU A CD1 1 
ATOM   1162 C  CD2 . LEU A 1 144 ? 54.931 19.550 63.696 1.00 42.67 ? 401 LEU A CD2 1 
ATOM   1163 N  N   . ALA A 1 145 ? 53.774 14.783 62.757 1.00 45.46 ? 402 ALA A N   1 
ATOM   1164 C  CA  . ALA A 1 145 ? 53.422 13.358 62.666 1.00 45.87 ? 402 ALA A CA  1 
ATOM   1165 C  C   . ALA A 1 145 ? 52.207 13.065 61.807 1.00 46.25 ? 402 ALA A C   1 
ATOM   1166 O  O   . ALA A 1 145 ? 51.224 13.799 61.839 1.00 46.41 ? 402 ALA A O   1 
ATOM   1167 C  CB  . ALA A 1 145 ? 53.213 12.776 64.068 1.00 45.80 ? 402 ALA A CB  1 
ATOM   1168 N  N   . ALA A 1 146 ? 52.279 11.973 61.051 1.00 47.11 ? 403 ALA A N   1 
ATOM   1169 C  CA  . ALA A 1 146 ? 51.198 11.545 60.164 1.00 47.91 ? 403 ALA A CA  1 
ATOM   1170 C  C   . ALA A 1 146 ? 50.068 10.800 60.894 1.00 49.04 ? 403 ALA A C   1 
ATOM   1171 O  O   . ALA A 1 146 ? 50.229 10.393 62.037 1.00 48.28 ? 403 ALA A O   1 
ATOM   1172 C  CB  . ALA A 1 146 ? 51.759 10.660 59.049 1.00 47.64 ? 403 ALA A CB  1 
ATOM   1173 N  N   . HIS A 1 147 ? 48.939 10.651 60.185 1.00 50.97 ? 404 HIS A N   1 
ATOM   1174 C  CA  . HIS A 1 147 ? 47.814 9.738  60.500 1.00 52.44 ? 404 HIS A CA  1 
ATOM   1175 C  C   . HIS A 1 147 ? 46.749 10.374 61.389 1.00 53.51 ? 404 HIS A C   1 
ATOM   1176 O  O   . HIS A 1 147 ? 47.089 11.030 62.353 1.00 53.47 ? 404 HIS A O   1 
ATOM   1177 C  CB  . HIS A 1 147 ? 48.284 8.421  61.124 1.00 52.53 ? 404 HIS A CB  1 
ATOM   1178 C  CG  . HIS A 1 147 ? 49.315 7.698  60.318 1.00 54.07 ? 404 HIS A CG  1 
ATOM   1179 N  ND1 . HIS A 1 147 ? 49.214 7.538  58.952 1.00 55.71 ? 404 HIS A ND1 1 
ATOM   1180 C  CD2 . HIS A 1 147 ? 50.462 7.080  60.688 1.00 54.42 ? 404 HIS A CD2 1 
ATOM   1181 C  CE1 . HIS A 1 147 ? 50.256 6.854  58.514 1.00 55.83 ? 404 HIS A CE1 1 
ATOM   1182 N  NE2 . HIS A 1 147 ? 51.028 6.565  59.548 1.00 55.67 ? 404 HIS A NE2 1 
ATOM   1183 N  N   . ILE A 1 148 ? 45.471 10.140 61.068 1.00 55.21 ? 405 ILE A N   1 
ATOM   1184 C  CA  . ILE A 1 148 ? 44.321 10.753 61.785 1.00 56.61 ? 405 ILE A CA  1 
ATOM   1185 C  C   . ILE A 1 148 ? 44.452 10.662 63.298 1.00 57.44 ? 405 ILE A C   1 
ATOM   1186 O  O   . ILE A 1 148 ? 44.167 11.621 64.015 1.00 56.99 ? 405 ILE A O   1 
ATOM   1187 C  CB  . ILE A 1 148 ? 42.931 10.096 61.435 1.00 57.02 ? 405 ILE A CB  1 
ATOM   1188 C  CG1 . ILE A 1 148 ? 42.798 9.812  59.929 1.00 59.48 ? 405 ILE A CG1 1 
ATOM   1189 C  CG2 . ILE A 1 148 ? 41.779 10.987 61.925 1.00 56.90 ? 405 ILE A CG2 1 
ATOM   1190 C  CD1 . ILE A 1 148 ? 41.322 9.767  59.363 1.00 61.73 ? 405 ILE A CD1 1 
ATOM   1191 N  N   . GLU A 1 149 ? 44.904 9.509  63.781 1.00 58.77 ? 406 GLU A N   1 
ATOM   1192 C  CA  . GLU A 1 149 ? 44.831 9.214  65.208 1.00 60.07 ? 406 GLU A CA  1 
ATOM   1193 C  C   . GLU A 1 149 ? 46.017 9.737  66.022 1.00 60.26 ? 406 GLU A C   1 
ATOM   1194 O  O   . GLU A 1 149 ? 46.008 9.621  67.245 1.00 60.69 ? 406 GLU A O   1 
ATOM   1195 C  CB  . GLU A 1 149 ? 44.582 7.709  65.450 1.00 60.60 ? 406 GLU A CB  1 
ATOM   1196 C  CG  . GLU A 1 149 ? 45.560 6.744  64.750 1.00 63.83 ? 406 GLU A CG  1 
ATOM   1197 C  CD  . GLU A 1 149 ? 45.203 6.422  63.287 1.00 66.66 ? 406 GLU A CD  1 
ATOM   1198 O  OE1 . GLU A 1 149 ? 44.089 5.903  63.015 1.00 70.23 ? 406 GLU A OE1 1 
ATOM   1199 O  OE2 . GLU A 1 149 ? 46.059 6.662  62.413 1.00 66.58 ? 406 GLU A OE2 1 
ATOM   1200 N  N   . GLU A 1 150 ? 46.998 10.374 65.371 1.00 60.50 ? 407 GLU A N   1 
ATOM   1201 C  CA  . GLU A 1 150 ? 48.205 10.832 66.069 1.00 60.60 ? 407 GLU A CA  1 
ATOM   1202 C  C   . GLU A 1 150 ? 48.219 12.334 66.376 1.00 60.60 ? 407 GLU A C   1 
ATOM   1203 O  O   . GLU A 1 150 ? 49.290 12.953 66.428 1.00 60.25 ? 407 GLU A O   1 
ATOM   1204 C  CB  . GLU A 1 150 ? 49.459 10.453 65.271 1.00 60.78 ? 407 GLU A CB  1 
ATOM   1205 C  CG  . GLU A 1 150 ? 49.672 8.951  65.050 1.00 61.87 ? 407 GLU A CG  1 
ATOM   1206 C  CD  . GLU A 1 150 ? 49.748 8.133  66.347 1.00 64.34 ? 407 GLU A CD  1 
ATOM   1207 O  OE1 . GLU A 1 150 ? 50.159 8.666  67.398 1.00 65.19 ? 407 GLU A OE1 1 
ATOM   1208 O  OE2 . GLU A 1 150 ? 49.380 6.940  66.307 1.00 66.91 ? 407 GLU A OE2 1 
ATOM   1209 N  N   . TYR A 1 151 ? 47.044 12.913 66.615 1.00 60.59 ? 408 TYR A N   1 
ATOM   1210 C  CA  . TYR A 1 151 ? 46.933 14.363 66.810 1.00 60.83 ? 408 TYR A CA  1 
ATOM   1211 C  C   . TYR A 1 151 ? 47.693 14.839 68.040 1.00 60.15 ? 408 TYR A C   1 
ATOM   1212 O  O   . TYR A 1 151 ? 48.242 15.938 68.040 1.00 59.67 ? 408 TYR A O   1 
ATOM   1213 C  CB  . TYR A 1 151 ? 45.466 14.845 66.855 1.00 61.29 ? 408 TYR A CB  1 
ATOM   1214 C  CG  . TYR A 1 151 ? 44.604 14.202 67.921 1.00 64.16 ? 408 TYR A CG  1 
ATOM   1215 C  CD1 . TYR A 1 151 ? 44.511 14.747 69.203 1.00 66.74 ? 408 TYR A CD1 1 
ATOM   1216 C  CD2 . TYR A 1 151 ? 43.871 13.050 67.641 1.00 67.07 ? 408 TYR A CD2 1 
ATOM   1217 C  CE1 . TYR A 1 151 ? 43.720 14.149 70.178 1.00 68.79 ? 408 TYR A CE1 1 
ATOM   1218 C  CE2 . TYR A 1 151 ? 43.082 12.447 68.605 1.00 68.75 ? 408 TYR A CE2 1 
ATOM   1219 C  CZ  . TYR A 1 151 ? 43.008 12.995 69.868 1.00 69.78 ? 408 TYR A CZ  1 
ATOM   1220 O  OH  . TYR A 1 151 ? 42.215 12.381 70.811 1.00 72.45 ? 408 TYR A OH  1 
ATOM   1221 N  N   . GLU A 1 152 ? 47.727 14.014 69.081 1.00 59.70 ? 409 GLU A N   1 
ATOM   1222 C  CA  . GLU A 1 152 ? 48.463 14.357 70.298 1.00 59.64 ? 409 GLU A CA  1 
ATOM   1223 C  C   . GLU A 1 152 ? 49.957 14.433 70.023 1.00 57.90 ? 409 GLU A C   1 
ATOM   1224 O  O   . GLU A 1 152 ? 50.642 15.289 70.570 1.00 57.88 ? 409 GLU A O   1 
ATOM   1225 C  CB  . GLU A 1 152 ? 48.156 13.372 71.446 1.00 60.33 ? 409 GLU A CB  1 
ATOM   1226 C  CG  . GLU A 1 152 ? 46.855 13.725 72.190 1.00 64.65 ? 409 GLU A CG  1 
ATOM   1227 C  CD  . GLU A 1 152 ? 46.369 12.638 73.155 1.00 70.18 ? 409 GLU A CD  1 
ATOM   1228 O  OE1 . GLU A 1 152 ? 46.259 11.446 72.752 1.00 73.61 ? 409 GLU A OE1 1 
ATOM   1229 O  OE2 . GLU A 1 152 ? 46.067 12.990 74.318 1.00 73.67 ? 409 GLU A OE2 1 
ATOM   1230 N  N   . ARG A 1 153 ? 50.460 13.553 69.165 1.00 56.16 ? 410 ARG A N   1 
ATOM   1231 C  CA  . ARG A 1 153 ? 51.869 13.597 68.797 1.00 54.97 ? 410 ARG A CA  1 
ATOM   1232 C  C   . ARG A 1 153 ? 52.189 14.848 67.979 1.00 53.95 ? 410 ARG A C   1 
ATOM   1233 O  O   . ARG A 1 153 ? 53.248 15.455 68.157 1.00 53.27 ? 410 ARG A O   1 
ATOM   1234 C  CB  . ARG A 1 153 ? 52.266 12.327 68.045 1.00 54.92 ? 410 ARG A CB  1 
ATOM   1235 C  CG  . ARG A 1 153 ? 53.684 12.302 67.542 1.00 54.29 ? 410 ARG A CG  1 
ATOM   1236 C  CD  . ARG A 1 153 ? 54.703 12.571 68.621 1.00 53.75 ? 410 ARG A CD  1 
ATOM   1237 N  NE  . ARG A 1 153 ? 56.042 12.452 68.062 1.00 54.07 ? 410 ARG A NE  1 
ATOM   1238 C  CZ  . ARG A 1 153 ? 56.736 11.318 67.981 1.00 55.04 ? 410 ARG A CZ  1 
ATOM   1239 N  NH1 . ARG A 1 153 ? 56.241 10.182 68.466 1.00 54.01 ? 410 ARG A NH1 1 
ATOM   1240 N  NH2 . ARG A 1 153 ? 57.950 11.325 67.428 1.00 55.10 ? 410 ARG A NH2 1 
ATOM   1241 N  N   . ARG A 1 154 ? 51.278 15.240 67.090 1.00 53.11 ? 411 ARG A N   1 
ATOM   1242 C  CA  . ARG A 1 154 ? 51.444 16.498 66.360 1.00 52.86 ? 411 ARG A CA  1 
ATOM   1243 C  C   . ARG A 1 154 ? 51.543 17.673 67.334 1.00 52.53 ? 411 ARG A C   1 
ATOM   1244 O  O   . ARG A 1 154 ? 52.430 18.517 67.216 1.00 52.45 ? 411 ARG A O   1 
ATOM   1245 C  CB  . ARG A 1 154 ? 50.307 16.725 65.360 1.00 52.60 ? 411 ARG A CB  1 
ATOM   1246 C  CG  . ARG A 1 154 ? 50.346 15.784 64.168 1.00 52.43 ? 411 ARG A CG  1 
ATOM   1247 C  CD  . ARG A 1 154 ? 49.270 16.142 63.134 1.00 53.45 ? 411 ARG A CD  1 
ATOM   1248 N  NE  . ARG A 1 154 ? 47.975 15.497 63.374 1.00 53.66 ? 411 ARG A NE  1 
ATOM   1249 C  CZ  . ARG A 1 154 ? 47.710 14.215 63.128 1.00 53.34 ? 411 ARG A CZ  1 
ATOM   1250 N  NH1 . ARG A 1 154 ? 48.661 13.407 62.663 1.00 53.52 ? 411 ARG A NH1 1 
ATOM   1251 N  NH2 . ARG A 1 154 ? 46.491 13.730 63.358 1.00 52.41 ? 411 ARG A NH2 1 
ATOM   1252 N  N   . ASN A 1 155 ? 50.635 17.718 68.297 1.00 52.27 ? 412 ASN A N   1 
ATOM   1253 C  CA  . ASN A 1 155 ? 50.656 18.755 69.300 1.00 52.58 ? 412 ASN A CA  1 
ATOM   1254 C  C   . ASN A 1 155 ? 52.012 18.765 69.977 1.00 52.89 ? 412 ASN A C   1 
ATOM   1255 O  O   . ASN A 1 155 ? 52.626 19.825 70.112 1.00 52.87 ? 412 ASN A O   1 
ATOM   1256 C  CB  . ASN A 1 155 ? 49.549 18.554 70.350 1.00 52.61 ? 412 ASN A CB  1 
ATOM   1257 C  CG  . ASN A 1 155 ? 48.143 18.754 69.789 1.00 53.52 ? 412 ASN A CG  1 
ATOM   1258 O  OD1 . ASN A 1 155 ? 47.956 19.103 68.613 1.00 54.87 ? 412 ASN A OD1 1 
ATOM   1259 N  ND2 . ASN A 1 155 ? 47.141 18.535 70.639 1.00 54.37 ? 412 ASN A ND2 1 
ATOM   1260 N  N   . GLN A 1 156 ? 52.485 17.582 70.384 1.00 52.94 ? 413 GLN A N   1 
ATOM   1261 C  CA  . GLN A 1 156 ? 53.781 17.455 71.039 1.00 53.22 ? 413 GLN A CA  1 
ATOM   1262 C  C   . GLN A 1 156 ? 54.954 17.842 70.122 1.00 53.02 ? 413 GLN A C   1 
ATOM   1263 O  O   . GLN A 1 156 ? 55.940 18.435 70.593 1.00 53.68 ? 413 GLN A O   1 
ATOM   1264 C  CB  . GLN A 1 156 ? 53.973 16.031 71.580 1.00 53.60 ? 413 GLN A CB  1 
ATOM   1265 C  CG  . GLN A 1 156 ? 55.183 15.863 72.505 1.00 55.32 ? 413 GLN A CG  1 
ATOM   1266 C  CD  . GLN A 1 156 ? 55.056 16.675 73.792 1.00 56.85 ? 413 GLN A CD  1 
ATOM   1267 O  OE1 . GLN A 1 156 ? 54.108 16.504 74.542 1.00 59.57 ? 413 GLN A OE1 1 
ATOM   1268 N  NE2 . GLN A 1 156 ? 56.011 17.562 74.042 1.00 56.85 ? 413 GLN A NE2 1 
ATOM   1269 N  N   . ASP A 1 157 ? 54.866 17.515 68.833 1.00 52.32 ? 414 ASP A N   1 
ATOM   1270 C  CA  . ASP A 1 157 ? 55.920 17.896 67.889 1.00 52.07 ? 414 ASP A CA  1 
ATOM   1271 C  C   . ASP A 1 157 ? 56.029 19.409 67.855 1.00 52.22 ? 414 ASP A C   1 
ATOM   1272 O  O   . ASP A 1 157 ? 57.145 19.967 67.903 1.00 51.63 ? 414 ASP A O   1 
ATOM   1273 C  CB  . ASP A 1 157 ? 55.650 17.367 66.475 1.00 52.06 ? 414 ASP A CB  1 
ATOM   1274 C  CG  . ASP A 1 157 ? 55.781 15.848 66.368 1.00 51.59 ? 414 ASP A CG  1 
ATOM   1275 O  OD1 . ASP A 1 157 ? 56.492 15.251 67.188 1.00 50.60 ? 414 ASP A OD1 1 
ATOM   1276 O  OD2 . ASP A 1 157 ? 55.189 15.255 65.442 1.00 50.75 ? 414 ASP A OD2 1 
ATOM   1277 N  N   . TYR A 1 158 ? 54.869 20.073 67.791 1.00 52.15 ? 415 TYR A N   1 
ATOM   1278 C  CA  . TYR A 1 158 ? 54.823 21.534 67.815 1.00 52.31 ? 415 TYR A CA  1 
ATOM   1279 C  C   . TYR A 1 158 ? 55.478 22.075 69.079 1.00 52.56 ? 415 TYR A C   1 
ATOM   1280 O  O   . TYR A 1 158 ? 56.366 22.930 68.997 1.00 52.36 ? 415 TYR A O   1 
ATOM   1281 C  CB  . TYR A 1 158 ? 53.384 22.052 67.695 1.00 52.54 ? 415 TYR A CB  1 
ATOM   1282 C  CG  . TYR A 1 158 ? 53.244 23.526 67.947 1.00 52.17 ? 415 TYR A CG  1 
ATOM   1283 C  CD1 . TYR A 1 158 ? 53.451 24.442 66.928 1.00 53.30 ? 415 TYR A CD1 1 
ATOM   1284 C  CD2 . TYR A 1 158 ? 52.925 24.012 69.214 1.00 53.49 ? 415 TYR A CD2 1 
ATOM   1285 C  CE1 . TYR A 1 158 ? 53.329 25.802 67.146 1.00 54.03 ? 415 TYR A CE1 1 
ATOM   1286 C  CE2 . TYR A 1 158 ? 52.810 25.376 69.451 1.00 52.86 ? 415 TYR A CE2 1 
ATOM   1287 C  CZ  . TYR A 1 158 ? 53.010 26.261 68.409 1.00 54.59 ? 415 TYR A CZ  1 
ATOM   1288 O  OH  . TYR A 1 158 ? 52.897 27.607 68.619 1.00 57.81 ? 415 TYR A OH  1 
ATOM   1289 N  N   . LYS A 1 159 ? 55.050 21.584 70.240 1.00 53.17 ? 416 LYS A N   1 
ATOM   1290 C  CA  . LYS A 1 159 ? 55.629 22.032 71.505 1.00 54.36 ? 416 LYS A CA  1 
ATOM   1291 C  C   . LYS A 1 159 ? 57.134 21.791 71.523 1.00 53.71 ? 416 LYS A C   1 
ATOM   1292 O  O   . LYS A 1 159 ? 57.876 22.638 71.999 1.00 53.36 ? 416 LYS A O   1 
ATOM   1293 C  CB  . LYS A 1 159 ? 55.008 21.340 72.729 1.00 55.20 ? 416 LYS A CB  1 
ATOM   1294 C  CG  . LYS A 1 159 ? 53.525 21.604 72.991 1.00 58.83 ? 416 LYS A CG  1 
ATOM   1295 C  CD  . LYS A 1 159 ? 53.074 20.899 74.299 1.00 62.95 ? 416 LYS A CD  1 
ATOM   1296 C  CE  . LYS A 1 159 ? 51.722 20.174 74.136 1.00 65.60 ? 416 LYS A CE  1 
ATOM   1297 N  NZ  . LYS A 1 159 ? 50.564 21.135 74.079 1.00 67.23 ? 416 LYS A NZ  1 
ATOM   1298 N  N   . ASP A 1 160 ? 57.580 20.641 71.009 1.00 53.54 ? 417 ASP A N   1 
ATOM   1299 C  CA  . ASP A 1 160 ? 59.021 20.311 71.020 1.00 53.64 ? 417 ASP A CA  1 
ATOM   1300 C  C   . ASP A 1 160 ? 59.846 21.228 70.130 1.00 52.80 ? 417 ASP A C   1 
ATOM   1301 O  O   . ASP A 1 160 ? 60.962 21.598 70.492 1.00 53.82 ? 417 ASP A O   1 
ATOM   1302 C  CB  . ASP A 1 160 ? 59.277 18.834 70.659 1.00 53.94 ? 417 ASP A CB  1 
ATOM   1303 C  CG  . ASP A 1 160 ? 58.829 17.869 71.760 1.00 55.84 ? 417 ASP A CG  1 
ATOM   1304 O  OD1 . ASP A 1 160 ? 58.779 16.641 71.518 1.00 57.98 ? 417 ASP A OD1 1 
ATOM   1305 O  OD2 . ASP A 1 160 ? 58.503 18.340 72.871 1.00 59.32 ? 417 ASP A OD2 1 
ATOM   1306 N  N   . ILE A 1 161 ? 59.309 21.609 68.976 1.00 52.11 ? 418 ILE A N   1 
ATOM   1307 C  CA  . ILE A 1 161 ? 60.005 22.546 68.091 1.00 51.36 ? 418 ILE A CA  1 
ATOM   1308 C  C   . ILE A 1 161 ? 60.105 23.897 68.797 1.00 51.97 ? 418 ILE A C   1 
ATOM   1309 O  O   . ILE A 1 161 ? 61.159 24.533 68.765 1.00 52.01 ? 418 ILE A O   1 
ATOM   1310 C  CB  . ILE A 1 161 ? 59.307 22.680 66.716 1.00 50.91 ? 418 ILE A CB  1 
ATOM   1311 C  CG1 . ILE A 1 161 ? 59.371 21.351 65.945 1.00 50.35 ? 418 ILE A CG1 1 
ATOM   1312 C  CG2 . ILE A 1 161 ? 59.946 23.765 65.893 1.00 49.72 ? 418 ILE A CG2 1 
ATOM   1313 C  CD1 . ILE A 1 161 ? 58.273 21.199 64.868 1.00 48.25 ? 418 ILE A CD1 1 
ATOM   1314 N  N   . CYS A 1 162 ? 59.026 24.314 69.467 1.00 52.36 ? 419 CYS A N   1 
ATOM   1315 C  CA  . CYS A 1 162 ? 59.002 25.607 70.158 1.00 52.86 ? 419 CYS A CA  1 
ATOM   1316 C  C   . CYS A 1 162 ? 59.989 25.678 71.319 1.00 53.28 ? 419 CYS A C   1 
ATOM   1317 O  O   . CYS A 1 162 ? 60.688 26.674 71.462 1.00 52.98 ? 419 CYS A O   1 
ATOM   1318 C  CB  . CYS A 1 162 ? 57.586 25.967 70.645 1.00 53.00 ? 419 CYS A CB  1 
ATOM   1319 S  SG  . CYS A 1 162 ? 56.414 26.398 69.316 1.00 52.36 ? 419 CYS A SG  1 
ATOM   1320 N  N   . SER A 1 163 ? 60.065 24.624 72.130 1.00 54.10 ? 420 SER A N   1 
ATOM   1321 C  CA  . SER A 1 163 ? 60.991 24.619 73.282 1.00 54.97 ? 420 SER A CA  1 
ATOM   1322 C  C   . SER A 1 163 ? 62.449 24.394 72.910 1.00 54.82 ? 420 SER A C   1 
ATOM   1323 O  O   . SER A 1 163 ? 63.317 24.972 73.540 1.00 55.33 ? 420 SER A O   1 
ATOM   1324 C  CB  . SER A 1 163 ? 60.570 23.604 74.359 1.00 55.12 ? 420 SER A CB  1 
ATOM   1325 O  OG  . SER A 1 163 ? 60.471 22.294 73.839 1.00 57.55 ? 420 SER A OG  1 
ATOM   1326 N  N   . ARG A 1 164 ? 62.732 23.582 71.892 1.00 55.00 ? 421 ARG A N   1 
ATOM   1327 C  CA  . ARG A 1 164 ? 64.128 23.231 71.578 1.00 55.09 ? 421 ARG A CA  1 
ATOM   1328 C  C   . ARG A 1 164 ? 64.809 24.139 70.558 1.00 55.84 ? 421 ARG A C   1 
ATOM   1329 O  O   . ARG A 1 164 ? 66.025 24.176 70.505 1.00 56.08 ? 421 ARG A O   1 
ATOM   1330 C  CB  . ARG A 1 164 ? 64.227 21.770 71.111 1.00 55.02 ? 421 ARG A CB  1 
ATOM   1331 C  CG  . ARG A 1 164 ? 63.921 20.735 72.199 1.00 54.30 ? 421 ARG A CG  1 
ATOM   1332 C  CD  . ARG A 1 164 ? 63.603 19.359 71.611 1.00 53.56 ? 421 ARG A CD  1 
ATOM   1333 N  NE  . ARG A 1 164 ? 64.672 18.911 70.729 1.00 53.92 ? 421 ARG A NE  1 
ATOM   1334 C  CZ  . ARG A 1 164 ? 64.581 17.923 69.838 1.00 52.80 ? 421 ARG A CZ  1 
ATOM   1335 N  NH1 . ARG A 1 164 ? 63.467 17.218 69.682 1.00 52.22 ? 421 ARG A NH1 1 
ATOM   1336 N  NH2 . ARG A 1 164 ? 65.625 17.650 69.081 1.00 53.26 ? 421 ARG A NH2 1 
ATOM   1337 N  N   . MET A 1 165 ? 64.043 24.859 69.744 1.00 56.95 ? 422 MET A N   1 
ATOM   1338 C  CA  . MET A 1 165 ? 64.623 25.732 68.724 1.00 57.88 ? 422 MET A CA  1 
ATOM   1339 C  C   . MET A 1 165 ? 65.222 26.956 69.420 1.00 59.23 ? 422 MET A C   1 
ATOM   1340 O  O   . MET A 1 165 ? 64.497 27.744 70.013 1.00 59.56 ? 422 MET A O   1 
ATOM   1341 C  CB  . MET A 1 165 ? 63.543 26.128 67.700 1.00 57.72 ? 422 MET A CB  1 
ATOM   1342 C  CG  . MET A 1 165 ? 63.994 26.944 66.483 1.00 57.30 ? 422 MET A CG  1 
ATOM   1343 S  SD  . MET A 1 165 ? 64.673 26.001 65.100 1.00 58.81 ? 422 MET A SD  1 
ATOM   1344 C  CE  . MET A 1 165 ? 63.262 25.053 64.559 1.00 57.11 ? 422 MET A CE  1 
ATOM   1345 N  N   . GLN A 1 166 ? 66.545 27.086 69.362 1.00 60.88 ? 423 GLN A N   1 
ATOM   1346 C  CA  . GLN A 1 166 ? 67.272 28.238 69.917 1.00 62.15 ? 423 GLN A CA  1 
ATOM   1347 C  C   . GLN A 1 166 ? 68.242 28.827 68.898 1.00 62.30 ? 423 GLN A C   1 
ATOM   1348 O  O   . GLN A 1 166 ? 69.031 28.105 68.307 1.00 62.03 ? 423 GLN A O   1 
ATOM   1349 C  CB  . GLN A 1 166 ? 68.091 27.810 71.129 1.00 62.85 ? 423 GLN A CB  1 
ATOM   1350 C  CG  . GLN A 1 166 ? 67.323 27.081 72.207 1.00 65.70 ? 423 GLN A CG  1 
ATOM   1351 C  CD  . GLN A 1 166 ? 68.153 26.913 73.474 1.00 69.92 ? 423 GLN A CD  1 
ATOM   1352 O  OE1 . GLN A 1 166 ? 69.359 26.610 73.419 1.00 70.98 ? 423 GLN A OE1 1 
ATOM   1353 N  NE2 . GLN A 1 166 ? 67.513 27.123 74.629 1.00 71.60 ? 423 GLN A NE2 1 
ATOM   1354 N  N   . PHE A 1 167 ? 68.201 30.137 68.712 1.00 63.46 ? 424 PHE A N   1 
ATOM   1355 C  CA  . PHE A 1 167 ? 69.094 30.809 67.768 1.00 64.46 ? 424 PHE A CA  1 
ATOM   1356 C  C   . PHE A 1 167 ? 70.227 31.537 68.489 1.00 66.69 ? 424 PHE A C   1 
ATOM   1357 O  O   . PHE A 1 167 ? 70.044 32.060 69.585 1.00 66.87 ? 424 PHE A O   1 
ATOM   1358 C  CB  . PHE A 1 167 ? 68.319 31.827 66.921 1.00 63.80 ? 424 PHE A CB  1 
ATOM   1359 C  CG  . PHE A 1 167 ? 67.108 31.263 66.227 1.00 61.10 ? 424 PHE A CG  1 
ATOM   1360 C  CD1 . PHE A 1 167 ? 67.227 30.624 65.006 1.00 59.27 ? 424 PHE A CD1 1 
ATOM   1361 C  CD2 . PHE A 1 167 ? 65.850 31.398 66.779 1.00 58.74 ? 424 PHE A CD2 1 
ATOM   1362 C  CE1 . PHE A 1 167 ? 66.117 30.114 64.356 1.00 57.77 ? 424 PHE A CE1 1 
ATOM   1363 C  CE2 . PHE A 1 167 ? 64.727 30.880 66.131 1.00 58.17 ? 424 PHE A CE2 1 
ATOM   1364 C  CZ  . PHE A 1 167 ? 64.867 30.242 64.918 1.00 56.97 ? 424 PHE A CZ  1 
ATOM   1365 N  N   . CYS A 1 168 ? 71.389 31.603 67.853 1.00 69.71 ? 425 CYS A N   1 
ATOM   1366 C  CA  . CYS A 1 168 ? 72.481 32.453 68.342 1.00 72.42 ? 425 CYS A CA  1 
ATOM   1367 C  C   . CYS A 1 168 ? 72.085 33.904 68.320 1.00 74.45 ? 425 CYS A C   1 
ATOM   1368 O  O   . CYS A 1 168 ? 71.171 34.305 67.608 1.00 74.57 ? 425 CYS A O   1 
ATOM   1369 C  CB  . CYS A 1 168 ? 73.748 32.289 67.500 1.00 72.32 ? 425 CYS A CB  1 
ATOM   1370 S  SG  . CYS A 1 168 ? 74.352 30.605 67.490 1.00 74.74 ? 425 CYS A SG  1 
ATOM   1371 N  N   . GLN A 1 169 ? 72.824 34.690 69.085 1.00 77.67 ? 426 GLN A N   1 
ATOM   1372 C  CA  . GLN A 1 169 ? 72.541 36.099 69.283 1.00 80.13 ? 426 GLN A CA  1 
ATOM   1373 C  C   . GLN A 1 169 ? 73.876 36.855 69.358 1.00 82.02 ? 426 GLN A C   1 
ATOM   1374 O  O   . GLN A 1 169 ? 74.908 36.245 69.655 1.00 82.50 ? 426 GLN A O   1 
ATOM   1375 C  CB  . GLN A 1 169 ? 71.793 36.234 70.597 1.00 80.57 ? 426 GLN A CB  1 
ATOM   1376 C  CG  . GLN A 1 169 ? 70.704 37.255 70.610 1.00 81.87 ? 426 GLN A CG  1 
ATOM   1377 C  CD  . GLN A 1 169 ? 69.970 37.258 71.926 1.00 83.70 ? 426 GLN A CD  1 
ATOM   1378 O  OE1 . GLN A 1 169 ? 69.192 38.172 72.207 1.00 86.23 ? 426 GLN A OE1 1 
ATOM   1379 N  NE2 . GLN A 1 169 ? 70.207 36.231 72.750 1.00 83.81 ? 426 GLN A NE2 1 
ATOM   1380 N  N   . PRO A 1 170 ? 73.873 38.174 69.080 1.00 84.19 ? 427 PRO A N   1 
ATOM   1381 C  CA  . PRO A 1 170 ? 75.121 38.943 69.273 1.00 85.47 ? 427 PRO A CA  1 
ATOM   1382 C  C   . PRO A 1 170 ? 75.542 39.143 70.745 1.00 86.73 ? 427 PRO A C   1 
ATOM   1383 O  O   . PRO A 1 170 ? 76.732 39.310 71.015 1.00 86.92 ? 427 PRO A O   1 
ATOM   1384 C  CB  . PRO A 1 170 ? 74.814 40.298 68.608 1.00 85.41 ? 427 PRO A CB  1 
ATOM   1385 C  CG  . PRO A 1 170 ? 73.684 40.019 67.666 1.00 84.97 ? 427 PRO A CG  1 
ATOM   1386 C  CD  . PRO A 1 170 ? 72.867 38.946 68.324 1.00 84.36 ? 427 PRO A CD  1 
ATOM   1387 N  N   . ASP A 1 171 ? 74.582 39.115 71.674 1.00 88.20 ? 428 ASP A N   1 
ATOM   1388 C  CA  . ASP A 1 171 ? 74.857 39.326 73.104 1.00 89.15 ? 428 ASP A CA  1 
ATOM   1389 C  C   . ASP A 1 171 ? 74.783 38.020 73.928 1.00 89.72 ? 428 ASP A C   1 
ATOM   1390 O  O   . ASP A 1 171 ? 73.687 37.483 74.127 1.00 90.22 ? 428 ASP A O   1 
ATOM   1391 C  CB  . ASP A 1 171 ? 73.860 40.346 73.662 1.00 89.33 ? 428 ASP A CB  1 
ATOM   1392 C  CG  . ASP A 1 171 ? 74.272 40.889 75.018 1.00 90.44 ? 428 ASP A CG  1 
ATOM   1393 O  OD1 . ASP A 1 171 ? 75.237 40.350 75.622 1.00 91.03 ? 428 ASP A OD1 1 
ATOM   1394 O  OD2 . ASP A 1 171 ? 73.625 41.860 75.474 1.00 90.98 ? 428 ASP A OD2 1 
ATOM   1395 N  N   . PRO A 1 172 ? 75.941 37.513 74.427 1.00 90.29 ? 429 PRO A N   1 
ATOM   1396 C  CA  . PRO A 1 172 ? 75.915 36.280 75.258 1.00 90.12 ? 429 PRO A CA  1 
ATOM   1397 C  C   . PRO A 1 172 ? 75.410 36.464 76.705 1.00 89.73 ? 429 PRO A C   1 
ATOM   1398 O  O   . PRO A 1 172 ? 75.202 35.466 77.402 1.00 89.87 ? 429 PRO A O   1 
ATOM   1399 C  CB  . PRO A 1 172 ? 77.381 35.798 75.256 1.00 90.29 ? 429 PRO A CB  1 
ATOM   1400 C  CG  . PRO A 1 172 ? 78.158 36.774 74.375 1.00 90.57 ? 429 PRO A CG  1 
ATOM   1401 C  CD  . PRO A 1 172 ? 77.319 38.016 74.244 1.00 90.49 ? 429 PRO A CD  1 
ATOM   1402 N  N   . SER A 1 173 ? 75.236 37.713 77.152 1.00 89.04 ? 430 SER A N   1 
ATOM   1403 C  CA  . SER A 1 173 ? 74.541 38.007 78.418 1.00 88.46 ? 430 SER A CA  1 
