data_3N1G
# 
_entry.id   3N1G 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3N1G         
RCSB  RCSB059259   
WWPDB D_1000059259 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3d1m . unspecified 
PDB 3N1F . unspecified 
PDB 3N1M . unspecified 
PDB 3N1O . unspecified 
PDB 3N1P . unspecified 
PDB 3N1Q . unspecified 
PDB 3N1R . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3N1G 
_pdbx_database_status.recvd_initial_deposition_date   2010-05-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kavran, J.M.' 1 
'Leahy, D.J.'  2 
# 
_citation.id                        primary 
_citation.title                     'All mammalian hedgehog proteins interact with CDO and BOC in a conserved manner.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      2010 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20519495 
_citation.pdbx_database_id_DOI      10.1074/jbc.M110.131680 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kavran, J.M.'  1 
primary 'Ward, M.D.'    2 
primary 'Oladosu, O.O.' 3 
primary 'Mulepati, S.'  4 
primary 'Leahy, D.J.'   5 
# 
_cell.entry_id           3N1G 
_cell.length_a           87.210 
_cell.length_b           92.985 
_cell.length_c           74.684 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3N1G 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Desert hedgehog protein' 19133.469 2   ? ? ? ? 
2 polymer     man 'Brother of CDO'          12736.038 2   ? ? ? ? 
3 non-polymer syn 'CALCIUM ION'             40.078    4   ? ? ? ? 
4 non-polymer syn 'ZINC ION'                65.409    2   ? ? ? ? 
5 non-polymer syn 'MAGNESIUM ION'           24.305    1   ? ? ? ? 
6 water       nat water                     18.015    710 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'DHH, HHG-3, Desert hedgehog protein N-product, Desert hedgehog protein C-product' 
2 'Protein BOC'                                                                      
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSGPGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLM
TERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESR
NHVHVSVKAD
;
;GSGPGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLM
TERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESR
NHVHVSVKAD
;
B,A ? 
2 'polypeptide(L)' no no 
;GSTERPVAGPYITFTDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDKYWHSISHLQPETSY
DIKMQCFNEGGESEFSNVMICETKARKSSGQ
;
;GSTERPVAGPYITFTDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDKYWHSISHLQPETSY
DIKMQCFNEGGESEFSNVMICETKARKSSGQ
;
C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   GLY n 
1 4   PRO n 
1 5   GLY n 
1 6   PRO n 
1 7   GLY n 
1 8   ARG n 
1 9   GLY n 
1 10  PRO n 
1 11  VAL n 
1 12  GLY n 
1 13  ARG n 
1 14  ARG n 
1 15  ARG n 
1 16  TYR n 
1 17  ALA n 
1 18  ARG n 
1 19  LYS n 
1 20  GLN n 
1 21  LEU n 
1 22  VAL n 
1 23  PRO n 
1 24  LEU n 
1 25  LEU n 
1 26  TYR n 
1 27  LYS n 
1 28  GLN n 
1 29  PHE n 
1 30  VAL n 
1 31  PRO n 
1 32  GLY n 
1 33  VAL n 
1 34  PRO n 
1 35  GLU n 
1 36  ARG n 
1 37  THR n 
1 38  LEU n 
1 39  GLY n 
1 40  ALA n 
1 41  SER n 
1 42  GLY n 
1 43  PRO n 
1 44  ALA n 
1 45  GLU n 
1 46  GLY n 
1 47  ARG n 
1 48  VAL n 
1 49  ALA n 
1 50  ARG n 
1 51  GLY n 
1 52  SER n 
1 53  GLU n 
1 54  ARG n 
1 55  PHE n 
1 56  ARG n 
1 57  ASP n 
1 58  LEU n 
1 59  VAL n 
1 60  PRO n 
1 61  ASN n 
1 62  TYR n 
1 63  ASN n 
1 64  PRO n 
1 65  ASP n 
1 66  ILE n 
1 67  ILE n 
1 68  PHE n 
1 69  LYS n 
1 70  ASP n 
1 71  GLU n 
1 72  GLU n 
1 73  ASN n 
1 74  SER n 
1 75  GLY n 
1 76  ALA n 
1 77  ASP n 
1 78  ARG n 
1 79  LEU n 
1 80  MET n 
1 81  THR n 
1 82  GLU n 
1 83  ARG n 
1 84  CYS n 
1 85  LYS n 
1 86  GLU n 
1 87  ARG n 
1 88  VAL n 
1 89  ASN n 
1 90  ALA n 
1 91  LEU n 
1 92  ALA n 
1 93  ILE n 
1 94  ALA n 
1 95  VAL n 
1 96  MET n 
1 97  ASN n 
1 98  MET n 
1 99  TRP n 
1 100 PRO n 
1 101 GLY n 
1 102 VAL n 
1 103 ARG n 
1 104 LEU n 
1 105 ARG n 
1 106 VAL n 
1 107 THR n 
1 108 GLU n 
1 109 GLY n 
1 110 TRP n 
1 111 ASP n 
1 112 GLU n 
1 113 ASP n 
1 114 GLY n 
1 115 HIS n 
1 116 HIS n 
1 117 ALA n 
1 118 GLN n 
1 119 ASP n 
1 120 SER n 
1 121 LEU n 
1 122 HIS n 
1 123 TYR n 
1 124 GLU n 
1 125 GLY n 
1 126 ARG n 
1 127 ALA n 
1 128 LEU n 
1 129 ASP n 
1 130 ILE n 
1 131 THR n 
1 132 THR n 
1 133 SER n 
1 134 ASP n 
1 135 ARG n 
1 136 ASP n 
1 137 ARG n 
1 138 ASN n 
1 139 LYS n 
1 140 TYR n 
1 141 GLY n 
1 142 LEU n 
1 143 LEU n 
1 144 ALA n 
1 145 ARG n 
1 146 LEU n 
1 147 ALA n 
1 148 VAL n 
1 149 GLU n 
1 150 ALA n 
1 151 GLY n 
1 152 PHE n 
1 153 ASP n 
1 154 TRP n 
1 155 VAL n 
1 156 TYR n 
1 157 TYR n 
1 158 GLU n 
1 159 SER n 
1 160 ARG n 
1 161 ASN n 
1 162 HIS n 
1 163 VAL n 
1 164 HIS n 
1 165 VAL n 
1 166 SER n 
1 167 VAL n 
1 168 LYS n 
1 169 ALA n 
1 170 ASP n 
2 1   GLY n 
2 2   SER n 
2 3   THR n 
2 4   GLU n 
2 5   ARG n 
2 6   PRO n 
2 7   VAL n 
2 8   ALA n 
2 9   GLY n 
2 10  PRO n 
2 11  TYR n 
2 12  ILE n 
2 13  THR n 
2 14  PHE n 
2 15  THR n 
2 16  ASP n 
2 17  ALA n 
2 18  VAL n 
2 19  ASN n 
2 20  GLU n 
2 21  THR n 
2 22  THR n 
2 23  ILE n 
2 24  MET n 
2 25  LEU n 
2 26  LYS n 
2 27  TRP n 
2 28  MET n 
2 29  TYR n 
2 30  ILE n 
2 31  PRO n 
2 32  ALA n 
2 33  SER n 
2 34  ASN n 
2 35  ASN n 
2 36  ASN n 
2 37  THR n 
2 38  PRO n 
2 39  ILE n 
2 40  HIS n 
2 41  GLY n 
2 42  PHE n 
2 43  TYR n 
2 44  ILE n 
2 45  TYR n 
2 46  TYR n 
2 47  ARG n 
2 48  PRO n 
2 49  THR n 
2 50  ASP n 
2 51  SER n 
2 52  ASP n 
2 53  ASN n 
2 54  ASP n 
2 55  SER n 
2 56  ASP n 
2 57  TYR n 
2 58  LYS n 
2 59  LYS n 
2 60  ASP n 
2 61  MET n 
2 62  VAL n 
2 63  GLU n 
2 64  GLY n 
2 65  ASP n 
2 66  LYS n 
2 67  TYR n 
2 68  TRP n 
2 69  HIS n 
2 70  SER n 
2 71  ILE n 
2 72  SER n 
2 73  HIS n 
2 74  LEU n 
2 75  GLN n 
2 76  PRO n 
2 77  GLU n 
2 78  THR n 
2 79  SER n 
2 80  TYR n 
2 81  ASP n 
2 82  ILE n 
2 83  LYS n 
2 84  MET n 
2 85  GLN n 
2 86  CYS n 
2 87  PHE n 
2 88  ASN n 
2 89  GLU n 
2 90  GLY n 
2 91  GLY n 
2 92  GLU n 
2 93  SER n 
2 94  GLU n 
2 95  PHE n 
2 96  SER n 
2 97  ASN n 
2 98  VAL n 
2 99  MET n 
2 100 ILE n 
2 101 CYS n 
2 102 GLU n 
2 103 THR n 
2 104 LYS n 
2 105 ALA n 
2 106 ARG n 
2 107 LYS n 
2 108 SER n 
2 109 SER n 
2 110 GLY n 
2 111 GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? DHH                   ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human ? 'BOC, UNQ604/PRO1190' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DHH_HUMAN O43323 1 
;GPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERC
KERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVH
VSVKAD
;
24  ? 
2 UNP BOC_HUMAN Q9BWV1 2 
;ERPVAGPYITFTDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDKYWHSISHLQPETSYDIK
MQCFNEGGESEFSNVMICETKARKSSGQ
;
710 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3N1G B 5 ? 170 ? O43323 24  ? 189 ? 24  189 
2 2 3N1G C 4 ? 111 ? Q9BWV1 710 ? 817 ? 710 817 
3 1 3N1G A 5 ? 170 ? O43323 24  ? 189 ? 24  189 
4 2 3N1G D 4 ? 111 ? Q9BWV1 710 ? 817 ? 710 817 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3N1G GLY B 1 ? UNP O43323 ? ? 'EXPRESSION TAG' 20  1  
1 3N1G SER B 2 ? UNP O43323 ? ? 'EXPRESSION TAG' 21  2  
1 3N1G GLY B 3 ? UNP O43323 ? ? 'EXPRESSION TAG' 22  3  
1 3N1G PRO B 4 ? UNP O43323 ? ? 'EXPRESSION TAG' 23  4  
2 3N1G GLY C 1 ? UNP Q9BWV1 ? ? 'EXPRESSION TAG' 707 5  
2 3N1G SER C 2 ? UNP Q9BWV1 ? ? 'EXPRESSION TAG' 708 6  
2 3N1G THR C 3 ? UNP Q9BWV1 ? ? 'EXPRESSION TAG' 709 7  
3 3N1G GLY A 1 ? UNP O43323 ? ? 'EXPRESSION TAG' 20  8  
3 3N1G SER A 2 ? UNP O43323 ? ? 'EXPRESSION TAG' 21  9  
3 3N1G GLY A 3 ? UNP O43323 ? ? 'EXPRESSION TAG' 22  10 
3 3N1G PRO A 4 ? UNP O43323 ? ? 'EXPRESSION TAG' 23  11 
4 3N1G GLY D 1 ? UNP Q9BWV1 ? ? 'EXPRESSION TAG' 707 12 
4 3N1G SER D 2 ? UNP Q9BWV1 ? ? 'EXPRESSION TAG' 708 13 
4 3N1G THR D 3 ? UNP Q9BWV1 ? ? 'EXPRESSION TAG' 709 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          3N1G 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.38 
_exptl_crystal.density_percent_sol   48.22 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '30% PEG 4000, 200 mM MgCl2, 100 mM Tris, pH 8.0, VAPOR DIFFUSION, temperature 298K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RIGAKU SATURN 944+' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-E SUPERBRIGHT' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3N1G 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   1.9 
_reflns.d_resolution_low             25 
_reflns.d_resolution_high            1.9 
_reflns.number_obs                   47802 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3N1G 
_refine.ls_number_reflns_obs                     41996 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.01 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             24.648 
_refine.ls_d_res_high                            1.9 
_refine.ls_percent_reflns_obs                    86.48 
_refine.ls_R_factor_obs                          0.1842 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1822 
_refine.ls_R_factor_R_free                       0.2218 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.09 
_refine.ls_number_reflns_R_free                  2138 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -7.2780 
_refine.aniso_B[2][2]                            -6.9634 
_refine.aniso_B[3][3]                            -6.4674 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.341 
_refine.solvent_model_param_bsol                 50.000 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            1.11 
_refine.pdbx_overall_phase_error                 18.02 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4077 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         7 
_refine_hist.number_atoms_solvent             710 
_refine_hist.number_atoms_total               4794 
_refine_hist.d_res_high                       1.9 
_refine_hist.d_res_low                        24.648 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.007  ? ? 4205 'X-RAY DIFFRACTION' ? 
f_angle_d          1.140  ? ? 5704 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 16.023 ? ? 1544 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.079  ? ? 592  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 753  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 1.9    1.9436  1624 0.2113 54.00  0.2371 . . 94  . . . . 
'X-RAY DIFFRACTION' . 1.9436 1.9922  2432 0.1986 80.00  0.2796 . . 135 . . . . 
'X-RAY DIFFRACTION' . 1.9922 2.0461  2844 0.1791 94.00  0.2221 . . 158 . . . . 
'X-RAY DIFFRACTION' . 2.0461 2.1062  2921 0.1663 97.00  0.2143 . . 163 . . . . 
'X-RAY DIFFRACTION' . 2.1062 2.1742  2950 0.1626 96.00  0.2001 . . 146 . . . . 
'X-RAY DIFFRACTION' . 2.1742 2.2518  2822 0.1646 93.00  0.2228 . . 150 . . . . 
'X-RAY DIFFRACTION' . 2.2518 2.3419  2554 0.1697 84.00  0.2051 . . 148 . . . . 
'X-RAY DIFFRACTION' . 2.3419 2.4484  2488 0.1678 82.00  0.2419 . . 152 . . . . 
'X-RAY DIFFRACTION' . 2.4484 2.5774  2505 0.1772 81.00  0.2636 . . 115 . . . . 
'X-RAY DIFFRACTION' . 2.5774 2.7387  2399 0.1916 78.00  0.2363 . . 112 . . . . 
'X-RAY DIFFRACTION' . 2.7387 2.9498  2391 0.1957 78.00  0.2253 . . 113 . . . . 
'X-RAY DIFFRACTION' . 2.9498 3.2461  2752 0.1723 89.00  0.2480 . . 162 . . . . 
'X-RAY DIFFRACTION' . 3.2461 3.7144  3103 0.1472 100.00 0.1780 . . 162 . . . . 
'X-RAY DIFFRACTION' . 3.7144 4.6746  2937 0.1394 94.00  0.1745 . . 175 . . . . 
'X-RAY DIFFRACTION' . 4.6746 24.6505 3136 0.1695 95.00  0.1842 . . 153 . . . . 
# 
_struct.entry_id                  3N1G 
_struct.title                     'Crystal structure of DhhN bound to BOCFn3' 
_struct.pdbx_descriptor           'Desert hedgehog protein, Brother of CDO' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3N1G 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            
;Binding Sites, Calcium, Cell Adhesion Molecules, Cell Cycle Proteins, Cell Line, Conserved Sequence, Fibronectins, Hedgehog Proteins, Immunoglobulin G, Membrane Glycoproteins, Membrane Proteins, Protein Binding, Tertiary, Receptors, Cell Surface, Sequence Homology, Signal Transduction, Tumor Suppressor Proteins
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 3 ? 
I N N 4 ? 
J N N 3 ? 
K N N 5 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
O N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 52  ? ASP A 57  ? SER B 71  ASP B 76  1 ? 6  
HELX_P HELX_P2  2  GLY A 75  ? ASP A 77  ? GLY B 94  ASP B 96  5 ? 3  
HELX_P HELX_P3  3  THR A 81  ? TRP A 99  ? THR B 100 TRP B 118 1 ? 19 
HELX_P HELX_P4  4  SER A 120 ? GLY A 125 ? SER B 139 GLY B 144 5 ? 6  
HELX_P HELX_P5  5  ASP A 136 ? ASN A 138 ? ASP B 155 ASN B 157 5 ? 3  
HELX_P HELX_P6  6  LYS A 139 ? ALA A 150 ? LYS B 158 ALA B 169 1 ? 12 
HELX_P HELX_P7  7  ILE B 30  ? ASN B 35  ? ILE C 736 ASN C 741 5 ? 6  
HELX_P HELX_P8  8  ASN B 53  ? TYR B 57  ? ASN C 759 TYR C 763 5 ? 5  
HELX_P HELX_P9  9  SER C 52  ? ASP C 57  ? SER A 71  ASP A 76  1 ? 6  
HELX_P HELX_P10 10 GLY C 75  ? ASP C 77  ? GLY A 94  ASP A 96  5 ? 3  
HELX_P HELX_P11 11 THR C 81  ? TRP C 99  ? THR A 100 TRP A 118 1 ? 19 
HELX_P HELX_P12 12 SER C 120 ? GLY C 125 ? SER A 139 GLY A 144 5 ? 6  
HELX_P HELX_P13 13 ASP C 136 ? ASN C 138 ? ASP A 155 ASN A 157 5 ? 3  
HELX_P HELX_P14 14 LYS C 139 ? ALA C 150 ? LYS A 158 ALA A 169 1 ? 12 
HELX_P HELX_P15 15 ASN D 53  ? TYR D 57  ? ASN D 759 TYR D 763 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 122 NE2 ? ? ? 1_555 G ZN  . ZN ? ? B HIS 141 B ZN  192 1_555 ? ? ? ? ? ? ? 2.139 ? 
metalc2  metalc ? ? A ASP 129 OD1 ? ? ? 1_555 G ZN  . ZN ? ? B ASP 148 B ZN  192 1_555 ? ? ? ? ? ? ? 2.171 ? 
metalc3  metalc ? ? C ASP 129 OD1 ? ? ? 1_555 I ZN  . ZN ? ? A ASP 148 A ZN  191 1_555 ? ? ? ? ? ? ? 2.218 ? 
metalc4  metalc ? ? A HIS 164 ND1 ? ? ? 1_555 G ZN  . ZN ? ? B HIS 183 B ZN  192 1_555 ? ? ? ? ? ? ? 2.231 ? 
metalc5  metalc ? ? C GLU 108 OE2 ? ? ? 1_555 J CA  . CA ? ? A GLU 127 A CA  192 1_555 ? ? ? ? ? ? ? 2.320 ? 
metalc6  metalc ? ? A GLU 72  OE2 ? ? ? 1_555 E CA  . CA ? ? B GLU 91  B CA  190 1_555 ? ? ? ? ? ? ? 2.337 ? 
metalc7  metalc ? ? A ASP 111 OD1 ? ? ? 1_555 E CA  . CA ? ? B ASP 130 B CA  190 1_555 ? ? ? ? ? ? ? 2.348 ? 
metalc8  metalc ? ? C THR 107 O   ? ? ? 1_555 J CA  . CA ? ? A THR 126 A CA  192 1_555 ? ? ? ? ? ? ? 2.382 ? 
metalc9  metalc ? ? A THR 107 O   ? ? ? 1_555 F CA  . CA ? ? B THR 126 B CA  191 1_555 ? ? ? ? ? ? ? 2.392 ? 
metalc10 metalc ? ? C ASP 111 OD1 ? ? ? 1_555 H CA  . CA ? ? A ASP 130 A CA  190 1_555 ? ? ? ? ? ? ? 2.406 ? 
metalc11 metalc ? ? A GLU 71  OE2 ? ? ? 1_555 F CA  . CA ? ? B GLU 90  B CA  191 1_555 ? ? ? ? ? ? ? 2.433 ? 
metalc12 metalc ? ? C HIS 164 ND1 ? ? ? 1_555 I ZN  . ZN ? ? A HIS 183 A ZN  191 1_555 ? ? ? ? ? ? ? 2.438 ? 
metalc13 metalc ? ? C HIS 122 NE2 ? ? ? 1_555 I ZN  . ZN ? ? A HIS 141 A ZN  191 1_555 ? ? ? ? ? ? ? 2.441 ? 
metalc14 metalc ? ? C GLU 72  OE2 ? ? ? 1_555 H CA  . CA ? ? A GLU 91  A CA  190 1_555 ? ? ? ? ? ? ? 2.442 ? 
metalc15 metalc ? ? A GLU 108 OE2 ? ? ? 1_555 F CA  . CA ? ? B GLU 127 B CA  191 1_555 ? ? ? ? ? ? ? 2.447 ? 
metalc16 metalc ? ? A ASP 77  OD2 ? ? ? 1_555 F CA  . CA ? ? B ASP 96  B CA  191 1_555 ? ? ? ? ? ? ? 2.454 ? 
metalc17 metalc ? ? A ASP 113 OD2 ? ? ? 1_555 E CA  . CA ? ? B ASP 132 B CA  190 1_555 ? ? ? ? ? ? ? 2.456 ? 
metalc18 metalc ? ? C ASP 113 OD2 ? ? ? 1_555 H CA  . CA ? ? A ASP 132 A CA  190 1_555 ? ? ? ? ? ? ? 2.489 ? 
metalc19 metalc ? ? C ASP 77  OD2 ? ? ? 1_555 J CA  . CA ? ? A ASP 96  A CA  192 1_555 ? ? ? ? ? ? ? 2.490 ? 
metalc20 metalc ? ? C GLU 72  OE2 ? ? ? 1_555 J CA  . CA ? ? A GLU 91  A CA  192 1_555 ? ? ? ? ? ? ? 2.491 ? 
metalc21 metalc ? ? C GLU 71  OE2 ? ? ? 1_555 J CA  . CA ? ? A GLU 90  A CA  192 1_555 ? ? ? ? ? ? ? 2.520 ? 
metalc22 metalc ? ? C GLU 71  OE1 ? ? ? 1_555 J CA  . CA ? ? A GLU 90  A CA  192 1_555 ? ? ? ? ? ? ? 2.522 ? 
metalc23 metalc ? ? A GLU 71  OE1 ? ? ? 1_555 F CA  . CA ? ? B GLU 90  B CA  191 1_555 ? ? ? ? ? ? ? 2.531 ? 
metalc24 metalc ? ? A ASP 77  OD1 ? ? ? 1_555 F CA  . CA ? ? B ASP 96  B CA  191 1_555 ? ? ? ? ? ? ? 2.549 ? 
metalc25 metalc ? ? A GLU 72  OE2 ? ? ? 1_555 F CA  . CA ? ? B GLU 91  B CA  191 1_555 ? ? ? ? ? ? ? 2.550 ? 
metalc26 metalc ? ? C ASP 77  OD1 ? ? ? 1_555 J CA  . CA ? ? A ASP 96  A CA  192 1_555 ? ? ? ? ? ? ? 2.558 ? 
metalc27 metalc ? ? A GLU 108 OE2 ? ? ? 1_555 E CA  . CA ? ? B GLU 127 B CA  190 1_555 ? ? ? ? ? ? ? 2.616 ? 
metalc28 metalc ? ? C GLU 108 OE1 ? ? ? 1_555 H CA  . CA ? ? A GLU 127 A CA  190 1_555 ? ? ? ? ? ? ? 2.617 ? 
metalc29 metalc ? ? C LYS 168 O   ? ? ? 1_555 K MG  . MG ? ? A LYS 187 A MG  193 1_555 ? ? ? ? ? ? ? 2.675 ? 
metalc30 metalc ? ? A GLU 108 OE1 ? ? ? 1_555 E CA  . CA ? ? B GLU 127 B CA  190 1_555 ? ? ? ? ? ? ? 2.680 ? 
metalc31 metalc ? ? A GLU 72  OE1 ? ? ? 1_555 F CA  . CA ? ? B GLU 91  B CA  191 1_555 ? ? ? ? ? ? ? 2.728 ? 
metalc32 metalc ? ? C GLU 108 OE2 ? ? ? 1_555 H CA  . CA ? ? A GLU 127 A CA  190 1_555 ? ? ? ? ? ? ? 2.730 ? 
metalc33 metalc ? ? C GLU 72  OE1 ? ? ? 1_555 J CA  . CA ? ? A GLU 91  A CA  192 1_555 ? ? ? ? ? ? ? 2.819 ? 
metalc34 metalc ? ? C ASP 170 OD1 ? ? ? 1_555 K MG  . MG ? ? A ASP 189 A MG  193 1_555 ? ? ? ? ? ? ? 2.850 ? 
metalc35 metalc ? ? C THR 81  OG1 ? ? ? 1_555 K MG  . MG ? ? A THR 100 A MG  193 1_555 ? ? ? ? ? ? ? 2.877 ? 
metalc36 metalc ? ? H CA  .   CA  ? ? ? 1_555 N HOH . O  ? ? A CA  190 A HOH 16  1_555 ? ? ? ? ? ? ? 2.451 ? 
metalc37 metalc ? ? I ZN  .   ZN  ? ? ? 1_555 N HOH . O  ? ? A ZN  191 A HOH 305 1_555 ? ? ? ? ? ? ? 2.495 ? 
metalc38 metalc ? ? E CA  .   CA  ? ? ? 1_555 L HOH . O  ? ? B CA  190 B HOH 15  1_555 ? ? ? ? ? ? ? 2.507 ? 
metalc39 metalc ? ? E CA  .   CA  ? ? ? 1_555 L HOH . O  ? ? B CA  190 B HOH 7   1_555 ? ? ? ? ? ? ? 2.540 ? 
metalc40 metalc ? ? H CA  .   CA  ? ? ? 1_555 N HOH . O  ? ? A CA  190 A HOH 8   1_555 ? ? ? ? ? ? ? 2.651 ? 
metalc41 metalc ? ? H CA  .   CA  ? ? ? 1_555 N HOH . O  ? ? A CA  190 A HOH 14  1_555 ? ? ? ? ? ? ? 2.846 ? 
metalc42 metalc ? ? E CA  .   CA  ? ? ? 1_555 L HOH . O  ? ? B CA  190 B HOH 209 1_555 ? ? ? ? ? ? ? 2.885 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 VAL 30 A . ? VAL 49 B PRO 31 A ? PRO 50 B 1 -0.19 
2 GLN 20 C . ? GLN 39 A LEU 21 C ? LEU 40 A 1 -1.97 
3 VAL 30 C . ? VAL 49 A PRO 31 C ? PRO 50 A 1 -5.83 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 3 ? 
D ? 4 ? 
E ? 6 ? 
F ? 2 ? 
G ? 3 ? 
H ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? parallel      
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 29  ? VAL A 30  ? PHE B 48  VAL B 49  
A 2 TRP A 154 ? TYR A 156 ? TRP B 173 TYR B 175 
A 3 VAL A 163 ? SER A 166 ? VAL B 182 SER B 185 
A 4 ALA A 127 ? THR A 132 ? ALA B 146 THR B 151 
A 5 LEU A 104 ? GLU A 108 ? LEU B 123 GLU B 127 
A 6 ILE A 66  ? PHE A 68  ? ILE B 85  PHE B 87  
B 1 VAL A 59  ? PRO A 60  ? VAL B 78  PRO B 79  
B 2 LEU A 79  ? MET A 80  ? LEU B 98  MET B 99  
C 1 TYR B 11  ? ASN B 19  ? TYR C 717 ASN C 725 
C 2 THR B 22  ? MET B 28  ? THR C 728 MET C 734 
C 3 TRP B 68  ? ILE B 71  ? TRP C 774 ILE C 777 
D 1 LYS B 58  ? GLU B 63  ? LYS C 764 GLU C 769 
D 2 GLY B 41  ? PRO B 48  ? GLY C 747 PRO C 754 
D 3 SER B 79  ? PHE B 87  ? SER C 785 PHE C 793 
D 4 MET B 99  ? GLU B 102 ? MET C 805 GLU C 808 
E 1 PHE C 29  ? VAL C 30  ? PHE A 48  VAL A 49  
E 2 TRP C 154 ? TYR C 156 ? TRP A 173 TYR A 175 
E 3 VAL C 163 ? SER C 166 ? VAL A 182 SER A 185 
E 4 ALA C 127 ? THR C 132 ? ALA A 146 THR A 151 
E 5 LEU C 104 ? GLU C 108 ? LEU A 123 GLU A 127 
E 6 ILE C 66  ? PHE C 68  ? ILE A 85  PHE A 87  
F 1 VAL C 59  ? PRO C 60  ? VAL A 78  PRO A 79  
F 2 LEU C 79  ? MET C 80  ? LEU A 98  MET A 99  
G 1 TYR D 11  ? ALA D 17  ? TYR D 717 ALA D 723 
G 2 ILE D 23  ? MET D 28  ? ILE D 729 MET D 734 
G 3 TRP D 68  ? ILE D 71  ? TRP D 774 ILE D 777 
H 1 LYS D 58  ? GLU D 63  ? LYS D 764 GLU D 769 
H 2 GLY D 41  ? PRO D 48  ? GLY D 747 PRO D 754 
H 3 SER D 79  ? PHE D 87  ? SER D 785 PHE D 793 
H 4 MET D 99  ? GLU D 102 ? MET D 805 GLU D 808 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 30  ? N VAL B 49  O VAL A 155 ? O VAL B 174 
A 2 3 N TYR A 156 ? N TYR B 175 O HIS A 164 ? O HIS B 183 
A 3 4 O VAL A 163 ? O VAL B 182 N ILE A 130 ? N ILE B 149 
A 4 5 O ASP A 129 ? O ASP B 148 N THR A 107 ? N THR B 126 
A 5 6 O VAL A 106 ? O VAL B 125 N ILE A 67  ? N ILE B 86  
B 1 2 N VAL A 59  ? N VAL B 78  O MET A 80  ? O MET B 99  
C 1 2 N ASP B 16  ? N ASP C 722 O MET B 24  ? O MET C 730 
C 2 3 N ILE B 23  ? N ILE C 729 O ILE B 71  ? O ILE C 777 
D 1 2 O LYS B 58  ? O LYS C 764 N TYR B 46  ? N TYR C 752 
D 2 3 N TYR B 45  ? N TYR C 751 O LYS B 83  ? O LYS C 789 
D 3 4 N ILE B 82  ? N ILE C 788 O MET B 99  ? O MET C 805 
E 1 2 N VAL C 30  ? N VAL A 49  O VAL C 155 ? O VAL A 174 
E 2 3 N TYR C 156 ? N TYR A 175 O HIS C 164 ? O HIS A 183 
E 3 4 O VAL C 163 ? O VAL A 182 N ILE C 130 ? N ILE A 149 
E 4 5 O ASP C 129 ? O ASP A 148 N THR C 107 ? N THR A 126 
E 5 6 O VAL C 106 ? O VAL A 125 N ILE C 67  ? N ILE A 86  
F 1 2 N VAL C 59  ? N VAL A 78  O MET C 80  ? O MET A 99  
G 1 2 N ASP D 16  ? N ASP D 722 O MET D 24  ? O MET D 730 
G 2 3 N LEU D 25  ? N LEU D 731 O HIS D 69  ? O HIS D 775 
H 1 2 O LYS D 58  ? O LYS D 764 N TYR D 46  ? N TYR D 752 
H 2 3 N ARG D 47  ? N ARG D 753 O ASP D 81  ? O ASP D 787 
H 3 4 N ILE D 82  ? N ILE D 788 O MET D 99  ? O MET D 805 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CA B 190' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA B 191' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE ZN B 192' 
AC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CA A 190' 
AC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 191' 
AC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA A 192' 
AC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 193' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 HOH L .   ? HOH B 7   . ? 1_555 ? 
