data_3MXW
# 
_entry.id   3MXW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3MXW         
RCSB  RCSB059131   
WWPDB D_1000059131 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3MXV . unspecified 
PDB 1VHH . unspecified 
PDB 3M1N . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3MXW 
_pdbx_database_status.recvd_initial_deposition_date   2010-05-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hymowitz, S.G.' 1 
'Maun, H.R.'     2 
# 
_citation.id                        primary 
_citation.title                     'Hedgehog pathway antagonist 5E1 binds hedgehog at the pseudo-active site.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            285 
_citation.page_first                26570 
_citation.page_last                 26580 
_citation.year                      2010 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20504762 
_citation.pdbx_database_id_DOI      10.1074/jbc.M110.112284 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Maun, H.R.'       1 
primary 'Wen, X.'          2 
primary 'Lingel, A.'       3 
primary 'de Sauvage, F.J.' 4 
primary 'Lazarus, R.A.'    5 
primary 'Scales, S.J.'     6 
primary 'Hymowitz, S.G.'   7 
# 
_cell.entry_id           3MXW 
_cell.length_a           60.306 
_cell.length_b           90.544 
_cell.length_c           111.672 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3MXW 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Sonic hedgehog protein' 19122.484 1   ? ? ? ? 
2 polymer     man '5E1 light chain'        23507.143 1   ? ? ? ? 
3 polymer     man '5E1 heavy chain'        23816.602 1   ? ? ? ? 
4 non-polymer syn 'ZINC ION'               65.409    1   ? ? ? ? 
5 non-polymer syn 'CALCIUM ION'            40.078    2   ? ? ? ? 
6 non-polymer syn 'SULFATE ION'            96.063    3   ? ? ? ? 
7 water       nat water                    18.015    423 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'SHH, HHG-1, Sonic hedgehog protein N-product, Sonic hedgehog protein C-product' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNA
LAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAE
NSVAAKSGG
;
;GFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNA
LAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAE
NSVAAKSGG
;
A ? 
2 'polypeptide(L)' no no 
;DIVMTQTPKFLLVSAGDKVTITCKASQSVSNDLTWYQQKPGQSPKLLIYYASNRYTGVPDRFTGSGYGTDFTFTISTVQA
EDLAVYFCQQDYGSPPTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
;
;DIVMTQTPKFLLVSAGDKVTITCKASQSVSNDLTWYQQKPGQSPKLLIYYASNRYTGVPDRFTGSGYGTDFTFTISTVQA
EDLAVYFCQQDYGSPPTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
;
L ? 
3 'polypeptide(L)' no no 
;QVQLQQSGPELVRPGVSVKISCKGSGYTFIDEALHWVKQSHAESLEWIGVIRPYSGETNYNQKFKDKATMTVDISSSTAY
LELARLTSEDSAIYYCARDWERGDFFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
;
;QVQLQQSGPELVRPGVSVKISCKGSGYTFIDEALHWVKQSHAESLEWIGVIRPYSGETNYNQKFKDKATMTVDISSSTAY
LELARLTSEDSAIYYCARDWERGDFFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
;
H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PHE n 
1 3   GLY n 
1 4   LYS n 
1 5   ARG n 
1 6   ARG n 
1 7   HIS n 
1 8   PRO n 
1 9   LYS n 
1 10  LYS n 
1 11  LEU n 
1 12  THR n 
1 13  PRO n 
1 14  LEU n 
1 15  ALA n 
1 16  TYR n 
1 17  LYS n 
1 18  GLN n 
1 19  PHE n 
1 20  ILE n 
1 21  PRO n 
1 22  ASN n 
1 23  VAL n 
1 24  ALA n 
1 25  GLU n 
1 26  LYS n 
1 27  THR n 
1 28  LEU n 
1 29  GLY n 
1 30  ALA n 
1 31  SER n 
1 32  GLY n 
1 33  ARG n 
1 34  TYR n 
1 35  GLU n 
1 36  GLY n 
1 37  LYS n 
1 38  ILE n 
1 39  SER n 
1 40  ARG n 
1 41  ASN n 
1 42  SER n 
1 43  GLU n 
1 44  ARG n 
1 45  PHE n 
1 46  LYS n 
1 47  GLU n 
1 48  LEU n 
1 49  THR n 
1 50  PRO n 
1 51  ASN n 
1 52  TYR n 
1 53  ASN n 
1 54  PRO n 
1 55  ASP n 
1 56  ILE n 
1 57  ILE n 
1 58  PHE n 
1 59  LYS n 
1 60  ASP n 
1 61  GLU n 
1 62  GLU n 
1 63  ASN n 
1 64  THR n 
1 65  GLY n 
1 66  ALA n 
1 67  ASP n 
1 68  ARG n 
1 69  LEU n 
1 70  MET n 
1 71  THR n 
1 72  GLN n 
1 73  ARG n 
1 74  CYS n 
1 75  LYS n 
1 76  ASP n 
1 77  LYS n 
1 78  LEU n 
1 79  ASN n 
1 80  ALA n 
1 81  LEU n 
1 82  ALA n 
1 83  ILE n 
1 84  SER n 
1 85  VAL n 
1 86  MET n 
1 87  ASN n 
1 88  GLN n 
1 89  TRP n 
1 90  PRO n 
1 91  GLY n 
1 92  VAL n 
1 93  LYS n 
1 94  LEU n 
1 95  ARG n 
1 96  VAL n 
1 97  THR n 
1 98  GLU n 
1 99  GLY n 
1 100 TRP n 
1 101 ASP n 
1 102 GLU n 
1 103 ASP n 
1 104 GLY n 
1 105 HIS n 
1 106 HIS n 
1 107 SER n 
1 108 GLU n 
1 109 GLU n 
1 110 SER n 
1 111 LEU n 
1 112 HIS n 
1 113 TYR n 
1 114 GLU n 
1 115 GLY n 
1 116 ARG n 
1 117 ALA n 
1 118 VAL n 
1 119 ASP n 
1 120 ILE n 
1 121 THR n 
1 122 THR n 
1 123 SER n 
1 124 ASP n 
1 125 ARG n 
1 126 ASP n 
1 127 ARG n 
1 128 SER n 
1 129 LYS n 
1 130 TYR n 
1 131 GLY n 
1 132 MET n 
1 133 LEU n 
1 134 ALA n 
1 135 ARG n 
1 136 LEU n 
1 137 ALA n 
1 138 VAL n 
1 139 GLU n 
1 140 ALA n 
1 141 GLY n 
1 142 PHE n 
1 143 ASP n 
1 144 TRP n 
1 145 VAL n 
1 146 TYR n 
1 147 TYR n 
1 148 GLU n 
1 149 SER n 
1 150 LYS n 
1 151 ALA n 
1 152 HIS n 
1 153 ILE n 
1 154 HIS n 
1 155 CYS n 
1 156 SER n 
1 157 VAL n 
1 158 LYS n 
1 159 ALA n 
1 160 GLU n 
1 161 ASN n 
1 162 SER n 
1 163 VAL n 
1 164 ALA n 
1 165 ALA n 
1 166 LYS n 
1 167 SER n 
1 168 GLY n 
1 169 GLY n 
2 1   ASP n 
2 2   ILE n 
2 3   VAL n 
2 4   MET n 
2 5   THR n 
2 6   GLN n 
2 7   THR n 
2 8   PRO n 
2 9   LYS n 
2 10  PHE n 
2 11  LEU n 
2 12  LEU n 
2 13  VAL n 
2 14  SER n 
2 15  ALA n 
2 16  GLY n 
2 17  ASP n 
2 18  LYS n 
2 19  VAL n 
2 20  THR n 
2 21  ILE n 
2 22  THR n 
2 23  CYS n 
2 24  LYS n 
2 25  ALA n 
2 26  SER n 
2 27  GLN n 
2 28  SER n 
2 29  VAL n 
2 30  SER n 
2 31  ASN n 
2 32  ASP n 
2 33  LEU n 
2 34  THR n 
2 35  TRP n 
2 36  TYR n 
2 37  GLN n 
2 38  GLN n 
2 39  LYS n 
2 40  PRO n 
2 41  GLY n 
2 42  GLN n 
2 43  SER n 
2 44  PRO n 
2 45  LYS n 
2 46  LEU n 
2 47  LEU n 
2 48  ILE n 
2 49  TYR n 
2 50  TYR n 
2 51  ALA n 
2 52  SER n 
2 53  ASN n 
2 54  ARG n 
2 55  TYR n 
2 56  THR n 
2 57  GLY n 
2 58  VAL n 
2 59  PRO n 
2 60  ASP n 
2 61  ARG n 
2 62  PHE n 
2 63  THR n 
2 64  GLY n 
2 65  SER n 
2 66  GLY n 
2 67  TYR n 
2 68  GLY n 
2 69  THR n 
2 70  ASP n 
2 71  PHE n 
2 72  THR n 
2 73  PHE n 
2 74  THR n 
2 75  ILE n 
2 76  SER n 
2 77  THR n 
2 78  VAL n 
2 79  GLN n 
2 80  ALA n 
2 81  GLU n 
2 82  ASP n 
2 83  LEU n 
2 84  ALA n 
2 85  VAL n 
2 86  TYR n 
2 87  PHE n 
2 88  CYS n 
2 89  GLN n 
2 90  GLN n 
2 91  ASP n 
2 92  TYR n 
2 93  GLY n 
2 94  SER n 
2 95  PRO n 
2 96  PRO n 
2 97  THR n 
2 98  PHE n 
2 99  GLY n 
2 100 GLY n 
2 101 GLY n 
2 102 THR n 
2 103 LYS n 
2 104 VAL n 
2 105 GLU n 
2 106 ILE n 
2 107 LYS n 
2 108 ARG n 
2 109 THR n 
2 110 VAL n 
2 111 ALA n 
2 112 ALA n 
2 113 PRO n 
2 114 SER n 
2 115 VAL n 
2 116 PHE n 
2 117 ILE n 
2 118 PHE n 
2 119 PRO n 
2 120 PRO n 
2 121 SER n 
2 122 ASP n 
2 123 GLU n 
2 124 GLN n 
2 125 LEU n 
2 126 LYS n 
2 127 SER n 
2 128 GLY n 
2 129 THR n 
2 130 ALA n 
2 131 SER n 
2 132 VAL n 
2 133 VAL n 
2 134 CYS n 
2 135 LEU n 
2 136 LEU n 
2 137 ASN n 
2 138 ASN n 
2 139 PHE n 
2 140 TYR n 
2 141 PRO n 
2 142 ARG n 
2 143 GLU n 
2 144 ALA n 
2 145 LYS n 
2 146 VAL n 
2 147 GLN n 
2 148 TRP n 
2 149 LYS n 
2 150 VAL n 
2 151 ASP n 
2 152 ASN n 
2 153 ALA n 
2 154 LEU n 
2 155 GLN n 
2 156 SER n 
2 157 GLY n 
2 158 ASN n 
2 159 SER n 
2 160 GLN n 
2 161 GLU n 
2 162 SER n 
2 163 VAL n 
2 164 THR n 
2 165 GLU n 
2 166 GLN n 
2 167 ASP n 
2 168 SER n 
2 169 LYS n 
2 170 ASP n 
2 171 SER n 
2 172 THR n 
2 173 TYR n 
2 174 SER n 
2 175 LEU n 
2 176 SER n 
2 177 SER n 
2 178 THR n 
2 179 LEU n 
2 180 THR n 
2 181 LEU n 
2 182 SER n 
2 183 LYS n 
2 184 ALA n 
2 185 ASP n 
2 186 TYR n 
2 187 GLU n 
2 188 LYS n 
2 189 HIS n 
2 190 LYS n 
2 191 VAL n 
2 192 TYR n 
2 193 ALA n 
2 194 CYS n 
2 195 GLU n 
2 196 VAL n 
2 197 THR n 
2 198 HIS n 
2 199 GLN n 
2 200 GLY n 
2 201 LEU n 
2 202 SER n 
2 203 SER n 
2 204 PRO n 
2 205 VAL n 
2 206 THR n 
2 207 LYS n 
2 208 SER n 
2 209 PHE n 
2 210 ASN n 
2 211 ARG n 
2 212 GLY n 
2 213 GLU n 
2 214 CYS n 
3 1   GLN n 
3 2   VAL n 
3 3   GLN n 
3 4   LEU n 
3 5   GLN n 
3 6   GLN n 
3 7   SER n 
3 8   GLY n 
3 9   PRO n 
3 10  GLU n 
3 11  LEU n 
3 12  VAL n 
3 13  ARG n 
3 14  PRO n 
3 15  GLY n 
3 16  VAL n 
3 17  SER n 
3 18  VAL n 
3 19  LYS n 
3 20  ILE n 
3 21  SER n 
3 22  CYS n 
3 23  LYS n 
3 24  GLY n 
3 25  SER n 
3 26  GLY n 
3 27  TYR n 
3 28  THR n 
3 29  PHE n 
3 30  ILE n 
3 31  ASP n 
3 32  GLU n 
3 33  ALA n 
3 34  LEU n 
3 35  HIS n 
3 36  TRP n 
3 37  VAL n 
3 38  LYS n 
3 39  GLN n 
3 40  SER n 
3 41  HIS n 
3 42  ALA n 
3 43  GLU n 
3 44  SER n 
3 45  LEU n 
3 46  GLU n 
3 47  TRP n 
3 48  ILE n 
3 49  GLY n 
3 50  VAL n 
3 51  ILE n 
3 52  ARG n 
3 53  PRO n 
3 54  TYR n 
3 55  SER n 
3 56  GLY n 
3 57  GLU n 
3 58  THR n 
3 59  ASN n 
3 60  TYR n 
3 61  ASN n 
3 62  GLN n 
3 63  LYS n 
3 64  PHE n 
3 65  LYS n 
3 66  ASP n 
3 67  LYS n 
3 68  ALA n 
3 69  THR n 
3 70  MET n 
3 71  THR n 
3 72  VAL n 
3 73  ASP n 
3 74  ILE n 
3 75  SER n 
3 76  SER n 
3 77  SER n 
3 78  THR n 
3 79  ALA n 
3 80  TYR n 
3 81  LEU n 
3 82  GLU n 
3 83  LEU n 
3 84  ALA n 
3 85  ARG n 
3 86  LEU n 
3 87  THR n 
3 88  SER n 
3 89  GLU n 
3 90  ASP n 
3 91  SER n 
3 92  ALA n 
3 93  ILE n 
3 94  TYR n 
3 95  TYR n 
3 96  CYS n 
3 97  ALA n 
3 98  ARG n 
3 99  ASP n 
3 100 TRP n 
3 101 GLU n 
3 102 ARG n 
3 103 GLY n 
3 104 ASP n 
3 105 PHE n 
3 106 PHE n 
3 107 ASP n 
3 108 TYR n 
3 109 TRP n 
3 110 GLY n 
3 111 GLN n 
3 112 GLY n 
3 113 THR n 
3 114 LEU n 
3 115 VAL n 
3 116 THR n 
3 117 VAL n 
3 118 SER n 
3 119 SER n 
3 120 ALA n 
3 121 SER n 
3 122 THR n 
3 123 LYS n 
3 124 GLY n 
3 125 PRO n 
3 126 SER n 
3 127 VAL n 
3 128 PHE n 
3 129 PRO n 
3 130 LEU n 
3 131 ALA n 
3 132 PRO n 
3 133 SER n 
3 134 SER n 
3 135 LYS n 
3 136 SER n 
3 137 THR n 
3 138 SER n 
3 139 GLY n 
3 140 GLY n 
3 141 THR n 
3 142 ALA n 
3 143 ALA n 
3 144 LEU n 
3 145 GLY n 
3 146 CYS n 
3 147 LEU n 
3 148 VAL n 
3 149 LYS n 
3 150 ASP n 
3 151 TYR n 
3 152 PHE n 
3 153 PRO n 
3 154 GLU n 
3 155 PRO n 
3 156 VAL n 
3 157 THR n 
3 158 VAL n 
3 159 SER n 
3 160 TRP n 
3 161 ASN n 
3 162 SER n 
3 163 GLY n 
3 164 ALA n 
3 165 LEU n 
3 166 THR n 
3 167 SER n 
3 168 GLY n 
3 169 VAL n 
3 170 HIS n 
3 171 THR n 
3 172 PHE n 
3 173 PRO n 
3 174 ALA n 
3 175 VAL n 
3 176 LEU n 
3 177 GLN n 
3 178 SER n 
3 179 SER n 
3 180 GLY n 
3 181 LEU n 
3 182 TYR n 
3 183 SER n 
3 184 LEU n 
3 185 SER n 
3 186 SER n 
3 187 VAL n 
3 188 VAL n 
3 189 THR n 
3 190 VAL n 
3 191 PRO n 
3 192 SER n 
3 193 SER n 
3 194 SER n 
3 195 LEU n 
3 196 GLY n 
3 197 THR n 
3 198 GLN n 
3 199 THR n 
3 200 TYR n 
3 201 ILE n 
3 202 CYS n 
3 203 ASN n 
3 204 VAL n 
3 205 ASN n 
3 206 HIS n 
3 207 LYS n 
3 208 PRO n 
3 209 SER n 
3 210 ASN n 
3 211 THR n 
3 212 LYS n 
3 213 VAL n 
3 214 ASP n 
3 215 LYS n 
3 216 LYS n 
3 217 VAL n 
3 218 GLU n 
3 219 PRO n 
3 220 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? SHH ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'rosetta 2' ? ? ? 
? ? ? ? plasmid ? ? ? 'PET101/D-TOPO (INVITROGEN) WITH T7 promoter' ? ? 
2 1 sample ? ? ? human ? ?   ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ?           ? ? ? 
? ? ? ? ?       ? ? ? ?                                             ? ? 
3 1 sample ? ? ? human ? ?   ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ?           ? ? ? 
? ? ? ? ?       ? ? ? ?                                             ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP SHH_HUMAN Q15465 1 
;GFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNA
LAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAE
NSVAAKSGG
;
29 ? 
2 PDB 3MXW      3MXW   2 ? ?  ? 
3 PDB 3MXW      3MXW   3 ? ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3MXW A 1 ? 169 ? Q15465 29 ? 197 ? 29 197 
2 2 3MXW L 1 ? 214 ? 3MXW   1  ? 214 ? 1  214 
3 3 3MXW H 1 ? 220 ? 3MXW   1  ? 214 ? 1  214 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          3MXW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.29 
_exptl_crystal.density_percent_sol   46.39 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    
;protein solution (20 mM Hepes, pH 7.2, 0.1 M NaCl, 5 mM CaCl2) was mixed with equal volume of well solution (0.2 M lithium sulfate, 100 mM Hepes, pH 7.5, and 22% w/v PEG 4000), VAPOR DIFFUSION, HANGING DROP, temperature 292K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2009-01-28 
_diffrn_detector.details                'Single crystal, cylindrically bent, Si(220)' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Single crystal, cylindrically bent, Si(220)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97740 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.1' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97740 
# 
_reflns.entry_id                     3MXW 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            1.83 
_reflns.number_obs                   54683 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.068 
_reflns.pdbx_netI_over_sigmaI        16.4 
_reflns.B_iso_Wilson_estimate        19.6 
_reflns.pdbx_redundancy              4.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.83 
_reflns_shell.d_res_low              1.90 
_reflns_shell.percent_possible_all   90.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.464 
_reflns_shell.meanI_over_sigI_obs    2.2 
_reflns_shell.pdbx_redundancy        2.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4917 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3MXW 
_refine.ls_number_reflns_obs                     54255 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          -3.0 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.51 
_refine.ls_d_res_high                            1.83 
_refine.ls_percent_reflns_obs                    98.86 
_refine.ls_R_factor_obs                          0.18056 
_refine.ls_R_factor_all                          0.18056 
_refine.ls_R_factor_R_work                       0.17639 
_refine.ls_R_factor_R_free                       0.21844 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.1 
_refine.ls_number_reflns_R_free                  5441 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.961 
_refine.correlation_coeff_Fo_to_Fc_free          0.942 
_refine.B_iso_mean                               25.797 
_refine.aniso_B[1][1]                            -0.85 
_refine.aniso_B[2][2]                            0.54 
_refine.aniso_B[3][3]                            0.32 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB entry 1VHH, refined fab' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.133 
_refine.overall_SU_ML                            0.084 
_refine.overall_SU_B                             5.323 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4537 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         18 
_refine_hist.number_atoms_solvent             423 
_refine_hist.number_atoms_total               4978 
_refine_hist.d_res_high                       1.83 
_refine_hist.d_res_low                        47.51 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.011  0.022  ? 4708 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.255  1.951  ? 6389 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.486  5.000  ? 596  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   34.743 24.554 ? 202  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   11.538 15.000 ? 772  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   15.895 15.000 ? 20   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.088  0.200  ? 708  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.004  0.020  ? 3553 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.196  0.200  ? 2029 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.300  0.200  ? 3175 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.137  0.200  ? 408  'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      0.150  0.200  ? 2    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.183  0.200  ? 44   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.362  0.200  ? 25   'X-RAY DIFFRACTION' ? 
r_mcbond_it              2.596  2.500  ? 3035 'X-RAY DIFFRACTION' ? 
r_mcangle_it             3.460  5.000  ? 4752 'X-RAY DIFFRACTION' ? 
r_scbond_it              3.063  2.500  ? 1945 'X-RAY DIFFRACTION' ? 
r_scangle_it             4.446  5.000  ? 1630 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   25 
_refine_ls_shell.d_res_high                       1.830 
_refine_ls_shell.d_res_low                        1.868 
_refine_ls_shell.number_reflns_R_work             2548 
_refine_ls_shell.R_factor_R_work                  0.246 
_refine_ls_shell.percent_reflns_obs               87.84 
_refine_ls_shell.R_factor_R_free                  0.338 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             269 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3MXW 
_struct.title                     'Crystal structure Sonic hedgehog bound to the 5E1 fab fragment' 
_struct.pdbx_descriptor           'Sonic hedgehog protein, 5E1 light chain, 5E1 heavy chain' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3MXW 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
'antibody complex, fab fragment, metalloprotease, calcium binding, zinc hydrolase, development, morphogen, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
J N N 7 ? 
K N N 7 ? 
L N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 43  ? LEU A 48  ? GLU A 71  LEU A 76  5 ? 6  
HELX_P HELX_P2  2  GLY A 65  ? ASP A 67  ? GLY A 93  ASP A 95  5 ? 3  
HELX_P HELX_P3  3  THR A 71  ? TRP A 89  ? THR A 99  TRP A 117 1 ? 19 
HELX_P HELX_P4  4  SER A 110 ? GLY A 115 ? SER A 138 GLY A 143 5 ? 6  
HELX_P HELX_P5  5  ASP A 126 ? SER A 128 ? ASP A 154 SER A 156 5 ? 3  
HELX_P HELX_P6  6  LYS A 129 ? ALA A 140 ? LYS A 157 ALA A 168 1 ? 12 
HELX_P HELX_P7  7  ALA A 159 ? VAL A 163 ? ALA A 187 VAL A 191 5 ? 5  
HELX_P HELX_P8  8  GLN B 79  ? LEU B 83  ? GLN L 79  LEU L 83  5 ? 5  
HELX_P HELX_P9  9  SER B 121 ? SER B 127 ? SER L 121 SER L 127 1 ? 7  
HELX_P HELX_P10 10 LYS B 183 ? GLU B 187 ? LYS L 183 GLU L 187 1 ? 5  
HELX_P HELX_P11 11 THR C 28  ? GLU C 32  ? THR H 28  GLU H 32  5 ? 5  
HELX_P HELX_P12 12 GLN C 62  ? LYS C 65  ? GLN H 61  LYS H 64  5 ? 4  
HELX_P HELX_P13 13 ILE C 74  ? SER C 76  ? ILE H 73  SER H 75  5 ? 3  
HELX_P HELX_P14 14 THR C 87  ? SER C 91  ? THR H 83  SER H 87  5 ? 5  
HELX_P HELX_P15 15 SER C 162 ? ALA C 164 ? SER H 156 ALA H 158 5 ? 3  
HELX_P HELX_P16 16 SER C 193 ? LEU C 195 ? SER H 187 LEU H 189 5 ? 3  
HELX_P HELX_P17 17 LYS C 207 ? ASN C 210 ? LYS H 201 ASN H 204 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? B CYS 23  SG  ? ? ? 1_555 B CYS 88  SG ? ? L CYS 23  L CYS 88  1_555 ? ? ? ? ? ? ? 2.078 ? 
disulf2  disulf ? ? B CYS 134 SG  ? ? ? 1_555 B CYS 194 SG ? ? L CYS 134 L CYS 194 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf3  disulf ? ? C CYS 22  SG  ? ? ? 1_555 C CYS 96  SG ? ? H CYS 22  H CYS 92  1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf4  disulf ? ? C CYS 146 SG  ? ? ? 1_555 C CYS 202 SG ? ? H CYS 140 H CYS 196 1_555 ? ? ? ? ? ? ? 2.058 ? 
metalc1  metalc ? ? D ZN  .   ZN  ? ? ? 1_555 J HOH .   O  ? ? A ZN  400 A HOH 334 1_555 ? ? ? ? ? ? ? 1.854 ? 
metalc2  metalc ? ? A ASP 119 OD1 ? ? ? 1_555 D ZN  .   ZN ? ? A ASP 147 A ZN  400 1_555 ? ? ? ? ? ? ? 1.971 ? 
metalc3  metalc ? ? A HIS 112 NE2 ? ? ? 1_555 D ZN  .   ZN ? ? A HIS 140 A ZN  400 1_555 ? ? ? ? ? ? ? 2.068 ? 
metalc4  metalc ? ? A HIS 154 ND1 ? ? ? 1_555 D ZN  .   ZN ? ? A HIS 182 A ZN  400 1_555 ? ? ? ? ? ? ? 2.072 ? 
metalc5  metalc ? ? F CA  .   CA  ? ? ? 1_555 J HOH .   O  ? ? A CA  402 A HOH 373 1_555 ? ? ? ? ? ? ? 2.288 ? 
metalc6  metalc ? ? A ASP 101 OD1 ? ? ? 1_555 F CA  .   CA ? ? A ASP 129 A CA  402 1_555 ? ? ? ? ? ? ? 2.307 ? 
metalc7  metalc ? ? A ASP 103 OD2 ? ? ? 1_555 F CA  .   CA ? ? A ASP 131 A CA  402 1_555 ? ? ? ? ? ? ? 2.342 ? 
metalc8  metalc ? ? A GLU 62  OE2 ? ? ? 1_555 F CA  .   CA ? ? A GLU 90  A CA  402 1_555 ? ? ? ? ? ? ? 2.343 ? 
metalc9  metalc ? ? A GLU 98  OE1 ? ? ? 1_555 F CA  .   CA ? ? A GLU 126 A CA  402 1_555 ? ? ? ? ? ? ? 2.353 ? 
metalc10 metalc ? ? A GLU 98  OE2 ? ? ? 1_555 E CA  .   CA ? ? A GLU 126 A CA  401 1_555 ? ? ? ? ? ? ? 2.361 ? 
metalc11 metalc ? ? A GLU 61  OE2 ? ? ? 1_555 E CA  .   CA ? ? A GLU 89  A CA  401 1_555 ? ? ? ? ? ? ? 2.362 ? 
metalc12 metalc ? ? A ASP 67  OD2 ? ? ? 1_555 E CA  .   CA ? ? A ASP 95  A CA  401 1_555 ? ? ? ? ? ? ? 2.365 ? 
metalc13 metalc ? ? A THR 97  O   ? ? ? 1_555 E CA  .   CA ? ? A THR 125 A CA  401 1_555 ? ? ? ? ? ? ? 2.372 ? 
metalc14 metalc ? ? A GLU 98  OE2 ? ? ? 1_555 F CA  .   CA ? ? A GLU 126 A CA  402 1_555 ? ? ? ? ? ? ? 2.376 ? 
metalc15 metalc ? ? A GLU 62  OE2 ? ? ? 1_555 E CA  .   CA ? ? A GLU 90  A CA  401 1_555 ? ? ? ? ? ? ? 2.377 ? 
metalc16 metalc ? ? A GLU 61  OE1 ? ? ? 1_555 E CA  .   CA ? ? A GLU 89  A CA  401 1_555 ? ? ? ? ? ? ? 2.386 ? 
metalc17 metalc ? ? A ASP 67  OD1 ? ? ? 1_555 E CA  .   CA ? ? A ASP 95  A CA  401 1_555 ? ? ? ? ? ? ? 2.402 ? 
metalc18 metalc ? ? A GLU 62  OE1 ? ? ? 1_555 E CA  .   CA ? ? A GLU 90  A CA  401 1_555 ? ? ? ? ? ? ? 2.427 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ILE 20  A . ? ILE 48  A PRO 21  A ? PRO 49  A 1 -0.54 
2 THR 7   B . ? THR 7   L PRO 8   B ? PRO 8   L 1 -7.92 
3 SER 94  B . ? SER 94  L PRO 95  B ? PRO 95  L 1 1.47  
4 TYR 140 B . ? TYR 140 L PRO 141 B ? PRO 141 L 1 -0.68 
5 PHE 152 C . ? PHE 146 H PRO 153 C ? PRO 147 H 1 -4.74 
6 GLU 154 C . ? GLU 148 H PRO 155 C ? PRO 149 H 1 -1.41 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 4 ? 
D ? 6 ? 
E ? 4 ? 
F ? 4 ? 
G ? 4 ? 
H ? 4 ? 
I ? 6 ? 
J ? 4 ? 
K ? 4 ? 
L ? 4 ? 
M ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
I 4 5 ? anti-parallel 
I 5 6 ? anti-parallel 
J 1 2 ? parallel      
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 19  ? ILE A 20  ? PHE A 47  ILE A 48  
A 2 TRP A 144 ? SER A 149 ? TRP A 172 SER A 177 
A 3 HIS A 152 ? SER A 156 ? HIS A 180 SER A 184 
A 4 ALA A 117 ? THR A 122 ? ALA A 145 THR A 150 
A 5 LEU A 94  ? GLU A 98  ? LEU A 122 GLU A 126 
A 6 ILE A 56  ? PHE A 58  ? ILE A 84  PHE A 86  
B 1 THR A 49  ? PRO A 50  ? THR A 77  PRO A 78  
B 2 LEU A 69  ? MET A 70  ? LEU A 97  MET A 98  
C 1 MET B 4   ? THR B 7   ? MET L 4   THR L 7   
C 2 VAL B 19  ? ALA B 25  ? VAL L 19  ALA L 25  
C 3 ASP B 70  ? ILE B 75  ? ASP L 70  ILE L 75  
C 4 PHE B 62  ? TYR B 67  ? PHE L 62  TYR L 67  
D 1 PHE B 10  ? SER B 14  ? PHE L 10  SER L 14  
D 2 THR B 102 ? LYS B 107 ? THR L 102 LYS L 107 
D 3 ALA B 84  ? GLN B 90  ? ALA L 84  GLN L 90  
D 4 LEU B 33  ? GLN B 38  ? LEU L 33  GLN L 38  
D 5 LYS B 45  ? TYR B 49  ? LYS L 45  TYR L 49  
D 6 ASN B 53  ? ARG B 54  ? ASN L 53  ARG L 54  
E 1 PHE B 10  ? SER B 14  ? PHE L 10  SER L 14  
E 2 THR B 102 ? LYS B 107 ? THR L 102 LYS L 107 
E 3 ALA B 84  ? GLN B 90  ? ALA L 84  GLN L 90  
E 4 THR B 97  ? PHE B 98  ? THR L 97  PHE L 98  
F 1 SER B 114 ? PHE B 118 ? SER L 114 PHE L 118 
F 2 THR B 129 ? PHE B 139 ? THR L 129 PHE L 139 
F 3 TYR B 173 ? SER B 182 ? TYR L 173 SER L 182 
F 4 SER B 159 ? VAL B 163 ? SER L 159 VAL L 163 
G 1 ALA B 153 ? LEU B 154 ? ALA L 153 LEU L 154 
G 2 LYS B 145 ? VAL B 150 ? LYS L 145 VAL L 150 
G 3 VAL B 191 ? THR B 197 ? VAL L 191 THR L 197 
G 4 VAL B 205 ? ASN B 210 ? VAL L 205 ASN L 210 
H 1 GLN C 3   ? GLN C 6   ? GLN H 3   GLN H 6   
H 2 VAL C 18  ? SER C 25  ? VAL H 18  SER H 25  
H 3 THR C 78  ? LEU C 83  ? THR H 77  LEU H 82  
H 4 ALA C 68  ? ASP C 73  ? ALA H 67  ASP H 72  
I 1 GLU C 10  ? VAL C 12  ? GLU H 10  VAL H 12  
I 2 THR C 113 ? VAL C 117 ? THR H 107 VAL H 111 
I 3 ALA C 92  ? ASP C 99  ? ALA H 88  ASP H 95  
I 4 LEU C 34  ? GLN C 39  ? LEU H 34  GLN H 39  
I 5 LEU C 45  ? ILE C 51  ? LEU H 45  ILE H 51  
I 6 THR C 58  ? TYR C 60  ? THR H 57  TYR H 59  
J 1 GLU C 10  ? VAL C 12  ? GLU H 10  VAL H 12  
J 2 THR C 113 ? VAL C 117 ? THR H 107 VAL H 111 
J 3 ALA C 92  ? ASP C 99  ? ALA H 88  ASP H 95  
J 4 PHE C 106 K TRP C 109 ? PHE H 100 TRP H 103 
K 1 SER C 126 ? LEU C 130 ? SER H 120 LEU H 124 
K 2 THR C 141 ? TYR C 151 ? THR H 135 TYR H 145 
K 3 TYR C 182 ? PRO C 191 ? TYR H 176 PRO H 185 
K 4 VAL C 169 ? THR C 171 ? VAL H 163 THR H 165 
L 1 THR C 137 ? SER C 138 ? THR H 131 SER H 132 
L 2 THR C 141 ? TYR C 151 ? THR H 135 TYR H 145 
L 3 TYR C 182 ? PRO C 191 ? TYR H 176 PRO H 185 
L 4 VAL C 175 ? LEU C 176 ? VAL H 169 LEU H 170 
M 1 THR C 157 ? TRP C 160 ? THR H 151 TRP H 154 
M 2 ILE C 201 ? HIS C 206 ? ILE H 195 HIS H 200 
M 3 THR C 211 ? LYS C 216 ? THR H 205 LYS H 210 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 20  ? N ILE A 48  O VAL A 145 ? O VAL A 173 
A 2 3 N TYR A 146 ? N TYR A 174 O HIS A 154 ? O HIS A 182 
A 3 4 O CYS A 155 ? O CYS A 183 N VAL A 118 ? N VAL A 146 
A 4 5 O ASP A 119 ? O ASP A 147 N THR A 97  ? N THR A 125 
A 5 6 O VAL A 96  ? O VAL A 124 N ILE A 57  ? N ILE A 85  
B 1 2 N THR A 49  ? N THR A 77  O MET A 70  ? O MET A 98  
C 1 2 N THR B 7   ? N THR L 7   O THR B 22  ? O THR L 22  
C 2 3 N ILE B 21  ? N ILE L 21  O PHE B 73  ? O PHE L 73  
C 3 4 O THR B 74  ? O THR L 74  N THR B 63  ? N THR L 63  
D 1 2 N LEU B 11  ? N LEU L 11  O GLU B 105 ? O GLU L 105 
D 2 3 O VAL B 104 ? O VAL L 104 N ALA B 84  ? N ALA L 84  
D 3 4 O GLN B 89  ? O GLN L 89  N THR B 34  ? N THR L 34  
D 4 5 N TRP B 35  ? N TRP L 35  O LEU B 47  ? O LEU L 47  
D 5 6 N TYR B 49  ? N TYR L 49  O ASN B 53  ? O ASN L 53  
E 1 2 N LEU B 11  ? N LEU L 11  O GLU B 105 ? O GLU L 105 
E 2 3 O VAL B 104 ? O VAL L 104 N ALA B 84  ? N ALA L 84  
E 3 4 N GLN B 90  ? N GLN L 90  O THR B 97  ? O THR L 97  
F 1 2 N SER B 114 ? N SER L 114 O ASN B 137 ? O ASN L 137 
F 2 3 N VAL B 132 ? N VAL L 132 O LEU B 179 ? O LEU L 179 
F 3 4 O THR B 178 ? O THR L 178 N GLN B 160 ? N GLN L 160 
G 1 2 O ALA B 153 ? O ALA L 153 N VAL B 150 ? N VAL L 150 
G 2 3 N GLN B 147 ? N GLN L 147 O GLU B 195 ? O GLU L 195 
G 3 4 N VAL B 196 ? N VAL L 196 O VAL B 205 ? O VAL L 205 
H 1 2 N GLN C 5   ? N GLN H 5   O LYS C 23  ? O LYS H 23  
H 2 3 N CYS C 22  ? N CYS H 22  O ALA C 79  ? O ALA H 78  
H 3 4 O THR C 78  ? O THR H 77  N ASP C 73  ? N ASP H 72  
I 1 2 N GLU C 10  ? N GLU H 10  O THR C 116 ? O THR H 110 
I 2 3 O VAL C 115 ? O VAL H 109 N ALA C 92  ? N ALA H 88  
I 3 4 O ALA C 97  ? O ALA H 93  N HIS C 35  ? N HIS H 35  
I 4 5 N TRP C 36  ? N TRP H 36  O ILE C 48  ? O ILE H 48  
I 5 6 N VAL C 50  ? N VAL H 50  O ASN C 59  ? O ASN H 58  
J 1 2 N GLU C 10  ? N GLU H 10  O THR C 116 ? O THR H 110 
J 2 3 O VAL C 115 ? O VAL H 109 N ALA C 92  ? N ALA H 88  
J 3 4 N ARG C 98  ? N ARG H 94  O TYR C 108 ? O TYR H 102 
K 1 2 N PHE C 128 ? N PHE H 122 O LEU C 147 ? O LEU H 141 
K 2 3 N VAL C 148 ? N VAL H 142 O LEU C 184 ? O LEU H 178 
K 3 4 O VAL C 187 ? O VAL H 181 N HIS C 170 ? N HIS H 164 
L 1 2 N SER C 138 ? N SER H 132 O THR C 141 ? O THR H 135 
L 2 3 N VAL C 148 ? N VAL H 142 O LEU C 184 ? O LEU H 178 
L 3 4 O SER C 183 ? O SER H 177 N VAL C 175 ? N VAL H 169 
M 1 2 N SER C 159 ? N SER H 153 O ASN C 203 ? O ASN H 197 
M 2 3 N VAL C 204 ? N VAL H 198 O VAL C 213 ? O VAL H 207 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE ZN A 400'  
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 401'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 402'  
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 A 1'   
AC5 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE SO4 A 3'   
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 L 215' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  SO4 H .   ? SO4 A 3   . ? 1_555 ? 
2  AC1 6  HIS A 112 ? HIS A 140 . ? 1_555 ? 
3  AC1 6  ASP A 119 ? ASP A 147 . ? 1_555 ? 
4  AC1 6  GLU A 148 ? GLU A 176 . ? 1_555 ? 
5  AC1 6  HIS A 154 ? HIS A 182 . ? 1_555 ? 
6  AC1 6  HOH J .   ? HOH A 334 . ? 1_555 ? 
7  AC2 5  GLU A 61  ? GLU A 89  . ? 1_555 ? 
8  AC2 5  GLU A 62  ? GLU A 90  . ? 1_555 ? 
9  AC2 5  ASP A 67  ? ASP A 95  . ? 1_555 ? 
10 AC2 5  THR A 97  ? THR A 125 . ? 1_555 ? 
11 AC2 5  GLU A 98  ? GLU A 126 . ? 1_555 ? 
12 AC3 5  GLU A 62  ? GLU A 90  . ? 1_555 ? 
13 AC3 5  GLU A 98  ? GLU A 126 . ? 1_555 ? 
14 AC3 5  ASP A 101 ? ASP A 129 . ? 1_555 ? 
15 AC3 5  ASP A 103 ? ASP A 131 . ? 1_555 ? 
16 AC3 5  HOH J .   ? HOH A 373 . ? 1_555 ? 
17 AC4 2  ARG A 73  ? ARG A 101 . ? 1_555 ? 
18 AC4 2  LYS A 77  ? LYS A 105 . ? 1_555 ? 
19 AC5 10 HOH J .   ? HOH A 7   . ? 1_555 ? 
20 AC5 10 HIS A 106 ? HIS A 134 . ? 1_555 ? 
21 AC5 10 SER A 107 ? SER A 135 . ? 1_555 ? 
22 AC5 10 SER A 110 ? SER A 138 . ? 1_555 ? 
23 AC5 10 HIS A 112 ? HIS A 140 . ? 1_555 ? 
24 AC5 10 GLU A 148 ? GLU A 176 . ? 1_555 ? 
25 AC5 10 HIS A 154 ? HIS A 182 . ? 1_555 ? 
26 AC5 10 HOH J .   ? HOH A 334 . ? 1_555 ? 
27 AC5 10 ZN  D .   ? ZN  A 400 . ? 1_555 ? 
28 AC5 10 HOH J .   ? HOH A 436 . ? 1_555 ? 
29 AC6 5  LYS B 39  ? LYS L 39  . ? 1_555 ? 
30 AC6 5  GLN B 42  ? GLN L 42  . ? 1_555 ? 
31 AC6 5  LYS B 45  ? LYS L 45  . ? 1_555 ? 
32 AC6 5  HOH K .   ? HOH L 256 . ? 1_555 ? 
33 AC6 5  HOH K .   ? HOH L 446 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3MXW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3MXW 
_atom_sites.fract_transf_matrix[1][1]   0.016582 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011044 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008955 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LEU A 1 11  ? -15.759 -15.489 66.157  1.00 34.45 ? 39  LEU A N   1 
ATOM   2    C  CA  . LEU A 1 11  ? -15.028 -15.413 64.850  1.00 37.21 ? 39  LEU A CA  1 
ATOM   3    C  C   . LEU A 1 11  ? -15.980 -15.720 63.701  1.00 32.90 ? 39  LEU A C   1 
ATOM   4    O  O   . LEU A 1 11  ? -16.420 -16.859 63.545  1.00 38.48 ? 39  LEU A O   1 
ATOM   5    C  CB  . LEU A 1 11  ? -13.848 -16.396 64.822  1.00 38.36 ? 39  LEU A CB  1 
ATOM   6    C  CG  . LEU A 1 11  ? -12.643 -16.202 65.749  1.00 40.12 ? 39  LEU A CG  1 
ATOM   7    C  CD1 . LEU A 1 11  ? -11.496 -17.068 65.263  1.00 41.28 ? 39  LEU A CD1 1 
ATOM   8    C  CD2 . LEU A 1 11  ? -12.206 -14.739 65.839  1.00 41.80 ? 39  LEU A CD2 1 
ATOM   9    N  N   . THR A 1 12  ? -16.328 -14.701 62.920  1.00 29.38 ? 40  THR A N   1 
ATOM   10   C  CA  . THR A 1 12  ? -17.290 -14.885 61.835  1.00 26.22 ? 40  THR A CA  1 
ATOM   11   C  C   . THR A 1 12  ? -16.566 -14.872 60.489  1.00 26.27 ? 40  THR A C   1 
ATOM   12   O  O   . THR A 1 12  ? -15.621 -14.094 60.290  1.00 26.58 ? 40  THR A O   1 
ATOM   13   C  CB  . THR A 1 12  ? -18.447 -13.830 61.847  1.00 32.20 ? 40  THR A CB  1 
ATOM   14   O  OG1 . THR A 1 12  ? -17.924 -12.527 61.576  1.00 37.55 ? 40  THR A OG1 1 
ATOM   15   C  CG2 . THR A 1 12  ? -19.174 -13.811 63.190  1.00 29.70 ? 40  THR A CG2 1 
ATOM   16   N  N   . PRO A 1 13  ? -16.986 -15.743 59.560  1.00 25.30 ? 41  PRO A N   1 
ATOM   17   C  CA  . PRO A 1 13  ? -16.266 -15.786 58.283  1.00 23.02 ? 41  PRO A CA  1 
ATOM   18   C  C   . PRO A 1 13  ? -16.447 -14.488 57.515  1.00 23.86 ? 41  PRO A C   1 
ATOM   19   O  O   . PRO A 1 13  ? -17.482 -13.832 57.661  1.00 26.08 ? 41  PRO A O   1 
ATOM   20   C  CB  . PRO A 1 13  ? -16.964 -16.919 57.516  1.00 24.98 ? 41  PRO A CB  1 
ATOM   21   C  CG  . PRO A 1 13  ? -17.749 -17.691 58.550  1.00 31.22 ? 41  PRO A CG  1 
ATOM   22   C  CD  . PRO A 1 13  ? -18.116 -16.692 59.605  1.00 27.08 ? 41  PRO A CD  1 
ATOM   23   N  N   . LEU A 1 14  ? -15.469 -14.127 56.695  1.00 25.09 ? 42  LEU A N   1 
ATOM   24   C  CA  . LEU A 1 14  ? -15.658 -13.013 55.764  1.00 22.50 ? 42  LEU A CA  1 
ATOM   25   C  C   . LEU A 1 14  ? -16.634 -13.420 54.673  1.00 21.59 ? 42  LEU A C   1 
ATOM   26   O  O   . LEU A 1 14  ? -16.652 -14.575 54.226  1.00 24.78 ? 42  LEU A O   1 
ATOM   27   C  CB  . LEU A 1 14  ? -14.315 -12.554 55.148  1.00 21.68 ? 42  LEU A CB  1 
ATOM   28   C  CG  . LEU A 1 14  ? -13.516 -11.501 55.937  1.00 26.62 ? 42  LEU A CG  1 
ATOM   29   C  CD1 . LEU A 1 14  ? -12.956 -12.054 57.283  1.00 25.48 ? 42  LEU A CD1 1 
ATOM   30   C  CD2 . LEU A 1 14  ? -12.387 -10.911 55.069  1.00 26.07 ? 42  LEU A CD2 1 
ATOM   31   N  N   . ALA A 1 15  ? -17.436 -12.460 54.242  1.00 22.71 ? 43  ALA A N   1 
ATOM   32   C  CA  . ALA A 1 15  ? -18.307 -12.644 53.095  1.00 22.87 ? 43  ALA A CA  1 
ATOM   33   C  C   . ALA A 1 15  ? -17.493 -12.591 51.810  1.00 25.35 ? 43  ALA A C   1 
ATOM   34   O  O   . ALA A 1 15  ? -16.415 -11.993 51.767  1.00 21.59 ? 43  ALA A O   1 
ATOM   35   C  CB  . ALA A 1 15  ? -19.364 -11.574 53.084  1.00 20.72 ? 43  ALA A CB  1 
ATOM   36   N  N   . TYR A 1 16  ? -18.023 -13.203 50.756  1.00 24.39 ? 44  TYR A N   1 
ATOM   37   C  CA  . TYR A 1 16  ? -17.401 -13.099 49.436  1.00 26.50 ? 44  TYR A CA  1 
ATOM   38   C  C   . TYR A 1 16  ? -17.224 -11.630 49.002  1.00 21.23 ? 44  TYR A C   1 
ATOM   39   O  O   . TYR A 1 16  ? -18.167 -10.833 49.103  1.00 24.57 ? 44  TYR A O   1 
ATOM   40   C  CB  . TYR A 1 16  ? -18.227 -13.882 48.413  1.00 25.56 ? 44  TYR A CB  1 
ATOM   41   C  CG  . TYR A 1 16  ? -17.586 -13.918 47.052  1.00 24.35 ? 44  TYR A CG  1 
ATOM   42   C  CD1 . TYR A 1 16  ? -16.265 -14.345 46.901  1.00 23.57 ? 44  TYR A CD1 1 
ATOM   43   C  CD2 . TYR A 1 16  ? -18.294 -13.538 45.912  1.00 28.12 ? 44  TYR A CD2 1 
ATOM   44   C  CE1 . TYR A 1 16  ? -15.661 -14.371 45.648  1.00 24.91 ? 44  TYR A CE1 1 
ATOM   45   C  CE2 . TYR A 1 16  ? -17.685 -13.562 44.650  1.00 23.30 ? 44  TYR A CE2 1 
ATOM   46   C  CZ  . TYR A 1 16  ? -16.375 -13.999 44.535  1.00 24.45 ? 44  TYR A CZ  1 
ATOM   47   O  OH  . TYR A 1 16  ? -15.747 -14.039 43.309  1.00 26.39 ? 44  TYR A OH  1 
ATOM   48   N  N   . LYS A 1 17  ? -16.015 -11.302 48.534  1.00 21.74 ? 45  LYS A N   1 
ATOM   49   C  CA  . LYS A 1 17  ? -15.555 -9.932  48.150  1.00 18.34 ? 45  LYS A CA  1 
ATOM   50   C  C   . LYS A 1 17  ? -15.330 -8.965  49.310  1.00 21.78 ? 45  LYS A C   1 
ATOM   51   O  O   . LYS A 1 17  ? -15.018 -7.796  49.096  1.00 23.91 ? 45  LYS A O   1 
ATOM   52   C  CB  . LYS A 1 17  ? -16.447 -9.272  47.090  1.00 20.90 ? 45  LYS A CB  1 
ATOM   53   C  CG  . LYS A 1 17  ? -16.554 -10.053 45.768  1.00 22.17 ? 45  LYS A CG  1 
ATOM   54   C  CD  . LYS A 1 17  ? -15.195 -10.177 45.065  1.00 21.23 ? 45  LYS A CD  1 
ATOM   55   C  CE  . LYS A 1 17  ? -15.381 -10.707 43.649  1.00 24.58 ? 45  LYS A CE  1 
ATOM   56   N  NZ  . LYS A 1 17  ? -14.078 -10.917 42.942  1.00 25.03 ? 45  LYS A NZ  1 
ATOM   57   N  N   . GLN A 1 18  ? -15.513 -9.428  50.538  1.00 19.38 ? 46  GLN A N   1 
ATOM   58   C  CA  . GLN A 1 18  ? -15.263 -8.569  51.691  1.00 22.59 ? 46  GLN A CA  1 
ATOM   59   C  C   . GLN A 1 18  ? -13.754 -8.428  51.896  1.00 21.24 ? 46  GLN A C   1 
ATOM   60   O  O   . GLN A 1 18  ? -12.995 -9.370  51.659  1.00 22.52 ? 46  GLN A O   1 
ATOM   61   C  CB  . GLN A 1 18  ? -15.905 -9.148  52.961  1.00 20.73 ? 46  GLN A CB  1 
ATOM   62   C  CG  . GLN A 1 18  ? -15.644 -8.311  54.246  1.00 22.19 ? 46  GLN A CG  1 
ATOM   63   C  CD  . GLN A 1 18  ? -16.476 -8.787  55.427  1.00 26.22 ? 46  GLN A CD  1 
ATOM   64   O  OE1 . GLN A 1 18  ? -17.034 -9.879  55.394  1.00 21.09 ? 46  GLN A OE1 1 
ATOM   65   N  NE2 . GLN A 1 18  ? -16.580 -7.953  56.473  1.00 24.77 ? 46  GLN A NE2 1 
ATOM   66   N  N   . PHE A 1 19  ? -13.343 -7.246  52.350  1.00 22.18 ? 47  PHE A N   1 
ATOM   67   C  CA  . PHE A 1 19  ? -11.976 -7.010  52.792  1.00 24.00 ? 47  PHE A CA  1 
ATOM   68   C  C   . PHE A 1 19  ? -11.957 -6.333  54.149  1.00 23.36 ? 47  PHE A C   1 
ATOM   69   O  O   . PHE A 1 19  ? -12.827 -5.511  54.464  1.00 21.88 ? 47  PHE A O   1 
ATOM   70   C  CB  . PHE A 1 19  ? -11.166 -6.190  51.770  1.00 22.84 ? 47  PHE A CB  1 
ATOM   71   C  CG  . PHE A 1 19  ? -11.895 -4.998  51.215  1.00 24.14 ? 47  PHE A CG  1 
ATOM   72   C  CD1 . PHE A 1 19  ? -12.648 -5.116  50.043  1.00 24.70 ? 47  PHE A CD1 1 
ATOM   73   C  CD2 . PHE A 1 19  ? -11.817 -3.745  51.847  1.00 23.10 ? 47  PHE A CD2 1 
ATOM   74   C  CE1 . PHE A 1 19  ? -13.334 -4.001  49.513  1.00 27.78 ? 47  PHE A CE1 1 
ATOM   75   C  CE2 . PHE A 1 19  ? -12.489 -2.632  51.326  1.00 24.43 ? 47  PHE A CE2 1 
ATOM   76   C  CZ  . PHE A 1 19  ? -13.247 -2.761  50.147  1.00 28.03 ? 47  PHE A CZ  1 
ATOM   77   N  N   . ILE A 1 20  ? -10.956 -6.697  54.942  1.00 22.04 ? 48  ILE A N   1 
ATOM   78   C  CA  . ILE A 1 20  ? -10.765 -6.148  56.286  1.00 20.87 ? 48  ILE A CA  1 
ATOM   79   C  C   . ILE A 1 20  ? -9.276  -5.776  56.480  1.00 23.22 ? 48  ILE A C   1 
ATOM   80   O  O   . ILE A 1 20  ? -8.388  -6.609  56.197  1.00 23.20 ? 48  ILE A O   1 
ATOM   81   C  CB  . ILE A 1 20  ? -11.189 -7.186  57.358  1.00 20.90 ? 48  ILE A CB  1 
ATOM   82   C  CG1 . ILE A 1 20  ? -12.696 -7.467  57.268  1.00 22.78 ? 48  ILE A CG1 1 
ATOM   83   C  CG2 . ILE A 1 20  ? -10.738 -6.761  58.751  1.00 20.54 ? 48  ILE A CG2 1 
ATOM   84   C  CD1 . ILE A 1 20  ? -13.164 -8.575  58.209  1.00 25.61 ? 48  ILE A CD1 1 
ATOM   85   N  N   . PRO A 1 21  ? -8.998  -4.547  56.980  1.00 24.93 ? 49  PRO A N   1 
ATOM   86   C  CA  . PRO A 1 21  ? -10.004 -3.525  57.346  1.00 21.67 ? 49  PRO A CA  1 
ATOM   87   C  C   . PRO A 1 21  ? -10.758 -3.056  56.112  1.00 23.78 ? 49  PRO A C   1 
ATOM   88   O  O   . PRO A 1 21  ? -10.282 -3.266  54.983  1.00 21.30 ? 49  PRO A O   1 
ATOM   89   C  CB  . PRO A 1 21  ? -9.159  -2.390  57.942  1.00 22.67 ? 49  PRO A CB  1 
ATOM   90   C  CG  . PRO A 1 21  ? -7.813  -2.557  57.309  1.00 26.08 ? 49  PRO A CG  1 
ATOM   91   C  CD  . PRO A 1 21  ? -7.629  -4.060  57.233  1.00 21.77 ? 49  PRO A CD  1 
ATOM   92   N  N   . ASN A 1 22  ? -11.920 -2.440  56.321  1.00 23.87 ? 50  ASN A N   1 
ATOM   93   C  CA  . ASN A 1 22  ? -12.810 -2.063  55.225  1.00 23.71 ? 50  ASN A CA  1 
ATOM   94   C  C   . ASN A 1 22  ? -12.359 -0.765  54.552  1.00 26.18 ? 50  ASN A C   1 
ATOM   95   O  O   . ASN A 1 22  ? -13.108 0.218   54.507  1.00 25.08 ? 50  ASN A O   1 
ATOM   96   C  CB  . ASN A 1 22  ? -14.263 -1.930  55.728  1.00 24.62 ? 50  ASN A CB  1 
ATOM   97   C  CG  . ASN A 1 22  ? -15.299 -1.992  54.594  1.00 28.26 ? 50  ASN A CG  1 
ATOM   98   O  OD1 . ASN A 1 22  ? -14.990 -2.409  53.473  1.00 26.87 ? 50  ASN A OD1 1 
ATOM   99   N  ND2 . ASN A 1 22  ? -16.545 -1.591  54.898  1.00 23.12 ? 50  ASN A ND2 1 
ATOM   100  N  N   . VAL A 1 23  ? -11.128 -0.778  54.041  1.00 22.52 ? 51  VAL A N   1 
ATOM   101  C  CA  . VAL A 1 23  ? -10.537 0.348   53.293  1.00 23.61 ? 51  VAL A CA  1 
ATOM   102  C  C   . VAL A 1 23  ? -9.664  -0.240  52.193  1.00 23.64 ? 51  VAL A C   1 
ATOM   103  O  O   . VAL A 1 23  ? -9.289  -1.424  52.268  1.00 24.84 ? 51  VAL A O   1 
ATOM   104  C  CB  . VAL A 1 23  ? -9.643  1.240   54.183  1.00 21.48 ? 51  VAL A CB  1 
ATOM   105  C  CG1 . VAL A 1 23  ? -10.480 2.070   55.164  1.00 23.15 ? 51  VAL A CG1 1 
ATOM   106  C  CG2 . VAL A 1 23  ? -8.575  0.393   54.908  1.00 22.90 ? 51  VAL A CG2 1 
ATOM   107  N  N   . ALA A 1 24  ? -9.303  0.569   51.195  1.00 22.19 ? 52  ALA A N   1 
ATOM   108  C  CA  . ALA A 1 24  ? -8.437  0.078   50.109  1.00 23.57 ? 52  ALA A CA  1 
ATOM   109  C  C   . ALA A 1 24  ? -7.099  -0.457  50.639  1.00 20.63 ? 52  ALA A C   1 
ATOM   110  O  O   . ALA A 1 24  ? -6.532  0.095   51.591  1.00 22.26 ? 52  ALA A O   1 
ATOM   111  C  CB  . ALA A 1 24  ? -8.203  1.172   49.075  1.00 21.93 ? 52  ALA A CB  1 
ATOM   112  N  N   . GLU A 1 25  ? -6.610  -1.526  50.011  1.00 19.68 ? 53  GLU A N   1 
ATOM   113  C  CA  . GLU A 1 25  ? -5.370  -2.194  50.398  1.00 20.76 ? 53  GLU A CA  1 
ATOM   114  C  C   . GLU A 1 25  ? -4.194  -1.255  50.619  1.00 22.11 ? 53  GLU A C   1 
ATOM   115  O  O   . GLU A 1 25  ? -3.431  -1.415  51.582  1.00 20.81 ? 53  GLU A O   1 
ATOM   116  C  CB  . GLU A 1 25  ? -4.968  -3.215  49.334  1.00 22.83 ? 53  GLU A CB  1 
ATOM   117  C  CG  . GLU A 1 25  ? -3.685  -3.983  49.695  1.00 23.05 ? 53  GLU A CG  1 
ATOM   118  C  CD  . GLU A 1 25  ? -3.355  -5.072  48.706  1.00 23.98 ? 53  GLU A CD  1 
ATOM   119  O  OE1 . GLU A 1 25  ? -3.567  -4.873  47.489  1.00 25.16 ? 53  GLU A OE1 1 
ATOM   120  O  OE2 . GLU A 1 25  ? -2.876  -6.129  49.149  1.00 22.49 ? 53  GLU A OE2 1 
ATOM   121  N  N   . LYS A 1 26  ? -4.040  -0.289  49.715  1.00 23.56 ? 54  LYS A N   1 
ATOM   122  C  CA  . LYS A 1 26  ? -2.849  0.552   49.705  1.00 24.69 ? 54  LYS A CA  1 
ATOM   123  C  C   . LYS A 1 26  ? -2.970  1.783   50.612  1.00 24.23 ? 54  LYS A C   1 
ATOM   124  O  O   . LYS A 1 26  ? -2.091  2.660   50.599  1.00 22.63 ? 54  LYS A O   1 
ATOM   125  C  CB  . LYS A 1 26  ? -2.487  0.964   48.275  1.00 30.17 ? 54  LYS A CB  1 
ATOM   126  C  CG  . LYS A 1 26  ? -2.434  -0.175  47.271  1.00 32.95 ? 54  LYS A CG  1 
ATOM   127  C  CD  . LYS A 1 26  ? -1.058  -0.734  47.026  1.00 36.36 ? 54  LYS A CD  1 
ATOM   128  C  CE  . LYS A 1 26  ? -1.121  -1.860  45.978  1.00 36.10 ? 54  LYS A CE  1 
ATOM   129  N  NZ  . LYS A 1 26  ? -1.497  -1.364  44.622  1.00 36.38 ? 54  LYS A NZ  1 
ATOM   130  N  N   . THR A 1 27  ? -4.045  1.861   51.400  1.00 22.07 ? 55  THR A N   1 
ATOM   131  C  CA  . THR A 1 27  ? -4.227  3.010   52.276  1.00 25.03 ? 55  THR A CA  1 
ATOM   132  C  C   . THR A 1 27  ? -3.469  2.775   53.580  1.00 22.80 ? 55  THR A C   1 
ATOM   133  O  O   . THR A 1 27  ? -3.139  1.628   53.908  1.00 20.92 ? 55  THR A O   1 
ATOM   134  C  CB  . THR A 1 27  ? -5.715  3.345   52.552  1.00 25.82 ? 55  THR A CB  1 
ATOM   135  O  OG1 . THR A 1 27  ? -6.351  2.234   53.181  1.00 26.85 ? 55  THR A OG1 1 
ATOM   136  C  CG2 . THR A 1 27  ? -6.451  3.711   51.265  1.00 26.36 ? 55  THR A CG2 1 
ATOM   137  N  N   . LEU A 1 28  ? -3.211  3.856   54.314  1.00 21.67 ? 56  LEU A N   1 
ATOM   138  C  CA  . LEU A 1 28  ? -2.388  3.804   55.523  1.00 21.19 ? 56  LEU A CA  1 
ATOM   139  C  C   . LEU A 1 28  ? -2.944  2.850   56.591  1.00 22.42 ? 56  LEU A C   1 
ATOM   140  O  O   . LEU A 1 28  ? -2.178  2.148   57.255  1.00 21.60 ? 56  LEU A O   1 
ATOM   141  C  CB  . LEU A 1 28  ? -2.161  5.219   56.092  1.00 20.75 ? 56  LEU A CB  1 
ATOM   142  C  CG  . LEU A 1 28  ? -1.116  5.378   57.202  1.00 19.84 ? 56  LEU A CG  1 
ATOM   143  C  CD1 . LEU A 1 28  ? 0.204   4.748   56.803  1.00 23.36 ? 56  LEU A CD1 1 
ATOM   144  C  CD2 . LEU A 1 28  ? -0.922  6.850   57.546  1.00 17.84 ? 56  LEU A CD2 1 
ATOM   145  N  N   . GLY A 1 29  ? -4.266  2.794   56.733  1.00 27.51 ? 57  GLY A N   1 
ATOM   146  C  CA  . GLY A 1 29  ? -4.886  1.868   57.699  1.00 25.27 ? 57  GLY A CA  1 
ATOM   147  C  C   . GLY A 1 29  ? -4.736  0.385   57.372  1.00 24.37 ? 57  GLY A C   1 
ATOM   148  O  O   . GLY A 1 29  ? -4.924  -0.478  58.234  1.00 27.43 ? 57  GLY A O   1 
ATOM   149  N  N   . ALA A 1 30  ? -4.395  0.077   56.128  1.00 22.48 ? 58  ALA A N   1 
ATOM   150  C  CA  . ALA A 1 30  ? -4.303  -1.304  55.690  1.00 22.28 ? 58  ALA A CA  1 
ATOM   151  C  C   . ALA A 1 30  ? -2.829  -1.651  55.441  1.00 20.69 ? 58  ALA A C   1 
ATOM   152  O  O   . ALA A 1 30  ? -2.001  -1.551  56.366  1.00 22.47 ? 58  ALA A O   1 
ATOM   153  C  CB  . ALA A 1 30  ? -5.177  -1.526  54.440  1.00 20.87 ? 58  ALA A CB  1 
ATOM   154  N  N   . SER A 1 31  ? -2.484  -2.006  54.203  1.00 24.61 ? 59  SER A N   1 
ATOM   155  C  CA  . SER A 1 31  ? -1.120  -2.452  53.887  1.00 21.50 ? 59  SER A CA  1 
ATOM   156  C  C   . SER A 1 31  ? -0.190  -1.324  53.434  1.00 24.49 ? 59  SER A C   1 
ATOM   157  O  O   . SER A 1 31  ? 1.032   -1.477  53.466  1.00 21.64 ? 59  SER A O   1 
ATOM   158  C  CB  . SER A 1 31  ? -1.136  -3.604  52.876  1.00 22.63 ? 59  SER A CB  1 
ATOM   159  O  OG  . SER A 1 31  ? -1.603  -4.793  53.506  1.00 20.51 ? 59  SER A OG  1 
ATOM   160  N  N   . GLY A 1 32  ? -0.765  -0.195  53.027  1.00 22.34 ? 60  GLY A N   1 
ATOM   161  C  CA  . GLY A 1 32  ? 0.025   0.971   52.617  1.00 21.24 ? 60  GLY A CA  1 
ATOM   162  C  C   . GLY A 1 32  ? 0.525   0.861   51.188  1.00 22.61 ? 60  GLY A C   1 
ATOM   163  O  O   . GLY A 1 32  ? 0.297   -0.150  50.520  1.00 20.40 ? 60  GLY A O   1 
ATOM   164  N  N   . ARG A 1 33  ? 1.235   1.891   50.732  1.00 20.04 ? 61  ARG A N   1 
ATOM   165  C  CA  . ARG A 1 33  ? 1.599   2.041   49.320  1.00 21.52 ? 61  ARG A CA  1 
ATOM   166  C  C   . ARG A 1 33  ? 2.535   0.966   48.787  1.00 21.88 ? 61  ARG A C   1 
ATOM   167  O  O   . ARG A 1 33  ? 3.364   0.412   49.516  1.00 22.46 ? 61  ARG A O   1 
ATOM   168  C  CB  . ARG A 1 33  ? 2.199   3.429   49.037  1.00 21.23 ? 61  ARG A CB  1 
ATOM   169  C  CG  . ARG A 1 33  ? 1.169   4.554   49.000  1.00 22.18 ? 61  ARG A CG  1 
ATOM   170  C  CD  . ARG A 1 33  ? 1.779   5.871   48.546  1.00 21.57 ? 61  ARG A CD  1 
ATOM   171  N  NE  . ARG A 1 33  ? 2.788   6.378   49.482  1.00 16.38 ? 61  ARG A NE  1 
ATOM   172  C  CZ  . ARG A 1 33  ? 3.788   7.180   49.150  1.00 13.53 ? 61  ARG A CZ  1 
ATOM   173  N  NH1 . ARG A 1 33  ? 3.928   7.606   47.898  1.00 16.55 ? 61  ARG A NH1 1 
ATOM   174  N  NH2 . ARG A 1 33  ? 4.641   7.588   50.080  1.00 14.98 ? 61  ARG A NH2 1 
ATOM   175  N  N   . TYR A 1 34  ? 2.374   0.701   47.493  1.00 23.98 ? 62  TYR A N   1 
ATOM   176  C  CA  . TYR A 1 34  ? 3.260   -0.132  46.693  1.00 27.49 ? 62  TYR A CA  1 
ATOM   177  C  C   . TYR A 1 34  ? 4.561   0.627   46.552  1.00 25.29 ? 62  TYR A C   1 
ATOM   178  O  O   . TYR A 1 34  ? 4.562   1.800   46.145  1.00 29.51 ? 62  TYR A O   1 
ATOM   179  C  CB  . TYR A 1 34  ? 2.629   -0.291  45.312  1.00 31.05 ? 62  TYR A CB  1 
ATOM   180  C  CG  . TYR A 1 34  ? 3.371   -1.116  44.281  1.00 30.52 ? 62  TYR A CG  1 
ATOM   181  C  CD1 . TYR A 1 34  ? 3.576   -2.481  44.466  1.00 32.34 ? 62  TYR A CD1 1 
ATOM   182  C  CD2 . TYR A 1 34  ? 3.799   -0.540  43.076  1.00 33.02 ? 62  TYR A CD2 1 
ATOM   183  C  CE1 . TYR A 1 34  ? 4.226   -3.249  43.507  1.00 31.87 ? 62  TYR A CE1 1 
ATOM   184  C  CE2 . TYR A 1 34  ? 4.439   -1.311  42.099  1.00 31.26 ? 62  TYR A CE2 1 
ATOM   185  C  CZ  . TYR A 1 34  ? 4.639   -2.665  42.328  1.00 31.81 ? 62  TYR A CZ  1 
ATOM   186  O  OH  . TYR A 1 34  ? 5.262   -3.449  41.382  1.00 31.04 ? 62  TYR A OH  1 
ATOM   187  N  N   . GLU A 1 35  ? 5.665   -0.033  46.885  1.00 25.13 ? 63  GLU A N   1 
ATOM   188  C  CA  . GLU A 1 35  ? 6.971   0.620   46.831  1.00 27.07 ? 63  GLU A CA  1 
ATOM   189  C  C   . GLU A 1 35  ? 7.684   0.407   45.508  1.00 30.20 ? 63  GLU A C   1 
ATOM   190  O  O   . GLU A 1 35  ? 8.488   1.243   45.096  1.00 36.85 ? 63  GLU A O   1 
ATOM   191  C  CB  . GLU A 1 35  ? 7.850   0.177   47.996  1.00 25.76 ? 63  GLU A CB  1 
ATOM   192  C  CG  . GLU A 1 35  ? 7.422   0.780   49.321  1.00 22.63 ? 63  GLU A CG  1 
ATOM   193  C  CD  . GLU A 1 35  ? 8.478   0.636   50.381  1.00 20.87 ? 63  GLU A CD  1 
ATOM   194  O  OE1 . GLU A 1 35  ? 8.983   -0.490  50.571  1.00 21.93 ? 63  GLU A OE1 1 
ATOM   195  O  OE2 . GLU A 1 35  ? 8.802   1.644   51.023  1.00 15.32 ? 63  GLU A OE2 1 
ATOM   196  N  N   . GLY A 1 36  ? 7.389   -0.701  44.837  1.00 24.95 ? 64  GLY A N   1 
ATOM   197  C  CA  . GLY A 1 36  ? 7.947   -0.939  43.510  1.00 22.14 ? 64  GLY A CA  1 
ATOM   198  C  C   . GLY A 1 36  ? 8.249   -2.401  43.284  1.00 22.42 ? 64  GLY A C   1 
ATOM   199  O  O   . GLY A 1 36  ? 8.606   -3.124  44.223  1.00 21.74 ? 64  GLY A O   1 
ATOM   200  N  N   . LYS A 1 37  ? 8.103   -2.831  42.031  1.00 23.71 ? 65  LYS A N   1 
ATOM   201  C  CA  . LYS A 1 37  ? 8.316   -4.226  41.637  1.00 24.44 ? 65  LYS A CA  1 
ATOM   202  C  C   . LYS A 1 37  ? 9.712   -4.701  42.025  1.00 19.45 ? 65  LYS A C   1 
ATOM   203  O  O   . LYS A 1 37  ? 10.696  -3.967  41.856  1.00 20.97 ? 65  LYS A O   1 
ATOM   204  C  CB  . LYS A 1 37  ? 8.144   -4.363  40.124  1.00 28.45 ? 65  LYS A CB  1 
ATOM   205  C  CG  . LYS A 1 37  ? 8.251   -5.783  39.584  1.00 30.69 ? 65  LYS A CG  1 
ATOM   206  C  CD  . LYS A 1 37  ? 8.321   -5.758  38.058  1.00 40.76 ? 65  LYS A CD  1 
ATOM   207  C  CE  . LYS A 1 37  ? 7.794   -7.056  37.450  1.00 46.86 ? 65  LYS A CE  1 
ATOM   208  N  NZ  . LYS A 1 37  ? 7.741   -6.994  35.950  1.00 48.61 ? 65  LYS A NZ  1 
ATOM   209  N  N   . ILE A 1 38  ? 9.784   -5.918  42.549  1.00 18.16 ? 66  ILE A N   1 
ATOM   210  C  CA  . ILE A 1 38  ? 11.056  -6.556  42.870  1.00 23.09 ? 66  ILE A CA  1 
ATOM   211  C  C   . ILE A 1 38  ? 11.281  -7.647  41.830  1.00 21.06 ? 66  ILE A C   1 
ATOM   212  O  O   . ILE A 1 38  ? 10.528  -8.610  41.768  1.00 22.95 ? 66  ILE A O   1 
ATOM   213  C  CB  . ILE A 1 38  ? 11.060  -7.176  44.308  1.00 20.74 ? 66  ILE A CB  1 
ATOM   214  C  CG1 . ILE A 1 38  ? 10.999  -6.083  45.384  1.00 22.62 ? 66  ILE A CG1 1 
ATOM   215  C  CG2 . ILE A 1 38  ? 12.276  -8.071  44.494  1.00 25.61 ? 66  ILE A CG2 1 
ATOM   216  C  CD1 . ILE A 1 38  ? 11.002  -6.609  46.811  1.00 22.28 ? 66  ILE A CD1 1 
ATOM   217  N  N   . SER A 1 39  ? 12.299  -7.485  40.998  1.00 21.45 ? 67  SER A N   1 
ATOM   218  C  CA  . SER A 1 39  ? 12.582  -8.472  39.974  1.00 22.71 ? 67  SER A CA  1 
ATOM   219  C  C   . SER A 1 39  ? 13.706  -9.407  40.426  1.00 24.54 ? 67  SER A C   1 
ATOM   220  O  O   . SER A 1 39  ? 14.494  -9.053  41.308  1.00 24.07 ? 67  SER A O   1 
ATOM   221  C  CB  . SER A 1 39  ? 12.912  -7.789  38.643  1.00 24.28 ? 67  SER A CB  1 
ATOM   222  O  OG  . SER A 1 39  ? 14.079  -7.001  38.749  1.00 33.96 ? 67  SER A OG  1 
ATOM   223  N  N   . ARG A 1 40  ? 13.755  -10.601 39.839  1.00 23.04 ? 68  ARG A N   1 
ATOM   224  C  CA  . ARG A 1 40  ? 14.781  -11.602 40.175  1.00 28.37 ? 68  ARG A CA  1 
ATOM   225  C  C   . ARG A 1 40  ? 16.211  -11.033 40.154  1.00 31.28 ? 68  ARG A C   1 
ATOM   226  O  O   . ARG A 1 40  ? 17.001  -11.300 41.062  1.00 32.21 ? 68  ARG A O   1 
ATOM   227  C  CB  . ARG A 1 40  ? 14.676  -12.807 39.236  1.00 29.13 ? 68  ARG A CB  1 
ATOM   228  C  CG  . ARG A 1 40  ? 15.489  -14.026 39.676  1.00 28.97 ? 68  ARG A CG  1 
ATOM   229  C  CD  . ARG A 1 40  ? 15.096  -15.271 38.886  1.00 28.33 ? 68  ARG A CD  1 
ATOM   230  N  NE  . ARG A 1 40  ? 13.826  -15.856 39.325  1.00 24.49 ? 68  ARG A NE  1 
ATOM   231  C  CZ  . ARG A 1 40  ? 13.697  -16.656 40.384  1.00 26.03 ? 68  ARG A CZ  1 
ATOM   232  N  NH1 . ARG A 1 40  ? 14.759  -16.958 41.128  1.00 27.48 ? 68  ARG A NH1 1 
ATOM   233  N  NH2 . ARG A 1 40  ? 12.511  -17.153 40.703  1.00 23.49 ? 68  ARG A NH2 1 
ATOM   234  N  N   . ASN A 1 41  ? 16.534  -10.238 39.132  1.00 33.67 ? 69  ASN A N   1 
ATOM   235  C  CA  . ASN A 1 41  ? 17.891  -9.690  38.979  1.00 40.96 ? 69  ASN A CA  1 
ATOM   236  C  C   . ASN A 1 41  ? 18.177  -8.410  39.780  1.00 40.45 ? 69  ASN A C   1 
ATOM   237  O  O   . ASN A 1 41  ? 19.079  -7.645  39.426  1.00 39.10 ? 69  ASN A O   1 
ATOM   238  C  CB  . ASN A 1 41  ? 18.215  -9.457  37.492  1.00 44.79 ? 69  ASN A CB  1 
ATOM   239  C  CG  . ASN A 1 41  ? 18.739  -10.708 36.789  1.00 47.94 ? 69  ASN A CG  1 
ATOM   240  O  OD1 . ASN A 1 41  ? 18.782  -11.806 37.361  1.00 47.62 ? 69  ASN A OD1 1 
ATOM   241  N  ND2 . ASN A 1 41  ? 19.147  -10.540 35.534  1.00 50.18 ? 69  ASN A ND2 1 
ATOM   242  N  N   . SER A 1 42  ? 17.428  -8.191  40.860  1.00 38.16 ? 70  SER A N   1 
ATOM   243  C  CA  . SER A 1 42  ? 17.537  -6.950  41.635  1.00 34.70 ? 70  SER A CA  1 
ATOM   244  C  C   . SER A 1 42  ? 18.182  -7.141  42.999  1.00 31.42 ? 70  SER A C   1 
ATOM   245  O  O   . SER A 1 42  ? 18.190  -8.241  43.547  1.00 29.29 ? 70  SER A O   1 
ATOM   246  C  CB  . SER A 1 42  ? 16.165  -6.295  41.814  1.00 32.54 ? 70  SER A CB  1 
ATOM   247  O  OG  . SER A 1 42  ? 15.415  -6.935  42.834  1.00 31.75 ? 70  SER A OG  1 
ATOM   248  N  N   . GLU A 1 43  ? 18.712  -6.047  43.536  1.00 31.06 ? 71  GLU A N   1 
ATOM   249  C  CA  . GLU A 1 43  ? 19.328  -6.026  44.855  1.00 32.32 ? 71  GLU A CA  1 
ATOM   250  C  C   . GLU A 1 43  ? 18.283  -6.222  45.949  1.00 32.41 ? 71  GLU A C   1 
ATOM   251  O  O   . GLU A 1 43  ? 18.567  -6.818  46.989  1.00 33.24 ? 71  GLU A O   1 
ATOM   252  C  CB  . GLU A 1 43  ? 20.087  -4.705  45.055  1.00 35.47 ? 71  GLU A CB  1 
ATOM   253  C  CG  . GLU A 1 43  ? 21.261  -4.773  46.024  1.00 38.15 ? 71  GLU A CG  1 
ATOM   254  C  CD  . GLU A 1 43  ? 22.258  -5.874  45.680  1.00 41.81 ? 71  GLU A CD  1 
ATOM   255  O  OE1 . GLU A 1 43  ? 22.572  -6.057  44.483  1.00 43.42 ? 71  GLU A OE1 1 
ATOM   256  O  OE2 . GLU A 1 43  ? 22.728  -6.558  46.614  1.00 43.55 ? 71  GLU A OE2 1 
ATOM   257  N  N   . ARG A 1 44  ? 17.070  -5.724  45.707  1.00 27.87 ? 72  ARG A N   1 
ATOM   258  C  CA  . ARG A 1 44  ? 15.984  -5.890  46.657  1.00 24.16 ? 72  ARG A CA  1 
ATOM   259  C  C   . ARG A 1 44  ? 15.409  -7.311  46.630  1.00 21.05 ? 72  ARG A C   1 
ATOM   260  O  O   . ARG A 1 44  ? 14.717  -7.706  47.558  1.00 23.00 ? 72  ARG A O   1 
ATOM   261  C  CB  . ARG A 1 44  ? 14.875  -4.851  46.439  1.00 26.56 ? 72  ARG A CB  1 
ATOM   262  C  CG  . ARG A 1 44  ? 15.143  -3.485  47.094  1.00 29.43 ? 72  ARG A CG  1 
ATOM   263  C  CD  . ARG A 1 44  ? 13.863  -2.651  47.142  1.00 32.14 ? 72  ARG A CD  1 
ATOM   264  N  NE  . ARG A 1 44  ? 13.316  -2.487  45.798  1.00 34.97 ? 72  ARG A NE  1 
ATOM   265  C  CZ  . ARG A 1 44  ? 12.030  -2.572  45.461  1.00 29.80 ? 72  ARG A CZ  1 
ATOM   266  N  NH1 . ARG A 1 44  ? 11.078  -2.826  46.356  1.00 32.29 ? 72  ARG A NH1 1 
ATOM   267  N  NH2 . ARG A 1 44  ? 11.698  -2.405  44.192  1.00 29.14 ? 72  ARG A NH2 1 
ATOM   268  N  N   . PHE A 1 45  ? 15.718  -8.081  45.584  1.00 20.40 ? 73  PHE A N   1 
ATOM   269  C  CA  . PHE A 1 45  ? 15.325  -9.497  45.543  1.00 22.82 ? 73  PHE A CA  1 
ATOM   270  C  C   . PHE A 1 45  ? 15.954  -10.267 46.708  1.00 20.27 ? 73  PHE A C   1 
ATOM   271  O  O   . PHE A 1 45  ? 15.350  -11.205 47.240  1.00 21.40 ? 73  PHE A O   1 
ATOM   272  C  CB  . PHE A 1 45  ? 15.737  -10.157 44.221  1.00 25.22 ? 73  PHE A CB  1 
ATOM   273  C  CG  . PHE A 1 45  ? 15.230  -11.580 44.069  1.00 25.79 ? 73  PHE A CG  1 
ATOM   274  C  CD1 . PHE A 1 45  ? 13.868  -11.835 43.977  1.00 22.53 ? 73  PHE A CD1 1 
ATOM   275  C  CD2 . PHE A 1 45  ? 16.125  -12.657 43.998  1.00 27.61 ? 73  PHE A CD2 1 
ATOM   276  C  CE1 . PHE A 1 45  ? 13.387  -13.148 43.842  1.00 26.68 ? 73  PHE A CE1 1 
ATOM   277  C  CE2 . PHE A 1 45  ? 15.656  -13.975 43.848  1.00 24.83 ? 73  PHE A CE2 1 
ATOM   278  C  CZ  . PHE A 1 45  ? 14.295  -14.214 43.763  1.00 23.95 ? 73  PHE A CZ  1 
ATOM   279  N  N   . LYS A 1 46  ? 17.155  -9.841  47.092  1.00 19.49 ? 74  LYS A N   1 
ATOM   280  C  CA  . LYS A 1 46  ? 17.907  -10.430 48.204  1.00 25.87 ? 74  LYS A CA  1 
ATOM   281  C  C   . LYS A 1 46  ? 17.242  -10.231 49.570  1.00 26.14 ? 74  LYS A C   1 
ATOM   282  O  O   . LYS A 1 46  ? 17.559  -10.948 50.516  1.00 27.13 ? 74  LYS A O   1 
ATOM   283  C  CB  . LYS A 1 46  ? 19.334  -9.875  48.239  1.00 26.91 ? 74  LYS A CB  1 
ATOM   284  C  CG  . LYS A 1 46  ? 20.245  -10.356 47.108  1.00 30.15 ? 74  LYS A CG  1 
ATOM   285  C  CD  . LYS A 1 46  ? 21.645  -9.725  47.168  1.00 31.58 ? 74  LYS A CD  1 
ATOM   286  C  CE  . LYS A 1 46  ? 22.378  -10.037 48.491  1.00 36.31 ? 74  LYS A CE  1 
ATOM   287  N  NZ  . LYS A 1 46  ? 23.877  -9.908  48.415  1.00 34.64 ? 74  LYS A NZ  1 
ATOM   288  N  N   . GLU A 1 47  ? 16.345  -9.250  49.672  1.00 29.49 ? 75  GLU A N   1 
ATOM   289  C  CA  . GLU A 1 47  ? 15.540  -9.026  50.887  1.00 33.45 ? 75  GLU A CA  1 
ATOM   290  C  C   . GLU A 1 47  ? 14.465  -10.098 51.073  1.00 28.38 ? 75  GLU A C   1 
ATOM   291  O  O   . GLU A 1 47  ? 13.880  -10.225 52.151  1.00 34.17 ? 75  GLU A O   1 
ATOM   292  C  CB  . GLU A 1 47  ? 14.831  -7.670  50.837  1.00 37.12 ? 75  GLU A CB  1 
ATOM   293  C  CG  . GLU A 1 47  ? 15.724  -6.464  50.626  1.00 39.99 ? 75  GLU A CG  1 
ATOM   294  C  CD  . GLU A 1 47  ? 14.918  -5.192  50.400  1.00 41.06 ? 75  GLU A CD  1 
ATOM   295  O  OE1 . GLU A 1 47  ? 13.686  -5.286  50.164  1.00 43.62 ? 75  GLU A OE1 1 
ATOM   296  O  OE2 . GLU A 1 47  ? 15.520  -4.100  50.461  1.00 42.95 ? 75  GLU A OE2 1 
ATOM   297  N  N   . LEU A 1 48  ? 14.171  -10.841 50.014  1.00 22.61 ? 76  LEU A N   1 
ATOM   298  C  CA  . LEU A 1 48  ? 13.167  -11.907 50.106  1.00 19.76 ? 76  LEU A CA  1 
ATOM   299  C  C   . LEU A 1 48  ? 13.846  -13.253 50.389  1.00 24.94 ? 76  LEU A C   1 
ATOM   300  O  O   . LEU A 1 48  ? 14.880  -13.573 49.807  1.00 24.70 ? 76  LEU A O   1 
ATOM   301  C  CB  . LEU A 1 48  ? 12.340  -11.996 48.830  1.00 19.00 ? 76  LEU A CB  1 
ATOM   302  C  CG  . LEU A 1 48  ? 11.620  -10.721 48.352  1.00 20.43 ? 76  LEU A CG  1 
ATOM   303  C  CD1 . LEU A 1 48  ? 10.861  -11.048 47.093  1.00 24.76 ? 76  LEU A CD1 1 
ATOM   304  C  CD2 . LEU A 1 48  ? 10.665  -10.160 49.406  1.00 20.73 ? 76  LEU A CD2 1 
ATOM   305  N  N   . THR A 1 49  ? 13.243  -14.033 51.275  1.00 28.57 ? 77  THR A N   1 
ATOM   306  C  CA  . THR A 1 49  ? 13.768  -15.358 51.614  1.00 32.74 ? 77  THR A CA  1 
ATOM   307  C  C   . THR A 1 49  ? 12.638  -16.389 51.533  1.00 29.22 ? 77  THR A C   1 
ATOM   308  O  O   . THR A 1 49  ? 11.476  -16.050 51.771  1.00 26.92 ? 77  THR A O   1 
ATOM   309  C  CB  . THR A 1 49  ? 14.516  -15.375 52.995  1.00 35.16 ? 77  THR A CB  1 
ATOM   310  O  OG1 . THR A 1 49  ? 14.728  -16.725 53.420  1.00 43.08 ? 77  THR A OG1 1 
ATOM   311  C  CG2 . THR A 1 49  ? 13.735  -14.664 54.066  1.00 36.64 ? 77  THR A CG2 1 
ATOM   312  N  N   . PRO A 1 50  ? 12.964  -17.640 51.144  1.00 27.96 ? 78  PRO A N   1 
ATOM   313  C  CA  . PRO A 1 50  ? 11.877  -18.605 51.033  1.00 24.53 ? 78  PRO A CA  1 
ATOM   314  C  C   . PRO A 1 50  ? 11.322  -19.058 52.391  1.00 25.08 ? 78  PRO A C   1 
ATOM   315  O  O   . PRO A 1 50  ? 12.092  -19.363 53.307  1.00 24.37 ? 78  PRO A O   1 
ATOM   316  C  CB  . PRO A 1 50  ? 12.513  -19.791 50.277  1.00 25.62 ? 78  PRO A CB  1 
ATOM   317  C  CG  . PRO A 1 50  ? 13.904  -19.384 49.916  1.00 27.63 ? 78  PRO A CG  1 
ATOM   318  C  CD  . PRO A 1 50  ? 14.272  -18.219 50.776  1.00 26.55 ? 78  PRO A CD  1 
ATOM   319  N  N   . ASN A 1 51  ? 9.993   -19.104 52.499  1.00 23.07 ? 79  ASN A N   1 
ATOM   320  C  CA  . ASN A 1 51  ? 9.307   -19.713 53.657  1.00 21.84 ? 79  ASN A CA  1 
ATOM   321  C  C   . ASN A 1 51  ? 9.315   -21.226 53.468  1.00 21.81 ? 79  ASN A C   1 
ATOM   322  O  O   . ASN A 1 51  ? 8.782   -21.732 52.487  1.00 22.93 ? 79  ASN A O   1 
ATOM   323  C  CB  . ASN A 1 51  ? 7.868   -19.168 53.778  1.00 22.11 ? 79  ASN A CB  1 
ATOM   324  C  CG  . ASN A 1 51  ? 7.188   -19.547 55.090  1.00 25.62 ? 79  ASN A CG  1 
ATOM   325  O  OD1 . ASN A 1 51  ? 7.320   -20.671 55.560  1.00 27.84 ? 79  ASN A OD1 1 
ATOM   326  N  ND2 . ASN A 1 51  ? 6.436   -18.606 55.673  1.00 24.41 ? 79  ASN A ND2 1 
ATOM   327  N  N   . TYR A 1 52  ? 9.956   -21.937 54.401  1.00 21.71 ? 80  TYR A N   1 
ATOM   328  C  CA  . TYR A 1 52  ? 10.109  -23.391 54.326  1.00 19.92 ? 80  TYR A CA  1 
ATOM   329  C  C   . TYR A 1 52  ? 9.299   -24.131 55.416  1.00 20.45 ? 80  TYR A C   1 
ATOM   330  O  O   . TYR A 1 52  ? 9.591   -25.287 55.760  1.00 21.37 ? 80  TYR A O   1 
ATOM   331  C  CB  . TYR A 1 52  ? 11.603  -23.782 54.424  1.00 23.14 ? 80  TYR A CB  1 
ATOM   332  C  CG  . TYR A 1 52  ? 12.430  -23.465 53.181  1.00 21.24 ? 80  TYR A CG  1 
ATOM   333  C  CD1 . TYR A 1 52  ? 12.080  -23.999 51.934  1.00 22.38 ? 80  TYR A CD1 1 
ATOM   334  C  CD2 . TYR A 1 52  ? 13.553  -22.642 53.253  1.00 20.90 ? 80  TYR A CD2 1 
ATOM   335  C  CE1 . TYR A 1 52  ? 12.818  -23.720 50.792  1.00 24.00 ? 80  TYR A CE1 1 
ATOM   336  C  CE2 . TYR A 1 52  ? 14.314  -22.360 52.109  1.00 24.22 ? 80  TYR A CE2 1 
ATOM   337  C  CZ  . TYR A 1 52  ? 13.933  -22.909 50.883  1.00 24.27 ? 80  TYR A CZ  1 
ATOM   338  O  OH  . TYR A 1 52  ? 14.668  -22.650 49.739  1.00 27.35 ? 80  TYR A OH  1 
ATOM   339  N  N   . ASN A 1 53  ? 8.305   -23.451 55.963  1.00 20.47 ? 81  ASN A N   1 
ATOM   340  C  CA  . ASN A 1 53  ? 7.448   -23.980 57.013  1.00 22.14 ? 81  ASN A CA  1 
ATOM   341  C  C   . ASN A 1 53  ? 6.850   -25.339 56.602  1.00 21.50 ? 81  ASN A C   1 
ATOM   342  O  O   . ASN A 1 53  ? 6.121   -25.405 55.607  1.00 24.53 ? 81  ASN A O   1 
ATOM   343  C  CB  . ASN A 1 53  ? 6.315   -22.983 57.310  1.00 20.77 ? 81  ASN A CB  1 
ATOM   344  C  CG  . ASN A 1 53  ? 5.597   -23.271 58.636  1.00 22.47 ? 81  ASN A CG  1 
ATOM   345  O  OD1 . ASN A 1 53  ? 5.536   -24.410 59.086  1.00 22.55 ? 81  ASN A OD1 1 
ATOM   346  N  ND2 . ASN A 1 53  ? 5.055   -22.230 59.259  1.00 19.85 ? 81  ASN A ND2 1 
ATOM   347  N  N   . PRO A 1 54  ? 7.160   -26.412 57.360  1.00 24.99 ? 82  PRO A N   1 
ATOM   348  C  CA  . PRO A 1 54  ? 6.626   -27.743 57.024  1.00 23.48 ? 82  PRO A CA  1 
ATOM   349  C  C   . PRO A 1 54  ? 5.109   -27.845 57.153  1.00 24.01 ? 82  PRO A C   1 
ATOM   350  O  O   . PRO A 1 54  ? 4.499   -28.780 56.611  1.00 24.48 ? 82  PRO A O   1 
ATOM   351  C  CB  . PRO A 1 54  ? 7.311   -28.659 58.042  1.00 27.15 ? 82  PRO A CB  1 
ATOM   352  C  CG  . PRO A 1 54  ? 7.650   -27.759 59.176  1.00 28.62 ? 82  PRO A CG  1 
ATOM   353  C  CD  . PRO A 1 54  ? 8.044   -26.473 58.543  1.00 24.21 ? 82  PRO A CD  1 
ATOM   354  N  N   . ASP A 1 55  ? 4.504   -26.876 57.834  1.00 22.93 ? 83  ASP A N   1 
ATOM   355  C  CA  . ASP A 1 55  ? 3.062   -26.876 58.044  1.00 24.96 ? 83  ASP A CA  1 
ATOM   356  C  C   . ASP A 1 55  ? 2.297   -26.033 57.025  1.00 22.68 ? 83  ASP A C   1 
ATOM   357  O  O   . ASP A 1 55  ? 1.111   -25.778 57.199  1.00 24.88 ? 83  ASP A O   1 
ATOM   358  C  CB  . ASP A 1 55  ? 2.732   -26.459 59.472  1.00 23.30 ? 83  ASP A CB  1 
ATOM   359  C  CG  . ASP A 1 55  ? 3.251   -27.454 60.498  1.00 29.11 ? 83  ASP A CG  1 
ATOM   360  O  OD1 . ASP A 1 55  ? 3.263   -28.678 60.220  1.00 25.64 ? 83  ASP A OD1 1 
ATOM   361  O  OD2 . ASP A 1 55  ? 3.647   -27.008 61.587  1.00 29.41 ? 83  ASP A OD2 1 
ATOM   362  N  N   . ILE A 1 56  ? 2.987   -25.628 55.961  1.00 19.99 ? 84  ILE A N   1 
ATOM   363  C  CA  . ILE A 1 56  ? 2.378   -24.891 54.860  1.00 21.07 ? 84  ILE A CA  1 
ATOM   364  C  C   . ILE A 1 56  ? 2.646   -25.626 53.559  1.00 23.17 ? 84  ILE A C   1 
ATOM   365  O  O   . ILE A 1 56  ? 3.776   -26.063 53.301  1.00 23.83 ? 84  ILE A O   1 
ATOM   366  C  CB  . ILE A 1 56  ? 2.883   -23.407 54.781  1.00 22.13 ? 84  ILE A CB  1 
ATOM   367  C  CG1 . ILE A 1 56  ? 2.670   -22.681 56.126  1.00 27.40 ? 84  ILE A CG1 1 
ATOM   368  C  CG2 . ILE A 1 56  ? 2.180   -22.625 53.637  1.00 21.47 ? 84  ILE A CG2 1 
ATOM   369  C  CD1 . ILE A 1 56  ? 3.215   -21.228 56.149  1.00 22.28 ? 84  ILE A CD1 1 
ATOM   370  N  N   . ILE A 1 57  ? 1.597   -25.770 52.752  1.00 21.46 ? 85  ILE A N   1 
ATOM   371  C  CA  . ILE A 1 57  ? 1.696   -26.340 51.412  1.00 21.69 ? 85  ILE A CA  1 
ATOM   372  C  C   . ILE A 1 57  ? 1.903   -25.194 50.411  1.00 23.73 ? 85  ILE A C   1 
ATOM   373  O  O   . ILE A 1 57  ? 1.121   -24.232 50.383  1.00 23.39 ? 85  ILE A O   1 
ATOM   374  C  CB  . ILE A 1 57  ? 0.416   -27.145 51.033  1.00 22.51 ? 85  ILE A CB  1 
ATOM   375  C  CG1 . ILE A 1 57  ? 0.113   -28.267 52.063  1.00 24.77 ? 85  ILE A CG1 1 
ATOM   376  C  CG2 . ILE A 1 57  ? 0.513   -27.699 49.608  1.00 26.15 ? 85  ILE A CG2 1 
ATOM   377  C  CD1 . ILE A 1 57  ? 1.232   -29.276 52.277  1.00 27.16 ? 85  ILE A CD1 1 
ATOM   378  N  N   . PHE A 1 58  ? 2.962   -25.279 49.610  1.00 22.34 ? 86  PHE A N   1 
ATOM   379  C  CA  . PHE A 1 58  ? 3.158   -24.295 48.545  1.00 19.85 ? 86  PHE A CA  1 
ATOM   380  C  C   . PHE A 1 58  ? 2.860   -24.944 47.203  1.00 21.89 ? 86  PHE A C   1 
ATOM   381  O  O   . PHE A 1 58  ? 3.489   -25.947 46.839  1.00 22.54 ? 86  PHE A O   1 
ATOM   382  C  CB  . PHE A 1 58  ? 4.576   -23.676 48.592  1.00 21.91 ? 86  PHE A CB  1 
ATOM   383  C  CG  . PHE A 1 58  ? 4.788   -22.769 49.765  1.00 22.47 ? 86  PHE A CG  1 
ATOM   384  C  CD1 . PHE A 1 58  ? 4.522   -21.410 49.666  1.00 21.29 ? 86  PHE A CD1 1 
ATOM   385  C  CD2 . PHE A 1 58  ? 5.211   -23.292 50.996  1.00 25.33 ? 86  PHE A CD2 1 
ATOM   386  C  CE1 . PHE A 1 58  ? 4.704   -20.559 50.774  1.00 21.11 ? 86  PHE A CE1 1 
ATOM   387  C  CE2 . PHE A 1 58  ? 5.376   -22.478 52.098  1.00 21.53 ? 86  PHE A CE2 1 
ATOM   388  C  CZ  . PHE A 1 58  ? 5.139   -21.100 51.991  1.00 21.85 ? 86  PHE A CZ  1 
ATOM   389  N  N   . LYS A 1 59  ? 1.899   -24.378 46.477  1.00 22.31 ? 87  LYS A N   1 
ATOM   390  C  CA  . LYS A 1 59  ? 1.498   -24.917 45.181  1.00 18.85 ? 87  LYS A CA  1 
ATOM   391  C  C   . LYS A 1 59  ? 2.706   -25.043 44.245  1.00 21.10 ? 87  LYS A C   1 
ATOM   392  O  O   . LYS A 1 59  ? 2.957   -26.126 43.716  1.00 20.10 ? 87  LYS A O   1 
ATOM   393  C  CB  . LYS A 1 59  ? 0.389   -24.066 44.554  1.00 21.53 ? 87  LYS A CB  1 
ATOM   394  C  CG  . LYS A 1 59  ? -0.167  -24.649 43.260  1.00 18.36 ? 87  LYS A CG  1 
ATOM   395  C  CD  . LYS A 1 59  ? -1.336  -23.821 42.758  1.00 23.39 ? 87  LYS A CD  1 
ATOM   396  C  CE  . LYS A 1 59  ? -2.032  -24.527 41.608  1.00 21.81 ? 87  LYS A CE  1 
ATOM   397  N  NZ  . LYS A 1 59  ? -3.238  -23.718 41.178  1.00 21.94 ? 87  LYS A NZ  1 
ATOM   398  N  N   . ASP A 1 60  ? 3.459   -23.949 44.076  1.00 23.88 ? 88  ASP A N   1 
ATOM   399  C  CA  . ASP A 1 60  ? 4.684   -23.934 43.258  1.00 22.95 ? 88  ASP A CA  1 
ATOM   400  C  C   . ASP A 1 60  ? 4.456   -24.591 41.882  1.00 23.60 ? 88  ASP A C   1 
ATOM   401  O  O   . ASP A 1 60  ? 5.258   -25.420 41.430  1.00 23.69 ? 88  ASP A O   1 
ATOM   402  C  CB  . ASP A 1 60  ? 5.827   -24.632 44.026  1.00 21.82 ? 88  ASP A CB  1 
ATOM   403  C  CG  . ASP A 1 60  ? 7.201   -24.406 43.409  1.00 27.40 ? 88  ASP A CG  1 
ATOM   404  O  OD1 . ASP A 1 60  ? 7.434   -23.381 42.718  1.00 25.50 ? 88  ASP A OD1 1 
ATOM   405  O  OD2 . ASP A 1 60  ? 8.072   -25.283 43.634  1.00 29.01 ? 88  ASP A OD2 1 