ATOM   1404 C  C   . SER A 1 173 ? 73.140 37.400 78.417 1.00 87.55 ? 430 SER A C   1 
ATOM   1405 O  O   . SER A 1 173 ? 72.754 36.689 79.355 1.00 87.59 ? 430 SER A O   1 
ATOM   1406 C  CB  . SER A 1 173 ? 74.378 39.517 78.627 1.00 88.58 ? 430 SER A CB  1 
ATOM   1407 O  OG  . SER A 1 173 ? 75.625 40.170 78.758 1.00 89.81 ? 430 SER A OG  1 
ATOM   1408 N  N   . LEU A 1 174 ? 72.394 37.702 77.348 1.00 86.15 ? 431 LEU A N   1 
ATOM   1409 C  CA  . LEU A 1 174 ? 70.961 37.386 77.247 1.00 84.85 ? 431 LEU A CA  1 
ATOM   1410 C  C   . LEU A 1 174 ? 70.682 35.892 77.021 1.00 83.13 ? 431 LEU A C   1 
ATOM   1411 O  O   . LEU A 1 174 ? 71.550 35.163 76.524 1.00 83.32 ? 431 LEU A O   1 
ATOM   1412 C  CB  . LEU A 1 174 ? 70.335 38.202 76.108 1.00 85.08 ? 431 LEU A CB  1 
ATOM   1413 C  CG  . LEU A 1 174 ? 70.333 39.728 76.266 1.00 85.78 ? 431 LEU A CG  1 
ATOM   1414 C  CD1 . LEU A 1 174 ? 70.046 40.403 74.920 1.00 86.09 ? 431 LEU A CD1 1 
ATOM   1415 C  CD2 . LEU A 1 174 ? 69.325 40.175 77.331 1.00 85.94 ? 431 LEU A CD2 1 
ATOM   1416 N  N   . PRO A 1 175 ? 69.465 35.432 77.379 1.00 80.94 ? 432 PRO A N   1 
ATOM   1417 C  CA  . PRO A 1 175 ? 69.083 34.056 77.007 1.00 79.48 ? 432 PRO A CA  1 
ATOM   1418 C  C   . PRO A 1 175 ? 68.928 33.923 75.478 1.00 77.48 ? 432 PRO A C   1 
ATOM   1419 O  O   . PRO A 1 175 ? 68.502 34.891 74.819 1.00 77.25 ? 432 PRO A O   1 
ATOM   1420 C  CB  . PRO A 1 175 ? 67.732 33.861 77.701 1.00 79.59 ? 432 PRO A CB  1 
ATOM   1421 C  CG  . PRO A 1 175 ? 67.168 35.253 77.837 1.00 80.39 ? 432 PRO A CG  1 
ATOM   1422 C  CD  . PRO A 1 175 ? 68.344 36.180 77.984 1.00 80.83 ? 432 PRO A CD  1 
ATOM   1423 N  N   . PRO A 1 176 ? 69.278 32.747 74.909 1.00 74.80 ? 433 PRO A N   1 
ATOM   1424 C  CA  . PRO A 1 176 ? 69.160 32.626 73.436 1.00 72.62 ? 433 PRO A CA  1 
ATOM   1425 C  C   . PRO A 1 176 ? 67.746 32.910 72.892 1.00 69.55 ? 433 PRO A C   1 
ATOM   1426 O  O   . PRO A 1 176 ? 66.759 32.791 73.617 1.00 68.68 ? 433 PRO A O   1 
ATOM   1427 C  CB  . PRO A 1 176 ? 69.602 31.178 73.142 1.00 73.05 ? 433 PRO A CB  1 
ATOM   1428 C  CG  . PRO A 1 176 ? 70.442 30.767 74.364 1.00 74.22 ? 433 PRO A CG  1 
ATOM   1429 C  CD  . PRO A 1 176 ? 69.844 31.532 75.534 1.00 75.01 ? 433 PRO A CD  1 
ATOM   1430 N  N   . LEU A 1 177 ? 67.697 33.328 71.628 1.00 66.44 ? 434 LEU A N   1 
ATOM   1431 C  CA  . LEU A 1 177 ? 66.448 33.600 70.921 1.00 64.03 ? 434 LEU A CA  1 
ATOM   1432 C  C   . LEU A 1 177 ? 65.652 32.322 70.721 1.00 61.36 ? 434 LEU A C   1 
ATOM   1433 O  O   . LEU A 1 177 ? 66.192 31.314 70.274 1.00 60.01 ? 434 LEU A O   1 
ATOM   1434 C  CB  . LEU A 1 177 ? 66.726 34.195 69.535 1.00 64.11 ? 434 LEU A CB  1 
ATOM   1435 C  CG  . LEU A 1 177 ? 67.064 35.666 69.429 1.00 64.18 ? 434 LEU A CG  1 
ATOM   1436 C  CD1 . LEU A 1 177 ? 67.539 35.994 68.030 1.00 63.40 ? 434 LEU A CD1 1 
ATOM   1437 C  CD2 . LEU A 1 177 ? 65.846 36.476 69.810 1.00 65.15 ? 434 LEU A CD2 1 
ATOM   1438 N  N   . THR A 1 178 ? 64.371 32.385 71.059 1.00 58.78 ? 435 THR A N   1 
ATOM   1439 C  CA  . THR A 1 178 ? 63.419 31.358 70.691 1.00 57.13 ? 435 THR A CA  1 
ATOM   1440 C  C   . THR A 1 178 ? 62.552 31.888 69.534 1.00 55.29 ? 435 THR A C   1 
ATOM   1441 O  O   . THR A 1 178 ? 62.638 33.055 69.181 1.00 54.10 ? 435 THR A O   1 
ATOM   1442 C  CB  . THR A 1 178 ? 62.534 30.989 71.891 1.00 57.28 ? 435 THR A CB  1 
ATOM   1443 O  OG1 . THR A 1 178 ? 61.859 32.161 72.364 1.00 57.88 ? 435 THR A OG1 1 
ATOM   1444 C  CG2 . THR A 1 178 ? 63.382 30.395 73.019 1.00 56.83 ? 435 THR A CG2 1 
ATOM   1445 N  N   . ILE A 1 179 ? 61.724 31.016 68.961 1.00 53.64 ? 436 ILE A N   1 
ATOM   1446 C  CA  . ILE A 1 179 ? 60.819 31.378 67.884 1.00 52.35 ? 436 ILE A CA  1 
ATOM   1447 C  C   . ILE A 1 179 ? 59.916 32.542 68.304 1.00 51.89 ? 436 ILE A C   1 
ATOM   1448 O  O   . ILE A 1 179 ? 59.767 33.517 67.573 1.00 50.77 ? 436 ILE A O   1 
ATOM   1449 C  CB  . ILE A 1 179 ? 59.979 30.142 67.426 1.00 52.53 ? 436 ILE A CB  1 
ATOM   1450 C  CG1 . ILE A 1 179 ? 60.876 29.144 66.661 1.00 52.05 ? 436 ILE A CG1 1 
ATOM   1451 C  CG2 . ILE A 1 179 ? 58.788 30.568 66.546 1.00 51.09 ? 436 ILE A CG2 1 
ATOM   1452 C  CD1 . ILE A 1 179 ? 60.365 27.706 66.672 1.00 51.69 ? 436 ILE A CD1 1 
ATOM   1453 N  N   . SER A 1 180 ? 59.343 32.451 69.501 1.00 51.46 ? 437 SER A N   1 
ATOM   1454 C  CA  . SER A 1 180 ? 58.397 33.464 69.974 1.00 51.44 ? 437 SER A CA  1 
ATOM   1455 C  C   . SER A 1 180 ? 58.965 34.884 70.174 1.00 50.69 ? 437 SER A C   1 
ATOM   1456 O  O   . SER A 1 180 ? 58.204 35.824 70.178 1.00 50.82 ? 437 SER A O   1 
ATOM   1457 C  CB  . SER A 1 180 ? 57.719 33.008 71.266 1.00 51.36 ? 437 SER A CB  1 
ATOM   1458 O  OG  . SER A 1 180 ? 58.679 32.878 72.283 1.00 52.64 ? 437 SER A OG  1 
ATOM   1459 N  N   A ASN A 1 181 ? 60.275 35.031 70.346 0.57 50.35 ? 438 ASN A N   1 
ATOM   1460 N  N   B ASN A 1 181 ? 60.289 34.994 70.329 0.43 50.42 ? 438 ASN A N   1 
ATOM   1461 C  CA  A ASN A 1 181 ? 60.870 36.357 70.516 0.57 49.81 ? 438 ASN A CA  1 
ATOM   1462 C  CA  B ASN A 1 181 ? 61.000 36.272 70.474 0.43 49.97 ? 438 ASN A CA  1 
ATOM   1463 C  C   A ASN A 1 181 ? 61.169 37.023 69.171 0.57 49.26 ? 438 ASN A C   1 
ATOM   1464 C  C   B ASN A 1 181 ? 61.179 37.050 69.166 0.43 49.35 ? 438 ASN A C   1 
ATOM   1465 O  O   A ASN A 1 181 ? 62.310 37.375 68.868 0.57 49.30 ? 438 ASN A O   1 
ATOM   1466 O  O   B ASN A 1 181 ? 62.280 37.526 68.890 0.43 49.37 ? 438 ASN A O   1 
ATOM   1467 C  CB  A ASN A 1 181 ? 62.134 36.274 71.381 0.57 49.72 ? 438 ASN A CB  1 
ATOM   1468 C  CB  B ASN A 1 181 ? 62.417 36.028 71.025 0.43 49.96 ? 438 ASN A CB  1 
ATOM   1469 C  CG  A ASN A 1 181 ? 62.550 37.625 71.951 0.57 49.97 ? 438 ASN A CG  1 
ATOM   1470 C  CG  B ASN A 1 181 ? 62.445 35.710 72.516 0.43 50.69 ? 438 ASN A CG  1 
ATOM   1471 O  OD1 A ASN A 1 181 ? 61.777 38.588 71.954 0.57 50.22 ? 438 ASN A OD1 1 
ATOM   1472 O  OD1 B ASN A 1 181 ? 63.287 34.925 72.979 0.43 50.71 ? 438 ASN A OD1 1 
ATOM   1473 N  ND2 A ASN A 1 181 ? 63.782 37.697 72.436 0.57 50.26 ? 438 ASN A ND2 1 
ATOM   1474 N  ND2 B ASN A 1 181 ? 61.548 36.331 73.278 0.43 51.66 ? 438 ASN A ND2 1 
ATOM   1475 N  N   . HIS A 1 182 ? 60.128 37.190 68.366 1.00 48.71 ? 439 HIS A N   1 
ATOM   1476 C  CA  . HIS A 1 182 ? 60.235 37.909 67.081 1.00 47.95 ? 439 HIS A CA  1 
ATOM   1477 C  C   . HIS A 1 182 ? 58.988 38.738 66.831 1.00 47.49 ? 439 HIS A C   1 
ATOM   1478 O  O   . HIS A 1 182 ? 57.899 38.369 67.249 1.00 47.10 ? 439 HIS A O   1 
ATOM   1479 C  CB  . HIS A 1 182 ? 60.471 36.921 65.919 1.00 47.74 ? 439 HIS A CB  1 
ATOM   1480 C  CG  . HIS A 1 182 ? 61.789 36.224 65.994 1.00 45.79 ? 439 HIS A CG  1 
ATOM   1481 N  ND1 . HIS A 1 182 ? 61.985 35.091 66.750 1.00 42.39 ? 439 HIS A ND1 1 
ATOM   1482 C  CD2 . HIS A 1 182 ? 62.992 36.532 65.453 1.00 45.34 ? 439 HIS A CD2 1 
ATOM   1483 C  CE1 . HIS A 1 182 ? 63.252 34.723 66.660 1.00 43.99 ? 439 HIS A CE1 1 
ATOM   1484 N  NE2 . HIS A 1 182 ? 63.889 35.590 65.894 1.00 44.38 ? 439 HIS A NE2 1 
ATOM   1485 N  N   . ASP A 1 183 ? 59.161 39.865 66.155 1.00 47.76 ? 440 ASP A N   1 
ATOM   1486 C  CA  . ASP A 1 183 ? 58.049 40.757 65.818 1.00 48.16 ? 440 ASP A CA  1 
ATOM   1487 C  C   . ASP A 1 183 ? 57.066 40.068 64.894 1.00 48.59 ? 440 ASP A C   1 
ATOM   1488 O  O   . ASP A 1 183 ? 55.856 40.239 65.019 1.00 49.42 ? 440 ASP A O   1 
ATOM   1489 C  CB  . ASP A 1 183 ? 58.568 42.016 65.133 1.00 48.38 ? 440 ASP A CB  1 
ATOM   1490 C  CG  . ASP A 1 183 ? 59.531 42.812 66.011 1.00 48.64 ? 440 ASP A CG  1 
ATOM   1491 O  OD1 . ASP A 1 183 ? 59.436 42.695 67.243 1.00 49.69 ? 440 ASP A OD1 1 
ATOM   1492 O  OD2 . ASP A 1 183 ? 60.378 43.542 65.469 1.00 48.55 ? 440 ASP A OD2 1 
ATOM   1493 N  N   . VAL A 1 184 ? 57.596 39.282 63.962 1.00 48.24 ? 441 VAL A N   1 
ATOM   1494 C  CA  . VAL A 1 184 ? 56.784 38.595 62.974 1.00 47.59 ? 441 VAL A CA  1 
ATOM   1495 C  C   . VAL A 1 184 ? 57.184 37.129 62.950 1.00 47.34 ? 441 VAL A C   1 
ATOM   1496 O  O   . VAL A 1 184 ? 58.381 36.811 62.880 1.00 47.09 ? 441 VAL A O   1 
ATOM   1497 C  CB  . VAL A 1 184 ? 56.989 39.212 61.597 1.00 47.69 ? 441 VAL A CB  1 
ATOM   1498 C  CG1 . VAL A 1 184 ? 56.347 38.329 60.494 1.00 46.76 ? 441 VAL A CG1 1 
ATOM   1499 C  CG2 . VAL A 1 184 ? 56.444 40.629 61.587 1.00 46.10 ? 441 VAL A CG2 1 
ATOM   1500 N  N   . ILE A 1 185 ? 56.187 36.250 63.052 1.00 46.55 ? 442 ILE A N   1 
ATOM   1501 C  CA  . ILE A 1 185 ? 56.396 34.821 62.918 1.00 46.23 ? 442 ILE A CA  1 
ATOM   1502 C  C   . ILE A 1 185 ? 55.460 34.292 61.839 1.00 46.29 ? 442 ILE A C   1 
ATOM   1503 O  O   . ILE A 1 185 ? 54.261 34.530 61.891 1.00 45.66 ? 442 ILE A O   1 
ATOM   1504 C  CB  . ILE A 1 185 ? 56.139 34.046 64.227 1.00 46.52 ? 442 ILE A CB  1 
ATOM   1505 C  CG1 . ILE A 1 185 ? 56.896 34.674 65.413 1.00 46.88 ? 442 ILE A CG1 1 
ATOM   1506 C  CG2 . ILE A 1 185 ? 56.546 32.560 64.046 1.00 44.83 ? 442 ILE A CG2 1 
ATOM   1507 C  CD1 . ILE A 1 185 ? 56.427 34.141 66.824 1.00 46.22 ? 442 ILE A CD1 1 
ATOM   1508 N  N   . LEU A 1 186 ? 56.036 33.613 60.845 1.00 46.59 ? 443 LEU A N   1 
ATOM   1509 C  CA  . LEU A 1 186 ? 55.283 32.906 59.803 1.00 46.17 ? 443 LEU A CA  1 
ATOM   1510 C  C   . LEU A 1 186 ? 55.618 31.435 59.988 1.00 46.48 ? 443 LEU A C   1 
ATOM   1511 O  O   . LEU A 1 186 ? 56.785 31.065 60.005 1.00 46.02 ? 443 LEU A O   1 
ATOM   1512 C  CB  . LEU A 1 186 ? 55.680 33.361 58.399 1.00 45.52 ? 443 LEU A CB  1 
ATOM   1513 C  CG  . LEU A 1 186 ? 55.558 34.858 58.071 1.00 45.50 ? 443 LEU A CG  1 
ATOM   1514 C  CD1 . LEU A 1 186 ? 55.975 35.136 56.625 1.00 43.52 ? 443 LEU A CD1 1 
ATOM   1515 C  CD2 . LEU A 1 186 ? 54.155 35.402 58.325 1.00 43.56 ? 443 LEU A CD2 1 
ATOM   1516 N  N   . TRP A 1 187 ? 54.589 30.614 60.178 1.00 46.58 ? 444 TRP A N   1 
ATOM   1517 C  CA  . TRP A 1 187 ? 54.761 29.198 60.382 1.00 46.58 ? 444 TRP A CA  1 
ATOM   1518 C  C   . TRP A 1 187 ? 54.009 28.481 59.281 1.00 46.58 ? 444 TRP A C   1 
ATOM   1519 O  O   . TRP A 1 187 ? 52.817 28.713 59.080 1.00 46.33 ? 444 TRP A O   1 
ATOM   1520 C  CB  . TRP A 1 187 ? 54.241 28.790 61.743 1.00 46.59 ? 444 TRP A CB  1 
ATOM   1521 C  CG  . TRP A 1 187 ? 54.620 27.386 62.147 1.00 47.08 ? 444 TRP A CG  1 
ATOM   1522 C  CD1 . TRP A 1 187 ? 54.377 26.233 61.455 1.00 46.86 ? 444 TRP A CD1 1 
ATOM   1523 C  CD2 . TRP A 1 187 ? 55.267 26.997 63.360 1.00 46.58 ? 444 TRP A CD2 1 
ATOM   1524 N  NE1 . TRP A 1 187 ? 54.842 25.152 62.162 1.00 46.84 ? 444 TRP A NE1 1 
ATOM   1525 C  CE2 . TRP A 1 187 ? 55.397 25.595 63.333 1.00 48.13 ? 444 TRP A CE2 1 
ATOM   1526 C  CE3 . TRP A 1 187 ? 55.748 27.700 64.469 1.00 47.21 ? 444 TRP A CE3 1 
ATOM   1527 C  CZ2 . TRP A 1 187 ? 55.991 24.876 64.375 1.00 48.99 ? 444 TRP A CZ2 1 
ATOM   1528 C  CZ3 . TRP A 1 187 ? 56.339 26.996 65.498 1.00 48.29 ? 444 TRP A CZ3 1 
ATOM   1529 C  CH2 . TRP A 1 187 ? 56.463 25.592 65.442 1.00 49.16 ? 444 TRP A CH2 1 
ATOM   1530 N  N   . LEU A 1 188 ? 54.725 27.629 58.549 1.00 46.47 ? 445 LEU A N   1 
ATOM   1531 C  CA  . LEU A 1 188 ? 54.153 26.897 57.423 1.00 46.01 ? 445 LEU A CA  1 
ATOM   1532 C  C   . LEU A 1 188 ? 54.578 25.447 57.514 1.00 46.18 ? 445 LEU A C   1 
ATOM   1533 O  O   . LEU A 1 188 ? 55.485 25.116 58.269 1.00 45.75 ? 445 LEU A O   1 
ATOM   1534 C  CB  . LEU A 1 188 ? 54.602 27.516 56.103 1.00 45.77 ? 445 LEU A CB  1 
ATOM   1535 C  CG  . LEU A 1 188 ? 56.111 27.624 55.861 1.00 46.31 ? 445 LEU A CG  1 
ATOM   1536 C  CD1 . LEU A 1 188 ? 56.657 26.334 55.258 1.00 44.67 ? 445 LEU A CD1 1 
ATOM   1537 C  CD2 . LEU A 1 188 ? 56.429 28.838 54.972 1.00 44.67 ? 445 LEU A CD2 1 
ATOM   1538 N  N   . GLY A 1 189 ? 53.911 24.574 56.767 1.00 46.20 ? 446 GLY A N   1 
ATOM   1539 C  CA  . GLY A 1 189 ? 54.352 23.201 56.680 1.00 46.34 ? 446 GLY A CA  1 
ATOM   1540 C  C   . GLY A 1 189 ? 53.266 22.213 56.354 1.00 46.46 ? 446 GLY A C   1 
ATOM   1541 O  O   . GLY A 1 189 ? 52.119 22.577 56.161 1.00 46.45 ? 446 GLY A O   1 
ATOM   1542 N  N   . ASP A 1 190 ? 53.656 20.944 56.272 1.00 46.90 ? 447 ASP A N   1 
ATOM   1543 C  CA  . ASP A 1 190 ? 52.706 19.836 56.268 1.00 46.73 ? 447 ASP A CA  1 
ATOM   1544 C  C   . ASP A 1 190 ? 52.441 19.519 57.722 1.00 46.62 ? 447 ASP A C   1 
ATOM   1545 O  O   . ASP A 1 190 ? 53.135 18.703 58.323 1.00 46.41 ? 447 ASP A O   1 
ATOM   1546 C  CB  . ASP A 1 190 ? 53.274 18.624 55.525 1.00 46.51 ? 447 ASP A CB  1 
ATOM   1547 C  CG  . ASP A 1 190 ? 52.362 17.413 55.585 1.00 46.42 ? 447 ASP A CG  1 
ATOM   1548 O  OD1 . ASP A 1 190 ? 51.335 17.441 56.310 1.00 46.27 ? 447 ASP A OD1 1 
ATOM   1549 O  OD2 . ASP A 1 190 ? 52.687 16.413 54.917 1.00 45.74 ? 447 ASP A OD2 1 
ATOM   1550 N  N   . LEU A 1 191 ? 51.450 20.191 58.290 1.00 46.84 ? 448 LEU A N   1 
ATOM   1551 C  CA  . LEU A 1 191 ? 51.145 20.024 59.703 1.00 47.62 ? 448 LEU A CA  1 
ATOM   1552 C  C   . LEU A 1 191 ? 50.379 18.715 59.959 1.00 48.03 ? 448 LEU A C   1 
ATOM   1553 O  O   . LEU A 1 191 ? 50.289 18.269 61.089 1.00 47.68 ? 448 LEU A O   1 
ATOM   1554 C  CB  . LEU A 1 191 ? 50.375 21.228 60.238 1.00 47.41 ? 448 LEU A CB  1 
ATOM   1555 C  CG  . LEU A 1 191 ? 50.964 22.610 59.930 1.00 47.78 ? 448 LEU A CG  1 
ATOM   1556 C  CD1 . LEU A 1 191 ? 50.192 23.673 60.702 1.00 45.35 ? 448 LEU A CD1 1 
ATOM   1557 C  CD2 . LEU A 1 191 ? 52.469 22.692 60.228 1.00 47.05 ? 448 LEU A CD2 1 
ATOM   1558 N  N   . ASN A 1 192 ? 49.831 18.120 58.898 1.00 48.96 ? 449 ASN A N   1 
ATOM   1559 C  CA  . ASN A 1 192 ? 49.307 16.748 58.925 1.00 49.44 ? 449 ASN A CA  1 
ATOM   1560 C  C   . ASN A 1 192 ? 48.030 16.529 59.730 1.00 50.24 ? 449 ASN A C   1 
ATOM   1561 O  O   . ASN A 1 192 ? 47.637 15.384 59.988 1.00 50.02 ? 449 ASN A O   1 
ATOM   1562 C  CB  . ASN A 1 192 ? 50.399 15.761 59.386 1.00 49.59 ? 449 ASN A CB  1 
ATOM   1563 C  CG  . ASN A 1 192 ? 50.833 14.809 58.289 1.00 49.52 ? 449 ASN A CG  1 
ATOM   1564 O  OD1 . ASN A 1 192 ? 50.037 14.431 57.428 1.00 49.74 ? 449 ASN A OD1 1 
ATOM   1565 N  ND2 . ASN A 1 192 ? 52.090 14.390 58.334 1.00 48.74 ? 449 ASN A ND2 1 
ATOM   1566 N  N   . TYR A 1 193 ? 47.357 17.611 60.104 1.00 51.30 ? 450 TYR A N   1 
ATOM   1567 C  CA  . TYR A 1 193 ? 46.090 17.481 60.793 1.00 51.84 ? 450 TYR A CA  1 
ATOM   1568 C  C   . TYR A 1 193 ? 45.012 17.084 59.783 1.00 52.91 ? 450 TYR A C   1 
ATOM   1569 O  O   . TYR A 1 193 ? 45.041 17.498 58.624 1.00 52.50 ? 450 TYR A O   1 
ATOM   1570 C  CB  . TYR A 1 193 ? 45.743 18.767 61.536 1.00 52.01 ? 450 TYR A CB  1 
ATOM   1571 C  CG  . TYR A 1 193 ? 46.607 19.021 62.764 1.00 50.96 ? 450 TYR A CG  1 
ATOM   1572 C  CD1 . TYR A 1 193 ? 46.321 18.414 63.975 1.00 50.07 ? 450 TYR A CD1 1 
ATOM   1573 C  CD2 . TYR A 1 193 ? 47.697 19.881 62.710 1.00 49.82 ? 450 TYR A CD2 1 
ATOM   1574 C  CE1 . TYR A 1 193 ? 47.107 18.647 65.099 1.00 48.67 ? 450 TYR A CE1 1 
ATOM   1575 C  CE2 . TYR A 1 193 ? 48.479 20.123 63.831 1.00 49.34 ? 450 TYR A CE2 1 
ATOM   1576 C  CZ  . TYR A 1 193 ? 48.180 19.505 65.017 1.00 48.76 ? 450 TYR A CZ  1 
ATOM   1577 O  OH  . TYR A 1 193 ? 48.969 19.742 66.124 1.00 48.73 ? 450 TYR A OH  1 
ATOM   1578 N  N   . ARG A 1 194 ? 44.079 16.255 60.239 1.00 54.37 ? 451 ARG A N   1 
ATOM   1579 C  CA  . ARG A 1 194 ? 43.099 15.606 59.376 1.00 55.78 ? 451 ARG A CA  1 
ATOM   1580 C  C   . ARG A 1 194 ? 41.670 15.994 59.773 1.00 57.35 ? 451 ARG A C   1 
ATOM   1581 O  O   . ARG A 1 194 ? 41.468 16.803 60.681 1.00 57.16 ? 451 ARG A O   1 
ATOM   1582 C  CB  . ARG A 1 194 ? 43.265 14.084 59.494 1.00 55.67 ? 451 ARG A CB  1 
ATOM   1583 C  CG  . ARG A 1 194 ? 44.698 13.568 59.351 1.00 54.86 ? 451 ARG A CG  1 
ATOM   1584 C  CD  . ARG A 1 194 ? 45.372 14.049 58.066 1.00 53.82 ? 451 ARG A CD  1 
ATOM   1585 N  NE  . ARG A 1 194 ? 46.742 13.589 57.974 1.00 53.39 ? 451 ARG A NE  1 
ATOM   1586 C  CZ  . ARG A 1 194 ? 47.131 12.425 57.445 1.00 55.71 ? 451 ARG A CZ  1 
ATOM   1587 N  NH1 . ARG A 1 194 ? 46.259 11.564 56.923 1.00 55.45 ? 451 ARG A NH1 1 
ATOM   1588 N  NH2 . ARG A 1 194 ? 48.420 12.124 57.425 1.00 56.02 ? 451 ARG A NH2 1 
ATOM   1589 N  N   . ILE A 1 195 ? 40.690 15.397 59.095 1.00 59.28 ? 452 ILE A N   1 
ATOM   1590 C  CA  . ILE A 1 195 ? 39.268 15.610 59.401 1.00 60.83 ? 452 ILE A CA  1 
ATOM   1591 C  C   . ILE A 1 195 ? 38.736 14.534 60.378 1.00 62.65 ? 452 ILE A C   1 
ATOM   1592 O  O   . ILE A 1 195 ? 38.690 13.353 60.032 1.00 62.68 ? 452 ILE A O   1 
ATOM   1593 C  CB  . ILE A 1 195 ? 38.439 15.595 58.103 1.00 60.67 ? 452 ILE A CB  1 
ATOM   1594 C  CG1 . ILE A 1 195 ? 39.027 16.557 57.065 1.00 60.62 ? 452 ILE A CG1 1 
ATOM   1595 C  CG2 . ILE A 1 195 ? 36.981 15.957 58.369 1.00 60.86 ? 452 ILE A CG2 1 
ATOM   1596 C  CD1 . ILE A 1 195 ? 38.973 18.016 57.454 1.00 60.57 ? 452 ILE A CD1 1 
ATOM   1597 N  N   . GLU A 1 196 ? 38.370 14.954 61.596 1.00 64.71 ? 453 GLU A N   1 
ATOM   1598 C  CA  A GLU A 1 196 ? 37.789 14.033 62.587 0.50 65.64 ? 453 GLU A CA  1 
ATOM   1599 C  CA  B GLU A 1 196 ? 37.747 14.100 62.626 0.50 65.64 ? 453 GLU A CA  1 
ATOM   1600 C  C   . GLU A 1 196 ? 36.394 13.556 62.185 1.00 66.48 ? 453 GLU A C   1 
ATOM   1601 O  O   . GLU A 1 196 ? 35.723 14.163 61.341 1.00 66.17 ? 453 GLU A O   1 
ATOM   1602 C  CB  A GLU A 1 196 ? 37.701 14.672 63.984 0.50 65.71 ? 453 GLU A CB  1 
ATOM   1603 C  CB  B GLU A 1 196 ? 37.500 14.898 63.928 0.50 65.73 ? 453 GLU A CB  1 
ATOM   1604 C  CG  A GLU A 1 196 ? 38.994 14.635 64.788 0.50 66.40 ? 453 GLU A CG  1 
ATOM   1605 C  CG  B GLU A 1 196 ? 38.548 14.740 65.021 0.50 66.37 ? 453 GLU A CG  1 
ATOM   1606 C  CD  A GLU A 1 196 ? 39.380 13.244 65.278 0.50 66.70 ? 453 GLU A CD  1 
ATOM   1607 C  CD  B GLU A 1 196 ? 38.199 15.510 66.293 0.50 67.29 ? 453 GLU A CD  1 
ATOM   1608 O  OE1 A GLU A 1 196 ? 38.784 12.243 64.819 0.50 68.34 ? 453 GLU A OE1 1 
ATOM   1609 O  OE1 B GLU A 1 196 ? 37.040 15.960 66.428 0.50 67.19 ? 453 GLU A OE1 1 
ATOM   1610 O  OE2 A GLU A 1 196 ? 40.290 13.154 66.126 0.50 65.83 ? 453 GLU A OE2 1 
ATOM   1611 O  OE2 B GLU A 1 196 ? 39.088 15.662 67.165 0.50 68.33 ? 453 GLU A OE2 1 
ATOM   1612 N  N   . GLU A 1 197 ? 35.992 12.439 62.797 1.00 68.16 ? 454 GLU A N   1 
ATOM   1613 C  CA  . GLU A 1 197 ? 34.613 11.926 62.771 1.00 69.60 ? 454 GLU A CA  1 
ATOM   1614 C  C   . GLU A 1 197 ? 34.035 11.469 61.421 1.00 70.04 ? 454 GLU A C   1 
ATOM   1615 O  O   . GLU A 1 197 ? 33.604 10.317 61.299 1.00 70.71 ? 454 GLU A O   1 
ATOM   1616 C  CB  . GLU A 1 197 ? 33.682 12.953 63.420 1.00 70.00 ? 454 GLU A CB  1 
ATOM   1617 C  CG  . GLU A 1 197 ? 32.323 12.387 63.816 1.00 72.75 ? 454 GLU A CG  1 
ATOM   1618 C  CD  . GLU A 1 197 ? 31.464 13.382 64.573 1.00 75.46 ? 454 GLU A CD  1 
ATOM   1619 O  OE1 . GLU A 1 197 ? 32.012 14.122 65.427 1.00 76.80 ? 454 GLU A OE1 1 
ATOM   1620 O  OE2 . GLU A 1 197 ? 30.237 13.417 64.309 1.00 77.62 ? 454 GLU A OE2 1 
ATOM   1621 N  N   . LEU A 1 198 ? 33.998 12.352 60.424 1.00 70.48 ? 455 LEU A N   1 
ATOM   1622 C  CA  . LEU A 1 198 ? 33.345 12.037 59.142 1.00 70.69 ? 455 LEU A CA  1 
ATOM   1623 C  C   . LEU A 1 198 ? 34.043 10.869 58.447 1.00 71.26 ? 455 LEU A C   1 
ATOM   1624 O  O   . LEU A 1 198 ? 35.232 10.637 58.667 1.00 71.41 ? 455 LEU A O   1 
ATOM   1625 C  CB  . LEU A 1 198 ? 33.324 13.256 58.211 1.00 70.57 ? 455 LEU A CB  1 
ATOM   1626 C  CG  . LEU A 1 198 ? 32.838 14.590 58.793 1.00 70.14 ? 455 LEU A CG  1 
ATOM   1627 C  CD1 . LEU A 1 198 ? 32.881 15.664 57.729 1.00 68.29 ? 455 LEU A CD1 1 
ATOM   1628 C  CD2 . LEU A 1 198 ? 31.431 14.459 59.395 1.00 70.56 ? 455 LEU A CD2 1 
ATOM   1629 N  N   . ASP A 1 199 ? 33.295 10.124 57.631 1.00 71.90 ? 456 ASP A N   1 
ATOM   1630 C  CA  . ASP A 1 199 ? 33.855 8.987  56.895 1.00 72.18 ? 456 ASP A CA  1 
ATOM   1631 C  C   . ASP A 1 199 ? 34.307 9.470  55.540 1.00 71.91 ? 456 ASP A C   1 
ATOM   1632 O  O   . ASP A 1 199 ? 33.904 10.537 55.099 1.00 72.07 ? 456 ASP A O   1 
ATOM   1633 C  CB  . ASP A 1 199 ? 32.881 7.783  56.794 1.00 72.63 ? 456 ASP A CB  1 
ATOM   1634 C  CG  . ASP A 1 199 ? 31.546 8.112  56.104 1.00 74.01 ? 456 ASP A CG  1 
ATOM   1635 O  OD1 . ASP A 1 199 ? 31.532 8.672  54.986 1.00 75.49 ? 456 ASP A OD1 1 
ATOM   1636 O  OD2 . ASP A 1 199 ? 30.490 7.762  56.680 1.00 76.67 ? 456 ASP A OD2 1 
ATOM   1637 N  N   . VAL A 1 200 ? 35.145 8.679  54.887 1.00 71.99 ? 457 VAL A N   1 
ATOM   1638 C  CA  . VAL A 1 200 ? 35.849 9.115  53.687 1.00 72.18 ? 457 VAL A CA  1 
ATOM   1639 C  C   . VAL A 1 200 ? 34.871 9.610  52.633 1.00 72.35 ? 457 VAL A C   1 
ATOM   1640 O  O   . VAL A 1 200 ? 35.114 10.622 51.985 1.00 72.11 ? 457 VAL A O   1 
ATOM   1641 C  CB  . VAL A 1 200 ? 36.731 7.980  53.105 1.00 72.23 ? 457 VAL A CB  1 
ATOM   1642 C  CG1 . VAL A 1 200 ? 37.439 8.437  51.845 1.00 71.84 ? 457 VAL A CG1 1 
ATOM   1643 C  CG2 . VAL A 1 200 ? 37.750 7.527  54.138 1.00 73.28 ? 457 VAL A CG2 1 
ATOM   1644 N  N   . GLU A 1 201 ? 33.754 8.901  52.490 1.00 72.76 ? 458 GLU A N   1 
ATOM   1645 C  CA  . GLU A 1 201 ? 32.748 9.209  51.467 1.00 72.92 ? 458 GLU A CA  1 
ATOM   1646 C  C   . GLU A 1 201 ? 32.067 10.557 51.734 1.00 72.03 ? 458 GLU A C   1 