2  AC1 7 HOH L .   ? HOH B 15  . ? 1_555 ? 
3  AC1 7 GLU A 72  ? GLU B 91  . ? 1_555 ? 
4  AC1 7 GLU A 108 ? GLU B 127 . ? 1_555 ? 
5  AC1 7 ASP A 111 ? ASP B 130 . ? 1_555 ? 
6  AC1 7 ASP A 113 ? ASP B 132 . ? 1_555 ? 
7  AC1 7 HOH L .   ? HOH B 209 . ? 1_555 ? 
8  AC2 5 GLU A 71  ? GLU B 90  . ? 1_555 ? 
9  AC2 5 GLU A 72  ? GLU B 91  . ? 1_555 ? 
10 AC2 5 ASP A 77  ? ASP B 96  . ? 1_555 ? 
11 AC2 5 THR A 107 ? THR B 126 . ? 1_555 ? 
12 AC2 5 GLU A 108 ? GLU B 127 . ? 1_555 ? 
13 AC3 6 HIS A 122 ? HIS B 141 . ? 1_555 ? 
14 AC3 6 ASP A 129 ? ASP B 148 . ? 1_555 ? 
15 AC3 6 GLU A 158 ? GLU B 177 . ? 1_555 ? 
16 AC3 6 HIS A 164 ? HIS B 183 . ? 1_555 ? 
17 AC3 6 HOH L .   ? HOH B 278 . ? 1_555 ? 
18 AC3 6 HOH L .   ? HOH B 510 . ? 1_555 ? 
19 AC4 7 HOH N .   ? HOH A 8   . ? 1_555 ? 
20 AC4 7 HOH N .   ? HOH A 14  . ? 1_555 ? 
21 AC4 7 HOH N .   ? HOH A 16  . ? 1_555 ? 
22 AC4 7 GLU C 72  ? GLU A 91  . ? 1_555 ? 
23 AC4 7 GLU C 108 ? GLU A 127 . ? 1_555 ? 
24 AC4 7 ASP C 111 ? ASP A 130 . ? 1_555 ? 
25 AC4 7 ASP C 113 ? ASP A 132 . ? 1_555 ? 
26 AC5 5 HIS C 122 ? HIS A 141 . ? 1_555 ? 
27 AC5 5 ASP C 129 ? ASP A 148 . ? 1_555 ? 
28 AC5 5 GLU C 158 ? GLU A 177 . ? 1_555 ? 
29 AC5 5 HIS C 164 ? HIS A 183 . ? 1_555 ? 
30 AC5 5 HOH N .   ? HOH A 305 . ? 1_555 ? 
31 AC6 5 GLU C 71  ? GLU A 90  . ? 1_555 ? 
32 AC6 5 GLU C 72  ? GLU A 91  . ? 1_555 ? 
33 AC6 5 ASP C 77  ? ASP A 96  . ? 1_555 ? 
34 AC6 5 THR C 107 ? THR A 126 . ? 1_555 ? 
35 AC6 5 GLU C 108 ? GLU A 127 . ? 1_555 ? 
36 AC7 6 THR C 81  ? THR A 100 . ? 1_555 ? 
37 AC7 6 ARG C 83  ? ARG A 102 . ? 1_555 ? 
38 AC7 6 VAL C 167 ? VAL A 186 . ? 1_555 ? 
39 AC7 6 LYS C 168 ? LYS A 187 . ? 1_555 ? 
40 AC7 6 ALA C 169 ? ALA A 188 . ? 1_555 ? 
41 AC7 6 ASP C 170 ? ASP A 189 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3N1G 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3N1G 
_atom_sites.fract_transf_matrix[1][1]   0.011467 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010754 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013390 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
MG 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLN A 1 20  ? 28.906 14.292  -0.258  1.00 62.35  ? 39  GLN B N   1 
ATOM   2    C  CA  . GLN A 1 20  ? 29.009 15.128  0.932   1.00 48.22  ? 39  GLN B CA  1 
ATOM   3    C  C   . GLN A 1 20  ? 28.016 14.686  2.001   1.00 40.00  ? 39  GLN B C   1 
ATOM   4    O  O   . GLN A 1 20  ? 26.806 14.854  1.844   1.00 33.73  ? 39  GLN B O   1 
ATOM   5    C  CB  . GLN A 1 20  ? 28.781 16.597  0.576   1.00 54.59  ? 39  GLN B CB  1 
ATOM   6    C  CG  . GLN A 1 20  ? 29.829 17.542  1.140   1.00 58.13  ? 39  GLN B CG  1 
ATOM   7    C  CD  . GLN A 1 20  ? 29.841 17.564  2.656   1.00 55.59  ? 39  GLN B CD  1 
ATOM   8    O  OE1 . GLN A 1 20  ? 28.789 17.570  3.296   1.00 62.18  ? 39  GLN B OE1 1 
ATOM   9    N  NE2 . GLN A 1 20  ? 31.034 17.574  3.238   1.00 45.94  ? 39  GLN B NE2 1 
ATOM   10   N  N   . LEU A 1 21  ? 28.533 14.121  3.088   1.00 30.45  ? 40  LEU B N   1 
ATOM   11   C  CA  . LEU A 1 21  ? 27.699 13.658  4.177   1.00 23.69  ? 40  LEU B CA  1 
ATOM   12   C  C   . LEU A 1 21  ? 27.276 14.807  5.070   1.00 29.74  ? 40  LEU B C   1 
ATOM   13   O  O   . LEU A 1 21  ? 28.068 15.712  5.359   1.00 23.89  ? 40  LEU B O   1 
ATOM   14   C  CB  . LEU A 1 21  ? 28.442 12.608  4.995   1.00 25.76  ? 40  LEU B CB  1 
ATOM   15   C  CG  . LEU A 1 21  ? 28.744 11.303  4.269   1.00 32.59  ? 40  LEU B CG  1 
ATOM   16   C  CD1 . LEU A 1 21  ? 29.805 10.536  5.037   1.00 36.98  ? 40  LEU B CD1 1 
ATOM   17   C  CD2 . LEU A 1 21  ? 27.480 10.471  4.086   1.00 35.66  ? 40  LEU B CD2 1 
ATOM   18   N  N   . VAL A 1 22  ? 26.013 14.757  5.484   1.00 25.71  ? 41  VAL B N   1 
ATOM   19   C  CA  . VAL A 1 22  ? 25.435 15.712  6.416   1.00 29.62  ? 41  VAL B CA  1 
ATOM   20   C  C   . VAL A 1 22  ? 25.084 14.966  7.707   1.00 24.14  ? 41  VAL B C   1 
ATOM   21   O  O   . VAL A 1 22  ? 24.233 14.073  7.699   1.00 21.52  ? 41  VAL B O   1 
ATOM   22   C  CB  . VAL A 1 22  ? 24.142 16.341  5.831   1.00 24.85  ? 41  VAL B CB  1 
ATOM   23   C  CG1 . VAL A 1 22  ? 23.535 17.344  6.809   1.00 22.91  ? 41  VAL B CG1 1 
ATOM   24   C  CG2 . VAL A 1 22  ? 24.414 16.993  4.475   1.00 23.77  ? 41  VAL B CG2 1 
ATOM   25   N  N   . PRO A 1 23  ? 25.737 15.322  8.826   1.00 23.28  ? 42  PRO B N   1 
ATOM   26   C  CA  . PRO A 1 23  ? 25.406 14.635  10.076  1.00 17.77  ? 42  PRO B CA  1 
ATOM   27   C  C   . PRO A 1 23  ? 23.982 14.947  10.511  1.00 24.74  ? 42  PRO B C   1 
ATOM   28   O  O   . PRO A 1 23  ? 23.460 16.007  10.154  1.00 19.78  ? 42  PRO B O   1 
ATOM   29   C  CB  . PRO A 1 23  ? 26.399 15.235  11.080  1.00 21.54  ? 42  PRO B CB  1 
ATOM   30   C  CG  . PRO A 1 23  ? 27.483 15.821  10.249  1.00 29.56  ? 42  PRO B CG  1 
ATOM   31   C  CD  . PRO A 1 23  ? 26.802 16.315  9.016   1.00 23.90  ? 42  PRO B CD  1 
ATOM   32   N  N   . LEU A 1 24  ? 23.370 14.042  11.268  1.00 22.18  ? 43  LEU B N   1 
ATOM   33   C  CA  . LEU A 1 24  ? 22.068 14.299  11.870  1.00 18.08  ? 43  LEU B CA  1 
ATOM   34   C  C   . LEU A 1 24  ? 22.267 15.250  13.031  1.00 20.43  ? 43  LEU B C   1 
ATOM   35   O  O   . LEU A 1 24  ? 23.321 15.247  13.659  1.00 19.76  ? 43  LEU B O   1 
ATOM   36   C  CB  . LEU A 1 24  ? 21.419 13.002  12.389  1.00 17.44  ? 43  LEU B CB  1 
ATOM   37   C  CG  . LEU A 1 24  ? 20.509 12.217  11.444  1.00 18.69  ? 43  LEU B CG  1 
ATOM   38   C  CD1 . LEU A 1 24  ? 21.298 11.724  10.260  1.00 19.83  ? 43  LEU B CD1 1 
ATOM   39   C  CD2 . LEU A 1 24  ? 19.879 11.045  12.192  1.00 20.47  ? 43  LEU B CD2 1 
ATOM   40   N  N   . LEU A 1 25  ? 21.250 16.067  13.305  1.00 19.07  ? 44  LEU B N   1 
ATOM   41   C  CA  . LEU A 1 25  ? 21.273 16.948  14.453  1.00 24.71  ? 44  LEU B CA  1 
ATOM   42   C  C   . LEU A 1 25  ? 20.737 16.182  15.652  1.00 25.41  ? 44  LEU B C   1 
ATOM   43   O  O   . LEU A 1 25  ? 19.971 15.226  15.501  1.00 22.28  ? 44  LEU B O   1 
ATOM   44   C  CB  . LEU A 1 25  ? 20.412 18.182  14.172  1.00 27.91  ? 44  LEU B CB  1 
ATOM   45   C  CG  . LEU A 1 25  ? 20.794 18.829  12.841  1.00 37.13  ? 44  LEU B CG  1 
ATOM   46   C  CD1 . LEU A 1 25  ? 19.652 19.624  12.235  1.00 43.52  ? 44  LEU B CD1 1 
ATOM   47   C  CD2 . LEU A 1 25  ? 22.030 19.693  13.040  1.00 41.08  ? 44  LEU B CD2 1 
ATOM   48   N  N   . TYR A 1 26  ? 21.161 16.596  16.839  1.00 28.64  ? 45  TYR B N   1 
ATOM   49   C  CA  . TYR A 1 26  ? 20.678 16.006  18.073  1.00 27.16  ? 45  TYR B CA  1 
ATOM   50   C  C   . TYR A 1 26  ? 19.152 15.934  18.032  1.00 24.30  ? 45  TYR B C   1 
ATOM   51   O  O   . TYR A 1 26  ? 18.498 16.906  17.668  1.00 19.55  ? 45  TYR B O   1 
ATOM   52   C  CB  . TYR A 1 26  ? 21.160 16.853  19.254  1.00 25.37  ? 45  TYR B CB  1 
ATOM   53   C  CG  . TYR A 1 26  ? 20.570 16.473  20.581  1.00 27.72  ? 45  TYR B CG  1 
ATOM   54   C  CD1 . TYR A 1 26  ? 20.639 15.166  21.052  1.00 28.86  ? 45  TYR B CD1 1 
ATOM   55   C  CD2 . TYR A 1 26  ? 19.961 17.426  21.380  1.00 32.10  ? 45  TYR B CD2 1 
ATOM   56   C  CE1 . TYR A 1 26  ? 20.098 14.824  22.282  1.00 29.77  ? 45  TYR B CE1 1 
ATOM   57   C  CE2 . TYR A 1 26  ? 19.427 17.097  22.605  1.00 30.39  ? 45  TYR B CE2 1 
ATOM   58   C  CZ  . TYR A 1 26  ? 19.493 15.801  23.050  1.00 36.32  ? 45  TYR B CZ  1 
ATOM   59   O  OH  . TYR A 1 26  ? 18.945 15.497  24.273  1.00 43.09  ? 45  TYR B OH  1 
ATOM   60   N  N   . LYS A 1 27  ? 18.596 14.775  18.379  1.00 21.71  ? 46  LYS B N   1 
ATOM   61   C  CA  . LYS A 1 27  ? 17.143 14.555  18.408  1.00 23.04  ? 46  LYS B CA  1 
ATOM   62   C  C   . LYS A 1 27  ? 16.474 14.379  17.044  1.00 22.98  ? 46  LYS B C   1 
ATOM   63   O  O   . LYS A 1 27  ? 15.266 14.153  16.973  1.00 18.87  ? 46  LYS B O   1 
ATOM   64   C  CB  . LYS A 1 27  ? 16.419 15.647  19.214  1.00 27.60  ? 46  LYS B CB  1 
ATOM   65   C  CG  . LYS A 1 27  ? 16.535 15.472  20.721  1.00 36.35  ? 46  LYS B CG  1 
ATOM   66   C  CD  . LYS A 1 27  ? 16.070 14.082  21.128  1.00 36.83  ? 46  LYS B CD  1 
ATOM   67   C  CE  . LYS A 1 27  ? 16.108 13.903  22.627  1.00 43.25  ? 46  LYS B CE  1 
ATOM   68   N  NZ  . LYS A 1 27  ? 15.577 12.566  23.005  1.00 48.53  ? 46  LYS B NZ  1 
ATOM   69   N  N   . GLN A 1 28  ? 17.245 14.477  15.965  1.00 23.21  ? 47  GLN B N   1 
ATOM   70   C  CA  . GLN A 1 28  ? 16.701 14.243  14.628  1.00 20.48  ? 47  GLN B CA  1 
ATOM   71   C  C   . GLN A 1 28  ? 16.516 12.754  14.373  1.00 17.80  ? 47  GLN B C   1 
ATOM   72   O  O   . GLN A 1 28  ? 17.332 11.941  14.818  1.00 17.65  ? 47  GLN B O   1 
ATOM   73   C  CB  . GLN A 1 28  ? 17.643 14.816  13.561  1.00 24.35  ? 47  GLN B CB  1 
ATOM   74   C  CG  . GLN A 1 28  ? 17.200 14.532  12.115  1.00 26.57  ? 47  GLN B CG  1 
ATOM   75   C  CD  . GLN A 1 28  ? 18.038 15.281  11.082  1.00 31.62  ? 47  GLN B CD  1 
ATOM   76   O  OE1 . GLN A 1 28  ? 19.121 15.800  11.391  1.00 25.80  ? 47  GLN B OE1 1 
ATOM   77   N  NE2 . GLN A 1 28  ? 17.537 15.345  9.849   1.00 36.61  ? 47  GLN B NE2 1 
ATOM   78   N  N   . PHE A 1 29  ? 15.454 12.393  13.658  1.00 22.13  ? 48  PHE B N   1 
ATOM   79   C  CA  . PHE A 1 29  ? 15.291 11.015  13.201  1.00 21.07  ? 48  PHE B CA  1 
ATOM   80   C  C   . PHE A 1 29  ? 15.070 10.946  11.692  1.00 20.23  ? 48  PHE B C   1 
ATOM   81   O  O   . PHE A 1 29  ? 14.421 11.811  11.104  1.00 17.43  ? 48  PHE B O   1 
ATOM   82   C  CB  . PHE A 1 29  ? 14.194 10.271  13.980  1.00 16.32  ? 48  PHE B CB  1 
ATOM   83   C  CG  . PHE A 1 29  ? 12.916 11.042  14.145  1.00 19.74  ? 48  PHE B CG  1 
ATOM   84   C  CD1 . PHE A 1 29  ? 12.775 11.957  15.171  1.00 24.78  ? 48  PHE B CD1 1 
ATOM   85   C  CD2 . PHE A 1 29  ? 11.835 10.811  13.307  1.00 17.66  ? 48  PHE B CD2 1 
ATOM   86   C  CE1 . PHE A 1 29  ? 11.590 12.661  15.336  1.00 28.56  ? 48  PHE B CE1 1 
ATOM   87   C  CE2 . PHE A 1 29  ? 10.641 11.504  13.470  1.00 19.78  ? 48  PHE B CE2 1 
ATOM   88   C  CZ  . PHE A 1 29  ? 10.522 12.433  14.480  1.00 24.79  ? 48  PHE B CZ  1 
ATOM   89   N  N   . VAL A 1 30  ? 15.641 9.920   11.077  1.00 17.96  ? 49  VAL B N   1 
ATOM   90   C  CA  . VAL A 1 30  ? 15.601 9.734   9.634   1.00 16.45  ? 49  VAL B CA  1 
ATOM   91   C  C   . VAL A 1 30  ? 15.220 8.280   9.307   1.00 17.74  ? 49  VAL B C   1 
ATOM   92   O  O   . VAL A 1 30  ? 15.889 7.348   9.762   1.00 19.44  ? 49  VAL B O   1 
ATOM   93   C  CB  . VAL A 1 30  ? 16.996 10.028  9.017   1.00 17.27  ? 49  VAL B CB  1 
ATOM   94   C  CG1 . VAL A 1 30  ? 17.025 9.620   7.545   1.00 16.38  ? 49  VAL B CG1 1 
ATOM   95   C  CG2 . VAL A 1 30  ? 17.383 11.496  9.236   1.00 19.57  ? 49  VAL B CG2 1 
ATOM   96   N  N   . PRO A 1 31  ? 14.153 8.078   8.510   1.00 21.12  ? 50  PRO B N   1 
ATOM   97   C  CA  . PRO A 1 31  ? 13.304 9.128   7.918   1.00 19.93  ? 50  PRO B CA  1 
ATOM   98   C  C   . PRO A 1 31  ? 12.487 9.822   8.991   1.00 21.29  ? 50  PRO B C   1 
ATOM   99   O  O   . PRO A 1 31  ? 12.303 9.244   10.068  1.00 19.89  ? 50  PRO B O   1 
ATOM   100  C  CB  . PRO A 1 31  ? 12.378 8.341   6.986   1.00 24.92  ? 50  PRO B CB  1 
ATOM   101  C  CG  . PRO A 1 31  ? 12.312 6.968   7.612   1.00 20.41  ? 50  PRO B CG  1 
ATOM   102  C  CD  . PRO A 1 31  ? 13.749 6.741   8.040   1.00 18.37  ? 50  PRO B CD  1 
ATOM   103  N  N   . GLY A 1 32  ? 12.016 11.034  8.699   1.00 21.78  ? 51  GLY B N   1 
ATOM   104  C  CA  . GLY A 1 32  ? 11.291 11.854  9.658   1.00 19.81  ? 51  GLY B CA  1 
ATOM   105  C  C   . GLY A 1 32  ? 9.842  11.451  9.894   1.00 19.16  ? 51  GLY B C   1 
ATOM   106  O  O   . GLY A 1 32  ? 8.923  12.274  9.776   1.00 19.15  ? 51  GLY B O   1 
ATOM   107  N  N   . VAL A 1 33  ? 9.639  10.181  10.219  1.00 20.74  ? 52  VAL B N   1 
ATOM   108  C  CA  . VAL A 1 33  ? 8.320  9.666   10.581  1.00 20.92  ? 52  VAL B CA  1 
ATOM   109  C  C   . VAL A 1 33  ? 8.533  8.785   11.806  1.00 22.47  ? 52  VAL B C   1 
ATOM   110  O  O   . VAL A 1 33  ? 9.674  8.410   12.100  1.00 15.67  ? 52  VAL B O   1 
ATOM   111  C  CB  . VAL A 1 33  ? 7.733  8.808   9.458   1.00 17.74  ? 52  VAL B CB  1 
ATOM   112  C  CG1 . VAL A 1 33  ? 7.517  9.646   8.172   1.00 18.23  ? 52  VAL B CG1 1 
ATOM   113  C  CG2 . VAL A 1 33  ? 8.638  7.614   9.188   1.00 20.02  ? 52  VAL B CG2 1 
ATOM   114  N  N   . PRO A 1 34  ? 7.449  8.440   12.527  1.00 18.71  ? 53  PRO B N   1 
ATOM   115  C  CA  . PRO A 1 34  ? 7.647  7.575   13.701  1.00 21.55  ? 53  PRO B CA  1 
ATOM   116  C  C   . PRO A 1 34  ? 8.277  6.234   13.322  1.00 18.63  ? 53  PRO B C   1 
ATOM   117  O  O   . PRO A 1 34  ? 8.046  5.744   12.216  1.00 16.56  ? 53  PRO B O   1 
ATOM   118  C  CB  . PRO A 1 34  ? 6.227  7.377   14.238  1.00 25.04  ? 53  PRO B CB  1 
ATOM   119  C  CG  . PRO A 1 34  ? 5.457  8.610   13.728  1.00 27.97  ? 53  PRO B CG  1 
ATOM   120  C  CD  . PRO A 1 34  ? 6.032  8.820   12.349  1.00 20.78  ? 53  PRO B CD  1 
ATOM   121  N  N   . GLU A 1 35  ? 9.054  5.665   14.240  1.00 20.99  ? 54  GLU B N   1 
ATOM   122  C  CA  . GLU A 1 35  ? 9.850  4.459   13.984  1.00 17.37  ? 54  GLU B CA  1 
ATOM   123  C  C   . GLU A 1 35  ? 9.045  3.280   13.473  1.00 19.12  ? 54  GLU B C   1 
ATOM   124  O  O   . GLU A 1 35  ? 9.490  2.559   12.576  1.00 17.25  ? 54  GLU B O   1 
ATOM   125  C  CB  . GLU A 1 35  ? 10.565 4.010   15.262  1.00 15.06  ? 54  GLU B CB  1 
ATOM   126  C  CG  . GLU A 1 35  ? 11.429 2.775   15.069  1.00 18.61  ? 54  GLU B CG  1 
ATOM   127  C  CD  . GLU A 1 35  ? 12.201 2.404   16.327  1.00 21.28  ? 54  GLU B CD  1 
ATOM   128  O  OE1 . GLU A 1 35  ? 11.664 2.561   17.445  1.00 17.34  ? 54  GLU B OE1 1 
ATOM   129  O  OE2 . GLU A 1 35  ? 13.345 1.953   16.189  1.00 15.39  ? 54  GLU B OE2 1 
ATOM   130  N  N   . ARG A 1 36  ? 7.879  3.053   14.067  1.00 13.89  ? 55  ARG B N   1 
ATOM   131  C  CA  . ARG A 1 36  ? 7.085  1.877   13.736  1.00 19.88  ? 55  ARG B CA  1 
ATOM   132  C  C   . ARG A 1 36  ? 6.187  2.043   12.505  1.00 25.97  ? 55  ARG B C   1 
ATOM   133  O  O   . ARG A 1 36  ? 5.426  1.142   12.157  1.00 23.04  ? 55  ARG B O   1 
ATOM   134  C  CB  . ARG A 1 36  ? 6.281  1.412   14.953  1.00 34.47  ? 55  ARG B CB  1 
ATOM   135  C  CG  . ARG A 1 36  ? 7.159  0.830   16.056  1.00 44.89  ? 55  ARG B CG  1 
ATOM   136  C  CD  . ARG A 1 36  ? 6.332  0.227   17.184  1.00 55.15  ? 55  ARG B CD  1 
ATOM   137  N  NE  . ARG A 1 36  ? 5.434  1.206   17.790  1.00 59.43  ? 55  ARG B NE  1 
ATOM   138  C  CZ  . ARG A 1 36  ? 5.730  1.919   18.872  1.00 55.55  ? 55  ARG B CZ  1 
ATOM   139  N  NH1 . ARG A 1 36  ? 6.897  1.753   19.470  1.00 54.37  ? 55  ARG B NH1 1 
ATOM   140  N  NH2 . ARG A 1 36  ? 4.859  2.795   19.356  1.00 52.73  ? 55  ARG B NH2 1 
ATOM   141  N  N   . THR A 1 37  ? 6.297  3.171   11.816  1.00 18.74  ? 56  THR B N   1 
ATOM   142  C  CA  . THR A 1 37  ? 5.483  3.361   10.621  1.00 23.36  ? 56  THR B CA  1 
ATOM   143  C  C   . THR A 1 37  ? 6.090  2.603   9.436   1.00 24.63  ? 56  THR B C   1 
ATOM   144  O  O   . THR A 1 37  ? 7.287  2.367   9.390   1.00 23.25  ? 56  THR B O   1 
ATOM   145  C  CB  . THR A 1 37  ? 5.250  4.852   10.298  1.00 31.59  ? 56  THR B CB  1 
ATOM   146  O  OG1 . THR A 1 37  ? 6.490  5.483   10.003  1.00 34.79  ? 56  THR B OG1 1 
ATOM   147  C  CG2 . THR A 1 37  ? 4.621  5.566   11.490  1.00 42.26  ? 56  THR B CG2 1 
ATOM   148  N  N   . LEU A 1 38  ? 5.247  2.197   8.490   1.00 23.35  ? 57  LEU B N   1 
ATOM   149  C  CA  . LEU A 1 38  ? 5.692  1.365   7.365   1.00 18.85  ? 57  LEU B CA  1 
ATOM   150  C  C   . LEU A 1 38  ? 6.904  1.897   6.580   1.00 28.24  ? 57  LEU B C   1 
ATOM   151  O  O   . LEU A 1 38  ? 7.796  1.131   6.240   1.00 45.29  ? 57  LEU B O   1 
ATOM   152  C  CB  . LEU A 1 38  ? 4.533  1.040   6.409   1.00 28.81  ? 57  LEU B CB  1 
ATOM   153  C  CG  . LEU A 1 38  ? 3.665  -0.155  6.816   1.00 41.19  ? 57  LEU B CG  1 
ATOM   154  C  CD1 . LEU A 1 38  ? 2.806  -0.620  5.645   1.00 45.79  ? 57  LEU B CD1 1 
ATOM   155  C  CD2 . LEU A 1 38  ? 4.532  -1.301  7.332   1.00 41.69  ? 57  LEU B CD2 1 
ATOM   156  N  N   . GLY A 1 39  ? 6.954  3.187   6.278   1.00 32.21  ? 58  GLY B N   1 
ATOM   157  C  CA  . GLY A 1 39  ? 8.134  3.712   5.589   1.00 33.65  ? 58  GLY B CA  1 
ATOM   158  C  C   . GLY A 1 39  ? 9.441  3.600   6.377   1.00 27.10  ? 58  GLY B C   1 
ATOM   159  O  O   . GLY A 1 39  ? 10.551 3.737   5.828   1.00 23.03  ? 58  GLY B O   1 
ATOM   160  N  N   . ALA A 1 40  ? 9.315  3.365   7.674   1.00 23.81  ? 59  ALA B N   1 
ATOM   161  C  CA  . ALA A 1 40  ? 10.482 3.289   8.552   1.00 21.55  ? 59  ALA B CA  1 
ATOM   162  C  C   . ALA A 1 40  ? 10.784 1.841   8.925   1.00 19.07  ? 59  ALA B C   1 
ATOM   163  O  O   . ALA A 1 40  ? 10.940 0.994   8.053   1.00 16.78  ? 59  ALA B O   1 
ATOM   164  C  CB  . ALA A 1 40  ? 10.269 4.146   9.788   1.00 18.00  ? 59  ALA B CB  1 
ATOM   165  N  N   . SER A 1 41  ? 10.872 1.540   10.218  1.00 15.20  ? 60  SER B N   1 
ATOM   166  C  CA  . SER A 1 41  ? 11.148 0.164   10.625  1.00 16.01  ? 60  SER B CA  1 
ATOM   167  C  C   . SER A 1 41  ? 9.889  -0.695  10.740  1.00 21.13  ? 60  SER B C   1 
ATOM   168  O  O   . SER A 1 41  ? 9.984  -1.923  10.866  1.00 16.44  ? 60  SER B O   1 
ATOM   169  C  CB  . SER A 1 41  ? 11.940 0.128   11.942  1.00 19.00  ? 60  SER B CB  1 
ATOM   170  O  OG  . SER A 1 41  ? 13.254 0.616   11.748  1.00 18.17  ? 60  SER B OG  1 
ATOM   171  N  N   . GLY A 1 42  ? 8.713  -0.060  10.684  1.00 15.13  ? 61  GLY B N   1 
ATOM   172  C  CA  . GLY A 1 42  ? 7.458  -0.790  10.773  1.00 15.59  ? 61  GLY B CA  1 
ATOM   173  C  C   . GLY A 1 42  ? 7.139  -1.362  12.151  1.00 19.44  ? 61  GLY B C   1 
ATOM   174  O  O   . GLY A 1 42  ? 7.895  -1.178  13.110  1.00 18.05  ? 61  GLY B O   1 
ATOM   175  N  N   . PRO A 1 43  ? 5.998  -2.056  12.258  1.00 23.28  ? 62  PRO B N   1 
ATOM   176  C  CA  . PRO A 1 43  ? 5.396  -2.475  13.534  1.00 24.40  ? 62  PRO B CA  1 
ATOM   177  C  C   . PRO A 1 43  ? 6.273  -3.378  14.392  1.00 22.01  ? 62  PRO B C   1 
ATOM   178  O  O   . PRO A 1 43  ? 6.965  -4.244  13.862  1.00 21.22  ? 62  PRO B O   1 
ATOM   179  C  CB  . PRO A 1 43  ? 4.162  -3.272  13.092  1.00 29.53  ? 62  PRO B CB  1 
ATOM   180  C  CG  . PRO A 1 43  ? 3.831  -2.731  11.726  1.00 36.63  ? 62  PRO B CG  1 
ATOM   181  C  CD  . PRO A 1 43  ? 5.156  -2.411  11.099  1.00 25.91  ? 62  PRO B CD  1 
ATOM   182  N  N   . ALA A 1 44  ? 6.240  -3.159  15.704  1.00 21.63  ? 63  ALA B N   1 
ATOM   183  C  CA  . ALA A 1 44  ? 6.712  -4.145  16.666  1.00 22.50  ? 63  ALA B CA  1 
ATOM   184  C  C   . ALA A 1 44  ? 5.878  -5.421  16.485  1.00 28.03  ? 63  ALA B C   1 
ATOM   185  O  O   . ALA A 1 44  ? 4.695  -5.349  16.177  1.00 27.17  ? 63  ALA B O   1 
ATOM   186  C  CB  . ALA A 1 44  ? 6.527  -3.616  18.051  1.00 19.48  ? 63  ALA B CB  1 
ATOM   187  N  N   . GLU A 1 45  ? 6.488  -6.586  16.658  1.00 29.84  ? 64  GLU B N   1 
ATOM   188  C  CA  . GLU A 1 45  ? 5.736  -7.841  16.550  1.00 32.82  ? 64  GLU B CA  1 
ATOM   189  C  C   . GLU A 1 45  ? 5.554  -8.493  17.913  1.00 30.93  ? 64  GLU B C   1 
ATOM   190  O  O   . GLU A 1 45  ? 4.903  -9.526  18.038  1.00 36.24  ? 64  GLU B O   1 
ATOM   191  C  CB  . GLU A 1 45  ? 6.388  -8.795  15.546  1.00 33.43  ? 64  GLU B CB  1 
ATOM   192  C  CG  . GLU A 1 45  ? 6.170  -8.339  14.106  1.00 39.73  ? 64  GLU B CG  1 
ATOM   193  C  CD  . GLU A 1 45  ? 7.034  -9.059  13.095  1.00 45.74  ? 64  GLU B CD  1 
ATOM   194  O  OE1 . GLU A 1 45  ? 7.848  -9.918  13.497  1.00 42.59  ? 64  GLU B OE1 1 
ATOM   195  O  OE2 . GLU A 1 45  ? 6.906  -8.752  11.887  1.00 49.30  ? 64  GLU B OE2 1 
ATOM   196  N  N   . GLY A 1 46  ? 6.108  -7.869  18.939  1.00 24.91  ? 65  GLY B N   1 
ATOM   197  C  CA  . GLY A 1 46  ? 5.938  -8.366  20.288  1.00 25.01  ? 65  GLY B CA  1 
ATOM   198  C  C   . GLY A 1 46  ? 7.270  -8.760  20.882  1.00 22.52  ? 65  GLY B C   1 
ATOM   199  O  O   . GLY A 1 46  ? 8.180  -9.231  20.190  1.00 24.45  ? 65  GLY B O   1 
ATOM   200  N  N   . ARG A 1 47  ? 7.384  -8.567  22.182  1.00 24.19  ? 66  ARG B N   1 
ATOM   201  C  CA  . ARG A 1 47  ? 8.639  -8.785  22.874  1.00 24.09  ? 66  ARG B CA  1 
ATOM   202  C  C   . ARG A 1 47  ? 9.096  -10.229 22.724  1.00 20.45  ? 66  ARG B C   1 
ATOM   203  O  O   . ARG A 1 47  ? 8.302  -11.154 22.818  1.00 21.57  ? 66  ARG B O   1 
ATOM   204  C  CB  . ARG A 1 47  ? 8.467  -8.416  24.341  1.00 24.87  ? 66  ARG B CB  1 
ATOM   205  C  CG  . ARG A 1 47  ? 9.675  -8.663  25.208  1.00 27.20  ? 66  ARG B CG  1 
ATOM   206  C  CD  . ARG A 1 47  ? 9.686  -7.686  26.388  1.00 30.30  ? 66  ARG B CD  1 
ATOM   207  N  NE  . ARG A 1 47  ? 10.732 -8.038  27.344  1.00 36.24  ? 66  ARG B NE  1 
ATOM   208  C  CZ  . ARG A 1 47  ? 10.873 -7.488  28.546  1.00 34.71  ? 66  ARG B CZ  1 
ATOM   209  N  NH1 . ARG A 1 47  ? 10.037 -6.544  28.954  1.00 36.34  ? 66  ARG B NH1 1 
ATOM   210  N  NH2 . ARG A 1 47  ? 11.855 -7.885  29.335  1.00 34.11  ? 66  ARG B NH2 1 
ATOM   211  N  N   . VAL A 1 48  ? 10.386 -10.419 22.477  1.00 18.03  ? 67  VAL B N   1 
ATOM   212  C  CA  . VAL A 1 48  ? 10.947 -11.750 22.318  1.00 21.47  ? 67  VAL B CA  1 
ATOM   213  C  C   . VAL A 1 48  ? 11.677 -12.133 23.594  1.00 21.96  ? 67  VAL B C   1 
ATOM   214  O  O   . VAL A 1 48  ? 12.646 -11.465 23.983  1.00 20.30  ? 67  VAL B O   1 
ATOM   215  C  CB  . VAL A 1 48  ? 11.906 -11.783 21.117  1.00 21.31  ? 67  VAL B CB  1 
ATOM   216  C  CG1 . VAL A 1 48  ? 12.626 -13.117 21.028  1.00 23.07  ? 67  VAL B CG1 1 
ATOM   217  C  CG2 . VAL A 1 48  ? 11.125 -11.496 19.837  1.00 22.95  ? 67  VAL B CG2 1 
ATOM   218  N  N   . ALA A 1 49  ? 11.200 -13.189 24.259  1.00 25.15  ? 68  ALA B N   1 
ATOM   219  C  CA  . ALA A 1 49  ? 11.759 -13.611 25.545  1.00 25.81  ? 68  ALA B CA  1 
ATOM   220  C  C   . ALA A 1 49  ? 12.772 -14.734 25.389  1.00 30.90  ? 68  ALA B C   1 
ATOM   221  O  O   . ALA A 1 49  ? 12.658 -15.565 24.477  1.00 25.77  ? 68  ALA B O   1 
ATOM   222  C  CB  . ALA A 1 49  ? 10.644 -14.057 26.498  1.00 26.78  ? 68  ALA B CB  1 
ATOM   223  N  N   . ARG A 1 50  ? 13.746 -14.773 26.297  1.00 28.97  ? 69  ARG B N   1 
ATOM   224  C  CA  . ARG A 1 50  ? 14.741 -15.830 26.281  1.00 25.28  ? 69  ARG B CA  1 
ATOM   225  C  C   . ARG A 1 50  ? 14.009 -17.165 26.286  1.00 31.22  ? 69  ARG B C   1 
ATOM   226  O  O   . ARG A 1 50  ? 13.070 -17.363 27.056  1.00 30.19  ? 69  ARG B O   1 
ATOM   227  C  CB  . ARG A 1 50  ? 15.693 -15.708 27.479  1.00 24.59  ? 69  ARG B CB  1 
ATOM   228  C  CG  . ARG A 1 50  ? 16.816 -16.731 27.495  1.00 24.91  ? 69  ARG B CG  1 
ATOM   229  C  CD  . ARG A 1 50  ? 17.843 -16.428 28.568  1.00 25.37  ? 69  ARG B CD  1 
ATOM   230  N  NE  . ARG A 1 50  ? 18.569 -15.200 28.283  1.00 21.79  ? 69  ARG B NE  1 
ATOM   231  C  CZ  . ARG A 1 50  ? 19.646 -15.150 27.508  1.00 26.33  ? 69  ARG B CZ  1 
ATOM   232  N  NH1 . ARG A 1 50  ? 20.112 -16.266 26.950  1.00 24.23  ? 69  ARG B NH1 1 
ATOM   233  N  NH2 . ARG A 1 50  ? 20.251 -13.994 27.290  1.00 22.19  ? 69  ARG B NH2 1 
ATOM   234  N  N   . GLY A 1 51  ? 14.406 -18.063 25.392  1.00 32.60  ? 70  GLY B N   1 
ATOM   235  C  CA  . GLY A 1 51  ? 13.848 -19.408 25.368  1.00 35.49  ? 70  GLY B CA  1 
ATOM   236  C  C   . GLY A 1 51  ? 12.626 -19.579 24.486  1.00 30.69  ? 70  GLY B C   1 
ATOM   237  O  O   . GLY A 1 51  ? 12.145 -20.691 24.297  1.00 35.80  ? 70  GLY B O   1 
ATOM   238  N  N   . SER A 1 52  ? 12.114 -18.476 23.955  1.00 27.61  ? 71  SER B N   1 
ATOM   239  C  CA  . SER A 1 52  ? 11.027 -18.537 22.981  1.00 25.55  ? 71  SER B CA  1 
ATOM   240  C  C   . SER A 1 52  ? 11.569 -18.990 21.634  1.00 30.07  ? 71  SER B C   1 
ATOM   241  O  O   . SER A 1 52  ? 12.777 -18.953 21.403  1.00 34.56  ? 71  SER B O   1 
ATOM   242  C  CB  . SER A 1 52  ? 10.378 -17.165 22.815  1.00 26.45  ? 71  SER B CB  1 
ATOM   243  O  OG  . SER A 1 52  ? 11.247 -16.290 22.116  1.00 24.96  ? 71  SER B OG  1 
ATOM   244  N  N   . GLU A 1 53  ? 10.682 -19.402 20.735  1.00 34.11  ? 72  GLU B N   1 
ATOM   245  C  CA  . GLU A 1 53  ? 11.119 -19.803 19.402  1.00 41.82  ? 72  GLU B CA  1 
ATOM   246  C  C   . GLU A 1 53  ? 11.679 -18.619 18.618  1.00 32.38  ? 72  GLU B C   1 
ATOM   247  O  O   . GLU A 1 53  ? 12.671 -18.760 17.895  1.00 33.66  ? 72  GLU B O   1 
ATOM   248  C  CB  . GLU A 1 53  ? 9.990  -20.478 18.618  1.00 55.79  ? 72  GLU B CB  1 
ATOM   249  C  CG  . GLU A 1 53  ? 9.580  -21.853 19.157  1.00 67.51  ? 72  GLU B CG  1 
ATOM   250  C  CD  . GLU A 1 53  ? 10.761 -22.800 19.361  1.00 73.02  ? 72  GLU B CD  1 
ATOM   251  O  OE1 . GLU A 1 53  ? 11.642 -22.881 18.476  1.00 72.74  ? 72  GLU B OE1 1 
ATOM   252  O  OE2 . GLU A 1 53  ? 10.800 -23.474 20.412  1.00 75.75  ? 72  GLU B OE2 1 
ATOM   253  N  N   . ARG A 1 54  ? 11.058 -17.452 18.750  1.00 27.05  ? 73  ARG B N   1 
ATOM   254  C  CA  . ARG A 1 54  ? 11.587 -16.270 18.065  1.00 23.06  ? 73  ARG B CA  1 
ATOM   255  C  C   . ARG A 1 54  ? 12.990 -15.966 18.592  1.00 25.45  ? 73  ARG B C   1 
ATOM   256  O  O   . ARG A 1 54  ? 13.865 -15.543 17.843  1.00 23.45  ? 73  ARG B O   1 
ATOM   257  C  CB  . ARG A 1 54  ? 10.668 -15.050 18.224  1.00 27.32  ? 73  ARG B CB  1 
ATOM   258  C  CG  . ARG A 1 54  ? 9.356  -15.119 17.435  1.00 30.49  ? 73  ARG B CG  1 
ATOM   259  C  CD  . ARG A 1 54  ? 8.511  -13.867 17.677  1.00 30.90  ? 73  ARG B CD  1 
ATOM   260  N  NE  . ARG A 1 54  ? 9.153  -12.671 17.144  1.00 35.67  ? 73  ARG B NE  1 
ATOM   261  C  CZ  . ARG A 1 54  ? 8.817  -11.425 17.469  1.00 36.75  ? 73  ARG B CZ  1 
ATOM   262  N  NH1 . ARG A 1 54  ? 7.835  -11.202 18.328  1.00 31.01  ? 73  ARG B NH1 1 
ATOM   263  N  NH2 . ARG A 1 54  ? 9.467  -10.399 16.930  1.00 37.90  ? 73  ARG B NH2 1 
ATOM   264  N  N   . PHE A 1 55  ? 13.206 -16.198 19.883  1.00 22.41  ? 74  PHE B N   1 
ATOM   265  C  CA  . PHE A 1 55  ? 14.531 -16.005 20.464  1.00 26.10  ? 74  PHE B CA  1 
ATOM   266  C  C   . PHE A 1 55  ? 15.586 -16.883 19.772  1.00 31.20  ? 74  PHE B C   1 
ATOM   267  O  O   . PHE A 1 55  ? 16.734 -16.454 19.543  1.00 22.26  ? 74  PHE B O   1 
ATOM   268  C  CB  . PHE A 1 55  ? 14.500 -16.300 21.963  1.00 22.51  ? 74  PHE B CB  1 
ATOM   269  C  CG  . PHE A 1 55  ? 15.843 -16.189 22.623  1.00 26.82  ? 74  PHE B CG  1 
ATOM   270  C  CD1 . PHE A 1 55  ? 16.337 -14.956 23.008  1.00 26.49  ? 74  PHE B CD1 1 
ATOM   271  C  CD2 . PHE A 1 55  ? 16.617 -17.320 22.855  1.00 28.89  ? 74  PHE B CD2 1 
ATOM   272  C  CE1 . PHE A 1 55  ? 17.587 -14.850 23.607  1.00 24.82  ? 74  PHE B CE1 1 
ATOM   273  C  CE2 . PHE A 1 55  ? 17.864 -17.221 23.458  1.00 21.41  ? 74  PHE B CE2 1 
ATOM   274  C  CZ  . PHE A 1 55  ? 18.349 -15.984 23.829  1.00 20.25  ? 74  PHE B CZ  1 
ATOM   275  N  N   . ARG A 1 56  ? 15.191 -18.107 19.433  1.00 25.39  ? 75  ARG B N   1 
ATOM   276  C  CA  . ARG A 1 56  ? 16.111 -19.048 18.817  1.00 31.15  ? 75  ARG B CA  1 
ATOM   277  C  C   . ARG A 1 56  ? 16.472 -18.637 17.403  1.00 28.07  ? 75  ARG B C   1 
ATOM   278  O  O   . ARG A 1 56  ? 17.502 -19.048 16.888  1.00 34.45  ? 75  ARG B O   1 
ATOM   279  C  CB  . ARG A 1 56  ? 15.543 -20.466 18.844  1.00 38.76  ? 75  ARG B CB  1 
ATOM   280  C  CG  . ARG A 1 56  ? 15.472 -21.050 20.235  1.00 40.67  ? 75  ARG B CG  1 