ATOM   406  N  N   . GLU A 1 61  ? 3.369   -24.196 41.220  1.00 23.01 ? 89  GLU A N   1 
ATOM   407  C  CA  . GLU A 1 61  ? 3.035   -24.692 39.890  1.00 21.83 ? 89  GLU A CA  1 
ATOM   408  C  C   . GLU A 1 61  ? 4.058   -24.187 38.862  1.00 24.53 ? 89  GLU A C   1 
ATOM   409  O  O   . GLU A 1 61  ? 4.244   -24.784 37.797  1.00 26.22 ? 89  GLU A O   1 
ATOM   410  C  CB  . GLU A 1 61  ? 1.589   -24.296 39.516  1.00 23.99 ? 89  GLU A CB  1 
ATOM   411  C  CG  . GLU A 1 61  ? 1.331   -22.812 39.202  1.00 23.33 ? 89  GLU A CG  1 
ATOM   412  C  CD  . GLU A 1 61  ? 1.285   -21.845 40.407  1.00 25.07 ? 89  GLU A CD  1 
ATOM   413  O  OE1 . GLU A 1 61  ? 1.447   -22.227 41.585  1.00 26.36 ? 89  GLU A OE1 1 
ATOM   414  O  OE2 . GLU A 1 61  ? 1.083   -20.641 40.165  1.00 26.88 ? 89  GLU A OE2 1 
ATOM   415  N  N   . GLU A 1 62  ? 4.743   -23.104 39.227  1.00 21.05 ? 90  GLU A N   1 
ATOM   416  C  CA  . GLU A 1 62  ? 5.811   -22.506 38.428  1.00 22.41 ? 90  GLU A CA  1 
ATOM   417  C  C   . GLU A 1 62  ? 7.099   -23.345 38.431  1.00 20.48 ? 90  GLU A C   1 
ATOM   418  O  O   . GLU A 1 62  ? 7.953   -23.176 37.568  1.00 24.81 ? 90  GLU A O   1 
ATOM   419  C  CB  . GLU A 1 62  ? 6.106   -21.090 38.954  1.00 22.11 ? 90  GLU A CB  1 
ATOM   420  C  CG  . GLU A 1 62  ? 4.889   -20.130 38.978  1.00 23.94 ? 90  GLU A CG  1 
ATOM   421  C  CD  . GLU A 1 62  ? 4.144   -20.027 40.324  1.00 24.89 ? 90  GLU A CD  1 
ATOM   422  O  OE1 . GLU A 1 62  ? 4.093   -20.982 41.131  1.00 25.06 ? 90  GLU A OE1 1 
ATOM   423  O  OE2 . GLU A 1 62  ? 3.540   -18.971 40.591  1.00 28.07 ? 90  GLU A OE2 1 
ATOM   424  N  N   . ASN A 1 63  ? 7.214   -24.261 39.394  1.00 21.57 ? 91  ASN A N   1 
ATOM   425  C  CA  . ASN A 1 63  ? 8.431   -25.047 39.630  1.00 26.67 ? 91  ASN A CA  1 
ATOM   426  C  C   . ASN A 1 63  ? 9.683   -24.170 39.779  1.00 26.53 ? 91  ASN A C   1 
ATOM   427  O  O   . ASN A 1 63  ? 10.757  -24.522 39.299  1.00 24.57 ? 91  ASN A O   1 
ATOM   428  C  CB  . ASN A 1 63  ? 8.635   -26.110 38.538  1.00 31.91 ? 91  ASN A CB  1 
ATOM   429  C  CG  . ASN A 1 63  ? 7.457   -27.074 38.417  1.00 40.01 ? 91  ASN A CG  1 
ATOM   430  O  OD1 . ASN A 1 63  ? 6.732   -27.333 39.388  1.00 43.41 ? 91  ASN A OD1 1 
ATOM   431  N  ND2 . ASN A 1 63  ? 7.270   -27.622 37.217  1.00 40.95 ? 91  ASN A ND2 1 
ATOM   432  N  N   . THR A 1 64  ? 9.534   -23.024 40.445  1.00 25.50 ? 92  THR A N   1 
ATOM   433  C  CA  . THR A 1 64  ? 10.643  -22.081 40.623  1.00 25.72 ? 92  THR A CA  1 
ATOM   434  C  C   . THR A 1 64  ? 10.892  -21.760 42.085  1.00 24.29 ? 92  THR A C   1 
ATOM   435  O  O   . THR A 1 64  ? 11.920  -21.167 42.433  1.00 22.13 ? 92  THR A O   1 
ATOM   436  C  CB  . THR A 1 64  ? 10.384  -20.733 39.920  1.00 22.93 ? 92  THR A CB  1 
ATOM   437  O  OG1 . THR A 1 64  ? 9.210   -20.128 40.471  1.00 25.79 ? 92  THR A OG1 1 
ATOM   438  C  CG2 . THR A 1 64  ? 10.233  -20.908 38.415  1.00 24.57 ? 92  THR A CG2 1 
ATOM   439  N  N   . GLY A 1 65  ? 9.938   -22.133 42.929  1.00 23.36 ? 93  GLY A N   1 
ATOM   440  C  CA  . GLY A 1 65  ? 9.973   -21.778 44.339  1.00 23.98 ? 93  GLY A CA  1 
ATOM   441  C  C   . GLY A 1 65  ? 9.534   -20.348 44.629  1.00 22.46 ? 93  GLY A C   1 
ATOM   442  O  O   . GLY A 1 65  ? 9.611   -19.915 45.774  1.00 21.87 ? 93  GLY A O   1 
ATOM   443  N  N   . ALA A 1 66  ? 9.072   -19.620 43.602  1.00 22.54 ? 94  ALA A N   1 
ATOM   444  C  CA  . ALA A 1 66  ? 8.625   -18.227 43.756  1.00 23.18 ? 94  ALA A CA  1 
ATOM   445  C  C   . ALA A 1 66  ? 7.579   -18.056 44.858  1.00 23.95 ? 94  ALA A C   1 
ATOM   446  O  O   . ALA A 1 66  ? 7.645   -17.084 45.627  1.00 22.19 ? 94  ALA A O   1 
ATOM   447  C  CB  . ALA A 1 66  ? 8.076   -17.681 42.432  1.00 24.15 ? 94  ALA A CB  1 
ATOM   448  N  N   . ASP A 1 67  ? 6.625   -18.996 44.932  1.00 20.44 ? 95  ASP A N   1 
ATOM   449  C  CA  . ASP A 1 67  ? 5.529   -18.918 45.907  1.00 20.63 ? 95  ASP A CA  1 
ATOM   450  C  C   . ASP A 1 67  ? 6.028   -18.847 47.361  1.00 20.80 ? 95  ASP A C   1 
ATOM   451  O  O   . ASP A 1 67  ? 5.338   -18.301 48.213  1.00 22.77 ? 95  ASP A O   1 
ATOM   452  C  CB  . ASP A 1 67  ? 4.521   -20.090 45.758  1.00 25.38 ? 95  ASP A CB  1 
ATOM   453  C  CG  . ASP A 1 67  ? 3.712   -20.041 44.440  1.00 24.78 ? 95  ASP A CG  1 
ATOM   454  O  OD1 . ASP A 1 67  ? 3.612   -18.993 43.776  1.00 22.86 ? 95  ASP A OD1 1 
ATOM   455  O  OD2 . ASP A 1 67  ? 3.151   -21.077 44.045  1.00 24.49 ? 95  ASP A OD2 1 
ATOM   456  N  N   . ARG A 1 68  ? 7.216   -19.396 47.636  1.00 18.23 ? 96  ARG A N   1 
ATOM   457  C  CA  . ARG A 1 68  ? 7.796   -19.362 48.988  1.00 19.85 ? 96  ARG A CA  1 
ATOM   458  C  C   . ARG A 1 68  ? 8.386   -18.017 49.360  1.00 21.76 ? 96  ARG A C   1 
ATOM   459  O  O   . ARG A 1 68  ? 8.570   -17.737 50.540  1.00 20.53 ? 96  ARG A O   1 
ATOM   460  C  CB  . ARG A 1 68  ? 8.915   -20.397 49.134  1.00 20.14 ? 96  ARG A CB  1 
ATOM   461  C  CG  . ARG A 1 68  ? 8.470   -21.806 48.960  1.00 22.35 ? 96  ARG A CG  1 
ATOM   462  C  CD  . ARG A 1 68  ? 9.602   -22.727 49.398  1.00 22.02 ? 96  ARG A CD  1 
ATOM   463  N  NE  . ARG A 1 68  ? 9.228   -24.128 49.238  1.00 30.99 ? 96  ARG A NE  1 
ATOM   464  C  CZ  . ARG A 1 68  ? 8.601   -24.852 50.161  1.00 29.54 ? 96  ARG A CZ  1 
ATOM   465  N  NH1 . ARG A 1 68  ? 8.259   -24.318 51.321  1.00 22.27 ? 96  ARG A NH1 1 
ATOM   466  N  NH2 . ARG A 1 68  ? 8.317   -26.122 49.917  1.00 33.64 ? 96  ARG A NH2 1 
ATOM   467  N  N   . LEU A 1 69  ? 8.702   -17.191 48.363  1.00 22.61 ? 97  LEU A N   1 
ATOM   468  C  CA  . LEU A 1 69  ? 9.416   -15.939 48.624  1.00 22.91 ? 97  LEU A CA  1 
ATOM   469  C  C   . LEU A 1 69  ? 8.470   -14.848 49.116  1.00 22.35 ? 97  LEU A C   1 
ATOM   470  O  O   . LEU A 1 69  ? 7.428   -14.610 48.518  1.00 20.04 ? 97  LEU A O   1 
ATOM   471  C  CB  . LEU A 1 69  ? 10.181  -15.462 47.384  1.00 23.64 ? 97  LEU A CB  1 
ATOM   472  C  CG  . LEU A 1 69  ? 11.433  -16.266 47.014  1.00 24.68 ? 97  LEU A CG  1 
ATOM   473  C  CD1 . LEU A 1 69  ? 11.951  -15.804 45.663  1.00 28.42 ? 97  LEU A CD1 1 
ATOM   474  C  CD2 . LEU A 1 69  ? 12.505  -16.105 48.062  1.00 26.55 ? 97  LEU A CD2 1 
ATOM   475  N  N   . MET A 1 70  ? 8.856   -14.186 50.206  1.00 21.71 ? 98  MET A N   1 
ATOM   476  C  CA  . MET A 1 70  ? 8.022   -13.164 50.835  1.00 23.17 ? 98  MET A CA  1 
ATOM   477  C  C   . MET A 1 70  ? 8.837   -12.355 51.846  1.00 22.11 ? 98  MET A C   1 
ATOM   478  O  O   . MET A 1 70  ? 9.950   -12.743 52.210  1.00 22.61 ? 98  MET A O   1 
ATOM   479  C  CB  . MET A 1 70  ? 6.796   -13.820 51.509  1.00 23.80 ? 98  MET A CB  1 
ATOM   480  C  CG  . MET A 1 70  ? 7.202   -14.810 52.581  1.00 22.76 ? 98  MET A CG  1 
ATOM   481  S  SD  . MET A 1 70  ? 5.835   -15.781 53.208  1.00 24.54 ? 98  MET A SD  1 
ATOM   482  C  CE  . MET A 1 70  ? 5.428   -16.785 51.771  1.00 23.27 ? 98  MET A CE  1 
ATOM   483  N  N   . THR A 1 71  ? 8.301   -11.214 52.278  1.00 19.50 ? 99  THR A N   1 
ATOM   484  C  CA  . THR A 1 71  ? 8.987   -10.396 53.289  1.00 20.47 ? 99  THR A CA  1 
ATOM   485  C  C   . THR A 1 71  ? 8.912   -11.080 54.647  1.00 21.51 ? 99  THR A C   1 
ATOM   486  O  O   . THR A 1 71  ? 8.103   -11.991 54.847  1.00 22.07 ? 99  THR A O   1 
ATOM   487  C  CB  . THR A 1 71  ? 8.353   -9.004  53.439  1.00 17.94 ? 99  THR A CB  1 
ATOM   488  O  OG1 . THR A 1 71  ? 6.966   -9.149  53.791  1.00 19.49 ? 99  THR A OG1 1 
ATOM   489  C  CG2 . THR A 1 71  ? 8.502   -8.179  52.118  1.00 20.24 ? 99  THR A CG2 1 
ATOM   490  N  N   . GLN A 1 72  ? 9.738   -10.613 55.578  1.00 22.72 ? 100 GLN A N   1 
ATOM   491  C  CA  . GLN A 1 72  ? 9.735   -11.146 56.938  1.00 23.04 ? 100 GLN A CA  1 
ATOM   492  C  C   . GLN A 1 72  ? 8.381   -10.990 57.614  1.00 22.71 ? 100 GLN A C   1 
ATOM   493  O  O   . GLN A 1 72  ? 7.897   -11.933 58.241  1.00 23.10 ? 100 GLN A O   1 
ATOM   494  C  CB  . GLN A 1 72  ? 10.833  -10.514 57.802  1.00 26.13 ? 100 GLN A CB  1 
ATOM   495  C  CG  . GLN A 1 72  ? 11.091  -11.298 59.114  1.00 31.47 ? 100 GLN A CG  1 
ATOM   496  C  CD  . GLN A 1 72  ? 11.440  -12.773 58.876  1.00 35.57 ? 100 GLN A CD  1 
ATOM   497  O  OE1 . GLN A 1 72  ? 12.409  -13.091 58.183  1.00 37.87 ? 100 GLN A OE1 1 
ATOM   498  N  NE2 . GLN A 1 72  ? 10.637  -13.680 59.443  1.00 35.73 ? 100 GLN A NE2 1 
ATOM   499  N  N   . ARG A 1 73  ? 7.765   -9.811  57.492  1.00 23.93 ? 101 ARG A N   1 
ATOM   500  C  CA  . ARG A 1 73  ? 6.441   -9.591  58.082  1.00 22.25 ? 101 ARG A CA  1 
ATOM   501  C  C   . ARG A 1 73  ? 5.383   -10.526 57.484  1.00 21.09 ? 101 ARG A C   1 
ATOM   502  O  O   . ARG A 1 73  ? 4.521   -11.053 58.201  1.00 19.93 ? 101 ARG A O   1 
ATOM   503  C  CB  . ARG A 1 73  ? 6.026   -8.114  57.984  1.00 24.14 ? 101 ARG A CB  1 
ATOM   504  C  CG  . ARG A 1 73  ? 4.654   -7.800  58.578  1.00 25.65 ? 101 ARG A CG  1 
ATOM   505  C  CD  . ARG A 1 73  ? 4.361   -6.287  58.538  1.00 25.26 ? 101 ARG A CD  1 
ATOM   506  N  NE  . ARG A 1 73  ? 3.093   -5.951  59.185  1.00 21.34 ? 101 ARG A NE  1 
ATOM   507  C  CZ  . ARG A 1 73  ? 2.912   -5.791  60.498  1.00 23.74 ? 101 ARG A CZ  1 
ATOM   508  N  NH1 . ARG A 1 73  ? 3.918   -5.928  61.357  1.00 23.71 ? 101 ARG A NH1 1 
ATOM   509  N  NH2 . ARG A 1 73  ? 1.707   -5.488  60.959  1.00 25.80 ? 101 ARG A NH2 1 
ATOM   510  N  N   . CYS A 1 74  ? 5.457   -10.753 56.177  1.00 21.78 ? 102 CYS A N   1 
ATOM   511  C  CA  . CYS A 1 74  ? 4.555   -11.703 55.524  1.00 21.40 ? 102 CYS A CA  1 
ATOM   512  C  C   . CYS A 1 74  ? 4.723   -13.122 56.091  1.00 23.25 ? 102 CYS A C   1 
ATOM   513  O  O   . CYS A 1 74  ? 3.726   -13.787 56.424  1.00 22.75 ? 102 CYS A O   1 
ATOM   514  C  CB  . CYS A 1 74  ? 4.763   -11.694 54.007  1.00 23.78 ? 102 CYS A CB  1 
ATOM   515  S  SG  . CYS A 1 74  ? 3.427   -12.501 53.118  1.00 25.06 ? 102 CYS A SG  1 
ATOM   516  N  N   . LYS A 1 75  ? 5.974   -13.563 56.230  1.00 23.13 ? 103 LYS A N   1 
ATOM   517  C  CA  . LYS A 1 75  ? 6.291   -14.841 56.883  1.00 20.50 ? 103 LYS A CA  1 
ATOM   518  C  C   . LYS A 1 75  ? 5.692   -14.962 58.271  1.00 22.79 ? 103 LYS A C   1 
ATOM   519  O  O   . LYS A 1 75  ? 5.105   -15.992 58.612  1.00 22.41 ? 103 LYS A O   1 
ATOM   520  C  CB  . LYS A 1 75  ? 7.802   -15.012 57.018  1.00 25.52 ? 103 LYS A CB  1 
ATOM   521  C  CG  . LYS A 1 75  ? 8.486   -15.408 55.745  1.00 30.36 ? 103 LYS A CG  1 
ATOM   522  C  CD  . LYS A 1 75  ? 9.835   -16.022 56.052  1.00 37.31 ? 103 LYS A CD  1 
ATOM   523  C  CE  . LYS A 1 75  ? 10.527  -16.431 54.779  1.00 42.29 ? 103 LYS A CE  1 
ATOM   524  N  NZ  . LYS A 1 75  ? 11.763  -17.198 55.105  1.00 48.41 ? 103 LYS A NZ  1 
ATOM   525  N  N   . ASP A 1 76  ? 5.872   -13.914 59.074  1.00 21.88 ? 104 ASP A N   1 
ATOM   526  C  CA  . ASP A 1 76  ? 5.457   -13.918 60.474  1.00 24.04 ? 104 ASP A CA  1 
ATOM   527  C  C   . ASP A 1 76  ? 3.946   -14.112 60.558  1.00 22.17 ? 104 ASP A C   1 
ATOM   528  O  O   . ASP A 1 76  ? 3.460   -14.964 61.306  1.00 18.81 ? 104 ASP A O   1 
ATOM   529  C  CB  . ASP A 1 76  ? 5.852   -12.613 61.169  1.00 22.34 ? 104 ASP A CB  1 
ATOM   530  C  CG  . ASP A 1 76  ? 7.343   -12.522 61.489  1.00 25.44 ? 104 ASP A CG  1 
ATOM   531  O  OD1 . ASP A 1 76  ? 8.071   -13.544 61.456  1.00 23.37 ? 104 ASP A OD1 1 
ATOM   532  O  OD2 . ASP A 1 76  ? 7.783   -11.400 61.805  1.00 26.25 ? 104 ASP A OD2 1 
ATOM   533  N  N   . LYS A 1 77  ? 3.199   -13.312 59.802  1.00 20.56 ? 105 LYS A N   1 
ATOM   534  C  CA  . LYS A 1 77  ? 1.744   -13.464 59.825  1.00 21.53 ? 105 LYS A CA  1 
ATOM   535  C  C   . LYS A 1 77  ? 1.299   -14.801 59.225  1.00 24.18 ? 105 LYS A C   1 
ATOM   536  O  O   . LYS A 1 77  ? 0.399   -15.453 59.764  1.00 23.45 ? 105 LYS A O   1 
ATOM   537  C  CB  . LYS A 1 77  ? 1.045   -12.277 59.154  1.00 22.37 ? 105 LYS A CB  1 
ATOM   538  C  CG  . LYS A 1 77  ? 1.527   -10.926 59.633  1.00 21.64 ? 105 LYS A CG  1 
ATOM   539  C  CD  . LYS A 1 77  ? 1.381   -10.738 61.130  1.00 21.93 ? 105 LYS A CD  1 
ATOM   540  C  CE  . LYS A 1 77  ? 1.853   -9.350  61.538  1.00 21.29 ? 105 LYS A CE  1 
ATOM   541  N  NZ  . LYS A 1 77  ? 2.101   -9.272  63.014  1.00 23.33 ? 105 LYS A NZ  1 
ATOM   542  N  N   . LEU A 1 78  ? 1.945   -15.214 58.136  1.00 20.05 ? 106 LEU A N   1 
ATOM   543  C  CA  . LEU A 1 78  ? 1.640   -16.520 57.499  1.00 20.04 ? 106 LEU A CA  1 
ATOM   544  C  C   . LEU A 1 78  ? 1.905   -17.716 58.419  1.00 18.06 ? 106 LEU A C   1 
ATOM   545  O  O   . LEU A 1 78  ? 1.144   -18.696 58.421  1.00 23.43 ? 106 LEU A O   1 
ATOM   546  C  CB  . LEU A 1 78  ? 2.422   -16.676 56.178  1.00 18.81 ? 106 LEU A CB  1 
ATOM   547  C  CG  . LEU A 1 78  ? 1.918   -17.756 55.208  1.00 21.78 ? 106 LEU A CG  1 
ATOM   548  C  CD1 . LEU A 1 78  ? 0.600   -17.358 54.523  1.00 21.61 ? 106 LEU A CD1 1 
ATOM   549  C  CD2 . LEU A 1 78  ? 2.988   -18.059 54.161  1.00 22.73 ? 106 LEU A CD2 1 
ATOM   550  N  N   . ASN A 1 79  ? 2.972   -17.637 59.206  1.00 19.79 ? 107 ASN A N   1 
ATOM   551  C  CA  . ASN A 1 79  ? 3.329   -18.723 60.119  1.00 22.19 ? 107 ASN A CA  1 
ATOM   552  C  C   . ASN A 1 79  ? 2.345   -18.858 61.289  1.00 22.54 ? 107 ASN A C   1 
ATOM   553  O  O   . ASN A 1 79  ? 2.006   -19.966 61.687  1.00 22.58 ? 107 ASN A O   1 
ATOM   554  C  CB  . ASN A 1 79  ? 4.756   -18.547 60.628  1.00 21.08 ? 107 ASN A CB  1 
ATOM   555  C  CG  . ASN A 1 79  ? 5.801   -18.831 59.556  1.00 23.54 ? 107 ASN A CG  1 
ATOM   556  O  OD1 . ASN A 1 79  ? 5.517   -19.479 58.545  1.00 21.09 ? 107 ASN A OD1 1 
ATOM   557  N  ND2 . ASN A 1 79  ? 7.021   -18.346 59.779  1.00 20.74 ? 107 ASN A ND2 1 
ATOM   558  N  N   . ALA A 1 80  ? 1.889   -17.720 61.810  1.00 24.35 ? 108 ALA A N   1 
ATOM   559  C  CA  . ALA A 1 80  ? 0.822   -17.688 62.800  1.00 23.52 ? 108 ALA A CA  1 
ATOM   560  C  C   . ALA A 1 80  ? -0.446  -18.295 62.205  1.00 22.11 ? 108 ALA A C   1 
ATOM   561  O  O   . ALA A 1 80  ? -1.128  -19.097 62.862  1.00 21.07 ? 108 ALA A O   1 
ATOM   562  C  CB  . ALA A 1 80  ? 0.559   -16.257 63.264  1.00 22.67 ? 108 ALA A CB  1 
ATOM   563  N  N   . LEU A 1 81  ? -0.757  -17.919 60.965  1.00 20.92 ? 109 LEU A N   1 
ATOM   564  C  CA  . LEU A 1 81  ? -1.928  -18.480 60.289  1.00 19.93 ? 109 LEU A CA  1 
ATOM   565  C  C   . LEU A 1 81  ? -1.829  -20.000 60.119  1.00 24.87 ? 109 LEU A C   1 
ATOM   566  O  O   . LEU A 1 81  ? -2.818  -20.712 60.308  1.00 21.19 ? 109 LEU A O   1 
ATOM   567  C  CB  . LEU A 1 81  ? -2.206  -17.764 58.961  1.00 21.70 ? 109 LEU A CB  1 
ATOM   568  C  CG  . LEU A 1 81  ? -3.419  -18.275 58.179  1.00 20.81 ? 109 LEU A CG  1 
ATOM   569  C  CD1 . LEU A 1 81  ? -4.683  -18.224 59.022  1.00 23.10 ? 109 LEU A CD1 1 
ATOM   570  C  CD2 . LEU A 1 81  ? -3.595  -17.475 56.876  1.00 18.45 ? 109 LEU A CD2 1 
ATOM   571  N  N   . ALA A 1 82  ? -0.632  -20.499 59.805  1.00 21.92 ? 110 ALA A N   1 
ATOM   572  C  CA  . ALA A 1 82  ? -0.445  -21.948 59.681  1.00 24.98 ? 110 ALA A CA  1 
ATOM   573  C  C   . ALA A 1 82  ? -0.871  -22.679 60.957  1.00 23.92 ? 110 ALA A C   1 
ATOM   574  O  O   . ALA A 1 82  ? -1.529  -23.737 60.891  1.00 25.17 ? 110 ALA A O   1 
ATOM   575  C  CB  . ALA A 1 82  ? 0.993   -22.284 59.295  1.00 23.01 ? 110 ALA A CB  1 
ATOM   576  N  N   . ILE A 1 83  ? -0.551  -22.099 62.112  1.00 21.65 ? 111 ILE A N   1 
ATOM   577  C  CA  . ILE A 1 83  ? -0.925  -22.695 63.392  1.00 21.62 ? 111 ILE A CA  1 
ATOM   578  C  C   . ILE A 1 83  ? -2.457  -22.738 63.555  1.00 22.27 ? 111 ILE A C   1 
ATOM   579  O  O   . ILE A 1 83  ? -3.023  -23.791 63.884  1.00 22.12 ? 111 ILE A O   1 
ATOM   580  C  CB  . ILE A 1 83  ? -0.270  -21.971 64.599  1.00 23.66 ? 111 ILE A CB  1 
ATOM   581  C  CG1 . ILE A 1 83  ? 1.248   -22.146 64.566  1.00 24.65 ? 111 ILE A CG1 1 
ATOM   582  C  CG2 . ILE A 1 83  ? -0.809  -22.531 65.935  1.00 24.80 ? 111 ILE A CG2 1 
ATOM   583  C  CD1 . ILE A 1 83  ? 2.003   -21.225 65.510  1.00 27.20 ? 111 ILE A CD1 1 
ATOM   584  N  N   . SER A 1 84  ? -3.116  -21.602 63.333  1.00 22.68 ? 112 SER A N   1 
ATOM   585  C  CA  . SER A 1 84  ? -4.565  -21.506 63.590  1.00 23.55 ? 112 SER A CA  1 
ATOM   586  C  C   . SER A 1 84  ? -5.386  -22.343 62.616  1.00 23.22 ? 112 SER A C   1 
ATOM   587  O  O   . SER A 1 84  ? -6.431  -22.890 63.005  1.00 23.55 ? 112 SER A O   1 
ATOM   588  C  CB  . SER A 1 84  ? -5.053  -20.049 63.577  1.00 23.49 ? 112 SER A CB  1 
ATOM   589  O  OG  . SER A 1 84  ? -4.797  -19.436 62.344  1.00 29.54 ? 112 SER A OG  1 
ATOM   590  N  N   . VAL A 1 85  ? -4.930  -22.449 61.367  1.00 21.94 ? 113 VAL A N   1 
ATOM   591  C  CA  . VAL A 1 85  ? -5.591  -23.320 60.379  1.00 23.02 ? 113 VAL A CA  1 
ATOM   592  C  C   . VAL A 1 85  ? -5.671  -24.774 60.887  1.00 24.44 ? 113 VAL A C   1 
ATOM   593  O  O   . VAL A 1 85  ? -6.749  -25.375 60.911  1.00 21.59 ? 113 VAL A O   1 
ATOM   594  C  CB  . VAL A 1 85  ? -4.944  -23.229 58.962  1.00 22.70 ? 113 VAL A CB  1 
ATOM   595  C  CG1 . VAL A 1 85  ? -5.469  -24.345 58.060  1.00 24.36 ? 113 VAL A CG1 1 
ATOM   596  C  CG2 . VAL A 1 85  ? -5.258  -21.846 58.303  1.00 21.61 ? 113 VAL A CG2 1 
ATOM   597  N  N   . MET A 1 86  ? -4.535  -25.326 61.316  1.00 22.59 ? 114 MET A N   1 
ATOM   598  C  CA  . MET A 1 86  ? -4.495  -26.699 61.828  1.00 22.46 ? 114 MET A CA  1 
ATOM   599  C  C   . MET A 1 86  ? -5.341  -26.868 63.087  1.00 23.79 ? 114 MET A C   1 
ATOM   600  O  O   . MET A 1 86  ? -5.893  -27.942 63.328  1.00 21.97 ? 114 MET A O   1 
ATOM   601  C  CB  . MET A 1 86  ? -3.052  -27.130 62.107  1.00 23.81 ? 114 MET A CB  1 
ATOM   602  C  CG  . MET A 1 86  ? -2.165  -27.176 60.865  1.00 25.39 ? 114 MET A CG  1 
ATOM   603  S  SD  . MET A 1 86  ? -0.454  -27.691 61.206  1.00 29.67 ? 114 MET A SD  1 
ATOM   604  C  CE  . MET A 1 86  ? -0.697  -29.311 61.906  1.00 38.45 ? 114 MET A CE  1 
ATOM   605  N  N   . ASN A 1 87  ? -5.441  -25.809 63.892  1.00 20.97 ? 115 ASN A N   1 
ATOM   606  C  CA  A ASN A 1 87  ? -6.257  -25.834 65.110  0.50 23.97 ? 115 ASN A CA  1 
ATOM   607  C  CA  B ASN A 1 87  ? -6.249  -25.871 65.101  0.50 23.53 ? 115 ASN A CA  1 
ATOM   608  C  C   . ASN A 1 87  ? -7.743  -25.822 64.770  1.00 22.36 ? 115 ASN A C   1 
ATOM   609  O  O   . ASN A 1 87  ? -8.546  -26.526 65.389  1.00 22.08 ? 115 ASN A O   1 
ATOM   610  C  CB  A ASN A 1 87  ? -5.915  -24.650 66.023  0.50 24.04 ? 115 ASN A CB  1 
ATOM   611  C  CB  B ASN A 1 87  ? -5.833  -24.773 66.088  0.50 22.79 ? 115 ASN A CB  1 
ATOM   612  C  CG  A ASN A 1 87  ? -6.761  -24.625 67.290  0.50 25.42 ? 115 ASN A CG  1 
ATOM   613  C  CG  B ASN A 1 87  ? -4.490  -25.065 66.760  0.50 22.87 ? 115 ASN A CG  1 
ATOM   614  O  OD1 A ASN A 1 87  ? -6.590  -25.453 68.186  0.50 27.82 ? 115 ASN A OD1 1 
ATOM   615  O  OD1 B ASN A 1 87  ? -4.022  -26.208 66.788  0.50 23.82 ? 115 ASN A OD1 1 
ATOM   616  N  ND2 A ASN A 1 87  ? -7.675  -23.667 67.370  0.50 26.08 ? 115 ASN A ND2 1 
ATOM   617  N  ND2 B ASN A 1 87  ? -3.874  -24.028 67.320  0.50 24.46 ? 115 ASN A ND2 1 
ATOM   618  N  N   . GLN A 1 88  ? -8.094  -25.015 63.768  1.00 25.17 ? 116 GLN A N   1 
ATOM   619  C  CA  . GLN A 1 88  ? -9.464  -24.890 63.289  1.00 24.70 ? 116 GLN A CA  1 
ATOM   620  C  C   . GLN A 1 88  ? -9.969  -26.186 62.665  1.00 23.19 ? 116 GLN A C   1 
ATOM   621  O  O   . GLN A 1 88  ? -11.067 -26.624 62.989  1.00 22.53 ? 116 GLN A O   1 
ATOM   622  C  CB  . GLN A 1 88  ? -9.568  -23.745 62.269  1.00 25.99 ? 116 GLN A CB  1 
ATOM   623  C  CG  . GLN A 1 88  ? -10.998 -23.358 61.903  1.00 26.00 ? 116 GLN A CG  1 
ATOM   624  C  CD  . GLN A 1 88  ? -11.727 -22.702 63.056  1.00 31.23 ? 116 GLN A CD  1 
ATOM   625  O  OE1 . GLN A 1 88  ? -11.108 -22.121 63.947  1.00 31.86 ? 116 GLN A OE1 1 
ATOM   626  N  NE2 . GLN A 1 88  ? -13.042 -22.804 63.055  1.00 34.94 ? 116 GLN A NE2 1 
ATOM   627  N  N   . TRP A 1 89  ? -9.174  -26.779 61.766  1.00 23.70 ? 117 TRP A N   1 
ATOM   628  C  CA  . TRP A 1 89  ? -9.542  -28.020 61.069  1.00 21.00 ? 117 TRP A CA  1 
ATOM   629  C  C   . TRP A 1 89  ? -8.435  -29.077 61.167  1.00 23.17 ? 117 TRP A C   1 
ATOM   630  O  O   . TRP A 1 89  ? -7.543  -29.134 60.322  1.00 22.23 ? 117 TRP A O   1 
ATOM   631  C  CB  . TRP A 1 89  ? -9.830  -27.746 59.589  1.00 24.76 ? 117 TRP A CB  1 
ATOM   632  C  CG  . TRP A 1 89  ? -10.885 -26.698 59.317  1.00 25.32 ? 117 TRP A CG  1 
ATOM   633  C  CD1 . TRP A 1 89  ? -12.240 -26.828 59.456  1.00 26.21 ? 117 TRP A CD1 1 
ATOM   634  C  CD2 . TRP A 1 89  ? -10.655 -25.366 58.829  1.00 24.26 ? 117 TRP A CD2 1 
ATOM   635  N  NE1 . TRP A 1 89  ? -12.871 -25.644 59.084  1.00 23.63 ? 117 TRP A NE1 1 
ATOM   636  C  CE2 . TRP A 1 89  ? -11.918 -24.741 58.691  1.00 25.54 ? 117 TRP A CE2 1 
ATOM   637  C  CE3 . TRP A 1 89  ? -9.496  -24.638 58.495  1.00 21.95 ? 117 TRP A CE3 1 
ATOM   638  C  CZ2 . TRP A 1 89  ? -12.055 -23.414 58.239  1.00 24.02 ? 117 TRP A CZ2 1 
ATOM   639  C  CZ3 . TRP A 1 89  ? -9.632  -23.328 58.045  1.00 22.46 ? 117 TRP A CZ3 1 
ATOM   640  C  CH2 . TRP A 1 89  ? -10.908 -22.731 57.916  1.00 24.53 ? 117 TRP A CH2 1 
ATOM   641  N  N   . PRO A 1 90  ? -8.491  -29.933 62.188  1.00 23.07 ? 118 PRO A N   1 
ATOM   642  C  CA  . PRO A 1 90  ? -7.431  -30.949 62.334  1.00 27.82 ? 118 PRO A CA  1 
ATOM   643  C  C   . PRO A 1 90  ? -7.272  -31.810 61.079  1.00 27.16 ? 118 PRO A C   1 
ATOM   644  O  O   . PRO A 1 90  ? -8.260  -32.276 60.520  1.00 27.66 ? 118 PRO A O   1 
ATOM   645  C  CB  . PRO A 1 90  ? -7.927  -31.799 63.508  1.00 30.08 ? 118 PRO A CB  1 
ATOM   646  C  CG  . PRO A 1 90  ? -8.786  -30.879 64.296  1.00 30.54 ? 118 PRO A CG  1 
ATOM   647  C  CD  . PRO A 1 90  ? -9.486  -30.022 63.268  1.00 28.04 ? 118 PRO A CD  1 
ATOM   648  N  N   . GLY A 1 91  ? -6.029  -31.998 60.641  1.00 26.96 ? 119 GLY A N   1 
ATOM   649  C  CA  . GLY A 1 91  ? -5.741  -32.735 59.413  1.00 26.20 ? 119 GLY A CA  1 
ATOM   650  C  C   . GLY A 1 91  ? -5.647  -31.847 58.177  1.00 25.14 ? 119 GLY A C   1 
ATOM   651  O  O   . GLY A 1 91  ? -5.276  -32.330 57.106  1.00 29.93 ? 119 GLY A O   1 
ATOM   652  N  N   . VAL A 1 92  ? -5.992  -30.562 58.310  1.00 22.66 ? 120 VAL A N   1 
ATOM   653  C  CA  . VAL A 1 92  ? -5.927  -29.636 57.184  1.00 23.45 ? 120 VAL A CA  1 
ATOM   654  C  C   . VAL A 1 92  ? -4.789  -28.641 57.452  1.00 21.99 ? 120 VAL A C   1 
ATOM   655  O  O   . VAL A 1 92  ? -4.455  -28.362 58.607  1.00 24.40 ? 120 VAL A O   1 
ATOM   656  C  CB  . VAL A 1 92  ? -7.288  -28.924 56.950  1.00 24.58 ? 120 VAL A CB  1 
ATOM   657  C  CG1 . VAL A 1 92  ? -7.205  -27.913 55.789  1.00 23.71 ? 120 VAL A CG1 1 
ATOM   658  C  CG2 . VAL A 1 92  ? -8.384  -29.967 56.671  1.00 26.04 ? 120 VAL A CG2 1 
ATOM   659  N  N   . LYS A 1 93  ? -4.164  -28.153 56.392  1.00 19.55 ? 121 LYS A N   1 
ATOM   660  C  CA  . LYS A 1 93  ? -3.092  -27.173 56.533  1.00 20.04 ? 121 LYS A CA  1 
ATOM   661  C  C   . LYS A 1 93  ? -3.358  -25.976 55.657  1.00 22.96 ? 121 LYS A C   1 
ATOM   662  O  O   . LYS A 1 93  ? -4.122  -26.047 54.687  1.00 23.01 ? 121 LYS A O   1 
ATOM   663  C  CB  . LYS A 1 93  ? -1.742  -27.781 56.130  1.00 23.72 ? 121 LYS A CB  1 
ATOM   664  C  CG  . LYS A 1 93  ? -1.198  -28.828 57.122  1.00 25.29 ? 121 LYS A CG  1 
ATOM   665  C  CD  . LYS A 1 93  ? 0.237   -29.191 56.787  1.00 26.12 ? 121 LYS A CD  1 
ATOM   666  C  CE  . LYS A 1 93  ? 0.746   -30.249 57.755  1.00 30.29 ? 121 LYS A CE  1 
ATOM   667  N  NZ  . LYS A 1 93  ? 2.166   -30.636 57.465  1.00 34.85 ? 121 LYS A NZ  1 
ATOM   668  N  N   . LEU A 1 94  ? -2.702  -24.875 56.005  1.00 23.03 ? 122 LEU A N   1 
ATOM   669  C  CA  . LEU A 1 94  ? -2.643  -23.712 55.165  1.00 22.02 ? 122 LEU A CA  1 
ATOM   670  C  C   . LEU A 1 94  ? -1.955  -24.023 53.823  1.00 23.22 ? 122 LEU A C   1 
ATOM   671  O  O   . LEU A 1 94  ? -0.957  -24.736 53.781  1.00 21.72 ? 122 LEU A O   1 
ATOM   672  C  CB  . LEU A 1 94  ? -1.902  -22.589 55.915  1.00 28.87 ? 122 LEU A CB  1 
ATOM   673  C  CG  . LEU A 1 94  ? -1.668  -21.283 55.167  1.00 22.37 ? 122 LEU A CG  1 
ATOM   674  C  CD1 . LEU A 1 94  ? -3.016  -20.590 54.801  1.00 24.73 ? 122 LEU A CD1 1 
ATOM   675  C  CD2 . LEU A 1 94  ? -0.756  -20.386 56.009  1.00 23.77 ? 122 LEU A CD2 1 
ATOM   676  N  N   . ARG A 1 95  ? -2.499  -23.472 52.729  1.00 20.65 ? 123 ARG A N   1 
ATOM   677  C  CA  . ARG A 1 95  ? -1.924  -23.628 51.394  1.00 21.66 ? 123 ARG A CA  1 
ATOM   678  C  C   . ARG A 1 95  ? -1.697  -22.252 50.736  1.00 23.25 ? 123 ARG A C   1 
ATOM   679  O  O   . ARG A 1 95  ? -2.521  -21.344 50.870  1.00 23.72 ? 123 ARG A O   1 
ATOM   680  C  CB  . ARG A 1 95  ? -2.839  -24.518 50.532  1.00 22.43 ? 123 ARG A CB  1 
ATOM   681  C  CG  . ARG A 1 95  ? -2.348  -24.793 49.100  1.00 18.97 ? 123 ARG A CG  1 
ATOM   682  C  CD  . ARG A 1 95  ? -3.095  -25.989 48.515  1.00 22.94 ? 123 ARG A CD  1 
ATOM   683  N  NE  . ARG A 1 95  ? -2.893  -26.121 47.068  1.00 23.58 ? 123 ARG A NE  1 
ATOM   684  C  CZ  . ARG A 1 95  ? -3.623  -25.470 46.161  1.00 24.57 ? 123 ARG A CZ  1 
ATOM   685  N  NH1 . ARG A 1 95  ? -4.585  -24.641 46.562  1.00 20.73 ? 123 ARG A NH1 1 
ATOM   686  N  NH2 . ARG A 1 95  ? -3.387  -25.640 44.863  1.00 24.04 ? 123 ARG A NH2 1 
ATOM   687  N  N   . VAL A 1 96  ? -0.557  -22.096 50.062  1.00 22.76 ? 124 VAL A N   1 
ATOM   688  C  CA  . VAL A 1 96  ? -0.237  -20.869 49.325  1.00 24.11 ? 124 VAL A CA  1 
ATOM   689  C  C   . VAL A 1 96  ? -0.203  -21.170 47.820  1.00 24.39 ? 124 VAL A C   1 
ATOM   690  O  O   . VAL A 1 96  ? 0.555   -22.029 47.372  1.00 21.26 ? 124 VAL A O   1 
ATOM   691  C  CB  . VAL A 1 96  ? 1.127   -20.261 49.800  1.00 24.91 ? 124 VAL A CB  1 
ATOM   692  C  CG1 . VAL A 1 96  ? 1.542   -19.080 48.943  1.00 22.38 ? 124 VAL A CG1 1 
ATOM   693  C  CG2 . VAL A 1 96  ? 1.057   -19.853 51.295  1.00 22.04 ? 124 VAL A CG2 1 
ATOM   694  N  N   . THR A 1 97  ? -1.024  -20.464 47.046  1.00 22.83 ? 125 THR A N   1 
ATOM   695  C  CA  . THR A 1 97  ? -1.040  -20.638 45.596  1.00 23.09 ? 125 THR A CA  1 
ATOM   696  C  C   . THR A 1 97  ? -0.117  -19.636 44.903  1.00 23.73 ? 125 THR A C   1 
ATOM   697  O  O   . THR A 1 97  ? 0.393   -19.899 43.799  1.00 23.64 ? 125 THR A O   1 
ATOM   698  C  CB  . THR A 1 97  ? -2.461  -20.472 44.999  1.00 24.98 ? 125 THR A CB  1 
ATOM   699  O  OG1 . THR A 1 97  ? -2.953  -19.160 45.286  1.00 24.08 ? 125 THR A OG1 1 
ATOM   700  C  CG2 . THR A 1 97  ? -3.440  -21.508 45.557  1.00 25.21 ? 125 THR A CG2 1 
ATOM   701  N  N   . GLU A 1 98  ? 0.054   -18.476 45.542  1.00 23.59 ? 126 GLU A N   1 
ATOM   702  C  CA  . GLU A 1 98  ? 0.890   -17.387 45.022  1.00 24.47 ? 126 GLU A CA  1 
ATOM   703  C  C   . GLU A 1 98  ? 1.578   -16.667 46.173  1.00 26.22 ? 126 GLU A C   1 
ATOM   704  O  O   . GLU A 1 98  ? 0.933   -16.325 47.175  1.00 23.54 ? 126 GLU A O   1 
ATOM   705  C  CB  . GLU A 1 98  ? 0.041   -16.361 44.230  1.00 23.82 ? 126 GLU A CB  1 
ATOM   706  C  CG  . GLU A 1 98  ? -0.250  -16.729 42.780  1.00 28.52 ? 126 GLU A CG  1 
ATOM   707  C  CD  . GLU A 1 98  ? 1.003   -16.705 41.905  1.00 30.33 ? 126 GLU A CD  1 
ATOM   708  O  OE1 . GLU A 1 98  ? 1.420   -15.605 41.442  1.00 28.86 ? 126 GLU A OE1 1 
ATOM   709  O  OE2 . GLU A 1 98  ? 1.580   -17.786 41.675  1.00 26.86 ? 126 GLU A OE2 1 
ATOM   710  N  N   . GLY A 1 99  ? 2.882   -16.438 46.028  1.00 23.41 ? 127 GLY A N   1 
ATOM   711  C  CA  . GLY A 1 99  ? 3.630   -15.617 46.980  1.00 24.58 ? 127 GLY A CA  1 
ATOM   712  C  C   . GLY A 1 99  ? 4.177   -14.422 46.229  1.00 24.01 ? 127 GLY A C   1 
ATOM   713  O  O   . GLY A 1 99  ? 3.416   -13.654 45.608  1.00 23.00 ? 127 GLY A O   1 
ATOM   714  N  N   . TRP A 1 100 ? 5.497   -14.253 46.266  1.00 20.77 ? 128 TRP A N   1 
ATOM   715  C  CA  . TRP A 1 100 ? 6.131   -13.322 45.345  1.00 21.81 ? 128 TRP A CA  1 
ATOM   716  C  C   . TRP A 1 100 ? 5.825   -13.797 43.919  1.00 26.14 ? 128 TRP A C   1 
ATOM   717  O  O   . TRP A 1 100 ? 5.761   -15.002 43.672  1.00 31.33 ? 128 TRP A O   1 
ATOM   718  C  CB  . TRP A 1 100 ? 7.633   -13.265 45.599  1.00 21.32 ? 128 TRP A CB  1 
ATOM   719  C  CG  . TRP A 1 100 ? 8.382   -12.472 44.593  1.00 20.06 ? 128 TRP A CG  1 
ATOM   720  C  CD1 . TRP A 1 100 ? 8.432   -11.119 44.488  1.00 20.33 ? 128 TRP A CD1 1 
ATOM   721  C  CD2 . TRP A 1 100 ? 9.192   -12.992 43.538  1.00 22.19 ? 128 TRP A CD2 1 
ATOM   722  N  NE1 . TRP A 1 100 ? 9.238   -10.753 43.434  1.00 21.54 ? 128 TRP A NE1 1 
ATOM   723  C  CE2 . TRP A 1 100 ? 9.715   -11.885 42.831  1.00 23.01 ? 128 TRP A CE2 1 
ATOM   724  C  CE3 . TRP A 1 100 ? 9.537   -14.287 43.126  1.00 19.90 ? 128 TRP A CE3 1 
ATOM   725  C  CZ2 . TRP A 1 100 ? 10.559  -12.028 41.729  1.00 23.09 ? 128 TRP A CZ2 1 
ATOM   726  C  CZ3 . TRP A 1 100 ? 10.387  -14.431 42.022  1.00 21.01 ? 128 TRP A CZ3 1 
ATOM   727  C  CH2 . TRP A 1 100 ? 10.879  -13.307 41.337  1.00 22.06 ? 128 TRP A CH2 1 
ATOM   728  N  N   . ASP A 1 101 ? 5.614   -12.858 42.995  1.00 22.73 ? 129 ASP A N   1 
ATOM   729  C  CA  . ASP A 1 101 ? 5.279   -13.210 41.625  1.00 25.63 ? 129 ASP A CA  1 
ATOM   730  C  C   . ASP A 1 101 ? 6.173   -12.508 40.600  1.00 26.03 ? 129 ASP A C   1 
ATOM   731  O  O   . ASP A 1 101 ? 6.432   -11.312 40.699  1.00 24.44 ? 129 ASP A O   1 
ATOM   732  C  CB  . ASP A 1 101 ? 3.792   -12.941 41.320  1.00 25.74 ? 129 ASP A CB  1 
ATOM   733  C  CG  . ASP A 1 101 ? 3.391   -13.394 39.914  1.00 29.76 ? 129 ASP A CG  1 
ATOM   734  O  OD1 . ASP A 1 101 ? 3.674   -14.560 39.553  1.00 26.55 ? 129 ASP A OD1 1 
ATOM   735  O  OD2 . ASP A 1 101 ? 2.795   -12.588 39.166  1.00 25.45 ? 129 ASP A OD2 1 
ATOM   736  N  N   . GLU A 1 102 ? 6.633   -13.277 39.617  1.00 23.61 ? 130 GLU A N   1 
ATOM   737  C  CA  . GLU A 1 102 ? 7.317   -12.743 38.450  1.00 24.33 ? 130 GLU A CA  1 
ATOM   738  C  C   . GLU A 1 102 ? 6.572   -13.125 37.159  1.00 27.26 ? 130 GLU A C   1 
ATOM   739  O  O   . GLU A 1 102 ? 7.054   -12.845 36.068  1.00 27.85 ? 130 GLU A O   1 
ATOM   740  C  CB  . GLU A 1 102 ? 8.761   -13.263 38.401  1.00 26.71 ? 130 GLU A CB  1 
ATOM   741  C  CG  . GLU A 1 102 ? 8.882   -14.796 38.540  1.00 24.51 ? 130 GLU A CG  1 
ATOM   742  C  CD  . GLU A 1 102 ? 10.317  -15.317 38.435  1.00 27.59 ? 130 GLU A CD  1 
ATOM   743  O  OE1 . GLU A 1 102 ? 11.239  -14.524 38.142  1.00 25.40 ? 130 GLU A OE1 1 
ATOM   744  O  OE2 . GLU A 1 102 ? 10.515  -16.533 38.647  1.00 27.19 ? 130 GLU A OE2 1 
ATOM   745  N  N   . ASP A 1 103 ? 5.403   -13.759 37.298  1.00 28.76 ? 131 ASP A N   1 
ATOM   746  C  CA  . ASP A 1 103 ? 4.614   -14.228 36.151  1.00 32.73 ? 131 ASP A CA  1 
ATOM   747  C  C   . ASP A 1 103 ? 3.773   -13.130 35.503  1.00 34.55 ? 131 ASP A C   1 
ATOM   748  O  O   . ASP A 1 103 ? 3.309   -13.295 34.373  1.00 35.23 ? 131 ASP A O   1 
ATOM   749  C  CB  . ASP A 1 103 ? 3.666   -15.364 36.562  1.00 34.98 ? 131 ASP A CB  1 
ATOM   750  C  CG  . ASP A 1 103 ? 4.395   -16.611 37.020  1.00 37.52 ? 131 ASP A CG  1 
ATOM   751  O  OD1 . ASP A 1 103 ? 5.274   -17.104 36.266  1.00 37.67 ? 131 ASP A OD1 1 
ATOM   752  O  OD2 . ASP A 1 103 ? 4.068   -17.097 38.133  1.00 37.64 ? 131 ASP A OD2 1 
ATOM   753  N  N   . GLY A 1 104 ? 3.562   -12.029 36.222  1.00 31.94 ? 132 GLY A N   1 
ATOM   754  C  CA  . GLY A 1 104 ? 2.658   -10.962 35.781  1.00 28.39 ? 132 GLY A CA  1 
ATOM   755  C  C   . GLY A 1 104 ? 1.187   -11.318 35.944  1.00 28.46 ? 132 GLY A C   1 
ATOM   756  O  O   . GLY A 1 104 ? 0.318   -10.724 35.283  1.00 28.08 ? 132 GLY A O   1 
ATOM   757  N  N   . HIS A 1 105 ? 0.905   -12.280 36.828  1.00 25.72 ? 133 HIS A N   1 
ATOM   758  C  CA  . HIS A 1 105 ? -0.450  -12.827 37.003  1.00 28.04 ? 133 HIS A CA  1 
ATOM   759  C  C   . HIS A 1 105 ? -1.267  -12.119 38.081  1.00 27.27 ? 133 HIS A C   1 
ATOM   760  O  O   . HIS A 1 105 ? -2.088  -12.741 38.757  1.00 28.76 ? 133 HIS A O   1 
ATOM   761  C  CB  . HIS A 1 105 ? -0.397  -14.340 37.280  1.00 29.94 ? 133 HIS A CB  1 
ATOM   762  C  CG  . HIS A 1 105 ? -0.064  -15.163 36.069  1.00 33.56 ? 133 HIS A CG  1 
ATOM   763  N  ND1 . HIS A 1 105 ? 0.497   -16.418 36.155  1.00 36.66 ? 133 HIS A ND1 1 
ATOM   764  C  CD2 . HIS A 1 105 ? -0.210  -14.908 34.748  1.00 30.60 ? 133 HIS A CD2 1 
ATOM   765  C  CE1 . HIS A 1 105 ? 0.681   -16.902 34.938  1.00 35.87 ? 133 HIS A CE1 1 
ATOM   766  N  NE2 . HIS A 1 105 ? 0.259   -16.005 34.066  1.00 32.78 ? 133 HIS A NE2 1 
ATOM   767  N  N   . HIS A 1 106 ? -1.037  -10.816 38.237  1.00 27.30 ? 134 HIS A N   1 
ATOM   768  C  CA  . HIS A 1 106 ? -1.768  -10.020 39.215  1.00 27.86 ? 134 HIS A CA  1 
ATOM   769  C  C   . HIS A 1 106 ? -2.027  -8.632  38.640  1.00 24.17 ? 134 HIS A C   1 
ATOM   770  O  O   . HIS A 1 106 ? -1.732  -8.381  37.465  1.00 25.36 ? 134 HIS A O   1 
ATOM   771  C  CB  . HIS A 1 106 ? -1.019  -9.968  40.563  1.00 25.38 ? 134 HIS A CB  1 
ATOM   772  C  CG  . HIS A 1 106 ? -0.727  -11.317 41.140  1.00 22.15 ? 134 HIS A CG  1 
ATOM   773  N  ND1 . HIS A 1 106 ? -1.597  -11.973 41.990  1.00 24.48 ? 134 HIS A ND1 1 
ATOM   774  C  CD2 . HIS A 1 106 ? 0.328   -12.147 40.966  1.00 22.40 ? 134 HIS A CD2 1 
ATOM   775  C  CE1 . HIS A 1 106 ? -1.081  -13.150 42.318  1.00 24.00 ? 134 HIS A CE1 1 
ATOM   776  N  NE2 . HIS A 1 106 ? 0.086   -13.278 41.704  1.00 22.88 ? 134 HIS A NE2 1 
ATOM   777  N  N   . SER A 1 107 ? -2.592  -7.735  39.444  1.00 28.39 ? 135 SER A N   1 
ATOM   778  C  CA  . SER A 1 107 ? -2.856  -6.366  39.004  1.00 30.49 ? 135 SER A CA  1 
ATOM   779  C  C   . SER A 1 107 ? -1.544  -5.648  38.714  1.00 33.99 ? 135 SER A C   1 
ATOM   780  O  O   . SER A 1 107 ? -0.475  -6.098  39.152  1.00 31.99 ? 135 SER A O   1 
ATOM   781  C  CB  . SER A 1 107 ? -3.654  -5.599  40.066  1.00 32.85 ? 135 SER A CB  1 
ATOM   782  O  OG  . SER A 1 107 ? -2.905  -5.492  41.263  1.00 33.62 ? 135 SER A OG  1 
ATOM   783  N  N   . GLU A 1 108 ? -1.633  -4.541  37.977  1.00 32.70 ? 136 GLU A N   1 
ATOM   784  C  CA  . GLU A 1 108 ? -0.470  -3.771  37.534  1.00 37.47 ? 136 GLU A CA  1 
ATOM   785  C  C   . GLU A 1 108 ? 0.554   -3.474  38.628  1.00 31.41 ? 136 GLU A C   1 
ATOM   786  O  O   . GLU A 1 108 ? 1.758   -3.604  38.400  1.00 37.85 ? 136 GLU A O   1 
ATOM   787  C  CB  . GLU A 1 108 ? -0.915  -2.443  36.914  1.00 40.26 ? 136 GLU A CB  1 
ATOM   788  C  CG  . GLU A 1 108 ? -1.356  -2.520  35.475  1.00 45.21 ? 136 GLU A CG  1 
ATOM   789  C  CD  . GLU A 1 108 ? -1.496  -1.143  34.841  1.00 45.33 ? 136 GLU A CD  1 
ATOM   790  O  OE1 . GLU A 1 108 ? -0.701  -0.239  35.189  1.00 48.18 ? 136 GLU A OE1 1 
ATOM   791  O  OE2 . GLU A 1 108 ? -2.402  -0.964  33.994  1.00 49.21 ? 136 GLU A OE2 1 
ATOM   792  N  N   . GLU A 1 109 ? 0.076   -3.048  39.797  1.00 28.26 ? 137 GLU A N   1 
ATOM   793  C  CA  . GLU A 1 109 ? 0.972   -2.677  40.903  1.00 26.26 ? 137 GLU A CA  1 
ATOM   794  C  C   . GLU A 1 109 ? 0.716   -3.534  42.139  1.00 25.18 ? 137 GLU A C   1 
ATOM   795  O  O   . GLU A 1 109 ? 0.490   -3.039  43.249  1.00 29.23 ? 137 GLU A O   1 
ATOM   796  C  CB  . GLU A 1 109 ? 0.841   -1.198  41.219  1.00 29.69 ? 137 GLU A CB  1 
ATOM   797  C  CG  . GLU A 1 109 ? 1.523   -0.342  40.160  1.00 33.72 ? 137 GLU A CG  1 
ATOM   798  C  CD  . GLU A 1 109 ? 1.512   1.136   40.483  1.00 37.41 ? 137 GLU A CD  1 
ATOM   799  O  OE1 . GLU A 1 109 ? 1.038   1.522   41.576  1.00 35.64 ? 137 GLU A OE1 1 
ATOM   800  O  OE2 . GLU A 1 109 ? 1.987   1.911   39.629  1.00 40.63 ? 137 GLU A OE2 1 
ATOM   801  N  N   . SER A 1 110 ? 0.758   -4.839  41.926  1.00 22.70 ? 138 SER A N   1 
ATOM   802  C  CA  . SER A 1 110 ? 0.375   -5.791  42.972  1.00 22.41 ? 138 SER A CA  1 
ATOM   803  C  C   . SER A 1 110 ? 1.448   -5.896  44.055  1.00 21.55 ? 138 SER A C   1 
ATOM   804  O  O   . SER A 1 110 ? 2.652   -5.906  43.753  1.00 20.08 ? 138 SER A O   1 
ATOM   805  C  CB  . SER A 1 110 ? 0.154   -7.163  42.362  1.00 23.82 ? 138 SER A CB  1 
ATOM   806  O  OG  . SER A 1 110 ? -0.036  -8.127  43.389  1.00 22.23 ? 138 SER A OG  1 
ATOM   807  N  N   . LEU A 1 111 ? 1.017   -5.989  45.311  1.00 20.53 ? 139 LEU A N   1 
ATOM   808  C  CA  . LEU A 1 111 ? 1.966   -6.256  46.401  1.00 20.76 ? 139 LEU A CA  1 
ATOM   809  C  C   . LEU A 1 111 ? 2.667   -7.611  46.249  1.00 19.69 ? 139 LEU A C   1 
ATOM   810  O  O   . LEU A 1 111 ? 3.724   -7.833  46.847  1.00 22.90 ? 139 LEU A O   1 
ATOM   811  C  CB  . LEU A 1 111 ? 1.301   -6.099  47.775  1.00 24.13 ? 139 LEU A CB  1 
ATOM   812  C  CG  . LEU A 1 111 ? 0.802   -4.678  48.124  1.00 28.71 ? 139 LEU A CG  1 
ATOM   813  C  CD1 . LEU A 1 111 ? 0.344   -4.600  49.567  1.00 26.64 ? 139 LEU A CD1 1 
ATOM   814  C  CD2 . LEU A 1 111 ? 1.844   -3.584  47.840  1.00 32.80 ? 139 LEU A CD2 1 
ATOM   815  N  N   . HIS A 1 112 ? 2.104   -8.511  45.441  1.00 20.46 ? 140 HIS A N   1 
ATOM   816  C  CA  . HIS A 1 112 ? 2.800   -9.779  45.108  1.00 22.09 ? 140 HIS A CA  1 
ATOM   817  C  C   . HIS A 1 112 ? 4.158   -9.578  44.467  1.00 20.52 ? 140 HIS A C   1 
ATOM   818  O  O   . HIS A 1 112 ? 5.055   -10.400 44.642  1.00 22.49 ? 140 HIS A O   1 
ATOM   819  C  CB  . HIS A 1 112 ? 1.961   -10.632 44.163  1.00 21.17 ? 140 HIS A CB  1 
ATOM   820  C  CG  . HIS A 1 112 ? 0.793   -11.284 44.837  1.00 20.18 ? 140 HIS A CG  1 
ATOM   821  N  ND1 . HIS A 1 112 ? 0.915   -12.449 45.559  1.00 19.99 ? 140 HIS A ND1 1 
ATOM   822  C  CD2 . HIS A 1 112 ? -0.503  -10.910 44.932  1.00 21.33 ? 140 HIS A CD2 1 
ATOM   823  C  CE1 . HIS A 1 112 ? -0.270  -12.787 46.041  1.00 20.71 ? 140 HIS A CE1 1 
ATOM   824  N  NE2 . HIS A 1 112 ? -1.147  -11.868 45.676  1.00 22.40 ? 140 HIS A NE2 1 
ATOM   825  N  N   . TYR A 1 113 ? 4.295   -8.492  43.718  1.00 20.35 ? 141 TYR A N   1 
ATOM   826  C  CA  . TYR A 1 113 ? 5.503   -8.235  42.953  1.00 22.09 ? 141 TYR A CA  1 
ATOM   827  C  C   . TYR A 1 113 ? 6.652   -7.827  43.863  1.00 22.28 ? 141 TYR A C   1 
ATOM   828  O  O   . TYR A 1 113 ? 7.802   -7.818  43.445  1.00 23.83 ? 141 TYR A O   1 
ATOM   829  C  CB  . TYR A 1 113 ? 5.256   -7.193  41.864  1.00 22.36 ? 141 TYR A CB  1 
ATOM   830  C  CG  . TYR A 1 113 ? 4.166   -7.566  40.870  1.00 22.67 ? 141 TYR A CG  1 
ATOM   831  C  CD1 . TYR A 1 113 ? 3.873   -8.906  40.569  1.00 25.35 ? 141 TYR A CD1 1 
ATOM   832  C  CD2 . TYR A 1 113 ? 3.434   -6.564  40.213  1.00 25.57 ? 141 TYR A CD2 1 
ATOM   833  C  CE1 . TYR A 1 113 ? 2.857   -9.240  39.661  1.00 24.09 ? 141 TYR A CE1 1 
ATOM   834  C  CE2 . TYR A 1 113 ? 2.430   -6.890  39.296  1.00 24.04 ? 141 TYR A CE2 1 
ATOM   835  C  CZ  . TYR A 1 113 ? 2.149   -8.223  39.021  1.00 26.86 ? 141 TYR A CZ  1 
ATOM   836  O  OH  . TYR A 1 113 ? 1.148   -8.536  38.111  1.00 24.65 ? 141 TYR A OH  1 
ATOM   837  N  N   . GLU A 1 114 ? 6.338   -7.514  45.116  1.00 21.20 ? 142 GLU A N   1 
ATOM   838  C  CA  . GLU A 1 114 ? 7.392   -7.191  46.064  1.00 28.30 ? 142 GLU A CA  1 
ATOM   839  C  C   . GLU A 1 114 ? 7.355   -8.058  47.318  1.00 22.93 ? 142 GLU A C   1 
ATOM   840  O  O   . GLU A 1 114 ? 7.893   -7.670  48.356  1.00 21.94 ? 142 GLU A O   1 
ATOM   841  C  CB  . GLU A 1 114 ? 7.407   -5.692  46.390  1.00 27.98 ? 142 GLU A CB  1 
ATOM   842  C  CG  . GLU A 1 114 ? 6.110   -5.123  46.932  1.00 29.24 ? 142 GLU A CG  1 
ATOM   843  C  CD  . GLU A 1 114 ? 6.268   -3.693  47.415  1.00 32.97 ? 142 GLU A CD  1 
ATOM   844  O  OE1 . GLU A 1 114 ? 7.207   -3.421  48.188  1.00 41.91 ? 142 GLU A OE1 1 
ATOM   845  O  OE2 . GLU A 1 114 ? 5.461   -2.837  47.032  1.00 33.99 ? 142 GLU A OE2 1 
ATOM   846  N  N   . GLY A 1 115 ? 6.726   -9.231  47.200  1.00 23.87 ? 143 GLY A N   1 
ATOM   847  C  CA  . GLY A 1 115 ? 6.719   -10.241 48.266  1.00 23.44 ? 143 GLY A CA  1 
ATOM   848  C  C   . GLY A 1 115 ? 5.913   -9.867  49.499  1.00 22.94 ? 143 GLY A C   1 
ATOM   849  O  O   . GLY A 1 115 ? 6.162   -10.382 50.583  1.00 22.38 ? 143 GLY A O   1 
ATOM   850  N  N   . ARG A 1 116 ? 4.936   -8.979  49.328  1.00 22.32 ? 144 ARG A N   1 
ATOM   851  C  CA  . ARG A 1 116 ? 4.131   -8.498  50.450  1.00 22.11 ? 144 ARG A CA  1 
ATOM   852  C  C   . ARG A 1 116 ? 2.729   -9.075  50.445  1.00 21.73 ? 144 ARG A C   1 
ATOM   853  O  O   . ARG A 1 116 ? 1.880   -8.645  51.238  1.00 21.26 ? 144 ARG A O   1 
ATOM   854  C  CB  . ARG A 1 116 ? 4.064   -6.962  50.468  1.00 23.02 ? 144 ARG A CB  1 
ATOM   855  C  CG  . ARG A 1 116 ? 5.372   -6.308  50.959  1.00 21.86 ? 144 ARG A CG  1 
ATOM   856  C  CD  . ARG A 1 116 ? 5.387   -4.790  50.746  1.00 26.02 ? 144 ARG A CD  1 
ATOM   857  N  NE  . ARG A 1 116 ? 4.181   -4.159  51.270  1.00 27.34 ? 144 ARG A NE  1 
ATOM   858  C  CZ  . ARG A 1 116 ? 3.736   -2.960  50.905  1.00 26.47 ? 144 ARG A CZ  1 
ATOM   859  N  NH1 . ARG A 1 116 ? 4.388   -2.248  49.993  1.00 27.09 ? 144 ARG A NH1 1 
ATOM   860  N  NH2 . ARG A 1 116 ? 2.623   -2.481  51.440  1.00 26.25 ? 144 ARG A NH2 1 
ATOM   861  N  N   . ALA A 1 117 ? 2.482   -10.044 49.565  1.00 22.38 ? 145 ALA A N   1 
ATOM   862  C  CA  . ALA A 1 117 ? 1.156   -10.667 49.506  1.00 21.81 ? 145 ALA A CA  1 
ATOM   863  C  C   . ALA A 1 117 ? 1.239   -12.152 49.241  1.00 21.93 ? 145 ALA A C   1 
ATOM   864  O  O   . ALA A 1 117 ? 2.209   -12.644 48.610  1.00 22.44 ? 145 ALA A O   1 
ATOM   865  C  CB  . ALA A 1 117 ? 0.246   -9.966  48.479  1.00 20.06 ? 145 ALA A CB  1 
ATOM   866  N  N   . VAL A 1 118 ? 0.251   -12.859 49.781  1.00 19.24 ? 146 VAL A N   1 
ATOM   867  C  CA  . VAL A 1 118 ? 0.012   -14.276 49.488  1.00 20.72 ? 146 VAL A CA  1 
ATOM   868  C  C   . VAL A 1 118 ? -1.452  -14.523 49.137  1.00 22.77 ? 146 VAL A C   1 
ATOM   869  O  O   . VAL A 1 118 ? -2.355  -13.862 49.666  1.00 24.24 ? 146 VAL A O   1 
ATOM   870  C  CB  . VAL A 1 118 ? 0.393   -15.225 50.684  1.00 22.28 ? 146 VAL A CB  1 
ATOM   871  C  CG1 . VAL A 1 118 ? 1.923   -15.327 50.843  1.00 23.44 ? 146 VAL A CG1 1 
ATOM   872  C  CG2 . VAL A 1 118 ? -0.302  -14.795 51.998  1.00 24.10 ? 146 VAL A CG2 1 
ATOM   873  N  N   . ASP A 1 119 ? -1.672  -15.458 48.222  1.00 21.65 ? 147 ASP A N   1 
ATOM   874  C  CA  . ASP A 1 119 ? -3.008  -16.009 47.974  1.00 21.98 ? 147 ASP A CA  1 
ATOM   875  C  C   . ASP A 1 119 ? -3.031  -17.390 48.564  1.00 22.55 ? 147 ASP A C   1 
ATOM   876  O  O   . ASP A 1 119 ? -2.102  -18.187 48.323  1.00 23.94 ? 147 ASP A O   1 
ATOM   877  C  CB  . ASP A 1 119 ? -3.316  -16.052 46.481  1.00 21.42 ? 147 ASP A CB  1 
ATOM   878  C  CG  . ASP A 1 119 ? -3.309  -14.673 45.858  1.00 20.22 ? 147 ASP A CG  1 
ATOM   879  O  OD1 . ASP A 1 119 ? -3.629  -13.706 46.584  1.00 24.24 ? 147 ASP A OD1 1 
ATOM   880  O  OD2 . ASP A 1 119 ? -2.977  -14.555 44.655  1.00 22.08 ? 147 ASP A OD2 1 
ATOM   881  N  N   . ILE A 1 120 ? -4.077  -17.656 49.349  1.00 24.66 ? 148 ILE A N   1 
ATOM   882  C  CA  . ILE A 1 120 ? -4.122  -18.822 50.212  1.00 22.77 ? 148 ILE A CA  1 
ATOM   883  C  C   . ILE A 1 120 ? -5.427  -19.590 50.059  1.00 21.77 ? 148 ILE A C   1 
ATOM   884  O  O   . ILE A 1 120 ? -6.480  -19.029 49.672  1.00 20.95 ? 148 ILE A O   1 
ATOM   885  C  CB  . ILE A 1 120 ? -3.895  -18.443 51.707  1.00 19.25 ? 148 ILE A CB  1 
ATOM   886  C  CG1 . ILE A 1 120 ? -5.005  -17.483 52.202  1.00 22.19 ? 148 ILE A CG1 1 
ATOM   887  C  CG2 . ILE A 1 120 ? -2.465  -17.899 51.933  1.00 21.81 ? 148 ILE A CG2 1 
ATOM   888  C  CD1 . ILE A 1 120 ? -5.100  -17.351 53.742  1.00 24.10 ? 148 ILE A CD1 1 
ATOM   889  N  N   . THR A 1 121 ? -5.340  -20.882 50.341  1.00 24.53 ? 149 THR A N   1 
ATOM   890  C  CA  . THR A 1 121 ? -6.493  -21.775 50.425  1.00 22.62 ? 149 THR A CA  1 
ATOM   891  C  C   . THR A 1 121 ? -6.231  -22.693 51.607  1.00 20.97 ? 149 THR A C   1 
ATOM   892  O  O   . THR A 1 121 ? -5.217  -22.556 52.272  1.00 20.17 ? 149 THR A O   1 
ATOM   893  C  CB  . THR A 1 121 ? -6.676  -22.651 49.149  1.00 25.50 ? 149 THR A CB  1 
ATOM   894  O  OG1 . THR A 1 121 ? -5.691  -23.704 49.131  1.00 23.02 ? 149 THR A OG1 1 
ATOM   895  C  CG2 . THR A 1 121 ? -6.572  -21.792 47.864  1.00 22.53 ? 149 THR A CG2 1 
ATOM   896  N  N   . THR A 1 122 ? -7.156  -23.619 51.878  1.00 22.09 ? 150 THR A N   1 
ATOM   897  C  CA  . THR A 1 122 ? -6.845  -24.755 52.729  1.00 22.52 ? 150 THR A CA  1 
ATOM   898  C  C   . THR A 1 122 ? -6.267  -25.878 51.863  1.00 20.58 ? 150 THR A C   1 
ATOM   899  O  O   . THR A 1 122 ? -6.411  -25.871 50.631  1.00 21.36 ? 150 THR A O   1 
ATOM   900  C  CB  . THR A 1 122 ? -8.092  -25.251 53.514  1.00 23.65 ? 150 THR A CB  1 
ATOM   901  O  OG1 . THR A 1 122 ? -9.174  -25.421 52.607  1.00 23.49 ? 150 THR A OG1 1 
ATOM   902  C  CG2 . THR A 1 122 ? -8.509  -24.222 54.558  1.00 23.95 ? 150 THR A CG2 1 
ATOM   903  N  N   . SER A 1 123 ? -5.598  -26.841 52.505  1.00 21.65 ? 151 SER A N   1 
ATOM   904  C  CA  . SER A 1 123 ? -4.899  -27.890 51.766  1.00 21.37 ? 151 SER A CA  1 
ATOM   905  C  C   . SER A 1 123 ? -5.865  -28.820 51.009  1.00 23.85 ? 151 SER A C   1 
ATOM   906  O  O   . SER A 1 123 ? -5.484  -29.446 50.001  1.00 23.79 ? 151 SER A O   1 
ATOM   907  C  CB  . SER A 1 123 ? -3.987  -28.691 52.704  1.00 23.00 ? 151 SER A CB  1 
ATOM   908  O  OG  . SER A 1 123 ? -4.731  -29.243 53.779  1.00 22.17 ? 151 SER A OG  1 
ATOM   909  N  N   . ASP A 1 124 ? -7.088  -28.944 51.527  1.00 22.67 ? 152 ASP A N   1 
ATOM   910  C  CA  . ASP A 1 124 ? -8.117  -29.779 50.905  1.00 23.51 ? 152 ASP A CA  1 
ATOM   911  C  C   . ASP A 1 124 ? -8.908  -29.038 49.803  1.00 22.47 ? 152 ASP A C   1 
ATOM   912  O  O   . ASP A 1 124 ? -9.790  -29.625 49.150  1.00 24.51 ? 152 ASP A O   1 
ATOM   913  C  CB  . ASP A 1 124 ? -9.055  -30.386 51.970  1.00 23.14 ? 152 ASP A CB  1 
ATOM   914  C  CG  . ASP A 1 124 ? -9.840  -29.337 52.753  1.00 23.92 ? 152 ASP A CG  1 
ATOM   915  O  OD1 . ASP A 1 124 ? -9.702  -28.108 52.526  1.00 23.74 ? 152 ASP A OD1 1 
ATOM   916  O  OD2 . ASP A 1 124 ? -10.625 -29.752 53.627  1.00 26.34 ? 152 ASP A OD2 1 
ATOM   917  N  N   . ARG A 1 125 ? -8.565  -27.762 49.598  1.00 21.62 ? 153 ARG A N   1 
ATOM   918  C  CA  . ARG A 1 125 ? -9.173  -26.899 48.578  1.00 22.38 ? 153 ARG A CA  1 
ATOM   919  C  C   . ARG A 1 125 ? -10.706 -26.896 48.639  1.00 25.09 ? 153 ARG A C   1 
ATOM   920  O  O   . ARG A 1 125 ? -11.408 -26.826 47.627  1.00 22.32 ? 153 ARG A O   1 
ATOM   921  C  CB  . ARG A 1 125 ? -8.624  -27.229 47.192  1.00 25.40 ? 153 ARG A CB  1 
ATOM   922  C  CG  . ARG A 1 125 ? -7.137  -26.924 47.112  1.00 25.69 ? 153 ARG A CG  1 
ATOM   923  C  CD  . ARG A 1 125 ? -6.502  -27.672 45.999  1.00 25.62 ? 153 ARG A CD  1 
ATOM   924  N  NE  . ARG A 1 125 ? -6.684  -26.971 44.729  1.00 26.67 ? 153 ARG A NE  1 
ATOM   925  C  CZ  . ARG A 1 125 ? -6.186  -27.391 43.568  1.00 28.17 ? 153 ARG A CZ  1 
ATOM   926  N  NH1 . ARG A 1 125 ? -6.412  -26.686 42.466  1.00 23.67 ? 153 ARG A NH1 1 
ATOM   927  N  NH2 . ARG A 1 125 ? -5.473  -28.515 43.502  1.00 26.39 ? 153 ARG A NH2 1 
ATOM   928  N  N   . ASP A 1 126 ? -11.204 -26.957 49.869  1.00 23.91 ? 154 ASP A N   1 
ATOM   929  C  CA  . ASP A 1 126 ? -12.626 -26.915 50.139  1.00 22.33 ? 154 ASP A CA  1 
ATOM   930  C  C   . ASP A 1 126 ? -13.041 -25.456 50.169  1.00 20.02 ? 154 ASP A C   1 
ATOM   931  O  O   . ASP A 1 126 ? -12.813 -24.764 51.163  1.00 21.43 ? 154 ASP A O   1 
ATOM   932  C  CB  . ASP A 1 126 ? -12.893 -27.566 51.502  1.00 21.58 ? 154 ASP A CB  1 
ATOM   933  C  CG  . ASP A 1 126 ? -14.361 -27.541 51.905  1.00 25.94 ? 154 ASP A CG  1 
ATOM   934  O  OD1 . ASP A 1 126 ? -15.218 -27.020 51.151  1.00 25.49 ? 154 ASP A OD1 1 
ATOM   935  O  OD2 . ASP A 1 126 ? -14.660 -28.065 53.005  1.00 27.01 ? 154 ASP A OD2 1 
ATOM   936  N  N   . ARG A 1 127 ? -13.649 -24.987 49.082  1.00 22.54 ? 155 ARG A N   1 
ATOM   937  C  CA  . ARG A 1 127 ? -14.037 -23.574 48.964  1.00 22.79 ? 155 ARG A CA  1 
ATOM   938  C  C   . ARG A 1 127 ? -14.937 -23.083 50.106  1.00 23.68 ? 155 ARG A C   1 
ATOM   939  O  O   . ARG A 1 127 ? -14.900 -21.902 50.455  1.00 22.56 ? 155 ARG A O   1 
ATOM   940  C  CB  . ARG A 1 127 ? -14.750 -23.330 47.636  1.00 21.91 ? 155 ARG A CB  1 
ATOM   941  C  CG  . ARG A 1 127 ? -13.844 -23.364 46.411  1.00 22.91 ? 155 ARG A CG  1 
ATOM   942  C  CD  . ARG A 1 127 ? -14.636 -22.967 45.152  1.00 25.74 ? 155 ARG A CD  1 
ATOM   943  N  NE  . ARG A 1 127 ? -13.768 -22.762 43.985  1.00 24.70 ? 155 ARG A NE  1 
ATOM   944  C  CZ  . ARG A 1 127 ? -14.196 -22.312 42.805  1.00 24.56 ? 155 ARG A CZ  1 
ATOM   945  N  NH1 . ARG A 1 127 ? -15.485 -22.013 42.608  1.00 19.87 ? 155 ARG A NH1 1 
ATOM   946  N  NH2 . ARG A 1 127 ? -13.328 -22.154 41.813  1.00 25.31 ? 155 ARG A NH2 1 
ATOM   947  N  N   . SER A 1 128 ? -15.729 -23.985 50.686  1.00 22.67 ? 156 SER A N   1 
ATOM   948  C  CA  . SER A 1 128 ? -16.643 -23.608 51.780  1.00 26.16 ? 156 SER A CA  1 
ATOM   949  C  C   . SER A 1 128 ? -15.918 -23.127 53.052  1.00 25.29 ? 156 SER A C   1 
ATOM   950  O  O   . SER A 1 128 ? -16.523 -22.471 53.900  1.00 25.60 ? 156 SER A O   1 
ATOM   951  C  CB  . SER A 1 128 ? -17.595 -24.755 52.121  1.00 23.80 ? 156 SER A CB  1 
ATOM   952  O  OG  . SER A 1 128 ? -16.917 -25.776 52.818  1.00 24.96 ? 156 SER A OG  1 
ATOM   953  N  N   . LYS A 1 129 ? -14.641 -23.484 53.187  1.00 22.23 ? 157 LYS A N   1 
ATOM   954  C  CA  . LYS A 1 129 ? -13.811 -23.034 54.317  1.00 22.92 ? 157 LYS A CA  1 
ATOM   955  C  C   . LYS A 1 129 ? -13.165 -21.664 54.133  1.00 22.84 ? 157 LYS A C   1 
ATOM   956  O  O   . LYS A 1 129 ? -12.566 -21.151 55.077  1.00 22.29 ? 157 LYS A O   1 
ATOM   957  C  CB  . LYS A 1 129 ? -12.676 -24.035 54.599  1.00 21.75 ? 157 LYS A CB  1 
ATOM   958  C  CG  . LYS A 1 129 ? -13.150 -25.439 55.061  1.00 19.78 ? 157 LYS A CG  1 
ATOM   959  C  CD  . LYS A 1 129 ? -11.946 -26.351 55.370  1.00 23.31 ? 157 LYS A CD  1 
ATOM   960  C  CE  . LYS A 1 129 ? -12.384 -27.691 56.005  1.00 24.41 ? 157 LYS A CE  1 
ATOM   961  N  NZ  . LYS A 1 129 ? -12.769 -28.722 54.993  1.00 21.64 ? 157 LYS A NZ  1 
ATOM   962  N  N   . TYR A 1 130 ? -13.248 -21.092 52.933  1.00 19.95 ? 158 TYR A N   1 
ATOM   963  C  CA  . TYR A 1 130 ? -12.402 -19.910 52.627  1.00 20.73 ? 158 TYR A CA  1 
ATOM   964  C  C   . TYR A 1 130 ? -12.796 -18.613 53.361  1.00 21.88 ? 158 TYR A C   1 
ATOM   965  O  O   . TYR A 1 130 ? -11.932 -17.835 53.753  1.00 22.58 ? 158 TYR A O   1 
ATOM   966  C  CB  . TYR A 1 130 ? -12.275 -19.675 51.105  1.00 19.08 ? 158 TYR A CB  1 
ATOM   967  C  CG  . TYR A 1 130 ? -11.568 -20.789 50.315  1.00 20.33 ? 158 TYR A CG  1 
ATOM   968  C  CD1 . TYR A 1 130 ? -10.981 -21.897 50.942  1.00 20.20 ? 158 TYR A CD1 1 
ATOM   969  C  CD2 . TYR A 1 130 ? -11.476 -20.705 48.928  1.00 25.40 ? 158 TYR A CD2 1 
ATOM   970  C  CE1 . TYR A 1 130 ? -10.340 -22.927 50.177  1.00 20.73 ? 158 TYR A CE1 1 
ATOM   971  C  CE2 . TYR A 1 130 ? -10.843 -21.695 48.171  1.00 22.59 ? 158 TYR A CE2 1 
ATOM   972  C  CZ  . TYR A 1 130 ? -10.274 -22.799 48.798  1.00 22.64 ? 158 TYR A CZ  1 
ATOM   973  O  OH  . TYR A 1 130 ? -9.656  -23.762 48.020  1.00 23.56 ? 158 TYR A OH  1 
ATOM   974  N  N   . GLY A 1 131 ? -14.092 -18.385 53.547  1.00 21.80 ? 159 GLY A N   1 
ATOM   975  C  CA  . GLY A 1 131 ? -14.547 -17.246 54.361  1.00 23.72 ? 159 GLY A CA  1 
ATOM   976  C  C   . GLY A 1 131 ? -13.968 -17.313 55.778  1.00 23.76 ? 159 GLY A C   1 
ATOM   977  O  O   . GLY A 1 131 ? -13.458 -16.317 56.307  1.00 23.00 ? 159 GLY A O   1 
ATOM   978  N  N   . MET A 1 132 ? -14.003 -18.496 56.376  1.00 22.41 ? 160 MET A N   1 
ATOM   979  C  CA  . MET A 1 132 ? -13.425 -18.672 57.714  1.00 24.23 ? 160 MET A CA  1 
ATOM   980  C  C   . MET A 1 132 ? -11.898 -18.590 57.680  1.00 23.94 ? 160 MET A C   1 
ATOM   981  O  O   . MET A 1 132 ? -11.275 -18.008 58.584  1.00 22.96 ? 160 MET A O   1 
ATOM   982  C  CB  . MET A 1 132 ? -13.894 -19.999 58.339  1.00 27.16 ? 160 MET A CB  1 
ATOM   983  C  CG  . MET A 1 132 ? -13.451 -20.203 59.790  1.00 27.21 ? 160 MET A CG  1 
ATOM   984  S  SD  . MET A 1 132 ? -13.892 -18.857 60.937  1.00 30.62 ? 160 MET A SD  1 
ATOM   985  C  CE  . MET A 1 132 ? -15.652 -18.842 60.893  1.00 39.18 ? 160 MET A CE  1 
ATOM   986  N  N   . LEU A 1 133 ? -11.286 -19.179 56.649  1.00 22.47 ? 161 LEU A N   1 
ATOM   987  C  CA  . LEU A 1 133 ? -9.824  -19.033 56.450  1.00 21.29 ? 161 LEU A CA  1 
ATOM   988  C  C   . LEU A 1 133 ? -9.420  -17.551 56.464  1.00 21.45 ? 161 LEU A C   1 
ATOM   989  O  O   . LEU A 1 133 ? -8.410  -17.171 57.084  1.00 21.94 ? 161 LEU A O   1 
ATOM   990  C  CB  . LEU A 1 133 ? -9.402  -19.644 55.102  1.00 21.22 ? 161 LEU A CB  1 
ATOM   991  C  CG  . LEU A 1 133 ? -7.900  -19.562 54.764  1.00 21.87 ? 161 LEU A CG  1 
ATOM   992  C  CD1 . LEU A 1 133 ? -7.018  -20.281 55.830  1.00 22.02 ? 161 LEU A CD1 1 
ATOM   993  C  CD2 . LEU A 1 133 ? -7.676  -20.130 53.380  1.00 22.51 ? 161 LEU A CD2 1 
ATOM   994  N  N   . ALA A 1 134 ? -10.209 -16.730 55.761  1.00 25.77 ? 162 ALA A N   1 
ATOM   995  C  CA  . ALA A 1 134 ? -9.996  -15.293 55.697  1.00 21.44 ? 162 ALA A CA  1 
ATOM   996  C  C   . ALA A 1 134 ? -10.078 -14.655 57.087  1.00 19.94 ? 162 ALA A C   1 
ATOM   997  O  O   . ALA A 1 134 ? -9.250  -13.806 57.424  1.00 21.20 ? 162 ALA A O   1 
ATOM   998  C  CB  . ALA A 1 134 ? -10.972 -14.632 54.724  1.00 22.79 ? 162 ALA A CB  1 
ATOM   999  N  N   . ARG A 1 135 ? -11.057 -15.066 57.888  1.00 20.96 ? 163 ARG A N   1 
ATOM   1000 C  CA  . ARG A 1 135 ? -11.157 -14.560 59.259  1.00 20.50 ? 163 ARG A CA  1 
ATOM   1001 C  C   . ARG A 1 135 ? -9.913  -14.946 60.064  1.00 21.84 ? 163 ARG A C   1 
ATOM   1002 O  O   . ARG A 1 135 ? -9.379  -14.139 60.828  1.00 22.55 ? 163 ARG A O   1 
ATOM   1003 C  CB  . ARG A 1 135 ? -12.439 -15.049 59.942  1.00 19.00 ? 163 ARG A CB  1 
ATOM   1004 C  CG  . ARG A 1 135 ? -12.536 -14.758 61.466  1.00 20.00 ? 163 ARG A CG  1 
ATOM   1005 C  CD  . ARG A 1 135 ? -12.406 -13.283 61.810  1.00 24.30 ? 163 ARG A CD  1 
ATOM   1006 N  NE  . ARG A 1 135 ? -13.429 -12.447 61.179  1.00 23.90 ? 163 ARG A NE  1 
ATOM   1007 C  CZ  . ARG A 1 135 ? -13.436 -11.115 61.213  1.00 28.52 ? 163 ARG A CZ  1 
ATOM   1008 N  NH1 . ARG A 1 135 ? -12.479 -10.445 61.855  1.00 28.96 ? 163 ARG A NH1 1 
ATOM   1009 N  NH2 . ARG A 1 135 ? -14.415 -10.450 60.619  1.00 24.54 ? 163 ARG A NH2 1 
ATOM   1010 N  N   . LEU A 1 136 ? -9.451  -16.185 59.894  1.00 21.57 ? 164 LEU A N   1 
ATOM   1011 C  CA  . LEU A 1 136 ? -8.232  -16.619 60.572  1.00 19.80 ? 164 LEU A CA  1 
ATOM   1012 C  C   . LEU A 1 136 ? -7.022  -15.769 60.183  1.00 19.64 ? 164 LEU A C   1 
ATOM   1013 O  O   . LEU A 1 136 ? -6.171  -15.469 61.033  1.00 18.35 ? 164 LEU A O   1 
ATOM   1014 C  CB  . LEU A 1 136 ? -7.968  -18.108 60.330  1.00 23.43 ? 164 LEU A CB  1 
ATOM   1015 C  CG  . LEU A 1 136 ? -8.980  -19.086 60.959  1.00 22.32 ? 164 LEU A CG  1 
ATOM   1016 C  CD1 . LEU A 1 136 ? -8.676  -20.532 60.555  1.00 24.23 ? 164 LEU A CD1 1 
ATOM   1017 C  CD2 . LEU A 1 136 ? -9.062  -18.982 62.494  1.00 24.06 ? 164 LEU A CD2 1 
ATOM   1018 N  N   . ALA A 1 137 ? -6.973  -15.353 58.914  1.00 21.17 ? 165 ALA A N   1 
ATOM   1019 C  CA  . ALA A 1 137 ? -5.881  -14.517 58.416  1.00 19.41 ? 165 ALA A CA  1 
ATOM   1020 C  C   . ALA A 1 137 ? -5.918  -13.114 59.051  1.00 20.34 ? 165 ALA A C   1 
ATOM   1021 O  O   . ALA A 1 137 ? -4.873  -12.539 59.367  1.00 19.61 ? 165 ALA A O   1 
ATOM   1022 C  CB  . ALA A 1 137 ? -5.936  -14.451 56.878  1.00 21.85 ? 165 ALA A CB  1 
ATOM   1023 N  N   . VAL A 1 138 ? -7.116  -12.550 59.226  1.00 18.86 ? 166 VAL A N   1 
ATOM   1024 C  CA  . VAL A 1 138 ? -7.262  -11.293 59.968  1.00 22.06 ? 166 VAL A CA  1 
ATOM   1025 C  C   . VAL A 1 138 ? -6.718  -11.450 61.396  1.00 22.73 ? 166 VAL A C   1 
ATOM   1026 O  O   . VAL A 1 138 ? -5.884  -10.654 61.861  1.00 21.37 ? 166 VAL A O   1 
ATOM   1027 C  CB  . VAL A 1 138 ? -8.751  -10.813 60.007  1.00 20.10 ? 166 VAL A CB  1 
ATOM   1028 C  CG1 . VAL A 1 138 ? -8.899  -9.581  60.940  1.00 21.70 ? 166 VAL A CG1 1 
ATOM   1029 C  CG2 . VAL A 1 138 ? -9.243  -10.505 58.626  1.00 17.26 ? 166 VAL A CG2 1 
ATOM   1030 N  N   . GLU A 1 139 ? -7.179  -12.496 62.085  1.00 19.83 ? 167 GLU A N   1 
ATOM   1031 C  CA  . GLU A 1 139 ? -6.757  -12.749 63.447  1.00 21.48 ? 167 GLU A CA  1 
ATOM   1032 C  C   . GLU A 1 139 ? -5.235  -13.033 63.577  1.00 22.00 ? 167 GLU A C   1 
ATOM   1033 O  O   . GLU A 1 139 ? -4.631  -12.727 64.605  1.00 21.57 ? 167 GLU A O   1 
ATOM   1034 C  CB  . GLU A 1 139 ? -7.614  -13.862 64.074  1.00 22.70 ? 167 GLU A CB  1 
ATOM   1035 C  CG  . GLU A 1 139 ? -9.143  -13.565 64.026  1.00 28.86 ? 167 GLU A CG  1 
ATOM   1036 C  CD  . GLU A 1 139 ? -9.529  -12.223 64.656  1.00 35.69 ? 167 GLU A CD  1 
ATOM   1037 O  OE1 . GLU A 1 139 ? -9.146  -11.980 65.817  1.00 34.32 ? 167 GLU A OE1 1 
ATOM   1038 O  OE2 . GLU A 1 139 ? -10.215 -11.407 63.993  1.00 39.49 ? 167 GLU A OE2 1 
ATOM   1039 N  N   . ALA A 1 140 ? -4.631  -13.578 62.524  1.00 23.24 ? 168 ALA A N   1 
ATOM   1040 C  CA  . ALA A 1 140 ? -3.188  -13.840 62.488  1.00 24.31 ? 168 ALA A CA  1 
ATOM   1041 C  C   . ALA A 1 140 ? -2.371  -12.564 62.298  1.00 26.54 ? 168 ALA A C   1 
ATOM   1042 O  O   . ALA A 1 140 ? -1.138  -12.588 62.416  1.00 23.24 ? 168 ALA A O   1 
ATOM   1043 C  CB  . ALA A 1 140 ? -2.856  -14.844 61.368  1.00 24.63 ? 168 ALA A CB  1 
ATOM   1044 N  N   . GLY A 1 141 ? -3.048  -11.459 61.976  1.00 20.94 ? 169 GLY A N   1 
ATOM   1045 C  CA  . GLY A 1 141 ? -2.386  -10.151 61.932  1.00 22.04 ? 169 GLY A CA  1 
ATOM   1046 C  C   . GLY A 1 141 ? -2.033  -9.616  60.550  1.00 23.52 ? 169 GLY A C   1 
ATOM   1047 O  O   . GLY A 1 141 ? -1.318  -8.621  60.446  1.00 22.07 ? 169 GLY A O   1 
ATOM   1048 N  N   . PHE A 1 142 ? -2.529  -10.256 59.491  1.00 21.04 ? 170 PHE A N   1 
ATOM   1049 C  CA  . PHE A 1 142 ? -2.350  -9.695  58.154  1.00 20.73 ? 170 PHE A CA  1 
ATOM   1050 C  C   . PHE A 1 142 ? -2.955  -8.274  58.115  1.00 21.49 ? 170 PHE A C   1 
ATOM   1051 O  O   . PHE A 1 142 ? -4.030  -8.015  58.660  1.00 22.13 ? 170 PHE A O   1 
ATOM   1052 C  CB  . PHE A 1 142 ? -2.934  -10.604 57.058  1.00 22.41 ? 170 PHE A CB  1 
ATOM   1053 C  CG  . PHE A 1 142 ? -2.005  -11.727 56.644  1.00 21.33 ? 170 PHE A CG  1 
ATOM   1054 C  CD1 . PHE A 1 142 ? -0.985  -11.491 55.723  1.00 22.27 ? 170 PHE A CD1 1 
ATOM   1055 C  CD2 . PHE A 1 142 ? -2.139  -13.003 57.193  1.00 23.30 ? 170 PHE A CD2 1 
ATOM   1056 C  CE1 . PHE A 1 142 ? -0.111  -12.527 55.334  1.00 23.41 ? 170 PHE A CE1 1 
ATOM   1057 C  CE2 . PHE A 1 142 ? -1.262  -14.046 56.821  1.00 21.34 ? 170 PHE A CE2 1 
ATOM   1058 C  CZ  . PHE A 1 142 ? -0.252  -13.794 55.887  1.00 19.58 ? 170 PHE A CZ  1 
ATOM   1059 N  N   . ASP A 1 143 ? -2.223  -7.354  57.504  1.00 20.49 ? 171 ASP A N   1 
ATOM   1060 C  CA  . ASP A 1 143 ? -2.629  -5.954  57.446  1.00 20.74 ? 171 ASP A CA  1 
ATOM   1061 C  C   . ASP A 1 143 ? -3.833  -5.691  56.522  1.00 22.69 ? 171 ASP A C   1 
ATOM   1062 O  O   . ASP A 1 143 ? -4.531  -4.684  56.670  1.00 20.48 ? 171 ASP A O   1 
ATOM   1063 C  CB  . ASP A 1 143 ? -1.427  -5.092  57.045  1.00 20.99 ? 171 ASP A CB  1 
ATOM   1064 C  CG  . ASP A 1 143 ? -0.278  -5.229  58.035  1.00 24.68 ? 171 ASP A CG  1 
ATOM   1065 O  OD1 . ASP A 1 143 ? -0.498  -4.967  59.232  1.00 21.57 ? 171 ASP A OD1 1 
ATOM   1066 O  OD2 . ASP A 1 143 ? 0.835   -5.616  57.631  1.00 22.05 ? 171 ASP A OD2 1 
ATOM   1067 N  N   . TRP A 1 144 ? -4.059  -6.585  55.562  1.00 22.74 ? 172 TRP A N   1 
ATOM   1068 C  CA  . TRP A 1 144 ? -5.246  -6.508  54.702  1.00 22.35 ? 172 TRP A CA  1 
ATOM   1069 C  C   . TRP A 1 144 ? -5.571  -7.917  54.256  1.00 23.06 ? 172 TRP A C   1 
ATOM   1070 O  O   . TRP A 1 144 ? -4.661  -8.672  53.887  1.00 23.37 ? 172 TRP A O   1 
ATOM   1071 C  CB  . TRP A 1 144 ? -5.004  -5.612  53.479  1.00 20.18 ? 172 TRP A CB  1 
ATOM   1072 C  CG  . TRP A 1 144 ? -6.256  -5.108  52.758  1.00 19.50 ? 172 TRP A CG  1 
ATOM   1073 C  CD1 . TRP A 1 144 ? -7.172  -4.217  53.241  1.00 19.68 ? 172 TRP A CD1 1 
ATOM   1074 C  CD2 . TRP A 1 144 ? -6.684  -5.431  51.417  1.00 19.65 ? 172 TRP A CD2 1 
ATOM   1075 N  NE1 . TRP A 1 144 ? -8.150  -3.969  52.308  1.00 18.43 ? 172 TRP A NE1 1 
ATOM   1076 C  CE2 . TRP A 1 144 ? -7.880  -4.695  51.173  1.00 17.41 ? 172 TRP A CE2 1 
ATOM   1077 C  CE3 . TRP A 1 144 ? -6.182  -6.275  50.400  1.00 24.68 ? 172 TRP A CE3 1 
ATOM   1078 C  CZ2 . TRP A 1 144 ? -8.571  -4.762  49.954  1.00 22.58 ? 172 TRP A CZ2 1 
ATOM   1079 C  CZ3 . TRP A 1 144 ? -6.870  -6.329  49.173  1.00 19.88 ? 172 TRP A CZ3 1 
ATOM   1080 C  CH2 . TRP A 1 144 ? -8.058  -5.578  48.966  1.00 21.07 ? 172 TRP A CH2 1 
ATOM   1081 N  N   . VAL A 1 145 ? -6.857  -8.269  54.324  1.00 22.19 ? 173 VAL A N   1 
ATOM   1082 C  CA  . VAL A 1 145 ? -7.347  -9.590  53.902  1.00 22.39 ? 173 VAL A CA  1 
ATOM   1083 C  C   . VAL A 1 145 ? -8.577  -9.361  53.010  1.00 20.36 ? 173 VAL A C   1 
ATOM   1084 O  O   . VAL A 1 145 ? -9.478  -8.591  53.375  1.00 22.40 ? 173 VAL A O   1 
ATOM   1085 C  CB  . VAL A 1 145 ? -7.711  -10.486 55.112  1.00 22.92 ? 173 VAL A CB  1 
ATOM   1086 C  CG1 . VAL A 1 145 ? -8.247  -11.860 54.654  1.00 22.23 ? 173 VAL A CG1 1 
ATOM   1087 C  CG2 . VAL A 1 145 ? -6.490  -10.697 56.025  1.00 19.62 ? 173 VAL A CG2 1 
ATOM   1088 N  N   . TYR A 1 146 ? -8.619  -10.043 51.872  1.00 21.40 ? 174 TYR A N   1 
ATOM   1089 C  CA  . TYR A 1 146 ? -9.654  -9.824  50.863  1.00 21.28 ? 174 TYR A CA  1 
ATOM   1090 C  C   . TYR A 1 146 ? -10.088 -11.168 50.279  1.00 23.07 ? 174 TYR A C   1 
ATOM   1091 O  O   . TYR A 1 146 ? -9.250  -11.973 49.817  1.00 22.55 ? 174 TYR A O   1 
ATOM   1092 C  CB  . TYR A 1 146 ? -9.040  -8.952  49.781  1.00 22.56 ? 174 TYR A CB  1 
ATOM   1093 C  CG  . TYR A 1 146 ? -9.852  -8.685  48.533  1.00 23.19 ? 174 TYR A CG  1 
ATOM   1094 C  CD1 . TYR A 1 146 ? -11.246 -8.510  48.576  1.00 24.08 ? 174 TYR A CD1 1 
ATOM   1095 C  CD2 . TYR A 1 146 ? -9.204  -8.547  47.296  1.00 22.70 ? 174 TYR A CD2 1 
ATOM   1096 C  CE1 . TYR A 1 146 ? -11.961 -8.234  47.410  1.00 25.24 ? 174 TYR A CE1 1 
ATOM   1097 C  CE2 . TYR A 1 146 ? -9.917  -8.253  46.126  1.00 23.73 ? 174 TYR A CE2 1 
ATOM   1098 C  CZ  . TYR A 1 146 ? -11.289 -8.102  46.192  1.00 26.12 ? 174 TYR A CZ  1 
ATOM   1099 O  OH  . TYR A 1 146 ? -12.010 -7.822  45.053  1.00 25.15 ? 174 TYR A OH  1 
ATOM   1100 N  N   . TYR A 1 147 ? -11.389 -11.422 50.322  1.00 22.92 ? 175 TYR A N   1 
ATOM   1101 C  CA  . TYR A 1 147 ? -11.943 -12.689 49.838  1.00 21.31 ? 175 TYR A CA  1 
ATOM   1102 C  C   . TYR A 1 147 ? -12.147 -12.425 48.357  1.00 20.41 ? 175 TYR A C   1 
ATOM   1103 O  O   . TYR A 1 147 ? -13.253 -12.159 47.898  1.00 20.95 ? 175 TYR A O   1 
ATOM   1104 C  CB  . TYR A 1 147 ? -13.232 -13.004 50.595  1.00 20.37 ? 175 TYR A CB  1 
ATOM   1105 C  CG  . TYR A 1 147 ? -13.825 -14.379 50.368  1.00 24.94 ? 175 TYR A CG  1 
ATOM   1106 C  CD1 . TYR A 1 147 ? -14.782 -14.893 51.262  1.00 23.76 ? 175 TYR A CD1 1 
ATOM   1107 C  CD2 . TYR A 1 147 ? -13.446 -15.173 49.272  1.00 21.54 ? 175 TYR A CD2 1 
ATOM   1108 C  CE1 . TYR A 1 147 ? -15.361 -16.142 51.058  1.00 24.30 ? 175 TYR A CE1 1 
ATOM   1109 C  CE2 . TYR A 1 147 ? -14.023 -16.442 49.060  1.00 21.50 ? 175 TYR A CE2 1 
ATOM   1110 C  CZ  . TYR A 1 147 ? -14.962 -16.921 49.963  1.00 25.12 ? 175 TYR A CZ  1 
ATOM   1111 O  OH  . TYR A 1 147 ? -15.539 -18.164 49.757  1.00 22.60 ? 175 TYR A OH  1 
ATOM   1112 N  N   . GLU A 1 148 ? -11.028 -12.498 47.636  1.00 19.92 ? 176 GLU A N   1 
ATOM   1113 C  CA  . GLU A 1 148 ? -10.858 -11.977 46.281  1.00 22.03 ? 176 GLU A CA  1 
ATOM   1114 C  C   . GLU A 1 148 ? -11.527 -12.770 45.163  1.00 24.54 ? 176 GLU A C   1 
ATOM   1115 O  O   . GLU A 1 148 ? -11.946 -12.188 44.163  1.00 24.04 ? 176 GLU A O   1 
ATOM   1116 C  CB  . GLU A 1 148 ? -9.354  -11.876 45.969  1.00 24.85 ? 176 GLU A CB  1 
ATOM   1117 C  CG  . GLU A 1 148 ? -9.035  -11.235 44.595  1.00 23.71 ? 176 GLU A CG  1 
ATOM   1118 C  CD  . GLU A 1 148 ? -7.567  -10.875 44.440  1.00 25.25 ? 176 GLU A CD  1 
ATOM   1119 O  OE1 . GLU A 1 148 ? -6.670  -11.635 44.873  1.00 24.50 ? 176 GLU A OE1 1 
ATOM   1120 O  OE2 . GLU A 1 148 ? -7.310  -9.817  43.850  1.00 27.88 ? 176 GLU A OE2 1 
ATOM   1121 N  N   . SER A 1 149 ? -11.563 -14.089 45.306  1.00 23.69 ? 177 SER A N   1 
ATOM   1122 C  CA  . SER A 1 149 ? -12.204 -14.956 44.319  1.00 23.31 ? 177 SER A CA  1 
ATOM   1123 C  C   . SER A 1 149 ? -12.802 -16.157 45.028  1.00 22.87 ? 177 SER A C   1 
ATOM   1124 O  O   . SER A 1 149 ? -12.543 -16.390 46.196  1.00 23.13 ? 177 SER A O   1 
ATOM   1125 C  CB  . SER A 1 149 ? -11.217 -15.419 43.234  1.00 23.15 ? 177 SER A CB  1 
ATOM   1126 O  OG  . SER A 1 149 ? -10.497 -16.557 43.659  1.00 22.58 ? 177 SER A OG  1 
ATOM   1127 N  N   . LYS A 1 150 ? -13.602 -16.931 44.309  1.00 24.42 ? 178 LYS A N   1 
ATOM   1128 C  CA  . LYS A 1 150 ? -14.171 -18.151 44.890  1.00 23.59 ? 178 LYS A CA  1 
ATOM   1129 C  C   . LYS A 1 150 ? -13.061 -19.139 45.278  1.00 21.34 ? 178 LYS A C   1 
ATOM   1130 O  O   . LYS A 1 150 ? -13.251 -20.021 46.132  1.00 21.97 ? 178 LYS A O   1 
ATOM   1131 C  CB  . LYS A 1 150 ? -15.091 -18.812 43.869  1.00 28.09 ? 178 LYS A CB  1 
ATOM   1132 C  CG  . LYS A 1 150 ? -16.130 -17.909 43.267  1.00 34.17 ? 178 LYS A CG  1 
ATOM   1133 C  CD  . LYS A 1 150 ? -17.340 -17.744 44.163  1.00 31.90 ? 178 LYS A CD  1 
ATOM   1134 C  CE  . LYS A 1 150 ? -18.397 -16.899 43.448  1.00 31.46 ? 178 LYS A CE  1 
ATOM   1135 N  NZ  . LYS A 1 150 ? -19.199 -17.654 42.446  1.00 30.74 ? 178 LYS A NZ  1 
ATOM   1136 N  N   . ALA A 1 151 ? -11.903 -18.964 44.653  1.00 20.62 ? 179 ALA A N   1 
ATOM   1137 C  CA  . ALA A 1 151 ? -10.813 -19.948 44.696  1.00 21.14 ? 179 ALA A CA  1 
ATOM   1138 C  C   . ALA A 1 151 ? -9.668  -19.567 45.628  1.00 22.64 ? 179 ALA A C   1 