ATOM   1647 O  O   . GLU A 1 201 ? 31.822 11.333 50.809 1.00 71.43 ? 458 GLU A O   1 
ATOM   1648 C  CB  . GLU A 1 201 ? 31.694 8.085  51.382 1.00 73.54 ? 458 GLU A CB  1 
ATOM   1649 C  CG  . GLU A 1 201 ? 32.250 6.670  51.001 1.00 75.38 ? 458 GLU A CG  1 
ATOM   1650 C  CD  . GLU A 1 201 ? 32.720 5.822  52.209 1.00 77.86 ? 458 GLU A CD  1 
ATOM   1651 O  OE1 . GLU A 1 201 ? 32.478 6.210  53.383 1.00 78.52 ? 458 GLU A OE1 1 
ATOM   1652 O  OE2 . GLU A 1 201 ? 33.345 4.756  51.973 1.00 79.39 ? 458 GLU A OE2 1 
ATOM   1653 N  N   . LYS A 1 202 ? 31.767 10.821 53.002 1.00 71.36 ? 459 LYS A N   1 
ATOM   1654 C  CA  . LYS A 1 202 ? 31.155 12.088 53.410 1.00 71.23 ? 459 LYS A CA  1 
ATOM   1655 C  C   . LYS A 1 202 ? 32.123 13.265 53.184 1.00 70.44 ? 459 LYS A C   1 
ATOM   1656 O  O   . LYS A 1 202 ? 31.714 14.321 52.675 1.00 70.53 ? 459 LYS A O   1 
ATOM   1657 C  CB  . LYS A 1 202 ? 30.699 11.996 54.875 1.00 71.57 ? 459 LYS A CB  1 
ATOM   1658 C  CG  . LYS A 1 202 ? 30.114 13.276 55.496 1.00 73.24 ? 459 LYS A CG  1 
ATOM   1659 C  CD  . LYS A 1 202 ? 28.902 13.826 54.739 1.00 75.91 ? 459 LYS A CD  1 
ATOM   1660 C  CE  . LYS A 1 202 ? 28.196 14.922 55.565 1.00 77.51 ? 459 LYS A CE  1 
ATOM   1661 N  NZ  . LYS A 1 202 ? 27.082 15.585 54.818 1.00 78.72 ? 459 LYS A NZ  1 
ATOM   1662 N  N   . VAL A 1 203 ? 33.400 13.068 53.533 1.00 69.12 ? 460 VAL A N   1 
ATOM   1663 C  CA  . VAL A 1 203 ? 34.449 14.064 53.274 1.00 68.10 ? 460 VAL A CA  1 
ATOM   1664 C  C   . VAL A 1 203 ? 34.530 14.409 51.783 1.00 67.44 ? 460 VAL A C   1 
ATOM   1665 O  O   . VAL A 1 203 ? 34.524 15.582 51.423 1.00 67.08 ? 460 VAL A O   1 
ATOM   1666 C  CB  . VAL A 1 203 ? 35.849 13.592 53.784 1.00 67.96 ? 460 VAL A CB  1 
ATOM   1667 C  CG1 . VAL A 1 203 ? 36.935 14.529 53.314 1.00 67.44 ? 460 VAL A CG1 1 
ATOM   1668 C  CG2 . VAL A 1 203 ? 35.874 13.480 55.306 1.00 67.22 ? 460 VAL A CG2 1 
ATOM   1669 N  N   . LYS A 1 204 ? 34.584 13.395 50.925 1.00 66.88 ? 461 LYS A N   1 
ATOM   1670 C  CA  . LYS A 1 204 ? 34.676 13.621 49.478 1.00 66.85 ? 461 LYS A CA  1 
ATOM   1671 C  C   . LYS A 1 204 ? 33.423 14.277 48.884 1.00 67.27 ? 461 LYS A C   1 
ATOM   1672 O  O   . LYS A 1 204 ? 33.512 15.013 47.898 1.00 66.97 ? 461 LYS A O   1 
ATOM   1673 C  CB  . LYS A 1 204 ? 34.973 12.315 48.734 1.00 66.75 ? 461 LYS A CB  1 
ATOM   1674 C  CG  . LYS A 1 204 ? 36.334 11.716 49.051 1.00 65.57 ? 461 LYS A CG  1 
ATOM   1675 C  CD  . LYS A 1 204 ? 36.587 10.451 48.270 1.00 64.79 ? 461 LYS A CD  1 
ATOM   1676 C  CE  . LYS A 1 204 ? 37.989 9.905  48.517 1.00 64.15 ? 461 LYS A CE  1 
ATOM   1677 N  NZ  . LYS A 1 204 ? 38.264 8.712  47.699 1.00 62.42 ? 461 LYS A NZ  1 
ATOM   1678 N  N   . LYS A 1 205 ? 32.265 14.008 49.485 1.00 67.90 ? 462 LYS A N   1 
ATOM   1679 C  CA  . LYS A 1 205 ? 31.001 14.590 49.030 1.00 68.67 ? 462 LYS A CA  1 
ATOM   1680 C  C   . LYS A 1 205 ? 30.973 16.082 49.350 1.00 68.18 ? 462 LYS A C   1 
ATOM   1681 O  O   . LYS A 1 205 ? 30.751 16.901 48.453 1.00 68.01 ? 462 LYS A O   1 
ATOM   1682 C  CB  . LYS A 1 205 ? 29.799 13.866 49.671 1.00 69.24 ? 462 LYS A CB  1 
ATOM   1683 C  CG  . LYS A 1 205 ? 28.404 14.350 49.222 1.00 71.43 ? 462 LYS A CG  1 
ATOM   1684 C  CD  . LYS A 1 205 ? 28.242 14.462 47.680 1.00 74.24 ? 462 LYS A CD  1 
ATOM   1685 C  CE  . LYS A 1 205 ? 26.752 14.575 47.264 1.00 76.58 ? 462 LYS A CE  1 
ATOM   1686 N  NZ  . LYS A 1 205 ? 26.461 15.750 46.360 1.00 77.65 ? 462 LYS A NZ  1 
ATOM   1687 N  N   . LEU A 1 206 ? 31.223 16.427 50.616 1.00 67.77 ? 463 LEU A N   1 
ATOM   1688 C  CA  . LEU A 1 206 ? 31.376 17.834 51.023 1.00 67.36 ? 463 LEU A CA  1 
ATOM   1689 C  C   . LEU A 1 206 ? 32.317 18.631 50.100 1.00 67.40 ? 463 LEU A C   1 
ATOM   1690 O  O   . LEU A 1 206 ? 32.036 19.782 49.763 1.00 67.37 ? 463 LEU A O   1 
ATOM   1691 C  CB  . LEU A 1 206 ? 31.850 17.924 52.473 1.00 67.12 ? 463 LEU A CB  1 
ATOM   1692 C  CG  . LEU A 1 206 ? 30.831 17.536 53.550 1.00 66.62 ? 463 LEU A CG  1 
ATOM   1693 C  CD1 . LEU A 1 206 ? 31.475 17.448 54.929 1.00 64.62 ? 463 LEU A CD1 1 
ATOM   1694 C  CD2 . LEU A 1 206 ? 29.678 18.517 53.585 1.00 65.88 ? 463 LEU A CD2 1 
ATOM   1695 N  N   . ILE A 1 207 ? 33.411 18.011 49.665 1.00 67.70 ? 464 ILE A N   1 
ATOM   1696 C  CA  . ILE A 1 207 ? 34.371 18.669 48.762 1.00 67.90 ? 464 ILE A CA  1 
ATOM   1697 C  C   . ILE A 1 207 ? 33.814 18.881 47.350 1.00 68.85 ? 464 ILE A C   1 
ATOM   1698 O  O   . ILE A 1 207 ? 34.102 19.892 46.699 1.00 68.50 ? 464 ILE A O   1 
ATOM   1699 C  CB  . ILE A 1 207 ? 35.704 17.884 48.689 1.00 67.48 ? 464 ILE A CB  1 
ATOM   1700 C  CG1 . ILE A 1 207 ? 36.409 17.937 50.046 1.00 66.96 ? 464 ILE A CG1 1 
ATOM   1701 C  CG2 . ILE A 1 207 ? 36.606 18.445 47.599 1.00 66.59 ? 464 ILE A CG2 1 
ATOM   1702 C  CD1 . ILE A 1 207 ? 37.401 16.849 50.263 1.00 66.00 ? 464 ILE A CD1 1 
ATOM   1703 N  N   . GLU A 1 208 ? 33.029 17.920 46.872 1.00 70.27 ? 465 GLU A N   1 
ATOM   1704 C  CA  . GLU A 1 208 ? 32.398 18.034 45.558 1.00 71.45 ? 465 GLU A CA  1 
ATOM   1705 C  C   . GLU A 1 208 ? 31.334 19.117 45.608 1.00 71.22 ? 465 GLU A C   1 
ATOM   1706 O  O   . GLU A 1 208 ? 31.124 19.831 44.638 1.00 71.33 ? 465 GLU A O   1 
ATOM   1707 C  CB  . GLU A 1 208 ? 31.783 16.701 45.113 1.00 72.16 ? 465 GLU A CB  1 
ATOM   1708 C  CG  . GLU A 1 208 ? 31.676 16.572 43.591 1.00 75.08 ? 465 GLU A CG  1 
ATOM   1709 C  CD  . GLU A 1 208 ? 31.127 15.225 43.124 1.00 79.58 ? 465 GLU A CD  1 
ATOM   1710 O  OE1 . GLU A 1 208 ? 31.002 14.280 43.953 1.00 81.60 ? 465 GLU A OE1 1 
ATOM   1711 O  OE2 . GLU A 1 208 ? 30.828 15.117 41.908 1.00 82.21 ? 465 GLU A OE2 1 
ATOM   1712 N  N   . GLU A 1 209 ? 30.688 19.234 46.764 1.00 71.40 ? 466 GLU A N   1 
ATOM   1713 C  CA  . GLU A 1 209 ? 29.716 20.288 47.032 1.00 71.69 ? 466 GLU A CA  1 
ATOM   1714 C  C   . GLU A 1 209 ? 30.371 21.649 47.301 1.00 71.14 ? 466 GLU A C   1 
ATOM   1715 O  O   . GLU A 1 209 ? 29.688 22.671 47.297 1.00 70.99 ? 466 GLU A O   1 
ATOM   1716 C  CB  . GLU A 1 209 ? 28.836 19.892 48.233 1.00 72.11 ? 466 GLU A CB  1 
ATOM   1717 C  CG  . GLU A 1 209 ? 27.851 18.763 47.931 1.00 73.69 ? 466 GLU A CG  1 
ATOM   1718 C  CD  . GLU A 1 209 ? 27.185 18.168 49.178 1.00 76.60 ? 466 GLU A CD  1 
ATOM   1719 O  OE1 . GLU A 1 209 ? 27.392 18.679 50.305 1.00 77.65 ? 466 GLU A OE1 1 
ATOM   1720 O  OE2 . GLU A 1 209 ? 26.440 17.169 49.018 1.00 78.68 ? 466 GLU A OE2 1 
ATOM   1721 N  N   . LYS A 1 210 ? 31.683 21.654 47.535 1.00 70.48 ? 467 LYS A N   1 
ATOM   1722 C  CA  . LYS A 1 210 ? 32.433 22.861 47.896 1.00 70.03 ? 467 LYS A CA  1 
ATOM   1723 C  C   . LYS A 1 210 ? 31.971 23.472 49.229 1.00 69.05 ? 467 LYS A C   1 
ATOM   1724 O  O   . LYS A 1 210 ? 32.069 24.675 49.422 1.00 68.73 ? 467 LYS A O   1 
ATOM   1725 C  CB  . LYS A 1 210 ? 32.388 23.910 46.769 1.00 70.24 ? 467 LYS A CB  1 
ATOM   1726 C  CG  . LYS A 1 210 ? 33.043 23.466 45.466 1.00 71.54 ? 467 LYS A CG  1 
ATOM   1727 C  CD  . LYS A 1 210 ? 32.930 24.551 44.395 1.00 73.67 ? 467 LYS A CD  1 
ATOM   1728 C  CE  . LYS A 1 210 ? 34.146 24.578 43.450 1.00 75.75 ? 467 LYS A CE  1 
ATOM   1729 N  NZ  . LYS A 1 210 ? 34.417 23.267 42.782 1.00 77.21 ? 467 LYS A NZ  1 
ATOM   1730 N  N   . ASP A 1 211 ? 31.496 22.635 50.150 1.00 68.19 ? 468 ASP A N   1 
ATOM   1731 C  CA  . ASP A 1 211 ? 31.090 23.087 51.483 1.00 67.67 ? 468 ASP A CA  1 
ATOM   1732 C  C   . ASP A 1 211 ? 32.285 23.023 52.453 1.00 67.12 ? 468 ASP A C   1 
ATOM   1733 O  O   . ASP A 1 211 ? 32.355 22.178 53.359 1.00 66.47 ? 468 ASP A O   1 
ATOM   1734 C  CB  . ASP A 1 211 ? 29.904 22.247 51.979 1.00 67.86 ? 468 ASP A CB  1 
ATOM   1735 C  CG  . ASP A 1 211 ? 29.175 22.872 53.176 1.00 68.72 ? 468 ASP A CG  1 
ATOM   1736 O  OD1 . ASP A 1 211 ? 29.616 23.911 53.733 1.00 69.35 ? 468 ASP A OD1 1 
ATOM   1737 O  OD2 . ASP A 1 211 ? 28.141 22.293 53.566 1.00 70.90 ? 468 ASP A OD2 1 
ATOM   1738 N  N   . PHE A 1 212 ? 33.221 23.947 52.254 1.00 66.76 ? 469 PHE A N   1 
ATOM   1739 C  CA  . PHE A 1 212 ? 34.467 23.976 53.016 1.00 66.25 ? 469 PHE A CA  1 
ATOM   1740 C  C   . PHE A 1 212 ? 34.273 24.451 54.460 1.00 66.60 ? 469 PHE A C   1 
ATOM   1741 O  O   . PHE A 1 212 ? 35.012 24.027 55.350 1.00 66.52 ? 469 PHE A O   1 
ATOM   1742 C  CB  . PHE A 1 212 ? 35.513 24.833 52.301 1.00 65.94 ? 469 PHE A CB  1 
ATOM   1743 C  CG  . PHE A 1 212 ? 35.855 24.360 50.898 1.00 64.60 ? 469 PHE A CG  1 
ATOM   1744 C  CD1 . PHE A 1 212 ? 36.109 23.028 50.631 1.00 64.42 ? 469 PHE A CD1 1 
ATOM   1745 C  CD2 . PHE A 1 212 ? 35.952 25.261 49.856 1.00 64.35 ? 469 PHE A CD2 1 
ATOM   1746 C  CE1 . PHE A 1 212 ? 36.433 22.602 49.345 1.00 64.68 ? 469 PHE A CE1 1 
ATOM   1747 C  CE2 . PHE A 1 212 ? 36.276 24.840 48.575 1.00 64.79 ? 469 PHE A CE2 1 
ATOM   1748 C  CZ  . PHE A 1 212 ? 36.514 23.504 48.322 1.00 64.05 ? 469 PHE A CZ  1 
ATOM   1749 N  N   . GLN A 1 213 ? 33.279 25.306 54.701 1.00 67.02 ? 470 GLN A N   1 
ATOM   1750 C  CA  . GLN A 1 213 ? 32.961 25.753 56.068 1.00 67.62 ? 470 GLN A CA  1 
ATOM   1751 C  C   . GLN A 1 213 ? 32.561 24.566 56.960 1.00 67.13 ? 470 GLN A C   1 
ATOM   1752 O  O   . GLN A 1 213 ? 32.976 24.482 58.120 1.00 67.02 ? 470 GLN A O   1 
ATOM   1753 C  CB  . GLN A 1 213 ? 31.843 26.807 56.054 1.00 68.18 ? 470 GLN A CB  1 
ATOM   1754 C  CG  . GLN A 1 213 ? 31.412 27.316 57.458 1.00 71.04 ? 470 GLN A CG  1 
ATOM   1755 C  CD  . GLN A 1 213 ? 29.887 27.489 57.594 1.00 75.21 ? 470 GLN A CD  1 
ATOM   1756 O  OE1 . GLN A 1 213 ? 29.333 28.534 57.225 1.00 77.43 ? 470 GLN A OE1 1 
ATOM   1757 N  NE2 . GLN A 1 213 ? 29.208 26.459 58.127 1.00 75.45 ? 470 GLN A NE2 1 
ATOM   1758 N  N   . MET A 1 214 ? 31.767 23.658 56.397 1.00 66.77 ? 471 MET A N   1 
ATOM   1759 C  CA  . MET A 1 214 ? 31.265 22.482 57.105 1.00 66.71 ? 471 MET A CA  1 
ATOM   1760 C  C   . MET A 1 214 ? 32.363 21.441 57.318 1.00 65.54 ? 471 MET A C   1 
ATOM   1761 O  O   . MET A 1 214 ? 32.519 20.907 58.414 1.00 65.17 ? 471 MET A O   1 
ATOM   1762 C  CB  . MET A 1 214 ? 30.114 21.858 56.303 1.00 67.42 ? 471 MET A CB  1 
ATOM   1763 C  CG  . MET A 1 214 ? 29.528 20.580 56.892 1.00 70.25 ? 471 MET A CG  1 
ATOM   1764 S  SD  . MET A 1 214 ? 28.820 20.800 58.538 1.00 77.27 ? 471 MET A SD  1 
ATOM   1765 C  CE  . MET A 1 214 ? 27.697 19.383 58.560 1.00 78.89 ? 471 MET A CE  1 
ATOM   1766 N  N   . LEU A 1 215 ? 33.117 21.150 56.263 1.00 64.45 ? 472 LEU A N   1 
ATOM   1767 C  CA  . LEU A 1 215 ? 34.279 20.272 56.381 1.00 63.57 ? 472 LEU A CA  1 
ATOM   1768 C  C   . LEU A 1 215 ? 35.255 20.836 57.417 1.00 62.81 ? 472 LEU A C   1 
ATOM   1769 O  O   . LEU A 1 215 ? 35.775 20.090 58.244 1.00 62.22 ? 472 LEU A O   1 
ATOM   1770 C  CB  . LEU A 1 215 ? 34.954 20.102 55.018 1.00 63.63 ? 472 LEU A CB  1 
ATOM   1771 C  CG  . LEU A 1 215 ? 36.070 19.061 54.870 1.00 64.18 ? 472 LEU A CG  1 
ATOM   1772 C  CD1 . LEU A 1 215 ? 35.595 17.657 55.239 1.00 62.99 ? 472 LEU A CD1 1 
ATOM   1773 C  CD2 . LEU A 1 215 ? 36.635 19.092 53.448 1.00 62.71 ? 472 LEU A CD2 1 
ATOM   1774 N  N   . TYR A 1 216 ? 35.458 22.158 57.403 1.00 62.07 ? 473 TYR A N   1 
ATOM   1775 C  CA  . TYR A 1 216 ? 36.378 22.815 58.344 1.00 61.63 ? 473 TYR A CA  1 
ATOM   1776 C  C   . TYR A 1 216 ? 35.960 22.671 59.808 1.00 61.17 ? 473 TYR A C   1 
ATOM   1777 O  O   . TYR A 1 216 ? 36.816 22.669 60.698 1.00 61.51 ? 473 TYR A O   1 
ATOM   1778 C  CB  . TYR A 1 216 ? 36.582 24.305 57.985 1.00 61.82 ? 473 TYR A CB  1 
ATOM   1779 C  CG  . TYR A 1 216 ? 37.561 25.055 58.881 1.00 61.40 ? 473 TYR A CG  1 
ATOM   1780 C  CD1 . TYR A 1 216 ? 38.927 24.760 58.863 1.00 62.64 ? 473 TYR A CD1 1 
ATOM   1781 C  CD2 . TYR A 1 216 ? 37.126 26.061 59.735 1.00 61.31 ? 473 TYR A CD2 1 
ATOM   1782 C  CE1 . TYR A 1 216 ? 39.836 25.447 59.685 1.00 62.05 ? 473 TYR A CE1 1 
ATOM   1783 C  CE2 . TYR A 1 216 ? 38.024 26.762 60.549 1.00 62.32 ? 473 TYR A CE2 1 
ATOM   1784 C  CZ  . TYR A 1 216 ? 39.379 26.449 60.520 1.00 62.58 ? 473 TYR A CZ  1 
ATOM   1785 O  OH  . TYR A 1 216 ? 40.263 27.122 61.339 1.00 61.18 ? 473 TYR A OH  1 
ATOM   1786 N  N   . ALA A 1 217 ? 34.667 22.522 60.077 1.00 60.56 ? 474 ALA A N   1 
ATOM   1787 C  CA  . ALA A 1 217 ? 34.205 22.353 61.466 1.00 60.10 ? 474 ALA A CA  1 
ATOM   1788 C  C   . ALA A 1 217 ? 34.754 21.077 62.097 1.00 59.82 ? 474 ALA A C   1 
ATOM   1789 O  O   . ALA A 1 217 ? 34.784 20.955 63.314 1.00 59.54 ? 474 ALA A O   1 
ATOM   1790 C  CB  . ALA A 1 217 ? 32.697 22.373 61.539 1.00 59.61 ? 474 ALA A CB  1 
ATOM   1791 N  N   . TYR A 1 218 ? 35.200 20.144 61.256 1.00 60.03 ? 475 TYR A N   1 
ATOM   1792 C  CA  . TYR A 1 218 ? 35.749 18.854 61.694 1.00 60.38 ? 475 TYR A CA  1 
ATOM   1793 C  C   . TYR A 1 218 ? 37.277 18.760 61.579 1.00 59.76 ? 475 TYR A C   1 
ATOM   1794 O  O   . TYR A 1 218 ? 37.854 17.685 61.807 1.00 59.86 ? 475 TYR A O   1 
ATOM   1795 C  CB  . TYR A 1 218 ? 35.103 17.728 60.877 1.00 60.71 ? 475 TYR A CB  1 
ATOM   1796 C  CG  . TYR A 1 218 ? 33.628 17.584 61.164 1.00 63.55 ? 475 TYR A CG  1 
ATOM   1797 C  CD1 . TYR A 1 218 ? 33.187 16.932 62.316 1.00 66.61 ? 475 TYR A CD1 1 
ATOM   1798 C  CD2 . TYR A 1 218 ? 32.675 18.128 60.308 1.00 66.12 ? 475 TYR A CD2 1 
ATOM   1799 C  CE1 . TYR A 1 218 ? 31.831 16.807 62.604 1.00 68.82 ? 475 TYR A CE1 1 
ATOM   1800 C  CE2 . TYR A 1 218 ? 31.315 18.014 60.585 1.00 68.43 ? 475 TYR A CE2 1 
ATOM   1801 C  CZ  . TYR A 1 218 ? 30.899 17.350 61.733 1.00 69.53 ? 475 TYR A CZ  1 
ATOM   1802 O  OH  . TYR A 1 218 ? 29.555 17.224 62.003 1.00 71.66 ? 475 TYR A OH  1 
ATOM   1803 N  N   . ASP A 1 219 ? 37.926 19.874 61.228 1.00 58.61 ? 476 ASP A N   1 
ATOM   1804 C  CA  . ASP A 1 219 ? 39.373 19.895 61.034 1.00 57.32 ? 476 ASP A CA  1 
ATOM   1805 C  C   . ASP A 1 219 ? 40.080 19.869 62.385 1.00 57.08 ? 476 ASP A C   1 
ATOM   1806 O  O   . ASP A 1 219 ? 39.732 20.623 63.296 1.00 56.62 ? 476 ASP A O   1 
ATOM   1807 C  CB  . ASP A 1 219 ? 39.774 21.134 60.235 1.00 56.94 ? 476 ASP A CB  1 
ATOM   1808 C  CG  . ASP A 1 219 ? 41.265 21.253 60.054 1.00 54.70 ? 476 ASP A CG  1 
ATOM   1809 O  OD1 . ASP A 1 219 ? 41.821 20.621 59.121 1.00 50.84 ? 476 ASP A OD1 1 
ATOM   1810 O  OD2 . ASP A 1 219 ? 41.871 21.996 60.847 1.00 51.02 ? 476 ASP A OD2 1 
ATOM   1811 N  N   . GLN A 1 220 ? 41.078 18.998 62.509 1.00 56.89 ? 477 GLN A N   1 
ATOM   1812 C  CA  . GLN A 1 220 ? 41.750 18.787 63.783 1.00 56.89 ? 477 GLN A CA  1 
ATOM   1813 C  C   . GLN A 1 220 ? 42.544 20.005 64.234 1.00 57.01 ? 477 GLN A C   1 
ATOM   1814 O  O   . GLN A 1 220 ? 42.616 20.282 65.431 1.00 57.06 ? 477 GLN A O   1 
ATOM   1815 C  CB  . GLN A 1 220 ? 42.685 17.583 63.709 1.00 57.22 ? 477 GLN A CB  1 
ATOM   1816 C  CG  . GLN A 1 220 ? 42.010 16.225 63.731 1.00 57.37 ? 477 GLN A CG  1 
ATOM   1817 C  CD  . GLN A 1 220 ? 43.004 15.083 63.561 1.00 56.91 ? 477 GLN A CD  1 
ATOM   1818 O  OE1 . GLN A 1 220 ? 44.072 15.257 62.974 1.00 56.66 ? 477 GLN A OE1 1 
ATOM   1819 N  NE2 . GLN A 1 220 ? 42.656 13.913 64.078 1.00 55.56 ? 477 GLN A NE2 1 
ATOM   1820 N  N   . LEU A 1 221 ? 43.148 20.731 63.291 1.00 57.01 ? 478 LEU A N   1 
ATOM   1821 C  CA  . LEU A 1 221 ? 43.931 21.899 63.668 1.00 56.90 ? 478 LEU A CA  1 
ATOM   1822 C  C   . LEU A 1 221 ? 43.008 22.955 64.271 1.00 57.55 ? 478 LEU A C   1 
ATOM   1823 O  O   . LEU A 1 221 ? 43.305 23.483 65.334 1.00 57.88 ? 478 LEU A O   1 
ATOM   1824 C  CB  . LEU A 1 221 ? 44.747 22.459 62.496 1.00 56.45 ? 478 LEU A CB  1 
ATOM   1825 C  CG  . LEU A 1 221 ? 45.561 23.721 62.814 1.00 54.88 ? 478 LEU A CG  1 
ATOM   1826 C  CD1 . LEU A 1 221 ? 46.568 23.474 63.941 1.00 51.88 ? 478 LEU A CD1 1 
ATOM   1827 C  CD2 . LEU A 1 221 ? 46.248 24.250 61.570 1.00 52.67 ? 478 LEU A CD2 1 
ATOM   1828 N  N   . LYS A 1 222 ? 41.890 23.242 63.609 1.00 58.28 ? 479 LYS A N   1 
ATOM   1829 C  CA  . LYS A 1 222 ? 40.877 24.157 64.149 1.00 59.04 ? 479 LYS A CA  1 
ATOM   1830 C  C   . LYS A 1 222 ? 40.516 23.790 65.581 1.00 59.27 ? 479 LYS A C   1 
ATOM   1831 O  O   . LYS A 1 222 ? 40.531 24.645 66.466 1.00 59.80 ? 479 LYS A O   1 
ATOM   1832 C  CB  . LYS A 1 222 ? 39.598 24.117 63.292 1.00 59.59 ? 479 LYS A CB  1 
ATOM   1833 C  CG  . LYS A 1 222 ? 38.466 25.072 63.740 1.00 60.41 ? 479 LYS A CG  1 
ATOM   1834 C  CD  . LYS A 1 222 ? 37.090 24.495 63.398 1.00 62.44 ? 479 LYS A CD  1 
ATOM   1835 C  CE  . LYS A 1 222 ? 35.998 25.564 63.312 1.00 63.53 ? 479 LYS A CE  1 
ATOM   1836 N  NZ  . LYS A 1 222 ? 35.681 26.146 64.638 1.00 64.56 ? 479 LYS A NZ  1 
ATOM   1837 N  N   . ILE A 1 223 ? 40.191 22.517 65.799 1.00 59.50 ? 480 ILE A N   1 
ATOM   1838 C  CA  . ILE A 1 223 ? 39.776 22.027 67.117 1.00 59.48 ? 480 ILE A CA  1 
ATOM   1839 C  C   . ILE A 1 223 ? 40.902 22.187 68.138 1.00 59.89 ? 480 ILE A C   1 
ATOM   1840 O  O   . ILE A 1 223 ? 40.675 22.723 69.232 1.00 60.64 ? 480 ILE A O   1 
ATOM   1841 C  CB  . ILE A 1 223 ? 39.271 20.541 67.047 1.00 59.80 ? 480 ILE A CB  1 
ATOM   1842 C  CG1 . ILE A 1 223 ? 37.936 20.470 66.282 1.00 59.48 ? 480 ILE A CG1 1 
ATOM   1843 C  CG2 . ILE A 1 223 ? 39.125 19.924 68.444 1.00 58.26 ? 480 ILE A CG2 1 
ATOM   1844 C  CD1 . ILE A 1 223 ? 37.631 19.109 65.676 1.00 58.04 ? 480 ILE A CD1 1 
ATOM   1845 N  N   . GLN A 1 224 ? 42.117 21.765 67.784 1.00 59.82 ? 481 GLN A N   1 
ATOM   1846 C  CA  . GLN A 1 224 ? 43.264 21.915 68.692 1.00 59.69 ? 481 GLN A CA  1 
ATOM   1847 C  C   . GLN A 1 224 ? 43.604 23.373 69.012 1.00 60.01 ? 481 GLN A C   1 
ATOM   1848 O  O   . GLN A 1 224 ? 43.952 23.693 70.154 1.00 59.66 ? 481 GLN A O   1 
ATOM   1849 C  CB  . GLN A 1 224 ? 44.500 21.192 68.147 1.00 59.63 ? 481 GLN A CB  1 
ATOM   1850 C  CG  . GLN A 1 224 ? 44.361 19.680 68.081 1.00 58.72 ? 481 GLN A CG  1 
ATOM   1851 C  CD  . GLN A 1 224 ? 43.845 19.088 69.378 1.00 58.45 ? 481 GLN A CD  1 
ATOM   1852 O  OE1 . GLN A 1 224 ? 44.380 19.365 70.451 1.00 57.54 ? 481 GLN A OE1 1 
ATOM   1853 N  NE2 . GLN A 1 224 ? 42.798 18.272 69.284 1.00 56.57 ? 481 GLN A NE2 1 
ATOM   1854 N  N   . VAL A 1 225 ? 43.500 24.251 68.016 1.00 60.52 ? 482 VAL A N   1 
ATOM   1855 C  CA  . VAL A 1 225 ? 43.707 25.685 68.241 1.00 61.05 ? 482 VAL A CA  1 
ATOM   1856 C  C   . VAL A 1 225 ? 42.649 26.244 69.211 1.00 62.07 ? 482 VAL A C   1 
ATOM   1857 O  O   . VAL A 1 225 ? 42.986 27.000 70.122 1.00 62.31 ? 482 VAL A O   1 
ATOM   1858 C  CB  . VAL A 1 225 ? 43.692 26.500 66.925 1.00 61.08 ? 482 VAL A CB  1 
ATOM   1859 C  CG1 . VAL A 1 225 ? 43.634 28.004 67.221 1.00 59.66 ? 482 VAL A CG1 1 
ATOM   1860 C  CG2 . VAL A 1 225 ? 44.913 26.155 66.066 1.00 59.57 ? 482 VAL A CG2 1 
ATOM   1861 N  N   . ALA A 1 226 ? 41.387 25.850 69.036 1.00 62.88 ? 483 ALA A N   1 
ATOM   1862 C  CA  . ALA A 1 226 ? 40.321 26.272 69.954 1.00 63.52 ? 483 ALA A CA  1 
ATOM   1863 C  C   . ALA A 1 226 ? 40.589 25.787 71.384 1.00 64.04 ? 483 ALA A C   1 
ATOM   1864 O  O   . ALA A 1 226 ? 40.351 26.520 72.342 1.00 64.64 ? 483 ALA A O   1 
ATOM   1865 C  CB  . ALA A 1 226 ? 38.961 25.777 69.470 1.00 63.43 ? 483 ALA A CB  1 
ATOM   1866 N  N   . ALA A 1 227 ? 41.103 24.564 71.525 1.00 64.19 ? 484 ALA A N   1 
ATOM   1867 C  CA  . ALA A 1 227 ? 41.413 24.005 72.845 1.00 64.07 ? 484 ALA A CA  1 
ATOM   1868 C  C   . ALA A 1 227 ? 42.718 24.546 73.430 1.00 64.18 ? 484 ALA A C   1 
ATOM   1869 O  O   . ALA A 1 227 ? 43.079 24.205 74.550 1.00 64.06 ? 484 ALA A O   1 
ATOM   1870 C  CB  . ALA A 1 227 ? 41.458 22.485 72.778 1.00 63.97 ? 484 ALA A CB  1 
ATOM   1871 N  N   . LYS A 1 228 ? 43.430 25.369 72.663 1.00 64.67 ? 485 LYS A N   1 
ATOM   1872 C  CA  . LYS A 1 228 ? 44.685 26.008 73.105 1.00 64.88 ? 485 LYS A CA  1 
ATOM   1873 C  C   . LYS A 1 228 ? 45.853 25.043 73.392 1.00 64.17 ? 485 LYS A C   1 
ATOM   1874 O  O   . LYS A 1 228 ? 46.744 25.340 74.209 1.00 64.15 ? 485 LYS A O   1 
ATOM   1875 C  CB  . LYS A 1 228 ? 44.419 26.930 74.300 1.00 65.44 ? 485 LYS A CB  1 
ATOM   1876 C  CG  . LYS A 1 228 ? 43.560 28.137 73.942 1.00 67.64 ? 485 LYS A CG  1 
ATOM   1877 C  CD  . LYS A 1 228 ? 43.152 28.911 75.193 1.00 71.29 ? 485 LYS A CD  1 
ATOM   1878 C  CE  . LYS A 1 228 ? 42.428 30.216 74.842 1.00 73.18 ? 485 LYS A CE  1 
ATOM   1879 N  NZ  . LYS A 1 228 ? 42.221 31.061 76.066 1.00 75.59 ? 485 LYS A NZ  1 
ATOM   1880 N  N   . THR A 1 229 ? 45.867 23.909 72.694 1.00 63.38 ? 486 THR A N   1 
ATOM   1881 C  CA  . THR A 1 229 ? 46.970 22.951 72.804 1.00 63.12 ? 486 THR A CA  1 
ATOM   1882 C  C   . THR A 1 229 ? 48.136 23.278 71.851 1.00 62.87 ? 486 THR A C   1 
ATOM   1883 O  O   . THR A 1 229 ? 49.249 22.842 72.095 1.00 63.25 ? 486 THR A O   1 
ATOM   1884 C  CB  . THR A 1 229 ? 46.499 21.506 72.535 1.00 63.26 ? 486 THR A CB  1 
ATOM   1885 O  OG1 . THR A 1 229 ? 45.913 21.421 71.226 1.00 62.67 ? 486 THR A OG1 1 
ATOM   1886 C  CG2 . THR A 1 229 ? 45.487 21.055 73.594 1.00 62.19 ? 486 THR A CG2 1 
ATOM   1887 N  N   . VAL A 1 230 ? 47.874 24.040 70.782 1.00 62.27 ? 487 VAL A N   1 
ATOM   1888 C  CA  . VAL A 1 230 ? 48.883 24.401 69.775 1.00 61.68 ? 487 VAL A CA  1 