ATOM   281  C  CD  . ARG A 1 56  ? 14.998 -22.488 20.197  1.00 51.73  ? 75  ARG B CD  1 
ATOM   282  N  NE  . ARG A 1 56  ? 14.872 -23.032 21.546  1.00 64.74  ? 75  ARG B NE  1 
ATOM   283  C  CZ  . ARG A 1 56  ? 13.811 -22.856 22.327  1.00 68.10  ? 75  ARG B CZ  1 
ATOM   284  N  NH1 . ARG A 1 56  ? 12.774 -22.152 21.893  1.00 64.05  ? 75  ARG B NH1 1 
ATOM   285  N  NH2 . ARG A 1 56  ? 13.785 -23.387 23.543  1.00 72.45  ? 75  ARG B NH2 1 
ATOM   286  N  N   . ASP A 1 57  ? 15.636 -17.814 16.779  1.00 24.91  ? 76  ASP B N   1 
ATOM   287  C  CA  . ASP A 1 57  ? 15.994 -17.241 15.480  1.00 30.41  ? 76  ASP B CA  1 
ATOM   288  C  C   . ASP A 1 57  ? 16.973 -16.062 15.584  1.00 30.84  ? 76  ASP B C   1 
ATOM   289  O  O   . ASP A 1 57  ? 17.424 -15.533 14.564  1.00 31.88  ? 76  ASP B O   1 
ATOM   290  C  CB  . ASP A 1 57  ? 14.747 -16.788 14.718  1.00 30.20  ? 76  ASP B CB  1 
ATOM   291  C  CG  . ASP A 1 57  ? 13.815 -17.944 14.360  1.00 38.90  ? 76  ASP B CG  1 
ATOM   292  O  OD1 . ASP A 1 57  ? 14.302 -19.081 14.161  1.00 34.07  ? 76  ASP B OD1 1 
ATOM   293  O  OD2 . ASP A 1 57  ? 12.591 -17.701 14.272  1.00 43.16  ? 76  ASP B OD2 1 
ATOM   294  N  N   . LEU A 1 58  ? 17.292 -15.623 16.798  1.00 29.61  ? 77  LEU B N   1 
ATOM   295  C  CA  . LEU A 1 58  ? 18.260 -14.532 16.939  1.00 24.47  ? 77  LEU B CA  1 
ATOM   296  C  C   . LEU A 1 58  ? 19.643 -15.133 16.895  1.00 26.53  ? 77  LEU B C   1 
ATOM   297  O  O   . LEU A 1 58  ? 19.867 -16.213 17.439  1.00 21.61  ? 77  LEU B O   1 
ATOM   298  C  CB  . LEU A 1 58  ? 18.072 -13.753 18.247  1.00 21.31  ? 77  LEU B CB  1 
ATOM   299  C  CG  . LEU A 1 58  ? 16.756 -12.989 18.405  1.00 19.70  ? 77  LEU B CG  1 
ATOM   300  C  CD1 . LEU A 1 58  ? 16.740 -12.263 19.733  1.00 22.47  ? 77  LEU B CD1 1 
ATOM   301  C  CD2 . LEU A 1 58  ? 16.536 -12.017 17.261  1.00 21.65  ? 77  LEU B CD2 1 
ATOM   302  N  N   . VAL A 1 59  ? 20.582 -14.443 16.256  1.00 25.51  ? 78  VAL B N   1 
ATOM   303  C  CA  . VAL A 1 59  ? 21.913 -15.001 16.105  1.00 24.23  ? 78  VAL B CA  1 
ATOM   304  C  C   . VAL A 1 59  ? 22.966 -14.037 16.634  1.00 21.44  ? 78  VAL B C   1 
ATOM   305  O  O   . VAL A 1 59  ? 22.947 -12.864 16.286  1.00 19.71  ? 78  VAL B O   1 
ATOM   306  C  CB  . VAL A 1 59  ? 22.210 -15.318 14.634  1.00 28.67  ? 78  VAL B CB  1 
ATOM   307  C  CG1 . VAL A 1 59  ? 23.615 -15.895 14.490  1.00 26.15  ? 78  VAL B CG1 1 
ATOM   308  C  CG2 . VAL A 1 59  ? 21.173 -16.291 14.092  1.00 32.45  ? 78  VAL B CG2 1 
ATOM   309  N  N   . PRO A 1 60  ? 23.891 -14.538 17.464  1.00 19.41  ? 79  PRO B N   1 
ATOM   310  C  CA  . PRO A 1 60  ? 24.938 -13.692 18.043  1.00 19.81  ? 79  PRO B CA  1 
ATOM   311  C  C   . PRO A 1 60  ? 25.922 -13.219 16.970  1.00 19.94  ? 79  PRO B C   1 
ATOM   312  O  O   . PRO A 1 60  ? 26.549 -14.036 16.305  1.00 17.65  ? 79  PRO B O   1 
ATOM   313  C  CB  . PRO A 1 60  ? 25.656 -14.625 19.027  1.00 22.74  ? 79  PRO B CB  1 
ATOM   314  C  CG  . PRO A 1 60  ? 24.830 -15.860 19.108  1.00 28.81  ? 79  PRO B CG  1 
ATOM   315  C  CD  . PRO A 1 60  ? 24.039 -15.951 17.856  1.00 23.42  ? 79  PRO B CD  1 
ATOM   316  N  N   . ASN A 1 61  ? 26.058 -11.907 16.822  1.00 13.51  ? 80  ASN B N   1 
ATOM   317  C  CA  . ASN A 1 61  ? 26.993 -11.334 15.864  1.00 13.41  ? 80  ASN B CA  1 
ATOM   318  C  C   . ASN A 1 61  ? 28.405 -11.292 16.468  1.00 20.14  ? 80  ASN B C   1 
ATOM   319  O  O   . ASN A 1 61  ? 28.643 -10.609 17.464  1.00 23.58  ? 80  ASN B O   1 
ATOM   320  C  CB  . ASN A 1 61  ? 26.526 -9.928  15.473  1.00 14.04  ? 80  ASN B CB  1 
ATOM   321  C  CG  . ASN A 1 61  ? 27.262 -9.391  14.263  1.00 18.28  ? 80  ASN B CG  1 
ATOM   322  O  OD1 . ASN A 1 61  ? 28.399 -9.782  13.999  1.00 20.16  ? 80  ASN B OD1 1 
ATOM   323  N  ND2 . ASN A 1 61  ? 26.614 -8.507  13.514  1.00 14.90  ? 80  ASN B ND2 1 
ATOM   324  N  N   . TYR A 1 62  ? 29.332 -12.044 15.882  1.00 14.68  ? 81  TYR B N   1 
ATOM   325  C  CA  . TYR A 1 62  ? 30.709 -12.070 16.378  1.00 14.15  ? 81  TYR B CA  1 
ATOM   326  C  C   . TYR A 1 62  ? 31.672 -11.370 15.422  1.00 16.24  ? 81  TYR B C   1 
ATOM   327  O  O   . TYR A 1 62  ? 32.851 -11.715 15.353  1.00 19.08  ? 81  TYR B O   1 
ATOM   328  C  CB  . TYR A 1 62  ? 31.162 -13.509 16.662  1.00 17.92  ? 81  TYR B CB  1 
ATOM   329  C  CG  . TYR A 1 62  ? 30.881 -13.902 18.095  1.00 19.11  ? 81  TYR B CG  1 
ATOM   330  C  CD1 . TYR A 1 62  ? 31.813 -13.651 19.087  1.00 22.21  ? 81  TYR B CD1 1 
ATOM   331  C  CD2 . TYR A 1 62  ? 29.656 -14.455 18.459  1.00 20.90  ? 81  TYR B CD2 1 
ATOM   332  C  CE1 . TYR A 1 62  ? 31.555 -13.978 20.405  1.00 26.36  ? 81  TYR B CE1 1 
ATOM   333  C  CE2 . TYR A 1 62  ? 29.385 -14.789 19.776  1.00 26.43  ? 81  TYR B CE2 1 
ATOM   334  C  CZ  . TYR A 1 62  ? 30.336 -14.547 20.744  1.00 28.03  ? 81  TYR B CZ  1 
ATOM   335  O  OH  . TYR A 1 62  ? 30.079 -14.871 22.065  1.00 31.26  ? 81  TYR B OH  1 
ATOM   336  N  N   . ASN A 1 63  ? 31.144 -10.403 14.673  1.00 16.88  ? 82  ASN B N   1 
ATOM   337  C  CA  . ASN A 1 63  ? 31.951 -9.511  13.841  1.00 11.67  ? 82  ASN B CA  1 
ATOM   338  C  C   . ASN A 1 63  ? 32.967 -8.814  14.738  1.00 12.99  ? 82  ASN B C   1 
ATOM   339  O  O   . ASN A 1 63  ? 32.577 -8.076  15.637  1.00 16.49  ? 82  ASN B O   1 
ATOM   340  C  CB  . ASN A 1 63  ? 31.029 -8.473  13.199  1.00 18.61  ? 82  ASN B CB  1 
ATOM   341  C  CG  . ASN A 1 63  ? 31.740 -7.620  12.186  1.00 20.16  ? 82  ASN B CG  1 
ATOM   342  O  OD1 . ASN A 1 63  ? 32.972 -7.524  12.199  1.00 18.81  ? 82  ASN B OD1 1 
ATOM   343  N  ND2 . ASN A 1 63  ? 30.973 -7.011  11.271  1.00 16.62  ? 82  ASN B ND2 1 
ATOM   344  N  N   . PRO A 1 64  ? 34.274 -9.061  14.517  1.00 14.01  ? 83  PRO B N   1 
ATOM   345  C  CA  . PRO A 1 64  ? 35.317 -8.528  15.400  1.00 17.08  ? 83  PRO B CA  1 
ATOM   346  C  C   . PRO A 1 64  ? 35.462 -7.012  15.287  1.00 20.81  ? 83  PRO B C   1 
ATOM   347  O  O   . PRO A 1 64  ? 36.121 -6.405  16.120  1.00 19.52  ? 83  PRO B O   1 
ATOM   348  C  CB  . PRO A 1 64  ? 36.596 -9.197  14.879  1.00 16.13  ? 83  PRO B CB  1 
ATOM   349  C  CG  . PRO A 1 64  ? 36.331 -9.416  13.453  1.00 19.73  ? 83  PRO B CG  1 
ATOM   350  C  CD  . PRO A 1 64  ? 34.847 -9.746  13.349  1.00 16.96  ? 83  PRO B CD  1 
ATOM   351  N  N   . ASP A 1 65  ? 34.866 -6.412  14.263  1.00 18.67  ? 84  ASP B N   1 
ATOM   352  C  CA  . ASP A 1 65  ? 34.941 -4.964  14.097  1.00 20.39  ? 84  ASP B CA  1 
ATOM   353  C  C   . ASP A 1 65  ? 33.793 -4.226  14.758  1.00 16.62  ? 84  ASP B C   1 
ATOM   354  O  O   . ASP A 1 65  ? 33.570 -3.047  14.497  1.00 17.52  ? 84  ASP B O   1 
ATOM   355  C  CB  . ASP A 1 65  ? 35.040 -4.610  12.624  1.00 22.03  ? 84  ASP B CB  1 
ATOM   356  C  CG  . ASP A 1 65  ? 36.340 -5.118  12.003  1.00 26.86  ? 84  ASP B CG  1 
ATOM   357  O  OD1 . ASP A 1 65  ? 37.364 -5.208  12.723  1.00 27.44  ? 84  ASP B OD1 1 
ATOM   358  O  OD2 . ASP A 1 65  ? 36.339 -5.416  10.802  1.00 24.35  ? 84  ASP B OD2 1 
ATOM   359  N  N   . ILE A 1 66  ? 33.049 -4.933  15.601  1.00 15.79  ? 85  ILE B N   1 
ATOM   360  C  CA  . ILE A 1 66  ? 32.021 -4.306  16.421  1.00 16.53  ? 85  ILE B CA  1 
ATOM   361  C  C   . ILE A 1 66  ? 32.354 -4.626  17.861  1.00 18.43  ? 85  ILE B C   1 
ATOM   362  O  O   . ILE A 1 66  ? 32.643 -5.776  18.187  1.00 19.81  ? 85  ILE B O   1 
ATOM   363  C  CB  . ILE A 1 66  ? 30.616 -4.842  16.091  1.00 18.42  ? 85  ILE B CB  1 
ATOM   364  C  CG1 . ILE A 1 66  ? 30.271 -4.582  14.625  1.00 16.10  ? 85  ILE B CG1 1 
ATOM   365  C  CG2 . ILE A 1 66  ? 29.574 -4.180  16.958  1.00 17.65  ? 85  ILE B CG2 1 
ATOM   366  C  CD1 . ILE A 1 66  ? 28.898 -5.110  14.230  1.00 20.49  ? 85  ILE B CD1 1 
ATOM   367  N  N   . ILE A 1 67  ? 32.369 -3.608  18.713  1.00 15.96  ? 86  ILE B N   1 
ATOM   368  C  CA  . ILE A 1 67  ? 32.553 -3.826  20.140  1.00 10.92  ? 86  ILE B CA  1 
ATOM   369  C  C   . ILE A 1 67  ? 31.184 -3.970  20.807  1.00 18.65  ? 86  ILE B C   1 
ATOM   370  O  O   . ILE A 1 67  ? 30.310 -3.126  20.619  1.00 18.81  ? 86  ILE B O   1 
ATOM   371  C  CB  . ILE A 1 67  ? 33.253 -2.613  20.770  1.00 16.89  ? 86  ILE B CB  1 
ATOM   372  C  CG1 . ILE A 1 67  ? 34.577 -2.350  20.064  1.00 23.63  ? 86  ILE B CG1 1 
ATOM   373  C  CG2 . ILE A 1 67  ? 33.483 -2.828  22.276  1.00 20.70  ? 86  ILE B CG2 1 
ATOM   374  C  CD1 . ILE A 1 67  ? 35.219 -1.078  20.502  1.00 28.22  ? 86  ILE B CD1 1 
ATOM   375  N  N   . PHE A 1 68  ? 30.989 -5.007  21.614  1.00 16.22  ? 87  PHE B N   1 
ATOM   376  C  CA  . PHE A 1 68  ? 29.742 -5.097  22.365  1.00 14.70  ? 87  PHE B CA  1 
ATOM   377  C  C   . PHE A 1 68  ? 29.962 -4.784  23.853  1.00 17.90  ? 87  PHE B C   1 
ATOM   378  O  O   . PHE A 1 68  ? 30.803 -5.385  24.525  1.00 19.54  ? 87  PHE B O   1 
ATOM   379  C  CB  . PHE A 1 68  ? 29.056 -6.449  22.141  1.00 18.06  ? 87  PHE B CB  1 
ATOM   380  C  CG  . PHE A 1 68  ? 28.664 -6.695  20.697  1.00 15.35  ? 87  PHE B CG  1 
ATOM   381  C  CD1 . PHE A 1 68  ? 27.396 -6.363  20.239  1.00 14.04  ? 87  PHE B CD1 1 
ATOM   382  C  CD2 . PHE A 1 68  ? 29.575 -7.229  19.802  1.00 19.02  ? 87  PHE B CD2 1 
ATOM   383  C  CE1 . PHE A 1 68  ? 27.034 -6.568  18.915  1.00 15.74  ? 87  PHE B CE1 1 
ATOM   384  C  CE2 . PHE A 1 68  ? 29.223 -7.442  18.476  1.00 16.27  ? 87  PHE B CE2 1 
ATOM   385  C  CZ  . PHE A 1 68  ? 27.954 -7.106  18.027  1.00 14.56  ? 87  PHE B CZ  1 
ATOM   386  N  N   . LYS A 1 69  ? 29.204 -3.824  24.360  1.00 18.21  ? 88  LYS B N   1 
ATOM   387  C  CA  . LYS A 1 69  ? 29.324 -3.401  25.752  1.00 17.82  ? 88  LYS B CA  1 
ATOM   388  C  C   . LYS A 1 69  ? 29.094 -4.565  26.717  1.00 13.30  ? 88  LYS B C   1 
ATOM   389  O  O   . LYS A 1 69  ? 29.911 -4.806  27.607  1.00 18.19  ? 88  LYS B O   1 
ATOM   390  C  CB  . LYS A 1 69  ? 28.339 -2.270  26.046  1.00 18.83  ? 88  LYS B CB  1 
ATOM   391  C  CG  . LYS A 1 69  ? 28.365 -1.784  27.498  1.00 16.63  ? 88  LYS B CG  1 
ATOM   392  C  CD  . LYS A 1 69  ? 27.521 -0.519  27.680  1.00 13.25  ? 88  LYS B CD  1 
ATOM   393  C  CE  . LYS A 1 69  ? 27.412 -0.133  29.163  1.00 18.21  ? 88  LYS B CE  1 
ATOM   394  N  NZ  . LYS A 1 69  ? 28.679 0.397   29.694  1.00 18.42  ? 88  LYS B NZ  1 
ATOM   395  N  N   . ASP A 1 70  ? 27.979 -5.273  26.548  1.00 11.28  ? 89  ASP B N   1 
ATOM   396  C  CA  . ASP A 1 70  ? 27.699 -6.489  27.335  1.00 16.95  ? 89  ASP B CA  1 
ATOM   397  C  C   . ASP A 1 70  ? 27.886 -6.275  28.836  1.00 17.87  ? 89  ASP B C   1 
ATOM   398  O  O   . ASP A 1 70  ? 28.452 -7.127  29.544  1.00 17.28  ? 89  ASP B O   1 
ATOM   399  C  CB  . ASP A 1 70  ? 28.541 -7.683  26.843  1.00 18.64  ? 89  ASP B CB  1 
ATOM   400  C  CG  . ASP A 1 70  ? 28.125 -9.021  27.490  1.00 26.33  ? 89  ASP B CG  1 
ATOM   401  O  OD1 . ASP A 1 70  ? 26.925 -9.222  27.778  1.00 25.46  ? 89  ASP B OD1 1 
ATOM   402  O  OD2 . ASP A 1 70  ? 29.010 -9.881  27.713  1.00 26.80  ? 89  ASP B OD2 1 
ATOM   403  N  N   . GLU A 1 71  ? 27.386 -5.145  29.326  1.00 18.43  ? 90  GLU B N   1 
ATOM   404  C  CA  . GLU A 1 71  ? 27.357 -4.926  30.769  1.00 15.51  ? 90  GLU B CA  1 
ATOM   405  C  C   . GLU A 1 71  ? 26.525 -6.003  31.462  1.00 20.15  ? 90  GLU B C   1 
ATOM   406  O  O   . GLU A 1 71  ? 26.680 -6.239  32.662  1.00 23.92  ? 90  GLU B O   1 
ATOM   407  C  CB  . GLU A 1 71  ? 26.847 -3.525  31.112  1.00 15.72  ? 90  GLU B CB  1 
ATOM   408  C  CG  . GLU A 1 71  ? 25.351 -3.319  30.953  1.00 14.73  ? 90  GLU B CG  1 
ATOM   409  C  CD  . GLU A 1 71  ? 24.889 -3.206  29.498  1.00 18.82  ? 90  GLU B CD  1 
ATOM   410  O  OE1 . GLU A 1 71  ? 25.739 -3.227  28.577  1.00 16.04  ? 90  GLU B OE1 1 
ATOM   411  O  OE2 . GLU A 1 71  ? 23.658 -3.096  29.287  1.00 19.27  ? 90  GLU B OE2 1 
ATOM   412  N  N   . GLU A 1 72  ? 25.646 -6.655  30.703  1.00 18.84  ? 91  GLU B N   1 
ATOM   413  C  CA  . GLU A 1 72  ? 24.817 -7.734  31.224  1.00 18.89  ? 91  GLU B CA  1 
ATOM   414  C  C   . GLU A 1 72  ? 25.651 -8.972  31.524  1.00 22.66  ? 91  GLU B C   1 
ATOM   415  O  O   . GLU A 1 72  ? 25.210 -9.846  32.268  1.00 20.60  ? 91  GLU B O   1 
ATOM   416  C  CB  . GLU A 1 72  ? 23.716 -8.113  30.224  1.00 17.80  ? 91  GLU B CB  1 
ATOM   417  C  CG  . GLU A 1 72  ? 22.773 -6.990  29.897  1.00 19.23  ? 91  GLU B CG  1 
ATOM   418  C  CD  . GLU A 1 72  ? 23.215 -6.157  28.705  1.00 20.66  ? 91  GLU B CD  1 
ATOM   419  O  OE1 . GLU A 1 72  ? 24.428 -6.120  28.366  1.00 19.78  ? 91  GLU B OE1 1 
ATOM   420  O  OE2 . GLU A 1 72  ? 22.326 -5.523  28.107  1.00 18.22  ? 91  GLU B OE2 1 
ATOM   421  N  N   . ASN A 1 73  ? 26.853 -9.041  30.955  1.00 19.20  ? 92  ASN B N   1 
ATOM   422  C  CA  . ASN A 1 73  ? 27.670 -10.248 31.025  1.00 20.92  ? 92  ASN B CA  1 
ATOM   423  C  C   . ASN A 1 73  ? 26.839 -11.466 30.634  1.00 26.37  ? 92  ASN B C   1 
ATOM   424  O  O   . ASN A 1 73  ? 26.860 -12.503 31.300  1.00 25.65  ? 92  ASN B O   1 
ATOM   425  C  CB  . ASN A 1 73  ? 28.278 -10.415 32.423  1.00 24.29  ? 92  ASN B CB  1 
ATOM   426  C  CG  . ASN A 1 73  ? 29.335 -9.353  32.728  1.00 30.13  ? 92  ASN B CG  1 
ATOM   427  O  OD1 . ASN A 1 73  ? 30.288 -9.175  31.972  1.00 34.28  ? 92  ASN B OD1 1 
ATOM   428  N  ND2 . ASN A 1 73  ? 29.156 -8.639  33.830  1.00 29.20  ? 92  ASN B ND2 1 
ATOM   429  N  N   . SER A 1 74  ? 26.107 -11.328 29.535  1.00 19.55  ? 93  SER B N   1 
ATOM   430  C  CA  . SER A 1 74  ? 25.158 -12.348 29.127  1.00 22.91  ? 93  SER B CA  1 
ATOM   431  C  C   . SER A 1 74  ? 25.212 -12.614 27.627  1.00 21.20  ? 93  SER B C   1 
ATOM   432  O  O   . SER A 1 74  ? 24.693 -13.622 27.174  1.00 25.36  ? 93  SER B O   1 
ATOM   433  C  CB  . SER A 1 74  ? 23.732 -11.946 29.525  1.00 25.03  ? 93  SER B CB  1 
ATOM   434  O  OG  . SER A 1 74  ? 23.210 -10.981 28.625  1.00 22.52  ? 93  SER B OG  1 
ATOM   435  N  N   . GLY A 1 75  ? 25.811 -11.699 26.861  1.00 22.21  ? 94  GLY B N   1 
ATOM   436  C  CA  . GLY A 1 75  ? 25.878 -11.830 25.410  1.00 23.57  ? 94  GLY B CA  1 
ATOM   437  C  C   . GLY A 1 75  ? 24.632 -11.321 24.691  1.00 23.31  ? 94  GLY B C   1 
ATOM   438  O  O   . GLY A 1 75  ? 24.512 -11.427 23.460  1.00 20.16  ? 94  GLY B O   1 
ATOM   439  N  N   . ALA A 1 76  ? 23.698 -10.759 25.454  1.00 15.92  ? 95  ALA B N   1 
ATOM   440  C  CA  . ALA A 1 76  ? 22.437 -10.270 24.881  1.00 21.22  ? 95  ALA B CA  1 
ATOM   441  C  C   . ALA A 1 76  ? 22.654 -9.222  23.788  1.00 18.19  ? 95  ALA B C   1 
ATOM   442  O  O   . ALA A 1 76  ? 21.935 -9.199  22.797  1.00 14.43  ? 95  ALA B O   1 
ATOM   443  C  CB  . ALA A 1 76  ? 21.510 -9.702  25.986  1.00 12.13  ? 95  ALA B CB  1 
ATOM   444  N  N   . ASP A 1 77  ? 23.629 -8.342  23.983  1.00 13.29  ? 96  ASP B N   1 
ATOM   445  C  CA  . ASP A 1 77  ? 23.831 -7.239  23.056  1.00 16.63  ? 96  ASP B CA  1 
ATOM   446  C  C   . ASP A 1 77  ? 24.193 -7.715  21.647  1.00 16.62  ? 96  ASP B C   1 
ATOM   447  O  O   . ASP A 1 77  ? 23.981 -6.975  20.696  1.00 14.07  ? 96  ASP B O   1 
ATOM   448  C  CB  . ASP A 1 77  ? 24.928 -6.305  23.553  1.00 17.51  ? 96  ASP B CB  1 
ATOM   449  C  CG  . ASP A 1 77  ? 24.491 -5.451  24.731  1.00 16.40  ? 96  ASP B CG  1 
ATOM   450  O  OD1 . ASP A 1 77  ? 23.274 -5.200  24.911  1.00 17.22  ? 96  ASP B OD1 1 
ATOM   451  O  OD2 . ASP A 1 77  ? 25.392 -5.035  25.471  1.00 19.31  ? 96  ASP B OD2 1 
ATOM   452  N  N   . ARG A 1 78  ? 24.763 -8.919  21.523  1.00 13.81  ? 97  ARG B N   1 
ATOM   453  C  CA  . ARG A 1 78  ? 25.159 -9.460  20.212  1.00 15.36  ? 97  ARG B CA  1 
ATOM   454  C  C   . ARG A 1 78  ? 23.986 -10.074 19.431  1.00 16.78  ? 97  ARG B C   1 
ATOM   455  O  O   . ARG A 1 78  ? 24.099 -10.296 18.209  1.00 15.05  ? 97  ARG B O   1 
ATOM   456  C  CB  . ARG A 1 78  ? 26.243 -10.551 20.362  1.00 19.30  ? 97  ARG B CB  1 
ATOM   457  C  CG  . ARG A 1 78  ? 27.560 -10.126 20.994  1.00 22.79  ? 97  ARG B CG  1 
ATOM   458  C  CD  . ARG A 1 78  ? 28.522 -11.339 21.104  1.00 21.48  ? 97  ARG B CD  1 
ATOM   459  N  NE  . ARG A 1 78  ? 29.832 -10.966 21.648  1.00 20.28  ? 97  ARG B NE  1 
ATOM   460  C  CZ  . ARG A 1 78  ? 30.826 -10.492 20.910  1.00 22.99  ? 97  ARG B CZ  1 
ATOM   461  N  NH1 . ARG A 1 78  ? 30.663 -10.342 19.600  1.00 18.36  ? 97  ARG B NH1 1 
ATOM   462  N  NH2 . ARG A 1 78  ? 31.987 -10.174 21.474  1.00 22.32  ? 97  ARG B NH2 1 
ATOM   463  N  N   . LEU A 1 79  ? 22.897 -10.409 20.124  1.00 15.24  ? 98  LEU B N   1 
ATOM   464  C  CA  . LEU A 1 79  ? 21.775 -11.133 19.500  1.00 15.01  ? 98  LEU B CA  1 
ATOM   465  C  C   . LEU A 1 79  ? 20.934 -10.185 18.636  1.00 13.62  ? 98  LEU B C   1 
ATOM   466  O  O   . LEU A 1 79  ? 20.462 -9.161  19.119  1.00 19.36  ? 98  LEU B O   1 
ATOM   467  C  CB  . LEU A 1 79  ? 20.866 -11.789 20.552  1.00 14.65  ? 98  LEU B CB  1 
ATOM   468  C  CG  . LEU A 1 79  ? 21.502 -12.913 21.369  1.00 20.71  ? 98  LEU B CG  1 
ATOM   469  C  CD1 . LEU A 1 79  ? 20.583 -13.376 22.486  1.00 18.92  ? 98  LEU B CD1 1 
ATOM   470  C  CD2 . LEU A 1 79  ? 21.845 -14.070 20.443  1.00 21.35  ? 98  LEU B CD2 1 
ATOM   471  N  N   . MET A 1 80  ? 20.738 -10.540 17.371  1.00 14.25  ? 99  MET B N   1 
ATOM   472  C  CA  . MET A 1 80  ? 20.024 -9.658  16.457  1.00 22.40  ? 99  MET B CA  1 
ATOM   473  C  C   . MET A 1 80  ? 19.430 -10.447 15.291  1.00 19.99  ? 99  MET B C   1 
ATOM   474  O  O   . MET A 1 80  ? 19.838 -11.587 15.039  1.00 19.28  ? 99  MET B O   1 
ATOM   475  C  CB  . MET A 1 80  ? 20.969 -8.547  15.964  1.00 17.33  ? 99  MET B CB  1 
ATOM   476  C  CG  . MET A 1 80  ? 22.269 -9.063  15.346  1.00 15.11  ? 99  MET B CG  1 
ATOM   477  S  SD  . MET A 1 80  ? 23.332 -7.683  14.855  1.00 16.41  ? 99  MET B SD  1 
ATOM   478  C  CE  . MET A 1 80  ? 24.017 -7.232  16.450  1.00 16.29  ? 99  MET B CE  1 
ATOM   479  N  N   . THR A 1 81  ? 18.437 -9.864  14.616  1.00 13.60  ? 100 THR B N   1 
ATOM   480  C  CA  . THR A 1 81  ? 17.833 -10.499 13.452  1.00 18.12  ? 100 THR B CA  1 
ATOM   481  C  C   . THR A 1 81  ? 18.800 -10.489 12.281  1.00 19.43  ? 100 THR B C   1 
ATOM   482  O  O   . THR A 1 81  ? 19.838 -9.836  12.329  1.00 16.56  ? 100 THR B O   1 
ATOM   483  C  CB  . THR A 1 81  ? 16.593 -9.743  12.974  1.00 19.29  ? 100 THR B CB  1 
ATOM   484  O  OG1 . THR A 1 81  ? 16.966 -8.404  12.630  1.00 15.42  ? 100 THR B OG1 1 
ATOM   485  C  CG2 . THR A 1 81  ? 15.509 -9.715  14.072  1.00 20.78  ? 100 THR B CG2 1 
ATOM   486  N  N   . GLU A 1 82  ? 18.437 -11.191 11.211  1.00 14.65  ? 101 GLU B N   1 
ATOM   487  C  CA  . GLU A 1 82  ? 19.286 -11.238 10.027  1.00 16.03  ? 101 GLU B CA  1 
ATOM   488  C  C   . GLU A 1 82  ? 19.441 -9.852  9.388   1.00 18.52  ? 101 GLU B C   1 
ATOM   489  O  O   . GLU A 1 82  ? 20.537 -9.463  8.991   1.00 14.66  ? 101 GLU B O   1 
ATOM   490  C  CB  . GLU A 1 82  ? 18.716 -12.228 9.009   1.00 17.94  ? 101 GLU B CB  1 
ATOM   491  C  CG  . GLU A 1 82  ? 19.599 -12.397 7.798   1.00 31.79  ? 101 GLU B CG  1 
ATOM   492  C  CD  . GLU A 1 82  ? 18.913 -13.177 6.694   1.00 47.10  ? 101 GLU B CD  1 
ATOM   493  O  OE1 . GLU A 1 82  ? 18.624 -12.577 5.638   1.00 55.11  ? 101 GLU B OE1 1 
ATOM   494  O  OE2 . GLU A 1 82  ? 18.655 -14.384 6.886   1.00 49.97  ? 101 GLU B OE2 1 
ATOM   495  N  N   . ARG A 1 83  ? 18.349 -9.100  9.277   1.00 18.23  ? 102 ARG B N   1 
ATOM   496  C  CA  . ARG A 1 83  ? 18.439 -7.781  8.656   1.00 15.06  ? 102 ARG B CA  1 
ATOM   497  C  C   . ARG A 1 83  ? 19.311 -6.829  9.493   1.00 16.40  ? 102 ARG B C   1 
ATOM   498  O  O   . ARG A 1 83  ? 20.059 -6.007  8.947   1.00 17.69  ? 102 ARG B O   1 
ATOM   499  C  CB  . ARG A 1 83  ? 17.047 -7.175  8.448   1.00 16.00  ? 102 ARG B CB  1 
ATOM   500  C  CG  . ARG A 1 83  ? 17.081 -5.780  7.825   1.00 16.98  ? 102 ARG B CG  1 
ATOM   501  C  CD  . ARG A 1 83  ? 15.731 -5.401  7.219   1.00 23.95  ? 102 ARG B CD  1 
ATOM   502  N  NE  . ARG A 1 83  ? 15.773 -4.054  6.659   1.00 32.64  ? 102 ARG B NE  1 
ATOM   503  C  CZ  . ARG A 1 83  ? 16.111 -3.775  5.403   1.00 47.31  ? 102 ARG B CZ  1 
ATOM   504  N  NH1 . ARG A 1 83  ? 16.433 -4.755  4.563   1.00 42.03  ? 102 ARG B NH1 1 
ATOM   505  N  NH2 . ARG A 1 83  ? 16.125 -2.515  4.988   1.00 53.13  ? 102 ARG B NH2 1 
ATOM   506  N  N   . CYS A 1 84  ? 19.198 -6.936  10.815  1.00 15.91  ? 103 CYS B N   1 
ATOM   507  C  CA  . CYS A 1 84  ? 19.960 -6.081  11.710  1.00 15.47  ? 103 CYS B CA  1 
ATOM   508  C  C   . CYS A 1 84  ? 21.421 -6.412  11.536  1.00 14.76  ? 103 CYS B C   1 
ATOM   509  O  O   . CYS A 1 84  ? 22.269 -5.520  11.490  1.00 16.65  ? 103 CYS B O   1 
ATOM   510  C  CB  . CYS A 1 84  ? 19.554 -6.287  13.180  1.00 15.15  ? 103 CYS B CB  1 
ATOM   511  S  SG  . CYS A 1 84  ? 20.282 -5.067  14.377  1.00 17.27  ? 103 CYS B SG  1 
ATOM   512  N  N   . LYS A 1 85  ? 21.717 -7.703  11.442  1.00 15.71  ? 104 LYS B N   1 
ATOM   513  C  CA  . LYS A 1 85  ? 23.101 -8.148  11.263  1.00 12.81  ? 104 LYS B CA  1 
ATOM   514  C  C   . LYS A 1 85  ? 23.691 -7.600  9.980   1.00 12.75  ? 104 LYS B C   1 
ATOM   515  O  O   . LYS A 1 85  ? 24.805 -7.064  9.978   1.00 14.35  ? 104 LYS B O   1 
ATOM   516  C  CB  . LYS A 1 85  ? 23.192 -9.682  11.237  1.00 14.61  ? 104 LYS B CB  1 
ATOM   517  C  CG  . LYS A 1 85  ? 24.582 -10.191 10.827  1.00 16.82  ? 104 LYS B CG  1 
ATOM   518  C  CD  . LYS A 1 85  ? 24.500 -11.570 10.180  1.00 22.74  ? 104 LYS B CD  1 
ATOM   519  C  CE  . LYS A 1 85  ? 23.502 -11.589 9.034   1.00 22.67  ? 104 LYS B CE  1 
ATOM   520  N  NZ  . LYS A 1 85  ? 23.501 -12.892 8.302   1.00 24.05  ? 104 LYS B NZ  1 
ATOM   521  N  N   . GLU A 1 86  ? 22.962 -7.748  8.874   1.00 18.52  ? 105 GLU B N   1 
ATOM   522  C  CA  A GLU A 1 86  ? 23.436 -7.252  7.585   0.63 17.29  ? 105 GLU B CA  1 
ATOM   523  C  CA  B GLU A 1 86  ? 23.445 -7.258  7.587   0.37 17.67  ? 105 GLU B CA  1 
ATOM   524  C  C   . GLU A 1 86  ? 23.724 -5.757  7.627   1.00 17.06  ? 105 GLU B C   1 
ATOM   525  O  O   . GLU A 1 86  ? 24.749 -5.291  7.123   1.00 13.60  ? 105 GLU B O   1 
ATOM   526  C  CB  A GLU A 1 86  ? 22.414 -7.556  6.492   0.63 19.19  ? 105 GLU B CB  1 
ATOM   527  C  CB  B GLU A 1 86  ? 22.449 -7.586  6.470   0.37 20.25  ? 105 GLU B CB  1 
ATOM   528  C  CG  A GLU A 1 86  ? 22.445 -8.999  6.044   0.63 22.94  ? 105 GLU B CG  1 
ATOM   529  C  CG  B GLU A 1 86  ? 22.352 -9.072  6.151   0.37 24.43  ? 105 GLU B CG  1 
ATOM   530  C  CD  A GLU A 1 86  ? 21.273 -9.362  5.171   0.63 33.31  ? 105 GLU B CD  1 
ATOM   531  C  CD  B GLU A 1 86  ? 23.707 -9.707  5.901   0.37 27.39  ? 105 GLU B CD  1 
ATOM   532  O  OE1 A GLU A 1 86  ? 20.273 -8.607  5.164   0.63 35.12  ? 105 GLU B OE1 1 
ATOM   533  O  OE1 B GLU A 1 86  ? 24.567 -9.057  5.275   0.37 33.83  ? 105 GLU B OE1 1 
ATOM   534  O  OE2 A GLU A 1 86  ? 21.355 -10.410 4.496   0.63 43.30  ? 105 GLU B OE2 1 
ATOM   535  O  OE2 B GLU A 1 86  ? 23.916 -10.857 6.335   0.37 35.36  ? 105 GLU B OE2 1 
ATOM   536  N  N   . ARG A 1 87  ? 22.822 -4.998  8.233   1.00 15.40  ? 106 ARG B N   1 
ATOM   537  C  CA  . ARG A 1 87  ? 22.985 -3.549  8.226   1.00 16.99  ? 106 ARG B CA  1 
ATOM   538  C  C   . ARG A 1 87  ? 24.106 -3.123  9.169   1.00 16.87  ? 106 ARG B C   1 
ATOM   539  O  O   . ARG A 1 87  ? 24.846 -2.199  8.878   1.00 14.49  ? 106 ARG B O   1 
ATOM   540  C  CB  . ARG A 1 87  ? 21.679 -2.846  8.577   1.00 16.50  ? 106 ARG B CB  1 
ATOM   541  C  CG  . ARG A 1 87  ? 20.533 -3.109  7.602   1.00 15.72  ? 106 ARG B CG  1 
ATOM   542  C  CD  . ARG A 1 87  ? 20.928 -2.691  6.185   1.00 21.34  ? 106 ARG B CD  1 
ATOM   543  N  NE  . ARG A 1 87  ? 21.338 -3.820  5.351   1.00 32.24  ? 106 ARG B NE  1 
ATOM   544  C  CZ  . ARG A 1 87  ? 22.359 -3.798  4.495   1.00 32.55  ? 106 ARG B CZ  1 
ATOM   545  N  NH1 . ARG A 1 87  ? 23.116 -2.708  4.371   1.00 26.84  ? 106 ARG B NH1 1 
ATOM   546  N  NH2 . ARG A 1 87  ? 22.635 -4.874  3.769   1.00 32.54  ? 106 ARG B NH2 1 
ATOM   547  N  N   . VAL A 1 88  ? 24.234 -3.791  10.308  1.00 14.95  ? 107 VAL B N   1 
ATOM   548  C  CA  . VAL A 1 88  ? 25.270 -3.386  11.255  1.00 11.41  ? 107 VAL B CA  1 
ATOM   549  C  C   . VAL A 1 88  ? 26.646 -3.789  10.722  1.00 13.74  ? 107 VAL B C   1 
ATOM   550  O  O   . VAL A 1 88  ? 27.638 -3.105  10.971  1.00 14.21  ? 107 VAL B O   1 
ATOM   551  C  CB  . VAL A 1 88  ? 25.004 -3.938  12.688  1.00 13.38  ? 107 VAL B CB  1 
ATOM   552  C  CG1 . VAL A 1 88  ? 25.417 -5.387  12.795  1.00 16.15  ? 107 VAL B CG1 1 
ATOM   553  C  CG2 . VAL A 1 88  ? 25.722 -3.096  13.745  1.00 13.73  ? 107 VAL B CG2 1 
ATOM   554  N  N   . ASN A 1 89  ? 26.716 -4.889  9.969   1.00 14.44  ? 108 ASN B N   1 
ATOM   555  C  CA  . ASN A 1 89  ? 28.009 -5.278  9.409   1.00 13.47  ? 108 ASN B CA  1 
ATOM   556  C  C   . ASN A 1 89  ? 28.457 -4.254  8.372   1.00 16.28  ? 108 ASN B C   1 
ATOM   557  O  O   . ASN A 1 89  ? 29.648 -3.941  8.258   1.00 17.28  ? 108 ASN B O   1 
ATOM   558  C  CB  . ASN A 1 89  ? 27.969 -6.681  8.814   1.00 12.62  ? 108 ASN B CB  1 
ATOM   559  C  CG  . ASN A 1 89  ? 27.946 -7.757  9.873   1.00 19.64  ? 108 ASN B CG  1 
ATOM   560  O  OD1 . ASN A 1 89  ? 28.121 -7.470  11.060  1.00 14.99  ? 108 ASN B OD1 1 
ATOM   561  N  ND2 . ASN A 1 89  ? 27.728 -9.018  9.452   1.00 12.33  ? 108 ASN B ND2 1 
ATOM   562  N  N   . ALA A 1 90  ? 27.498 -3.696  7.645   1.00 15.26  ? 109 ALA B N   1 
ATOM   563  C  CA  . ALA A 1 90  ? 27.823 -2.633  6.691   1.00 17.83  ? 109 ALA B CA  1 
ATOM   564  C  C   . ALA A 1 90  ? 28.282 -1.380  7.445   1.00 16.88  ? 109 ALA B C   1 
ATOM   565  O  O   . ALA A 1 90  ? 29.283 -0.742  7.081   1.00 14.59  ? 109 ALA B O   1 
ATOM   566  C  CB  . ALA A 1 90  ? 26.632 -2.326  5.820   1.00 21.03  ? 109 ALA B CB  1 
ATOM   567  N  N   . LEU A 1 91  ? 27.555 -1.031  8.499   1.00 14.74  ? 110 LEU B N   1 
ATOM   568  C  CA  . LEU A 1 91  ? 27.920 0.152   9.286   1.00 16.89  ? 110 LEU B CA  1 
ATOM   569  C  C   . LEU A 1 91  ? 29.330 0.023   9.848   1.00 13.97  ? 110 LEU B C   1 
ATOM   570  O  O   . LEU A 1 91  ? 30.106 0.969   9.782   1.00 16.47  ? 110 LEU B O   1 
ATOM   571  C  CB  . LEU A 1 91  ? 26.923 0.389   10.421  1.00 13.47  ? 110 LEU B CB  1 
ATOM   572  C  CG  . LEU A 1 91  ? 27.205 1.594   11.331  1.00 12.78  ? 110 LEU B CG  1 
ATOM   573  C  CD1 . LEU A 1 91  ? 27.397 2.883   10.511  1.00 9.14   ? 110 LEU B CD1 1 
ATOM   574  C  CD2 . LEU A 1 91  ? 26.050 1.726   12.357  1.00 11.15  ? 110 LEU B CD2 1 
ATOM   575  N  N   . ALA A 1 92  ? 29.662 -1.148  10.392  1.00 16.76  ? 111 ALA B N   1 
ATOM   576  C  CA  . ALA A 1 92  ? 30.989 -1.392  10.965  1.00 13.90  ? 111 ALA B CA  1 
ATOM   577  C  C   . ALA A 1 92  ? 32.104 -1.065  9.975   1.00 19.89  ? 111 ALA B C   1 
ATOM   578  O  O   . ALA A 1 92  ? 33.137 -0.484  10.346  1.00 16.18  ? 111 ALA B O   1 
ATOM   579  C  CB  . ALA A 1 92  ? 31.100 -2.849  11.423  1.00 12.18  ? 111 ALA B CB  1 
ATOM   580  N  N   . ILE A 1 93  ? 31.902 -1.454  8.718   1.00 15.14  ? 112 ILE B N   1 
ATOM   581  C  CA  . ILE A 1 93  ? 32.864 -1.155  7.649   1.00 17.50  ? 112 ILE B CA  1 
ATOM   582  C  C   . ILE A 1 93  ? 32.998 0.345   7.421   1.00 20.19  ? 112 ILE B C   1 
ATOM   583  O  O   . ILE A 1 93  ? 34.119 0.881   7.323   1.00 17.50  ? 112 ILE B O   1 