ATOM   1139 O  O   . ALA A 1 151 ? -8.772  -20.383 45.866  1.00 24.10 ? 179 ALA A O   1 
ATOM   1140 C  CB  . ALA A 1 151 ? -10.277 -20.218 43.272  1.00 21.38 ? 179 ALA A CB  1 
ATOM   1141 N  N   . HIS A 1 152 ? -9.675  -18.344 46.166  1.00 22.35 ? 180 HIS A N   1 
ATOM   1142 C  CA  . HIS A 1 152 ? -8.581  -17.944 47.052  1.00 20.59 ? 180 HIS A CA  1 
ATOM   1143 C  C   . HIS A 1 152 ? -8.892  -16.701 47.877  1.00 22.27 ? 180 HIS A C   1 
ATOM   1144 O  O   . HIS A 1 152 ? -9.766  -15.889 47.517  1.00 23.72 ? 180 HIS A O   1 
ATOM   1145 C  CB  . HIS A 1 152 ? -7.279  -17.688 46.256  1.00 20.78 ? 180 HIS A CB  1 
ATOM   1146 C  CG  . HIS A 1 152 ? -7.246  -16.351 45.562  1.00 22.67 ? 180 HIS A CG  1 
ATOM   1147 N  ND1 . HIS A 1 152 ? -7.883  -16.117 44.362  1.00 25.81 ? 180 HIS A ND1 1 
ATOM   1148 C  CD2 . HIS A 1 152 ? -6.662  -15.180 45.909  1.00 20.10 ? 180 HIS A CD2 1 
ATOM   1149 C  CE1 . HIS A 1 152 ? -7.684  -14.864 43.994  1.00 27.27 ? 180 HIS A CE1 1 
ATOM   1150 N  NE2 . HIS A 1 152 ? -6.936  -14.277 44.910  1.00 20.91 ? 180 HIS A NE2 1 
ATOM   1151 N  N   . ILE A 1 153 ? -8.139  -16.578 48.972  1.00 21.14 ? 181 ILE A N   1 
ATOM   1152 C  CA  . ILE A 1 153 ? -8.089  -15.373 49.803  1.00 24.85 ? 181 ILE A CA  1 
ATOM   1153 C  C   . ILE A 1 153 ? -6.741  -14.646 49.569  1.00 24.74 ? 181 ILE A C   1 
ATOM   1154 O  O   . ILE A 1 153 ? -5.680  -15.261 49.577  1.00 23.23 ? 181 ILE A O   1 
ATOM   1155 C  CB  . ILE A 1 153 ? -8.219  -15.721 51.314  1.00 22.30 ? 181 ILE A CB  1 
ATOM   1156 C  CG1 . ILE A 1 153 ? -9.451  -16.612 51.586  1.00 22.70 ? 181 ILE A CG1 1 
ATOM   1157 C  CG2 . ILE A 1 153 ? -8.234  -14.436 52.154  1.00 21.19 ? 181 ILE A CG2 1 
ATOM   1158 C  CD1 . ILE A 1 153 ? -10.775 -15.962 51.203  1.00 22.06 ? 181 ILE A CD1 1 
ATOM   1159 N  N   . HIS A 1 154 ? -6.803  -13.339 49.335  1.00 22.61 ? 182 HIS A N   1 
ATOM   1160 C  CA  . HIS A 1 154 ? -5.599  -12.523 49.181  1.00 22.89 ? 182 HIS A CA  1 
ATOM   1161 C  C   . HIS A 1 154 ? -5.288  -11.866 50.520  1.00 24.07 ? 182 HIS A C   1 
ATOM   1162 O  O   . HIS A 1 154 ? -6.151  -11.174 51.087  1.00 22.63 ? 182 HIS A O   1 
ATOM   1163 C  CB  . HIS A 1 154 ? -5.865  -11.434 48.133  1.00 22.47 ? 182 HIS A CB  1 
ATOM   1164 C  CG  . HIS A 1 154 ? -4.807  -10.375 48.062  1.00 22.73 ? 182 HIS A CG  1 
ATOM   1165 N  ND1 . HIS A 1 154 ? -3.738  -10.444 47.194  1.00 23.70 ? 182 HIS A ND1 1 
ATOM   1166 C  CD2 . HIS A 1 154 ? -4.660  -9.215  48.749  1.00 22.32 ? 182 HIS A CD2 1 
ATOM   1167 C  CE1 . HIS A 1 154 ? -2.984  -9.369  47.340  1.00 22.98 ? 182 HIS A CE1 1 
ATOM   1168 N  NE2 . HIS A 1 154 ? -3.520  -8.609  48.279  1.00 25.21 ? 182 HIS A NE2 1 
ATOM   1169 N  N   . CYS A 1 155 ? -4.062  -12.059 51.009  1.00 21.86 ? 183 CYS A N   1 
ATOM   1170 C  CA  . CYS A 1 155 ? -3.615  -11.436 52.256  1.00 23.30 ? 183 CYS A CA  1 
ATOM   1171 C  C   . CYS A 1 155 ? -2.333  -10.652 52.003  1.00 25.93 ? 183 CYS A C   1 
ATOM   1172 O  O   . CYS A 1 155 ? -1.471  -11.099 51.248  1.00 22.40 ? 183 CYS A O   1 
ATOM   1173 C  CB  . CYS A 1 155 ? -3.347  -12.495 53.329  1.00 24.83 ? 183 CYS A CB  1 
ATOM   1174 S  SG  . CYS A 1 155 ? -4.689  -13.685 53.588  1.00 24.90 ? 183 CYS A SG  1 
ATOM   1175 N  N   . SER A 1 156 ? -2.192  -9.502  52.647  1.00 22.25 ? 184 SER A N   1 
ATOM   1176 C  CA  . SER A 1 156 ? -0.999  -8.684  52.449  1.00 23.11 ? 184 SER A CA  1 
ATOM   1177 C  C   . SER A 1 156 ? -0.543  -7.999  53.731  1.00 19.58 ? 184 SER A C   1 
ATOM   1178 O  O   . SER A 1 156 ? -1.258  -7.993  54.751  1.00 21.11 ? 184 SER A O   1 
ATOM   1179 C  CB  . SER A 1 156 ? -1.202  -7.659  51.325  1.00 23.44 ? 184 SER A CB  1 
ATOM   1180 O  OG  . SER A 1 156 ? -2.189  -6.689  51.649  1.00 22.81 ? 184 SER A OG  1 
ATOM   1181 N  N   . VAL A 1 157 ? 0.654   -7.419  53.667  1.00 21.43 ? 185 VAL A N   1 
ATOM   1182 C  CA  . VAL A 1 157 ? 1.282   -6.783  54.822  1.00 18.74 ? 185 VAL A CA  1 
ATOM   1183 C  C   . VAL A 1 157 ? 1.911   -5.442  54.452  1.00 22.30 ? 185 VAL A C   1 
ATOM   1184 O  O   . VAL A 1 157 ? 2.278   -5.203  53.283  1.00 21.62 ? 185 VAL A O   1 
ATOM   1185 C  CB  . VAL A 1 157 ? 2.387   -7.696  55.472  1.00 21.74 ? 185 VAL A CB  1 
ATOM   1186 C  CG1 . VAL A 1 157 ? 1.767   -8.967  56.080  1.00 21.79 ? 185 VAL A CG1 1 
ATOM   1187 C  CG2 . VAL A 1 157 ? 3.488   -8.059  54.436  1.00 22.73 ? 185 VAL A CG2 1 
ATOM   1188 N  N   . LYS A 1 158 ? 2.041   -4.578  55.457  1.00 21.90 ? 186 LYS A N   1 
ATOM   1189 C  CA  . LYS A 1 158 ? 2.884   -3.373  55.365  1.00 20.06 ? 186 LYS A CA  1 
ATOM   1190 C  C   . LYS A 1 158 ? 4.316   -3.695  54.937  1.00 22.85 ? 186 LYS A C   1 
ATOM   1191 O  O   . LYS A 1 158 ? 4.842   -4.770  55.242  1.00 21.07 ? 186 LYS A O   1 
ATOM   1192 C  CB  . LYS A 1 158 ? 2.967   -2.669  56.718  1.00 23.17 ? 186 LYS A CB  1 
ATOM   1193 C  CG  . LYS A 1 158 ? 1.646   -2.187  57.283  1.00 28.62 ? 186 LYS A CG  1 
ATOM   1194 C  CD  . LYS A 1 158 ? 1.862   -1.665  58.710  1.00 32.52 ? 186 LYS A CD  1 
ATOM   1195 C  CE  . LYS A 1 158 ? 0.567   -1.642  59.508  1.00 39.69 ? 186 LYS A CE  1 
ATOM   1196 N  NZ  . LYS A 1 158 ? -0.580  -1.037  58.755  1.00 42.40 ? 186 LYS A NZ  1 
ATOM   1197 N  N   . ALA A 1 159 ? 4.960   -2.731  54.279  1.00 21.87 ? 187 ALA A N   1 
ATOM   1198 C  CA  . ALA A 1 159 ? 6.366   -2.849  53.914  1.00 20.41 ? 187 ALA A CA  1 
ATOM   1199 C  C   . ALA A 1 159 ? 7.209   -2.875  55.182  1.00 22.68 ? 187 ALA A C   1 
ATOM   1200 O  O   . ALA A 1 159 ? 6.831   -2.285  56.209  1.00 24.47 ? 187 ALA A O   1 
ATOM   1201 C  CB  . ALA A 1 159 ? 6.800   -1.674  53.021  1.00 19.07 ? 187 ALA A CB  1 
ATOM   1202 N  N   . GLU A 1 160 ? 8.362   -3.537  55.095  1.00 21.78 ? 188 GLU A N   1 
ATOM   1203 C  CA  . GLU A 1 160 ? 9.340   -3.552  56.191  1.00 22.60 ? 188 GLU A CA  1 
ATOM   1204 C  C   . GLU A 1 160 ? 9.718   -2.170  56.732  1.00 27.68 ? 188 GLU A C   1 
ATOM   1205 O  O   . GLU A 1 160 ? 9.884   -2.004  57.944  1.00 28.33 ? 188 GLU A O   1 
ATOM   1206 C  CB  . GLU A 1 160 ? 10.612  -4.310  55.778  1.00 22.68 ? 188 GLU A CB  1 
ATOM   1207 C  CG  . GLU A 1 160 ? 10.408  -5.802  55.517  1.00 25.19 ? 188 GLU A CG  1 
ATOM   1208 C  CD  . GLU A 1 160 ? 9.779   -6.535  56.690  1.00 27.48 ? 188 GLU A CD  1 
ATOM   1209 O  OE1 . GLU A 1 160 ? 10.257  -6.360  57.826  1.00 26.52 ? 188 GLU A OE1 1 
ATOM   1210 O  OE2 . GLU A 1 160 ? 8.807   -7.288  56.480  1.00 24.66 ? 188 GLU A OE2 1 
ATOM   1211 N  N   . ASN A 1 161 ? 9.877   -1.185  55.847  1.00 30.25 ? 189 ASN A N   1 
ATOM   1212 C  CA  . ASN A 1 161 ? 10.323  0.142   56.298  1.00 32.13 ? 189 ASN A CA  1 
ATOM   1213 C  C   . ASN A 1 161 ? 9.187   1.040   56.813  1.00 34.03 ? 189 ASN A C   1 
ATOM   1214 O  O   . ASN A 1 161 ? 9.420   2.180   57.224  1.00 32.22 ? 189 ASN A O   1 
ATOM   1215 C  CB  . ASN A 1 161 ? 11.221  0.838   55.257  1.00 35.67 ? 189 ASN A CB  1 
ATOM   1216 C  CG  . ASN A 1 161 ? 10.516  1.108   53.944  1.00 36.61 ? 189 ASN A CG  1 
ATOM   1217 O  OD1 . ASN A 1 161 ? 9.318   1.367   53.910  1.00 43.54 ? 189 ASN A OD1 1 
ATOM   1218 N  ND2 . ASN A 1 161 ? 11.271  1.065   52.849  1.00 35.45 ? 189 ASN A ND2 1 
ATOM   1219 N  N   . SER A 1 162 ? 7.967   0.501   56.796  1.00 34.71 ? 190 SER A N   1 
ATOM   1220 C  CA  . SER A 1 162 ? 6.811   1.121   57.436  1.00 37.81 ? 190 SER A CA  1 
ATOM   1221 C  C   . SER A 1 162 ? 6.563   0.594   58.854  1.00 40.91 ? 190 SER A C   1 
ATOM   1222 O  O   . SER A 1 162 ? 5.653   1.064   59.539  1.00 43.51 ? 190 SER A O   1 
ATOM   1223 C  CB  . SER A 1 162 ? 5.559   0.899   56.590  1.00 39.88 ? 190 SER A CB  1 
ATOM   1224 O  OG  . SER A 1 162 ? 5.617   1.668   55.408  1.00 41.37 ? 190 SER A OG  1 
ATOM   1225 N  N   . VAL A 1 163 ? 7.353   -0.387  59.288  1.00 41.51 ? 191 VAL A N   1 
ATOM   1226 C  CA  . VAL A 1 163 ? 7.181   -0.973  60.623  1.00 44.61 ? 191 VAL A CA  1 
ATOM   1227 C  C   . VAL A 1 163 ? 8.451   -0.878  61.463  1.00 46.24 ? 191 VAL A C   1 
ATOM   1228 O  O   . VAL A 1 163 ? 8.456   -0.239  62.514  1.00 47.30 ? 191 VAL A O   1 
ATOM   1229 C  CB  . VAL A 1 163 ? 6.659   -2.452  60.584  1.00 46.24 ? 191 VAL A CB  1 
ATOM   1230 C  CG1 . VAL A 1 163 ? 5.268   -2.530  59.952  1.00 44.11 ? 191 VAL A CG1 1 
ATOM   1231 C  CG2 . VAL A 1 163 ? 7.632   -3.379  59.861  1.00 47.31 ? 191 VAL A CG2 1 
ATOM   1232 N  N   . ASP B 2 1   ? -30.402 -17.217 36.999  1.00 32.44 ? 1   ASP L N   1 
ATOM   1233 C  CA  . ASP B 2 1   ? -29.057 -16.989 36.410  1.00 29.73 ? 1   ASP L CA  1 
ATOM   1234 C  C   . ASP B 2 1   ? -28.867 -15.542 35.999  1.00 28.06 ? 1   ASP L C   1 
ATOM   1235 O  O   . ASP B 2 1   ? -29.833 -14.828 35.719  1.00 25.63 ? 1   ASP L O   1 
ATOM   1236 C  CB  . ASP B 2 1   ? -28.841 -17.904 35.212  1.00 32.55 ? 1   ASP L CB  1 
ATOM   1237 C  CG  . ASP B 2 1   ? -29.043 -19.374 35.557  1.00 34.56 ? 1   ASP L CG  1 
ATOM   1238 O  OD1 . ASP B 2 1   ? -29.521 -19.690 36.677  1.00 35.61 ? 1   ASP L OD1 1 
ATOM   1239 O  OD2 . ASP B 2 1   ? -28.726 -20.211 34.697  1.00 31.69 ? 1   ASP L OD2 1 
ATOM   1240 N  N   . ILE B 2 2   ? -27.613 -15.114 35.969  1.00 23.01 ? 2   ILE L N   1 
ATOM   1241 C  CA  . ILE B 2 2   ? -27.286 -13.751 35.595  1.00 22.66 ? 2   ILE L CA  1 
ATOM   1242 C  C   . ILE B 2 2   ? -27.155 -13.672 34.078  1.00 19.90 ? 2   ILE L C   1 
ATOM   1243 O  O   . ILE B 2 2   ? -26.507 -14.511 33.460  1.00 20.48 ? 2   ILE L O   1 
ATOM   1244 C  CB  . ILE B 2 2   ? -26.007 -13.263 36.297  1.00 21.88 ? 2   ILE L CB  1 
ATOM   1245 C  CG1 . ILE B 2 2   ? -26.151 -13.440 37.818  1.00 20.73 ? 2   ILE L CG1 1 
ATOM   1246 C  CG2 . ILE B 2 2   ? -25.720 -11.800 35.936  1.00 21.08 ? 2   ILE L CG2 1 
ATOM   1247 C  CD1 . ILE B 2 2   ? -24.954 -12.959 38.631  1.00 22.84 ? 2   ILE L CD1 1 
ATOM   1248 N  N   . VAL B 2 3   ? -27.799 -12.671 33.481  1.00 20.93 ? 3   VAL L N   1 
ATOM   1249 C  CA  . VAL B 2 3   ? -27.752 -12.491 32.029  1.00 21.31 ? 3   VAL L CA  1 
ATOM   1250 C  C   . VAL B 2 3   ? -26.763 -11.375 31.697  1.00 22.00 ? 3   VAL L C   1 
ATOM   1251 O  O   . VAL B 2 3   ? -26.814 -10.287 32.290  1.00 21.65 ? 3   VAL L O   1 
ATOM   1252 C  CB  . VAL B 2 3   ? -29.175 -12.230 31.440  1.00 23.59 ? 3   VAL L CB  1 
ATOM   1253 C  CG1 . VAL B 2 3   ? -29.118 -11.821 29.964  1.00 25.66 ? 3   VAL L CG1 1 
ATOM   1254 C  CG2 . VAL B 2 3   ? -30.049 -13.473 31.605  1.00 25.59 ? 3   VAL L CG2 1 
ATOM   1255 N  N   . MET B 2 4   ? -25.847 -11.667 30.775  1.00 19.92 ? 4   MET L N   1 
ATOM   1256 C  CA  . MET B 2 4   ? -24.879 -10.681 30.315  1.00 20.07 ? 4   MET L CA  1 
ATOM   1257 C  C   . MET B 2 4   ? -25.308 -10.210 28.934  1.00 20.16 ? 4   MET L C   1 
ATOM   1258 O  O   . MET B 2 4   ? -25.366 -11.007 27.996  1.00 22.04 ? 4   MET L O   1 
ATOM   1259 C  CB  . MET B 2 4   ? -23.469 -11.279 30.270  1.00 22.01 ? 4   MET L CB  1 
ATOM   1260 C  CG  . MET B 2 4   ? -23.023 -11.933 31.571  1.00 24.69 ? 4   MET L CG  1 
ATOM   1261 S  SD  . MET B 2 4   ? -23.012 -10.792 32.943  1.00 26.59 ? 4   MET L SD  1 
ATOM   1262 C  CE  . MET B 2 4   ? -21.780 -9.636  32.397  1.00 26.78 ? 4   MET L CE  1 
ATOM   1263 N  N   . THR B 2 5   ? -25.638 -8.924  28.828  1.00 23.86 ? 5   THR L N   1 
ATOM   1264 C  CA  . THR B 2 5   ? -26.066 -8.345  27.554  1.00 24.32 ? 5   THR L CA  1 
ATOM   1265 C  C   . THR B 2 5   ? -24.920 -7.548  26.963  1.00 20.99 ? 5   THR L C   1 
ATOM   1266 O  O   . THR B 2 5   ? -24.461 -6.560  27.542  1.00 22.39 ? 5   THR L O   1 
ATOM   1267 C  CB  . THR B 2 5   ? -27.306 -7.474  27.703  1.00 24.42 ? 5   THR L CB  1 
ATOM   1268 O  OG1 . THR B 2 5   ? -28.278 -8.178  28.478  1.00 28.84 ? 5   THR L OG1 1 
ATOM   1269 C  CG2 . THR B 2 5   ? -27.898 -7.154  26.339  1.00 26.60 ? 5   THR L CG2 1 
ATOM   1270 N  N   . GLN B 2 6   ? -24.478 -7.995  25.800  1.00 19.60 ? 6   GLN L N   1 
ATOM   1271 C  CA  . GLN B 2 6   ? -23.287 -7.465  25.168  1.00 22.69 ? 6   GLN L CA  1 
ATOM   1272 C  C   . GLN B 2 6   ? -23.678 -6.661  23.943  1.00 23.16 ? 6   GLN L C   1 
ATOM   1273 O  O   . GLN B 2 6   ? -24.492 -7.115  23.130  1.00 24.03 ? 6   GLN L O   1 
ATOM   1274 C  CB  . GLN B 2 6   ? -22.372 -8.628  24.782  1.00 27.53 ? 6   GLN L CB  1 
ATOM   1275 C  CG  . GLN B 2 6   ? -20.924 -8.258  24.671  1.00 28.44 ? 6   GLN L CG  1 
ATOM   1276 C  CD  . GLN B 2 6   ? -20.030 -9.429  24.319  1.00 23.10 ? 6   GLN L CD  1 
ATOM   1277 O  OE1 . GLN B 2 6   ? -20.171 -10.538 24.845  1.00 22.85 ? 6   GLN L OE1 1 
ATOM   1278 N  NE2 . GLN B 2 6   ? -19.081 -9.176  23.441  1.00 21.45 ? 6   GLN L NE2 1 
ATOM   1279 N  N   . THR B 2 7   ? -23.093 -5.471  23.820  1.00 22.94 ? 7   THR L N   1 
ATOM   1280 C  CA  . THR B 2 7   ? -23.397 -4.535  22.722  1.00 24.76 ? 7   THR L CA  1 
ATOM   1281 C  C   . THR B 2 7   ? -22.114 -3.792  22.290  1.00 24.05 ? 7   THR L C   1 
ATOM   1282 O  O   . THR B 2 7   ? -21.222 -3.549  23.117  1.00 23.90 ? 7   THR L O   1 
ATOM   1283 C  CB  . THR B 2 7   ? -24.464 -3.484  23.132  1.00 25.35 ? 7   THR L CB  1 
ATOM   1284 O  OG1 . THR B 2 7   ? -24.049 -2.804  24.322  1.00 24.93 ? 7   THR L OG1 1 
ATOM   1285 C  CG2 . THR B 2 7   ? -25.838 -4.118  23.374  1.00 25.62 ? 7   THR L CG2 1 
ATOM   1286 N  N   . PRO B 2 8   ? -21.991 -3.475  20.989  1.00 25.71 ? 8   PRO L N   1 
ATOM   1287 C  CA  . PRO B 2 8   ? -22.884 -3.908  19.901  1.00 27.40 ? 8   PRO L CA  1 
ATOM   1288 C  C   . PRO B 2 8   ? -22.666 -5.377  19.532  1.00 26.00 ? 8   PRO L C   1 
ATOM   1289 O  O   . PRO B 2 8   ? -21.763 -6.022  20.067  1.00 24.50 ? 8   PRO L O   1 
ATOM   1290 C  CB  . PRO B 2 8   ? -22.485 -2.986  18.741  1.00 26.05 ? 8   PRO L CB  1 
ATOM   1291 C  CG  . PRO B 2 8   ? -21.040 -2.695  19.000  1.00 26.13 ? 8   PRO L CG  1 
ATOM   1292 C  CD  . PRO B 2 8   ? -20.908 -2.600  20.496  1.00 26.10 ? 8   PRO L CD  1 
ATOM   1293 N  N   . LYS B 2 9   ? -23.481 -5.895  18.620  1.00 27.01 ? 9   LYS L N   1 
ATOM   1294 C  CA  . LYS B 2 9   ? -23.340 -7.276  18.144  1.00 28.44 ? 9   LYS L CA  1 
ATOM   1295 C  C   . LYS B 2 9   ? -22.229 -7.381  17.092  1.00 23.88 ? 9   LYS L C   1 
ATOM   1296 O  O   . LYS B 2 9   ? -21.621 -8.437  16.906  1.00 22.17 ? 9   LYS L O   1 
ATOM   1297 C  CB  . LYS B 2 9   ? -24.668 -7.777  17.558  1.00 35.70 ? 9   LYS L CB  1 
ATOM   1298 C  CG  . LYS B 2 9   ? -25.907 -7.491  18.423  1.00 40.03 ? 9   LYS L CG  1 
ATOM   1299 C  CD  . LYS B 2 9   ? -26.188 -8.614  19.415  1.00 45.32 ? 9   LYS L CD  1 
ATOM   1300 C  CE  . LYS B 2 9   ? -27.369 -8.291  20.355  1.00 46.04 ? 9   LYS L CE  1 
ATOM   1301 N  NZ  . LYS B 2 9   ? -26.972 -7.697  21.679  1.00 50.38 ? 9   LYS L NZ  1 
ATOM   1302 N  N   . PHE B 2 10  ? -21.969 -6.269  16.413  1.00 22.28 ? 10  PHE L N   1 
ATOM   1303 C  CA  . PHE B 2 10  ? -21.020 -6.242  15.306  1.00 26.52 ? 10  PHE L CA  1 
ATOM   1304 C  C   . PHE B 2 10  ? -20.389 -4.854  15.216  1.00 23.65 ? 10  PHE L C   1 
ATOM   1305 O  O   . PHE B 2 10  ? -21.060 -3.848  15.462  1.00 19.82 ? 10  PHE L O   1 
ATOM   1306 C  CB  . PHE B 2 10  ? -21.754 -6.628  14.007  1.00 34.87 ? 10  PHE L CB  1 
ATOM   1307 C  CG  . PHE B 2 10  ? -21.231 -5.954  12.772  1.00 39.85 ? 10  PHE L CG  1 
ATOM   1308 C  CD1 . PHE B 2 10  ? -20.208 -6.539  12.024  1.00 43.84 ? 10  PHE L CD1 1 
ATOM   1309 C  CD2 . PHE B 2 10  ? -21.775 -4.739  12.341  1.00 43.93 ? 10  PHE L CD2 1 
ATOM   1310 C  CE1 . PHE B 2 10  ? -19.722 -5.911  10.870  1.00 42.77 ? 10  PHE L CE1 1 
ATOM   1311 C  CE2 . PHE B 2 10  ? -21.297 -4.105  11.188  1.00 43.64 ? 10  PHE L CE2 1 
ATOM   1312 C  CZ  . PHE B 2 10  ? -20.269 -4.696  10.453  1.00 41.78 ? 10  PHE L CZ  1 
ATOM   1313 N  N   . LEU B 2 11  ? -19.100 -4.809  14.884  1.00 22.06 ? 11  LEU L N   1 
ATOM   1314 C  CA  . LEU B 2 11  ? -18.399 -3.557  14.602  1.00 21.29 ? 11  LEU L CA  1 
ATOM   1315 C  C   . LEU B 2 11  ? -17.558 -3.720  13.354  1.00 23.04 ? 11  LEU L C   1 
ATOM   1316 O  O   . LEU B 2 11  ? -16.895 -4.751  13.192  1.00 21.61 ? 11  LEU L O   1 
ATOM   1317 C  CB  . LEU B 2 11  ? -17.487 -3.162  15.765  1.00 23.00 ? 11  LEU L CB  1 
ATOM   1318 C  CG  . LEU B 2 11  ? -18.108 -2.494  16.991  1.00 27.83 ? 11  LEU L CG  1 
ATOM   1319 C  CD1 . LEU B 2 11  ? -17.100 -2.438  18.122  1.00 25.58 ? 11  LEU L CD1 1 
ATOM   1320 C  CD2 . LEU B 2 11  ? -18.623 -1.087  16.657  1.00 25.77 ? 11  LEU L CD2 1 
ATOM   1321 N  N   . LEU B 2 12  ? -17.597 -2.715  12.480  1.00 19.34 ? 12  LEU L N   1 
ATOM   1322 C  CA  . LEU B 2 12  ? -16.703 -2.637  11.318  1.00 19.35 ? 12  LEU L CA  1 
ATOM   1323 C  C   . LEU B 2 12  ? -15.780 -1.445  11.537  1.00 21.97 ? 12  LEU L C   1 
ATOM   1324 O  O   . LEU B 2 12  ? -16.233 -0.308  11.722  1.00 20.64 ? 12  LEU L O   1 
ATOM   1325 C  CB  . LEU B 2 12  ? -17.482 -2.485  10.013  1.00 18.77 ? 12  LEU L CB  1 
ATOM   1326 C  CG  . LEU B 2 12  ? -16.712 -2.383  8.691   1.00 19.87 ? 12  LEU L CG  1 
ATOM   1327 C  CD1 . LEU B 2 12  ? -15.994 -3.690  8.334   1.00 21.90 ? 12  LEU L CD1 1 
ATOM   1328 C  CD2 . LEU B 2 12  ? -17.668 -1.992  7.568   1.00 19.62 ? 12  LEU L CD2 1 
ATOM   1329 N  N   . VAL B 2 13  ? -14.482 -1.720  11.515  1.00 18.77 ? 13  VAL L N   1 
ATOM   1330 C  CA  A VAL B 2 13  ? -13.487 -0.766  11.978  0.50 18.13 ? 13  VAL L CA  1 
ATOM   1331 C  CA  B VAL B 2 13  ? -13.480 -0.768  11.989  0.50 20.09 ? 13  VAL L CA  1 
ATOM   1332 C  C   . VAL B 2 13  ? -12.220 -0.855  11.116  1.00 20.01 ? 13  VAL L C   1 
ATOM   1333 O  O   . VAL B 2 13  ? -11.806 -1.942  10.723  1.00 19.49 ? 13  VAL L O   1 
ATOM   1334 C  CB  A VAL B 2 13  ? -13.205 -0.996  13.509  0.50 19.44 ? 13  VAL L CB  1 
ATOM   1335 C  CB  B VAL B 2 13  ? -13.137 -1.038  13.498  0.50 23.61 ? 13  VAL L CB  1 
ATOM   1336 C  CG1 A VAL B 2 13  ? -12.636 -2.393  13.798  0.50 11.30 ? 13  VAL L CG1 1 
ATOM   1337 C  CG1 B VAL B 2 13  ? -11.927 -0.270  13.937  0.50 27.12 ? 13  VAL L CG1 1 
ATOM   1338 C  CG2 A VAL B 2 13  ? -12.337 0.085   14.102  0.50 22.94 ? 13  VAL L CG2 1 
ATOM   1339 C  CG2 B VAL B 2 13  ? -14.315 -0.673  14.423  0.50 22.02 ? 13  VAL L CG2 1 
ATOM   1340 N  N   . SER B 2 14  ? -11.624 0.293   10.808  1.00 16.56 ? 14  SER L N   1 
ATOM   1341 C  CA  . SER B 2 14  ? -10.349 0.334   10.076  1.00 18.92 ? 14  SER L CA  1 
ATOM   1342 C  C   . SER B 2 14  ? -9.207  0.137   11.072  1.00 19.94 ? 14  SER L C   1 
ATOM   1343 O  O   . SER B 2 14  ? -9.316  0.538   12.240  1.00 17.72 ? 14  SER L O   1 
ATOM   1344 C  CB  . SER B 2 14  ? -10.160 1.670   9.361   1.00 20.54 ? 14  SER L CB  1 
ATOM   1345 O  OG  . SER B 2 14  ? -11.063 1.813   8.289   1.00 23.09 ? 14  SER L OG  1 
ATOM   1346 N  N   . ALA B 2 15  ? -8.122  -0.496  10.626  1.00 21.99 ? 15  ALA L N   1 
ATOM   1347 C  CA  . ALA B 2 15  ? -6.933  -0.627  11.461  1.00 22.90 ? 15  ALA L CA  1 
ATOM   1348 C  C   . ALA B 2 15  ? -6.519  0.769   11.926  1.00 21.83 ? 15  ALA L C   1 
ATOM   1349 O  O   . ALA B 2 15  ? -6.447  1.702   11.121  1.00 21.39 ? 15  ALA L O   1 
ATOM   1350 C  CB  . ALA B 2 15  ? -5.798  -1.298  10.688  1.00 24.88 ? 15  ALA L CB  1 
ATOM   1351 N  N   . GLY B 2 16  ? -6.267  0.903   13.226  1.00 22.17 ? 16  GLY L N   1 
ATOM   1352 C  CA  . GLY B 2 16  ? -5.950  2.194   13.833  1.00 23.42 ? 16  GLY L CA  1 
ATOM   1353 C  C   . GLY B 2 16  ? -7.099  2.837   14.597  1.00 26.68 ? 16  GLY L C   1 
ATOM   1354 O  O   . GLY B 2 16  ? -6.866  3.730   15.432  1.00 28.67 ? 16  GLY L O   1 
ATOM   1355 N  N   . ASP B 2 17  ? -8.333  2.417   14.310  1.00 21.98 ? 17  ASP L N   1 
ATOM   1356 C  CA  . ASP B 2 17  ? -9.510  2.984   14.983  1.00 24.80 ? 17  ASP L CA  1 
ATOM   1357 C  C   . ASP B 2 17  ? -9.679  2.374   16.382  1.00 23.39 ? 17  ASP L C   1 
ATOM   1358 O  O   . ASP B 2 17  ? -9.095  1.328   16.700  1.00 23.68 ? 17  ASP L O   1 
ATOM   1359 C  CB  . ASP B 2 17  ? -10.817 2.741   14.208  1.00 22.46 ? 17  ASP L CB  1 
ATOM   1360 C  CG  . ASP B 2 17  ? -10.906 3.462   12.857  1.00 28.91 ? 17  ASP L CG  1 
ATOM   1361 O  OD1 . ASP B 2 17  ? -10.159 4.427   12.566  1.00 25.19 ? 17  ASP L OD1 1 
ATOM   1362 O  OD2 . ASP B 2 17  ? -11.793 3.040   12.066  1.00 32.03 ? 17  ASP L OD2 1 
ATOM   1363 N  N   . LYS B 2 18  ? -10.513 3.015   17.196  1.00 23.78 ? 18  LYS L N   1 
ATOM   1364 C  CA  . LYS B 2 18  ? -10.840 2.527   18.531  1.00 25.78 ? 18  LYS L CA  1 
ATOM   1365 C  C   . LYS B 2 18  ? -12.029 1.572   18.495  1.00 25.35 ? 18  LYS L C   1 
ATOM   1366 O  O   . LYS B 2 18  ? -12.990 1.791   17.754  1.00 24.04 ? 18  LYS L O   1 
ATOM   1367 C  CB  . LYS B 2 18  ? -11.162 3.703   19.450  1.00 27.58 ? 18  LYS L CB  1 
ATOM   1368 C  CG  . LYS B 2 18  ? -11.277 3.360   20.932  1.00 34.78 ? 18  LYS L CG  1 
ATOM   1369 C  CD  . LYS B 2 18  ? -11.628 4.614   21.723  1.00 41.08 ? 18  LYS L CD  1 
ATOM   1370 C  CE  . LYS B 2 18  ? -11.434 4.415   23.214  1.00 48.33 ? 18  LYS L CE  1 
ATOM   1371 N  NZ  . LYS B 2 18  ? -11.718 5.668   23.982  1.00 50.27 ? 18  LYS L NZ  1 
ATOM   1372 N  N   . VAL B 2 19  ? -11.960 0.528   19.317  1.00 22.44 ? 19  VAL L N   1 
ATOM   1373 C  CA  . VAL B 2 19  ? -13.066 -0.401  19.490  1.00 23.50 ? 19  VAL L CA  1 
ATOM   1374 C  C   . VAL B 2 19  ? -13.546 -0.346  20.939  1.00 23.50 ? 19  VAL L C   1 
ATOM   1375 O  O   . VAL B 2 19  ? -12.752 -0.495  21.865  1.00 22.55 ? 19  VAL L O   1 
ATOM   1376 C  CB  . VAL B 2 19  ? -12.659 -1.850  19.129  1.00 22.14 ? 19  VAL L CB  1 
ATOM   1377 C  CG1 . VAL B 2 19  ? -13.688 -2.845  19.648  1.00 24.14 ? 19  VAL L CG1 1 
ATOM   1378 C  CG2 . VAL B 2 19  ? -12.488 -2.011  17.626  1.00 23.94 ? 19  VAL L CG2 1 
ATOM   1379 N  N   . THR B 2 20  ? -14.846 -0.130  21.122  1.00 25.47 ? 20  THR L N   1 
ATOM   1380 C  CA  . THR B 2 20  ? -15.455 -0.076  22.453  1.00 25.62 ? 20  THR L CA  1 
ATOM   1381 C  C   . THR B 2 20  ? -16.632 -1.049  22.507  1.00 25.02 ? 20  THR L C   1 
ATOM   1382 O  O   . THR B 2 20  ? -17.617 -0.904  21.760  1.00 23.89 ? 20  THR L O   1 
ATOM   1383 C  CB  . THR B 2 20  ? -15.925 1.358   22.815  1.00 24.67 ? 20  THR L CB  1 
ATOM   1384 O  OG1 . THR B 2 20  ? -14.816 2.265   22.738  1.00 29.01 ? 20  THR L OG1 1 
ATOM   1385 C  CG2 . THR B 2 20  ? -16.520 1.414   24.238  1.00 25.35 ? 20  THR L CG2 1 
ATOM   1386 N  N   . ILE B 2 21  ? -16.519 -2.037  23.386  1.00 22.54 ? 21  ILE L N   1 
ATOM   1387 C  CA  . ILE B 2 21  ? -17.555 -3.052  23.566  1.00 22.66 ? 21  ILE L CA  1 
ATOM   1388 C  C   . ILE B 2 21  ? -18.067 -2.924  24.999  1.00 23.07 ? 21  ILE L C   1 
ATOM   1389 O  O   . ILE B 2 21  ? -17.291 -2.689  25.925  1.00 24.44 ? 21  ILE L O   1 
ATOM   1390 C  CB  . ILE B 2 21  ? -17.021 -4.485  23.289  1.00 23.42 ? 21  ILE L CB  1 
ATOM   1391 C  CG1 . ILE B 2 21  ? -16.671 -4.664  21.808  1.00 25.25 ? 21  ILE L CG1 1 
ATOM   1392 C  CG2 . ILE B 2 21  ? -18.045 -5.557  23.713  1.00 27.10 ? 21  ILE L CG2 1 
ATOM   1393 C  CD1 . ILE B 2 21  ? -15.794 -5.900  21.541  1.00 24.02 ? 21  ILE L CD1 1 
ATOM   1394 N  N   . THR B 2 22  ? -19.380 -3.053  25.156  1.00 23.63 ? 22  THR L N   1 
ATOM   1395 C  CA  . THR B 2 22  ? -20.042 -2.931  26.446  1.00 24.90 ? 22  THR L CA  1 
ATOM   1396 C  C   . THR B 2 22  ? -20.688 -4.247  26.853  1.00 28.05 ? 22  THR L C   1 
ATOM   1397 O  O   . THR B 2 22  ? -21.290 -4.947  26.039  1.00 24.27 ? 22  THR L O   1 
ATOM   1398 C  CB  . THR B 2 22  ? -21.105 -1.810  26.406  1.00 25.32 ? 22  THR L CB  1 
ATOM   1399 O  OG1 . THR B 2 22  ? -20.464 -0.587  26.044  1.00 26.26 ? 22  THR L OG1 1 
ATOM   1400 C  CG2 . THR B 2 22  ? -21.803 -1.640  27.767  1.00 26.07 ? 22  THR L CG2 1 
ATOM   1401 N  N   . CYS B 2 23  ? -20.536 -4.582  28.126  1.00 28.29 ? 23  CYS L N   1 
ATOM   1402 C  CA  . CYS B 2 23  ? -21.180 -5.748  28.689  1.00 25.73 ? 23  CYS L CA  1 
ATOM   1403 C  C   . CYS B 2 23  ? -21.947 -5.287  29.929  1.00 25.36 ? 23  CYS L C   1 
ATOM   1404 O  O   . CYS B 2 23  ? -21.394 -4.619  30.802  1.00 25.78 ? 23  CYS L O   1 
ATOM   1405 C  CB  . CYS B 2 23  ? -20.129 -6.825  28.990  1.00 31.35 ? 23  CYS L CB  1 
ATOM   1406 S  SG  . CYS B 2 23  ? -20.760 -8.326  29.709  1.00 40.06 ? 23  CYS L SG  1 
ATOM   1407 N  N   . LYS B 2 24  ? -23.235 -5.606  29.969  1.00 24.07 ? 24  LYS L N   1 
ATOM   1408 C  CA  . LYS B 2 24  ? -24.096 -5.243  31.093  1.00 28.33 ? 24  LYS L CA  1 
ATOM   1409 C  C   . LYS B 2 24  ? -24.712 -6.471  31.764  1.00 28.49 ? 24  LYS L C   1 
ATOM   1410 O  O   . LYS B 2 24  ? -25.368 -7.288  31.113  1.00 27.75 ? 24  LYS L O   1 
ATOM   1411 C  CB  . LYS B 2 24  ? -25.185 -4.259  30.654  1.00 29.67 ? 24  LYS L CB  1 
ATOM   1412 C  CG  . LYS B 2 24  ? -24.664 -2.851  30.377  1.00 31.21 ? 24  LYS L CG  1 
ATOM   1413 C  CD  . LYS B 2 24  ? -25.791 -1.918  29.987  1.00 36.38 ? 24  LYS L CD  1 
ATOM   1414 C  CE  . LYS B 2 24  ? -25.266 -0.543  29.623  1.00 37.01 ? 24  LYS L CE  1 
ATOM   1415 N  NZ  . LYS B 2 24  ? -26.397 0.406   29.405  1.00 39.59 ? 24  LYS L NZ  1 
ATOM   1416 N  N   . ALA B 2 25  ? -24.485 -6.591  33.070  1.00 24.81 ? 25  ALA L N   1 
ATOM   1417 C  CA  . ALA B 2 25  ? -25.041 -7.678  33.864  1.00 22.29 ? 25  ALA L CA  1 
ATOM   1418 C  C   . ALA B 2 25  ? -26.427 -7.304  34.423  1.00 21.75 ? 25  ALA L C   1 
ATOM   1419 O  O   . ALA B 2 25  ? -26.674 -6.153  34.803  1.00 23.47 ? 25  ALA L O   1 
ATOM   1420 C  CB  . ALA B 2 25  ? -24.092 -8.037  34.977  1.00 22.88 ? 25  ALA L CB  1 
ATOM   1421 N  N   . SER B 2 26  ? -27.326 -8.285  34.447  1.00 21.21 ? 26  SER L N   1 
ATOM   1422 C  CA  . SER B 2 26  ? -28.688 -8.106  34.964  1.00 23.24 ? 26  SER L CA  1 
ATOM   1423 C  C   . SER B 2 26  ? -28.739 -7.877  36.479  1.00 23.67 ? 26  SER L C   1 
ATOM   1424 O  O   . SER B 2 26  ? -29.754 -7.424  37.025  1.00 22.75 ? 26  SER L O   1 
ATOM   1425 C  CB  . SER B 2 26  ? -29.565 -9.298  34.570  1.00 25.03 ? 26  SER L CB  1 
ATOM   1426 O  OG  . SER B 2 26  ? -29.085 -10.508 35.133  1.00 24.37 ? 26  SER L OG  1 
ATOM   1427 N  N   . GLN B 2 27  ? -27.651 -8.214  37.164  1.00 21.75 ? 27  GLN L N   1 
ATOM   1428 C  CA  . GLN B 2 27  ? -27.490 -7.880  38.567  1.00 26.04 ? 27  GLN L CA  1 
ATOM   1429 C  C   . GLN B 2 27  ? -26.000 -7.772  38.833  1.00 24.82 ? 27  GLN L C   1 
ATOM   1430 O  O   . GLN B 2 27  ? -25.199 -8.192  38.005  1.00 21.22 ? 27  GLN L O   1 
ATOM   1431 C  CB  . GLN B 2 27  ? -28.147 -8.934  39.461  1.00 29.41 ? 27  GLN L CB  1 
ATOM   1432 C  CG  . GLN B 2 27  ? -27.493 -10.299 39.395  1.00 31.49 ? 27  GLN L CG  1 
ATOM   1433 C  CD  . GLN B 2 27  ? -28.210 -11.320 40.235  1.00 33.46 ? 27  GLN L CD  1 
ATOM   1434 O  OE1 . GLN B 2 27  ? -29.250 -11.849 39.840  1.00 35.78 ? 27  GLN L OE1 1 
ATOM   1435 N  NE2 . GLN B 2 27  ? -27.651 -11.615 41.403  1.00 33.32 ? 27  GLN L NE2 1 
ATOM   1436 N  N   . SER B 2 28  ? -25.633 -7.203  39.977  1.00 24.60 ? 28  SER L N   1 
ATOM   1437 C  CA  . SER B 2 28  ? -24.236 -6.927  40.256  1.00 23.87 ? 28  SER L CA  1 
ATOM   1438 C  C   . SER B 2 28  ? -23.399 -8.198  40.159  1.00 22.69 ? 28  SER L C   1 
ATOM   1439 O  O   . SER B 2 28  ? -23.776 -9.248  40.685  1.00 22.79 ? 28  SER L O   1 
ATOM   1440 C  CB  . SER B 2 28  ? -24.050 -6.300  41.628  1.00 25.84 ? 28  SER L CB  1 
ATOM   1441 O  OG  . SER B 2 28  ? -22.684 -5.989  41.808  1.00 23.34 ? 28  SER L OG  1 
ATOM   1442 N  N   . VAL B 2 29  ? -22.275 -8.095  39.463  1.00 19.80 ? 29  VAL L N   1 
ATOM   1443 C  CA  . VAL B 2 29  ? -21.303 -9.195  39.469  1.00 19.16 ? 29  VAL L CA  1 
ATOM   1444 C  C   . VAL B 2 29  ? -19.950 -8.780  40.065  1.00 19.97 ? 29  VAL L C   1 
ATOM   1445 O  O   . VAL B 2 29  ? -18.925 -9.403  39.767  1.00 20.92 ? 29  VAL L O   1 
ATOM   1446 C  CB  . VAL B 2 29  ? -21.125 -9.866  38.075  1.00 22.57 ? 29  VAL L CB  1 
ATOM   1447 C  CG1 . VAL B 2 29  ? -22.450 -10.491 37.593  1.00 21.26 ? 29  VAL L CG1 1 
ATOM   1448 C  CG2 . VAL B 2 29  ? -20.515 -8.897  37.040  1.00 17.31 ? 29  VAL L CG2 1 
ATOM   1449 N  N   . SER B 2 30  ? -19.968 -7.746  40.913  1.00 17.49 ? 30  SER L N   1 
ATOM   1450 C  CA  . SER B 2 30  ? -18.754 -7.189  41.525  1.00 16.63 ? 30  SER L CA  1 
ATOM   1451 C  C   . SER B 2 30  ? -17.729 -6.936  40.415  1.00 20.70 ? 30  SER L C   1 
ATOM   1452 O  O   . SER B 2 30  ? -18.041 -6.286  39.411  1.00 19.49 ? 30  SER L O   1 
ATOM   1453 C  CB  . SER B 2 30  ? -18.225 -8.161  42.612  1.00 17.89 ? 30  SER L CB  1 
ATOM   1454 O  OG  . SER B 2 30  ? -17.167 -7.596  43.373  1.00 19.37 ? 30  SER L OG  1 
ATOM   1455 N  N   . ASN B 2 31  ? -16.530 -7.489  40.560  1.00 20.14 ? 31  ASN L N   1 
ATOM   1456 C  CA  . ASN B 2 31  ? -15.540 -7.400  39.510  1.00 19.17 ? 31  ASN L CA  1 
ATOM   1457 C  C   . ASN B 2 31  ? -15.267 -8.743  38.812  1.00 21.87 ? 31  ASN L C   1 
ATOM   1458 O  O   . ASN B 2 31  ? -14.262 -8.887  38.123  1.00 24.31 ? 31  ASN L O   1 
ATOM   1459 C  CB  . ASN B 2 31  ? -14.254 -6.741  40.038  1.00 20.78 ? 31  ASN L CB  1 
ATOM   1460 C  CG  . ASN B 2 31  ? -13.574 -7.558  41.132  1.00 22.93 ? 31  ASN L CG  1 
ATOM   1461 O  OD1 . ASN B 2 31  ? -14.201 -8.396  41.792  1.00 21.49 ? 31  ASN L OD1 1 
ATOM   1462 N  ND2 . ASN B 2 31  ? -12.281 -7.322  41.322  1.00 23.53 ? 31  ASN L ND2 1 
ATOM   1463 N  N   . ASP B 2 32  ? -16.171 -9.716  38.982  1.00 20.76 ? 32  ASP L N   1 
ATOM   1464 C  CA  . ASP B 2 32  ? -15.960 -11.071 38.452  1.00 21.33 ? 32  ASP L CA  1 
ATOM   1465 C  C   . ASP B 2 32  ? -16.323 -11.157 36.981  1.00 22.48 ? 32  ASP L C   1 
ATOM   1466 O  O   . ASP B 2 32  ? -17.269 -11.844 36.598  1.00 20.67 ? 32  ASP L O   1 
ATOM   1467 C  CB  . ASP B 2 32  ? -16.756 -12.094 39.254  1.00 23.95 ? 32  ASP L CB  1 
ATOM   1468 C  CG  . ASP B 2 32  ? -16.141 -12.377 40.615  1.00 22.22 ? 32  ASP L CG  1 
ATOM   1469 O  OD1 . ASP B 2 32  ? -14.906 -12.192 40.785  1.00 21.94 ? 32  ASP L OD1 1 
ATOM   1470 O  OD2 . ASP B 2 32  ? -16.893 -12.801 41.508  1.00 22.75 ? 32  ASP L OD2 1 
ATOM   1471 N  N   . LEU B 2 33  ? -15.579 -10.426 36.169  1.00 20.04 ? 33  LEU L N   1 
ATOM   1472 C  CA  . LEU B 2 33  ? -15.890 -10.319 34.763  1.00 20.33 ? 33  LEU L CA  1 
ATOM   1473 C  C   . LEU B 2 33  ? -14.640 -10.530 33.932  1.00 21.97 ? 33  LEU L C   1 
ATOM   1474 O  O   . LEU B 2 33  ? -13.598 -9.915  34.173  1.00 19.45 ? 33  LEU L O   1 
ATOM   1475 C  CB  . LEU B 2 33  ? -16.577 -8.979  34.448  1.00 23.52 ? 33  LEU L CB  1 
ATOM   1476 C  CG  . LEU B 2 33  ? -17.238 -9.017  33.066  1.00 24.78 ? 33  LEU L CG  1 
ATOM   1477 C  CD1 . LEU B 2 33  ? -18.645 -8.528  33.062  1.00 33.76 ? 33  LEU L CD1 1 
ATOM   1478 C  CD2 . LEU B 2 33  ? -16.380 -8.345  32.018  1.00 24.46 ? 33  LEU L CD2 1 
ATOM   1479 N  N   . THR B 2 34  ? -14.778 -11.410 32.942  1.00 19.39 ? 34  THR L N   1 
ATOM   1480 C  CA  . THR B 2 34  ? -13.680 -11.872 32.123  1.00 19.32 ? 34  THR L CA  1 
ATOM   1481 C  C   . THR B 2 34  ? -14.020 -11.550 30.675  1.00 17.11 ? 34  THR L C   1 
ATOM   1482 O  O   . THR B 2 34  ? -15.186 -11.627 30.280  1.00 20.33 ? 34  THR L O   1 
ATOM   1483 C  CB  . THR B 2 34  ? -13.520 -13.406 32.281  1.00 20.58 ? 34  THR L CB  1 
ATOM   1484 O  OG1 . THR B 2 34  ? -13.315 -13.730 33.666  1.00 19.86 ? 34  THR L OG1 1 
ATOM   1485 C  CG2 . THR B 2 34  ? -12.351 -13.934 31.478  1.00 22.31 ? 34  THR L CG2 1 
ATOM   1486 N  N   . TRP B 2 35  ? -13.008 -11.160 29.908  1.00 15.81 ? 35  TRP L N   1 
ATOM   1487 C  CA  . TRP B 2 35  ? -13.161 -10.959 28.467  1.00 16.83 ? 35  TRP L CA  1 
ATOM   1488 C  C   . TRP B 2 35  ? -12.275 -11.947 27.711  1.00 19.35 ? 35  TRP L C   1 
ATOM   1489 O  O   . TRP B 2 35  ? -11.084 -12.078 28.016  1.00 21.62 ? 35  TRP L O   1 
ATOM   1490 C  CB  . TRP B 2 35  ? -12.760 -9.538  28.076  1.00 18.18 ? 35  TRP L CB  1 
ATOM   1491 C  CG  . TRP B 2 35  ? -13.680 -8.459  28.583  1.00 16.90 ? 35  TRP L CG  1 
ATOM   1492 C  CD1 . TRP B 2 35  ? -13.539 -7.718  29.719  1.00 20.11 ? 35  TRP L CD1 1 
ATOM   1493 C  CD2 . TRP B 2 35  ? -14.875 -8.005  27.946  1.00 21.34 ? 35  TRP L CD2 1 
ATOM   1494 N  NE1 . TRP B 2 35  ? -14.575 -6.815  29.828  1.00 22.69 ? 35  TRP L NE1 1 
ATOM   1495 C  CE2 . TRP B 2 35  ? -15.414 -6.977  28.753  1.00 20.83 ? 35  TRP L CE2 1 
ATOM   1496 C  CE3 . TRP B 2 35  ? -15.531 -8.352  26.754  1.00 23.64 ? 35  TRP L CE3 1 
ATOM   1497 C  CZ2 . TRP B 2 35  ? -16.590 -6.295  28.412  1.00 22.58 ? 35  TRP L CZ2 1 
ATOM   1498 C  CZ3 . TRP B 2 35  ? -16.712 -7.675  26.413  1.00 20.44 ? 35  TRP L CZ3 1 
ATOM   1499 C  CH2 . TRP B 2 35  ? -17.217 -6.649  27.239  1.00 19.34 ? 35  TRP L CH2 1 
ATOM   1500 N  N   . TYR B 2 36  ? -12.868 -12.602 26.713  1.00 19.74 ? 36  TYR L N   1 
ATOM   1501 C  CA  . TYR B 2 36  ? -12.184 -13.545 25.832  1.00 19.42 ? 36  TYR L CA  1 
ATOM   1502 C  C   . TYR B 2 36  ? -12.257 -13.079 24.389  1.00 19.74 ? 36  TYR L C   1 
ATOM   1503 O  O   . TYR B 2 36  ? -13.193 -12.375 23.996  1.00 19.91 ? 36  TYR L O   1 
ATOM   1504 C  CB  . TYR B 2 36  ? -12.860 -14.918 25.850  1.00 18.29 ? 36  TYR L CB  1 
ATOM   1505 C  CG  . TYR B 2 36  ? -12.920 -15.609 27.181  1.00 20.74 ? 36  TYR L CG  1 
ATOM   1506 C  CD1 . TYR B 2 36  ? -14.055 -15.501 27.990  1.00 19.25 ? 36  TYR L CD1 1 
ATOM   1507 C  CD2 . TYR B 2 36  ? -11.871 -16.413 27.608  1.00 20.08 ? 36  TYR L CD2 1 
ATOM   1508 C  CE1 . TYR B 2 36  ? -14.125 -16.159 29.196  1.00 20.82 ? 36  TYR L CE1 1 
ATOM   1509 C  CE2 . TYR B 2 36  ? -11.934 -17.081 28.820  1.00 20.03 ? 36  TYR L CE2 1 
ATOM   1510 C  CZ  . TYR B 2 36  ? -13.056 -16.947 29.608  1.00 21.27 ? 36  TYR L CZ  1 
ATOM   1511 O  OH  . TYR B 2 36  ? -13.113 -17.610 30.821  1.00 19.72 ? 36  TYR L OH  1 
ATOM   1512 N  N   . GLN B 2 37  ? -11.252 -13.486 23.623  1.00 20.31 ? 37  GLN L N   1 
ATOM   1513 C  CA  . GLN B 2 37  ? -11.125 -13.210 22.202  1.00 17.56 ? 37  GLN L CA  1 
ATOM   1514 C  C   . GLN B 2 37  ? -11.176 -14.550 21.491  1.00 20.53 ? 37  GLN L C   1 
ATOM   1515 O  O   . GLN B 2 37  ? -10.401 -15.453 21.817  1.00 22.40 ? 37  GLN L O   1 
ATOM   1516 C  CB  . GLN B 2 37  ? -9.766  -12.589 21.909  1.00 16.33 ? 37  GLN L CB  1 
ATOM   1517 C  CG  . GLN B 2 37  ? -9.511  -12.276 20.402  1.00 16.33 ? 37  GLN L CG  1 
ATOM   1518 C  CD  . GLN B 2 37  ? -8.050  -11.863 20.209  1.00 23.13 ? 37  GLN L CD  1 
ATOM   1519 O  OE1 . GLN B 2 37  ? -7.125  -12.611 20.568  1.00 23.00 ? 37  GLN L OE1 1 
ATOM   1520 N  NE2 . GLN B 2 37  ? -7.840  -10.662 19.688  1.00 21.34 ? 37  GLN L NE2 1 
ATOM   1521 N  N   . GLN B 2 38  ? -12.045 -14.679 20.495  1.00 21.64 ? 38  GLN L N   1 
ATOM   1522 C  CA  . GLN B 2 38  ? -12.083 -15.918 19.719  1.00 19.51 ? 38  GLN L CA  1 
ATOM   1523 C  C   . GLN B 2 38  ? -11.897 -15.634 18.227  1.00 20.26 ? 38  GLN L C   1 
ATOM   1524 O  O   . GLN B 2 38  ? -12.821 -15.155 17.564  1.00 19.10 ? 38  GLN L O   1 
ATOM   1525 C  CB  . GLN B 2 38  ? -13.407 -16.661 19.935  1.00 22.08 ? 38  GLN L CB  1 
ATOM   1526 C  CG  . GLN B 2 38  ? -13.469 -18.004 19.158  1.00 23.65 ? 38  GLN L CG  1 
ATOM   1527 C  CD  . GLN B 2 38  ? -14.690 -18.830 19.544  1.00 24.24 ? 38  GLN L CD  1 
ATOM   1528 O  OE1 . GLN B 2 38  ? -15.774 -18.289 19.767  1.00 28.47 ? 38  GLN L OE1 1 
ATOM   1529 N  NE2 . GLN B 2 38  ? -14.506 -20.137 19.659  1.00 24.31 ? 38  GLN L NE2 1 
ATOM   1530 N  N   . LYS B 2 39  ? -10.704 -15.949 17.728  1.00 21.70 ? 39  LYS L N   1 
ATOM   1531 C  CA  . LYS B 2 39  ? -10.345 -15.751 16.322  1.00 22.00 ? 39  LYS L CA  1 
ATOM   1532 C  C   . LYS B 2 39  ? -10.955 -16.886 15.502  1.00 23.10 ? 39  LYS L C   1 
ATOM   1533 O  O   . LYS B 2 39  ? -11.240 -17.955 16.050  1.00 26.96 ? 39  LYS L O   1 
ATOM   1534 C  CB  . LYS B 2 39  ? -8.822  -15.668 16.160  1.00 21.51 ? 39  LYS L CB  1 
ATOM   1535 C  CG  . LYS B 2 39  ? -8.191  -14.482 16.935  1.00 23.80 ? 39  LYS L CG  1 
ATOM   1536 C  CD  . LYS B 2 39  ? -6.753  -14.245 16.538  1.00 24.16 ? 39  LYS L CD  1 
ATOM   1537 C  CE  . LYS B 2 39  ? -6.184  -13.070 17.313  1.00 26.18 ? 39  LYS L CE  1 
ATOM   1538 N  NZ  . LYS B 2 39  ? -4.742  -12.845 17.017  1.00 25.11 ? 39  LYS L NZ  1 
ATOM   1539 N  N   . PRO B 2 40  ? -11.198 -16.652 14.195  1.00 27.61 ? 40  PRO L N   1 
ATOM   1540 C  CA  . PRO B 2 40  ? -11.862 -17.658 13.347  1.00 28.13 ? 40  PRO L CA  1 
ATOM   1541 C  C   . PRO B 2 40  ? -11.235 -19.045 13.477  1.00 29.58 ? 40  PRO L C   1 
ATOM   1542 O  O   . PRO B 2 40  ? -10.014 -19.177 13.375  1.00 28.45 ? 40  PRO L O   1 
ATOM   1543 C  CB  . PRO B 2 40  ? -11.654 -17.098 11.927  1.00 27.98 ? 40  PRO L CB  1 
ATOM   1544 C  CG  . PRO B 2 40  ? -11.621 -15.632 12.130  1.00 24.32 ? 40  PRO L CG  1 
ATOM   1545 C  CD  . PRO B 2 40  ? -10.902 -15.414 13.443  1.00 27.01 ? 40  PRO L CD  1 
ATOM   1546 N  N   . GLY B 2 41  ? -12.063 -20.049 13.765  1.00 27.94 ? 41  GLY L N   1 
ATOM   1547 C  CA  . GLY B 2 41  ? -11.624 -21.443 13.854  1.00 32.90 ? 41  GLY L CA  1 
ATOM   1548 C  C   . GLY B 2 41  ? -10.686 -21.749 15.010  1.00 32.86 ? 41  GLY L C   1 
ATOM   1549 O  O   . GLY B 2 41  ? -9.936  -22.725 14.966  1.00 37.21 ? 41  GLY L O   1 
ATOM   1550 N  N   . GLN B 2 42  ? -10.710 -20.897 16.034  1.00 27.45 ? 42  GLN L N   1 
ATOM   1551 C  CA  . GLN B 2 42  ? -9.922  -21.106 17.238  0.50 19.83 ? 42  GLN L CA  1 
ATOM   1552 C  C   . GLN B 2 42  ? -10.826 -21.189 18.464  1.00 21.71 ? 42  GLN L C   1 
ATOM   1553 O  O   . GLN B 2 42  ? -12.015 -20.851 18.435  1.00 26.47 ? 42  GLN L O   1 
ATOM   1554 C  CB  . GLN B 2 42  ? -8.884  -19.982 17.434  0.50 19.25 ? 42  GLN L CB  1 
ATOM   1555 C  CG  . GLN B 2 42  ? -7.760  -19.929 16.387  0.50 19.48 ? 42  GLN L CG  1 
ATOM   1556 C  CD  . GLN B 2 42  ? -6.643  -18.952 16.741  0.50 17.86 ? 42  GLN L CD  1 
ATOM   1557 O  OE1 . GLN B 2 42  ? -6.664  -18.305 17.780  0.50 18.28 ? 42  GLN L OE1 1 
ATOM   1558 N  NE2 . GLN B 2 42  ? -5.660  -18.850 15.869  0.50 19.36 ? 42  GLN L NE2 1 
ATOM   1559 N  N   . SER B 2 43  ? -10.232 -21.663 19.549  1.00 21.71 ? 43  SER L N   1 
ATOM   1560 C  CA  A SER B 2 43  ? -10.891 -21.688 20.835  0.50 21.40 ? 43  SER L CA  1 
ATOM   1561 C  CA  B SER B 2 43  ? -10.900 -21.681 20.832  0.50 23.94 ? 43  SER L CA  1 
ATOM   1562 C  C   . SER B 2 43  ? -10.746 -20.288 21.452  1.00 23.78 ? 43  SER L C   1 
ATOM   1563 O  O   . SER B 2 43  ? -9.846  -19.521 21.056  1.00 23.82 ? 43  SER L O   1 
ATOM   1564 C  CB  A SER B 2 43  ? -10.241 -22.747 21.728  0.50 19.31 ? 43  SER L CB  1 
ATOM   1565 C  CB  B SER B 2 43  ? -10.295 -22.761 21.732  0.50 26.32 ? 43  SER L CB  1 
ATOM   1566 O  OG  A SER B 2 43  ? -10.177 -24.001 21.063  0.50 16.70 ? 43  SER L OG  1 
ATOM   1567 O  OG  B SER B 2 43  ? -8.913  -22.938 21.474  0.50 30.37 ? 43  SER L OG  1 
ATOM   1568 N  N   . PRO B 2 44  ? -11.632 -19.932 22.406  1.00 22.70 ? 44  PRO L N   1 
ATOM   1569 C  CA  . PRO B 2 44  ? -11.479 -18.604 22.997  1.00 23.91 ? 44  PRO L CA  1 
ATOM   1570 C  C   . PRO B 2 44  ? -10.139 -18.454 23.713  1.00 25.49 ? 44  PRO L C   1 
ATOM   1571 O  O   . PRO B 2 44  ? -9.577  -19.444 24.181  1.00 26.97 ? 44  PRO L O   1 
ATOM   1572 C  CB  . PRO B 2 44  ? -12.629 -18.534 24.005  1.00 23.80 ? 44  PRO L CB  1 
ATOM   1573 C  CG  . PRO B 2 44  ? -13.642 -19.524 23.483  1.00 26.29 ? 44  PRO L CG  1 
ATOM   1574 C  CD  . PRO B 2 44  ? -12.801 -20.636 22.956  1.00 23.23 ? 44  PRO L CD  1 
ATOM   1575 N  N   . LYS B 2 45  ? -9.634  -17.225 23.756  1.00 20.79 ? 45  LYS L N   1 
ATOM   1576 C  CA  . LYS B 2 45  ? -8.380  -16.884 24.442  1.00 23.02 ? 45  LYS L CA  1 
ATOM   1577 C  C   . LYS B 2 45  ? -8.664  -15.828 25.510  1.00 22.39 ? 45  LYS L C   1 
ATOM   1578 O  O   . LYS B 2 45  ? -9.270  -14.788 25.232  1.00 21.71 ? 45  LYS L O   1 
ATOM   1579 C  CB  . LYS B 2 45  ? -7.359  -16.345 23.434  1.00 24.82 ? 45  LYS L CB  1 
ATOM   1580 C  CG  . LYS B 2 45  ? -6.074  -15.768 24.047  1.00 29.21 ? 45  LYS L CG  1 
ATOM   1581 C  CD  . LYS B 2 45  ? -5.229  -15.047 22.996  1.00 30.25 ? 45  LYS L CD  1 
ATOM   1582 C  CE  . LYS B 2 45  ? -4.055  -14.324 23.640  1.00 36.60 ? 45  LYS L CE  1 
ATOM   1583 N  NZ  . LYS B 2 45  ? -3.050  -13.857 22.633  1.00 42.03 ? 45  LYS L NZ  1 
ATOM   1584 N  N   . LEU B 2 46  ? -8.210  -16.089 26.729  1.00 19.20 ? 46  LEU L N   1 
ATOM   1585 C  CA  . LEU B 2 46  ? -8.366  -15.136 27.828  1.00 22.61 ? 46  LEU L CA  1 
ATOM   1586 C  C   . LEU B 2 46  ? -7.547  -13.839 27.664  1.00 23.51 ? 46  LEU L C   1 
ATOM   1587 O  O   . LEU B 2 46  ? -6.314  -13.871 27.539  1.00 21.12 ? 46  LEU L O   1 
ATOM   1588 C  CB  . LEU B 2 46  ? -7.988  -15.824 29.147  1.00 20.65 ? 46  LEU L CB  1 
ATOM   1589 C  CG  . LEU B 2 46  ? -7.847  -14.947 30.400  1.00 25.32 ? 46  LEU L CG  1 
ATOM   1590 C  CD1 . LEU B 2 46  ? -9.185  -14.350 30.752  1.00 26.18 ? 46  LEU L CD1 1 
ATOM   1591 C  CD2 . LEU B 2 46  ? -7.281  -15.765 31.561  1.00 28.84 ? 46  LEU L CD2 1 
ATOM   1592 N  N   . LEU B 2 47  ? -8.231  -12.697 27.729  1.00 18.81 ? 47  LEU L N   1 
ATOM   1593 C  CA  . LEU B 2 47  ? -7.548  -11.383 27.610  1.00 18.72 ? 47  LEU L CA  1 
ATOM   1594 C  C   . LEU B 2 47  ? -7.556  -10.564 28.901  1.00 20.25 ? 47  LEU L C   1 
ATOM   1595 O  O   . LEU B 2 47  ? -6.525  -10.045 29.307  1.00 22.04 ? 47  LEU L O   1 
ATOM   1596 C  CB  . LEU B 2 47  ? -8.174  -10.548 26.493  1.00 21.08 ? 47  LEU L CB  1 
ATOM   1597 C  CG  . LEU B 2 47  ? -8.109  -11.044 25.050  1.00 24.82 ? 47  LEU L CG  1 
ATOM   1598 C  CD1 . LEU B 2 47  ? -8.672  -9.943  24.168  1.00 24.09 ? 47  LEU L CD1 1 
ATOM   1599 C  CD2 . LEU B 2 47  ? -6.694  -11.406 24.634  1.00 22.68 ? 47  LEU L CD2 1 
ATOM   1600 N  N   . ILE B 2 48  ? -8.723  -10.452 29.534  1.00 19.69 ? 48  ILE L N   1 
ATOM   1601 C  CA  . ILE B 2 48  ? -8.892  -9.595  30.733  1.00 20.30 ? 48  ILE L CA  1 
ATOM   1602 C  C   . ILE B 2 48  ? -9.645  -10.413 31.782  1.00 22.78 ? 48  ILE L C   1 
ATOM   1603 O  O   . ILE B 2 48  ? -10.576 -11.145 31.446  1.00 22.05 ? 48  ILE L O   1 
ATOM   1604 C  CB  . ILE B 2 48  ? -9.711  -8.300  30.413  1.00 20.02 ? 48  ILE L CB  1 
ATOM   1605 C  CG1 . ILE B 2 48  ? -9.146  -7.538  29.189  1.00 20.23 ? 48  ILE L CG1 1 
ATOM   1606 C  CG2 . ILE B 2 48  ? -9.901  -7.412  31.669  1.00 20.65 ? 48  ILE L CG2 1 
ATOM   1607 C  CD1 . ILE B 2 48  ? -7.846  -6.786  29.429  1.00 22.26 ? 48  ILE L CD1 1 
ATOM   1608 N  N   . TYR B 2 49  ? -9.257  -10.283 33.046  1.00 21.86 ? 49  TYR L N   1 
ATOM   1609 C  CA  . TYR B 2 49  ? -10.007 -10.908 34.133  1.00 21.19 ? 49  TYR L CA  1 
ATOM   1610 C  C   . TYR B 2 49  ? -10.118 -9.920  35.299  1.00 21.06 ? 49  TYR L C   1 
ATOM   1611 O  O   . TYR B 2 49  ? -9.432  -8.893  35.299  1.00 21.40 ? 49  TYR L O   1 
ATOM   1612 C  CB  . TYR B 2 49  ? -9.341  -12.228 34.566  1.00 25.19 ? 49  TYR L CB  1 
ATOM   1613 C  CG  . TYR B 2 49  ? -7.962  -12.028 35.135  1.00 26.84 ? 49  TYR L CG  1 
ATOM   1614 C  CD1 . TYR B 2 49  ? -6.850  -11.896 34.298  1.00 23.74 ? 49  TYR L CD1 1 
ATOM   1615 C  CD2 . TYR B 2 49  ? -7.768  -11.952 36.520  1.00 28.04 ? 49  TYR L CD2 1 
ATOM   1616 C  CE1 . TYR B 2 49  ? -5.580  -11.686 34.828  1.00 28.97 ? 49  TYR L CE1 1 
ATOM   1617 C  CE2 . TYR B 2 49  ? -6.511  -11.747 37.060  1.00 29.38 ? 49  TYR L CE2 1 
ATOM   1618 C  CZ  . TYR B 2 49  ? -5.424  -11.619 36.214  1.00 29.83 ? 49  TYR L CZ  1 
ATOM   1619 O  OH  . TYR B 2 49  ? -4.182  -11.416 36.755  1.00 31.60 ? 49  TYR L OH  1 
ATOM   1620 N  N   . TYR B 2 50  ? -10.965 -10.223 36.286  1.00 19.42 ? 50  TYR L N   1 
ATOM   1621 C  CA  . TYR B 2 50  ? -11.286 -9.255  37.362  1.00 16.43 ? 50  TYR L CA  1 
ATOM   1622 C  C   . TYR B 2 50  ? -11.592 -7.859  36.790  1.00 19.80 ? 50  TYR L C   1 
ATOM   1623 O  O   . TYR B 2 50  ? -11.191 -6.828  37.366  1.00 18.13 ? 50  TYR L O   1 
ATOM   1624 C  CB  . TYR B 2 50  ? -10.169 -9.158  38.411  1.00 19.48 ? 50  TYR L CB  1 
ATOM   1625 C  CG  . TYR B 2 50  ? -9.811  -10.451 39.130  1.00 18.21 ? 50  TYR L CG  1 
ATOM   1626 C  CD1 . TYR B 2 50  ? -10.664 -11.564 39.123  1.00 23.35 ? 50  TYR L CD1 1 
ATOM   1627 C  CD2 . TYR B 2 50  ? -8.615  -10.544 39.843  1.00 19.38 ? 50  TYR L CD2 1 
ATOM   1628 C  CE1 . TYR B 2 50  ? -10.302 -12.751 39.792  1.00 20.76 ? 50  TYR L CE1 1 
ATOM   1629 C  CE2 . TYR B 2 50  ? -8.255  -11.711 40.517  1.00 21.66 ? 50  TYR L CE2 1 
ATOM   1630 C  CZ  . TYR B 2 50  ? -9.100  -12.812 40.485  1.00 21.09 ? 50  TYR L CZ  1 
ATOM   1631 O  OH  . TYR B 2 50  ? -8.734  -13.955 41.175  1.00 20.38 ? 50  TYR L OH  1 
ATOM   1632 N  N   . ALA B 2 51  ? -12.294 -7.862  35.653  1.00 19.79 ? 51  ALA L N   1 
ATOM   1633 C  CA  . ALA B 2 51  ? -12.775 -6.657  34.945  1.00 17.47 ? 51  ALA L CA  1 
ATOM   1634 C  C   . ALA B 2 51  ? -11.683 -5.802  34.289  1.00 19.40 ? 51  ALA L C   1 
ATOM   1635 O  O   . ALA B 2 51  ? -11.924 -5.218  33.237  1.00 20.35 ? 51  ALA L O   1 
ATOM   1636 C  CB  . ALA B 2 51  ? -13.652 -5.797  35.867  1.00 20.87 ? 51  ALA L CB  1 
ATOM   1637 N  N   . SER B 2 52  ? -10.502 -5.706  34.903  1.00 21.50 ? 52  SER L N   1 
ATOM   1638 C  CA  . SER B 2 52  ? -9.473  -4.785  34.410  1.00 19.28 ? 52  SER L CA  1 
ATOM   1639 C  C   . SER B 2 52  ? -8.045  -5.331  34.303  1.00 22.98 ? 52  SER L C   1 
ATOM   1640 O  O   . SER B 2 52  ? -7.181  -4.647  33.752  1.00 26.45 ? 52  SER L O   1 
ATOM   1641 C  CB  . SER B 2 52  ? -9.467  -3.496  35.234  1.00 20.95 ? 52  SER L CB  1 
ATOM   1642 O  OG  . SER B 2 52  ? -9.275  -3.781  36.603  1.00 20.62 ? 52  SER L OG  1 
ATOM   1643 N  N   . ASN B 2 53  ? -7.779  -6.521  34.847  1.00 20.46 ? 53  ASN L N   1 
ATOM   1644 C  CA  . ASN B 2 53  ? -6.428  -7.082  34.803  1.00 22.86 ? 53  ASN L CA  1 
ATOM   1645 C  C   . ASN B 2 53  ? -6.142  -7.688  33.436  1.00 21.47 ? 53  ASN L C   1 
ATOM   1646 O  O   . ASN B 2 53  ? -6.863  -8.581  32.991  1.00 22.63 ? 53  ASN L O   1 
ATOM   1647 C  CB  . ASN B 2 53  ? -6.225  -8.159  35.882  1.00 22.51 ? 53  ASN L CB  1 
ATOM   1648 C  CG  . ASN B 2 53  ? -6.228  -7.599  37.295  1.00 27.84 ? 53  ASN L CG  1 
ATOM   1649 O  OD1 . ASN B 2 53  ? -6.154  -6.391  37.509  1.00 26.42 ? 53  ASN L OD1 1 
ATOM   1650 N  ND2 . ASN B 2 53  ? -6.290  -8.493  38.274  1.00 29.83 ? 53  ASN L ND2 1 
ATOM   1651 N  N   . ARG B 2 54  ? -5.097  -7.205  32.767  1.00 22.37 ? 54  ARG L N   1 
ATOM   1652 C  CA  . ARG B 2 54  ? -4.645  -7.844  31.525  1.00 24.03 ? 54  ARG L CA  1 
ATOM   1653 C  C   . ARG B 2 54  ? -3.961  -9.149  31.881  1.00 26.11 ? 54  ARG L C   1 
ATOM   1654 O  O   . ARG B 2 54  ? -3.149  -9.188  32.813  1.00 28.60 ? 54  ARG L O   1 
ATOM   1655 C  CB  . ARG B 2 54  ? -3.639  -6.974  30.767  1.00 27.75 ? 54  ARG L CB  1 
ATOM   1656 C  CG  . ARG B 2 54  ? -4.188  -5.793  30.017  1.00 37.72 ? 54  ARG L CG  1 
ATOM   1657 C  CD  . ARG B 2 54  ? -3.066  -5.176  29.164  1.00 36.80 ? 54  ARG L CD  1 
ATOM   1658 N  NE  . ARG B 2 54  ? -3.340  -3.790  28.789  1.00 38.89 ? 54  ARG L NE  1 
ATOM   1659 C  CZ  . ARG B 2 54  ? -2.968  -2.720  29.488  1.00 41.76 ? 54  ARG L CZ  1 
ATOM   1660 N  NH1 . ARG B 2 54  ? -2.294  -2.850  30.630  1.00 43.43 ? 54  ARG L NH1 1 
ATOM   1661 N  NH2 . ARG B 2 54  ? -3.267  -1.510  29.038  1.00 42.31 ? 54  ARG L NH2 1 
ATOM   1662 N  N   . TYR B 2 55  ? -4.286  -10.211 31.150  1.00 26.15 ? 55  TYR L N   1 
ATOM   1663 C  CA  . TYR B 2 55  ? -3.596  -11.485 31.305  1.00 27.45 ? 55  TYR L CA  1 
ATOM   1664 C  C   . TYR B 2 55  ? -2.226  -11.373 30.636  1.00 30.28 ? 55  TYR L C   1 
ATOM   1665 O  O   . TYR B 2 55  ? -1.994  -10.479 29.809  1.00 30.11 ? 55  TYR L O   1 
ATOM   1666 C  CB  . TYR B 2 55  ? -4.427  -12.633 30.702  1.00 27.61 ? 55  TYR L CB  1 
ATOM   1667 C  CG  . TYR B 2 55  ? -3.871  -14.027 30.953  1.00 25.23 ? 55  TYR L CG  1 
ATOM   1668 C  CD1 . TYR B 2 55  ? -3.928  -14.597 32.221  1.00 27.58 ? 55  TYR L CD1 1 
ATOM   1669 C  CD2 . TYR B 2 55  ? -3.325  -14.787 29.918  1.00 31.43 ? 55  TYR L CD2 1 
ATOM   1670 C  CE1 . TYR B 2 55  ? -3.436  -15.871 32.461  1.00 28.73 ? 55  TYR L CE1 1 
ATOM   1671 C  CE2 . TYR B 2 55  ? -2.818  -16.083 30.151  1.00 28.34 ? 55  TYR L CE2 1 
ATOM   1672 C  CZ  . TYR B 2 55  ? -2.886  -16.610 31.423  1.00 28.29 ? 55  TYR L CZ  1 
ATOM   1673 O  OH  . TYR B 2 55  ? -2.400  -17.872 31.688  1.00 28.67 ? 55  TYR L OH  1 
ATOM   1674 N  N   . THR B 2 56  ? -1.312  -12.267 31.000  1.00 32.33 ? 56  THR L N   1 
ATOM   1675 C  CA  . THR B 2 56  ? 0.056   -12.218 30.480  1.00 39.22 ? 56  THR L CA  1 
ATOM   1676 C  C   . THR B 2 56  ? 0.129   -12.344 28.972  1.00 37.56 ? 56  THR L C   1 
ATOM   1677 O  O   . THR B 2 56  ? -0.640  -13.082 28.357  1.00 37.21 ? 56  THR L O   1 
ATOM   1678 C  CB  . THR B 2 56  ? 0.942   -13.292 31.115  1.00 43.58 ? 56  THR L CB  1 
ATOM   1679 O  OG1 . THR B 2 56  ? 0.244   -14.547 31.118  1.00 44.93 ? 56  THR L OG1 1 
ATOM   1680 C  CG2 . THR B 2 56  ? 1.267   -12.891 32.523  1.00 41.91 ? 56  THR L CG2 1 
ATOM   1681 N  N   . GLY B 2 57  ? 1.051   -11.592 28.382  1.00 41.05 ? 57  GLY L N   1 
ATOM   1682 C  CA  . GLY B 2 57  ? 1.260   -11.634 26.947  1.00 40.14 ? 57  GLY L CA  1 
ATOM   1683 C  C   . GLY B 2 57  ? 0.307   -10.746 26.178  1.00 37.84 ? 57  GLY L C   1 
ATOM   1684 O  O   . GLY B 2 57  ? 0.571   -10.440 25.022  1.00 42.24 ? 57  GLY L O   1 
ATOM   1685 N  N   . VAL B 2 58  ? -0.790  -10.334 26.822  1.00 33.37 ? 58  VAL L N   1 
ATOM   1686 C  CA  . VAL B 2 58  ? -1.840  -9.525  26.186  1.00 31.85 ? 58  VAL L CA  1 
ATOM   1687 C  C   . VAL B 2 58  ? -1.359  -8.083  25.937  1.00 28.18 ? 58  VAL L C   1 
ATOM   1688 O  O   . VAL B 2 58  ? -0.948  -7.391  26.879  1.00 27.11 ? 58  VAL L O   1 
ATOM   1689 C  CB  . VAL B 2 58  ? -3.154  -9.537  27.024  1.00 30.95 ? 58  VAL L CB  1 
ATOM   1690 C  CG1 . VAL B 2 58  ? -4.218  -8.608  26.428  1.00 31.18 ? 58  VAL L CG1 1 
ATOM   1691 C  CG2 . VAL B 2 58  ? -3.694  -10.963 27.149  1.00 31.00 ? 58  VAL L CG2 1 
ATOM   1692 N  N   . PRO B 2 59  ? -1.405  -7.632  24.667  1.00 30.57 ? 59  PRO L N   1 
ATOM   1693 C  CA  . PRO B 2 59  ? -0.913  -6.303  24.294  1.00 32.07 ? 59  PRO L CA  1 
ATOM   1694 C  C   . PRO B 2 59  ? -1.605  -5.177  25.054  1.00 31.34 ? 59  PRO L C   1 
ATOM   1695 O  O   . PRO B 2 59  ? -2.781  -5.300  25.419  1.00 28.81 ? 59  PRO L O   1 
ATOM   1696 C  CB  . PRO B 2 59  ? -1.264  -6.205  22.809  1.00 31.49 ? 59  PRO L CB  1 
ATOM   1697 C  CG  . PRO B 2 59  ? -1.344  -7.604  22.349  1.00 35.53 ? 59  PRO L CG  1 
ATOM   1698 C  CD  . PRO B 2 59  ? -1.926  -8.359  23.497  1.00 29.47 ? 59  PRO L CD  1 
ATOM   1699 N  N   . ASP B 2 60  ? -0.853  -4.101  25.279  1.00 26.95 ? 60  ASP L N   1 
ATOM   1700 C  CA  . ASP B 2 60  ? -1.308  -2.883  25.934  1.00 28.99 ? 60  ASP L CA  1 
ATOM   1701 C  C   . ASP B 2 60  ? -2.546  -2.244  25.311  1.00 24.55 ? 60  ASP L C   1 
ATOM   1702 O  O   . ASP B 2 60  ? -3.285  -1.529  25.990  1.00 24.13 ? 60  ASP L O   1 
ATOM   1703 C  CB  . ASP B 2 60  ? -0.171  -1.853  25.926  1.00 35.72 ? 60  ASP L CB  1 
ATOM   1704 C  CG  . ASP B 2 60  ? 0.840   -2.078  27.039  1.00 42.81 ? 60  ASP L CG  1 
ATOM   1705 O  OD1 . ASP B 2 60  ? 0.605   -2.931  27.924  1.00 43.80 ? 60  ASP L OD1 1 
ATOM   1706 O  OD2 . ASP B 2 60  ? 1.873   -1.379  27.033  1.00 46.69 ? 60  ASP L OD2 1 
ATOM   1707 N  N   . ARG B 2 61  ? -2.764  -2.483  24.018  1.00 25.20 ? 61  ARG L N   1 
ATOM   1708 C  CA  . ARG B 2 61  ? -3.918  -1.896  23.338  1.00 24.61 ? 61  ARG L CA  1 
ATOM   1709 C  C   . ARG B 2 61  ? -5.264  -2.414  23.854  1.00 24.18 ? 61  ARG L C   1 
ATOM   1710 O  O   . ARG B 2 61  ? -6.285  -1.764  23.621  1.00 22.59 ? 61  ARG L O   1 
ATOM   1711 C  CB  . ARG B 2 61  ? -3.807  -2.004  21.803  1.00 24.81 ? 61  ARG L CB  1 
ATOM   1712 C  CG  . ARG B 2 61  ? -3.966  -3.394  21.225  1.00 27.55 ? 61  ARG L CG  1 
ATOM   1713 C  CD  . ARG B 2 61  ? -3.866  -3.360  19.699  1.00 25.72 ? 61  ARG L CD  1 
ATOM   1714 N  NE  . ARG B 2 61  ? -3.865  -4.696  19.115  1.00 27.54 ? 61  ARG L NE  1 
ATOM   1715 C  CZ  . ARG B 2 61  ? -2.812  -5.508  19.103  1.00 31.49 ? 61  ARG L CZ  1 
ATOM   1716 N  NH1 . ARG B 2 61  ? -1.653  -5.113  19.635  1.00 28.00 ? 61  ARG L NH1 1 
ATOM   1717 N  NH2 . ARG B 2 61  ? -2.907  -6.711  18.544  1.00 28.05 ? 61  ARG L NH2 1 
ATOM   1718 N  N   . PHE B 2 62  ? -5.250  -3.558  24.560  1.00 22.21 ? 62  PHE L N   1 
ATOM   1719 C  CA  . PHE B 2 62  ? -6.451  -4.156  25.145  1.00 22.60 ? 62  PHE L CA  1 
ATOM   1720 C  C   . PHE B 2 62  ? -6.578  -3.751  26.604  1.00 25.40 ? 62  PHE L C   1 
ATOM   1721 O  O   . PHE B 2 62  ? -5.656  -3.970  27.395  1.00 24.82 ? 62  PHE L O   1 
ATOM   1722 C  CB  . PHE B 2 62  ? -6.415  -5.694  25.067  1.00 23.69 ? 62  PHE L CB  1 
ATOM   1723 C  CG  . PHE B 2 62  ? -6.336  -6.240  23.668  1.00 25.37 ? 62  PHE L CG  1 
ATOM   1724 C  CD1 . PHE B 2 62  ? -7.459  -6.272  22.854  1.00 25.54 ? 62  PHE L CD1 1 
ATOM   1725 C  CD2 . PHE B 2 62  ? -5.138  -6.745  23.171  1.00 27.05 ? 62  PHE L CD2 1 
ATOM   1726 C  CE1 . PHE B 2 62  ? -7.388  -6.790  21.558  1.00 25.22 ? 62  PHE L CE1 1 
ATOM   1727 C  CE2 . PHE B 2 62  ? -5.060  -7.262  21.869  1.00 30.19 ? 62  PHE L CE2 1 
ATOM   1728 C  CZ  . PHE B 2 62  ? -6.198  -7.283  21.066  1.00 23.41 ? 62  PHE L CZ  1 
ATOM   1729 N  N   . THR B 2 63  ? -7.717  -3.163  26.961  1.00 21.72 ? 63  THR L N   1 
ATOM   1730 C  CA  . THR B 2 63  ? -8.011  -2.836  28.358  1.00 23.34 ? 63  THR L CA  1 
ATOM   1731 C  C   . THR B 2 63  ? -9.451  -3.201  28.708  1.00 22.50 ? 63  THR L C   1 
ATOM   1732 O  O   . THR B 2 63  ? -10.301 -3.340  27.826  1.00 24.01 ? 63  THR L O   1 
ATOM   1733 C  CB  . THR B 2 63  ? -7.773  -1.334  28.688  1.00 26.61 ? 63  THR L CB  1 
ATOM   1734 O  OG1 . THR B 2 63  ? -8.678  -0.522  27.929  1.00 22.64 ? 63  THR L OG1 1 
ATOM   1735 C  CG2 . THR B 2 63  ? -6.338  -0.896  28.385  1.00 25.48 ? 63  THR L CG2 1 
ATOM   1736 N  N   . GLY B 2 64  ? -9.713  -3.381  29.997  1.00 23.38 ? 64  GLY L N   1 
ATOM   1737 C  CA  . GLY B 2 64  ? -11.077 -3.524  30.495  1.00 24.13 ? 64  GLY L CA  1 
ATOM   1738 C  C   . GLY B 2 64  ? -11.296 -2.592  31.674  1.00 21.51 ? 64  GLY L C   1 
ATOM   1739 O  O   . GLY B 2 64  ? -10.353 -2.243  32.382  1.00 20.49 ? 64  GLY L O   1 
ATOM   1740 N  N   . SER B 2 65  ? -12.539 -2.177  31.882  1.00 19.96 ? 65  SER L N   1 
ATOM   1741 C  CA  . SER B 2 65  ? -12.895 -1.380  33.052  1.00 21.15 ? 65  SER L CA  1 
ATOM   1742 C  C   . SER B 2 65  ? -14.311 -1.692  33.495  1.00 20.15 ? 65  SER L C   1 
ATOM   1743 O  O   . SER B 2 65  ? -15.072 -2.347  32.776  1.00 22.36 ? 65  SER L O   1 
ATOM   1744 C  CB  . SER B 2 65  ? -12.747 0.124   32.765  1.00 26.77 ? 65  SER L CB  1 
ATOM   1745 O  OG  . SER B 2 65  ? -13.649 0.532   31.752  1.00 29.91 ? 65  SER L OG  1 
ATOM   1746 N  N   . GLY B 2 66  ? -14.656 -1.222  34.689  1.00 26.32 ? 66  GLY L N   1 
ATOM   1747 C  CA  . GLY B 2 66  ? -16.004 -1.376  35.213  1.00 23.52 ? 66  GLY L CA  1 
ATOM   1748 C  C   . GLY B 2 66  ? -16.083 -2.156  36.507  1.00 20.79 ? 66  GLY L C   1 
ATOM   1749 O  O   . GLY B 2 66  ? -15.174 -2.905  36.869  1.00 22.02 ? 66  GLY L O   1 
ATOM   1750 N  N   . TYR B 2 67  ? -17.200 -1.980  37.193  1.00 22.24 ? 67  TYR L N   1 
ATOM   1751 C  CA  . TYR B 2 67  ? -17.471 -2.659  38.447  1.00 25.46 ? 67  TYR L CA  1 
ATOM   1752 C  C   . TYR B 2 67  ? -18.972 -2.663  38.617  1.00 27.81 ? 67  TYR L C   1 
ATOM   1753 O  O   . TYR B 2 67  ? -19.612 -1.621  38.441  1.00 30.01 ? 67  TYR L O   1 
ATOM   1754 C  CB  . TYR B 2 67  ? -16.830 -1.928  39.634  1.00 27.21 ? 67  TYR L CB  1 
ATOM   1755 C  CG  . TYR B 2 67  ? -17.052 -2.658  40.945  1.00 27.77 ? 67  TYR L CG  1 
ATOM   1756 C  CD1 . TYR B 2 67  ? -16.103 -3.558  41.429  1.00 27.37 ? 67  TYR L CD1 1 
ATOM   1757 C  CD2 . TYR B 2 67  ? -18.229 -2.476  41.676  1.00 26.22 ? 67  TYR L CD2 1 
ATOM   1758 C  CE1 . TYR B 2 67  ? -16.314 -4.252  42.616  1.00 28.69 ? 67  TYR L CE1 1 
ATOM   1759 C  CE2 . TYR B 2 67  ? -18.452 -3.166  42.860  1.00 29.32 ? 67  TYR L CE2 1 
ATOM   1760 C  CZ  . TYR B 2 67  ? -17.487 -4.052  43.321  1.00 29.35 ? 67  TYR L CZ  1 
ATOM   1761 O  OH  . TYR B 2 67  ? -17.696 -4.736  44.491  1.00 31.95 ? 67  TYR L OH  1 
ATOM   1762 N  N   . GLY B 2 68  ? -19.528 -3.829  38.935  1.00 21.09 ? 68  GLY L N   1 
ATOM   1763 C  CA  . GLY B 2 68  ? -20.930 -3.943  39.329  1.00 21.64 ? 68  GLY L CA  1 
ATOM   1764 C  C   . GLY B 2 68  ? -21.769 -4.518  38.211  1.00 24.97 ? 68  GLY L C   1 
ATOM   1765 O  O   . GLY B 2 68  ? -21.841 -5.731  38.050  1.00 23.02 ? 68  GLY L O   1 
ATOM   1766 N  N   . THR B 2 69  ? -22.391 -3.639  37.422  1.00 24.22 ? 69  THR L N   1 
ATOM   1767 C  CA  . THR B 2 69  ? -23.201 -4.066  36.282  1.00 23.38 ? 69  THR L CA  1 
ATOM   1768 C  C   . THR B 2 69  ? -22.655 -3.606  34.920  1.00 25.94 ? 69  THR L C   1 
ATOM   1769 O  O   . THR B 2 69  ? -22.911 -4.254  33.907  1.00 26.95 ? 69  THR L O   1 
ATOM   1770 C  CB  . THR B 2 69  ? -24.665 -3.584  36.409  1.00 24.59 ? 69  THR L CB  1 
ATOM   1771 O  OG1 . THR B 2 69  ? -24.683 -2.160  36.499  1.00 23.62 ? 69  THR L OG1 1 
ATOM   1772 C  CG2 . THR B 2 69  ? -25.337 -4.181  37.650  1.00 27.98 ? 69  THR L CG2 1 
ATOM   1773 N  N   . ASP B 2 70  ? -21.910 -2.500  34.897  1.00 22.84 ? 70  ASP L N   1 
ATOM   1774 C  CA  . ASP B 2 70  ? -21.477 -1.897  33.623  1.00 25.77 ? 70  ASP L CA  1 
ATOM   1775 C  C   . ASP B 2 70  ? -20.000 -2.097  33.351  1.00 23.67 ? 70  ASP L C   1 
ATOM   1776 O  O   . ASP B 2 70  ? -19.161 -1.650  34.125  1.00 26.46 ? 70  ASP L O   1 
ATOM   1777 C  CB  . ASP B 2 70  ? -21.773 -0.391  33.598  1.00 28.59 ? 70  ASP L CB  1 
ATOM   1778 C  CG  . ASP B 2 70  ? -23.252 -0.072  33.691  1.00 35.65 ? 70  ASP L CG  1 
ATOM   1779 O  OD1 . ASP B 2 70  ? -24.094 -0.994  33.612  1.00 34.92 ? 70  ASP L OD1 1 
ATOM   1780 O  OD2 . ASP B 2 70  ? -23.566 1.128   33.839  1.00 40.19 ? 70  ASP L OD2 1 
ATOM   1781 N  N   . PHE B 2 71  ? -19.692 -2.741  32.230  1.00 21.59 ? 71  PHE L N   1 
ATOM   1782 C  CA  . PHE B 2 71  ? -18.313 -3.112  31.901  1.00 23.35 ? 71  PHE L CA  1 
ATOM   1783 C  C   . PHE B 2 71  ? -17.984 -2.735  30.466  1.00 24.48 ? 71  PHE L C   1 
ATOM   1784 O  O   . PHE B 2 71  ? -18.839 -2.815  29.576  1.00 22.97 ? 71  PHE L O   1 
ATOM   1785 C  CB  . PHE B 2 71  ? -18.066 -4.610  32.142  1.00 19.61 ? 71  PHE L CB  1 
ATOM   1786 C  CG  . PHE B 2 71  ? -18.331 -5.044  33.570  1.00 20.92 ? 71  PHE L CG  1 
ATOM   1787 C  CD1 . PHE B 2 71  ? -17.335 -4.954  34.544  1.00 21.65 ? 71  PHE L CD1 1 
ATOM   1788 C  CD2 . PHE B 2 71  ? -19.588 -5.515  33.938  1.00 19.52 ? 71  PHE L CD2 1 
ATOM   1789 C  CE1 . PHE B 2 71  ? -17.579 -5.340  35.858  1.00 18.82 ? 71  PHE L CE1 1 
ATOM   1790 C  CE2 . PHE B 2 71  ? -19.847 -5.908  35.248  1.00 17.75 ? 71  PHE L CE2 1 
ATOM   1791 C  CZ  . PHE B 2 71  ? -18.846 -5.811  36.216  1.00 16.39 ? 71  PHE L CZ  1 
ATOM   1792 N  N   . THR B 2 72  ? -16.742 -2.313  30.264  1.00 22.53 ? 72  THR L N   1 
ATOM   1793 C  CA  . THR B 2 72  ? -16.285 -1.822  28.972  1.00 21.99 ? 72  THR L CA  1 
ATOM   1794 C  C   . THR B 2 72  ? -14.978 -2.503  28.604  1.00 23.77 ? 72  THR L C   1 
ATOM   1795 O  O   . THR B 2 72  ? -14.057 -2.589  29.424  1.00 25.20 ? 72  THR L O   1 
ATOM   1796 C  CB  . THR B 2 72  ? -16.088 -0.296  29.006  1.00 23.88 ? 72  THR L CB  1 
ATOM   1797 O  OG1 . THR B 2 72  ? -17.295 0.327   29.461  1.00 24.52 ? 72  THR L OG1 1 
ATOM   1798 C  CG2 . THR B 2 72  ? -15.763 0.247   27.616  1.00 27.08 ? 72  THR L CG2 1 
ATOM   1799 N  N   . PHE B 2 73  ? -14.920 -2.991  27.369  1.00 21.51 ? 73  PHE L N   1 
ATOM   1800 C  CA  . PHE B 2 73  ? -13.707 -3.577  26.803  1.00 20.02 ? 73  PHE L CA  1 
ATOM   1801 C  C   . PHE B 2 73  ? -13.301 -2.680  25.647  1.00 22.78 ? 73  PHE L C   1 
ATOM   1802 O  O   . PHE B 2 73  ? -14.127 -2.370  24.785  1.00 22.62 ? 73  PHE L O   1 
ATOM   1803 C  CB  . PHE B 2 73  ? -13.995 -4.998  26.300  1.00 21.22 ? 73  PHE L CB  1 
ATOM   1804 C  CG  . PHE B 2 73  ? -12.851 -5.627  25.545  1.00 19.76 ? 73  PHE L CG  1 
ATOM   1805 C  CD1 . PHE B 2 73  ? -11.818 -6.274  26.231  1.00 21.92 ? 73  PHE L CD1 1 
ATOM   1806 C  CD2 . PHE B 2 73  ? -12.814 -5.583  24.157  1.00 20.48 ? 73  PHE L CD2 1 
ATOM   1807 C  CE1 . PHE B 2 73  ? -10.757 -6.856  25.546  1.00 23.92 ? 73  PHE L CE1 1 
ATOM   1808 C  CE2 . PHE B 2 73  ? -11.749 -6.158  23.454  1.00 24.96 ? 73  PHE L CE2 1 
ATOM   1809 C  CZ  . PHE B 2 73  ? -10.719 -6.793  24.151  1.00 22.99 ? 73  PHE L CZ  1 
ATOM   1810 N  N   . THR B 2 74  ? -12.032 -2.279  25.627  1.00 22.56 ? 74  THR L N   1 
ATOM   1811 C  CA  . THR B 2 74  ? -11.528 -1.336  24.637  1.00 24.07 ? 74  THR L CA  1 
ATOM   1812 C  C   . THR B 2 74  ? -10.275 -1.863  23.916  1.00 25.43 ? 74  THR L C   1 
ATOM   1813 O  O   . THR B 2 74  ? -9.359  -2.392  24.539  1.00 23.89 ? 74  THR L O   1 
ATOM   1814 C  CB  . THR B 2 74  ? -11.203 0.039   25.308  1.00 24.70 ? 74  THR L CB  1 
ATOM   1815 O  OG1 . THR B 2 74  ? -12.374 0.560   25.965  1.00 25.09 ? 74  THR L OG1 1 
ATOM   1816 C  CG2 . THR B 2 74  ? -10.713 1.047   24.297  1.00 24.43 ? 74  THR L CG2 1 
ATOM   1817 N  N   . ILE B 2 75  ? -10.245 -1.716  22.598  1.00 23.71 ? 75  ILE L N   1 
ATOM   1818 C  CA  . ILE B 2 75  ? -8.999  -1.854  21.860  1.00 22.33 ? 75  ILE L CA  1 
ATOM   1819 C  C   . ILE B 2 75  ? -8.652  -0.436  21.393  1.00 20.78 ? 75  ILE L C   1 
ATOM   1820 O  O   . ILE B 2 75  ? -9.394  0.163   20.618  1.00 22.46 ? 75  ILE L O   1 
ATOM   1821 C  CB  . ILE B 2 75  ? -9.095  -2.827  20.651  1.00 21.28 ? 75  ILE L CB  1 
ATOM   1822 C  CG1 . ILE B 2 75  ? -9.874  -4.113  21.008  1.00 21.76 ? 75  ILE L CG1 1 
ATOM   1823 C  CG2 . ILE B 2 75  ? -7.689  -3.162  20.156  1.00 21.92 ? 75  ILE L CG2 1 
ATOM   1824 C  CD1 . ILE B 2 75  ? -10.165 -5.037  19.792  1.00 23.06 ? 75  ILE L CD1 1 
ATOM   1825 N  N   . SER B 2 76  ? -7.544  0.105   21.893  1.00 22.78 ? 76  SER L N   1 
ATOM   1826 C  CA  . SER B 2 76  ? -7.211  1.520   21.682  1.00 24.91 ? 76  SER L CA  1 
ATOM   1827 C  C   . SER B 2 76  ? -6.943  1.844   20.216  1.00 26.64 ? 76  SER L C   1 
ATOM   1828 O  O   . SER B 2 76  ? -7.461  2.835   19.679  1.00 27.37 ? 76  SER L O   1 
ATOM   1829 C  CB  . SER B 2 76  ? -6.019  1.923   22.549  1.00 26.92 ? 76  SER L CB  1 
ATOM   1830 O  OG  . SER B 2 76  ? -4.903  1.097   22.268  1.00 27.84 ? 76  SER L OG  1 
ATOM   1831 N  N   . THR B 2 77  ? -6.127  1.006   19.580  1.00 26.14 ? 77  THR L N   1 
ATOM   1832 C  CA  . THR B 2 77  ? -5.816  1.118   18.161  1.00 28.54 ? 77  THR L CA  1 
ATOM   1833 C  C   . THR B 2 77  ? -5.895  -0.277  17.580  1.00 24.35 ? 77  THR L C   1 
ATOM   1834 O  O   . THR B 2 77  ? -4.973  -1.073  17.750  1.00 24.08 ? 77  THR L O   1 
ATOM   1835 C  CB  . THR B 2 77  ? -4.387  1.693   17.914  1.00 31.83 ? 77  THR L CB  1 
ATOM   1836 O  OG1 . THR B 2 77  ? -3.411  0.868   18.574  1.00 32.67 ? 77  THR L OG1 1 
ATOM   1837 C  CG2 . THR B 2 77  ? -4.276  3.102   18.436  1.00 31.09 ? 77  THR L CG2 1 
ATOM   1838 N  N   . VAL B 2 78  ? -7.003  -0.585  16.910  1.00 25.11 ? 78  VAL L N   1 
ATOM   1839 C  CA  . VAL B 2 78  ? -7.232  -1.953  16.422  1.00 24.03 ? 78  VAL L CA  1 
ATOM   1840 C  C   . VAL B 2 78  ? -6.254  -2.315  15.293  1.00 24.01 ? 78  VAL L C   1 
ATOM   1841 O  O   . VAL B 2 78  ? -5.901  -1.479  14.455  1.00 24.27 ? 78  VAL L O   1 
ATOM   1842 C  CB  . VAL B 2 78  ? -8.719  -2.198  16.029  1.00 24.17 ? 78  VAL L CB  1 
ATOM   1843 C  CG1 . VAL B 2 78  ? -9.046  -1.526  14.733  1.00 26.25 ? 78  VAL L CG1 1 
ATOM   1844 C  CG2 . VAL B 2 78  ? -9.035  -3.705  15.939  1.00 26.31 ? 78  VAL L CG2 1 
ATOM   1845 N  N   . GLN B 2 79  ? -5.810  -3.570  15.308  1.00 23.13 ? 79  GLN L N   1 
ATOM   1846 C  CA  A GLN B 2 79  ? -4.868  -4.092  14.325  0.50 22.17 ? 79  GLN L CA  1 
ATOM   1847 C  CA  B GLN B 2 79  ? -4.889  -4.059  14.294  0.50 22.11 ? 79  GLN L CA  1 
ATOM   1848 C  C   . GLN B 2 79  ? -5.572  -5.139  13.472  1.00 21.37 ? 79  GLN L C   1 
ATOM   1849 O  O   . GLN B 2 79  ? -6.585  -5.692  13.888  1.00 20.14 ? 79  GLN L O   1 
ATOM   1850 C  CB  A GLN B 2 79  ? -3.657  -4.718  15.031  0.50 21.64 ? 79  GLN L CB  1 
ATOM   1851 C  CB  B GLN B 2 79  ? -3.596  -4.567  14.941  0.50 22.40 ? 79  GLN L CB  1 
ATOM   1852 C  CG  A GLN B 2 79  ? -2.845  -3.743  15.899  0.50 24.20 ? 79  GLN L CG  1 
ATOM   1853 C  CG  B GLN B 2 79  ? -2.604  -3.436  15.253  0.50 22.35 ? 79  GLN L CG  1 
ATOM   1854 C  CD  A GLN B 2 79  ? -2.369  -2.513  15.140  0.50 25.70 ? 79  GLN L CD  1 
ATOM   1855 C  CD  B GLN B 2 79  ? -1.538  -3.828  16.258  0.50 25.06 ? 79  GLN L CD  1 
ATOM   1856 O  OE1 A GLN B 2 79  ? -1.783  -2.616  14.059  0.50 28.98 ? 79  GLN L OE1 1 
ATOM   1857 O  OE1 B GLN B 2 79  ? -1.259  -5.011  16.464  0.50 27.92 ? 79  GLN L OE1 1 
ATOM   1858 N  NE2 A GLN B 2 79  ? -2.621  -1.337  15.709  0.50 24.12 ? 79  GLN L NE2 1 
ATOM   1859 N  NE2 B GLN B 2 79  ? -0.938  -2.829  16.899  0.50 20.80 ? 79  GLN L NE2 1 
ATOM   1860 N  N   . ALA B 2 80  ? -5.029  -5.412  12.291  1.00 22.46 ? 80  ALA L N   1 
ATOM   1861 C  CA  . ALA B 2 80  ? -5.632  -6.395  11.375  1.00 20.80 ? 80  ALA L CA  1 
ATOM   1862 C  C   . ALA B 2 80  ? -5.862  -7.754  12.046  1.00 20.87 ? 80  ALA L C   1 
ATOM   1863 O  O   . ALA B 2 80  ? -6.875  -8.413  11.802  1.00 20.17 ? 80  ALA L O   1 
ATOM   1864 C  CB  . ALA B 2 80  ? -4.786  -6.540  10.129  1.00 21.84 ? 80  ALA L CB  1 
ATOM   1865 N  N   . GLU B 2 81  ? -4.948  -8.155  12.927  1.00 18.53 ? 81  GLU L N   1 
ATOM   1866 C  CA  . GLU B 2 81  ? -5.047  -9.461  13.567  1.00 19.40 ? 81  GLU L CA  1 
ATOM   1867 C  C   . GLU B 2 81  ? -6.080  -9.556  14.673  1.00 20.32 ? 81  GLU L C   1 
ATOM   1868 O  O   . GLU B 2 81  ? -6.323  -10.651 15.184  1.00 21.91 ? 81  GLU L O   1 
ATOM   1869 C  CB  . GLU B 2 81  ? -3.693  -9.947  14.079  1.00 25.19 ? 81  GLU L CB  1 
ATOM   1870 C  CG  . GLU B 2 81  ? -3.069  -9.045  15.119  1.00 30.09 ? 81  GLU L CG  1 
ATOM   1871 C  CD  . GLU B 2 81  ? -2.085  -8.040  14.526  1.00 35.43 ? 81  GLU L CD  1 