ATOM   1889 C  C   . VAL A 1 230 ? 48.615 25.770 69.177 1.00 61.38 ? 487 VAL A C   1 
ATOM   1890 O  O   . VAL A 1 230 ? 47.493 26.267 69.227 1.00 61.35 ? 487 VAL A O   1 
ATOM   1891 C  CB  . VAL A 1 230 ? 48.897 23.412 68.580 1.00 61.80 ? 487 VAL A CB  1 
ATOM   1892 C  CG1 . VAL A 1 230 ? 49.464 22.088 68.985 1.00 61.84 ? 487 VAL A CG1 1 
ATOM   1893 C  CG2 . VAL A 1 230 ? 47.491 23.246 67.991 1.00 61.01 ? 487 VAL A CG2 1 
ATOM   1894 N  N   . PHE A 1 231 ? 49.651 26.362 68.590 1.00 60.96 ? 488 PHE A N   1 
ATOM   1895 C  CA  . PHE A 1 231 ? 49.539 27.613 67.832 1.00 60.65 ? 488 PHE A CA  1 
ATOM   1896 C  C   . PHE A 1 231 ? 48.809 28.720 68.590 1.00 60.94 ? 488 PHE A C   1 
ATOM   1897 O  O   . PHE A 1 231 ? 47.984 29.446 68.044 1.00 60.91 ? 488 PHE A O   1 
ATOM   1898 C  CB  . PHE A 1 231 ? 48.895 27.345 66.462 1.00 60.32 ? 488 PHE A CB  1 
ATOM   1899 C  CG  . PHE A 1 231 ? 49.800 26.607 65.512 1.00 59.44 ? 488 PHE A CG  1 
ATOM   1900 C  CD1 . PHE A 1 231 ? 50.829 27.279 64.853 1.00 58.67 ? 488 PHE A CD1 1 
ATOM   1901 C  CD2 . PHE A 1 231 ? 49.658 25.247 65.309 1.00 58.24 ? 488 PHE A CD2 1 
ATOM   1902 C  CE1 . PHE A 1 231 ? 51.682 26.609 63.990 1.00 57.87 ? 488 PHE A CE1 1 
ATOM   1903 C  CE2 . PHE A 1 231 ? 50.509 24.566 64.447 1.00 58.22 ? 488 PHE A CE2 1 
ATOM   1904 C  CZ  . PHE A 1 231 ? 51.519 25.253 63.780 1.00 58.24 ? 488 PHE A CZ  1 
ATOM   1905 N  N   . GLU A 1 232 ? 49.165 28.864 69.855 1.00 61.41 ? 489 GLU A N   1 
ATOM   1906 C  CA  . GLU A 1 232 ? 48.574 29.877 70.718 1.00 61.85 ? 489 GLU A CA  1 
ATOM   1907 C  C   . GLU A 1 232 ? 48.909 31.277 70.197 1.00 60.64 ? 489 GLU A C   1 
ATOM   1908 O  O   . GLU A 1 232 ? 50.082 31.617 70.051 1.00 61.08 ? 489 GLU A O   1 
ATOM   1909 C  CB  . GLU A 1 232 ? 49.089 29.690 72.155 1.00 62.54 ? 489 GLU A CB  1 
ATOM   1910 C  CG  . GLU A 1 232 ? 48.030 29.929 73.226 1.00 65.76 ? 489 GLU A CG  1 
ATOM   1911 C  CD  . GLU A 1 232 ? 48.287 29.172 74.541 1.00 69.17 ? 489 GLU A CD  1 
ATOM   1912 O  OE1 . GLU A 1 232 ? 48.964 28.110 74.528 1.00 70.84 ? 489 GLU A OE1 1 
ATOM   1913 O  OE2 . GLU A 1 232 ? 47.782 29.646 75.587 1.00 71.50 ? 489 GLU A OE2 1 
ATOM   1914 N  N   . GLY A 1 233 ? 47.881 32.073 69.892 1.00 59.24 ? 490 GLY A N   1 
ATOM   1915 C  CA  . GLY A 1 233 ? 48.075 33.450 69.394 1.00 57.91 ? 490 GLY A CA  1 
ATOM   1916 C  C   . GLY A 1 233 ? 48.325 33.575 67.888 1.00 56.75 ? 490 GLY A C   1 
ATOM   1917 O  O   . GLY A 1 233 ? 48.469 34.681 67.369 1.00 56.48 ? 490 GLY A O   1 
ATOM   1918 N  N   . PHE A 1 234 ? 48.381 32.450 67.181 1.00 55.30 ? 491 PHE A N   1 
ATOM   1919 C  CA  . PHE A 1 234 ? 48.518 32.469 65.728 1.00 54.25 ? 491 PHE A CA  1 
ATOM   1920 C  C   . PHE A 1 234 ? 47.163 32.588 65.061 1.00 53.14 ? 491 PHE A C   1 
ATOM   1921 O  O   . PHE A 1 234 ? 46.158 32.168 65.605 1.00 52.99 ? 491 PHE A O   1 
ATOM   1922 C  CB  . PHE A 1 234 ? 49.199 31.206 65.219 1.00 54.06 ? 491 PHE A CB  1 
ATOM   1923 C  CG  . PHE A 1 234 ? 50.680 31.189 65.418 1.00 54.40 ? 491 PHE A CG  1 
ATOM   1924 C  CD1 . PHE A 1 234 ? 51.535 31.467 64.363 1.00 53.51 ? 491 PHE A CD1 1 
ATOM   1925 C  CD2 . PHE A 1 234 ? 51.224 30.879 66.661 1.00 55.76 ? 491 PHE A CD2 1 
ATOM   1926 C  CE1 . PHE A 1 234 ? 52.906 31.442 64.530 1.00 54.55 ? 491 PHE A CE1 1 
ATOM   1927 C  CE2 . PHE A 1 234 ? 52.604 30.849 66.845 1.00 55.70 ? 491 PHE A CE2 1 
ATOM   1928 C  CZ  . PHE A 1 234 ? 53.447 31.130 65.771 1.00 55.49 ? 491 PHE A CZ  1 
ATOM   1929 N  N   . THR A 1 235 ? 47.157 33.151 63.862 1.00 52.00 ? 492 THR A N   1 
ATOM   1930 C  CA  . THR A 1 235 ? 45.970 33.208 63.030 1.00 51.09 ? 492 THR A CA  1 
ATOM   1931 C  C   . THR A 1 235 ? 46.192 32.368 61.772 1.00 50.68 ? 492 THR A C   1 
ATOM   1932 O  O   . THR A 1 235 ? 47.301 32.315 61.257 1.00 50.54 ? 492 THR A O   1 
ATOM   1933 C  CB  . THR A 1 235 ? 45.683 34.672 62.652 1.00 50.86 ? 492 THR A CB  1 
ATOM   1934 O  OG1 . THR A 1 235 ? 45.569 35.428 63.854 1.00 50.69 ? 492 THR A OG1 1 
ATOM   1935 C  CG2 . THR A 1 235 ? 44.402 34.822 61.848 1.00 49.19 ? 492 THR A CG2 1 
ATOM   1936 N  N   . GLU A 1 236 ? 45.142 31.698 61.306 1.00 50.32 ? 493 GLU A N   1 
ATOM   1937 C  CA  . GLU A 1 236 ? 45.105 31.132 59.961 1.00 50.26 ? 493 GLU A CA  1 
ATOM   1938 C  C   . GLU A 1 236 ? 43.969 31.772 59.171 1.00 49.95 ? 493 GLU A C   1 
ATOM   1939 O  O   . GLU A 1 236 ? 42.880 31.974 59.687 1.00 49.88 ? 493 GLU A O   1 
ATOM   1940 C  CB  . GLU A 1 236 ? 44.902 29.611 59.984 1.00 50.24 ? 493 GLU A CB  1 
ATOM   1941 C  CG  . GLU A 1 236 ? 44.992 28.975 58.590 1.00 50.65 ? 493 GLU A CG  1 
ATOM   1942 C  CD  . GLU A 1 236 ? 44.604 27.499 58.542 1.00 51.07 ? 493 GLU A CD  1 
ATOM   1943 O  OE1 . GLU A 1 236 ? 43.879 27.036 59.439 1.00 50.62 ? 493 GLU A OE1 1 
ATOM   1944 O  OE2 . GLU A 1 236 ? 45.016 26.805 57.580 1.00 50.59 ? 493 GLU A OE2 1 
ATOM   1945 N  N   . GLY A 1 237 ? 44.220 32.059 57.905 1.00 50.03 ? 494 GLY A N   1 
ATOM   1946 C  CA  . GLY A 1 237 ? 43.175 32.540 57.025 1.00 50.60 ? 494 GLY A CA  1 
ATOM   1947 C  C   . GLY A 1 237 ? 42.150 31.470 56.678 1.00 51.01 ? 494 GLY A C   1 
ATOM   1948 O  O   . GLY A 1 237 ? 42.388 30.263 56.844 1.00 51.00 ? 494 GLY A O   1 
ATOM   1949 N  N   . GLU A 1 238 ? 41.009 31.920 56.175 1.00 51.38 ? 495 GLU A N   1 
ATOM   1950 C  CA  . GLU A 1 238 ? 39.920 31.017 55.818 1.00 51.79 ? 495 GLU A CA  1 
ATOM   1951 C  C   . GLU A 1 238 ? 40.382 30.076 54.719 1.00 51.01 ? 495 GLU A C   1 
ATOM   1952 O  O   . GLU A 1 238 ? 41.010 30.494 53.749 1.00 50.05 ? 495 GLU A O   1 
ATOM   1953 C  CB  . GLU A 1 238 ? 38.686 31.802 55.341 1.00 52.02 ? 495 GLU A CB  1 
ATOM   1954 C  CG  . GLU A 1 238 ? 37.436 30.952 55.273 1.00 54.37 ? 495 GLU A CG  1 
ATOM   1955 C  CD  . GLU A 1 238 ? 36.245 31.681 54.658 1.00 57.65 ? 495 GLU A CD  1 
ATOM   1956 O  OE1 . GLU A 1 238 ? 36.217 32.939 54.657 1.00 58.38 ? 495 GLU A OE1 1 
ATOM   1957 O  OE2 . GLU A 1 238 ? 35.334 30.979 54.166 1.00 58.63 ? 495 GLU A OE2 1 
ATOM   1958 N  N   . LEU A 1 239 ? 40.067 28.799 54.884 1.00 50.82 ? 496 LEU A N   1 
ATOM   1959 C  CA  . LEU A 1 239 ? 40.372 27.796 53.870 1.00 50.44 ? 496 LEU A CA  1 
ATOM   1960 C  C   . LEU A 1 239 ? 39.282 27.824 52.804 1.00 50.38 ? 496 LEU A C   1 
ATOM   1961 O  O   . LEU A 1 239 ? 38.152 27.455 53.084 1.00 50.87 ? 496 LEU A O   1 
ATOM   1962 C  CB  . LEU A 1 239 ? 40.456 26.410 54.520 1.00 50.02 ? 496 LEU A CB  1 
ATOM   1963 C  CG  . LEU A 1 239 ? 41.709 26.190 55.361 1.00 49.79 ? 496 LEU A CG  1 
ATOM   1964 C  CD1 . LEU A 1 239 ? 41.522 25.051 56.376 1.00 48.84 ? 496 LEU A CD1 1 
ATOM   1965 C  CD2 . LEU A 1 239 ? 42.922 25.956 54.444 1.00 48.24 ? 496 LEU A CD2 1 
ATOM   1966 N  N   . THR A 1 240 ? 39.614 28.290 51.605 1.00 50.44 ? 497 THR A N   1 
ATOM   1967 C  CA  . THR A 1 240 ? 38.658 28.371 50.491 1.00 50.68 ? 497 THR A CA  1 
ATOM   1968 C  C   . THR A 1 240 ? 39.073 27.478 49.325 1.00 51.08 ? 497 THR A C   1 
ATOM   1969 O  O   . THR A 1 240 ? 38.410 27.470 48.282 1.00 50.94 ? 497 THR A O   1 
ATOM   1970 C  CB  . THR A 1 240 ? 38.517 29.816 49.948 1.00 50.56 ? 497 THR A CB  1 
ATOM   1971 O  OG1 . THR A 1 240 ? 39.775 30.237 49.419 1.00 51.68 ? 497 THR A OG1 1 
ATOM   1972 C  CG2 . THR A 1 240 ? 38.093 30.781 51.058 1.00 49.87 ? 497 THR A CG2 1 
ATOM   1973 N  N   . PHE A 1 241 ? 40.165 26.728 49.504 1.00 51.08 ? 498 PHE A N   1 
ATOM   1974 C  CA  . PHE A 1 241 ? 40.605 25.762 48.513 1.00 50.88 ? 498 PHE A CA  1 
ATOM   1975 C  C   . PHE A 1 241 ? 40.305 24.373 49.034 1.00 50.95 ? 498 PHE A C   1 
ATOM   1976 O  O   . PHE A 1 241 ? 40.045 24.201 50.220 1.00 51.38 ? 498 PHE A O   1 
ATOM   1977 C  CB  . PHE A 1 241 ? 42.089 25.922 48.179 1.00 50.89 ? 498 PHE A CB  1 
ATOM   1978 C  CG  . PHE A 1 241 ? 43.001 26.016 49.378 1.00 50.49 ? 498 PHE A CG  1 
ATOM   1979 C  CD1 . PHE A 1 241 ? 43.584 24.868 49.930 1.00 49.78 ? 498 PHE A CD1 1 
ATOM   1980 C  CD2 . PHE A 1 241 ? 43.333 27.259 49.917 1.00 48.39 ? 498 PHE A CD2 1 
ATOM   1981 C  CE1 . PHE A 1 241 ? 44.470 24.956 51.023 1.00 48.71 ? 498 PHE A CE1 1 
ATOM   1982 C  CE2 . PHE A 1 241 ? 44.211 27.358 51.003 1.00 48.76 ? 498 PHE A CE2 1 
ATOM   1983 C  CZ  . PHE A 1 241 ? 44.775 26.203 51.563 1.00 48.57 ? 498 PHE A CZ  1 
ATOM   1984 N  N   . GLN A 1 242 ? 40.297 23.381 48.155 1.00 50.76 ? 499 GLN A N   1 
ATOM   1985 C  CA  . GLN A 1 242 ? 39.994 22.026 48.610 1.00 51.10 ? 499 GLN A CA  1 
ATOM   1986 C  C   . GLN A 1 242 ? 41.240 21.384 49.225 1.00 50.68 ? 499 GLN A C   1 
ATOM   1987 O  O   . GLN A 1 242 ? 42.367 21.759 48.891 1.00 50.38 ? 499 GLN A O   1 
ATOM   1988 C  CB  . GLN A 1 242 ? 39.448 21.156 47.469 1.00 51.19 ? 499 GLN A CB  1 
ATOM   1989 C  CG  . GLN A 1 242 ? 40.465 20.748 46.430 1.00 52.16 ? 499 GLN A CG  1 
ATOM   1990 C  CD  . GLN A 1 242 ? 39.864 19.878 45.341 1.00 54.70 ? 499 GLN A CD  1 
ATOM   1991 O  OE1 . GLN A 1 242 ? 38.864 20.243 44.731 1.00 55.99 ? 499 GLN A OE1 1 
ATOM   1992 N  NE2 . GLN A 1 242 ? 40.483 18.724 45.086 1.00 55.45 ? 499 GLN A NE2 1 
ATOM   1993 N  N   . PRO A 1 243 ? 41.038 20.397 50.105 1.00 50.06 ? 500 PRO A N   1 
ATOM   1994 C  CA  . PRO A 1 243 ? 42.133 19.638 50.677 1.00 50.12 ? 500 PRO A CA  1 
ATOM   1995 C  C   . PRO A 1 243 ? 43.265 19.302 49.699 1.00 49.68 ? 500 PRO A C   1 
ATOM   1996 O  O   . PRO A 1 243 ? 43.029 19.033 48.515 1.00 49.95 ? 500 PRO A O   1 
ATOM   1997 C  CB  . PRO A 1 243 ? 41.425 18.391 51.193 1.00 50.24 ? 500 PRO A CB  1 
ATOM   1998 C  CG  . PRO A 1 243 ? 40.144 18.973 51.740 1.00 49.99 ? 500 PRO A CG  1 
ATOM   1999 C  CD  . PRO A 1 243 ? 39.756 20.030 50.733 1.00 50.07 ? 500 PRO A CD  1 
ATOM   2000 N  N   . THR A 1 244 ? 44.488 19.367 50.211 1.00 49.20 ? 501 THR A N   1 
ATOM   2001 C  CA  . THR A 1 244 ? 45.680 19.338 49.386 1.00 49.07 ? 501 THR A CA  1 
ATOM   2002 C  C   . THR A 1 244 ? 46.324 17.958 49.363 1.00 49.80 ? 501 THR A C   1 
ATOM   2003 O  O   . THR A 1 244 ? 47.310 17.740 48.671 1.00 49.83 ? 501 THR A O   1 
ATOM   2004 C  CB  . THR A 1 244 ? 46.692 20.426 49.865 1.00 49.15 ? 501 THR A CB  1 
ATOM   2005 O  OG1 . THR A 1 244 ? 46.955 20.282 51.271 1.00 47.82 ? 501 THR A OG1 1 
ATOM   2006 C  CG2 . THR A 1 244 ? 46.128 21.802 49.583 1.00 46.63 ? 501 THR A CG2 1 
ATOM   2007 N  N   . TYR A 1 245 ? 45.726 17.034 50.105 1.00 50.59 ? 502 TYR A N   1 
ATOM   2008 C  CA  . TYR A 1 245 ? 46.155 15.651 50.184 1.00 51.65 ? 502 TYR A CA  1 
ATOM   2009 C  C   . TYR A 1 245 ? 44.885 14.777 50.204 1.00 51.94 ? 502 TYR A C   1 
ATOM   2010 O  O   . TYR A 1 245 ? 43.861 15.234 50.724 1.00 52.04 ? 502 TYR A O   1 
ATOM   2011 C  CB  . TYR A 1 245 ? 46.977 15.513 51.463 1.00 51.73 ? 502 TYR A CB  1 
ATOM   2012 C  CG  . TYR A 1 245 ? 47.048 14.162 52.136 1.00 52.53 ? 502 TYR A CG  1 
ATOM   2013 C  CD1 . TYR A 1 245 ? 48.196 13.358 52.033 1.00 52.89 ? 502 TYR A CD1 1 
ATOM   2014 C  CD2 . TYR A 1 245 ? 46.017 13.728 52.953 1.00 53.10 ? 502 TYR A CD2 1 
ATOM   2015 C  CE1 . TYR A 1 245 ? 48.278 12.132 52.707 1.00 52.97 ? 502 TYR A CE1 1 
ATOM   2016 C  CE2 . TYR A 1 245 ? 46.090 12.511 53.623 1.00 54.00 ? 502 TYR A CE2 1 
ATOM   2017 C  CZ  . TYR A 1 245 ? 47.215 11.716 53.494 1.00 54.17 ? 502 TYR A CZ  1 
ATOM   2018 O  OH  . TYR A 1 245 ? 47.247 10.509 54.174 1.00 55.46 ? 502 TYR A OH  1 
ATOM   2019 N  N   . LYS A 1 246 ? 44.893 13.554 49.669 1.00 51.91 ? 503 LYS A N   1 
ATOM   2020 C  CA  . LYS A 1 246 ? 46.012 12.854 49.061 1.00 51.97 ? 503 LYS A CA  1 
ATOM   2021 C  C   . LYS A 1 246 ? 45.612 12.469 47.654 1.00 52.64 ? 503 LYS A C   1 
ATOM   2022 O  O   . LYS A 1 246 ? 44.548 11.879 47.465 1.00 52.79 ? 503 LYS A O   1 
ATOM   2023 C  CB  . LYS A 1 246 ? 46.275 11.567 49.832 1.00 51.98 ? 503 LYS A CB  1 
ATOM   2024 C  CG  . LYS A 1 246 ? 47.461 10.760 49.329 1.00 52.06 ? 503 LYS A CG  1 
ATOM   2025 C  CD  . LYS A 1 246 ? 47.639 9.478  50.120 1.00 52.45 ? 503 LYS A CD  1 
ATOM   2026 C  CE  . LYS A 1 246 ? 48.696 8.548  49.492 1.00 52.91 ? 503 LYS A CE  1 
ATOM   2027 N  NZ  . LYS A 1 246 ? 50.078 8.953  49.805 1.00 50.81 ? 503 LYS A NZ  1 
ATOM   2028 N  N   . TYR A 1 247 ? 46.465 12.781 46.681 1.00 53.18 ? 504 TYR A N   1 
ATOM   2029 C  CA  . TYR A 1 247 ? 46.172 12.591 45.277 1.00 53.93 ? 504 TYR A CA  1 
ATOM   2030 C  C   . TYR A 1 247 ? 47.044 11.492 44.683 1.00 54.99 ? 504 TYR A C   1 
ATOM   2031 O  O   . TYR A 1 247 ? 48.175 11.286 45.131 1.00 55.80 ? 504 TYR A O   1 
ATOM   2032 C  CB  . TYR A 1 247 ? 46.465 13.885 44.496 1.00 54.09 ? 504 TYR A CB  1 
ATOM   2033 C  CG  . TYR A 1 247 ? 45.570 15.041 44.861 1.00 54.20 ? 504 TYR A CG  1 
ATOM   2034 C  CD1 . TYR A 1 247 ? 44.426 15.307 44.129 1.00 54.55 ? 504 TYR A CD1 1 
ATOM   2035 C  CD2 . TYR A 1 247 ? 45.866 15.872 45.930 1.00 52.99 ? 504 TYR A CD2 1 
ATOM   2036 C  CE1 . TYR A 1 247 ? 43.587 16.362 44.456 1.00 54.16 ? 504 TYR A CE1 1 
ATOM   2037 C  CE2 . TYR A 1 247 ? 45.027 16.928 46.265 1.00 53.95 ? 504 TYR A CE2 1 
ATOM   2038 C  CZ  . TYR A 1 247 ? 43.889 17.165 45.528 1.00 54.60 ? 504 TYR A CZ  1 
ATOM   2039 O  OH  . TYR A 1 247 ? 43.050 18.215 45.852 1.00 56.94 ? 504 TYR A OH  1 
ATOM   2040 N  N   . ASP A 1 248 ? 46.538 10.798 43.664 1.00 55.16 ? 505 ASP A N   1 
ATOM   2041 C  CA  . ASP A 1 248 ? 47.400 9.993  42.818 1.00 55.61 ? 505 ASP A CA  1 
ATOM   2042 C  C   . ASP A 1 248 ? 48.393 10.936 42.137 1.00 55.86 ? 505 ASP A C   1 
ATOM   2043 O  O   . ASP A 1 248 ? 48.012 11.968 41.585 1.00 55.93 ? 505 ASP A O   1 
ATOM   2044 C  CB  . ASP A 1 248 ? 46.605 9.221  41.741 1.00 55.61 ? 505 ASP A CB  1 
ATOM   2045 C  CG  . ASP A 1 248 ? 45.764 8.070  42.311 1.00 56.59 ? 505 ASP A CG  1 
ATOM   2046 O  OD1 . ASP A 1 248 ? 45.966 7.647  43.476 1.00 55.43 ? 505 ASP A OD1 1 
ATOM   2047 O  OD2 . ASP A 1 248 ? 44.880 7.586  41.569 1.00 58.79 ? 505 ASP A OD2 1 
ATOM   2048 N  N   . THR A 1 249 ? 49.665 10.573 42.185 1.00 56.29 ? 506 THR A N   1 
ATOM   2049 C  CA  . THR A 1 249 ? 50.710 11.258 41.445 1.00 56.82 ? 506 THR A CA  1 
ATOM   2050 C  C   . THR A 1 249 ? 50.297 11.438 39.990 1.00 57.01 ? 506 THR A C   1 
ATOM   2051 O  O   . THR A 1 249 ? 49.681 10.553 39.419 1.00 57.08 ? 506 THR A O   1 
ATOM   2052 C  CB  . THR A 1 249 ? 52.010 10.437 41.538 1.00 56.85 ? 506 THR A CB  1 
ATOM   2053 O  OG1 . THR A 1 249 ? 52.537 10.575 42.863 1.00 58.76 ? 506 THR A OG1 1 
ATOM   2054 C  CG2 . THR A 1 249 ? 53.041 10.897 40.547 1.00 57.34 ? 506 THR A CG2 1 
ATOM   2055 N  N   . GLY A 1 250 ? 50.621 12.590 39.405 1.00 57.29 ? 507 GLY A N   1 
ATOM   2056 C  CA  . GLY A 1 250 ? 50.316 12.876 38.000 1.00 57.53 ? 507 GLY A CA  1 
ATOM   2057 C  C   . GLY A 1 250 ? 48.864 13.236 37.683 1.00 57.91 ? 507 GLY A C   1 
ATOM   2058 O  O   . GLY A 1 250 ? 48.503 13.373 36.518 1.00 58.05 ? 507 GLY A O   1 
ATOM   2059 N  N   . SER A 1 251 ? 48.039 13.410 38.713 1.00 58.16 ? 508 SER A N   1 
ATOM   2060 C  CA  . SER A 1 251 ? 46.609 13.623 38.536 1.00 58.28 ? 508 SER A CA  1 
ATOM   2061 C  C   . SER A 1 251 ? 45.996 14.519 39.617 1.00 58.23 ? 508 SER A C   1 
ATOM   2062 O  O   . SER A 1 251 ? 46.670 14.929 40.566 1.00 57.46 ? 508 SER A O   1 
ATOM   2063 C  CB  . SER A 1 251 ? 45.891 12.269 38.586 1.00 58.63 ? 508 SER A CB  1 
ATOM   2064 O  OG  . SER A 1 251 ? 45.515 11.946 39.918 1.00 58.00 ? 508 SER A OG  1 
ATOM   2065 N  N   . ASP A 1 252 ? 44.698 14.780 39.457 1.00 58.64 ? 509 ASP A N   1 
ATOM   2066 C  CA  . ASP A 1 252 ? 43.877 15.476 40.445 1.00 58.97 ? 509 ASP A CA  1 
ATOM   2067 C  C   . ASP A 1 252 ? 42.867 14.518 41.099 1.00 59.10 ? 509 ASP A C   1 
ATOM   2068 O  O   . ASP A 1 252 ? 41.881 14.958 41.701 1.00 59.44 ? 509 ASP A O   1 
ATOM   2069 C  CB  . ASP A 1 252 ? 43.121 16.624 39.779 1.00 59.11 ? 509 ASP A CB  1 
ATOM   2070 C  CG  . ASP A 1 252 ? 44.036 17.746 39.286 1.00 60.77 ? 509 ASP A CG  1 
ATOM   2071 O  OD1 . ASP A 1 252 ? 45.195 17.853 39.744 1.00 61.62 ? 509 ASP A OD1 1 
ATOM   2072 O  OD2 . ASP A 1 252 ? 43.571 18.553 38.444 1.00 62.96 ? 509 ASP A OD2 1 
ATOM   2073 N  N   . ASP A 1 253 ? 43.105 13.214 40.997 1.00 59.21 ? 510 ASP A N   1 
ATOM   2074 C  CA  . ASP A 1 253 ? 42.198 12.236 41.587 1.00 59.45 ? 510 ASP A CA  1 
ATOM   2075 C  C   . ASP A 1 253 ? 42.619 11.926 43.011 1.00 59.65 ? 510 ASP A C   1 
ATOM   2076 O  O   . ASP A 1 253 ? 43.796 11.936 43.324 1.00 59.48 ? 510 ASP A O   1 
ATOM   2077 C  CB  . ASP A 1 253 ? 42.199 10.928 40.788 1.00 59.49 ? 510 ASP A CB  1 
ATOM   2078 C  CG  . ASP A 1 253 ? 41.701 11.099 39.370 1.00 60.07 ? 510 ASP A CG  1 
ATOM   2079 O  OD1 . ASP A 1 253 ? 40.645 11.731 39.149 1.00 61.20 ? 510 ASP A OD1 1 
ATOM   2080 O  OD2 . ASP A 1 253 ? 42.370 10.582 38.466 1.00 61.33 ? 510 ASP A OD2 1 
ATOM   2081 N  N   . TRP A 1 254 ? 41.653 11.617 43.863 1.00 60.02 ? 511 TRP A N   1 
ATOM   2082 C  CA  . TRP A 1 254 ? 41.949 11.190 45.198 1.00 60.88 ? 511 TRP A CA  1 
ATOM   2083 C  C   . TRP A 1 254 ? 42.617 9.822  45.163 1.00 61.61 ? 511 TRP A C   1 
ATOM   2084 O  O   . TRP A 1 254 ? 42.294 8.990  44.310 1.00 61.85 ? 511 TRP A O   1 
ATOM   2085 C  CB  . TRP A 1 254 ? 40.680 11.101 46.031 1.00 61.14 ? 511 TRP A CB  1 
ATOM   2086 C  CG  . TRP A 1 254 ? 39.938 12.393 46.173 1.00 62.61 ? 511 TRP A CG  1 
ATOM   2087 C  CD1 . TRP A 1 254 ? 38.647 12.635 45.802 1.00 64.10 ? 511 TRP A CD1 1 
ATOM   2088 C  CD2 . TRP A 1 254 ? 40.429 13.616 46.730 1.00 62.96 ? 511 TRP A CD2 1 
ATOM   2089 N  NE1 . TRP A 1 254 ? 38.301 13.926 46.099 1.00 64.30 ? 511 TRP A NE1 1 
ATOM   2090 C  CE2 . TRP A 1 254 ? 39.377 14.555 46.665 1.00 63.97 ? 511 TRP A CE2 1 
ATOM   2091 C  CE3 . TRP A 1 254 ? 41.651 14.012 47.278 1.00 62.94 ? 511 TRP A CE3 1 
ATOM   2092 C  CZ2 . TRP A 1 254 ? 39.514 15.868 47.123 1.00 63.25 ? 511 TRP A CZ2 1 
ATOM   2093 C  CZ3 . TRP A 1 254 ? 41.782 15.317 47.735 1.00 62.83 ? 511 TRP A CZ3 1 
ATOM   2094 C  CH2 . TRP A 1 254 ? 40.723 16.225 47.655 1.00 62.74 ? 511 TRP A CH2 1 
ATOM   2095 N  N   . ASP A 1 255 ? 43.544 9.610  46.097 1.00 62.04 ? 512 ASP A N   1 
ATOM   2096 C  CA  . ASP A 1 255 ? 44.262 8.347  46.281 1.00 62.44 ? 512 ASP A CA  1 
ATOM   2097 C  C   . ASP A 1 255 ? 43.394 7.114  45.958 1.00 63.19 ? 512 ASP A C   1 
ATOM   2098 O  O   . ASP A 1 255 ? 42.433 6.845  46.662 1.00 62.96 ? 512 ASP A O   1 
ATOM   2099 C  CB  . ASP A 1 255 ? 44.767 8.284  47.733 1.00 61.92 ? 512 ASP A CB  1 
ATOM   2100 C  CG  . ASP A 1 255 ? 45.437 6.964  48.082 1.00 61.56 ? 512 ASP A CG  1 
ATOM   2101 O  OD1 . ASP A 1 255 ? 46.129 6.378  47.217 1.00 59.57 ? 512 ASP A OD1 1 
ATOM   2102 O  OD2 . ASP A 1 255 ? 45.287 6.530  49.246 1.00 60.38 ? 512 ASP A OD2 1 
ATOM   2103 N  N   . THR A 1 256 ? 43.744 6.387  44.893 1.00 64.16 ? 513 THR A N   1 
ATOM   2104 C  CA  . THR A 1 256 ? 43.051 5.136  44.527 1.00 65.14 ? 513 THR A CA  1 
ATOM   2105 C  C   . THR A 1 256 ? 43.863 3.877  44.875 1.00 66.34 ? 513 THR A C   1 
ATOM   2106 O  O   . THR A 1 256 ? 43.535 2.794  44.418 1.00 66.45 ? 513 THR A O   1 
ATOM   2107 C  CB  . THR A 1 256 ? 42.707 5.074  43.020 1.00 64.72 ? 513 THR A CB  1 
ATOM   2108 O  OG1 . THR A 1 256 ? 43.899 5.246  42.255 1.00 64.46 ? 513 THR A OG1 1 
ATOM   2109 C  CG2 . THR A 1 256 ? 41.686 6.137  42.630 1.00 64.62 ? 513 THR A CG2 1 
ATOM   2110 N  N   . SER A 1 257 ? 44.915 4.017  45.680 1.00 67.61 ? 514 SER A N   1 
ATOM   2111 C  CA  . SER A 1 257 ? 45.677 2.867  46.167 1.00 68.25 ? 514 SER A CA  1 
ATOM   2112 C  C   . SER A 1 257 ? 44.850 2.103  47.199 1.00 69.32 ? 514 SER A C   1 
ATOM   2113 O  O   . SER A 1 257 ? 43.704 2.462  47.470 1.00 69.49 ? 514 SER A O   1 
ATOM   2114 C  CB  . SER A 1 257 ? 46.985 3.325  46.808 1.00 68.16 ? 514 SER A CB  1 
ATOM   2115 O  OG  . SER A 1 257 ? 46.741 3.847  48.101 1.00 67.89 ? 514 SER A OG  1 
ATOM   2116 N  N   . GLU A 1 258 ? 45.442 1.057  47.780 1.00 70.45 ? 515 GLU A N   1 
ATOM   2117 C  CA  . GLU A 1 258 ? 44.752 0.230  48.772 1.00 71.05 ? 515 GLU A CA  1 
ATOM   2118 C  C   . GLU A 1 258 ? 44.433 1.019  50.044 1.00 71.40 ? 515 GLU A C   1 
ATOM   2119 O  O   . GLU A 1 258 ? 43.346 0.877  50.603 1.00 72.10 ? 515 GLU A O   1 
ATOM   2120 C  CB  . GLU A 1 258 ? 45.572 -1.030 49.113 1.00 71.21 ? 515 GLU A CB  1 
ATOM   2121 N  N   . LYS A 1 259 ? 45.359 1.863  50.497 1.00 71.77 ? 516 LYS A N   1 
ATOM   2122 C  CA  . LYS A 1 259 ? 45.114 2.650  51.724 1.00 71.68 ? 516 LYS A CA  1 
ATOM   2123 C  C   . LYS A 1 259 ? 43.943 3.643  51.592 1.00 70.86 ? 516 LYS A C   1 
ATOM   2124 O  O   . LYS A 1 259 ? 43.353 4.028  52.599 1.00 70.61 ? 516 LYS A O   1 
ATOM   2125 C  CB  . LYS A 1 259 ? 46.380 3.340  52.272 1.00 72.09 ? 516 LYS A CB  1 
ATOM   2126 C  CG  . LYS A 1 259 ? 47.617 3.440  51.360 1.00 73.68 ? 516 LYS A CG  1 
ATOM   2127 C  CD  . LYS A 1 259 ? 48.765 4.144  52.121 1.00 75.14 ? 516 LYS A CD  1 
ATOM   2128 C  CE  . LYS A 1 259 ? 50.112 4.086  51.390 1.00 76.12 ? 516 LYS A CE  1 
ATOM   2129 N  NZ  . LYS A 1 259 ? 51.187 4.871  52.110 1.00 76.28 ? 516 LYS A NZ  1 
ATOM   2130 N  N   . CYS A 1 260 ? 43.613 4.028  50.353 1.00 70.11 ? 517 CYS A N   1 