ATOM   584  C  CB  . ILE A 1 93  ? 32.470 -1.837  6.322   1.00 17.67  ? 112 ILE B CB  1 
ATOM   585  C  CG1 . ILE A 1 93  ? 32.576 -3.364  6.447   1.00 16.46  ? 112 ILE B CG1 1 
ATOM   586  C  CG2 . ILE A 1 93  ? 33.374 -1.382  5.204   1.00 24.03  ? 112 ILE B CG2 1 
ATOM   587  C  CD1 . ILE A 1 93  ? 32.078 -4.102  5.223   1.00 18.46  ? 112 ILE B CD1 1 
ATOM   588  N  N   . ALA A 1 94  ? 31.854 1.020   7.341   1.00 18.91  ? 113 ALA B N   1 
ATOM   589  C  CA  . ALA A 1 94  ? 31.804 2.463   7.115   1.00 18.03  ? 113 ALA B CA  1 
ATOM   590  C  C   . ALA A 1 94  ? 32.510 3.229   8.221   1.00 16.24  ? 113 ALA B C   1 
ATOM   591  O  O   . ALA A 1 94  ? 33.227 4.192   7.967   1.00 18.01  ? 113 ALA B O   1 
ATOM   592  C  CB  . ALA A 1 94  ? 30.356 2.935   6.997   1.00 18.97  ? 113 ALA B CB  1 
ATOM   593  N  N   . VAL A 1 95  ? 32.319 2.785   9.454   1.00 15.58  ? 114 VAL B N   1 
ATOM   594  C  CA  . VAL A 1 95  ? 32.889 3.473   10.607  1.00 20.93  ? 114 VAL B CA  1 
ATOM   595  C  C   . VAL A 1 95  ? 34.424 3.436   10.591  1.00 19.81  ? 114 VAL B C   1 
ATOM   596  O  O   . VAL A 1 95  ? 35.083 4.447   10.849  1.00 19.70  ? 114 VAL B O   1 
ATOM   597  C  CB  . VAL A 1 95  ? 32.332 2.887   11.936  1.00 17.43  ? 114 VAL B CB  1 
ATOM   598  C  CG1 . VAL A 1 95  ? 33.112 3.410   13.141  1.00 18.91  ? 114 VAL B CG1 1 
ATOM   599  C  CG2 . VAL A 1 95  ? 30.829 3.219   12.086  1.00 13.58  ? 114 VAL B CG2 1 
ATOM   600  N  N   . MET A 1 96  ? 34.988 2.265   10.300  1.00 17.55  ? 115 MET B N   1 
ATOM   601  C  CA  . MET A 1 96  ? 36.445 2.098   10.292  1.00 21.52  ? 115 MET B CA  1 
ATOM   602  C  C   . MET A 1 96  ? 37.108 2.858   9.148   1.00 24.45  ? 115 MET B C   1 
ATOM   603  O  O   . MET A 1 96  ? 38.230 3.337   9.282   1.00 23.75  ? 115 MET B O   1 
ATOM   604  C  CB  . MET A 1 96  ? 36.815 0.623   10.194  1.00 15.31  ? 115 MET B CB  1 
ATOM   605  C  CG  . MET A 1 96  ? 36.468 -0.183  11.428  1.00 17.44  ? 115 MET B CG  1 
ATOM   606  S  SD  . MET A 1 96  ? 36.954 -1.905  11.268  1.00 31.21  ? 115 MET B SD  1 
ATOM   607  C  CE  . MET A 1 96  ? 38.739 -1.762  11.284  1.00 56.28  ? 115 MET B CE  1 
ATOM   608  N  N   . ASN A 1 97  ? 36.417 2.935   8.017   1.00 23.15  ? 116 ASN B N   1 
ATOM   609  C  CA  . ASN A 1 97  ? 36.891 3.700   6.869   1.00 23.16  ? 116 ASN B CA  1 
ATOM   610  C  C   . ASN A 1 97  ? 36.851 5.190   7.181   1.00 20.74  ? 116 ASN B C   1 
ATOM   611  O  O   . ASN A 1 97  ? 37.765 5.935   6.826   1.00 18.12  ? 116 ASN B O   1 
ATOM   612  C  CB  . ASN A 1 97  ? 36.046 3.399   5.625   1.00 28.56  ? 116 ASN B CB  1 
ATOM   613  C  CG  . ASN A 1 97  ? 36.403 2.059   4.975   1.00 42.15  ? 116 ASN B CG  1 
ATOM   614  O  OD1 . ASN A 1 97  ? 37.420 1.449   5.307   1.00 45.20  ? 116 ASN B OD1 1 
ATOM   615  N  ND2 . ASN A 1 97  ? 35.564 1.607   4.040   1.00 36.79  ? 116 ASN B ND2 1 
ATOM   616  N  N   . MET A 1 98  ? 35.802 5.638   7.874   1.00 19.47  ? 117 MET B N   1 
ATOM   617  C  CA  . MET A 1 98  ? 35.665 7.069   8.168   1.00 21.87  ? 117 MET B CA  1 
ATOM   618  C  C   . MET A 1 98  ? 36.703 7.559   9.181   1.00 25.79  ? 117 MET B C   1 
ATOM   619  O  O   . MET A 1 98  ? 37.261 8.641   9.036   1.00 22.76  ? 117 MET B O   1 
ATOM   620  C  CB  . MET A 1 98  ? 34.245 7.406   8.650   1.00 18.39  ? 117 MET B CB  1 
ATOM   621  C  CG  . MET A 1 98  ? 34.039 8.870   9.032   1.00 20.66  ? 117 MET B CG  1 
ATOM   622  S  SD  . MET A 1 98  ? 34.191 10.017  7.639   1.00 25.06  ? 117 MET B SD  1 
ATOM   623  C  CE  . MET A 1 98  ? 32.834 9.485   6.597   1.00 23.97  ? 117 MET B CE  1 
ATOM   624  N  N   . TRP A 1 99  ? 36.958 6.748   10.202  1.00 23.17  ? 118 TRP B N   1 
ATOM   625  C  CA  . TRP A 1 99  ? 37.832 7.128   11.304  1.00 21.84  ? 118 TRP B CA  1 
ATOM   626  C  C   . TRP A 1 99  ? 38.846 6.002   11.552  1.00 22.92  ? 118 TRP B C   1 
ATOM   627  O  O   . TRP A 1 99  ? 38.546 5.040   12.260  1.00 19.22  ? 118 TRP B O   1 
ATOM   628  C  CB  . TRP A 1 99  ? 37.004 7.356   12.581  1.00 22.52  ? 118 TRP B CB  1 
ATOM   629  C  CG  . TRP A 1 99  ? 35.935 8.455   12.546  1.00 22.58  ? 118 TRP B CG  1 
ATOM   630  C  CD1 . TRP A 1 99  ? 36.141 9.806   12.501  1.00 25.46  ? 118 TRP B CD1 1 
ATOM   631  C  CD2 . TRP A 1 99  ? 34.503 8.272   12.616  1.00 20.67  ? 118 TRP B CD2 1 
ATOM   632  N  NE1 . TRP A 1 99  ? 34.931 10.473  12.510  1.00 24.31  ? 118 TRP B NE1 1 
ATOM   633  C  CE2 . TRP A 1 99  ? 33.914 9.553   12.575  1.00 24.06  ? 118 TRP B CE2 1 
ATOM   634  C  CE3 . TRP A 1 99  ? 33.668 7.150   12.683  1.00 17.48  ? 118 TRP B CE3 1 
ATOM   635  C  CZ2 . TRP A 1 99  ? 32.525 9.744   12.621  1.00 18.95  ? 118 TRP B CZ2 1 
ATOM   636  C  CZ3 . TRP A 1 99  ? 32.278 7.341   12.716  1.00 17.24  ? 118 TRP B CZ3 1 
ATOM   637  C  CH2 . TRP A 1 99  ? 31.729 8.630   12.682  1.00 20.66  ? 118 TRP B CH2 1 
ATOM   638  N  N   . PRO A 1 100 ? 40.047 6.105   10.968  1.00 25.97  ? 119 PRO B N   1 
ATOM   639  C  CA  . PRO A 1 100 ? 41.024 5.030   11.166  1.00 27.17  ? 119 PRO B CA  1 
ATOM   640  C  C   . PRO A 1 100 ? 41.249 4.720   12.650  1.00 26.82  ? 119 PRO B C   1 
ATOM   641  O  O   . PRO A 1 100 ? 41.421 5.629   13.451  1.00 22.25  ? 119 PRO B O   1 
ATOM   642  C  CB  . PRO A 1 100 ? 42.290 5.589   10.521  1.00 30.84  ? 119 PRO B CB  1 
ATOM   643  C  CG  . PRO A 1 100 ? 41.770 6.490   9.437   1.00 33.59  ? 119 PRO B CG  1 
ATOM   644  C  CD  . PRO A 1 100 ? 40.541 7.139   10.039  1.00 33.05  ? 119 PRO B CD  1 
ATOM   645  N  N   . GLY A 1 101 ? 41.195 3.447   13.013  1.00 26.86  ? 120 GLY B N   1 
ATOM   646  C  CA  . GLY A 1 101 ? 41.440 3.039   14.389  1.00 29.59  ? 120 GLY B CA  1 
ATOM   647  C  C   . GLY A 1 101 ? 40.206 3.023   15.276  1.00 22.00  ? 120 GLY B C   1 
ATOM   648  O  O   . GLY A 1 101 ? 40.238 2.515   16.404  1.00 22.61  ? 120 GLY B O   1 
ATOM   649  N  N   . VAL A 1 102 ? 39.109 3.570   14.770  1.00 14.48  ? 121 VAL B N   1 
ATOM   650  C  CA  . VAL A 1 102 ? 37.864 3.646   15.524  1.00 16.12  ? 121 VAL B CA  1 
ATOM   651  C  C   . VAL A 1 102 ? 36.896 2.585   15.012  1.00 18.55  ? 121 VAL B C   1 
ATOM   652  O  O   . VAL A 1 102 ? 36.832 2.337   13.811  1.00 19.93  ? 121 VAL B O   1 
ATOM   653  C  CB  . VAL A 1 102 ? 37.232 5.038   15.387  1.00 14.87  ? 121 VAL B CB  1 
ATOM   654  C  CG1 . VAL A 1 102 ? 35.859 5.071   16.025  1.00 15.05  ? 121 VAL B CG1 1 
ATOM   655  C  CG2 . VAL A 1 102 ? 38.154 6.097   16.012  1.00 19.55  ? 121 VAL B CG2 1 
ATOM   656  N  N   . ARG A 1 103 ? 36.154 1.967   15.926  1.00 16.53  ? 122 ARG B N   1 
ATOM   657  C  CA  . ARG A 1 103 ? 35.167 0.936   15.582  1.00 17.57  ? 122 ARG B CA  1 
ATOM   658  C  C   . ARG A 1 103 ? 33.799 1.292   16.114  1.00 19.02  ? 122 ARG B C   1 
ATOM   659  O  O   . ARG A 1 103 ? 33.670 2.108   17.025  1.00 18.30  ? 122 ARG B O   1 
ATOM   660  C  CB  . ARG A 1 103 ? 35.589 -0.439  16.141  1.00 14.43  ? 122 ARG B CB  1 
ATOM   661  C  CG  . ARG A 1 103 ? 36.977 -0.823  15.700  1.00 26.01  ? 122 ARG B CG  1 
ATOM   662  C  CD  . ARG A 1 103 ? 37.383 -2.275  15.945  1.00 38.65  ? 122 ARG B CD  1 
ATOM   663  N  NE  . ARG A 1 103 ? 38.617 -2.533  15.187  1.00 52.25  ? 122 ARG B NE  1 
ATOM   664  C  CZ  . ARG A 1 103 ? 39.195 -3.721  15.017  1.00 62.90  ? 122 ARG B CZ  1 
ATOM   665  N  NH1 . ARG A 1 103 ? 38.671 -4.816  15.555  1.00 64.18  ? 122 ARG B NH1 1 
ATOM   666  N  NH2 . ARG A 1 103 ? 40.312 -3.809  14.299  1.00 62.00  ? 122 ARG B NH2 1 
ATOM   667  N  N   . LEU A 1 104 ? 32.779 0.661   15.540  1.00 17.43  ? 123 LEU B N   1 
ATOM   668  C  CA  . LEU A 1 104 ? 31.416 0.782   16.015  1.00 17.06  ? 123 LEU B CA  1 
ATOM   669  C  C   . LEU A 1 104 ? 31.330 0.088   17.369  1.00 19.39  ? 123 LEU B C   1 
ATOM   670  O  O   . LEU A 1 104 ? 31.975 -0.943  17.580  1.00 16.32  ? 123 LEU B O   1 
ATOM   671  C  CB  . LEU A 1 104 ? 30.464 0.083   15.051  1.00 15.11  ? 123 LEU B CB  1 
ATOM   672  C  CG  . LEU A 1 104 ? 28.992 0.096   15.437  1.00 18.02  ? 123 LEU B CG  1 
ATOM   673  C  CD1 . LEU A 1 104 ? 28.454 1.549   15.363  1.00 10.68  ? 123 LEU B CD1 1 
ATOM   674  C  CD2 . LEU A 1 104 ? 28.192 -0.835  14.532  1.00 13.21  ? 123 LEU B CD2 1 
ATOM   675  N  N   . ARG A 1 105 ? 30.547 0.664   18.278  1.00 15.08  ? 124 ARG B N   1 
ATOM   676  C  CA  . ARG A 1 105 ? 30.329 0.082   19.590  1.00 15.30  ? 124 ARG B CA  1 
ATOM   677  C  C   . ARG A 1 105 ? 28.826 0.001   19.844  1.00 17.19  ? 124 ARG B C   1 
ATOM   678  O  O   . ARG A 1 105 ? 28.089 0.950   19.575  1.00 21.06  ? 124 ARG B O   1 
ATOM   679  C  CB  . ARG A 1 105 ? 31.027 0.915   20.684  1.00 17.81  ? 124 ARG B CB  1 
ATOM   680  C  CG  . ARG A 1 105 ? 30.693 0.477   22.129  1.00 18.04  ? 124 ARG B CG  1 
ATOM   681  C  CD  . ARG A 1 105 ? 31.658 1.129   23.113  1.00 20.46  ? 124 ARG B CD  1 
ATOM   682  N  NE  . ARG A 1 105 ? 31.222 1.055   24.501  1.00 18.56  ? 124 ARG B NE  1 
ATOM   683  C  CZ  . ARG A 1 105 ? 30.477 1.981   25.099  1.00 22.22  ? 124 ARG B CZ  1 
ATOM   684  N  NH1 . ARG A 1 105 ? 30.047 3.053   24.419  1.00 17.39  ? 124 ARG B NH1 1 
ATOM   685  N  NH2 . ARG A 1 105 ? 30.154 1.834   26.377  1.00 19.51  ? 124 ARG B NH2 1 
ATOM   686  N  N   . VAL A 1 106 ? 28.381 -1.148  20.340  1.00 15.65  ? 125 VAL B N   1 
ATOM   687  C  CA  . VAL A 1 106 ? 26.973 -1.379  20.654  1.00 18.04  ? 125 VAL B CA  1 
ATOM   688  C  C   . VAL A 1 106 ? 26.795 -1.432  22.159  1.00 14.95  ? 125 VAL B C   1 
ATOM   689  O  O   . VAL A 1 106 ? 27.405 -2.273  22.821  1.00 17.89  ? 125 VAL B O   1 
ATOM   690  C  CB  . VAL A 1 106 ? 26.510 -2.731  20.063  1.00 17.65  ? 125 VAL B CB  1 
ATOM   691  C  CG1 . VAL A 1 106 ? 25.130 -3.116  20.610  1.00 17.19  ? 125 VAL B CG1 1 
ATOM   692  C  CG2 . VAL A 1 106 ? 26.524 -2.672  18.529  1.00 15.29  ? 125 VAL B CG2 1 
ATOM   693  N  N   . THR A 1 107 ? 25.975 -0.536  22.708  1.00 13.52  ? 126 THR B N   1 
ATOM   694  C  CA  . THR A 1 107 ? 25.667 -0.535  24.142  1.00 13.63  ? 126 THR B CA  1 
ATOM   695  C  C   . THR A 1 107 ? 24.453 -1.404  24.505  1.00 18.49  ? 126 THR B C   1 
ATOM   696  O  O   . THR A 1 107 ? 24.399 -1.957  25.598  1.00 16.20  ? 126 THR B O   1 
ATOM   697  C  CB  . THR A 1 107 ? 25.398 0.889   24.657  1.00 14.76  ? 126 THR B CB  1 
ATOM   698  O  OG1 . THR A 1 107 ? 24.362 1.488   23.876  1.00 16.73  ? 126 THR B OG1 1 
ATOM   699  C  CG2 . THR A 1 107 ? 26.672 1.759   24.567  1.00 16.18  ? 126 THR B CG2 1 
ATOM   700  N  N   . GLU A 1 108 ? 23.480 -1.487  23.596  1.00 18.23  ? 127 GLU B N   1 
ATOM   701  C  CA  . GLU A 1 108 ? 22.271 -2.304  23.762  1.00 20.14  ? 127 GLU B CA  1 
ATOM   702  C  C   . GLU A 1 108 ? 21.902 -2.897  22.411  1.00 20.21  ? 127 GLU B C   1 
ATOM   703  O  O   . GLU A 1 108 ? 21.772 -2.154  21.439  1.00 15.80  ? 127 GLU B O   1 
ATOM   704  C  CB  . GLU A 1 108 ? 21.070 -1.445  24.190  1.00 20.02  ? 127 GLU B CB  1 
ATOM   705  C  CG  . GLU A 1 108 ? 20.966 -1.104  25.657  1.00 21.72  ? 127 GLU B CG  1 
ATOM   706  C  CD  . GLU A 1 108 ? 20.625 -2.313  26.471  1.00 15.00  ? 127 GLU B CD  1 
ATOM   707  O  OE1 . GLU A 1 108 ? 19.426 -2.576  26.723  1.00 16.12  ? 127 GLU B OE1 1 
ATOM   708  O  OE2 . GLU A 1 108 ? 21.571 -3.016  26.838  1.00 17.13  ? 127 GLU B OE2 1 
ATOM   709  N  N   . GLY A 1 109 ? 21.731 -4.217  22.358  1.00 20.31  ? 128 GLY B N   1 
ATOM   710  C  CA  . GLY A 1 109 ? 21.163 -4.883  21.196  1.00 18.07  ? 128 GLY B CA  1 
ATOM   711  C  C   . GLY A 1 109 ? 19.801 -5.441  21.589  1.00 13.95  ? 128 GLY B C   1 
ATOM   712  O  O   . GLY A 1 109 ? 18.918 -4.697  22.020  1.00 17.49  ? 128 GLY B O   1 
ATOM   713  N  N   . TRP A 1 110 ? 19.628 -6.755  21.472  1.00 12.70  ? 129 TRP B N   1 
ATOM   714  C  CA  . TRP A 1 110 ? 18.418 -7.376  21.999  1.00 17.70  ? 129 TRP B CA  1 
ATOM   715  C  C   . TRP A 1 110 ? 18.424 -7.219  23.509  1.00 18.59  ? 129 TRP B C   1 
ATOM   716  O  O   . TRP A 1 110 ? 19.464 -7.385  24.145  1.00 18.06  ? 129 TRP B O   1 
ATOM   717  C  CB  . TRP A 1 110 ? 18.343 -8.854  21.622  1.00 16.14  ? 129 TRP B CB  1 
ATOM   718  C  CG  . TRP A 1 110 ? 17.226 -9.570  22.327  1.00 15.34  ? 129 TRP B CG  1 
ATOM   719  C  CD1 . TRP A 1 110 ? 15.898 -9.549  22.004  1.00 19.08  ? 129 TRP B CD1 1 
ATOM   720  C  CD2 . TRP A 1 110 ? 17.347 -10.416 23.471  1.00 18.87  ? 129 TRP B CD2 1 
ATOM   721  N  NE1 . TRP A 1 110 ? 15.183 -10.333 22.885  1.00 21.71  ? 129 TRP B NE1 1 
ATOM   722  C  CE2 . TRP A 1 110 ? 16.052 -10.873 23.798  1.00 18.07  ? 129 TRP B CE2 1 
ATOM   723  C  CE3 . TRP A 1 110 ? 18.425 -10.823 24.258  1.00 14.28  ? 129 TRP B CE3 1 
ATOM   724  C  CZ2 . TRP A 1 110 ? 15.809 -11.725 24.876  1.00 20.93  ? 129 TRP B CZ2 1 
ATOM   725  C  CZ3 . TRP A 1 110 ? 18.182 -11.668 25.327  1.00 19.62  ? 129 TRP B CZ3 1 
ATOM   726  C  CH2 . TRP A 1 110 ? 16.886 -12.111 25.625  1.00 23.60  ? 129 TRP B CH2 1 
ATOM   727  N  N   . ASP A 1 111 ? 17.275 -6.866  24.080  1.00 16.55  ? 130 ASP B N   1 
ATOM   728  C  CA  . ASP A 1 111 ? 17.209 -6.581  25.506  1.00 16.19  ? 130 ASP B CA  1 
ATOM   729  C  C   . ASP A 1 111 ? 16.247 -7.482  26.276  1.00 17.71  ? 130 ASP B C   1 
ATOM   730  O  O   . ASP A 1 111 ? 15.153 -7.793  25.810  1.00 19.48  ? 130 ASP B O   1 
ATOM   731  C  CB  . ASP A 1 111 ? 16.811 -5.131  25.781  1.00 14.28  ? 130 ASP B CB  1 
ATOM   732  C  CG  . ASP A 1 111 ? 16.725 -4.846  27.272  1.00 20.19  ? 130 ASP B CG  1 
ATOM   733  O  OD1 . ASP A 1 111 ? 17.752 -5.012  27.934  1.00 18.88  ? 130 ASP B OD1 1 
ATOM   734  O  OD2 . ASP A 1 111 ? 15.645 -4.493  27.796  1.00 18.15  ? 130 ASP B OD2 1 
ATOM   735  N  N   . GLU A 1 112 ? 16.667 -7.878  27.472  1.00 17.76  ? 131 GLU B N   1 
ATOM   736  C  CA  . GLU A 1 112 ? 15.791 -8.553  28.420  1.00 16.73  ? 131 GLU B CA  1 
ATOM   737  C  C   . GLU A 1 112 ? 15.839 -7.889  29.798  1.00 21.74  ? 131 GLU B C   1 
ATOM   738  O  O   . GLU A 1 112 ? 15.217 -8.372  30.735  1.00 20.26  ? 131 GLU B O   1 
ATOM   739  C  CB  . GLU A 1 112 ? 16.161 -10.031 28.549  1.00 18.35  ? 131 GLU B CB  1 
ATOM   740  C  CG  . GLU A 1 112 ? 17.576 -10.265 29.041  1.00 19.08  ? 131 GLU B CG  1 
ATOM   741  C  CD  . GLU A 1 112 ? 17.956 -11.740 29.076  1.00 26.66  ? 131 GLU B CD  1 
ATOM   742  O  OE1 . GLU A 1 112 ? 17.050 -12.612 29.025  1.00 25.03  ? 131 GLU B OE1 1 
ATOM   743  O  OE2 . GLU A 1 112 ? 19.171 -12.023 29.146  1.00 27.88  ? 131 GLU B OE2 1 
ATOM   744  N  N   . ASP A 1 113 ? 16.569 -6.787  29.928  1.00 21.02  ? 132 ASP B N   1 
ATOM   745  C  CA  . ASP A 1 113 ? 16.646 -6.082  31.217  1.00 15.61  ? 132 ASP B CA  1 
ATOM   746  C  C   . ASP A 1 113 ? 15.397 -5.272  31.505  1.00 22.27  ? 132 ASP B C   1 
ATOM   747  O  O   . ASP A 1 113 ? 15.045 -5.058  32.666  1.00 24.36  ? 132 ASP B O   1 
ATOM   748  C  CB  . ASP A 1 113 ? 17.878 -5.185  31.256  1.00 20.09  ? 132 ASP B CB  1 
ATOM   749  C  CG  . ASP A 1 113 ? 19.157 -5.978  31.202  1.00 18.15  ? 132 ASP B CG  1 
ATOM   750  O  OD1 . ASP A 1 113 ? 19.481 -6.644  32.206  1.00 19.81  ? 132 ASP B OD1 1 
ATOM   751  O  OD2 . ASP A 1 113 ? 19.827 -5.967  30.154  1.00 18.24  ? 132 ASP B OD2 1 
ATOM   752  N  N   . GLY A 1 114 ? 14.753 -4.794  30.444  1.00 20.48  ? 133 GLY B N   1 
ATOM   753  C  CA  . GLY A 1 114 ? 13.431 -4.209  30.551  1.00 20.54  ? 133 GLY B CA  1 
ATOM   754  C  C   . GLY A 1 114 ? 13.347 -2.711  30.791  1.00 21.27  ? 133 GLY B C   1 
ATOM   755  O  O   . GLY A 1 114 ? 12.311 -2.211  31.226  1.00 23.55  ? 133 GLY B O   1 
ATOM   756  N  N   . HIS A 1 115 ? 14.409 -1.977  30.503  1.00 19.29  ? 134 HIS B N   1 
ATOM   757  C  CA  . HIS A 1 115 ? 14.370 -0.540  30.738  1.00 20.99  ? 134 HIS B CA  1 
ATOM   758  C  C   . HIS A 1 115 ? 13.876 0.237   29.519  1.00 25.56  ? 134 HIS B C   1 
ATOM   759  O  O   . HIS A 1 115 ? 13.674 1.448   29.592  1.00 26.57  ? 134 HIS B O   1 
ATOM   760  C  CB  . HIS A 1 115 ? 15.725 0.001   31.236  1.00 26.66  ? 134 HIS B CB  1 
ATOM   761  C  CG  . HIS A 1 115 ? 16.883 -0.317  30.338  1.00 25.72  ? 134 HIS B CG  1 
ATOM   762  N  ND1 . HIS A 1 115 ? 17.197 0.443   29.232  1.00 27.89  ? 134 HIS B ND1 1 
ATOM   763  C  CD2 . HIS A 1 115 ? 17.809 -1.302  30.393  1.00 30.60  ? 134 HIS B CD2 1 
ATOM   764  C  CE1 . HIS A 1 115 ? 18.260 -0.066  28.636  1.00 28.42  ? 134 HIS B CE1 1 
ATOM   765  N  NE2 . HIS A 1 115 ? 18.655 -1.123  29.322  1.00 24.38  ? 134 HIS B NE2 1 
ATOM   766  N  N   . HIS A 1 116 ? 13.668 -0.457  28.404  1.00 20.08  ? 135 HIS B N   1 
ATOM   767  C  CA  . HIS A 1 116 ? 13.182 0.202   27.199  1.00 16.86  ? 135 HIS B CA  1 
ATOM   768  C  C   . HIS A 1 116 ? 11.659 0.316   27.208  1.00 22.61  ? 135 HIS B C   1 
ATOM   769  O  O   . HIS A 1 116 ? 10.963 -0.481  27.846  1.00 16.94  ? 135 HIS B O   1 
ATOM   770  C  CB  . HIS A 1 116 ? 13.670 -0.534  25.950  1.00 16.48  ? 135 HIS B CB  1 
ATOM   771  C  CG  . HIS A 1 116 ? 15.156 -0.685  25.878  1.00 15.64  ? 135 HIS B CG  1 
ATOM   772  N  ND1 . HIS A 1 116 ? 15.993 0.330   25.457  1.00 20.12  ? 135 HIS B ND1 1 
ATOM   773  C  CD2 . HIS A 1 116 ? 15.958 -1.740  26.157  1.00 15.73  ? 135 HIS B CD2 1 
ATOM   774  C  CE1 . HIS A 1 116 ? 17.244 -0.089  25.490  1.00 17.72  ? 135 HIS B CE1 1 
ATOM   775  N  NE2 . HIS A 1 116 ? 17.249 -1.342  25.916  1.00 19.22  ? 135 HIS B NE2 1 
ATOM   776  N  N   . ALA A 1 117 ? 11.138 1.321   26.513  1.00 23.78  ? 136 ALA B N   1 
ATOM   777  C  CA  . ALA A 1 117 ? 9.696  1.549   26.472  1.00 22.84  ? 136 ALA B CA  1 
ATOM   778  C  C   . ALA A 1 117 ? 8.925  0.379   25.876  1.00 28.68  ? 136 ALA B C   1 
ATOM   779  O  O   . ALA A 1 117 ? 9.481  -0.431  25.132  1.00 25.57  ? 136 ALA B O   1 
ATOM   780  C  CB  . ALA A 1 117 ? 9.394  2.808   25.694  1.00 28.88  ? 136 ALA B CB  1 
ATOM   781  N  N   . GLN A 1 118 ? 7.634  0.312   26.189  1.00 25.26  ? 137 GLN B N   1 
ATOM   782  C  CA  . GLN A 1 118 ? 6.745  -0.671  25.585  1.00 28.14  ? 137 GLN B CA  1 
ATOM   783  C  C   . GLN A 1 118 ? 6.869  -0.631  24.063  1.00 19.58  ? 137 GLN B C   1 
ATOM   784  O  O   . GLN A 1 118 ? 6.964  0.446   23.461  1.00 26.56  ? 137 GLN B O   1 
ATOM   785  C  CB  . GLN A 1 118 ? 5.292  -0.395  25.993  1.00 40.87  ? 137 GLN B CB  1 
ATOM   786  C  CG  . GLN A 1 118 ? 4.261  -1.262  25.272  1.00 52.00  ? 137 GLN B CG  1 
ATOM   787  C  CD  . GLN A 1 118 ? 4.312  -2.721  25.701  1.00 61.76  ? 137 GLN B CD  1 
ATOM   788  O  OE1 . GLN A 1 118 ? 4.797  -3.046  26.788  1.00 65.37  ? 137 GLN B OE1 1 
ATOM   789  N  NE2 . GLN A 1 118 ? 3.807  -3.609  24.847  1.00 63.29  ? 137 GLN B NE2 1 
ATOM   790  N  N   . ASP A 1 119 ? 6.903  -1.799  23.436  1.00 22.83  ? 138 ASP B N   1 
ATOM   791  C  CA  . ASP A 1 119 ? 6.995  -1.874  21.980  1.00 21.84  ? 138 ASP B CA  1 
ATOM   792  C  C   . ASP A 1 119 ? 8.351  -1.458  21.419  1.00 21.40  ? 138 ASP B C   1 
ATOM   793  O  O   . ASP A 1 119 ? 8.479  -1.283  20.206  1.00 20.14  ? 138 ASP B O   1 
ATOM   794  C  CB  . ASP A 1 119 ? 5.919  -1.009  21.328  1.00 31.67  ? 138 ASP B CB  1 
ATOM   795  C  CG  . ASP A 1 119 ? 4.533  -1.551  21.549  1.00 40.12  ? 138 ASP B CG  1 
ATOM   796  O  OD1 . ASP A 1 119 ? 4.399  -2.774  21.745  1.00 46.48  ? 138 ASP B OD1 1 
ATOM   797  O  OD2 . ASP A 1 119 ? 3.581  -0.750  21.514  1.00 40.62  ? 138 ASP B OD2 1 
ATOM   798  N  N   . SER A 1 120 ? 9.351  -1.278  22.281  1.00 18.68  ? 139 SER B N   1 
ATOM   799  C  CA  . SER A 1 120 ? 10.685 -0.957  21.789  1.00 18.73  ? 139 SER B CA  1 
ATOM   800  C  C   . SER A 1 120 ? 11.171 -2.076  20.868  1.00 21.24  ? 139 SER B C   1 
ATOM   801  O  O   . SER A 1 120 ? 10.954 -3.261  21.146  1.00 17.64  ? 139 SER B O   1 
ATOM   802  C  CB  . SER A 1 120 ? 11.664 -0.771  22.952  1.00 14.71  ? 139 SER B CB  1 
ATOM   803  O  OG  . SER A 1 120 ? 13.022 -0.814  22.525  1.00 17.65  ? 139 SER B OG  1 
ATOM   804  N  N   . LEU A 1 121 ? 11.837 -1.706  19.779  1.00 15.10  ? 140 LEU B N   1 
ATOM   805  C  CA  . LEU A 1 121 ? 12.358 -2.716  18.862  1.00 18.81  ? 140 LEU B CA  1 
ATOM   806  C  C   . LEU A 1 121 ? 13.584 -3.441  19.452  1.00 18.17  ? 140 LEU B C   1 
ATOM   807  O  O   . LEU A 1 121 ? 14.025 -4.476  18.937  1.00 15.45  ? 140 LEU B O   1 
ATOM   808  C  CB  . LEU A 1 121 ? 12.629 -2.108  17.480  1.00 17.98  ? 140 LEU B CB  1 
ATOM   809  C  CG  . LEU A 1 121 ? 11.364 -1.676  16.711  1.00 18.46  ? 140 LEU B CG  1 
ATOM   810  C  CD1 . LEU A 1 121 ? 11.700 -1.159  15.329  1.00 19.34  ? 140 LEU B CD1 1 
ATOM   811  C  CD2 . LEU A 1 121 ? 10.371 -2.826  16.579  1.00 22.06  ? 140 LEU B CD2 1 
ATOM   812  N  N   . HIS A 1 122 ? 14.115 -2.922  20.554  1.00 14.98  ? 141 HIS B N   1 
ATOM   813  C  CA  . HIS A 1 122 ? 15.186 -3.619  21.261  1.00 18.75  ? 141 HIS B CA  1 
ATOM   814  C  C   . HIS A 1 122 ? 14.734 -4.981  21.754  1.00 20.73  ? 141 HIS B C   1 
ATOM   815  O  O   . HIS A 1 122 ? 15.554 -5.865  21.949  1.00 18.63  ? 141 HIS B O   1 
ATOM   816  C  CB  . HIS A 1 122 ? 15.698 -2.817  22.463  1.00 15.15  ? 141 HIS B CB  1 
ATOM   817  C  CG  . HIS A 1 122 ? 16.564 -1.661  22.085  1.00 16.97  ? 141 HIS B CG  1 
ATOM   818  N  ND1 . HIS A 1 122 ? 17.880 -1.816  21.710  1.00 15.76  ? 141 HIS B ND1 1 
ATOM   819  C  CD2 . HIS A 1 122 ? 16.314 -0.331  22.046  1.00 15.16  ? 141 HIS B CD2 1 
ATOM   820  C  CE1 . HIS A 1 122 ? 18.396 -0.635  21.428  1.00 12.91  ? 141 HIS B CE1 1 
ATOM   821  N  NE2 . HIS A 1 122 ? 17.468 0.283   21.629  1.00 17.17  ? 141 HIS B NE2 1 
ATOM   822  N  N   . TYR A 1 123 ? 13.436 -5.135  21.981  1.00 18.93  ? 142 TYR B N   1 
ATOM   823  C  CA  . TYR A 1 123 ? 12.906 -6.375  22.537  1.00 19.78  ? 142 TYR B CA  1 
ATOM   824  C  C   . TYR A 1 123 ? 12.824 -7.459  21.475  1.00 18.99  ? 142 TYR B C   1 
ATOM   825  O  O   . TYR A 1 123 ? 12.542 -8.601  21.775  1.00 21.81  ? 142 TYR B O   1 
ATOM   826  C  CB  . TYR A 1 123 ? 11.537 -6.150  23.208  1.00 14.77  ? 142 TYR B CB  1 
ATOM   827  C  CG  . TYR A 1 123 ? 11.641 -5.301  24.451  1.00 17.76  ? 142 TYR B CG  1 
ATOM   828  C  CD1 . TYR A 1 123 ? 12.548 -5.626  25.450  1.00 21.88  ? 142 TYR B CD1 1 
ATOM   829  C  CD2 . TYR A 1 123 ? 10.847 -4.170  24.629  1.00 14.58  ? 142 TYR B CD2 1 
ATOM   830  C  CE1 . TYR A 1 123 ? 12.669 -4.849  26.600  1.00 21.98  ? 142 TYR B CE1 1 
ATOM   831  C  CE2 . TYR A 1 123 ? 10.960 -3.378  25.792  1.00 15.44  ? 142 TYR B CE2 1 
ATOM   832  C  CZ  . TYR A 1 123 ? 11.869 -3.729  26.762  1.00 21.99  ? 142 TYR B CZ  1 
ATOM   833  O  OH  . TYR A 1 123 ? 11.993 -2.962  27.903  1.00 25.65  ? 142 TYR B OH  1 
ATOM   834  N  N   . GLU A 1 124 ? 13.110 -7.103  20.232  1.00 13.36  ? 143 GLU B N   1 
ATOM   835  C  CA  . GLU A 1 124 ? 12.930 -8.042  19.134  1.00 18.70  ? 143 GLU B CA  1 
ATOM   836  C  C   . GLU A 1 124 ? 14.204 -8.316  18.340  1.00 19.39  ? 143 GLU B C   1 
ATOM   837  O  O   . GLU A 1 124 ? 14.166 -8.990  17.320  1.00 19.02  ? 143 GLU B O   1 
ATOM   838  C  CB  . GLU A 1 124 ? 11.827 -7.510  18.222  1.00 21.03  ? 143 GLU B CB  1 
ATOM   839  C  CG  . GLU A 1 124 ? 10.616 -7.085  19.025  1.00 28.64  ? 143 GLU B CG  1 
ATOM   840  C  CD  . GLU A 1 124 ? 9.374  -6.878  18.189  1.00 29.01  ? 143 GLU B CD  1 
ATOM   841  O  OE1 . GLU A 1 124 ? 9.309  -7.381  17.046  1.00 27.00  ? 143 GLU B OE1 1 
ATOM   842  O  OE2 . GLU A 1 124 ? 8.455  -6.215  18.697  1.00 26.47  ? 143 GLU B OE2 1 
ATOM   843  N  N   . GLY A 1 125 ? 15.331 -7.801  18.817  1.00 19.83  ? 144 GLY B N   1 
ATOM   844  C  CA  . GLY A 1 125 ? 16.592 -7.972  18.119  1.00 16.81  ? 144 GLY B CA  1 
ATOM   845  C  C   . GLY A 1 125 ? 16.687 -7.075  16.904  1.00 21.93  ? 144 GLY B C   1 
ATOM   846  O  O   . GLY A 1 125 ? 17.519 -7.309  16.012  1.00 17.05  ? 144 GLY B O   1 
ATOM   847  N  N   . ARG A 1 126 ? 15.849 -6.040  16.874  1.00 13.92  ? 145 ARG B N   1 
ATOM   848  C  CA  . ARG A 1 126 ? 15.743 -5.176  15.690  1.00 16.54  ? 145 ARG B CA  1 
ATOM   849  C  C   . ARG A 1 126 ? 16.293 -3.764  15.897  1.00 15.43  ? 145 ARG B C   1 
ATOM   850  O  O   . ARG A 1 126 ? 16.203 -2.918  15.005  1.00 16.85  ? 145 ARG B O   1 
ATOM   851  C  CB  . ARG A 1 126 ? 14.290 -5.121  15.196  1.00 15.20  ? 145 ARG B CB  1 
ATOM   852  C  CG  . ARG A 1 126 ? 13.814 -6.394  14.517  1.00 13.23  ? 145 ARG B CG  1 
ATOM   853  C  CD  . ARG A 1 126 ? 12.274 -6.401  14.349  1.00 18.90  ? 145 ARG B CD  1 
ATOM   854  N  NE  . ARG A 1 126 ? 11.795 -5.180  13.701  1.00 22.66  ? 145 ARG B NE  1 
ATOM   855  C  CZ  . ARG A 1 126 ? 10.525 -4.775  13.672  1.00 23.82  ? 145 ARG B CZ  1 
ATOM   856  N  NH1 . ARG A 1 126 ? 9.573  -5.484  14.258  1.00 18.02  ? 145 ARG B NH1 1 
ATOM   857  N  NH2 . ARG A 1 126 ? 10.208 -3.638  13.058  1.00 24.67  ? 145 ARG B NH2 1 
ATOM   858  N  N   . ALA A 1 127 ? 16.858 -3.500  17.070  1.00 17.59  ? 146 ALA B N   1 
ATOM   859  C  CA  . ALA A 1 127 ? 17.382 -2.165  17.380  1.00 15.24  ? 146 ALA B CA  1 
ATOM   860  C  C   . ALA A 1 127 ? 18.695 -2.206  18.163  1.00 11.42  ? 146 ALA B C   1 
ATOM   861  O  O   . ALA A 1 127 ? 18.896 -3.059  19.031  1.00 19.19  ? 146 ALA B O   1 
ATOM   862  C  CB  . ALA A 1 127 ? 16.339 -1.357  18.145  1.00 18.26  ? 146 ALA B CB  1 
ATOM   863  N  N   . LEU A 1 128 ? 19.579 -1.251  17.876  1.00 13.58  ? 147 LEU B N   1 
ATOM   864  C  CA  . LEU A 1 128 ? 20.853 -1.145  18.569  1.00 16.19  ? 147 LEU B CA  1 
ATOM   865  C  C   . LEU A 1 128 ? 21.065 0.275   19.078  1.00 13.75  ? 147 LEU B C   1 
ATOM   866  O  O   . LEU A 1 128 ? 20.741 1.241   18.392  1.00 16.90  ? 147 LEU B O   1 
ATOM   867  C  CB  . LEU A 1 128 ? 21.992 -1.468  17.616  1.00 14.27  ? 147 LEU B CB  1 
ATOM   868  C  CG  . LEU A 1 128 ? 21.917 -2.755  16.830  1.00 13.62  ? 147 LEU B CG  1 
ATOM   869  C  CD1 . LEU A 1 128 ? 23.068 -2.726  15.821  1.00 20.46  ? 147 LEU B CD1 1 
ATOM   870  C  CD2 . LEU A 1 128 ? 22.038 -3.945  17.767  1.00 12.88  ? 147 LEU B CD2 1 
ATOM   871  N  N   . ASP A 1 129 ? 21.611 0.413   20.279  1.00 16.85  ? 148 ASP B N   1 
ATOM   872  C  CA  . ASP A 1 129 ? 22.131 1.721   20.676  1.00 18.25  ? 148 ASP B CA  1 
ATOM   873  C  C   . ASP A 1 129 ? 23.612 1.703   20.453  1.00 16.36  ? 148 ASP B C   1 
ATOM   874  O  O   . ASP A 1 129 ? 24.275 0.750   20.864  1.00 15.53  ? 148 ASP B O   1 
ATOM   875  C  CB  . ASP A 1 129 ? 21.795 2.012   22.122  1.00 18.06  ? 148 ASP B CB  1 
ATOM   876  C  CG  . ASP A 1 129 ? 20.338 2.324   22.292  1.00 18.64  ? 148 ASP B CG  1 
ATOM   877  O  OD1 . ASP A 1 129 ? 19.770 2.835   21.303  1.00 16.61  ? 148 ASP B OD1 1 
ATOM   878  O  OD2 . ASP A 1 129 ? 19.775 2.053   23.366  1.00 18.48  ? 148 ASP B OD2 1 
ATOM   879  N  N   . ILE A 1 130 ? 24.126 2.732   19.783  1.00 15.61  ? 149 ILE B N   1 
ATOM   880  C  CA  . ILE A 1 130 ? 25.499 2.704   19.315  1.00 14.64  ? 149 ILE B CA  1 
ATOM   881  C  C   . ILE A 1 130 ? 26.270 3.966   19.666  1.00 13.70  ? 149 ILE B C   1 
ATOM   882  O  O   . ILE A 1 130 ? 25.685 5.038   19.888  1.00 15.05  ? 149 ILE B O   1 
ATOM   883  C  CB  . ILE A 1 130 ? 25.573 2.467   17.784  1.00 17.16  ? 149 ILE B CB  1 
ATOM   884  C  CG1 . ILE A 1 130 ? 24.842 3.584   17.033  1.00 17.08  ? 149 ILE B CG1 1 
ATOM   885  C  CG2 . ILE A 1 130 ? 25.017 1.084   17.435  1.00 16.05  ? 149 ILE B CG2 1 
ATOM   886  C  CD1 . ILE A 1 130 ? 25.008 3.530   15.530  1.00 13.66  ? 149 ILE B CD1 1 
ATOM   887  N  N   . THR A 1 131 ? 27.588 3.805   19.753  1.00 16.01  ? 150 THR B N   1 