ATOM   1872 O  OE1 . GLU B 2 81  ? -2.281  -7.538  13.374  1.00 31.34 ? 81  GLU L OE1 1 
ATOM   1873 O  OE2 . GLU B 2 81  ? -1.098  -7.747  15.238  1.00 35.48 ? 81  GLU L OE2 1 
ATOM   1874 N  N   . ASP B 2 82  ? -6.677  -8.421  15.049  1.00 18.02 ? 82  ASP L N   1 
ATOM   1875 C  CA  . ASP B 2 82  ? -7.664  -8.409  16.114  1.00 19.68 ? 82  ASP L CA  1 
ATOM   1876 C  C   . ASP B 2 82  ? -9.070  -8.799  15.645  1.00 21.15 ? 82  ASP L C   1 
ATOM   1877 O  O   . ASP B 2 82  ? -10.000 -8.841  16.455  1.00 20.25 ? 82  ASP L O   1 
ATOM   1878 C  CB  . ASP B 2 82  ? -7.707  -7.048  16.833  1.00 22.29 ? 82  ASP L CB  1 
ATOM   1879 C  CG  . ASP B 2 82  ? -6.359  -6.625  17.407  1.00 24.44 ? 82  ASP L CG  1 
ATOM   1880 O  OD1 . ASP B 2 82  ? -5.523  -7.491  17.762  1.00 24.48 ? 82  ASP L OD1 1 
ATOM   1881 O  OD2 . ASP B 2 82  ? -6.140  -5.398  17.505  1.00 22.96 ? 82  ASP L OD2 1 
ATOM   1882 N  N   . LEU B 2 83  ? -9.239  -9.102  14.359  1.00 18.84 ? 83  LEU L N   1 
ATOM   1883 C  CA  . LEU B 2 83  ? -10.537 -9.611  13.914  1.00 20.93 ? 83  LEU L CA  1 
ATOM   1884 C  C   . LEU B 2 83  ? -10.883 -10.891 14.688  1.00 20.64 ? 83  LEU L C   1 
ATOM   1885 O  O   . LEU B 2 83  ? -10.064 -11.829 14.771  1.00 19.77 ? 83  LEU L O   1 
ATOM   1886 C  CB  . LEU B 2 83  ? -10.607 -9.780  12.391  1.00 27.51 ? 83  LEU L CB  1 
ATOM   1887 C  CG  . LEU B 2 83  ? -9.961  -10.915 11.615  1.00 29.71 ? 83  LEU L CG  1 
ATOM   1888 C  CD1 . LEU B 2 83  ? -10.916 -12.073 11.493  1.00 33.88 ? 83  LEU L CD1 1 
ATOM   1889 C  CD2 . LEU B 2 83  ? -9.628  -10.428 10.231  1.00 30.34 ? 83  LEU L CD2 1 
ATOM   1890 N  N   . ALA B 2 84  ? -12.078 -10.917 15.278  1.00 20.06 ? 84  ALA L N   1 
ATOM   1891 C  CA  . ALA B 2 84  ? -12.433 -11.968 16.240  1.00 19.03 ? 84  ALA L CA  1 
ATOM   1892 C  C   . ALA B 2 84  ? -13.832 -11.705 16.732  1.00 21.87 ? 84  ALA L C   1 
ATOM   1893 O  O   . ALA B 2 84  ? -14.369 -10.625 16.496  1.00 20.61 ? 84  ALA L O   1 
ATOM   1894 C  CB  . ALA B 2 84  ? -11.452 -11.949 17.438  1.00 22.18 ? 84  ALA L CB  1 
ATOM   1895 N  N   . VAL B 2 85  ? -14.420 -12.693 17.413  1.00 21.86 ? 85  VAL L N   1 
ATOM   1896 C  CA  . VAL B 2 85  ? -15.591 -12.452 18.257  1.00 18.37 ? 85  VAL L CA  1 
ATOM   1897 C  C   . VAL B 2 85  ? -15.097 -12.341 19.694  1.00 21.85 ? 85  VAL L C   1 
ATOM   1898 O  O   . VAL B 2 85  ? -14.343 -13.201 20.168  1.00 21.95 ? 85  VAL L O   1 
ATOM   1899 C  CB  . VAL B 2 85  ? -16.635 -13.563 18.142  1.00 20.40 ? 85  VAL L CB  1 
ATOM   1900 C  CG1 . VAL B 2 85  ? -17.837 -13.278 19.050  1.00 19.66 ? 85  VAL L CG1 1 
ATOM   1901 C  CG2 . VAL B 2 85  ? -17.065 -13.745 16.671  1.00 22.53 ? 85  VAL L CG2 1 
ATOM   1902 N  N   . TYR B 2 86  ? -15.500 -11.265 20.358  1.00 18.98 ? 86  TYR L N   1 
ATOM   1903 C  CA  . TYR B 2 86  ? -15.120 -10.999 21.739  1.00 18.44 ? 86  TYR L CA  1 
ATOM   1904 C  C   . TYR B 2 86  ? -16.310 -11.318 22.644  1.00 20.03 ? 86  TYR L C   1 
ATOM   1905 O  O   . TYR B 2 86  ? -17.455 -10.966 22.316  1.00 23.76 ? 86  TYR L O   1 
ATOM   1906 C  CB  . TYR B 2 86  ? -14.673 -9.533  21.890  1.00 19.47 ? 86  TYR L CB  1 
ATOM   1907 C  CG  . TYR B 2 86  ? -13.392 -9.256  21.139  1.00 19.36 ? 86  TYR L CG  1 
ATOM   1908 C  CD1 . TYR B 2 86  ? -13.408 -8.946  19.777  1.00 18.33 ? 86  TYR L CD1 1 
ATOM   1909 C  CD2 . TYR B 2 86  ? -12.161 -9.354  21.779  1.00 20.43 ? 86  TYR L CD2 1 
ATOM   1910 C  CE1 . TYR B 2 86  ? -12.203 -8.715  19.068  1.00 17.45 ? 86  TYR L CE1 1 
ATOM   1911 C  CE2 . TYR B 2 86  ? -10.968 -9.126  21.098  1.00 19.93 ? 86  TYR L CE2 1 
ATOM   1912 C  CZ  . TYR B 2 86  ? -10.997 -8.814  19.745  1.00 16.40 ? 86  TYR L CZ  1 
ATOM   1913 O  OH  . TYR B 2 86  ? -9.812  -8.608  19.079  1.00 19.97 ? 86  TYR L OH  1 
ATOM   1914 N  N   . PHE B 2 87  ? -16.041 -11.973 23.773  1.00 19.89 ? 87  PHE L N   1 
ATOM   1915 C  CA  . PHE B 2 87  ? -17.103 -12.368 24.717  1.00 22.04 ? 87  PHE L CA  1 
ATOM   1916 C  C   . PHE B 2 87  ? -16.786 -11.897 26.126  1.00 23.59 ? 87  PHE L C   1 
ATOM   1917 O  O   . PHE B 2 87  ? -15.628 -12.000 26.578  1.00 22.97 ? 87  PHE L O   1 
ATOM   1918 C  CB  . PHE B 2 87  ? -17.239 -13.897 24.815  1.00 26.20 ? 87  PHE L CB  1 
ATOM   1919 C  CG  . PHE B 2 87  ? -17.651 -14.585 23.546  1.00 28.04 ? 87  PHE L CG  1 
ATOM   1920 C  CD1 . PHE B 2 87  ? -19.005 -14.772 23.237  1.00 24.85 ? 87  PHE L CD1 1 
ATOM   1921 C  CD2 . PHE B 2 87  ? -16.683 -15.109 22.688  1.00 24.24 ? 87  PHE L CD2 1 
ATOM   1922 C  CE1 . PHE B 2 87  ? -19.386 -15.451 22.064  1.00 26.31 ? 87  PHE L CE1 1 
ATOM   1923 C  CE2 . PHE B 2 87  ? -17.049 -15.786 21.502  1.00 25.34 ? 87  PHE L CE2 1 
ATOM   1924 C  CZ  . PHE B 2 87  ? -18.401 -15.972 21.199  1.00 24.59 ? 87  PHE L CZ  1 
ATOM   1925 N  N   . CYS B 2 88  ? -17.799 -11.410 26.842  1.00 20.36 ? 88  CYS L N   1 
ATOM   1926 C  CA  . CYS B 2 88  ? -17.646 -11.257 28.293  1.00 21.84 ? 88  CYS L CA  1 
ATOM   1927 C  C   . CYS B 2 88  ? -18.198 -12.488 29.013  1.00 22.85 ? 88  CYS L C   1 
ATOM   1928 O  O   . CYS B 2 88  ? -19.000 -13.255 28.451  1.00 22.24 ? 88  CYS L O   1 
ATOM   1929 C  CB  . CYS B 2 88  ? -18.308 -9.959  28.791  1.00 24.39 ? 88  CYS L CB  1 
ATOM   1930 S  SG  . CYS B 2 88  ? -20.091 -9.910  28.543  1.00 26.38 ? 88  CYS L SG  1 
ATOM   1931 N  N   . GLN B 2 89  ? -17.740 -12.709 30.246  1.00 19.90 ? 89  GLN L N   1 
ATOM   1932 C  CA  . GLN B 2 89  ? -18.259 -13.788 31.059  1.00 18.99 ? 89  GLN L CA  1 
ATOM   1933 C  C   . GLN B 2 89  ? -18.214 -13.347 32.505  1.00 19.22 ? 89  GLN L C   1 
ATOM   1934 O  O   . GLN B 2 89  ? -17.182 -12.844 32.958  1.00 21.88 ? 89  GLN L O   1 
ATOM   1935 C  CB  . GLN B 2 89  ? -17.404 -15.066 30.914  1.00 20.43 ? 89  GLN L CB  1 
ATOM   1936 C  CG  . GLN B 2 89  ? -17.917 -16.246 31.750  1.00 19.18 ? 89  GLN L CG  1 
ATOM   1937 C  CD  . GLN B 2 89  ? -16.810 -17.049 32.452  1.00 24.61 ? 89  GLN L CD  1 
ATOM   1938 O  OE1 . GLN B 2 89  ? -16.975 -17.471 33.601  1.00 27.95 ? 89  GLN L OE1 1 
ATOM   1939 N  NE2 . GLN B 2 89  ? -15.681 -17.239 31.784  1.00 19.95 ? 89  GLN L NE2 1 
ATOM   1940 N  N   . GLN B 2 90  ? -19.305 -13.572 33.228  1.00 18.26 ? 90  GLN L N   1 
ATOM   1941 C  CA  . GLN B 2 90  ? -19.306 -13.387 34.687  1.00 21.35 ? 90  GLN L CA  1 
ATOM   1942 C  C   . GLN B 2 90  ? -19.155 -14.714 35.433  1.00 22.80 ? 90  GLN L C   1 
ATOM   1943 O  O   . GLN B 2 90  ? -19.644 -15.754 34.979  1.00 18.00 ? 90  GLN L O   1 
ATOM   1944 C  CB  . GLN B 2 90  ? -20.565 -12.647 35.181  1.00 20.66 ? 90  GLN L CB  1 
ATOM   1945 C  CG  . GLN B 2 90  ? -21.924 -13.419 35.048  1.00 22.08 ? 90  GLN L CG  1 
ATOM   1946 C  CD  . GLN B 2 90  ? -22.228 -14.363 36.225  1.00 19.24 ? 90  GLN L CD  1 
ATOM   1947 O  OE1 . GLN B 2 90  ? -21.806 -14.127 37.352  1.00 19.24 ? 90  GLN L OE1 1 
ATOM   1948 N  NE2 . GLN B 2 90  ? -22.975 -15.435 35.952  1.00 20.78 ? 90  GLN L NE2 1 
ATOM   1949 N  N   . ASP B 2 91  ? -18.488 -14.679 36.584  1.00 18.20 ? 91  ASP L N   1 
ATOM   1950 C  CA  . ASP B 2 91  ? -18.499 -15.854 37.466  1.00 18.30 ? 91  ASP L CA  1 
ATOM   1951 C  C   . ASP B 2 91  ? -18.825 -15.483 38.905  1.00 16.88 ? 91  ASP L C   1 
ATOM   1952 O  O   . ASP B 2 91  ? -18.479 -16.204 39.841  1.00 19.33 ? 91  ASP L O   1 
ATOM   1953 C  CB  . ASP B 2 91  ? -17.206 -16.680 37.354  1.00 24.62 ? 91  ASP L CB  1 
ATOM   1954 C  CG  . ASP B 2 91  ? -16.022 -16.015 38.025  1.00 23.38 ? 91  ASP L CG  1 
ATOM   1955 O  OD1 . ASP B 2 91  ? -15.663 -14.889 37.619  1.00 25.68 ? 91  ASP L OD1 1 
ATOM   1956 O  OD2 . ASP B 2 91  ? -15.446 -16.634 38.952  1.00 28.85 ? 91  ASP L OD2 1 
ATOM   1957 N  N   . TYR B 2 92  ? -19.535 -14.367 39.080  1.00 17.10 ? 92  TYR L N   1 
ATOM   1958 C  CA  . TYR B 2 92  ? -20.003 -13.988 40.413  1.00 16.48 ? 92  TYR L CA  1 
ATOM   1959 C  C   . TYR B 2 92  ? -21.072 -14.959 40.918  1.00 18.02 ? 92  TYR L C   1 
ATOM   1960 O  O   . TYR B 2 92  ? -20.977 -15.491 42.035  1.00 19.77 ? 92  TYR L O   1 
ATOM   1961 C  CB  . TYR B 2 92  ? -20.549 -12.556 40.422  1.00 21.74 ? 92  TYR L CB  1 
ATOM   1962 C  CG  . TYR B 2 92  ? -20.952 -12.078 41.799  1.00 19.16 ? 92  TYR L CG  1 
ATOM   1963 C  CD1 . TYR B 2 92  ? -19.992 -11.603 42.692  1.00 18.99 ? 92  TYR L CD1 1 
ATOM   1964 C  CD2 . TYR B 2 92  ? -22.290 -12.105 42.209  1.00 18.70 ? 92  TYR L CD2 1 
ATOM   1965 C  CE1 . TYR B 2 92  ? -20.347 -11.173 43.958  1.00 20.83 ? 92  TYR L CE1 1 
ATOM   1966 C  CE2 . TYR B 2 92  ? -22.660 -11.665 43.491  1.00 21.23 ? 92  TYR L CE2 1 
ATOM   1967 C  CZ  . TYR B 2 92  ? -21.671 -11.198 44.348  1.00 23.26 ? 92  TYR L CZ  1 
ATOM   1968 O  OH  . TYR B 2 92  ? -21.983 -10.763 45.606  1.00 22.90 ? 92  TYR L OH  1 
ATOM   1969 N  N   . GLY B 2 93  ? -22.093 -15.168 40.092  1.00 18.99 ? 93  GLY L N   1 
ATOM   1970 C  CA  . GLY B 2 93  ? -23.190 -16.078 40.404  1.00 21.26 ? 93  GLY L CA  1 
ATOM   1971 C  C   . GLY B 2 93  ? -22.971 -17.417 39.727  1.00 23.42 ? 93  GLY L C   1 
ATOM   1972 O  O   . GLY B 2 93  ? -22.155 -17.539 38.813  1.00 22.39 ? 93  GLY L O   1 
ATOM   1973 N  N   . SER B 2 94  ? -23.689 -18.427 40.200  1.00 20.67 ? 94  SER L N   1 
ATOM   1974 C  CA  . SER B 2 94  ? -23.618 -19.756 39.618  1.00 23.59 ? 94  SER L CA  1 
ATOM   1975 C  C   . SER B 2 94  ? -24.926 -20.000 38.892  1.00 23.08 ? 94  SER L C   1 
ATOM   1976 O  O   . SER B 2 94  ? -25.987 -19.740 39.455  1.00 23.53 ? 94  SER L O   1 
ATOM   1977 C  CB  . SER B 2 94  ? -23.417 -20.818 40.703  1.00 27.08 ? 94  SER L CB  1 
ATOM   1978 O  OG  . SER B 2 94  ? -23.110 -22.064 40.106  1.00 30.36 ? 94  SER L OG  1 
ATOM   1979 N  N   . PRO B 2 95  ? -24.863 -20.488 37.634  1.00 19.41 ? 95  PRO L N   1 
ATOM   1980 C  CA  . PRO B 2 95  ? -23.674 -20.844 36.881  1.00 18.03 ? 95  PRO L CA  1 
ATOM   1981 C  C   . PRO B 2 95  ? -22.969 -19.635 36.262  1.00 19.56 ? 95  PRO L C   1 
ATOM   1982 O  O   . PRO B 2 95  ? -23.593 -18.571 36.098  1.00 21.35 ? 95  PRO L O   1 
ATOM   1983 C  CB  . PRO B 2 95  ? -24.242 -21.710 35.750  1.00 22.31 ? 95  PRO L CB  1 
ATOM   1984 C  CG  . PRO B 2 95  ? -25.579 -21.110 35.487  1.00 19.34 ? 95  PRO L CG  1 
ATOM   1985 C  CD  . PRO B 2 95  ? -26.091 -20.745 36.855  1.00 21.33 ? 95  PRO L CD  1 
ATOM   1986 N  N   . PRO B 2 96  ? -21.683 -19.802 35.910  1.00 21.43 ? 96  PRO L N   1 
ATOM   1987 C  CA  . PRO B 2 96  ? -21.021 -18.779 35.105  1.00 19.65 ? 96  PRO L CA  1 
ATOM   1988 C  C   . PRO B 2 96  ? -21.821 -18.620 33.807  1.00 20.71 ? 96  PRO L C   1 
ATOM   1989 O  O   . PRO B 2 96  ? -22.408 -19.598 33.316  1.00 18.38 ? 96  PRO L O   1 
ATOM   1990 C  CB  . PRO B 2 96  ? -19.647 -19.381 34.821  1.00 20.54 ? 96  PRO L CB  1 
ATOM   1991 C  CG  . PRO B 2 96  ? -19.440 -20.434 35.849  1.00 19.77 ? 96  PRO L CG  1 
ATOM   1992 C  CD  . PRO B 2 96  ? -20.801 -20.946 36.211  1.00 22.41 ? 96  PRO L CD  1 
ATOM   1993 N  N   . THR B 2 97  ? -21.885 -17.395 33.288  1.00 19.36 ? 97  THR L N   1 
ATOM   1994 C  CA  . THR B 2 97  ? -22.665 -17.103 32.078  1.00 20.56 ? 97  THR L CA  1 
ATOM   1995 C  C   . THR B 2 97  ? -21.889 -16.145 31.196  1.00 22.28 ? 97  THR L C   1 
ATOM   1996 O  O   . THR B 2 97  ? -21.127 -15.328 31.707  1.00 21.86 ? 97  THR L O   1 
ATOM   1997 C  CB  . THR B 2 97  ? -24.065 -16.489 32.381  1.00 19.82 ? 97  THR L CB  1 
ATOM   1998 O  OG1 . THR B 2 97  ? -23.933 -15.334 33.218  1.00 23.21 ? 97  THR L OG1 1 
ATOM   1999 C  CG2 . THR B 2 97  ? -24.994 -17.512 33.076  1.00 21.12 ? 97  THR L CG2 1 
ATOM   2000 N  N   . PHE B 2 98  ? -22.095 -16.257 29.880  1.00 22.74 ? 98  PHE L N   1 
ATOM   2001 C  CA  . PHE B 2 98  ? -21.376 -15.462 28.880  1.00 20.07 ? 98  PHE L CA  1 
ATOM   2002 C  C   . PHE B 2 98  ? -22.295 -14.457 28.200  1.00 18.00 ? 98  PHE L C   1 
ATOM   2003 O  O   . PHE B 2 98  ? -23.496 -14.700 28.060  1.00 21.84 ? 98  PHE L O   1 
ATOM   2004 C  CB  . PHE B 2 98  ? -20.804 -16.385 27.793  1.00 23.02 ? 98  PHE L CB  1 
ATOM   2005 C  CG  . PHE B 2 98  ? -19.735 -17.328 28.287  1.00 21.68 ? 98  PHE L CG  1 
ATOM   2006 C  CD1 . PHE B 2 98  ? -18.385 -17.076 28.016  1.00 22.81 ? 98  PHE L CD1 1 
ATOM   2007 C  CD2 . PHE B 2 98  ? -20.079 -18.487 28.978  1.00 23.24 ? 98  PHE L CD2 1 
ATOM   2008 C  CE1 . PHE B 2 98  ? -17.377 -17.968 28.458  1.00 22.33 ? 98  PHE L CE1 1 
ATOM   2009 C  CE2 . PHE B 2 98  ? -19.088 -19.372 29.429  1.00 23.21 ? 98  PHE L CE2 1 
ATOM   2010 C  CZ  . PHE B 2 98  ? -17.748 -19.111 29.165  1.00 19.90 ? 98  PHE L CZ  1 
ATOM   2011 N  N   . GLY B 2 99  ? -21.734 -13.345 27.749  1.00 22.54 ? 99  GLY L N   1 
ATOM   2012 C  CA  . GLY B 2 99  ? -22.445 -12.455 26.811  1.00 22.43 ? 99  GLY L CA  1 
ATOM   2013 C  C   . GLY B 2 99  ? -22.571 -13.103 25.433  1.00 22.10 ? 99  GLY L C   1 
ATOM   2014 O  O   . GLY B 2 99  ? -21.965 -14.154 25.163  1.00 22.87 ? 99  GLY L O   1 
ATOM   2015 N  N   . GLY B 2 100 ? -23.341 -12.478 24.546  1.00 21.60 ? 100 GLY L N   1 
ATOM   2016 C  CA  . GLY B 2 100 ? -23.643 -13.083 23.249  1.00 23.91 ? 100 GLY L CA  1 
ATOM   2017 C  C   . GLY B 2 100 ? -22.558 -12.908 22.199  1.00 26.72 ? 100 GLY L C   1 
ATOM   2018 O  O   . GLY B 2 100 ? -22.652 -13.453 21.098  1.00 26.02 ? 100 GLY L O   1 
ATOM   2019 N  N   . GLY B 2 101 ? -21.529 -12.137 22.525  1.00 23.90 ? 101 GLY L N   1 
ATOM   2020 C  CA  . GLY B 2 101 ? -20.441 -11.913 21.569  1.00 26.18 ? 101 GLY L CA  1 
ATOM   2021 C  C   . GLY B 2 101 ? -20.562 -10.625 20.777  1.00 21.67 ? 101 GLY L C   1 
ATOM   2022 O  O   . GLY B 2 101 ? -21.671 -10.131 20.504  1.00 21.84 ? 101 GLY L O   1 
ATOM   2023 N  N   . THR B 2 102 ? -19.405 -10.058 20.443  1.00 19.52 ? 102 THR L N   1 
ATOM   2024 C  CA  . THR B 2 102 ? -19.298 -8.945  19.499  1.00 19.39 ? 102 THR L CA  1 
ATOM   2025 C  C   . THR B 2 102 ? -18.282 -9.300  18.417  1.00 19.99 ? 102 THR L C   1 
ATOM   2026 O  O   . THR B 2 102 ? -17.118 -9.563  18.723  1.00 19.19 ? 102 THR L O   1 
ATOM   2027 C  CB  . THR B 2 102 ? -18.824 -7.641  20.188  1.00 21.48 ? 102 THR L CB  1 
ATOM   2028 O  OG1 . THR B 2 102 ? -19.761 -7.246  21.195  1.00 23.95 ? 102 THR L OG1 1 
ATOM   2029 C  CG2 . THR B 2 102 ? -18.669 -6.526  19.163  1.00 19.84 ? 102 THR L CG2 1 
ATOM   2030 N  N   . LYS B 2 103 ? -18.730 -9.308  17.159  1.00 19.78 ? 103 LYS L N   1 
ATOM   2031 C  CA  . LYS B 2 103 ? -17.863 -9.593  16.019  1.00 21.79 ? 103 LYS L CA  1 
ATOM   2032 C  C   . LYS B 2 103 ? -17.212 -8.312  15.524  1.00 18.86 ? 103 LYS L C   1 
ATOM   2033 O  O   . LYS B 2 103 ? -17.893 -7.345  15.156  1.00 21.05 ? 103 LYS L O   1 
ATOM   2034 C  CB  . LYS B 2 103 ? -18.631 -10.266 14.884  1.00 24.31 ? 103 LYS L CB  1 
ATOM   2035 C  CG  . LYS B 2 103 ? -17.735 -10.781 13.774  1.00 21.92 ? 103 LYS L CG  1 
ATOM   2036 C  CD  . LYS B 2 103 ? -18.541 -11.469 12.688  1.00 27.02 ? 103 LYS L CD  1 
ATOM   2037 C  CE  . LYS B 2 103 ? -17.625 -12.136 11.671  1.00 28.41 ? 103 LYS L CE  1 
ATOM   2038 N  NZ  . LYS B 2 103 ? -18.394 -12.713 10.518  1.00 35.82 ? 103 LYS L NZ  1 
ATOM   2039 N  N   . VAL B 2 104 ? -15.885 -8.304  15.574  1.00 20.01 ? 104 VAL L N   1 
ATOM   2040 C  CA  . VAL B 2 104 ? -15.091 -7.170  15.120  1.00 19.98 ? 104 VAL L CA  1 
ATOM   2041 C  C   . VAL B 2 104 ? -14.525 -7.552  13.755  1.00 21.17 ? 104 VAL L C   1 
ATOM   2042 O  O   . VAL B 2 104 ? -13.727 -8.499  13.641  1.00 19.37 ? 104 VAL L O   1 
ATOM   2043 C  CB  . VAL B 2 104 ? -13.960 -6.833  16.120  1.00 20.13 ? 104 VAL L CB  1 
ATOM   2044 C  CG1 . VAL B 2 104 ? -13.035 -5.738  15.564  1.00 22.47 ? 104 VAL L CG1 1 
ATOM   2045 C  CG2 . VAL B 2 104 ? -14.554 -6.408  17.473  1.00 19.90 ? 104 VAL L CG2 1 
ATOM   2046 N  N   . GLU B 2 105 ? -14.995 -6.843  12.731  1.00 18.87 ? 105 GLU L N   1 
ATOM   2047 C  CA  . GLU B 2 105 ? -14.584 -7.052  11.353  1.00 23.04 ? 105 GLU L CA  1 
ATOM   2048 C  C   . GLU B 2 105 ? -13.755 -5.858  10.929  1.00 21.26 ? 105 GLU L C   1 
ATOM   2049 O  O   . GLU B 2 105 ? -13.931 -4.760  11.457  1.00 20.69 ? 105 GLU L O   1 
ATOM   2050 C  CB  . GLU B 2 105 ? -15.800 -7.152  10.425  1.00 27.79 ? 105 GLU L CB  1 
ATOM   2051 C  CG  . GLU B 2 105 ? -16.849 -8.186  10.813  1.00 31.42 ? 105 GLU L CG  1 
ATOM   2052 C  CD  . GLU B 2 105 ? -17.827 -8.470  9.661   1.00 36.30 ? 105 GLU L CD  1 
ATOM   2053 O  OE1 . GLU B 2 105 ? -17.992 -7.605  8.780   1.00 43.09 ? 105 GLU L OE1 1 
ATOM   2054 O  OE2 . GLU B 2 105 ? -18.421 -9.562  9.631   1.00 41.49 ? 105 GLU L OE2 1 
ATOM   2055 N  N   . ILE B 2 106 ? -12.867 -6.062  9.960   1.00 17.24 ? 106 ILE L N   1 
ATOM   2056 C  CA  . ILE B 2 106 ? -11.906 -5.012  9.593   1.00 16.64 ? 106 ILE L CA  1 
ATOM   2057 C  C   . ILE B 2 106 ? -12.276 -4.411  8.248   1.00 16.56 ? 106 ILE L C   1 
ATOM   2058 O  O   . ILE B 2 106 ? -12.566 -5.129  7.289   1.00 17.39 ? 106 ILE L O   1 
ATOM   2059 C  CB  . ILE B 2 106 ? -10.427 -5.528  9.584   1.00 18.59 ? 106 ILE L CB  1 
ATOM   2060 C  CG1 . ILE B 2 106 ? -10.038 -6.138  10.954  1.00 18.17 ? 106 ILE L CG1 1 
ATOM   2061 C  CG2 . ILE B 2 106 ? -9.442  -4.415  9.083   1.00 16.72 ? 106 ILE L CG2 1 
ATOM   2062 C  CD1 . ILE B 2 106 ? -9.928  -5.147  12.133  1.00 20.43 ? 106 ILE L CD1 1 
ATOM   2063 N  N   . LYS B 2 107 ? -12.319 -3.081  8.215   1.00 17.14 ? 107 LYS L N   1 
ATOM   2064 C  CA  . LYS B 2 107 ? -12.482 -2.314  6.989   1.00 16.59 ? 107 LYS L CA  1 
ATOM   2065 C  C   . LYS B 2 107 ? -11.093 -1.998  6.428   1.00 18.69 ? 107 LYS L C   1 
ATOM   2066 O  O   . LYS B 2 107 ? -10.174 -1.695  7.194   1.00 18.48 ? 107 LYS L O   1 
ATOM   2067 C  CB  . LYS B 2 107 ? -13.250 -1.016  7.294   1.00 20.12 ? 107 LYS L CB  1 
ATOM   2068 C  CG  . LYS B 2 107 ? -13.518 -0.148  6.093   1.00 27.28 ? 107 LYS L CG  1 
ATOM   2069 C  CD  . LYS B 2 107 ? -13.999 1.241   6.526   1.00 31.57 ? 107 LYS L CD  1 
ATOM   2070 C  CE  . LYS B 2 107 ? -14.032 2.204   5.338   1.00 38.48 ? 107 LYS L CE  1 
ATOM   2071 N  NZ  . LYS B 2 107 ? -12.676 2.541   4.778   1.00 40.54 ? 107 LYS L NZ  1 
ATOM   2072 N  N   . ARG B 2 108 ? -10.936 -2.104  5.107   1.00 18.15 ? 108 ARG L N   1 
ATOM   2073 C  CA  . ARG B 2 108 ? -9.654  -1.787  4.444   1.00 18.11 ? 108 ARG L CA  1 
ATOM   2074 C  C   . ARG B 2 108 ? -9.904  -1.208  3.057   1.00 24.00 ? 108 ARG L C   1 
ATOM   2075 O  O   . ARG B 2 108 ? -11.058 -1.057  2.648   1.00 22.15 ? 108 ARG L O   1 
ATOM   2076 C  CB  . ARG B 2 108 ? -8.723  -3.019  4.382   1.00 19.11 ? 108 ARG L CB  1 
ATOM   2077 C  CG  . ARG B 2 108 ? -9.308  -4.258  3.690   1.00 19.85 ? 108 ARG L CG  1 
ATOM   2078 C  CD  . ARG B 2 108 ? -8.220  -5.085  3.011   1.00 21.70 ? 108 ARG L CD  1 
ATOM   2079 N  NE  . ARG B 2 108 ? -7.625  -4.385  1.861   1.00 23.65 ? 108 ARG L NE  1 
ATOM   2080 C  CZ  . ARG B 2 108 ? -6.433  -4.652  1.332   1.00 25.37 ? 108 ARG L CZ  1 
ATOM   2081 N  NH1 . ARG B 2 108 ? -5.658  -5.615  1.834   1.00 19.64 ? 108 ARG L NH1 1 
ATOM   2082 N  NH2 . ARG B 2 108 ? -6.013  -3.947  0.289   1.00 22.54 ? 108 ARG L NH2 1 
ATOM   2083 N  N   . THR B 2 109 ? -8.829  -0.876  2.343   1.00 20.88 ? 109 THR L N   1 
ATOM   2084 C  CA  . THR B 2 109 ? -8.950  -0.417  0.953   1.00 18.89 ? 109 THR L CA  1 
ATOM   2085 C  C   . THR B 2 109 ? -9.388  -1.554  0.014   1.00 19.37 ? 109 THR L C   1 
ATOM   2086 O  O   . THR B 2 109 ? -9.221  -2.747  0.305   1.00 19.63 ? 109 THR L O   1 
ATOM   2087 C  CB  . THR B 2 109 ? -7.619  0.204   0.434   1.00 21.72 ? 109 THR L CB  1 
ATOM   2088 O  OG1 . THR B 2 109 ? -6.573  -0.770  0.512   1.00 22.31 ? 109 THR L OG1 1 
ATOM   2089 C  CG2 . THR B 2 109 ? -7.243  1.446   1.252   1.00 24.06 ? 109 THR L CG2 1 
ATOM   2090 N  N   . VAL B 2 110 ? -9.944  -1.174  -1.128  1.00 20.38 ? 110 VAL L N   1 
ATOM   2091 C  CA  . VAL B 2 110 ? -10.332 -2.152  -2.146  1.00 19.13 ? 110 VAL L CA  1 
ATOM   2092 C  C   . VAL B 2 110 ? -9.129  -2.975  -2.640  1.00 22.18 ? 110 VAL L C   1 
ATOM   2093 O  O   . VAL B 2 110 ? -8.020  -2.449  -2.819  1.00 18.81 ? 110 VAL L O   1 
ATOM   2094 C  CB  . VAL B 2 110 ? -11.069 -1.454  -3.320  1.00 19.16 ? 110 VAL L CB  1 
ATOM   2095 C  CG1 . VAL B 2 110 ? -11.302 -2.414  -4.479  1.00 21.18 ? 110 VAL L CG1 1 
ATOM   2096 C  CG2 . VAL B 2 110 ? -12.405 -0.942  -2.831  1.00 24.66 ? 110 VAL L CG2 1 
ATOM   2097 N  N   . ALA B 2 111 ? -9.363  -4.270  -2.824  1.00 19.91 ? 111 ALA L N   1 
ATOM   2098 C  CA  . ALA B 2 111 ? -8.375  -5.170  -3.396  1.00 21.36 ? 111 ALA L CA  1 
ATOM   2099 C  C   . ALA B 2 111 ? -9.073  -6.049  -4.418  1.00 20.81 ? 111 ALA L C   1 
ATOM   2100 O  O   . ALA B 2 111 ? -10.060 -6.724  -4.100  1.00 20.00 ? 111 ALA L O   1 
ATOM   2101 C  CB  . ALA B 2 111 ? -7.732  -6.031  -2.307  1.00 20.26 ? 111 ALA L CB  1 
ATOM   2102 N  N   . ALA B 2 112 ? -8.560  -6.026  -5.643  1.00 20.22 ? 112 ALA L N   1 
ATOM   2103 C  CA  . ALA B 2 112 ? -9.038  -6.885  -6.729  1.00 21.25 ? 112 ALA L CA  1 
ATOM   2104 C  C   . ALA B 2 112 ? -8.658  -8.347  -6.507  1.00 21.98 ? 112 ALA L C   1 
ATOM   2105 O  O   . ALA B 2 112 ? -7.540  -8.626  -6.057  1.00 22.29 ? 112 ALA L O   1 
ATOM   2106 C  CB  . ALA B 2 112 ? -8.458  -6.399  -8.077  1.00 23.09 ? 112 ALA L CB  1 
ATOM   2107 N  N   . PRO B 2 113 ? -9.566  -9.280  -6.865  1.00 21.22 ? 113 PRO L N   1 
ATOM   2108 C  CA  . PRO B 2 113 ? -9.259  -10.702 -6.765  1.00 22.08 ? 113 PRO L CA  1 
ATOM   2109 C  C   . PRO B 2 113 ? -8.306  -11.140 -7.861  1.00 22.76 ? 113 PRO L C   1 
ATOM   2110 O  O   . PRO B 2 113 ? -8.343  -10.592 -8.972  1.00 22.37 ? 113 PRO L O   1 
ATOM   2111 C  CB  . PRO B 2 113 ? -10.618 -11.384 -6.959  1.00 22.05 ? 113 PRO L CB  1 
ATOM   2112 C  CG  . PRO B 2 113 ? -11.443 -10.417 -7.738  1.00 21.48 ? 113 PRO L CG  1 
ATOM   2113 C  CD  . PRO B 2 113 ? -10.930 -9.035  -7.391  1.00 20.81 ? 113 PRO L CD  1 
ATOM   2114 N  N   . SER B 2 114 ? -7.450  -12.098 -7.523  1.00 22.74 ? 114 SER L N   1 
ATOM   2115 C  CA  . SER B 2 114 ? -6.746  -12.902 -8.516  1.00 23.31 ? 114 SER L CA  1 
ATOM   2116 C  C   . SER B 2 114 ? -7.648  -14.086 -8.846  1.00 24.12 ? 114 SER L C   1 
ATOM   2117 O  O   . SER B 2 114 ? -8.135  -14.775 -7.947  1.00 22.99 ? 114 SER L O   1 
ATOM   2118 C  CB  . SER B 2 114 ? -5.405  -13.378 -7.959  1.00 25.57 ? 114 SER L CB  1 
ATOM   2119 O  OG  . SER B 2 114 ? -4.570  -12.255 -7.673  1.00 29.66 ? 114 SER L OG  1 
ATOM   2120 N  N   . VAL B 2 115 ? -7.874  -14.318 -10.133 1.00 17.87 ? 115 VAL L N   1 
ATOM   2121 C  CA  . VAL B 2 115 ? -8.886  -15.298 -10.549 1.00 20.84 ? 115 VAL L CA  1 
ATOM   2122 C  C   . VAL B 2 115 ? -8.201  -16.466 -11.254 1.00 22.81 ? 115 VAL L C   1 
ATOM   2123 O  O   . VAL B 2 115 ? -7.331  -16.258 -12.107 1.00 19.44 ? 115 VAL L O   1 
ATOM   2124 C  CB  . VAL B 2 115 ? -9.953  -14.667 -11.479 1.00 20.66 ? 115 VAL L CB  1 
ATOM   2125 C  CG1 . VAL B 2 115 ? -11.025 -15.694 -11.854 1.00 20.38 ? 115 VAL L CG1 1 
ATOM   2126 C  CG2 . VAL B 2 115 ? -10.607 -13.430 -10.809 1.00 21.44 ? 115 VAL L CG2 1 
ATOM   2127 N  N   . PHE B 2 116 ? -8.621  -17.683 -10.901 1.00 21.52 ? 116 PHE L N   1 
ATOM   2128 C  CA  . PHE B 2 116 ? -8.055  -18.916 -11.427 1.00 19.85 ? 116 PHE L CA  1 
ATOM   2129 C  C   . PHE B 2 116 ? -9.210  -19.857 -11.763 1.00 21.75 ? 116 PHE L C   1 
ATOM   2130 O  O   . PHE B 2 116 ? -10.240 -19.846 -11.079 1.00 21.32 ? 116 PHE L O   1 
ATOM   2131 C  CB  . PHE B 2 116 ? -7.147  -19.596 -10.383 1.00 18.72 ? 116 PHE L CB  1 
ATOM   2132 C  CG  . PHE B 2 116 ? -6.034  -18.714 -9.855  1.00 21.11 ? 116 PHE L CG  1 
ATOM   2133 C  CD1 . PHE B 2 116 ? -4.760  -18.766 -10.410 1.00 24.72 ? 116 PHE L CD1 1 
ATOM   2134 C  CD2 . PHE B 2 116 ? -6.258  -17.873 -8.763  1.00 24.81 ? 116 PHE L CD2 1 
ATOM   2135 C  CE1 . PHE B 2 116 ? -3.723  -17.952 -9.912  1.00 23.06 ? 116 PHE L CE1 1 
ATOM   2136 C  CE2 . PHE B 2 116 ? -5.241  -17.054 -8.257  1.00 25.79 ? 116 PHE L CE2 1 
ATOM   2137 C  CZ  . PHE B 2 116 ? -3.974  -17.105 -8.821  1.00 22.71 ? 116 PHE L CZ  1 
ATOM   2138 N  N   . ILE B 2 117 ? -9.045  -20.664 -12.807 1.00 17.67 ? 117 ILE L N   1 
ATOM   2139 C  CA  . ILE B 2 117 ? -10.057 -21.689 -13.133 1.00 19.86 ? 117 ILE L CA  1 
ATOM   2140 C  C   . ILE B 2 117 ? -9.432  -23.086 -13.231 1.00 21.99 ? 117 ILE L C   1 
ATOM   2141 O  O   . ILE B 2 117 ? -8.311  -23.220 -13.705 1.00 19.65 ? 117 ILE L O   1 
ATOM   2142 C  CB  . ILE B 2 117 ? -10.888 -21.325 -14.420 1.00 18.54 ? 117 ILE L CB  1 
ATOM   2143 C  CG1 . ILE B 2 117 ? -12.155 -22.183 -14.529 1.00 19.17 ? 117 ILE L CG1 1 
ATOM   2144 C  CG2 . ILE B 2 117 ? -10.020 -21.416 -15.701 1.00 19.00 ? 117 ILE L CG2 1 
ATOM   2145 C  CD1 . ILE B 2 117 ? -13.053 -21.835 -15.744 1.00 17.17 ? 117 ILE L CD1 1 
ATOM   2146 N  N   . PHE B 2 118 ? -10.154 -24.111 -12.768 1.00 18.25 ? 118 PHE L N   1 
ATOM   2147 C  CA  . PHE B 2 118 ? -9.645  -25.484 -12.723 1.00 16.34 ? 118 PHE L CA  1 
ATOM   2148 C  C   . PHE B 2 118 ? -10.636 -26.402 -13.414 1.00 18.55 ? 118 PHE L C   1 
ATOM   2149 O  O   . PHE B 2 118 ? -11.797 -26.471 -12.993 1.00 20.46 ? 118 PHE L O   1 
ATOM   2150 C  CB  . PHE B 2 118 ? -9.453  -25.980 -11.279 1.00 16.80 ? 118 PHE L CB  1 
ATOM   2151 C  CG  . PHE B 2 118 ? -8.479  -25.154 -10.463 1.00 17.80 ? 118 PHE L CG  1 
ATOM   2152 C  CD1 . PHE B 2 118 ? -7.114  -25.462 -10.448 1.00 19.76 ? 118 PHE L CD1 1 
ATOM   2153 C  CD2 . PHE B 2 118 ? -8.932  -24.085 -9.689  1.00 18.92 ? 118 PHE L CD2 1 
ATOM   2154 C  CE1 . PHE B 2 118 ? -6.216  -24.710 -9.672  1.00 18.44 ? 118 PHE L CE1 1 
ATOM   2155 C  CE2 . PHE B 2 118 ? -8.040  -23.319 -8.915  1.00 21.28 ? 118 PHE L CE2 1 
ATOM   2156 C  CZ  . PHE B 2 118 ? -6.689  -23.641 -8.907  1.00 20.87 ? 118 PHE L CZ  1 
ATOM   2157 N  N   . PRO B 2 119 ? -10.199 -27.094 -14.490 1.00 20.08 ? 119 PRO L N   1 
ATOM   2158 C  CA  . PRO B 2 119 ? -11.058 -28.120 -15.082 1.00 20.05 ? 119 PRO L CA  1 
ATOM   2159 C  C   . PRO B 2 119 ? -11.235 -29.290 -14.113 1.00 21.12 ? 119 PRO L C   1 
ATOM   2160 O  O   . PRO B 2 119 ? -10.505 -29.371 -13.116 1.00 22.08 ? 119 PRO L O   1 
ATOM   2161 C  CB  . PRO B 2 119 ? -10.276 -28.569 -16.330 1.00 20.40 ? 119 PRO L CB  1 
ATOM   2162 C  CG  . PRO B 2 119 ? -9.288  -27.488 -16.588 1.00 23.24 ? 119 PRO L CG  1 
ATOM   2163 C  CD  . PRO B 2 119 ? -8.935  -26.941 -15.235 1.00 22.00 ? 119 PRO L CD  1 
ATOM   2164 N  N   . PRO B 2 120 ? -12.231 -30.160 -14.366 1.00 23.87 ? 120 PRO L N   1 
ATOM   2165 C  CA  . PRO B 2 120 ? -12.364 -31.365 -13.548 1.00 21.04 ? 120 PRO L CA  1 
ATOM   2166 C  C   . PRO B 2 120 ? -11.147 -32.276 -13.729 1.00 21.97 ? 120 PRO L C   1 
ATOM   2167 O  O   . PRO B 2 120 ? -10.531 -32.288 -14.811 1.00 21.00 ? 120 PRO L O   1 
ATOM   2168 C  CB  . PRO B 2 120 ? -13.622 -32.042 -14.109 1.00 24.08 ? 120 PRO L CB  1 
ATOM   2169 C  CG  . PRO B 2 120 ? -13.854 -31.427 -15.458 1.00 24.03 ? 120 PRO L CG  1 
ATOM   2170 C  CD  . PRO B 2 120 ? -13.296 -30.050 -15.385 1.00 21.77 ? 120 PRO L CD  1 
ATOM   2171 N  N   . SER B 2 121 ? -10.801 -33.013 -12.681 1.00 19.50 ? 121 SER L N   1 
ATOM   2172 C  CA  . SER B 2 121 ? -9.734  -34.013 -12.777 1.00 24.78 ? 121 SER L CA  1 
ATOM   2173 C  C   . SER B 2 121 ? -10.187 -35.213 -13.609 1.00 23.20 ? 121 SER L C   1 
ATOM   2174 O  O   . SER B 2 121 ? -11.380 -35.525 -13.672 1.00 23.71 ? 121 SER L O   1 
ATOM   2175 C  CB  . SER B 2 121 ? -9.279  -34.466 -11.381 1.00 23.89 ? 121 SER L CB  1 
ATOM   2176 O  OG  . SER B 2 121 ? -10.321 -35.112 -10.664 1.00 24.52 ? 121 SER L OG  1 
ATOM   2177 N  N   . ASP B 2 122 ? -9.232  -35.887 -14.247 1.00 25.67 ? 122 ASP L N   1 
ATOM   2178 C  CA  . ASP B 2 122 ? -9.527  -37.106 -14.994 1.00 29.93 ? 122 ASP L CA  1 
ATOM   2179 C  C   . ASP B 2 122 ? -10.107 -38.176 -14.078 1.00 27.82 ? 122 ASP L C   1 
ATOM   2180 O  O   . ASP B 2 122 ? -11.006 -38.924 -14.485 1.00 27.69 ? 122 ASP L O   1 
ATOM   2181 C  CB  . ASP B 2 122 ? -8.273  -37.631 -15.703 1.00 34.63 ? 122 ASP L CB  1 
ATOM   2182 C  CG  . ASP B 2 122 ? -7.873  -36.779 -16.902 1.00 39.54 ? 122 ASP L CG  1 
ATOM   2183 O  OD1 . ASP B 2 122 ? -8.756  -36.181 -17.564 1.00 38.17 ? 122 ASP L OD1 1 
ATOM   2184 O  OD2 . ASP B 2 122 ? -6.661  -36.716 -17.185 1.00 43.02 ? 122 ASP L OD2 1 
ATOM   2185 N  N   . GLU B 2 123 ? -9.601  -38.224 -12.842 1.00 25.62 ? 123 GLU L N   1 
ATOM   2186 C  CA  . GLU B 2 123 ? -10.099 -39.151 -11.824 1.00 32.08 ? 123 GLU L CA  1 
ATOM   2187 C  C   . GLU B 2 123 ? -11.584 -38.933 -11.546 1.00 30.33 ? 123 GLU L C   1 
ATOM   2188 O  O   . GLU B 2 123 ? -12.359 -39.894 -11.496 1.00 33.08 ? 123 GLU L O   1 
ATOM   2189 C  CB  . GLU B 2 123 ? -9.295  -39.037 -10.522 1.00 33.45 ? 123 GLU L CB  1 
ATOM   2190 C  CG  . GLU B 2 123 ? -9.739  -40.021 -9.434  1.00 39.73 ? 123 GLU L CG  1 
ATOM   2191 C  CD  . GLU B 2 123 ? -9.043  -39.814 -8.089  1.00 43.64 ? 123 GLU L CD  1 
ATOM   2192 O  OE1 . GLU B 2 123 ? -8.323  -38.800 -7.905  1.00 47.31 ? 123 GLU L OE1 1 
ATOM   2193 O  OE2 . GLU B 2 123 ? -9.232  -40.682 -7.206  1.00 49.02 ? 123 GLU L OE2 1 
ATOM   2194 N  N   . GLN B 2 124 ? -11.984 -37.675 -11.354 1.00 28.97 ? 124 GLN L N   1 
ATOM   2195 C  CA  . GLN B 2 124 ? -13.401 -37.394 -11.156 1.00 25.35 ? 124 GLN L CA  1 
ATOM   2196 C  C   . GLN B 2 124 ? -14.225 -37.737 -12.401 1.00 21.92 ? 124 GLN L C   1 
ATOM   2197 O  O   . GLN B 2 124 ? -15.270 -38.366 -12.300 1.00 23.61 ? 124 GLN L O   1 
ATOM   2198 C  CB  . GLN B 2 124 ? -13.655 -35.954 -10.720 1.00 20.40 ? 124 GLN L CB  1 
ATOM   2199 C  CG  . GLN B 2 124 ? -15.108 -35.742 -10.334 1.00 22.14 ? 124 GLN L CG  1 
ATOM   2200 C  CD  . GLN B 2 124 ? -15.455 -34.301 -10.061 1.00 23.47 ? 124 GLN L CD  1 
ATOM   2201 O  OE1 . GLN B 2 124 ? -14.772 -33.377 -10.526 1.00 21.61 ? 124 GLN L OE1 1 
ATOM   2202 N  NE2 . GLN B 2 124 ? -16.518 -34.095 -9.279  1.00 23.53 ? 124 GLN L NE2 1 
ATOM   2203 N  N   . LEU B 2 125 ? -13.740 -37.340 -13.568 1.00 23.37 ? 125 LEU L N   1 
ATOM   2204 C  CA  . LEU B 2 125 ? -14.422 -37.657 -14.817 1.00 29.14 ? 125 LEU L CA  1 
ATOM   2205 C  C   . LEU B 2 125 ? -14.732 -39.157 -14.949 1.00 32.83 ? 125 LEU L C   1 
ATOM   2206 O  O   . LEU B 2 125 ? -15.832 -39.530 -15.370 1.00 29.75 ? 125 LEU L O   1 
ATOM   2207 C  CB  . LEU B 2 125 ? -13.612 -37.140 -16.010 1.00 31.06 ? 125 LEU L CB  1 
ATOM   2208 C  CG  . LEU B 2 125 ? -13.651 -35.625 -16.227 1.00 29.98 ? 125 LEU L CG  1 
ATOM   2209 C  CD1 . LEU B 2 125 ? -12.693 -35.215 -17.341 1.00 31.53 ? 125 LEU L CD1 1 
ATOM   2210 C  CD2 . LEU B 2 125 ? -15.073 -35.153 -16.542 1.00 28.85 ? 125 LEU L CD2 1 
ATOM   2211 N  N   . LYS B 2 126 ? -13.771 -40.004 -14.571 1.00 36.78 ? 126 LYS L N   1 
ATOM   2212 C  CA  . LYS B 2 126 ? -13.972 -41.463 -14.540 1.00 41.03 ? 126 LYS L CA  1 
ATOM   2213 C  C   . LYS B 2 126 ? -15.189 -41.878 -13.717 1.00 40.37 ? 126 LYS L C   1 
ATOM   2214 O  O   . LYS B 2 126 ? -15.885 -42.828 -14.072 1.00 41.78 ? 126 LYS L O   1 
ATOM   2215 C  CB  . LYS B 2 126 ? -12.734 -42.174 -13.994 1.00 45.02 ? 126 LYS L CB  1 
ATOM   2216 C  CG  . LYS B 2 126 ? -11.699 -42.525 -15.043 1.00 52.30 ? 126 LYS L CG  1 
ATOM   2217 C  CD  . LYS B 2 126 ? -10.572 -43.346 -14.439 1.00 56.86 ? 126 LYS L CD  1 
ATOM   2218 C  CE  . LYS B 2 126 ? -9.535  -43.705 -15.490 1.00 59.42 ? 126 LYS L CE  1 
ATOM   2219 N  NZ  . LYS B 2 126 ? -8.429  -44.527 -14.921 1.00 61.26 ? 126 LYS L NZ  1 
ATOM   2220 N  N   . SER B 2 127 ? -15.444 -41.156 -12.626 1.00 39.20 ? 127 SER L N   1 
ATOM   2221 C  CA  . SER B 2 127 ? -16.535 -41.480 -11.708 1.00 38.47 ? 127 SER L CA  1 
ATOM   2222 C  C   . SER B 2 127 ? -17.918 -41.024 -12.186 1.00 35.99 ? 127 SER L C   1 
ATOM   2223 O  O   . SER B 2 127 ? -18.916 -41.325 -11.535 1.00 32.18 ? 127 SER L O   1 
ATOM   2224 C  CB  . SER B 2 127 ? -16.252 -40.916 -10.312 1.00 39.46 ? 127 SER L CB  1 
ATOM   2225 O  OG  . SER B 2 127 ? -16.386 -39.501 -10.286 1.00 37.88 ? 127 SER L OG  1 
ATOM   2226 N  N   . GLY B 2 128 ? -17.973 -40.297 -13.305 1.00 35.53 ? 128 GLY L N   1 
ATOM   2227 C  CA  . GLY B 2 128 ? -19.254 -39.892 -13.915 1.00 31.91 ? 128 GLY L CA  1 
ATOM   2228 C  C   . GLY B 2 128 ? -19.668 -38.440 -13.693 1.00 30.05 ? 128 GLY L C   1 
ATOM   2229 O  O   . GLY B 2 128 ? -20.736 -38.006 -14.147 1.00 25.10 ? 128 GLY L O   1 
ATOM   2230 N  N   . THR B 2 129 ? -18.815 -37.679 -13.012 1.00 27.34 ? 129 THR L N   1 
ATOM   2231 C  CA  . THR B 2 129 ? -19.138 -36.304 -12.653 1.00 26.13 ? 129 THR L CA  1 
ATOM   2232 C  C   . THR B 2 129 ? -18.000 -35.369 -13.041 1.00 25.20 ? 129 THR L C   1 
ATOM   2233 O  O   . THR B 2 129 ? -16.845 -35.787 -13.126 1.00 26.25 ? 129 THR L O   1 
ATOM   2234 C  CB  . THR B 2 129 ? -19.457 -36.189 -11.142 1.00 28.76 ? 129 THR L CB  1 
ATOM   2235 O  OG1 . THR B 2 129 ? -20.535 -37.076 -10.823 1.00 29.06 ? 129 THR L OG1 1 
ATOM   2236 C  CG2 . THR B 2 129 ? -19.878 -34.771 -10.768 1.00 29.82 ? 129 THR L CG2 1 
ATOM   2237 N  N   . ALA B 2 130 ? -18.345 -34.107 -13.286 1.00 24.36 ? 130 ALA L N   1 
ATOM   2238 C  CA  . ALA B 2 130 ? -17.377 -33.079 -13.622 1.00 23.51 ? 130 ALA L CA  1 
ATOM   2239 C  C   . ALA B 2 130 ? -17.625 -31.836 -12.777 1.00 25.26 ? 130 ALA L C   1 
ATOM   2240 O  O   . ALA B 2 130 ? -18.657 -31.170 -12.938 1.00 25.58 ? 130 ALA L O   1 
ATOM   2241 C  CB  . ALA B 2 130 ? -17.479 -32.736 -15.097 1.00 23.64 ? 130 ALA L CB  1 
ATOM   2242 N  N   . SER B 2 131 ? -16.691 -31.541 -11.872 1.00 23.07 ? 131 SER L N   1 
ATOM   2243 C  CA  . SER B 2 131 ? -16.703 -30.290 -11.110 1.00 23.83 ? 131 SER L CA  1 
ATOM   2244 C  C   . SER B 2 131 ? -15.665 -29.323 -11.663 1.00 23.69 ? 131 SER L C   1 
ATOM   2245 O  O   . SER B 2 131 ? -14.487 -29.675 -11.794 1.00 21.48 ? 131 SER L O   1 
ATOM   2246 C  CB  . SER B 2 131 ? -16.465 -30.536 -9.615  1.00 26.91 ? 131 SER L CB  1 
ATOM   2247 O  OG  . SER B 2 131 ? -17.468 -31.381 -9.074  1.00 27.92 ? 131 SER L OG  1 
ATOM   2248 N  N   . VAL B 2 132 ? -16.120 -28.111 -11.996 1.00 20.98 ? 132 VAL L N   1 
ATOM   2249 C  CA  . VAL B 2 132 ? -15.250 -27.042 -12.462 1.00 20.53 ? 132 VAL L CA  1 
ATOM   2250 C  C   . VAL B 2 132 ? -15.181 -25.974 -11.380 1.00 18.20 ? 132 VAL L C   1 
ATOM   2251 O  O   . VAL B 2 132 ? -16.233 -25.533 -10.891 1.00 23.62 ? 132 VAL L O   1 
ATOM   2252 C  CB  . VAL B 2 132 ? -15.763 -26.393 -13.764 1.00 18.67 ? 132 VAL L CB  1 
ATOM   2253 C  CG1 . VAL B 2 132 ? -14.673 -25.496 -14.367 1.00 20.23 ? 132 VAL L CG1 1 
ATOM   2254 C  CG2 . VAL B 2 132 ? -16.172 -27.458 -14.788 1.00 20.81 ? 132 VAL L CG2 1 
ATOM   2255 N  N   . VAL B 2 133 ? -13.962 -25.558 -11.016 1.00 17.57 ? 133 VAL L N   1 
ATOM   2256 C  CA  . VAL B 2 133 ? -13.766 -24.633 -9.901  1.00 18.91 ? 133 VAL L CA  1 
ATOM   2257 C  C   . VAL B 2 133 ? -13.219 -23.295 -10.353 1.00 24.40 ? 133 VAL L C   1 
ATOM   2258 O  O   . VAL B 2 133 ? -12.226 -23.212 -11.089 1.00 24.90 ? 133 VAL L O   1 
ATOM   2259 C  CB  . VAL B 2 133 ? -12.885 -25.254 -8.768  1.00 19.28 ? 133 VAL L CB  1 
ATOM   2260 C  CG1 . VAL B 2 133 ? -12.615 -24.233 -7.619  1.00 19.68 ? 133 VAL L CG1 1 
ATOM   2261 C  CG2 . VAL B 2 133 ? -13.556 -26.509 -8.217  1.00 22.30 ? 133 VAL L CG2 1 
ATOM   2262 N  N   . CYS B 2 134 ? -13.879 -22.242 -9.904  1.00 19.87 ? 134 CYS L N   1 
ATOM   2263 C  CA  . CYS B 2 134 ? -13.383 -20.897 -10.105 1.00 21.53 ? 134 CYS L CA  1 
ATOM   2264 C  C   . CYS B 2 134 ? -12.971 -20.316 -8.757  1.00 23.39 ? 134 CYS L C   1 
ATOM   2265 O  O   . CYS B 2 134 ? -13.755 -20.345 -7.799  1.00 22.96 ? 134 CYS L O   1 
ATOM   2266 C  CB  . CYS B 2 134 ? -14.476 -20.027 -10.720 1.00 21.67 ? 134 CYS L CB  1 
ATOM   2267 S  SG  . CYS B 2 134 ? -13.827 -18.441 -11.194 1.00 27.54 ? 134 CYS L SG  1 
ATOM   2268 N  N   . LEU B 2 135 ? -11.742 -19.803 -8.691  1.00 21.50 ? 135 LEU L N   1 
ATOM   2269 C  CA  . LEU B 2 135 ? -11.166 -19.299 -7.455  1.00 20.64 ? 135 LEU L CA  1 
ATOM   2270 C  C   . LEU B 2 135 ? -10.938 -17.790 -7.558  1.00 20.85 ? 135 LEU L C   1 
ATOM   2271 O  O   . LEU B 2 135 ? -10.338 -17.323 -8.525  1.00 21.49 ? 135 LEU L O   1 
ATOM   2272 C  CB  . LEU B 2 135 ? -9.834  -20.023 -7.139  1.00 22.73 ? 135 LEU L CB  1 
ATOM   2273 C  CG  . LEU B 2 135 ? -9.011  -19.422 -5.994  1.00 19.06 ? 135 LEU L CG  1 
ATOM   2274 C  CD1 . LEU B 2 135 ? -9.791  -19.533 -4.664  1.00 20.73 ? 135 LEU L CD1 1 
ATOM   2275 C  CD2 . LEU B 2 135 ? -7.660  -20.132 -5.862  1.00 23.30 ? 135 LEU L CD2 1 
ATOM   2276 N  N   . LEU B 2 136 ? -11.429 -17.054 -6.562  1.00 18.62 ? 136 LEU L N   1 
ATOM   2277 C  CA  . LEU B 2 136 ? -11.199 -15.618 -6.439  1.00 22.33 ? 136 LEU L CA  1 
ATOM   2278 C  C   . LEU B 2 136 ? -10.392 -15.380 -5.173  1.00 22.00 ? 136 LEU L C   1 
ATOM   2279 O  O   . LEU B 2 136 ? -10.895 -15.576 -4.057  1.00 21.44 ? 136 LEU L O   1 
ATOM   2280 C  CB  . LEU B 2 136 ? -12.520 -14.854 -6.333  1.00 21.14 ? 136 LEU L CB  1 
ATOM   2281 C  CG  . LEU B 2 136 ? -13.388 -14.593 -7.560  1.00 22.12 ? 136 LEU L CG  1 
ATOM   2282 C  CD1 . LEU B 2 136 ? -13.897 -15.887 -8.137  1.00 20.72 ? 136 LEU L CD1 1 
ATOM   2283 C  CD2 . LEU B 2 136 ? -14.551 -13.701 -7.098  1.00 22.27 ? 136 LEU L CD2 1 
ATOM   2284 N  N   . ASN B 2 137 ? -9.155  -14.926 -5.340  1.00 20.68 ? 137 ASN L N   1 
ATOM   2285 C  CA  . ASN B 2 137 ? -8.214  -14.926 -4.231  1.00 22.76 ? 137 ASN L CA  1 
ATOM   2286 C  C   . ASN B 2 137 ? -7.910  -13.542 -3.681  1.00 20.42 ? 137 ASN L C   1 
ATOM   2287 O  O   . ASN B 2 137 ? -7.583  -12.639 -4.439  1.00 22.97 ? 137 ASN L O   1 
ATOM   2288 C  CB  . ASN B 2 137 ? -6.916  -15.582 -4.693  1.00 24.99 ? 137 ASN L CB  1 
ATOM   2289 C  CG  . ASN B 2 137 ? -6.506  -16.708 -3.810  1.00 37.48 ? 137 ASN L CG  1 
ATOM   2290 O  OD1 . ASN B 2 137 ? -7.283  -17.641 -3.567  1.00 41.43 ? 137 ASN L OD1 1 
ATOM   2291 N  ND2 . ASN B 2 137 ? -5.281  -16.644 -3.312  1.00 42.77 ? 137 ASN L ND2 1 
ATOM   2292 N  N   . ASN B 2 138 ? -8.012  -13.396 -2.359  1.00 20.99 ? 138 ASN L N   1 
ATOM   2293 C  CA  . ASN B 2 138 ? -7.578  -12.201 -1.627  1.00 20.06 ? 138 ASN L CA  1 
ATOM   2294 C  C   . ASN B 2 138 ? -8.136  -10.878 -2.158  1.00 22.27 ? 138 ASN L C   1 
ATOM   2295 O  O   . ASN B 2 138 ? -7.385  -10.021 -2.613  1.00 20.80 ? 138 ASN L O   1 
ATOM   2296 C  CB  . ASN B 2 138 ? -6.050  -12.142 -1.525  1.00 23.83 ? 138 ASN L CB  1 
ATOM   2297 C  CG  . ASN B 2 138 ? -5.487  -13.274 -0.668  1.00 28.50 ? 138 ASN L CG  1 
ATOM   2298 O  OD1 . ASN B 2 138 ? -5.081  -13.073 0.484   1.00 36.68 ? 138 ASN L OD1 1 
ATOM   2299 N  ND2 . ASN B 2 138 ? -5.490  -14.466 -1.215  1.00 25.63 ? 138 ASN L ND2 1 
ATOM   2300 N  N   . PHE B 2 139 ? -9.450  -10.719 -2.053  1.00 18.52 ? 139 PHE L N   1 
ATOM   2301 C  CA  . PHE B 2 139 ? -10.123 -9.489  -2.479  1.00 16.76 ? 139 PHE L CA  1 
ATOM   2302 C  C   . PHE B 2 139 ? -10.852 -8.765  -1.341  1.00 18.95 ? 139 PHE L C   1 
ATOM   2303 O  O   . PHE B 2 139 ? -11.124 -9.335  -0.275  1.00 19.40 ? 139 PHE L O   1 
ATOM   2304 C  CB  . PHE B 2 139 ? -11.078 -9.778  -3.649  1.00 19.91 ? 139 PHE L CB  1 
ATOM   2305 C  CG  . PHE B 2 139 ? -12.187 -10.761 -3.319  1.00 21.79 ? 139 PHE L CG  1 
ATOM   2306 C  CD1 . PHE B 2 139 ? -13.414 -10.304 -2.848  1.00 20.95 ? 139 PHE L CD1 1 
ATOM   2307 C  CD2 . PHE B 2 139 ? -12.001 -12.137 -3.493  1.00 19.91 ? 139 PHE L CD2 1 
ATOM   2308 C  CE1 . PHE B 2 139 ? -14.458 -11.212 -2.539  1.00 23.99 ? 139 PHE L CE1 1 
ATOM   2309 C  CE2 . PHE B 2 139 ? -13.036 -13.062 -3.186  1.00 22.59 ? 139 PHE L CE2 1 
ATOM   2310 C  CZ  . PHE B 2 139 ? -14.271 -12.590 -2.719  1.00 23.68 ? 139 PHE L CZ  1 
ATOM   2311 N  N   . TYR B 2 140 ? -11.144 -7.486  -1.573  1.00 18.05 ? 140 TYR L N   1 
ATOM   2312 C  CA  . TYR B 2 140 ? -11.902 -6.667  -0.623  1.00 20.33 ? 140 TYR L CA  1 
ATOM   2313 C  C   . TYR B 2 140 ? -12.634 -5.576  -1.414  1.00 19.33 ? 140 TYR L C   1 
ATOM   2314 O  O   . TYR B 2 140 ? -12.043 -4.971  -2.308  1.00 20.37 ? 140 TYR L O   1 
ATOM   2315 C  CB  . TYR B 2 140 ? -10.992 -6.039  0.458   1.00 19.38 ? 140 TYR L CB  1 
ATOM   2316 C  CG  . TYR B 2 140 ? -11.843 -5.397  1.532   1.00 19.79 ? 140 TYR L CG  1 
ATOM   2317 C  CD1 . TYR B 2 140 ? -12.291 -4.082  1.397   1.00 22.21 ? 140 TYR L CD1 1 
ATOM   2318 C  CD2 . TYR B 2 140 ? -12.277 -6.134  2.635   1.00 19.14 ? 140 TYR L CD2 1 
ATOM   2319 C  CE1 . TYR B 2 140 ? -13.116 -3.497  2.351   1.00 21.57 ? 140 TYR L CE1 1 
ATOM   2320 C  CE2 . TYR B 2 140 ? -13.096 -5.560  3.587   1.00 21.35 ? 140 TYR L CE2 1 
ATOM   2321 C  CZ  . TYR B 2 140 ? -13.510 -4.248  3.442   1.00 20.50 ? 140 TYR L CZ  1 
ATOM   2322 O  OH  . TYR B 2 140 ? -14.338 -3.677  4.373   1.00 22.01 ? 140 TYR L OH  1 
ATOM   2323 N  N   . PRO B 2 141 ? -13.924 -5.319  -1.105  1.00 20.54 ? 141 PRO L N   1 
ATOM   2324 C  CA  . PRO B 2 141 ? -14.779 -5.961  -0.090  1.00 20.24 ? 141 PRO L CA  1 
ATOM   2325 C  C   . PRO B 2 141 ? -15.342 -7.313  -0.520  1.00 23.05 ? 141 PRO L C   1 
ATOM   2326 O  O   . PRO B 2 141 ? -15.065 -7.786  -1.615  1.00 19.01 ? 141 PRO L O   1 
ATOM   2327 C  CB  . PRO B 2 141 ? -15.903 -4.939  0.109   1.00 21.52 ? 141 PRO L CB  1 
ATOM   2328 C  CG  . PRO B 2 141 ? -16.023 -4.257  -1.231  1.00 21.01 ? 141 PRO L CG  1 
ATOM   2329 C  CD  . PRO B 2 141 ? -14.633 -4.234  -1.821  1.00 20.92 ? 141 PRO L CD  1 
ATOM   2330 N  N   . ARG B 2 142 ? -16.144 -7.914  0.353   1.00 21.71 ? 142 ARG L N   1 
ATOM   2331 C  CA  . ARG B 2 142 ? -16.752 -9.220  0.112   1.00 27.95 ? 142 ARG L CA  1 
ATOM   2332 C  C   . ARG B 2 142 ? -17.616 -9.293  -1.150  1.00 27.58 ? 142 ARG L C   1 
ATOM   2333 O  O   . ARG B 2 142 ? -17.756 -10.362 -1.745  1.00 28.88 ? 142 ARG L O   1 
ATOM   2334 C  CB  . ARG B 2 142 ? -17.610 -9.576  1.323   1.00 32.48 ? 142 ARG L CB  1 
ATOM   2335 C  CG  . ARG B 2 142 ? -17.460 -10.974 1.812   1.00 39.46 ? 142 ARG L CG  1 
ATOM   2336 C  CD  . ARG B 2 142 ? -18.263 -11.157 3.099   1.00 43.78 ? 142 ARG L CD  1 
ATOM   2337 N  NE  . ARG B 2 142 ? -18.006 -10.089 4.070   1.00 45.79 ? 142 ARG L NE  1 
ATOM   2338 C  CZ  . ARG B 2 142 ? -18.415 -10.110 5.336   1.00 49.66 ? 142 ARG L CZ  1 
ATOM   2339 N  NH1 . ARG B 2 142 ? -18.127 -9.092  6.136   1.00 51.33 ? 142 ARG L NH1 1 
ATOM   2340 N  NH2 . ARG B 2 142 ? -19.108 -11.147 5.806   1.00 49.57 ? 142 ARG L NH2 1 
ATOM   2341 N  N   . GLU B 2 143 ? -18.218 -8.167  -1.532  1.00 27.65 ? 143 GLU L N   1 
ATOM   2342 C  CA  . GLU B 2 143 ? -19.112 -8.086  -2.693  1.00 29.84 ? 143 GLU L CA  1 
ATOM   2343 C  C   . GLU B 2 143 ? -18.392 -8.474  -3.996  1.00 31.26 ? 143 GLU L C   1 
ATOM   2344 O  O   . GLU B 2 143 ? -17.473 -7.789  -4.415  1.00 25.48 ? 143 GLU L O   1 
ATOM   2345 C  CB  . GLU B 2 143 ? -19.685 -6.668  -2.826  1.00 34.18 ? 143 GLU L CB  1 
ATOM   2346 C  CG  . GLU B 2 143 ? -20.866 -6.361  -1.914  1.00 38.45 ? 143 GLU L CG  1 
ATOM   2347 C  CD  . GLU B 2 143 ? -20.491 -6.002  -0.475  1.00 43.04 ? 143 GLU L CD  1 
ATOM   2348 O  OE1 . GLU B 2 143 ? -19.286 -5.922  -0.118  1.00 35.29 ? 143 GLU L OE1 1 
ATOM   2349 O  OE2 . GLU B 2 143 ? -21.441 -5.781  0.311   1.00 45.43 ? 143 GLU L OE2 1 
ATOM   2350 N  N   . ALA B 2 144 ? -18.830 -9.577  -4.611  1.00 29.75 ? 144 ALA L N   1 
ATOM   2351 C  CA  . ALA B 2 144 ? -18.241 -10.117 -5.848  1.00 29.75 ? 144 ALA L CA  1 
ATOM   2352 C  C   . ALA B 2 144 ? -19.313 -10.927 -6.577  1.00 32.84 ? 144 ALA L C   1 
ATOM   2353 O  O   . ALA B 2 144 ? -20.083 -11.644 -5.937  1.00 31.43 ? 144 ALA L O   1 
ATOM   2354 C  CB  . ALA B 2 144 ? -17.058 -11.014 -5.523  1.00 26.71 ? 144 ALA L CB  1 
ATOM   2355 N  N   . LYS B 2 145 ? -19.369 -10.797 -7.901  1.00 29.95 ? 145 LYS L N   1 
ATOM   2356 C  CA  . LYS B 2 145 ? -20.261 -11.618 -8.719  1.00 28.70 ? 145 LYS L CA  1 
ATOM   2357 C  C   . LYS B 2 145 ? -19.453 -12.624 -9.555  1.00 28.13 ? 145 LYS L C   1 
ATOM   2358 O  O   . LYS B 2 145 ? -18.514 -12.247 -10.248 1.00 23.97 ? 145 LYS L O   1 
ATOM   2359 C  CB  . LYS B 2 145 ? -21.114 -10.733 -9.614  1.00 33.87 ? 145 LYS L CB  1 
ATOM   2360 C  CG  . LYS B 2 145 ? -22.143 -11.481 -10.459 1.00 39.79 ? 145 LYS L CG  1 
ATOM   2361 C  CD  . LYS B 2 145 ? -23.102 -10.519 -11.143 1.00 43.91 ? 145 LYS L CD  1 
ATOM   2362 C  CE  . LYS B 2 145 ? -22.434 -9.751  -12.289 1.00 46.04 ? 145 LYS L CE  1 
ATOM   2363 N  NZ  . LYS B 2 145 ? -23.327 -8.680  -12.836 1.00 47.06 ? 145 LYS L NZ  1 
ATOM   2364 N  N   . VAL B 2 146 ? -19.810 -13.902 -9.442  1.00 24.60 ? 146 VAL L N   1 
ATOM   2365 C  CA  . VAL B 2 146 ? -19.290 -14.952 -10.308 1.00 23.84 ? 146 VAL L CA  1 
ATOM   2366 C  C   . VAL B 2 146 ? -20.424 -15.393 -11.251 1.00 24.72 ? 146 VAL L C   1 
ATOM   2367 O  O   . VAL B 2 146 ? -21.548 -15.636 -10.806 1.00 29.13 ? 146 VAL L O   1 
ATOM   2368 C  CB  . VAL B 2 146 ? -18.763 -16.154 -9.492  1.00 24.87 ? 146 VAL L CB  1 
ATOM   2369 C  CG1 . VAL B 2 146 ? -18.403 -17.343 -10.404 1.00 29.59 ? 146 VAL L CG1 1 
ATOM   2370 C  CG2 . VAL B 2 146 ? -17.565 -15.743 -8.649  1.00 27.16 ? 146 VAL L CG2 1 
ATOM   2371 N  N   . GLN B 2 147 ? -20.124 -15.445 -12.543 1.00 23.07 ? 147 GLN L N   1 
ATOM   2372 C  CA  . GLN B 2 147 ? -21.050 -15.956 -13.550 1.00 27.70 ? 147 GLN L CA  1 
ATOM   2373 C  C   . GLN B 2 147 ? -20.368 -17.036 -14.387 1.00 25.22 ? 147 GLN L C   1 
ATOM   2374 O  O   . GLN B 2 147 ? -19.313 -16.804 -14.986 1.00 20.87 ? 147 GLN L O   1 
ATOM   2375 C  CB  . GLN B 2 147 ? -21.566 -14.827 -14.450 1.00 30.12 ? 147 GLN L CB  1 
ATOM   2376 C  CG  . GLN B 2 147 ? -22.728 -14.032 -13.824 1.00 37.20 ? 147 GLN L CG  1 
ATOM   2377 C  CD  . GLN B 2 147 ? -23.366 -13.033 -14.774 1.00 38.54 ? 147 GLN L CD  1 
ATOM   2378 O  OE1 . GLN B 2 147 ? -22.690 -12.404 -15.594 1.00 44.15 ? 147 GLN L OE1 1 
ATOM   2379 N  NE2 . GLN B 2 147 ? -24.675 -12.867 -14.653 1.00 42.23 ? 147 GLN L NE2 1 
ATOM   2380 N  N   . TRP B 2 148 ? -20.969 -18.220 -14.410 1.00 20.50 ? 148 TRP L N   1 
ATOM   2381 C  CA  . TRP B 2 148 ? -20.449 -19.316 -15.211 1.00 18.86 ? 148 TRP L CA  1 
ATOM   2382 C  C   . TRP B 2 148 ? -21.065 -19.239 -16.600 1.00 19.30 ? 148 TRP L C   1 
ATOM   2383 O  O   . TRP B 2 148 ? -22.272 -19.005 -16.750 1.00 20.67 ? 148 TRP L O   1 
ATOM   2384 C  CB  . TRP B 2 148 ? -20.779 -20.667 -14.574 1.00 18.31 ? 148 TRP L CB  1 
ATOM   2385 C  CG  . TRP B 2 148 ? -19.944 -21.017 -13.402 1.00 19.97 ? 148 TRP L CG  1 
ATOM   2386 C  CD1 . TRP B 2 148 ? -20.283 -20.904 -12.079 1.00 20.47 ? 148 TRP L CD1 1 
ATOM   2387 C  CD2 . TRP B 2 148 ? -18.628 -21.569 -13.433 1.00 21.89 ? 148 TRP L CD2 1 
ATOM   2388 N  NE1 . TRP B 2 148 ? -19.252 -21.352 -11.285 1.00 21.11 ? 148 TRP L NE1 1 
ATOM   2389 C  CE2 . TRP B 2 148 ? -18.223 -21.764 -12.090 1.00 20.76 ? 148 TRP L CE2 1 
ATOM   2390 C  CE3 . TRP B 2 148 ? -17.742 -21.914 -14.469 1.00 22.13 ? 148 TRP L CE3 1 
ATOM   2391 C  CZ2 . TRP B 2 148 ? -16.977 -22.279 -11.754 1.00 19.42 ? 148 TRP L CZ2 1 
ATOM   2392 C  CZ3 . TRP B 2 148 ? -16.499 -22.437 -14.129 1.00 18.70 ? 148 TRP L CZ3 1 
ATOM   2393 C  CH2 . TRP B 2 148 ? -16.130 -22.612 -12.789 1.00 18.62 ? 148 TRP L CH2 1 
ATOM   2394 N  N   . LYS B 2 149 ? -20.220 -19.414 -17.612 1.00 21.48 ? 149 LYS L N   1 
ATOM   2395 C  CA  . LYS B 2 149 ? -20.665 -19.526 -18.998 1.00 24.83 ? 149 LYS L CA  1 
ATOM   2396 C  C   . LYS B 2 149 ? -20.107 -20.808 -19.605 1.00 23.13 ? 149 LYS L C   1 
ATOM   2397 O  O   . LYS B 2 149 ? -18.941 -21.179 -19.383 1.00 22.16 ? 149 LYS L O   1 
ATOM   2398 C  CB  . LYS B 2 149 ? -20.245 -18.309 -19.825 1.00 25.85 ? 149 LYS L CB  1 
ATOM   2399 C  CG  . LYS B 2 149 ? -20.683 -16.967 -19.248 1.00 31.01 ? 149 LYS L CG  1 
ATOM   2400 C  CD  . LYS B 2 149 ? -20.294 -15.813 -20.146 1.00 31.83 ? 149 LYS L CD  1 
ATOM   2401 C  CE  . LYS B 2 149 ? -20.495 -14.488 -19.426 1.00 38.62 ? 149 LYS L CE  1 
ATOM   2402 N  NZ  . LYS B 2 149 ? -20.669 -13.365 -20.390 1.00 40.94 ? 149 LYS L NZ  1 
ATOM   2403 N  N   . VAL B 2 150 ? -20.958 -21.503 -20.338 1.00 20.51 ? 150 VAL L N   1 
ATOM   2404 C  CA  . VAL B 2 150 ? -20.573 -22.735 -21.041 1.00 20.23 ? 150 VAL L CA  1 
ATOM   2405 C  C   . VAL B 2 150 ? -20.993 -22.559 -22.499 1.00 20.92 ? 150 VAL L C   1 
ATOM   2406 O  O   . VAL B 2 150 ? -22.186 -22.408 -22.795 1.00 20.35 ? 150 VAL L O   1 
ATOM   2407 C  CB  . VAL B 2 150 ? -21.237 -23.999 -20.413 1.00 20.64 ? 150 VAL L CB  1 
ATOM   2408 C  CG1 . VAL B 2 150 ? -20.876 -25.249 -21.201 1.00 19.46 ? 150 VAL L CG1 1 
ATOM   2409 C  CG2 . VAL B 2 150 ? -20.827 -24.168 -18.953 1.00 21.61 ? 150 VAL L CG2 1 
ATOM   2410 N  N   . ASP B 2 151 ? -20.010 -22.561 -23.402 1.00 17.04 ? 151 ASP L N   1 
ATOM   2411 C  CA  . ASP B 2 151 ? -20.220 -22.166 -24.803 1.00 15.13 ? 151 ASP L CA  1 
ATOM   2412 C  C   . ASP B 2 151 ? -21.007 -20.853 -24.897 1.00 17.57 ? 151 ASP L C   1 
ATOM   2413 O  O   . ASP B 2 151 ? -21.944 -20.718 -25.701 1.00 18.74 ? 151 ASP L O   1 
ATOM   2414 C  CB  . ASP B 2 151 ? -20.882 -23.294 -25.610 1.00 20.42 ? 151 ASP L CB  1 
ATOM   2415 C  CG  . ASP B 2 151 ? -19.944 -24.473 -25.850 1.00 21.84 ? 151 ASP L CG  1 
ATOM   2416 O  OD1 . ASP B 2 151 ? -18.712 -24.258 -25.912 1.00 23.79 ? 151 ASP L OD1 1 
ATOM   2417 O  OD2 . ASP B 2 151 ? -20.443 -25.609 -25.994 1.00 25.25 ? 151 ASP L OD2 1 
ATOM   2418 N  N   . ASN B 2 152 ? -20.603 -19.907 -24.045 1.00 20.34 ? 152 ASN L N   1 
ATOM   2419 C  CA  . ASN B 2 152 ? -21.161 -18.556 -23.935 1.00 22.32 ? 152 ASN L CA  1 
ATOM   2420 C  C   . ASN B 2 152 ? -22.569 -18.460 -23.328 1.00 22.43 ? 152 ASN L C   1 
ATOM   2421 O  O   . ASN B 2 152 ? -23.115 -17.363 -23.210 1.00 25.07 ? 152 ASN L O   1 
ATOM   2422 C  CB  . ASN B 2 152 ? -21.054 -17.785 -25.264 1.00 23.67 ? 152 ASN L CB  1 
ATOM   2423 C  CG  . ASN B 2 152 ? -21.165 -16.283 -25.078 1.00 24.52 ? 152 ASN L CG  1 
ATOM   2424 O  OD1 . ASN B 2 152 ? -20.489 -15.693 -24.230 1.00 31.29 ? 152 ASN L OD1 1 
ATOM   2425 N  ND2 . ASN B 2 152 ? -22.024 -15.658 -25.861 1.00 24.19 ? 152 ASN L ND2 1 
ATOM   2426 N  N   . ALA B 2 153 ? -23.137 -19.593 -22.921 1.00 20.40 ? 153 ALA L N   1 
ATOM   2427 C  CA  . ALA B 2 153 ? -24.480 -19.598 -22.334 1.00 20.40 ? 153 ALA L CA  1 
ATOM   2428 C  C   . ALA B 2 153 ? -24.402 -19.428 -20.833 1.00 20.53 ? 153 ALA L C   1 
ATOM   2429 O  O   . ALA B 2 153 ? -23.649 -20.128 -20.150 1.00 16.70 ? 153 ALA L O   1 
ATOM   2430 C  CB  . ALA B 2 153 ? -25.247 -20.862 -22.705 1.00 19.92 ? 153 ALA L CB  1 
ATOM   2431 N  N   . LEU B 2 154 ? -25.164 -18.473 -20.311 1.00 19.62 ? 154 LEU L N   1 
ATOM   2432 C  CA  . LEU B 2 154 ? -25.116 -18.205 -18.881 1.00 28.15 ? 154 LEU L CA  1 
ATOM   2433 C  C   . LEU B 2 154 ? -25.753 -19.369 -18.137 1.00 24.40 ? 154 LEU L C   1 
ATOM   2434 O  O   . LEU B 2 154 ? -26.844 -19.820 -18.485 1.00 20.19 ? 154 LEU L O   1 
ATOM   2435 C  CB  . LEU B 2 154 ? -25.810 -16.875 -18.547 1.00 32.78 ? 154 LEU L CB  1 
ATOM   2436 C  CG  . LEU B 2 154 ? -24.977 -15.579 -18.618 1.00 39.53 ? 154 LEU L CG  1 
ATOM   2437 C  CD1 . LEU B 2 154 ? -24.484 -15.242 -20.037 1.00 42.80 ? 154 LEU L CD1 1 
ATOM   2438 C  CD2 . LEU B 2 154 ? -25.759 -14.399 -18.036 1.00 38.46 ? 154 LEU L CD2 1 
ATOM   2439 N  N   . GLN B 2 155 ? -25.049 -19.862 -17.128 1.00 23.04 ? 155 GLN L N   1 
ATOM   2440 C  CA  . GLN B 2 155 ? -25.503 -20.983 -16.321 1.00 24.83 ? 155 GLN L CA  1 
ATOM   2441 C  C   . GLN B 2 155 ? -26.330 -20.498 -15.133 1.00 28.61 ? 155 GLN L C   1 
ATOM   2442 O  O   . GLN B 2 155 ? -26.029 -19.462 -14.534 1.00 25.00 ? 155 GLN L O   1 
ATOM   2443 C  CB  . GLN B 2 155 ? -24.293 -21.782 -15.818 1.00 24.61 ? 155 GLN L CB  1 
ATOM   2444 C  CG  . GLN B 2 155 ? -23.411 -22.334 -16.936 1.00 23.50 ? 155 GLN L CG  1 
ATOM   2445 C  CD  . GLN B 2 155 ? -24.191 -23.224 -17.889 1.00 23.66 ? 155 GLN L CD  1 
ATOM   2446 O  OE1 . GLN B 2 155 ? -24.441 -22.859 -19.045 1.00 25.24 ? 155 GLN L OE1 1 
ATOM   2447 N  NE2 . GLN B 2 155 ? -24.613 -24.386 -17.397 1.00 18.74 ? 155 GLN L NE2 1 
ATOM   2448 N  N   . SER B 2 156 ? -27.379 -21.247 -14.808 1.00 27.65 ? 156 SER L N   1 
ATOM   2449 C  CA  . SER B 2 156 ? -28.105 -21.049 -13.554 1.00 29.46 ? 156 SER L CA  1 
ATOM   2450 C  C   . SER B 2 156 ? -28.453 -22.412 -12.953 1.00 28.25 ? 156 SER L C   1 
ATOM   2451 O  O   . SER B 2 156 ? -28.859 -23.333 -13.678 1.00 31.54 ? 156 SER L O   1 
ATOM   2452 C  CB  . SER B 2 156 ? -29.370 -20.209 -13.786 1.00 28.73 ? 156 SER L CB  1 
ATOM   2453 O  OG  . SER B 2 156 ? -30.294 -20.895 -14.617 1.00 30.86 ? 156 SER L OG  1 
ATOM   2454 N  N   . GLY B 2 157 ? -28.283 -22.538 -11.642 1.00 25.54 ? 157 GLY L N   1 
ATOM   2455 C  CA  . GLY B 2 157 ? -28.793 -23.687 -10.901 1.00 27.25 ? 157 GLY L CA  1 
ATOM   2456 C  C   . GLY B 2 157 ? -27.871 -24.883 -10.741 1.00 30.02 ? 157 GLY L C   1 
ATOM   2457 O  O   . GLY B 2 157 ? -28.274 -25.903 -10.179 1.00 33.64 ? 157 GLY L O   1 
ATOM   2458 N  N   . ASN B 2 158 ? -26.643 -24.762 -11.230 1.00 20.95 ? 158 ASN L N   1 
ATOM   2459 C  CA  . ASN B 2 158 ? -25.678 -25.869 -11.201 1.00 21.34 ? 158 ASN L CA  1 
ATOM   2460 C  C   . ASN B 2 158 ? -24.339 -25.501 -10.570 1.00 21.83 ? 158 ASN L C   1 
ATOM   2461 O  O   . ASN B 2 158 ? -23.323 -26.178 -10.801 1.00 21.60 ? 158 ASN L O   1 
ATOM   2462 C  CB  . ASN B 2 158 ? -25.457 -26.454 -12.610 1.00 24.38 ? 158 ASN L CB  1 
ATOM   2463 C  CG  . ASN B 2 158 ? -25.262 -25.381 -13.684 1.00 26.09 ? 158 ASN L CG  1 
ATOM   2464 O  OD1 . ASN B 2 158 ? -25.393 -25.668 -14.886 1.00 32.43 ? 158 ASN L OD1 1 
ATOM   2465 N  ND2 . ASN B 2 158 ? -24.982 -24.146 -13.267 1.00 21.43 ? 158 ASN L ND2 1 
ATOM   2466 N  N   . SER B 2 159 ? -24.349 -24.450 -9.749  1.00 20.37 ? 159 SER L N   1 
ATOM   2467 C  CA  . SER B 2 159 ? -23.154 -24.011 -9.043  1.00 18.67 ? 159 SER L CA  1 
ATOM   2468 C  C   . SER B 2 159 ? -23.420 -23.722 -7.568  1.00 22.70 ? 159 SER L C   1 
ATOM   2469 O  O   . SER B 2 159 ? -24.568 -23.450 -7.166  1.00 21.09 ? 159 SER L O   1 
ATOM   2470 C  CB  . SER B 2 159 ? -22.510 -22.787 -9.720  1.00 22.20 ? 159 SER L CB  1 
ATOM   2471 O  OG  . SER B 2 159 ? -23.357 -21.639 -9.728  1.00 23.38 ? 159 SER L OG  1 
ATOM   2472 N  N   . GLN B 2 160 ? -22.359 -23.829 -6.770  1.00 19.70 ? 160 GLN L N   1 
ATOM   2473 C  CA  . GLN B 2 160 ? -22.385 -23.414 -5.369  1.00 21.25 ? 160 GLN L CA  1 
ATOM   2474 C  C   . GLN B 2 160 ? -21.135 -22.632 -5.043  1.00 20.33 ? 160 GLN L C   1 
ATOM   2475 O  O   . GLN B 2 160 ? -20.060 -22.903 -5.582  1.00 20.69 ? 160 GLN L O   1 
ATOM   2476 C  CB  . GLN B 2 160 ? -22.463 -24.609 -4.423  1.00 21.61 ? 160 GLN L CB  1 
ATOM   2477 C  CG  . GLN B 2 160 ? -23.656 -25.491 -4.657  1.00 23.45 ? 160 GLN L CG  1 
ATOM   2478 C  CD  . GLN B 2 160 ? -23.851 -26.482 -3.551  1.00 28.47 ? 160 GLN L CD  1 
ATOM   2479 O  OE1 . GLN B 2 160 ? -23.473 -27.648 -3.683  1.00 34.89 ? 160 GLN L OE1 1 
ATOM   2480 N  NE2 . GLN B 2 160 ? -24.460 -26.039 -2.451  1.00 28.31 ? 160 GLN L NE2 1 
ATOM   2481 N  N   . GLU B 2 161 ? -21.272 -21.704 -4.112  1.00 17.92 ? 161 GLU L N   1 
ATOM   2482 C  CA  . GLU B 2 161 ? -20.208 -20.744 -3.803  1.00 20.89 ? 161 GLU L CA  1 
ATOM   2483 C  C   . GLU B 2 161 ? -19.951 -20.764 -2.302  1.00 22.91 ? 161 GLU L C   1 
ATOM   2484 O  O   . GLU B 2 161 ? -20.872 -21.019 -1.522  1.00 21.52 ? 161 GLU L O   1 
ATOM   2485 C  CB  . GLU B 2 161 ? -20.774 -19.379 -4.158  1.00 27.07 ? 161 GLU L CB  1 
ATOM   2486 C  CG  . GLU B 2 161 ? -19.820 -18.360 -4.539  1.00 35.78 ? 161 GLU L CG  1 
ATOM   2487 C  CD  . GLU B 2 161 ? -20.541 -17.126 -5.012  1.00 31.62 ? 161 GLU L CD  1 
ATOM   2488 O  OE1 . GLU B 2 161 ? -21.016 -16.334 -4.164  1.00 34.15 ? 161 GLU L OE1 1 
ATOM   2489 O  OE2 . GLU B 2 161 ? -20.631 -16.965 -6.233  1.00 28.27 ? 161 GLU L OE2 1 
ATOM   2490 N  N   . SER B 2 162 ? -18.726 -20.445 -1.897  1.00 20.17 ? 162 SER L N   1 
ATOM   2491 C  CA  . SER B 2 162 ? -18.418 -20.268 -0.497  1.00 23.00 ? 162 SER L CA  1 
ATOM   2492 C  C   . SER B 2 162 ? -17.356 -19.169 -0.331  1.00 20.46 ? 162 SER L C   1 
ATOM   2493 O  O   . SER B 2 162 ? -16.406 -19.100 -1.122  1.00 20.61 ? 162 SER L O   1 
ATOM   2494 C  CB  . SER B 2 162 ? -17.918 -21.620 0.017   1.00 29.17 ? 162 SER L CB  1 
ATOM   2495 O  OG  . SER B 2 162 ? -17.249 -21.527 1.215   1.00 27.43 ? 162 SER L OG  1 
ATOM   2496 N  N   . VAL B 2 163 ? -17.528 -18.314 0.679   1.00 20.35 ? 163 VAL L N   1 
ATOM   2497 C  CA  . VAL B 2 163 ? -16.557 -17.252 0.997   1.00 20.28 ? 163 VAL L CA  1 
ATOM   2498 C  C   . VAL B 2 163 ? -15.820 -17.567 2.306   1.00 23.52 ? 163 VAL L C   1 
ATOM   2499 O  O   . VAL B 2 163 ? -16.402 -18.108 3.232   1.00 20.38 ? 163 VAL L O   1 
ATOM   2500 C  CB  . VAL B 2 163 ? -17.194 -15.817 1.039   1.00 22.95 ? 163 VAL L CB  1 
ATOM   2501 C  CG1 . VAL B 2 163 ? -18.176 -15.662 2.213   1.00 23.63 ? 163 VAL L CG1 1 
ATOM   2502 C  CG2 . VAL B 2 163 ? -16.093 -14.729 1.082   1.00 20.85 ? 163 VAL L CG2 1 
ATOM   2503 N  N   . THR B 2 164 ? -14.535 -17.239 2.374   1.00 23.39 ? 164 THR L N   1 
ATOM   2504 C  CA  . THR B 2 164 ? -13.765 -17.488 3.598   1.00 21.80 ? 164 THR L CA  1 
ATOM   2505 C  C   . THR B 2 164 ? -14.118 -16.443 4.658   1.00 22.10 ? 164 THR L C   1 
ATOM   2506 O  O   . THR B 2 164 ? -14.697 -15.397 4.361   1.00 22.81 ? 164 THR L O   1 
ATOM   2507 C  CB  . THR B 2 164 ? -12.245 -17.374 3.368   1.00 23.06 ? 164 THR L CB  1 
ATOM   2508 O  OG1 . THR B 2 164 ? -11.947 -16.054 2.926   1.00 20.17 ? 164 THR L OG1 1 
ATOM   2509 C  CG2 . THR B 2 164 ? -11.747 -18.359 2.317   1.00 19.37 ? 164 THR L CG2 1 
ATOM   2510 N  N   . GLU B 2 165 ? -13.737 -16.731 5.894   1.00 20.46 ? 165 GLU L N   1 
ATOM   2511 C  CA  . GLU B 2 165 ? -13.644 -15.718 6.913   1.00 23.81 ? 165 GLU L CA  1 
ATOM   2512 C  C   . GLU B 2 165 ? -12.612 -14.696 6.445   1.00 22.43 ? 165 GLU L C   1 
ATOM   2513 O  O   . GLU B 2 165 ? -11.806 -14.959 5.529   1.00 21.78 ? 165 GLU L O   1 
ATOM   2514 C  CB  . GLU B 2 165 ? -13.222 -16.324 8.264   1.00 23.22 ? 165 GLU L CB  1 
ATOM   2515 C  CG  . GLU B 2 165 ? -11.781 -16.868 8.316   1.00 31.42 ? 165 GLU L CG  1 
ATOM   2516 C  CD  . GLU B 2 165 ? -11.611 -18.310 7.798   1.00 41.29 ? 165 GLU L CD  1 
ATOM   2517 O  OE1 . GLU B 2 165 ? -12.466 -18.836 7.018   1.00 34.54 ? 165 GLU L OE1 1 
ATOM   2518 O  OE2 . GLU B 2 165 ? -10.584 -18.917 8.194   1.00 44.09 ? 165 GLU L OE2 1 
ATOM   2519 N  N   . GLN B 2 166 ? -12.624 -13.533 7.076   1.00 23.74 ? 166 GLN L N   1 
ATOM   2520 C  CA  . GLN B 2 166 ? -11.639 -12.502 6.752   1.00 22.40 ? 166 GLN L CA  1 
ATOM   2521 C  C   . GLN B 2 166 ? -10.228 -12.937 7.160   1.00 22.58 ? 166 GLN L C   1 
ATOM   2522 O  O   . GLN B 2 166 ? -10.037 -13.588 8.200   1.00 21.39 ? 166 GLN L O   1 
ATOM   2523 C  CB  . GLN B 2 166 ? -12.040 -11.199 7.435   1.00 23.12 ? 166 GLN L CB  1 
ATOM   2524 C  CG  . GLN B 2 166 ? -11.217 -10.001 7.038   1.00 23.97 ? 166 GLN L CG  1 
ATOM   2525 C  CD  . GLN B 2 166 ? -11.857 -8.698  7.480   1.00 24.20 ? 166 GLN L CD  1 
ATOM   2526 O  OE1 . GLN B 2 166 ? -12.501 -8.627  8.536   1.00 24.02 ? 166 GLN L OE1 1 
ATOM   2527 N  NE2 . GLN B 2 166 ? -11.681 -7.660  6.681   1.00 20.16 ? 166 GLN L NE2 1 
ATOM   2528 N  N   . ASP B 2 167 ? -9.236  -12.544 6.360   1.00 21.95 ? 167 ASP L N   1 
ATOM   2529 C  CA  . ASP B 2 167 ? -7.850  -12.884 6.633   1.00 21.93 ? 167 ASP L CA  1 
ATOM   2530 C  C   . ASP B 2 167 ? -7.308  -12.024 7.778   1.00 24.68 ? 167 ASP L C   1 
ATOM   2531 O  O   . ASP B 2 167 ? -7.524  -10.814 7.790   1.00 23.44 ? 167 ASP L O   1 
ATOM   2532 C  CB  . ASP B 2 167 ? -7.007  -12.695 5.374   1.00 22.15 ? 167 ASP L CB  1 
ATOM   2533 C  CG  . ASP B 2 167 ? -5.620  -13.304 5.502   1.00 27.42 ? 167 ASP L CG  1 
ATOM   2534 O  OD1 . ASP B 2 167 ? -5.465  -14.497 5.172   1.00 27.94 ? 167 ASP L OD1 1 
ATOM   2535 O  OD2 . ASP B 2 167 ? -4.687  -12.583 5.898   1.00 27.64 ? 167 ASP L OD2 1 
ATOM   2536 N  N   . SER B 2 168 ? -6.613  -12.652 8.738   1.00 21.20 ? 168 SER L N   1 
ATOM   2537 C  CA  . SER B 2 168 ? -6.080  -11.937 9.911   1.00 18.67 ? 168 SER L CA  1 
ATOM   2538 C  C   . SER B 2 168 ? -4.843  -11.098 9.603   1.00 25.11 ? 168 SER L C   1 
ATOM   2539 O  O   . SER B 2 168 ? -4.422  -10.293 10.432  1.00 24.33 ? 168 SER L O   1 
ATOM   2540 C  CB  . SER B 2 168 ? -5.771  -12.920 11.064  1.00 26.53 ? 168 SER L CB  1 
ATOM   2541 O  OG  . SER B 2 168 ? -6.940  -13.561 11.554  1.00 31.32 ? 168 SER L OG  1 
ATOM   2542 N  N   . LYS B 2 169 ? -4.241  -11.280 8.425   1.00 25.18 ? 169 LYS L N   1 
ATOM   2543 C  CA  . LYS B 2 169 ? -3.045  -10.511 8.080   1.00 24.41 ? 169 LYS L CA  1 
ATOM   2544 C  C   . LYS B 2 169 ? -3.298  -9.376  7.079   1.00 23.32 ? 169 LYS L C   1 
ATOM   2545 O  O   . LYS B 2 169 ? -2.752  -8.288  7.244   1.00 24.45 ? 169 LYS L O   1 
ATOM   2546 C  CB  . LYS B 2 169 ? -1.927  -11.419 7.555   1.00 28.54 ? 169 LYS L CB  1 
ATOM   2547 C  CG  . LYS B 2 169 ? -1.406  -12.438 8.548   1.00 33.02 ? 169 LYS L CG  1 
ATOM   2548 C  CD  . LYS B 2 169 ? -0.498  -13.428 7.816   1.00 42.26 ? 169 LYS L CD  1 
ATOM   2549 C  CE  . LYS B 2 169 ? -0.122  -14.612 8.682   1.00 46.91 ? 169 LYS L CE  1 
ATOM   2550 N  NZ  . LYS B 2 169 ? 1.061   -14.301 9.511   1.00 47.85 ? 169 LYS L NZ  1 
ATOM   2551 N  N   . ASP B 2 170 ? -4.092  -9.625  6.038   1.00 22.79 ? 170 ASP L N   1 
ATOM   2552 C  CA  . ASP B 2 170 ? -4.333  -8.587  5.020   1.00 24.14 ? 170 ASP L CA  1 
ATOM   2553 C  C   . ASP B 2 170 ? -5.798  -8.159  4.917   1.00 22.77 ? 170 ASP L C   1 
ATOM   2554 O  O   . ASP B 2 170 ? -6.145  -7.343  4.066   1.00 18.12 ? 170 ASP L O   1 
ATOM   2555 C  CB  . ASP B 2 170 ? -3.770  -8.988  3.643   1.00 26.40 ? 170 ASP L CB  1 
ATOM   2556 C  CG  . ASP B 2 170 ? -4.547  -10.125 2.985   1.00 27.94 ? 170 ASP L CG  1 
ATOM   2557 O  OD1 . ASP B 2 170 ? -5.642  -10.487 3.465   1.00 23.23 ? 170 ASP L OD1 1 
ATOM   2558 O  OD2 . ASP B 2 170 ? -4.055  -10.670 1.964   1.00 30.02 ? 170 ASP L OD2 1 
ATOM   2559 N  N   . SER B 2 171 ? -6.646  -8.742  5.768   1.00 18.83 ? 171 SER L N   1 
ATOM   2560 C  CA  . SER B 2 171 ? -8.060  -8.343  5.890   1.00 18.83 ? 171 SER L CA  1 
ATOM   2561 C  C   . SER B 2 171 ? -8.872  -8.552  4.591   1.00 20.75 ? 171 SER L C   1 
ATOM   2562 O  O   . SER B 2 171 ? -9.918  -7.913  4.399   1.00 22.37 ? 171 SER L O   1 
ATOM   2563 C  CB  . SER B 2 171 ? -8.208  -6.885  6.392   1.00 22.16 ? 171 SER L CB  1 
ATOM   2564 O  OG  . SER B 2 171 ? -7.317  -6.573  7.471   1.00 21.84 ? 171 SER L OG  1 
ATOM   2565 N  N   . THR B 2 172 ? -8.409  -9.458  3.728   1.00 20.72 ? 172 THR L N   1 
ATOM   2566 C  CA  . THR B 2 172 ? -9.164  -9.804  2.509   1.00 19.83 ? 172 THR L CA  1 
ATOM   2567 C  C   . THR B 2 172 ? -10.044 -11.035 2.691   1.00 21.66 ? 172 THR L C   1 
ATOM   2568 O  O   . THR B 2 172 ? -9.992  -11.722 3.722   1.00 20.81 ? 172 THR L O   1 
ATOM   2569 C  CB  . THR B 2 172 ? -8.234  -10.062 1.316   1.00 18.40 ? 172 THR L CB  1 
ATOM   2570 O  OG1 . THR B 2 172 ? -7.407  -11.208 1.591   1.00 22.51 ? 172 THR L OG1 1 
ATOM   2571 C  CG2 . THR B 2 172 ? -7.350  -8.799  0.999   1.00 19.54 ? 172 THR L CG2 1 
ATOM   2572 N  N   . TYR B 2 173 ? -10.825 -11.322 1.655   1.00 20.50 ? 173 TYR L N   1 
ATOM   2573 C  CA  . TYR B 2 173 ? -11.627 -12.540 1.575   1.00 20.46 ? 173 TYR L CA  1 
ATOM   2574 C  C   . TYR B 2 173 ? -11.219 -13.310 0.329   1.00 21.90 ? 173 TYR L C   1 
ATOM   2575 O  O   . TYR B 2 173 ? -10.672 -12.735 -0.614  1.00 19.98 ? 173 TYR L O   1 
ATOM   2576 C  CB  . TYR B 2 173 ? -13.110 -12.174 1.471   1.00 23.62 ? 173 TYR L CB  1 
ATOM   2577 C  CG  . TYR B 2 173 ? -13.607 -11.383 2.654   1.00 25.63 ? 173 TYR L CG  1 
ATOM   2578 C  CD1 . TYR B 2 173 ? -13.481 -9.992  2.700   1.00 28.59 ? 173 TYR L CD1 1 
ATOM   2579 C  CD2 . TYR B 2 173 ? -14.169 -12.034 3.755   1.00 24.72 ? 173 TYR L CD2 1 
ATOM   2580 C  CE1 . TYR B 2 173 ? -13.922 -9.262  3.820   1.00 26.56 ? 173 TYR L CE1 1 
ATOM   2581 C  CE2 . TYR B 2 173 ? -14.613 -11.325 4.870   1.00 25.97 ? 173 TYR L CE2 1 
ATOM   2582 C  CZ  . TYR B 2 173 ? -14.490 -9.943  4.894   1.00 26.66 ? 173 TYR L CZ  1 
ATOM   2583 O  OH  . TYR B 2 173 ? -14.927 -9.245  5.992   1.00 25.97 ? 173 TYR L OH  1 
ATOM   2584 N  N   . SER B 2 174 ? -11.496 -14.606 0.327   1.00 21.37 ? 174 SER L N   1 
ATOM   2585 C  CA  . SER B 2 174 ? -11.388 -15.398 -0.889  1.00 19.24 ? 174 SER L CA  1 
ATOM   2586 C  C   . SER B 2 174 ? -12.698 -16.142 -1.116  1.00 20.36 ? 174 SER L C   1 
ATOM   2587 O  O   . SER B 2 174 ? -13.493 -16.329 -0.177  1.00 20.31 ? 174 SER L O   1 
ATOM   2588 C  CB  . SER B 2 174 ? -10.164 -16.336 -0.824  1.00 19.91 ? 174 SER L CB  1 
ATOM   2589 O  OG  . SER B 2 174 ? -8.950  -15.583 -0.715  1.00 19.56 ? 174 SER L OG  1 
ATOM   2590 N  N   . LEU B 2 175 ? -12.929 -16.564 -2.352  1.00 20.06 ? 175 LEU L N   1 
ATOM   2591 C  CA  . LEU B 2 175 ? -14.201 -17.193 -2.709  1.00 21.62 ? 175 LEU L CA  1 
ATOM   2592 C  C   . LEU B 2 175 ? -13.955 -18.291 -3.717  1.00 23.00 ? 175 LEU L C   1 
ATOM   2593 O  O   . LEU B 2 175 ? -13.153 -18.131 -4.636  1.00 22.41 ? 175 LEU L O   1 
ATOM   2594 C  CB  . LEU B 2 175 ? -15.145 -16.145 -3.303  1.00 20.19 ? 175 LEU L CB  1 
ATOM   2595 C  CG  . LEU B 2 175 ? -16.549 -16.592 -3.739  1.00 23.21 ? 175 LEU L CG  1 
ATOM   2596 C  CD1 . LEU B 2 175 ? -17.538 -15.431 -3.578  1.00 27.18 ? 175 LEU L CD1 1 
ATOM   2597 C  CD2 . LEU B 2 175 ? -16.583 -17.122 -5.173  1.00 24.61 ? 175 LEU L CD2 1 
ATOM   2598 N  N   . SER B 2 176 ? -14.661 -19.406 -3.536  1.00 21.41 ? 176 SER L N   1 
ATOM   2599 C  CA  . SER B 2 176 ? -14.582 -20.535 -4.445  1.00 24.80 ? 176 SER L CA  1 
ATOM   2600 C  C   . SER B 2 176 ? -15.983 -20.760 -5.005  1.00 27.61 ? 176 SER L C   1 
ATOM   2601 O  O   . SER B 2 176 ? -16.967 -20.690 -4.263  1.00 27.64 ? 176 SER L O   1 
ATOM   2602 C  CB  . SER B 2 176 ? -14.082 -21.754 -3.661  1.00 27.48 ? 176 SER L CB  1 
ATOM   2603 O  OG  . SER B 2 176 ? -14.029 -22.950 -4.423  1.00 36.47 ? 176 SER L OG  1 
ATOM   2604 N  N   . SER B 2 177 ? -16.085 -20.963 -6.318  1.00 22.69 ? 177 SER L N   1 