ATOM   2131 C  CA  . CYS A 1 260 ? 42.453 4.882  50.037 1.00 69.43 ? 517 CYS A CA  1 
ATOM   2132 C  C   . CYS A 1 260 ? 42.244 6.027  51.046 1.00 67.67 ? 517 CYS A C   1 
ATOM   2133 O  O   . CYS A 1 260 ? 41.225 6.083  51.738 1.00 67.82 ? 517 CYS A O   1 
ATOM   2134 C  CB  . CYS A 1 260 ? 41.191 4.012  49.931 1.00 69.88 ? 517 CYS A CB  1 
ATOM   2135 S  SG  . CYS A 1 260 ? 39.720 4.884  49.306 1.00 72.88 ? 517 CYS A SG  1 
ATOM   2136 N  N   . ARG A 1 261 ? 43.210 6.937  51.122 1.00 65.67 ? 518 ARG A N   1 
ATOM   2137 C  CA  . ARG A 1 261 ? 43.246 7.918  52.210 1.00 64.25 ? 518 ARG A CA  1 
ATOM   2138 C  C   . ARG A 1 261 ? 42.118 8.950  52.124 1.00 62.39 ? 518 ARG A C   1 
ATOM   2139 O  O   . ARG A 1 261 ? 41.721 9.359  51.043 1.00 61.75 ? 518 ARG A O   1 
ATOM   2140 C  CB  . ARG A 1 261 ? 44.594 8.650  52.244 1.00 64.46 ? 518 ARG A CB  1 
ATOM   2141 C  CG  . ARG A 1 261 ? 45.816 7.773  52.534 1.00 65.19 ? 518 ARG A CG  1 
ATOM   2142 C  CD  . ARG A 1 261 ? 45.790 7.126  53.930 1.00 66.10 ? 518 ARG A CD  1 
ATOM   2143 N  NE  . ARG A 1 261 ? 47.133 6.687  54.336 1.00 67.55 ? 518 ARG A NE  1 
ATOM   2144 C  CZ  . ARG A 1 261 ? 47.412 5.660  55.149 1.00 68.90 ? 518 ARG A CZ  1 
ATOM   2145 N  NH1 . ARG A 1 261 ? 46.449 4.903  55.671 1.00 68.32 ? 518 ARG A NH1 1 
ATOM   2146 N  NH2 . ARG A 1 261 ? 48.682 5.374  55.434 1.00 69.81 ? 518 ARG A NH2 1 
ATOM   2147 N  N   . ALA A 1 262 ? 41.608 9.345  53.286 1.00 60.67 ? 519 ALA A N   1 
ATOM   2148 C  CA  . ALA A 1 262 ? 40.657 10.440 53.398 1.00 59.49 ? 519 ALA A CA  1 
ATOM   2149 C  C   . ALA A 1 262 ? 41.375 11.771 53.124 1.00 58.70 ? 519 ALA A C   1 
ATOM   2150 O  O   . ALA A 1 262 ? 42.460 12.015 53.676 1.00 58.03 ? 519 ALA A O   1 
ATOM   2151 C  CB  . ALA A 1 262 ? 40.063 10.464 54.782 1.00 59.41 ? 519 ALA A CB  1 
ATOM   2152 N  N   . PRO A 1 263 ? 40.775 12.637 52.285 1.00 57.20 ? 520 PRO A N   1 
ATOM   2153 C  CA  . PRO A 1 263 ? 41.344 13.959 52.070 1.00 56.35 ? 520 PRO A CA  1 
ATOM   2154 C  C   . PRO A 1 263 ? 41.568 14.727 53.357 1.00 55.36 ? 520 PRO A C   1 
ATOM   2155 O  O   . PRO A 1 263 ? 40.888 14.477 54.359 1.00 54.89 ? 520 PRO A O   1 
ATOM   2156 C  CB  . PRO A 1 263 ? 40.291 14.668 51.217 1.00 56.38 ? 520 PRO A CB  1 
ATOM   2157 C  CG  . PRO A 1 263 ? 39.615 13.588 50.464 1.00 56.89 ? 520 PRO A CG  1 
ATOM   2158 C  CD  . PRO A 1 263 ? 39.634 12.379 51.386 1.00 57.59 ? 520 PRO A CD  1 
ATOM   2159 N  N   . ALA A 1 264 ? 42.520 15.656 53.317 1.00 54.14 ? 521 ALA A N   1 
ATOM   2160 C  CA  . ALA A 1 264 ? 42.870 16.442 54.494 1.00 53.40 ? 521 ALA A CA  1 
ATOM   2161 C  C   . ALA A 1 264 ? 43.558 17.741 54.081 1.00 52.69 ? 521 ALA A C   1 
ATOM   2162 O  O   . ALA A 1 264 ? 44.276 17.776 53.079 1.00 52.43 ? 521 ALA A O   1 
ATOM   2163 C  CB  . ALA A 1 264 ? 43.770 15.622 55.427 1.00 52.77 ? 521 ALA A CB  1 
ATOM   2164 N  N   . TRP A 1 265 ? 43.308 18.811 54.841 1.00 51.89 ? 522 TRP A N   1 
ATOM   2165 C  CA  . TRP A 1 265 ? 44.067 20.054 54.693 1.00 50.97 ? 522 TRP A CA  1 
ATOM   2166 C  C   . TRP A 1 265 ? 45.328 19.867 55.519 1.00 50.26 ? 522 TRP A C   1 
ATOM   2167 O  O   . TRP A 1 265 ? 45.417 20.330 56.663 1.00 50.19 ? 522 TRP A O   1 
ATOM   2168 C  CB  . TRP A 1 265 ? 43.281 21.275 55.194 1.00 50.94 ? 522 TRP A CB  1 
ATOM   2169 C  CG  . TRP A 1 265 ? 42.187 21.806 54.279 1.00 50.92 ? 522 TRP A CG  1 
ATOM   2170 C  CD1 . TRP A 1 265 ? 42.347 22.346 53.042 1.00 50.53 ? 522 TRP A CD1 1 
ATOM   2171 C  CD2 . TRP A 1 265 ? 40.787 21.894 54.573 1.00 50.68 ? 522 TRP A CD2 1 
ATOM   2172 N  NE1 . TRP A 1 265 ? 41.140 22.748 52.533 1.00 50.03 ? 522 TRP A NE1 1 
ATOM   2173 C  CE2 . TRP A 1 265 ? 40.163 22.483 53.455 1.00 51.55 ? 522 TRP A CE2 1 
ATOM   2174 C  CE3 . TRP A 1 265 ? 39.998 21.511 55.664 1.00 51.98 ? 522 TRP A CE3 1 
ATOM   2175 C  CZ2 . TRP A 1 265 ? 38.782 22.706 53.396 1.00 52.10 ? 522 TRP A CZ2 1 
ATOM   2176 C  CZ3 . TRP A 1 265 ? 38.614 21.732 55.608 1.00 51.96 ? 522 TRP A CZ3 1 
ATOM   2177 C  CH2 . TRP A 1 265 ? 38.029 22.325 54.485 1.00 52.40 ? 522 TRP A CH2 1 
ATOM   2178 N  N   . CYS A 1 266 ? 46.280 19.136 54.957 1.00 49.42 ? 523 CYS A N   1 
ATOM   2179 C  CA  . CYS A 1 266 ? 47.538 18.844 55.642 1.00 49.10 ? 523 CYS A CA  1 
ATOM   2180 C  C   . CYS A 1 266 ? 48.448 20.071 55.684 1.00 48.62 ? 523 CYS A C   1 
ATOM   2181 O  O   . CYS A 1 266 ? 49.195 20.270 56.645 1.00 48.57 ? 523 CYS A O   1 
ATOM   2182 C  CB  . CYS A 1 266 ? 48.277 17.700 54.927 1.00 49.20 ? 523 CYS A CB  1 
ATOM   2183 S  SG  . CYS A 1 266 ? 47.611 16.018 55.228 1.00 49.97 ? 523 CYS A SG  1 
ATOM   2184 N  N   . ASP A 1 267 ? 48.352 20.888 54.636 1.00 48.11 ? 524 ASP A N   1 
ATOM   2185 C  CA  . ASP A 1 267 ? 49.341 21.876 54.301 1.00 47.50 ? 524 ASP A CA  1 
ATOM   2186 C  C   . ASP A 1 267 ? 48.795 23.265 54.597 1.00 47.52 ? 524 ASP A C   1 
ATOM   2187 O  O   . ASP A 1 267 ? 47.815 23.697 54.002 1.00 47.63 ? 524 ASP A O   1 
ATOM   2188 C  CB  . ASP A 1 267 ? 49.718 21.674 52.852 1.00 47.37 ? 524 ASP A CB  1 
ATOM   2189 C  CG  . ASP A 1 267 ? 50.155 20.229 52.585 1.00 47.75 ? 524 ASP A CG  1 
ATOM   2190 O  OD1 . ASP A 1 267 ? 51.179 19.806 53.174 1.00 45.41 ? 524 ASP A OD1 1 
ATOM   2191 O  OD2 . ASP A 1 267 ? 49.456 19.509 51.827 1.00 48.45 ? 524 ASP A OD2 1 
ATOM   2192 N  N   . ARG A 1 268 ? 49.431 23.934 55.560 1.00 47.20 ? 525 ARG A N   1 
ATOM   2193 C  CA  . ARG A 1 268 ? 48.869 25.105 56.212 1.00 47.08 ? 525 ARG A CA  1 
ATOM   2194 C  C   . ARG A 1 268 ? 49.917 26.202 56.374 1.00 47.14 ? 525 ARG A C   1 
ATOM   2195 O  O   . ARG A 1 268 ? 51.119 25.941 56.340 1.00 47.26 ? 525 ARG A O   1 
ATOM   2196 C  CB  . ARG A 1 268 ? 48.308 24.720 57.580 1.00 46.89 ? 525 ARG A CB  1 
ATOM   2197 C  CG  . ARG A 1 268 ? 47.497 23.407 57.599 1.00 47.46 ? 525 ARG A CG  1 
ATOM   2198 C  CD  . ARG A 1 268 ? 46.183 23.519 56.836 1.00 47.55 ? 525 ARG A CD  1 
ATOM   2199 N  NE  . ARG A 1 268 ? 45.130 24.093 57.671 1.00 47.35 ? 525 ARG A NE  1 
ATOM   2200 C  CZ  . ARG A 1 268 ? 44.289 23.390 58.429 1.00 48.03 ? 525 ARG A CZ  1 
ATOM   2201 N  NH1 . ARG A 1 268 ? 44.340 22.064 58.470 1.00 48.48 ? 525 ARG A NH1 1 
ATOM   2202 N  NH2 . ARG A 1 268 ? 43.376 24.021 59.147 1.00 48.43 ? 525 ARG A NH2 1 
ATOM   2203 N  N   . ILE A 1 269 ? 49.444 27.434 56.505 1.00 47.07 ? 526 ILE A N   1 
ATOM   2204 C  CA  . ILE A 1 269 ? 50.298 28.589 56.783 1.00 46.74 ? 526 ILE A CA  1 
ATOM   2205 C  C   . ILE A 1 269 ? 49.581 29.421 57.841 1.00 46.37 ? 526 ILE A C   1 
ATOM   2206 O  O   . ILE A 1 269 ? 48.401 29.721 57.684 1.00 46.25 ? 526 ILE A O   1 
ATOM   2207 C  CB  . ILE A 1 269 ? 50.536 29.435 55.510 1.00 46.74 ? 526 ILE A CB  1 
ATOM   2208 C  CG1 . ILE A 1 269 ? 51.150 28.573 54.386 1.00 46.30 ? 526 ILE A CG1 1 
ATOM   2209 C  CG2 . ILE A 1 269 ? 51.438 30.651 55.814 1.00 46.56 ? 526 ILE A CG2 1 
ATOM   2210 C  CD1 . ILE A 1 269 ? 51.253 29.286 53.021 1.00 43.62 ? 526 ILE A CD1 1 
ATOM   2211 N  N   . LEU A 1 270 ? 50.280 29.762 58.925 1.00 46.19 ? 527 LEU A N   1 
ATOM   2212 C  CA  . LEU A 1 270 ? 49.732 30.603 59.991 1.00 45.74 ? 527 LEU A CA  1 
ATOM   2213 C  C   . LEU A 1 270 ? 50.706 31.715 60.327 1.00 46.34 ? 527 LEU A C   1 
ATOM   2214 O  O   . LEU A 1 270 ? 51.858 31.656 59.939 1.00 46.67 ? 527 LEU A O   1 
ATOM   2215 C  CB  . LEU A 1 270 ? 49.457 29.790 61.251 1.00 45.60 ? 527 LEU A CB  1 
ATOM   2216 C  CG  . LEU A 1 270 ? 48.497 28.596 61.165 1.00 44.53 ? 527 LEU A CG  1 
ATOM   2217 C  CD1 . LEU A 1 270 ? 49.241 27.361 60.698 1.00 41.20 ? 527 LEU A CD1 1 
ATOM   2218 C  CD2 . LEU A 1 270 ? 47.811 28.356 62.512 1.00 42.68 ? 527 LEU A CD2 1 
ATOM   2219 N  N   . TRP A 1 271 ? 50.252 32.722 61.069 1.00 47.08 ? 528 TRP A N   1 
ATOM   2220 C  CA  . TRP A 1 271 ? 51.083 33.875 61.371 1.00 47.52 ? 528 TRP A CA  1 
ATOM   2221 C  C   . TRP A 1 271 ? 50.763 34.517 62.698 1.00 48.28 ? 528 TRP A C   1 
ATOM   2222 O  O   . TRP A 1 271 ? 49.658 34.387 63.214 1.00 47.98 ? 528 TRP A O   1 
ATOM   2223 C  CB  . TRP A 1 271 ? 50.961 34.940 60.271 1.00 47.59 ? 528 TRP A CB  1 
ATOM   2224 C  CG  . TRP A 1 271 ? 49.720 35.809 60.330 1.00 47.99 ? 528 TRP A CG  1 
ATOM   2225 C  CD1 . TRP A 1 271 ? 49.569 36.991 61.005 1.00 48.60 ? 528 TRP A CD1 1 
ATOM   2226 C  CD2 . TRP A 1 271 ? 48.478 35.578 59.657 1.00 48.53 ? 528 TRP A CD2 1 
ATOM   2227 N  NE1 . TRP A 1 271 ? 48.304 37.502 60.807 1.00 47.73 ? 528 TRP A NE1 1 
ATOM   2228 C  CE2 . TRP A 1 271 ? 47.616 36.652 59.983 1.00 48.58 ? 528 TRP A CE2 1 
ATOM   2229 C  CE3 . TRP A 1 271 ? 48.004 34.562 58.823 1.00 48.79 ? 528 TRP A CE3 1 
ATOM   2230 C  CZ2 . TRP A 1 271 ? 46.325 36.743 59.487 1.00 47.65 ? 528 TRP A CZ2 1 
ATOM   2231 C  CZ3 . TRP A 1 271 ? 46.719 34.654 58.335 1.00 47.60 ? 528 TRP A CZ3 1 
ATOM   2232 C  CH2 . TRP A 1 271 ? 45.891 35.733 58.673 1.00 48.29 ? 528 TRP A CH2 1 
ATOM   2233 N  N   . LYS A 1 272 ? 51.757 35.228 63.227 1.00 49.39 ? 529 LYS A N   1 
ATOM   2234 C  CA  . LYS A 1 272 ? 51.629 36.001 64.451 1.00 50.19 ? 529 LYS A CA  1 
ATOM   2235 C  C   . LYS A 1 272 ? 52.495 37.252 64.368 1.00 50.36 ? 529 LYS A C   1 
ATOM   2236 O  O   . LYS A 1 272 ? 53.659 37.184 63.996 1.00 50.06 ? 529 LYS A O   1 
ATOM   2237 C  CB  . LYS A 1 272 ? 52.061 35.159 65.637 1.00 50.67 ? 529 LYS A CB  1 
ATOM   2238 C  CG  . LYS A 1 272 ? 51.833 35.808 66.971 1.00 52.99 ? 529 LYS A CG  1 
ATOM   2239 C  CD  . LYS A 1 272 ? 52.270 34.906 68.113 1.00 56.34 ? 529 LYS A CD  1 
ATOM   2240 C  CE  . LYS A 1 272 ? 52.127 35.627 69.455 1.00 59.52 ? 529 LYS A CE  1 
ATOM   2241 N  NZ  . LYS A 1 272 ? 52.163 34.660 70.615 1.00 63.92 ? 529 LYS A NZ  1 
ATOM   2242 N  N   . GLY A 1 273 ? 51.912 38.395 64.717 1.00 50.80 ? 530 GLY A N   1 
ATOM   2243 C  CA  . GLY A 1 273 ? 52.637 39.653 64.784 1.00 50.67 ? 530 GLY A CA  1 
ATOM   2244 C  C   . GLY A 1 273 ? 51.760 40.826 64.411 1.00 51.11 ? 530 GLY A C   1 
ATOM   2245 O  O   . GLY A 1 273 ? 50.678 40.664 63.852 1.00 50.84 ? 530 GLY A O   1 
ATOM   2246 N  N   . LYS A 1 274 ? 52.254 42.016 64.726 1.00 52.02 ? 531 LYS A N   1 
ATOM   2247 C  CA  . LYS A 1 274 ? 51.590 43.270 64.383 1.00 52.66 ? 531 LYS A CA  1 
ATOM   2248 C  C   . LYS A 1 274 ? 51.789 43.615 62.917 1.00 51.78 ? 531 LYS A C   1 
ATOM   2249 O  O   . LYS A 1 274 ? 52.748 43.156 62.277 1.00 51.96 ? 531 LYS A O   1 
ATOM   2250 C  CB  . LYS A 1 274 ? 52.161 44.409 65.224 1.00 53.54 ? 531 LYS A CB  1 
ATOM   2251 C  CG  . LYS A 1 274 ? 51.775 44.389 66.710 1.00 56.96 ? 531 LYS A CG  1 
ATOM   2252 C  CD  . LYS A 1 274 ? 52.481 45.540 67.434 1.00 61.32 ? 531 LYS A CD  1 
ATOM   2253 C  CE  . LYS A 1 274 ? 52.312 45.461 68.950 1.00 65.03 ? 531 LYS A CE  1 
ATOM   2254 N  NZ  . LYS A 1 274 ? 53.573 45.928 69.641 1.00 67.53 ? 531 LYS A NZ  1 
ATOM   2255 N  N   . ASN A 1 275 ? 50.880 44.435 62.407 1.00 50.84 ? 532 ASN A N   1 
ATOM   2256 C  CA  . ASN A 1 275 ? 50.945 44.965 61.050 1.00 50.53 ? 532 ASN A CA  1 
ATOM   2257 C  C   . ASN A 1 275 ? 51.007 43.884 59.955 1.00 50.24 ? 532 ASN A C   1 
ATOM   2258 O  O   . ASN A 1 275 ? 51.721 44.045 58.968 1.00 49.51 ? 532 ASN A O   1 
ATOM   2259 C  CB  . ASN A 1 275 ? 52.120 45.945 60.909 1.00 50.47 ? 532 ASN A CB  1 
ATOM   2260 C  CG  . ASN A 1 275 ? 52.130 47.024 61.998 1.00 51.14 ? 532 ASN A CG  1 
ATOM   2261 O  OD1 . ASN A 1 275 ? 53.040 47.073 62.827 1.00 54.07 ? 532 ASN A OD1 1 
ATOM   2262 N  ND2 . ASN A 1 275 ? 51.120 47.867 62.008 1.00 49.88 ? 532 ASN A ND2 1 
ATOM   2263 N  N   . ILE A 1 276 ? 50.258 42.794 60.132 1.00 49.86 ? 533 ILE A N   1 
ATOM   2264 C  CA  . ILE A 1 276 ? 50.163 41.770 59.102 1.00 49.84 ? 533 ILE A CA  1 
ATOM   2265 C  C   . ILE A 1 276 ? 48.750 41.704 58.504 1.00 50.01 ? 533 ILE A C   1 
ATOM   2266 O  O   . ILE A 1 276 ? 47.767 41.706 59.229 1.00 50.45 ? 533 ILE A O   1 
ATOM   2267 C  CB  . ILE A 1 276 ? 50.596 40.382 59.630 1.00 49.65 ? 533 ILE A CB  1 
ATOM   2268 C  CG1 . ILE A 1 276 ? 52.056 40.424 60.111 1.00 48.82 ? 533 ILE A CG1 1 
ATOM   2269 C  CG2 . ILE A 1 276 ? 50.463 39.334 58.534 1.00 48.95 ? 533 ILE A CG2 1 
ATOM   2270 C  CD1 . ILE A 1 276 ? 52.448 39.276 61.022 1.00 47.14 ? 533 ILE A CD1 1 
ATOM   2271 N  N   . THR A 1 277 ? 48.676 41.647 57.175 1.00 49.92 ? 534 THR A N   1 
ATOM   2272 C  CA  . THR A 1 277 ? 47.433 41.431 56.444 1.00 49.91 ? 534 THR A CA  1 
ATOM   2273 C  C   . THR A 1 277 ? 47.629 40.352 55.369 1.00 49.28 ? 534 THR A C   1 
ATOM   2274 O  O   . THR A 1 277 ? 48.525 40.454 54.532 1.00 48.63 ? 534 THR A O   1 
ATOM   2275 C  CB  . THR A 1 277 ? 46.926 42.755 55.785 1.00 50.15 ? 534 THR A CB  1 
ATOM   2276 O  OG1 . THR A 1 277 ? 46.469 43.650 56.808 1.00 52.45 ? 534 THR A OG1 1 
ATOM   2277 C  CG2 . THR A 1 277 ? 45.764 42.500 54.859 1.00 50.27 ? 534 THR A CG2 1 
ATOM   2278 N  N   . GLN A 1 278 ? 46.784 39.324 55.401 1.00 48.66 ? 535 GLN A N   1 
ATOM   2279 C  CA  . GLN A 1 278 ? 46.807 38.274 54.392 1.00 48.67 ? 535 GLN A CA  1 
ATOM   2280 C  C   . GLN A 1 278 ? 46.025 38.723 53.169 1.00 48.73 ? 535 GLN A C   1 
ATOM   2281 O  O   . GLN A 1 278 ? 44.868 39.069 53.279 1.00 48.41 ? 535 GLN A O   1 
ATOM   2282 C  CB  . GLN A 1 278 ? 46.210 36.970 54.933 1.00 48.69 ? 535 GLN A CB  1 
ATOM   2283 C  CG  . GLN A 1 278 ? 46.404 35.766 53.996 1.00 48.51 ? 535 GLN A CG  1 
ATOM   2284 C  CD  . GLN A 1 278 ? 46.066 34.448 54.663 1.00 48.62 ? 535 GLN A CD  1 
ATOM   2285 O  OE1 . GLN A 1 278 ? 44.926 34.241 55.069 1.00 48.18 ? 535 GLN A OE1 1 
ATOM   2286 N  NE2 . GLN A 1 278 ? 47.057 33.548 54.784 1.00 46.94 ? 535 GLN A NE2 1 
ATOM   2287 N  N   . LEU A 1 279 ? 46.683 38.730 52.015 1.00 48.97 ? 536 LEU A N   1 
ATOM   2288 C  CA  . LEU A 1 279 ? 46.062 39.093 50.755 1.00 49.03 ? 536 LEU A CA  1 
ATOM   2289 C  C   . LEU A 1 279 ? 45.534 37.869 49.986 1.00 49.07 ? 536 LEU A C   1 
ATOM   2290 O  O   . LEU A 1 279 ? 44.715 38.013 49.088 1.00 49.00 ? 536 LEU A O   1 
ATOM   2291 C  CB  . LEU A 1 279 ? 47.074 39.824 49.877 1.00 49.30 ? 536 LEU A CB  1 
ATOM   2292 C  CG  . LEU A 1 279 ? 47.815 41.014 50.517 1.00 50.65 ? 536 LEU A CG  1 
ATOM   2293 C  CD1 . LEU A 1 279 ? 48.830 41.562 49.546 1.00 49.97 ? 536 LEU A CD1 1 
ATOM   2294 C  CD2 . LEU A 1 279 ? 46.840 42.103 50.952 1.00 50.82 ? 536 LEU A CD2 1 
ATOM   2295 N  N   . SER A 1 280 ? 46.024 36.676 50.315 1.00 48.91 ? 537 SER A N   1 
ATOM   2296 C  CA  . SER A 1 280 ? 45.645 35.467 49.593 1.00 48.68 ? 537 SER A CA  1 
ATOM   2297 C  C   . SER A 1 280 ? 46.094 34.217 50.336 1.00 48.75 ? 537 SER A C   1 
ATOM   2298 O  O   . SER A 1 280 ? 47.090 34.227 51.076 1.00 48.23 ? 537 SER A O   1 
ATOM   2299 C  CB  . SER A 1 280 ? 46.234 35.465 48.168 1.00 48.54 ? 537 SER A CB  1 
ATOM   2300 O  OG  . SER A 1 280 ? 47.630 35.252 48.173 1.00 49.76 ? 537 SER A OG  1 
ATOM   2301 N  N   . TYR A 1 281 ? 45.337 33.145 50.134 1.00 48.48 ? 538 TYR A N   1 
ATOM   2302 C  CA  . TYR A 1 281 ? 45.656 31.856 50.700 1.00 48.64 ? 538 TYR A CA  1 
ATOM   2303 C  C   . TYR A 1 281 ? 45.064 30.822 49.734 1.00 49.54 ? 538 TYR A C   1 
ATOM   2304 O  O   . TYR A 1 281 ? 43.855 30.749 49.587 1.00 49.21 ? 538 TYR A O   1 
ATOM   2305 C  CB  . TYR A 1 281 ? 45.046 31.773 52.093 1.00 48.01 ? 538 TYR A CB  1 
ATOM   2306 C  CG  . TYR A 1 281 ? 45.434 30.597 52.970 1.00 46.84 ? 538 TYR A CG  1 
ATOM   2307 C  CD1 . TYR A 1 281 ? 46.667 29.960 52.853 1.00 45.25 ? 538 TYR A CD1 1 
ATOM   2308 C  CD2 . TYR A 1 281 ? 44.574 30.159 53.971 1.00 44.92 ? 538 TYR A CD2 1 
ATOM   2309 C  CE1 . TYR A 1 281 ? 47.006 28.907 53.687 1.00 43.37 ? 538 TYR A CE1 1 
ATOM   2310 C  CE2 . TYR A 1 281 ? 44.915 29.118 54.811 1.00 44.63 ? 538 TYR A CE2 1 
ATOM   2311 C  CZ  . TYR A 1 281 ? 46.133 28.496 54.675 1.00 43.91 ? 538 TYR A CZ  1 
ATOM   2312 O  OH  . TYR A 1 281 ? 46.468 27.452 55.538 1.00 43.39 ? 538 TYR A OH  1 
ATOM   2313 N  N   . GLN A 1 282 ? 45.930 30.069 49.056 1.00 50.32 ? 539 GLN A N   1 
ATOM   2314 C  CA  . GLN A 1 282 ? 45.545 29.286 47.891 1.00 51.24 ? 539 GLN A CA  1 
ATOM   2315 C  C   . GLN A 1 282 ? 46.334 27.990 47.824 1.00 50.96 ? 539 GLN A C   1 
ATOM   2316 O  O   . GLN A 1 282 ? 47.453 27.907 48.351 1.00 50.54 ? 539 GLN A O   1 
ATOM   2317 C  CB  . GLN A 1 282 ? 45.835 30.081 46.617 1.00 51.90 ? 539 GLN A CB  1 
ATOM   2318 C  CG  . GLN A 1 282 ? 45.215 31.477 46.606 1.00 56.64 ? 539 GLN A CG  1 
ATOM   2319 C  CD  . GLN A 1 282 ? 45.567 32.295 45.367 1.00 60.78 ? 539 GLN A CD  1 
ATOM   2320 O  OE1 . GLN A 1 282 ? 46.685 32.795 45.238 1.00 64.27 ? 539 GLN A OE1 1 
ATOM   2321 N  NE2 . GLN A 1 282 ? 44.595 32.458 44.464 1.00 62.61 ? 539 GLN A NE2 1 
ATOM   2322 N  N   . SER A 1 283 ? 45.749 26.984 47.168 1.00 50.55 ? 540 SER A N   1 
ATOM   2323 C  CA  . SER A 1 283 ? 46.507 25.808 46.722 1.00 50.26 ? 540 SER A CA  1 
ATOM   2324 C  C   . SER A 1 283 ? 46.649 25.923 45.227 1.00 50.14 ? 540 SER A C   1 
ATOM   2325 O  O   . SER A 1 283 ? 46.006 26.768 44.615 1.00 49.96 ? 540 SER A O   1 
ATOM   2326 C  CB  . SER A 1 283 ? 45.852 24.473 47.120 1.00 50.24 ? 540 SER A CB  1 
ATOM   2327 O  OG  . SER A 1 283 ? 44.656 24.198 46.410 1.00 49.91 ? 540 SER A OG  1 
ATOM   2328 N  N   . HIS A 1 284 ? 47.513 25.090 44.657 1.00 49.92 ? 541 HIS A N   1 
ATOM   2329 C  CA  . HIS A 1 284 ? 47.855 25.150 43.252 1.00 49.79 ? 541 HIS A CA  1 
ATOM   2330 C  C   . HIS A 1 284 ? 47.690 23.758 42.647 1.00 50.30 ? 541 HIS A C   1 
ATOM   2331 O  O   . HIS A 1 284 ? 48.619 22.946 42.649 1.00 50.08 ? 541 HIS A O   1 
ATOM   2332 C  CB  . HIS A 1 284 ? 49.270 25.692 43.104 1.00 49.77 ? 541 HIS A CB  1 
ATOM   2333 C  CG  . HIS A 1 284 ? 49.435 27.065 43.679 1.00 49.48 ? 541 HIS A CG  1 
ATOM   2334 N  ND1 . HIS A 1 284 ? 49.468 28.198 42.898 1.00 49.70 ? 541 HIS A ND1 1 
ATOM   2335 C  CD2 . HIS A 1 284 ? 49.529 27.491 44.961 1.00 49.70 ? 541 HIS A CD2 1 
ATOM   2336 C  CE1 . HIS A 1 284 ? 49.593 29.262 43.673 1.00 50.03 ? 541 HIS A CE1 1 
ATOM   2337 N  NE2 . HIS A 1 284 ? 49.625 28.862 44.930 1.00 48.91 ? 541 HIS A NE2 1 
ATOM   2338 N  N   . MET A 1 285 ? 46.481 23.498 42.141 1.00 50.80 ? 542 MET A N   1 
ATOM   2339 C  CA  . MET A 1 285 ? 46.086 22.183 41.633 1.00 51.12 ? 542 MET A CA  1 
ATOM   2340 C  C   . MET A 1 285 ? 46.885 21.757 40.407 1.00 51.06 ? 542 MET A C   1 
ATOM   2341 O  O   . MET A 1 285 ? 47.090 20.573 40.202 1.00 51.34 ? 542 MET A O   1 
ATOM   2342 C  CB  . MET A 1 285 ? 44.593 22.163 41.285 1.00 51.35 ? 542 MET A CB  1 
ATOM   2343 C  CG  . MET A 1 285 ? 43.645 22.279 42.462 1.00 51.81 ? 542 MET A CG  1 
ATOM   2344 S  SD  . MET A 1 285 ? 43.533 20.829 43.524 1.00 56.34 ? 542 MET A SD  1 
ATOM   2345 C  CE  . MET A 1 285 ? 42.794 19.658 42.384 1.00 56.19 ? 542 MET A CE  1 
ATOM   2346 N  N   . ALA A 1 286 ? 47.347 22.713 39.605 1.00 51.24 ? 543 ALA A N   1 
ATOM   2347 C  CA  . ALA A 1 286 ? 48.007 22.403 38.339 1.00 51.14 ? 543 ALA A CA  1 
ATOM   2348 C  C   . ALA A 1 286 ? 49.329 21.648 38.497 1.00 51.44 ? 543 ALA A C   1 
ATOM   2349 O  O   . ALA A 1 286 ? 49.840 21.084 37.532 1.00 51.93 ? 543 ALA A O   1 
ATOM   2350 C  CB  . ALA A 1 286 ? 48.226 23.650 37.544 1.00 50.40 ? 543 ALA A CB  1 
ATOM   2351 N  N   . LEU A 1 287 ? 49.907 21.652 39.689 1.00 51.61 ? 544 LEU A N   1 
ATOM   2352 C  CA  . LEU A 1 287 ? 51.170 20.940 39.908 1.00 51.48 ? 544 LEU A CA  1 
ATOM   2353 C  C   . LEU A 1 287 ? 50.865 19.529 40.384 1.00 51.33 ? 544 LEU A C   1 
ATOM   2354 O  O   . LEU A 1 287 ? 50.163 19.331 41.371 1.00 50.43 ? 544 LEU A O   1 
ATOM   2355 C  CB  . LEU A 1 287 ? 52.063 21.717 40.881 1.00 51.46 ? 544 LEU A CB  1 
ATOM   2356 C  CG  . LEU A 1 287 ? 52.566 22.995 40.197 1.00 52.34 ? 544 LEU A CG  1 
ATOM   2357 C  CD1 . LEU A 1 287 ? 52.799 24.101 41.162 1.00 54.37 ? 544 LEU A CD1 1 
ATOM   2358 C  CD2 . LEU A 1 287 ? 53.827 22.723 39.399 1.00 52.98 ? 544 LEU A CD2 1 
ATOM   2359 N  N   . LYS A 1 288 ? 51.372 18.549 39.646 1.00 52.02 ? 545 LYS A N   1 
ATOM   2360 C  CA  . LYS A 1 288 ? 51.004 17.156 39.867 1.00 52.97 ? 545 LYS A CA  1 
ATOM   2361 C  C   . LYS A 1 288 ? 52.174 16.209 40.110 1.00 52.28 ? 545 LYS A C   1 
ATOM   2362 O  O   . LYS A 1 288 ? 51.984 15.001 40.098 1.00 52.75 ? 545 LYS A O   1 
ATOM   2363 C  CB  . LYS A 1 288 ? 50.197 16.658 38.662 1.00 53.72 ? 545 LYS A CB  1 
ATOM   2364 C  CG  . LYS A 1 288 ? 48.885 17.388 38.451 1.00 56.08 ? 545 LYS A CG  1 
ATOM   2365 C  CD  . LYS A 1 288 ? 48.367 17.128 37.041 1.00 59.84 ? 545 LYS A CD  1 
ATOM   2366 C  CE  . LYS A 1 288 ? 46.946 17.667 36.861 1.00 61.67 ? 545 LYS A CE  1 
ATOM   2367 N  NZ  . LYS A 1 288 ? 46.604 17.698 35.410 1.00 64.74 ? 545 LYS A NZ  1 
ATOM   2368 N  N   . THR A 1 289 ? 53.373 16.737 40.330 1.00 51.65 ? 546 THR A N   1 
ATOM   2369 C  CA  . THR A 1 289 ? 54.526 15.902 40.662 1.00 51.12 ? 546 THR A CA  1 
ATOM   2370 C  C   . THR A 1 289 ? 54.308 15.068 41.937 1.00 50.30 ? 546 THR A C   1 
ATOM   2371 O  O   . THR A 1 289 ? 54.837 13.968 42.046 1.00 50.34 ? 546 THR A O   1 
ATOM   2372 C  CB  . THR A 1 289 ? 55.776 16.746 40.840 1.00 51.16 ? 546 THR A CB  1 
ATOM   2373 O  OG1 . THR A 1 289 ? 56.164 17.279 39.573 1.00 52.20 ? 546 THR A OG1 1 