ATOM   888  C  CA  . THR A 1 131 ? 28.514 4.923   19.882  1.00 14.74  ? 150 THR B CA  1 
ATOM   889  C  C   . THR A 1 131 ? 29.729 4.557   19.039  1.00 17.70  ? 150 THR B C   1 
ATOM   890  O  O   . THR A 1 131 ? 29.771 3.478   18.446  1.00 16.37  ? 150 THR B O   1 
ATOM   891  C  CB  . THR A 1 131 ? 28.999 5.118   21.338  1.00 19.69  ? 150 THR B CB  1 
ATOM   892  O  OG1 . THR A 1 131 ? 29.888 4.050   21.692  1.00 15.59  ? 150 THR B OG1 1 
ATOM   893  C  CG2 . THR A 1 131 ? 27.815 5.173   22.330  1.00 21.05  ? 150 THR B CG2 1 
ATOM   894  N  N   . THR A 1 132 ? 30.720 5.441   18.979  1.00 16.99  ? 151 THR B N   1 
ATOM   895  C  CA  . THR A 1 132 ? 32.018 5.033   18.444  1.00 17.73  ? 151 THR B CA  1 
ATOM   896  C  C   . THR A 1 132 ? 32.828 4.438   19.589  1.00 19.15  ? 151 THR B C   1 
ATOM   897  O  O   . THR A 1 132 ? 32.523 4.677   20.755  1.00 20.89  ? 151 THR B O   1 
ATOM   898  C  CB  . THR A 1 132 ? 32.795 6.209   17.810  1.00 17.92  ? 151 THR B CB  1 
ATOM   899  O  OG1 . THR A 1 132 ? 32.791 7.323   18.709  1.00 20.75  ? 151 THR B OG1 1 
ATOM   900  C  CG2 . THR A 1 132 ? 32.159 6.628   16.494  1.00 17.58  ? 151 THR B CG2 1 
ATOM   901  N  N   . SER A 1 133 ? 33.857 3.665   19.261  1.00 20.47  ? 152 SER B N   1 
ATOM   902  C  CA  . SER A 1 133 ? 34.652 2.995   20.285  1.00 20.59  ? 152 SER B CA  1 
ATOM   903  C  C   . SER A 1 133 ? 35.399 3.971   21.195  1.00 23.47  ? 152 SER B C   1 
ATOM   904  O  O   . SER A 1 133 ? 35.776 3.633   22.324  1.00 18.28  ? 152 SER B O   1 
ATOM   905  C  CB  . SER A 1 133 ? 35.648 2.042   19.630  1.00 21.16  ? 152 SER B CB  1 
ATOM   906  O  OG  . SER A 1 133 ? 36.478 2.727   18.708  1.00 19.95  ? 152 SER B OG  1 
ATOM   907  N  N   . ASP A 1 134 ? 35.617 5.177   20.701  1.00 21.11  ? 153 ASP B N   1 
ATOM   908  C  CA  . ASP A 1 134 ? 36.311 6.206   21.492  1.00 22.64  ? 153 ASP B CA  1 
ATOM   909  C  C   . ASP A 1 134 ? 35.370 7.122   22.297  1.00 20.60  ? 153 ASP B C   1 
ATOM   910  O  O   . ASP A 1 134 ? 35.823 8.051   22.970  1.00 18.35  ? 153 ASP B O   1 
ATOM   911  C  CB  . ASP A 1 134 ? 37.250 7.028   20.601  1.00 25.98  ? 153 ASP B CB  1 
ATOM   912  C  CG  . ASP A 1 134 ? 36.516 7.831   19.558  1.00 28.35  ? 153 ASP B CG  1 
ATOM   913  O  OD1 . ASP A 1 134 ? 35.263 7.797   19.536  1.00 25.14  ? 153 ASP B OD1 1 
ATOM   914  O  OD2 . ASP A 1 134 ? 37.201 8.503   18.758  1.00 24.02  ? 153 ASP B OD2 1 
ATOM   915  N  N   . ARG A 1 135 ? 34.073 6.827   22.254  1.00 18.94  ? 154 ARG B N   1 
ATOM   916  C  CA  . ARG A 1 135 ? 33.051 7.618   22.945  1.00 25.62  ? 154 ARG B CA  1 
ATOM   917  C  C   . ARG A 1 135 ? 33.156 9.113   22.634  1.00 22.39  ? 154 ARG B C   1 
ATOM   918  O  O   . ARG A 1 135 ? 32.839 9.939   23.472  1.00 25.83  ? 154 ARG B O   1 
ATOM   919  C  CB  . ARG A 1 135 ? 33.100 7.396   24.463  1.00 24.81  ? 154 ARG B CB  1 
ATOM   920  C  CG  . ARG A 1 135 ? 32.612 6.031   24.953  1.00 28.48  ? 154 ARG B CG  1 
ATOM   921  C  CD  . ARG A 1 135 ? 33.666 4.938   24.756  1.00 27.27  ? 154 ARG B CD  1 
ATOM   922  N  NE  . ARG A 1 135 ? 33.509 3.845   25.712  1.00 29.15  ? 154 ARG B NE  1 
ATOM   923  C  CZ  . ARG A 1 135 ? 34.015 2.620   25.559  1.00 31.84  ? 154 ARG B CZ  1 
ATOM   924  N  NH1 . ARG A 1 135 ? 34.713 2.303   24.470  1.00 25.13  ? 154 ARG B NH1 1 
ATOM   925  N  NH2 . ARG A 1 135 ? 33.821 1.700   26.497  1.00 27.32  ? 154 ARG B NH2 1 
ATOM   926  N  N   . ASP A 1 136 ? 33.604 9.468   21.436  1.00 25.07  ? 155 ASP B N   1 
ATOM   927  C  CA  . ASP A 1 136 ? 33.719 10.881  21.083  1.00 27.48  ? 155 ASP B CA  1 
ATOM   928  C  C   . ASP A 1 136 ? 32.375 11.419  20.599  1.00 24.47  ? 155 ASP B C   1 
ATOM   929  O  O   . ASP A 1 136 ? 31.961 11.157  19.475  1.00 21.66  ? 155 ASP B O   1 
ATOM   930  C  CB  . ASP A 1 136 ? 34.792 11.105  20.017  1.00 25.64  ? 155 ASP B CB  1 
ATOM   931  C  CG  . ASP A 1 136 ? 34.850 12.547  19.541  1.00 27.26  ? 155 ASP B CG  1 
ATOM   932  O  OD1 . ASP A 1 136 ? 34.091 13.387  20.082  1.00 28.04  ? 155 ASP B OD1 1 
ATOM   933  O  OD2 . ASP A 1 136 ? 35.647 12.847  18.625  1.00 26.98  ? 155 ASP B OD2 1 
ATOM   934  N  N   . ARG A 1 137 ? 31.697 12.187  21.442  1.00 21.56  ? 156 ARG B N   1 
ATOM   935  C  CA  . ARG A 1 137 ? 30.335 12.605  21.108  1.00 25.76  ? 156 ARG B CA  1 
ATOM   936  C  C   . ARG A 1 137 ? 30.270 13.447  19.840  1.00 23.26  ? 156 ARG B C   1 
ATOM   937  O  O   . ARG A 1 137 ? 29.244 13.506  19.173  1.00 25.63  ? 156 ARG B O   1 
ATOM   938  C  CB  . ARG A 1 137 ? 29.682 13.318  22.287  1.00 30.15  ? 156 ARG B CB  1 
ATOM   939  C  CG  . ARG A 1 137 ? 29.231 12.351  23.372  1.00 34.75  ? 156 ARG B CG  1 
ATOM   940  C  CD  . ARG A 1 137 ? 29.252 13.012  24.728  1.00 45.13  ? 156 ARG B CD  1 
ATOM   941  N  NE  . ARG A 1 137 ? 28.783 12.128  25.795  1.00 50.30  ? 156 ARG B NE  1 
ATOM   942  C  CZ  . ARG A 1 137 ? 29.428 11.045  26.221  1.00 46.57  ? 156 ARG B CZ  1 
ATOM   943  N  NH1 . ARG A 1 137 ? 30.569 10.662  25.655  1.00 44.71  ? 156 ARG B NH1 1 
ATOM   944  N  NH2 . ARG A 1 137 ? 28.923 10.330  27.215  1.00 43.55  ? 156 ARG B NH2 1 
ATOM   945  N  N   . ASN A 1 138 ? 31.375 14.100  19.507  1.00 21.28  ? 157 ASN B N   1 
ATOM   946  C  CA  . ASN A 1 138 ? 31.438 14.879  18.276  1.00 27.20  ? 157 ASN B CA  1 
ATOM   947  C  C   . ASN A 1 138 ? 31.263 14.048  17.009  1.00 24.90  ? 157 ASN B C   1 
ATOM   948  O  O   . ASN A 1 138 ? 30.937 14.592  15.965  1.00 23.25  ? 157 ASN B O   1 
ATOM   949  C  CB  . ASN A 1 138 ? 32.740 15.680  18.206  1.00 32.28  ? 157 ASN B CB  1 
ATOM   950  C  CG  . ASN A 1 138 ? 32.536 17.125  18.567  1.00 44.13  ? 157 ASN B CG  1 
ATOM   951  O  OD1 . ASN A 1 138 ? 32.902 18.022  17.804  1.00 54.55  ? 157 ASN B OD1 1 
ATOM   952  N  ND2 . ASN A 1 138 ? 31.902 17.365  19.713  1.00 41.20  ? 157 ASN B ND2 1 
ATOM   953  N  N   . LYS A 1 139 ? 31.471 12.734  17.116  1.00 21.23  ? 158 LYS B N   1 
ATOM   954  C  CA  . LYS A 1 139 ? 31.310 11.821  15.974  1.00 19.23  ? 158 LYS B CA  1 
ATOM   955  C  C   . LYS A 1 139 ? 29.894 11.272  15.803  1.00 16.93  ? 158 LYS B C   1 
ATOM   956  O  O   . LYS A 1 139 ? 29.592 10.661  14.782  1.00 21.64  ? 158 LYS B O   1 
ATOM   957  C  CB  . LYS A 1 139 ? 32.256 10.616  16.114  1.00 17.29  ? 158 LYS B CB  1 
ATOM   958  C  CG  . LYS A 1 139 ? 33.749 10.967  16.060  1.00 25.92  ? 158 LYS B CG  1 
ATOM   959  C  CD  . LYS A 1 139 ? 34.622 9.708   16.079  1.00 22.45  ? 158 LYS B CD  1 
ATOM   960  C  CE  . LYS A 1 139 ? 36.113 10.041  15.869  1.00 21.24  ? 158 LYS B CE  1 
ATOM   961  N  NZ  . LYS A 1 139 ? 36.703 10.620  17.098  1.00 24.00  ? 158 LYS B NZ  1 
ATOM   962  N  N   . TYR A 1 140 ? 29.035 11.451  16.799  1.00 16.37  ? 159 TYR B N   1 
ATOM   963  C  CA  . TYR A 1 140 ? 27.752 10.733  16.805  1.00 14.88  ? 159 TYR B CA  1 
ATOM   964  C  C   . TYR A 1 140 ? 26.775 11.206  15.733  1.00 16.32  ? 159 TYR B C   1 
ATOM   965  O  O   . TYR A 1 140 ? 26.041 10.399  15.146  1.00 19.27  ? 159 TYR B O   1 
ATOM   966  C  CB  . TYR A 1 140 ? 27.093 10.790  18.185  1.00 17.91  ? 159 TYR B CB  1 
ATOM   967  C  CG  . TYR A 1 140 ? 27.836 10.069  19.285  1.00 19.44  ? 159 TYR B CG  1 
ATOM   968  C  CD1 . TYR A 1 140 ? 29.075 9.464   19.057  1.00 17.84  ? 159 TYR B CD1 1 
ATOM   969  C  CD2 . TYR A 1 140 ? 27.312 10.022  20.565  1.00 17.65  ? 159 TYR B CD2 1 
ATOM   970  C  CE1 . TYR A 1 140 ? 29.749 8.822   20.083  1.00 18.43  ? 159 TYR B CE1 1 
ATOM   971  C  CE2 . TYR A 1 140 ? 27.967 9.380   21.590  1.00 21.07  ? 159 TYR B CE2 1 
ATOM   972  C  CZ  . TYR A 1 140 ? 29.187 8.790   21.353  1.00 20.81  ? 159 TYR B CZ  1 
ATOM   973  O  OH  . TYR A 1 140 ? 29.828 8.168   22.403  1.00 16.22  ? 159 TYR B OH  1 
ATOM   974  N  N   . GLY A 1 141 ? 26.748 12.512  15.482  1.00 20.68  ? 160 GLY B N   1 
ATOM   975  C  CA  . GLY A 1 141 ? 25.926 13.043  14.415  1.00 16.40  ? 160 GLY B CA  1 
ATOM   976  C  C   . GLY A 1 141 ? 26.302 12.381  13.102  1.00 19.93  ? 160 GLY B C   1 
ATOM   977  O  O   . GLY A 1 141 ? 25.436 11.947  12.336  1.00 20.67  ? 160 GLY B O   1 
ATOM   978  N  N   . LEU A 1 142 ? 27.604 12.290  12.839  1.00 14.35  ? 161 LEU B N   1 
ATOM   979  C  CA  . LEU A 1 142 ? 28.068 11.644  11.609  1.00 15.52  ? 161 LEU B CA  1 
ATOM   980  C  C   . LEU A 1 142 ? 27.867 10.113  11.632  1.00 20.81  ? 161 LEU B C   1 
ATOM   981  O  O   . LEU A 1 142 ? 27.526 9.501   10.608  1.00 16.45  ? 161 LEU B O   1 
ATOM   982  C  CB  . LEU A 1 142 ? 29.526 12.001  11.311  1.00 18.64  ? 161 LEU B CB  1 
ATOM   983  C  CG  . LEU A 1 142 ? 30.114 11.320  10.071  1.00 21.06  ? 161 LEU B CG  1 
ATOM   984  C  CD1 . LEU A 1 142 ? 29.338 11.722  8.829   1.00 21.76  ? 161 LEU B CD1 1 
ATOM   985  C  CD2 . LEU A 1 142 ? 31.610 11.633  9.924   1.00 25.67  ? 161 LEU B CD2 1 
ATOM   986  N  N   . LEU A 1 143 ? 28.094 9.495   12.790  1.00 14.73  ? 162 LEU B N   1 
ATOM   987  C  CA  . LEU A 1 143 ? 27.792 8.075   12.965  1.00 16.55  ? 162 LEU B CA  1 
ATOM   988  C  C   . LEU A 1 143 ? 26.346 7.797   12.572  1.00 15.66  ? 162 LEU B C   1 
ATOM   989  O  O   . LEU A 1 143 ? 26.055 6.832   11.862  1.00 14.86  ? 162 LEU B O   1 
ATOM   990  C  CB  . LEU A 1 143 ? 28.009 7.657   14.419  1.00 18.92  ? 162 LEU B CB  1 
ATOM   991  C  CG  . LEU A 1 143 ? 27.697 6.207   14.757  1.00 16.80  ? 162 LEU B CG  1 
ATOM   992  C  CD1 . LEU A 1 143 ? 28.600 5.271   13.937  1.00 15.17  ? 162 LEU B CD1 1 
ATOM   993  C  CD2 . LEU A 1 143 ? 27.881 5.977   16.249  1.00 16.32  ? 162 LEU B CD2 1 
ATOM   994  N  N   . ALA A 1 144 ? 25.437 8.649   13.023  1.00 18.84  ? 163 ALA B N   1 
ATOM   995  C  CA  . ALA A 1 144 ? 24.025 8.466   12.720  1.00 19.23  ? 163 ALA B CA  1 
ATOM   996  C  C   . ALA A 1 144 ? 23.829 8.506   11.208  1.00 18.13  ? 163 ALA B C   1 
ATOM   997  O  O   . ALA A 1 144 ? 23.149 7.659   10.635  1.00 18.39  ? 163 ALA B O   1 
ATOM   998  C  CB  . ALA A 1 144 ? 23.201 9.535   13.400  1.00 19.69  ? 163 ALA B CB  1 
ATOM   999  N  N   . ARG A 1 145 ? 24.441 9.486   10.552  1.00 13.82  ? 164 ARG B N   1 
ATOM   1000 C  CA  . ARG A 1 145 ? 24.329 9.573   9.092   1.00 18.92  ? 164 ARG B CA  1 
ATOM   1001 C  C   . ARG A 1 145 ? 24.895 8.312   8.406   1.00 19.35  ? 164 ARG B C   1 
ATOM   1002 O  O   . ARG A 1 145 ? 24.304 7.790   7.463   1.00 19.89  ? 164 ARG B O   1 
ATOM   1003 C  CB  . ARG A 1 145 ? 24.998 10.858  8.568   1.00 21.89  ? 164 ARG B CB  1 
ATOM   1004 C  CG  . ARG A 1 145 ? 25.122 10.959  7.039   1.00 21.07  ? 164 ARG B CG  1 
ATOM   1005 C  CD  . ARG A 1 145 ? 23.793 10.793  6.318   1.00 20.82  ? 164 ARG B CD  1 
ATOM   1006 N  NE  . ARG A 1 145 ? 22.810 11.798  6.705   1.00 22.47  ? 164 ARG B NE  1 
ATOM   1007 C  CZ  . ARG A 1 145 ? 21.560 11.810  6.249   1.00 28.22  ? 164 ARG B CZ  1 
ATOM   1008 N  NH1 . ARG A 1 145 ? 21.167 10.872  5.402   1.00 27.66  ? 164 ARG B NH1 1 
ATOM   1009 N  NH2 . ARG A 1 145 ? 20.705 12.752  6.632   1.00 24.84  ? 164 ARG B NH2 1 
ATOM   1010 N  N   . LEU A 1 146 ? 26.019 7.804   8.896   1.00 16.76  ? 165 LEU B N   1 
ATOM   1011 C  CA  . LEU A 1 146 ? 26.579 6.572   8.335   1.00 19.93  ? 165 LEU B CA  1 
ATOM   1012 C  C   . LEU A 1 146 ? 25.590 5.417   8.486   1.00 17.38  ? 165 LEU B C   1 
ATOM   1013 O  O   . LEU A 1 146 ? 25.485 4.553   7.612   1.00 15.55  ? 165 LEU B O   1 
ATOM   1014 C  CB  . LEU A 1 146 ? 27.906 6.217   9.014   1.00 15.67  ? 165 LEU B CB  1 
ATOM   1015 C  CG  . LEU A 1 146 ? 29.076 7.158   8.698   1.00 14.97  ? 165 LEU B CG  1 
ATOM   1016 C  CD1 . LEU A 1 146 ? 30.362 6.589   9.286   1.00 23.58  ? 165 LEU B CD1 1 
ATOM   1017 C  CD2 . LEU A 1 146 ? 29.248 7.358   7.187   1.00 15.72  ? 165 LEU B CD2 1 
ATOM   1018 N  N   . ALA A 1 147 ? 24.856 5.408   9.592   1.00 14.26  ? 166 ALA B N   1 
ATOM   1019 C  CA  . ALA A 1 147 ? 23.879 4.346   9.811   1.00 18.68  ? 166 ALA B CA  1 
ATOM   1020 C  C   . ALA A 1 147 ? 22.758 4.415   8.763   1.00 20.62  ? 166 ALA B C   1 
ATOM   1021 O  O   . ALA A 1 147 ? 22.300 3.385   8.289   1.00 14.63  ? 166 ALA B O   1 
ATOM   1022 C  CB  . ALA A 1 147 ? 23.320 4.415   11.198  1.00 15.34  ? 166 ALA B CB  1 
ATOM   1023 N  N   . VAL A 1 148 ? 22.321 5.626   8.417   1.00 15.62  ? 167 VAL B N   1 
ATOM   1024 C  CA  . VAL A 1 148 ? 21.365 5.820   7.325   1.00 16.26  ? 167 VAL B CA  1 
ATOM   1025 C  C   . VAL A 1 148 ? 21.927 5.273   6.021   1.00 18.18  ? 167 VAL B C   1 
ATOM   1026 O  O   . VAL A 1 148 ? 21.270 4.508   5.305   1.00 17.92  ? 167 VAL B O   1 
ATOM   1027 C  CB  . VAL A 1 148 ? 21.011 7.322   7.147   1.00 20.35  ? 167 VAL B CB  1 
ATOM   1028 C  CG1 . VAL A 1 148 ? 20.070 7.523   5.974   1.00 18.80  ? 167 VAL B CG1 1 
ATOM   1029 C  CG2 . VAL A 1 148 ? 20.407 7.893   8.440   1.00 16.71  ? 167 VAL B CG2 1 
ATOM   1030 N  N   . GLU A 1 149 ? 23.154 5.663   5.704   1.00 16.55  ? 168 GLU B N   1 
ATOM   1031 C  CA  . GLU A 1 149 ? 23.757 5.205   4.455   1.00 19.80  ? 168 GLU B CA  1 
ATOM   1032 C  C   . GLU A 1 149 ? 23.961 3.699   4.444   1.00 17.88  ? 168 GLU B C   1 
ATOM   1033 O  O   . GLU A 1 149 ? 23.941 3.085   3.381   1.00 20.16  ? 168 GLU B O   1 
ATOM   1034 C  CB  . GLU A 1 149 ? 25.070 5.934   4.175   1.00 24.57  ? 168 GLU B CB  1 
ATOM   1035 C  CG  . GLU A 1 149 ? 24.920 7.452   4.156   1.00 31.31  ? 168 GLU B CG  1 
ATOM   1036 C  CD  . GLU A 1 149 ? 23.922 7.942   3.115   1.00 44.20  ? 168 GLU B CD  1 
ATOM   1037 O  OE1 . GLU A 1 149 ? 24.120 7.633   1.920   1.00 49.04  ? 168 GLU B OE1 1 
ATOM   1038 O  OE2 . GLU A 1 149 ? 22.947 8.642   3.490   1.00 39.60  ? 168 GLU B OE2 1 
ATOM   1039 N  N   . ALA A 1 150 ? 24.140 3.109   5.623   1.00 16.86  ? 169 ALA B N   1 
ATOM   1040 C  CA  . ALA A 1 150 ? 24.319 1.663   5.757   1.00 18.88  ? 169 ALA B CA  1 
ATOM   1041 C  C   . ALA A 1 150 ? 23.008 0.876   5.629   1.00 19.90  ? 169 ALA B C   1 
ATOM   1042 O  O   . ALA A 1 150 ? 23.021 -0.351  5.613   1.00 18.02  ? 169 ALA B O   1 
ATOM   1043 C  CB  . ALA A 1 150 ? 25.017 1.331   7.081   1.00 14.08  ? 169 ALA B CB  1 
ATOM   1044 N  N   . GLY A 1 151 ? 21.885 1.578   5.536   1.00 17.95  ? 170 GLY B N   1 
ATOM   1045 C  CA  . GLY A 1 151 ? 20.607 0.921   5.280   1.00 21.65  ? 170 GLY B CA  1 
ATOM   1046 C  C   . GLY A 1 151 ? 19.725 0.635   6.489   1.00 19.85  ? 170 GLY B C   1 
ATOM   1047 O  O   . GLY A 1 151 ? 18.746 -0.119  6.385   1.00 16.77  ? 170 GLY B O   1 
ATOM   1048 N  N   . PHE A 1 152 ? 20.051 1.207   7.644   1.00 19.66  ? 171 PHE B N   1 
ATOM   1049 C  CA  . PHE A 1 152 ? 19.136 1.079   8.771   1.00 17.47  ? 171 PHE B CA  1 
ATOM   1050 C  C   . PHE A 1 152 ? 17.835 1.778   8.426   1.00 16.01  ? 171 PHE B C   1 
ATOM   1051 O  O   . PHE A 1 152 ? 17.838 2.861   7.851   1.00 17.19  ? 171 PHE B O   1 
ATOM   1052 C  CB  . PHE A 1 152 ? 19.731 1.624   10.075  1.00 17.35  ? 171 PHE B CB  1 
ATOM   1053 C  CG  . PHE A 1 152 ? 20.671 0.659   10.732  1.00 17.58  ? 171 PHE B CG  1 
ATOM   1054 C  CD1 . PHE A 1 152 ? 20.183 -0.331  11.572  1.00 15.71  ? 171 PHE B CD1 1 
ATOM   1055 C  CD2 . PHE A 1 152 ? 22.021 0.689   10.447  1.00 18.81  ? 171 PHE B CD2 1 
ATOM   1056 C  CE1 . PHE A 1 152 ? 21.037 -1.244  12.156  1.00 12.74  ? 171 PHE B CE1 1 
ATOM   1057 C  CE2 . PHE A 1 152 ? 22.883 -0.227  11.027  1.00 18.17  ? 171 PHE B CE2 1 
ATOM   1058 C  CZ  . PHE A 1 152 ? 22.394 -1.187  11.883  1.00 13.55  ? 171 PHE B CZ  1 
ATOM   1059 N  N   . ASP A 1 153 ? 16.722 1.154   8.786   1.00 15.51  ? 172 ASP B N   1 
ATOM   1060 C  CA  . ASP A 1 153 ? 15.417 1.642   8.356   1.00 18.61  ? 172 ASP B CA  1 
ATOM   1061 C  C   . ASP A 1 153 ? 14.906 2.830   9.173   1.00 18.14  ? 172 ASP B C   1 
ATOM   1062 O  O   . ASP A 1 153 ? 14.019 3.548   8.722   1.00 17.01  ? 172 ASP B O   1 
ATOM   1063 C  CB  . ASP A 1 153 ? 14.413 0.489   8.343   1.00 17.64  ? 172 ASP B CB  1 
ATOM   1064 C  CG  . ASP A 1 153 ? 14.849 -0.631  7.428   1.00 25.40  ? 172 ASP B CG  1 
ATOM   1065 O  OD1 . ASP A 1 153 ? 14.918 -0.402  6.202   1.00 24.07  ? 172 ASP B OD1 1 
ATOM   1066 O  OD2 . ASP A 1 153 ? 15.140 -1.736  7.933   1.00 17.93  ? 172 ASP B OD2 1 
ATOM   1067 N  N   . TRP A 1 154 ? 15.472 3.038   10.361  1.00 16.97  ? 173 TRP B N   1 
ATOM   1068 C  CA  . TRP A 1 154 ? 15.197 4.233   11.166  1.00 14.57  ? 173 TRP B CA  1 
ATOM   1069 C  C   . TRP A 1 154 ? 16.437 4.530   12.005  1.00 15.03  ? 173 TRP B C   1 
ATOM   1070 O  O   . TRP A 1 154 ? 17.056 3.618   12.535  1.00 17.45  ? 173 TRP B O   1 
ATOM   1071 C  CB  . TRP A 1 154 ? 13.999 3.999   12.089  1.00 17.93  ? 173 TRP B CB  1 
ATOM   1072 C  CG  . TRP A 1 154 ? 13.304 5.253   12.628  1.00 16.25  ? 173 TRP B CG  1 
ATOM   1073 C  CD1 . TRP A 1 154 ? 12.559 6.159   11.912  1.00 13.89  ? 173 TRP B CD1 1 
ATOM   1074 C  CD2 . TRP A 1 154 ? 13.245 5.688   14.004  1.00 17.10  ? 173 TRP B CD2 1 
ATOM   1075 N  NE1 . TRP A 1 154 ? 12.062 7.135   12.755  1.00 19.01  ? 173 TRP B NE1 1 
ATOM   1076 C  CE2 . TRP A 1 154 ? 12.463 6.864   14.041  1.00 13.88  ? 173 TRP B CE2 1 
ATOM   1077 C  CE3 . TRP A 1 154 ? 13.780 5.197   15.203  1.00 21.79  ? 173 TRP B CE3 1 
ATOM   1078 C  CZ2 . TRP A 1 154 ? 12.210 7.555   15.225  1.00 17.70  ? 173 TRP B CZ2 1 
ATOM   1079 C  CZ3 . TRP A 1 154 ? 13.529 5.891   16.386  1.00 19.88  ? 173 TRP B CZ3 1 
ATOM   1080 C  CH2 . TRP A 1 154 ? 12.750 7.052   16.387  1.00 16.87  ? 173 TRP B CH2 1 
ATOM   1081 N  N   . VAL A 1 155 ? 16.807 5.803   12.096  1.00 14.01  ? 174 VAL B N   1 
ATOM   1082 C  CA  . VAL A 1 155 ? 17.991 6.233   12.816  1.00 11.44  ? 174 VAL B CA  1 
ATOM   1083 C  C   . VAL A 1 155 ? 17.593 7.481   13.588  1.00 17.35  ? 174 VAL B C   1 
ATOM   1084 O  O   . VAL A 1 155 ? 17.021 8.410   13.017  1.00 17.93  ? 174 VAL B O   1 
ATOM   1085 C  CB  . VAL A 1 155 ? 19.140 6.549   11.841  1.00 14.17  ? 174 VAL B CB  1 
ATOM   1086 C  CG1 . VAL A 1 155 ? 20.310 7.194   12.569  1.00 11.09  ? 174 VAL B CG1 1 
ATOM   1087 C  CG2 . VAL A 1 155 ? 19.571 5.270   11.101  1.00 15.71  ? 174 VAL B CG2 1 
ATOM   1088 N  N   . TYR A 1 156 ? 17.886 7.489   14.887  1.00 17.41  ? 175 TYR B N   1 
ATOM   1089 C  CA  . TYR A 1 156 ? 17.401 8.522   15.798  1.00 15.39  ? 175 TYR B CA  1 
ATOM   1090 C  C   . TYR A 1 156 ? 18.547 8.940   16.697  1.00 17.62  ? 175 TYR B C   1 
ATOM   1091 O  O   . TYR A 1 156 ? 19.111 8.124   17.428  1.00 18.18  ? 175 TYR B O   1 
ATOM   1092 C  CB  . TYR A 1 156 ? 16.228 7.958   16.620  1.00 17.57  ? 175 TYR B CB  1 
ATOM   1093 C  CG  . TYR A 1 156 ? 15.625 8.857   17.690  1.00 18.06  ? 175 TYR B CG  1 
ATOM   1094 C  CD1 . TYR A 1 156 ? 15.598 10.245  17.552  1.00 18.44  ? 175 TYR B CD1 1 
ATOM   1095 C  CD2 . TYR A 1 156 ? 15.031 8.298   18.823  1.00 21.78  ? 175 TYR B CD2 1 
ATOM   1096 C  CE1 . TYR A 1 156 ? 15.020 11.047  18.529  1.00 20.53  ? 175 TYR B CE1 1 
ATOM   1097 C  CE2 . TYR A 1 156 ? 14.452 9.090   19.798  1.00 21.15  ? 175 TYR B CE2 1 
ATOM   1098 C  CZ  . TYR A 1 156 ? 14.448 10.461  19.641  1.00 19.16  ? 175 TYR B CZ  1 
ATOM   1099 O  OH  . TYR A 1 156 ? 13.885 11.243  20.608  1.00 19.52  ? 175 TYR B OH  1 
ATOM   1100 N  N   . TYR A 1 157 ? 18.925 10.206  16.615  1.00 13.68  ? 176 TYR B N   1 
ATOM   1101 C  CA  . TYR A 1 157 ? 20.013 10.718  17.440  1.00 18.87  ? 176 TYR B CA  1 
ATOM   1102 C  C   . TYR A 1 157 ? 19.358 11.012  18.803  1.00 20.51  ? 176 TYR B C   1 
ATOM   1103 O  O   . TYR A 1 157 ? 19.083 12.163  19.175  1.00 21.46  ? 176 TYR B O   1 
ATOM   1104 C  CB  . TYR A 1 157 ? 20.623 11.958  16.773  1.00 15.03  ? 176 TYR B CB  1 
ATOM   1105 C  CG  . TYR A 1 157 ? 21.908 12.490  17.375  1.00 20.23  ? 176 TYR B CG  1 
ATOM   1106 C  CD1 . TYR A 1 157 ? 22.330 12.119  18.653  1.00 12.98  ? 176 TYR B CD1 1 
ATOM   1107 C  CD2 . TYR A 1 157 ? 22.673 13.409  16.674  1.00 17.45  ? 176 TYR B CD2 1 
ATOM   1108 C  CE1 . TYR A 1 157 ? 23.500 12.643  19.191  1.00 15.68  ? 176 TYR B CE1 1 
ATOM   1109 C  CE2 . TYR A 1 157 ? 23.838 13.935  17.203  1.00 21.87  ? 176 TYR B CE2 1 
ATOM   1110 C  CZ  . TYR A 1 157 ? 24.250 13.553  18.458  1.00 20.28  ? 176 TYR B CZ  1 
ATOM   1111 O  OH  . TYR A 1 157 ? 25.414 14.099  18.956  1.00 19.45  ? 176 TYR B OH  1 
ATOM   1112 N  N   . GLU A 1 158 ? 19.121 9.926   19.529  1.00 20.29  ? 177 GLU B N   1 
ATOM   1113 C  CA  . GLU A 1 158 ? 18.166 9.852   20.628  1.00 20.64  ? 177 GLU B CA  1 
ATOM   1114 C  C   . GLU A 1 158 ? 18.657 10.568  21.879  1.00 27.49  ? 177 GLU B C   1 
ATOM   1115 O  O   . GLU A 1 158 ? 17.870 11.130  22.644  1.00 28.55  ? 177 GLU B O   1 
ATOM   1116 C  CB  . GLU A 1 158 ? 17.918 8.361   20.919  1.00 21.32  ? 177 GLU B CB  1 
ATOM   1117 C  CG  . GLU A 1 158 ? 17.139 8.000   22.164  1.00 25.55  ? 177 GLU B CG  1 
ATOM   1118 C  CD  . GLU A 1 158 ? 16.696 6.540   22.135  1.00 31.84  ? 177 GLU B CD  1 
ATOM   1119 O  OE1 . GLU A 1 158 ? 17.564 5.635   22.111  1.00 33.54  ? 177 GLU B OE1 1 
ATOM   1120 O  OE2 . GLU A 1 158 ? 15.478 6.291   22.135  1.00 35.88  ? 177 GLU B OE2 1 
ATOM   1121 N  N   . SER A 1 159 ? 19.967 10.552  22.062  1.00 22.20  ? 178 SER B N   1 
ATOM   1122 C  CA  . SER A 1 159 ? 20.597 11.063  23.267  1.00 23.28  ? 178 SER B CA  1 
ATOM   1123 C  C   . SER A 1 159 ? 21.908 11.707  22.862  1.00 24.39  ? 178 SER B C   1 
ATOM   1124 O  O   . SER A 1 159 ? 22.438 11.415  21.794  1.00 23.93  ? 178 SER B O   1 
ATOM   1125 C  CB  . SER A 1 159 ? 20.877 9.908   24.226  1.00 24.98  ? 178 SER B CB  1 
ATOM   1126 O  OG  . SER A 1 159 ? 21.743 10.313  25.274  1.00 26.04  ? 178 SER B OG  1 
ATOM   1127 N  N   . ARG A 1 160 ? 22.439 12.599  23.688  1.00 21.49  ? 179 ARG B N   1 
ATOM   1128 C  CA  . ARG A 1 160 ? 23.796 13.066  23.444  1.00 20.39  ? 179 ARG B CA  1 
ATOM   1129 C  C   . ARG A 1 160 ? 24.784 11.922  23.636  1.00 21.56  ? 179 ARG B C   1 
ATOM   1130 O  O   . ARG A 1 160 ? 25.925 11.989  23.171  1.00 23.71  ? 179 ARG B O   1 
ATOM   1131 C  CB  . ARG A 1 160 ? 24.136 14.246  24.351  1.00 32.62  ? 179 ARG B CB  1 
ATOM   1132 C  CG  . ARG A 1 160 ? 23.242 15.453  24.108  1.00 36.84  ? 179 ARG B CG  1 
ATOM   1133 C  CD  . ARG A 1 160 ? 23.659 16.622  24.965  1.00 48.70  ? 179 ARG B CD  1 
ATOM   1134 N  NE  . ARG A 1 160 ? 22.750 17.758  24.842  1.00 47.60  ? 179 ARG B NE  1 
ATOM   1135 C  CZ  . ARG A 1 160 ? 22.640 18.503  23.750  1.00 44.61  ? 179 ARG B CZ  1 
ATOM   1136 N  NH1 . ARG A 1 160 ? 23.365 18.217  22.677  1.00 44.94  ? 179 ARG B NH1 1 
ATOM   1137 N  NH2 . ARG A 1 160 ? 21.795 19.528  23.725  1.00 40.30  ? 179 ARG B NH2 1 
ATOM   1138 N  N   . ASN A 1 161 ? 24.340 10.863  24.309  1.00 16.95  ? 180 ASN B N   1 
ATOM   1139 C  CA  . ASN A 1 161 ? 25.248 9.787   24.704  1.00 18.28  ? 180 ASN B CA  1 
ATOM   1140 C  C   . ASN A 1 161 ? 25.215 8.534   23.834  1.00 16.26  ? 180 ASN B C   1 
ATOM   1141 O  O   . ASN A 1 161 ? 26.071 7.655   23.980  1.00 17.73  ? 180 ASN B O   1 
ATOM   1142 C  CB  . ASN A 1 161 ? 25.004 9.408   26.164  1.00 21.07  ? 180 ASN B CB  1 
ATOM   1143 C  CG  . ASN A 1 161 ? 25.173 10.580  27.091  1.00 28.17  ? 180 ASN B CG  1 
ATOM   1144 O  OD1 . ASN A 1 161 ? 24.277 10.912  27.869  1.00 28.60  ? 180 ASN B OD1 1 
ATOM   1145 N  ND2 . ASN A 1 161 ? 26.313 11.238  26.989  1.00 22.74  ? 180 ASN B ND2 1 
ATOM   1146 N  N   . HIS A 1 162 ? 24.228 8.431   22.948  1.00 19.66  ? 181 HIS B N   1 
ATOM   1147 C  CA  . HIS A 1 162 ? 24.187 7.315   22.005  1.00 20.87  ? 181 HIS B CA  1 
ATOM   1148 C  C   . HIS A 1 162 ? 23.213 7.617   20.868  1.00 23.22  ? 181 HIS B C   1 
ATOM   1149 O  O   . HIS A 1 162 ? 22.351 8.505   20.993  1.00 17.70  ? 181 HIS B O   1 
ATOM   1150 C  CB  . HIS A 1 162 ? 23.735 6.033   22.707  1.00 20.58  ? 181 HIS B CB  1 
ATOM   1151 C  CG  . HIS A 1 162 ? 22.264 6.008   23.017  1.00 24.58  ? 181 HIS B CG  1 
ATOM   1152 N  ND1 . HIS A 1 162 ? 21.752 6.382   24.242  1.00 32.18  ? 181 HIS B ND1 1 
ATOM   1153 C  CD2 . HIS A 1 162 ? 21.196 5.671   22.253  1.00 20.59  ? 181 HIS B CD2 1 
ATOM   1154 C  CE1 . HIS A 1 162 ? 20.435 6.263   24.222  1.00 29.81  ? 181 HIS B CE1 1 
ATOM   1155 N  NE2 . HIS A 1 162 ? 20.073 5.833   23.027  1.00 18.49  ? 181 HIS B NE2 1 
ATOM   1156 N  N   . VAL A 1 163 ? 23.360 6.867   19.777  1.00 22.51  ? 182 VAL B N   1 
ATOM   1157 C  CA  . VAL A 1 163 ? 22.436 6.907   18.640  1.00 20.83  ? 182 VAL B CA  1 
ATOM   1158 C  C   . VAL A 1 163 ? 21.612 5.612   18.640  1.00 20.94  ? 182 VAL B C   1 
ATOM   1159 O  O   . VAL A 1 163 ? 22.130 4.548   18.965  1.00 18.80  ? 182 VAL B O   1 
ATOM   1160 C  CB  . VAL A 1 163 ? 23.197 7.035   17.297  1.00 17.43  ? 182 VAL B CB  1 
ATOM   1161 C  CG1 . VAL A 1 163 ? 22.230 6.925   16.113  1.00 15.16  ? 182 VAL B CG1 1 
ATOM   1162 C  CG2 . VAL A 1 163 ? 23.974 8.354   17.236  1.00 18.70  ? 182 VAL B CG2 1 
ATOM   1163 N  N   . HIS A 1 164 ? 20.331 5.715   18.291  1.00 16.04  ? 183 HIS B N   1 
ATOM   1164 C  CA  . HIS A 1 164 ? 19.437 4.562   18.189  1.00 17.31  ? 183 HIS B CA  1 
ATOM   1165 C  C   . HIS A 1 164 ? 19.193 4.214   16.727  1.00 14.02  ? 183 HIS B C   1 
ATOM   1166 O  O   . HIS A 1 164 ? 18.854 5.085   15.928  1.00 16.36  ? 183 HIS B O   1 
ATOM   1167 C  CB  . HIS A 1 164 ? 18.102 4.888   18.870  1.00 13.92  ? 183 HIS B CB  1 
ATOM   1168 C  CG  . HIS A 1 164 ? 17.026 3.862   18.662  1.00 16.39  ? 183 HIS B CG  1 
ATOM   1169 N  ND1 . HIS A 1 164 ? 16.701 2.926   19.614  1.00 18.14  ? 183 HIS B ND1 1 
ATOM   1170 C  CD2 . HIS A 1 164 ? 16.154 3.678   17.639  1.00 14.35  ? 183 HIS B CD2 1 
ATOM   1171 C  CE1 . HIS A 1 164 ? 15.700 2.178   19.180  1.00 16.44  ? 183 HIS B CE1 1 
ATOM   1172 N  NE2 . HIS A 1 164 ? 15.341 2.622   17.986  1.00 17.92  ? 183 HIS B NE2 1 
ATOM   1173 N  N   . VAL A 1 165 ? 19.373 2.948   16.373  1.00 13.45  ? 184 VAL B N   1 
ATOM   1174 C  CA  . VAL A 1 165 ? 19.142 2.520   14.996  1.00 8.97   ? 184 VAL B CA  1 
ATOM   1175 C  C   . VAL A 1 165 ? 18.316 1.238   14.966  1.00 18.57  ? 184 VAL B C   1 
ATOM   1176 O  O   . VAL A 1 165 ? 18.475 0.366   15.829  1.00 16.10  ? 184 VAL B O   1 
ATOM   1177 C  CB  . VAL A 1 165 ? 20.466 2.296   14.233  1.00 12.69  ? 184 VAL B CB  1 
ATOM   1178 C  CG1 . VAL A 1 165 ? 21.339 3.568   14.268  1.00 13.86  ? 184 VAL B CG1 1 
ATOM   1179 C  CG2 . VAL A 1 165 ? 21.213 1.084   14.799  1.00 12.37  ? 184 VAL B CG2 1 
ATOM   1180 N  N   . SER A 1 166 ? 17.437 1.106   13.979  1.00 16.44  ? 185 SER B N   1 
ATOM   1181 C  CA  . SER A 1 166 ? 16.579 -0.073  13.959  1.00 13.60  ? 185 SER B CA  1 
ATOM   1182 C  C   . SER A 1 166 ? 16.288 -0.518  12.540  1.00 16.96  ? 185 SER B C   1 
ATOM   1183 O  O   . SER A 1 166 ? 16.548 0.218   11.580  1.00 14.82  ? 185 SER B O   1 
ATOM   1184 C  CB  . SER A 1 166 ? 15.279 0.159   14.746  1.00 15.77  ? 185 SER B CB  1 
ATOM   1185 O  OG  . SER A 1 166 ? 14.461 1.153   14.132  1.00 18.00  ? 185 SER B OG  1 
ATOM   1186 N  N   . VAL A 1 167 ? 15.753 -1.731  12.412  1.00 15.41  ? 186 VAL B N   1 
ATOM   1187 C  CA  . VAL A 1 167 ? 15.450 -2.312  11.107  1.00 13.32  ? 186 VAL B CA  1 
ATOM   1188 C  C   . VAL A 1 167 ? 14.035 -2.896  11.036  1.00 16.14  ? 186 VAL B C   1 
ATOM   1189 O  O   . VAL A 1 167 ? 13.433 -3.234  12.052  1.00 13.97  ? 186 VAL B O   1 
ATOM   1190 C  CB  . VAL A 1 167 ? 16.456 -3.426  10.728  1.00 8.61   ? 186 VAL B CB  1 