ATOM   2605 C  CA  . SER B 2 177 ? -17.342 -21.355 -6.935  1.00 23.35 ? 177 SER L CA  1 
ATOM   2606 C  C   . SER B 2 177 ? -17.133 -22.644 -7.726  1.00 22.47 ? 177 SER L C   1 
ATOM   2607 O  O   . SER B 2 177 ? -16.172 -22.781 -8.493  1.00 25.08 ? 177 SER L O   1 
ATOM   2608 C  CB  . SER B 2 177 ? -17.891 -20.242 -7.833  1.00 26.27 ? 177 SER L CB  1 
ATOM   2609 O  OG  . SER B 2 177 ? -19.075 -20.660 -8.496  1.00 23.43 ? 177 SER L OG  1 
ATOM   2610 N  N   . THR B 2 178 ? -18.029 -23.594 -7.522  1.00 20.85 ? 178 THR L N   1 
ATOM   2611 C  CA  . THR B 2 178 ? -17.926 -24.878 -8.188  1.00 21.10 ? 178 THR L CA  1 
ATOM   2612 C  C   . THR B 2 178 ? -19.134 -25.088 -9.063  1.00 22.33 ? 178 THR L C   1 
ATOM   2613 O  O   . THR B 2 178 ? -20.263 -25.018 -8.588  1.00 21.91 ? 178 THR L O   1 
ATOM   2614 C  CB  . THR B 2 178 ? -17.831 -26.039 -7.171  1.00 21.18 ? 178 THR L CB  1 
ATOM   2615 O  OG1 . THR B 2 178 ? -16.691 -25.829 -6.324  1.00 26.90 ? 178 THR L OG1 1 
ATOM   2616 C  CG2 . THR B 2 178 ? -17.721 -27.393 -7.902  1.00 21.72 ? 178 THR L CG2 1 
ATOM   2617 N  N   . LEU B 2 179 ? -18.882 -25.317 -10.346 1.00 18.39 ? 179 LEU L N   1 
ATOM   2618 C  CA  . LEU B 2 179 ? -19.920 -25.704 -11.302 1.00 20.34 ? 179 LEU L CA  1 
ATOM   2619 C  C   . LEU B 2 179 ? -19.922 -27.230 -11.392 1.00 21.67 ? 179 LEU L C   1 
ATOM   2620 O  O   . LEU B 2 179 ? -18.902 -27.834 -11.719 1.00 21.94 ? 179 LEU L O   1 
ATOM   2621 C  CB  . LEU B 2 179 ? -19.631 -25.081 -12.676 1.00 18.48 ? 179 LEU L CB  1 
ATOM   2622 C  CG  . LEU B 2 179 ? -20.581 -25.352 -13.867 1.00 20.28 ? 179 LEU L CG  1 
ATOM   2623 C  CD1 . LEU B 2 179 ? -21.865 -24.525 -13.694 1.00 19.49 ? 179 LEU L CD1 1 
ATOM   2624 C  CD2 . LEU B 2 179 ? -19.952 -25.021 -15.195 1.00 21.78 ? 179 LEU L CD2 1 
ATOM   2625 N  N   . THR B 2 180 ? -21.058 -27.861 -11.113 1.00 23.51 ? 180 THR L N   1 
ATOM   2626 C  CA  . THR B 2 180 ? -21.107 -29.324 -11.184 1.00 24.60 ? 180 THR L CA  1 
ATOM   2627 C  C   . THR B 2 180 ? -22.038 -29.860 -12.261 1.00 24.86 ? 180 THR L C   1 
ATOM   2628 O  O   . THR B 2 180 ? -23.237 -29.552 -12.286 1.00 23.07 ? 180 THR L O   1 
ATOM   2629 C  CB  . THR B 2 180 ? -21.404 -29.963 -9.817  1.00 28.46 ? 180 THR L CB  1 
ATOM   2630 O  OG1 . THR B 2 180 ? -20.434 -29.501 -8.875  1.00 29.07 ? 180 THR L OG1 1 
ATOM   2631 C  CG2 . THR B 2 180 ? -21.309 -31.497 -9.903  1.00 29.89 ? 180 THR L CG2 1 
ATOM   2632 N  N   . LEU B 2 181 ? -21.461 -30.660 -13.152 1.00 20.54 ? 181 LEU L N   1 
ATOM   2633 C  CA  . LEU B 2 181 ? -22.188 -31.264 -14.264 1.00 24.47 ? 181 LEU L CA  1 
ATOM   2634 C  C   . LEU B 2 181 ? -21.964 -32.771 -14.269 1.00 24.83 ? 181 LEU L C   1 
ATOM   2635 O  O   . LEU B 2 181 ? -20.948 -33.260 -13.760 1.00 23.96 ? 181 LEU L O   1 
ATOM   2636 C  CB  . LEU B 2 181 ? -21.705 -30.683 -15.600 1.00 26.52 ? 181 LEU L CB  1 
ATOM   2637 C  CG  . LEU B 2 181 ? -21.719 -29.167 -15.818 1.00 32.15 ? 181 LEU L CG  1 
ATOM   2638 C  CD1 . LEU B 2 181 ? -21.167 -28.846 -17.205 1.00 35.07 ? 181 LEU L CD1 1 
ATOM   2639 C  CD2 . LEU B 2 181 ? -23.116 -28.585 -15.655 1.00 33.43 ? 181 LEU L CD2 1 
ATOM   2640 N  N   . SER B 2 182 ? -22.902 -33.514 -14.851 1.00 24.87 ? 182 SER L N   1 
ATOM   2641 C  CA  . SER B 2 182 ? -22.645 -34.910 -15.152 1.00 24.55 ? 182 SER L CA  1 
ATOM   2642 C  C   . SER B 2 182 ? -21.566 -34.946 -16.235 1.00 24.68 ? 182 SER L C   1 
ATOM   2643 O  O   . SER B 2 182 ? -21.472 -34.018 -17.047 1.00 23.80 ? 182 SER L O   1 
ATOM   2644 C  CB  . SER B 2 182 ? -23.916 -35.599 -15.652 1.00 27.45 ? 182 SER L CB  1 
ATOM   2645 O  OG  . SER B 2 182 ? -24.300 -35.099 -16.922 1.00 26.71 ? 182 SER L OG  1 
ATOM   2646 N  N   . LYS B 2 183 ? -20.766 -36.013 -16.250 1.00 28.03 ? 183 LYS L N   1 
ATOM   2647 C  CA  . LYS B 2 183 ? -19.770 -36.246 -17.308 1.00 28.78 ? 183 LYS L CA  1 
ATOM   2648 C  C   . LYS B 2 183 ? -20.384 -36.084 -18.695 1.00 28.26 ? 183 LYS L C   1 
ATOM   2649 O  O   . LYS B 2 183 ? -19.763 -35.489 -19.587 1.00 28.56 ? 183 LYS L O   1 
ATOM   2650 C  CB  . LYS B 2 183 ? -19.133 -37.642 -17.157 1.00 28.89 ? 183 LYS L CB  1 
ATOM   2651 C  CG  . LYS B 2 183 ? -18.011 -37.948 -18.143 1.00 33.93 ? 183 LYS L CG  1 
ATOM   2652 C  CD  . LYS B 2 183 ? -17.591 -39.406 -18.044 1.00 35.53 ? 183 LYS L CD  1 
ATOM   2653 C  CE  . LYS B 2 183 ? -16.458 -39.722 -19.000 1.00 43.94 ? 183 LYS L CE  1 
ATOM   2654 N  NZ  . LYS B 2 183 ? -16.012 -41.134 -18.881 1.00 47.99 ? 183 LYS L NZ  1 
ATOM   2655 N  N   . ALA B 2 184 ? -21.605 -36.601 -18.861 1.00 23.37 ? 184 ALA L N   1 
ATOM   2656 C  CA  . ALA B 2 184 ? -22.320 -36.556 -20.140 1.00 25.59 ? 184 ALA L CA  1 
ATOM   2657 C  C   . ALA B 2 184 ? -22.563 -35.125 -20.618 1.00 24.61 ? 184 ALA L C   1 
ATOM   2658 O  O   . ALA B 2 184 ? -22.289 -34.816 -21.779 1.00 24.11 ? 184 ALA L O   1 
ATOM   2659 C  CB  . ALA B 2 184 ? -23.637 -37.330 -20.061 1.00 27.79 ? 184 ALA L CB  1 
ATOM   2660 N  N   . ASP B 2 185 ? -23.061 -34.266 -19.723 1.00 23.08 ? 185 ASP L N   1 
ATOM   2661 C  CA  . ASP B 2 185 ? -23.282 -32.851 -20.036 1.00 25.88 ? 185 ASP L CA  1 
ATOM   2662 C  C   . ASP B 2 185 ? -21.967 -32.122 -20.265 1.00 26.14 ? 185 ASP L C   1 
ATOM   2663 O  O   . ASP B 2 185 ? -21.841 -31.344 -21.210 1.00 27.36 ? 185 ASP L O   1 
ATOM   2664 C  CB  . ASP B 2 185 ? -24.058 -32.143 -18.919 1.00 30.22 ? 185 ASP L CB  1 
ATOM   2665 C  CG  . ASP B 2 185 ? -25.520 -32.543 -18.870 1.00 35.68 ? 185 ASP L CG  1 
ATOM   2666 O  OD1 . ASP B 2 185 ? -26.015 -33.196 -19.818 1.00 36.15 ? 185 ASP L OD1 1 
ATOM   2667 O  OD2 . ASP B 2 185 ? -26.175 -32.201 -17.865 1.00 37.55 ? 185 ASP L OD2 1 
ATOM   2668 N  N   . TYR B 2 186 ? -20.991 -32.374 -19.391 1.00 24.09 ? 186 TYR L N   1 
ATOM   2669 C  CA  . TYR B 2 186 ? -19.666 -31.776 -19.535 1.00 23.32 ? 186 TYR L CA  1 
ATOM   2670 C  C   . TYR B 2 186 ? -19.097 -32.030 -20.933 1.00 24.47 ? 186 TYR L C   1 
ATOM   2671 O  O   . TYR B 2 186 ? -18.518 -31.130 -21.547 1.00 24.15 ? 186 TYR L O   1 
ATOM   2672 C  CB  . TYR B 2 186 ? -18.707 -32.306 -18.469 1.00 25.15 ? 186 TYR L CB  1 
ATOM   2673 C  CG  . TYR B 2 186 ? -17.290 -31.761 -18.586 1.00 23.41 ? 186 TYR L CG  1 
ATOM   2674 C  CD1 . TYR B 2 186 ? -17.000 -30.436 -18.256 1.00 24.07 ? 186 TYR L CD1 1 
ATOM   2675 C  CD2 . TYR B 2 186 ? -16.239 -32.578 -18.994 1.00 21.72 ? 186 TYR L CD2 1 
ATOM   2676 C  CE1 . TYR B 2 186 ? -15.698 -29.926 -18.362 1.00 22.40 ? 186 TYR L CE1 1 
ATOM   2677 C  CE2 . TYR B 2 186 ? -14.922 -32.078 -19.082 1.00 23.45 ? 186 TYR L CE2 1 
ATOM   2678 C  CZ  . TYR B 2 186 ? -14.667 -30.757 -18.775 1.00 24.08 ? 186 TYR L CZ  1 
ATOM   2679 O  OH  . TYR B 2 186 ? -13.380 -30.255 -18.868 1.00 24.26 ? 186 TYR L OH  1 
ATOM   2680 N  N   . GLU B 2 187 ? -19.279 -33.250 -21.440 1.00 25.71 ? 187 GLU L N   1 
ATOM   2681 C  CA  . GLU B 2 187 ? -18.707 -33.639 -22.735 1.00 28.01 ? 187 GLU L CA  1 
ATOM   2682 C  C   . GLU B 2 187 ? -19.497 -33.123 -23.933 1.00 28.22 ? 187 GLU L C   1 
ATOM   2683 O  O   . GLU B 2 187 ? -19.089 -33.323 -25.085 1.00 28.91 ? 187 GLU L O   1 
ATOM   2684 C  CB  . GLU B 2 187 ? -18.545 -35.159 -22.832 1.00 31.27 ? 187 GLU L CB  1 
ATOM   2685 C  CG  . GLU B 2 187 ? -17.464 -35.717 -21.931 1.00 35.20 ? 187 GLU L CG  1 
ATOM   2686 C  CD  . GLU B 2 187 ? -17.322 -37.225 -22.040 1.00 36.02 ? 187 GLU L CD  1 
ATOM   2687 O  OE1 . GLU B 2 187 ? -18.129 -37.861 -22.758 1.00 36.97 ? 187 GLU L OE1 1 
ATOM   2688 O  OE2 . GLU B 2 187 ? -16.396 -37.770 -21.399 1.00 38.99 ? 187 GLU L OE2 1 
ATOM   2689 N  N   . LYS B 2 188 ? -20.628 -32.474 -23.673 1.00 25.91 ? 188 LYS L N   1 
ATOM   2690 C  CA  . LYS B 2 188 ? -21.435 -31.906 -24.750 1.00 29.59 ? 188 LYS L CA  1 
ATOM   2691 C  C   . LYS B 2 188 ? -20.922 -30.527 -25.147 1.00 26.55 ? 188 LYS L C   1 
ATOM   2692 O  O   . LYS B 2 188 ? -21.313 -30.001 -26.185 1.00 26.38 ? 188 LYS L O   1 
ATOM   2693 C  CB  . LYS B 2 188 ? -22.911 -31.811 -24.348 1.00 30.90 ? 188 LYS L CB  1 
ATOM   2694 C  CG  . LYS B 2 188 ? -23.684 -33.119 -24.384 1.00 34.53 ? 188 LYS L CG  1 
ATOM   2695 C  CD  . LYS B 2 188 ? -25.122 -32.884 -23.930 1.00 37.73 ? 188 LYS L CD  1 
ATOM   2696 C  CE  . LYS B 2 188 ? -25.907 -34.181 -23.747 1.00 43.18 ? 188 LYS L CE  1 
ATOM   2697 N  NZ  . LYS B 2 188 ? -26.350 -34.776 -25.041 1.00 46.23 ? 188 LYS L NZ  1 
ATOM   2698 N  N   . HIS B 2 189 ? -20.046 -29.947 -24.323 1.00 24.07 ? 189 HIS L N   1 
ATOM   2699 C  CA  . HIS B 2 189 ? -19.636 -28.562 -24.504 1.00 25.93 ? 189 HIS L CA  1 
ATOM   2700 C  C   . HIS B 2 189 ? -18.121 -28.374 -24.562 1.00 24.39 ? 189 HIS L C   1 
ATOM   2701 O  O   . HIS B 2 189 ? -17.358 -29.239 -24.127 1.00 27.07 ? 189 HIS L O   1 
ATOM   2702 C  CB  . HIS B 2 189 ? -20.276 -27.696 -23.416 1.00 27.60 ? 189 HIS L CB  1 
ATOM   2703 C  CG  . HIS B 2 189 ? -21.762 -27.855 -23.336 1.00 30.99 ? 189 HIS L CG  1 
ATOM   2704 N  ND1 . HIS B 2 189 ? -22.388 -28.523 -22.304 1.00 36.49 ? 189 HIS L ND1 1 
ATOM   2705 C  CD2 . HIS B 2 189 ? -22.744 -27.460 -24.178 1.00 27.95 ? 189 HIS L CD2 1 
ATOM   2706 C  CE1 . HIS B 2 189 ? -23.693 -28.519 -22.508 1.00 35.31 ? 189 HIS L CE1 1 
ATOM   2707 N  NE2 . HIS B 2 189 ? -23.934 -27.881 -23.640 1.00 31.64 ? 189 HIS L NE2 1 
ATOM   2708 N  N   . LYS B 2 190 ? -17.699 -27.237 -25.108 1.00 24.53 ? 190 LYS L N   1 
ATOM   2709 C  CA  . LYS B 2 190 ? -16.281 -26.964 -25.341 1.00 25.13 ? 190 LYS L CA  1 
ATOM   2710 C  C   . LYS B 2 190 ? -15.703 -25.926 -24.381 1.00 22.30 ? 190 LYS L C   1 
ATOM   2711 O  O   . LYS B 2 190 ? -14.755 -26.229 -23.671 1.00 24.38 ? 190 LYS L O   1 
ATOM   2712 C  CB  . LYS B 2 190 ? -16.057 -26.531 -26.797 1.00 27.23 ? 190 LYS L CB  1 
ATOM   2713 C  CG  . LYS B 2 190 ? -14.625 -26.166 -27.149 1.00 31.23 ? 190 LYS L CG  1 
ATOM   2714 C  CD  . LYS B 2 190 ? -14.547 -25.667 -28.584 1.00 37.12 ? 190 LYS L CD  1 
ATOM   2715 C  CE  . LYS B 2 190 ? -13.240 -24.942 -28.867 1.00 41.18 ? 190 LYS L CE  1 
ATOM   2716 N  NZ  . LYS B 2 190 ? -13.322 -24.157 -30.140 1.00 40.16 ? 190 LYS L NZ  1 
ATOM   2717 N  N   . VAL B 2 191 ? -16.274 -24.716 -24.373 1.00 21.76 ? 191 VAL L N   1 
ATOM   2718 C  CA  . VAL B 2 191 ? -15.709 -23.555 -23.652 1.00 19.61 ? 191 VAL L CA  1 
ATOM   2719 C  C   . VAL B 2 191 ? -16.342 -23.373 -22.274 1.00 19.24 ? 191 VAL L C   1 
ATOM   2720 O  O   . VAL B 2 191 ? -17.558 -23.185 -22.159 1.00 19.21 ? 191 VAL L O   1 
ATOM   2721 C  CB  . VAL B 2 191 ? -15.859 -22.224 -24.454 1.00 21.59 ? 191 VAL L CB  1 
ATOM   2722 C  CG1 . VAL B 2 191 ? -15.060 -21.096 -23.795 1.00 20.31 ? 191 VAL L CG1 1 
ATOM   2723 C  CG2 . VAL B 2 191 ? -15.441 -22.394 -25.928 1.00 22.55 ? 191 VAL L CG2 1 
ATOM   2724 N  N   . TYR B 2 192 ? -15.511 -23.440 -21.238 1.00 17.27 ? 192 TYR L N   1 
ATOM   2725 C  CA  . TYR B 2 192 ? -15.962 -23.286 -19.848 1.00 19.89 ? 192 TYR L CA  1 
ATOM   2726 C  C   . TYR B 2 192 ? -15.334 -22.028 -19.300 1.00 20.75 ? 192 TYR L C   1 
ATOM   2727 O  O   . TYR B 2 192 ? -14.109 -21.913 -19.265 1.00 22.41 ? 192 TYR L O   1 
ATOM   2728 C  CB  . TYR B 2 192 ? -15.568 -24.511 -19.024 1.00 21.70 ? 192 TYR L CB  1 
ATOM   2729 C  CG  . TYR B 2 192 ? -16.436 -25.670 -19.385 1.00 23.74 ? 192 TYR L CG  1 
ATOM   2730 C  CD1 . TYR B 2 192 ? -17.570 -25.957 -18.634 1.00 22.15 ? 192 TYR L CD1 1 
ATOM   2731 C  CD2 . TYR B 2 192 ? -16.170 -26.441 -20.518 1.00 20.09 ? 192 TYR L CD2 1 
ATOM   2732 C  CE1 . TYR B 2 192 ? -18.407 -26.995 -18.976 1.00 21.40 ? 192 TYR L CE1 1 
ATOM   2733 C  CE2 . TYR B 2 192 ? -17.021 -27.495 -20.878 1.00 20.57 ? 192 TYR L CE2 1 
ATOM   2734 C  CZ  . TYR B 2 192 ? -18.131 -27.762 -20.094 1.00 20.51 ? 192 TYR L CZ  1 
ATOM   2735 O  OH  . TYR B 2 192 ? -18.999 -28.782 -20.428 1.00 23.32 ? 192 TYR L OH  1 
ATOM   2736 N  N   . ALA B 2 193 ? -16.170 -21.079 -18.889 1.00 18.07 ? 193 ALA L N   1 
ATOM   2737 C  CA  . ALA B 2 193 ? -15.676 -19.771 -18.495 1.00 19.02 ? 193 ALA L CA  1 
ATOM   2738 C  C   . ALA B 2 193 ? -16.273 -19.348 -17.174 1.00 22.24 ? 193 ALA L C   1 
ATOM   2739 O  O   . ALA B 2 193 ? -17.437 -19.645 -16.891 1.00 21.61 ? 193 ALA L O   1 
ATOM   2740 C  CB  . ALA B 2 193 ? -15.959 -18.737 -19.584 1.00 16.54 ? 193 ALA L CB  1 
ATOM   2741 N  N   . CYS B 2 194 ? -15.435 -18.712 -16.355 1.00 22.01 ? 194 CYS L N   1 
ATOM   2742 C  CA  . CYS B 2 194 ? -15.858 -18.078 -15.120 1.00 20.75 ? 194 CYS L CA  1 
ATOM   2743 C  C   . CYS B 2 194 ? -15.649 -16.566 -15.305 1.00 23.53 ? 194 CYS L C   1 
ATOM   2744 O  O   . CYS B 2 194 ? -14.518 -16.124 -15.542 1.00 23.06 ? 194 CYS L O   1 
ATOM   2745 C  CB  . CYS B 2 194 ? -15.006 -18.622 -13.956 1.00 26.87 ? 194 CYS L CB  1 
ATOM   2746 S  SG  . CYS B 2 194 ? -15.214 -17.692 -12.471 1.00 35.67 ? 194 CYS L SG  1 
ATOM   2747 N  N   . GLU B 2 195 ? -16.730 -15.779 -15.238 1.00 20.89 ? 195 GLU L N   1 
ATOM   2748 C  CA  . GLU B 2 195 ? -16.634 -14.312 -15.363 1.00 21.85 ? 195 GLU L CA  1 
ATOM   2749 C  C   . GLU B 2 195 ? -16.810 -13.631 -14.004 1.00 20.53 ? 195 GLU L C   1 
ATOM   2750 O  O   . GLU B 2 195 ? -17.818 -13.835 -13.337 1.00 21.86 ? 195 GLU L O   1 
ATOM   2751 C  CB  . GLU B 2 195 ? -17.687 -13.783 -16.337 1.00 24.67 ? 195 GLU L CB  1 
ATOM   2752 C  CG  . GLU B 2 195 ? -17.669 -12.274 -16.528 1.00 29.62 ? 195 GLU L CG  1 
ATOM   2753 C  CD  . GLU B 2 195 ? -18.982 -11.748 -17.066 1.00 35.07 ? 195 GLU L CD  1 
ATOM   2754 O  OE1 . GLU B 2 195 ? -19.959 -11.641 -16.287 1.00 37.65 ? 195 GLU L OE1 1 
ATOM   2755 O  OE2 . GLU B 2 195 ? -19.031 -11.445 -18.270 1.00 36.89 ? 195 GLU L OE2 1 
ATOM   2756 N  N   . VAL B 2 196 ? -15.829 -12.829 -13.611 1.00 18.03 ? 196 VAL L N   1 
ATOM   2757 C  CA  . VAL B 2 196 ? -15.815 -12.204 -12.284 1.00 21.64 ? 196 VAL L CA  1 
ATOM   2758 C  C   . VAL B 2 196 ? -15.974 -10.689 -12.383 1.00 22.18 ? 196 VAL L C   1 
ATOM   2759 O  O   . VAL B 2 196 ? -15.249 -10.022 -13.132 1.00 21.05 ? 196 VAL L O   1 
ATOM   2760 C  CB  . VAL B 2 196 ? -14.506 -12.543 -11.533 1.00 23.07 ? 196 VAL L CB  1 
ATOM   2761 C  CG1 . VAL B 2 196 ? -14.389 -11.764 -10.202 1.00 18.13 ? 196 VAL L CG1 1 
ATOM   2762 C  CG2 . VAL B 2 196 ? -14.407 -14.037 -11.311 1.00 22.01 ? 196 VAL L CG2 1 
ATOM   2763 N  N   . THR B 2 197 ? -16.936 -10.177 -11.628 1.00 23.32 ? 197 THR L N   1 
ATOM   2764 C  CA  . THR B 2 197 ? -17.162 -8.756  -11.452 1.00 22.56 ? 197 THR L CA  1 
ATOM   2765 C  C   . THR B 2 197 ? -16.872 -8.401  -9.998  1.00 23.29 ? 197 THR L C   1 
ATOM   2766 O  O   . THR B 2 197 ? -17.356 -9.066  -9.078  1.00 21.57 ? 197 THR L O   1 
ATOM   2767 C  CB  . THR B 2 197 ? -18.622 -8.361  -11.795 1.00 25.14 ? 197 THR L CB  1 
ATOM   2768 O  OG1 . THR B 2 197 ? -18.930 -8.783  -13.127 1.00 25.85 ? 197 THR L OG1 1 
ATOM   2769 C  CG2 . THR B 2 197 ? -18.802 -6.853  -11.715 1.00 24.66 ? 197 THR L CG2 1 
ATOM   2770 N  N   . HIS B 2 198 ? -16.062 -7.360  -9.814  1.00 21.53 ? 198 HIS L N   1 
ATOM   2771 C  CA  . HIS B 2 198 ? -15.699 -6.845  -8.492  1.00 22.17 ? 198 HIS L CA  1 
ATOM   2772 C  C   . HIS B 2 198 ? -15.229 -5.399  -8.670  1.00 21.78 ? 198 HIS L C   1 
ATOM   2773 O  O   . HIS B 2 198 ? -14.590 -5.064  -9.675  1.00 22.06 ? 198 HIS L O   1 
ATOM   2774 C  CB  . HIS B 2 198 ? -14.597 -7.711  -7.856  1.00 19.12 ? 198 HIS L CB  1 
ATOM   2775 C  CG  . HIS B 2 198 ? -14.132 -7.232  -6.514  1.00 20.53 ? 198 HIS L CG  1 
ATOM   2776 N  ND1 . HIS B 2 198 ? -14.619 -7.746  -5.329  1.00 21.55 ? 198 HIS L ND1 1 
ATOM   2777 C  CD2 . HIS B 2 198 ? -13.216 -6.292  -6.169  1.00 20.30 ? 198 HIS L CD2 1 
ATOM   2778 C  CE1 . HIS B 2 198 ? -14.021 -7.146  -4.312  1.00 20.82 ? 198 HIS L CE1 1 
ATOM   2779 N  NE2 . HIS B 2 198 ? -13.170 -6.256  -4.795  1.00 25.63 ? 198 HIS L NE2 1 
ATOM   2780 N  N   . GLN B 2 199 ? -15.564 -4.563  -7.684  1.00 23.95 ? 199 GLN L N   1 
ATOM   2781 C  CA  . GLN B 2 199 ? -15.145 -3.151  -7.572  1.00 26.61 ? 199 GLN L CA  1 
ATOM   2782 C  C   . GLN B 2 199 ? -13.716 -2.829  -7.937  1.00 22.80 ? 199 GLN L C   1 
ATOM   2783 O  O   . GLN B 2 199 ? -13.434 -1.758  -8.456  1.00 24.26 ? 199 GLN L O   1 
ATOM   2784 C  CB  . GLN B 2 199 ? -15.222 -2.746  -6.111  1.00 29.82 ? 199 GLN L CB  1 
ATOM   2785 C  CG  . GLN B 2 199 ? -16.436 -2.085  -5.727  1.00 35.30 ? 199 GLN L CG  1 
ATOM   2786 C  CD  . GLN B 2 199 ? -16.564 -2.148  -4.255  1.00 30.82 ? 199 GLN L CD  1 
ATOM   2787 O  OE1 . GLN B 2 199 ? -17.277 -2.999  -3.746  1.00 30.85 ? 199 GLN L OE1 1 
ATOM   2788 N  NE2 . GLN B 2 199 ? -15.847 -1.266  -3.544  1.00 27.44 ? 199 GLN L NE2 1 
ATOM   2789 N  N   . GLY B 2 200 ? -12.813 -3.728  -7.573  1.00 23.42 ? 200 GLY L N   1 
ATOM   2790 C  CA  . GLY B 2 200 ? -11.383 -3.523  -7.763  1.00 24.08 ? 200 GLY L CA  1 
ATOM   2791 C  C   . GLY B 2 200 ? -10.918 -3.752  -9.189  1.00 23.43 ? 200 GLY L C   1 
ATOM   2792 O  O   . GLY B 2 200 ? -9.775  -3.449  -9.516  1.00 25.45 ? 200 GLY L O   1 
ATOM   2793 N  N   . LEU B 2 201 ? -11.798 -4.281  -10.035 1.00 24.20 ? 201 LEU L N   1 
ATOM   2794 C  CA  . LEU B 2 201 ? -11.468 -4.522  -11.454 1.00 22.72 ? 201 LEU L CA  1 
ATOM   2795 C  C   . LEU B 2 201 ? -12.098 -3.445  -12.333 1.00 27.99 ? 201 LEU L C   1 
ATOM   2796 O  O   . LEU B 2 201 ? -13.248 -3.070  -12.104 1.00 27.14 ? 201 LEU L O   1 
ATOM   2797 C  CB  . LEU B 2 201 ? -11.968 -5.905  -11.891 1.00 22.76 ? 201 LEU L CB  1 
ATOM   2798 C  CG  . LEU B 2 201 ? -11.500 -7.085  -11.037 1.00 21.50 ? 201 LEU L CG  1 
ATOM   2799 C  CD1 . LEU B 2 201 ? -12.401 -8.293  -11.263 1.00 25.90 ? 201 LEU L CD1 1 
ATOM   2800 C  CD2 . LEU B 2 201 ? -10.025 -7.410  -11.303 1.00 24.50 ? 201 LEU L CD2 1 
ATOM   2801 N  N   . SER B 2 202 ? -11.339 -2.954  -13.320 1.00 26.56 ? 202 SER L N   1 
ATOM   2802 C  CA  . SER B 2 202 ? -11.805 -1.915  -14.257 1.00 33.23 ? 202 SER L CA  1 
ATOM   2803 C  C   . SER B 2 202 ? -12.987 -2.389  -15.085 1.00 33.33 ? 202 SER L C   1 
ATOM   2804 O  O   . SER B 2 202 ? -13.878 -1.604  -15.422 1.00 33.43 ? 202 SER L O   1 
ATOM   2805 C  CB  . SER B 2 202 ? -10.685 -1.502  -15.214 1.00 36.46 ? 202 SER L CB  1 
ATOM   2806 O  OG  . SER B 2 202 ? -9.720  -0.697  -14.568 1.00 43.83 ? 202 SER L OG  1 
ATOM   2807 N  N   . SER B 2 203 ? -12.952 -3.673  -15.442 1.00 26.95 ? 203 SER L N   1 
ATOM   2808 C  CA  . SER B 2 203 ? -14.039 -4.357  -16.134 1.00 28.64 ? 203 SER L CA  1 
ATOM   2809 C  C   . SER B 2 203 ? -13.951 -5.847  -15.770 1.00 30.68 ? 203 SER L C   1 
ATOM   2810 O  O   . SER B 2 203 ? -12.915 -6.292  -15.264 1.00 28.01 ? 203 SER L O   1 
ATOM   2811 C  CB  . SER B 2 203 ? -13.939 -4.137  -17.648 1.00 31.21 ? 203 SER L CB  1 
ATOM   2812 O  OG  . SER B 2 203 ? -12.754 -4.714  -18.163 1.00 34.66 ? 203 SER L OG  1 
ATOM   2813 N  N   . PRO B 2 204 ? -15.040 -6.614  -15.989 1.00 31.92 ? 204 PRO L N   1 
ATOM   2814 C  CA  . PRO B 2 204 ? -15.053 -8.007  -15.524 1.00 30.72 ? 204 PRO L CA  1 
ATOM   2815 C  C   . PRO B 2 204 ? -13.956 -8.871  -16.143 1.00 29.74 ? 204 PRO L C   1 
ATOM   2816 O  O   . PRO B 2 204 ? -13.607 -8.698  -17.308 1.00 29.24 ? 204 PRO L O   1 
ATOM   2817 C  CB  . PRO B 2 204 ? -16.442 -8.504  -15.932 1.00 33.98 ? 204 PRO L CB  1 
ATOM   2818 C  CG  . PRO B 2 204 ? -17.272 -7.246  -16.070 1.00 32.83 ? 204 PRO L CG  1 
ATOM   2819 C  CD  . PRO B 2 204 ? -16.315 -6.241  -16.631 1.00 31.82 ? 204 PRO L CD  1 
ATOM   2820 N  N   . VAL B 2 205 ? -13.417 -9.778  -15.335 1.00 24.11 ? 205 VAL L N   1 
ATOM   2821 C  CA  . VAL B 2 205 ? -12.324 -10.671 -15.723 1.00 25.26 ? 205 VAL L CA  1 
ATOM   2822 C  C   . VAL B 2 205 ? -12.891 -12.061 -16.037 1.00 26.41 ? 205 VAL L C   1 
ATOM   2823 O  O   . VAL B 2 205 ? -13.650 -12.630 -15.234 1.00 25.00 ? 205 VAL L O   1 
ATOM   2824 C  CB  . VAL B 2 205 ? -11.270 -10.784 -14.586 1.00 27.13 ? 205 VAL L CB  1 
ATOM   2825 C  CG1 . VAL B 2 205 ? -10.300 -11.937 -14.832 1.00 28.23 ? 205 VAL L CG1 1 
ATOM   2826 C  CG2 . VAL B 2 205 ? -10.505 -9.468  -14.413 1.00 30.85 ? 205 VAL L CG2 1 
ATOM   2827 N  N   . THR B 2 206 ? -12.522 -12.608 -17.190 1.00 24.04 ? 206 THR L N   1 
ATOM   2828 C  CA  . THR B 2 206 ? -12.955 -13.962 -17.557 1.00 24.95 ? 206 THR L CA  1 
ATOM   2829 C  C   . THR B 2 206 ? -11.762 -14.895 -17.597 1.00 24.44 ? 206 THR L C   1 
ATOM   2830 O  O   . THR B 2 206 ? -10.732 -14.593 -18.214 1.00 23.73 ? 206 THR L O   1 
ATOM   2831 C  CB  . THR B 2 206 ? -13.720 -13.995 -18.909 1.00 27.83 ? 206 THR L CB  1 
ATOM   2832 O  OG1 . THR B 2 206 ? -14.929 -13.233 -18.802 1.00 29.07 ? 206 THR L OG1 1 
ATOM   2833 C  CG2 . THR B 2 206 ? -14.069 -15.443 -19.324 1.00 28.42 ? 206 THR L CG2 1 
ATOM   2834 N  N   . LYS B 2 207 ? -11.888 -16.024 -16.915 1.00 21.16 ? 207 LYS L N   1 
ATOM   2835 C  CA  . LYS B 2 207 ? -10.911 -17.095 -17.052 1.00 21.99 ? 207 LYS L CA  1 
ATOM   2836 C  C   . LYS B 2 207 ? -11.647 -18.240 -17.706 1.00 20.51 ? 207 LYS L C   1 
ATOM   2837 O  O   . LYS B 2 207 ? -12.763 -18.558 -17.320 1.00 19.33 ? 207 LYS L O   1 
ATOM   2838 C  CB  . LYS B 2 207 ? -10.354 -17.520 -15.689 1.00 21.34 ? 207 LYS L CB  1 
ATOM   2839 C  CG  . LYS B 2 207 ? -9.587  -16.427 -14.950 1.00 21.71 ? 207 LYS L CG  1 
ATOM   2840 C  CD  . LYS B 2 207 ? -8.363  -15.964 -15.738 1.00 25.86 ? 207 LYS L CD  1 
ATOM   2841 C  CE  . LYS B 2 207 ? -7.754  -14.697 -15.119 1.00 33.15 ? 207 LYS L CE  1 
ATOM   2842 N  NZ  . LYS B 2 207 ? -6.573  -14.184 -15.898 1.00 35.30 ? 207 LYS L NZ  1 
ATOM   2843 N  N   . SER B 2 208 ? -11.047 -18.842 -18.716 1.00 18.14 ? 208 SER L N   1 
ATOM   2844 C  CA  . SER B 2 208 ? -11.726 -19.930 -19.410 1.00 20.25 ? 208 SER L CA  1 
ATOM   2845 C  C   . SER B 2 208 ? -10.761 -21.016 -19.874 1.00 22.18 ? 208 SER L C   1 
ATOM   2846 O  O   . SER B 2 208 ? -9.542  -20.814 -19.899 1.00 22.96 ? 208 SER L O   1 
ATOM   2847 C  CB  . SER B 2 208 ? -12.548 -19.399 -20.590 1.00 22.92 ? 208 SER L CB  1 
ATOM   2848 O  OG  . SER B 2 208 ? -11.718 -18.815 -21.576 1.00 25.81 ? 208 SER L OG  1 
ATOM   2849 N  N   . PHE B 2 209 ? -11.323 -22.166 -20.240 1.00 20.88 ? 209 PHE L N   1 
ATOM   2850 C  CA  . PHE B 2 209 ? -10.557 -23.228 -20.893 1.00 23.45 ? 209 PHE L CA  1 
ATOM   2851 C  C   . PHE B 2 209 ? -11.442 -23.902 -21.917 1.00 25.29 ? 209 PHE L C   1 
ATOM   2852 O  O   . PHE B 2 209 ? -12.670 -23.794 -21.845 1.00 25.75 ? 209 PHE L O   1 
ATOM   2853 C  CB  . PHE B 2 209 ? -9.997  -24.253 -19.872 1.00 20.56 ? 209 PHE L CB  1 
ATOM   2854 C  CG  . PHE B 2 209 ? -11.058 -25.020 -19.113 1.00 22.80 ? 209 PHE L CG  1 
ATOM   2855 C  CD1 . PHE B 2 209 ? -11.535 -24.545 -17.891 1.00 22.20 ? 209 PHE L CD1 1 
ATOM   2856 C  CD2 . PHE B 2 209 ? -11.571 -26.220 -19.617 1.00 21.74 ? 209 PHE L CD2 1 
ATOM   2857 C  CE1 . PHE B 2 209 ? -12.523 -25.256 -17.176 1.00 22.80 ? 209 PHE L CE1 1 
ATOM   2858 C  CE2 . PHE B 2 209 ? -12.540 -26.936 -18.927 1.00 22.62 ? 209 PHE L CE2 1 
ATOM   2859 C  CZ  . PHE B 2 209 ? -13.023 -26.467 -17.705 1.00 22.02 ? 209 PHE L CZ  1 
ATOM   2860 N  N   . ASN B 2 210 ? -10.820 -24.572 -22.884 1.00 24.50 ? 210 ASN L N   1 
ATOM   2861 C  CA  . ASN B 2 210 ? -11.537 -25.426 -23.830 1.00 26.18 ? 210 ASN L CA  1 
ATOM   2862 C  C   . ASN B 2 210 ? -11.343 -26.868 -23.408 1.00 25.05 ? 210 ASN L C   1 
ATOM   2863 O  O   . ASN B 2 210 ? -10.211 -27.321 -23.287 1.00 27.52 ? 210 ASN L O   1 
ATOM   2864 C  CB  . ASN B 2 210 ? -10.988 -25.260 -25.250 1.00 28.63 ? 210 ASN L CB  1 
ATOM   2865 C  CG  . ASN B 2 210 ? -11.201 -23.870 -25.818 1.00 32.12 ? 210 ASN L CG  1 
ATOM   2866 O  OD1 . ASN B 2 210 ? -10.455 -23.438 -26.690 1.00 36.19 ? 210 ASN L OD1 1 
ATOM   2867 N  ND2 . ASN B 2 210 ? -12.222 -23.169 -25.339 1.00 34.15 ? 210 ASN L ND2 1 
ATOM   2868 N  N   . ARG B 2 211 ? -12.439 -27.577 -23.161 1.00 25.98 ? 211 ARG L N   1 
ATOM   2869 C  CA  . ARG B 2 211 ? -12.379 -28.977 -22.752 1.00 27.71 ? 211 ARG L CA  1 
ATOM   2870 C  C   . ARG B 2 211 ? -11.606 -29.756 -23.821 1.00 32.62 ? 211 ARG L C   1 
ATOM   2871 O  O   . ARG B 2 211 ? -11.935 -29.674 -24.999 1.00 28.86 ? 211 ARG L O   1 
ATOM   2872 C  CB  . ARG B 2 211 ? -13.797 -29.539 -22.582 1.00 27.31 ? 211 ARG L CB  1 
ATOM   2873 C  CG  . ARG B 2 211 ? -13.860 -31.043 -22.317 1.00 28.66 ? 211 ARG L CG  1 
ATOM   2874 C  CD  . ARG B 2 211 ? -15.291 -31.591 -22.425 1.00 28.05 ? 211 ARG L CD  1 
ATOM   2875 N  NE  . ARG B 2 211 ? -15.899 -31.300 -23.723 1.00 28.32 ? 211 ARG L NE  1 
ATOM   2876 C  CZ  . ARG B 2 211 ? -15.652 -31.964 -24.845 1.00 30.65 ? 211 ARG L CZ  1 
ATOM   2877 N  NH1 . ARG B 2 211 ? -14.813 -32.993 -24.854 1.00 30.69 ? 211 ARG L NH1 1 
ATOM   2878 N  NH2 . ARG B 2 211 ? -16.256 -31.599 -25.966 1.00 32.91 ? 211 ARG L NH2 1 
ATOM   2879 N  N   . GLY B 2 212 ? -10.574 -30.483 -23.398 1.00 38.14 ? 212 GLY L N   1 
ATOM   2880 C  CA  . GLY B 2 212 ? -9.690  -31.194 -24.321 1.00 42.86 ? 212 GLY L CA  1 
ATOM   2881 C  C   . GLY B 2 212 ? -8.288  -30.606 -24.364 1.00 48.18 ? 212 GLY L C   1 
ATOM   2882 O  O   . GLY B 2 212 ? -8.072  -29.504 -24.879 1.00 49.34 ? 212 GLY L O   1 
ATOM   2883 N  N   . GLN C 3 1   ? 4.473   -26.487 28.462  1.00 30.82 ? 1   GLN H N   1 
ATOM   2884 C  CA  . GLN C 3 1   ? 3.411   -25.966 27.554  1.00 28.43 ? 1   GLN H CA  1 
ATOM   2885 C  C   . GLN C 3 1   ? 2.103   -26.665 27.873  1.00 26.14 ? 1   GLN H C   1 
ATOM   2886 O  O   . GLN C 3 1   ? 1.942   -27.863 27.621  1.00 25.12 ? 1   GLN H O   1 
ATOM   2887 C  CB  . GLN C 3 1   ? 3.801   -26.150 26.077  1.00 31.31 ? 1   GLN H CB  1 
ATOM   2888 C  CG  . GLN C 3 1   ? 4.675   -27.377 25.801  1.00 34.62 ? 1   GLN H CG  1 
ATOM   2889 C  CD  . GLN C 3 1   ? 5.866   -27.474 26.753  1.00 42.35 ? 1   GLN H CD  1 
ATOM   2890 O  OE1 . GLN C 3 1   ? 6.045   -28.470 27.447  1.00 39.64 ? 1   GLN H OE1 1 
ATOM   2891 N  NE2 . GLN C 3 1   ? 6.674   -26.421 26.800  1.00 50.05 ? 1   GLN H NE2 1 
ATOM   2892 N  N   . VAL C 3 2   ? 1.173   -25.916 28.453  1.00 26.56 ? 2   VAL H N   1 
ATOM   2893 C  CA  . VAL C 3 2   ? -0.108  -26.496 28.839  1.00 23.25 ? 2   VAL H CA  1 
ATOM   2894 C  C   . VAL C 3 2   ? -0.883  -26.793 27.573  1.00 23.02 ? 2   VAL H C   1 
ATOM   2895 O  O   . VAL C 3 2   ? -0.966  -25.938 26.686  1.00 22.91 ? 2   VAL H O   1 
ATOM   2896 C  CB  . VAL C 3 2   ? -0.915  -25.560 29.760  1.00 25.24 ? 2   VAL H CB  1 
ATOM   2897 C  CG1 . VAL C 3 2   ? -2.282  -26.175 30.083  1.00 27.27 ? 2   VAL H CG1 1 
ATOM   2898 C  CG2 . VAL C 3 2   ? -0.128  -25.271 31.046  1.00 20.75 ? 2   VAL H CG2 1 
ATOM   2899 N  N   . GLN C 3 3   ? -1.431  -28.003 27.492  1.00 22.55 ? 3   GLN H N   1 
ATOM   2900 C  CA  . GLN C 3 3   ? -2.303  -28.386 26.385  1.00 29.16 ? 3   GLN H CA  1 
ATOM   2901 C  C   . GLN C 3 3   ? -3.463  -29.277 26.845  1.00 25.05 ? 3   GLN H C   1 
ATOM   2902 O  O   . GLN C 3 3   ? -3.275  -30.214 27.637  1.00 24.54 ? 3   GLN H O   1 
ATOM   2903 C  CB  . GLN C 3 3   ? -1.487  -29.086 25.285  1.00 31.73 ? 3   GLN H CB  1 
ATOM   2904 C  CG  . GLN C 3 3   ? -2.294  -29.453 24.042  1.00 40.71 ? 3   GLN H CG  1 
ATOM   2905 C  CD  . GLN C 3 3   ? -1.426  -29.852 22.855  1.00 44.35 ? 3   GLN H CD  1 
ATOM   2906 O  OE1 . GLN C 3 3   ? -0.200  -29.991 22.967  1.00 46.51 ? 3   GLN H OE1 1 
ATOM   2907 N  NE2 . GLN C 3 3   ? -2.068  -30.042 21.704  1.00 50.50 ? 3   GLN H NE2 1 
ATOM   2908 N  N   . LEU C 3 4   ? -4.655  -28.974 26.329  1.00 22.01 ? 4   LEU H N   1 
ATOM   2909 C  CA  . LEU C 3 4   ? -5.837  -29.823 26.497  1.00 21.26 ? 4   LEU H CA  1 
ATOM   2910 C  C   . LEU C 3 4   ? -6.192  -30.352 25.116  1.00 20.29 ? 4   LEU H C   1 
ATOM   2911 O  O   . LEU C 3 4   ? -6.499  -29.574 24.201  1.00 23.28 ? 4   LEU H O   1 
ATOM   2912 C  CB  . LEU C 3 4   ? -7.007  -29.023 27.089  1.00 22.24 ? 4   LEU H CB  1 
ATOM   2913 C  CG  . LEU C 3 4   ? -6.769  -28.436 28.495  1.00 25.53 ? 4   LEU H CG  1 
ATOM   2914 C  CD1 . LEU C 3 4   ? -7.977  -27.617 28.936  1.00 24.75 ? 4   LEU H CD1 1 
ATOM   2915 C  CD2 . LEU C 3 4   ? -6.430  -29.511 29.521  1.00 28.14 ? 4   LEU H CD2 1 
ATOM   2916 N  N   . GLN C 3 5   ? -6.088  -31.669 24.964  1.00 22.47 ? 5   GLN H N   1 
ATOM   2917 C  CA  . GLN C 3 5   ? -6.321  -32.337 23.693  1.00 22.05 ? 5   GLN H CA  1 
ATOM   2918 C  C   . GLN C 3 5   ? -7.637  -33.103 23.731  1.00 22.17 ? 5   GLN H C   1 
ATOM   2919 O  O   . GLN C 3 5   ? -7.777  -34.067 24.478  1.00 23.42 ? 5   GLN H O   1 
ATOM   2920 C  CB  . GLN C 3 5   ? -5.153  -33.281 23.357  1.00 19.82 ? 5   GLN H CB  1 
ATOM   2921 C  CG  . GLN C 3 5   ? -5.333  -34.086 22.058  1.00 33.44 ? 5   GLN H CG  1 
ATOM   2922 C  CD  . GLN C 3 5   ? -5.342  -33.225 20.784  1.00 37.37 ? 5   GLN H CD  1 
ATOM   2923 O  OE1 . GLN C 3 5   ? -4.600  -32.248 20.660  1.00 39.22 ? 5   GLN H OE1 1 
ATOM   2924 N  NE2 . GLN C 3 5   ? -6.181  -33.605 19.829  1.00 37.98 ? 5   GLN H NE2 1 
ATOM   2925 N  N   . GLN C 3 6   ? -8.599  -32.673 22.916  1.00 19.30 ? 6   GLN H N   1 
ATOM   2926 C  CA  . GLN C 3 6   ? -9.906  -33.340 22.868  1.00 18.98 ? 6   GLN H CA  1 
ATOM   2927 C  C   . GLN C 3 6   ? -9.990  -34.430 21.799  1.00 20.03 ? 6   GLN H C   1 
ATOM   2928 O  O   . GLN C 3 6   ? -9.234  -34.423 20.811  1.00 20.55 ? 6   GLN H O   1 
ATOM   2929 C  CB  . GLN C 3 6   ? -11.032 -32.301 22.686  1.00 19.86 ? 6   GLN H CB  1 
ATOM   2930 C  CG  . GLN C 3 6   ? -11.092 -31.301 23.857  1.00 18.70 ? 6   GLN H CG  1 
ATOM   2931 C  CD  . GLN C 3 6   ? -12.242 -30.326 23.744  1.00 20.71 ? 6   GLN H CD  1 
ATOM   2932 O  OE1 . GLN C 3 6   ? -12.045 -29.129 23.901  1.00 20.98 ? 6   GLN H OE1 1 
ATOM   2933 N  NE2 . GLN C 3 6   ? -13.455 -30.836 23.497  1.00 21.67 ? 6   GLN H NE2 1 
ATOM   2934 N  N   . SER C 3 7   ? -10.913 -35.369 22.011  1.00 19.11 ? 7   SER H N   1 
ATOM   2935 C  CA  . SER C 3 7   ? -11.215 -36.404 21.024  1.00 19.69 ? 7   SER H CA  1 
ATOM   2936 C  C   . SER C 3 7   ? -11.897 -35.803 19.798  1.00 23.46 ? 7   SER H C   1 
ATOM   2937 O  O   . SER C 3 7   ? -12.379 -34.663 19.841  1.00 20.34 ? 7   SER H O   1 
ATOM   2938 C  CB  . SER C 3 7   ? -12.083 -37.498 21.651  1.00 18.84 ? 7   SER H CB  1 
ATOM   2939 O  OG  . SER C 3 7   ? -13.192 -36.922 22.319  1.00 20.09 ? 7   SER H OG  1 
ATOM   2940 N  N   . GLY C 3 8   ? -11.909 -36.571 18.709  1.00 21.58 ? 8   GLY H N   1 
ATOM   2941 C  CA  . GLY C 3 8   ? -12.349 -36.087 17.407  1.00 21.68 ? 8   GLY H CA  1 
ATOM   2942 C  C   . GLY C 3 8   ? -13.854 -35.923 17.275  1.00 19.87 ? 8   GLY H C   1 
ATOM   2943 O  O   . GLY C 3 8   ? -14.615 -36.281 18.194  1.00 19.93 ? 8   GLY H O   1 
ATOM   2944 N  N   . PRO C 3 9   ? -14.299 -35.388 16.122  1.00 16.63 ? 9   PRO H N   1 
ATOM   2945 C  CA  . PRO C 3 9   ? -15.730 -35.138 15.896  1.00 16.83 ? 9   PRO H CA  1 
ATOM   2946 C  C   . PRO C 3 9   ? -16.539 -36.437 15.933  1.00 16.30 ? 9   PRO H C   1 
ATOM   2947 O  O   . PRO C 3 9   ? -15.997 -37.515 15.663  1.00 18.87 ? 9   PRO H O   1 
ATOM   2948 C  CB  . PRO C 3 9   ? -15.781 -34.540 14.488  1.00 20.09 ? 9   PRO H CB  1 
ATOM   2949 C  CG  . PRO C 3 9   ? -14.483 -34.932 13.831  1.00 20.36 ? 9   PRO H CG  1 
ATOM   2950 C  CD  . PRO C 3 9   ? -13.472 -34.982 14.969  1.00 19.32 ? 9   PRO H CD  1 
ATOM   2951 N  N   . GLU C 3 10  ? -17.822 -36.327 16.275  1.00 16.81 ? 10  GLU H N   1 
ATOM   2952 C  CA  . GLU C 3 10  ? -18.677 -37.498 16.461  1.00 18.55 ? 10  GLU H CA  1 
ATOM   2953 C  C   . GLU C 3 10  ? -19.961 -37.302 15.702  1.00 16.97 ? 10  GLU H C   1 
ATOM   2954 O  O   . GLU C 3 10  ? -20.523 -36.206 15.717  1.00 21.53 ? 10  GLU H O   1 
ATOM   2955 C  CB  . GLU C 3 10  ? -19.048 -37.660 17.937  1.00 26.02 ? 10  GLU H CB  1 
ATOM   2956 C  CG  . GLU C 3 10  ? -17.879 -37.755 18.907  1.00 30.05 ? 10  GLU H CG  1 
ATOM   2957 C  CD  . GLU C 3 10  ? -17.479 -39.188 19.208  1.00 35.26 ? 10  GLU H CD  1 
ATOM   2958 O  OE1 . GLU C 3 10  ? -18.079 -40.116 18.622  1.00 35.81 ? 10  GLU H OE1 1 
ATOM   2959 O  OE2 . GLU C 3 10  ? -16.577 -39.388 20.049  1.00 35.09 ? 10  GLU H OE2 1 
ATOM   2960 N  N   . LEU C 3 11  ? -20.404 -38.361 15.035  1.00 16.41 ? 11  LEU H N   1 
ATOM   2961 C  CA  . LEU C 3 11  ? -21.758 -38.462 14.514  1.00 15.81 ? 11  LEU H CA  1 
ATOM   2962 C  C   . LEU C 3 11  ? -22.477 -39.432 15.427  1.00 17.08 ? 11  LEU H C   1 
ATOM   2963 O  O   . LEU C 3 11  ? -22.022 -40.564 15.610  1.00 15.40 ? 11  LEU H O   1 
ATOM   2964 C  CB  . LEU C 3 11  ? -21.744 -39.025 13.096  1.00 14.36 ? 11  LEU H CB  1 
ATOM   2965 C  CG  . LEU C 3 11  ? -23.088 -39.314 12.425  1.00 13.81 ? 11  LEU H CG  1 
ATOM   2966 C  CD1 . LEU C 3 11  ? -23.852 -38.026 12.144  1.00 14.64 ? 11  LEU H CD1 1 
ATOM   2967 C  CD2 . LEU C 3 11  ? -22.866 -40.107 11.165  1.00 15.94 ? 11  LEU H CD2 1 
ATOM   2968 N  N   . VAL C 3 12  ? -23.597 -39.001 15.998  1.00 13.68 ? 12  VAL H N   1 
ATOM   2969 C  CA  . VAL C 3 12  ? -24.344 -39.873 16.892  1.00 15.48 ? 12  VAL H CA  1 
ATOM   2970 C  C   . VAL C 3 12  ? -25.822 -39.820 16.583  1.00 15.91 ? 12  VAL H C   1 
ATOM   2971 O  O   . VAL C 3 12  ? -26.353 -38.763 16.255  1.00 14.10 ? 12  VAL H O   1 
ATOM   2972 C  CB  . VAL C 3 12  ? -24.071 -39.584 18.399  1.00 22.18 ? 12  VAL H CB  1 
ATOM   2973 C  CG1 . VAL C 3 12  ? -22.820 -40.326 18.849  1.00 29.71 ? 12  VAL H CG1 1 
ATOM   2974 C  CG2 . VAL C 3 12  ? -23.918 -38.108 18.657  1.00 26.38 ? 12  VAL H CG2 1 
ATOM   2975 N  N   . ARG C 3 13  ? -26.469 -40.975 16.667  1.00 16.86 ? 13  ARG H N   1 
ATOM   2976 C  CA  . ARG C 3 13  ? -27.899 -41.075 16.414  1.00 21.50 ? 13  ARG H CA  1 
ATOM   2977 C  C   . ARG C 3 13  ? -28.703 -40.445 17.557  1.00 21.10 ? 13  ARG H C   1 
ATOM   2978 O  O   . ARG C 3 13  ? -28.247 -40.446 18.699  1.00 20.01 ? 13  ARG H O   1 
ATOM   2979 C  CB  . ARG C 3 13  ? -28.286 -42.531 16.131  1.00 23.92 ? 13  ARG H CB  1 
ATOM   2980 C  CG  . ARG C 3 13  ? -27.704 -42.976 14.799  1.00 27.06 ? 13  ARG H CG  1 
ATOM   2981 C  CD  . ARG C 3 13  ? -27.979 -44.416 14.398  1.00 32.69 ? 13  ARG H CD  1 
ATOM   2982 N  NE  . ARG C 3 13  ? -27.386 -44.647 13.077  1.00 39.46 ? 13  ARG H NE  1 
ATOM   2983 C  CZ  . ARG C 3 13  ? -28.056 -44.601 11.927  1.00 46.07 ? 13  ARG H CZ  1 
ATOM   2984 N  NH1 . ARG C 3 13  ? -29.368 -44.366 11.918  1.00 46.29 ? 13  ARG H NH1 1 
ATOM   2985 N  NH2 . ARG C 3 13  ? -27.415 -44.811 10.779  1.00 47.01 ? 13  ARG H NH2 1 
ATOM   2986 N  N   . PRO C 3 14  ? -29.871 -39.855 17.237  1.00 19.47 ? 14  PRO H N   1 
ATOM   2987 C  CA  . PRO C 3 14  ? -30.752 -39.316 18.272  1.00 19.46 ? 14  PRO H CA  1 
ATOM   2988 C  C   . PRO C 3 14  ? -31.115 -40.391 19.300  1.00 18.01 ? 14  PRO H C   1 
ATOM   2989 O  O   . PRO C 3 14  ? -31.369 -41.541 18.931  1.00 15.97 ? 14  PRO H O   1 
ATOM   2990 C  CB  . PRO C 3 14  ? -32.009 -38.913 17.495  1.00 23.75 ? 14  PRO H CB  1 
ATOM   2991 C  CG  . PRO C 3 14  ? -31.553 -38.713 16.088  1.00 25.24 ? 14  PRO H CG  1 
ATOM   2992 C  CD  . PRO C 3 14  ? -30.424 -39.671 15.880  1.00 23.02 ? 14  PRO H CD  1 
ATOM   2993 N  N   . GLY C 3 15  ? -31.122 -40.014 20.574  1.00 22.30 ? 15  GLY H N   1 
ATOM   2994 C  CA  . GLY C 3 15  ? -31.542 -40.917 21.655  1.00 20.56 ? 15  GLY H CA  1 
ATOM   2995 C  C   . GLY C 3 15  ? -30.412 -41.718 22.271  1.00 24.93 ? 15  GLY H C   1 
ATOM   2996 O  O   . GLY C 3 15  ? -30.587 -42.351 23.318  1.00 29.48 ? 15  GLY H O   1 
ATOM   2997 N  N   . VAL C 3 16  ? -29.257 -41.686 21.614  1.00 20.23 ? 16  VAL H N   1 
ATOM   2998 C  CA  . VAL C 3 16  ? -28.066 -42.435 22.015  1.00 23.13 ? 16  VAL H CA  1 
ATOM   2999 C  C   . VAL C 3 16  ? -27.196 -41.470 22.843  1.00 25.39 ? 16  VAL H C   1 
ATOM   3000 O  O   . VAL C 3 16  ? -27.464 -40.267 22.856  1.00 27.05 ? 16  VAL H O   1 
ATOM   3001 C  CB  . VAL C 3 16  ? -27.327 -42.983 20.741  1.00 24.41 ? 16  VAL H CB  1 
ATOM   3002 C  CG1 . VAL C 3 16  ? -26.007 -43.652 21.074  1.00 29.67 ? 16  VAL H CG1 1 
ATOM   3003 C  CG2 . VAL C 3 16  ? -28.222 -43.973 19.980  1.00 25.68 ? 16  VAL H CG2 1 
ATOM   3004 N  N   . SER C 3 17  ? -26.194 -41.992 23.555  1.00 21.57 ? 17  SER H N   1 
ATOM   3005 C  CA  A SER C 3 17  ? -25.251 -41.152 24.295  0.50 21.56 ? 17  SER H CA  1 
ATOM   3006 C  CA  B SER C 3 17  ? -25.259 -41.135 24.285  0.50 20.67 ? 17  SER H CA  1 
ATOM   3007 C  C   . SER C 3 17  ? -23.925 -41.016 23.551  1.00 21.19 ? 17  SER H C   1 
ATOM   3008 O  O   . SER C 3 17  ? -23.600 -41.830 22.680  1.00 21.74 ? 17  SER H O   1 
ATOM   3009 C  CB  A SER C 3 17  ? -25.006 -41.725 25.694  0.50 22.27 ? 17  SER H CB  1 
ATOM   3010 C  CB  B SER C 3 17  ? -25.048 -41.640 25.718  0.50 20.20 ? 17  SER H CB  1 
ATOM   3011 O  OG  A SER C 3 17  ? -26.217 -41.832 26.422  0.50 22.83 ? 17  SER H OG  1 
ATOM   3012 O  OG  B SER C 3 17  ? -24.285 -42.834 25.751  0.50 18.24 ? 17  SER H OG  1 
ATOM   3013 N  N   . VAL C 3 18  ? -23.161 -39.993 23.909  1.00 22.84 ? 18  VAL H N   1 
ATOM   3014 C  CA  . VAL C 3 18  ? -21.841 -39.762 23.349  1.00 24.85 ? 18  VAL H CA  1 
ATOM   3015 C  C   . VAL C 3 18  ? -20.887 -39.434 24.495  1.00 25.96 ? 18  VAL H C   1 
ATOM   3016 O  O   . VAL C 3 18  ? -21.253 -38.704 25.419  1.00 27.36 ? 18  VAL H O   1 
ATOM   3017 C  CB  . VAL C 3 18  ? -21.871 -38.605 22.310  1.00 23.42 ? 18  VAL H CB  1 
ATOM   3018 C  CG1 . VAL C 3 18  ? -22.137 -37.263 22.983  1.00 26.00 ? 18  VAL H CG1 1 
ATOM   3019 C  CG2 . VAL C 3 18  ? -20.576 -38.559 21.492  1.00 29.38 ? 18  VAL H CG2 1 
ATOM   3020 N  N   . LYS C 3 19  ? -19.673 -39.970 24.429  1.00 24.12 ? 19  LYS H N   1 
ATOM   3021 C  CA  . LYS C 3 19  ? -18.662 -39.666 25.431  1.00 21.57 ? 19  LYS H CA  1 
ATOM   3022 C  C   . LYS C 3 19  ? -17.444 -39.052 24.773  1.00 22.36 ? 19  LYS H C   1 
ATOM   3023 O  O   . LYS C 3 19  ? -16.803 -39.664 23.914  1.00 27.27 ? 19  LYS H O   1 
ATOM   3024 C  CB  . LYS C 3 19  ? -18.287 -40.922 26.217  1.00 25.82 ? 19  LYS H CB  1 
ATOM   3025 C  CG  . LYS C 3 19  ? -17.522 -40.653 27.508  1.00 24.79 ? 19  LYS H CG  1 
ATOM   3026 C  CD  . LYS C 3 19  ? -17.152 -41.964 28.167  1.00 24.14 ? 19  LYS H CD  1 
ATOM   3027 C  CE  . LYS C 3 19  ? -16.781 -41.798 29.628  1.00 27.24 ? 19  LYS H CE  1 
ATOM   3028 N  NZ  . LYS C 3 19  ? -16.712 -43.144 30.313  1.00 23.08 ? 19  LYS H NZ  1 
ATOM   3029 N  N   . ILE C 3 20  ? -17.127 -37.832 25.180  1.00 19.31 ? 20  ILE H N   1 
ATOM   3030 C  CA  . ILE C 3 20  ? -16.002 -37.130 24.602  1.00 23.38 ? 20  ILE H CA  1 
ATOM   3031 C  C   . ILE C 3 20  ? -14.929 -36.915 25.659  1.00 22.31 ? 20  ILE H C   1 
ATOM   3032 O  O   . ILE C 3 20  ? -15.225 -36.865 26.857  1.00 22.61 ? 20  ILE H O   1 
ATOM   3033 C  CB  . ILE C 3 20  ? -16.439 -35.842 23.863  1.00 28.11 ? 20  ILE H CB  1 
ATOM   3034 C  CG1 . ILE C 3 20  ? -17.095 -34.842 24.803  1.00 30.94 ? 20  ILE H CG1 1 
ATOM   3035 C  CG2 . ILE C 3 20  ? -17.408 -36.199 22.722  1.00 30.32 ? 20  ILE H CG2 1 
ATOM   3036 C  CD1 . ILE C 3 20  ? -17.719 -33.635 24.059  1.00 29.09 ? 20  ILE H CD1 1 
ATOM   3037 N  N   . SER C 3 21  ? -13.682 -36.828 25.220  1.00 21.65 ? 21  SER H N   1 
ATOM   3038 C  CA  . SER C 3 21  ? -12.570 -36.863 26.159  1.00 21.71 ? 21  SER H CA  1 
ATOM   3039 C  C   . SER C 3 21  ? -11.689 -35.630 26.037  1.00 21.17 ? 21  SER H C   1 
ATOM   3040 O  O   . SER C 3 21  ? -11.691 -34.929 25.006  1.00 18.75 ? 21  SER H O   1 
ATOM   3041 C  CB  . SER C 3 21  ? -11.735 -38.144 25.987  1.00 22.34 ? 21  SER H CB  1 
ATOM   3042 O  OG  . SER C 3 21  ? -11.002 -38.147 24.768  1.00 21.72 ? 21  SER H OG  1 
ATOM   3043 N  N   . CYS C 3 22  ? -10.922 -35.387 27.093  1.00 19.60 ? 22  CYS H N   1 
ATOM   3044 C  CA  . CYS C 3 22  ? -10.070 -34.211 27.154  1.00 21.65 ? 22  CYS H CA  1 
ATOM   3045 C  C   . CYS C 3 22  ? -8.824  -34.579 27.944  1.00 21.45 ? 22  CYS H C   1 
ATOM   3046 O  O   . CYS C 3 22  ? -8.911  -34.792 29.158  1.00 23.98 ? 22  CYS H O   1 
ATOM   3047 C  CB  . CYS C 3 22  ? -10.820 -33.064 27.836  1.00 24.35 ? 22  CYS H CB  1 
ATOM   3048 S  SG  . CYS C 3 22  ? -9.824  -31.584 28.185  1.00 26.58 ? 22  CYS H SG  1 
ATOM   3049 N  N   . LYS C 3 23  ? -7.681  -34.667 27.258  1.00 21.25 ? 23  LYS H N   1 
ATOM   3050 C  CA  . LYS C 3 23  ? -6.431  -35.088 27.903  1.00 22.38 ? 23  LYS H CA  1 
ATOM   3051 C  C   . LYS C 3 23  ? -5.527  -33.899 28.183  1.00 20.77 ? 23  LYS H C   1 
ATOM   3052 O  O   . LYS C 3 23  ? -5.238  -33.107 27.289  1.00 23.93 ? 23  LYS H O   1 
ATOM   3053 C  CB  . LYS C 3 23  ? -5.701  -36.140 27.059  1.00 23.25 ? 23  LYS H CB  1 
ATOM   3054 C  CG  . LYS C 3 23  ? -4.362  -36.601 27.637  1.00 25.06 ? 23  LYS H CG  1 
ATOM   3055 C  CD  . LYS C 3 23  ? -3.658  -37.564 26.687  1.00 31.08 ? 23  LYS H CD  1 
ATOM   3056 C  CE  . LYS C 3 23  ? -2.231  -37.885 27.154  1.00 39.34 ? 23  LYS H CE  1 
ATOM   3057 N  NZ  . LYS C 3 23  ? -2.213  -38.737 28.368  1.00 42.25 ? 23  LYS H NZ  1 
ATOM   3058 N  N   . GLY C 3 24  ? -5.110  -33.756 29.438  1.00 24.77 ? 24  GLY H N   1 
ATOM   3059 C  CA  . GLY C 3 24  ? -4.259  -32.626 29.836  1.00 23.64 ? 24  GLY H CA  1 
ATOM   3060 C  C   . GLY C 3 24  ? -2.793  -32.988 29.872  1.00 26.26 ? 24  GLY H C   1 
ATOM   3061 O  O   . GLY C 3 24  ? -2.414  -34.070 30.361  1.00 26.32 ? 24  GLY H O   1 
ATOM   3062 N  N   . SER C 3 25  ? -1.955  -32.088 29.359  1.00 22.61 ? 25  SER H N   1 
ATOM   3063 C  CA  . SER C 3 25  ? -0.508  -32.270 29.440  1.00 24.44 ? 25  SER H CA  1 
ATOM   3064 C  C   . SER C 3 25  ? 0.182   -30.936 29.730  1.00 21.44 ? 25  SER H C   1 
ATOM   3065 O  O   . SER C 3 25  ? -0.415  -29.869 29.565  1.00 20.82 ? 25  SER H O   1 
ATOM   3066 C  CB  . SER C 3 25  ? 0.037   -32.871 28.141  1.00 26.60 ? 25  SER H CB  1 
ATOM   3067 O  OG  . SER C 3 25  ? -0.198  -31.975 27.067  1.00 25.62 ? 25  SER H OG  1 
ATOM   3068 N  N   . GLY C 3 26  ? 1.439   -31.007 30.164  1.00 20.69 ? 26  GLY H N   1 
ATOM   3069 C  CA  . GLY C 3 26  ? 2.222   -29.797 30.433  1.00 26.06 ? 26  GLY H CA  1 
ATOM   3070 C  C   . GLY C 3 26  ? 1.916   -29.170 31.785  1.00 28.97 ? 26  GLY H C   1 
ATOM   3071 O  O   . GLY C 3 26  ? 2.349   -28.052 32.075  1.00 26.39 ? 26  GLY H O   1 
ATOM   3072 N  N   . TYR C 3 27  ? 1.174   -29.901 32.612  1.00 27.31 ? 27  TYR H N   1 
ATOM   3073 C  CA  . TYR C 3 27  ? 0.926   -29.522 34.006  1.00 25.83 ? 27  TYR H CA  1 
ATOM   3074 C  C   . TYR C 3 27  ? 0.526   -30.782 34.777  1.00 28.58 ? 27  TYR H C   1 
ATOM   3075 O  O   . TYR C 3 27  ? 0.291   -31.833 34.169  1.00 27.40 ? 27  TYR H O   1 
ATOM   3076 C  CB  . TYR C 3 27  ? -0.151  -28.428 34.102  1.00 27.42 ? 27  TYR H CB  1 
ATOM   3077 C  CG  . TYR C 3 27  ? -1.566  -28.870 33.789  1.00 23.46 ? 27  TYR H CG  1 
ATOM   3078 C  CD1 . TYR C 3 27  ? -2.449  -29.221 34.815  1.00 24.60 ? 27  TYR H CD1 1 
ATOM   3079 C  CD2 . TYR C 3 27  ? -2.032  -28.922 32.475  1.00 23.94 ? 27  TYR H CD2 1 
ATOM   3080 C  CE1 . TYR C 3 27  ? -3.761  -29.620 34.544  1.00 25.77 ? 27  TYR H CE1 1 
ATOM   3081 C  CE2 . TYR C 3 27  ? -3.350  -29.312 32.194  1.00 25.99 ? 27  TYR H CE2 1 
ATOM   3082 C  CZ  . TYR C 3 27  ? -4.197  -29.668 33.233  1.00 25.40 ? 27  TYR H CZ  1 
ATOM   3083 O  OH  . TYR C 3 27  ? -5.485  -30.059 32.966  1.00 29.51 ? 27  TYR H OH  1 
ATOM   3084 N  N   . THR C 3 28  ? 0.466   -30.694 36.103  1.00 27.60 ? 28  THR H N   1 
ATOM   3085 C  CA  . THR C 3 28  ? 0.030   -31.843 36.896  1.00 27.21 ? 28  THR H CA  1 
ATOM   3086 C  C   . THR C 3 28  ? -1.496  -31.952 36.809  1.00 26.91 ? 28  THR H C   1 
ATOM   3087 O  O   . THR C 3 28  ? -2.225  -31.148 37.395  1.00 26.32 ? 28  THR H O   1 
ATOM   3088 C  CB  . THR C 3 28  ? 0.524   -31.755 38.349  1.00 28.73 ? 28  THR H CB  1 
ATOM   3089 O  OG1 . THR C 3 28  ? 1.932   -31.477 38.349  1.00 30.23 ? 28  THR H OG1 1 
ATOM   3090 C  CG2 . THR C 3 28  ? 0.289   -33.082 39.086  1.00 27.01 ? 28  THR H CG2 1 
ATOM   3091 N  N   . PHE C 3 29  ? -1.965  -32.931 36.041  1.00 32.06 ? 29  PHE H N   1 
ATOM   3092 C  CA  . PHE C 3 29  ? -3.392  -33.050 35.707  1.00 34.67 ? 29  PHE H CA  1 
ATOM   3093 C  C   . PHE C 3 29  ? -4.317  -32.986 36.921  1.00 35.01 ? 29  PHE H C   1 
ATOM   3094 O  O   . PHE C 3 29  ? -5.288  -32.232 36.926  1.00 32.80 ? 29  PHE H O   1 
ATOM   3095 C  CB  . PHE C 3 29  ? -3.662  -34.338 34.924  1.00 36.46 ? 29  PHE H CB  1 
ATOM   3096 C  CG  . PHE C 3 29  ? -5.128  -34.611 34.680  1.00 37.33 ? 29  PHE H CG  1 
ATOM   3097 C  CD1 . PHE C 3 29  ? -5.792  -34.012 33.617  1.00 37.19 ? 29  PHE H CD1 1 
ATOM   3098 C  CD2 . PHE C 3 29  ? -5.841  -35.474 35.513  1.00 38.49 ? 29  PHE H CD2 1 
ATOM   3099 C  CE1 . PHE C 3 29  ? -7.145  -34.266 33.384  1.00 37.80 ? 29  PHE H CE1 1 
ATOM   3100 C  CE2 . PHE C 3 29  ? -7.196  -35.733 35.287  1.00 38.08 ? 29  PHE H CE2 1 
ATOM   3101 C  CZ  . PHE C 3 29  ? -7.844  -35.126 34.216  1.00 36.63 ? 29  PHE H CZ  1 
ATOM   3102 N  N   . ILE C 3 30  ? -4.009  -33.790 37.936  1.00 36.34 ? 30  ILE H N   1 
ATOM   3103 C  CA  . ILE C 3 30  ? -4.857  -33.907 39.123  1.00 34.52 ? 30  ILE H CA  1 
ATOM   3104 C  C   . ILE C 3 30  ? -5.061  -32.551 39.821  1.00 31.72 ? 30  ILE H C   1 
ATOM   3105 O  O   . ILE C 3 30  ? -6.070  -32.337 40.485  1.00 35.51 ? 30  ILE H O   1 
ATOM   3106 C  CB  . ILE C 3 30  ? -4.312  -34.997 40.113  1.00 31.27 ? 30  ILE H CB  1 
ATOM   3107 C  CG1 . ILE C 3 30  ? -5.417  -35.464 41.074  1.00 32.72 ? 30  ILE H CG1 1 
ATOM   3108 C  CG2 . ILE C 3 30  ? -3.038  -34.510 40.844  1.00 34.44 ? 30  ILE H CG2 1 
ATOM   3109 C  CD1 . ILE C 3 30  ? -5.007  -36.600 42.034  1.00 34.48 ? 30  ILE H CD1 1 
ATOM   3110 N  N   . ASP C 3 31  ? -4.114  -31.638 39.619  1.00 29.75 ? 31  ASP H N   1 
ATOM   3111 C  CA  . ASP C 3 31  ? -4.043  -30.371 40.351  1.00 34.01 ? 31  ASP H CA  1 
ATOM   3112 C  C   . ASP C 3 31  ? -4.987  -29.237 39.955  1.00 31.10 ? 31  ASP H C   1 
ATOM   3113 O  O   . ASP C 3 31  ? -5.126  -28.285 40.718  1.00 31.95 ? 31  ASP H O   1 
ATOM   3114 C  CB  . ASP C 3 31  ? -2.617  -29.822 40.304  1.00 38.01 ? 31  ASP H CB  1 
ATOM   3115 C  CG  . ASP C 3 31  ? -1.687  -30.520 41.271  1.00 43.98 ? 31  ASP H CG  1 
ATOM   3116 O  OD1 . ASP C 3 31  ? -2.142  -31.385 42.064  1.00 44.90 ? 31  ASP H OD1 1 
ATOM   3117 O  OD2 . ASP C 3 31  ? -0.483  -30.191 41.230  1.00 46.95 ? 31  ASP H OD2 1 
ATOM   3118 N  N   . GLU C 3 32  ? -5.593  -29.288 38.769  1.00 28.48 ? 32  GLU H N   1 
ATOM   3119 C  CA  . GLU C 3 32  ? -6.494  -28.205 38.351  1.00 24.01 ? 32  GLU H CA  1 
ATOM   3120 C  C   . GLU C 3 32  ? -7.878  -28.706 37.917  1.00 23.89 ? 32  GLU H C   1 
ATOM   3121 O  O   . GLU C 3 32  ? -8.009  -29.807 37.383  1.00 22.90 ? 32  GLU H O   1 
ATOM   3122 C  CB  . GLU C 3 32  ? -5.906  -27.344 37.212  1.00 29.65 ? 32  GLU H CB  1 
ATOM   3123 C  CG  . GLU C 3 32  ? -4.470  -26.830 37.399  1.00 35.58 ? 32  GLU H CG  1 
ATOM   3124 C  CD  . GLU C 3 32  ? -4.278  -25.924 38.614  1.00 39.80 ? 32  GLU H CD  1 
ATOM   3125 O  OE1 . GLU C 3 32  ? -5.200  -25.149 38.980  1.00 37.47 ? 32  GLU H OE1 1 
ATOM   3126 O  OE2 . GLU C 3 32  ? -3.174  -25.989 39.197  1.00 41.79 ? 32  GLU H OE2 1 
ATOM   3127 N  N   . ALA C 3 33  ? -8.885  -27.858 38.126  1.00 20.10 ? 33  ALA H N   1 
ATOM   3128 C  CA  . ALA C 3 33  ? -10.261 -28.149 37.753  1.00 22.19 ? 33  ALA H CA  1 
ATOM   3129 C  C   . ALA C 3 33  ? -10.429 -28.021 36.252  1.00 24.23 ? 33  ALA H C   1 
ATOM   3130 O  O   . ALA C 3 33  ? -9.756  -27.210 35.597  1.00 22.63 ? 33  ALA H O   1 
ATOM   3131 C  CB  . ALA C 3 33  ? -11.210 -27.186 38.455  1.00 23.21 ? 33  ALA H CB  1 
ATOM   3132 N  N   . LEU C 3 34  ? -11.352 -28.805 35.714  1.00 21.63 ? 34  LEU H N   1 
ATOM   3133 C  CA  . LEU C 3 34  ? -11.603 -28.812 34.294  1.00 20.02 ? 34  LEU H CA  1 
ATOM   3134 C  C   . LEU C 3 34  ? -13.089 -28.590 34.086  1.00 21.65 ? 34  LEU H C   1 
ATOM   3135 O  O   . LEU C 3 34  ? -13.933 -29.251 34.719  1.00 21.46 ? 34  LEU H O   1 
ATOM   3136 C  CB  . LEU C 3 34  ? -11.158 -30.140 33.669  1.00 24.84 ? 34  LEU H CB  1 
ATOM   3137 C  CG  . LEU C 3 34  ? -9.694  -30.378 33.278  1.00 28.07 ? 34  LEU H CG  1 
ATOM   3138 C  CD1 . LEU C 3 34  ? -9.525  -31.835 32.852  1.00 31.59 ? 34  LEU H CD1 1 
ATOM   3139 C  CD2 . LEU C 3 34  ? -9.204  -29.446 32.147  1.00 29.41 ? 34  LEU H CD2 1 
ATOM   3140 N  N   . HIS C 3 35  ? -13.397 -27.648 33.213  1.00 17.76 ? 35  HIS H N   1 
ATOM   3141 C  CA  . HIS C 3 35  ? -14.774 -27.235 32.957  1.00 20.76 ? 35  HIS H CA  1 
ATOM   3142 C  C   . HIS C 3 35  ? -15.159 -27.631 31.545  1.00 21.08 ? 35  HIS H C   1 
ATOM   3143 O  O   . HIS C 3 35  ? -14.297 -27.823 30.684  1.00 21.78 ? 35  HIS H O   1 
ATOM   3144 C  CB  . HIS C 3 35  ? -14.911 -25.719 33.076  1.00 21.39 ? 35  HIS H CB  1 
ATOM   3145 C  CG  . HIS C 3 35  ? -14.494 -25.168 34.403  1.00 22.49 ? 35  HIS H CG  1 
ATOM   3146 N  ND1 . HIS C 3 35  ? -15.376 -24.530 35.245  1.00 21.34 ? 35  HIS H ND1 1 
ATOM   3147 C  CD2 . HIS C 3 35  ? -13.289 -25.132 35.020  1.00 23.84 ? 35  HIS H CD2 1 
ATOM   3148 C  CE1 . HIS C 3 35  ? -14.739 -24.130 36.330  1.00 21.98 ? 35  HIS H CE1 1 
ATOM   3149 N  NE2 . HIS C 3 35  ? -13.469 -24.487 36.221  1.00 23.05 ? 35  HIS H NE2 1 
ATOM   3150 N  N   . TRP C 3 36  ? -16.453 -27.770 31.314  1.00 19.11 ? 36  TRP H N   1 
ATOM   3151 C  CA  . TRP C 3 36  ? -16.956 -28.055 29.988  1.00 21.70 ? 36  TRP H CA  1 
ATOM   3152 C  C   . TRP C 3 36  ? -17.863 -26.919 29.570  1.00 22.82 ? 36  TRP H C   1 
ATOM   3153 O  O   . TRP C 3 36  ? -18.667 -26.417 30.375  1.00 19.96 ? 36  TRP H O   1 
ATOM   3154 C  CB  . TRP C 3 36  ? -17.691 -29.403 29.963  1.00 19.39 ? 36  TRP H CB  1 
ATOM   3155 C  CG  . TRP C 3 36  ? -16.756 -30.566 30.231  1.00 21.19 ? 36  TRP H CG  1 
ATOM   3156 C  CD1 . TRP C 3 36  ? -16.420 -31.098 31.443  1.00 22.06 ? 36  TRP H CD1 1 
ATOM   3157 C  CD2 . TRP C 3 36  ? -16.042 -31.316 29.245  1.00 22.41 ? 36  TRP H CD2 1 
ATOM   3158 N  NE1 . TRP C 3 36  ? -15.532 -32.139 31.270  1.00 19.56 ? 36  TRP H NE1 1 
ATOM   3159 C  CE2 . TRP C 3 36  ? -15.291 -32.295 29.928  1.00 22.33 ? 36  TRP H CE2 1 
ATOM   3160 C  CE3 . TRP C 3 36  ? -15.966 -31.254 27.838  1.00 19.86 ? 36  TRP H CE3 1 
ATOM   3161 C  CZ2 . TRP C 3 36  ? -14.473 -33.214 29.258  1.00 20.64 ? 36  TRP H CZ2 1 
ATOM   3162 C  CZ3 . TRP C 3 36  ? -15.154 -32.178 27.173  1.00 19.96 ? 36  TRP H CZ3 1 
ATOM   3163 C  CH2 . TRP C 3 36  ? -14.423 -33.138 27.887  1.00 21.06 ? 36  TRP H CH2 1 
ATOM   3164 N  N   . VAL C 3 37  ? -17.714 -26.512 28.313  1.00 22.50 ? 37  VAL H N   1 
ATOM   3165 C  CA  . VAL C 3 37  ? -18.471 -25.398 27.761  1.00 19.02 ? 37  VAL H CA  1 
ATOM   3166 C  C   . VAL C 3 37  ? -19.023 -25.800 26.390  1.00 21.22 ? 37  VAL H C   1 
ATOM   3167 O  O   . VAL C 3 37  ? -18.300 -26.374 25.559  1.00 22.83 ? 37  VAL H O   1 
ATOM   3168 C  CB  . VAL C 3 37  ? -17.573 -24.127 27.609  1.00 23.81 ? 37  VAL H CB  1 
ATOM   3169 C  CG1 . VAL C 3 37  ? -18.368 -22.963 26.984  1.00 23.15 ? 37  VAL H CG1 1 
ATOM   3170 C  CG2 . VAL C 3 37  ? -16.975 -23.706 28.966  1.00 23.29 ? 37  VAL H CG2 1 
ATOM   3171 N  N   . LYS C 3 38  ? -20.295 -25.490 26.164  1.00 21.84 ? 38  LYS H N   1 
ATOM   3172 C  CA  . LYS C 3 38  ? -20.962 -25.728 24.873  1.00 22.16 ? 38  LYS H CA  1 
ATOM   3173 C  C   . LYS C 3 38  ? -20.936 -24.457 24.020  1.00 23.99 ? 38  LYS H C   1 
ATOM   3174 O  O   . LYS C 3 38  ? -21.164 -23.364 24.533  1.00 24.50 ? 38  LYS H O   1 
ATOM   3175 C  CB  . LYS C 3 38  ? -22.403 -26.179 25.131  1.00 18.75 ? 38  LYS H CB  1 
ATOM   3176 C  CG  . LYS C 3 38  ? -23.268 -26.407 23.898  1.00 19.44 ? 38  LYS H CG  1 
ATOM   3177 C  CD  . LYS C 3 38  ? -24.679 -26.783 24.294  1.00 20.64 ? 38  LYS H CD  1 
ATOM   3178 C  CE  . LYS C 3 38  ? -25.568 -26.920 23.070  1.00 22.83 ? 38  LYS H CE  1 
ATOM   3179 N  NZ  . LYS C 3 38  ? -26.953 -27.328 23.469  1.00 20.46 ? 38  LYS H NZ  1 
ATOM   3180 N  N   . GLN C 3 39  ? -20.648 -24.601 22.728  1.00 23.67 ? 39  GLN H N   1 
ATOM   3181 C  CA  . GLN C 3 39  ? -20.812 -23.498 21.779  1.00 22.50 ? 39  GLN H CA  1 
ATOM   3182 C  C   . GLN C 3 39  ? -21.688 -23.886 20.596  1.00 25.23 ? 39  GLN H C   1 
ATOM   3183 O  O   . GLN C 3 39  ? -21.338 -24.769 19.823  1.00 21.49 ? 39  GLN H O   1 
ATOM   3184 C  CB  . GLN C 3 39  ? -19.463 -22.981 21.261  1.00 21.15 ? 39  GLN H CB  1 
ATOM   3185 C  CG  . GLN C 3 39  ? -19.605 -21.701 20.409  1.00 23.31 ? 39  GLN H CG  1 
ATOM   3186 C  CD  . GLN C 3 39  ? -18.304 -20.929 20.252  1.00 25.87 ? 39  GLN H CD  1 
ATOM   3187 O  OE1 . GLN C 3 39  ? -17.251 -21.520 20.039  1.00 24.33 ? 39  GLN H OE1 1 
ATOM   3188 N  NE2 . GLN C 3 39  ? -18.380 -19.596 20.342  1.00 26.12 ? 39  GLN H NE2 1 
ATOM   3189 N  N   . SER C 3 40  ? -22.822 -23.217 20.454  1.00 28.75 ? 40  SER H N   1 
ATOM   3190 C  CA  . SER C 3 40  ? -23.620 -23.352 19.242  1.00 36.51 ? 40  SER H CA  1 
ATOM   3191 C  C   . SER C 3 40  ? -23.301 -22.150 18.352  1.00 40.68 ? 40  SER H C   1 
ATOM   3192 O  O   . SER C 3 40  ? -22.141 -21.798 18.194  1.00 43.50 ? 40  SER H O   1 
ATOM   3193 C  CB  . SER C 3 40  ? -25.108 -23.457 19.579  1.00 37.59 ? 40  SER H CB  1 
ATOM   3194 O  OG  . SER C 3 40  ? -25.458 -22.574 20.628  1.00 38.73 ? 40  SER H OG  1 
ATOM   3195 N  N   . HIS C 3 41  ? -24.325 -21.542 17.761  1.00 51.66 ? 41  HIS H N   1 
ATOM   3196 C  CA  . HIS C 3 41  ? -24.194 -20.231 17.129  1.00 54.04 ? 41  HIS H CA  1 
ATOM   3197 C  C   . HIS C 3 41  ? -25.268 -19.280 17.678  1.00 52.88 ? 41  HIS H C   1 
ATOM   3198 O  O   . HIS C 3 41  ? -25.048 -18.069 17.766  1.00 55.37 ? 41  HIS H O   1 
ATOM   3199 C  CB  . HIS C 3 41  ? -24.275 -20.345 15.602  1.00 54.76 ? 41  HIS H CB  1 
ATOM   3200 C  CG  . HIS C 3 41  ? -23.897 -19.086 14.880  1.00 59.96 ? 41  HIS H CG  1 
ATOM   3201 N  ND1 . HIS C 3 41  ? -24.803 -18.081 14.606  1.00 62.25 ? 41  HIS H ND1 1 
ATOM   3202 C  CD2 . HIS C 3 41  ? -22.710 -18.669 14.375  1.00 59.63 ? 41  HIS H CD2 1 
ATOM   3203 C  CE1 . HIS C 3 41  ? -24.190 -17.100 13.966  1.00 61.46 ? 41  HIS H CE1 1 
ATOM   3204 N  NE2 . HIS C 3 41  ? -22.920 -17.433 13.811  1.00 60.65 ? 41  HIS H NE2 1 
ATOM   3205 N  N   . ALA C 3 42  ? -26.406 -19.852 18.072  1.00 51.08 ? 42  ALA H N   1 
ATOM   3206 C  CA  . ALA C 3 42  ? -27.580 -19.093 18.528  1.00 53.73 ? 42  ALA H CA  1 
ATOM   3207 C  C   . ALA C 3 42  ? -27.603 -18.803 20.038  1.00 53.46 ? 42  ALA H C   1 
ATOM   3208 O  O   . ALA C 3 42  ? -28.266 -17.858 20.485  1.00 51.69 ? 42  ALA H O   1 
ATOM   3209 C  CB  . ALA C 3 42  ? -28.877 -19.805 18.101  1.00 53.61 ? 42  ALA H CB  1 
ATOM   3210 N  N   . GLU C 3 43  ? -26.894 -19.622 20.814  1.00 52.12 ? 43  GLU H N   1 
ATOM   3211 C  CA  . GLU C 3 43  ? -26.806 -19.445 22.272  1.00 53.03 ? 43  GLU H CA  1 
ATOM   3212 C  C   . GLU C 3 43  ? -25.335 -19.361 22.714  1.00 47.57 ? 43  GLU H C   1 
ATOM   3213 O  O   . GLU C 3 43  ? -24.986 -19.772 23.829  1.00 46.69 ? 43  GLU H O   1 
ATOM   3214 C  CB  . GLU C 3 43  ? -27.536 -20.604 22.975  1.00 58.43 ? 43  GLU H CB  1 
ATOM   3215 C  CG  . GLU C 3 43  ? -27.830 -20.397 24.467  1.00 65.50 ? 43  GLU H CG  1 
ATOM   3216 C  CD  . GLU C 3 43  ? -28.877 -19.326 24.746  1.00 69.94 ? 43  GLU H CD  1 
ATOM   3217 O  OE1 . GLU C 3 43  ? -29.777 -19.119 23.903  1.00 72.85 ? 43  GLU H OE1 1 
ATOM   3218 O  OE2 . GLU C 3 43  ? -28.802 -18.695 25.821  1.00 71.55 ? 43  GLU H OE2 1 
ATOM   3219 N  N   . SER C 3 44  ? -24.508 -18.750 21.857  1.00 40.80 ? 44  SER H N   1 
ATOM   3220 C  CA  . SER C 3 44  ? -23.065 -19.051 21.739  1.00 37.61 ? 44  SER H CA  1 
ATOM   3221 C  C   . SER C 3 44  ? -22.387 -19.875 22.872  1.00 36.04 ? 44  SER H C   1 
ATOM   3222 O  O   . SER C 3 44  ? -22.470 -21.097 22.795  1.00 41.23 ? 44  SER H O   1 
ATOM   3223 C  CB  . SER C 3 44  ? -22.237 -17.881 21.183  1.00 40.77 ? 44  SER H CB  1 
ATOM   3224 O  OG  . SER C 3 44  ? -21.425 -18.311 20.079  1.00 37.35 ? 44  SER H OG  1 
ATOM   3225 N  N   . LEU C 3 45  ? -21.768 -19.276 23.904  1.00 31.43 ? 45  LEU H N   1 
ATOM   3226 C  CA  . LEU C 3 45  ? -21.083 -20.091 24.943  1.00 22.59 ? 45  LEU H CA  1 
ATOM   3227 C  C   . LEU C 3 45  ? -21.930 -20.341 26.209  1.00 29.43 ? 45  LEU H C   1 
ATOM   3228 O  O   . LEU C 3 45  ? -22.508 -19.406 26.771  1.00 25.41 ? 45  LEU H O   1 
ATOM   3229 C  CB  . LEU C 3 45  ? -19.725 -19.491 25.347  1.00 23.02 ? 45  LEU H CB  1 
ATOM   3230 C  CG  . LEU C 3 45  ? -18.652 -19.313 24.268  1.00 25.18 ? 45  LEU H CG  1 
ATOM   3231 C  CD1 . LEU C 3 45  ? -17.752 -18.172 24.662  1.00 24.80 ? 45  LEU H CD1 1 
ATOM   3232 C  CD2 . LEU C 3 45  ? -17.839 -20.579 24.032  1.00 26.75 ? 45  LEU H CD2 1 
ATOM   3233 N  N   . GLU C 3 46  ? -21.983 -21.599 26.653  1.00 24.66 ? 46  GLU H N   1 
ATOM   3234 C  CA  . GLU C 3 46  ? -22.742 -21.991 27.844  1.00 25.99 ? 46  GLU H CA  1 
ATOM   3235 C  C   . GLU C 3 46  ? -21.907 -22.938 28.691  1.00 23.40 ? 46  GLU H C   1 
ATOM   3236 O  O   . GLU C 3 46  ? -21.367 -23.921 28.190  1.00 23.36 ? 46  GLU H O   1 
ATOM   3237 C  CB  . GLU C 3 46  ? -24.029 -22.729 27.472  1.00 27.20 ? 46  GLU H CB  1 
ATOM   3238 C  CG  . GLU C 3 46  ? -25.079 -21.916 26.751  1.00 29.52 ? 46  GLU H CG  1 
ATOM   3239 C  CD  . GLU C 3 46  ? -26.330 -22.748 26.502  1.00 33.79 ? 46  GLU H CD  1 
ATOM   3240 O  OE1 . GLU C 3 46  ? -26.271 -23.682 25.673  1.00 35.70 ? 46  GLU H OE1 1 
ATOM   3241 O  OE2 . GLU C 3 46  ? -27.359 -22.471 27.147  1.00 36.34 ? 46  GLU H OE2 1 
ATOM   3242 N  N   . TRP C 3 47  ? -21.817 -22.642 29.978  1.00 21.55 ? 47  TRP H N   1 
ATOM   3243 C  CA  . TRP C 3 47  ? -21.042 -23.460 30.903  1.00 21.58 ? 47  TRP H CA  1 
ATOM   3244 C  C   . TRP C 3 47  ? -21.866 -24.674 31.304  1.00 20.92 ? 47  TRP H C   1 
ATOM   3245 O  O   . TRP C 3 47  ? -23.015 -24.542 31.745  1.00 21.53 ? 47  TRP H O   1 
ATOM   3246 C  CB  . TRP C 3 47  ? -20.676 -22.618 32.125  1.00 22.42 ? 47  TRP H CB  1 
ATOM   3247 C  CG  . TRP C 3 47  ? -19.859 -23.277 33.180  1.00 20.79 ? 47  TRP H CG  1 
ATOM   3248 C  CD1 . TRP C 3 47  ? -18.496 -23.383 33.218  1.00 21.31 ? 47  TRP H CD1 1 
ATOM   3249 C  CD2 . TRP C 3 47  ? -20.344 -23.867 34.395  1.00 19.26 ? 47  TRP H CD2 1 
ATOM   3250 N  NE1 . TRP C 3 47  ? -18.106 -24.026 34.373  1.00 19.27 ? 47  TRP H NE1 1 
ATOM   3251 C  CE2 . TRP C 3 47  ? -19.218 -24.321 35.117  1.00 19.80 ? 47  TRP H CE2 1 
ATOM   3252 C  CE3 . TRP C 3 47  ? -21.629 -24.071 34.935  1.00 19.42 ? 47  TRP H CE3 1 
ATOM   3253 C  CZ2 . TRP C 3 47  ? -19.326 -24.980 36.360  1.00 19.38 ? 47  TRP H CZ2 1 
ATOM   3254 C  CZ3 . TRP C 3 47  ? -21.735 -24.707 36.187  1.00 21.05 ? 47  TRP H CZ3 1 
ATOM   3255 C  CH2 . TRP C 3 47  ? -20.587 -25.159 36.875  1.00 20.69 ? 47  TRP H CH2 1 
ATOM   3256 N  N   . ILE C 3 48  ? -21.278 -25.856 31.124  1.00 19.77 ? 48  ILE H N   1 
ATOM   3257 C  CA  . ILE C 3 48  ? -21.951 -27.124 31.422  1.00 20.19 ? 48  ILE H CA  1 
ATOM   3258 C  C   . ILE C 3 48  ? -21.694 -27.565 32.861  1.00 19.05 ? 48  ILE H C   1 
ATOM   3259 O  O   . ILE C 3 48  ? -22.622 -27.924 33.593  1.00 17.64 ? 48  ILE H O   1 
ATOM   3260 C  CB  . ILE C 3 48  ? -21.499 -28.233 30.442  1.00 18.79 ? 48  ILE H CB  1 
ATOM   3261 C  CG1 . ILE C 3 48  ? -21.943 -27.909 29.017  1.00 22.69 ? 48  ILE H CG1 1 
ATOM   3262 C  CG2 . ILE C 3 48  ? -22.029 -29.624 30.879  1.00 19.93 ? 48  ILE H CG2 1 
ATOM   3263 C  CD1 . ILE C 3 48  ? -21.297 -28.839 27.959  1.00 20.78 ? 48  ILE H CD1 1 
ATOM   3264 N  N   . GLY C 3 49  ? -20.426 -27.545 33.266  1.00 18.56 ? 49  GLY H N   1 
ATOM   3265 C  CA  . GLY C 3 49  ? -20.092 -27.967 34.618  1.00 20.16 ? 49  GLY H CA  1 
ATOM   3266 C  C   . GLY C 3 49  ? -18.601 -28.004 34.820  1.00 19.97 ? 49  GLY H C   1 
ATOM   3267 O  O   . GLY C 3 49  ? -17.836 -27.668 33.916  1.00 21.94 ? 49  GLY H O   1 
ATOM   3268 N  N   . VAL C 3 50  ? -18.199 -28.423 36.010  1.00 20.68 ? 50  VAL H N   1 
ATOM   3269 C  CA  . VAL C 3 50  ? -16.791 -28.510 36.371  1.00 18.31 ? 50  VAL H CA  1 
ATOM   3270 C  C   . VAL C 3 50  ? -16.558 -29.795 37.147  1.00 20.89 ? 50  VAL H C   1 
ATOM   3271 O  O   . VAL C 3 50  ? -17.423 -30.241 37.914  1.00 19.71 ? 50  VAL H O   1 
ATOM   3272 C  CB  . VAL C 3 50  ? -16.323 -27.241 37.186  1.00 17.33 ? 50  VAL H CB  1 
ATOM   3273 C  CG1 . VAL C 3 50  ? -17.137 -27.052 38.476  1.00 19.77 ? 50  VAL H CG1 1 
ATOM   3274 C  CG2 . VAL C 3 50  ? -14.812 -27.288 37.496  1.00 17.94 ? 50  VAL H CG2 1 
ATOM   3275 N  N   . ILE C 3 51  ? -15.403 -30.405 36.908  1.00 19.14 ? 51  ILE H N   1 
ATOM   3276 C  CA  . ILE C 3 51  ? -14.932 -31.518 37.724  1.00 21.36 ? 51  ILE H CA  1 
ATOM   3277 C  C   . ILE C 3 51  ? -13.581 -31.150 38.338  1.00 22.11 ? 51  ILE H C   1 
ATOM   3278 O  O   . ILE C 3 51  ? -12.730 -30.538 37.687  1.00 19.67 ? 51  ILE H O   1 
ATOM   3279 C  CB  . ILE C 3 51  ? -14.865 -32.867 36.925  1.00 21.45 ? 51  ILE H CB  1 
ATOM   3280 C  CG1 . ILE C 3 51  ? -14.425 -34.018 37.836  1.00 21.48 ? 51  ILE H CG1 1 
ATOM   3281 C  CG2 . ILE C 3 51  ? -13.958 -32.737 35.684  1.00 22.62 ? 51  ILE H CG2 1 
ATOM   3282 C  CD1 . ILE C 3 51  ? -14.840 -35.407 37.359  1.00 24.77 ? 51  ILE H CD1 1 
ATOM   3283 N  N   . ARG C 3 52  ? -13.394 -31.542 39.592  1.00 21.98 ? 52  ARG H N   1 
ATOM   3284 C  CA  . ARG C 3 52  ? -12.159 -31.275 40.325  1.00 22.47 ? 52  ARG H CA  1 
ATOM   3285 C  C   . ARG C 3 52  ? -11.464 -32.601 40.583  1.00 21.86 ? 52  ARG H C   1 
ATOM   3286 O  O   . ARG C 3 52  ? -11.846 -33.334 41.499  1.00 22.60 ? 52  ARG H O   1 
ATOM   3287 C  CB  . ARG C 3 52  ? -12.470 -30.502 41.613  1.00 22.66 ? 52  ARG H CB  1 
ATOM   3288 C  CG  . ARG C 3 52  ? -13.117 -29.150 41.283  1.00 24.24 ? 52  ARG H CG  1 
ATOM   3289 C  CD  . ARG C 3 52  ? -13.426 -28.251 42.482  1.00 32.08 ? 52  ARG H CD  1 
ATOM   3290 N  NE  . ARG C 3 52  ? -14.435 -27.249 42.108  1.00 39.47 ? 52  ARG H NE  1 
ATOM   3291 C  CZ  . ARG C 3 52  ? -14.202 -26.131 41.418  1.00 43.48 ? 52  ARG H CZ  1 
ATOM   3292 N  NH1 . ARG C 3 52  ? -12.976 -25.814 41.008  1.00 50.57 ? 52  ARG H NH1 1 
ATOM   3293 N  NH2 . ARG C 3 52  ? -15.204 -25.312 41.137  1.00 43.07 ? 52  ARG H NH2 1 
ATOM   3294 N  N   . PRO C 3 53  ? -10.464 -32.936 39.740  1.00 23.48 ? 53  PRO H N   1 
ATOM   3295 C  CA  . PRO C 3 53  ? -9.785  -34.247 39.808  1.00 24.26 ? 53  PRO H CA  1 
ATOM   3296 C  C   . PRO C 3 53  ? -9.205  -34.528 41.188  1.00 24.39 ? 53  PRO H C   1 
ATOM   3297 O  O   . PRO C 3 53  ? -9.184  -35.684 41.626  1.00 22.75 ? 53  PRO H O   1 
ATOM   3298 C  CB  . PRO C 3 53  ? -8.654  -34.109 38.782  1.00 22.43 ? 53  PRO H CB  1 
ATOM   3299 C  CG  . PRO C 3 53  ? -9.166  -33.094 37.803  1.00 24.19 ? 53  PRO H CG  1 
ATOM   3300 C  CD  . PRO C 3 53  ? -9.907  -32.096 38.661  1.00 22.85 ? 53  PRO H CD  1 
ATOM   3301 N  N   . TYR C 3 54  ? -8.759  -33.477 41.877  1.00 23.05 ? 54  TYR H N   1 
ATOM   3302 C  CA  . TYR C 3 54  ? -8.115  -33.636 43.187  1.00 22.47 ? 54  TYR H CA  1 
ATOM   3303 C  C   . TYR C 3 54  ? -9.065  -34.101 44.285  1.00 26.49 ? 54  TYR H C   1 
ATOM   3304 O  O   . TYR C 3 54  ? -8.641  -34.740 45.260  1.00 25.16 ? 54  TYR H O   1 
ATOM   3305 C  CB  . TYR C 3 54  ? -7.409  -32.344 43.613  1.00 22.32 ? 54  TYR H CB  1 
ATOM   3306 C  CG  . TYR C 3 54  ? -8.210  -31.071 43.435  1.00 21.82 ? 54  TYR H CG  1 
ATOM   3307 C  CD1 . TYR C 3 54  ? -9.009  -30.568 44.469  1.00 19.36 ? 54  TYR H CD1 1 
ATOM   3308 C  CD2 . TYR C 3 54  ? -8.145  -30.351 42.238  1.00 18.74 ? 54  TYR H CD2 1 
ATOM   3309 C  CE1 . TYR C 3 54  ? -9.740  -29.391 44.300  1.00 21.70 ? 54  TYR H CE1 1 
ATOM   3310 C  CE2 . TYR C 3 54  ? -8.875  -29.171 42.055  1.00 22.90 ? 54  TYR H CE2 1 
ATOM   3311 C  CZ  . TYR C 3 54  ? -9.657  -28.692 43.095  1.00 24.81 ? 54  TYR H CZ  1 
ATOM   3312 O  OH  . TYR C 3 54  ? -10.350 -27.519 42.923  1.00 25.20 ? 54  TYR H OH  1 
ATOM   3313 N  N   . SER C 3 55  ? -10.345 -33.781 44.134  1.00 25.11 ? 55  SER H N   1 
ATOM   3314 C  CA  . SER C 3 55  ? -11.346 -34.136 45.147  1.00 28.42 ? 55  SER H CA  1 
ATOM   3315 C  C   . SER C 3 55  ? -12.418 -35.096 44.613  1.00 30.01 ? 55  SER H C   1 
ATOM   3316 O  O   . SER C 3 55  ? -13.117 -35.760 45.393  1.00 30.35 ? 55  SER H O   1 
ATOM   3317 C  CB  . SER C 3 55  ? -11.999 -32.871 45.712  1.00 26.92 ? 55  SER H CB  1 
ATOM   3318 O  OG  . SER C 3 55  ? -12.731 -32.200 44.706  1.00 26.68 ? 55  SER H OG  1 
ATOM   3319 N  N   . GLY C 3 56  A -12.535 -35.176 43.291  1.00 27.42 ? 55  GLY H N   1 
ATOM   3320 C  CA  . GLY C 3 56  A -13.581 -35.976 42.641  1.00 30.56 ? 55  GLY H CA  1 
ATOM   3321 C  C   . GLY C 3 56  A -14.928 -35.268 42.571  1.00 27.60 ? 55  GLY H C   1 
ATOM   3322 O  O   . GLY C 3 56  A -15.899 -35.825 42.069  1.00 29.81 ? 55  GLY H O   1 
ATOM   3323 N  N   . GLU C 3 57  ? -14.977 -34.039 43.076  1.00 23.50 ? 56  GLU H N   1 
ATOM   3324 C  CA  . GLU C 3 57  ? -16.195 -33.234 43.128  1.00 24.84 ? 56  GLU H CA  1 
ATOM   3325 C  C   . GLU C 3 57  ? -16.643 -32.759 41.746  1.00 24.37 ? 56  GLU H C   1 
ATOM   3326 O  O   . GLU C 3 57  ? -15.823 -32.327 40.934  1.00 22.41 ? 56  GLU H O   1 
ATOM   3327 C  CB  . GLU C 3 57  ? -15.962 -32.021 44.033  1.00 31.13 ? 56  GLU H CB  1 
ATOM   3328 C  CG  . GLU C 3 57  ? -17.225 -31.307 44.485  1.00 42.83 ? 56  GLU H CG  1 
ATOM   3329 C  CD  . GLU C 3 57  ? -16.995 -29.843 44.828  1.00 50.27 ? 56  GLU H CD  1 
ATOM   3330 O  OE1 . GLU C 3 57  ? -15.879 -29.490 45.274  1.00 56.53 ? 56  GLU H OE1 1 
ATOM   3331 O  OE2 . GLU C 3 57  ? -17.941 -29.039 44.663  1.00 52.31 ? 56  GLU H OE2 1 
ATOM   3332 N  N   . THR C 3 58  ? -17.952 -32.818 41.502  1.00 23.03 ? 57  THR H N   1 
ATOM   3333 C  CA  . THR C 3 58  ? -18.548 -32.258 40.289  1.00 25.45 ? 57  THR H CA  1 
ATOM   3334 C  C   . THR C 3 58  ? -19.632 -31.227 40.642  1.00 27.59 ? 57  THR H C   1 
ATOM   3335 O  O   . THR C 3 58  ? -20.324 -31.367 41.654  1.00 25.63 ? 57  THR H O   1 
ATOM   3336 C  CB  . THR C 3 58  ? -19.164 -33.367 39.394  1.00 26.00 ? 57  THR H CB  1 
ATOM   3337 O  OG1 . THR C 3 58  ? -19.995 -34.225 40.189  1.00 26.50 ? 57  THR H OG1 1 