ATOM   2374 C  CG2 . THR A 1 289 ? 56.919 15.912 41.414 1.00 52.13 ? 546 THR A CG2 1 
ATOM   2375 N  N   . SER A 1 290 ? 53.502 15.572 42.866 1.00 48.99 ? 547 SER A N   1 
ATOM   2376 C  CA  . SER A 1 290 ? 53.384 14.978 44.189 1.00 48.26 ? 547 SER A CA  1 
ATOM   2377 C  C   . SER A 1 290 ? 51.984 14.503 44.487 1.00 48.13 ? 547 SER A C   1 
ATOM   2378 O  O   . SER A 1 290 ? 51.046 14.825 43.765 1.00 48.83 ? 547 SER A O   1 
ATOM   2379 C  CB  . SER A 1 290 ? 53.788 16.005 45.245 1.00 48.00 ? 547 SER A CB  1 
ATOM   2380 O  OG  . SER A 1 290 ? 53.640 15.498 46.564 1.00 46.88 ? 547 SER A OG  1 
ATOM   2381 N  N   . ASP A 1 291 ? 51.850 13.735 45.561 1.00 47.59 ? 548 ASP A N   1 
ATOM   2382 C  CA  . ASP A 1 291 ? 50.552 13.390 46.092 1.00 47.96 ? 548 ASP A CA  1 
ATOM   2383 C  C   . ASP A 1 291 ? 49.943 14.513 46.957 1.00 47.63 ? 548 ASP A C   1 
ATOM   2384 O  O   . ASP A 1 291 ? 48.785 14.410 47.368 1.00 47.01 ? 548 ASP A O   1 
ATOM   2385 C  CB  . ASP A 1 291 ? 50.605 12.064 46.874 1.00 48.50 ? 548 ASP A CB  1 
ATOM   2386 C  CG  . ASP A 1 291 ? 51.475 12.133 48.120 1.00 50.66 ? 548 ASP A CG  1 
ATOM   2387 O  OD1 . ASP A 1 291 ? 52.342 13.035 48.214 1.00 51.27 ? 548 ASP A OD1 1 
ATOM   2388 O  OD2 . ASP A 1 291 ? 51.288 11.258 49.006 1.00 54.84 ? 548 ASP A OD2 1 
ATOM   2389 N  N   . HIS A 1 292 ? 50.723 15.560 47.244 1.00 47.34 ? 549 HIS A N   1 
ATOM   2390 C  CA  . HIS A 1 292 ? 50.190 16.804 47.804 1.00 47.30 ? 549 HIS A CA  1 
ATOM   2391 C  C   . HIS A 1 292 ? 50.173 17.885 46.739 1.00 47.50 ? 549 HIS A C   1 
ATOM   2392 O  O   . HIS A 1 292 ? 50.976 17.840 45.790 1.00 47.83 ? 549 HIS A O   1 
ATOM   2393 C  CB  . HIS A 1 292 ? 51.057 17.333 48.950 1.00 47.40 ? 549 HIS A CB  1 
ATOM   2394 C  CG  . HIS A 1 292 ? 51.013 16.510 50.198 1.00 46.23 ? 549 HIS A CG  1 
ATOM   2395 N  ND1 . HIS A 1 292 ? 50.447 16.973 51.364 1.00 46.22 ? 549 HIS A ND1 1 
ATOM   2396 C  CD2 . HIS A 1 292 ? 51.511 15.284 50.479 1.00 44.61 ? 549 HIS A CD2 1 
ATOM   2397 C  CE1 . HIS A 1 292 ? 50.574 16.055 52.306 1.00 46.92 ? 549 HIS A CE1 1 
ATOM   2398 N  NE2 . HIS A 1 292 ? 51.218 15.018 51.796 1.00 45.09 ? 549 HIS A NE2 1 
ATOM   2399 N  N   . LYS A 1 293 ? 49.274 18.859 46.900 1.00 47.21 ? 550 LYS A N   1 
ATOM   2400 C  CA  . LYS A 1 293 ? 49.359 20.100 46.138 1.00 47.39 ? 550 LYS A CA  1 
ATOM   2401 C  C   . LYS A 1 293 ? 50.083 21.168 46.989 1.00 47.32 ? 550 LYS A C   1 
ATOM   2402 O  O   . LYS A 1 293 ? 49.947 21.196 48.219 1.00 46.43 ? 550 LYS A O   1 
ATOM   2403 C  CB  . LYS A 1 293 ? 47.961 20.620 45.741 1.00 47.73 ? 550 LYS A CB  1 
ATOM   2404 C  CG  . LYS A 1 293 ? 47.082 19.636 44.956 1.00 47.99 ? 550 LYS A CG  1 
ATOM   2405 C  CD  . LYS A 1 293 ? 47.691 19.250 43.625 1.00 48.77 ? 550 LYS A CD  1 
ATOM   2406 C  CE  . LYS A 1 293 ? 46.737 18.371 42.814 1.00 48.74 ? 550 LYS A CE  1 
ATOM   2407 N  NZ  . LYS A 1 293 ? 47.225 18.123 41.438 1.00 48.13 ? 550 LYS A NZ  1 
ATOM   2408 N  N   . PRO A 1 294 ? 50.852 22.054 46.338 1.00 47.17 ? 551 PRO A N   1 
ATOM   2409 C  CA  . PRO A 1 294 ? 51.478 23.164 47.058 1.00 47.40 ? 551 PRO A CA  1 
ATOM   2410 C  C   . PRO A 1 294 ? 50.476 24.211 47.542 1.00 47.30 ? 551 PRO A C   1 
ATOM   2411 O  O   . PRO A 1 294 ? 49.408 24.382 46.941 1.00 47.47 ? 551 PRO A O   1 
ATOM   2412 C  CB  . PRO A 1 294 ? 52.397 23.808 46.013 1.00 47.77 ? 551 PRO A CB  1 
ATOM   2413 C  CG  . PRO A 1 294 ? 52.210 23.056 44.753 1.00 48.01 ? 551 PRO A CG  1 
ATOM   2414 C  CD  . PRO A 1 294 ? 51.102 22.098 44.896 1.00 47.11 ? 551 PRO A CD  1 
ATOM   2415 N  N   . VAL A 1 295 ? 50.844 24.918 48.609 1.00 46.87 ? 552 VAL A N   1 
ATOM   2416 C  CA  . VAL A 1 295 ? 50.027 25.977 49.173 1.00 46.13 ? 552 VAL A CA  1 
ATOM   2417 C  C   . VAL A 1 295 ? 50.829 27.264 49.240 1.00 46.14 ? 552 VAL A C   1 
ATOM   2418 O  O   . VAL A 1 295 ? 52.036 27.226 49.393 1.00 45.94 ? 552 VAL A O   1 
ATOM   2419 C  CB  . VAL A 1 295 ? 49.515 25.596 50.538 1.00 45.94 ? 552 VAL A CB  1 
ATOM   2420 C  CG1 . VAL A 1 295 ? 48.865 26.792 51.233 1.00 44.60 ? 552 VAL A CG1 1 
ATOM   2421 C  CG2 . VAL A 1 295 ? 48.537 24.442 50.398 1.00 45.73 ? 552 VAL A CG2 1 
ATOM   2422 N  N   . SER A 1 296 ? 50.155 28.400 49.068 1.00 46.31 ? 553 SER A N   1 
ATOM   2423 C  CA  . SER A 1 296 ? 50.818 29.698 49.132 1.00 46.37 ? 553 SER A CA  1 
ATOM   2424 C  C   . SER A 1 296 ? 49.971 30.734 49.855 1.00 46.57 ? 553 SER A C   1 
ATOM   2425 O  O   . SER A 1 296 ? 48.751 30.585 49.972 1.00 46.91 ? 553 SER A O   1 
ATOM   2426 C  CB  . SER A 1 296 ? 51.155 30.204 47.744 1.00 46.17 ? 553 SER A CB  1 
ATOM   2427 O  OG  . SER A 1 296 ? 49.986 30.625 47.093 1.00 46.11 ? 553 SER A OG  1 
ATOM   2428 N  N   . SER A 1 297 ? 50.642 31.757 50.378 1.00 46.66 ? 554 SER A N   1 
ATOM   2429 C  CA  . SER A 1 297 ? 49.983 32.915 50.946 1.00 46.79 ? 554 SER A CA  1 
ATOM   2430 C  C   . SER A 1 297 ? 50.846 34.137 50.695 1.00 46.82 ? 554 SER A C   1 
ATOM   2431 O  O   . SER A 1 297 ? 52.068 34.062 50.822 1.00 47.12 ? 554 SER A O   1 
ATOM   2432 C  CB  . SER A 1 297 ? 49.751 32.740 52.434 1.00 46.75 ? 554 SER A CB  1 
ATOM   2433 O  OG  . SER A 1 297 ? 49.080 33.872 52.984 1.00 48.90 ? 554 SER A OG  1 
ATOM   2434 N  N   . VAL A 1 298 ? 50.218 35.239 50.290 1.00 46.42 ? 555 VAL A N   1 
ATOM   2435 C  CA  . VAL A 1 298 ? 50.900 36.504 50.207 1.00 46.49 ? 555 VAL A CA  1 
ATOM   2436 C  C   . VAL A 1 298 ? 50.376 37.435 51.319 1.00 47.01 ? 555 VAL A C   1 
ATOM   2437 O  O   . VAL A 1 298 ? 49.154 37.524 51.586 1.00 46.82 ? 555 VAL A O   1 
ATOM   2438 C  CB  . VAL A 1 298 ? 50.775 37.155 48.809 1.00 46.87 ? 555 VAL A CB  1 
ATOM   2439 C  CG1 . VAL A 1 298 ? 51.556 38.460 48.771 1.00 46.44 ? 555 VAL A CG1 1 
ATOM   2440 C  CG2 . VAL A 1 298 ? 51.290 36.207 47.709 1.00 45.76 ? 555 VAL A CG2 1 
ATOM   2441 N  N   . PHE A 1 299 ? 51.322 38.092 51.986 1.00 46.90 ? 556 PHE A N   1 
ATOM   2442 C  CA  . PHE A 1 299 ? 51.043 38.988 53.093 1.00 46.77 ? 556 PHE A CA  1 
ATOM   2443 C  C   . PHE A 1 299 ? 51.602 40.382 52.800 1.00 47.31 ? 556 PHE A C   1 
ATOM   2444 O  O   . PHE A 1 299 ? 52.627 40.530 52.133 1.00 46.47 ? 556 PHE A O   1 
ATOM   2445 C  CB  . PHE A 1 299 ? 51.755 38.518 54.350 1.00 46.57 ? 556 PHE A CB  1 
ATOM   2446 C  CG  . PHE A 1 299 ? 51.312 37.196 54.866 1.00 45.93 ? 556 PHE A CG  1 
ATOM   2447 C  CD1 . PHE A 1 299 ? 50.221 37.099 55.718 1.00 45.24 ? 556 PHE A CD1 1 
ATOM   2448 C  CD2 . PHE A 1 299 ? 52.027 36.050 54.574 1.00 45.64 ? 556 PHE A CD2 1 
ATOM   2449 C  CE1 . PHE A 1 299 ? 49.835 35.886 56.228 1.00 45.13 ? 556 PHE A CE1 1 
ATOM   2450 C  CE2 . PHE A 1 299 ? 51.643 34.822 55.089 1.00 44.14 ? 556 PHE A CE2 1 
ATOM   2451 C  CZ  . PHE A 1 299 ? 50.552 34.740 55.915 1.00 44.69 ? 556 PHE A CZ  1 
ATOM   2452 N  N   . ASP A 1 300 ? 50.927 41.395 53.337 1.00 48.11 ? 557 ASP A N   1 
ATOM   2453 C  CA  . ASP A 1 300 ? 51.469 42.746 53.439 1.00 48.63 ? 557 ASP A CA  1 
ATOM   2454 C  C   . ASP A 1 300 ? 51.924 42.853 54.867 1.00 48.06 ? 557 ASP A C   1 
ATOM   2455 O  O   . ASP A 1 300 ? 51.129 42.663 55.783 1.00 47.68 ? 557 ASP A O   1 
ATOM   2456 C  CB  . ASP A 1 300 ? 50.401 43.807 53.167 1.00 49.40 ? 557 ASP A CB  1 
ATOM   2457 C  CG  . ASP A 1 300 ? 50.557 44.482 51.813 1.00 52.87 ? 557 ASP A CG  1 
ATOM   2458 O  OD1 . ASP A 1 300 ? 51.637 44.415 51.193 1.00 57.66 ? 557 ASP A OD1 1 
ATOM   2459 O  OD2 . ASP A 1 300 ? 49.573 45.097 51.364 1.00 58.87 ? 557 ASP A OD2 1 
ATOM   2460 N  N   . ILE A 1 301 ? 53.200 43.143 55.069 1.00 47.72 ? 558 ILE A N   1 
ATOM   2461 C  CA  . ILE A 1 301 ? 53.742 43.205 56.419 1.00 47.37 ? 558 ILE A CA  1 
ATOM   2462 C  C   . ILE A 1 301 ? 54.424 44.538 56.629 1.00 47.63 ? 558 ILE A C   1 
ATOM   2463 O  O   . ILE A 1 301 ? 55.304 44.921 55.835 1.00 47.57 ? 558 ILE A O   1 
ATOM   2464 C  CB  . ILE A 1 301 ? 54.732 42.066 56.699 1.00 47.26 ? 558 ILE A CB  1 
ATOM   2465 C  CG1 . ILE A 1 301 ? 54.054 40.711 56.465 1.00 46.55 ? 558 ILE A CG1 1 
ATOM   2466 C  CG2 . ILE A 1 301 ? 55.269 42.171 58.127 1.00 45.69 ? 558 ILE A CG2 1 
ATOM   2467 C  CD1 . ILE A 1 301 ? 54.939 39.526 56.721 1.00 46.43 ? 558 ILE A CD1 1 
ATOM   2468 N  N   . GLY A 1 302 ? 53.991 45.241 57.679 1.00 47.30 ? 559 GLY A N   1 
ATOM   2469 C  CA  . GLY A 1 302 ? 54.587 46.510 58.069 1.00 47.49 ? 559 GLY A CA  1 
ATOM   2470 C  C   . GLY A 1 302 ? 55.928 46.300 58.737 1.00 47.61 ? 559 GLY A C   1 
ATOM   2471 O  O   . GLY A 1 302 ? 56.037 45.570 59.711 1.00 48.31 ? 559 GLY A O   1 
ATOM   2472 N  N   . VAL A 1 303 ? 56.957 46.926 58.196 1.00 48.09 ? 560 VAL A N   1 
ATOM   2473 C  CA  . VAL A 1 303 ? 58.322 46.767 58.696 1.00 48.04 ? 560 VAL A CA  1 
ATOM   2474 C  C   . VAL A 1 303 ? 58.845 48.120 59.195 1.00 47.86 ? 560 VAL A C   1 
ATOM   2475 O  O   . VAL A 1 303 ? 58.582 49.164 58.582 1.00 47.55 ? 560 VAL A O   1 
ATOM   2476 C  CB  . VAL A 1 303 ? 59.211 46.180 57.577 1.00 48.06 ? 560 VAL A CB  1 
ATOM   2477 C  CG1 . VAL A 1 303 ? 60.706 46.356 57.871 1.00 47.88 ? 560 VAL A CG1 1 
ATOM   2478 C  CG2 . VAL A 1 303 ? 58.870 44.714 57.376 1.00 47.92 ? 560 VAL A CG2 1 
ATOM   2479 N  N   . ARG A 1 304 ? 59.557 48.102 60.316 1.00 48.09 ? 561 ARG A N   1 
ATOM   2480 C  CA  . ARG A 1 304 ? 60.135 49.338 60.890 1.00 48.69 ? 561 ARG A CA  1 
ATOM   2481 C  C   . ARG A 1 304 ? 61.356 49.759 60.111 1.00 47.88 ? 561 ARG A C   1 
ATOM   2482 O  O   . ARG A 1 304 ? 62.391 49.098 60.189 1.00 48.15 ? 561 ARG A O   1 
ATOM   2483 C  CB  . ARG A 1 304 ? 60.548 49.136 62.344 1.00 49.10 ? 561 ARG A CB  1 
ATOM   2484 C  CG  . ARG A 1 304 ? 59.401 49.100 63.314 1.00 52.23 ? 561 ARG A CG  1 
ATOM   2485 C  CD  . ARG A 1 304 ? 59.374 50.298 64.283 1.00 55.83 ? 561 ARG A CD  1 
ATOM   2486 N  NE  . ARG A 1 304 ? 57.986 50.560 64.665 1.00 58.92 ? 561 ARG A NE  1 
ATOM   2487 C  CZ  . ARG A 1 304 ? 57.333 51.706 64.496 1.00 60.61 ? 561 ARG A CZ  1 
ATOM   2488 N  NH1 . ARG A 1 304 ? 57.929 52.790 64.002 1.00 60.64 ? 561 ARG A NH1 1 
ATOM   2489 N  NH2 . ARG A 1 304 ? 56.060 51.777 64.866 1.00 63.44 ? 561 ARG A NH2 1 
ATOM   2490 N  N   . VAL A 1 305 ? 61.240 50.848 59.366 1.00 47.58 ? 562 VAL A N   1 
ATOM   2491 C  CA  . VAL A 1 305 ? 62.354 51.370 58.574 1.00 47.61 ? 562 VAL A CA  1 
ATOM   2492 C  C   . VAL A 1 305 ? 62.879 52.667 59.185 1.00 48.66 ? 562 VAL A C   1 
ATOM   2493 O  O   . VAL A 1 305 ? 62.118 53.473 59.734 1.00 48.62 ? 562 VAL A O   1 
ATOM   2494 C  CB  . VAL A 1 305 ? 61.917 51.602 57.114 1.00 47.73 ? 562 VAL A CB  1 
ATOM   2495 C  CG1 . VAL A 1 305 ? 63.068 52.204 56.252 1.00 45.15 ? 562 VAL A CG1 1 
ATOM   2496 C  CG2 . VAL A 1 305 ? 61.365 50.298 56.532 1.00 45.43 ? 562 VAL A CG2 1 
ATOM   2497 N  N   . VAL A 1 306 ? 64.187 52.846 59.106 1.00 49.78 ? 563 VAL A N   1 
ATOM   2498 C  CA  . VAL A 1 306 ? 64.838 54.038 59.619 1.00 50.64 ? 563 VAL A CA  1 
ATOM   2499 C  C   . VAL A 1 306 ? 64.645 55.167 58.621 1.00 51.71 ? 563 VAL A C   1 
ATOM   2500 O  O   . VAL A 1 306 ? 64.986 55.022 57.457 1.00 50.97 ? 563 VAL A O   1 
ATOM   2501 C  CB  . VAL A 1 306 ? 66.362 53.786 59.863 1.00 50.72 ? 563 VAL A CB  1 
ATOM   2502 C  CG1 . VAL A 1 306 ? 67.095 55.087 60.238 1.00 49.61 ? 563 VAL A CG1 1 
ATOM   2503 C  CG2 . VAL A 1 306 ? 66.549 52.729 60.931 1.00 48.53 ? 563 VAL A CG2 1 
ATOM   2504 N  N   . ALA A 1 307 ? 64.075 56.275 59.081 1.00 53.85 ? 564 ALA A N   1 
ATOM   2505 C  CA  . ALA A 1 307 ? 63.967 57.488 58.269 1.00 56.03 ? 564 ALA A CA  1 
ATOM   2506 C  C   . ALA A 1 307 ? 65.366 58.050 57.938 1.00 58.30 ? 564 ALA A C   1 
ATOM   2507 O  O   . ALA A 1 307 ? 66.244 58.061 58.801 1.00 58.43 ? 564 ALA A O   1 
ATOM   2508 C  CB  . ALA A 1 307 ? 63.142 58.515 58.999 1.00 55.42 ? 564 ALA A CB  1 
ATOM   2509 N  N   . HIS A 1 308 ? 65.584 58.486 56.700 1.00 61.08 ? 565 HIS A N   1 
ATOM   2510 C  CA  . HIS A 1 308 ? 66.864 59.114 56.322 1.00 63.79 ? 565 HIS A CA  1 
ATOM   2511 C  C   . HIS A 1 308 ? 66.951 60.525 56.898 1.00 65.86 ? 565 HIS A C   1 
ATOM   2512 O  O   . HIS A 1 308 ? 66.024 61.315 56.744 1.00 65.69 ? 565 HIS A O   1 
ATOM   2513 C  CB  . HIS A 1 308 ? 67.039 59.198 54.796 1.00 63.75 ? 565 HIS A CB  1 
ATOM   2514 C  CG  . HIS A 1 308 ? 67.254 57.874 54.127 1.00 65.62 ? 565 HIS A CG  1 
ATOM   2515 N  ND1 . HIS A 1 308 ? 67.675 57.763 52.815 1.00 66.77 ? 565 HIS A ND1 1 
ATOM   2516 C  CD2 . HIS A 1 308 ? 67.093 56.604 54.579 1.00 66.39 ? 565 HIS A CD2 1 
ATOM   2517 C  CE1 . HIS A 1 308 ? 67.765 56.484 52.492 1.00 66.63 ? 565 HIS A CE1 1 
ATOM   2518 N  NE2 . HIS A 1 308 ? 67.414 55.760 53.542 1.00 66.38 ? 565 HIS A NE2 1 
ATOM   2519 N  N   . HIS A 1 309 ? 68.072 60.834 57.548 1.00 69.00 ? 566 HIS A N   1 
ATOM   2520 C  CA  . HIS A 1 309 ? 68.328 62.177 58.090 1.00 71.42 ? 566 HIS A CA  1 
ATOM   2521 C  C   . HIS A 1 309 ? 69.066 63.036 57.073 1.00 72.78 ? 566 HIS A C   1 
ATOM   2522 O  O   . HIS A 1 309 ? 70.111 62.634 56.582 1.00 73.00 ? 566 HIS A O   1 
ATOM   2523 C  CB  . HIS A 1 309 ? 69.166 62.085 59.371 1.00 71.97 ? 566 HIS A CB  1 
ATOM   2524 C  CG  . HIS A 1 309 ? 69.310 63.389 60.101 1.00 74.76 ? 566 HIS A CG  1 
ATOM   2525 N  ND1 . HIS A 1 309 ? 70.395 63.679 60.901 1.00 77.99 ? 566 HIS A ND1 1 
ATOM   2526 C  CD2 . HIS A 1 309 ? 68.510 64.483 60.143 1.00 76.81 ? 566 HIS A CD2 1 
ATOM   2527 C  CE1 . HIS A 1 309 ? 70.251 64.890 61.414 1.00 78.79 ? 566 HIS A CE1 1 
ATOM   2528 N  NE2 . HIS A 1 309 ? 69.115 65.400 60.969 1.00 77.99 ? 566 HIS A NE2 1 
ATOM   2529 N  N   . HIS A 1 310 ? 68.519 64.211 56.762 1.00 74.81 ? 567 HIS A N   1 
ATOM   2530 C  CA  . HIS A 1 310 ? 69.202 65.195 55.911 1.00 76.34 ? 567 HIS A CA  1 
ATOM   2531 C  C   . HIS A 1 310 ? 69.302 66.540 56.636 1.00 76.53 ? 567 HIS A C   1 
ATOM   2532 O  O   . HIS A 1 310 ? 70.403 67.040 56.870 1.00 77.21 ? 567 HIS A O   1 
ATOM   2533 C  CB  . HIS A 1 310 ? 68.466 65.379 54.583 1.00 76.89 ? 567 HIS A CB  1 
ATOM   2534 C  CG  . HIS A 1 310 ? 68.292 64.111 53.798 1.00 79.85 ? 567 HIS A CG  1 
ATOM   2535 N  ND1 . HIS A 1 310 ? 67.053 63.551 53.549 1.00 82.02 ? 567 HIS A ND1 1 
ATOM   2536 C  CD2 . HIS A 1 310 ? 69.200 63.296 53.206 1.00 82.34 ? 567 HIS A CD2 1 
ATOM   2537 C  CE1 . HIS A 1 310 ? 67.207 62.449 52.833 1.00 83.26 ? 567 HIS A CE1 1 
ATOM   2538 N  NE2 . HIS A 1 310 ? 68.500 62.268 52.617 1.00 83.86 ? 567 HIS A NE2 1 
HETATM 2539 C  C1  . GOL B 2 .   ? 62.930 51.284 51.509 1.00 77.83 ? 1   GOL A C1  1 
HETATM 2540 O  O1  . GOL B 2 .   ? 63.365 52.354 52.324 1.00 78.61 ? 1   GOL A O1  1 
HETATM 2541 C  C2  . GOL B 2 .   ? 64.150 50.535 50.996 1.00 77.36 ? 1   GOL A C2  1 
HETATM 2542 O  O2  . GOL B 2 .   ? 64.649 51.178 49.849 1.00 78.85 ? 1   GOL A O2  1 
HETATM 2543 C  C3  . GOL B 2 .   ? 63.830 49.081 50.660 1.00 76.29 ? 1   GOL A C3  1 
HETATM 2544 O  O3  . GOL B 2 .   ? 64.503 48.164 51.505 1.00 73.28 ? 1   GOL A O3  1 
HETATM 2545 MG MG  . MG  C 3 .   ? 54.787 10.829 51.158 1.00 83.55 ? 571 MG  A MG  1 
HETATM 2546 C  C1  . PIF D 4 .   ? 54.854 9.202  57.126 1.00 69.42 ? 572 PIF A C1  1 
HETATM 2547 O  O1  . PIF D 4 .   ? 56.212 9.355  57.521 1.00 68.27 ? 572 PIF A O1  1 
HETATM 2548 P  P1  . PIF D 4 .   ? 57.010 8.770  58.791 1.00 66.40 ? 572 PIF A P1  1 
HETATM 2549 C  C2  . PIF D 4 .   ? 54.472 7.765  56.774 1.00 70.23 ? 572 PIF A C2  1 
HETATM 2550 O  O2  . PIF D 4 .   ? 55.401 7.188  55.834 1.00 68.81 ? 572 PIF A O2  1 
HETATM 2551 C  C3  . PIF D 4 .   ? 53.022 7.766  56.245 1.00 70.53 ? 572 PIF A C3  1 
HETATM 2552 O  O3  . PIF D 4 .   ? 52.647 6.446  55.850 1.00 69.16 ? 572 PIF A O3  1 
HETATM 2553 C  C4  . PIF D 4 .   ? 52.772 8.722  55.070 1.00 71.01 ? 572 PIF A C4  1 
HETATM 2554 O  O4  . PIF D 4 .   ? 51.373 8.978  54.908 1.00 72.65 ? 572 PIF A O4  1 
HETATM 2555 P  P4  . PIF D 4 .   ? 50.519 8.296  53.716 1.00 72.13 ? 572 PIF A P4  1 
HETATM 2556 C  C5  . PIF D 4 .   ? 53.369 10.105 55.227 1.00 71.35 ? 572 PIF A C5  1 
HETATM 2557 O  O5  . PIF D 4 .   ? 53.501 10.678 53.906 1.00 73.39 ? 572 PIF A O5  1 
HETATM 2558 C  C6  . PIF D 4 .   ? 54.728 10.116 55.914 1.00 70.69 ? 572 PIF A C6  1 
HETATM 2559 O  O6  . PIF D 4 .   ? 54.999 11.460 56.314 1.00 71.48 ? 572 PIF A O6  1 
HETATM 2560 C  C7  . PIF D 4 .   ? 58.497 6.516  58.648 1.00 71.68 ? 572 PIF A C7  1 
HETATM 2561 C  C8  . PIF D 4 .   ? 59.947 6.873  58.325 1.00 73.54 ? 572 PIF A C8  1 
HETATM 2562 C  C9  . PIF D 4 .   ? 60.897 6.174  59.278 1.00 75.19 ? 572 PIF A C9  1 
HETATM 2563 C  C10 . PIF D 4 .   ? 61.392 3.839  59.892 1.00 78.17 ? 572 PIF A C10 1 
HETATM 2564 C  C11 . PIF D 4 .   ? 62.452 4.104  60.945 1.00 77.81 ? 572 PIF A C11 1 
HETATM 2565 O  O11 . PIF D 4 .   ? 58.073 9.810  59.063 1.00 65.54 ? 572 PIF A O11 1 
HETATM 2566 C  C12 . PIF D 4 .   ? 63.542 3.026  61.007 1.00 77.50 ? 572 PIF A C12 1 
HETATM 2567 O  O12 . PIF D 4 .   ? 56.105 8.329  59.911 1.00 66.51 ? 572 PIF A O12 1 
HETATM 2568 C  C13 . PIF D 4 .   ? 64.259 2.989  62.362 1.00 77.53 ? 572 PIF A C13 1 
HETATM 2569 O  O13 . PIF D 4 .   ? 57.632 7.470  58.043 1.00 69.48 ? 572 PIF A O13 1 
HETATM 2570 C  C14 . PIF D 4 .   ? 65.708 3.481  62.319 1.00 77.17 ? 572 PIF A C14 1 
HETATM 2571 O  O14 . PIF D 4 .   ? 60.313 6.477  57.007 1.00 73.98 ? 572 PIF A O14 1 
HETATM 2572 C  C15 . PIF D 4 .   ? 66.201 3.861  63.720 1.00 76.64 ? 572 PIF A C15 1 
HETATM 2573 O  O15 . PIF D 4 .   ? 60.429 4.864  59.546 1.00 76.17 ? 572 PIF A O15 1 
HETATM 2574 C  C16 . PIF D 4 .   ? 67.605 4.463  63.700 1.00 76.01 ? 572 PIF A C16 1 
HETATM 2575 O  O16 . PIF D 4 .   ? 61.292 2.778  59.295 1.00 81.03 ? 572 PIF A O16 1 
HETATM 2576 C  C17 . PIF D 4 .   ? 67.791 5.524  64.765 1.00 74.70 ? 572 PIF A C17 1 
HETATM 2577 O  O17 . PIF D 4 .   ? 61.664 8.359  56.916 1.00 72.59 ? 572 PIF A O17 1 
HETATM 2578 C  C18 . PIF D 4 .   ? 61.371 7.288  56.416 1.00 73.33 ? 572 PIF A C18 1 
HETATM 2579 C  C19 . PIF D 4 .   ? 62.095 6.797  55.183 1.00 73.01 ? 572 PIF A C19 1 
HETATM 2580 C  C20 . PIF D 4 .   ? 63.571 6.555  55.510 1.00 72.64 ? 572 PIF A C20 1 
HETATM 2581 C  C21 . PIF D 4 .   ? 63.769 5.463  56.564 1.00 72.48 ? 572 PIF A C21 1 
HETATM 2582 C  C22 . PIF D 4 .   ? 65.027 4.645  56.272 1.00 72.12 ? 572 PIF A C22 1 
HETATM 2583 C  C23 . PIF D 4 .   ? 65.465 3.760  57.436 1.00 71.72 ? 572 PIF A C23 1 
HETATM 2584 C  C24 . PIF D 4 .   ? 65.290 2.275  57.139 1.00 71.51 ? 572 PIF A C24 1 
HETATM 2585 C  C25 . PIF D 4 .   ? 66.008 1.430  58.168 1.00 71.57 ? 572 PIF A C25 1 
HETATM 2586 O  O41 . PIF D 4 .   ? 50.843 6.811  53.884 1.00 69.25 ? 572 PIF A O41 1 
HETATM 2587 O  O42 . PIF D 4 .   ? 49.120 8.732  54.083 1.00 70.83 ? 572 PIF A O42 1 
HETATM 2588 O  O43 . PIF D 4 .   ? 51.050 8.956  52.463 1.00 70.45 ? 572 PIF A O43 1 
HETATM 2589 S  S   . SO4 E 5 .   ? 65.582 3.418  50.556 1.00 79.35 ? 573 SO4 A S   1 
HETATM 2590 O  O1  . SO4 E 5 .   ? 66.116 2.316  49.772 1.00 80.50 ? 573 SO4 A O1  1 
HETATM 2591 O  O2  . SO4 E 5 .   ? 64.576 4.146  49.774 1.00 80.54 ? 573 SO4 A O2  1 
HETATM 2592 O  O3  . SO4 E 5 .   ? 64.936 2.873  51.758 1.00 78.94 ? 573 SO4 A O3  1 
HETATM 2593 O  O4  . SO4 E 5 .   ? 66.698 4.306  50.844 1.00 76.90 ? 573 SO4 A O4  1 
HETATM 2594 C  C1  . GOL F 2 .   ? 58.910 7.526  66.509 1.00 89.47 ? 574 GOL A C1  1 
HETATM 2595 O  O1  . GOL F 2 .   ? 57.787 8.058  65.868 1.00 89.09 ? 574 GOL A O1  1 
HETATM 2596 C  C2  . GOL F 2 .   ? 58.468 6.857  67.795 1.00 90.62 ? 574 GOL A C2  1 
HETATM 2597 O  O2  . GOL F 2 .   ? 58.193 7.884  68.718 1.00 91.56 ? 574 GOL A O2  1 
HETATM 2598 C  C3  . GOL F 2 .   ? 59.542 5.938  68.376 1.00 91.10 ? 574 GOL A C3  1 
HETATM 2599 O  O3  . GOL F 2 .   ? 60.196 5.212  67.363 1.00 91.17 ? 574 GOL A O3  1 
HETATM 2600 CL CL  . CL  G 6 .   ? 47.301 26.338 39.805 1.00 86.73 ? 575 CL  A CL  1 
HETATM 2601 O  O   . HOH H 7 .   ? 63.215 10.372 47.546 1.00 45.57 ? 2   HOH A O   1 
HETATM 2602 O  O   . HOH H 7 .   ? 59.913 15.869 55.529 1.00 44.40 ? 3   HOH A O   1 
HETATM 2603 O  O   . HOH H 7 .   ? 44.531 39.422 57.381 1.00 52.04 ? 4   HOH A O   1 
HETATM 2604 O  O   . HOH H 7 .   ? 42.608 18.529 57.600 1.00 42.67 ? 5   HOH A O   1 
HETATM 2605 O  O   . HOH H 7 .   ? 38.785 27.766 57.284 1.00 49.96 ? 6   HOH A O   1 
HETATM 2606 O  O   . HOH H 7 .   ? 70.192 14.423 54.842 1.00 45.45 ? 7   HOH A O   1 
HETATM 2607 O  O   . HOH H 7 .   ? 55.096 43.024 39.740 1.00 49.62 ? 8   HOH A O   1 
HETATM 2608 O  O   . HOH H 7 .   ? 53.217 21.424 52.336 1.00 39.21 ? 9   HOH A O   1 
HETATM 2609 O  O   . HOH H 7 .   ? 60.640 26.279 38.105 1.00 47.72 ? 10  HOH A O   1 
HETATM 2610 O  O   . HOH H 7 .   ? 46.497 31.151 56.323 1.00 47.01 ? 11  HOH A O   1 
HETATM 2611 O  O   . HOH H 7 .   ? 67.749 18.872 64.281 1.00 53.26 ? 12  HOH A O   1 
HETATM 2612 O  O   . HOH H 7 .   ? 72.315 19.093 46.268 1.00 49.91 ? 13  HOH A O   1 
HETATM 2613 O  O   . HOH H 7 .   ? 47.468 20.207 58.764 1.00 44.51 ? 14  HOH A O   1 
HETATM 2614 O  O   . HOH H 7 .   ? 43.254 11.853 56.153 1.00 49.70 ? 15  HOH A O   1 
HETATM 2615 O  O   . HOH H 7 .   ? 66.127 51.009 57.898 1.00 48.21 ? 16  HOH A O   1 