ATOM   1191 C  CG1 . VAL A 1 167 ? 17.878 -2.863  10.602  1.00 12.19  ? 186 VAL B CG1 1 
ATOM   1192 C  CG2 . VAL A 1 167 ? 16.419 -4.567  11.746  1.00 14.91  ? 186 VAL B CG2 1 
ATOM   1193 N  N   . LYS A 1 168 ? 13.512 -3.001  9.819   1.00 18.30  ? 187 LYS B N   1 
ATOM   1194 C  CA  . LYS A 1 168 ? 12.275 -3.738  9.584   1.00 17.38  ? 187 LYS B CA  1 
ATOM   1195 C  C   . LYS A 1 168 ? 12.468 -5.185  10.030  1.00 21.61  ? 187 LYS B C   1 
ATOM   1196 O  O   . LYS A 1 168 ? 13.602 -5.662  10.171  1.00 23.44  ? 187 LYS B O   1 
ATOM   1197 C  CB  . LYS A 1 168 ? 11.954 -3.763  8.093   1.00 16.60  ? 187 LYS B CB  1 
ATOM   1198 C  CG  . LYS A 1 168 ? 11.870 -2.442  7.389   1.00 25.05  ? 187 LYS B CG  1 
ATOM   1199 C  CD  . LYS A 1 168 ? 11.725 -2.714  5.881   1.00 37.23  ? 187 LYS B CD  1 
ATOM   1200 C  CE  . LYS A 1 168 ? 11.687 -1.438  5.039   1.00 47.68  ? 187 LYS B CE  1 
ATOM   1201 N  NZ  . LYS A 1 168 ? 10.571 -0.501  5.381   1.00 46.55  ? 187 LYS B NZ  1 
ATOM   1202 N  N   . ALA A 1 169 ? 11.364 -5.898  10.230  1.00 20.54  ? 188 ALA B N   1 
ATOM   1203 C  CA  . ALA A 1 169 ? 11.448 -7.315  10.564  1.00 22.50  ? 188 ALA B CA  1 
ATOM   1204 C  C   . ALA A 1 169 ? 11.881 -8.112  9.328   1.00 29.07  ? 188 ALA B C   1 
ATOM   1205 O  O   . ALA A 1 169 ? 11.758 -7.637  8.207   1.00 28.94  ? 188 ALA B O   1 
ATOM   1206 C  CB  . ALA A 1 169 ? 10.103 -7.817  11.081  1.00 28.94  ? 188 ALA B CB  1 
ATOM   1207 N  N   . ASP A 1 170 ? 12.570 -9.142  9.729   1.00 30.96  ? 189 ASP B N   1 
ATOM   1208 C  CA  . ASP A 1 170 ? 12.918 -10.080 8.667   1.00 39.53  ? 189 ASP B CA  1 
ATOM   1209 C  C   . ASP A 1 170 ? 11.685 -10.468 7.885   1.00 48.91  ? 189 ASP B C   1 
ATOM   1210 O  O   . ASP A 1 170 ? 11.639 -10.386 6.656   1.00 57.89  ? 189 ASP B O   1 
ATOM   1211 C  CB  . ASP A 1 170 ? 13.593 -11.325 9.245   1.00 20.00  ? 189 ASP B CB  1 
ATOM   1212 C  CG  . ASP A 1 170 ? 14.993 -11.041 9.756   1.00 20.00  ? 189 ASP B CG  1 
ATOM   1213 O  OD1 . ASP A 1 170 ? 15.548 -9.977  9.415   1.00 20.00  ? 189 ASP B OD1 1 
ATOM   1214 O  OD2 . ASP A 1 170 ? 15.615 -11.826 10.502  1.00 20.00  ? 189 ASP B OD2 1 
ATOM   1215 N  N   . GLU B 2 4   ? 22.785 -20.570 53.490  1.00 20.00  ? 710 GLU C N   1 
ATOM   1216 C  CA  . GLU B 2 4   ? 22.345 -19.296 54.048  1.00 20.00  ? 710 GLU C CA  1 
ATOM   1217 C  C   . GLU B 2 4   ? 22.504 -18.165 53.036  1.00 20.00  ? 710 GLU C C   1 
ATOM   1218 O  O   . GLU B 2 4   ? 21.634 -17.305 52.911  1.00 20.00  ? 710 GLU C O   1 
ATOM   1219 C  CB  . GLU B 2 4   ? 23.122 -18.973 55.325  1.00 20.00  ? 710 GLU C CB  1 
ATOM   1220 C  CG  . GLU B 2 4   ? 24.623 -18.844 55.121  1.00 20.00  ? 710 GLU C CG  1 
ATOM   1221 C  CD  . GLU B 2 4   ? 25.333 -18.301 56.345  1.00 20.00  ? 710 GLU C CD  1 
ATOM   1222 O  OE1 . GLU B 2 4   ? 24.644 -17.833 57.275  1.00 20.00  ? 710 GLU C OE1 1 
ATOM   1223 O  OE2 . GLU B 2 4   ? 26.581 -18.341 56.377  1.00 20.00  ? 710 GLU C OE2 1 
ATOM   1224 N  N   . ARG B 2 5   ? 23.621 -18.176 52.316  1.00 20.00  ? 711 ARG C N   1 
ATOM   1225 C  CA  . ARG B 2 5   ? 23.898 -17.152 51.317  1.00 20.00  ? 711 ARG C CA  1 
ATOM   1226 C  C   . ARG B 2 5   ? 22.810 -17.116 50.248  1.00 20.00  ? 711 ARG C C   1 
ATOM   1227 O  O   . ARG B 2 5   ? 22.424 -18.152 49.706  1.00 20.00  ? 711 ARG C O   1 
ATOM   1228 C  CB  . ARG B 2 5   ? 25.263 -17.390 50.668  1.00 20.00  ? 711 ARG C CB  1 
ATOM   1229 C  CG  . ARG B 2 5   ? 25.420 -18.764 50.039  1.00 20.00  ? 711 ARG C CG  1 
ATOM   1230 C  CD  . ARG B 2 5   ? 26.812 -18.950 49.457  1.00 20.00  ? 711 ARG C CD  1 
ATOM   1231 N  NE  . ARG B 2 5   ? 26.959 -20.238 48.786  1.00 20.00  ? 711 ARG C NE  1 
ATOM   1232 C  CZ  . ARG B 2 5   ? 28.036 -20.604 48.098  1.00 20.00  ? 711 ARG C CZ  1 
ATOM   1233 N  NH1 . ARG B 2 5   ? 29.065 -19.777 47.985  1.00 20.00  ? 711 ARG C NH1 1 
ATOM   1234 N  NH2 . ARG B 2 5   ? 28.082 -21.798 47.521  1.00 20.00  ? 711 ARG C NH2 1 
ATOM   1235 N  N   . PRO B 2 6   ? 22.318 -15.918 49.951  1.00 56.45  ? 712 PRO C N   1 
ATOM   1236 C  CA  . PRO B 2 6   ? 21.269 -15.743 48.940  1.00 52.97  ? 712 PRO C CA  1 
ATOM   1237 C  C   . PRO B 2 6   ? 21.853 -15.928 47.550  1.00 46.14  ? 712 PRO C C   1 
ATOM   1238 O  O   . PRO B 2 6   ? 22.933 -15.417 47.273  1.00 46.93  ? 712 PRO C O   1 
ATOM   1239 C  CB  . PRO B 2 6   ? 20.838 -14.288 49.128  1.00 53.64  ? 712 PRO C CB  1 
ATOM   1240 C  CG  . PRO B 2 6   ? 22.016 -13.615 49.720  1.00 54.58  ? 712 PRO C CG  1 
ATOM   1241 C  CD  . PRO B 2 6   ? 22.747 -14.638 50.540  1.00 57.43  ? 712 PRO C CD  1 
ATOM   1242 N  N   . VAL B 2 7   ? 21.156 -16.669 46.699  1.00 45.87  ? 713 VAL C N   1 
ATOM   1243 C  CA  . VAL B 2 7   ? 21.620 -16.909 45.342  1.00 48.62  ? 713 VAL C CA  1 
ATOM   1244 C  C   . VAL B 2 7   ? 20.811 -16.066 44.351  1.00 49.75  ? 713 VAL C C   1 
ATOM   1245 O  O   . VAL B 2 7   ? 21.374 -15.242 43.630  1.00 45.54  ? 713 VAL C O   1 
ATOM   1246 C  CB  . VAL B 2 7   ? 21.578 -18.416 44.981  1.00 57.95  ? 713 VAL C CB  1 
ATOM   1247 C  CG1 . VAL B 2 7   ? 20.267 -19.052 45.440  1.00 59.00  ? 713 VAL C CG1 1 
ATOM   1248 C  CG2 . VAL B 2 7   ? 21.816 -18.626 43.494  1.00 57.03  ? 713 VAL C CG2 1 
ATOM   1249 N  N   . ALA B 2 8   ? 19.494 -16.254 44.332  1.00 52.49  ? 714 ALA C N   1 
ATOM   1250 C  CA  . ALA B 2 8   ? 18.630 -15.438 43.480  1.00 48.73  ? 714 ALA C CA  1 
ATOM   1251 C  C   . ALA B 2 8   ? 18.655 -13.981 43.940  1.00 42.45  ? 714 ALA C C   1 
ATOM   1252 O  O   . ALA B 2 8   ? 18.548 -13.699 45.136  1.00 42.04  ? 714 ALA C O   1 
ATOM   1253 C  CB  . ALA B 2 8   ? 17.208 -15.978 43.481  1.00 47.36  ? 714 ALA C CB  1 
ATOM   1254 N  N   . GLY B 2 9   ? 18.802 -13.061 42.988  1.00 35.15  ? 715 GLY C N   1 
ATOM   1255 C  CA  . GLY B 2 9   ? 18.965 -11.654 43.309  1.00 33.49  ? 715 GLY C CA  1 
ATOM   1256 C  C   . GLY B 2 9   ? 17.689 -10.850 43.164  1.00 33.30  ? 715 GLY C C   1 
ATOM   1257 O  O   . GLY B 2 9   ? 16.671 -11.374 42.704  1.00 33.29  ? 715 GLY C O   1 
ATOM   1258 N  N   . PRO B 2 10  ? 17.731 -9.565  43.551  1.00 33.50  ? 716 PRO C N   1 
ATOM   1259 C  CA  . PRO B 2 10  ? 16.570 -8.713  43.305  1.00 27.05  ? 716 PRO C CA  1 
ATOM   1260 C  C   . PRO B 2 10  ? 16.392 -8.493  41.804  1.00 26.77  ? 716 PRO C C   1 
ATOM   1261 O  O   . PRO B 2 10  ? 17.315 -8.756  41.022  1.00 28.48  ? 716 PRO C O   1 
ATOM   1262 C  CB  . PRO B 2 10  ? 16.941 -7.389  43.997  1.00 29.50  ? 716 PRO C CB  1 
ATOM   1263 C  CG  . PRO B 2 10  ? 18.209 -7.648  44.756  1.00 31.75  ? 716 PRO C CG  1 
ATOM   1264 C  CD  . PRO B 2 10  ? 18.868 -8.812  44.103  1.00 35.57  ? 716 PRO C CD  1 
ATOM   1265 N  N   . TYR B 2 11  ? 15.220 -8.018  41.395  1.00 19.99  ? 717 TYR C N   1 
ATOM   1266 C  CA  . TYR B 2 11  ? 15.027 -7.643  40.001  1.00 22.27  ? 717 TYR C CA  1 
ATOM   1267 C  C   . TYR B 2 11  ? 14.620 -6.178  39.980  1.00 22.77  ? 717 TYR C C   1 
ATOM   1268 O  O   . TYR B 2 11  ? 13.692 -5.775  40.683  1.00 27.11  ? 717 TYR C O   1 
ATOM   1269 C  CB  . TYR B 2 11  ? 13.969 -8.532  39.332  1.00 21.47  ? 717 TYR C CB  1 
ATOM   1270 C  CG  . TYR B 2 11  ? 13.518 -8.072  37.954  1.00 25.92  ? 717 TYR C CG  1 
ATOM   1271 C  CD1 . TYR B 2 11  ? 14.229 -8.425  36.811  1.00 28.15  ? 717 TYR C CD1 1 
ATOM   1272 C  CD2 . TYR B 2 11  ? 12.370 -7.307  37.798  1.00 33.21  ? 717 TYR C CD2 1 
ATOM   1273 C  CE1 . TYR B 2 11  ? 13.820 -8.009  35.551  1.00 33.06  ? 717 TYR C CE1 1 
ATOM   1274 C  CE2 . TYR B 2 11  ? 11.949 -6.880  36.540  1.00 40.45  ? 717 TYR C CE2 1 
ATOM   1275 C  CZ  . TYR B 2 11  ? 12.678 -7.237  35.418  1.00 41.46  ? 717 TYR C CZ  1 
ATOM   1276 O  OH  . TYR B 2 11  ? 12.254 -6.825  34.169  1.00 41.63  ? 717 TYR C OH  1 
ATOM   1277 N  N   . ILE B 2 12  ? 15.315 -5.373  39.187  1.00 23.93  ? 718 ILE C N   1 
ATOM   1278 C  CA  . ILE B 2 12  ? 14.992 -3.950  39.124  1.00 18.21  ? 718 ILE C CA  1 
ATOM   1279 C  C   . ILE B 2 12  ? 13.823 -3.715  38.185  1.00 24.22  ? 718 ILE C C   1 
ATOM   1280 O  O   . ILE B 2 12  ? 13.909 -4.016  36.995  1.00 25.37  ? 718 ILE C O   1 
ATOM   1281 C  CB  . ILE B 2 12  ? 16.198 -3.117  38.665  1.00 20.44  ? 718 ILE C CB  1 
ATOM   1282 C  CG1 . ILE B 2 12  ? 17.376 -3.327  39.625  1.00 20.33  ? 718 ILE C CG1 1 
ATOM   1283 C  CG2 . ILE B 2 12  ? 15.800 -1.638  38.568  1.00 19.98  ? 718 ILE C CG2 1 
ATOM   1284 C  CD1 . ILE B 2 12  ? 18.723 -2.738  39.135  1.00 21.16  ? 718 ILE C CD1 1 
ATOM   1285 N  N   . THR B 2 13  ? 12.738 -3.157  38.711  1.00 21.55  ? 719 THR C N   1 
ATOM   1286 C  CA  . THR B 2 13  ? 11.513 -3.003  37.936  1.00 23.14  ? 719 THR C CA  1 
ATOM   1287 C  C   . THR B 2 13  ? 11.372 -1.618  37.327  1.00 25.52  ? 719 THR C C   1 
ATOM   1288 O  O   . THR B 2 13  ? 10.545 -1.402  36.445  1.00 28.40  ? 719 THR C O   1 
ATOM   1289 C  CB  . THR B 2 13  ? 10.288 -3.230  38.820  1.00 26.11  ? 719 THR C CB  1 
ATOM   1290 O  OG1 . THR B 2 13  ? 10.369 -2.358  39.955  1.00 25.70  ? 719 THR C OG1 1 
ATOM   1291 C  CG2 . THR B 2 13  ? 10.226 -4.682  39.286  1.00 28.57  ? 719 THR C CG2 1 
ATOM   1292 N  N   . PHE B 2 14  ? 12.166 -0.672  37.810  1.00 20.54  ? 720 PHE C N   1 
ATOM   1293 C  CA  . PHE B 2 14  ? 12.010 0.715   37.382  1.00 23.00  ? 720 PHE C CA  1 
ATOM   1294 C  C   . PHE B 2 14  ? 13.264 1.536   37.632  1.00 24.11  ? 720 PHE C C   1 
ATOM   1295 O  O   . PHE B 2 14  ? 13.839 1.482   38.720  1.00 26.49  ? 720 PHE C O   1 
ATOM   1296 C  CB  . PHE B 2 14  ? 10.828 1.347   38.126  1.00 25.23  ? 720 PHE C CB  1 
ATOM   1297 C  CG  . PHE B 2 14  ? 10.629 2.813   37.836  1.00 28.16  ? 720 PHE C CG  1 
ATOM   1298 C  CD1 . PHE B 2 14  ? 9.791  3.223   36.809  1.00 37.99  ? 720 PHE C CD1 1 
ATOM   1299 C  CD2 . PHE B 2 14  ? 11.266 3.778   38.602  1.00 32.15  ? 720 PHE C CD2 1 
ATOM   1300 C  CE1 . PHE B 2 14  ? 9.601  4.578   36.544  1.00 38.85  ? 720 PHE C CE1 1 
ATOM   1301 C  CE2 . PHE B 2 14  ? 11.084 5.127   38.342  1.00 35.61  ? 720 PHE C CE2 1 
ATOM   1302 C  CZ  . PHE B 2 14  ? 10.250 5.526   37.314  1.00 39.17  ? 720 PHE C CZ  1 
ATOM   1303 N  N   . THR B 2 15  ? 13.690 2.291   36.617  1.00 23.47  ? 721 THR C N   1 
ATOM   1304 C  CA  . THR B 2 15  ? 14.678 3.355   36.807  1.00 22.42  ? 721 THR C CA  1 
ATOM   1305 C  C   . THR B 2 15  ? 14.258 4.592   36.035  1.00 28.77  ? 721 THR C C   1 
ATOM   1306 O  O   . THR B 2 15  ? 13.813 4.494   34.892  1.00 27.08  ? 721 THR C O   1 
ATOM   1307 C  CB  . THR B 2 15  ? 16.089 2.957   36.338  1.00 25.02  ? 721 THR C CB  1 
ATOM   1308 O  OG1 . THR B 2 15  ? 16.059 2.701   34.932  1.00 24.02  ? 721 THR C OG1 1 
ATOM   1309 C  CG2 . THR B 2 15  ? 16.554 1.725   37.067  1.00 20.72  ? 721 THR C CG2 1 
ATOM   1310 N  N   . ASP B 2 16  ? 14.408 5.757   36.664  1.00 25.30  ? 722 ASP C N   1 
ATOM   1311 C  CA  . ASP B 2 16  ? 14.112 7.017   35.996  1.00 22.98  ? 722 ASP C CA  1 
ATOM   1312 C  C   . ASP B 2 16  ? 14.909 8.138   36.656  1.00 29.25  ? 722 ASP C C   1 
ATOM   1313 O  O   . ASP B 2 16  ? 15.134 8.134   37.870  1.00 25.68  ? 722 ASP C O   1 
ATOM   1314 C  CB  . ASP B 2 16  ? 12.611 7.320   36.045  1.00 30.78  ? 722 ASP C CB  1 
ATOM   1315 C  CG  . ASP B 2 16  ? 12.173 8.347   34.995  1.00 40.56  ? 722 ASP C CG  1 
ATOM   1316 O  OD1 . ASP B 2 16  ? 12.918 8.574   34.013  1.00 37.24  ? 722 ASP C OD1 1 
ATOM   1317 O  OD2 . ASP B 2 16  ? 11.073 8.922   35.153  1.00 48.34  ? 722 ASP C OD2 1 
ATOM   1318 N  N   . ALA B 2 17  ? 15.359 9.084   35.844  1.00 22.47  ? 723 ALA C N   1 
ATOM   1319 C  CA  . ALA B 2 17  ? 16.012 10.272  36.352  1.00 24.40  ? 723 ALA C CA  1 
ATOM   1320 C  C   . ALA B 2 17  ? 15.004 11.037  37.208  1.00 28.32  ? 723 ALA C C   1 
ATOM   1321 O  O   . ALA B 2 17  ? 13.818 11.078  36.882  1.00 31.65  ? 723 ALA C O   1 
ATOM   1322 C  CB  . ALA B 2 17  ? 16.479 11.133  35.197  1.00 29.03  ? 723 ALA C CB  1 
ATOM   1323 N  N   . VAL B 2 18  ? 15.458 11.619  38.311  1.00 27.63  ? 724 VAL C N   1 
ATOM   1324 C  CA  . VAL B 2 18  ? 14.601 12.510  39.084  1.00 28.26  ? 724 VAL C CA  1 
ATOM   1325 C  C   . VAL B 2 18  ? 15.035 13.962  38.908  1.00 29.15  ? 724 VAL C C   1 
ATOM   1326 O  O   . VAL B 2 18  ? 14.221 14.872  39.019  1.00 24.43  ? 724 VAL C O   1 
ATOM   1327 C  CB  . VAL B 2 18  ? 14.553 12.149  40.575  1.00 40.46  ? 724 VAL C CB  1 
ATOM   1328 C  CG1 . VAL B 2 18  ? 14.416 10.636  40.762  1.00 45.47  ? 724 VAL C CG1 1 
ATOM   1329 C  CG2 . VAL B 2 18  ? 15.762 12.667  41.280  1.00 37.78  ? 724 VAL C CG2 1 
ATOM   1330 N  N   . ASN B 2 19  ? 16.322 14.171  38.636  1.00 28.67  ? 725 ASN C N   1 
ATOM   1331 C  CA  . ASN B 2 19  ? 16.842 15.475  38.215  1.00 24.66  ? 725 ASN C CA  1 
ATOM   1332 C  C   . ASN B 2 19  ? 18.224 15.313  37.574  1.00 29.56  ? 725 ASN C C   1 
ATOM   1333 O  O   . ASN B 2 19  ? 18.582 14.210  37.158  1.00 24.22  ? 725 ASN C O   1 
ATOM   1334 C  CB  . ASN B 2 19  ? 16.846 16.493  39.366  1.00 29.80  ? 725 ASN C CB  1 
ATOM   1335 C  CG  . ASN B 2 19  ? 17.622 16.016  40.577  1.00 24.70  ? 725 ASN C CG  1 
ATOM   1336 O  OD1 . ASN B 2 19  ? 18.675 15.396  40.450  1.00 26.00  ? 725 ASN C OD1 1 
ATOM   1337 N  ND2 . ASN B 2 19  ? 17.109 16.325  41.768  1.00 23.19  ? 725 ASN C ND2 1 
ATOM   1338 N  N   . GLU B 2 20  ? 19.007 16.384  37.486  1.00 28.79  ? 726 GLU C N   1 
ATOM   1339 C  CA  . GLU B 2 20  ? 20.300 16.276  36.807  1.00 25.45  ? 726 GLU C CA  1 
ATOM   1340 C  C   . GLU B 2 20  ? 21.397 15.513  37.567  1.00 24.22  ? 726 GLU C C   1 
ATOM   1341 O  O   . GLU B 2 20  ? 22.420 15.171  36.986  1.00 29.40  ? 726 GLU C O   1 
ATOM   1342 C  CB  . GLU B 2 20  ? 20.826 17.644  36.361  1.00 25.26  ? 726 GLU C CB  1 
ATOM   1343 C  CG  . GLU B 2 20  ? 21.226 18.567  37.484  1.00 37.08  ? 726 GLU C CG  1 
ATOM   1344 C  CD  . GLU B 2 20  ? 20.115 19.517  37.864  1.00 45.68  ? 726 GLU C CD  1 
ATOM   1345 O  OE1 . GLU B 2 20  ? 20.306 20.738  37.677  1.00 51.06  ? 726 GLU C OE1 1 
ATOM   1346 O  OE2 . GLU B 2 20  ? 19.050 19.046  38.325  1.00 41.77  ? 726 GLU C OE2 1 
ATOM   1347 N  N   . THR B 2 21  ? 21.192 15.224  38.851  1.00 28.19  ? 727 THR C N   1 
ATOM   1348 C  CA  . THR B 2 21  ? 22.234 14.541  39.630  1.00 25.69  ? 727 THR C CA  1 
ATOM   1349 C  C   . THR B 2 21  ? 21.710 13.305  40.360  1.00 27.28  ? 727 THR C C   1 
ATOM   1350 O  O   . THR B 2 21  ? 22.422 12.707  41.169  1.00 25.68  ? 727 THR C O   1 
ATOM   1351 C  CB  . THR B 2 21  ? 22.845 15.482  40.691  1.00 23.47  ? 727 THR C CB  1 
ATOM   1352 O  OG1 . THR B 2 21  ? 21.848 15.780  41.676  1.00 26.35  ? 727 THR C OG1 1 
ATOM   1353 C  CG2 . THR B 2 21  ? 23.324 16.775  40.056  1.00 25.33  ? 727 THR C CG2 1 
ATOM   1354 N  N   . THR B 2 22  ? 20.467 12.929  40.084  1.00 24.56  ? 728 THR C N   1 
ATOM   1355 C  CA  . THR B 2 22  ? 19.802 11.910  40.883  1.00 21.02  ? 728 THR C CA  1 
ATOM   1356 C  C   . THR B 2 22  ? 18.991 10.962  40.003  1.00 24.65  ? 728 THR C C   1 
ATOM   1357 O  O   . THR B 2 22  ? 18.272 11.400  39.095  1.00 25.62  ? 728 THR C O   1 
ATOM   1358 C  CB  . THR B 2 22  ? 18.868 12.573  41.945  1.00 29.79  ? 728 THR C CB  1 
ATOM   1359 O  OG1 . THR B 2 22  ? 19.590 13.574  42.676  1.00 25.33  ? 728 THR C OG1 1 
ATOM   1360 C  CG2 . THR B 2 22  ? 18.317 11.553  42.918  1.00 25.73  ? 728 THR C CG2 1 
ATOM   1361 N  N   . ILE B 2 23  ? 19.110 9.668   40.285  1.00 20.75  ? 729 ILE C N   1 
ATOM   1362 C  CA  . ILE B 2 23  ? 18.315 8.647   39.609  1.00 22.32  ? 729 ILE C CA  1 
ATOM   1363 C  C   . ILE B 2 23  ? 17.638 7.775   40.648  1.00 24.54  ? 729 ILE C C   1 
ATOM   1364 O  O   . ILE B 2 23  ? 18.277 7.325   41.598  1.00 26.30  ? 729 ILE C O   1 
ATOM   1365 C  CB  . ILE B 2 23  ? 19.195 7.730   38.730  1.00 25.13  ? 729 ILE C CB  1 
ATOM   1366 C  CG1 . ILE B 2 23  ? 19.791 8.501   37.556  1.00 22.38  ? 729 ILE C CG1 1 
ATOM   1367 C  CG2 . ILE B 2 23  ? 18.399 6.514   38.229  1.00 25.30  ? 729 ILE C CG2 1 
ATOM   1368 C  CD1 . ILE B 2 23  ? 20.917 7.753   36.859  1.00 23.01  ? 729 ILE C CD1 1 
ATOM   1369 N  N   . MET B 2 24  ? 16.348 7.534   40.443  1.00 21.66  ? 730 MET C N   1 
ATOM   1370 C  CA  A MET B 2 24  ? 15.544 6.685   41.316  0.31 25.36  ? 730 MET C CA  1 
ATOM   1371 C  CA  B MET B 2 24  ? 15.565 6.681   41.329  0.69 25.18  ? 730 MET C CA  1 
ATOM   1372 C  C   . MET B 2 24  ? 15.421 5.274   40.742  1.00 27.35  ? 730 MET C C   1 
ATOM   1373 O  O   . MET B 2 24  ? 15.249 5.107   39.539  1.00 24.74  ? 730 MET C O   1 
ATOM   1374 C  CB  A MET B 2 24  ? 14.149 7.296   41.448  0.31 26.25  ? 730 MET C CB  1 
ATOM   1375 C  CB  B MET B 2 24  ? 14.183 7.296   41.526  0.69 26.79  ? 730 MET C CB  1 
ATOM   1376 C  CG  A MET B 2 24  ? 13.121 6.416   42.121  0.31 30.45  ? 730 MET C CG  1 
ATOM   1377 C  CG  B MET B 2 24  ? 13.369 6.716   42.658  0.69 34.03  ? 730 MET C CG  1 
ATOM   1378 S  SD  A MET B 2 24  ? 13.332 6.421   43.904  0.31 39.58  ? 730 MET C SD  1 
ATOM   1379 S  SD  B MET B 2 24  ? 11.608 6.841   42.295  0.69 49.33  ? 730 MET C SD  1 
ATOM   1380 C  CE  A MET B 2 24  ? 13.769 8.132   44.184  0.31 34.55  ? 730 MET C CE  1 
ATOM   1381 C  CE  B MET B 2 24  ? 11.604 8.085   41.010  0.69 40.78  ? 730 MET C CE  1 
ATOM   1382 N  N   . LEU B 2 25  ? 15.504 4.256   41.592  1.00 25.35  ? 731 LEU C N   1 
ATOM   1383 C  CA  . LEU B 2 25  ? 15.236 2.887   41.138  1.00 27.44  ? 731 LEU C CA  1 
ATOM   1384 C  C   . LEU B 2 25  ? 14.258 2.178   42.068  1.00 27.72  ? 731 LEU C C   1 
ATOM   1385 O  O   . LEU B 2 25  ? 14.107 2.571   43.219  1.00 26.53  ? 731 LEU C O   1 
ATOM   1386 C  CB  . LEU B 2 25  ? 16.515 2.066   40.979  1.00 22.61  ? 731 LEU C CB  1 
ATOM   1387 C  CG  . LEU B 2 25  ? 17.384 1.698   42.179  1.00 27.45  ? 731 LEU C CG  1 
ATOM   1388 C  CD1 . LEU B 2 25  ? 18.186 0.426   41.879  1.00 34.14  ? 731 LEU C CD1 1 
ATOM   1389 C  CD2 . LEU B 2 25  ? 18.321 2.836   42.523  1.00 27.79  ? 731 LEU C CD2 1 
ATOM   1390 N  N   . LYS B 2 26  ? 13.585 1.148   41.558  1.00 24.14  ? 732 LYS C N   1 
ATOM   1391 C  CA  . LYS B 2 26  ? 12.702 0.319   42.370  1.00 24.94  ? 732 LYS C CA  1 
ATOM   1392 C  C   . LYS B 2 26  ? 12.970 -1.149  42.061  1.00 26.81  ? 732 LYS C C   1 
ATOM   1393 O  O   . LYS B 2 26  ? 13.332 -1.489  40.941  1.00 27.10  ? 732 LYS C O   1 
ATOM   1394 C  CB  . LYS B 2 26  ? 11.229 0.639   42.090  1.00 25.13  ? 732 LYS C CB  1 
ATOM   1395 C  CG  . LYS B 2 26  ? 10.925 2.130   41.955  1.00 25.45  ? 732 LYS C CG  1 
ATOM   1396 C  CD  . LYS B 2 26  ? 9.432  2.396   41.828  1.00 29.87  ? 732 LYS C CD  1 
ATOM   1397 C  CE  . LYS B 2 26  ? 8.791  2.642   43.181  1.00 37.71  ? 732 LYS C CE  1 
ATOM   1398 N  NZ  . LYS B 2 26  ? 7.386  3.118   43.026  1.00 45.17  ? 732 LYS C NZ  1 
ATOM   1399 N  N   . TRP B 2 27  ? 12.784 -2.022  43.046  1.00 22.70  ? 733 TRP C N   1 
ATOM   1400 C  CA  . TRP B 2 27  ? 13.048 -3.439  42.825  1.00 23.14  ? 733 TRP C CA  1 
ATOM   1401 C  C   . TRP B 2 27  ? 12.082 -4.361  43.547  1.00 26.18  ? 733 TRP C C   1 
ATOM   1402 O  O   . TRP B 2 27  ? 11.420 -3.980  44.514  1.00 29.57  ? 733 TRP C O   1 
ATOM   1403 C  CB  . TRP B 2 27  ? 14.492 -3.802  43.180  1.00 23.88  ? 733 TRP C CB  1 
ATOM   1404 C  CG  . TRP B 2 27  ? 14.844 -3.604  44.631  1.00 26.47  ? 733 TRP C CG  1 
ATOM   1405 C  CD1 . TRP B 2 27  ? 14.723 -4.519  45.642  1.00 25.76  ? 733 TRP C CD1 1 
ATOM   1406 C  CD2 . TRP B 2 27  ? 15.392 -2.419  45.228  1.00 26.37  ? 733 TRP C CD2 1 
ATOM   1407 N  NE1 . TRP B 2 27  ? 15.157 -3.971  46.833  1.00 24.15  ? 733 TRP C NE1 1 
ATOM   1408 C  CE2 . TRP B 2 27  ? 15.565 -2.682  46.603  1.00 25.46  ? 733 TRP C CE2 1 
ATOM   1409 C  CE3 . TRP B 2 27  ? 15.746 -1.162  44.735  1.00 29.13  ? 733 TRP C CE3 1 
ATOM   1410 C  CZ2 . TRP B 2 27  ? 16.082 -1.733  47.486  1.00 32.99  ? 733 TRP C CZ2 1 
ATOM   1411 C  CZ3 . TRP B 2 27  ? 16.252 -0.223  45.615  1.00 34.49  ? 733 TRP C CZ3 1 
ATOM   1412 C  CH2 . TRP B 2 27  ? 16.418 -0.513  46.969  1.00 30.83  ? 733 TRP C CH2 1 
ATOM   1413 N  N   . MET B 2 28  ? 12.006 -5.581  43.040  1.00 27.31  ? 734 MET C N   1 
ATOM   1414 C  CA  . MET B 2 28  ? 11.252 -6.643  43.683  1.00 26.74  ? 734 MET C CA  1 
ATOM   1415 C  C   . MET B 2 28  ? 12.245 -7.671  44.193  1.00 29.27  ? 734 MET C C   1 
ATOM   1416 O  O   . MET B 2 28  ? 13.196 -8.038  43.495  1.00 29.56  ? 734 MET C O   1 
ATOM   1417 C  CB  . MET B 2 28  ? 10.275 -7.302  42.695  1.00 31.94  ? 734 MET C CB  1 
ATOM   1418 C  CG  . MET B 2 28  ? 9.127  -6.416  42.226  1.00 41.42  ? 734 MET C CG  1 
ATOM   1419 S  SD  . MET B 2 28  ? 8.051  -5.861  43.576  1.00 132.55 ? 734 MET C SD  1 
ATOM   1420 C  CE  . MET B 2 28  ? 6.764  -4.993  42.674  1.00 59.20  ? 734 MET C CE  1 
ATOM   1421 N  N   . TYR B 2 29  ? 12.049 -8.102  45.432  1.00 31.31  ? 735 TYR C N   1 
ATOM   1422 C  CA  . TYR B 2 29  ? 12.803 -9.215  45.981  1.00 30.75  ? 735 TYR C CA  1 
ATOM   1423 C  C   . TYR B 2 29  ? 11.882 -10.027 46.887  1.00 37.55  ? 735 TYR C C   1 
ATOM   1424 O  O   . TYR B 2 29  ? 11.224 -9.478  47.777  1.00 40.79  ? 735 TYR C O   1 
ATOM   1425 C  CB  . TYR B 2 29  ? 14.047 -8.759  46.752  1.00 25.87  ? 735 TYR C CB  1 
ATOM   1426 C  CG  . TYR B 2 29  ? 14.754 -9.931  47.385  1.00 30.38  ? 735 TYR C CG  1 
ATOM   1427 C  CD1 . TYR B 2 29  ? 15.466 -10.836 46.608  1.00 35.78  ? 735 TYR C CD1 1 
ATOM   1428 C  CD2 . TYR B 2 29  ? 14.678 -10.160 48.751  1.00 33.63  ? 735 TYR C CD2 1 
ATOM   1429 C  CE1 . TYR B 2 29  ? 16.106 -11.927 47.179  1.00 39.00  ? 735 TYR C CE1 1 
ATOM   1430 C  CE2 . TYR B 2 29  ? 15.303 -11.246 49.332  1.00 38.08  ? 735 TYR C CE2 1 
ATOM   1431 C  CZ  . TYR B 2 29  ? 16.018 -12.129 48.540  1.00 42.41  ? 735 TYR C CZ  1 
ATOM   1432 O  OH  . TYR B 2 29  ? 16.642 -13.217 49.113  1.00 40.95  ? 735 TYR C OH  1 
ATOM   1433 N  N   . ILE B 2 30  ? 11.830 -11.331 46.631  1.00 35.04  ? 736 ILE C N   1 
ATOM   1434 C  CA  . ILE B 2 30  ? 10.979 -12.251 47.374  1.00 37.41  ? 736 ILE C CA  1 
ATOM   1435 C  C   . ILE B 2 30  ? 11.854 -13.138 48.252  1.00 41.16  ? 736 ILE C C   1 
ATOM   1436 O  O   . ILE B 2 30  ? 12.581 -13.989 47.744  1.00 40.99  ? 736 ILE C O   1 
ATOM   1437 C  CB  . ILE B 2 30  ? 10.138 -13.113 46.400  1.00 41.44  ? 736 ILE C CB  1 
ATOM   1438 C  CG1 . ILE B 2 30  ? 9.302  -12.206 45.489  1.00 44.13  ? 736 ILE C CG1 1 
ATOM   1439 C  CG2 . ILE B 2 30  ? 9.255  -14.121 47.156  1.00 35.73  ? 736 ILE C CG2 1 
ATOM   1440 C  CD1 . ILE B 2 30  ? 8.306  -12.954 44.621  1.00 50.15  ? 736 ILE C CD1 1 
ATOM   1441 N  N   . PRO B 2 31  ? 11.803 -12.924 49.577  1.00 42.11  ? 737 PRO C N   1 
ATOM   1442 C  CA  . PRO B 2 31  ? 12.638 -13.667 50.529  1.00 38.18  ? 737 PRO C CA  1 
ATOM   1443 C  C   . PRO B 2 31  ? 12.462 -15.174 50.367  1.00 45.61  ? 737 PRO C C   1 
ATOM   1444 O  O   . PRO B 2 31  ? 13.420 -15.938 50.507  1.00 47.55  ? 737 PRO C O   1 
ATOM   1445 C  CB  . PRO B 2 31  ? 12.105 -13.214 51.889  1.00 40.87  ? 737 PRO C CB  1 
ATOM   1446 C  CG  . PRO B 2 31  ? 11.491 -11.879 51.629  1.00 38.19  ? 737 PRO C CG  1 
ATOM   1447 C  CD  . PRO B 2 31  ? 10.924 -11.950 50.248  1.00 38.22  ? 737 PRO C CD  1 
ATOM   1448 N  N   . ALA B 2 32  ? 11.239 -15.589 50.055  1.00 47.60  ? 738 ALA C N   1 
ATOM   1449 C  CA  . ALA B 2 32  ? 10.930 -17.001 49.867  1.00 47.08  ? 738 ALA C CA  1 
ATOM   1450 C  C   . ALA B 2 32  ? 11.790 -17.641 48.772  1.00 54.08  ? 738 ALA C C   1 
ATOM   1451 O  O   . ALA B 2 32  ? 11.958 -18.863 48.743  1.00 62.49  ? 738 ALA C O   1 
ATOM   1452 C  CB  . ALA B 2 32  ? 9.443  -17.180 49.558  1.00 37.35  ? 738 ALA C CB  1 
ATOM   1453 N  N   . SER B 2 33  ? 12.333 -16.817 47.880  1.00 49.25  ? 739 SER C N   1 
ATOM   1454 C  CA  . SER B 2 33  ? 13.138 -17.312 46.764  1.00 51.32  ? 739 SER C CA  1 
ATOM   1455 C  C   . SER B 2 33  ? 14.514 -17.781 47.232  1.00 53.89  ? 739 SER C C   1 
ATOM   1456 O  O   . SER B 2 33  ? 15.267 -18.384 46.465  1.00 56.45  ? 739 SER C O   1 
ATOM   1457 C  CB  . SER B 2 33  ? 13.294 -16.236 45.684  1.00 48.70  ? 739 SER C CB  1 
ATOM   1458 O  OG  . SER B 2 33  ? 14.186 -15.214 46.109  1.00 47.07  ? 739 SER C OG  1 
ATOM   1459 N  N   . ASN B 2 34  ? 14.833 -17.500 48.492  1.00 52.22  ? 740 ASN C N   1 
ATOM   1460 C  CA  . ASN B 2 34  ? 16.115 -17.895 49.062  1.00 55.31  ? 740 ASN C CA  1 
ATOM   1461 C  C   . ASN B 2 34  ? 15.947 -18.726 50.330  1.00 65.36  ? 740 ASN C C   1 
ATOM   1462 O  O   . ASN B 2 34  ? 16.887 -18.885 51.110  1.00 67.38  ? 740 ASN C O   1 
ATOM   1463 C  CB  . ASN B 2 34  ? 16.975 -16.663 49.351  1.00 51.43  ? 740 ASN C CB  1 
ATOM   1464 C  CG  . ASN B 2 34  ? 17.833 -16.260 48.169  1.00 50.30  ? 740 ASN C CG  1 
ATOM   1465 O  OD1 . ASN B 2 34  ? 18.590 -17.070 47.634  1.00 42.91  ? 740 ASN C OD1 1 
ATOM   1466 N  ND2 . ASN B 2 34  ? 17.722 -15.003 47.758  1.00 49.99  ? 740 ASN C ND2 1 
ATOM   1467 N  N   . ASN B 2 35  ? 14.752 -19.280 50.508  1.00 20.00  ? 741 ASN C N   1 
ATOM   1468 C  CA  . ASN B 2 35  ? 14.369 -20.060 51.678  1.00 20.00  ? 741 ASN C CA  1 
ATOM   1469 C  C   . ASN B 2 35  ? 14.230 -19.219 52.914  1.00 20.00  ? 741 ASN C C   1 
ATOM   1470 O  O   . ASN B 2 35  ? 14.573 -19.621 53.986  1.00 20.00  ? 741 ASN C O   1 
ATOM   1471 C  CB  . ASN B 2 35  ? 15.340 -21.194 51.947  1.00 20.00  ? 741 ASN C CB  1 
ATOM   1472 C  CG  . ASN B 2 35  ? 15.493 -22.105 50.795  1.00 20.00  ? 741 ASN C CG  1 
ATOM   1473 O  OD1 . ASN B 2 35  ? 14.650 -22.185 49.957  1.00 20.00  ? 741 ASN C OD1 1 
ATOM   1474 N  ND2 . ASN B 2 35  ? 16.580 -22.787 50.750  1.00 20.00  ? 741 ASN C ND2 1 
ATOM   1475 N  N   . ASN B 2 36  ? 13.713 -18.026 52.723  1.00 67.00  ? 742 ASN C N   1 
ATOM   1476 C  CA  . ASN B 2 36  ? 13.480 -17.084 53.771  1.00 60.80  ? 742 ASN C CA  1 
ATOM   1477 C  C   . ASN B 2 36  ? 14.733 -16.690 54.503  1.00 53.71  ? 742 ASN C C   1 
ATOM   1478 O  O   . ASN B 2 36  ? 14.654 -16.195 55.559  1.00 48.70  ? 742 ASN C O   1 
ATOM   1479 C  CB  . ASN B 2 36  ? 12.356 -17.543 54.702  1.00 64.29  ? 742 ASN C CB  1 
ATOM   1480 C  CG  . ASN B 2 36  ? 10.976 -17.285 54.120  1.00 66.22  ? 742 ASN C CG  1 
ATOM   1481 O  OD1 . ASN B 2 36  ? 10.452 -16.201 54.184  1.00 74.40  ? 742 ASN C OD1 1 
ATOM   1482 N  ND2 . ASN B 2 36  ? 10.400 -18.314 53.541  1.00 55.54  ? 742 ASN C ND2 1 
ATOM   1483 N  N   . THR B 2 37  ? 15.885 -16.846 53.861  1.00 54.66  ? 743 THR C N   1 
ATOM   1484 C  CA  . THR B 2 37  ? 17.175 -16.407 54.377  1.00 54.79  ? 743 THR C CA  1 
ATOM   1485 C  C   . THR B 2 37  ? 17.181 -14.906 54.649  1.00 53.06  ? 743 THR C C   1 
ATOM   1486 O  O   . THR B 2 37  ? 16.779 -14.110 53.798  1.00 53.44  ? 743 THR C O   1 
ATOM   1487 C  CB  . THR B 2 37  ? 18.320 -16.747 53.405  1.00 53.62  ? 743 THR C CB  1 
ATOM   1488 O  OG1 . THR B 2 37  ? 19.578 -16.474 54.030  1.00 54.05  ? 743 THR C OG1 1 
ATOM   1489 C  CG2 . THR B 2 37  ? 18.200 -15.921 52.133  1.00 50.36  ? 743 THR C CG2 1 
ATOM   1490 N  N   . PRO B 2 38  ? 17.636 -14.525 55.836  1.00 55.59  ? 744 PRO C N   1 
ATOM   1491 C  CA  . PRO B 2 38  ? 17.696 -13.111 56.223  1.00 55.55  ? 744 PRO C CA  1 
ATOM   1492 C  C   . PRO B 2 38  ? 18.571 -12.302 55.271  1.00 58.31  ? 744 PRO C C   1 
ATOM   1493 O  O   . PRO B 2 38  ? 19.514 -12.839 54.696  1.00 59.33  ? 744 PRO C O   1 
ATOM   1494 C  CB  . PRO B 2 38  ? 18.344 -13.161 57.613  1.00 53.02  ? 744 PRO C CB  1 