ATOM   3338 C  CG2 . THR C 3 58  ? -18.083 -34.209 38.754  1.00 25.11 ? 57  THR H CG2 1 
ATOM   3339 N  N   . ASN C 3 59  ? -19.750 -30.193 39.812  1.00 26.25 ? 58  ASN H N   1 
ATOM   3340 C  CA  . ASN C 3 59  ? -20.849 -29.228 39.870  1.00 26.35 ? 58  ASN H CA  1 
ATOM   3341 C  C   . ASN C 3 59  ? -21.393 -29.034 38.462  1.00 24.01 ? 58  ASN H C   1 
ATOM   3342 O  O   . ASN C 3 59  ? -20.629 -28.726 37.543  1.00 19.45 ? 58  ASN H O   1 
ATOM   3343 C  CB  . ASN C 3 59  ? -20.380 -27.878 40.423  1.00 31.17 ? 58  ASN H CB  1 
ATOM   3344 C  CG  . ASN C 3 59  ? -19.991 -27.942 41.883  1.00 41.93 ? 58  ASN H CG  1 
ATOM   3345 O  OD1 . ASN C 3 59  ? -20.814 -28.250 42.751  1.00 47.96 ? 58  ASN H OD1 1 
ATOM   3346 N  ND2 . ASN C 3 59  ? -18.735 -27.633 42.168  1.00 44.51 ? 58  ASN H ND2 1 
ATOM   3347 N  N   . TYR C 3 60  ? -22.699 -29.232 38.297  1.00 19.41 ? 59  TYR H N   1 
ATOM   3348 C  CA  . TYR C 3 60  ? -23.373 -29.107 37.000  1.00 21.19 ? 59  TYR H CA  1 
ATOM   3349 C  C   . TYR C 3 60  ? -24.267 -27.878 36.919  1.00 22.32 ? 59  TYR H C   1 
ATOM   3350 O  O   . TYR C 3 60  ? -24.961 -27.541 37.881  1.00 22.43 ? 59  TYR H O   1 
ATOM   3351 C  CB  . TYR C 3 60  ? -24.258 -30.331 36.716  1.00 23.44 ? 59  TYR H CB  1 
ATOM   3352 C  CG  . TYR C 3 60  ? -23.515 -31.639 36.599  1.00 23.53 ? 59  TYR H CG  1 
ATOM   3353 C  CD1 . TYR C 3 60  ? -23.188 -32.371 37.731  1.00 24.37 ? 59  TYR H CD1 1 
ATOM   3354 C  CD2 . TYR C 3 60  ? -23.169 -32.158 35.353  1.00 24.81 ? 59  TYR H CD2 1 
ATOM   3355 C  CE1 . TYR C 3 60  ? -22.511 -33.577 37.633  1.00 25.11 ? 59  TYR H CE1 1 
ATOM   3356 C  CE2 . TYR C 3 60  ? -22.491 -33.376 35.245  1.00 24.43 ? 59  TYR H CE2 1 
ATOM   3357 C  CZ  . TYR C 3 60  ? -22.163 -34.074 36.395  1.00 24.63 ? 59  TYR H CZ  1 
ATOM   3358 O  OH  . TYR C 3 60  ? -21.491 -35.283 36.329  1.00 25.63 ? 59  TYR H OH  1 
ATOM   3359 N  N   . ASN C 3 61  ? -24.272 -27.231 35.752  1.00 23.05 ? 60  ASN H N   1 
ATOM   3360 C  CA  . ASN C 3 61  ? -25.318 -26.269 35.393  1.00 19.64 ? 60  ASN H CA  1 
ATOM   3361 C  C   . ASN C 3 61  ? -26.639 -27.027 35.456  1.00 24.39 ? 60  ASN H C   1 
ATOM   3362 O  O   . ASN C 3 61  ? -26.752 -28.110 34.866  1.00 22.78 ? 60  ASN H O   1 
ATOM   3363 C  CB  . ASN C 3 61  ? -25.077 -25.754 33.962  1.00 20.84 ? 60  ASN H CB  1 
ATOM   3364 C  CG  . ASN C 3 61  ? -25.957 -24.564 33.584  1.00 22.16 ? 60  ASN H CG  1 
ATOM   3365 O  OD1 . ASN C 3 61  ? -27.087 -24.413 34.064  1.00 24.02 ? 60  ASN H OD1 1 
ATOM   3366 N  ND2 . ASN C 3 61  ? -25.437 -23.707 32.705  1.00 19.32 ? 60  ASN H ND2 1 
ATOM   3367 N  N   . GLN C 3 62  ? -27.622 -26.492 36.184  1.00 24.25 ? 61  GLN H N   1 
ATOM   3368 C  CA  . GLN C 3 62  ? -28.944 -27.127 36.250  1.00 29.89 ? 61  GLN H CA  1 
ATOM   3369 C  C   . GLN C 3 62  ? -29.501 -27.424 34.848  1.00 27.03 ? 61  GLN H C   1 
ATOM   3370 O  O   . GLN C 3 62  ? -30.145 -28.453 34.651  1.00 27.38 ? 61  GLN H O   1 
ATOM   3371 C  CB  . GLN C 3 62  ? -29.933 -26.296 37.088  1.00 32.77 ? 61  GLN H CB  1 
ATOM   3372 C  CG  . GLN C 3 62  ? -31.330 -26.930 37.223  1.00 40.94 ? 61  GLN H CG  1 
ATOM   3373 C  CD  . GLN C 3 62  ? -32.182 -26.312 38.332  1.00 44.92 ? 61  GLN H CD  1 
ATOM   3374 O  OE1 . GLN C 3 62  ? -31.661 -25.698 39.271  1.00 53.17 ? 61  GLN H OE1 1 
ATOM   3375 N  NE2 . GLN C 3 62  ? -33.500 -26.489 38.232  1.00 48.68 ? 61  GLN H NE2 1 
ATOM   3376 N  N   . LYS C 3 63  ? -29.233 -26.544 33.878  1.00 27.34 ? 62  LYS H N   1 
ATOM   3377 C  CA  . LYS C 3 63  ? -29.700 -26.746 32.487  1.00 29.52 ? 62  LYS H CA  1 
ATOM   3378 C  C   . LYS C 3 63  ? -29.198 -28.074 31.872  1.00 28.03 ? 62  LYS H C   1 
ATOM   3379 O  O   . LYS C 3 63  ? -29.851 -28.639 30.990  1.00 29.83 ? 62  LYS H O   1 
ATOM   3380 C  CB  . LYS C 3 63  ? -29.325 -25.547 31.592  1.00 29.16 ? 62  LYS H CB  1 
ATOM   3381 C  CG  . LYS C 3 63  ? -29.781 -25.674 30.131  1.00 31.98 ? 62  LYS H CG  1 
ATOM   3382 C  CD  . LYS C 3 63  ? -29.139 -24.655 29.190  1.00 34.27 ? 62  LYS H CD  1 
ATOM   3383 C  CE  . LYS C 3 63  ? -29.557 -24.916 27.741  1.00 32.48 ? 62  LYS H CE  1 
ATOM   3384 N  NZ  . LYS C 3 63  ? -29.533 -23.681 26.895  1.00 32.71 ? 62  LYS H NZ  1 
ATOM   3385 N  N   . PHE C 3 64  ? -28.057 -28.565 32.363  1.00 24.77 ? 63  PHE H N   1 
ATOM   3386 C  CA  . PHE C 3 64  ? -27.409 -29.781 31.847  1.00 25.18 ? 63  PHE H CA  1 
ATOM   3387 C  C   . PHE C 3 64  ? -27.432 -30.969 32.828  1.00 27.65 ? 63  PHE H C   1 
ATOM   3388 O  O   . PHE C 3 64  ? -26.918 -32.043 32.518  1.00 29.98 ? 63  PHE H O   1 
ATOM   3389 C  CB  . PHE C 3 64  ? -25.963 -29.461 31.427  1.00 21.83 ? 63  PHE H CB  1 
ATOM   3390 C  CG  . PHE C 3 64  ? -25.883 -28.506 30.274  1.00 25.28 ? 63  PHE H CG  1 
ATOM   3391 C  CD1 . PHE C 3 64  ? -26.013 -28.970 28.966  1.00 26.65 ? 63  PHE H CD1 1 
ATOM   3392 C  CD2 . PHE C 3 64  ? -25.749 -27.139 30.489  1.00 23.14 ? 63  PHE H CD2 1 
ATOM   3393 C  CE1 . PHE C 3 64  ? -25.992 -28.095 27.896  1.00 24.62 ? 63  PHE H CE1 1 
ATOM   3394 C  CE2 . PHE C 3 64  ? -25.707 -26.248 29.411  1.00 25.03 ? 63  PHE H CE2 1 
ATOM   3395 C  CZ  . PHE C 3 64  ? -25.823 -26.730 28.118  1.00 27.25 ? 63  PHE H CZ  1 
ATOM   3396 N  N   . LYS C 3 65  ? -28.040 -30.777 33.995  1.00 29.38 ? 64  LYS H N   1 
ATOM   3397 C  CA  . LYS C 3 65  ? -28.037 -31.797 35.050  1.00 32.90 ? 64  LYS H CA  1 
ATOM   3398 C  C   . LYS C 3 65  ? -28.569 -33.162 34.586  1.00 34.24 ? 64  LYS H C   1 
ATOM   3399 O  O   . LYS C 3 65  ? -27.997 -34.199 34.932  1.00 34.45 ? 64  LYS H O   1 
ATOM   3400 C  CB  . LYS C 3 65  ? -28.811 -31.318 36.281  1.00 37.03 ? 64  LYS H CB  1 
ATOM   3401 C  CG  . LYS C 3 65  ? -28.350 -31.993 37.559  1.00 42.90 ? 64  LYS H CG  1 
ATOM   3402 C  CD  . LYS C 3 65  ? -29.408 -31.934 38.645  1.00 48.70 ? 64  LYS H CD  1 
ATOM   3403 C  CE  . LYS C 3 65  ? -28.884 -32.538 39.939  1.00 49.90 ? 64  LYS H CE  1 
ATOM   3404 N  NZ  . LYS C 3 65  ? -29.888 -32.452 41.036  1.00 52.84 ? 64  LYS H NZ  1 
ATOM   3405 N  N   . ASP C 3 66  ? -29.645 -33.158 33.799  1.00 31.65 ? 65  ASP H N   1 
ATOM   3406 C  CA  . ASP C 3 66  ? -30.240 -34.404 33.295  1.00 36.01 ? 65  ASP H CA  1 
ATOM   3407 C  C   . ASP C 3 66  ? -29.477 -34.997 32.101  1.00 33.60 ? 65  ASP H C   1 
ATOM   3408 O  O   . ASP C 3 66  ? -29.602 -36.182 31.796  1.00 35.92 ? 65  ASP H O   1 
ATOM   3409 C  CB  . ASP C 3 66  ? -31.705 -34.173 32.907  1.00 40.88 ? 65  ASP H CB  1 
ATOM   3410 C  CG  . ASP C 3 66  ? -32.582 -33.791 34.098  1.00 46.39 ? 65  ASP H CG  1 
ATOM   3411 O  OD1 . ASP C 3 66  ? -32.239 -34.136 35.254  1.00 45.22 ? 65  ASP H OD1 1 
ATOM   3412 O  OD2 . ASP C 3 66  ? -33.628 -33.144 33.865  1.00 49.55 ? 65  ASP H OD2 1 
ATOM   3413 N  N   . LYS C 3 67  ? -28.678 -34.160 31.454  1.00 28.14 ? 66  LYS H N   1 
ATOM   3414 C  CA  . LYS C 3 67  ? -28.049 -34.470 30.177  1.00 29.82 ? 66  LYS H CA  1 
ATOM   3415 C  C   . LYS C 3 67  ? -26.600 -34.970 30.337  1.00 31.19 ? 66  LYS H C   1 
ATOM   3416 O  O   . LYS C 3 67  ? -26.207 -35.949 29.699  1.00 31.70 ? 66  LYS H O   1 
ATOM   3417 C  CB  . LYS C 3 67  ? -28.115 -33.207 29.297  1.00 31.32 ? 66  LYS H CB  1 
ATOM   3418 C  CG  . LYS C 3 67  ? -27.356 -33.231 27.957  1.00 33.31 ? 66  LYS H CG  1 
ATOM   3419 C  CD  . LYS C 3 67  ? -28.059 -34.068 26.894  1.00 31.93 ? 66  LYS H CD  1 
ATOM   3420 C  CE  . LYS C 3 67  ? -29.463 -33.570 26.609  1.00 32.24 ? 66  LYS H CE  1 
ATOM   3421 N  NZ  . LYS C 3 67  ? -30.165 -34.484 25.675  1.00 29.98 ? 66  LYS H NZ  1 
ATOM   3422 N  N   . ALA C 3 68  ? -25.829 -34.312 31.206  1.00 23.17 ? 67  ALA H N   1 
ATOM   3423 C  CA  . ALA C 3 68  ? -24.369 -34.481 31.249  1.00 23.00 ? 67  ALA H CA  1 
ATOM   3424 C  C   . ALA C 3 68  ? -23.873 -35.301 32.432  1.00 20.26 ? 67  ALA H C   1 
ATOM   3425 O  O   . ALA C 3 68  ? -24.458 -35.258 33.511  1.00 24.86 ? 67  ALA H O   1 
ATOM   3426 C  CB  . ALA C 3 68  ? -23.676 -33.105 31.233  1.00 20.26 ? 67  ALA H CB  1 
ATOM   3427 N  N   . THR C 3 69  ? -22.787 -36.044 32.212  1.00 21.96 ? 68  THR H N   1 
ATOM   3428 C  CA  . THR C 3 69  ? -22.032 -36.700 33.293  1.00 20.63 ? 68  THR H CA  1 
ATOM   3429 C  C   . THR C 3 69  ? -20.542 -36.468 33.092  1.00 20.35 ? 68  THR H C   1 
ATOM   3430 O  O   . THR C 3 69  ? -19.996 -36.759 32.028  1.00 18.44 ? 68  THR H O   1 
ATOM   3431 C  CB  . THR C 3 69  ? -22.294 -38.213 33.352  1.00 22.96 ? 68  THR H CB  1 
ATOM   3432 O  OG1 . THR C 3 69  ? -23.702 -38.451 33.487  1.00 21.26 ? 68  THR H OG1 1 
ATOM   3433 C  CG2 . THR C 3 69  ? -21.531 -38.860 34.532  1.00 23.34 ? 68  THR H CG2 1 
ATOM   3434 N  N   . MET C 3 70  ? -19.899 -35.926 34.120  1.00 18.67 ? 69  MET H N   1 
ATOM   3435 C  CA  . MET C 3 70  ? -18.467 -35.657 34.082  1.00 21.21 ? 69  MET H CA  1 
ATOM   3436 C  C   . MET C 3 70  ? -17.716 -36.683 34.918  1.00 18.57 ? 69  MET H C   1 
ATOM   3437 O  O   . MET C 3 70  ? -18.094 -36.964 36.069  1.00 19.54 ? 69  MET H O   1 
ATOM   3438 C  CB  . MET C 3 70  ? -18.171 -34.246 34.597  1.00 20.99 ? 69  MET H CB  1 
ATOM   3439 C  CG  . MET C 3 70  ? -18.633 -33.112 33.679  1.00 20.25 ? 69  MET H CG  1 
ATOM   3440 S  SD  . MET C 3 70  ? -18.430 -31.479 34.438  1.00 22.40 ? 69  MET H SD  1 
ATOM   3441 C  CE  . MET C 3 70  ? -19.416 -31.695 35.918  1.00 18.82 ? 69  MET H CE  1 
ATOM   3442 N  N   . THR C 3 71  ? -16.658 -37.250 34.336  1.00 22.08 ? 70  THR H N   1 
ATOM   3443 C  CA  . THR C 3 71  ? -15.763 -38.165 35.050  1.00 20.78 ? 70  THR H CA  1 
ATOM   3444 C  C   . THR C 3 71  ? -14.294 -37.840 34.730  1.00 20.74 ? 70  THR H C   1 
ATOM   3445 O  O   . THR C 3 71  ? -14.013 -37.077 33.808  1.00 22.20 ? 70  THR H O   1 
ATOM   3446 C  CB  . THR C 3 71  ? -16.057 -39.651 34.703  1.00 22.43 ? 70  THR H CB  1 
ATOM   3447 O  OG1 . THR C 3 71  ? -15.915 -39.861 33.293  1.00 26.16 ? 70  THR H OG1 1 
ATOM   3448 C  CG2 . THR C 3 71  ? -17.471 -40.058 35.153  1.00 22.34 ? 70  THR H CG2 1 
ATOM   3449 N  N   . VAL C 3 72  ? -13.362 -38.399 35.500  1.00 24.74 ? 71  VAL H N   1 
ATOM   3450 C  CA  . VAL C 3 72  ? -11.929 -38.322 35.165  1.00 23.28 ? 71  VAL H CA  1 
ATOM   3451 C  C   . VAL C 3 72  ? -11.256 -39.691 35.313  1.00 23.40 ? 71  VAL H C   1 
ATOM   3452 O  O   . VAL C 3 72  ? -11.698 -40.539 36.096  1.00 24.51 ? 71  VAL H O   1 
ATOM   3453 C  CB  . VAL C 3 72  ? -11.125 -37.283 36.031  1.00 25.17 ? 71  VAL H CB  1 
ATOM   3454 C  CG1 . VAL C 3 72  ? -11.440 -35.863 35.640  1.00 29.67 ? 71  VAL H CG1 1 
ATOM   3455 C  CG2 . VAL C 3 72  ? -11.351 -37.505 37.552  1.00 26.83 ? 71  VAL H CG2 1 
ATOM   3456 N  N   . ASP C 3 73  ? -10.183 -39.889 34.557  1.00 23.38 ? 72  ASP H N   1 
ATOM   3457 C  CA  . ASP C 3 73  ? -9.274  -40.997 34.785  1.00 25.52 ? 72  ASP H CA  1 
ATOM   3458 C  C   . ASP C 3 73  ? -7.912  -40.390 35.087  1.00 27.90 ? 72  ASP H C   1 
ATOM   3459 O  O   . ASP C 3 73  ? -7.190  -39.962 34.182  1.00 27.35 ? 72  ASP H O   1 
ATOM   3460 C  CB  . ASP C 3 73  ? -9.212  -41.937 33.577  1.00 27.43 ? 72  ASP H CB  1 
ATOM   3461 C  CG  . ASP C 3 73  ? -8.203  -43.076 33.769  1.00 32.97 ? 72  ASP H CG  1 
ATOM   3462 O  OD1 . ASP C 3 73  ? -7.929  -43.453 34.930  1.00 31.07 ? 72  ASP H OD1 1 
ATOM   3463 O  OD2 . ASP C 3 73  ? -7.685  -43.588 32.758  1.00 34.55 ? 72  ASP H OD2 1 
ATOM   3464 N  N   . ILE C 3 74  ? -7.569  -40.341 36.370  1.00 30.03 ? 73  ILE H N   1 
ATOM   3465 C  CA  . ILE C 3 74  ? -6.346  -39.672 36.803  1.00 33.10 ? 73  ILE H CA  1 
ATOM   3466 C  C   . ILE C 3 74  ? -5.089  -40.324 36.218  1.00 33.17 ? 73  ILE H C   1 
ATOM   3467 O  O   . ILE C 3 74  ? -4.192  -39.619 35.765  1.00 35.23 ? 73  ILE H O   1 
ATOM   3468 C  CB  . ILE C 3 74  ? -6.280  -39.505 38.349  1.00 35.26 ? 73  ILE H CB  1 
ATOM   3469 C  CG1 . ILE C 3 74  ? -7.408  -38.564 38.814  1.00 33.53 ? 73  ILE H CG1 1 
ATOM   3470 C  CG2 . ILE C 3 74  ? -4.924  -38.919 38.780  1.00 33.90 ? 73  ILE H CG2 1 
ATOM   3471 C  CD1 . ILE C 3 74  ? -7.731  -38.629 40.306  1.00 34.98 ? 73  ILE H CD1 1 
ATOM   3472 N  N   . SER C 3 75  ? -5.056  -41.655 36.173  1.00 34.16 ? 74  SER H N   1 
ATOM   3473 C  CA  . SER C 3 75  ? -3.870  -42.382 35.696  1.00 35.04 ? 74  SER H CA  1 
ATOM   3474 C  C   . SER C 3 75  ? -3.492  -42.038 34.250  1.00 35.16 ? 74  SER H C   1 
ATOM   3475 O  O   . SER C 3 75  ? -2.317  -42.111 33.883  1.00 32.99 ? 74  SER H O   1 
ATOM   3476 C  CB  . SER C 3 75  ? -4.018  -43.897 35.897  1.00 33.48 ? 74  SER H CB  1 
ATOM   3477 O  OG  . SER C 3 75  ? -5.051  -44.435 35.090  1.00 33.38 ? 74  SER H OG  1 
ATOM   3478 N  N   . SER C 3 76  ? -4.482  -41.641 33.446  1.00 32.30 ? 75  SER H N   1 
ATOM   3479 C  CA  . SER C 3 76  ? -4.239  -41.280 32.048  1.00 31.98 ? 75  SER H CA  1 
ATOM   3480 C  C   . SER C 3 76  ? -4.421  -39.780 31.777  1.00 30.64 ? 75  SER H C   1 
ATOM   3481 O  O   . SER C 3 76  ? -4.385  -39.346 30.623  1.00 30.14 ? 75  SER H O   1 
ATOM   3482 C  CB  . SER C 3 76  ? -5.133  -42.102 31.122  1.00 31.80 ? 75  SER H CB  1 
ATOM   3483 O  OG  . SER C 3 76  ? -6.477  -41.677 31.229  1.00 33.94 ? 75  SER H OG  1 
ATOM   3484 N  N   . SER C 3 77  ? -4.602  -39.001 32.844  1.00 25.95 ? 76  SER H N   1 
ATOM   3485 C  CA  . SER C 3 77  ? -4.755  -37.540 32.757  1.00 26.16 ? 76  SER H CA  1 
ATOM   3486 C  C   . SER C 3 77  ? -5.865  -37.112 31.777  1.00 25.55 ? 76  SER H C   1 
ATOM   3487 O  O   . SER C 3 77  ? -5.675  -36.183 30.986  1.00 22.54 ? 76  SER H O   1 
ATOM   3488 C  CB  . SER C 3 77  ? -3.424  -36.867 32.367  1.00 27.43 ? 76  SER H CB  1 
ATOM   3489 O  OG  . SER C 3 77  ? -2.347  -37.315 33.175  1.00 26.73 ? 76  SER H OG  1 
ATOM   3490 N  N   . THR C 3 78  ? -7.009  -37.796 31.840  1.00 24.50 ? 77  THR H N   1 
ATOM   3491 C  CA  . THR C 3 78  ? -8.102  -37.599 30.884  1.00 21.58 ? 77  THR H CA  1 
ATOM   3492 C  C   . THR C 3 78  ? -9.427  -37.372 31.595  1.00 24.91 ? 77  THR H C   1 
ATOM   3493 O  O   . THR C 3 78  ? -9.807  -38.144 32.484  1.00 28.19 ? 77  THR H O   1 
ATOM   3494 C  CB  . THR C 3 78  ? -8.253  -38.813 29.917  1.00 26.14 ? 77  THR H CB  1 
ATOM   3495 O  OG1 . THR C 3 78  ? -7.007  -39.049 29.245  1.00 25.01 ? 77  THR H OG1 1 
ATOM   3496 C  CG2 . THR C 3 78  ? -9.356  -38.541 28.870  1.00 23.53 ? 77  THR H CG2 1 
ATOM   3497 N  N   . ALA C 3 79  ? -10.125 -36.307 31.202  1.00 22.03 ? 78  ALA H N   1 
ATOM   3498 C  CA  . ALA C 3 79  ? -11.482 -36.074 31.669  1.00 19.92 ? 78  ALA H CA  1 
ATOM   3499 C  C   . ALA C 3 79  ? -12.462 -36.471 30.581  1.00 21.11 ? 78  ALA H C   1 
ATOM   3500 O  O   . ALA C 3 79  ? -12.151 -36.363 29.399  1.00 22.63 ? 78  ALA H O   1 
ATOM   3501 C  CB  . ALA C 3 79  ? -11.683 -34.636 32.024  1.00 17.24 ? 78  ALA H CB  1 
ATOM   3502 N  N   . TYR C 3 80  ? -13.659 -36.890 30.987  1.00 20.78 ? 79  TYR H N   1 
ATOM   3503 C  CA  . TYR C 3 80  ? -14.695 -37.318 30.048  1.00 19.38 ? 79  TYR H CA  1 
ATOM   3504 C  C   . TYR C 3 80  ? -16.011 -36.573 30.269  1.00 20.66 ? 79  TYR H C   1 
ATOM   3505 O  O   . TYR C 3 80  ? -16.404 -36.326 31.407  1.00 21.52 ? 79  TYR H O   1 
ATOM   3506 C  CB  . TYR C 3 80  ? -14.948 -38.826 30.179  1.00 25.13 ? 79  TYR H CB  1 
ATOM   3507 C  CG  . TYR C 3 80  ? -13.732 -39.670 29.920  1.00 26.76 ? 79  TYR H CG  1 
ATOM   3508 C  CD1 . TYR C 3 80  ? -13.402 -40.066 28.624  1.00 24.75 ? 79  TYR H CD1 1 
ATOM   3509 C  CD2 . TYR C 3 80  ? -12.895 -40.063 30.972  1.00 29.23 ? 79  TYR H CD2 1 
ATOM   3510 C  CE1 . TYR C 3 80  ? -12.281 -40.827 28.377  1.00 25.95 ? 79  TYR H CE1 1 
ATOM   3511 C  CE2 . TYR C 3 80  ? -11.770 -40.825 30.736  1.00 26.74 ? 79  TYR H CE2 1 
ATOM   3512 C  CZ  . TYR C 3 80  ? -11.466 -41.202 29.440  1.00 28.72 ? 79  TYR H CZ  1 
ATOM   3513 O  OH  . TYR C 3 80  ? -10.347 -41.967 29.198  1.00 31.53 ? 79  TYR H OH  1 
ATOM   3514 N  N   . LEU C 3 81  ? -16.687 -36.237 29.174  1.00 21.54 ? 80  LEU H N   1 
ATOM   3515 C  CA  . LEU C 3 81  ? -18.041 -35.680 29.220  1.00 17.25 ? 80  LEU H CA  1 
ATOM   3516 C  C   . LEU C 3 81  ? -18.985 -36.608 28.454  1.00 19.44 ? 80  LEU H C   1 
ATOM   3517 O  O   . LEU C 3 81  ? -18.790 -36.863 27.261  1.00 18.77 ? 80  LEU H O   1 
ATOM   3518 C  CB  . LEU C 3 81  ? -18.092 -34.270 28.611  1.00 19.02 ? 80  LEU H CB  1 
ATOM   3519 C  CG  . LEU C 3 81  ? -19.478 -33.606 28.511  1.00 19.72 ? 80  LEU H CG  1 
ATOM   3520 C  CD1 . LEU C 3 81  ? -20.133 -33.401 29.883  1.00 22.26 ? 80  LEU H CD1 1 
ATOM   3521 C  CD2 . LEU C 3 81  ? -19.390 -32.263 27.728  1.00 17.84 ? 80  LEU H CD2 1 
ATOM   3522 N  N   . GLU C 3 82  ? -19.983 -37.132 29.158  1.00 20.82 ? 81  GLU H N   1 
ATOM   3523 C  CA  . GLU C 3 82  ? -20.988 -37.987 28.553  1.00 21.71 ? 81  GLU H CA  1 
ATOM   3524 C  C   . GLU C 3 82  ? -22.317 -37.252 28.490  1.00 23.67 ? 81  GLU H C   1 
ATOM   3525 O  O   . GLU C 3 82  ? -22.831 -36.778 29.505  1.00 25.60 ? 81  GLU H O   1 
ATOM   3526 C  CB  . GLU C 3 82  ? -21.137 -39.306 29.318  1.00 22.97 ? 81  GLU H CB  1 
ATOM   3527 C  CG  . GLU C 3 82  ? -22.225 -40.219 28.736  1.00 27.45 ? 81  GLU H CG  1 
ATOM   3528 C  CD  . GLU C 3 82  ? -22.052 -41.697 29.085  1.00 34.03 ? 81  GLU H CD  1 
ATOM   3529 O  OE1 . GLU C 3 82  ? -21.587 -42.012 30.203  1.00 35.45 ? 81  GLU H OE1 1 
ATOM   3530 O  OE2 . GLU C 3 82  ? -22.404 -42.547 28.232  1.00 36.56 ? 81  GLU H OE2 1 
ATOM   3531 N  N   . LEU C 3 83  ? -22.860 -37.154 27.283  1.00 22.40 ? 82  LEU H N   1 
ATOM   3532 C  CA  . LEU C 3 83  ? -24.136 -36.493 27.047  1.00 22.09 ? 82  LEU H CA  1 
ATOM   3533 C  C   . LEU C 3 83  ? -25.123 -37.557 26.615  1.00 23.50 ? 82  LEU H C   1 
ATOM   3534 O  O   . LEU C 3 83  ? -24.887 -38.259 25.640  1.00 22.24 ? 82  LEU H O   1 
ATOM   3535 C  CB  . LEU C 3 83  ? -23.985 -35.428 25.953  1.00 24.99 ? 82  LEU H CB  1 
ATOM   3536 C  CG  . LEU C 3 83  ? -22.894 -34.383 26.199  1.00 26.23 ? 82  LEU H CG  1 
ATOM   3537 C  CD1 . LEU C 3 83  ? -22.503 -33.679 24.899  1.00 27.30 ? 82  LEU H CD1 1 
ATOM   3538 C  CD2 . LEU C 3 83  ? -23.347 -33.393 27.244  1.00 24.23 ? 82  LEU H CD2 1 
ATOM   3539 N  N   . ALA C 3 84  A -26.219 -37.677 27.353  1.00 23.07 ? 82  ALA H N   1 
ATOM   3540 C  CA  . ALA C 3 84  A -27.179 -38.745 27.139  1.00 20.24 ? 82  ALA H CA  1 
ATOM   3541 C  C   . ALA C 3 84  A -28.380 -38.244 26.351  1.00 18.28 ? 82  ALA H C   1 
ATOM   3542 O  O   . ALA C 3 84  A -28.635 -37.036 26.297  1.00 19.93 ? 82  ALA H O   1 
ATOM   3543 C  CB  . ALA C 3 84  A -27.616 -39.318 28.477  1.00 22.54 ? 82  ALA H CB  1 
ATOM   3544 N  N   . ARG C 3 85  B -29.077 -39.178 25.713  1.00 21.32 ? 82  ARG H N   1 
ATOM   3545 C  CA  . ARG C 3 85  B -30.400 -38.940 25.125  1.00 27.25 ? 82  ARG H CA  1 
ATOM   3546 C  C   . ARG C 3 85  B -30.390 -37.757 24.164  1.00 23.92 ? 82  ARG H C   1 
ATOM   3547 O  O   . ARG C 3 85  B -31.193 -36.822 24.273  1.00 23.63 ? 82  ARG H O   1 
ATOM   3548 C  CB  . ARG C 3 85  B -31.454 -38.759 26.222  1.00 28.90 ? 82  ARG H CB  1 
ATOM   3549 C  CG  . ARG C 3 85  B -31.717 -40.015 27.036  1.00 33.67 ? 82  ARG H CG  1 
ATOM   3550 C  CD  . ARG C 3 85  B -32.827 -39.790 28.060  1.00 35.48 ? 82  ARG H CD  1 
ATOM   3551 N  NE  . ARG C 3 85  B -32.442 -38.765 29.030  1.00 39.43 ? 82  ARG H NE  1 
ATOM   3552 C  CZ  . ARG C 3 85  B -31.625 -38.975 30.059  1.00 43.49 ? 82  ARG H CZ  1 
ATOM   3553 N  NH1 . ARG C 3 85  B -31.105 -40.180 30.275  1.00 41.70 ? 82  ARG H NH1 1 
ATOM   3554 N  NH2 . ARG C 3 85  B -31.330 -37.974 30.878  1.00 46.09 ? 82  ARG H NH2 1 
ATOM   3555 N  N   . LEU C 3 86  C -29.466 -37.812 23.216  1.00 22.78 ? 82  LEU H N   1 
ATOM   3556 C  CA  . LEU C 3 86  C -29.210 -36.684 22.333  1.00 22.47 ? 82  LEU H CA  1 
ATOM   3557 C  C   . LEU C 3 86  C -30.396 -36.309 21.436  1.00 18.42 ? 82  LEU H C   1 
ATOM   3558 O  O   . LEU C 3 86  C -31.117 -37.166 20.939  1.00 18.08 ? 82  LEU H O   1 
ATOM   3559 C  CB  . LEU C 3 86  C -27.946 -36.931 21.503  1.00 22.08 ? 82  LEU H CB  1 
ATOM   3560 C  CG  . LEU C 3 86  C -26.646 -37.130 22.290  1.00 25.81 ? 82  LEU H CG  1 
ATOM   3561 C  CD1 . LEU C 3 86  C -25.517 -37.499 21.352  1.00 30.20 ? 82  LEU H CD1 1 
ATOM   3562 C  CD2 . LEU C 3 86  C -26.267 -35.904 23.113  1.00 22.88 ? 82  LEU H CD2 1 
ATOM   3563 N  N   . THR C 3 87  ? -30.586 -35.005 21.266  1.00 21.33 ? 83  THR H N   1 
ATOM   3564 C  CA  . THR C 3 87  ? -31.550 -34.452 20.322  1.00 23.57 ? 83  THR H CA  1 
ATOM   3565 C  C   . THR C 3 87  ? -30.820 -33.452 19.417  1.00 25.34 ? 83  THR H C   1 
ATOM   3566 O  O   . THR C 3 87  ? -29.629 -33.179 19.609  1.00 20.51 ? 83  THR H O   1 
ATOM   3567 C  CB  . THR C 3 87  ? -32.738 -33.746 21.046  1.00 25.51 ? 83  THR H CB  1 
ATOM   3568 O  OG1 . THR C 3 87  ? -32.268 -32.614 21.793  1.00 26.45 ? 83  THR H OG1 1 
ATOM   3569 C  CG2 . THR C 3 87  ? -33.448 -34.705 21.995  1.00 26.48 ? 83  THR H CG2 1 
ATOM   3570 N  N   . SER C 3 88  ? -31.534 -32.912 18.433  1.00 27.22 ? 84  SER H N   1 
ATOM   3571 C  CA  . SER C 3 88  ? -31.006 -31.850 17.563  1.00 28.75 ? 84  SER H CA  1 
ATOM   3572 C  C   . SER C 3 88  ? -30.392 -30.690 18.347  1.00 30.21 ? 84  SER H C   1 
ATOM   3573 O  O   . SER C 3 88  ? -29.354 -30.153 17.945  1.00 31.61 ? 84  SER H O   1 
ATOM   3574 C  CB  . SER C 3 88  ? -32.095 -31.339 16.610  1.00 32.37 ? 84  SER H CB  1 
ATOM   3575 O  OG  . SER C 3 88  ? -33.194 -30.798 17.328  1.00 37.25 ? 84  SER H OG  1 
ATOM   3576 N  N   . GLU C 3 89  ? -31.009 -30.323 19.469  1.00 29.02 ? 85  GLU H N   1 
ATOM   3577 C  CA  . GLU C 3 89  ? -30.468 -29.259 20.332  1.00 33.73 ? 85  GLU H CA  1 
ATOM   3578 C  C   . GLU C 3 89  ? -29.022 -29.532 20.772  1.00 27.92 ? 85  GLU H C   1 
ATOM   3579 O  O   . GLU C 3 89  ? -28.297 -28.627 21.201  1.00 25.65 ? 85  GLU H O   1 
ATOM   3580 C  CB  . GLU C 3 89  ? -31.354 -29.049 21.575  1.00 39.76 ? 85  GLU H CB  1 
ATOM   3581 C  CG  . GLU C 3 89  ? -32.871 -29.145 21.342  1.00 49.05 ? 85  GLU H CG  1 
ATOM   3582 C  CD  . GLU C 3 89  ? -33.456 -27.949 20.596  1.00 55.47 ? 85  GLU H CD  1 
ATOM   3583 O  OE1 . GLU C 3 89  ? -32.754 -26.919 20.452  1.00 59.41 ? 85  GLU H OE1 1 
ATOM   3584 O  OE2 . GLU C 3 89  ? -34.628 -28.041 20.157  1.00 55.40 ? 85  GLU H OE2 1 
ATOM   3585 N  N   . ASP C 3 90  ? -28.598 -30.786 20.676  1.00 24.69 ? 86  ASP H N   1 
ATOM   3586 C  CA  . ASP C 3 90  ? -27.296 -31.165 21.215  1.00 20.37 ? 86  ASP H CA  1 
ATOM   3587 C  C   . ASP C 3 90  ? -26.159 -31.079 20.192  1.00 18.42 ? 86  ASP H C   1 
ATOM   3588 O  O   . ASP C 3 90  ? -24.997 -31.162 20.571  1.00 19.03 ? 86  ASP H O   1 
ATOM   3589 C  CB  . ASP C 3 90  ? -27.376 -32.550 21.857  1.00 25.61 ? 86  ASP H CB  1 
ATOM   3590 C  CG  . ASP C 3 90  ? -28.298 -32.574 23.068  1.00 28.34 ? 86  ASP H CG  1 
ATOM   3591 O  OD1 . ASP C 3 90  ? -28.159 -31.698 23.950  1.00 29.36 ? 86  ASP H OD1 1 
ATOM   3592 O  OD2 . ASP C 3 90  ? -29.167 -33.466 23.140  1.00 26.62 ? 86  ASP H OD2 1 
ATOM   3593 N  N   . SER C 3 91  ? -26.488 -30.916 18.907  1.00 19.58 ? 87  SER H N   1 
ATOM   3594 C  CA  . SER C 3 91  ? -25.442 -30.668 17.892  1.00 21.06 ? 87  SER H CA  1 
ATOM   3595 C  C   . SER C 3 91  ? -24.777 -29.321 18.164  1.00 20.98 ? 87  SER H C   1 
ATOM   3596 O  O   . SER C 3 91  ? -25.452 -28.271 18.153  1.00 18.43 ? 87  SER H O   1 
ATOM   3597 C  CB  . SER C 3 91  ? -26.013 -30.702 16.480  1.00 20.66 ? 87  SER H CB  1 
ATOM   3598 O  OG  . SER C 3 91  ? -26.586 -31.958 16.195  1.00 18.57 ? 87  SER H OG  1 
ATOM   3599 N  N   . ALA C 3 92  ? -23.469 -29.356 18.427  1.00 17.62 ? 88  ALA H N   1 
ATOM   3600 C  CA  . ALA C 3 92  ? -22.698 -28.176 18.847  1.00 17.91 ? 88  ALA H CA  1 
ATOM   3601 C  C   . ALA C 3 92  ? -21.223 -28.537 18.951  1.00 20.60 ? 88  ALA H C   1 
ATOM   3602 O  O   . ALA C 3 92  ? -20.853 -29.693 18.791  1.00 19.99 ? 88  ALA H O   1 
ATOM   3603 C  CB  . ALA C 3 92  ? -23.207 -27.660 20.216  1.00 18.42 ? 88  ALA H CB  1 
ATOM   3604 N  N   . ILE C 3 93  ? -20.392 -27.530 19.210  1.00 19.81 ? 89  ILE H N   1 
ATOM   3605 C  CA  . ILE C 3 93  ? -19.010 -27.721 19.591  1.00 19.42 ? 89  ILE H CA  1 
ATOM   3606 C  C   . ILE C 3 93  ? -18.971 -27.757 21.113  1.00 18.21 ? 89  ILE H C   1 
ATOM   3607 O  O   . ILE C 3 93  ? -19.628 -26.958 21.779  1.00 23.57 ? 89  ILE H O   1 
ATOM   3608 C  CB  . ILE C 3 93  ? -18.105 -26.579 19.050  1.00 21.51 ? 89  ILE H CB  1 
ATOM   3609 C  CG1 . ILE C 3 93  ? -18.151 -26.568 17.512  1.00 24.67 ? 89  ILE H CG1 1 
ATOM   3610 C  CG2 . ILE C 3 93  ? -16.665 -26.721 19.586  1.00 22.23 ? 89  ILE H CG2 1 
ATOM   3611 C  CD1 . ILE C 3 93  ? -17.486 -25.343 16.859  1.00 31.46 ? 89  ILE H CD1 1 
ATOM   3612 N  N   . TYR C 3 94  ? -18.233 -28.720 21.652  1.00 19.52 ? 90  TYR H N   1 
ATOM   3613 C  CA  . TYR C 3 94  ? -18.045 -28.842 23.094  1.00 18.72 ? 90  TYR H CA  1 
ATOM   3614 C  C   . TYR C 3 94  ? -16.573 -28.675 23.407  1.00 21.30 ? 90  TYR H C   1 
ATOM   3615 O  O   . TYR C 3 94  ? -15.717 -29.368 22.814  1.00 21.24 ? 90  TYR H O   1 
ATOM   3616 C  CB  . TYR C 3 94  ? -18.570 -30.198 23.603  1.00 20.99 ? 90  TYR H CB  1 
ATOM   3617 C  CG  . TYR C 3 94  ? -20.064 -30.330 23.443  1.00 19.69 ? 90  TYR H CG  1 
ATOM   3618 C  CD1 . TYR C 3 94  ? -20.620 -30.810 22.254  1.00 18.68 ? 90  TYR H CD1 1 
ATOM   3619 C  CD2 . TYR C 3 94  ? -20.930 -29.942 24.476  1.00 20.33 ? 90  TYR H CD2 1 
ATOM   3620 C  CE1 . TYR C 3 94  ? -22.021 -30.912 22.099  1.00 18.78 ? 90  TYR H CE1 1 
ATOM   3621 C  CE2 . TYR C 3 94  ? -22.311 -30.032 24.333  1.00 19.80 ? 90  TYR H CE2 1 
ATOM   3622 C  CZ  . TYR C 3 94  ? -22.850 -30.523 23.149  1.00 17.36 ? 90  TYR H CZ  1 
ATOM   3623 O  OH  . TYR C 3 94  ? -24.216 -30.612 23.010  1.00 17.63 ? 90  TYR H OH  1 
ATOM   3624 N  N   . TYR C 3 95  ? -16.273 -27.745 24.320  1.00 18.08 ? 91  TYR H N   1 
ATOM   3625 C  CA  . TYR C 3 95  ? -14.913 -27.514 24.773  1.00 21.17 ? 91  TYR H CA  1 
ATOM   3626 C  C   . TYR C 3 95  ? -14.696 -28.034 26.179  1.00 22.46 ? 91  TYR H C   1 
ATOM   3627 O  O   . TYR C 3 95  ? -15.591 -27.943 27.022  1.00 21.16 ? 91  TYR H O   1 
ATOM   3628 C  CB  . TYR C 3 95  ? -14.611 -26.025 24.844  1.00 19.43 ? 91  TYR H CB  1 
ATOM   3629 C  CG  . TYR C 3 95  ? -14.598 -25.309 23.542  1.00 21.40 ? 91  TYR H CG  1 
ATOM   3630 C  CD1 . TYR C 3 95  ? -13.485 -25.379 22.705  1.00 22.84 ? 91  TYR H CD1 1 
ATOM   3631 C  CD2 . TYR C 3 95  ? -15.681 -24.508 23.159  1.00 22.76 ? 91  TYR H CD2 1 
ATOM   3632 C  CE1 . TYR C 3 95  ? -13.463 -24.696 21.487  1.00 23.74 ? 91  TYR H CE1 1 
ATOM   3633 C  CE2 . TYR C 3 95  ? -15.670 -23.829 21.949  1.00 23.77 ? 91  TYR H CE2 1 
ATOM   3634 C  CZ  . TYR C 3 95  ? -14.551 -23.926 21.124  1.00 24.64 ? 91  TYR H CZ  1 
ATOM   3635 O  OH  . TYR C 3 95  ? -14.517 -23.243 19.926  1.00 27.32 ? 91  TYR H OH  1 
ATOM   3636 N  N   . CYS C 3 96  ? -13.495 -28.531 26.444  1.00 19.29 ? 92  CYS H N   1 
ATOM   3637 C  CA  . CYS C 3 96  ? -13.015 -28.559 27.840  1.00 19.08 ? 92  CYS H CA  1 
ATOM   3638 C  C   . CYS C 3 96  ? -12.116 -27.327 28.050  1.00 23.07 ? 92  CYS H C   1 
ATOM   3639 O  O   . CYS C 3 96  ? -11.537 -26.809 27.105  1.00 21.31 ? 92  CYS H O   1 
ATOM   3640 C  CB  . CYS C 3 96  ? -12.259 -29.844 28.148  1.00 22.09 ? 92  CYS H CB  1 
ATOM   3641 S  SG  . CYS C 3 96  ? -10.777 -30.115 27.159  1.00 25.32 ? 92  CYS H SG  1 
ATOM   3642 N  N   . ALA C 3 97  ? -12.019 -26.850 29.285  1.00 22.35 ? 93  ALA H N   1 
ATOM   3643 C  CA  . ALA C 3 97  ? -11.232 -25.658 29.575  1.00 22.83 ? 93  ALA H CA  1 
ATOM   3644 C  C   . ALA C 3 97  ? -10.787 -25.740 31.026  1.00 23.80 ? 93  ALA H C   1 
ATOM   3645 O  O   . ALA C 3 97  ? -11.549 -26.200 31.881  1.00 22.27 ? 93  ALA H O   1 
ATOM   3646 C  CB  . ALA C 3 97  ? -12.055 -24.391 29.325  1.00 21.82 ? 93  ALA H CB  1 
ATOM   3647 N  N   . ARG C 3 98  ? -9.564  -25.288 31.296  1.00 19.00 ? 94  ARG H N   1 
ATOM   3648 C  CA  . ARG C 3 98  ? -8.979  -25.355 32.614  1.00 21.71 ? 94  ARG H CA  1 
ATOM   3649 C  C   . ARG C 3 98  ? -9.158  -24.010 33.331  1.00 25.40 ? 94  ARG H C   1 
ATOM   3650 O  O   . ARG C 3 98  ? -8.998  -22.960 32.715  1.00 24.59 ? 94  ARG H O   1 
ATOM   3651 C  CB  . ARG C 3 98  ? -7.478  -25.622 32.442  1.00 26.10 ? 94  ARG H CB  1 
ATOM   3652 C  CG  . ARG C 3 98  ? -6.734  -25.970 33.682  1.00 30.32 ? 94  ARG H CG  1 
ATOM   3653 C  CD  . ARG C 3 98  ? -5.230  -26.007 33.404  1.00 30.15 ? 94  ARG H CD  1 
ATOM   3654 N  NE  . ARG C 3 98  ? -4.598  -24.684 33.434  1.00 27.07 ? 94  ARG H NE  1 
ATOM   3655 C  CZ  . ARG C 3 98  ? -3.311  -24.496 33.736  1.00 26.43 ? 94  ARG H CZ  1 
ATOM   3656 N  NH1 . ARG C 3 98  ? -2.539  -25.538 34.015  1.00 22.83 ? 94  ARG H NH1 1 
ATOM   3657 N  NH2 . ARG C 3 98  ? -2.791  -23.275 33.758  1.00 27.65 ? 94  ARG H NH2 1 
ATOM   3658 N  N   . ASP C 3 99  ? -9.478  -24.029 34.620  1.00 23.18 ? 95  ASP H N   1 
ATOM   3659 C  CA  . ASP C 3 99  ? -9.310  -22.797 35.389  1.00 23.71 ? 95  ASP H CA  1 
ATOM   3660 C  C   . ASP C 3 99  ? -7.900  -22.753 35.984  1.00 24.19 ? 95  ASP H C   1 
ATOM   3661 O  O   . ASP C 3 99  ? -7.173  -23.753 35.917  1.00 26.48 ? 95  ASP H O   1 
ATOM   3662 C  CB  . ASP C 3 99  ? -10.472 -22.523 36.375  1.00 25.71 ? 95  ASP H CB  1 
ATOM   3663 C  CG  . ASP C 3 99  ? -10.392 -23.311 37.673  1.00 28.65 ? 95  ASP H CG  1 
ATOM   3664 O  OD1 . ASP C 3 99  ? -9.375  -23.219 38.398  1.00 28.59 ? 95  ASP H OD1 1 
ATOM   3665 O  OD2 . ASP C 3 99  ? -11.402 -23.980 38.007  1.00 26.78 ? 95  ASP H OD2 1 
ATOM   3666 N  N   . TRP C 3 100 ? -7.478  -21.605 36.508  1.00 20.36 ? 96  TRP H N   1 
ATOM   3667 C  CA  . TRP C 3 100 ? -6.142  -21.531 37.107  1.00 22.64 ? 96  TRP H CA  1 
ATOM   3668 C  C   . TRP C 3 100 ? -6.190  -21.106 38.573  1.00 20.04 ? 96  TRP H C   1 
ATOM   3669 O  O   . TRP C 3 100 ? -5.275  -20.442 39.090  1.00 19.44 ? 96  TRP H O   1 
ATOM   3670 C  CB  . TRP C 3 100 ? -5.183  -20.670 36.266  1.00 26.82 ? 96  TRP H CB  1 
ATOM   3671 C  CG  . TRP C 3 100 ? -5.714  -19.324 35.783  1.00 26.60 ? 96  TRP H CG  1 
ATOM   3672 C  CD1 . TRP C 3 100 ? -6.832  -19.093 35.020  1.00 28.47 ? 96  TRP H CD1 1 
ATOM   3673 C  CD2 . TRP C 3 100 ? -5.087  -18.048 35.968  1.00 26.64 ? 96  TRP H CD2 1 
ATOM   3674 N  NE1 . TRP C 3 100 ? -6.958  -17.742 34.757  1.00 29.69 ? 96  TRP H NE1 1 
ATOM   3675 C  CE2 . TRP C 3 100 ? -5.898  -17.082 35.323  1.00 26.92 ? 96  TRP H CE2 1 
ATOM   3676 C  CE3 . TRP C 3 100 ? -3.934  -17.626 36.640  1.00 25.74 ? 96  TRP H CE3 1 
ATOM   3677 C  CZ2 . TRP C 3 100 ? -5.588  -15.718 35.328  1.00 28.56 ? 96  TRP H CZ2 1 
ATOM   3678 C  CZ3 . TRP C 3 100 ? -3.625  -16.274 36.648  1.00 28.18 ? 96  TRP H CZ3 1 
ATOM   3679 C  CH2 . TRP C 3 100 ? -4.446  -15.333 35.992  1.00 28.38 ? 96  TRP H CH2 1 
ATOM   3680 N  N   . GLU C 3 101 ? -7.266  -21.524 39.242  1.00 19.97 ? 97  GLU H N   1 
ATOM   3681 C  CA  . GLU C 3 101 ? -7.444  -21.326 40.686  1.00 16.94 ? 97  GLU H CA  1 
ATOM   3682 C  C   . GLU C 3 101 ? -7.451  -19.833 41.080  1.00 17.77 ? 97  GLU H C   1 
ATOM   3683 O  O   . GLU C 3 101 ? -6.984  -19.444 42.152  1.00 15.90 ? 97  GLU H O   1 
ATOM   3684 C  CB  . GLU C 3 101 ? -6.434  -22.176 41.501  1.00 18.50 ? 97  GLU H CB  1 
ATOM   3685 C  CG  . GLU C 3 101 ? -6.961  -22.556 42.881  1.00 16.05 ? 97  GLU H CG  1 
ATOM   3686 C  CD  . GLU C 3 101 ? -6.095  -23.542 43.654  1.00 17.11 ? 97  GLU H CD  1 
ATOM   3687 O  OE1 . GLU C 3 101 ? -6.568  -23.973 44.720  1.00 17.24 ? 97  GLU H OE1 1 
ATOM   3688 O  OE2 . GLU C 3 101 ? -4.949  -23.882 43.239  1.00 18.74 ? 97  GLU H OE2 1 
ATOM   3689 N  N   . ARG C 3 102 ? -8.013  -19.019 40.184  1.00 19.55 ? 98  ARG H N   1 
ATOM   3690 C  CA  . ARG C 3 102 ? -8.272  -17.591 40.441  1.00 21.12 ? 98  ARG H CA  1 
ATOM   3691 C  C   . ARG C 3 102 ? -9.768  -17.284 40.326  1.00 20.10 ? 98  ARG H C   1 
ATOM   3692 O  O   . ARG C 3 102 ? -10.165 -16.116 40.359  1.00 19.29 ? 98  ARG H O   1 
ATOM   3693 C  CB  . ARG C 3 102 ? -7.548  -16.708 39.401  1.00 24.07 ? 98  ARG H CB  1 
ATOM   3694 C  CG  . ARG C 3 102 ? -6.109  -17.073 39.131  1.00 31.57 ? 98  ARG H CG  1 
ATOM   3695 C  CD  . ARG C 3 102 ? -5.241  -16.894 40.360  1.00 31.98 ? 98  ARG H CD  1 
ATOM   3696 N  NE  . ARG C 3 102 ? -5.258  -15.503 40.821  1.00 30.62 ? 98  ARG H NE  1 
ATOM   3697 C  CZ  . ARG C 3 102 ? -4.707  -15.083 41.953  1.00 27.33 ? 98  ARG H CZ  1 
ATOM   3698 N  NH1 . ARG C 3 102 ? -4.088  -15.953 42.742  1.00 21.67 ? 98  ARG H NH1 1 
ATOM   3699 N  NH2 . ARG C 3 102 ? -4.780  -13.787 42.291  1.00 24.44 ? 98  ARG H NH2 1 
ATOM   3700 N  N   . GLY C 3 103 ? -10.588 -18.326 40.192  1.00 21.06 ? 99  GLY H N   1 
ATOM   3701 C  CA  . GLY C 3 103 ? -12.015 -18.164 39.905  1.00 25.04 ? 99  GLY H CA  1 
ATOM   3702 C  C   . GLY C 3 103 ? -12.458 -19.048 38.741  1.00 25.15 ? 99  GLY H C   1 
ATOM   3703 O  O   . GLY C 3 103 ? -11.661 -19.807 38.177  1.00 23.70 ? 99  GLY H O   1 
ATOM   3704 N  N   . ASP C 3 104 ? -13.734 -18.947 38.372  1.00 18.03 ? 100 ASP H N   1 
ATOM   3705 C  CA  . ASP C 3 104 ? -14.295 -19.858 37.382  1.00 20.99 ? 100 ASP H CA  1 
ATOM   3706 C  C   . ASP C 3 104 ? -14.276 -19.239 35.995  1.00 18.65 ? 100 ASP H C   1 
ATOM   3707 O  O   . ASP C 3 104 ? -15.323 -18.917 35.398  1.00 22.78 ? 100 ASP H O   1 
ATOM   3708 C  CB  . ASP C 3 104 ? -15.671 -20.348 37.827  1.00 21.53 ? 100 ASP H CB  1 
ATOM   3709 C  CG  . ASP C 3 104 ? -15.577 -21.247 39.064  1.00 20.49 ? 100 ASP H CG  1 
ATOM   3710 O  OD1 . ASP C 3 104 ? -14.785 -22.221 39.039  1.00 24.17 ? 100 ASP H OD1 1 
ATOM   3711 O  OD2 . ASP C 3 104 ? -16.248 -20.959 40.073  1.00 24.96 ? 100 ASP H OD2 1 
ATOM   3712 N  N   . PHE C 3 105 A -13.050 -19.055 35.515  1.00 19.99 ? 100 PHE H N   1 
ATOM   3713 C  CA  . PHE C 3 105 A -12.762 -18.548 34.181  1.00 22.35 ? 100 PHE H CA  1 
ATOM   3714 C  C   . PHE C 3 105 A -11.439 -19.190 33.732  1.00 21.41 ? 100 PHE H C   1 
ATOM   3715 O  O   . PHE C 3 105 A -10.681 -19.710 34.561  1.00 20.97 ? 100 PHE H O   1 
ATOM   3716 C  CB  . PHE C 3 105 A -12.738 -17.014 34.162  1.00 24.09 ? 100 PHE H CB  1 
ATOM   3717 C  CG  . PHE C 3 105 A -11.697 -16.408 35.054  1.00 20.31 ? 100 PHE H CG  1 
ATOM   3718 C  CD1 . PHE C 3 105 A -10.428 -16.145 34.564  1.00 22.58 ? 100 PHE H CD1 1 
ATOM   3719 C  CD2 . PHE C 3 105 A -11.990 -16.085 36.380  1.00 21.95 ? 100 PHE H CD2 1 
ATOM   3720 C  CE1 . PHE C 3 105 A -9.450  -15.573 35.387  1.00 22.28 ? 100 PHE H CE1 1 
ATOM   3721 C  CE2 . PHE C 3 105 A -11.018 -15.526 37.211  1.00 22.91 ? 100 PHE H CE2 1 
ATOM   3722 C  CZ  . PHE C 3 105 A -9.745  -15.273 36.716  1.00 23.69 ? 100 PHE H CZ  1 
ATOM   3723 N  N   . PHE C 3 106 K -11.173 -19.162 32.429  1.00 21.09 ? 100 PHE H N   1 
ATOM   3724 C  CA  . PHE C 3 106 K -10.379 -20.240 31.807  1.00 23.20 ? 100 PHE H CA  1 
ATOM   3725 C  C   . PHE C 3 106 K -9.178  -19.770 30.998  1.00 21.35 ? 100 PHE H C   1 
ATOM   3726 O  O   . PHE C 3 106 K -9.324  -19.036 30.013  1.00 24.79 ? 100 PHE H O   1 
ATOM   3727 C  CB  . PHE C 3 106 K -11.314 -21.155 30.987  1.00 22.27 ? 100 PHE H CB  1 
ATOM   3728 C  CG  . PHE C 3 106 K -12.618 -21.382 31.664  1.00 20.37 ? 100 PHE H CG  1 
ATOM   3729 C  CD1 . PHE C 3 106 K -12.646 -21.996 32.917  1.00 22.25 ? 100 PHE H CD1 1 
ATOM   3730 C  CD2 . PHE C 3 106 K -13.802 -20.881 31.138  1.00 20.77 ? 100 PHE H CD2 1 
ATOM   3731 C  CE1 . PHE C 3 106 K -13.851 -22.148 33.603  1.00 24.80 ? 100 PHE H CE1 1 
ATOM   3732 C  CE2 . PHE C 3 106 K -14.993 -21.046 31.812  1.00 22.10 ? 100 PHE H CE2 1 
ATOM   3733 C  CZ  . PHE C 3 106 K -15.020 -21.681 33.047  1.00 24.72 ? 100 PHE H CZ  1 
ATOM   3734 N  N   . ASP C 3 107 ? -7.998  -20.217 31.431  1.00 20.27 ? 101 ASP H N   1 
ATOM   3735 C  CA  . ASP C 3 107 ? -6.752  -19.832 30.781  1.00 23.29 ? 101 ASP H CA  1 
ATOM   3736 C  C   . ASP C 3 107 ? -6.393  -20.706 29.572  1.00 25.57 ? 101 ASP H C   1 
ATOM   3737 O  O   . ASP C 3 107 ? -5.909  -20.190 28.568  1.00 30.15 ? 101 ASP H O   1 
ATOM   3738 C  CB  . ASP C 3 107 ? -5.577  -19.677 31.779  1.00 24.00 ? 101 ASP H CB  1 
ATOM   3739 C  CG  . ASP C 3 107 ? -5.194  -20.972 32.514  1.00 26.43 ? 101 ASP H CG  1 
ATOM   3740 O  OD1 . ASP C 3 107 ? -5.917  -21.996 32.492  1.00 25.53 ? 101 ASP H OD1 1 
ATOM   3741 O  OD2 . ASP C 3 107 ? -4.113  -20.968 33.147  1.00 27.87 ? 101 ASP H OD2 1 
ATOM   3742 N  N   . TYR C 3 108 ? -6.647  -22.012 29.654  1.00 22.21 ? 102 TYR H N   1 
ATOM   3743 C  CA  . TYR C 3 108 ? -6.341  -22.915 28.545  1.00 20.88 ? 102 TYR H CA  1 
ATOM   3744 C  C   . TYR C 3 108 ? -7.586  -23.690 28.137  1.00 21.87 ? 102 TYR H C   1 
ATOM   3745 O  O   . TYR C 3 108 ? -8.299  -24.216 28.985  1.00 22.85 ? 102 TYR H O   1 
ATOM   3746 C  CB  . TYR C 3 108 ? -5.192  -23.871 28.888  1.00 25.73 ? 102 TYR H CB  1 
ATOM   3747 C  CG  . TYR C 3 108 ? -3.851  -23.167 29.005  1.00 28.16 ? 102 TYR H CG  1 
ATOM   3748 C  CD1 . TYR C 3 108 ? -3.034  -22.985 27.889  1.00 27.19 ? 102 TYR H CD1 1 
ATOM   3749 C  CD2 . TYR C 3 108 ? -3.414  -22.677 30.229  1.00 27.04 ? 102 TYR H CD2 1 
ATOM   3750 C  CE1 . TYR C 3 108 ? -1.803  -22.317 27.999  1.00 29.58 ? 102 TYR H CE1 1 
ATOM   3751 C  CE2 . TYR C 3 108 ? -2.196  -22.021 30.349  1.00 28.93 ? 102 TYR H CE2 1 
ATOM   3752 C  CZ  . TYR C 3 108 ? -1.404  -21.837 29.231  1.00 28.77 ? 102 TYR H CZ  1 
ATOM   3753 O  OH  . TYR C 3 108 ? -0.197  -21.192 29.372  1.00 30.30 ? 102 TYR H OH  1 
ATOM   3754 N  N   . TRP C 3 109 ? -7.831  -23.733 26.833  1.00 20.95 ? 103 TRP H N   1 
ATOM   3755 C  CA  . TRP C 3 109 ? -9.001  -24.399 26.271  1.00 24.14 ? 103 TRP H CA  1 
ATOM   3756 C  C   . TRP C 3 109 ? -8.550  -25.527 25.362  1.00 23.21 ? 103 TRP H C   1 
ATOM   3757 O  O   . TRP C 3 109 ? -7.514  -25.424 24.700  1.00 21.06 ? 103 TRP H O   1 
ATOM   3758 C  CB  . TRP C 3 109 ? -9.827  -23.406 25.430  1.00 22.64 ? 103 TRP H CB  1 
ATOM   3759 C  CG  . TRP C 3 109 ? -10.489 -22.258 26.198  1.00 24.26 ? 103 TRP H CG  1 
ATOM   3760 C  CD1 . TRP C 3 109 ? -9.856  -21.241 26.872  1.00 20.56 ? 103 TRP H CD1 1 
ATOM   3761 C  CD2 . TRP C 3 109 ? -11.903 -22.010 26.332  1.00 23.35 ? 103 TRP H CD2 1 
ATOM   3762 N  NE1 . TRP C 3 109 ? -10.793 -20.394 27.434  1.00 22.07 ? 103 TRP H NE1 1 
ATOM   3763 C  CE2 . TRP C 3 109 ? -12.053 -20.840 27.121  1.00 24.71 ? 103 TRP H CE2 1 
ATOM   3764 C  CE3 . TRP C 3 109 ? -13.056 -22.686 25.898  1.00 20.61 ? 103 TRP H CE3 1 
ATOM   3765 C  CZ2 . TRP C 3 109 ? -13.318 -20.312 27.459  1.00 20.55 ? 103 TRP H CZ2 1 
ATOM   3766 C  CZ3 . TRP C 3 109 ? -14.315 -22.161 26.224  1.00 22.22 ? 103 TRP H CZ3 1 
ATOM   3767 C  CH2 . TRP C 3 109 ? -14.433 -20.985 26.997  1.00 23.63 ? 103 TRP H CH2 1 
ATOM   3768 N  N   . GLY C 3 110 ? -9.357  -26.583 25.290  1.00 19.74 ? 104 GLY H N   1 
ATOM   3769 C  CA  . GLY C 3 110 ? -9.174  -27.610 24.293  1.00 20.99 ? 104 GLY H CA  1 
ATOM   3770 C  C   . GLY C 3 110 ? -9.561  -27.055 22.936  1.00 21.69 ? 104 GLY H C   1 
ATOM   3771 O  O   . GLY C 3 110 ? -10.092 -25.937 22.832  1.00 19.52 ? 104 GLY H O   1 
ATOM   3772 N  N   . GLN C 3 111 ? -9.326  -27.849 21.897  1.00 19.40 ? 105 GLN H N   1 
ATOM   3773 C  CA  . GLN C 3 111 ? -9.569  -27.396 20.523  1.00 20.93 ? 105 GLN H CA  1 
ATOM   3774 C  C   . GLN C 3 111 ? -11.056 -27.492 20.102  1.00 23.37 ? 105 GLN H C   1 
ATOM   3775 O  O   . GLN C 3 111 ? -11.431 -27.040 19.013  1.00 25.40 ? 105 GLN H O   1 
ATOM   3776 C  CB  . GLN C 3 111 ? -8.629  -28.142 19.544  1.00 24.81 ? 105 GLN H CB  1 
ATOM   3777 C  CG  . GLN C 3 111 ? -9.104  -29.526 19.038  1.00 24.95 ? 105 GLN H CG  1 
ATOM   3778 C  CD  . GLN C 3 111 ? -8.779  -30.685 19.972  1.00 23.35 ? 105 GLN H CD  1 
ATOM   3779 O  OE1 . GLN C 3 111 ? -8.524  -30.498 21.159  1.00 24.48 ? 105 GLN H OE1 1 
ATOM   3780 N  NE2 . GLN C 3 111 ? -8.807  -31.903 19.430  1.00 25.16 ? 105 GLN H NE2 1 
ATOM   3781 N  N   . GLY C 3 112 ? -11.883 -28.085 20.968  1.00 19.16 ? 106 GLY H N   1 
ATOM   3782 C  CA  . GLY C 3 112 ? -13.294 -28.299 20.691  1.00 20.27 ? 106 GLY H CA  1 
ATOM   3783 C  C   . GLY C 3 112 ? -13.538 -29.632 20.009  1.00 20.93 ? 106 GLY H C   1 
ATOM   3784 O  O   . GLY C 3 112 ? -12.679 -30.119 19.252  1.00 20.91 ? 106 GLY H O   1 
ATOM   3785 N  N   . THR C 3 113 ? -14.704 -30.219 20.293  1.00 18.71 ? 107 THR H N   1 
ATOM   3786 C  CA  . THR C 3 113 ? -15.169 -31.453 19.657  1.00 17.66 ? 107 THR H CA  1 
ATOM   3787 C  C   . THR C 3 113 ? -16.549 -31.196 19.031  1.00 20.49 ? 107 THR H C   1 
ATOM   3788 O  O   . THR C 3 113 ? -17.497 -30.794 19.723  1.00 20.26 ? 107 THR H O   1 
ATOM   3789 C  CB  . THR C 3 113 ? -15.320 -32.615 20.693  1.00 20.39 ? 107 THR H CB  1 
ATOM   3790 O  OG1 . THR C 3 113 ? -14.042 -32.963 21.233  1.00 23.84 ? 107 THR H OG1 1 
ATOM   3791 C  CG2 . THR C 3 113 ? -15.941 -33.859 20.060  1.00 22.50 ? 107 THR H CG2 1 
ATOM   3792 N  N   . LEU C 3 114 ? -16.664 -31.406 17.728  1.00 19.78 ? 108 LEU H N   1 
ATOM   3793 C  CA  . LEU C 3 114 ? -17.941 -31.166 17.076  1.00 20.31 ? 108 LEU H CA  1 
ATOM   3794 C  C   . LEU C 3 114 ? -18.786 -32.434 17.131  1.00 20.82 ? 108 LEU H C   1 
ATOM   3795 O  O   . LEU C 3 114 ? -18.375 -33.505 16.644  1.00 18.13 ? 108 LEU H O   1 
ATOM   3796 C  CB  . LEU C 3 114 ? -17.766 -30.676 15.628  1.00 20.37 ? 108 LEU H CB  1 
ATOM   3797 C  CG  . LEU C 3 114 ? -19.066 -30.429 14.832  1.00 23.13 ? 108 LEU H CG  1 
ATOM   3798 C  CD1 . LEU C 3 114 ? -19.834 -29.240 15.381  1.00 23.27 ? 108 LEU H CD1 1 
ATOM   3799 C  CD2 . LEU C 3 114 ? -18.785 -30.201 13.363  1.00 23.21 ? 108 LEU H CD2 1 
ATOM   3800 N  N   . VAL C 3 115 ? -19.961 -32.300 17.735  1.00 16.24 ? 109 VAL H N   1 
ATOM   3801 C  CA  . VAL C 3 115 ? -20.928 -33.400 17.801  1.00 17.12 ? 109 VAL H CA  1 
ATOM   3802 C  C   . VAL C 3 115 ? -22.104 -33.090 16.884  1.00 18.26 ? 109 VAL H C   1 
ATOM   3803 O  O   . VAL C 3 115 ? -22.744 -32.047 17.041  1.00 19.38 ? 109 VAL H O   1 
ATOM   3804 C  CB  . VAL C 3 115 ? -21.427 -33.653 19.271  1.00 19.20 ? 109 VAL H CB  1 
ATOM   3805 C  CG1 . VAL C 3 115 ? -22.499 -34.740 19.319  1.00 24.63 ? 109 VAL H CG1 1 
ATOM   3806 C  CG2 . VAL C 3 115 ? -20.265 -34.010 20.187  1.00 17.99 ? 109 VAL H CG2 1 
ATOM   3807 N  N   . THR C 3 116 ? -22.382 -33.987 15.930  1.00 16.39 ? 110 THR H N   1 
ATOM   3808 C  CA  . THR C 3 116 ? -23.544 -33.878 15.049  1.00 14.86 ? 110 THR H CA  1 
ATOM   3809 C  C   . THR C 3 116 ? -24.532 -34.998 15.358  1.00 18.27 ? 110 THR H C   1 
ATOM   3810 O  O   . THR C 3 116 ? -24.205 -36.185 15.240  1.00 16.63 ? 110 THR H O   1 
ATOM   3811 C  CB  . THR C 3 116 ? -23.122 -33.941 13.550  1.00 16.41 ? 110 THR H CB  1 
ATOM   3812 O  OG1 . THR C 3 116 ? -22.148 -32.914 13.285  1.00 16.65 ? 110 THR H OG1 1 
ATOM   3813 C  CG2 . THR C 3 116 ? -24.346 -33.791 12.611  1.00 16.63 ? 110 THR H CG2 1 
ATOM   3814 N  N   . VAL C 3 117 ? -25.745 -34.618 15.758  1.00 19.81 ? 111 VAL H N   1 
ATOM   3815 C  CA  . VAL C 3 117 ? -26.795 -35.589 16.057  1.00 18.66 ? 111 VAL H CA  1 
ATOM   3816 C  C   . VAL C 3 117 ? -27.625 -35.800 14.790  1.00 21.22 ? 111 VAL H C   1 
ATOM   3817 O  O   . VAL C 3 117 ? -28.250 -34.862 14.276  1.00 21.16 ? 111 VAL H O   1 
ATOM   3818 C  CB  . VAL C 3 117 ? -27.712 -35.119 17.225  1.00 21.30 ? 111 VAL H CB  1 
ATOM   3819 C  CG1 . VAL C 3 117 ? -28.800 -36.161 17.498  1.00 21.71 ? 111 VAL H CG1 1 
ATOM   3820 C  CG2 . VAL C 3 117 ? -26.903 -34.869 18.480  1.00 19.35 ? 111 VAL H CG2 1 
ATOM   3821 N  N   . SER C 3 118 ? -27.604 -37.024 14.274  1.00 19.00 ? 112 SER H N   1 
ATOM   3822 C  CA  . SER C 3 118 ? -28.281 -37.330 13.003  1.00 21.89 ? 112 SER H CA  1 
ATOM   3823 C  C   . SER C 3 118 ? -28.487 -38.816 12.877  1.00 20.34 ? 112 SER H C   1 
ATOM   3824 O  O   . SER C 3 118 ? -27.659 -39.594 13.353  1.00 21.53 ? 112 SER H O   1 
ATOM   3825 C  CB  . SER C 3 118 ? -27.447 -36.820 11.810  1.00 24.68 ? 112 SER H CB  1 
ATOM   3826 O  OG  . SER C 3 118 ? -27.977 -37.303 10.576  1.00 23.27 ? 112 SER H OG  1 
ATOM   3827 N  N   . SER C 3 119 ? -29.597 -39.205 12.246  1.00 21.36 ? 113 SER H N   1 
ATOM   3828 C  CA  . SER C 3 119 ? -29.892 -40.599 11.922  1.00 23.29 ? 113 SER H CA  1 
ATOM   3829 C  C   . SER C 3 119 ? -29.272 -41.048 10.586  1.00 24.72 ? 113 SER H C   1 
ATOM   3830 O  O   . SER C 3 119 ? -29.301 -42.233 10.254  1.00 26.44 ? 113 SER H O   1 
ATOM   3831 C  CB  . SER C 3 119 ? -31.412 -40.845 11.921  1.00 28.80 ? 113 SER H CB  1 
ATOM   3832 O  OG  . SER C 3 119 ? -32.081 -39.896 11.098  1.00 30.28 ? 113 SER H OG  1 
ATOM   3833 N  N   . ALA C 3 120 ? -28.691 -40.108 9.842   1.00 21.57 ? 114 ALA H N   1 
ATOM   3834 C  CA  . ALA C 3 120 ? -28.052 -40.417 8.563   1.00 23.17 ? 114 ALA H CA  1 
ATOM   3835 C  C   . ALA C 3 120 ? -26.701 -41.102 8.741   1.00 25.84 ? 114 ALA H C   1 
ATOM   3836 O  O   . ALA C 3 120 ? -26.004 -40.853 9.719   1.00 26.77 ? 114 ALA H O   1 
ATOM   3837 C  CB  . ALA C 3 120 ? -27.894 -39.173 7.733   1.00 21.65 ? 114 ALA H CB  1 
ATOM   3838 N  N   . SER C 3 121 ? -26.347 -41.966 7.788   1.00 24.58 ? 115 SER H N   1 
ATOM   3839 C  CA  . SER C 3 121 ? -25.075 -42.684 7.820   1.00 26.63 ? 115 SER H CA  1 
ATOM   3840 C  C   . SER C 3 121 ? -23.937 -41.744 7.480   1.00 23.73 ? 115 SER H C   1 
ATOM   3841 O  O   . SER C 3 121 ? -24.117 -40.793 6.711   1.00 22.76 ? 115 SER H O   1 
ATOM   3842 C  CB  . SER C 3 121 ? -25.091 -43.860 6.839   1.00 28.87 ? 115 SER H CB  1 
ATOM   3843 O  OG  . SER C 3 121 ? -26.025 -44.840 7.248   1.00 37.67 ? 115 SER H OG  1 
ATOM   3844 N  N   . THR C 3 122 ? -22.770 -41.985 8.072   1.00 21.39 ? 116 THR H N   1 
ATOM   3845 C  CA  . THR C 3 122 ? -21.591 -41.243 7.681   1.00 21.27 ? 116 THR H CA  1 
ATOM   3846 C  C   . THR C 3 122 ? -21.231 -41.594 6.237   1.00 22.85 ? 116 THR H C   1 
ATOM   3847 O  O   . THR C 3 122 ? -21.475 -42.726 5.777   1.00 19.75 ? 116 THR H O   1 
ATOM   3848 C  CB  . THR C 3 122 ? -20.368 -41.499 8.616   1.00 20.54 ? 116 THR H CB  1 
ATOM   3849 O  OG1 . THR C 3 122 ? -19.367 -40.510 8.366   1.00 21.99 ? 116 THR H OG1 1 
ATOM   3850 C  CG2 . THR C 3 122 ? -19.775 -42.896 8.418   1.00 19.23 ? 116 THR H CG2 1 
ATOM   3851 N  N   . LYS C 3 123 ? -20.681 -40.621 5.522   1.00 19.97 ? 117 LYS H N   1 
ATOM   3852 C  CA  . LYS C 3 123 ? -20.083 -40.883 4.213   1.00 24.67 ? 117 LYS H CA  1 
ATOM   3853 C  C   . LYS C 3 123 ? -18.722 -40.213 4.122   1.00 21.22 ? 117 LYS H C   1 
ATOM   3854 O  O   . LYS C 3 123 ? -18.574 -39.032 4.444   1.00 21.51 ? 117 LYS H O   1 
ATOM   3855 C  CB  . LYS C 3 123 ? -20.986 -40.409 3.068   1.00 25.35 ? 117 LYS H CB  1 
ATOM   3856 C  CG  . LYS C 3 123 ? -20.344 -40.641 1.696   1.00 32.42 ? 117 LYS H CG  1 
ATOM   3857 C  CD  . LYS C 3 123 ? -21.294 -40.370 0.537   1.00 36.25 ? 117 LYS H CD  1 
ATOM   3858 C  CE  . LYS C 3 123 ? -20.629 -40.737 -0.790  1.00 41.14 ? 117 LYS H CE  1 
ATOM   3859 N  NZ  . LYS C 3 123 ? -19.249 -40.150 -0.898  1.00 44.46 ? 117 LYS H NZ  1 
ATOM   3860 N  N   . GLY C 3 124 ? -17.718 -40.975 3.693   1.00 18.11 ? 118 GLY H N   1 
ATOM   3861 C  CA  . GLY C 3 124 ? -16.374 -40.420 3.528   1.00 21.08 ? 118 GLY H CA  1 
ATOM   3862 C  C   . GLY C 3 124 ? -16.237 -39.668 2.217   1.00 21.28 ? 118 GLY H C   1 
ATOM   3863 O  O   . GLY C 3 124 ? -16.923 -39.990 1.247   1.00 23.50 ? 118 GLY H O   1 
ATOM   3864 N  N   . PRO C 3 125 ? -15.340 -38.671 2.175   1.00 23.39 ? 119 PRO H N   1 
ATOM   3865 C  CA  . PRO C 3 125 ? -15.172 -37.839 0.984   1.00 24.49 ? 119 PRO H CA  1 
ATOM   3866 C  C   . PRO C 3 125 ? -14.336 -38.486 -0.126  1.00 26.48 ? 119 PRO H C   1 
ATOM   3867 O  O   . PRO C 3 125 ? -13.527 -39.395 0.137   1.00 22.58 ? 119 PRO H O   1 
ATOM   3868 C  CB  . PRO C 3 125 ? -14.426 -36.616 1.529   1.00 25.28 ? 119 PRO H CB  1 
ATOM   3869 C  CG  . PRO C 3 125 ? -13.606 -37.154 2.663   1.00 21.80 ? 119 PRO H CG  1 
ATOM   3870 C  CD  . PRO C 3 125 ? -14.455 -38.241 3.279   1.00 23.32 ? 119 PRO H CD  1 
ATOM   3871 N  N   . SER C 3 126 ? -14.560 -38.021 -1.355  1.00 22.02 ? 120 SER H N   1 
ATOM   3872 C  CA  . SER C 3 126 ? -13.650 -38.260 -2.463  1.00 21.43 ? 120 SER H CA  1 
ATOM   3873 C  C   . SER C 3 126 ? -12.739 -37.037 -2.534  1.00 21.65 ? 120 SER H C   1 
ATOM   3874 O  O   . SER C 3 126 ? -13.194 -35.918 -2.325  1.00 29.48 ? 120 SER H O   1 
ATOM   3875 C  CB  . SER C 3 126 ? -14.418 -38.384 -3.774  1.00 27.06 ? 120 SER H CB  1 
ATOM   3876 O  OG  . SER C 3 126 ? -15.288 -39.499 -3.756  1.00 32.66 ? 120 SER H OG  1 
ATOM   3877 N  N   . VAL C 3 127 ? -11.462 -37.251 -2.824  1.00 20.63 ? 121 VAL H N   1 
ATOM   3878 C  CA  . VAL C 3 127 ? -10.500 -36.133 -2.920  1.00 20.41 ? 121 VAL H CA  1 
ATOM   3879 C  C   . VAL C 3 127 ? -9.962  -36.088 -4.344  1.00 25.13 ? 121 VAL H C   1 
ATOM   3880 O  O   . VAL C 3 127 ? -9.417  -37.098 -4.838  1.00 22.71 ? 121 VAL H O   1 
ATOM   3881 C  CB  . VAL C 3 127 ? -9.343  -36.254 -1.877  1.00 24.05 ? 121 VAL H CB  1 
ATOM   3882 C  CG1 . VAL C 3 127 ? -8.376  -35.070 -1.987  1.00 24.74 ? 121 VAL H CG1 1 
ATOM   3883 C  CG2 . VAL C 3 127 ? -9.903  -36.338 -0.455  1.00 25.44 ? 121 VAL H CG2 1 
ATOM   3884 N  N   . PHE C 3 128 ? -10.141 -34.935 -5.000  1.00 21.06 ? 122 PHE H N   1 
ATOM   3885 C  CA  . PHE C 3 128 ? -9.659  -34.706 -6.374  1.00 21.73 ? 122 PHE H CA  1 
ATOM   3886 C  C   . PHE C 3 128 ? -8.672  -33.552 -6.433  1.00 18.73 ? 122 PHE H C   1 
ATOM   3887 O  O   . PHE C 3 128 ? -8.834  -32.554 -5.714  1.00 21.80 ? 122 PHE H O   1 
ATOM   3888 C  CB  . PHE C 3 128 ? -10.818 -34.414 -7.335  1.00 20.75 ? 122 PHE H CB  1 
ATOM   3889 C  CG  . PHE C 3 128 ? -11.890 -35.468 -7.318  1.00 22.11 ? 122 PHE H CG  1 
ATOM   3890 C  CD1 . PHE C 3 128 ? -11.617 -36.759 -7.771  1.00 22.24 ? 122 PHE H CD1 1 
ATOM   3891 C  CD2 . PHE C 3 128 ? -13.150 -35.184 -6.803  1.00 20.22 ? 122 PHE H CD2 1 
ATOM   3892 C  CE1 . PHE C 3 128 ? -12.594 -37.748 -7.736  1.00 23.99 ? 122 PHE H CE1 1 
ATOM   3893 C  CE2 . PHE C 3 128 ? -14.133 -36.169 -6.769  1.00 21.35 ? 122 PHE H CE2 1 
ATOM   3894 C  CZ  . PHE C 3 128 ? -13.851 -37.448 -7.240  1.00 20.81 ? 122 PHE H CZ  1 
ATOM   3895 N  N   . PRO C 3 129 ? -7.651  -33.664 -7.302  1.00 21.85 ? 123 PRO H N   1 
ATOM   3896 C  CA  . PRO C 3 129 ? -6.672  -32.586 -7.419  1.00 21.01 ? 123 PRO H CA  1 
ATOM   3897 C  C   . PRO C 3 129 ? -7.227  -31.367 -8.175  1.00 22.70 ? 123 PRO H C   1 
ATOM   3898 O  O   . PRO C 3 129 ? -8.045  -31.516 -9.100  1.00 20.66 ? 123 PRO H O   1 
ATOM   3899 C  CB  . PRO C 3 129 ? -5.530  -33.247 -8.210  1.00 23.32 ? 123 PRO H CB  1 
ATOM   3900 C  CG  . PRO C 3 129 ? -6.253  -34.261 -9.082  1.00 25.64 ? 123 PRO H CG  1 
ATOM   3901 C  CD  . PRO C 3 129 ? -7.348  -34.797 -8.209  1.00 25.28 ? 123 PRO H CD  1 
ATOM   3902 N  N   . LEU C 3 130 ? -6.812  -30.176 -7.754  1.00 21.77 ? 124 LEU H N   1 
ATOM   3903 C  CA  . LEU C 3 130 ? -7.013  -28.951 -8.536  1.00 19.59 ? 124 LEU H CA  1 
ATOM   3904 C  C   . LEU C 3 130 ? -5.617  -28.548 -9.025  1.00 19.94 ? 124 LEU H C   1 
ATOM   3905 O  O   . LEU C 3 130 ? -4.875  -27.873 -8.329  1.00 20.37 ? 124 LEU H O   1 
ATOM   3906 C  CB  . LEU C 3 130 ? -7.657  -27.851 -7.687  1.00 19.64 ? 124 LEU H CB  1 
ATOM   3907 C  CG  . LEU C 3 130 ? -9.074  -28.135 -7.171  1.00 20.51 ? 124 LEU H CG  1 
ATOM   3908 C  CD1 . LEU C 3 130 ? -9.445  -27.106 -6.111  1.00 21.09 ? 124 LEU H CD1 1 
ATOM   3909 C  CD2 . LEU C 3 130 ? -10.103 -28.111 -8.330  1.00 24.84 ? 124 LEU H CD2 1 
ATOM   3910 N  N   . ALA C 3 131 ? -5.255  -29.038 -10.203 1.00 21.86 ? 125 ALA H N   1 
ATOM   3911 C  CA  . ALA C 3 131 ? -3.877  -28.961 -10.676 1.00 24.09 ? 125 ALA H CA  1 
ATOM   3912 C  C   . ALA C 3 131 ? -3.475  -27.533 -11.045 1.00 21.30 ? 125 ALA H C   1 
ATOM   3913 O  O   . ALA C 3 131 ? -4.263  -26.787 -11.635 1.00 21.59 ? 125 ALA H O   1 
ATOM   3914 C  CB  . ALA C 3 131 ? -3.660  -29.914 -11.877 1.00 23.09 ? 125 ALA H CB  1 
ATOM   3915 N  N   . PRO C 3 132 ? -2.235  -27.146 -10.706 1.00 23.26 ? 126 PRO H N   1 
ATOM   3916 C  CA  . PRO C 3 132 ? -1.796  -25.865 -11.261 1.00 23.74 ? 126 PRO H CA  1 
ATOM   3917 C  C   . PRO C 3 132 ? -1.640  -26.067 -12.774 1.00 29.39 ? 126 PRO H C   1 
ATOM   3918 O  O   . PRO C 3 132 ? -1.084  -27.080 -13.204 1.00 30.36 ? 126 PRO H O   1 
ATOM   3919 C  CB  . PRO C 3 132 ? -0.433  -25.621 -10.585 1.00 24.79 ? 126 PRO H CB  1 
ATOM   3920 C  CG  . PRO C 3 132 ? 0.061   -26.989 -10.185 1.00 25.80 ? 126 PRO H CG  1 
ATOM   3921 C  CD  . PRO C 3 132 ? -1.185  -27.823 -9.913  1.00 24.07 ? 126 PRO H CD  1 
ATOM   3922 N  N   . SER C 3 133 ? -2.175  -25.140 -13.563 1.00 33.83 ? 127 SER H N   1 
ATOM   3923 C  CA  . SER C 3 133 ? -2.068  -25.199 -15.026 1.00 39.30 ? 127 SER H CA  1 
ATOM   3924 C  C   . SER C 3 133 ? -1.855  -23.796 -15.564 1.00 40.61 ? 127 SER H C   1 
ATOM   3925 O  O   . SER C 3 133 ? -1.755  -22.843 -14.792 1.00 39.27 ? 127 SER H O   1 
ATOM   3926 C  CB  . SER C 3 133 ? -3.341  -25.793 -15.649 1.00 42.23 ? 127 SER H CB  1 
ATOM   3927 O  OG  . SER C 3 133 ? -4.383  -24.827 -15.721 1.00 39.64 ? 127 SER H OG  1 
ATOM   3928 N  N   . SER C 3 134 ? -1.828  -23.663 -16.889 1.00 43.84 ? 128 SER H N   1 
ATOM   3929 C  CA  . SER C 3 134 ? -1.733  -22.343 -17.513 1.00 45.57 ? 128 SER H CA  1 
ATOM   3930 C  C   . SER C 3 134 ? -2.991  -21.476 -17.314 1.00 43.50 ? 128 SER H C   1 
ATOM   3931 O  O   . SER C 3 134 ? -2.973  -20.283 -17.631 1.00 44.63 ? 128 SER H O   1 
ATOM   3932 C  CB  . SER C 3 134 ? -1.397  -22.470 -18.999 1.00 48.42 ? 128 SER H CB  1 
ATOM   3933 O  OG  . SER C 3 134 ? -0.810  -21.271 -19.463 1.00 54.24 ? 128 SER H OG  1 
ATOM   3934 N  N   . LYS C 3 135 ? -4.062  -22.077 -16.781 1.00 39.99 ? 129 LYS H N   1 
ATOM   3935 C  CA  . LYS C 3 135 ? -5.330  -21.366 -16.489 1.00 38.60 ? 129 LYS H CA  1 
ATOM   3936 C  C   . LYS C 3 135 ? -5.431  -20.922 -15.015 1.00 36.23 ? 129 LYS H C   1 
ATOM   3937 O  O   . LYS C 3 135 ? -6.409  -20.239 -14.595 1.00 23.62 ? 129 LYS H O   1 
ATOM   3938 C  CB  . LYS C 3 135 ? -6.543  -22.227 -16.877 1.00 41.32 ? 129 LYS H CB  1 
ATOM   3939 C  CG  . LYS C 3 135 ? -6.608  -22.649 -18.351 1.00 43.96 ? 129 LYS H CG  1 
ATOM   3940 C  CD  . LYS C 3 135 ? -6.534  -21.464 -19.314 1.00 48.66 ? 129 LYS H CD  1 
ATOM   3941 C  CE  . LYS C 3 135 ? -6.373  -21.943 -20.752 1.00 52.87 ? 129 LYS H CE  1 
ATOM   3942 N  NZ  . LYS C 3 135 ? -6.147  -20.813 -21.692 1.00 56.28 ? 129 LYS H NZ  1 
ATOM   3943 N  N   . SER C 3 136 ? -4.416  -21.317 -14.237 1.00 36.70 ? 130 SER H N   1 
ATOM   3944 C  CA  . SER C 3 136 ? -4.289  -20.887 -12.843 1.00 35.48 ? 130 SER H CA  1 
ATOM   3945 C  C   . SER C 3 136 ? -2.926  -20.221 -12.495 1.00 41.19 ? 130 SER H C   1 
ATOM   3946 O  O   . SER C 3 136 ? -2.283  -20.591 -11.500 1.00 38.35 ? 130 SER H O   1 
ATOM   3947 C  CB  . SER C 3 136 ? -4.685  -22.019 -11.860 1.00 39.35 ? 130 SER H CB  1 
ATOM   3948 O  OG  . SER C 3 136 ? -3.928  -23.204 -12.031 1.00 35.78 ? 130 SER H OG  1 
ATOM   3949 N  N   . THR C 3 137 ? -2.538  -19.214 -13.299 1.00 43.18 ? 131 THR H N   1 
ATOM   3950 C  CA  . THR C 3 137 ? -1.337  -18.356 -13.063 1.00 46.37 ? 131 THR H CA  1 
ATOM   3951 C  C   . THR C 3 137 ? -1.581  -16.818 -13.062 1.00 46.12 ? 131 THR H C   1 
ATOM   3952 O  O   . THR C 3 137 ? -2.293  -16.282 -13.921 1.00 48.55 ? 131 THR H O   1 
ATOM   3953 C  CB  . THR C 3 137 ? -0.187  -18.686 -14.039 1.00 48.36 ? 131 THR H CB  1 
ATOM   3954 O  OG1 . THR C 3 137 ? 0.935   -17.830 -13.769 1.00 49.67 ? 131 THR H OG1 1 
ATOM   3955 C  CG2 . THR C 3 137 ? -0.631  -18.513 -15.488 1.00 45.03 ? 131 THR H CG2 1 
ATOM   3956 N  N   . SER C 3 138 ? -0.949  -16.121 -12.113 1.00 39.67 ? 132 SER H N   1 
ATOM   3957 C  CA  . SER C 3 138 ? -1.260  -14.720 -11.806 1.00 36.01 ? 132 SER H CA  1 
ATOM   3958 C  C   . SER C 3 138 ? -0.052  -13.961 -11.231 1.00 34.29 ? 132 SER H C   1 
ATOM   3959 O  O   . SER C 3 138 ? 0.311   -14.141 -10.073 1.00 28.59 ? 132 SER H O   1 
ATOM   3960 C  CB  . SER C 3 138 ? -2.444  -14.649 -10.827 1.00 37.37 ? 132 SER H CB  1 
ATOM   3961 O  OG  . SER C 3 138 ? -2.699  -13.325 -10.384 1.00 39.81 ? 132 SER H OG  1 
ATOM   3962 N  N   . GLY C 3 139 ? 0.558   -13.103 -12.044 1.00 33.90 ? 133 GLY H N   1 
ATOM   3963 C  CA  . GLY C 3 139 ? 1.740   -12.340 -11.632 1.00 30.90 ? 133 GLY H CA  1 
ATOM   3964 C  C   . GLY C 3 139 ? 2.912   -13.213 -11.196 1.00 23.70 ? 133 GLY H C   1 
ATOM   3965 O  O   . GLY C 3 139 ? 3.586   -12.886 -10.228 1.00 25.31 ? 133 GLY H O   1 
ATOM   3966 N  N   . GLY C 3 140 ? 3.133   -14.325 -11.898 1.00 23.43 ? 134 GLY H N   1 
ATOM   3967 C  CA  . GLY C 3 140 ? 4.195   -15.295 -11.557 1.00 19.99 ? 134 GLY H CA  1 
ATOM   3968 C  C   . GLY C 3 140 ? 3.846   -16.275 -10.430 1.00 20.69 ? 134 GLY H C   1 
ATOM   3969 O  O   . GLY C 3 140 ? 4.713   -16.999 -9.928  1.00 22.19 ? 134 GLY H O   1 
ATOM   3970 N  N   . THR C 3 141 ? 2.592   -16.295 -10.009 1.00 21.96 ? 135 THR H N   1 
ATOM   3971 C  CA  . THR C 3 141 ? 2.139   -17.255 -8.986  1.00 21.68 ? 135 THR H CA  1 
ATOM   3972 C  C   . THR C 3 141 ? 1.202   -18.272 -9.629  1.00 26.90 ? 135 THR H C   1 
ATOM   3973 O  O   . THR C 3 141 ? 0.602   -17.993 -10.668 1.00 25.16 ? 135 THR H O   1 
ATOM   3974 C  CB  . THR C 3 141 ? 1.432   -16.564 -7.803  1.00 27.93 ? 135 THR H CB  1 
ATOM   3975 O  OG1 . THR C 3 141 ? 0.185   -16.017 -8.239  1.00 27.71 ? 135 THR H OG1 1 
ATOM   3976 C  CG2 . THR C 3 141 ? 2.297   -15.448 -7.237  1.00 25.84 ? 135 THR H CG2 1 
ATOM   3977 N  N   . ALA C 3 142 ? 1.100   -19.452 -9.023  1.00 20.57 ? 136 ALA H N   1 
ATOM   3978 C  CA  . ALA C 3 142 ? 0.217   -20.491 -9.495  1.00 20.33 ? 136 ALA H CA  1 
ATOM   3979 C  C   . ALA C 3 142 ? -0.660  -20.859 -8.330  1.00 23.52 ? 136 ALA H C   1 
ATOM   3980 O  O   . ALA C 3 142 ? -0.209  -20.850 -7.177  1.00 24.34 ? 136 ALA H O   1 
ATOM   3981 C  CB  . ALA C 3 142 ? 1.028   -21.719 -9.977  1.00 20.29 ? 136 ALA H CB  1 
ATOM   3982 N  N   . ALA C 3 143 ? -1.913  -21.177 -8.621  1.00 21.46 ? 137 ALA H N   1 
ATOM   3983 C  CA  . ALA C 3 143 ? -2.807  -21.684 -7.595  1.00 17.95 ? 137 ALA H CA  1 
ATOM   3984 C  C   . ALA C 3 143 ? -3.041  -23.166 -7.831  1.00 19.75 ? 137 ALA H C   1 
ATOM   3985 O  O   . ALA C 3 143 ? -3.105  -23.633 -8.983  1.00 19.22 ? 137 ALA H O   1 
ATOM   3986 C  CB  . ALA C 3 143 ? -4.110  -20.899 -7.570  1.00 16.16 ? 137 ALA H CB  1 
ATOM   3987 N  N   . LEU C 3 144 ? -3.120  -23.915 -6.733  1.00 19.89 ? 138 LEU H N   1 
ATOM   3988 C  CA  . LEU C 3 144 ? -3.421  -25.342 -6.802  1.00 19.26 ? 138 LEU H CA  1 
ATOM   3989 C  C   . LEU C 3 144 ? -4.246  -25.717 -5.591  1.00 21.19 ? 138 LEU H C   1 
ATOM   3990 O  O   . LEU C 3 144 ? -4.378  -24.922 -4.659  1.00 19.54 ? 138 LEU H O   1 
ATOM   3991 C  CB  . LEU C 3 144 ? -2.138  -26.179 -6.887  1.00 19.72 ? 138 LEU H CB  1 
ATOM   3992 C  CG  . LEU C 3 144 ? -1.114  -26.018 -5.753  1.00 21.49 ? 138 LEU H CG  1 
ATOM   3993 C  CD1 . LEU C 3 144 ? -1.294  -27.136 -4.733  1.00 24.20 ? 138 LEU H CD1 1 
ATOM   3994 C  CD2 . LEU C 3 144 ? 0.310   -26.013 -6.295  1.00 26.05 ? 138 LEU H CD2 1 
ATOM   3995 N  N   . GLY C 3 145 ? -4.821  -26.912 -5.597  1.00 18.46 ? 139 GLY H N   1 
ATOM   3996 C  CA  . GLY C 3 145 ? -5.578  -27.315 -4.424  1.00 20.63 ? 139 GLY H CA  1 
ATOM   3997 C  C   . GLY C 3 145 ? -6.150  -28.708 -4.474  1.00 16.36 ? 139 GLY H C   1 
ATOM   3998 O  O   . GLY C 3 145 ? -5.729  -29.546 -5.275  1.00 17.07 ? 139 GLY H O   1 
ATOM   3999 N  N   . CYS C 3 146 ? -7.127  -28.947 -3.597  1.00 18.48 ? 140 CYS H N   1 
ATOM   4000 C  CA  . CYS C 3 146 ? -7.830  -30.219 -3.547  1.00 19.02 ? 140 CYS H CA  1 
ATOM   4001 C  C   . CYS C 3 146 ? -9.298  -29.932 -3.378  1.00 21.69 ? 140 CYS H C   1 
ATOM   4002 O  O   . CYS C 3 146 ? -9.666  -29.071 -2.582  1.00 20.66 ? 140 CYS H O   1 
ATOM   4003 C  CB  . CYS C 3 146 ? -7.324  -31.103 -2.392  1.00 22.82 ? 140 CYS H CB  1 
ATOM   4004 S  SG  . CYS C 3 146 ? -5.724  -31.868 -2.770  1.00 25.88 ? 140 CYS H SG  1 
ATOM   4005 N  N   . LEU C 3 147 ? -10.108 -30.656 -4.142  1.00 21.31 ? 141 LEU H N   1 
ATOM   4006 C  CA  . LEU C 3 147 ? -11.549 -30.657 -3.993  1.00 23.04 ? 141 LEU H CA  1 
ATOM   4007 C  C   . LEU C 3 147 ? -11.949 -31.859 -3.133  1.00 21.37 ? 141 LEU H C   1 
ATOM   4008 O  O   . LEU C 3 147 ? -11.621 -33.016 -3.447  1.00 24.72 ? 141 LEU H O   1 
ATOM   4009 C  CB  . LEU C 3 147 ? -12.203 -30.729 -5.376  1.00 22.90 ? 141 LEU H CB  1 
ATOM   4010 C  CG  . LEU C 3 147 ? -13.727 -30.834 -5.403  1.00 22.86 ? 141 LEU H CG  1 
ATOM   4011 C  CD1 . LEU C 3 147 ? -14.384 -29.581 -4.822  1.00 22.65 ? 141 LEU H CD1 1 
ATOM   4012 C  CD2 . LEU C 3 147 ? -14.207 -31.092 -6.830  1.00 23.41 ? 141 LEU H CD2 1 
ATOM   4013 N  N   . VAL C 3 148 ? -12.646 -31.582 -2.038  1.00 20.67 ? 142 VAL H N   1 
ATOM   4014 C  CA  . VAL C 3 148 ? -13.053 -32.629 -1.099  1.00 23.46 ? 142 VAL H CA  1 
ATOM   4015 C  C   . VAL C 3 148 ? -14.575 -32.747 -1.170  1.00 22.02 ? 142 VAL H C   1 
ATOM   4016 O  O   . VAL C 3 148 ? -15.293 -31.909 -0.629  1.00 24.46 ? 142 VAL H O   1 
ATOM   4017 C  CB  . VAL C 3 148 ? -12.574 -32.324 0.331   1.00 25.95 ? 142 VAL H CB  1 
ATOM   4018 C  CG1 . VAL C 3 148 ? -12.950 -33.459 1.275   1.00 24.11 ? 142 VAL H CG1 1 
ATOM   4019 C  CG2 . VAL C 3 148 ? -11.049 -32.078 0.347   1.00 22.39 ? 142 VAL H CG2 1 
ATOM   4020 N  N   . LYS C 3 149 ? -15.044 -33.776 -1.868  1.00 21.67 ? 143 LYS H N   1 
ATOM   4021 C  CA  . LYS C 3 149 ? -16.440 -33.847 -2.283  1.00 23.32 ? 143 LYS H CA  1 
ATOM   4022 C  C   . LYS C 3 149 ? -17.240 -34.994 -1.651  1.00 25.31 ? 143 LYS H C   1 
ATOM   4023 O  O   . LYS C 3 149 ? -16.742 -36.117 -1.524  1.00 23.72 ? 143 LYS H O   1 
ATOM   4024 C  CB  . LYS C 3 149 ? -16.506 -33.954 -3.820  1.00 26.67 ? 143 LYS H CB  1 
ATOM   4025 C  CG  . LYS C 3 149 ? -17.935 -33.784 -4.387  1.00 29.51 ? 143 LYS H CG  1 
ATOM   4026 C  CD  . LYS C 3 149 ? -17.982 -33.717 -5.911  1.00 31.12 ? 143 LYS H CD  1 
ATOM   4027 C  CE  . LYS C 3 149 ? -19.436 -33.521 -6.415  1.00 34.89 ? 143 LYS H CE  1 
ATOM   4028 N  NZ  . LYS C 3 149 ? -20.278 -34.746 -6.306  1.00 41.99 ? 143 LYS H NZ  1 
ATOM   4029 N  N   . ASP C 3 150 ? -18.487 -34.696 -1.288  1.00 22.95 ? 144 ASP H N   1 
ATOM   4030 C  CA  . ASP C 3 150 ? -19.496 -35.701 -0.931  1.00 23.66 ? 144 ASP H CA  1 
ATOM   4031 C  C   . ASP C 3 150 ? -19.210 -36.407 0.380   1.00 25.43 ? 144 ASP H C   1 
ATOM   4032 O  O   . ASP C 3 150 ? -18.991 -37.611 0.393   1.00 25.67 ? 144 ASP H O   1 
ATOM   4033 C  CB  . ASP C 3 150 ? -19.646 -36.739 -2.060  1.00 22.97 ? 144 ASP H CB  1 
ATOM   4034 C  CG  . ASP C 3 150 ? -20.320 -36.171 -3.276  1.00 25.67 ? 144 ASP H CG  1 
ATOM   4035 O  OD1 . ASP C 3 150 ? -20.931 -35.088 -3.165  1.00 25.68 ? 144 ASP H OD1 1 
ATOM   4036 O  OD2 . ASP C 3 150 ? -20.245 -36.813 -4.343  1.00 31.05 ? 144 ASP H OD2 1 
ATOM   4037 N  N   . TYR C 3 151 ? -19.197 -35.650 1.474   1.00 21.08 ? 145 TYR H N   1 
ATOM   4038 C  CA  . TYR C 3 151 ? -19.022 -36.248 2.807   1.00 21.43 ? 145 TYR H CA  1 
ATOM   4039 C  C   . TYR C 3 151 ? -20.108 -35.848 3.800   1.00 19.90 ? 145 TYR H C   1 
ATOM   4040 O  O   . TYR C 3 151 ? -20.815 -34.850 3.598   1.00 19.70 ? 145 TYR H O   1 
ATOM   4041 C  CB  . TYR C 3 151 ? -17.640 -35.929 3.370   1.00 21.50 ? 145 TYR H CB  1 
ATOM   4042 C  CG  . TYR C 3 151 ? -17.377 -34.458 3.619   1.00 18.26 ? 145 TYR H CG  1 
ATOM   4043 C  CD1 . TYR C 3 151 ? -16.852 -33.636 2.609   1.00 20.84 ? 145 TYR H CD1 1 
ATOM   4044 C  CD2 . TYR C 3 151 ? -17.639 -33.884 4.868   1.00 15.67 ? 145 TYR H CD2 1 
ATOM   4045 C  CE1 . TYR C 3 151 ? -16.602 -32.271 2.837   1.00 20.06 ? 145 TYR H CE1 1 
ATOM   4046 C  CE2 . TYR C 3 151 ? -17.382 -32.520 5.116   1.00 18.95 ? 145 TYR H CE2 1 
ATOM   4047 C  CZ  . TYR C 3 151 ? -16.870 -31.718 4.089   1.00 23.24 ? 145 TYR H CZ  1 
ATOM   4048 O  OH  . TYR C 3 151 ? -16.594 -30.376 4.324   1.00 20.72 ? 145 TYR H OH  1 
ATOM   4049 N  N   . PHE C 3 152 ? -20.250 -36.647 4.862   1.00 18.02 ? 146 PHE H N   1 
ATOM   4050 C  CA  . PHE C 3 152 ? -21.211 -36.357 5.922   1.00 18.66 ? 146 PHE H CA  1 
ATOM   4051 C  C   . PHE C 3 152 ? -20.790 -37.064 7.211   1.00 16.95 ? 146 PHE H C   1 
ATOM   4052 O  O   . PHE C 3 152 ? -20.379 -38.222 7.148   1.00 20.47 ? 146 PHE H O   1 
ATOM   4053 C  CB  . PHE C 3 152 ? -22.631 -36.789 5.526   1.00 20.51 ? 146 PHE H CB  1 
ATOM   4054 C  CG  . PHE C 3 152 ? -23.653 -36.407 6.553   1.00 21.32 ? 146 PHE H CG  1 
ATOM   4055 C  CD1 . PHE C 3 152 ? -24.168 -35.107 6.579   1.00 20.95 ? 146 PHE H CD1 1 
ATOM   4056 C  CD2 . PHE C 3 152 ? -24.037 -37.314 7.547   1.00 22.55 ? 146 PHE H CD2 1 
ATOM   4057 C  CE1 . PHE C 3 152 ? -25.080 -34.714 7.558   1.00 21.33 ? 146 PHE H CE1 1 
ATOM   4058 C  CE2 . PHE C 3 152 ? -24.966 -36.933 8.532   1.00 22.03 ? 146 PHE H CE2 1 
ATOM   4059 C  CZ  . PHE C 3 152 ? -25.476 -35.630 8.532   1.00 23.29 ? 146 PHE H CZ  1 
ATOM   4060 N  N   . PRO C 3 153 ? -20.883 -36.382 8.379   1.00 20.59 ? 147 PRO H N   1 
ATOM   4061 C  CA  . PRO C 3 153 ? -21.254 -34.984 8.612   1.00 18.82 ? 147 PRO H CA  1 
ATOM   4062 C  C   . PRO C 3 153 ? -20.007 -34.116 8.506   1.00 20.57 ? 147 PRO H C   1 
ATOM   4063 O  O   . PRO C 3 153 ? -18.968 -34.598 8.049   1.00 18.54 ? 147 PRO H O   1 
ATOM   4064 C  CB  . PRO C 3 153 ? -21.765 -35.025 10.068  1.00 21.20 ? 147 PRO H CB  1 
ATOM   4065 C  CG  . PRO C 3 153 ? -20.796 -35.961 10.725  1.00 19.02 ? 147 PRO H CG  1 
ATOM   4066 C  CD  . PRO C 3 153 ? -20.625 -37.076 9.661   1.00 22.61 ? 147 PRO H CD  1 
ATOM   4067 N  N   . GLU C 3 154 ? -20.073 -32.862 8.941   1.00 18.15 ? 148 GLU H N   1 
ATOM   4068 C  CA  . GLU C 3 154 ? -18.838 -32.105 9.085   1.00 19.84 ? 148 GLU H CA  1 
ATOM   4069 C  C   . GLU C 3 154 ? -18.125 -32.634 10.357  1.00 19.05 ? 148 GLU H C   1 
ATOM   4070 O  O   . GLU C 3 154 ? -18.759 -33.302 11.197  1.00 21.97 ? 148 GLU H O   1 