HETATM 2616 O  O   . HOH H 7 .   ? 43.940 21.699 46.890 1.00 52.47 ? 17  HOH A O   1 
HETATM 2617 O  O   . HOH H 7 .   ? 48.651 42.154 62.455 1.00 47.80 ? 18  HOH A O   1 
HETATM 2618 O  O   . HOH H 7 .   ? 61.907 28.341 69.892 1.00 52.86 ? 19  HOH A O   1 
HETATM 2619 O  O   . HOH H 7 .   ? 64.826 10.351 54.155 1.00 43.60 ? 20  HOH A O   1 
HETATM 2620 O  O   . HOH H 7 .   ? 77.024 13.865 52.812 1.00 53.28 ? 21  HOH A O   1 
HETATM 2621 O  O   . HOH H 7 .   ? 40.340 24.244 45.126 1.00 54.66 ? 22  HOH A O   1 
HETATM 2622 O  O   . HOH H 7 .   ? 42.992 25.526 44.696 1.00 52.15 ? 23  HOH A O   1 
HETATM 2623 O  O   . HOH H 7 .   ? 51.036 14.349 54.826 1.00 62.16 ? 24  HOH A O   1 
HETATM 2624 O  O   . HOH H 7 .   ? 47.284 39.746 62.418 1.00 53.99 ? 25  HOH A O   1 
HETATM 2625 O  O   . HOH H 7 .   ? 52.066 20.486 50.069 1.00 45.55 ? 26  HOH A O   1 
HETATM 2626 O  O   . HOH H 7 .   ? 57.991 48.695 50.182 1.00 56.81 ? 27  HOH A O   1 
HETATM 2627 O  O   . HOH H 7 .   ? 54.568 42.184 66.557 1.00 51.96 ? 28  HOH A O   1 
HETATM 2628 O  O   . HOH H 7 .   ? 45.581 28.743 42.751 1.00 72.37 ? 29  HOH A O   1 
HETATM 2629 O  O   . HOH H 7 .   ? 69.993 16.406 57.186 1.00 52.74 ? 30  HOH A O   1 
HETATM 2630 O  O   . HOH H 7 .   ? 56.788 24.539 73.984 1.00 53.89 ? 31  HOH A O   1 
HETATM 2631 O  O   . HOH H 7 .   ? 51.927 18.084 43.294 1.00 48.50 ? 32  HOH A O   1 
HETATM 2632 O  O   . HOH H 7 .   ? 58.248 20.227 39.799 1.00 51.73 ? 33  HOH A O   1 
HETATM 2633 O  O   . HOH H 7 .   ? 48.136 32.664 47.466 1.00 60.03 ? 34  HOH A O   1 
HETATM 2634 O  O   . HOH H 7 .   ? 55.434 35.710 69.987 1.00 71.20 ? 35  HOH A O   1 
HETATM 2635 O  O   . HOH H 7 .   ? 74.436 35.966 61.217 1.00 68.95 ? 36  HOH A O   1 
HETATM 2636 O  O   . HOH H 7 .   ? 75.482 16.002 58.048 1.00 52.71 ? 37  HOH A O   1 
HETATM 2637 O  O   . HOH H 7 .   ? 41.343 28.289 58.714 1.00 52.19 ? 38  HOH A O   1 
HETATM 2638 O  O   . HOH H 7 .   ? 67.764 13.384 42.347 1.00 60.90 ? 39  HOH A O   1 
HETATM 2639 O  O   . HOH H 7 .   ? 41.265 13.583 56.701 1.00 48.47 ? 40  HOH A O   1 
HETATM 2640 O  O   . HOH H 7 .   ? 50.119 47.275 64.908 1.00 62.54 ? 41  HOH A O   1 
HETATM 2641 O  O   . HOH H 7 .   ? 70.590 45.789 48.534 1.00 56.29 ? 42  HOH A O   1 
HETATM 2642 O  O   . HOH H 7 .   ? 64.907 37.973 37.407 1.00 65.83 ? 43  HOH A O   1 
HETATM 2643 O  O   . HOH H 7 .   ? 45.919 22.020 53.044 1.00 46.88 ? 44  HOH A O   1 
HETATM 2644 O  O   . HOH H 7 .   ? 71.193 22.847 55.939 1.00 48.47 ? 45  HOH A O   1 
HETATM 2645 O  O   . HOH H 7 .   ? 65.835 44.648 43.389 1.00 57.37 ? 46  HOH A O   1 
HETATM 2646 O  O   . HOH H 7 .   ? 56.146 10.682 63.828 1.00 47.36 ? 47  HOH A O   1 
HETATM 2647 O  O   . HOH H 7 .   ? 69.270 39.073 67.102 1.00 70.89 ? 48  HOH A O   1 
HETATM 2648 O  O   . HOH H 7 .   ? 45.527 28.224 70.261 1.00 69.88 ? 49  HOH A O   1 
HETATM 2649 O  O   . HOH H 7 .   ? 72.652 29.970 62.376 1.00 60.97 ? 50  HOH A O   1 
HETATM 2650 O  O   . HOH H 7 .   ? 63.570 36.353 39.071 1.00 49.91 ? 51  HOH A O   1 
HETATM 2651 O  O   . HOH H 7 .   ? 43.186 28.150 45.703 1.00 55.26 ? 52  HOH A O   1 
HETATM 2652 O  O   . HOH H 7 .   ? 40.518 27.559 65.784 1.00 62.18 ? 53  HOH A O   1 
HETATM 2653 O  O   . HOH H 7 .   ? 60.346 32.767 36.622 1.00 51.74 ? 54  HOH A O   1 
HETATM 2654 O  O   . HOH H 7 .   ? 59.228 48.950 48.330 1.00 68.18 ? 55  HOH A O   1 
HETATM 2655 O  O   . HOH H 7 .   ? 45.143 20.476 37.751 1.00 75.20 ? 56  HOH A O   1 
HETATM 2656 O  O   . HOH H 7 .   ? 49.307 40.298 43.436 1.00 50.62 ? 57  HOH A O   1 
HETATM 2657 O  O   . HOH H 7 .   ? 66.637 14.623 38.126 1.00 79.90 ? 58  HOH A O   1 
HETATM 2658 O  O   . HOH H 7 .   ? 61.043 33.563 34.387 1.00 63.08 ? 59  HOH A O   1 
HETATM 2659 O  O   . HOH H 7 .   ? 49.501 8.939  45.951 1.00 66.29 ? 60  HOH A O   1 
HETATM 2660 O  O   . HOH H 7 .   ? 48.883 38.444 65.042 1.00 58.98 ? 61  HOH A O   1 
HETATM 2661 O  O   . HOH H 7 .   ? 41.897 29.961 51.376 1.00 53.98 ? 62  HOH A O   1 
HETATM 2662 O  O   . HOH H 7 .   ? 73.041 16.629 54.924 1.00 50.97 ? 63  HOH A O   1 
HETATM 2663 O  O   . HOH H 7 .   ? 64.335 38.944 67.992 1.00 52.18 ? 64  HOH A O   1 
HETATM 2664 O  O   . HOH H 7 .   ? 35.528 14.988 46.074 1.00 56.45 ? 65  HOH A O   1 
HETATM 2665 O  O   . HOH H 7 .   ? 45.228 31.041 69.961 1.00 72.56 ? 66  HOH A O   1 
HETATM 2666 O  O   . HOH H 7 .   ? 39.356 28.863 62.795 1.00 78.15 ? 67  HOH A O   1 
HETATM 2667 O  O   . HOH H 7 .   ? 61.181 47.621 65.933 1.00 66.35 ? 68  HOH A O   1 
HETATM 2668 O  O   . HOH H 7 .   ? 66.463 11.162 60.245 1.00 45.25 ? 69  HOH A O   1 
HETATM 2669 O  O   . HOH H 7 .   ? 63.140 10.424 56.360 1.00 49.73 ? 70  HOH A O   1 
HETATM 2670 O  O   . HOH H 7 .   ? 62.160 14.789 56.587 1.00 43.20 ? 71  HOH A O   1 
HETATM 2671 O  O   . HOH H 7 .   ? 56.743 13.134 64.694 1.00 57.00 ? 72  HOH A O   1 
HETATM 2672 O  O   . HOH H 7 .   ? 54.670 10.283 61.613 1.00 50.94 ? 73  HOH A O   1 
HETATM 2673 O  O   . HOH H 7 .   ? 48.294 9.054  56.554 1.00 64.91 ? 74  HOH A O   1 
HETATM 2674 O  O   . HOH H 7 .   ? 53.127 4.360  57.297 1.00 77.47 ? 75  HOH A O   1 
HETATM 2675 O  O   . HOH H 7 .   ? 51.942 12.415 52.288 1.00 66.88 ? 76  HOH A O   1 
HETATM 2676 O  O   . HOH H 7 .   ? 53.965 12.929 50.279 1.00 56.00 ? 77  HOH A O   1 
HETATM 2677 O  O   . HOH H 7 .   ? 52.887 9.728  50.526 1.00 60.94 ? 78  HOH A O   1 
HETATM 2678 O  O   . HOH H 7 .   ? 55.967 9.160  52.046 1.00 76.16 ? 79  HOH A O   1 
HETATM 2679 O  O   . HOH H 7 .   ? 49.393 10.533 69.212 1.00 55.60 ? 80  HOH A O   1 
HETATM 2680 O  O   . HOH H 7 .   ? 46.767 11.156 69.320 1.00 67.12 ? 81  HOH A O   1 
HETATM 2681 O  O   . HOH H 7 .   ? 51.195 10.675 71.181 1.00 60.86 ? 82  HOH A O   1 
HETATM 2682 O  O   . HOH H 7 .   ? 52.999 8.673  67.586 1.00 66.09 ? 83  HOH A O   1 
HETATM 2683 O  O   . HOH H 7 .   ? 53.846 9.303  69.801 1.00 64.28 ? 84  HOH A O   1 
HETATM 2684 O  O   . HOH H 7 .   ? 54.355 9.073  65.307 1.00 54.20 ? 85  HOH A O   1 
HETATM 2685 O  O   . HOH H 7 .   ? 52.643 9.025  62.964 1.00 58.92 ? 86  HOH A O   1 
HETATM 2686 O  O   . HOH H 7 .   ? 57.482 7.136  62.210 1.00 63.90 ? 87  HOH A O   1 
HETATM 2687 O  O   . HOH H 7 .   ? 58.804 14.596 73.431 1.00 67.55 ? 88  HOH A O   1 
HETATM 2688 O  O   . HOH H 7 .   ? 57.560 15.147 69.616 1.00 55.29 ? 89  HOH A O   1 
HETATM 2689 O  O   . HOH H 7 .   ? 41.263 17.042 67.058 1.00 72.04 ? 90  HOH A O   1 
HETATM 2690 O  O   . HOH H 7 .   ? 58.712 20.479 74.672 1.00 64.51 ? 91  HOH A O   1 
HETATM 2691 O  O   . HOH H 7 .   ? 58.305 26.729 74.491 1.00 59.65 ? 92  HOH A O   1 
HETATM 2692 O  O   . HOH H 7 .   ? 68.322 19.748 67.155 1.00 70.94 ? 93  HOH A O   1 
HETATM 2693 O  O   . HOH H 7 .   ? 66.906 16.233 66.854 1.00 53.26 ? 94  HOH A O   1 
HETATM 2694 O  O   . HOH H 7 .   ? 70.246 23.346 64.650 1.00 61.06 ? 95  HOH A O   1 
HETATM 2695 O  O   . HOH H 7 .   ? 71.375 21.316 63.823 1.00 81.23 ? 96  HOH A O   1 
HETATM 2696 O  O   . HOH H 7 .   ? 71.828 18.771 64.775 1.00 58.95 ? 97  HOH A O   1 
HETATM 2697 O  O   . HOH H 7 .   ? 71.518 30.247 65.478 1.00 62.94 ? 98  HOH A O   1 
HETATM 2698 O  O   . HOH H 7 .   ? 68.368 24.941 68.224 1.00 65.50 ? 99  HOH A O   1 
HETATM 2699 O  O   . HOH H 7 .   ? 72.418 25.044 61.123 1.00 68.52 ? 100 HOH A O   1 
HETATM 2700 O  O   . HOH H 7 .   ? 70.256 36.635 66.185 1.00 53.73 ? 102 HOH A O   1 
HETATM 2701 O  O   . HOH H 7 .   ? 72.626 36.807 64.935 1.00 58.26 ? 103 HOH A O   1 
HETATM 2702 O  O   . HOH H 7 .   ? 74.436 40.522 60.518 1.00 54.79 ? 104 HOH A O   1 
HETATM 2703 O  O   . HOH H 7 .   ? 73.448 37.894 58.620 1.00 50.86 ? 105 HOH A O   1 
HETATM 2704 O  O   . HOH H 7 .   ? 68.643 44.683 59.301 1.00 51.16 ? 106 HOH A O   1 
HETATM 2705 O  O   . HOH H 7 .   ? 67.772 49.485 59.705 1.00 54.71 ? 107 HOH A O   1 
HETATM 2706 O  O   . HOH H 7 .   ? 66.676 53.117 56.276 1.00 57.55 ? 108 HOH A O   1 
HETATM 2707 O  O   . HOH H 7 .   ? 66.149 53.045 53.391 1.00 76.63 ? 109 HOH A O   1 
HETATM 2708 O  O   . HOH H 7 .   ? 58.953 35.082 73.993 1.00 74.56 ? 110 HOH A O   1 
HETATM 2709 O  O   . HOH H 7 .   ? 63.080 41.379 68.295 1.00 58.41 ? 111 HOH A O   1 
HETATM 2710 O  O   . HOH H 7 .   ? 65.228 44.249 65.396 1.00 85.21 ? 112 HOH A O   1 
HETATM 2711 O  O   . HOH H 7 .   ? 62.801 44.132 66.590 1.00 64.48 ? 113 HOH A O   1 
HETATM 2712 O  O   . HOH H 7 .   ? 72.054 44.884 62.419 1.00 67.22 ? 114 HOH A O   1 
HETATM 2713 O  O   . HOH H 7 .   ? 59.191 45.589 64.189 1.00 66.38 ? 115 HOH A O   1 
HETATM 2714 O  O   . HOH H 7 .   ? 56.625 45.932 64.765 1.00 67.64 ? 116 HOH A O   1 
HETATM 2715 O  O   . HOH H 7 .   ? 55.873 48.502 65.382 1.00 63.25 ? 117 HOH A O   1 
HETATM 2716 O  O   . HOH H 7 .   ? 56.054 44.311 66.768 1.00 71.43 ? 118 HOH A O   1 
HETATM 2717 O  O   . HOH H 7 .   ? 55.019 37.555 66.785 1.00 60.68 ? 119 HOH A O   1 
HETATM 2718 O  O   . HOH H 7 .   ? 60.794 40.421 69.993 1.00 72.58 ? 120 HOH A O   1 
HETATM 2719 O  O   . HOH H 7 .   ? 58.260 39.785 70.465 1.00 92.18 ? 121 HOH A O   1 
HETATM 2720 O  O   . HOH H 7 .   ? 55.469 45.104 62.372 1.00 64.23 ? 122 HOH A O   1 
HETATM 2721 O  O   . HOH H 7 .   ? 45.288 8.231  58.650 1.00 62.55 ? 123 HOH A O   1 
HETATM 2722 O  O   . HOH H 7 .   ? 44.823 5.965  59.834 1.00 76.78 ? 124 HOH A O   1 
HETATM 2723 O  O   . HOH H 7 .   ? 41.098 8.234  48.532 1.00 62.81 ? 125 HOH A O   1 
HETATM 2724 O  O   . HOH H 7 .   ? 42.619 11.719 49.372 1.00 52.97 ? 126 HOH A O   1 
HETATM 2725 O  O   . HOH H 7 .   ? 37.620 8.928  45.151 1.00 71.68 ? 127 HOH A O   1 
HETATM 2726 O  O   . HOH H 7 .   ? 39.582 8.993  43.281 1.00 58.70 ? 128 HOH A O   1 
HETATM 2727 O  O   . HOH H 7 .   ? 38.835 11.492 42.300 1.00 69.97 ? 129 HOH A O   1 
HETATM 2728 O  O   . HOH H 7 .   ? 39.362 16.635 42.884 1.00 64.36 ? 130 HOH A O   1 
HETATM 2729 O  O   . HOH H 7 .   ? 43.578 14.600 36.621 1.00 60.16 ? 131 HOH A O   1 
HETATM 2730 O  O   . HOH H 7 .   ? 48.885 15.856 42.203 1.00 58.52 ? 132 HOH A O   1 
HETATM 2731 O  O   . HOH H 7 .   ? 47.841 6.950  45.471 1.00 61.84 ? 133 HOH A O   1 
HETATM 2732 O  O   . HOH H 7 .   ? 50.463 7.397  42.220 1.00 80.63 ? 134 HOH A O   1 
HETATM 2733 O  O   . HOH H 7 .   ? 47.356 4.024  42.437 1.00 76.43 ? 135 HOH A O   1 
HETATM 2734 O  O   . HOH H 7 .   ? 39.296 11.931 57.840 1.00 52.81 ? 136 HOH A O   1 
HETATM 2735 O  O   . HOH H 7 .   ? 34.906 12.829 44.558 1.00 66.52 ? 138 HOH A O   1 
HETATM 2736 O  O   . HOH H 7 .   ? 29.355 21.853 43.295 1.00 76.65 ? 139 HOH A O   1 
HETATM 2737 O  O   . HOH H 7 .   ? 36.663 26.577 55.468 1.00 52.87 ? 140 HOH A O   1 
HETATM 2738 O  O   . HOH H 7 .   ? 35.436 28.465 53.124 1.00 68.40 ? 141 HOH A O   1 
HETATM 2739 O  O   . HOH H 7 .   ? 34.606 33.149 52.279 1.00 75.62 ? 142 HOH A O   1 
HETATM 2740 O  O   . HOH H 7 .   ? 37.850 35.165 54.804 1.00 64.21 ? 143 HOH A O   1 
HETATM 2741 O  O   . HOH H 7 .   ? 40.620 30.103 60.457 1.00 61.96 ? 144 HOH A O   1 
HETATM 2742 O  O   . HOH H 7 .   ? 42.341 28.614 63.982 1.00 68.95 ? 145 HOH A O   1 
HETATM 2743 O  O   . HOH H 7 .   ? 42.859 31.483 63.379 1.00 61.35 ? 146 HOH A O   1 
HETATM 2744 O  O   . HOH H 7 .   ? 47.762 36.080 65.424 1.00 47.89 ? 147 HOH A O   1 
HETATM 2745 O  O   . HOH H 7 .   ? 48.762 40.966 66.758 1.00 75.94 ? 148 HOH A O   1 
HETATM 2746 O  O   . HOH H 7 .   ? 46.699 43.938 60.677 1.00 55.15 ? 149 HOH A O   1 
HETATM 2747 O  O   . HOH H 7 .   ? 50.349 45.264 56.817 1.00 56.50 ? 150 HOH A O   1 
HETATM 2748 O  O   . HOH H 7 .   ? 52.561 41.379 37.670 1.00 72.39 ? 151 HOH A O   1 
HETATM 2749 O  O   . HOH H 7 .   ? 43.043 33.786 48.412 1.00 53.86 ? 152 HOH A O   1 
HETATM 2750 O  O   . HOH H 7 .   ? 41.209 33.250 53.061 1.00 66.73 ? 153 HOH A O   1 
HETATM 2751 O  O   . HOH H 7 .   ? 44.275 25.620 42.386 1.00 51.38 ? 154 HOH A O   1 
HETATM 2752 O  O   . HOH H 7 .   ? 55.830 20.227 41.000 1.00 54.15 ? 155 HOH A O   1 
HETATM 2753 O  O   . HOH H 7 .   ? 51.987 32.422 42.759 1.00 49.00 ? 156 HOH A O   1 
HETATM 2754 O  O   . HOH H 7 .   ? 53.290 46.345 50.022 1.00 65.34 ? 157 HOH A O   1 
HETATM 2755 O  O   . HOH H 7 .   ? 47.805 46.222 52.942 1.00 68.31 ? 158 HOH A O   1 
HETATM 2756 O  O   . HOH H 7 .   ? 55.674 54.691 63.664 1.00 53.49 ? 159 HOH A O   1 
HETATM 2757 O  O   . HOH H 7 .   ? 66.438 58.456 61.566 1.00 62.98 ? 160 HOH A O   1 
HETATM 2758 O  O   . HOH H 7 .   ? 72.488 29.268 52.846 1.00 45.04 ? 161 HOH A O   1 
HETATM 2759 O  O   . HOH H 7 .   ? 56.120 40.506 34.780 1.00 53.82 ? 162 HOH A O   1 
HETATM 2760 O  O   . HOH H 7 .   ? 59.843 40.736 33.863 1.00 57.83 ? 163 HOH A O   1 
HETATM 2761 O  O   . HOH H 7 .   ? 59.331 38.705 31.985 1.00 58.75 ? 164 HOH A O   1 
HETATM 2762 O  O   . HOH H 7 .   ? 58.740 33.661 32.449 1.00 77.01 ? 165 HOH A O   1 
HETATM 2763 O  O   . HOH H 7 .   ? 65.100 32.984 36.143 1.00 61.26 ? 166 HOH A O   1 
HETATM 2764 O  O   . HOH H 7 .   ? 63.369 34.211 38.111 1.00 74.63 ? 167 HOH A O   1 
HETATM 2765 O  O   . HOH H 7 .   ? 65.807 36.334 40.412 1.00 48.22 ? 168 HOH A O   1 
HETATM 2766 O  O   . HOH H 7 .   ? 66.228 33.757 40.852 1.00 59.57 ? 169 HOH A O   1 
HETATM 2767 O  O   . HOH H 7 .   ? 67.855 33.770 42.932 1.00 61.86 ? 170 HOH A O   1 
HETATM 2768 O  O   . HOH H 7 .   ? 71.783 35.162 45.227 1.00 63.73 ? 171 HOH A O   1 
HETATM 2769 O  O   . HOH H 7 .   ? 61.348 12.294 55.769 1.00 49.71 ? 172 HOH A O   1 
HETATM 2770 O  O   . HOH H 7 .   ? 58.837 11.251 55.855 1.00 65.78 ? 173 HOH A O   1 
HETATM 2771 O  O   . HOH H 7 .   ? 57.529 8.677  54.386 1.00 73.89 ? 174 HOH A O   1 
HETATM 2772 O  O   . HOH H 7 .   ? 49.800 39.082 45.391 1.00 67.48 ? 175 HOH A O   1 
HETATM 2773 O  O   . HOH H 7 .   ? 52.469 39.792 45.437 1.00 72.05 ? 176 HOH A O   1 
HETATM 2774 O  O   . HOH H 7 .   ? 62.008 22.054 37.091 1.00 69.35 ? 177 HOH A O   1 
HETATM 2775 O  O   . HOH H 7 .   ? 55.739 22.596 33.617 1.00 67.53 ? 178 HOH A O   1 
HETATM 2776 O  O   . HOH H 7 .   ? 59.864 28.837 33.562 1.00 76.13 ? 179 HOH A O   1 
HETATM 2777 O  O   . HOH H 7 .   ? 72.824 18.400 50.353 1.00 56.02 ? 180 HOH A O   1 
HETATM 2778 O  O   . HOH H 7 .   ? 69.384 47.327 58.199 1.00 65.79 ? 181 HOH A O   1 
HETATM 2779 O  O   . HOH H 7 .   ? 61.210 11.705 40.927 1.00 59.88 ? 182 HOH A O   1 
HETATM 2780 O  O   . HOH H 7 .   ? 51.688 28.229 70.974 1.00 61.03 ? 183 HOH A O   1 
HETATM 2781 O  O   . HOH H 7 .   ? 63.776 44.748 42.007 1.00 72.36 ? 184 HOH A O   1 
HETATM 2782 O  O   . HOH H 7 .   ? 76.991 16.887 56.093 1.00 66.55 ? 185 HOH A O   1 
HETATM 2783 O  O   . HOH H 7 .   ? 69.882 10.661 48.699 1.00 48.17 ? 186 HOH A O   1 
HETATM 2784 O  O   . HOH H 7 .   ? 70.044 8.041  48.330 1.00 49.49 ? 187 HOH A O   1 
HETATM 2785 O  O   . HOH H 7 .   ? 71.721 11.308 50.428 1.00 60.64 ? 188 HOH A O   1 
HETATM 2786 O  O   . HOH H 7 .   ? 72.084 21.477 53.938 1.00 51.69 ? 189 HOH A O   1 
HETATM 2787 O  O   . HOH H 7 .   ? 72.203 21.973 58.252 1.00 55.65 ? 190 HOH A O   1 
HETATM 2788 O  O   . HOH H 7 .   ? 63.319 5.904  48.230 1.00 73.20 ? 191 HOH A O   1 
HETATM 2789 O  O   . HOH H 7 .   ? 58.484 9.207  63.614 1.00 49.74 ? 192 HOH A O   1 
HETATM 2790 O  O   . HOH H 7 .   ? 70.678 16.048 40.279 1.00 55.56 ? 193 HOH A O   1 
HETATM 2791 O  O   . HOH H 7 .   ? 71.416 18.083 42.299 1.00 65.27 ? 194 HOH A O   1 
HETATM 2792 O  O   . HOH H 7 .   ? 73.983 18.461 43.909 1.00 68.58 ? 195 HOH A O   1 
HETATM 2793 O  O   . HOH H 7 .   ? 62.220 13.272 53.537 1.00 53.90 ? 196 HOH A O   1 
HETATM 2794 O  O   . HOH H 7 .   ? 74.143 4.403  49.385 1.00 53.60 ? 197 HOH A O   1 
HETATM 2795 O  O   . HOH H 7 .   ? 46.018 31.261 74.655 1.00 72.80 ? 198 HOH A O   1 
HETATM 2796 O  O   . HOH H 7 .   ? 37.410 10.189 56.622 1.00 66.24 ? 199 HOH A O   1 
HETATM 2797 O  O   . HOH H 7 .   ? 54.906 42.567 35.895 1.00 57.22 ? 200 HOH A O   1 
HETATM 2798 O  O   . HOH H 7 .   ? 59.068 29.794 71.062 1.00 56.99 ? 201 HOH A O   1 
HETATM 2799 O  O   . HOH H 7 .   ? 66.167 21.785 39.083 1.00 58.37 ? 202 HOH A O   1 
HETATM 2800 O  O   . HOH H 7 .   ? 67.228 41.048 65.574 1.00 62.91 ? 203 HOH A O   1 
HETATM 2801 O  O   . HOH H 7 .   ? 56.136 12.701 39.975 1.00 65.35 ? 204 HOH A O   1 
HETATM 2802 O  O   . HOH H 7 .   ? 67.466 11.201 46.328 1.00 68.57 ? 205 HOH A O   1 
HETATM 2803 O  O   . HOH H 7 .   ? 52.691 12.472 72.124 1.00 62.64 ? 206 HOH A O   1 
HETATM 2804 O  O   . HOH H 7 .   ? 48.185 5.505  63.789 1.00 78.50 ? 207 HOH A O   1 
HETATM 2805 O  O   . HOH H 7 .   ? 74.111 9.985  49.732 1.00 59.96 ? 208 HOH A O   1 
HETATM 2806 O  O   . HOH H 7 .   ? 54.641 51.218 52.826 1.00 51.69 ? 209 HOH A O   1 
HETATM 2807 O  O   . HOH H 7 .   ? 61.092 15.873 70.472 1.00 61.43 ? 210 HOH A O   1 
HETATM 2808 O  O   . HOH H 7 .   ? 54.573 32.051 69.717 1.00 68.19 ? 211 HOH A O   1 
HETATM 2809 O  O   . HOH H 7 .   ? 55.530 29.850 68.907 1.00 64.71 ? 212 HOH A O   1 
HETATM 2810 O  O   . HOH H 7 .   ? 56.314 29.084 71.630 1.00 73.82 ? 213 HOH A O   1 
HETATM 2811 O  O   . HOH H 7 .   ? 31.672 26.611 52.814 1.00 70.24 ? 214 HOH A O   1 
HETATM 2812 O  O   . HOH H 7 .   ? 31.475 10.684 48.300 1.00 69.26 ? 215 HOH A O   1 
HETATM 2813 O  O   . HOH H 7 .   ? 61.182 20.754 35.060 1.00 89.39 ? 216 HOH A O   1 
HETATM 2814 O  O   . HOH H 7 .   ? 41.977 13.476 37.627 1.00 76.05 ? 217 HOH A O   1 
HETATM 2815 O  O   . HOH H 7 .   ? 73.737 32.358 59.303 1.00 67.79 ? 218 HOH A O   1 
HETATM 2816 O  O   . HOH H 7 .   ? 41.971 7.664  55.690 1.00 62.72 ? 219 HOH A O   1 
HETATM 2817 O  O   . HOH H 7 .   ? 43.521 9.104  56.928 1.00 75.00 ? 220 HOH A O   1 
HETATM 2818 O  O   . HOH H 7 .   ? 61.910 44.684 40.222 1.00 69.49 ? 221 HOH A O   1 
HETATM 2819 O  O   . HOH H 7 .   ? 68.472 22.499 67.645 1.00 73.66 ? 222 HOH A O   1 
HETATM 2820 O  O   . HOH H 7 .   ? 42.797 26.740 61.806 1.00 58.55 ? 223 HOH A O   1 
HETATM 2821 O  O   . HOH H 7 .   ? 72.482 38.508 44.538 1.00 71.80 ? 224 HOH A O   1 
HETATM 2822 O  O   . HOH H 7 .   ? 73.408 33.375 71.730 1.00 79.87 ? 225 HOH A O   1 
HETATM 2823 O  O   . HOH H 7 .   ? 59.341 44.793 41.213 1.00 61.57 ? 226 HOH A O   1 
HETATM 2824 O  O   . HOH H 7 .   ? 52.318 13.886 74.284 1.00 68.21 ? 227 HOH A O   1 
HETATM 2825 O  O   . HOH H 7 .   ? 37.358 10.695 60.053 1.00 69.11 ? 228 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   258 258 MET MET A . n 
A 1 2   TYR 2   259 259 TYR TYR A . n 
A 1 3   THR 3   260 260 THR THR A . n 
A 1 4   TYR 4   261 261 TYR TYR A . n 
A 1 5   ILE 5   262 262 ILE ILE A . n 
A 1 6   GLN 6   263 263 GLN GLN A . n 
A 1 7   ASN 7   264 264 ASN ASN A . n 
A 1 8   PHE 8   265 265 PHE PHE A . n 
A 1 9   ARG 9   266 266 ARG ARG A . n 
A 1 10  PHE 10  267 267 PHE PHE A . n 
A 1 11  PHE 11  268 268 PHE PHE A . n 
A 1 12  ALA 12  269 269 ALA ALA A . n 
A 1 13  GLY 13  270 270 GLY GLY A . n 
A 1 14  THR 14  271 271 THR THR A . n 
A 1 15  TYR 15  272 272 TYR TYR A . n 
A 1 16  ASN 16  273 273 ASN ASN A . n 
A 1 17  VAL 17  274 274 VAL VAL A . n 
A 1 18  ASN 18  275 275 ASN ASN A . n 
A 1 19  GLY 19  276 276 GLY GLY A . n 
A 1 20  GLN 20  277 277 GLN GLN A . n 
A 1 21  SER 21  278 278 SER SER A . n 
A 1 22  PRO 22  279 279 PRO PRO A . n 
A 1 23  LYS 23  280 280 LYS LYS A . n 
A 1 24  GLU 24  281 281 GLU GLU A . n 
A 1 25  CYS 25  282 282 CYS CYS A . n 
A 1 26  LEU 26  283 283 LEU LEU A . n 
A 1 27  ARG 27  284 284 ARG ARG A . n 
A 1 28  LEU 28  285 285 LEU LEU A . n 
A 1 29  TRP 29  286 286 TRP TRP A . n 
A 1 30  LEU 30  287 287 LEU LEU A . n 
A 1 31  SER 31  288 288 SER SER A . n 
A 1 32  ASN 32  289 289 ASN ASN A . n 
A 1 33  GLY 33  290 290 GLY GLY A . n 
A 1 34  ILE 34  291 291 ILE ILE A . n 
A 1 35  GLN 35  292 292 GLN GLN A . n 
A 1 36  ALA 36  293 293 ALA ALA A . n 
A 1 37  PRO 37  294 294 PRO PRO A . n 
A 1 38  ASP 38  295 295 ASP ASP A . n 
A 1 39  VAL 39  296 296 VAL VAL A . n 
A 1 40  TYR 40  297 297 TYR TYR A . n 
A 1 41  CYS 41  298 298 CYS CYS A . n 
A 1 42  VAL 42  299 299 VAL VAL A . n 
A 1 43  GLY 43  300 300 GLY GLY A . n 
A 1 44  PHE 44  301 301 PHE PHE A . n 
A 1 45  GLN 45  302 302 GLN GLN A . n 
A 1 46  GLU 46  303 303 GLU GLU A . n 
A 1 47  LEU 47  304 304 LEU LEU A . n 
A 1 48  ASP 48  305 305 ASP ASP A . n 
A 1 49  LEU 49  306 306 LEU LEU A . n 
A 1 50  SER 50  307 307 SER SER A . n 
A 1 51  LYS 51  308 308 LYS LYS A . n 
A 1 52  GLU 52  309 309 GLU GLU A . n 
A 1 53  ALA 53  310 310 ALA ALA A . n 
A 1 54  PHE 54  311 311 PHE PHE A . n 
A 1 55  PHE 55  312 312 PHE PHE A . n 
A 1 56  PHE 56  313 313 PHE PHE A . n 
A 1 57  HIS 57  314 314 HIS HIS A . n 
A 1 58  ASP 58  315 315 ASP ASP A . n 
A 1 59  THR 59  316 316 THR THR A . n 
A 1 60  PRO 60  317 317 PRO PRO A . n 
A 1 61  LYS 61  318 318 LYS LYS A . n 
A 1 62  GLU 62  319 319 GLU GLU A . n 
A 1 63  GLU 63  320 320 GLU GLU A . n 
A 1 64  GLU 64  321 321 GLU GLU A . n 
A 1 65  TRP 65  322 322 TRP TRP A . n 
A 1 66  PHE 66  323 323 PHE PHE A . n 
A 1 67  LYS 67  324 324 LYS LYS A . n 
A 1 68  ALA 68  325 325 ALA ALA A . n 
A 1 69  VAL 69  326 326 VAL VAL A . n 
A 1 70  SER 70  327 327 SER SER A . n 
A 1 71  GLU 71  328 328 GLU GLU A . n 