ATOM   1495 C  CG  . PRO B 2 38  ? 19.052 -14.493 57.643  1.00 51.27  ? 744 PRO C CG  1 
ATOM   1496 C  CD  . PRO B 2 38  ? 18.099 -15.391 56.933  1.00 51.46  ? 744 PRO C CD  1 
ATOM   1497 N  N   . ILE B 2 39  ? 18.246 -11.023 55.116  1.00 56.18  ? 745 ILE C N   1 
ATOM   1498 C  CA  . ILE B 2 39  ? 19.003 -10.119 54.263  1.00 53.90  ? 745 ILE C CA  1 
ATOM   1499 C  C   . ILE B 2 39  ? 19.424 -8.894  55.067  1.00 58.29  ? 745 ILE C C   1 
ATOM   1500 O  O   . ILE B 2 39  ? 18.583 -8.239  55.686  1.00 63.72  ? 745 ILE C O   1 
ATOM   1501 C  CB  . ILE B 2 39  ? 18.144 -9.644  53.078  1.00 52.42  ? 745 ILE C CB  1 
ATOM   1502 C  CG1 . ILE B 2 39  ? 17.722 -10.828 52.201  1.00 47.81  ? 745 ILE C CG1 1 
ATOM   1503 C  CG2 . ILE B 2 39  ? 18.879 -8.586  52.275  1.00 56.84  ? 745 ILE C CG2 1 
ATOM   1504 C  CD1 . ILE B 2 39  ? 18.875 -11.556 51.529  1.00 40.48  ? 745 ILE C CD1 1 
ATOM   1505 N  N   . HIS B 2 40  ? 20.719 -8.582  55.061  1.00 56.23  ? 746 HIS C N   1 
ATOM   1506 C  CA  . HIS B 2 40  ? 21.213 -7.400  55.769  1.00 55.23  ? 746 HIS C CA  1 
ATOM   1507 C  C   . HIS B 2 40  ? 20.898 -6.121  55.005  1.00 51.82  ? 746 HIS C C   1 
ATOM   1508 O  O   . HIS B 2 40  ? 20.760 -5.049  55.598  1.00 52.93  ? 746 HIS C O   1 
ATOM   1509 C  CB  . HIS B 2 40  ? 22.718 -7.484  56.024  1.00 60.53  ? 746 HIS C CB  1 
ATOM   1510 C  CG  . HIS B 2 40  ? 23.145 -8.722  56.745  1.00 68.07  ? 746 HIS C CG  1 
ATOM   1511 N  ND1 . HIS B 2 40  ? 22.329 -9.382  57.642  1.00 69.34  ? 746 HIS C ND1 1 
ATOM   1512 C  CD2 . HIS B 2 40  ? 24.311 -9.411  56.721  1.00 69.90  ? 746 HIS C CD2 1 
ATOM   1513 C  CE1 . HIS B 2 40  ? 22.971 -10.430 58.126  1.00 72.19  ? 746 HIS C CE1 1 
ATOM   1514 N  NE2 . HIS B 2 40  ? 24.175 -10.471 57.583  1.00 72.96  ? 746 HIS C NE2 1 
ATOM   1515 N  N   . GLY B 2 41  ? 20.792 -6.228  53.685  1.00 39.03  ? 747 GLY C N   1 
ATOM   1516 C  CA  . GLY B 2 41  ? 20.455 -5.074  52.878  1.00 34.73  ? 747 GLY C CA  1 
ATOM   1517 C  C   . GLY B 2 41  ? 20.699 -5.379  51.423  1.00 35.37  ? 747 GLY C C   1 
ATOM   1518 O  O   . GLY B 2 41  ? 20.878 -6.545  51.061  1.00 30.52  ? 747 GLY C O   1 
ATOM   1519 N  N   . PHE B 2 42  ? 20.707 -4.334  50.596  1.00 29.44  ? 748 PHE C N   1 
ATOM   1520 C  CA  . PHE B 2 42  ? 21.027 -4.483  49.182  1.00 29.09  ? 748 PHE C CA  1 
ATOM   1521 C  C   . PHE B 2 42  ? 22.215 -3.609  48.823  1.00 35.96  ? 748 PHE C C   1 
ATOM   1522 O  O   . PHE B 2 42  ? 22.430 -2.556  49.425  1.00 35.99  ? 748 PHE C O   1 
ATOM   1523 C  CB  . PHE B 2 42  ? 19.828 -4.095  48.317  1.00 28.67  ? 748 PHE C CB  1 
ATOM   1524 C  CG  . PHE B 2 42  ? 18.562 -4.819  48.683  1.00 30.55  ? 748 PHE C CG  1 
ATOM   1525 C  CD1 . PHE B 2 42  ? 17.626 -4.226  49.516  1.00 32.83  ? 748 PHE C CD1 1 
ATOM   1526 C  CD2 . PHE B 2 42  ? 18.328 -6.098  48.217  1.00 39.55  ? 748 PHE C CD2 1 
ATOM   1527 C  CE1 . PHE B 2 42  ? 16.465 -4.890  49.863  1.00 35.00  ? 748 PHE C CE1 1 
ATOM   1528 C  CE2 . PHE B 2 42  ? 17.163 -6.777  48.562  1.00 40.84  ? 748 PHE C CE2 1 
ATOM   1529 C  CZ  . PHE B 2 42  ? 16.232 -6.169  49.389  1.00 38.03  ? 748 PHE C CZ  1 
ATOM   1530 N  N   . TYR B 2 43  ? 22.998 -4.058  47.846  1.00 35.23  ? 749 TYR C N   1 
ATOM   1531 C  CA  . TYR B 2 43  ? 24.034 -3.221  47.261  1.00 26.56  ? 749 TYR C CA  1 
ATOM   1532 C  C   . TYR B 2 43  ? 23.520 -2.742  45.917  1.00 28.21  ? 749 TYR C C   1 
ATOM   1533 O  O   . TYR B 2 43  ? 23.092 -3.553  45.094  1.00 26.97  ? 749 TYR C O   1 
ATOM   1534 C  CB  . TYR B 2 43  ? 25.331 -4.011  47.054  1.00 29.55  ? 749 TYR C CB  1 
ATOM   1535 C  CG  . TYR B 2 43  ? 26.079 -4.351  48.321  1.00 36.44  ? 749 TYR C CG  1 
ATOM   1536 C  CD1 . TYR B 2 43  ? 26.534 -5.645  48.556  1.00 38.65  ? 749 TYR C CD1 1 
ATOM   1537 C  CD2 . TYR B 2 43  ? 26.335 -3.381  49.282  1.00 40.32  ? 749 TYR C CD2 1 
ATOM   1538 C  CE1 . TYR B 2 43  ? 27.227 -5.963  49.715  1.00 42.96  ? 749 TYR C CE1 1 
ATOM   1539 C  CE2 . TYR B 2 43  ? 27.022 -3.688  50.446  1.00 45.73  ? 749 TYR C CE2 1 
ATOM   1540 C  CZ  . TYR B 2 43  ? 27.465 -4.982  50.652  1.00 46.66  ? 749 TYR C CZ  1 
ATOM   1541 O  OH  . TYR B 2 43  ? 28.145 -5.297  51.799  1.00 48.33  ? 749 TYR C OH  1 
ATOM   1542 N  N   . ILE B 2 44  ? 23.552 -1.431  45.696  1.00 29.45  ? 750 ILE C N   1 
ATOM   1543 C  CA  . ILE B 2 44  ? 23.184 -0.867  44.402  1.00 32.69  ? 750 ILE C CA  1 
ATOM   1544 C  C   . ILE B 2 44  ? 24.435 -0.311  43.725  1.00 34.42  ? 750 ILE C C   1 
ATOM   1545 O  O   . ILE B 2 44  ? 25.050 0.628   44.233  1.00 31.40  ? 750 ILE C O   1 
ATOM   1546 C  CB  . ILE B 2 44  ? 22.126 0.254   44.528  1.00 33.20  ? 750 ILE C CB  1 
ATOM   1547 C  CG1 . ILE B 2 44  ? 20.754 -0.314  44.907  1.00 34.31  ? 750 ILE C CG1 1 
ATOM   1548 C  CG2 . ILE B 2 44  ? 22.000 1.004   43.217  1.00 37.24  ? 750 ILE C CG2 1 
ATOM   1549 C  CD1 . ILE B 2 44  ? 20.605 -0.671  46.353  1.00 38.89  ? 750 ILE C CD1 1 
ATOM   1550 N  N   . TYR B 2 45  ? 24.805 -0.912  42.590  1.00 26.47  ? 751 TYR C N   1 
ATOM   1551 C  CA  . TYR B 2 45  ? 26.011 -0.555  41.851  1.00 25.11  ? 751 TYR C CA  1 
ATOM   1552 C  C   . TYR B 2 45  ? 25.689 0.381   40.687  1.00 20.74  ? 751 TYR C C   1 
ATOM   1553 O  O   . TYR B 2 45  ? 24.697 0.191   40.010  1.00 22.46  ? 751 TYR C O   1 
ATOM   1554 C  CB  . TYR B 2 45  ? 26.647 -1.815  41.272  1.00 27.00  ? 751 TYR C CB  1 
ATOM   1555 C  CG  . TYR B 2 45  ? 27.100 -2.811  42.304  1.00 29.36  ? 751 TYR C CG  1 
ATOM   1556 C  CD1 . TYR B 2 45  ? 28.437 -2.897  42.666  1.00 30.08  ? 751 TYR C CD1 1 
ATOM   1557 C  CD2 . TYR B 2 45  ? 26.196 -3.664  42.924  1.00 27.85  ? 751 TYR C CD2 1 
ATOM   1558 C  CE1 . TYR B 2 45  ? 28.862 -3.803  43.610  1.00 29.53  ? 751 TYR C CE1 1 
ATOM   1559 C  CE2 . TYR B 2 45  ? 26.613 -4.576  43.884  1.00 26.93  ? 751 TYR C CE2 1 
ATOM   1560 C  CZ  . TYR B 2 45  ? 27.950 -4.638  44.218  1.00 33.00  ? 751 TYR C CZ  1 
ATOM   1561 O  OH  . TYR B 2 45  ? 28.384 -5.538  45.164  1.00 34.46  ? 751 TYR C OH  1 
ATOM   1562 N  N   . TYR B 2 46  ? 26.544 1.364   40.438  1.00 18.55  ? 752 TYR C N   1 
ATOM   1563 C  CA  . TYR B 2 46  ? 26.346 2.253   39.291  1.00 20.78  ? 752 TYR C CA  1 
ATOM   1564 C  C   . TYR B 2 46  ? 27.673 2.695   38.680  1.00 25.67  ? 752 TYR C C   1 
ATOM   1565 O  O   . TYR B 2 46  ? 28.647 2.961   39.383  1.00 28.50  ? 752 TYR C O   1 
ATOM   1566 C  CB  . TYR B 2 46  ? 25.472 3.463   39.652  1.00 22.27  ? 752 TYR C CB  1 
ATOM   1567 C  CG  . TYR B 2 46  ? 25.864 4.158   40.938  1.00 25.85  ? 752 TYR C CG  1 
ATOM   1568 C  CD1 . TYR B 2 46  ? 26.596 5.339   40.923  1.00 24.86  ? 752 TYR C CD1 1 
ATOM   1569 C  CD2 . TYR B 2 46  ? 25.490 3.633   42.174  1.00 28.70  ? 752 TYR C CD2 1 
ATOM   1570 C  CE1 . TYR B 2 46  ? 26.955 5.975   42.102  1.00 30.40  ? 752 TYR C CE1 1 
ATOM   1571 C  CE2 . TYR B 2 46  ? 25.846 4.260   43.353  1.00 32.85  ? 752 TYR C CE2 1 
ATOM   1572 C  CZ  . TYR B 2 46  ? 26.580 5.430   43.311  1.00 30.61  ? 752 TYR C CZ  1 
ATOM   1573 O  OH  . TYR B 2 46  ? 26.931 6.051   44.486  1.00 33.96  ? 752 TYR C OH  1 
ATOM   1574 N  N   . ARG B 2 47  ? 27.697 2.761   37.356  1.00 23.04  ? 753 ARG C N   1 
ATOM   1575 C  CA  . ARG B 2 47  ? 28.910 3.082   36.618  1.00 27.77  ? 753 ARG C CA  1 
ATOM   1576 C  C   . ARG B 2 47  ? 28.540 3.946   35.427  1.00 23.08  ? 753 ARG C C   1 
ATOM   1577 O  O   . ARG B 2 47  ? 27.512 3.709   34.798  1.00 21.98  ? 753 ARG C O   1 
ATOM   1578 C  CB  . ARG B 2 47  ? 29.557 1.787   36.128  1.00 28.46  ? 753 ARG C CB  1 
ATOM   1579 C  CG  . ARG B 2 47  ? 30.636 1.964   35.077  1.00 29.49  ? 753 ARG C CG  1 
ATOM   1580 C  CD  . ARG B 2 47  ? 31.135 0.601   34.583  1.00 22.50  ? 753 ARG C CD  1 
ATOM   1581 N  NE  . ARG B 2 47  ? 30.138 -0.091  33.766  1.00 17.12  ? 753 ARG C NE  1 
ATOM   1582 C  CZ  . ARG B 2 47  ? 30.308 -1.311  33.271  1.00 21.72  ? 753 ARG C CZ  1 
ATOM   1583 N  NH1 . ARG B 2 47  ? 31.424 -1.978  33.531  1.00 20.37  ? 753 ARG C NH1 1 
ATOM   1584 N  NH2 . ARG B 2 47  ? 29.366 -1.870  32.527  1.00 20.22  ? 753 ARG C NH2 1 
ATOM   1585 N  N   . PRO B 2 48  ? 29.363 4.955   35.109  1.00 25.40  ? 754 PRO C N   1 
ATOM   1586 C  CA  . PRO B 2 48  ? 29.055 5.686   33.875  1.00 24.64  ? 754 PRO C CA  1 
ATOM   1587 C  C   . PRO B 2 48  ? 29.053 4.717   32.697  1.00 26.13  ? 754 PRO C C   1 
ATOM   1588 O  O   . PRO B 2 48  ? 29.920 3.836   32.627  1.00 22.15  ? 754 PRO C O   1 
ATOM   1589 C  CB  . PRO B 2 48  ? 30.209 6.676   33.758  1.00 20.67  ? 754 PRO C CB  1 
ATOM   1590 C  CG  . PRO B 2 48  ? 30.678 6.868   35.194  1.00 25.01  ? 754 PRO C CG  1 
ATOM   1591 C  CD  . PRO B 2 48  ? 30.507 5.535   35.840  1.00 22.40  ? 754 PRO C CD  1 
ATOM   1592 N  N   . THR B 2 49  ? 28.083 4.881   31.802  1.00 21.07  ? 755 THR C N   1 
ATOM   1593 C  CA  . THR B 2 49  ? 27.867 3.973   30.670  1.00 15.87  ? 755 THR C CA  1 
ATOM   1594 C  C   . THR B 2 49  ? 29.023 3.959   29.665  1.00 20.44  ? 755 THR C C   1 
ATOM   1595 O  O   . THR B 2 49  ? 29.249 2.966   28.978  1.00 19.55  ? 755 THR C O   1 
ATOM   1596 C  CB  . THR B 2 49  ? 26.517 4.295   29.983  1.00 15.79  ? 755 THR C CB  1 
ATOM   1597 O  OG1 . THR B 2 49  ? 25.459 4.093   30.936  1.00 18.14  ? 755 THR C OG1 1 
ATOM   1598 C  CG2 . THR B 2 49  ? 26.287 3.405   28.758  1.00 15.47  ? 755 THR C CG2 1 
ATOM   1599 N  N   . ASP B 2 50  ? 29.772 5.053   29.604  1.00 22.57  ? 756 ASP C N   1 
ATOM   1600 C  CA  . ASP B 2 50  ? 30.965 5.117   28.777  1.00 24.01  ? 756 ASP C CA  1 
ATOM   1601 C  C   . ASP B 2 50  ? 32.053 4.102   29.176  1.00 22.71  ? 756 ASP C C   1 
ATOM   1602 O  O   . ASP B 2 50  ? 32.907 3.729   28.361  1.00 21.39  ? 756 ASP C O   1 
ATOM   1603 C  CB  . ASP B 2 50  ? 31.528 6.540   28.792  1.00 25.35  ? 756 ASP C CB  1 
ATOM   1604 C  CG  . ASP B 2 50  ? 30.832 7.451   27.799  1.00 27.93  ? 756 ASP C CG  1 
ATOM   1605 O  OD1 . ASP B 2 50  ? 29.883 6.984   27.133  1.00 22.38  ? 756 ASP C OD1 1 
ATOM   1606 O  OD2 . ASP B 2 50  ? 31.240 8.629   27.673  1.00 24.35  ? 756 ASP C OD2 1 
ATOM   1607 N  N   . SER B 2 51  ? 32.030 3.653   30.425  1.00 18.00  ? 757 SER C N   1 
ATOM   1608 C  CA  . SER B 2 51  ? 32.984 2.634   30.856  1.00 22.76  ? 757 SER C CA  1 
ATOM   1609 C  C   . SER B 2 51  ? 32.432 1.217   30.677  1.00 24.21  ? 757 SER C C   1 
ATOM   1610 O  O   . SER B 2 51  ? 31.288 0.937   31.036  1.00 23.55  ? 757 SER C O   1 
ATOM   1611 C  CB  . SER B 2 51  ? 33.394 2.850   32.315  1.00 23.83  ? 757 SER C CB  1 
ATOM   1612 O  OG  . SER B 2 51  ? 34.058 1.700   32.824  1.00 26.92  ? 757 SER C OG  1 
ATOM   1613 N  N   . ASP B 2 52  ? 33.258 0.326   30.132  1.00 25.37  ? 758 ASP C N   1 
ATOM   1614 C  CA  . ASP B 2 52  ? 32.901 -1.086  29.992  1.00 23.65  ? 758 ASP C CA  1 
ATOM   1615 C  C   . ASP B 2 52  ? 33.704 -1.960  30.952  1.00 28.69  ? 758 ASP C C   1 
ATOM   1616 O  O   . ASP B 2 52  ? 33.717 -3.182  30.825  1.00 32.84  ? 758 ASP C O   1 
ATOM   1617 C  CB  . ASP B 2 52  ? 33.099 -1.560  28.551  1.00 20.82  ? 758 ASP C CB  1 
ATOM   1618 C  CG  . ASP B 2 52  ? 32.154 -0.874  27.576  1.00 19.71  ? 758 ASP C CG  1 
ATOM   1619 O  OD1 . ASP B 2 52  ? 32.353 -1.011  26.350  1.00 22.76  ? 758 ASP C OD1 1 
ATOM   1620 O  OD2 . ASP B 2 52  ? 31.207 -0.199  28.028  1.00 22.65  ? 758 ASP C OD2 1 
ATOM   1621 N  N   . ASN B 2 53  ? 34.366 -1.317  31.908  1.00 27.16  ? 759 ASN C N   1 
ATOM   1622 C  CA  . ASN B 2 53  ? 35.186 -1.994  32.917  1.00 29.92  ? 759 ASN C CA  1 
ATOM   1623 C  C   . ASN B 2 53  ? 34.368 -2.266  34.171  1.00 27.64  ? 759 ASN C C   1 
ATOM   1624 O  O   . ASN B 2 53  ? 33.899 -1.334  34.818  1.00 24.75  ? 759 ASN C O   1 
ATOM   1625 C  CB  . ASN B 2 53  ? 36.384 -1.102  33.263  1.00 32.11  ? 759 ASN C CB  1 
ATOM   1626 C  CG  . ASN B 2 53  ? 37.421 -1.800  34.117  1.00 33.72  ? 759 ASN C CG  1 
ATOM   1627 O  OD1 . ASN B 2 53  ? 37.122 -2.768  34.809  1.00 37.32  ? 759 ASN C OD1 1 
ATOM   1628 N  ND2 . ASN B 2 53  ? 38.652 -1.306  34.066  1.00 35.05  ? 759 ASN C ND2 1 
ATOM   1629 N  N   . ASP B 2 54  ? 34.188 -3.537  34.515  1.00 27.44  ? 760 ASP C N   1 
ATOM   1630 C  CA  . ASP B 2 54  ? 33.325 -3.894  35.642  1.00 37.86  ? 760 ASP C CA  1 
ATOM   1631 C  C   . ASP B 2 54  ? 33.909 -3.471  36.991  1.00 37.86  ? 760 ASP C C   1 
ATOM   1632 O  O   . ASP B 2 54  ? 33.246 -3.584  38.023  1.00 40.42  ? 760 ASP C O   1 
ATOM   1633 C  CB  . ASP B 2 54  ? 32.972 -5.389  35.623  1.00 37.68  ? 760 ASP C CB  1 
ATOM   1634 C  CG  . ASP B 2 54  ? 31.897 -5.723  34.597  1.00 40.09  ? 760 ASP C CG  1 
ATOM   1635 O  OD1 . ASP B 2 54  ? 31.365 -4.796  33.946  1.00 35.16  ? 760 ASP C OD1 1 
ATOM   1636 O  OD2 . ASP B 2 54  ? 31.574 -6.917  34.436  1.00 41.69  ? 760 ASP C OD2 1 
ATOM   1637 N  N   . SER B 2 55  ? 35.139 -2.967  36.979  1.00 35.92  ? 761 SER C N   1 
ATOM   1638 C  CA  A SER B 2 55  ? 35.769 -2.485  38.204  0.54 34.92  ? 761 SER C CA  1 
ATOM   1639 C  CA  B SER B 2 55  ? 35.780 -2.479  38.196  0.46 34.88  ? 761 SER C CA  1 
ATOM   1640 C  C   . SER B 2 55  ? 35.398 -1.031  38.498  1.00 33.52  ? 761 SER C C   1 
ATOM   1641 O  O   . SER B 2 55  ? 35.722 -0.508  39.561  1.00 37.31  ? 761 SER C O   1 
ATOM   1642 C  CB  A SER B 2 55  ? 37.295 -2.636  38.132  0.54 33.76  ? 761 SER C CB  1 
ATOM   1643 C  CB  B SER B 2 55  ? 37.302 -2.577  38.071  0.46 33.80  ? 761 SER C CB  1 
ATOM   1644 O  OG  A SER B 2 55  ? 37.677 -4.001  38.124  0.54 33.09  ? 761 SER C OG  1 
ATOM   1645 O  OG  B SER B 2 55  ? 37.786 -1.603  37.165  0.46 31.49  ? 761 SER C OG  1 
ATOM   1646 N  N   . ASP B 2 56  ? 34.712 -0.383  37.558  1.00 28.84  ? 762 ASP C N   1 
ATOM   1647 C  CA  . ASP B 2 56  ? 34.383 1.043   37.676  1.00 27.11  ? 762 ASP C CA  1 
ATOM   1648 C  C   . ASP B 2 56  ? 33.024 1.323   38.324  1.00 34.29  ? 762 ASP C C   1 
ATOM   1649 O  O   . ASP B 2 56  ? 32.544 2.461   38.295  1.00 34.44  ? 762 ASP C O   1 
ATOM   1650 C  CB  . ASP B 2 56  ? 34.419 1.725   36.299  1.00 27.98  ? 762 ASP C CB  1 
ATOM   1651 C  CG  . ASP B 2 56  ? 35.840 1.971   35.787  1.00 37.90  ? 762 ASP C CG  1 
ATOM   1652 O  OD1 . ASP B 2 56  ? 36.794 1.912   36.593  1.00 39.81  ? 762 ASP C OD1 1 
ATOM   1653 O  OD2 . ASP B 2 56  ? 35.994 2.237   34.569  1.00 32.05  ? 762 ASP C OD2 1 
ATOM   1654 N  N   . TYR B 2 57  ? 32.389 0.296   38.879  1.00 24.87  ? 763 TYR C N   1 
ATOM   1655 C  CA  . TYR B 2 57  ? 31.102 0.488   39.549  1.00 28.23  ? 763 TYR C CA  1 
ATOM   1656 C  C   . TYR B 2 57  ? 31.269 1.027   40.965  1.00 32.37  ? 763 TYR C C   1 
ATOM   1657 O  O   . TYR B 2 57  ? 32.016 0.455   41.753  1.00 31.88  ? 763 TYR C O   1 
ATOM   1658 C  CB  . TYR B 2 57  ? 30.358 -0.833  39.665  1.00 28.08  ? 763 TYR C CB  1 
ATOM   1659 C  CG  . TYR B 2 57  ? 29.590 -1.267  38.443  1.00 29.51  ? 763 TYR C CG  1 
ATOM   1660 C  CD1 . TYR B 2 57  ? 30.163 -2.129  37.512  1.00 32.42  ? 763 TYR C CD1 1 
ATOM   1661 C  CD2 . TYR B 2 57  ? 28.282 -0.851  38.238  1.00 25.64  ? 763 TYR C CD2 1 
ATOM   1662 C  CE1 . TYR B 2 57  ? 29.454 -2.546  36.394  1.00 29.28  ? 763 TYR C CE1 1 
ATOM   1663 C  CE2 . TYR B 2 57  ? 27.565 -1.266  37.130  1.00 20.76  ? 763 TYR C CE2 1 
ATOM   1664 C  CZ  . TYR B 2 57  ? 28.156 -2.113  36.213  1.00 23.04  ? 763 TYR C CZ  1 
ATOM   1665 O  OH  . TYR B 2 57  ? 27.440 -2.526  35.110  1.00 24.03  ? 763 TYR C OH  1 
ATOM   1666 N  N   . LYS B 2 58  ? 30.557 2.103   41.298  1.00 22.99  ? 764 LYS C N   1 
ATOM   1667 C  CA  . LYS B 2 58  ? 30.447 2.518   42.694  1.00 29.87  ? 764 LYS C CA  1 
ATOM   1668 C  C   . LYS B 2 58  ? 29.280 1.784   43.329  1.00 32.49  ? 764 LYS C C   1 
ATOM   1669 O  O   . LYS B 2 58  ? 28.375 1.305   42.629  1.00 26.34  ? 764 LYS C O   1 
ATOM   1670 C  CB  . LYS B 2 58  ? 30.267 4.033   42.830  1.00 38.62  ? 764 LYS C CB  1 
ATOM   1671 C  CG  . LYS B 2 58  ? 31.550 4.824   42.644  1.00 48.70  ? 764 LYS C CG  1 
ATOM   1672 C  CD  . LYS B 2 58  ? 31.273 6.318   42.538  1.00 60.73  ? 764 LYS C CD  1 
ATOM   1673 C  CE  . LYS B 2 58  ? 32.470 7.055   41.935  1.00 69.08  ? 764 LYS C CE  1 
ATOM   1674 N  NZ  . LYS B 2 58  ? 32.129 8.428   41.450  1.00 71.45  ? 764 LYS C NZ  1 
ATOM   1675 N  N   . LYS B 2 59  ? 29.296 1.707   44.653  1.00 30.42  ? 765 LYS C N   1 
ATOM   1676 C  CA  . LYS B 2 59  ? 28.335 0.892   45.382  1.00 37.47  ? 765 LYS C CA  1 
ATOM   1677 C  C   . LYS B 2 59  ? 27.629 1.684   46.488  1.00 40.18  ? 765 LYS C C   1 
ATOM   1678 O  O   . LYS B 2 59  ? 28.269 2.403   47.255  1.00 42.53  ? 765 LYS C O   1 
ATOM   1679 C  CB  . LYS B 2 59  ? 29.070 -0.306  45.990  1.00 40.94  ? 765 LYS C CB  1 
ATOM   1680 C  CG  . LYS B 2 59  ? 28.181 -1.439  46.456  1.00 43.67  ? 765 LYS C CG  1 
ATOM   1681 C  CD  . LYS B 2 59  ? 29.014 -2.643  46.875  1.00 46.98  ? 765 LYS C CD  1 
ATOM   1682 C  CE  . LYS B 2 59  ? 29.899 -2.317  48.070  1.00 51.42  ? 765 LYS C CE  1 
ATOM   1683 N  NZ  . LYS B 2 59  ? 30.688 -3.498  48.519  1.00 54.52  ? 765 LYS C NZ  1 
ATOM   1684 N  N   . ASP B 2 60  ? 26.304 1.560   46.557  1.00 39.22  ? 766 ASP C N   1 
ATOM   1685 C  CA  . ASP B 2 60  ? 25.529 2.129   47.657  1.00 43.14  ? 766 ASP C CA  1 
ATOM   1686 C  C   . ASP B 2 60  ? 24.998 1.008   48.537  1.00 53.72  ? 766 ASP C C   1 
ATOM   1687 O  O   . ASP B 2 60  ? 25.010 -0.163  48.154  1.00 60.29  ? 766 ASP C O   1 
ATOM   1688 C  CB  . ASP B 2 60  ? 24.350 2.956   47.144  1.00 44.91  ? 766 ASP C CB  1 
ATOM   1689 C  CG  . ASP B 2 60  ? 24.726 4.390   46.822  1.00 40.32  ? 766 ASP C CG  1 
ATOM   1690 O  OD1 . ASP B 2 60  ? 25.933 4.714   46.796  1.00 33.60  ? 766 ASP C OD1 1 
ATOM   1691 O  OD2 . ASP B 2 60  ? 23.800 5.195   46.590  1.00 42.93  ? 766 ASP C OD2 1 
ATOM   1692 N  N   . MET B 2 61  ? 24.637 1.291   49.784  1.00 52.62  ? 767 MET C N   1 
ATOM   1693 C  CA  . MET B 2 61  ? 24.069 0.301   50.696  1.00 47.18  ? 767 MET C CA  1 
ATOM   1694 C  C   . MET B 2 61  ? 22.740 0.788   51.261  1.00 44.16  ? 767 MET C C   1 
ATOM   1695 O  O   . MET B 2 61  ? 22.638 1.867   51.713  1.00 37.44  ? 767 MET C O   1 
ATOM   1696 C  CB  . MET B 2 61  ? 24.992 0.002   51.847  1.00 54.78  ? 767 MET C CB  1 
ATOM   1697 C  CG  . MET B 2 61  ? 24.659 -1.275  52.599  1.00 64.12  ? 767 MET C CG  1 
ATOM   1698 S  SD  . MET B 2 61  ? 23.616 -1.065  54.081  1.00 145.61 ? 767 MET C SD  1 
ATOM   1699 C  CE  . MET B 2 61  ? 24.799 -0.323  55.179  1.00 89.27  ? 767 MET C CE  1 
ATOM   1700 N  N   . VAL B 2 62  ? 21.730 -0.049  51.176  1.00 44.64  ? 768 VAL C N   1 
ATOM   1701 C  CA  . VAL B 2 62  ? 20.389 0.208   51.698  1.00 45.34  ? 768 VAL C CA  1 
ATOM   1702 C  C   . VAL B 2 62  ? 19.951 -0.959  52.571  1.00 44.36  ? 768 VAL C C   1 
ATOM   1703 O  O   . VAL B 2 62  ? 20.418 -2.079  52.387  1.00 43.50  ? 768 VAL C O   1 
ATOM   1704 C  CB  . VAL B 2 62  ? 19.366 0.406   50.566  1.00 52.65  ? 768 VAL C CB  1 
ATOM   1705 C  CG1 . VAL B 2 62  ? 19.772 1.580   49.687  1.00 53.72  ? 768 VAL C CG1 1 
ATOM   1706 C  CG2 . VAL B 2 62  ? 19.244 -0.860  49.743  1.00 54.14  ? 768 VAL C CG2 1 
ATOM   1707 N  N   . GLU B 2 63  ? 19.060 -0.698  53.525  1.00 43.57  ? 769 GLU C N   1 
ATOM   1708 C  CA  . GLU B 2 63  ? 18.642 -1.725  54.480  1.00 46.72  ? 769 GLU C CA  1 
ATOM   1709 C  C   . GLU B 2 63  ? 17.728 -2.772  53.849  1.00 43.39  ? 769 GLU C C   1 
ATOM   1710 O  O   . GLU B 2 63  ? 17.147 -2.544  52.798  1.00 43.78  ? 769 GLU C O   1 
ATOM   1711 C  CB  . GLU B 2 63  ? 17.956 -1.084  55.687  1.00 54.64  ? 769 GLU C CB  1 
ATOM   1712 C  CG  . GLU B 2 63  ? 18.832 -0.074  56.421  1.00 65.54  ? 769 GLU C CG  1 
ATOM   1713 C  CD  . GLU B 2 63  ? 20.161 -0.666  56.872  1.00 76.49  ? 769 GLU C CD  1 
ATOM   1714 O  OE1 . GLU B 2 63  ? 20.191 -1.867  57.216  1.00 80.76  ? 769 GLU C OE1 1 
ATOM   1715 O  OE2 . GLU B 2 63  ? 21.174 0.069   56.887  1.00 78.63  ? 769 GLU C OE2 1 
ATOM   1716 N  N   . GLY B 2 64  ? 17.593 -3.915  54.514  1.00 42.54  ? 770 GLY C N   1 
ATOM   1717 C  CA  . GLY B 2 64  ? 16.886 -5.058  53.954  1.00 46.04  ? 770 GLY C CA  1 
ATOM   1718 C  C   . GLY B 2 64  ? 15.394 -4.904  53.709  1.00 45.55  ? 770 GLY C C   1 
ATOM   1719 O  O   . GLY B 2 64  ? 14.795 -5.711  52.997  1.00 43.65  ? 770 GLY C O   1 
ATOM   1720 N  N   . ASP B 2 65  ? 14.788 -3.875  54.288  1.00 46.89  ? 771 ASP C N   1 
ATOM   1721 C  CA  . ASP B 2 65  ? 13.345 -3.685  54.142  1.00 52.52  ? 771 ASP C CA  1 
ATOM   1722 C  C   . ASP B 2 65  ? 12.968 -2.712  53.022  1.00 51.65  ? 771 ASP C C   1 
ATOM   1723 O  O   . ASP B 2 65  ? 11.786 -2.495  52.765  1.00 58.85  ? 771 ASP C O   1 
ATOM   1724 C  CB  . ASP B 2 65  ? 12.714 -3.236  55.465  1.00 56.64  ? 771 ASP C CB  1 
ATOM   1725 C  CG  . ASP B 2 65  ? 13.284 -1.925  55.972  1.00 60.19  ? 771 ASP C CG  1 
ATOM   1726 O  OD1 . ASP B 2 65  ? 14.102 -1.311  55.259  1.00 54.60  ? 771 ASP C OD1 1 
ATOM   1727 O  OD2 . ASP B 2 65  ? 12.911 -1.507  57.089  1.00 67.94  ? 771 ASP C OD2 1 
ATOM   1728 N  N   . LYS B 2 66  ? 13.970 -2.144  52.358  1.00 44.46  ? 772 LYS C N   1 
ATOM   1729 C  CA  . LYS B 2 66  ? 13.740 -1.150  51.307  1.00 46.75  ? 772 LYS C CA  1 
ATOM   1730 C  C   . LYS B 2 66  ? 13.395 -1.782  49.965  1.00 42.59  ? 772 LYS C C   1 
ATOM   1731 O  O   . LYS B 2 66  ? 13.927 -2.836  49.616  1.00 44.96  ? 772 LYS C O   1 
ATOM   1732 C  CB  . LYS B 2 66  ? 14.976 -0.272  51.130  1.00 50.11  ? 772 LYS C CB  1 
ATOM   1733 C  CG  . LYS B 2 66  ? 15.374 0.501   52.366  1.00 58.82  ? 772 LYS C CG  1 
ATOM   1734 C  CD  . LYS B 2 66  ? 14.350 1.557   52.704  1.00 61.69  ? 772 LYS C CD  1 
ATOM   1735 C  CE  . LYS B 2 66  ? 14.817 2.382   53.883  1.00 65.17  ? 772 LYS C CE  1 
ATOM   1736 N  NZ  . LYS B 2 66  ? 14.935 1.556   55.116  1.00 68.29  ? 772 LYS C NZ  1 
ATOM   1737 N  N   . TYR B 2 67  ? 12.520 -1.126  49.202  1.00 31.02  ? 773 TYR C N   1 
ATOM   1738 C  CA  . TYR B 2 67  ? 12.186 -1.599  47.871  1.00 25.26  ? 773 TYR C CA  1 
ATOM   1739 C  C   . TYR B 2 67  ? 12.454 -0.538  46.790  1.00 30.50  ? 773 TYR C C   1 
ATOM   1740 O  O   . TYR B 2 67  ? 12.137 -0.742  45.614  1.00 27.40  ? 773 TYR C O   1 
ATOM   1741 C  CB  . TYR B 2 67  ? 10.732 -2.085  47.821  1.00 36.63  ? 773 TYR C CB  1 
ATOM   1742 C  CG  . TYR B 2 67  ? 9.684  -0.980  47.886  1.00 49.54  ? 773 TYR C CG  1 
ATOM   1743 C  CD1 . TYR B 2 67  ? 9.248  -0.340  46.727  1.00 54.86  ? 773 TYR C CD1 1 
ATOM   1744 C  CD2 . TYR B 2 67  ? 9.117  -0.595  49.098  1.00 54.28  ? 773 TYR C CD2 1 
ATOM   1745 C  CE1 . TYR B 2 67  ? 8.290  0.658   46.773  1.00 57.19  ? 773 TYR C CE1 1 
ATOM   1746 C  CE2 . TYR B 2 67  ? 8.152  0.408   49.155  1.00 58.00  ? 773 TYR C CE2 1 
ATOM   1747 C  CZ  . TYR B 2 67  ? 7.742  1.030   47.986  1.00 60.20  ? 773 TYR C CZ  1 
ATOM   1748 O  OH  . TYR B 2 67  ? 6.785  2.027   48.019  1.00 57.93  ? 773 TYR C OH  1 
ATOM   1749 N  N   . TRP B 2 68  ? 13.032 0.589   47.200  1.00 31.31  ? 774 TRP C N   1 
ATOM   1750 C  CA  . TRP B 2 68  ? 13.412 1.648   46.269  1.00 32.43  ? 774 TRP C CA  1 
ATOM   1751 C  C   . TRP B 2 68  ? 14.507 2.515   46.861  1.00 32.86  ? 774 TRP C C   1 
ATOM   1752 O  O   . TRP B 2 68  ? 14.686 2.560   48.078  1.00 32.45  ? 774 TRP C O   1 
ATOM   1753 C  CB  . TRP B 2 68  ? 12.208 2.510   45.875  1.00 33.24  ? 774 TRP C CB  1 
ATOM   1754 C  CG  . TRP B 2 68  ? 11.661 3.358   46.987  1.00 37.47  ? 774 TRP C CG  1 
ATOM   1755 C  CD1 . TRP B 2 68  ? 10.726 2.997   47.902  1.00 42.71  ? 774 TRP C CD1 1 
ATOM   1756 C  CD2 . TRP B 2 68  ? 12.010 4.713   47.282  1.00 46.42  ? 774 TRP C CD2 1 
ATOM   1757 N  NE1 . TRP B 2 68  ? 10.474 4.040   48.761  1.00 47.57  ? 774 TRP C NE1 1 
ATOM   1758 C  CE2 . TRP B 2 68  ? 11.254 5.104   48.402  1.00 49.36  ? 774 TRP C CE2 1 
ATOM   1759 C  CE3 . TRP B 2 68  ? 12.903 5.629   46.718  1.00 57.02  ? 774 TRP C CE3 1 
ATOM   1760 C  CZ2 . TRP B 2 68  ? 11.352 6.378   48.962  1.00 58.25  ? 774 TRP C CZ2 1 
ATOM   1761 C  CZ3 . TRP B 2 68  ? 13.000 6.898   47.275  1.00 60.93  ? 774 TRP C CZ3 1 
ATOM   1762 C  CH2 . TRP B 2 68  ? 12.229 7.259   48.385  1.00 59.65  ? 774 TRP C CH2 1 
ATOM   1763 N  N   . HIS B 2 69  ? 15.240 3.206   45.991  1.00 28.92  ? 775 HIS C N   1 
ATOM   1764 C  CA  . HIS B 2 69  ? 16.389 3.989   46.412  1.00 28.33  ? 775 HIS C CA  1 
ATOM   1765 C  C   . HIS B 2 69  ? 16.657 5.106   45.409  1.00 31.26  ? 775 HIS C C   1 
ATOM   1766 O  O   . HIS B 2 69  ? 16.270 5.023   44.251  1.00 26.93  ? 775 HIS C O   1 
ATOM   1767 C  CB  . HIS B 2 69  ? 17.628 3.079   46.526  1.00 27.63  ? 775 HIS C CB  1 
ATOM   1768 C  CG  . HIS B 2 69  ? 18.899 3.810   46.852  1.00 30.06  ? 775 HIS C CG  1 
ATOM   1769 N  ND1 . HIS B 2 69  ? 19.100 4.464   48.049  1.00 32.19  ? 775 HIS C ND1 1 
ATOM   1770 C  CD2 . HIS B 2 69  ? 20.049 3.953   46.150  1.00 31.07  ? 775 HIS C CD2 1 
ATOM   1771 C  CE1 . HIS B 2 69  ? 20.311 4.994   48.063  1.00 30.56  ? 775 HIS C CE1 1 
ATOM   1772 N  NE2 . HIS B 2 69  ? 20.910 4.695   46.924  1.00 30.07  ? 775 HIS C NE2 1 
ATOM   1773 N  N   . SER B 2 70  ? 17.314 6.162   45.860  1.00 28.91  ? 776 SER C N   1 
ATOM   1774 C  CA  A SER B 2 70  ? 17.715 7.244   44.982  0.29 29.02  ? 776 SER C CA  1 
ATOM   1775 C  CA  B SER B 2 70  ? 17.726 7.230   44.961  0.71 29.20  ? 776 SER C CA  1 
ATOM   1776 C  C   . SER B 2 70  ? 19.237 7.368   44.982  1.00 26.50  ? 776 SER C C   1 
ATOM   1777 O  O   . SER B 2 70  ? 19.839 7.596   46.024  1.00 31.55  ? 776 SER C O   1 
ATOM   1778 C  CB  A SER B 2 70  ? 17.074 8.548   45.458  0.29 30.21  ? 776 SER C CB  1 
ATOM   1779 C  CB  B SER B 2 70  ? 17.071 8.557   45.347  0.71 29.87  ? 776 SER C CB  1 
ATOM   1780 O  OG  A SER B 2 70  ? 17.361 9.608   44.573  0.29 31.30  ? 776 SER C OG  1 
ATOM   1781 O  OG  B SER B 2 70  ? 15.736 8.607   44.892  0.71 29.82  ? 776 SER C OG  1 
ATOM   1782 N  N   . ILE B 2 71  ? 19.859 7.199   43.822  1.00 21.95  ? 777 ILE C N   1 
ATOM   1783 C  CA  . ILE B 2 71  ? 21.299 7.370   43.717  1.00 23.42  ? 777 ILE C CA  1 
ATOM   1784 C  C   . ILE B 2 71  ? 21.565 8.832   43.435  1.00 24.19  ? 777 ILE C C   1 
ATOM   1785 O  O   . ILE B 2 71  ? 21.069 9.373   42.442  1.00 28.63  ? 777 ILE C O   1 
ATOM   1786 C  CB  . ILE B 2 71  ? 21.912 6.548   42.576  1.00 26.66  ? 777 ILE C CB  1 
ATOM   1787 C  CG1 . ILE B 2 71  ? 21.593 5.061   42.738  1.00 29.53  ? 777 ILE C CG1 1 
ATOM   1788 C  CG2 . ILE B 2 71  ? 23.420 6.761   42.541  1.00 24.27  ? 777 ILE C CG2 1 
ATOM   1789 C  CD1 . ILE B 2 71  ? 21.816 4.262   41.453  1.00 24.66  ? 777 ILE C CD1 1 
ATOM   1790 N  N   . SER B 2 72  ? 22.342 9.467   44.308  1.00 25.45  ? 778 SER C N   1 
ATOM   1791 C  CA  . SER B 2 72  ? 22.537 10.915  44.249  1.00 22.25  ? 778 SER C CA  1 
ATOM   1792 C  C   . SER B 2 72  ? 23.952 11.319  43.836  1.00 23.08  ? 778 SER C C   1 
ATOM   1793 O  O   . SER B 2 72  ? 24.823 10.473  43.639  1.00 27.67  ? 778 SER C O   1 
ATOM   1794 C  CB  . SER B 2 72  ? 22.193 11.551  45.600  1.00 24.65  ? 778 SER C CB  1 
ATOM   1795 O  OG  . SER B 2 72  ? 20.804 11.469  45.857  1.00 30.74  ? 778 SER C OG  1 
ATOM   1796 N  N   . HIS B 2 73  ? 24.163 12.622  43.686  1.00 28.16  ? 779 HIS C N   1 
ATOM   1797 C  CA  . HIS B 2 73  ? 25.478 13.160  43.344  1.00 29.63  ? 779 HIS C CA  1 