ATOM   4071 C  CB  . GLU C 3 154 ? -19.106 -30.598 9.184   1.00 23.09 ? 148 GLU H CB  1 
ATOM   4072 C  CG  . GLU C 3 154 ? -19.745 -29.975 7.928   1.00 20.59 ? 148 GLU H CG  1 
ATOM   4073 C  CD  . GLU C 3 154 ? -19.511 -28.479 7.893   1.00 26.38 ? 148 GLU H CD  1 
ATOM   4074 O  OE1 . GLU C 3 154 ? -18.342 -28.079 7.778   1.00 22.90 ? 148 GLU H OE1 1 
ATOM   4075 O  OE2 . GLU C 3 154 ? -20.483 -27.704 8.027   1.00 26.51 ? 148 GLU H OE2 1 
ATOM   4076 N  N   . PRO C 3 155 ? -16.836 -32.329 10.524  1.00 20.43 ? 149 PRO H N   1 
ATOM   4077 C  CA  . PRO C 3 155 ? -15.922 -31.575 9.678   1.00 20.63 ? 149 PRO H CA  1 
ATOM   4078 C  C   . PRO C 3 155 ? -14.945 -32.437 8.871   1.00 21.48 ? 149 PRO H C   1 
ATOM   4079 O  O   . PRO C 3 155 ? -14.656 -33.568 9.249   1.00 23.15 ? 149 PRO H O   1 
ATOM   4080 C  CB  . PRO C 3 155 ? -15.132 -30.779 10.714  1.00 21.36 ? 149 PRO H CB  1 
ATOM   4081 C  CG  . PRO C 3 155 ? -15.036 -31.704 11.889  1.00 25.23 ? 149 PRO H CG  1 
ATOM   4082 C  CD  . PRO C 3 155 ? -16.189 -32.674 11.805  1.00 21.80 ? 149 PRO H CD  1 
ATOM   4083 N  N   . VAL C 3 156 ? -14.467 -31.891 7.760   1.00 24.04 ? 150 VAL H N   1 
ATOM   4084 C  CA  . VAL C 3 156 ? -13.239 -32.363 7.113   1.00 21.40 ? 150 VAL H CA  1 
ATOM   4085 C  C   . VAL C 3 156 ? -12.164 -31.382 7.552   1.00 27.62 ? 150 VAL H C   1 
ATOM   4086 O  O   . VAL C 3 156 ? -12.423 -30.179 7.650   1.00 28.43 ? 150 VAL H O   1 
ATOM   4087 C  CB  . VAL C 3 156 ? -13.393 -32.378 5.552   1.00 25.18 ? 150 VAL H CB  1 
ATOM   4088 C  CG1 . VAL C 3 156 ? -12.076 -32.124 4.834   1.00 27.82 ? 150 VAL H CG1 1 
ATOM   4089 C  CG2 . VAL C 3 156 ? -13.997 -33.694 5.085   1.00 19.93 ? 150 VAL H CG2 1 
ATOM   4090 N  N   . THR C 3 157 ? -10.976 -31.885 7.864   1.00 22.49 ? 151 THR H N   1 
ATOM   4091 C  CA  . THR C 3 157 ? -9.836  -30.995 8.016   1.00 28.18 ? 151 THR H CA  1 
ATOM   4092 C  C   . THR C 3 157 ? -8.838  -31.250 6.887   1.00 28.77 ? 151 THR H C   1 
ATOM   4093 O  O   . THR C 3 157 ? -8.713  -32.371 6.377   1.00 24.56 ? 151 THR H O   1 
ATOM   4094 C  CB  . THR C 3 157 ? -9.165  -31.118 9.393   1.00 33.57 ? 151 THR H CB  1 
ATOM   4095 O  OG1 . THR C 3 157 ? -8.663  -32.447 9.566   1.00 36.14 ? 151 THR H OG1 1 
ATOM   4096 C  CG2 . THR C 3 157 ? -10.169 -30.784 10.502  1.00 35.64 ? 151 THR H CG2 1 
ATOM   4097 N  N   . VAL C 3 158 ? -8.168  -30.188 6.465   1.00 26.34 ? 152 VAL H N   1 
ATOM   4098 C  CA  . VAL C 3 158 ? -7.169  -30.299 5.419   1.00 23.81 ? 152 VAL H CA  1 
ATOM   4099 C  C   . VAL C 3 158 ? -5.915  -29.611 5.896   1.00 22.78 ? 152 VAL H C   1 
ATOM   4100 O  O   . VAL C 3 158 ? -5.968  -28.500 6.436   1.00 22.85 ? 152 VAL H O   1 
ATOM   4101 C  CB  . VAL C 3 158 ? -7.631  -29.653 4.085   1.00 22.04 ? 152 VAL H CB  1 
ATOM   4102 C  CG1 . VAL C 3 158 ? -6.577  -29.829 2.995   1.00 22.53 ? 152 VAL H CG1 1 
ATOM   4103 C  CG2 . VAL C 3 158 ? -9.028  -30.242 3.621   1.00 23.18 ? 152 VAL H CG2 1 
ATOM   4104 N  N   . SER C 3 159 ? -4.799  -30.294 5.721   1.00 20.64 ? 153 SER H N   1 
ATOM   4105 C  CA  . SER C 3 159 ? -3.488  -29.680 5.856   1.00 20.90 ? 153 SER H CA  1 
ATOM   4106 C  C   . SER C 3 159 ? -2.716  -29.871 4.555   1.00 22.34 ? 153 SER H C   1 
ATOM   4107 O  O   . SER C 3 159 ? -3.100  -30.685 3.688   1.00 21.57 ? 153 SER H O   1 
ATOM   4108 C  CB  . SER C 3 159 ? -2.713  -30.247 7.070   1.00 25.50 ? 153 SER H CB  1 
ATOM   4109 O  OG  . SER C 3 159 ? -2.418  -31.615 6.924   1.00 28.58 ? 153 SER H OG  1 
ATOM   4110 N  N   . TRP C 3 160 ? -1.651  -29.089 4.396   1.00 22.12 ? 154 TRP H N   1 
ATOM   4111 C  CA  . TRP C 3 160 ? -0.770  -29.214 3.240   1.00 18.09 ? 154 TRP H CA  1 
ATOM   4112 C  C   . TRP C 3 160 ? 0.617   -29.576 3.689   1.00 21.95 ? 154 TRP H C   1 
ATOM   4113 O  O   . TRP C 3 160 ? 1.172   -28.941 4.613   1.00 21.76 ? 154 TRP H O   1 
ATOM   4114 C  CB  . TRP C 3 160 ? -0.752  -27.908 2.433   1.00 20.59 ? 154 TRP H CB  1 
ATOM   4115 C  CG  . TRP C 3 160 ? -2.030  -27.740 1.663   1.00 21.75 ? 154 TRP H CG  1 
ATOM   4116 C  CD1 . TRP C 3 160 ? -3.198  -27.163 2.098   1.00 24.30 ? 154 TRP H CD1 1 
ATOM   4117 C  CD2 . TRP C 3 160 ? -2.283  -28.220 0.346   1.00 23.00 ? 154 TRP H CD2 1 
ATOM   4118 N  NE1 . TRP C 3 160 ? -4.150  -27.237 1.111   1.00 24.23 ? 154 TRP H NE1 1 
ATOM   4119 C  CE2 . TRP C 3 160 ? -3.612  -27.874 0.021   1.00 24.14 ? 154 TRP H CE2 1 
ATOM   4120 C  CE3 . TRP C 3 160 ? -1.500  -28.898 -0.608  1.00 19.74 ? 154 TRP H CE3 1 
ATOM   4121 C  CZ2 . TRP C 3 160 ? -4.184  -28.184 -1.226  1.00 19.56 ? 154 TRP H CZ2 1 
ATOM   4122 C  CZ3 . TRP C 3 160 ? -2.061  -29.199 -1.846  1.00 22.78 ? 154 TRP H CZ3 1 
ATOM   4123 C  CH2 . TRP C 3 160 ? -3.393  -28.842 -2.143  1.00 21.56 ? 154 TRP H CH2 1 
ATOM   4124 N  N   . ASN C 3 161 ? 1.187   -30.594 3.038   1.00 20.85 ? 155 ASN H N   1 
ATOM   4125 C  CA  . ASN C 3 161 ? 2.547   -31.043 3.353   1.00 20.97 ? 155 ASN H CA  1 
ATOM   4126 C  C   . ASN C 3 161 ? 2.748   -31.319 4.844   1.00 21.56 ? 155 ASN H C   1 
ATOM   4127 O  O   . ASN C 3 161 ? 3.755   -30.899 5.454   1.00 20.11 ? 155 ASN H O   1 
ATOM   4128 C  CB  . ASN C 3 161 ? 3.577   -30.037 2.806   1.00 19.73 ? 155 ASN H CB  1 
ATOM   4129 C  CG  . ASN C 3 161 ? 3.616   -30.024 1.295   1.00 21.07 ? 155 ASN H CG  1 
ATOM   4130 O  OD1 . ASN C 3 161 ? 3.078   -30.922 0.656   1.00 22.27 ? 155 ASN H OD1 1 
ATOM   4131 N  ND2 . ASN C 3 161 ? 4.248   -29.003 0.712   1.00 20.40 ? 155 ASN H ND2 1 
ATOM   4132 N  N   . SER C 3 162 ? 1.778   -32.038 5.406   1.00 20.22 ? 156 SER H N   1 
ATOM   4133 C  CA  . SER C 3 162 ? 1.782   -32.469 6.811   1.00 27.65 ? 156 SER H CA  1 
ATOM   4134 C  C   . SER C 3 162 ? 1.889   -31.317 7.797   1.00 28.14 ? 156 SER H C   1 
ATOM   4135 O  O   . SER C 3 162 ? 2.437   -31.474 8.884   1.00 29.71 ? 156 SER H O   1 
ATOM   4136 C  CB  . SER C 3 162 ? 2.874   -33.526 7.048   1.00 24.42 ? 156 SER H CB  1 
ATOM   4137 O  OG  . SER C 3 162 ? 2.653   -34.647 6.213   1.00 31.09 ? 156 SER H OG  1 
ATOM   4138 N  N   . GLY C 3 163 ? 1.347   -30.161 7.406   1.00 26.37 ? 157 GLY H N   1 
ATOM   4139 C  CA  . GLY C 3 163 ? 1.371   -28.963 8.236   1.00 26.53 ? 157 GLY H CA  1 
ATOM   4140 C  C   . GLY C 3 163 ? 2.536   -28.037 7.959   1.00 28.13 ? 157 GLY H C   1 
ATOM   4141 O  O   . GLY C 3 163 ? 2.606   -26.952 8.524   1.00 27.83 ? 157 GLY H O   1 
ATOM   4142 N  N   . ALA C 3 164 ? 3.464   -28.461 7.100   1.00 24.57 ? 158 ALA H N   1 
ATOM   4143 C  CA  . ALA C 3 164 ? 4.625   -27.624 6.773   1.00 24.70 ? 158 ALA H CA  1 
ATOM   4144 C  C   . ALA C 3 164 ? 4.281   -26.434 5.870   1.00 26.60 ? 158 ALA H C   1 
ATOM   4145 O  O   . ALA C 3 164 ? 5.051   -25.476 5.793   1.00 25.49 ? 158 ALA H O   1 
ATOM   4146 C  CB  . ALA C 3 164 ? 5.750   -28.469 6.168   1.00 25.79 ? 158 ALA H CB  1 
ATOM   4147 N  N   . LEU C 3 165 ? 3.124   -26.494 5.196   1.00 22.07 ? 159 LEU H N   1 
ATOM   4148 C  CA  . LEU C 3 165 ? 2.696   -25.414 4.296   1.00 24.32 ? 159 LEU H CA  1 
ATOM   4149 C  C   . LEU C 3 165 ? 1.393   -24.788 4.818   1.00 24.94 ? 159 LEU H C   1 
ATOM   4150 O  O   . LEU C 3 165 ? 0.348   -25.421 4.794   1.00 25.09 ? 159 LEU H O   1 
ATOM   4151 C  CB  . LEU C 3 165 ? 2.521   -25.941 2.850   1.00 23.55 ? 159 LEU H CB  1 
ATOM   4152 C  CG  . LEU C 3 165 ? 1.991   -25.049 1.708   1.00 24.13 ? 159 LEU H CG  1 
ATOM   4153 C  CD1 . LEU C 3 165 ? 2.676   -23.695 1.580   1.00 28.52 ? 159 LEU H CD1 1 
ATOM   4154 C  CD2 . LEU C 3 165 ? 2.041   -25.777 0.345   1.00 24.13 ? 159 LEU H CD2 1 
ATOM   4155 N  N   . THR C 3 166 ? 1.462   -23.545 5.289   1.00 23.58 ? 160 THR H N   1 
ATOM   4156 C  CA  . THR C 3 166 ? 0.279   -22.872 5.845   1.00 21.30 ? 160 THR H CA  1 
ATOM   4157 C  C   . THR C 3 166 ? 0.049   -21.505 5.198   1.00 27.31 ? 160 THR H C   1 
ATOM   4158 O  O   . THR C 3 166 ? -1.099  -21.045 5.081   1.00 24.32 ? 160 THR H O   1 
ATOM   4159 C  CB  . THR C 3 166 ? 0.396   -22.692 7.384   1.00 23.60 ? 160 THR H CB  1 
ATOM   4160 O  OG1 . THR C 3 166 ? 1.599   -21.982 7.700   1.00 21.26 ? 160 THR H OG1 1 
ATOM   4161 C  CG2 . THR C 3 166 ? 0.418   -24.028 8.098   1.00 26.76 ? 160 THR H CG2 1 
ATOM   4162 N  N   . SER C 3 167 ? 1.135   -20.845 4.791   1.00 24.20 ? 161 SER H N   1 
ATOM   4163 C  CA  A SER C 3 167 ? 1.031   -19.539 4.164   0.50 25.34 ? 161 SER H CA  1 
ATOM   4164 C  CA  B SER C 3 167 ? 1.046   -19.530 4.142   0.50 25.43 ? 161 SER H CA  1 
ATOM   4165 C  C   . SER C 3 167 ? 0.239   -19.616 2.850   1.00 27.24 ? 161 SER H C   1 
ATOM   4166 O  O   . SER C 3 167 ? 0.466   -20.513 2.035   1.00 28.84 ? 161 SER H O   1 
ATOM   4167 C  CB  A SER C 3 167 ? 2.424   -18.969 3.930   0.50 24.67 ? 161 SER H CB  1 
ATOM   4168 C  CB  B SER C 3 167 ? 2.436   -18.970 3.824   0.50 25.07 ? 161 SER H CB  1 
ATOM   4169 O  OG  A SER C 3 167 ? 2.344   -17.618 3.555   0.50 26.00 ? 161 SER H OG  1 
ATOM   4170 O  OG  B SER C 3 167 ? 3.182   -18.703 4.991   0.50 25.91 ? 161 SER H OG  1 
ATOM   4171 N  N   . GLY C 3 168 ? -0.700  -18.681 2.666   1.00 25.08 ? 162 GLY H N   1 
ATOM   4172 C  CA  . GLY C 3 168 ? -1.481  -18.574 1.420   1.00 28.59 ? 162 GLY H CA  1 
ATOM   4173 C  C   . GLY C 3 168 ? -2.491  -19.693 1.183   1.00 24.28 ? 162 GLY H C   1 
ATOM   4174 O  O   . GLY C 3 168 ? -3.039  -19.816 0.086   1.00 27.07 ? 162 GLY H O   1 
ATOM   4175 N  N   . VAL C 3 169 ? -2.722  -20.517 2.200   1.00 23.28 ? 163 VAL H N   1 
ATOM   4176 C  CA  . VAL C 3 169 ? -3.736  -21.569 2.126   1.00 23.94 ? 163 VAL H CA  1 
ATOM   4177 C  C   . VAL C 3 169 ? -5.110  -20.975 2.406   1.00 23.61 ? 163 VAL H C   1 
ATOM   4178 O  O   . VAL C 3 169 ? -5.277  -20.176 3.329   1.00 22.61 ? 163 VAL H O   1 
ATOM   4179 C  CB  . VAL C 3 169 ? -3.448  -22.732 3.127   1.00 20.21 ? 163 VAL H CB  1 
ATOM   4180 C  CG1 . VAL C 3 169 ? -4.660  -23.680 3.243   1.00 23.60 ? 163 VAL H CG1 1 
ATOM   4181 C  CG2 . VAL C 3 169 ? -2.168  -23.489 2.732   1.00 20.29 ? 163 VAL H CG2 1 
ATOM   4182 N  N   . HIS C 3 170 ? -6.095  -21.347 1.595   1.00 22.28 ? 164 HIS H N   1 
ATOM   4183 C  CA  . HIS C 3 170 ? -7.492  -21.012 1.879   1.00 23.60 ? 164 HIS H CA  1 
ATOM   4184 C  C   . HIS C 3 170 ? -8.286  -22.323 1.876   1.00 23.47 ? 164 HIS H C   1 
ATOM   4185 O  O   . HIS C 3 170 ? -8.459  -22.954 0.852   1.00 21.75 ? 164 HIS H O   1 
ATOM   4186 C  CB  . HIS C 3 170 ? -8.075  -20.016 0.853   1.00 25.10 ? 164 HIS H CB  1 
ATOM   4187 C  CG  . HIS C 3 170 ? -7.339  -18.705 0.767   1.00 22.83 ? 164 HIS H CG  1 
ATOM   4188 N  ND1 . HIS C 3 170 ? -7.258  -17.817 1.818   1.00 24.49 ? 164 HIS H ND1 1 
ATOM   4189 C  CD2 . HIS C 3 170 ? -6.670  -18.130 -0.260  1.00 24.78 ? 164 HIS H CD2 1 
ATOM   4190 C  CE1 . HIS C 3 170 ? -6.568  -16.753 1.442   1.00 24.13 ? 164 HIS H CE1 1 
ATOM   4191 N  NE2 . HIS C 3 170 ? -6.212  -16.913 0.184   1.00 27.82 ? 164 HIS H NE2 1 
ATOM   4192 N  N   . THR C 3 171 ? -8.742  -22.747 3.041   1.00 24.07 ? 165 THR H N   1 
ATOM   4193 C  CA  . THR C 3 171 ? -9.627  -23.902 3.104   1.00 21.65 ? 165 THR H CA  1 
ATOM   4194 C  C   . THR C 3 171 ? -11.050 -23.393 3.320   1.00 24.45 ? 165 THR H C   1 
ATOM   4195 O  O   . THR C 3 171 ? -11.388 -22.859 4.375   1.00 20.98 ? 165 THR H O   1 
ATOM   4196 C  CB  . THR C 3 171 ? -9.166  -24.873 4.188   1.00 26.19 ? 165 THR H CB  1 
ATOM   4197 O  OG1 . THR C 3 171 ? -7.852  -25.320 3.839   1.00 25.60 ? 165 THR H OG1 1 
ATOM   4198 C  CG2 . THR C 3 171 ? -10.121 -26.080 4.293   1.00 24.64 ? 165 THR H CG2 1 
ATOM   4199 N  N   . PHE C 3 172 ? -11.878 -23.537 2.296   1.00 19.14 ? 166 PHE H N   1 
ATOM   4200 C  CA  . PHE C 3 172 ? -13.156 -22.835 2.307   1.00 23.75 ? 166 PHE H CA  1 
ATOM   4201 C  C   . PHE C 3 172 ? -14.191 -23.531 3.189   1.00 24.16 ? 166 PHE H C   1 
ATOM   4202 O  O   . PHE C 3 172 ? -14.161 -24.759 3.345   1.00 22.49 ? 166 PHE H O   1 
ATOM   4203 C  CB  . PHE C 3 172 ? -13.702 -22.682 0.898   1.00 23.79 ? 166 PHE H CB  1 
ATOM   4204 C  CG  . PHE C 3 172 ? -12.866 -21.783 0.005   1.00 23.13 ? 166 PHE H CG  1 
ATOM   4205 C  CD1 . PHE C 3 172 ? -13.201 -20.453 -0.158  1.00 25.71 ? 166 PHE H CD1 1 
ATOM   4206 C  CD2 . PHE C 3 172 ? -11.789 -22.306 -0.730  1.00 24.76 ? 166 PHE H CD2 1 
ATOM   4207 C  CE1 . PHE C 3 172 ? -12.433 -19.635 -0.974  1.00 24.59 ? 166 PHE H CE1 1 
ATOM   4208 C  CE2 . PHE C 3 172 ? -11.010 -21.491 -1.546  1.00 26.11 ? 166 PHE H CE2 1 
ATOM   4209 C  CZ  . PHE C 3 172 ? -11.339 -20.158 -1.670  1.00 24.47 ? 166 PHE H CZ  1 
ATOM   4210 N  N   . PRO C 3 173 ? -15.122 -22.739 3.757   1.00 24.64 ? 167 PRO H N   1 
ATOM   4211 C  CA  . PRO C 3 173 ? -16.304 -23.315 4.394   1.00 21.31 ? 167 PRO H CA  1 
ATOM   4212 C  C   . PRO C 3 173 ? -16.993 -24.304 3.459   1.00 22.92 ? 167 PRO H C   1 
ATOM   4213 O  O   . PRO C 3 173 ? -17.105 -24.060 2.237   1.00 22.95 ? 167 PRO H O   1 
ATOM   4214 C  CB  . PRO C 3 173 ? -17.194 -22.087 4.660   1.00 23.46 ? 167 PRO H CB  1 
ATOM   4215 C  CG  . PRO C 3 173 ? -16.205 -20.963 4.842   1.00 23.30 ? 167 PRO H CG  1 
ATOM   4216 C  CD  . PRO C 3 173 ? -15.090 -21.266 3.869   1.00 25.98 ? 167 PRO H CD  1 
ATOM   4217 N  N   . ALA C 3 174 ? -17.425 -25.424 4.034   1.00 23.13 ? 168 ALA H N   1 
ATOM   4218 C  CA  . ALA C 3 174 ? -18.174 -26.443 3.301   1.00 23.39 ? 168 ALA H CA  1 
ATOM   4219 C  C   . ALA C 3 174 ? -19.476 -25.860 2.758   1.00 22.16 ? 168 ALA H C   1 
ATOM   4220 O  O   . ALA C 3 174 ? -20.065 -24.970 3.372   1.00 20.25 ? 168 ALA H O   1 
ATOM   4221 C  CB  . ALA C 3 174 ? -18.484 -27.625 4.212   1.00 24.89 ? 168 ALA H CB  1 
ATOM   4222 N  N   . VAL C 3 175 ? -19.906 -26.351 1.601   1.00 20.03 ? 169 VAL H N   1 
ATOM   4223 C  CA  . VAL C 3 175 ? -21.262 -26.085 1.126   1.00 22.90 ? 169 VAL H CA  1 
ATOM   4224 C  C   . VAL C 3 175 ? -22.080 -27.370 1.255   1.00 23.16 ? 169 VAL H C   1 
ATOM   4225 O  O   . VAL C 3 175 ? -21.537 -28.476 1.208   1.00 22.94 ? 169 VAL H O   1 
ATOM   4226 C  CB  . VAL C 3 175 ? -21.300 -25.567 -0.344  1.00 25.30 ? 169 VAL H CB  1 
ATOM   4227 C  CG1 . VAL C 3 175 ? -20.611 -24.219 -0.465  1.00 25.63 ? 169 VAL H CG1 1 
ATOM   4228 C  CG2 . VAL C 3 175 ? -20.706 -26.588 -1.324  1.00 25.19 ? 169 VAL H CG2 1 
ATOM   4229 N  N   . LEU C 3 176 ? -23.379 -27.197 1.445   1.00 19.74 ? 170 LEU H N   1 
ATOM   4230 C  CA  . LEU C 3 176 ? -24.322 -28.297 1.544   1.00 22.71 ? 170 LEU H CA  1 
ATOM   4231 C  C   . LEU C 3 176 ? -24.882 -28.517 0.151   1.00 24.50 ? 170 LEU H C   1 
ATOM   4232 O  O   . LEU C 3 176 ? -25.511 -27.630 -0.427  1.00 25.02 ? 170 LEU H O   1 
ATOM   4233 C  CB  . LEU C 3 176 ? -25.415 -27.963 2.567   1.00 23.21 ? 170 LEU H CB  1 
ATOM   4234 C  CG  . LEU C 3 176 ? -26.506 -28.992 2.870   1.00 25.57 ? 170 LEU H CG  1 
ATOM   4235 C  CD1 . LEU C 3 176 ? -25.859 -30.300 3.381   1.00 26.88 ? 170 LEU H CD1 1 
ATOM   4236 C  CD2 . LEU C 3 176 ? -27.507 -28.413 3.880   1.00 22.90 ? 170 LEU H CD2 1 
ATOM   4237 N  N   . GLN C 3 177 ? -24.616 -29.696 -0.399  1.00 21.41 ? 171 GLN H N   1 
ATOM   4238 C  CA  . GLN C 3 177 ? -25.139 -30.075 -1.706  1.00 22.49 ? 171 GLN H CA  1 
ATOM   4239 C  C   . GLN C 3 177 ? -26.600 -30.490 -1.594  1.00 23.46 ? 171 GLN H C   1 
ATOM   4240 O  O   . GLN C 3 177 ? -27.102 -30.728 -0.490  1.00 23.62 ? 171 GLN H O   1 
ATOM   4241 C  CB  . GLN C 3 177 ? -24.269 -31.181 -2.317  1.00 26.91 ? 171 GLN H CB  1 
ATOM   4242 C  CG  . GLN C 3 177 ? -22.794 -30.767 -2.449  1.00 30.38 ? 171 GLN H CG  1 
ATOM   4243 C  CD  . GLN C 3 177 ? -21.899 -31.905 -2.868  1.00 38.03 ? 171 GLN H CD  1 
ATOM   4244 O  OE1 . GLN C 3 177 ? -21.453 -31.966 -4.019  1.00 39.83 ? 171 GLN H OE1 1 
ATOM   4245 N  NE2 . GLN C 3 177 ? -21.629 -32.825 -1.941  1.00 34.38 ? 171 GLN H NE2 1 
ATOM   4246 N  N   . SER C 3 178 ? -27.287 -30.563 -2.735  1.00 24.72 ? 172 SER H N   1 
ATOM   4247 C  CA  . SER C 3 178 ? -28.708 -30.893 -2.755  1.00 28.24 ? 172 SER H CA  1 
ATOM   4248 C  C   . SER C 3 178 ? -28.942 -32.279 -2.150  1.00 28.52 ? 172 SER H C   1 
ATOM   4249 O  O   . SER C 3 178 ? -29.985 -32.518 -1.541  1.00 26.19 ? 172 SER H O   1 
ATOM   4250 C  CB  . SER C 3 178 ? -29.278 -30.818 -4.179  1.00 27.15 ? 172 SER H CB  1 
ATOM   4251 O  OG  . SER C 3 178 ? -28.493 -31.575 -5.080  1.00 38.64 ? 172 SER H OG  1 
ATOM   4252 N  N   . SER C 3 179 ? -27.951 -33.162 -2.312  1.00 28.49 ? 173 SER H N   1 
ATOM   4253 C  CA  . SER C 3 179 ? -27.952 -34.511 -1.726  1.00 27.07 ? 173 SER H CA  1 
ATOM   4254 C  C   . SER C 3 179 ? -27.987 -34.536 -0.187  1.00 25.19 ? 173 SER H C   1 
ATOM   4255 O  O   . SER C 3 179 ? -28.343 -35.552 0.421   1.00 27.98 ? 173 SER H O   1 
ATOM   4256 C  CB  . SER C 3 179 ? -26.727 -35.288 -2.218  1.00 25.06 ? 173 SER H CB  1 
ATOM   4257 O  OG  . SER C 3 179 ? -25.522 -34.643 -1.823  1.00 21.94 ? 173 SER H OG  1 
ATOM   4258 N  N   . GLY C 3 180 ? -27.614 -33.430 0.440   1.00 20.72 ? 174 GLY H N   1 
ATOM   4259 C  CA  . GLY C 3 180 ? -27.422 -33.407 1.884   1.00 23.28 ? 174 GLY H CA  1 
ATOM   4260 C  C   . GLY C 3 180 ? -25.997 -33.735 2.300   1.00 24.47 ? 174 GLY H C   1 
ATOM   4261 O  O   . GLY C 3 180 ? -25.683 -33.755 3.505   1.00 22.98 ? 174 GLY H O   1 
ATOM   4262 N  N   . LEU C 3 181 ? -25.131 -33.978 1.310   1.00 20.75 ? 175 LEU H N   1 
ATOM   4263 C  CA  . LEU C 3 181 ? -23.712 -34.178 1.545   1.00 17.00 ? 175 LEU H CA  1 
ATOM   4264 C  C   . LEU C 3 181 ? -22.961 -32.850 1.433   1.00 20.90 ? 175 LEU H C   1 
ATOM   4265 O  O   . LEU C 3 181 ? -23.402 -31.942 0.730   1.00 23.97 ? 175 LEU H O   1 
ATOM   4266 C  CB  . LEU C 3 181 ? -23.121 -35.183 0.539   1.00 18.97 ? 175 LEU H CB  1 
ATOM   4267 C  CG  . LEU C 3 181 ? -23.748 -36.584 0.478   1.00 22.65 ? 175 LEU H CG  1 
ATOM   4268 C  CD1 . LEU C 3 181 ? -23.091 -37.419 -0.637  1.00 23.57 ? 175 LEU H CD1 1 
ATOM   4269 C  CD2 . LEU C 3 181 ? -23.647 -37.317 1.810   1.00 24.91 ? 175 LEU H CD2 1 
ATOM   4270 N  N   . TYR C 3 182 ? -21.822 -32.749 2.100   1.00 21.80 ? 176 TYR H N   1 
ATOM   4271 C  CA  . TYR C 3 182 ? -20.998 -31.537 2.041   1.00 17.44 ? 176 TYR H CA  1 
ATOM   4272 C  C   . TYR C 3 182 ? -19.879 -31.654 1.000   1.00 20.08 ? 176 TYR H C   1 
ATOM   4273 O  O   . TYR C 3 182 ? -19.476 -32.764 0.648   1.00 20.08 ? 176 TYR H O   1 
ATOM   4274 C  CB  . TYR C 3 182 ? -20.351 -31.263 3.404   1.00 22.54 ? 176 TYR H CB  1 
ATOM   4275 C  CG  . TYR C 3 182 ? -21.327 -30.928 4.497   1.00 20.56 ? 176 TYR H CG  1 
ATOM   4276 C  CD1 . TYR C 3 182 ? -21.827 -29.634 4.630   1.00 20.71 ? 176 TYR H CD1 1 
ATOM   4277 C  CD2 . TYR C 3 182 ? -21.753 -31.899 5.388   1.00 22.72 ? 176 TYR H CD2 1 
ATOM   4278 C  CE1 . TYR C 3 182 ? -22.753 -29.313 5.626   1.00 23.18 ? 176 TYR H CE1 1 
ATOM   4279 C  CE2 . TYR C 3 182 ? -22.661 -31.595 6.398   1.00 22.39 ? 176 TYR H CE2 1 
ATOM   4280 C  CZ  . TYR C 3 182 ? -23.150 -30.291 6.514   1.00 23.00 ? 176 TYR H CZ  1 
ATOM   4281 O  OH  . TYR C 3 182 ? -24.050 -29.975 7.504   1.00 25.57 ? 176 TYR H OH  1 
ATOM   4282 N  N   . SER C 3 183 ? -19.381 -30.496 0.536   1.00 19.80 ? 177 SER H N   1 
ATOM   4283 C  CA  A SER C 3 183 ? -18.200 -30.409 -0.323  0.50 21.02 ? 177 SER H CA  1 
ATOM   4284 C  CA  B SER C 3 183 ? -18.182 -30.415 -0.310  0.50 19.62 ? 177 SER H CA  1 
ATOM   4285 C  C   . SER C 3 183 ? -17.393 -29.179 0.101   1.00 22.28 ? 177 SER H C   1 
ATOM   4286 O  O   . SER C 3 183 ? -17.971 -28.168 0.470   1.00 20.07 ? 177 SER H O   1 
ATOM   4287 C  CB  A SER C 3 183 ? -18.637 -30.251 -1.781  0.50 22.86 ? 177 SER H CB  1 
ATOM   4288 C  CB  B SER C 3 183 ? -18.549 -30.286 -1.794  0.50 19.58 ? 177 SER H CB  1 
ATOM   4289 O  OG  A SER C 3 183 ? -17.570 -30.476 -2.678  0.50 25.54 ? 177 SER H OG  1 
ATOM   4290 O  OG  B SER C 3 183 ? -19.034 -31.506 -2.328  0.50 18.79 ? 177 SER H OG  1 
ATOM   4291 N  N   . LEU C 3 184 ? -16.067 -29.272 0.049   1.00 21.22 ? 178 LEU H N   1 
ATOM   4292 C  CA  . LEU C 3 184 ? -15.225 -28.108 0.238   1.00 21.12 ? 178 LEU H CA  1 
ATOM   4293 C  C   . LEU C 3 184 ? -14.011 -28.168 -0.679  1.00 21.60 ? 178 LEU H C   1 
ATOM   4294 O  O   . LEU C 3 184 ? -13.694 -29.220 -1.230  1.00 20.86 ? 178 LEU H O   1 
ATOM   4295 C  CB  . LEU C 3 184 ? -14.802 -27.934 1.708   1.00 21.00 ? 178 LEU H CB  1 
ATOM   4296 C  CG  . LEU C 3 184 ? -13.805 -28.857 2.430   1.00 21.42 ? 178 LEU H CG  1 
ATOM   4297 C  CD1 . LEU C 3 184 ? -12.346 -28.668 1.961   1.00 21.57 ? 178 LEU H CD1 1 
ATOM   4298 C  CD2 . LEU C 3 184 ? -13.892 -28.634 3.956   1.00 24.59 ? 178 LEU H CD2 1 
ATOM   4299 N  N   . SER C 3 185 ? -13.361 -27.020 -0.852  1.00 23.38 ? 179 SER H N   1 
ATOM   4300 C  CA  . SER C 3 185 ? -12.076 -26.972 -1.514  1.00 23.88 ? 179 SER H CA  1 
ATOM   4301 C  C   . SER C 3 185 ? -11.044 -26.336 -0.605  1.00 21.03 ? 179 SER H C   1 
ATOM   4302 O  O   . SER C 3 185 ? -11.371 -25.536 0.282   1.00 21.93 ? 179 SER H O   1 
ATOM   4303 C  CB  . SER C 3 185 ? -12.173 -26.227 -2.846  1.00 31.33 ? 179 SER H CB  1 
ATOM   4304 O  OG  . SER C 3 185 ? -12.709 -24.938 -2.655  1.00 39.01 ? 179 SER H OG  1 
ATOM   4305 N  N   . SER C 3 186 ? -9.791  -26.740 -0.798  1.00 20.80 ? 180 SER H N   1 
ATOM   4306 C  CA  . SER C 3 186 ? -8.678  -26.119 -0.106  1.00 18.99 ? 180 SER H CA  1 
ATOM   4307 C  C   . SER C 3 186 ? -7.656  -25.764 -1.166  1.00 18.66 ? 180 SER H C   1 
ATOM   4308 O  O   . SER C 3 186 ? -7.268  -26.616 -1.978  1.00 21.82 ? 180 SER H O   1 
ATOM   4309 C  CB  . SER C 3 186 ? -8.070  -27.083 0.921   1.00 19.90 ? 180 SER H CB  1 
ATOM   4310 O  OG  . SER C 3 186 ? -7.001  -26.458 1.603   1.00 19.84 ? 180 SER H OG  1 
ATOM   4311 N  N   . VAL C 3 187 ? -7.239  -24.503 -1.190  1.00 21.09 ? 181 VAL H N   1 
ATOM   4312 C  CA  . VAL C 3 187 ? -6.327  -24.046 -2.251  1.00 22.25 ? 181 VAL H CA  1 
ATOM   4313 C  C   . VAL C 3 187 ? -5.106  -23.393 -1.646  1.00 19.85 ? 181 VAL H C   1 
ATOM   4314 O  O   . VAL C 3 187 ? -5.111  -23.071 -0.485  1.00 22.08 ? 181 VAL H O   1 
ATOM   4315 C  CB  . VAL C 3 187 ? -7.002  -23.064 -3.260  1.00 24.20 ? 181 VAL H CB  1 
ATOM   4316 C  CG1 . VAL C 3 187 ? -8.204  -23.743 -3.953  1.00 27.07 ? 181 VAL H CG1 1 
ATOM   4317 C  CG2 . VAL C 3 187 ? -7.374  -21.720 -2.565  1.00 21.03 ? 181 VAL H CG2 1 
ATOM   4318 N  N   . VAL C 3 188 ? -4.062  -23.226 -2.454  1.00 20.36 ? 182 VAL H N   1 
ATOM   4319 C  CA  . VAL C 3 188 ? -2.851  -22.535 -2.027  1.00 22.28 ? 182 VAL H CA  1 
ATOM   4320 C  C   . VAL C 3 188 ? -2.266  -21.853 -3.244  1.00 21.00 ? 182 VAL H C   1 
ATOM   4321 O  O   . VAL C 3 188 ? -2.357  -22.379 -4.355  1.00 23.91 ? 182 VAL H O   1 
ATOM   4322 C  CB  . VAL C 3 188 ? -1.823  -23.493 -1.355  1.00 22.15 ? 182 VAL H CB  1 
ATOM   4323 C  CG1 . VAL C 3 188 ? -1.301  -24.534 -2.314  1.00 23.46 ? 182 VAL H CG1 1 
ATOM   4324 C  CG2 . VAL C 3 188 ? -0.663  -22.716 -0.750  1.00 24.17 ? 182 VAL H CG2 1 
ATOM   4325 N  N   . THR C 3 189 ? -1.686  -20.678 -3.041  1.00 21.84 ? 183 THR H N   1 
ATOM   4326 C  CA  . THR C 3 189 ? -0.935  -20.025 -4.113  1.00 20.45 ? 183 THR H CA  1 
ATOM   4327 C  C   . THR C 3 189 ? 0.543   -20.166 -3.805  1.00 21.02 ? 183 THR H C   1 
ATOM   4328 O  O   . THR C 3 189 ? 0.969   -19.996 -2.649  1.00 18.60 ? 183 THR H O   1 
ATOM   4329 C  CB  . THR C 3 189 ? -1.329  -18.550 -4.308  1.00 24.16 ? 183 THR H CB  1 
ATOM   4330 O  OG1 . THR C 3 189 ? -1.194  -17.854 -3.068  1.00 32.35 ? 183 THR H OG1 1 
ATOM   4331 C  CG2 . THR C 3 189 ? -2.782  -18.447 -4.770  1.00 20.72 ? 183 THR H CG2 1 
ATOM   4332 N  N   . VAL C 3 190 ? 1.320   -20.488 -4.836  1.00 18.68 ? 184 VAL H N   1 
ATOM   4333 C  CA  . VAL C 3 190 ? 2.743   -20.791 -4.688  1.00 19.47 ? 184 VAL H CA  1 
ATOM   4334 C  C   . VAL C 3 190 ? 3.534   -20.146 -5.852  1.00 17.38 ? 184 VAL H C   1 
ATOM   4335 O  O   . VAL C 3 190 ? 2.932   -19.701 -6.833  1.00 20.16 ? 184 VAL H O   1 
ATOM   4336 C  CB  . VAL C 3 190 ? 2.972   -22.341 -4.663  1.00 19.47 ? 184 VAL H CB  1 
ATOM   4337 C  CG1 . VAL C 3 190 ? 2.210   -23.011 -3.495  1.00 22.28 ? 184 VAL H CG1 1 
ATOM   4338 C  CG2 . VAL C 3 190 ? 2.563   -22.989 -6.022  1.00 17.29 ? 184 VAL H CG2 1 
ATOM   4339 N  N   . PRO C 3 191 ? 4.875   -20.092 -5.754  1.00 18.83 ? 185 PRO H N   1 
ATOM   4340 C  CA  . PRO C 3 191 ? 5.633   -19.576 -6.893  1.00 18.60 ? 185 PRO H CA  1 
ATOM   4341 C  C   . PRO C 3 191 ? 5.424   -20.473 -8.115  1.00 20.60 ? 185 PRO H C   1 
ATOM   4342 O  O   . PRO C 3 191 ? 5.461   -21.701 -7.991  1.00 17.89 ? 185 PRO H O   1 
ATOM   4343 C  CB  . PRO C 3 191 ? 7.090   -19.674 -6.419  1.00 16.94 ? 185 PRO H CB  1 
ATOM   4344 C  CG  . PRO C 3 191 ? 6.963   -19.666 -4.892  1.00 17.74 ? 185 PRO H CG  1 
ATOM   4345 C  CD  . PRO C 3 191 ? 5.757   -20.452 -4.626  1.00 17.28 ? 185 PRO H CD  1 
ATOM   4346 N  N   . SER C 3 192 ? 5.206   -19.869 -9.284  1.00 21.01 ? 186 SER H N   1 
ATOM   4347 C  CA  . SER C 3 192 ? 5.201   -20.663 -10.523 1.00 19.52 ? 186 SER H CA  1 
ATOM   4348 C  C   . SER C 3 192 ? 6.578   -21.262 -10.836 1.00 17.97 ? 186 SER H C   1 
ATOM   4349 O  O   . SER C 3 192 ? 6.665   -22.313 -11.482 1.00 19.62 ? 186 SER H O   1 
ATOM   4350 C  CB  . SER C 3 192 ? 4.678   -19.830 -11.709 1.00 19.20 ? 186 SER H CB  1 
ATOM   4351 O  OG  . SER C 3 192 ? 5.573   -18.798 -12.004 1.00 24.17 ? 186 SER H OG  1 
ATOM   4352 N  N   . SER C 3 193 ? 7.652   -20.613 -10.367 1.00 15.44 ? 187 SER H N   1 
ATOM   4353 C  CA  . SER C 3 193 ? 9.008   -20.985 -10.752 1.00 16.90 ? 187 SER H CA  1 
ATOM   4354 C  C   . SER C 3 193 ? 9.454   -22.329 -10.208 1.00 20.16 ? 187 SER H C   1 
ATOM   4355 O  O   . SER C 3 193 ? 10.351  -22.950 -10.766 1.00 20.25 ? 187 SER H O   1 
ATOM   4356 C  CB  . SER C 3 193 ? 10.027  -19.940 -10.287 1.00 17.59 ? 187 SER H CB  1 
ATOM   4357 O  OG  . SER C 3 193 ? 10.055  -19.870 -8.863  1.00 20.51 ? 187 SER H OG  1 
ATOM   4358 N  N   . SER C 3 194 ? 8.859   -22.749 -9.104  1.00 21.10 ? 188 SER H N   1 
ATOM   4359 C  CA  . SER C 3 194 ? 9.331   -23.943 -8.391  1.00 21.94 ? 188 SER H CA  1 
ATOM   4360 C  C   . SER C 3 194 ? 8.369   -25.130 -8.497  1.00 21.25 ? 188 SER H C   1 
ATOM   4361 O  O   . SER C 3 194 ? 8.458   -26.079 -7.714  1.00 19.18 ? 188 SER H O   1 
ATOM   4362 C  CB  . SER C 3 194 ? 9.588   -23.593 -6.922  1.00 17.05 ? 188 SER H CB  1 
ATOM   4363 O  OG  . SER C 3 194 ? 8.403   -23.105 -6.334  1.00 21.93 ? 188 SER H OG  1 
ATOM   4364 N  N   . LEU C 3 195 ? 7.449   -25.082 -9.462  1.00 20.94 ? 189 LEU H N   1 
ATOM   4365 C  CA  . LEU C 3 195 ? 6.494   -26.174 -9.654  1.00 18.29 ? 189 LEU H CA  1 
ATOM   4366 C  C   . LEU C 3 195 ? 7.209   -27.482 -9.992  1.00 16.91 ? 189 LEU H C   1 
ATOM   4367 O  O   . LEU C 3 195 ? 6.677   -28.561 -9.742  1.00 21.60 ? 189 LEU H O   1 
ATOM   4368 C  CB  . LEU C 3 195 ? 5.451   -25.841 -10.734 1.00 18.80 ? 189 LEU H CB  1 
ATOM   4369 C  CG  . LEU C 3 195 ? 4.403   -24.808 -10.292 1.00 18.04 ? 189 LEU H CG  1 
ATOM   4370 C  CD1 . LEU C 3 195 ? 3.506   -24.398 -11.476 1.00 23.03 ? 189 LEU H CD1 1 
ATOM   4371 C  CD2 . LEU C 3 195 ? 3.573   -25.283 -9.080  1.00 19.22 ? 189 LEU H CD2 1 
ATOM   4372 N  N   . GLY C 3 196 ? 8.414   -27.365 -10.543 1.00 20.45 ? 190 GLY H N   1 
ATOM   4373 C  CA  . GLY C 3 196 ? 9.225   -28.520 -10.900 1.00 18.77 ? 190 GLY H CA  1 
ATOM   4374 C  C   . GLY C 3 196 ? 10.021  -29.115 -9.749  1.00 26.06 ? 190 GLY H C   1 
ATOM   4375 O  O   . GLY C 3 196 ? 10.514  -30.245 -9.864  1.00 24.39 ? 190 GLY H O   1 
ATOM   4376 N  N   . THR C 3 197 ? 10.161  -28.376 -8.641  1.00 18.47 ? 191 THR H N   1 
ATOM   4377 C  CA  . THR C 3 197 ? 11.033  -28.839 -7.548  1.00 19.21 ? 191 THR H CA  1 
ATOM   4378 C  C   . THR C 3 197 ? 10.302  -29.118 -6.242  1.00 19.55 ? 191 THR H C   1 
ATOM   4379 O  O   . THR C 3 197 ? 10.790  -29.908 -5.427  1.00 17.40 ? 191 THR H O   1 
ATOM   4380 C  CB  . THR C 3 197 ? 12.223  -27.866 -7.266  1.00 17.82 ? 191 THR H CB  1 
ATOM   4381 O  OG1 . THR C 3 197 ? 11.712  -26.553 -7.019  1.00 17.61 ? 191 THR H OG1 1 
ATOM   4382 C  CG2 . THR C 3 197 ? 13.210  -27.846 -8.427  1.00 19.62 ? 191 THR H CG2 1 
ATOM   4383 N  N   . GLN C 3 198 ? 9.159   -28.457 -6.030  1.00 13.85 ? 192 GLN H N   1 
ATOM   4384 C  CA  . GLN C 3 198 ? 8.443   -28.576 -4.774  1.00 14.87 ? 192 GLN H CA  1 
ATOM   4385 C  C   . GLN C 3 198 ? 7.345   -29.608 -4.929  1.00 19.69 ? 192 GLN H C   1 
ATOM   4386 O  O   . GLN C 3 198 ? 6.807   -29.805 -6.022  1.00 20.81 ? 192 GLN H O   1 
ATOM   4387 C  CB  . GLN C 3 198 ? 7.829   -27.230 -4.346  1.00 16.36 ? 192 GLN H CB  1 
ATOM   4388 C  CG  . GLN C 3 198 ? 8.853   -26.051 -4.294  1.00 12.87 ? 192 GLN H CG  1 
ATOM   4389 C  CD  . GLN C 3 198 ? 10.142  -26.413 -3.548  1.00 14.91 ? 192 GLN H CD  1 
ATOM   4390 O  OE1 . GLN C 3 198 ? 11.231  -26.522 -4.142  1.00 18.98 ? 192 GLN H OE1 1 
ATOM   4391 N  NE2 . GLN C 3 198 ? 10.018  -26.595 -2.239  1.00 12.45 ? 192 GLN H NE2 1 
ATOM   4392 N  N   . THR C 3 199 ? 7.007   -30.246 -3.821  1.00 18.65 ? 193 THR H N   1 
ATOM   4393 C  CA  . THR C 3 199 ? 5.930   -31.232 -3.797  1.00 21.90 ? 193 THR H CA  1 
ATOM   4394 C  C   . THR C 3 199 ? 4.785   -30.697 -2.961  1.00 22.36 ? 193 THR H C   1 
ATOM   4395 O  O   . THR C 3 199 ? 5.008   -30.184 -1.856  1.00 22.52 ? 193 THR H O   1 
ATOM   4396 C  CB  . THR C 3 199 ? 6.454   -32.582 -3.246  1.00 22.83 ? 193 THR H CB  1 
ATOM   4397 O  OG1 . THR C 3 199 ? 7.410   -33.128 -4.165  1.00 23.15 ? 193 THR H OG1 1 
ATOM   4398 C  CG2 . THR C 3 199 ? 5.318   -33.574 -3.051  1.00 24.71 ? 193 THR H CG2 1 
ATOM   4399 N  N   . TYR C 3 200 ? 3.559   -30.801 -3.491  1.00 21.25 ? 194 TYR H N   1 
ATOM   4400 C  CA  . TYR C 3 200 ? 2.372   -30.315 -2.786  1.00 20.44 ? 194 TYR H CA  1 
ATOM   4401 C  C   . TYR C 3 200 ? 1.363   -31.432 -2.588  1.00 21.78 ? 194 TYR H C   1 
ATOM   4402 O  O   . TYR C 3 200 ? 0.872   -32.017 -3.542  1.00 21.92 ? 194 TYR H O   1 
ATOM   4403 C  CB  . TYR C 3 200 ? 1.740   -29.138 -3.537  1.00 19.62 ? 194 TYR H CB  1 
ATOM   4404 C  CG  . TYR C 3 200 ? 2.702   -27.989 -3.697  1.00 18.66 ? 194 TYR H CG  1 
ATOM   4405 C  CD1 . TYR C 3 200 ? 3.083   -27.226 -2.585  1.00 16.66 ? 194 TYR H CD1 1 
ATOM   4406 C  CD2 . TYR C 3 200 ? 3.244   -27.666 -4.940  1.00 17.04 ? 194 TYR H CD2 1 
ATOM   4407 C  CE1 . TYR C 3 200 ? 3.989   -26.187 -2.711  1.00 18.00 ? 194 TYR H CE1 1 
ATOM   4408 C  CE2 . TYR C 3 200 ? 4.152   -26.581 -5.086  1.00 16.74 ? 194 TYR H CE2 1 
ATOM   4409 C  CZ  . TYR C 3 200 ? 4.515   -25.861 -3.969  1.00 17.39 ? 194 TYR H CZ  1 
ATOM   4410 O  OH  . TYR C 3 200 ? 5.389   -24.806 -4.067  1.00 16.40 ? 194 TYR H OH  1 
ATOM   4411 N  N   . ILE C 3 201 ? 1.109   -31.745 -1.330  1.00 19.39 ? 195 ILE H N   1 
ATOM   4412 C  CA  . ILE C 3 201 ? 0.248   -32.857 -0.957  1.00 21.39 ? 195 ILE H CA  1 
ATOM   4413 C  C   . ILE C 3 201 ? -0.791  -32.346 0.038   1.00 19.56 ? 195 ILE H C   1 
ATOM   4414 O  O   . ILE C 3 201 ? -0.450  -31.758 1.088   1.00 20.69 ? 195 ILE H O   1 
ATOM   4415 C  CB  . ILE C 3 201 ? 1.057   -34.043 -0.327  1.00 17.67 ? 195 ILE H CB  1 
ATOM   4416 C  CG1 . ILE C 3 201 ? 2.081   -34.621 -1.319  1.00 18.83 ? 195 ILE H CG1 1 
ATOM   4417 C  CG2 . ILE C 3 201 ? 0.096   -35.124 0.211   1.00 16.22 ? 195 ILE H CG2 1 
ATOM   4418 C  CD1 . ILE C 3 201 ? 3.201   -35.413 -0.656  1.00 22.53 ? 195 ILE H CD1 1 
ATOM   4419 N  N   . CYS C 3 202 ? -2.065  -32.558 -0.285  1.00 19.90 ? 196 CYS H N   1 
ATOM   4420 C  CA  . CYS C 3 202 ? -3.118  -32.212 0.652   1.00 19.79 ? 196 CYS H CA  1 
ATOM   4421 C  C   . CYS C 3 202 ? -3.410  -33.437 1.497   1.00 21.55 ? 196 CYS H C   1 
ATOM   4422 O  O   . CYS C 3 202 ? -3.564  -34.547 0.971   1.00 23.95 ? 196 CYS H O   1 
ATOM   4423 C  CB  . CYS C 3 202 ? -4.377  -31.691 -0.055  1.00 24.41 ? 196 CYS H CB  1 
ATOM   4424 S  SG  . CYS C 3 202 ? -5.227  -32.918 -1.071  1.00 25.26 ? 196 CYS H SG  1 
ATOM   4425 N  N   . ASN C 3 203 ? -3.466  -33.231 2.809   1.00 19.94 ? 197 ASN H N   1 
ATOM   4426 C  CA  . ASN C 3 203 ? -3.772  -34.289 3.769   1.00 18.88 ? 197 ASN H CA  1 
ATOM   4427 C  C   . ASN C 3 203 ? -5.181  -34.056 4.259   1.00 20.12 ? 197 ASN H C   1 
ATOM   4428 O  O   . ASN C 3 203 ? -5.456  -33.056 4.927   1.00 21.18 ? 197 ASN H O   1 
ATOM   4429 C  CB  . ASN C 3 203 ? -2.794  -34.245 4.953   1.00 20.22 ? 197 ASN H CB  1 
ATOM   4430 C  CG  . ASN C 3 203 ? -1.384  -33.849 4.538   1.00 21.82 ? 197 ASN H CG  1 
ATOM   4431 O  OD1 . ASN C 3 203 ? -0.905  -32.750 4.867   1.00 23.30 ? 197 ASN H OD1 1 
ATOM   4432 N  ND2 . ASN C 3 203 ? -0.717  -34.730 3.783   1.00 22.45 ? 197 ASN H ND2 1 
ATOM   4433 N  N   . VAL C 3 204 ? -6.086  -34.960 3.886   1.00 18.09 ? 198 VAL H N   1 
ATOM   4434 C  CA  . VAL C 3 204 ? -7.502  -34.804 4.172   1.00 21.15 ? 198 VAL H CA  1 
ATOM   4435 C  C   . VAL C 3 204 ? -7.942  -35.813 5.245   1.00 23.81 ? 198 VAL H C   1 
ATOM   4436 O  O   . VAL C 3 204 ? -7.658  -37.010 5.108   1.00 22.05 ? 198 VAL H O   1 
ATOM   4437 C  CB  . VAL C 3 204 ? -8.351  -34.974 2.884   1.00 23.03 ? 198 VAL H CB  1 
ATOM   4438 C  CG1 . VAL C 3 204 ? -9.862  -34.809 3.187   1.00 23.85 ? 198 VAL H CG1 1 
ATOM   4439 C  CG2 . VAL C 3 204 ? -7.909  -33.966 1.806   1.00 23.29 ? 198 VAL H CG2 1 
ATOM   4440 N  N   . ASN C 3 205 ? -8.603  -35.319 6.303   1.00 22.65 ? 199 ASN H N   1 
ATOM   4441 C  CA  . ASN C 3 205 ? -9.127  -36.169 7.397   1.00 21.76 ? 199 ASN H CA  1 
ATOM   4442 C  C   . ASN C 3 205 ? -10.626 -36.007 7.521   1.00 22.48 ? 199 ASN H C   1 
ATOM   4443 O  O   . ASN C 3 205 ? -11.132 -34.884 7.563   1.00 23.20 ? 199 ASN H O   1 
ATOM   4444 C  CB  . ASN C 3 205 ? -8.514  -35.788 8.754   1.00 24.34 ? 199 ASN H CB  1 
ATOM   4445 C  CG  . ASN C 3 205 ? -7.093  -36.309 8.933   1.00 29.11 ? 199 ASN H CG  1 
ATOM   4446 O  OD1 . ASN C 3 205 ? -6.351  -36.425 7.976   1.00 30.33 ? 199 ASN H OD1 1 
ATOM   4447 N  ND2 . ASN C 3 205 ? -6.712  -36.599 10.173  1.00 33.89 ? 199 ASN H ND2 1 
ATOM   4448 N  N   . HIS C 3 206 ? -11.339 -37.120 7.582   1.00 23.05 ? 200 HIS H N   1 
ATOM   4449 C  CA  . HIS C 3 206 ? -12.752 -37.083 7.930   1.00 19.68 ? 200 HIS H CA  1 
ATOM   4450 C  C   . HIS C 3 206 ? -12.949 -38.156 8.991   1.00 23.93 ? 200 HIS H C   1 
ATOM   4451 O  O   . HIS C 3 206 ? -13.146 -39.337 8.682   1.00 23.06 ? 200 HIS H O   1 
ATOM   4452 C  CB  . HIS C 3 206 ? -13.643 -37.295 6.682   1.00 17.50 ? 200 HIS H CB  1 
ATOM   4453 C  CG  . HIS C 3 206 ? -15.118 -37.282 6.969   1.00 18.32 ? 200 HIS H CG  1 
ATOM   4454 N  ND1 . HIS C 3 206 ? -15.808 -36.132 7.301   1.00 20.14 ? 200 HIS H ND1 1 
ATOM   4455 C  CD2 . HIS C 3 206 ? -16.035 -38.278 6.971   1.00 18.10 ? 200 HIS H CD2 1 
ATOM   4456 C  CE1 . HIS C 3 206 ? -17.082 -36.422 7.500   1.00 16.63 ? 200 HIS H CE1 1 
ATOM   4457 N  NE2 . HIS C 3 206 ? -17.245 -37.720 7.309   1.00 25.34 ? 200 HIS H NE2 1 
ATOM   4458 N  N   . LYS C 3 207 ? -12.869 -37.741 10.253  1.00 20.08 ? 201 LYS H N   1 
ATOM   4459 C  CA  . LYS C 3 207 ? -12.925 -38.676 11.373  1.00 23.23 ? 201 LYS H CA  1 
ATOM   4460 C  C   . LYS C 3 207 ? -14.183 -39.556 11.445  1.00 20.65 ? 201 LYS H C   1 
ATOM   4461 O  O   . LYS C 3 207 ? -14.063 -40.760 11.692  1.00 20.17 ? 201 LYS H O   1 
ATOM   4462 C  CB  . LYS C 3 207 ? -12.661 -37.947 12.708  1.00 24.97 ? 201 LYS H CB  1 
ATOM   4463 C  CG  . LYS C 3 207 ? -12.614 -38.858 13.927  1.00 30.13 ? 201 LYS H CG  1 
ATOM   4464 C  CD  . LYS C 3 207 ? -11.455 -39.859 13.847  1.00 35.19 ? 201 LYS H CD  1 
ATOM   4465 C  CE  . LYS C 3 207 ? -11.512 -40.852 14.998  1.00 41.45 ? 201 LYS H CE  1 
ATOM   4466 N  NZ  . LYS C 3 207 ? -11.279 -40.171 16.293  1.00 43.44 ? 201 LYS H NZ  1 
ATOM   4467 N  N   . PRO C 3 208 ? -15.395 -38.985 11.227  1.00 22.31 ? 202 PRO H N   1 
ATOM   4468 C  CA  . PRO C 3 208 ? -16.598 -39.838 11.361  1.00 22.35 ? 202 PRO H CA  1 
ATOM   4469 C  C   . PRO C 3 208 ? -16.620 -41.069 10.444  1.00 20.50 ? 202 PRO H C   1 
ATOM   4470 O  O   . PRO C 3 208 ? -17.230 -42.092 10.798  1.00 18.73 ? 202 PRO H O   1 
ATOM   4471 C  CB  . PRO C 3 208 ? -17.750 -38.891 11.007  1.00 22.50 ? 202 PRO H CB  1 
ATOM   4472 C  CG  . PRO C 3 208 ? -17.188 -37.489 11.259  1.00 22.32 ? 202 PRO H CG  1 
ATOM   4473 C  CD  . PRO C 3 208 ? -15.741 -37.593 10.874  1.00 23.64 ? 202 PRO H CD  1 
ATOM   4474 N  N   . SER C 3 209 ? -15.962 -40.977 9.289   1.00 18.54 ? 203 SER H N   1 
ATOM   4475 C  CA  . SER C 3 209 ? -15.882 -42.110 8.353   1.00 21.27 ? 203 SER H CA  1 
ATOM   4476 C  C   . SER C 3 209 ? -14.529 -42.833 8.405   1.00 18.35 ? 203 SER H C   1 
ATOM   4477 O  O   . SER C 3 209 ? -14.288 -43.756 7.617   1.00 19.37 ? 203 SER H O   1 
ATOM   4478 C  CB  . SER C 3 209 ? -16.120 -41.629 6.919   1.00 17.67 ? 203 SER H CB  1 
ATOM   4479 O  OG  . SER C 3 209 ? -15.061 -40.789 6.492   1.00 20.41 ? 203 SER H OG  1 
ATOM   4480 N  N   . ASN C 3 210 ? -13.652 -42.392 9.307   1.00 19.76 ? 204 ASN H N   1 
ATOM   4481 C  CA  . ASN C 3 210 ? -12.286 -42.916 9.416   1.00 19.75 ? 204 ASN H CA  1 
ATOM   4482 C  C   . ASN C 3 210 ? -11.542 -42.810 8.091   1.00 25.30 ? 204 ASN H C   1 
ATOM   4483 O  O   . ASN C 3 210 ? -10.873 -43.739 7.662   1.00 24.43 ? 204 ASN H O   1 
ATOM   4484 C  CB  . ASN C 3 210 ? -12.275 -44.382 9.910   1.00 24.23 ? 204 ASN H CB  1 
ATOM   4485 C  CG  . ASN C 3 210 ? -12.708 -44.520 11.352  1.00 28.62 ? 204 ASN H CG  1 
ATOM   4486 O  OD1 . ASN C 3 210 ? -13.870 -44.833 11.635  1.00 25.58 ? 204 ASN H OD1 1 
ATOM   4487 N  ND2 . ASN C 3 210 ? -11.782 -44.276 12.278  1.00 26.22 ? 204 ASN H ND2 1 
ATOM   4488 N  N   . THR C 3 211 ? -11.704 -41.674 7.429   1.00 21.93 ? 205 THR H N   1 
ATOM   4489 C  CA  . THR C 3 211 ? -10.997 -41.386 6.201   1.00 23.47 ? 205 THR H CA  1 
ATOM   4490 C  C   . THR C 3 211 ? -9.763  -40.566 6.544   1.00 23.91 ? 205 THR H C   1 
ATOM   4491 O  O   . THR C 3 211 ? -9.854  -39.540 7.229   1.00 25.76 ? 205 THR H O   1 
ATOM   4492 C  CB  . THR C 3 211 ? -11.904 -40.616 5.201   1.00 26.33 ? 205 THR H CB  1 
ATOM   4493 O  OG1 . THR C 3 211 ? -13.042 -41.424 4.902   1.00 23.72 ? 205 THR H OG1 1 
ATOM   4494 C  CG2 . THR C 3 211 ? -11.158 -40.302 3.892   1.00 26.70 ? 205 THR H CG2 1 
ATOM   4495 N  N   . LYS C 3 212 ? -8.607  -41.055 6.102   1.00 22.12 ? 206 LYS H N   1 
ATOM   4496 C  CA  . LYS C 3 212 ? -7.383  -40.254 6.057   1.00 23.50 ? 206 LYS H CA  1 
ATOM   4497 C  C   . LYS C 3 212 ? -6.740  -40.492 4.693   1.00 27.90 ? 206 LYS H C   1 
ATOM   4498 O  O   . LYS C 3 212 ? -6.235  -41.586 4.416   1.00 23.78 ? 206 LYS H O   1 
ATOM   4499 C  CB  . LYS C 3 212 ? -6.411  -40.637 7.184   1.00 25.16 ? 206 LYS H CB  1 
ATOM   4500 C  CG  . LYS C 3 212 ? -6.916  -40.324 8.578   1.00 26.07 ? 206 LYS H CG  1 
ATOM   4501 C  CD  . LYS C 3 212 ? -5.827  -40.462 9.654   1.00 26.66 ? 206 LYS H CD  1 
ATOM   4502 C  CE  . LYS C 3 212 ? -6.409  -40.139 11.037  1.00 28.61 ? 206 LYS H CE  1 
ATOM   4503 N  NZ  . LYS C 3 212 ? -5.406  -40.364 12.146  1.00 35.64 ? 206 LYS H NZ  1 
ATOM   4504 N  N   . VAL C 3 213 ? -6.780  -39.470 3.843   1.00 25.04 ? 207 VAL H N   1 
ATOM   4505 C  CA  . VAL C 3 213 ? -6.355  -39.576 2.452   1.00 28.07 ? 207 VAL H CA  1 
ATOM   4506 C  C   . VAL C 3 213 ? -5.314  -38.487 2.184   1.00 27.72 ? 207 VAL H C   1 
ATOM   4507 O  O   . VAL C 3 213 ? -5.361  -37.421 2.784   1.00 24.68 ? 207 VAL H O   1 
ATOM   4508 C  CB  . VAL C 3 213 ? -7.569  -39.391 1.499   1.00 27.57 ? 207 VAL H CB  1 
ATOM   4509 C  CG1 . VAL C 3 213 ? -7.132  -38.979 0.094   1.00 37.49 ? 207 VAL H CG1 1 
ATOM   4510 C  CG2 . VAL C 3 213 ? -8.389  -40.664 1.437   1.00 34.65 ? 207 VAL H CG2 1 
ATOM   4511 N  N   . ASP C 3 214 ? -4.375  -38.774 1.288   1.00 25.62 ? 208 ASP H N   1 
ATOM   4512 C  CA  . ASP C 3 214 ? -3.381  -37.784 0.874   1.00 24.55 ? 208 ASP H CA  1 
ATOM   4513 C  C   . ASP C 3 214 ? -3.310  -37.791 -0.640  1.00 28.08 ? 208 ASP H C   1 
ATOM   4514 O  O   . ASP C 3 214 ? -3.368  -38.857 -1.264  1.00 27.35 ? 208 ASP H O   1 
ATOM   4515 C  CB  . ASP C 3 214 ? -2.026  -38.102 1.501   1.00 28.68 ? 208 ASP H CB  1 
ATOM   4516 C  CG  . ASP C 3 214 ? -2.105  -38.191 3.020   1.00 32.42 ? 208 ASP H CG  1 
ATOM   4517 O  OD1 . ASP C 3 214 ? -1.880  -37.174 3.685   1.00 27.91 ? 208 ASP H OD1 1 
ATOM   4518 O  OD2 . ASP C 3 214 ? -2.444  -39.268 3.553   1.00 34.46 ? 208 ASP H OD2 1 
ATOM   4519 N  N   . LYS C 3 215 ? -3.226  -36.600 -1.231  1.00 20.68 ? 209 LYS H N   1 
ATOM   4520 C  CA  . LYS C 3 215 ? -3.163  -36.479 -2.680  1.00 22.90 ? 209 LYS H CA  1 
ATOM   4521 C  C   . LYS C 3 215 ? -2.041  -35.523 -3.074  1.00 19.97 ? 209 LYS H C   1 
ATOM   4522 O  O   . LYS C 3 215 ? -2.057  -34.373 -2.667  1.00 20.11 ? 209 LYS H O   1 
ATOM   4523 C  CB  . LYS C 3 215 ? -4.502  -35.940 -3.198  1.00 26.29 ? 209 LYS H CB  1 
ATOM   4524 C  CG  . LYS C 3 215 ? -4.573  -35.708 -4.713  1.00 32.34 ? 209 LYS H CG  1 
ATOM   4525 C  CD  . LYS C 3 215 ? -4.816  -36.992 -5.497  1.00 39.53 ? 209 LYS H CD  1 
ATOM   4526 C  CE  . LYS C 3 215 ? -6.053  -37.730 -4.983  1.00 41.20 ? 209 LYS H CE  1 
ATOM   4527 N  NZ  . LYS C 3 215 ? -6.347  -38.946 -5.775  1.00 48.80 ? 209 LYS H NZ  1 
ATOM   4528 N  N   . LYS C 3 216 ? -1.094  -36.008 -3.869  1.00 19.67 ? 210 LYS H N   1 
ATOM   4529 C  CA  . LYS C 3 216 ? -0.050  -35.166 -4.454  1.00 20.50 ? 210 LYS H CA  1 
ATOM   4530 C  C   . LYS C 3 216 ? -0.659  -34.418 -5.634  1.00 21.38 ? 210 LYS H C   1 
ATOM   4531 O  O   . LYS C 3 216 ? -1.244  -35.028 -6.535  1.00 26.78 ? 210 LYS H O   1 
ATOM   4532 C  CB  . LYS C 3 216 ? 1.147   -36.021 -4.903  1.00 22.61 ? 210 LYS H CB  1 
ATOM   4533 C  CG  . LYS C 3 216 ? 2.233   -35.244 -5.635  1.00 23.24 ? 210 LYS H CG  1 
ATOM   4534 C  CD  . LYS C 3 216 ? 3.509   -36.084 -5.867  1.00 26.98 ? 210 LYS H CD  1 
ATOM   4535 C  CE  . LYS C 3 216 ? 3.240   -37.339 -6.701  1.00 33.47 ? 210 LYS H CE  1 
ATOM   4536 N  NZ  . LYS C 3 216 ? 4.450   -38.225 -6.873  1.00 34.55 ? 210 LYS H NZ  1 
ATOM   4537 N  N   . VAL C 3 217 ? -0.526  -33.097 -5.624  1.00 20.08 ? 211 VAL H N   1 
ATOM   4538 C  CA  . VAL C 3 217 ? -1.148  -32.253 -6.654  1.00 20.42 ? 211 VAL H CA  1 
ATOM   4539 C  C   . VAL C 3 217 ? -0.065  -31.792 -7.614  1.00 24.58 ? 211 VAL H C   1 
ATOM   4540 O  O   . VAL C 3 217 ? 0.798   -30.992 -7.251  1.00 23.96 ? 211 VAL H O   1 
ATOM   4541 C  CB  . VAL C 3 217 ? -1.915  -31.082 -6.024  1.00 17.68 ? 211 VAL H CB  1 
ATOM   4542 C  CG1 . VAL C 3 217 ? -2.575  -30.195 -7.095  1.00 19.65 ? 211 VAL H CG1 1 
ATOM   4543 C  CG2 . VAL C 3 217 ? -2.962  -31.632 -5.033  1.00 20.38 ? 211 VAL H CG2 1 
ATOM   4544 N  N   . GLU C 3 218 ? -0.118  -32.326 -8.833  1.00 24.67 ? 212 GLU H N   1 
ATOM   4545 C  CA  . GLU C 3 218 ? 0.913   -32.069 -9.831  1.00 29.64 ? 212 GLU H CA  1 
ATOM   4546 C  C   . GLU C 3 218 ? 0.417   -31.245 -11.018 1.00 29.34 ? 212 GLU H C   1 
ATOM   4547 O  O   . GLU C 3 218 ? -0.764  -31.319 -11.369 1.00 25.61 ? 212 GLU H O   1 
ATOM   4548 C  CB  . GLU C 3 218 ? 1.485   -33.399 -10.323 1.00 31.50 ? 212 GLU H CB  1 
ATOM   4549 C  CG  . GLU C 3 218 ? 2.206   -34.160 -9.239  1.00 41.93 ? 212 GLU H CG  1 
ATOM   4550 C  CD  . GLU C 3 218 ? 2.795   -35.460 -9.723  1.00 47.61 ? 212 GLU H CD  1 
ATOM   4551 O  OE1 . GLU C 3 218 ? 2.024   -36.364 -10.123 1.00 50.28 ? 212 GLU H OE1 1 
ATOM   4552 O  OE2 . GLU C 3 218 ? 4.035   -35.583 -9.678  1.00 52.18 ? 212 GLU H OE2 1 
ATOM   4553 N  N   . PRO C 3 219 ? 1.317   -30.453 -11.646 1.00 29.69 ? 213 PRO H N   1 
ATOM   4554 C  CA  . PRO C 3 219 ? 0.926   -29.840 -12.920 1.00 32.23 ? 213 PRO H CA  1 
ATOM   4555 C  C   . PRO C 3 219 ? 0.503   -30.957 -13.895 1.00 34.53 ? 213 PRO H C   1 
ATOM   4556 O  O   . PRO C 3 219 ? 1.121   -32.020 -13.894 1.00 32.75 ? 213 PRO H O   1 
ATOM   4557 C  CB  . PRO C 3 219 ? 2.216   -29.154 -13.388 1.00 33.16 ? 213 PRO H CB  1 
ATOM   4558 C  CG  . PRO C 3 219 ? 3.007   -28.928 -12.134 1.00 28.54 ? 213 PRO H CG  1 
ATOM   4559 C  CD  . PRO C 3 219 ? 2.698   -30.101 -11.257 1.00 31.29 ? 213 PRO H CD  1 
ATOM   4560 N  N   . LYS C 3 220 ? -0.552  -30.745 -14.684 1.00 40.54 ? 214 LYS H N   1 
ATOM   4561 C  CA  . LYS C 3 220 ? -1.057  -31.801 -15.589 1.00 45.30 ? 214 LYS H CA  1 
ATOM   4562 C  C   . LYS C 3 220 ? -0.427  -31.772 -16.988 1.00 50.54 ? 214 LYS H C   1 
ATOM   4563 O  O   . LYS C 3 220 ? -0.211  -30.703 -17.568 1.00 51.70 ? 214 LYS H O   1 
ATOM   4564 C  CB  . LYS C 3 220 ? -2.583  -31.765 -15.687 1.00 44.69 ? 214 LYS H CB  1 
HETATM 4565 ZN ZN  . ZN  D 4 .   ? -3.207  -11.927 45.848  1.00 24.71 ? 400 ZN  A ZN  1 
HETATM 4566 CA CA  . CA  E 5 .   ? 2.131   -20.023 42.190  1.00 23.94 ? 401 CA  A CA  1 
HETATM 4567 CA CA  . CA  F 5 .   ? 3.123   -16.693 40.237  1.00 30.82 ? 402 CA  A CA  1 
HETATM 4568 S  S   . SO4 G 6 .   ? 1.995   -5.985  64.572  1.00 60.51 ? 1   SO4 A S   1 
HETATM 4569 O  O1  . SO4 G 6 .   ? 3.347   -6.436  64.254  1.00 59.84 ? 1   SO4 A O1  1 
HETATM 4570 O  O2  . SO4 G 6 .   ? 1.010   -6.910  64.017  1.00 60.99 ? 1   SO4 A O2  1 
HETATM 4571 O  O3  . SO4 G 6 .   ? 1.824   -5.908  66.021  1.00 61.71 ? 1   SO4 A O3  1 
HETATM 4572 O  O4  . SO4 G 6 .   ? 1.793   -4.658  63.995  1.00 61.84 ? 1   SO4 A O4  1 
HETATM 4573 S  S   . SO4 H 6 .   ? -3.691  -8.553  43.479  1.00 38.94 ? 3   SO4 A S   1 
HETATM 4574 O  O1  . SO4 H 6 .   ? -4.013  -7.618  42.405  1.00 38.72 ? 3   SO4 A O1  1 
HETATM 4575 O  O2  . SO4 H 6 .   ? -4.829  -8.542  44.422  1.00 35.29 ? 3   SO4 A O2  1 
HETATM 4576 O  O3  . SO4 H 6 .   ? -3.521  -9.893  42.938  1.00 33.13 ? 3   SO4 A O3  1 
HETATM 4577 O  O4  . SO4 H 6 .   ? -2.475  -8.120  44.165  1.00 34.61 ? 3   SO4 A O4  1 
HETATM 4578 S  S   . SO4 I 6 .   ? -3.524  -15.726 18.922  1.00 48.59 ? 215 SO4 L S   1 
HETATM 4579 O  O1  . SO4 I 6 .   ? -3.065  -15.660 17.535  1.00 49.26 ? 215 SO4 L O1  1 
HETATM 4580 O  O2  . SO4 I 6 .   ? -4.595  -16.711 19.043  1.00 47.86 ? 215 SO4 L O2  1 
HETATM 4581 O  O3  . SO4 I 6 .   ? -2.412  -16.089 19.799  1.00 51.63 ? 215 SO4 L O3  1 
HETATM 4582 O  O4  . SO4 I 6 .   ? -4.017  -14.415 19.341  1.00 52.15 ? 215 SO4 L O4  1 
HETATM 4583 O  O   . HOH J 7 .   ? 6.331   -20.875 42.848  1.00 21.56 ? 5   HOH A O   1 
HETATM 4584 O  O   . HOH J 7 .   ? 8.362   -17.986 39.095  1.00 26.45 ? 6   HOH A O   1 
HETATM 4585 O  O   . HOH J 7 .   ? -1.768  -6.286  45.868  1.00 28.12 ? 7   HOH A O   1 
HETATM 4586 O  O   . HOH J 7 .   ? -1.267  -25.071 58.415  1.00 15.68 ? 8   HOH A O   1 
HETATM 4587 O  O   . HOH J 7 .   ? -5.642  -16.838 63.293  1.00 19.00 ? 12  HOH A O   1 
HETATM 4588 O  O   . HOH J 7 .   ? -16.034 -20.289 55.292  1.00 16.14 ? 14  HOH A O   1 
HETATM 4589 O  O   . HOH J 7 .   ? -8.968  -23.038 45.496  1.00 15.46 ? 21  HOH A O   1 
HETATM 4590 O  O   . HOH J 7 .   ? -15.278 -5.263  55.901  1.00 21.11 ? 23  HOH A O   1 
HETATM 4591 O  O   . HOH J 7 .   ? -15.342 -5.012  52.360  1.00 20.10 ? 27  HOH A O   1 
HETATM 4592 O  O   . HOH J 7 .   ? -7.879  -2.145  47.329  1.00 20.89 ? 198 HOH A O   1 
HETATM 4593 O  O   . HOH J 7 .   ? -4.034  -4.068  36.471  1.00 31.45 ? 199 HOH A O   1 
HETATM 4594 O  O   . HOH J 7 .   ? -18.720 -16.270 54.030  1.00 22.40 ? 200 HOH A O   1 
HETATM 4595 O  O   . HOH J 7 .   ? -5.163  -8.181  61.224  1.00 25.83 ? 201 HOH A O   1 
HETATM 4596 O  O   . HOH J 7 .   ? -4.605  -3.277  58.994  1.00 24.42 ? 202 HOH A O   1 
HETATM 4597 O  O   . HOH J 7 .   ? -7.197  -17.017 65.293  1.00 33.19 ? 203 HOH A O   1 
HETATM 4598 O  O   . HOH J 7 .   ? -16.147 -19.736 51.844  1.00 17.13 ? 204 HOH A O   1 
HETATM 4599 O  O   . HOH J 7 .   ? -1.953  7.816   53.355  1.00 27.79 ? 205 HOH A O   1 
HETATM 4600 O  O   . HOH J 7 .   ? -21.118 -14.148 51.144  1.00 31.89 ? 206 HOH A O   1 
HETATM 4601 O  O   . HOH J 7 .   ? -19.839 -20.320 42.780  1.00 28.76 ? 207 HOH A O   1 
HETATM 4602 O  O   . HOH J 7 .   ? 11.754  -26.457 56.848  1.00 24.04 ? 208 HOH A O   1 
HETATM 4603 O  O   . HOH J 7 .   ? 3.695   -22.063 61.755  1.00 21.74 ? 209 HOH A O   1 
HETATM 4604 O  O   . HOH J 7 .   ? -9.082  -8.330  42.480  1.00 24.07 ? 210 HOH A O   1 
HETATM 4605 O  O   . HOH J 7 .   ? 16.753  -3.219  44.155  1.00 28.42 ? 211 HOH A O   1 
HETATM 4606 O  O   . HOH J 7 .   ? 8.145   -9.398  40.172  1.00 24.19 ? 212 HOH A O   1 
HETATM 4607 O  O   . HOH J 7 .   ? -11.076 -24.078 44.028  1.00 24.24 ? 213 HOH A O   1 
HETATM 4608 O  O   . HOH J 7 .   ? -6.836  -7.456  58.239  1.00 16.89 ? 214 HOH A O   1 
HETATM 4609 O  O   . HOH J 7 .   ? 6.826   -6.566  54.695  1.00 21.55 ? 215 HOH A O   1 
HETATM 4610 O  O   . HOH J 7 .   ? -18.853 -8.477  50.657  1.00 30.35 ? 216 HOH A O   1 
HETATM 4611 O  O   . HOH J 7 .   ? 11.097  -13.476 54.989  1.00 47.29 ? 217 HOH A O   1 
HETATM 4612 O  O   . HOH J 7 .   ? -1.946  -27.928 43.848  1.00 23.64 ? 218 HOH A O   1 
HETATM 4613 O  O   . HOH J 7 .   ? 5.684   -9.392  62.029  1.00 29.93 ? 219 HOH A O   1 
HETATM 4614 O  O   . HOH J 7 .   ? -5.450  -0.228  47.027  1.00 24.85 ? 220 HOH A O   1 
HETATM 4615 O  O   . HOH J 7 .   ? 14.341  -3.390  42.832  1.00 40.09 ? 221 HOH A O   1 
HETATM 4616 O  O   . HOH J 7 .   ? -2.272  -10.856 34.769  1.00 27.98 ? 222 HOH A O   1 
HETATM 4617 O  O   . HOH J 7 .   ? -4.504  -30.423 45.627  1.00 26.92 ? 223 HOH A O   1 
HETATM 4618 O  O   . HOH J 7 .   ? -14.748 -7.540  61.588  1.00 32.19 ? 224 HOH A O   1 
HETATM 4619 O  O   . HOH J 7 .   ? -17.641 -5.245  54.061  1.00 33.45 ? 225 HOH A O   1 
HETATM 4620 O  O   . HOH J 7 .   ? -14.989 1.365   56.090  1.00 34.29 ? 226 HOH A O   1 
HETATM 4621 O  O   . HOH J 7 .   ? 7.207   -0.974  39.746  1.00 34.88 ? 227 HOH A O   1 
HETATM 4622 O  O   . HOH J 7 .   ? 6.341   -16.339 39.968  1.00 29.09 ? 228 HOH A O   1 
HETATM 4623 O  O   . HOH J 7 .   ? 7.719   -16.477 61.853  1.00 38.03 ? 229 HOH A O   1 
HETATM 4624 O  O   . HOH J 7 .   ? -15.973 -1.028  51.210  1.00 33.75 ? 230 HOH A O   1 
HETATM 4625 O  O   . HOH J 7 .   ? -12.502 -7.389  62.084  1.00 28.78 ? 231 HOH A O   1 
HETATM 4626 O  O   . HOH J 7 .   ? -6.332  -30.682 47.770  1.00 33.76 ? 232 HOH A O   1 
HETATM 4627 O  O   . HOH J 7 .   ? 6.735   -25.836 53.030  1.00 26.27 ? 233 HOH A O   1 
HETATM 4628 O  O   . HOH J 7 .   ? -17.767 -21.895 44.279  1.00 22.06 ? 234 HOH A O   1 
HETATM 4629 O  O   . HOH J 7 .   ? -21.072 -17.683 57.544  1.00 35.78 ? 235 HOH A O   1 
HETATM 4630 O  O   . HOH J 7 .   ? 7.380   -18.709 36.569  1.00 28.86 ? 236 HOH A O   1 
HETATM 4631 O  O   . HOH J 7 .   ? 4.867   -27.420 49.956  1.00 28.88 ? 237 HOH A O   1 
HETATM 4632 O  O   . HOH J 7 .   ? -3.604  -30.418 60.438  1.00 28.82 ? 238 HOH A O   1 
HETATM 4633 O  O   . HOH J 7 .   ? 5.405   -20.925 63.676  1.00 33.20 ? 239 HOH A O   1 
HETATM 4634 O  O   . HOH J 7 .   ? 3.479   -0.303  53.929  1.00 27.09 ? 240 HOH A O   1 
HETATM 4635 O  O   . HOH J 7 .   ? -19.575 -16.013 51.472  1.00 33.72 ? 241 HOH A O   1 
HETATM 4636 O  O   . HOH J 7 .   ? 13.907  -18.707 45.688  1.00 43.89 ? 242 HOH A O   1 
HETATM 4637 O  O   . HOH J 7 .   ? 4.853   -15.959 63.347  1.00 26.49 ? 243 HOH A O   1 
HETATM 4638 O  O   . HOH J 7 .   ? 14.561  -19.322 53.905  1.00 27.83 ? 244 HOH A O   1 
HETATM 4639 O  O   . HOH J 7 .   ? 9.445   3.297   44.524  1.00 28.17 ? 245 HOH A O   1 
HETATM 4640 O  O   . HOH J 7 .   ? -15.247 -19.730 47.671  1.00 27.98 ? 246 HOH A O   1 
HETATM 4641 O  O   . HOH J 7 .   ? 6.755   -6.861  61.250  1.00 26.86 ? 247 HOH A O   1 
HETATM 4642 O  O   . HOH J 7 .   ? -13.191 -28.286 62.723  1.00 27.40 ? 248 HOH A O   1 
HETATM 4643 O  O   . HOH J 7 .   ? -11.713 -26.463 45.042  1.00 25.12 ? 249 HOH A O   1 
HETATM 4644 O  O   . HOH J 7 .   ? 9.375   -19.676 58.070  1.00 37.51 ? 250 HOH A O   1 
HETATM 4645 O  O   . HOH J 7 .   ? -4.169  6.325   53.264  1.00 29.14 ? 251 HOH A O   1 
HETATM 4646 O  O   . HOH J 7 .   ? -0.736  -27.806 46.060  1.00 25.82 ? 252 HOH A O   1 
HETATM 4647 O  O   . HOH J 7 .   ? 12.239  -18.437 43.197  1.00 33.90 ? 253 HOH A O   1 
HETATM 4648 O  O   . HOH J 7 .   ? -14.902 -4.291  58.577  1.00 33.85 ? 254 HOH A O   1 
HETATM 4649 O  O   . HOH J 7 .   ? -7.190  -6.192  60.654  1.00 22.49 ? 255 HOH A O   1 
HETATM 4650 O  O   . HOH J 7 .   ? -1.746  -18.369 65.436  1.00 23.89 ? 256 HOH A O   1 
HETATM 4651 O  O   . HOH J 7 .   ? 3.853   -18.185 64.645  1.00 32.95 ? 257 HOH A O   1 
HETATM 4652 O  O   . HOH J 7 .   ? 10.143  -1.840  52.650  1.00 25.69 ? 258 HOH A O   1 
HETATM 4653 O  O   . HOH J 7 .   ? 9.016   -5.454  49.815  1.00 26.67 ? 259 HOH A O   1 
HETATM 4654 O  O   . HOH J 7 .   ? -12.931 -2.498  58.946  1.00 30.28 ? 260 HOH A O   1 
HETATM 4655 O  O   . HOH J 7 .   ? -8.163  -22.084 64.835  1.00 27.31 ? 261 HOH A O   1 
HETATM 4656 O  O   . HOH J 7 .   ? -2.372  -15.257 39.887  1.00 31.33 ? 262 HOH A O   1 
HETATM 4657 O  O   . HOH J 7 .   ? -17.034 -28.894 53.896  1.00 27.53 ? 263 HOH A O   1 
HETATM 4658 O  O   . HOH J 7 .   ? -3.544  -16.260 65.020  1.00 26.84 ? 264 HOH A O   1 
HETATM 4659 O  O   . HOH J 7 .   ? 15.835  -16.734 46.456  1.00 26.70 ? 265 HOH A O   1 
HETATM 4660 O  O   . HOH J 7 .   ? 2.475   6.768   45.484  1.00 33.22 ? 266 HOH A O   1 
HETATM 4661 O  O   . HOH J 7 .   ? 5.352   -10.295 37.732  1.00 33.86 ? 267 HOH A O   1 
HETATM 4662 O  O   . HOH J 7 .   ? 0.491   2.534   45.965  1.00 25.35 ? 268 HOH A O   1 
HETATM 4663 O  O   . HOH J 7 .   ? 9.717   -9.823  37.860  1.00 32.09 ? 269 HOH A O   1 
HETATM 4664 O  O   . HOH J 7 .   ? 6.825   1.809   53.238  1.00 34.92 ? 270 HOH A O   1 
HETATM 4665 O  O   . HOH J 7 .   ? 13.506  -5.024  40.804  1.00 32.76 ? 301 HOH A O   1 
HETATM 4666 O  O   . HOH J 7 .   ? 19.086  -3.817  41.206  1.00 42.94 ? 302 HOH A O   1 
HETATM 4667 O  O   . HOH J 7 .   ? 17.681  -1.124  45.855  1.00 42.13 ? 303 HOH A O   1 
HETATM 4668 O  O   . HOH J 7 .   ? -14.851 -11.919 64.190  1.00 30.93 ? 304 HOH A O   1 
HETATM 4669 O  O   . HOH J 7 .   ? -16.457 -11.326 59.491  1.00 30.53 ? 305 HOH A O   1 
HETATM 4670 O  O   . HOH J 7 .   ? -18.745 -20.071 52.269  1.00 26.72 ? 306 HOH A O   1 
HETATM 4671 O  O   . HOH J 7 .   ? -20.489 -14.906 55.623  1.00 39.98 ? 307 HOH A O   1 
HETATM 4672 O  O   . HOH J 7 .   ? -17.872 -8.476  59.006  1.00 31.35 ? 308 HOH A O   1 
HETATM 4673 O  O   . HOH J 7 .   ? -16.935 -0.201  57.581  1.00 28.06 ? 309 HOH A O   1 
HETATM 4674 O  O   . HOH J 7 .   ? -0.353  1.152   43.582  1.00 32.15 ? 311 HOH A O   1 
HETATM 4675 O  O   . HOH J 7 .   ? 4.464   1.350   51.935  1.00 36.41 ? 312 HOH A O   1 
HETATM 4676 O  O   . HOH J 7 .   ? 8.976   -2.881  48.979  1.00 35.83 ? 313 HOH A O   1 
HETATM 4677 O  O   . HOH J 7 .   ? 18.201  -13.630 46.804  1.00 34.09 ? 314 HOH A O   1 
HETATM 4678 O  O   . HOH J 7 .   ? 15.252  -13.844 47.212  1.00 43.89 ? 315 HOH A O   1 
HETATM 4679 O  O   . HOH J 7 .   ? 12.308  -12.667 53.106  1.00 42.72 ? 316 HOH A O   1 
HETATM 4680 O  O   . HOH J 7 .   ? 12.051  -20.086 46.856  1.00 36.87 ? 317 HOH A O   1 
HETATM 4681 O  O   . HOH J 7 .   ? 1.429   -19.886 37.376  1.00 27.51 ? 320 HOH A O   1 
HETATM 4682 O  O   . HOH J 7 .   ? 13.146  -1.947  55.874  1.00 47.47 ? 331 HOH A O   1 
HETATM 4683 O  O   . HOH J 7 .   ? 11.616  -6.280  52.369  1.00 39.52 ? 332 HOH A O   1 
HETATM 4684 O  O   . HOH J 7 .   ? 9.339   -4.467  52.537  1.00 25.90 ? 333 HOH A O   1 
HETATM 4685 O  O   . HOH J 7 .   ? -4.065  -11.630 44.231  1.00 20.12 ? 334 HOH A O   1 
HETATM 4686 O  O   . HOH J 7 .   ? -1.652  -6.369  61.902  1.00 40.86 ? 335 HOH A O   1 
HETATM 4687 O  O   . HOH J 7 .   ? -5.901  -31.615 53.369  1.00 32.07 ? 336 HOH A O   1 
HETATM 4688 O  O   . HOH J 7 .   ? -2.832  -29.531 49.377  1.00 27.32 ? 337 HOH A O   1 
HETATM 4689 O  O   . HOH J 7 .   ? -8.926  -31.911 47.729  1.00 30.97 ? 338 HOH A O   1 
HETATM 4690 O  O   . HOH J 7 .   ? -12.305 -30.068 48.336  1.00 33.49 ? 339 HOH A O   1 
HETATM 4691 O  O   . HOH J 7 .   ? -10.634 -23.272 41.519  1.00 34.35 ? 340 HOH A O   1 
HETATM 4692 O  O   . HOH J 7 .   ? -14.515 -6.752  44.610  1.00 30.85 ? 349 HOH A O   1 
HETATM 4693 O  O   . HOH J 7 .   ? -18.437 -23.031 48.566  1.00 33.04 ? 350 HOH A O   1 
HETATM 4694 O  O   . HOH J 7 .   ? -17.662 -25.655 48.303  1.00 33.96 ? 351 HOH A O   1 
HETATM 4695 O  O   . HOH J 7 .   ? -17.839 -20.797 46.827  1.00 23.91 ? 352 HOH A O   1 
HETATM 4696 O  O   . HOH J 7 .   ? 5.153   -8.247  36.007  1.00 46.68 ? 371 HOH A O   1 
HETATM 4697 O  O   . HOH J 7 .   ? 4.257   -16.686 42.224  1.00 22.44 ? 373 HOH A O   1 
HETATM 4698 O  O   . HOH J 7 .   ? -21.503 -23.243 51.575  1.00 38.72 ? 390 HOH A O   1 
HETATM 4699 O  O   . HOH J 7 .   ? 10.308  -23.386 60.772  1.00 42.90 ? 391 HOH A O   1 
HETATM 4700 O  O   . HOH J 7 .   ? -18.978 -17.708 49.544  1.00 45.32 ? 394 HOH A O   1 
HETATM 4701 O  O   . HOH J 7 .   ? -19.151 -17.969 47.006  1.00 49.88 ? 395 HOH A O   1 
HETATM 4702 O  O   . HOH J 7 .   ? -8.053  -19.705 65.960  1.00 41.10 ? 410 HOH A O   1 
HETATM 4703 O  O   . HOH J 7 .   ? -6.813  3.549   55.471  1.00 35.79 ? 422 HOH A O   1 
HETATM 4704 O  O   . HOH J 7 .   ? 11.836  -8.948  54.734  1.00 30.86 ? 425 HOH A O   1 
HETATM 4705 O  O   . HOH J 7 .   ? -1.621  -31.745 53.798  1.00 41.18 ? 433 HOH A O   1 
HETATM 4706 O  O   . HOH J 7 .   ? -1.963  -29.919 46.716  1.00 46.03 ? 434 HOH A O   1 
HETATM 4707 O  O   . HOH J 7 .   ? -4.855  -9.900  40.769  1.00 45.38 ? 436 HOH A O   1 
HETATM 4708 O  O   . HOH J 7 .   ? -2.424  -4.095  60.762  1.00 39.33 ? 437 HOH A O   1 
HETATM 4709 O  O   . HOH J 7 .   ? -6.847  0.139   60.242  1.00 45.72 ? 438 HOH A O   1 
HETATM 4710 O  O   . HOH J 7 .   ? -0.147  0.791   56.720  1.00 38.67 ? 439 HOH A O   1 
HETATM 4711 O  O   . HOH J 7 .   ? 2.507   1.825   55.570  1.00 34.25 ? 440 HOH A O   1 
HETATM 4712 O  O   . HOH J 7 .   ? 10.807  -17.037 59.372  1.00 32.60 ? 441 HOH A O   1 
HETATM 4713 O  O   . HOH J 7 .   ? -1.651  -25.882 65.396  1.00 33.33 ? 442 HOH A O   1 
HETATM 4714 O  O   . HOH J 7 .   ? -19.216 -10.184 56.932  1.00 35.35 ? 443 HOH A O   1 
HETATM 4715 O  O   . HOH J 7 .   ? -19.145 -7.487  53.278  1.00 35.33 ? 444 HOH A O   1 
HETATM 4716 O  O   . HOH J 7 .   ? -11.142 -10.235 42.107  1.00 30.71 ? 445 HOH A O   1 
HETATM 4717 O  O   . HOH J 7 .   ? -5.342  -21.443 67.064  1.00 35.08 ? 469 HOH A O   1 
HETATM 4718 O  O   . HOH J 7 .   ? -10.761 -4.133  46.220  1.00 48.03 ? 477 HOH A O   1 
HETATM 4719 O  O   . HOH J 7 .   ? 16.174  -14.313 55.913  1.00 39.70 ? 478 HOH A O   1 
HETATM 4720 O  O   . HOH J 7 .   ? 0.613   -13.067 64.258  1.00 44.45 ? 479 HOH A O   1 
HETATM 4721 O  O   . HOH J 7 .   ? -0.125  -10.151 64.590  1.00 38.71 ? 480 HOH A O   1 
HETATM 4722 O  O   . HOH J 7 .   ? 3.032   -12.127 64.208  1.00 41.60 ? 481 HOH A O   1 
HETATM 4723 O  O   . HOH J 7 .   ? -2.883  -7.387  35.476  1.00 38.55 ? 483 HOH A O   1 
HETATM 4724 O  O   . HOH K 7 .   ? -24.896 -23.203 -2.556  1.00 23.54 ? 216 HOH L O   1 
HETATM 4725 O  O   . HOH K 7 .   ? -7.538  -12.596 13.846  1.00 16.91 ? 217 HOH L O   1 
HETATM 4726 O  O   . HOH K 7 .   ? -20.112 -22.071 39.685  1.00 32.74 ? 218 HOH L O   1 
HETATM 4727 O  O   . HOH K 7 .   ? -16.907 -13.133 8.218   1.00 28.82 ? 219 HOH L O   1 
HETATM 4728 O  O   . HOH K 7 .   ? -19.979 -0.043  23.406  1.00 35.63 ? 220 HOH L O   1 
HETATM 4729 O  O   . HOH K 7 .   ? -7.607  0.082   25.565  1.00 26.06 ? 221 HOH L O   1 
HETATM 4730 O  O   . HOH K 7 .   ? -18.334 -19.936 -22.410 1.00 27.09 ? 222 HOH L O   1 
HETATM 4731 O  O   . HOH K 7 .   ? -21.912 -16.242 -1.111  1.00 43.30 ? 223 HOH L O   1 
HETATM 4732 O  O   . HOH K 7 .   ? -24.067 -10.054 21.714  1.00 26.62 ? 224 HOH L O   1 
HETATM 4733 O  O   . HOH K 7 .   ? -8.471  -13.987 1.644   1.00 15.62 ? 225 HOH L O   1 
HETATM 4734 O  O   . HOH K 7 .   ? -8.835  -17.337 19.597  1.00 17.65 ? 226 HOH L O   1 
HETATM 4735 O  O   . HOH K 7 .   ? -26.615 -16.913 39.461  1.00 31.68 ? 227 HOH L O   1 
HETATM 4736 O  O   . HOH K 7 .   ? -3.513  -15.193 -5.369  1.00 32.15 ? 228 HOH L O   1 
HETATM 4737 O  O   . HOH K 7 .   ? -25.680 -17.037 36.970  1.00 21.00 ? 229 HOH L O   1 
HETATM 4738 O  O   . HOH K 7 .   ? -23.554 -20.516 31.113  1.00 19.04 ? 230 HOH L O   1 
HETATM 4739 O  O   . HOH K 7 .   ? -3.306  -5.169  34.122  1.00 26.40 ? 231 HOH L O   1 
HETATM 4740 O  O   . HOH K 7 .   ? -12.092 -29.245 -10.671 1.00 17.89 ? 232 HOH L O   1 
HETATM 4741 O  O   . HOH K 7 .   ? -7.741  -8.534  9.236   1.00 20.86 ? 233 HOH L O   1 
HETATM 4742 O  O   . HOH K 7 .   ? -17.236 -5.432  -5.516  1.00 20.43 ? 234 HOH L O   1 
HETATM 4743 O  O   . HOH K 7 .   ? -12.241 -33.023 -10.287 1.00 21.23 ? 235 HOH L O   1 
HETATM 4744 O  O   . HOH K 7 .   ? -10.322 1.937   -1.586  1.00 27.86 ? 236 HOH L O   1 
HETATM 4745 O  O   . HOH K 7 .   ? -13.713 2.860   25.361  1.00 35.17 ? 237 HOH L O   1 
HETATM 4746 O  O   . HOH K 7 .   ? -14.479 -5.100  32.069  1.00 18.82 ? 238 HOH L O   1 
HETATM 4747 O  O   . HOH K 7 .   ? -5.196  -9.974  18.660  1.00 21.52 ? 239 HOH L O   1 
HETATM 4748 O  O   . HOH K 7 .   ? -8.789  -4.029  -13.585 1.00 44.86 ? 240 HOH L O   1 
HETATM 4749 O  O   . HOH K 7 .   ? -11.146 5.682   16.323  1.00 34.50 ? 241 HOH L O   1 
HETATM 4750 O  O   . HOH K 7 .   ? -15.628 -14.254 34.926  1.00 20.57 ? 242 HOH L O   1 
HETATM 4751 O  O   . HOH K 7 .   ? -6.034  -0.971  3.585   1.00 33.29 ? 243 HOH L O   1 
HETATM 4752 O  O   . HOH K 7 .   ? -22.949 -20.551 -7.245  1.00 19.03 ? 244 HOH L O   1 
HETATM 4753 O  O   . HOH K 7 .   ? -24.045 -16.715 -15.641 1.00 40.94 ? 245 HOH L O   1 
HETATM 4754 O  O   . HOH K 7 .   ? -26.291 -23.273 -5.022  1.00 16.27 ? 246 HOH L O   1 
HETATM 4755 O  O   . HOH K 7 .   ? -1.905  -9.059  11.118  1.00 34.32 ? 247 HOH L O   1 
HETATM 4756 O  O   . HOH K 7 .   ? -8.628  -17.681 9.479   1.00 38.76 ? 248 HOH L O   1 
HETATM 4757 O  O   . HOH K 7 .   ? -17.426 -27.785 -4.128  1.00 28.69 ? 249 HOH L O   1 
HETATM 4758 O  O   . HOH K 7 .   ? -17.057 -16.997 17.847  1.00 28.58 ? 250 HOH L O   1 
HETATM 4759 O  O   . HOH K 7 .   ? -7.647  -1.558  7.842   1.00 19.43 ? 251 HOH L O   1 
HETATM 4760 O  O   . HOH K 7 .   ? -16.740 -6.801  2.978   1.00 25.66 ? 252 HOH L O   1 
HETATM 4761 O  O   . HOH K 7 .   ? -2.838  -3.814  11.179  1.00 26.94 ? 253 HOH L O   1 
HETATM 4762 O  O   . HOH K 7 .   ? -7.260  -3.173  31.727  1.00 23.06 ? 254 HOH L O   1 
HETATM 4763 O  O   . HOH K 7 .   ? -12.603 -12.403 36.213  1.00 22.91 ? 255 HOH L O   1 
HETATM 4764 O  O   . HOH K 7 .   ? -7.020  -15.454 20.142  1.00 24.32 ? 256 HOH L O   1 
HETATM 4765 O  O   . HOH K 7 .   ? -6.319  -4.311  -6.190  1.00 28.45 ? 257 HOH L O   1 
HETATM 4766 O  O   . HOH K 7 .   ? -24.769 -3.867  26.678  1.00 28.56 ? 258 HOH L O   1 
HETATM 4767 O  O   . HOH K 7 .   ? -14.386 -13.201 9.215   1.00 24.85 ? 259 HOH L O   1 
HETATM 4768 O  O   . HOH K 7 .   ? -28.218 -8.103  31.049  1.00 27.61 ? 260 HOH L O   1 
HETATM 4769 O  O   . HOH K 7 .   ? -14.538 -10.936 12.530  1.00 24.18 ? 261 HOH L O   1 
HETATM 4770 O  O   . HOH K 7 .   ? -6.072  -37.776 -9.730  1.00 35.19 ? 262 HOH L O   1 
HETATM 4771 O  O   . HOH K 7 .   ? -6.071  -35.963 -13.242 1.00 30.90 ? 263 HOH L O   1 
HETATM 4772 O  O   . HOH K 7 .   ? -28.138 -19.344 32.534  1.00 29.06 ? 264 HOH L O   1 
HETATM 4773 O  O   . HOH K 7 .   ? -15.570 -5.894  -12.450 1.00 33.25 ? 265 HOH L O   1 
HETATM 4774 O  O   . HOH K 7 .   ? -21.048 -18.856 -8.026  1.00 24.92 ? 266 HOH L O   1 
HETATM 4775 O  O   . HOH K 7 .   ? -21.525 -14.676 -7.423  1.00 32.26 ? 267 HOH L O   1 
HETATM 4776 O  O   . HOH K 7 .   ? -23.461 -18.779 -13.075 1.00 27.95 ? 268 HOH L O   1 
HETATM 4777 O  O   . HOH K 7 .   ? -16.780 -24.170 -4.256  1.00 27.94 ? 269 HOH L O   1 
HETATM 4778 O  O   . HOH K 7 .   ? -25.668 -14.240 29.499  1.00 30.21 ? 270 HOH L O   1 
HETATM 4779 O  O   . HOH K 7 .   ? -19.904 -3.375  -4.702  1.00 33.65 ? 271 HOH L O   1 
HETATM 4780 O  O   . HOH K 7 .   ? -13.513 -13.597 38.558  1.00 22.99 ? 272 HOH L O   1 
HETATM 4781 O  O   . HOH K 7 .   ? -19.650 -11.447 -13.228 1.00 31.62 ? 273 HOH L O   1 
HETATM 4782 O  O   . HOH K 7 .   ? -18.790 -5.562  -7.986  1.00 31.21 ? 274 HOH L O   1 
HETATM 4783 O  O   . HOH K 7 .   ? -19.673 -0.638  12.773  1.00 29.28 ? 275 HOH L O   1 
HETATM 4784 O  O   . HOH K 7 .   ? -25.694 -9.840  42.560  1.00 34.99 ? 276 HOH L O   1 
HETATM 4785 O  O   . HOH K 7 .   ? -4.143  -13.617 14.379  1.00 25.67 ? 277 HOH L O   1 
HETATM 4786 O  O   . HOH K 7 .   ? -12.049 -0.461  28.682  1.00 27.72 ? 278 HOH L O   1 
HETATM 4787 O  O   . HOH K 7 .   ? -8.410  -13.007 -18.010 1.00 32.47 ? 279 HOH L O   1 
HETATM 4788 O  O   . HOH K 7 .   ? -20.233 -12.898 1.047   1.00 26.70 ? 280 HOH L O   1 
HETATM 4789 O  O   . HOH K 7 .   ? -10.501 -5.605  39.661  1.00 26.43 ? 281 HOH L O   1 
HETATM 4790 O  O   . HOH K 7 .   ? -10.849 -11.045 -18.978 1.00 29.42 ? 282 HOH L O   1 
HETATM 4791 O  O   . HOH K 7 .   ? -25.354 -31.996 -15.489 1.00 27.68 ? 283 HOH L O   1 
HETATM 4792 O  O   . HOH K 7 .   ? -8.834  -15.130 9.981   1.00 26.05 ? 284 HOH L O   1 
HETATM 4793 O  O   . HOH K 7 .   ? -14.197 -15.799 41.449  1.00 24.36 ? 285 HOH L O   1 
HETATM 4794 O  O   . HOH K 7 .   ? -21.563 -27.404 -7.677  1.00 26.12 ? 286 HOH L O   1 
HETATM 4795 O  O   . HOH K 7 .   ? -6.022  -4.210  7.260   1.00 28.04 ? 287 HOH L O   1 
HETATM 4796 O  O   . HOH K 7 .   ? -8.244  -17.837 -19.310 1.00 27.72 ? 288 HOH L O   1 
HETATM 4797 O  O   . HOH K 7 .   ? -14.030 -15.425 15.129  1.00 30.17 ? 289 HOH L O   1 
HETATM 4798 O  O   . HOH K 7 .   ? -24.107 -24.178 -23.420 1.00 28.78 ? 290 HOH L O   1 
HETATM 4799 O  O   . HOH K 7 .   ? -5.997  -15.512 8.616   1.00 24.30 ? 291 HOH L O   1 
HETATM 4800 O  O   . HOH K 7 .   ? -19.736 -19.131 38.999  1.00 29.81 ? 292 HOH L O   1 
HETATM 4801 O  O   . HOH K 7 .   ? -7.154  -20.454 24.649  1.00 32.33 ? 322 HOH L O   1 
HETATM 4802 O  O   . HOH K 7 .   ? -7.015  -19.951 21.386  1.00 37.18 ? 323 HOH L O   1 
HETATM 4803 O  O   . HOH K 7 .   ? -7.379  -22.641 19.351  1.00 34.05 ? 324 HOH L O   1 