A 1 72  GLY 72  329 329 GLY GLY A . n 
A 1 73  LEU 73  330 330 LEU LEU A . n 
A 1 74  HIS 74  331 331 HIS HIS A . n 
A 1 75  PRO 75  332 332 PRO PRO A . n 
A 1 76  ASP 76  333 333 ASP ASP A . n 
A 1 77  ALA 77  334 334 ALA ALA A . n 
A 1 78  LYS 78  335 335 LYS LYS A . n 
A 1 79  TYR 79  336 336 TYR TYR A . n 
A 1 80  ALA 80  337 337 ALA ALA A . n 
A 1 81  LYS 81  338 338 LYS LYS A . n 
A 1 82  VAL 82  339 339 VAL VAL A . n 
A 1 83  LYS 83  340 340 LYS LYS A . n 
A 1 84  LEU 84  341 341 LEU LEU A . n 
A 1 85  ILE 85  342 342 ILE ILE A . n 
A 1 86  ARG 86  343 343 ARG ARG A . n 
A 1 87  LEU 87  344 344 LEU LEU A . n 
A 1 88  VAL 88  345 345 VAL VAL A . n 
A 1 89  GLY 89  346 346 GLY GLY A . n 
A 1 90  ILE 90  347 347 ILE ILE A . n 
A 1 91  MET 91  348 348 MET MET A . n 
A 1 92  LEU 92  349 349 LEU LEU A . n 
A 1 93  LEU 93  350 350 LEU LEU A . n 
A 1 94  LEU 94  351 351 LEU LEU A . n 
A 1 95  TYR 95  352 352 TYR TYR A . n 
A 1 96  VAL 96  353 353 VAL VAL A . n 
A 1 97  LYS 97  354 354 LYS LYS A . n 
A 1 98  GLN 98  355 355 GLN GLN A . n 
A 1 99  GLU 99  356 356 GLU GLU A . n 
A 1 100 HIS 100 357 357 HIS HIS A . n 
A 1 101 ALA 101 358 358 ALA ALA A . n 
A 1 102 ALA 102 359 359 ALA ALA A . n 
A 1 103 TYR 103 360 360 TYR TYR A . n 
A 1 104 ILE 104 361 361 ILE ILE A . n 
A 1 105 SER 105 362 362 SER SER A . n 
A 1 106 GLU 106 363 363 GLU GLU A . n 
A 1 107 VAL 107 364 364 VAL VAL A . n 
A 1 108 GLU 108 365 365 GLU GLU A . n 
A 1 109 ALA 109 366 366 ALA ALA A . n 
A 1 110 GLU 110 367 367 GLU GLU A . n 
A 1 111 THR 111 368 368 THR THR A . n 
A 1 112 VAL 112 369 369 VAL VAL A . n 
A 1 113 GLY 113 370 370 GLY GLY A . n 
A 1 114 THR 114 371 371 THR THR A . n 
A 1 115 GLY 115 372 372 GLY GLY A . n 
A 1 116 ILE 116 373 373 ILE ILE A . n 
A 1 117 MET 117 374 374 MET MET A . n 
A 1 118 GLY 118 375 375 GLY GLY A . n 
A 1 119 ARG 119 376 376 ARG ARG A . n 
A 1 120 MET 120 377 377 MET MET A . n 
A 1 121 GLY 121 378 378 GLY GLY A . n 
A 1 122 ASN 122 379 379 ASN ASN A . n 
A 1 123 LYS 123 380 380 LYS LYS A . n 
A 1 124 GLY 124 381 381 GLY GLY A . n 
A 1 125 GLY 125 382 382 GLY GLY A . n 
A 1 126 VAL 126 383 383 VAL VAL A . n 
A 1 127 ALA 127 384 384 ALA ALA A . n 
A 1 128 ILE 128 385 385 ILE ILE A . n 
A 1 129 ARG 129 386 386 ARG ARG A . n 
A 1 130 PHE 130 387 387 PHE PHE A . n 
A 1 131 GLN 131 388 388 GLN GLN A . n 
A 1 132 PHE 132 389 389 PHE PHE A . n 
A 1 133 HIS 133 390 390 HIS HIS A . n 
A 1 134 ASN 134 391 391 ASN ASN A . n 
A 1 135 THR 135 392 392 THR THR A . n 
A 1 136 SER 136 393 393 SER SER A . n 
A 1 137 ILE 137 394 394 ILE ILE A . n 
A 1 138 CYS 138 395 395 CYS CYS A . n 
A 1 139 VAL 139 396 396 VAL VAL A . n 
A 1 140 VAL 140 397 397 VAL VAL A . n 
A 1 141 ASN 141 398 398 ASN ASN A . n 
A 1 142 SER 142 399 399 SER SER A . n 
A 1 143 HIS 143 400 400 HIS HIS A . n 
A 1 144 LEU 144 401 401 LEU LEU A . n 
A 1 145 ALA 145 402 402 ALA ALA A . n 
A 1 146 ALA 146 403 403 ALA ALA A . n 
A 1 147 HIS 147 404 404 HIS HIS A . n 
A 1 148 ILE 148 405 405 ILE ILE A . n 
A 1 149 GLU 149 406 406 GLU GLU A . n 
A 1 150 GLU 150 407 407 GLU GLU A . n 
A 1 151 TYR 151 408 408 TYR TYR A . n 
A 1 152 GLU 152 409 409 GLU GLU A . n 
A 1 153 ARG 153 410 410 ARG ARG A . n 
A 1 154 ARG 154 411 411 ARG ARG A . n 
A 1 155 ASN 155 412 412 ASN ASN A . n 
A 1 156 GLN 156 413 413 GLN GLN A . n 
A 1 157 ASP 157 414 414 ASP ASP A . n 
A 1 158 TYR 158 415 415 TYR TYR A . n 
A 1 159 LYS 159 416 416 LYS LYS A . n 
A 1 160 ASP 160 417 417 ASP ASP A . n 
A 1 161 ILE 161 418 418 ILE ILE A . n 
A 1 162 CYS 162 419 419 CYS CYS A . n 
A 1 163 SER 163 420 420 SER SER A . n 
A 1 164 ARG 164 421 421 ARG ARG A . n 
A 1 165 MET 165 422 422 MET MET A . n 
A 1 166 GLN 166 423 423 GLN GLN A . n 
A 1 167 PHE 167 424 424 PHE PHE A . n 
A 1 168 CYS 168 425 425 CYS CYS A . n 
A 1 169 GLN 169 426 426 GLN GLN A . n 
A 1 170 PRO 170 427 427 PRO PRO A . n 
A 1 171 ASP 171 428 428 ASP ASP A . n 
A 1 172 PRO 172 429 429 PRO PRO A . n 
A 1 173 SER 173 430 430 SER SER A . n 
A 1 174 LEU 174 431 431 LEU LEU A . n 
A 1 175 PRO 175 432 432 PRO PRO A . n 
A 1 176 PRO 176 433 433 PRO PRO A . n 
A 1 177 LEU 177 434 434 LEU LEU A . n 
A 1 178 THR 178 435 435 THR THR A . n 
A 1 179 ILE 179 436 436 ILE ILE A . n 
A 1 180 SER 180 437 437 SER SER A . n 
A 1 181 ASN 181 438 438 ASN ASN A . n 
A 1 182 HIS 182 439 439 HIS HIS A . n 
A 1 183 ASP 183 440 440 ASP ASP A . n 
A 1 184 VAL 184 441 441 VAL VAL A . n 
A 1 185 ILE 185 442 442 ILE ILE A . n 
A 1 186 LEU 186 443 443 LEU LEU A . n 
A 1 187 TRP 187 444 444 TRP TRP A . n 
A 1 188 LEU 188 445 445 LEU LEU A . n 
A 1 189 GLY 189 446 446 GLY GLY A . n 
A 1 190 ASP 190 447 447 ASP ASP A . n 
A 1 191 LEU 191 448 448 LEU LEU A . n 
A 1 192 ASN 192 449 449 ASN ASN A . n 
A 1 193 TYR 193 450 450 TYR TYR A . n 
A 1 194 ARG 194 451 451 ARG ARG A . n 
A 1 195 ILE 195 452 452 ILE ILE A . n 
A 1 196 GLU 196 453 453 GLU GLU A . n 
A 1 197 GLU 197 454 454 GLU GLU A . n 
A 1 198 LEU 198 455 455 LEU LEU A . n 
A 1 199 ASP 199 456 456 ASP ASP A . n 
A 1 200 VAL 200 457 457 VAL VAL A . n 
A 1 201 GLU 201 458 458 GLU GLU A . n 
A 1 202 LYS 202 459 459 LYS LYS A . n 
A 1 203 VAL 203 460 460 VAL VAL A . n 
A 1 204 LYS 204 461 461 LYS LYS A . n 
A 1 205 LYS 205 462 462 LYS LYS A . n 
A 1 206 LEU 206 463 463 LEU LEU A . n 
A 1 207 ILE 207 464 464 ILE ILE A . n 
A 1 208 GLU 208 465 465 GLU GLU A . n 
A 1 209 GLU 209 466 466 GLU GLU A . n 
A 1 210 LYS 210 467 467 LYS LYS A . n 
A 1 211 ASP 211 468 468 ASP ASP A . n 
A 1 212 PHE 212 469 469 PHE PHE A . n 
A 1 213 GLN 213 470 470 GLN GLN A . n 
A 1 214 MET 214 471 471 MET MET A . n 
A 1 215 LEU 215 472 472 LEU LEU A . n 
A 1 216 TYR 216 473 473 TYR TYR A . n 
A 1 217 ALA 217 474 474 ALA ALA A . n 
A 1 218 TYR 218 475 475 TYR TYR A . n 
A 1 219 ASP 219 476 476 ASP ASP A . n 
A 1 220 GLN 220 477 477 GLN GLN A . n 
A 1 221 LEU 221 478 478 LEU LEU A . n 
A 1 222 LYS 222 479 479 LYS LYS A . n 
A 1 223 ILE 223 480 480 ILE ILE A . n 
A 1 224 GLN 224 481 481 GLN GLN A . n 
A 1 225 VAL 225 482 482 VAL VAL A . n 
A 1 226 ALA 226 483 483 ALA ALA A . n 
A 1 227 ALA 227 484 484 ALA ALA A . n 
A 1 228 LYS 228 485 485 LYS LYS A . n 
A 1 229 THR 229 486 486 THR THR A . n 
A 1 230 VAL 230 487 487 VAL VAL A . n 
A 1 231 PHE 231 488 488 PHE PHE A . n 
A 1 232 GLU 232 489 489 GLU GLU A . n 
A 1 233 GLY 233 490 490 GLY GLY A . n 
A 1 234 PHE 234 491 491 PHE PHE A . n 
A 1 235 THR 235 492 492 THR THR A . n 
A 1 236 GLU 236 493 493 GLU GLU A . n 
A 1 237 GLY 237 494 494 GLY GLY A . n 
A 1 238 GLU 238 495 495 GLU GLU A . n 
A 1 239 LEU 239 496 496 LEU LEU A . n 
A 1 240 THR 240 497 497 THR THR A . n 
A 1 241 PHE 241 498 498 PHE PHE A . n 
A 1 242 GLN 242 499 499 GLN GLN A . n 
A 1 243 PRO 243 500 500 PRO PRO A . n 
A 1 244 THR 244 501 501 THR THR A . n 
A 1 245 TYR 245 502 502 TYR TYR A . n 
A 1 246 LYS 246 503 503 LYS LYS A . n 
A 1 247 TYR 247 504 504 TYR TYR A . n 
A 1 248 ASP 248 505 505 ASP ASP A . n 
A 1 249 THR 249 506 506 THR THR A . n 
A 1 250 GLY 250 507 507 GLY GLY A . n 
A 1 251 SER 251 508 508 SER SER A . n 
A 1 252 ASP 252 509 509 ASP ASP A . n 
A 1 253 ASP 253 510 510 ASP ASP A . n 
A 1 254 TRP 254 511 511 TRP TRP A . n 
A 1 255 ASP 255 512 512 ASP ASP A . n 
A 1 256 THR 256 513 513 THR THR A . n 
A 1 257 SER 257 514 514 SER SER A . n 
A 1 258 GLU 258 515 515 GLU GLU A . n 
A 1 259 LYS 259 516 516 LYS LYS A . n 
A 1 260 CYS 260 517 517 CYS CYS A . n 
A 1 261 ARG 261 518 518 ARG ARG A . n 
A 1 262 ALA 262 519 519 ALA ALA A . n 
A 1 263 PRO 263 520 520 PRO PRO A . n 
A 1 264 ALA 264 521 521 ALA ALA A . n 
A 1 265 TRP 265 522 522 TRP TRP A . n 
A 1 266 CYS 266 523 523 CYS CYS A . n 
A 1 267 ASP 267 524 524 ASP ASP A . n 
A 1 268 ARG 268 525 525 ARG ARG A . n 
A 1 269 ILE 269 526 526 ILE ILE A . n 
A 1 270 LEU 270 527 527 LEU LEU A . n 
A 1 271 TRP 271 528 528 TRP TRP A . n 
A 1 272 LYS 272 529 529 LYS LYS A . n 
A 1 273 GLY 273 530 530 GLY GLY A . n 
A 1 274 LYS 274 531 531 LYS LYS A . n 
A 1 275 ASN 275 532 532 ASN ASN A . n 
A 1 276 ILE 276 533 533 ILE ILE A . n 
A 1 277 THR 277 534 534 THR THR A . n 
A 1 278 GLN 278 535 535 GLN GLN A . n 
A 1 279 LEU 279 536 536 LEU LEU A . n 
A 1 280 SER 280 537 537 SER SER A . n 
A 1 281 TYR 281 538 538 TYR TYR A . n 
A 1 282 GLN 282 539 539 GLN GLN A . n 
A 1 283 SER 283 540 540 SER SER A . n 
A 1 284 HIS 284 541 541 HIS HIS A . n 
A 1 285 MET 285 542 542 MET MET A . n 
A 1 286 ALA 286 543 543 ALA ALA A . n 
A 1 287 LEU 287 544 544 LEU LEU A . n 
A 1 288 LYS 288 545 545 LYS LYS A . n 
A 1 289 THR 289 546 546 THR THR A . n 
A 1 290 SER 290 547 547 SER SER A . n 
A 1 291 ASP 291 548 548 ASP ASP A . n 
A 1 292 HIS 292 549 549 HIS HIS A . n 
A 1 293 LYS 293 550 550 LYS LYS A . n 
A 1 294 PRO 294 551 551 PRO PRO A . n 
A 1 295 VAL 295 552 552 VAL VAL A . n 
A 1 296 SER 296 553 553 SER SER A . n 
A 1 297 SER 297 554 554 SER SER A . n 
A 1 298 VAL 298 555 555 VAL VAL A . n 
A 1 299 PHE 299 556 556 PHE PHE A . n 
A 1 300 ASP 300 557 557 ASP ASP A . n 
A 1 301 ILE 301 558 558 ILE ILE A . n 
A 1 302 GLY 302 559 559 GLY GLY A . n 
A 1 303 VAL 303 560 560 VAL VAL A . n 
A 1 304 ARG 304 561 561 ARG ARG A . n 
A 1 305 VAL 305 562 562 VAL VAL A . n 
A 1 306 VAL 306 563 563 VAL VAL A . n 
A 1 307 ALA 307 564 564 ALA ALA A . n 
A 1 308 HIS 308 565 565 HIS HIS A . n 
A 1 309 HIS 309 566 566 HIS HIS A . n 
A 1 310 HIS 310 567 567 HIS HIS A . n 
A 1 311 HIS 311 568 ?   ?   ?   A . n 
A 1 312 HIS 312 569 ?   ?   ?   A . n 
A 1 313 HIS 313 570 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    monomeric 1 
2 software_defined_assembly PISA trimeric  3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1     A,B,C,D,E,F,G,H 
2 1,2,3 A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 5150  ? 
2 MORE         -123  ? 
2 'SSA (A^2)'  39450 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z             1.0000000000 0.0000000000 0.0000000000  0.0000000000   0.0000000000 
1.0000000000 0.0000000000  0.0000000000   0.0000000000  0.0000000000  1.0000000000 0.0000000000   
2 'crystal symmetry operation' 8_645  -z+1,x-1/2,-y+1/2 0.0000000000 0.0000000000 -1.0000000000 133.7610000000 1.0000000000 
0.0000000000 0.0000000000  -66.8805000000 0.0000000000  -1.0000000000 0.0000000000 66.8805000000  
3 'crystal symmetry operation' 11_556 y+1/2,-z+1/2,-x+1 0.0000000000 1.0000000000 0.0000000000  66.8805000000  0.0000000000 
0.0000000000 -1.0000000000 66.8805000000  -1.0000000000 0.0000000000  0.0000000000 133.7610000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? H HOH .  ? A HOH 79  ? 1_555 MG ? C MG . ? A MG 571 ? 1_555 O   ? H HOH .  ? A HOH 78  ? 1_555 100.9 ? 
2  O   ? H HOH .  ? A HOH 79  ? 1_555 MG ? C MG . ? A MG 571 ? 1_555 O   ? H HOH .  ? A HOH 77  ? 1_555 167.0 ? 
3  O   ? H HOH .  ? A HOH 78  ? 1_555 MG ? C MG . ? A MG 571 ? 1_555 O   ? H HOH .  ? A HOH 77  ? 1_555 92.0  ? 
4  O   ? H HOH .  ? A HOH 79  ? 1_555 MG ? C MG . ? A MG 571 ? 1_555 OE1 ? A GLU 46 ? A GLU 303 ? 1_555 84.6  ? 
5  O   ? H HOH .  ? A HOH 78  ? 1_555 MG ? C MG . ? A MG 571 ? 1_555 OE1 ? A GLU 46 ? A GLU 303 ? 1_555 174.2 ? 
6  O   ? H HOH .  ? A HOH 77  ? 1_555 MG ? C MG . ? A MG 571 ? 1_555 OE1 ? A GLU 46 ? A GLU 303 ? 1_555 82.4  ? 
7  O   ? H HOH .  ? A HOH 79  ? 1_555 MG ? C MG . ? A MG 571 ? 1_555 OD1 ? A ASN 18 ? A ASN 275 ? 1_555 103.1 ? 
8  O   ? H HOH .  ? A HOH 78  ? 1_555 MG ? C MG . ? A MG 571 ? 1_555 OD1 ? A ASN 18 ? A ASN 275 ? 1_555 80.9  ? 
9  O   ? H HOH .  ? A HOH 77  ? 1_555 MG ? C MG . ? A MG 571 ? 1_555 OD1 ? A ASN 18 ? A ASN 275 ? 1_555 77.5  ? 
10 OE1 ? A GLU 46 ? A GLU 303 ? 1_555 MG ? C MG . ? A MG 571 ? 1_555 OD1 ? A ASN 18 ? A ASN 275 ? 1_555 96.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-06-30 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2014-05-28 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC   'data collection' Quantum  ? 1 
PHASER phasing           .        ? 2 
REFMAC refinement        5.5.0102 ? 3 
XDS    'data reduction'  .        ? 4 
SCALA  'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 288 ? ? -155.21 64.90   
2  1 VAL A 345 ? ? 54.17   -108.32 
3  1 ARG A 376 ? ? -138.23 -31.20  
4  1 ARG A 376 ? ? -142.09 -23.77  
5  1 HIS A 390 ? ? 48.51   -119.60 
6  1 HIS A 404 ? ? 89.79   137.31  
7  1 ASN A 438 ? B -76.64  46.91   
8  1 GLU A 454 ? ? 65.03   -57.91  
9  1 PRO A 500 ? ? -39.47  141.61  
10 1 ASP A 512 ? ? -33.95  113.05  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 324 ? CD  ? A LYS 67  CD  
2 1 Y 1 A LYS 324 ? CE  ? A LYS 67  CE  
3 1 Y 1 A LYS 324 ? NZ  ? A LYS 67  NZ  
4 1 Y 1 A LYS 335 ? CE  ? A LYS 78  CE  
5 1 Y 1 A LYS 335 ? NZ  ? A LYS 78  NZ  
6 1 Y 1 A GLU 515 ? CG  ? A GLU 258 CG  
7 1 Y 1 A GLU 515 ? CD  ? A GLU 258 CD  
8 1 Y 1 A GLU 515 ? OE1 ? A GLU 258 OE1 
9 1 Y 1 A GLU 515 ? OE2 ? A GLU 258 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A HIS 568 ? A HIS 311 
2 1 Y 1 A HIS 569 ? A HIS 312 
3 1 Y 1 A HIS 570 ? A HIS 313 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 GLYCEROL GOL 
3 'MAGNESIUM ION' MG  
4 
;(2R)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5S,6R)-2,3,5,6-tetrahydroxy-4-(phosphonooxy)cyclohexyl]oxy}phosphoryl]oxy}propane-1,2-diyl dioctanoate
;
PIF 
5 'SULFATE ION' SO4 
6 'CHLORIDE ION' CL  
7 water HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 GOL 1   1   1   GOL GOL A . 
C 3 MG  1   571 1   MG  MG  A . 
D 4 PIF 1   572 1   PIF PIF A . 
E 5 SO4 1   573 1   SO4 SO4 A . 
F 2 GOL 1   574 1   GOL GOL A . 
G 6 CL  1   575 1   CL  CL  A . 
H 7 HOH 1   2   2   HOH HOH A . 
H 7 HOH 2   3   3   HOH HOH A . 
H 7 HOH 3   4   4   HOH HOH A . 
H 7 HOH 4   5   5   HOH HOH A . 
H 7 HOH 5   6   6   HOH HOH A . 
H 7 HOH 6   7   7   HOH HOH A . 
H 7 HOH 7   8   8   HOH HOH A . 
H 7 HOH 8   9   9   HOH HOH A . 
H 7 HOH 9   10  10  HOH HOH A . 
H 7 HOH 10  11  11  HOH HOH A . 
H 7 HOH 11  12  12  HOH HOH A . 
H 7 HOH 12  13  13  HOH HOH A . 
H 7 HOH 13  14  14  HOH HOH A . 
H 7 HOH 14  15  15  HOH HOH A . 
H 7 HOH 15  16  16  HOH HOH A . 
H 7 HOH 16  17  17  HOH HOH A . 
H 7 HOH 17  18  18  HOH HOH A . 
H 7 HOH 18  19  19  HOH HOH A . 
H 7 HOH 19  20  20  HOH HOH A . 
H 7 HOH 20  21  21  HOH HOH A . 
H 7 HOH 21  22  22  HOH HOH A . 
H 7 HOH 22  23  23  HOH HOH A . 
H 7 HOH 23  24  24  HOH HOH A . 
H 7 HOH 24  25  25  HOH HOH A . 
H 7 HOH 25  26  26  HOH HOH A . 
H 7 HOH 26  27  27  HOH HOH A . 
H 7 HOH 27  28  28  HOH HOH A . 
H 7 HOH 28  29  29  HOH HOH A . 
H 7 HOH 29  30  30  HOH HOH A . 
H 7 HOH 30  31  31  HOH HOH A . 
H 7 HOH 31  32  32  HOH HOH A . 
H 7 HOH 32  33  33  HOH HOH A . 
H 7 HOH 33  34  34  HOH HOH A . 
H 7 HOH 34  35  35  HOH HOH A . 
H 7 HOH 35  36  36  HOH HOH A . 
H 7 HOH 36  37  37  HOH HOH A . 
H 7 HOH 37  38  38  HOH HOH A . 
H 7 HOH 38  39  39  HOH HOH A . 
H 7 HOH 39  40  40  HOH HOH A . 
H 7 HOH 40  41  41  HOH HOH A . 
H 7 HOH 41  42  42  HOH HOH A . 
H 7 HOH 42  43  43  HOH HOH A . 
H 7 HOH 43  44  44  HOH HOH A . 
H 7 HOH 44  45  45  HOH HOH A . 
H 7 HOH 45  46  46  HOH HOH A . 
H 7 HOH 46  47  47  HOH HOH A . 
H 7 HOH 47  48  48  HOH HOH A . 
H 7 HOH 48  49  49  HOH HOH A . 
H 7 HOH 49  50  50  HOH HOH A . 
H 7 HOH 50  51  51  HOH HOH A . 
H 7 HOH 51  52  52  HOH HOH A . 
H 7 HOH 52  53  53  HOH HOH A . 
H 7 HOH 53  54  54  HOH HOH A . 
H 7 HOH 54  55  55  HOH HOH A . 
H 7 HOH 55  56  56  HOH HOH A . 
H 7 HOH 56  57  57  HOH HOH A . 
H 7 HOH 57  58  58  HOH HOH A . 
H 7 HOH 58  59  59  HOH HOH A . 
H 7 HOH 59  60  60  HOH HOH A . 
H 7 HOH 60  61  61  HOH HOH A . 
H 7 HOH 61  62  62  HOH HOH A . 
H 7 HOH 62  63  63  HOH HOH A . 
H 7 HOH 63  64  64  HOH HOH A . 
H 7 HOH 64  65  65  HOH HOH A . 
H 7 HOH 65  66  66  HOH HOH A . 
H 7 HOH 66  67  67  HOH HOH A . 
H 7 HOH 67  68  68  HOH HOH A . 
H 7 HOH 68  69  69  HOH HOH A . 
H 7 HOH 69  70  70  HOH HOH A . 
H 7 HOH 70  71  71  HOH HOH A . 
H 7 HOH 71  72  72  HOH HOH A . 
H 7 HOH 72  73  73  HOH HOH A . 
H 7 HOH 73  74  74  HOH HOH A . 
H 7 HOH 74  75  75  HOH HOH A . 
H 7 HOH 75  76  76  HOH HOH A . 
H 7 HOH 76  77  77  HOH HOH A . 
H 7 HOH 77  78  78  HOH HOH A . 
H 7 HOH 78  79  79  HOH HOH A . 
H 7 HOH 79  80  80  HOH HOH A . 
H 7 HOH 80  81  81  HOH HOH A . 
H 7 HOH 81  82  82  HOH HOH A . 
H 7 HOH 82  83  83  HOH HOH A . 
H 7 HOH 83  84  84  HOH HOH A . 
H 7 HOH 84  85  85  HOH HOH A . 
H 7 HOH 85  86  86  HOH HOH A . 
H 7 HOH 86  87  87  HOH HOH A . 
H 7 HOH 87  88  88  HOH HOH A . 
H 7 HOH 88  89  89  HOH HOH A . 
H 7 HOH 89  90  90  HOH HOH A . 
H 7 HOH 90  91  91  HOH HOH A . 
H 7 HOH 91  92  92  HOH HOH A . 
H 7 HOH 92  93  93  HOH HOH A . 
H 7 HOH 93  94  94  HOH HOH A . 
H 7 HOH 94  95  95  HOH HOH A . 
H 7 HOH 95  96  96  HOH HOH A . 
H 7 HOH 96  97  97  HOH HOH A . 
H 7 HOH 97  98  98  HOH HOH A . 
H 7 HOH 98  99  99  HOH HOH A . 
H 7 HOH 99  100 100 HOH HOH A . 
H 7 HOH 100 102 102 HOH HOH A . 
H 7 HOH 101 103 103 HOH HOH A . 
H 7 HOH 102 104 104 HOH HOH A . 
H 7 HOH 103 105 105 HOH HOH A . 
H 7 HOH 104 106 106 HOH HOH A . 
H 7 HOH 105 107 107 HOH HOH A . 
H 7 HOH 106 108 108 HOH HOH A . 
H 7 HOH 107 109 109 HOH HOH A . 
H 7 HOH 108 110 110 HOH HOH A . 
H 7 HOH 109 111 111 HOH HOH A . 
H 7 HOH 110 112 112 HOH HOH A . 
H 7 HOH 111 113 113 HOH HOH A . 
H 7 HOH 112 114 114 HOH HOH A . 
H 7 HOH 113 115 115 HOH HOH A . 
H 7 HOH 114 116 116 HOH HOH A . 
H 7 HOH 115 117 117 HOH HOH A . 
H 7 HOH 116 118 118 HOH HOH A . 
H 7 HOH 117 119 119 HOH HOH A . 
H 7 HOH 118 120 120 HOH HOH A . 
H 7 HOH 119 121 121 HOH HOH A . 
H 7 HOH 120 122 122 HOH HOH A . 
H 7 HOH 121 123 123 HOH HOH A . 
H 7 HOH 122 124 124 HOH HOH A . 
H 7 HOH 123 125 125 HOH HOH A . 
H 7 HOH 124 126 126 HOH HOH A . 
H 7 HOH 125 127 127 HOH HOH A . 
H 7 HOH 126 128 128 HOH HOH A . 
H 7 HOH 127 129 129 HOH HOH A . 
H 7 HOH 128 130 130 HOH HOH A . 
H 7 HOH 129 131 131 HOH HOH A . 
H 7 HOH 130 132 132 HOH HOH A . 
H 7 HOH 131 133 133 HOH HOH A . 
H 7 HOH 132 134 134 HOH HOH A . 
H 7 HOH 133 135 135 HOH HOH A . 
H 7 HOH 134 136 136 HOH HOH A . 
H 7 HOH 135 138 138 HOH HOH A . 
H 7 HOH 136 139 139 HOH HOH A . 
H 7 HOH 137 140 140 HOH HOH A . 
H 7 HOH 138 141 141 HOH HOH A . 
H 7 HOH 139 142 142 HOH HOH A . 
H 7 HOH 140 143 143 HOH HOH A . 
H 7 HOH 141 144 144 HOH HOH A . 
H 7 HOH 142 145 145 HOH HOH A . 
H 7 HOH 143 146 146 HOH HOH A . 
H 7 HOH 144 147 147 HOH HOH A . 
H 7 HOH 145 148 148 HOH HOH A . 
H 7 HOH 146 149 149 HOH HOH A . 
H 7 HOH 147 150 150 HOH HOH A . 
H 7 HOH 148 151 151 HOH HOH A . 
H 7 HOH 149 152 152 HOH HOH A . 
H 7 HOH 150 153 153 HOH HOH A . 
H 7 HOH 151 154 154 HOH HOH A . 
H 7 HOH 152 155 155 HOH HOH A . 
H 7 HOH 153 156 156 HOH HOH A . 
H 7 HOH 154 157 157 HOH HOH A . 
H 7 HOH 155 158 158 HOH HOH A . 
H 7 HOH 156 159 159 HOH HOH A . 
H 7 HOH 157 160 160 HOH HOH A . 
H 7 HOH 158 161 161 HOH HOH A . 
H 7 HOH 159 162 162 HOH HOH A . 
H 7 HOH 160 163 163 HOH HOH A . 
H 7 HOH 161 164 164 HOH HOH A . 
H 7 HOH 162 165 165 HOH HOH A . 
H 7 HOH 163 166 166 HOH HOH A . 
H 7 HOH 164 167 167 HOH HOH A . 
H 7 HOH 165 168 168 HOH HOH A . 
H 7 HOH 166 169 169 HOH HOH A . 
H 7 HOH 167 170 170 HOH HOH A . 
H 7 HOH 168 171 171 HOH HOH A . 
H 7 HOH 169 172 172 HOH HOH A . 
H 7 HOH 170 173 173 HOH HOH A . 
H 7 HOH 171 174 174 HOH HOH A . 
H 7 HOH 172 175 175 HOH HOH A . 
H 7 HOH 173 176 176 HOH HOH A . 
H 7 HOH 174 177 177 HOH HOH A . 
H 7 HOH 175 178 178 HOH HOH A . 
H 7 HOH 176 179 179 HOH HOH A . 
H 7 HOH 177 180 180 HOH HOH A . 
H 7 HOH 178 181 181 HOH HOH A . 
H 7 HOH 179 182 182 HOH HOH A . 
H 7 HOH 180 183 183 HOH HOH A . 
H 7 HOH 181 184 184 HOH HOH A . 
H 7 HOH 182 185 185 HOH HOH A . 
H 7 HOH 183 186 186 HOH HOH A . 
H 7 HOH 184 187 187 HOH HOH A . 
H 7 HOH 185 188 188 HOH HOH A . 
H 7 HOH 186 189 189 HOH HOH A . 
H 7 HOH 187 190 190 HOH HOH A . 
H 7 HOH 188 191 191 HOH HOH A . 
H 7 HOH 189 192 192 HOH HOH A . 
H 7 HOH 190 193 193 HOH HOH A . 
H 7 HOH 191 194 194 HOH HOH A . 
H 7 HOH 192 195 195 HOH HOH A . 
H 7 HOH 193 196 196 HOH HOH A . 
H 7 HOH 194 197 197 HOH HOH A . 
H 7 HOH 195 198 198 HOH HOH A . 
H 7 HOH 196 199 199 HOH HOH A . 
H 7 HOH 197 200 200 HOH HOH A . 
H 7 HOH 198 201 201 HOH HOH A . 
H 7 HOH 199 202 202 HOH HOH A . 
H 7 HOH 200 203 203 HOH HOH A . 
H 7 HOH 201 204 204 HOH HOH A . 
H 7 HOH 202 205 205 HOH HOH A . 
H 7 HOH 203 206 206 HOH HOH A . 
H 7 HOH 204 207 207 HOH HOH A . 
H 7 HOH 205 208 208 HOH HOH A . 
H 7 HOH 206 209 209 HOH HOH A . 
H 7 HOH 207 210 210 HOH HOH A . 
H 7 HOH 208 211 211 HOH HOH A . 
H 7 HOH 209 212 212 HOH HOH A . 
H 7 HOH 210 213 213 HOH HOH A . 
H 7 HOH 211 214 214 HOH HOH A . 
H 7 HOH 212 215 215 HOH HOH A . 
H 7 HOH 213 216 216 HOH HOH A . 
H 7 HOH 214 217 217 HOH HOH A . 
H 7 HOH 215 218 218 HOH HOH A . 
H 7 HOH 216 219 219 HOH HOH A . 
H 7 HOH 217 220 220 HOH HOH A . 
H 7 HOH 218 221 221 HOH HOH A . 
H 7 HOH 219 222 222 HOH HOH A . 
H 7 HOH 220 223 223 HOH HOH A . 
H 7 HOH 221 224 224 HOH HOH A . 
H 7 HOH 222 225 225 HOH HOH A . 
H 7 HOH 223 226 226 HOH HOH A . 
H 7 HOH 224 227 227 HOH HOH A . 
H 7 HOH 225 228 228 HOH HOH A . 
#