HETATM 4804 O  O   . HOH K 7 .   ? -22.632 -25.793 40.034  1.00 44.12 ? 344 HOH L O   1 
HETATM 4805 O  O   . HOH K 7 .   ? -29.109 -22.664 35.019  1.00 34.03 ? 345 HOH L O   1 
HETATM 4806 O  O   . HOH K 7 .   ? -27.208 -16.260 29.968  1.00 40.22 ? 348 HOH L O   1 
HETATM 4807 O  O   . HOH K 7 .   ? -5.441  -16.064 13.543  1.00 38.86 ? 353 HOH L O   1 
HETATM 4808 O  O   . HOH K 7 .   ? -7.979  -17.554 13.066  1.00 31.47 ? 354 HOH L O   1 
HETATM 4809 O  O   . HOH K 7 .   ? -13.944 -21.290 16.360  1.00 34.22 ? 359 HOH L O   1 
HETATM 4810 O  O   . HOH K 7 .   ? -24.613 -21.575 -12.096 1.00 27.16 ? 360 HOH L O   1 
HETATM 4811 O  O   . HOH K 7 .   ? -22.678 -17.937 -9.762  1.00 36.53 ? 361 HOH L O   1 
HETATM 4812 O  O   . HOH K 7 .   ? -23.962 -14.984 -9.642  1.00 40.00 ? 362 HOH L O   1 
HETATM 4813 O  O   . HOH K 7 .   ? -20.423 -13.603 -3.843  1.00 36.21 ? 363 HOH L O   1 
HETATM 4814 O  O   . HOH K 7 .   ? -15.139 -6.517  6.365   1.00 34.71 ? 364 HOH L O   1 
HETATM 4815 O  O   . HOH K 7 .   ? -18.726 -4.391  1.984   1.00 30.58 ? 365 HOH L O   1 
HETATM 4816 O  O   . HOH K 7 .   ? -17.000 -1.970  1.504   1.00 36.90 ? 366 HOH L O   1 
HETATM 4817 O  O   . HOH K 7 .   ? -25.942 -11.324 20.713  1.00 43.59 ? 368 HOH L O   1 
HETATM 4818 O  O   . HOH K 7 .   ? -21.922 -15.131 44.615  1.00 32.88 ? 369 HOH L O   1 
HETATM 4819 O  O   . HOH K 7 .   ? -24.812 -23.884 38.704  1.00 35.23 ? 370 HOH L O   1 
HETATM 4820 O  O   . HOH K 7 .   ? -22.208 -16.450 23.910  1.00 35.76 ? 372 HOH L O   1 
HETATM 4821 O  O   . HOH K 7 .   ? -11.415 -31.869 -19.272 1.00 32.52 ? 381 HOH L O   1 
HETATM 4822 O  O   . HOH K 7 .   ? -7.888  -29.154 -12.594 1.00 34.87 ? 382 HOH L O   1 
HETATM 4823 O  O   . HOH K 7 .   ? -21.676 -0.417  37.428  1.00 36.70 ? 386 HOH L O   1 
HETATM 4824 O  O   . HOH K 7 .   ? -18.915 0.322   36.152  1.00 34.87 ? 387 HOH L O   1 
HETATM 4825 O  O   . HOH K 7 .   ? -22.120 -20.302 0.639   1.00 27.72 ? 389 HOH L O   1 
HETATM 4826 O  O   . HOH K 7 .   ? 1.933   -4.147  24.309  1.00 39.07 ? 392 HOH L O   1 
HETATM 4827 O  O   . HOH K 7 .   ? -0.437  -2.645  21.716  1.00 38.54 ? 393 HOH L O   1 
HETATM 4828 O  O   . HOH K 7 .   ? -7.104  -37.293 -12.006 1.00 40.42 ? 411 HOH L O   1 
HETATM 4829 O  O   . HOH K 7 .   ? -7.680  -31.587 -15.895 1.00 39.92 ? 413 HOH L O   1 
HETATM 4830 O  O   . HOH K 7 .   ? -26.920 -12.995 26.577  1.00 52.49 ? 414 HOH L O   1 
HETATM 4831 O  O   . HOH K 7 .   ? -27.418 -3.307  27.161  1.00 38.98 ? 415 HOH L O   1 
HETATM 4832 O  O   . HOH K 7 .   ? -17.812 -36.537 -7.881  1.00 32.18 ? 419 HOH L O   1 
HETATM 4833 O  O   . HOH K 7 .   ? -18.980 -30.632 -7.179  1.00 33.14 ? 421 HOH L O   1 
HETATM 4834 O  O   . HOH K 7 .   ? -14.240 -10.533 9.851   1.00 28.75 ? 423 HOH L O   1 
HETATM 4835 O  O   . HOH K 7 .   ? -16.104 -10.523 8.323   1.00 36.90 ? 424 HOH L O   1 
HETATM 4836 O  O   . HOH K 7 .   ? -24.830 -4.291  16.169  1.00 32.72 ? 426 HOH L O   1 
HETATM 4837 O  O   . HOH K 7 .   ? -25.327 -10.511 24.908  1.00 33.82 ? 428 HOH L O   1 
HETATM 4838 O  O   . HOH K 7 .   ? -1.228  -4.485  32.661  1.00 41.68 ? 435 HOH L O   1 
HETATM 4839 O  O   . HOH K 7 .   ? -4.671  -18.626 21.327  1.00 39.67 ? 446 HOH L O   1 
HETATM 4840 O  O   . HOH K 7 .   ? -2.538  -15.586 -0.009  1.00 43.10 ? 458 HOH L O   1 
HETATM 4841 O  O   . HOH K 7 .   ? -3.991  -15.257 2.409   1.00 33.61 ? 459 HOH L O   1 
HETATM 4842 O  O   . HOH K 7 .   ? -20.045 -13.592 3.115   1.00 31.64 ? 462 HOH L O   1 
HETATM 4843 O  O   . HOH K 7 .   ? -6.776  -12.436 -12.253 1.00 36.10 ? 463 HOH L O   1 
HETATM 4844 O  O   . HOH K 7 .   ? -16.345 0.985   18.797  1.00 24.73 ? 464 HOH L O   1 
HETATM 4845 O  O   . HOH K 7 .   ? -18.868 0.734   20.068  1.00 33.74 ? 465 HOH L O   1 
HETATM 4846 O  O   . HOH K 7 .   ? -19.960 2.463   23.439  1.00 46.39 ? 466 HOH L O   1 
HETATM 4847 O  O   . HOH K 7 .   ? -20.841 -4.960  -6.521  1.00 39.09 ? 470 HOH L O   1 
HETATM 4848 O  O   . HOH K 7 .   ? -7.875  -24.446 -22.941 1.00 36.58 ? 471 HOH L O   1 
HETATM 4849 O  O   . HOH K 7 .   ? -26.497 -36.372 -17.618 1.00 41.77 ? 473 HOH L O   1 
HETATM 4850 O  O   . HOH K 7 .   ? -26.694 -17.004 -21.915 1.00 31.45 ? 474 HOH L O   1 
HETATM 4851 O  O   . HOH K 7 .   ? -2.205  -13.141 12.337  1.00 40.44 ? 476 HOH L O   1 
HETATM 4852 O  O   . HOH K 7 .   ? -30.002 -15.226 39.565  1.00 44.22 ? 484 HOH L O   1 
HETATM 4853 O  O   . HOH K 7 .   ? -30.597 -11.235 37.197  1.00 39.53 ? 485 HOH L O   1 
HETATM 4854 O  O   . HOH K 7 .   ? -28.283 -16.446 32.210  1.00 41.76 ? 486 HOH L O   1 
HETATM 4855 O  O   . HOH K 7 .   ? -22.257 -1.661  14.978  1.00 39.99 ? 487 HOH L O   1 
HETATM 4856 O  O   . HOH K 7 .   ? -10.009 1.620   5.863   1.00 35.90 ? 488 HOH L O   1 
HETATM 4857 O  O   . HOH K 7 .   ? -3.618  -3.490  8.463   1.00 41.69 ? 489 HOH L O   1 
HETATM 4858 O  O   . HOH K 7 .   ? -14.754 -13.465 13.431  1.00 44.65 ? 490 HOH L O   1 
HETATM 4859 O  O   . HOH K 7 .   ? -15.176 -14.966 10.962  1.00 35.40 ? 491 HOH L O   1 
HETATM 4860 O  O   . HOH K 7 .   ? -4.610  -11.889 21.250  1.00 33.09 ? 492 HOH L O   1 
HETATM 4861 O  O   . HOH K 7 .   ? -4.875  -8.854  -2.421  1.00 36.22 ? 493 HOH L O   1 
HETATM 4862 O  O   . HOH K 7 .   ? -5.237  -10.980 -5.045  1.00 34.51 ? 494 HOH L O   1 
HETATM 4863 O  O   . HOH K 7 .   ? -9.775  -6.446  -15.775 1.00 42.79 ? 495 HOH L O   1 
HETATM 4864 O  O   . HOH K 7 .   ? -14.411 -10.505 -19.198 1.00 35.56 ? 496 HOH L O   1 
HETATM 4865 O  O   . HOH K 7 .   ? -16.998 -17.756 -22.863 1.00 38.48 ? 497 HOH L O   1 
HETATM 4866 O  O   . HOH L 7 .   ? -19.114 -38.246 37.969  1.00 32.49 ? 215 HOH H O   1 
HETATM 4867 O  O   . HOH L 7 .   ? -19.711 -33.950 13.723  1.00 15.60 ? 216 HOH H O   1 
HETATM 4868 O  O   . HOH L 7 .   ? 4.856   -33.540 2.286   1.00 28.36 ? 217 HOH H O   1 
HETATM 4869 O  O   . HOH L 7 .   ? -13.006 -34.996 10.929  1.00 14.85 ? 218 HOH H O   1 
HETATM 4870 O  O   . HOH L 7 .   ? -12.232 -32.577 18.024  1.00 16.83 ? 219 HOH H O   1 
HETATM 4871 O  O   . HOH L 7 .   ? -26.133 -41.547 12.205  1.00 23.39 ? 220 HOH H O   1 
HETATM 4872 O  O   . HOH L 7 .   ? -6.539  -25.854 6.067   1.00 20.81 ? 221 HOH H O   1 
HETATM 4873 O  O   . HOH L 7 .   ? -15.116 -37.305 20.664  1.00 22.20 ? 222 HOH H O   1 
HETATM 4874 O  O   . HOH L 7 .   ? 6.056   -24.011 -6.558  1.00 18.12 ? 223 HOH H O   1 
HETATM 4875 O  O   . HOH L 7 .   ? 2.357   -34.576 3.248   1.00 19.95 ? 224 HOH H O   1 
HETATM 4876 O  O   . HOH L 7 .   ? -15.152 -34.486 33.045  1.00 24.17 ? 225 HOH H O   1 
HETATM 4877 O  O   . HOH L 7 .   ? -23.033 -30.213 14.376  1.00 29.51 ? 226 HOH H O   1 
HETATM 4878 O  O   . HOH L 7 .   ? 13.282  -31.146 -5.574  1.00 17.36 ? 227 HOH H O   1 
HETATM 4879 O  O   . HOH L 7 .   ? -16.000 -24.997 -0.106  1.00 26.94 ? 228 HOH H O   1 
HETATM 4880 O  O   . HOH L 7 .   ? -24.269 -24.507 1.326   1.00 20.48 ? 229 HOH H O   1 
HETATM 4881 O  O   . HOH L 7 .   ? -23.872 -18.470 29.149  1.00 21.61 ? 230 HOH H O   1 
HETATM 4882 O  O   . HOH L 7 .   ? 9.824   -32.246 -4.368  1.00 31.86 ? 231 HOH H O   1 
HETATM 4883 O  O   . HOH L 7 .   ? -13.942 -25.713 6.019   1.00 19.81 ? 232 HOH H O   1 
HETATM 4884 O  O   . HOH L 7 .   ? -25.936 -45.009 24.162  1.00 33.89 ? 233 HOH H O   1 
HETATM 4885 O  O   . HOH L 7 .   ? -8.578  -18.288 4.357   1.00 24.00 ? 234 HOH H O   1 
HETATM 4886 O  O   . HOH L 7 .   ? -2.608  -33.017 26.034  1.00 28.40 ? 235 HOH H O   1 
HETATM 4887 O  O   . HOH L 7 .   ? -8.963  -25.385 41.969  1.00 26.30 ? 236 HOH H O   1 
HETATM 4888 O  O   . HOH L 7 .   ? -14.305 -31.915 16.246  1.00 20.49 ? 237 HOH H O   1 
HETATM 4889 O  O   . HOH L 7 .   ? -11.038 -33.750 12.120  1.00 37.57 ? 238 HOH H O   1 
HETATM 4890 O  O   . HOH L 7 .   ? -27.354 -24.123 37.621  1.00 30.74 ? 239 HOH H O   1 
HETATM 4891 O  O   . HOH L 7 .   ? -8.870  -27.629 7.955   1.00 22.04 ? 240 HOH H O   1 
HETATM 4892 O  O   . HOH L 7 .   ? -4.651  -18.823 43.220  1.00 21.10 ? 241 HOH H O   1 
HETATM 4893 O  O   . HOH L 7 .   ? -24.167 -31.918 9.265   1.00 31.99 ? 242 HOH H O   1 
HETATM 4894 O  O   . HOH L 7 .   ? -30.570 -33.432 14.617  1.00 30.71 ? 243 HOH H O   1 
HETATM 4895 O  O   . HOH L 7 .   ? -13.523 -42.130 2.282   1.00 42.74 ? 244 HOH H O   1 
HETATM 4896 O  O   . HOH L 7 .   ? -9.068  -19.313 37.290  1.00 22.92 ? 245 HOH H O   1 
HETATM 4897 O  O   . HOH L 7 .   ? -9.164  -37.673 11.963  1.00 30.26 ? 246 HOH H O   1 
HETATM 4898 O  O   . HOH L 7 .   ? -4.972  -12.360 40.094  1.00 29.99 ? 247 HOH H O   1 
HETATM 4899 O  O   . HOH L 7 .   ? -11.071 -31.148 -8.984  1.00 22.76 ? 248 HOH H O   1 
HETATM 4900 O  O   . HOH L 7 .   ? -1.416  -26.920 6.357   1.00 21.46 ? 249 HOH H O   1 
HETATM 4901 O  O   . HOH L 7 .   ? -22.187 -31.606 10.829  1.00 20.58 ? 250 HOH H O   1 
HETATM 4902 O  O   . HOH L 7 .   ? -26.226 -21.137 31.446  1.00 21.67 ? 251 HOH H O   1 
HETATM 4903 O  O   . HOH L 7 .   ? -14.262 -27.873 7.265   1.00 27.15 ? 252 HOH H O   1 
HETATM 4904 O  O   . HOH L 7 .   ? -8.167  -21.351 5.375   1.00 26.60 ? 253 HOH H O   1 
HETATM 4905 O  O   . HOH L 7 .   ? -6.248  -18.168 26.900  1.00 21.46 ? 254 HOH H O   1 
HETATM 4906 O  O   . HOH L 7 .   ? -7.920  -25.404 39.381  1.00 20.91 ? 255 HOH H O   1 
HETATM 4907 O  O   . HOH L 7 .   ? 7.410   -17.594 -9.121  1.00 23.61 ? 256 HOH H O   1 
HETATM 4908 O  O   . HOH L 7 .   ? -24.405 -22.754 23.118  1.00 30.38 ? 257 HOH H O   1 
HETATM 4909 O  O   . HOH L 7 .   ? 6.259   -26.436 1.526   1.00 24.50 ? 258 HOH H O   1 
HETATM 4910 O  O   . HOH L 7 .   ? -5.883  -22.615 25.028  1.00 20.93 ? 259 HOH H O   1 
HETATM 4911 O  O   . HOH L 7 .   ? 1.557   -14.191 -14.325 1.00 28.28 ? 260 HOH H O   1 
HETATM 4912 O  O   . HOH L 7 .   ? -21.026 -22.491 3.598   1.00 23.46 ? 261 HOH H O   1 
HETATM 4913 O  O   . HOH L 7 .   ? -17.098 -27.533 10.433  1.00 25.96 ? 262 HOH H O   1 
HETATM 4914 O  O   . HOH L 7 .   ? 0.782   -28.058 37.543  1.00 29.89 ? 263 HOH H O   1 
HETATM 4915 O  O   . HOH L 7 .   ? 12.925  -24.572 -8.354  1.00 17.43 ? 264 HOH H O   1 
HETATM 4916 O  O   . HOH L 7 .   ? -6.837  -30.857 35.168  1.00 28.95 ? 265 HOH H O   1 
HETATM 4917 O  O   . HOH L 7 .   ? -26.154 -33.056 -5.102  1.00 32.24 ? 266 HOH H O   1 
HETATM 4918 O  O   . HOH L 7 .   ? 3.292   -31.492 -6.223  1.00 22.20 ? 267 HOH H O   1 
HETATM 4919 O  O   . HOH L 7 .   ? -19.298 -42.321 12.445  1.00 31.90 ? 268 HOH H O   1 
HETATM 4920 O  O   . HOH L 7 .   ? 6.672   -23.356 -2.219  1.00 23.51 ? 269 HOH H O   1 
HETATM 4921 O  O   . HOH L 7 .   ? -24.247 -30.100 40.753  1.00 31.05 ? 270 HOH H O   1 
HETATM 4922 O  O   . HOH L 7 .   ? -3.587  -17.904 -1.553  1.00 24.31 ? 271 HOH H O   1 
HETATM 4923 O  O   . HOH L 7 .   ? -18.240 -39.128 31.776  1.00 27.09 ? 272 HOH H O   1 
HETATM 4924 O  O   . HOH L 7 .   ? -9.901  -39.470 10.215  1.00 25.75 ? 273 HOH H O   1 
HETATM 4925 O  O   . HOH L 7 .   ? 4.851   -29.081 -7.766  1.00 23.67 ? 274 HOH H O   1 
HETATM 4926 O  O   . HOH L 7 .   ? 2.624   -20.135 -0.546  1.00 28.99 ? 275 HOH H O   1 
HETATM 4927 O  O   . HOH L 7 .   ? -0.013  -22.015 -13.407 1.00 28.17 ? 276 HOH H O   1 
HETATM 4928 O  O   . HOH L 7 .   ? -25.854 -29.484 -5.107  1.00 28.14 ? 277 HOH H O   1 
HETATM 4929 O  O   . HOH L 7 .   ? 3.649   -23.034 8.735   1.00 27.77 ? 278 HOH H O   1 
HETATM 4930 O  O   . HOH L 7 .   ? -5.462  -28.567 21.873  1.00 24.70 ? 279 HOH H O   1 
HETATM 4931 O  O   . HOH L 7 .   ? 6.240   -24.502 3.431   1.00 22.75 ? 280 HOH H O   1 
HETATM 4932 O  O   . HOH L 7 .   ? -17.562 -18.681 40.285  1.00 23.29 ? 281 HOH H O   1 
HETATM 4933 O  O   . HOH L 7 .   ? -1.371  -38.711 -4.854  1.00 25.37 ? 282 HOH H O   1 
HETATM 4934 O  O   . HOH L 7 .   ? -6.810  -31.335 -11.582 1.00 24.14 ? 283 HOH H O   1 
HETATM 4935 O  O   . HOH L 7 .   ? -22.809 -43.994 10.215  1.00 27.91 ? 284 HOH H O   1 
HETATM 4936 O  O   . HOH L 7 .   ? -8.616  -15.820 4.237   1.00 30.47 ? 285 HOH H O   1 
HETATM 4937 O  O   . HOH L 7 .   ? -6.067  -27.502 -13.515 1.00 24.85 ? 286 HOH H O   1 
HETATM 4938 O  O   . HOH L 7 .   ? -1.811  -35.900 37.935  1.00 29.15 ? 287 HOH H O   1 
HETATM 4939 O  O   . HOH L 7 .   ? -2.786  -25.033 24.618  1.00 24.85 ? 288 HOH H O   1 
HETATM 4940 O  O   . HOH L 7 .   ? 10.058  -25.490 -11.779 1.00 31.49 ? 289 HOH H O   1 
HETATM 4941 O  O   . HOH L 7 .   ? 1.910   -23.181 29.053  1.00 31.97 ? 290 HOH H O   1 
HETATM 4942 O  O   . HOH L 7 .   ? 5.581   -32.477 0.220   1.00 30.20 ? 291 HOH H O   1 
HETATM 4943 O  O   . HOH L 7 .   ? -3.127  -22.416 6.688   1.00 28.28 ? 292 HOH H O   1 
HETATM 4944 O  O   . HOH L 7 .   ? -17.134 -25.774 6.952   1.00 23.81 ? 293 HOH H O   1 
HETATM 4945 O  O   . HOH L 7 .   ? -5.799  -33.244 7.830   1.00 28.19 ? 294 HOH H O   1 
HETATM 4946 O  O   . HOH L 7 .   ? -4.894  -26.402 24.878  1.00 27.25 ? 295 HOH H O   1 
HETATM 4947 O  O   . HOH L 7 .   ? -23.668 -35.197 -3.744  1.00 30.06 ? 296 HOH H O   1 
HETATM 4948 O  O   . HOH L 7 .   ? -12.577 -23.985 17.934  1.00 34.76 ? 297 HOH H O   1 
HETATM 4949 O  O   . HOH L 7 .   ? -26.355 -29.880 24.845  1.00 26.20 ? 298 HOH H O   1 
HETATM 4950 O  O   . HOH L 7 .   ? 8.523   -29.535 -1.389  1.00 32.78 ? 299 HOH H O   1 
HETATM 4951 O  O   . HOH L 7 .   ? -31.702 -37.075 12.166  1.00 39.75 ? 300 HOH H O   1 
HETATM 4952 O  O   . HOH L 7 .   ? -24.939 -43.478 17.105  1.00 29.87 ? 301 HOH H O   1 
HETATM 4953 O  O   . HOH L 7 .   ? -10.452 -39.169 18.868  1.00 29.06 ? 302 HOH H O   1 
HETATM 4954 O  O   . HOH L 7 .   ? -3.111  -20.356 41.101  1.00 34.10 ? 319 HOH H O   1 
HETATM 4955 O  O   . HOH L 7 .   ? -2.533  -19.214 33.707  1.00 32.85 ? 321 HOH H O   1 
HETATM 4956 O  O   . HOH L 7 .   ? -6.882  -24.805 22.044  1.00 35.43 ? 325 HOH H O   1 
HETATM 4957 O  O   . HOH L 7 .   ? -10.098 -24.760 18.163  1.00 33.45 ? 326 HOH H O   1 
HETATM 4958 O  O   . HOH L 7 .   ? -9.768  -27.720 15.747  1.00 40.74 ? 327 HOH H O   1 
HETATM 4959 O  O   . HOH L 7 .   ? -12.190 -28.546 16.553  1.00 31.71 ? 328 HOH H O   1 
HETATM 4960 O  O   . HOH L 7 .   ? -13.664 -29.923 14.855  1.00 33.07 ? 329 HOH H O   1 
HETATM 4961 O  O   . HOH L 7 .   ? -11.847 -31.338 13.507  1.00 40.49 ? 330 HOH H O   1 
HETATM 4962 O  O   . HOH L 7 .   ? -6.212  -35.948 45.322  1.00 35.60 ? 341 HOH H O   1 
HETATM 4963 O  O   . HOH L 7 .   ? -19.474 -33.828 43.807  1.00 26.27 ? 342 HOH H O   1 
HETATM 4964 O  O   . HOH L 7 .   ? -18.261 -23.619 40.256  1.00 41.36 ? 343 HOH H O   1 
HETATM 4965 O  O   . HOH L 7 .   ? -27.590 -20.916 29.224  1.00 30.58 ? 346 HOH H O   1 
HETATM 4966 O  O   . HOH L 7 .   ? -26.417 -18.285 28.415  1.00 35.37 ? 347 HOH H O   1 
HETATM 4967 O  O   . HOH L 7 .   ? -14.590 -27.129 10.046  1.00 30.96 ? 355 HOH H O   1 
HETATM 4968 O  O   . HOH L 7 .   ? -22.068 -28.733 11.503  1.00 28.52 ? 356 HOH H O   1 
HETATM 4969 O  O   . HOH L 7 .   ? -20.251 -26.252 13.584  1.00 38.44 ? 357 HOH H O   1 
HETATM 4970 O  O   . HOH L 7 .   ? -18.948 -21.408 15.539  1.00 45.17 ? 358 HOH H O   1 
HETATM 4971 O  O   . HOH L 7 .   ? -5.292  -33.086 -12.830 1.00 42.68 ? 383 HOH H O   1 
HETATM 4972 O  O   . HOH L 7 .   ? -16.376 -29.608 6.839   1.00 17.56 ? 384 HOH H O   1 
HETATM 4973 O  O   . HOH L 7 .   ? -29.753 -27.679 25.001  1.00 36.38 ? 385 HOH H O   1 
HETATM 4974 O  O   . HOH L 7 .   ? 12.449  -21.638 -8.231  1.00 32.51 ? 388 HOH H O   1 
HETATM 4975 O  O   . HOH L 7 .   ? -1.965  -28.611 -15.208 1.00 42.50 ? 412 HOH H O   1 
HETATM 4976 O  O   . HOH L 7 .   ? 1.709   -11.755 -8.032  1.00 34.45 ? 416 HOH H O   1 
HETATM 4977 O  O   . HOH L 7 .   ? -10.745 -21.388 40.066  1.00 36.56 ? 417 HOH H O   1 
HETATM 4978 O  O   . HOH L 7 .   ? -24.822 -38.358 31.011  1.00 33.11 ? 418 HOH H O   1 
HETATM 4979 O  O   . HOH L 7 .   ? -2.524  -33.892 -9.673  1.00 33.93 ? 420 HOH H O   1 
HETATM 4980 O  O   . HOH L 7 .   ? -13.843 -39.264 17.062  1.00 32.78 ? 427 HOH H O   1 
HETATM 4981 O  O   . HOH L 7 .   ? -15.303 -42.475 32.629  1.00 31.29 ? 429 HOH H O   1 
HETATM 4982 O  O   . HOH L 7 .   ? -14.544 -39.615 37.900  1.00 32.03 ? 430 HOH H O   1 
HETATM 4983 O  O   . HOH L 7 .   ? -8.940  -41.604 38.416  1.00 36.84 ? 431 HOH H O   1 
HETATM 4984 O  O   . HOH L 7 .   ? -3.979  -32.195 43.794  1.00 38.51 ? 432 HOH H O   1 
HETATM 4985 O  O   . HOH L 7 .   ? 0.863   -24.505 25.358  1.00 33.39 ? 447 HOH H O   1 
HETATM 4986 O  O   . HOH L 7 .   ? 1.395   -25.899 22.934  1.00 45.04 ? 448 HOH H O   1 
HETATM 4987 O  O   . HOH L 7 .   ? -5.138  -29.943 19.550  1.00 44.15 ? 449 HOH H O   1 
HETATM 4988 O  O   . HOH L 7 .   ? -9.843  -32.255 16.572  1.00 33.25 ? 450 HOH H O   1 
HETATM 4989 O  O   . HOH L 7 .   ? -7.333  -38.781 14.008  1.00 40.98 ? 451 HOH H O   1 
HETATM 4990 O  O   . HOH L 7 .   ? 0.443   -36.191 7.188   1.00 34.03 ? 452 HOH H O   1 
HETATM 4991 O  O   . HOH L 7 .   ? -1.654  -27.348 9.321   1.00 40.01 ? 453 HOH H O   1 
HETATM 4992 O  O   . HOH L 7 .   ? -3.648  -25.361 6.207   1.00 27.24 ? 454 HOH H O   1 
HETATM 4993 O  O   . HOH L 7 .   ? -4.839  -27.910 8.867   1.00 34.30 ? 455 HOH H O   1 
HETATM 4994 O  O   . HOH L 7 .   ? 1.987   -17.641 0.850   1.00 32.02 ? 456 HOH H O   1 
HETATM 4995 O  O   . HOH L 7 .   ? 0.325   -16.526 -0.888  1.00 37.53 ? 457 HOH H O   1 
HETATM 4996 O  O   . HOH L 7 .   ? -1.418  -16.785 4.765   1.00 31.84 ? 460 HOH H O   1 
HETATM 4997 O  O   . HOH L 7 .   ? -3.003  -37.367 11.830  1.00 33.44 ? 461 HOH H O   1 
HETATM 4998 O  O   . HOH L 7 .   ? -16.166 -40.048 14.675  1.00 29.14 ? 467 HOH H O   1 
HETATM 4999 O  O   . HOH L 7 .   ? -18.627 -40.805 14.876  1.00 28.36 ? 468 HOH H O   1 
HETATM 5000 O  O   . HOH L 7 .   ? -8.467  -36.989 24.446  1.00 31.97 ? 472 HOH H O   1 
HETATM 5001 O  O   . HOH L 7 .   ? -14.904 -42.205 14.131  1.00 29.83 ? 475 HOH H O   1 
HETATM 5002 O  O   . HOH L 7 .   ? -21.423 -45.366 6.207   1.00 33.29 ? 498 HOH H O   1 
HETATM 5003 O  O   . HOH L 7 .   ? -17.990 -43.677 3.166   1.00 38.02 ? 499 HOH H O   1 
HETATM 5004 O  O   . HOH L 7 .   ? -29.345 -35.757 9.091   1.00 35.70 ? 500 HOH H O   1 
HETATM 5005 O  O   . HOH L 7 .   ? -10.815 -40.005 -3.527  1.00 34.16 ? 501 HOH H O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   29  ?   ?   ?   A . n 
A 1 2   PHE 2   30  ?   ?   ?   A . n 
A 1 3   GLY 3   31  ?   ?   ?   A . n 
A 1 4   LYS 4   32  ?   ?   ?   A . n 
A 1 5   ARG 5   33  ?   ?   ?   A . n 
A 1 6   ARG 6   34  ?   ?   ?   A . n 
A 1 7   HIS 7   35  ?   ?   ?   A . n 
A 1 8   PRO 8   36  ?   ?   ?   A . n 
A 1 9   LYS 9   37  ?   ?   ?   A . n 
A 1 10  LYS 10  38  ?   ?   ?   A . n 
A 1 11  LEU 11  39  39  LEU LEU A . n 
A 1 12  THR 12  40  40  THR THR A . n 
A 1 13  PRO 13  41  41  PRO PRO A . n 
A 1 14  LEU 14  42  42  LEU LEU A . n 
A 1 15  ALA 15  43  43  ALA ALA A . n 
A 1 16  TYR 16  44  44  TYR TYR A . n 
A 1 17  LYS 17  45  45  LYS LYS A . n 
A 1 18  GLN 18  46  46  GLN GLN A . n 
A 1 19  PHE 19  47  47  PHE PHE A . n 
A 1 20  ILE 20  48  48  ILE ILE A . n 
A 1 21  PRO 21  49  49  PRO PRO A . n 
A 1 22  ASN 22  50  50  ASN ASN A . n 
A 1 23  VAL 23  51  51  VAL VAL A . n 
A 1 24  ALA 24  52  52  ALA ALA A . n 
A 1 25  GLU 25  53  53  GLU GLU A . n 
A 1 26  LYS 26  54  54  LYS LYS A . n 
A 1 27  THR 27  55  55  THR THR A . n 
A 1 28  LEU 28  56  56  LEU LEU A . n 
A 1 29  GLY 29  57  57  GLY GLY A . n 
A 1 30  ALA 30  58  58  ALA ALA A . n 
A 1 31  SER 31  59  59  SER SER A . n 
A 1 32  GLY 32  60  60  GLY GLY A . n 
A 1 33  ARG 33  61  61  ARG ARG A . n 
A 1 34  TYR 34  62  62  TYR TYR A . n 
A 1 35  GLU 35  63  63  GLU GLU A . n 
A 1 36  GLY 36  64  64  GLY GLY A . n 
A 1 37  LYS 37  65  65  LYS LYS A . n 
A 1 38  ILE 38  66  66  ILE ILE A . n 
A 1 39  SER 39  67  67  SER SER A . n 
A 1 40  ARG 40  68  68  ARG ARG A . n 
A 1 41  ASN 41  69  69  ASN ASN A . n 
A 1 42  SER 42  70  70  SER SER A . n 
A 1 43  GLU 43  71  71  GLU GLU A . n 
A 1 44  ARG 44  72  72  ARG ARG A . n 
A 1 45  PHE 45  73  73  PHE PHE A . n 
A 1 46  LYS 46  74  74  LYS LYS A . n 
A 1 47  GLU 47  75  75  GLU GLU A . n 
A 1 48  LEU 48  76  76  LEU LEU A . n 
A 1 49  THR 49  77  77  THR THR A . n 
A 1 50  PRO 50  78  78  PRO PRO A . n 
A 1 51  ASN 51  79  79  ASN ASN A . n 
A 1 52  TYR 52  80  80  TYR TYR A . n 
A 1 53  ASN 53  81  81  ASN ASN A . n 
A 1 54  PRO 54  82  82  PRO PRO A . n 
A 1 55  ASP 55  83  83  ASP ASP A . n 
A 1 56  ILE 56  84  84  ILE ILE A . n 
A 1 57  ILE 57  85  85  ILE ILE A . n 
A 1 58  PHE 58  86  86  PHE PHE A . n 
A 1 59  LYS 59  87  87  LYS LYS A . n 
A 1 60  ASP 60  88  88  ASP ASP A . n 
A 1 61  GLU 61  89  89  GLU GLU A . n 
A 1 62  GLU 62  90  90  GLU GLU A . n 
A 1 63  ASN 63  91  91  ASN ASN A . n 
A 1 64  THR 64  92  92  THR THR A . n 
A 1 65  GLY 65  93  93  GLY GLY A . n 
A 1 66  ALA 66  94  94  ALA ALA A . n 
A 1 67  ASP 67  95  95  ASP ASP A . n 
A 1 68  ARG 68  96  96  ARG ARG A . n 
A 1 69  LEU 69  97  97  LEU LEU A . n 
A 1 70  MET 70  98  98  MET MET A . n 
A 1 71  THR 71  99  99  THR THR A . n 
A 1 72  GLN 72  100 100 GLN GLN A . n 
A 1 73  ARG 73  101 101 ARG ARG A . n 
A 1 74  CYS 74  102 102 CYS CYS A . n 
A 1 75  LYS 75  103 103 LYS LYS A . n 
A 1 76  ASP 76  104 104 ASP ASP A . n 
A 1 77  LYS 77  105 105 LYS LYS A . n 
A 1 78  LEU 78  106 106 LEU LEU A . n 
A 1 79  ASN 79  107 107 ASN ASN A . n 
A 1 80  ALA 80  108 108 ALA ALA A . n 
A 1 81  LEU 81  109 109 LEU LEU A . n 
A 1 82  ALA 82  110 110 ALA ALA A . n 
A 1 83  ILE 83  111 111 ILE ILE A . n 
A 1 84  SER 84  112 112 SER SER A . n 
A 1 85  VAL 85  113 113 VAL VAL A . n 
A 1 86  MET 86  114 114 MET MET A . n 
A 1 87  ASN 87  115 115 ASN ASN A . n 
A 1 88  GLN 88  116 116 GLN GLN A . n 
A 1 89  TRP 89  117 117 TRP TRP A . n 
A 1 90  PRO 90  118 118 PRO PRO A . n 
A 1 91  GLY 91  119 119 GLY GLY A . n 
A 1 92  VAL 92  120 120 VAL VAL A . n 
A 1 93  LYS 93  121 121 LYS LYS A . n 
A 1 94  LEU 94  122 122 LEU LEU A . n 
A 1 95  ARG 95  123 123 ARG ARG A . n 
A 1 96  VAL 96  124 124 VAL VAL A . n 
A 1 97  THR 97  125 125 THR THR A . n 
A 1 98  GLU 98  126 126 GLU GLU A . n 
A 1 99  GLY 99  127 127 GLY GLY A . n 
A 1 100 TRP 100 128 128 TRP TRP A . n 
A 1 101 ASP 101 129 129 ASP ASP A . n 
A 1 102 GLU 102 130 130 GLU GLU A . n 
A 1 103 ASP 103 131 131 ASP ASP A . n 
A 1 104 GLY 104 132 132 GLY GLY A . n 
A 1 105 HIS 105 133 133 HIS HIS A . n 
A 1 106 HIS 106 134 134 HIS HIS A . n 
A 1 107 SER 107 135 135 SER SER A . n 
A 1 108 GLU 108 136 136 GLU GLU A . n 
A 1 109 GLU 109 137 137 GLU GLU A . n 
A 1 110 SER 110 138 138 SER SER A . n 
A 1 111 LEU 111 139 139 LEU LEU A . n 
A 1 112 HIS 112 140 140 HIS HIS A . n 
A 1 113 TYR 113 141 141 TYR TYR A . n 
A 1 114 GLU 114 142 142 GLU GLU A . n 
A 1 115 GLY 115 143 143 GLY GLY A . n 
A 1 116 ARG 116 144 144 ARG ARG A . n 
A 1 117 ALA 117 145 145 ALA ALA A . n 
A 1 118 VAL 118 146 146 VAL VAL A . n 
A 1 119 ASP 119 147 147 ASP ASP A . n 
A 1 120 ILE 120 148 148 ILE ILE A . n 
A 1 121 THR 121 149 149 THR THR A . n 
A 1 122 THR 122 150 150 THR THR A . n 
A 1 123 SER 123 151 151 SER SER A . n 
A 1 124 ASP 124 152 152 ASP ASP A . n 
A 1 125 ARG 125 153 153 ARG ARG A . n 
A 1 126 ASP 126 154 154 ASP ASP A . n 
A 1 127 ARG 127 155 155 ARG ARG A . n 
A 1 128 SER 128 156 156 SER SER A . n 
A 1 129 LYS 129 157 157 LYS LYS A . n 
A 1 130 TYR 130 158 158 TYR TYR A . n 
A 1 131 GLY 131 159 159 GLY GLY A . n 
A 1 132 MET 132 160 160 MET MET A . n 
A 1 133 LEU 133 161 161 LEU LEU A . n 
A 1 134 ALA 134 162 162 ALA ALA A . n 
A 1 135 ARG 135 163 163 ARG ARG A . n 
A 1 136 LEU 136 164 164 LEU LEU A . n 
A 1 137 ALA 137 165 165 ALA ALA A . n 
A 1 138 VAL 138 166 166 VAL VAL A . n 
A 1 139 GLU 139 167 167 GLU GLU A . n 
A 1 140 ALA 140 168 168 ALA ALA A . n 
A 1 141 GLY 141 169 169 GLY GLY A . n 
A 1 142 PHE 142 170 170 PHE PHE A . n 
A 1 143 ASP 143 171 171 ASP ASP A . n 
A 1 144 TRP 144 172 172 TRP TRP A . n 
A 1 145 VAL 145 173 173 VAL VAL A . n 
A 1 146 TYR 146 174 174 TYR TYR A . n 
A 1 147 TYR 147 175 175 TYR TYR A . n 
A 1 148 GLU 148 176 176 GLU GLU A . n 
A 1 149 SER 149 177 177 SER SER A . n 
A 1 150 LYS 150 178 178 LYS LYS A . n 
A 1 151 ALA 151 179 179 ALA ALA A . n 
A 1 152 HIS 152 180 180 HIS HIS A . n 
A 1 153 ILE 153 181 181 ILE ILE A . n 
A 1 154 HIS 154 182 182 HIS HIS A . n 
A 1 155 CYS 155 183 183 CYS CYS A . n 
A 1 156 SER 156 184 184 SER SER A . n 
A 1 157 VAL 157 185 185 VAL VAL A . n 
A 1 158 LYS 158 186 186 LYS LYS A . n 
A 1 159 ALA 159 187 187 ALA ALA A . n 
A 1 160 GLU 160 188 188 GLU GLU A . n 
A 1 161 ASN 161 189 189 ASN ASN A . n 
A 1 162 SER 162 190 190 SER SER A . n 
A 1 163 VAL 163 191 191 VAL VAL A . n 
A 1 164 ALA 164 192 ?   ?   ?   A . n 
A 1 165 ALA 165 193 ?   ?   ?   A . n 
A 1 166 LYS 166 194 ?   ?   ?   A . n 
A 1 167 SER 167 195 ?   ?   ?   A . n 
A 1 168 GLY 168 196 ?   ?   ?   A . n 
A 1 169 GLY 169 197 ?   ?   ?   A . n 
B 2 1   ASP 1   1   1   ASP ASP L . n 
B 2 2   ILE 2   2   2   ILE ILE L . n 
B 2 3   VAL 3   3   3   VAL VAL L . n 
B 2 4   MET 4   4   4   MET MET L . n 
B 2 5   THR 5   5   5   THR THR L . n 
B 2 6   GLN 6   6   6   GLN GLN L . n 
B 2 7   THR 7   7   7   THR THR L . n 
B 2 8   PRO 8   8   8   PRO PRO L . n 
B 2 9   LYS 9   9   9   LYS LYS L . n 
B 2 10  PHE 10  10  10  PHE PHE L . n 
B 2 11  LEU 11  11  11  LEU LEU L . n 
B 2 12  LEU 12  12  12  LEU LEU L . n 
B 2 13  VAL 13  13  13  VAL VAL L . n 
B 2 14  SER 14  14  14  SER SER L . n 
B 2 15  ALA 15  15  15  ALA ALA L . n 
B 2 16  GLY 16  16  16  GLY GLY L . n 
B 2 17  ASP 17  17  17  ASP ASP L . n 
B 2 18  LYS 18  18  18  LYS LYS L . n 
B 2 19  VAL 19  19  19  VAL VAL L . n 
B 2 20  THR 20  20  20  THR THR L . n 
B 2 21  ILE 21  21  21  ILE ILE L . n 
B 2 22  THR 22  22  22  THR THR L . n 
B 2 23  CYS 23  23  23  CYS CYS L . n 
B 2 24  LYS 24  24  24  LYS LYS L . n 
B 2 25  ALA 25  25  25  ALA ALA L . n 
B 2 26  SER 26  26  26  SER SER L . n 
B 2 27  GLN 27  27  27  GLN GLN L . n 
B 2 28  SER 28  28  28  SER SER L . n 
B 2 29  VAL 29  29  29  VAL VAL L . n 
B 2 30  SER 30  30  30  SER SER L . n 
B 2 31  ASN 31  31  31  ASN ASN L . n 
B 2 32  ASP 32  32  32  ASP ASP L . n 
B 2 33  LEU 33  33  33  LEU LEU L . n 
B 2 34  THR 34  34  34  THR THR L . n 
B 2 35  TRP 35  35  35  TRP TRP L . n 
B 2 36  TYR 36  36  36  TYR TYR L . n 
B 2 37  GLN 37  37  37  GLN GLN L . n 
B 2 38  GLN 38  38  38  GLN GLN L . n 
B 2 39  LYS 39  39  39  LYS LYS L . n 
B 2 40  PRO 40  40  40  PRO PRO L . n 
B 2 41  GLY 41  41  41  GLY GLY L . n 
B 2 42  GLN 42  42  42  GLN GLN L . n 
B 2 43  SER 43  43  43  SER SER L . n 
B 2 44  PRO 44  44  44  PRO PRO L . n 
B 2 45  LYS 45  45  45  LYS LYS L . n 
B 2 46  LEU 46  46  46  LEU LEU L . n 
B 2 47  LEU 47  47  47  LEU LEU L . n 
B 2 48  ILE 48  48  48  ILE ILE L . n 
B 2 49  TYR 49  49  49  TYR TYR L . n 
B 2 50  TYR 50  50  50  TYR TYR L . n 
B 2 51  ALA 51  51  51  ALA ALA L . n 
B 2 52  SER 52  52  52  SER SER L . n 
B 2 53  ASN 53  53  53  ASN ASN L . n 
B 2 54  ARG 54  54  54  ARG ARG L . n 
B 2 55  TYR 55  55  55  TYR TYR L . n 
B 2 56  THR 56  56  56  THR THR L . n 
B 2 57  GLY 57  57  57  GLY GLY L . n 
B 2 58  VAL 58  58  58  VAL VAL L . n 
B 2 59  PRO 59  59  59  PRO PRO L . n 
B 2 60  ASP 60  60  60  ASP ASP L . n 
B 2 61  ARG 61  61  61  ARG ARG L . n 
B 2 62  PHE 62  62  62  PHE PHE L . n 
B 2 63  THR 63  63  63  THR THR L . n 
B 2 64  GLY 64  64  64  GLY GLY L . n 
B 2 65  SER 65  65  65  SER SER L . n 
B 2 66  GLY 66  66  66  GLY GLY L . n 
B 2 67  TYR 67  67  67  TYR TYR L . n 
B 2 68  GLY 68  68  68  GLY GLY L . n 
B 2 69  THR 69  69  69  THR THR L . n 
B 2 70  ASP 70  70  70  ASP ASP L . n 
B 2 71  PHE 71  71  71  PHE PHE L . n 
B 2 72  THR 72  72  72  THR THR L . n 
B 2 73  PHE 73  73  73  PHE PHE L . n 
B 2 74  THR 74  74  74  THR THR L . n 
B 2 75  ILE 75  75  75  ILE ILE L . n 
B 2 76  SER 76  76  76  SER SER L . n 
B 2 77  THR 77  77  77  THR THR L . n 
B 2 78  VAL 78  78  78  VAL VAL L . n 
B 2 79  GLN 79  79  79  GLN GLN L . n 
B 2 80  ALA 80  80  80  ALA ALA L . n 
B 2 81  GLU 81  81  81  GLU GLU L . n 
B 2 82  ASP 82  82  82  ASP ASP L . n 
B 2 83  LEU 83  83  83  LEU LEU L . n 
B 2 84  ALA 84  84  84  ALA ALA L . n 
B 2 85  VAL 85  85  85  VAL VAL L . n 
B 2 86  TYR 86  86  86  TYR TYR L . n 
B 2 87  PHE 87  87  87  PHE PHE L . n 
B 2 88  CYS 88  88  88  CYS CYS L . n 
B 2 89  GLN 89  89  89  GLN GLN L . n 
B 2 90  GLN 90  90  90  GLN GLN L . n 
B 2 91  ASP 91  91  91  ASP ASP L . n 
B 2 92  TYR 92  92  92  TYR TYR L . n 
B 2 93  GLY 93  93  93  GLY GLY L . n 
B 2 94  SER 94  94  94  SER SER L . n 
B 2 95  PRO 95  95  95  PRO PRO L . n 
B 2 96  PRO 96  96  96  PRO PRO L . n 
B 2 97  THR 97  97  97  THR THR L . n 
B 2 98  PHE 98  98  98  PHE PHE L . n 
B 2 99  GLY 99  99  99  GLY GLY L . n 
B 2 100 GLY 100 100 100 GLY GLY L . n 
B 2 101 GLY 101 101 101 GLY GLY L . n 
B 2 102 THR 102 102 102 THR THR L . n 
B 2 103 LYS 103 103 103 LYS LYS L . n 
B 2 104 VAL 104 104 104 VAL VAL L . n 
B 2 105 GLU 105 105 105 GLU GLU L . n 
B 2 106 ILE 106 106 106 ILE ILE L . n 
B 2 107 LYS 107 107 107 LYS LYS L . n 
B 2 108 ARG 108 108 108 ARG ARG L . n 
B 2 109 THR 109 109 109 THR THR L . n 
B 2 110 VAL 110 110 110 VAL VAL L . n 
B 2 111 ALA 111 111 111 ALA ALA L . n 
B 2 112 ALA 112 112 112 ALA ALA L . n 
B 2 113 PRO 113 113 113 PRO PRO L . n 
B 2 114 SER 114 114 114 SER SER L . n 
B 2 115 VAL 115 115 115 VAL VAL L . n 
B 2 116 PHE 116 116 116 PHE PHE L . n 
B 2 117 ILE 117 117 117 ILE ILE L . n 
B 2 118 PHE 118 118 118 PHE PHE L . n 
B 2 119 PRO 119 119 119 PRO PRO L . n 
B 2 120 PRO 120 120 120 PRO PRO L . n 
B 2 121 SER 121 121 121 SER SER L . n 
B 2 122 ASP 122 122 122 ASP ASP L . n 
B 2 123 GLU 123 123 123 GLU GLU L . n 
B 2 124 GLN 124 124 124 GLN GLN L . n 
B 2 125 LEU 125 125 125 LEU LEU L . n 
B 2 126 LYS 126 126 126 LYS LYS L . n 
B 2 127 SER 127 127 127 SER SER L . n 
B 2 128 GLY 128 128 128 GLY GLY L . n 
B 2 129 THR 129 129 129 THR THR L . n 
B 2 130 ALA 130 130 130 ALA ALA L . n 
B 2 131 SER 131 131 131 SER SER L . n 
B 2 132 VAL 132 132 132 VAL VAL L . n 
B 2 133 VAL 133 133 133 VAL VAL L . n 
B 2 134 CYS 134 134 134 CYS CYS L . n 
B 2 135 LEU 135 135 135 LEU LEU L . n 
B 2 136 LEU 136 136 136 LEU LEU L . n 
B 2 137 ASN 137 137 137 ASN ASN L . n 
B 2 138 ASN 138 138 138 ASN ASN L . n 
B 2 139 PHE 139 139 139 PHE PHE L . n 
B 2 140 TYR 140 140 140 TYR TYR L . n 
B 2 141 PRO 141 141 141 PRO PRO L . n 
B 2 142 ARG 142 142 142 ARG ARG L . n 
B 2 143 GLU 143 143 143 GLU GLU L . n 
B 2 144 ALA 144 144 144 ALA ALA L . n 
B 2 145 LYS 145 145 145 LYS LYS L . n 
B 2 146 VAL 146 146 146 VAL VAL L . n 
B 2 147 GLN 147 147 147 GLN GLN L . n 
B 2 148 TRP 148 148 148 TRP TRP L . n 
B 2 149 LYS 149 149 149 LYS LYS L . n 
B 2 150 VAL 150 150 150 VAL VAL L . n 
B 2 151 ASP 151 151 151 ASP ASP L . n 
B 2 152 ASN 152 152 152 ASN ASN L . n 
B 2 153 ALA 153 153 153 ALA ALA L . n 
B 2 154 LEU 154 154 154 LEU LEU L . n 
B 2 155 GLN 155 155 155 GLN GLN L . n 
B 2 156 SER 156 156 156 SER SER L . n 
B 2 157 GLY 157 157 157 GLY GLY L . n 
B 2 158 ASN 158 158 158 ASN ASN L . n 
B 2 159 SER 159 159 159 SER SER L . n 
B 2 160 GLN 160 160 160 GLN GLN L . n 
B 2 161 GLU 161 161 161 GLU GLU L . n 
B 2 162 SER 162 162 162 SER SER L . n 
B 2 163 VAL 163 163 163 VAL VAL L . n 
B 2 164 THR 164 164 164 THR THR L . n 
B 2 165 GLU 165 165 165 GLU GLU L . n 
B 2 166 GLN 166 166 166 GLN GLN L . n 
B 2 167 ASP 167 167 167 ASP ASP L . n 
B 2 168 SER 168 168 168 SER SER L . n 
B 2 169 LYS 169 169 169 LYS LYS L . n 
B 2 170 ASP 170 170 170 ASP ASP L . n 
B 2 171 SER 171 171 171 SER SER L . n 
B 2 172 THR 172 172 172 THR THR L . n 
B 2 173 TYR 173 173 173 TYR TYR L . n 
B 2 174 SER 174 174 174 SER SER L . n 
B 2 175 LEU 175 175 175 LEU LEU L . n 
B 2 176 SER 176 176 176 SER SER L . n 
B 2 177 SER 177 177 177 SER SER L . n 
B 2 178 THR 178 178 178 THR THR L . n 
B 2 179 LEU 179 179 179 LEU LEU L . n 
B 2 180 THR 180 180 180 THR THR L . n 
B 2 181 LEU 181 181 181 LEU LEU L . n 
B 2 182 SER 182 182 182 SER SER L . n 
B 2 183 LYS 183 183 183 LYS LYS L . n 
B 2 184 ALA 184 184 184 ALA ALA L . n 
B 2 185 ASP 185 185 185 ASP ASP L . n 
B 2 186 TYR 186 186 186 TYR TYR L . n 
B 2 187 GLU 187 187 187 GLU GLU L . n 
B 2 188 LYS 188 188 188 LYS LYS L . n 
B 2 189 HIS 189 189 189 HIS HIS L . n 
B 2 190 LYS 190 190 190 LYS LYS L . n 
B 2 191 VAL 191 191 191 VAL VAL L . n 
B 2 192 TYR 192 192 192 TYR TYR L . n 
B 2 193 ALA 193 193 193 ALA ALA L . n 
B 2 194 CYS 194 194 194 CYS CYS L . n 
B 2 195 GLU 195 195 195 GLU GLU L . n 
B 2 196 VAL 196 196 196 VAL VAL L . n 
B 2 197 THR 197 197 197 THR THR L . n 
B 2 198 HIS 198 198 198 HIS HIS L . n 
B 2 199 GLN 199 199 199 GLN GLN L . n 
B 2 200 GLY 200 200 200 GLY GLY L . n 
B 2 201 LEU 201 201 201 LEU LEU L . n 
B 2 202 SER 202 202 202 SER SER L . n 
B 2 203 SER 203 203 203 SER SER L . n 
B 2 204 PRO 204 204 204 PRO PRO L . n 
B 2 205 VAL 205 205 205 VAL VAL L . n 
B 2 206 THR 206 206 206 THR THR L . n 
B 2 207 LYS 207 207 207 LYS LYS L . n 
B 2 208 SER 208 208 208 SER SER L . n 
B 2 209 PHE 209 209 209 PHE PHE L . n 
B 2 210 ASN 210 210 210 ASN ASN L . n 
B 2 211 ARG 211 211 211 ARG ARG L . n 
B 2 212 GLY 212 212 212 GLY GLY L . n 
B 2 213 GLU 213 213 ?   ?   ?   L . n 
B 2 214 CYS 214 214 ?   ?   ?   L . n 
C 3 1   GLN 1   1   1   GLN GLN H . n 
C 3 2   VAL 2   2   2   VAL VAL H . n 
C 3 3   GLN 3   3   3   GLN GLN H . n 
C 3 4   LEU 4   4   4   LEU LEU H . n 
C 3 5   GLN 5   5   5   GLN GLN H . n 
C 3 6   GLN 6   6   6   GLN GLN H . n 
C 3 7   SER 7   7   7   SER SER H . n 
C 3 8   GLY 8   8   8   GLY GLY H . n 
C 3 9   PRO 9   9   9   PRO PRO H . n 
C 3 10  GLU 10  10  10  GLU GLU H . n 
C 3 11  LEU 11  11  11  LEU LEU H . n 
C 3 12  VAL 12  12  12  VAL VAL H . n 
C 3 13  ARG 13  13  13  ARG ARG H . n 
C 3 14  PRO 14  14  14  PRO PRO H . n 
C 3 15  GLY 15  15  15  GLY GLY H . n 
C 3 16  VAL 16  16  16  VAL VAL H . n 
C 3 17  SER 17  17  17  SER SER H . n 
C 3 18  VAL 18  18  18  VAL VAL H . n 
C 3 19  LYS 19  19  19  LYS LYS H . n 
C 3 20  ILE 20  20  20  ILE ILE H . n 
C 3 21  SER 21  21  21  SER SER H . n 
C 3 22  CYS 22  22  22  CYS CYS H . n 
C 3 23  LYS 23  23  23  LYS LYS H . n 
C 3 24  GLY 24  24  24  GLY GLY H . n 
C 3 25  SER 25  25  25  SER SER H . n 
C 3 26  GLY 26  26  26  GLY GLY H . n 
C 3 27  TYR 27  27  27  TYR TYR H . n 
C 3 28  THR 28  28  28  THR THR H . n 
C 3 29  PHE 29  29  29  PHE PHE H . n 
C 3 30  ILE 30  30  30  ILE ILE H . n 
C 3 31  ASP 31  31  31  ASP ASP H . n 
C 3 32  GLU 32  32  32  GLU GLU H . n 
C 3 33  ALA 33  33  33  ALA ALA H . n 
C 3 34  LEU 34  34  34  LEU LEU H . n 
C 3 35  HIS 35  35  35  HIS HIS H . n 
C 3 36  TRP 36  36  36  TRP TRP H . n 
C 3 37  VAL 37  37  37  VAL VAL H . n 
C 3 38  LYS 38  38  38  LYS LYS H . n 
C 3 39  GLN 39  39  39  GLN GLN H . n 
C 3 40  SER 40  40  40  SER SER H . n 
C 3 41  HIS 41  41  41  HIS HIS H . n 
C 3 42  ALA 42  42  42  ALA ALA H . n 
C 3 43  GLU 43  43  43  GLU GLU H . n 
C 3 44  SER 44  44  44  SER SER H . n 
C 3 45  LEU 45  45  45  LEU LEU H . n 
C 3 46  GLU 46  46  46  GLU GLU H . n 
C 3 47  TRP 47  47  47  TRP TRP H . n 
C 3 48  ILE 48  48  48  ILE ILE H . n 
C 3 49  GLY 49  49  49  GLY GLY H . n 
C 3 50  VAL 50  50  50  VAL VAL H . n 
C 3 51  ILE 51  51  51  ILE ILE H . n 
C 3 52  ARG 52  52  52  ARG ARG H . n 
C 3 53  PRO 53  53  53  PRO PRO H . n 
C 3 54  TYR 54  54  54  TYR TYR H . n 
C 3 55  SER 55  55  55  SER SER H . n 
C 3 56  GLY 56  55  55  GLY GLY H A n 
C 3 57  GLU 57  56  56  GLU GLU H . n 
C 3 58  THR 58  57  57  THR THR H . n 
C 3 59  ASN 59  58  58  ASN ASN H . n 
C 3 60  TYR 60  59  59  TYR TYR H . n 
C 3 61  ASN 61  60  60  ASN ASN H . n 
C 3 62  GLN 62  61  61  GLN GLN H . n 
C 3 63  LYS 63  62  62  LYS LYS H . n 
C 3 64  PHE 64  63  63  PHE PHE H . n 
C 3 65  LYS 65  64  64  LYS LYS H . n 
C 3 66  ASP 66  65  65  ASP ASP H . n 
C 3 67  LYS 67  66  66  LYS LYS H . n 
C 3 68  ALA 68  67  67  ALA ALA H . n 
C 3 69  THR 69  68  68  THR THR H . n 
C 3 70  MET 70  69  69  MET MET H . n 
C 3 71  THR 71  70  70  THR THR H . n 
C 3 72  VAL 72  71  71  VAL VAL H . n 
C 3 73  ASP 73  72  72  ASP ASP H . n 
C 3 74  ILE 74  73  73  ILE ILE H . n 
C 3 75  SER 75  74  74  SER SER H . n 
C 3 76  SER 76  75  75  SER SER H . n 
C 3 77  SER 77  76  76  SER SER H . n 
C 3 78  THR 78  77  77  THR THR H . n 
C 3 79  ALA 79  78  78  ALA ALA H . n 
C 3 80  TYR 80  79  79  TYR TYR H . n 
C 3 81  LEU 81  80  80  LEU LEU H . n 
C 3 82  GLU 82  81  81  GLU GLU H . n 
C 3 83  LEU 83  82  82  LEU LEU H . n 
C 3 84  ALA 84  82  82  ALA ALA H A n 
C 3 85  ARG 85  82  82  ARG ARG H B n 
C 3 86  LEU 86  82  82  LEU LEU H C n 
C 3 87  THR 87  83  83  THR THR H . n 
C 3 88  SER 88  84  84  SER SER H . n 
C 3 89  GLU 89  85  85  GLU GLU H . n 
C 3 90  ASP 90  86  86  ASP ASP H . n 
C 3 91  SER 91  87  87  SER SER H . n 
C 3 92  ALA 92  88  88  ALA ALA H . n 
C 3 93  ILE 93  89  89  ILE ILE H . n 
C 3 94  TYR 94  90  90  TYR TYR H . n 
C 3 95  TYR 95  91  91  TYR TYR H . n 
C 3 96  CYS 96  92  92  CYS CYS H . n 
C 3 97  ALA 97  93  93  ALA ALA H . n 
C 3 98  ARG 98  94  94  ARG ARG H . n 
C 3 99  ASP 99  95  95  ASP ASP H . n 
C 3 100 TRP 100 96  96  TRP TRP H . n 
C 3 101 GLU 101 97  97  GLU GLU H . n 
C 3 102 ARG 102 98  98  ARG ARG H . n 
C 3 103 GLY 103 99  99  GLY GLY H . n 
C 3 104 ASP 104 100 100 ASP ASP H . n 
C 3 105 PHE 105 100 100 PHE PHE H A n 
C 3 106 PHE 106 100 100 PHE PHE H K n 
C 3 107 ASP 107 101 101 ASP ASP H . n 
C 3 108 TYR 108 102 102 TYR TYR H . n 
C 3 109 TRP 109 103 103 TRP TRP H . n 
C 3 110 GLY 110 104 104 GLY GLY H . n 
C 3 111 GLN 111 105 105 GLN GLN H . n 
C 3 112 GLY 112 106 106 GLY GLY H . n 
C 3 113 THR 113 107 107 THR THR H . n 
C 3 114 LEU 114 108 108 LEU LEU H . n 
C 3 115 VAL 115 109 109 VAL VAL H . n 
C 3 116 THR 116 110 110 THR THR H . n 
C 3 117 VAL 117 111 111 VAL VAL H . n 
C 3 118 SER 118 112 112 SER SER H . n 
C 3 119 SER 119 113 113 SER SER H . n 
C 3 120 ALA 120 114 114 ALA ALA H . n 
C 3 121 SER 121 115 115 SER SER H . n 
C 3 122 THR 122 116 116 THR THR H . n 
C 3 123 LYS 123 117 117 LYS LYS H . n 
C 3 124 GLY 124 118 118 GLY GLY H . n 
C 3 125 PRO 125 119 119 PRO PRO H . n 
C 3 126 SER 126 120 120 SER SER H . n 
C 3 127 VAL 127 121 121 VAL VAL H . n 
C 3 128 PHE 128 122 122 PHE PHE H . n 
C 3 129 PRO 129 123 123 PRO PRO H . n 
C 3 130 LEU 130 124 124 LEU LEU H . n 
C 3 131 ALA 131 125 125 ALA ALA H . n 
C 3 132 PRO 132 126 126 PRO PRO H . n 
C 3 133 SER 133 127 127 SER SER H . n 
C 3 134 SER 134 128 128 SER SER H . n 
C 3 135 LYS 135 129 129 LYS LYS H . n 
C 3 136 SER 136 130 130 SER SER H . n 
C 3 137 THR 137 131 131 THR THR H . n 
C 3 138 SER 138 132 132 SER SER H . n 
C 3 139 GLY 139 133 133 GLY GLY H . n 
C 3 140 GLY 140 134 134 GLY GLY H . n 
C 3 141 THR 141 135 135 THR THR H . n 
C 3 142 ALA 142 136 136 ALA ALA H . n 
C 3 143 ALA 143 137 137 ALA ALA H . n 
C 3 144 LEU 144 138 138 LEU LEU H . n 
C 3 145 GLY 145 139 139 GLY GLY H . n 
C 3 146 CYS 146 140 140 CYS CYS H . n 
C 3 147 LEU 147 141 141 LEU LEU H . n 
C 3 148 VAL 148 142 142 VAL VAL H . n 
C 3 149 LYS 149 143 143 LYS LYS H . n 
C 3 150 ASP 150 144 144 ASP ASP H . n 
C 3 151 TYR 151 145 145 TYR TYR H . n 
C 3 152 PHE 152 146 146 PHE PHE H . n 
C 3 153 PRO 153 147 147 PRO PRO H . n 
C 3 154 GLU 154 148 148 GLU GLU H . n 
C 3 155 PRO 155 149 149 PRO PRO H . n 
C 3 156 VAL 156 150 150 VAL VAL H . n 
C 3 157 THR 157 151 151 THR THR H . n 
C 3 158 VAL 158 152 152 VAL VAL H . n 
C 3 159 SER 159 153 153 SER SER H . n 
C 3 160 TRP 160 154 154 TRP TRP H . n 
C 3 161 ASN 161 155 155 ASN ASN H . n 
C 3 162 SER 162 156 156 SER SER H . n 
C 3 163 GLY 163 157 157 GLY GLY H . n 
C 3 164 ALA 164 158 158 ALA ALA H . n 
C 3 165 LEU 165 159 159 LEU LEU H . n 
C 3 166 THR 166 160 160 THR THR H . n 
C 3 167 SER 167 161 161 SER SER H . n 
C 3 168 GLY 168 162 162 GLY GLY H . n 
C 3 169 VAL 169 163 163 VAL VAL H . n 
C 3 170 HIS 170 164 164 HIS HIS H . n 
C 3 171 THR 171 165 165 THR THR H . n 
C 3 172 PHE 172 166 166 PHE PHE H . n 
C 3 173 PRO 173 167 167 PRO PRO H . n 
C 3 174 ALA 174 168 168 ALA ALA H . n 
C 3 175 VAL 175 169 169 VAL VAL H . n 
C 3 176 LEU 176 170 170 LEU LEU H . n 
C 3 177 GLN 177 171 171 GLN GLN H . n 
C 3 178 SER 178 172 172 SER SER H . n 
C 3 179 SER 179 173 173 SER SER H . n 
C 3 180 GLY 180 174 174 GLY GLY H . n 
C 3 181 LEU 181 175 175 LEU LEU H . n 
C 3 182 TYR 182 176 176 TYR TYR H . n 
C 3 183 SER 183 177 177 SER SER H . n 
C 3 184 LEU 184 178 178 LEU LEU H . n 
C 3 185 SER 185 179 179 SER SER H . n 
C 3 186 SER 186 180 180 SER SER H . n 
C 3 187 VAL 187 181 181 VAL VAL H . n 
C 3 188 VAL 188 182 182 VAL VAL H . n 
C 3 189 THR 189 183 183 THR THR H . n 
C 3 190 VAL 190 184 184 VAL VAL H . n 
C 3 191 PRO 191 185 185 PRO PRO H . n 
C 3 192 SER 192 186 186 SER SER H . n 
C 3 193 SER 193 187 187 SER SER H . n 
C 3 194 SER 194 188 188 SER SER H . n 
C 3 195 LEU 195 189 189 LEU LEU H . n 
C 3 196 GLY 196 190 190 GLY GLY H . n 
C 3 197 THR 197 191 191 THR THR H . n 
C 3 198 GLN 198 192 192 GLN GLN H . n 
C 3 199 THR 199 193 193 THR THR H . n 
C 3 200 TYR 200 194 194 TYR TYR H . n 
C 3 201 ILE 201 195 195 ILE ILE H . n 
C 3 202 CYS 202 196 196 CYS CYS H . n 
C 3 203 ASN 203 197 197 ASN ASN H . n 
C 3 204 VAL 204 198 198 VAL VAL H . n 
C 3 205 ASN 205 199 199 ASN ASN H . n 
C 3 206 HIS 206 200 200 HIS HIS H . n 
C 3 207 LYS 207 201 201 LYS LYS H . n 
C 3 208 PRO 208 202 202 PRO PRO H . n 
C 3 209 SER 209 203 203 SER SER H . n 
C 3 210 ASN 210 204 204 ASN ASN H . n 
C 3 211 THR 211 205 205 THR THR H . n 
C 3 212 LYS 212 206 206 LYS LYS H . n 
C 3 213 VAL 213 207 207 VAL VAL H . n 
C 3 214 ASP 214 208 208 ASP ASP H . n 
C 3 215 LYS 215 209 209 LYS LYS H . n 
C 3 216 LYS 216 210 210 LYS LYS H . n 
C 3 217 VAL 217 211 211 VAL VAL H . n 
C 3 218 GLU 218 212 212 GLU GLU H . n 
C 3 219 PRO 219 213 213 PRO PRO H . n 
C 3 220 LYS 220 214 214 LYS ALA H . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6090  ? 
1 MORE         -112  ? 
1 'SSA (A^2)'  25180 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? J HOH .   ? A HOH 334 ? 1_555 ZN ? D ZN . ? A ZN 400 ? 1_555 OD1 ? A ASP 119 ? A ASP 147 ? 1_555 111.8 ? 
2  O   ? J HOH .   ? A HOH 334 ? 1_555 ZN ? D ZN . ? A ZN 400 ? 1_555 NE2 ? A HIS 112 ? A HIS 140 ? 1_555 112.6 ? 
3  OD1 ? A ASP 119 ? A ASP 147 ? 1_555 ZN ? D ZN . ? A ZN 400 ? 1_555 NE2 ? A HIS 112 ? A HIS 140 ? 1_555 105.7 ? 
4  O   ? J HOH .   ? A HOH 334 ? 1_555 ZN ? D ZN . ? A ZN 400 ? 1_555 ND1 ? A HIS 154 ? A HIS 182 ? 1_555 109.5 ? 
5  OD1 ? A ASP 119 ? A ASP 147 ? 1_555 ZN ? D ZN . ? A ZN 400 ? 1_555 ND1 ? A HIS 154 ? A HIS 182 ? 1_555 110.4 ? 
6  NE2 ? A HIS 112 ? A HIS 140 ? 1_555 ZN ? D ZN . ? A ZN 400 ? 1_555 ND1 ? A HIS 154 ? A HIS 182 ? 1_555 106.8 ? 
7  O   ? J HOH .   ? A HOH 373 ? 1_555 CA ? F CA . ? A CA 402 ? 1_555 OD1 ? A ASP 101 ? A ASP 129 ? 1_555 97.8  ? 
8  O   ? J HOH .   ? A HOH 373 ? 1_555 CA ? F CA . ? A CA 402 ? 1_555 OD2 ? A ASP 103 ? A ASP 131 ? 1_555 125.5 ? 
9  OD1 ? A ASP 101 ? A ASP 129 ? 1_555 CA ? F CA . ? A CA 402 ? 1_555 OD2 ? A ASP 103 ? A ASP 131 ? 1_555 78.3  ? 
10 O   ? J HOH .   ? A HOH 373 ? 1_555 CA ? F CA . ? A CA 402 ? 1_555 OE2 ? A GLU 62  ? A GLU 90  ? 1_555 77.5  ? 
11 OD1 ? A ASP 101 ? A ASP 129 ? 1_555 CA ? F CA . ? A CA 402 ? 1_555 OE2 ? A GLU 62  ? A GLU 90  ? 1_555 154.3 ? 
12 OD2 ? A ASP 103 ? A ASP 131 ? 1_555 CA ? F CA . ? A CA 402 ? 1_555 OE2 ? A GLU 62  ? A GLU 90  ? 1_555 84.0  ? 
13 O   ? J HOH .   ? A HOH 373 ? 1_555 CA ? F CA . ? A CA 402 ? 1_555 OE1 ? A GLU 98  ? A GLU 126 ? 1_555 85.0  ? 
14 OD1 ? A ASP 101 ? A ASP 129 ? 1_555 CA ? F CA . ? A CA 402 ? 1_555 OE1 ? A GLU 98  ? A GLU 126 ? 1_555 84.1  ? 
15 OD2 ? A ASP 103 ? A ASP 131 ? 1_555 CA ? F CA . ? A CA 402 ? 1_555 OE1 ? A GLU 98  ? A GLU 126 ? 1_555 146.3 ? 
16 OE2 ? A GLU 62  ? A GLU 90  ? 1_555 CA ? F CA . ? A CA 402 ? 1_555 OE1 ? A GLU 98  ? A GLU 126 ? 1_555 120.1 ? 
17 O   ? J HOH .   ? A HOH 373 ? 1_555 CA ? F CA . ? A CA 402 ? 1_555 OE2 ? A GLU 98  ? A GLU 126 ? 1_555 78.3  ? 
18 OD1 ? A ASP 101 ? A ASP 129 ? 1_555 CA ? F CA . ? A CA 402 ? 1_555 OE2 ? A GLU 98  ? A GLU 126 ? 1_555 139.5 ? 
19 OD2 ? A ASP 103 ? A ASP 131 ? 1_555 CA ? F CA . ? A CA 402 ? 1_555 OE2 ? A GLU 98  ? A GLU 126 ? 1_555 136.6 ? 
20 OE2 ? A GLU 62  ? A GLU 90  ? 1_555 CA ? F CA . ? A CA 402 ? 1_555 OE2 ? A GLU 98  ? A GLU 126 ? 1_555 65.0  ? 
21 OE1 ? A GLU 98  ? A GLU 126 ? 1_555 CA ? F CA . ? A CA 402 ? 1_555 OE2 ? A GLU 98  ? A GLU 126 ? 1_555 55.4  ? 
22 OE2 ? A GLU 98  ? A GLU 126 ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OE2 ? A GLU 61  ? A GLU 89  ? 1_555 87.6  ? 
23 OE2 ? A GLU 98  ? A GLU 126 ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OD2 ? A ASP 67  ? A ASP 95  ? 1_555 134.0 ? 
24 OE2 ? A GLU 61  ? A GLU 89  ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OD2 ? A ASP 67  ? A ASP 95  ? 1_555 138.3 ? 
25 OE2 ? A GLU 98  ? A GLU 126 ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 O   ? A THR 97  ? A THR 125 ? 1_555 85.8  ? 
26 OE2 ? A GLU 61  ? A GLU 89  ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 O   ? A THR 97  ? A THR 125 ? 1_555 105.7 ? 
27 OD2 ? A ASP 67  ? A ASP 95  ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 O   ? A THR 97  ? A THR 125 ? 1_555 78.9  ? 
28 OE2 ? A GLU 98  ? A GLU 126 ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OE2 ? A GLU 62  ? A GLU 90  ? 1_555 64.7  ? 
29 OE2 ? A GLU 61  ? A GLU 89  ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OE2 ? A GLU 62  ? A GLU 90  ? 1_555 78.6  ? 
30 OD2 ? A ASP 67  ? A ASP 95  ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OE2 ? A GLU 62  ? A GLU 90  ? 1_555 118.0 ? 
31 O   ? A THR 97  ? A THR 125 ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OE2 ? A GLU 62  ? A GLU 90  ? 1_555 150.2 ? 
32 OE2 ? A GLU 98  ? A GLU 126 ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OE1 ? A GLU 61  ? A GLU 89  ? 1_555 138.9 ? 
33 OE2 ? A GLU 61  ? A GLU 89  ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OE1 ? A GLU 61  ? A GLU 89  ? 1_555 54.1  ? 
34 OD2 ? A ASP 67  ? A ASP 95  ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OE1 ? A GLU 61  ? A GLU 89  ? 1_555 84.9  ? 
35 O   ? A THR 97  ? A THR 125 ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OE1 ? A GLU 61  ? A GLU 89  ? 1_555 90.6  ? 
36 OE2 ? A GLU 62  ? A GLU 90  ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OE1 ? A GLU 61  ? A GLU 89  ? 1_555 114.1 ? 
37 OE2 ? A GLU 98  ? A GLU 126 ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OD1 ? A ASP 67  ? A ASP 95  ? 1_555 83.2  ? 
38 OE2 ? A GLU 61  ? A GLU 89  ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OD1 ? A ASP 67  ? A ASP 95  ? 1_555 162.1 ? 
39 OD2 ? A ASP 67  ? A ASP 95  ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OD1 ? A ASP 67  ? A ASP 95  ? 1_555 53.6  ? 
40 O   ? A THR 97  ? A THR 125 ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OD1 ? A ASP 67  ? A ASP 95  ? 1_555 88.9  ? 
41 OE2 ? A GLU 62  ? A GLU 90  ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OD1 ? A ASP 67  ? A ASP 95  ? 1_555 83.6  ? 
42 OE1 ? A GLU 61  ? A GLU 89  ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OD1 ? A ASP 67  ? A ASP 95  ? 1_555 137.8 ? 
43 OE2 ? A GLU 98  ? A GLU 126 ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OE1 ? A GLU 62  ? A GLU 90  ? 1_555 117.9 ? 
44 OE2 ? A GLU 61  ? A GLU 89  ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OE1 ? A GLU 62  ? A GLU 90  ? 1_555 83.2  ? 
45 OD2 ? A ASP 67  ? A ASP 95  ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OE1 ? A GLU 62  ? A GLU 90  ? 1_555 79.5  ? 
46 O   ? A THR 97  ? A THR 125 ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OE1 ? A GLU 62  ? A GLU 90  ? 1_555 155.4 ? 
47 OE2 ? A GLU 62  ? A GLU 90  ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OE1 ? A GLU 62  ? A GLU 90  ? 1_555 53.3  ? 
48 OE1 ? A GLU 61  ? A GLU 89  ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OE1 ? A GLU 62  ? A GLU 90  ? 1_555 75.9  ? 
49 OD1 ? A ASP 67  ? A ASP 95  ? 1_555 CA ? E CA . ? A CA 401 ? 1_555 OE1 ? A GLU 62  ? A GLU 90  ? 1_555 87.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-05-26 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Refinement description'    
3 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined -15.2285 -20.1223 27.7473 -0.0885 -0.0341 -0.0850 0.0076  -0.0083 0.0099  0.6129 1.1798 1.9387 
0.0667  0.1683  -0.0410 0.0018  0.0176  -0.0194 -0.0258 -0.0547 0.0564  0.0888  -0.0582 -0.1463 
'X-RAY DIFFRACTION' 2 ? refined -11.8841 -24.7752 -5.6774 -0.0948 -0.0339 -0.0689 -0.0061 -0.0112 -0.0317 0.6747 0.9126 0.9875 
-0.1009 -0.2443 -0.0677 -0.0004 -0.0341 0.0345  0.1492  -0.0604 -0.0153 -0.1818 0.0127  -0.0698 
'X-RAY DIFFRACTION' 3 ? refined -0.6430  -13.8967 50.9946 -0.1240 -0.0976 -0.0793 -0.0096 -0.0231 0.0460  2.2798 2.4476 1.4423 
-0.2440 -0.2211 -0.5494 0.0077  -0.1018 0.0940  -0.0167 0.0384  -0.3257 0.0704  -0.1118 0.1031  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 L 1   L 107 ? . . . . ? 
'X-RAY DIFFRACTION' 2 1 H 1   H 110 ? . . . . ? 
'X-RAY DIFFRACTION' 3 2 L 108 L 212 ? . . . . ? 
'X-RAY DIFFRACTION' 4 2 H 111 H 214 ? . . . . ? 
'X-RAY DIFFRACTION' 5 3 A 39  A 191 ? . . . . ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
BOS      'data collection' .        ? 1 
PHASER   phasing           .        ? 2 
REFMAC   refinement        5.2.0019 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE1 A GLU 142 ? ? O A HOH 313 ? ? 2.01 
2 1 O   L HOH 263 ? ? O L HOH 411 ? ? 2.09 
3 1 O   L HOH 280 ? ? O L HOH 462 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O L HOH 462 ? ? 1_555 O H HOH 231 ? ? 4_445 1.40 
2 1 O A HOH 266 ? ? 1_555 O H HOH 461 ? ? 3_555 1.94 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 58  ? ? -110.48 -118.48 
2 1 HIS A 133 ? ? -92.06  32.92   
3 1 SER L 30  ? ? 49.93   -125.48 
4 1 ALA L 51  ? ? 69.56   -35.04  
5 1 ALA L 84  ? ? 179.33  167.47  
6 1 SER H 40  ? ? -99.05  -136.24 
7 1 SER H 44  ? ? -14.61  -93.73  
8 1 ASP H 144 ? ? 69.46   62.77   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   PHE 
_pdbx_validate_peptide_omega.auth_asym_id_1   H 
_pdbx_validate_peptide_omega.auth_seq_id_1    100 
_pdbx_validate_peptide_omega.PDB_ins_code_1   A 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   PHE 
_pdbx_validate_peptide_omega.auth_asym_id_2   H 
_pdbx_validate_peptide_omega.auth_seq_id_2    100 
_pdbx_validate_peptide_omega.PDB_ins_code_2   K 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -149.42 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 H LYS 214 ? CG ? C LYS 220 CG 
2 1 Y 1 H LYS 214 ? CD ? C LYS 220 CD 
3 1 Y 1 H LYS 214 ? CE ? C LYS 220 CE 
4 1 Y 1 H LYS 214 ? NZ ? C LYS 220 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 29  ? A GLY 1   
2  1 Y 1 A PHE 30  ? A PHE 2   
3  1 Y 1 A GLY 31  ? A GLY 3   
4  1 Y 1 A LYS 32  ? A LYS 4   
5  1 Y 1 A ARG 33  ? A ARG 5   
6  1 Y 1 A ARG 34  ? A ARG 6   
7  1 Y 1 A HIS 35  ? A HIS 7   
8  1 Y 1 A PRO 36  ? A PRO 8   
9  1 Y 1 A LYS 37  ? A LYS 9   
10 1 Y 1 A LYS 38  ? A LYS 10  
11 1 Y 1 A ALA 192 ? A ALA 164 
12 1 Y 1 A ALA 193 ? A ALA 165 
13 1 Y 1 A LYS 194 ? A LYS 166 
14 1 Y 1 A SER 195 ? A SER 167 
15 1 Y 1 A GLY 196 ? A GLY 168 
16 1 Y 1 A GLY 197 ? A GLY 169 
17 1 Y 1 L GLU 213 ? B GLU 213 
18 1 Y 1 L CYS 214 ? B CYS 214 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION'    ZN  
5 'CALCIUM ION' CA  
6 'SULFATE ION' SO4 
7 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 ZN  1   400 400 ZN  ZN  A . 
E 5 CA  1   401 401 CA  CA  A . 
F 5 CA  1   402 402 CA  CA  A . 
G 6 SO4 1   1   1   SO4 SO4 A . 
H 6 SO4 1   3   3   SO4 SO4 A . 
I 6 SO4 1   215 4   SO4 SO4 L . 
J 7 HOH 1   5   5   HOH HOH A . 
J 7 HOH 2   6   6   HOH HOH A . 
J 7 HOH 3   7   7   HOH HOH A . 
J 7 HOH 4   8   8   HOH HOH A . 
J 7 HOH 5   12  12  HOH HOH A . 
J 7 HOH 6   14  14  HOH HOH A . 
J 7 HOH 7   21  21  HOH HOH A . 
J 7 HOH 8   23  23  HOH HOH A . 
J 7 HOH 9   27  27  HOH HOH A . 
J 7 HOH 10  198 37  HOH HOH A . 
J 7 HOH 11  199 199 HOH HOH A . 
J 7 HOH 12  200 42  HOH HOH A . 
J 7 HOH 13  201 201 HOH HOH A . 
J 7 HOH 14  202 50  HOH HOH A . 
J 7 HOH 15  203 203 HOH HOH A . 
J 7 HOH 16  204 57  HOH HOH A . 
J 7 HOH 17  205 205 HOH HOH A . 
J 7 HOH 18  206 206 HOH HOH A . 
J 7 HOH 19  207 207 HOH HOH A . 
J 7 HOH 20  208 58  HOH HOH A . 
J 7 HOH 21  209 65  HOH HOH A . 
J 7 HOH 22  210 67  HOH HOH A . 
J 7 HOH 23  211 69  HOH HOH A . 
J 7 HOH 24  212 71  HOH HOH A . 
J 7 HOH 25  213 75  HOH HOH A . 
J 7 HOH 26  214 78  HOH HOH A . 
J 7 HOH 27  215 79  HOH HOH A . 
J 7 HOH 28  216 216 HOH HOH A . 
J 7 HOH 29  217 83  HOH HOH A . 
J 7 HOH 30  218 84  HOH HOH A . 
J 7 HOH 31  219 87  HOH HOH A . 
J 7 HOH 32  220 88  HOH HOH A . 
J 7 HOH 33  221 221 HOH HOH A . 
J 7 HOH 34  222 222 HOH HOH A . 
J 7 HOH 35  223 92  HOH HOH A . 
J 7 HOH 36  224 224 HOH HOH A . 
J 7 HOH 37  225 225 HOH HOH A . 
J 7 HOH 38  226 93  HOH HOH A . 
J 7 HOH 39  227 99  HOH HOH A . 
J 7 HOH 40  228 102 HOH HOH A . 
J 7 HOH 41  229 229 HOH HOH A . 
J 7 HOH 42  230 230 HOH HOH A . 
J 7 HOH 43  231 104 HOH HOH A . 
J 7 HOH 44  232 232 HOH HOH A . 
J 7 HOH 45  233 105 HOH HOH A . 
J 7 HOH 46  234 234 HOH HOH A . 
J 7 HOH 47  235 235 HOH HOH A . 
J 7 HOH 48  236 107 HOH HOH A . 
J 7 HOH 49  237 109 HOH HOH A . 
J 7 HOH 50  238 111 HOH HOH A . 
J 7 HOH 51  239 239 HOH HOH A . 
J 7 HOH 52  240 117 HOH HOH A . 
J 7 HOH 53  241 120 HOH HOH A . 
J 7 HOH 54  242 242 HOH HOH A . 
J 7 HOH 55  243 124 HOH HOH A . 
J 7 HOH 56  244 132 HOH HOH A . 
J 7 HOH 57  245 135 HOH HOH A . 
J 7 HOH 58  246 136 HOH HOH A . 
J 7 HOH 59  247 141 HOH HOH A . 
J 7 HOH 60  248 142 HOH HOH A . 
J 7 HOH 61  249 150 HOH HOH A . 
J 7 HOH 62  250 250 HOH HOH A . 
J 7 HOH 63  251 251 HOH HOH A . 
J 7 HOH 64  252 152 HOH HOH A . 
J 7 HOH 65  253 153 HOH HOH A . 
J 7 HOH 66  254 155 HOH HOH A . 
J 7 HOH 67  255 156 HOH HOH A . 
J 7 HOH 68  256 157 HOH HOH A . 
J 7 HOH 69  257 170 HOH HOH A . 
J 7 HOH 70  258 172 HOH HOH A . 
J 7 HOH 71  259 176 HOH HOH A . 
J 7 HOH 72  260 181 HOH HOH A . 
J 7 HOH 73  261 184 HOH HOH A . 
J 7 HOH 74  262 185 HOH HOH A . 
J 7 HOH 75  263 186 HOH HOH A . 
J 7 HOH 76  264 187 HOH HOH A . 
J 7 HOH 77  265 188 HOH HOH A . 
J 7 HOH 78  266 191 HOH HOH A . 
J 7 HOH 79  267 192 HOH HOH A . 
J 7 HOH 80  268 193 HOH HOH A . 
J 7 HOH 81  269 195 HOH HOH A . 
J 7 HOH 82  270 197 HOH HOH A . 
J 7 HOH 83  301 301 HOH HOH A . 
J 7 HOH 84  302 302 HOH HOH A . 
J 7 HOH 85  303 303 HOH HOH A . 
J 7 HOH 86  304 304 HOH HOH A . 
J 7 HOH 87  305 305 HOH HOH A . 
J 7 HOH 88  306 306 HOH HOH A . 
J 7 HOH 89  307 307 HOH HOH A . 
J 7 HOH 90  308 308 HOH HOH A . 
J 7 HOH 91  309 309 HOH HOH A . 
J 7 HOH 92  311 311 HOH HOH A . 
J 7 HOH 93  312 312 HOH HOH A . 
J 7 HOH 94  313 313 HOH HOH A . 
J 7 HOH 95  314 314 HOH HOH A . 
J 7 HOH 96  315 315 HOH HOH A . 
J 7 HOH 97  316 316 HOH HOH A . 
J 7 HOH 98  317 317 HOH HOH A . 
J 7 HOH 99  320 320 HOH HOH A . 
J 7 HOH 100 331 331 HOH HOH A . 
J 7 HOH 101 332 332 HOH HOH A . 
J 7 HOH 102 333 333 HOH HOH A . 
J 7 HOH 103 334 334 HOH HOH A . 
J 7 HOH 104 335 335 HOH HOH A . 
J 7 HOH 105 336 336 HOH HOH A . 
J 7 HOH 106 337 337 HOH HOH A . 
J 7 HOH 107 338 338 HOH HOH A . 
J 7 HOH 108 339 339 HOH HOH A . 
J 7 HOH 109 340 340 HOH HOH A . 
J 7 HOH 110 349 349 HOH HOH A . 
J 7 HOH 111 350 350 HOH HOH A . 
J 7 HOH 112 351 351 HOH HOH A . 
J 7 HOH 113 352 352 HOH HOH A . 
J 7 HOH 114 371 371 HOH HOH A . 
J 7 HOH 115 373 373 HOH HOH A . 
J 7 HOH 116 390 390 HOH HOH A . 
J 7 HOH 117 391 391 HOH HOH A . 
J 7 HOH 118 394 394 HOH HOH A . 
J 7 HOH 119 395 395 HOH HOH A . 
J 7 HOH 120 410 410 HOH HOH A . 
J 7 HOH 121 422 422 HOH HOH A . 
J 7 HOH 122 425 425 HOH HOH A . 
J 7 HOH 123 433 433 HOH HOH A . 
J 7 HOH 124 434 434 HOH HOH A . 
J 7 HOH 125 436 436 HOH HOH A . 
J 7 HOH 126 437 437 HOH HOH A . 
J 7 HOH 127 438 438 HOH HOH A . 
J 7 HOH 128 439 439 HOH HOH A . 
J 7 HOH 129 440 440 HOH HOH A . 
J 7 HOH 130 441 441 HOH HOH A . 
J 7 HOH 131 442 442 HOH HOH A . 
J 7 HOH 132 443 443 HOH HOH A . 
J 7 HOH 133 444 444 HOH HOH A . 
J 7 HOH 134 445 445 HOH HOH A . 
J 7 HOH 135 469 469 HOH HOH A . 
J 7 HOH 136 477 477 HOH HOH A . 
J 7 HOH 137 478 478 HOH HOH A . 
J 7 HOH 138 479 479 HOH HOH A . 
J 7 HOH 139 480 480 HOH HOH A . 
J 7 HOH 140 481 481 HOH HOH A . 
J 7 HOH 141 483 483 HOH HOH A . 
K 7 HOH 1   216 9   HOH HOH L . 
K 7 HOH 2   217 13  HOH HOH L . 
K 7 HOH 3   218 218 HOH HOH L . 
K 7 HOH 4   219 219 HOH HOH L . 
K 7 HOH 5   220 220 HOH HOH L . 
K 7 HOH 6   221 16  HOH HOH L . 
K 7 HOH 7   222 17  HOH HOH L . 
K 7 HOH 8   223 223 HOH HOH L . 
K 7 HOH 9   224 18  HOH HOH L . 
K 7 HOH 10  225 19  HOH HOH L . 
K 7 HOH 11  226 24  HOH HOH L . 
K 7 HOH 12  227 227 HOH HOH L . 
K 7 HOH 13  228 228 HOH HOH L . 
K 7 HOH 14  229 26  HOH HOH L . 
K 7 HOH 15  230 28  HOH HOH L . 
K 7 HOH 16  231 231 HOH HOH L . 
K 7 HOH 17  232 30  HOH HOH L . 
K 7 HOH 18  233 31  HOH HOH L . 
K 7 HOH 19  234 32  HOH HOH L . 
K 7 HOH 20  235 34  HOH HOH L . 
K 7 HOH 21  236 41  HOH HOH L . 
K 7 HOH 22  237 237 HOH HOH L . 
K 7 HOH 23  238 43  HOH HOH L . 
K 7 HOH 24  239 44  HOH HOH L . 
K 7 HOH 25  240 240 HOH HOH L . 
K 7 HOH 26  241 241 HOH HOH L . 
K 7 HOH 27  242 45  HOH HOH L . 
K 7 HOH 28  243 243 HOH HOH L . 
K 7 HOH 29  244 47  HOH HOH L . 
K 7 HOH 30  245 245 HOH HOH L . 
K 7 HOH 31  246 48  HOH HOH L . 
K 7 HOH 32  247 247 HOH HOH L . 
K 7 HOH 33  248 248 HOH HOH L . 
K 7 HOH 34  249 249 HOH HOH L . 
K 7 HOH 35  250 51  HOH HOH L . 
K 7 HOH 36  251 54  HOH HOH L . 
K 7 HOH 37  252 56  HOH HOH L . 
K 7 HOH 38  253 62  HOH HOH L . 
K 7 HOH 39  254 66  HOH HOH L . 
K 7 HOH 40  255 68  HOH HOH L . 
K 7 HOH 41  256 70  HOH HOH L . 
K 7 HOH 42  257 77  HOH HOH L . 
K 7 HOH 43  258 80  HOH HOH L . 
K 7 HOH 44  259 86  HOH HOH L . 
K 7 HOH 45  260 91  HOH HOH L . 
K 7 HOH 46  261 95  HOH HOH L . 
K 7 HOH 47  262 96  HOH HOH L . 
K 7 HOH 48  263 100 HOH HOH L . 
K 7 HOH 49  264 108 HOH HOH L . 
K 7 HOH 50  265 112 HOH HOH L . 
K 7 HOH 51  266 113 HOH HOH L . 
K 7 HOH 52  267 115 HOH HOH L . 
K 7 HOH 53  268 119 HOH HOH L . 
K 7 HOH 54  269 123 HOH HOH L . 
K 7 HOH 55  270 125 HOH HOH L . 
K 7 HOH 56  271 126 HOH HOH L . 
K 7 HOH 57  272 128 HOH HOH L . 
K 7 HOH 58  273 129 HOH HOH L . 
K 7 HOH 59  274 131 HOH HOH L . 
K 7 HOH 60  275 133 HOH HOH L . 
K 7 HOH 61  276 134 HOH HOH L . 
K 7 HOH 62  277 137 HOH HOH L . 
K 7 HOH 63  278 145 HOH HOH L . 
K 7 HOH 64  279 146 HOH HOH L . 
K 7 HOH 65  280 159 HOH HOH L . 
K 7 HOH 66  281 163 HOH HOH L . 
K 7 HOH 67  282 164 HOH HOH L . 
K 7 HOH 68  283 165 HOH HOH L . 
K 7 HOH 69  284 166 HOH HOH L . 
K 7 HOH 70  285 167 HOH HOH L . 
K 7 HOH 71  286 169 HOH HOH L . 
K 7 HOH 72  287 171 HOH HOH L . 
K 7 HOH 73  288 178 HOH HOH L . 
K 7 HOH 74  289 204 HOH HOH L . 
K 7 HOH 75  290 209 HOH HOH L . 
K 7 HOH 76  291 210 HOH HOH L . 
K 7 HOH 77  292 212 HOH HOH L . 
K 7 HOH 78  322 322 HOH HOH L . 
K 7 HOH 79  323 323 HOH HOH L . 
K 7 HOH 80  324 324 HOH HOH L . 
K 7 HOH 81  344 344 HOH HOH L . 
K 7 HOH 82  345 345 HOH HOH L . 
K 7 HOH 83  348 348 HOH HOH L . 
K 7 HOH 84  353 353 HOH HOH L . 
K 7 HOH 85  354 354 HOH HOH L . 
K 7 HOH 86  359 359 HOH HOH L . 
K 7 HOH 87  360 360 HOH HOH L . 
K 7 HOH 88  361 361 HOH HOH L . 
K 7 HOH 89  362 362 HOH HOH L . 
K 7 HOH 90  363 363 HOH HOH L . 
K 7 HOH 91  364 364 HOH HOH L . 
K 7 HOH 92  365 365 HOH HOH L . 
K 7 HOH 93  366 366 HOH HOH L . 
K 7 HOH 94  368 368 HOH HOH L . 
K 7 HOH 95  369 369 HOH HOH L . 
K 7 HOH 96  370 370 HOH HOH L . 
K 7 HOH 97  372 372 HOH HOH L . 
K 7 HOH 98  381 381 HOH HOH L . 
K 7 HOH 99  382 382 HOH HOH L . 
K 7 HOH 100 386 386 HOH HOH L . 
K 7 HOH 101 387 387 HOH HOH L . 
K 7 HOH 102 389 389 HOH HOH L . 
K 7 HOH 103 392 392 HOH HOH L . 
K 7 HOH 104 393 393 HOH HOH L . 
K 7 HOH 105 411 411 HOH HOH L . 
K 7 HOH 106 413 413 HOH HOH L . 
K 7 HOH 107 414 414 HOH HOH L . 
K 7 HOH 108 415 415 HOH HOH L . 
K 7 HOH 109 419 419 HOH HOH L . 
K 7 HOH 110 421 421 HOH HOH L . 
K 7 HOH 111 423 423 HOH HOH L . 
K 7 HOH 112 424 424 HOH HOH L . 
K 7 HOH 113 426 426 HOH HOH L . 
K 7 HOH 114 428 428 HOH HOH L . 
K 7 HOH 115 435 435 HOH HOH L . 
K 7 HOH 116 446 446 HOH HOH L . 
K 7 HOH 117 458 458 HOH HOH L . 
K 7 HOH 118 459 459 HOH HOH L . 
K 7 HOH 119 462 462 HOH HOH L . 
K 7 HOH 120 463 463 HOH HOH L . 
K 7 HOH 121 464 464 HOH HOH L . 
K 7 HOH 122 465 465 HOH HOH L . 
K 7 HOH 123 466 466 HOH HOH L . 
K 7 HOH 124 470 470 HOH HOH L . 
K 7 HOH 125 471 471 HOH HOH L . 
K 7 HOH 126 473 473 HOH HOH L . 
K 7 HOH 127 474 474 HOH HOH L . 
K 7 HOH 128 476 476 HOH HOH L . 
K 7 HOH 129 484 484 HOH HOH L . 
K 7 HOH 130 485 485 HOH HOH L . 
K 7 HOH 131 486 486 HOH HOH L . 
K 7 HOH 132 487 487 HOH HOH L . 
K 7 HOH 133 488 488 HOH HOH L . 
K 7 HOH 134 489 489 HOH HOH L . 
K 7 HOH 135 490 490 HOH HOH L . 
K 7 HOH 136 491 491 HOH HOH L . 
K 7 HOH 137 492 492 HOH HOH L . 
K 7 HOH 138 493 493 HOH HOH L . 
K 7 HOH 139 494 494 HOH HOH L . 
K 7 HOH 140 495 495 HOH HOH L . 
K 7 HOH 141 496 496 HOH HOH L . 
K 7 HOH 142 497 497 HOH HOH L . 
L 7 HOH 1   215 215 HOH HOH H . 
L 7 HOH 2   216 10  HOH HOH H . 
L 7 HOH 3   217 217 HOH HOH H . 
L 7 HOH 4   218 11  HOH HOH H . 
L 7 HOH 5   219 15  HOH HOH H . 
L 7 HOH 6   220 20  HOH HOH H . 
L 7 HOH 7   221 22  HOH HOH H . 
L 7 HOH 8   222 25  HOH HOH H . 
L 7 HOH 9   223 29  HOH HOH H . 
L 7 HOH 10  224 33  HOH HOH H . 
L 7 HOH 11  225 35  HOH HOH H . 
L 7 HOH 12  226 226 HOH HOH H . 
L 7 HOH 13  227 36  HOH HOH H . 
L 7 HOH 14  228 38  HOH HOH H . 
L 7 HOH 15  229 39  HOH HOH H . 
L 7 HOH 16  230 40  HOH HOH H . 
L 7 HOH 17  231 46  HOH HOH H . 
L 7 HOH 18  232 49  HOH HOH H . 
L 7 HOH 19  233 233 HOH HOH H . 
L 7 HOH 20  234 52  HOH HOH H . 
L 7 HOH 21  235 53  HOH HOH H . 
L 7 HOH 22  236 236 HOH HOH H . 
L 7 HOH 23  237 55  HOH HOH H . 
L 7 HOH 24  238 238 HOH HOH H . 
L 7 HOH 25  239 59  HOH HOH H . 
L 7 HOH 26  240 60  HOH HOH H . 
L 7 HOH 27  241 61  HOH HOH H . 
L 7 HOH 28  242 63  HOH HOH H . 
L 7 HOH 29  243 64  HOH HOH H . 
L 7 HOH 30  244 244 HOH HOH H . 
L 7 HOH 31  245 72  HOH HOH H . 
L 7 HOH 32  246 246 HOH HOH H . 
L 7 HOH 33  247 73  HOH HOH H . 
L 7 HOH 34  248 74  HOH HOH H . 
L 7 HOH 35  249 76  HOH HOH H . 
L 7 HOH 36  250 81  HOH HOH H . 
L 7 HOH 37  251 82  HOH HOH H . 
L 7 HOH 38  252 252 HOH HOH H . 
L 7 HOH 39  253 253 HOH HOH H . 
L 7 HOH 40  254 85  HOH HOH H . 
L 7 HOH 41  255 89  HOH HOH H . 
L 7 HOH 42  256 90  HOH HOH H . 
L 7 HOH 43  257 94  HOH HOH H . 
L 7 HOH 44  258 97  HOH HOH H . 
L 7 HOH 45  259 98  HOH HOH H . 
L 7 HOH 46  260 101 HOH HOH H . 
L 7 HOH 47  261 106 HOH HOH H . 
L 7 HOH 48  262 110 HOH HOH H . 
L 7 HOH 49  263 116 HOH HOH H . 
L 7 HOH 50  264 118 HOH HOH H . 
L 7 HOH 51  265 121 HOH HOH H . 
L 7 HOH 52  266 122 HOH HOH H . 
L 7 HOH 53  267 127 HOH HOH H . 
L 7 HOH 54  268 130 HOH HOH H . 
L 7 HOH 55  269 138 HOH HOH H . 
L 7 HOH 56  270 139 HOH HOH H . 
L 7 HOH 57  271 140 HOH HOH H . 
L 7 HOH 58  272 143 HOH HOH H . 
L 7 HOH 59  273 144 HOH HOH H . 
L 7 HOH 60  274 147 HOH HOH H . 
L 7 HOH 61  275 148 HOH HOH H . 
L 7 HOH 62  276 149 HOH HOH H . 
L 7 HOH 63  277 151 HOH HOH H . 
L 7 HOH 64  278 154 HOH HOH H . 
L 7 HOH 65  279 158 HOH HOH H . 
L 7 HOH 66  280 160 HOH HOH H . 
L 7 HOH 67  281 161 HOH HOH H . 
L 7 HOH 68  282 162 HOH HOH H . 
L 7 HOH 69  283 168 HOH HOH H . 
L 7 HOH 70  284 173 HOH HOH H . 
L 7 HOH 71  285 174 HOH HOH H . 
L 7 HOH 72  286 175 HOH HOH H . 
L 7 HOH 73  287 177 HOH HOH H . 
L 7 HOH 74  288 179 HOH HOH H . 
L 7 HOH 75  289 180 HOH HOH H . 
L 7 HOH 76  290 182 HOH HOH H . 
L 7 HOH 77  291 183 HOH HOH H . 
L 7 HOH 78  292 189 HOH HOH H . 
L 7 HOH 79  293 190 HOH HOH H . 
L 7 HOH 80  294 194 HOH HOH H . 
L 7 HOH 81  295 196 HOH HOH H . 
L 7 HOH 82  296 198 HOH HOH H . 
L 7 HOH 83  297 200 HOH HOH H . 
L 7 HOH 84  298 202 HOH HOH H . 
L 7 HOH 85  299 208 HOH HOH H . 
L 7 HOH 86  300 211 HOH HOH H . 
L 7 HOH 87  301 213 HOH HOH H . 
L 7 HOH 88  302 214 HOH HOH H . 
L 7 HOH 89  319 319 HOH HOH H . 
L 7 HOH 90  321 321 HOH HOH H . 
L 7 HOH 91  325 325 HOH HOH H . 
L 7 HOH 92  326 326 HOH HOH H . 
L 7 HOH 93  327 327 HOH HOH H . 
L 7 HOH 94  328 328 HOH HOH H . 
L 7 HOH 95  329 329 HOH HOH H . 
L 7 HOH 96  330 330 HOH HOH H . 
L 7 HOH 97  341 341 HOH HOH H . 
L 7 HOH 98  342 342 HOH HOH H . 
L 7 HOH 99  343 343 HOH HOH H . 
L 7 HOH 100 346 346 HOH HOH H . 
L 7 HOH 101 347 347 HOH HOH H . 
L 7 HOH 102 355 355 HOH HOH H . 
L 7 HOH 103 356 356 HOH HOH H . 
L 7 HOH 104 357 357 HOH HOH H . 
L 7 HOH 105 358 358 HOH HOH H . 
L 7 HOH 106 383 383 HOH HOH H . 
L 7 HOH 107 384 384 HOH HOH H . 
L 7 HOH 108 385 385 HOH HOH H . 
L 7 HOH 109 388 388 HOH HOH H . 
L 7 HOH 110 412 412 HOH HOH H . 
L 7 HOH 111 416 416 HOH HOH H . 
L 7 HOH 112 417 417 HOH HOH H . 
L 7 HOH 113 418 418 HOH HOH H . 
L 7 HOH 114 420 420 HOH HOH H . 
L 7 HOH 115 427 427 HOH HOH H . 
L 7 HOH 116 429 429 HOH HOH H . 
L 7 HOH 117 430 430 HOH HOH H . 
L 7 HOH 118 431 431 HOH HOH H . 
L 7 HOH 119 432 432 HOH HOH H . 
L 7 HOH 120 447 447 HOH HOH H . 
L 7 HOH 121 448 448 HOH HOH H . 
L 7 HOH 122 449 449 HOH HOH H . 
L 7 HOH 123 450 450 HOH HOH H . 
L 7 HOH 124 451 451 HOH HOH H . 
L 7 HOH 125 452 452 HOH HOH H . 
L 7 HOH 126 453 453 HOH HOH H . 
L 7 HOH 127 454 454 HOH HOH H . 
L 7 HOH 128 455 455 HOH HOH H . 
L 7 HOH 129 456 456 HOH HOH H . 
L 7 HOH 130 457 457 HOH HOH H . 
L 7 HOH 131 460 460 HOH HOH H . 
L 7 HOH 132 461 461 HOH HOH H . 
L 7 HOH 133 467 467 HOH HOH H . 
L 7 HOH 134 468 468 HOH HOH H . 
L 7 HOH 135 472 472 HOH HOH H . 
L 7 HOH 136 475 475 HOH HOH H . 
L 7 HOH 137 498 498 HOH HOH H . 
L 7 HOH 138 499 499 HOH HOH H . 
L 7 HOH 139 500 500 HOH HOH H . 
L 7 HOH 140 501 501 HOH HOH H . 
#