ATOM   1798 C  C   . HIS B 2 73  ? 26.063 12.572  42.053  1.00 29.24  ? 779 HIS C C   1 
ATOM   1799 O  O   . HIS B 2 73  ? 27.252 12.289  41.973  1.00 31.12  ? 779 HIS C O   1 
ATOM   1800 C  CB  . HIS B 2 73  ? 26.456 12.989  44.516  1.00 44.03  ? 779 HIS C CB  1 
ATOM   1801 C  CG  . HIS B 2 73  ? 25.883 13.392  45.841  1.00 50.28  ? 779 HIS C CG  1 
ATOM   1802 N  ND1 . HIS B 2 73  ? 25.588 12.483  46.834  1.00 53.84  ? 779 HIS C ND1 1 
ATOM   1803 C  CD2 . HIS B 2 73  ? 25.524 14.606  46.327  1.00 52.68  ? 779 HIS C CD2 1 
ATOM   1804 C  CE1 . HIS B 2 73  ? 25.080 13.116  47.877  1.00 56.15  ? 779 HIS C CE1 1 
ATOM   1805 N  NE2 . HIS B 2 73  ? 25.032 14.405  47.595  1.00 55.51  ? 779 HIS C NE2 1 
ATOM   1806 N  N   . LEU B 2 74  ? 25.224 12.407  41.040  1.00 25.96  ? 780 LEU C N   1 
ATOM   1807 C  CA  . LEU B 2 74  ? 25.681 11.976  39.724  1.00 23.30  ? 780 LEU C CA  1 
ATOM   1808 C  C   . LEU B 2 74  ? 25.958 13.208  38.866  1.00 29.44  ? 780 LEU C C   1 
ATOM   1809 O  O   . LEU B 2 74  ? 25.734 14.336  39.311  1.00 32.30  ? 780 LEU C O   1 
ATOM   1810 C  CB  . LEU B 2 74  ? 24.610 11.114  39.065  1.00 18.82  ? 780 LEU C CB  1 
ATOM   1811 C  CG  . LEU B 2 74  ? 24.194 9.915   39.919  1.00 22.13  ? 780 LEU C CG  1 
ATOM   1812 C  CD1 . LEU B 2 74  ? 22.995 9.173   39.328  1.00 27.19  ? 780 LEU C CD1 1 
ATOM   1813 C  CD2 . LEU B 2 74  ? 25.384 8.977   40.102  1.00 24.91  ? 780 LEU C CD2 1 
ATOM   1814 N  N   . GLN B 2 75  ? 26.426 12.998  37.639  1.00 24.63  ? 781 GLN C N   1 
ATOM   1815 C  CA  . GLN B 2 75  ? 26.651 14.105  36.713  1.00 22.32  ? 781 GLN C CA  1 
ATOM   1816 C  C   . GLN B 2 75  ? 25.429 14.333  35.827  1.00 29.76  ? 781 GLN C C   1 
ATOM   1817 O  O   . GLN B 2 75  ? 24.708 13.389  35.495  1.00 25.53  ? 781 GLN C O   1 
ATOM   1818 C  CB  . GLN B 2 75  ? 27.894 13.849  35.843  1.00 25.43  ? 781 GLN C CB  1 
ATOM   1819 C  CG  . GLN B 2 75  ? 29.197 13.733  36.637  1.00 26.95  ? 781 GLN C CG  1 
ATOM   1820 C  CD  . GLN B 2 75  ? 29.514 14.999  37.407  1.00 26.24  ? 781 GLN C CD  1 
ATOM   1821 O  OE1 . GLN B 2 75  ? 29.625 16.077  36.825  1.00 27.65  ? 781 GLN C OE1 1 
ATOM   1822 N  NE2 . GLN B 2 75  ? 29.648 14.877  38.723  1.00 28.30  ? 781 GLN C NE2 1 
ATOM   1823 N  N   . PRO B 2 76  ? 25.179 15.596  35.454  1.00 29.32  ? 782 PRO C N   1 
ATOM   1824 C  CA  . PRO B 2 76  ? 24.071 15.936  34.554  1.00 27.43  ? 782 PRO C CA  1 
ATOM   1825 C  C   . PRO B 2 76  ? 24.236 15.287  33.184  1.00 26.64  ? 782 PRO C C   1 
ATOM   1826 O  O   . PRO B 2 76  ? 25.363 15.086  32.718  1.00 23.63  ? 782 PRO C O   1 
ATOM   1827 C  CB  . PRO B 2 76  ? 24.189 17.459  34.422  1.00 26.51  ? 782 PRO C CB  1 
ATOM   1828 C  CG  . PRO B 2 76  ? 24.850 17.893  35.713  1.00 27.14  ? 782 PRO C CG  1 
ATOM   1829 C  CD  . PRO B 2 76  ? 25.837 16.793  36.015  1.00 28.91  ? 782 PRO C CD  1 
ATOM   1830 N  N   . GLU B 2 77  ? 23.110 14.952  32.567  1.00 24.96  ? 783 GLU C N   1 
ATOM   1831 C  CA  . GLU B 2 77  ? 23.079 14.435  31.198  1.00 28.19  ? 783 GLU C CA  1 
ATOM   1832 C  C   . GLU B 2 77  ? 24.046 13.285  30.996  1.00 23.36  ? 783 GLU C C   1 
ATOM   1833 O  O   . GLU B 2 77  ? 24.695 13.184  29.961  1.00 21.20  ? 783 GLU C O   1 
ATOM   1834 C  CB  . GLU B 2 77  ? 23.413 15.548  30.220  1.00 32.71  ? 783 GLU C CB  1 
ATOM   1835 C  CG  . GLU B 2 77  ? 22.748 15.399  28.885  1.00 46.53  ? 783 GLU C CG  1 
ATOM   1836 C  CD  . GLU B 2 77  ? 22.661 16.720  28.168  1.00 60.59  ? 783 GLU C CD  1 
ATOM   1837 O  OE1 . GLU B 2 77  ? 23.631 17.503  28.248  1.00 63.29  ? 783 GLU C OE1 1 
ATOM   1838 O  OE2 . GLU B 2 77  ? 21.618 16.976  27.535  1.00 69.63  ? 783 GLU C OE2 1 
ATOM   1839 N  N   . THR B 2 78  ? 24.140 12.418  31.988  1.00 21.55  ? 784 THR C N   1 
ATOM   1840 C  CA  . THR B 2 78  ? 25.076 11.309  31.936  1.00 24.06  ? 784 THR C CA  1 
ATOM   1841 C  C   . THR B 2 78  ? 24.340 9.983   32.094  1.00 26.50  ? 784 THR C C   1 
ATOM   1842 O  O   . THR B 2 78  ? 23.455 9.838   32.947  1.00 22.74  ? 784 THR C O   1 
ATOM   1843 C  CB  . THR B 2 78  ? 26.130 11.433  33.044  1.00 28.34  ? 784 THR C CB  1 
ATOM   1844 O  OG1 . THR B 2 78  ? 26.897 12.630  32.840  1.00 25.32  ? 784 THR C OG1 1 
ATOM   1845 C  CG2 . THR B 2 78  ? 27.053 10.211  33.046  1.00 27.73  ? 784 THR C CG2 1 
ATOM   1846 N  N   . SER B 2 79  ? 24.718 9.013   31.274  1.00 21.93  ? 785 SER C N   1 
ATOM   1847 C  CA  . SER B 2 79  ? 24.128 7.688   31.345  1.00 17.67  ? 785 SER C CA  1 
ATOM   1848 C  C   . SER B 2 79  ? 24.875 6.809   32.345  1.00 19.19  ? 785 SER C C   1 
ATOM   1849 O  O   . SER B 2 79  ? 26.104 6.810   32.377  1.00 21.99  ? 785 SER C O   1 
ATOM   1850 C  CB  . SER B 2 79  ? 24.170 7.036   29.963  1.00 25.14  ? 785 SER C CB  1 
ATOM   1851 O  OG  . SER B 2 79  ? 23.561 5.760   30.010  1.00 25.88  ? 785 SER C OG  1 
ATOM   1852 N  N   . TYR B 2 80  ? 24.121 6.051   33.143  1.00 15.51  ? 786 TYR C N   1 
ATOM   1853 C  CA  . TYR B 2 80  ? 24.686 5.105   34.097  1.00 17.67  ? 786 TYR C CA  1 
ATOM   1854 C  C   . TYR B 2 80  ? 24.158 3.709   33.874  1.00 20.56  ? 786 TYR C C   1 
ATOM   1855 O  O   . TYR B 2 80  ? 22.985 3.524   33.541  1.00 18.95  ? 786 TYR C O   1 
ATOM   1856 C  CB  . TYR B 2 80  ? 24.351 5.538   35.535  1.00 20.04  ? 786 TYR C CB  1 
ATOM   1857 C  CG  . TYR B 2 80  ? 25.087 6.788   35.913  1.00 26.75  ? 786 TYR C CG  1 
ATOM   1858 C  CD1 . TYR B 2 80  ? 24.576 8.036   35.585  1.00 29.21  ? 786 TYR C CD1 1 
ATOM   1859 C  CD2 . TYR B 2 80  ? 26.318 6.724   36.549  1.00 22.36  ? 786 TYR C CD2 1 
ATOM   1860 C  CE1 . TYR B 2 80  ? 25.261 9.192   35.899  1.00 22.74  ? 786 TYR C CE1 1 
ATOM   1861 C  CE2 . TYR B 2 80  ? 27.018 7.891   36.873  1.00 27.60  ? 786 TYR C CE2 1 
ATOM   1862 C  CZ  . TYR B 2 80  ? 26.477 9.114   36.545  1.00 21.83  ? 786 TYR C CZ  1 
ATOM   1863 O  OH  . TYR B 2 80  ? 27.144 10.279  36.851  1.00 21.17  ? 786 TYR C OH  1 
ATOM   1864 N  N   . ASP B 2 81  ? 25.041 2.732   34.049  1.00 20.27  ? 787 ASP C N   1 
ATOM   1865 C  CA  . ASP B 2 81  ? 24.663 1.336   34.126  1.00 22.99  ? 787 ASP C CA  1 
ATOM   1866 C  C   . ASP B 2 81  ? 24.347 1.082   35.589  1.00 21.43  ? 787 ASP C C   1 
ATOM   1867 O  O   . ASP B 2 81  ? 25.139 1.430   36.466  1.00 21.55  ? 787 ASP C O   1 
ATOM   1868 C  CB  . ASP B 2 81  ? 25.834 0.434   33.731  1.00 19.20  ? 787 ASP C CB  1 
ATOM   1869 C  CG  . ASP B 2 81  ? 26.447 0.803   32.386  1.00 23.42  ? 787 ASP C CG  1 
ATOM   1870 O  OD1 . ASP B 2 81  ? 25.733 1.357   31.521  1.00 23.51  ? 787 ASP C OD1 1 
ATOM   1871 O  OD2 . ASP B 2 81  ? 27.652 0.513   32.191  1.00 25.97  ? 787 ASP C OD2 1 
ATOM   1872 N  N   . ILE B 2 82  ? 23.204 0.463   35.855  1.00 21.63  ? 788 ILE C N   1 
ATOM   1873 C  CA  . ILE B 2 82  ? 22.791 0.204   37.231  1.00 16.55  ? 788 ILE C CA  1 
ATOM   1874 C  C   . ILE B 2 82  ? 22.398 -1.253  37.439  1.00 17.88  ? 788 ILE C C   1 
ATOM   1875 O  O   . ILE B 2 82  ? 21.574 -1.795  36.702  1.00 27.62  ? 788 ILE C O   1 
ATOM   1876 C  CB  . ILE B 2 82  ? 21.610 1.116   37.629  1.00 18.09  ? 788 ILE C CB  1 
ATOM   1877 C  CG1 . ILE B 2 82  ? 21.993 2.586   37.422  1.00 24.70  ? 788 ILE C CG1 1 
ATOM   1878 C  CG2 . ILE B 2 82  ? 21.199 0.853   39.060  1.00 22.48  ? 788 ILE C CG2 1 
ATOM   1879 C  CD1 . ILE B 2 82  ? 20.827 3.556   37.497  1.00 25.46  ? 788 ILE C CD1 1 
ATOM   1880 N  N   . LYS B 2 83  ? 22.993 -1.894  38.442  1.00 20.60  ? 789 LYS C N   1 
ATOM   1881 C  CA  . LYS B 2 83  ? 22.580 -3.237  38.839  1.00 26.23  ? 789 LYS C CA  1 
ATOM   1882 C  C   . LYS B 2 83  ? 22.702 -3.359  40.358  1.00 25.87  ? 789 LYS C C   1 
ATOM   1883 O  O   . LYS B 2 83  ? 23.258 -2.474  41.012  1.00 22.41  ? 789 LYS C O   1 
ATOM   1884 C  CB  . LYS B 2 83  ? 23.423 -4.308  38.133  1.00 19.86  ? 789 LYS C CB  1 
ATOM   1885 C  CG  . LYS B 2 83  ? 24.918 -4.201  38.421  1.00 21.71  ? 789 LYS C CG  1 
ATOM   1886 C  CD  . LYS B 2 83  ? 25.741 -5.178  37.580  1.00 19.24  ? 789 LYS C CD  1 
ATOM   1887 C  CE  . LYS B 2 83  ? 27.189 -5.228  38.036  1.00 23.56  ? 789 LYS C CE  1 
ATOM   1888 N  NZ  . LYS B 2 83  ? 28.033 -5.953  37.038  1.00 25.97  ? 789 LYS C NZ  1 
ATOM   1889 N  N   . MET B 2 84  ? 22.178 -4.442  40.922  1.00 25.06  ? 790 MET C N   1 
ATOM   1890 C  CA  . MET B 2 84  ? 22.179 -4.578  42.378  1.00 27.55  ? 790 MET C CA  1 
ATOM   1891 C  C   . MET B 2 84  ? 22.197 -6.029  42.824  1.00 27.16  ? 790 MET C C   1 
ATOM   1892 O  O   . MET B 2 84  ? 22.037 -6.944  42.015  1.00 26.81  ? 790 MET C O   1 
ATOM   1893 C  CB  . MET B 2 84  ? 20.950 -3.884  42.980  1.00 26.18  ? 790 MET C CB  1 
ATOM   1894 C  CG  . MET B 2 84  ? 19.622 -4.523  42.587  1.00 24.27  ? 790 MET C CG  1 
ATOM   1895 S  SD  . MET B 2 84  ? 18.186 -3.655  43.281  1.00 27.38  ? 790 MET C SD  1 
ATOM   1896 C  CE  . MET B 2 84  ? 18.522 -3.856  45.045  1.00 26.29  ? 790 MET C CE  1 
ATOM   1897 N  N   . GLN B 2 85  ? 22.377 -6.231  44.123  1.00 25.67  ? 791 GLN C N   1 
ATOM   1898 C  CA  . GLN B 2 85  ? 22.199 -7.550  44.703  1.00 31.00  ? 791 GLN C CA  1 
ATOM   1899 C  C   . GLN B 2 85  ? 21.777 -7.407  46.145  1.00 32.00  ? 791 GLN C C   1 
ATOM   1900 O  O   . GLN B 2 85  ? 21.809 -6.310  46.697  1.00 27.72  ? 791 GLN C O   1 
ATOM   1901 C  CB  . GLN B 2 85  ? 23.490 -8.346  44.625  1.00 41.72  ? 791 GLN C CB  1 
ATOM   1902 C  CG  . GLN B 2 85  ? 24.698 -7.501  44.860  1.00 45.49  ? 791 GLN C CG  1 
ATOM   1903 C  CD  . GLN B 2 85  ? 25.978 -8.205  44.495  1.00 43.70  ? 791 GLN C CD  1 
ATOM   1904 O  OE1 . GLN B 2 85  ? 25.991 -9.157  43.720  1.00 55.54  ? 791 GLN C OE1 1 
ATOM   1905 N  NE2 . GLN B 2 85  ? 27.069 -7.739  45.058  1.00 36.88  ? 791 GLN C NE2 1 
ATOM   1906 N  N   . CYS B 2 86  ? 21.373 -8.523  46.742  1.00 29.77  ? 792 CYS C N   1 
ATOM   1907 C  CA  . CYS B 2 86  ? 21.121 -8.581  48.170  1.00 29.99  ? 792 CYS C CA  1 
ATOM   1908 C  C   . CYS B 2 86  ? 22.232 -9.409  48.798  1.00 38.56  ? 792 CYS C C   1 
ATOM   1909 O  O   . CYS B 2 86  ? 22.957 -10.123 48.096  1.00 40.21  ? 792 CYS C O   1 
ATOM   1910 C  CB  . CYS B 2 86  ? 19.750 -9.203  48.454  1.00 31.04  ? 792 CYS C CB  1 
ATOM   1911 S  SG  . CYS B 2 86  ? 19.524 -10.865 47.786  1.00 33.76  ? 792 CYS C SG  1 
ATOM   1912 N  N   . PHE B 2 87  ? 22.371 -9.305  50.116  1.00 39.84  ? 793 PHE C N   1 
ATOM   1913 C  CA  . PHE B 2 87  ? 23.464 -9.966  50.810  1.00 35.18  ? 793 PHE C CA  1 
ATOM   1914 C  C   . PHE B 2 87  ? 23.110 -10.259 52.260  1.00 38.80  ? 793 PHE C C   1 
ATOM   1915 O  O   . PHE B 2 87  ? 22.213 -9.636  52.842  1.00 38.17  ? 793 PHE C O   1 
ATOM   1916 C  CB  . PHE B 2 87  ? 24.725 -9.100  50.761  1.00 35.34  ? 793 PHE C CB  1 
ATOM   1917 C  CG  . PHE B 2 87  ? 24.613 -7.814  51.538  1.00 37.04  ? 793 PHE C CG  1 
ATOM   1918 C  CD1 . PHE B 2 87  ? 24.983 -7.755  52.866  1.00 47.80  ? 793 PHE C CD1 1 
ATOM   1919 C  CD2 . PHE B 2 87  ? 24.149 -6.661  50.931  1.00 40.29  ? 793 PHE C CD2 1 
ATOM   1920 C  CE1 . PHE B 2 87  ? 24.880 -6.573  53.578  1.00 52.78  ? 793 PHE C CE1 1 
ATOM   1921 C  CE2 . PHE B 2 87  ? 24.043 -5.477  51.639  1.00 38.05  ? 793 PHE C CE2 1 
ATOM   1922 C  CZ  . PHE B 2 87  ? 24.408 -5.431  52.960  1.00 47.92  ? 793 PHE C CZ  1 
ATOM   1923 N  N   . ASN B 2 88  ? 23.813 -11.228 52.836  1.00 41.58  ? 794 ASN C N   1 
ATOM   1924 C  CA  . ASN B 2 88  ? 23.710 -11.507 54.258  1.00 50.04  ? 794 ASN C CA  1 
ATOM   1925 C  C   . ASN B 2 88  ? 25.062 -11.920 54.816  1.00 62.00  ? 794 ASN C C   1 
ATOM   1926 O  O   . ASN B 2 88  ? 26.107 -11.578 54.258  1.00 55.88  ? 794 ASN C O   1 
ATOM   1927 C  CB  . ASN B 2 88  ? 22.656 -12.579 54.544  1.00 46.85  ? 794 ASN C CB  1 
ATOM   1928 C  CG  . ASN B 2 88  ? 22.972 -13.901 53.885  1.00 48.07  ? 794 ASN C CG  1 
ATOM   1929 O  OD1 . ASN B 2 88  ? 24.106 -14.157 53.491  1.00 50.62  ? 794 ASN C OD1 1 
ATOM   1930 N  ND2 . ASN B 2 88  ? 21.961 -14.752 53.757  1.00 53.59  ? 794 ASN C ND2 1 
ATOM   1931 N  N   . GLU B 2 89  ? 25.028 -12.667 55.911  1.00 71.52  ? 795 GLU C N   1 
ATOM   1932 C  CA  . GLU B 2 89  ? 26.241 -13.083 56.603  1.00 80.19  ? 795 GLU C CA  1 
ATOM   1933 C  C   . GLU B 2 89  ? 27.073 -14.039 55.747  1.00 70.61  ? 795 GLU C C   1 
ATOM   1934 O  O   . GLU B 2 89  ? 28.241 -14.287 56.032  1.00 78.05  ? 795 GLU C O   1 
ATOM   1935 C  CB  . GLU B 2 89  ? 25.893 -13.709 57.970  1.00 90.43  ? 795 GLU C CB  1 
ATOM   1936 C  CG  . GLU B 2 89  ? 24.990 -14.957 57.923  1.00 98.52  ? 795 GLU C CG  1 
ATOM   1937 C  CD  . GLU B 2 89  ? 23.492 -14.641 57.877  1.00 102.69 ? 795 GLU C CD  1 
ATOM   1938 O  OE1 . GLU B 2 89  ? 23.122 -13.447 57.840  1.00 100.96 ? 795 GLU C OE1 1 
ATOM   1939 O  OE2 . GLU B 2 89  ? 22.681 -15.598 57.884  1.00 106.18 ? 795 GLU C OE2 1 
ATOM   1940 N  N   . GLY B 2 90  ? 26.469 -14.560 54.688  1.00 57.34  ? 796 GLY C N   1 
ATOM   1941 C  CA  . GLY B 2 90  ? 27.083 -15.613 53.902  1.00 54.41  ? 796 GLY C CA  1 
ATOM   1942 C  C   . GLY B 2 90  ? 27.723 -15.137 52.616  1.00 57.48  ? 796 GLY C C   1 
ATOM   1943 O  O   . GLY B 2 90  ? 28.701 -15.723 52.150  1.00 64.84  ? 796 GLY C O   1 
ATOM   1944 N  N   . GLY B 2 91  ? 27.175 -14.077 52.032  1.00 51.41  ? 797 GLY C N   1 
ATOM   1945 C  CA  . GLY B 2 91  ? 27.717 -13.547 50.797  1.00 47.95  ? 797 GLY C CA  1 
ATOM   1946 C  C   . GLY B 2 91  ? 26.671 -12.789 50.007  1.00 47.35  ? 797 GLY C C   1 
ATOM   1947 O  O   . GLY B 2 91  ? 25.583 -12.508 50.517  1.00 42.39  ? 797 GLY C O   1 
ATOM   1948 N  N   . GLU B 2 92  ? 27.005 -12.468 48.759  1.00 52.42  ? 798 GLU C N   1 
ATOM   1949 C  CA  . GLU B 2 92  ? 26.130 -11.680 47.896  1.00 49.18  ? 798 GLU C CA  1 
ATOM   1950 C  C   . GLU B 2 92  ? 25.396 -12.556 46.898  1.00 42.00  ? 798 GLU C C   1 
ATOM   1951 O  O   . GLU B 2 92  ? 25.935 -13.557 46.419  1.00 37.05  ? 798 GLU C O   1 
ATOM   1952 C  CB  . GLU B 2 92  ? 26.943 -10.629 47.131  1.00 57.58  ? 798 GLU C CB  1 
ATOM   1953 C  CG  . GLU B 2 92  ? 27.575 -9.550  48.004  1.00 66.46  ? 798 GLU C CG  1 
ATOM   1954 C  CD  . GLU B 2 92  ? 28.847 -10.014 48.683  1.00 77.41  ? 798 GLU C CD  1 
ATOM   1955 O  OE1 . GLU B 2 92  ? 29.420 -11.033 48.240  1.00 82.54  ? 798 GLU C OE1 1 
ATOM   1956 O  OE2 . GLU B 2 92  ? 29.273 -9.362  49.658  1.00 81.08  ? 798 GLU C OE2 1 
ATOM   1957 N  N   . SER B 2 93  ? 24.161 -12.177 46.575  1.00 33.90  ? 799 SER C N   1 
ATOM   1958 C  CA  . SER B 2 93  ? 23.414 -12.873 45.540  1.00 35.26  ? 799 SER C CA  1 
ATOM   1959 C  C   . SER B 2 93  ? 24.065 -12.591 44.194  1.00 35.45  ? 799 SER C C   1 
ATOM   1960 O  O   . SER B 2 93  ? 24.999 -11.789 44.096  1.00 27.55  ? 799 SER C O   1 
ATOM   1961 C  CB  . SER B 2 93  ? 21.960 -12.400 45.510  1.00 38.12  ? 799 SER C CB  1 
ATOM   1962 O  OG  . SER B 2 93  ? 21.869 -11.103 44.943  1.00 36.81  ? 799 SER C OG  1 
ATOM   1963 N  N   . GLU B 2 94  ? 23.579 -13.259 43.155  1.00 38.38  ? 800 GLU C N   1 
ATOM   1964 C  CA  . GLU B 2 94  ? 23.987 -12.903 41.806  1.00 44.70  ? 800 GLU C CA  1 
ATOM   1965 C  C   . GLU B 2 94  ? 23.388 -11.537 41.511  1.00 40.62  ? 800 GLU C C   1 
ATOM   1966 O  O   . GLU B 2 94  ? 22.446 -11.114 42.187  1.00 35.00  ? 800 GLU C O   1 
ATOM   1967 C  CB  . GLU B 2 94  ? 23.488 -13.938 40.801  1.00 50.49  ? 800 GLU C CB  1 
ATOM   1968 C  CG  . GLU B 2 94  ? 22.000 -14.197 40.889  1.00 62.73  ? 800 GLU C CG  1 
ATOM   1969 C  CD  . GLU B 2 94  ? 21.552 -15.357 40.023  1.00 72.67  ? 800 GLU C CD  1 
ATOM   1970 O  OE1 . GLU B 2 94  ? 22.353 -16.297 39.815  1.00 71.60  ? 800 GLU C OE1 1 
ATOM   1971 O  OE2 . GLU B 2 94  ? 20.390 -15.327 39.558  1.00 77.72  ? 800 GLU C OE2 1 
ATOM   1972 N  N   . PHE B 2 95  ? 23.943 -10.844 40.516  1.00 32.12  ? 801 PHE C N   1 
ATOM   1973 C  CA  . PHE B 2 95  ? 23.483 -9.503  40.165  1.00 30.58  ? 801 PHE C CA  1 
ATOM   1974 C  C   . PHE B 2 95  ? 22.092 -9.523  39.540  1.00 27.91  ? 801 PHE C C   1 
ATOM   1975 O  O   . PHE B 2 95  ? 21.717 -10.485 38.873  1.00 35.67  ? 801 PHE C O   1 
ATOM   1976 C  CB  . PHE B 2 95  ? 24.453 -8.850  39.179  1.00 32.77  ? 801 PHE C CB  1 
ATOM   1977 C  CG  . PHE B 2 95  ? 25.729 -8.387  39.804  1.00 34.81  ? 801 PHE C CG  1 
ATOM   1978 C  CD1 . PHE B 2 95  ? 26.929 -9.002  39.493  1.00 34.39  ? 801 PHE C CD1 1 
ATOM   1979 C  CD2 . PHE B 2 95  ? 25.731 -7.338  40.710  1.00 33.03  ? 801 PHE C CD2 1 
ATOM   1980 C  CE1 . PHE B 2 95  ? 28.109 -8.577  40.063  1.00 35.32  ? 801 PHE C CE1 1 
ATOM   1981 C  CE2 . PHE B 2 95  ? 26.912 -6.910  41.289  1.00 32.15  ? 801 PHE C CE2 1 
ATOM   1982 C  CZ  . PHE B 2 95  ? 28.106 -7.530  40.962  1.00 35.10  ? 801 PHE C CZ  1 
ATOM   1983 N  N   . SER B 2 96  ? 21.344 -8.447  39.751  1.00 22.06  ? 802 SER C N   1 
ATOM   1984 C  CA  . SER B 2 96  ? 20.064 -8.235  39.077  1.00 23.09  ? 802 SER C CA  1 
ATOM   1985 C  C   . SER B 2 96  ? 20.262 -8.027  37.574  1.00 22.41  ? 802 SER C C   1 
ATOM   1986 O  O   . SER B 2 96  ? 21.391 -8.007  37.071  1.00 24.71  ? 802 SER C O   1 
ATOM   1987 C  CB  . SER B 2 96  ? 19.410 -6.968  39.621  1.00 19.85  ? 802 SER C CB  1 
ATOM   1988 O  OG  . SER B 2 96  ? 20.217 -5.834  39.297  1.00 19.82  ? 802 SER C OG  1 
ATOM   1989 N  N   . ASN B 2 97  ? 19.149 -7.872  36.864  1.00 20.74  ? 803 ASN C N   1 
ATOM   1990 C  CA  . ASN B 2 97  ? 19.174 -7.288  35.531  1.00 17.04  ? 803 ASN C CA  1 
ATOM   1991 C  C   . ASN B 2 97  ? 19.910 -5.946  35.605  1.00 21.22  ? 803 ASN C C   1 
ATOM   1992 O  O   . ASN B 2 97  ? 20.005 -5.336  36.670  1.00 20.39  ? 803 ASN C O   1 
ATOM   1993 C  CB  . ASN B 2 97  ? 17.753 -7.097  35.008  1.00 16.96  ? 803 ASN C CB  1 
ATOM   1994 C  CG  . ASN B 2 97  ? 16.867 -6.339  35.985  1.00 23.46  ? 803 ASN C CG  1 
ATOM   1995 O  OD1 . ASN B 2 97  ? 16.927 -6.565  37.189  1.00 23.47  ? 803 ASN C OD1 1 
ATOM   1996 N  ND2 . ASN B 2 97  ? 16.035 -5.439  35.464  1.00 23.35  ? 803 ASN C ND2 1 
ATOM   1997 N  N   . VAL B 2 98  ? 20.448 -5.494  34.478  1.00 21.61  ? 804 VAL C N   1 
ATOM   1998 C  CA  . VAL B 2 98  ? 21.217 -4.255  34.456  1.00 23.47  ? 804 VAL C CA  1 
ATOM   1999 C  C   . VAL B 2 98  ? 20.461 -3.181  33.683  1.00 24.60  ? 804 VAL C C   1 
ATOM   2000 O  O   . VAL B 2 98  ? 20.127 -3.355  32.504  1.00 19.23  ? 804 VAL C O   1 
ATOM   2001 C  CB  . VAL B 2 98  ? 22.613 -4.480  33.828  1.00 19.17  ? 804 VAL C CB  1 
ATOM   2002 C  CG1 . VAL B 2 98  ? 23.506 -3.256  34.022  1.00 16.06  ? 804 VAL C CG1 1 
ATOM   2003 C  CG2 . VAL B 2 98  ? 23.261 -5.711  34.436  1.00 21.95  ? 804 VAL C CG2 1 
ATOM   2004 N  N   . MET B 2 99  ? 20.194 -2.068  34.352  1.00 20.89  ? 805 MET C N   1 
ATOM   2005 C  CA  . MET B 2 99  ? 19.457 -0.984  33.726  1.00 20.47  ? 805 MET C CA  1 
ATOM   2006 C  C   . MET B 2 99  ? 20.415 0.067   33.214  1.00 20.51  ? 805 MET C C   1 
ATOM   2007 O  O   . MET B 2 99  ? 21.505 0.253   33.747  1.00 24.56  ? 805 MET C O   1 
ATOM   2008 C  CB  . MET B 2 99  ? 18.477 -0.354  34.724  1.00 22.88  ? 805 MET C CB  1 
ATOM   2009 C  CG  . MET B 2 99  ? 17.568 -1.361  35.417  1.00 25.93  ? 805 MET C CG  1 
ATOM   2010 S  SD  . MET B 2 99  ? 16.308 -2.028  34.307  1.00 24.22  ? 805 MET C SD  1 
ATOM   2011 C  CE  . MET B 2 99  ? 15.089 -0.703  34.371  1.00 24.33  ? 805 MET C CE  1 
ATOM   2012 N  N   . ILE B 2 100 ? 20.018 0.743   32.150  1.00 16.87  ? 806 ILE C N   1 
ATOM   2013 C  CA  . ILE B 2 100 ? 20.757 1.908   31.694  1.00 17.05  ? 806 ILE C CA  1 
ATOM   2014 C  C   . ILE B 2 100 ? 19.803 3.082   31.873  1.00 24.71  ? 806 ILE C C   1 
ATOM   2015 O  O   . ILE B 2 100 ? 18.636 2.999   31.471  1.00 22.46  ? 806 ILE C O   1 
ATOM   2016 C  CB  . ILE B 2 100 ? 21.194 1.746   30.216  1.00 22.19  ? 806 ILE C CB  1 
ATOM   2017 C  CG1 . ILE B 2 100 ? 22.151 0.557   30.087  1.00 26.36  ? 806 ILE C CG1 1 
ATOM   2018 C  CG2 . ILE B 2 100 ? 21.844 3.021   29.685  1.00 20.90  ? 806 ILE C CG2 1 
ATOM   2019 C  CD1 . ILE B 2 100 ? 22.484 0.177   28.657  1.00 21.89  ? 806 ILE C CD1 1 
ATOM   2020 N  N   . CYS B 2 101 ? 20.269 4.144   32.522  1.00 22.65  ? 807 CYS C N   1 
ATOM   2021 C  CA  . CYS B 2 101 ? 19.420 5.302   32.799  1.00 18.87  ? 807 CYS C CA  1 
ATOM   2022 C  C   . CYS B 2 101 ? 20.237 6.588   32.758  1.00 18.57  ? 807 CYS C C   1 
ATOM   2023 O  O   . CYS B 2 101 ? 21.344 6.654   33.289  1.00 20.66  ? 807 CYS C O   1 
ATOM   2024 C  CB  . CYS B 2 101 ? 18.736 5.154   34.162  1.00 19.96  ? 807 CYS C CB  1 
ATOM   2025 S  SG  . CYS B 2 101 ? 17.505 6.416   34.525  1.00 28.71  ? 807 CYS C SG  1 
ATOM   2026 N  N   . GLU B 2 102 ? 19.691 7.615   32.130  1.00 18.18  ? 808 GLU C N   1 
ATOM   2027 C  CA  . GLU B 2 102 ? 20.401 8.876   32.014  1.00 27.36  ? 808 GLU C CA  1 
ATOM   2028 C  C   . GLU B 2 102 ? 19.844 9.878   33.034  1.00 27.47  ? 808 GLU C C   1 
ATOM   2029 O  O   . GLU B 2 102 ? 18.648 9.862   33.322  1.00 30.55  ? 808 GLU C O   1 
ATOM   2030 C  CB  . GLU B 2 102 ? 20.233 9.401   30.591  1.00 25.35  ? 808 GLU C CB  1 
ATOM   2031 C  CG  . GLU B 2 102 ? 21.365 10.245  30.091  1.00 34.66  ? 808 GLU C CG  1 
ATOM   2032 C  CD  . GLU B 2 102 ? 21.257 10.501  28.601  1.00 35.38  ? 808 GLU C CD  1 
ATOM   2033 O  OE1 . GLU B 2 102 ? 21.595 9.592   27.811  1.00 38.22  ? 808 GLU C OE1 1 
ATOM   2034 O  OE2 . GLU B 2 102 ? 20.835 11.610  28.225  1.00 42.53  ? 808 GLU C OE2 1 
ATOM   2035 N  N   . THR B 2 103 ? 20.704 10.722  33.601  1.00 27.56  ? 809 THR C N   1 
ATOM   2036 C  CA  . THR B 2 103 ? 20.239 11.808  34.464  1.00 27.47  ? 809 THR C CA  1 
ATOM   2037 C  C   . THR B 2 103 ? 19.742 12.925  33.575  1.00 28.64  ? 809 THR C C   1 
ATOM   2038 O  O   . THR B 2 103 ? 20.132 13.014  32.411  1.00 28.56  ? 809 THR C O   1 
ATOM   2039 C  CB  . THR B 2 103 ? 21.371 12.417  35.307  1.00 28.00  ? 809 THR C CB  1 
ATOM   2040 O  OG1 . THR B 2 103 ? 22.463 12.753  34.448  1.00 27.82  ? 809 THR C OG1 1 
ATOM   2041 C  CG2 . THR B 2 103 ? 21.847 11.456  36.391  1.00 26.03  ? 809 THR C CG2 1 
ATOM   2042 N  N   . LYS B 2 104 ? 18.922 13.811  34.128  1.00 26.47  ? 810 LYS C N   1 
ATOM   2043 C  CA  . LYS B 2 104 ? 18.374 14.912  33.344  1.00 27.90  ? 810 LYS C CA  1 
ATOM   2044 C  C   . LYS B 2 104 ? 19.432 15.911  32.892  1.00 32.53  ? 810 LYS C C   1 
ATOM   2045 O  O   . LYS B 2 104 ? 20.539 15.966  33.426  1.00 29.56  ? 810 LYS C O   1 
ATOM   2046 C  CB  . LYS B 2 104 ? 17.236 15.608  34.095  1.00 24.02  ? 810 LYS C CB  1 
ATOM   2047 C  CG  . LYS B 2 104 ? 16.028 14.704  34.264  1.00 33.02  ? 810 LYS C CG  1 
ATOM   2048 C  CD  . LYS B 2 104 ? 14.833 15.433  34.808  1.00 41.78  ? 810 LYS C CD  1 
ATOM   2049 C  CE  . LYS B 2 104 ? 13.603 14.550  34.715  1.00 50.83  ? 810 LYS C CE  1 
ATOM   2050 N  NZ  . LYS B 2 104 ? 12.470 15.083  35.520  1.00 53.88  ? 810 LYS C NZ  1 
ATOM   2051 N  N   . ALA B 2 105 ? 19.062 16.727  31.911  1.00 32.04  ? 811 ALA C N   1 
ATOM   2052 C  CA  . ALA B 2 105 ? 19.922 17.804  31.440  1.00 33.61  ? 811 ALA C CA  1 
ATOM   2053 C  C   . ALA B 2 105 ? 19.933 18.941  32.458  1.00 39.52  ? 811 ALA C C   1 
ATOM   2054 O  O   . ALA B 2 105 ? 18.879 19.410  32.890  1.00 39.11  ? 811 ALA C O   1 
ATOM   2055 C  CB  . ALA B 2 105 ? 19.452 18.305  30.085  1.00 20.00  ? 811 ALA C CB  1 
ATOM   2056 N  N   . ARG B 2 106 ? 21.128 19.373  32.837  1.00 46.11  ? 812 ARG C N   1 
ATOM   2057 C  CA  . ARG B 2 106 ? 21.293 20.410  33.850  1.00 58.30  ? 812 ARG C CA  1 
ATOM   2058 C  C   . ARG B 2 106 ? 20.211 21.491  33.797  1.00 60.99  ? 812 ARG C C   1 
ATOM   2059 O  O   . ARG B 2 106 ? 20.276 22.410  32.982  1.00 59.45  ? 812 ARG C O   1 
ATOM   2060 C  CB  . ARG B 2 106 ? 22.677 21.056  33.730  1.00 20.00  ? 812 ARG C CB  1 
ATOM   2061 C  CG  . ARG B 2 106 ? 22.840 22.329  34.544  1.00 20.00  ? 812 ARG C CG  1 
ATOM   2062 C  CD  . ARG B 2 106 ? 24.225 22.928  34.359  1.00 20.00  ? 812 ARG C CD  1 
ATOM   2063 N  NE  . ARG B 2 106 ? 25.266 21.905  34.351  1.00 20.00  ? 812 ARG C NE  1 
ATOM   2064 C  CZ  . ARG B 2 106 ? 25.878 21.451  35.440  1.00 20.00  ? 812 ARG C CZ  1 
ATOM   2065 N  NH1 . ARG B 2 106 ? 25.552 21.931  36.633  1.00 20.00  ? 812 ARG C NH1 1 
ATOM   2066 N  NH2 . ARG B 2 106 ? 26.815 20.518  35.338  1.00 20.00  ? 812 ARG C NH2 1 
ATOM   2067 N  N   . LYS B 2 107 ? 19.314 21.465  34.635  1.00 65.28  ? 813 LYS C N   1 
ATOM   2068 C  CA  . LYS B 2 107 ? 18.272 22.467  34.840  1.00 75.27  ? 813 LYS C CA  1 
ATOM   2069 C  C   . LYS B 2 107 ? 18.587 23.776  34.119  1.00 82.55  ? 813 LYS C C   1 
ATOM   2070 O  O   . LYS B 2 107 ? 18.049 24.832  34.457  1.00 86.70  ? 813 LYS C O   1 
ATOM   2071 C  CB  . LYS B 2 107 ? 18.077 22.732  36.334  1.00 20.00  ? 813 LYS C CB  1 
ATOM   2072 C  CG  . LYS B 2 107 ? 16.885 23.619  36.657  1.00 20.00  ? 813 LYS C CG  1 
ATOM   2073 C  CD  . LYS B 2 107 ? 16.735 23.820  38.156  1.00 20.00  ? 813 LYS C CD  1 
ATOM   2074 C  CE  . LYS B 2 107 ? 15.545 24.706  38.480  1.00 20.00  ? 813 LYS C CE  1 
ATOM   2075 N  NZ  . LYS B 2 107 ? 15.386 24.911  39.945  1.00 20.00  ? 813 LYS C NZ  1 
ATOM   2076 N  N   . GLN C 1 20  ? 28.682 -20.328 -11.197 1.00 82.84  ? 39  GLN A N   1 
ATOM   2077 C  CA  . GLN C 1 20  ? 27.254 -20.018 -11.182 1.00 78.55  ? 39  GLN A CA  1 
ATOM   2078 C  C   . GLN C 1 20  ? 26.904 -18.717 -10.434 1.00 73.82  ? 39  GLN A C   1 
ATOM   2079 O  O   . GLN C 1 20  ? 26.367 -17.792 -11.052 1.00 78.29  ? 39  GLN A O   1 
ATOM   2080 C  CB  . GLN C 1 20  ? 26.441 -21.206 -10.657 1.00 77.35  ? 39  GLN A CB  1 
ATOM   2081 N  N   . LEU C 1 21  ? 27.188 -18.619 -9.129  1.00 60.59  ? 40  LEU A N   1 
ATOM   2082 C  CA  . LEU C 1 21  ? 27.782 -19.679 -8.312  1.00 43.86  ? 40  LEU A CA  1 
ATOM   2083 C  C   . LEU C 1 21  ? 26.752 -20.222 -7.317  1.00 35.86  ? 40  LEU A C   1 
ATOM   2084 O  O   . LEU C 1 21  ? 26.013 -19.467 -6.679  1.00 31.60  ? 40  LEU A O   1 
ATOM   2085 C  CB  . LEU C 1 21  ? 29.001 -19.155 -7.540  1.00 38.28  ? 40  LEU A CB  1 
ATOM   2086 C  CG  . LEU C 1 21  ? 30.277 -18.805 -8.312  1.00 35.17  ? 40  LEU A CG  1 
ATOM   2087 C  CD1 . LEU C 1 21  ? 31.243 -18.031 -7.431  1.00 38.62  ? 40  LEU A CD1 1 
ATOM   2088 C  CD2 . LEU C 1 21  ? 30.944 -20.057 -8.861  1.00 36.61  ? 40  LEU A CD2 1 
ATOM   2089 N  N   . VAL C 1 22  ? 26.711 -21.538 -7.189  1.00 26.57  ? 41  VAL A N   1 
ATOM   2090 C  CA  . VAL C 1 22  ? 25.752 -22.180 -6.309  1.00 25.02  ? 41  VAL A CA  1 
ATOM   2091 C  C   . VAL C 1 22  ? 26.416 -22.493 -4.982  1.00 22.22  ? 41  VAL A C   1 
ATOM   2092 O  O   . VAL C 1 22  ? 27.413 -23.201 -4.949  1.00 21.20  ? 41  VAL A O   1 
ATOM   2093 C  CB  . VAL C 1 22  ? 25.275 -23.500 -6.926  1.00 26.57  ? 41  VAL A CB  1 
ATOM   2094 C  CG1 . VAL C 1 22  ? 24.251 -24.174 -6.014  1.00 27.60  ? 41  VAL A CG1 1 
ATOM   2095 C  CG2 . VAL C 1 22  ? 24.707 -23.252 -8.316  1.00 36.15  ? 41  VAL A CG2 1 
ATOM   2096 N  N   . PRO C 1 23  ? 25.867 -21.987 -3.874  1.00 21.00  ? 42  PRO A N   1 
ATOM   2097 C  CA  . PRO C 1 23  ? 26.555 -22.287 -2.611  1.00 20.37  ? 42  PRO A CA  1 
ATOM   2098 C  C   . PRO C 1 23  ? 26.437 -23.764 -2.266  1.00 23.14  ? 42  PRO A C   1 
ATOM   2099 O  O   . PRO C 1 23  ? 25.454 -24.393 -2.657  1.00 21.07  ? 42  PRO A O   1 
ATOM   2100 C  CB  . PRO C 1 23  ? 25.770 -21.459 -1.586  1.00 23.77  ? 42  PRO A CB  1 
ATOM   2101 C  CG  . PRO C 1 23  ? 24.428 -21.229 -2.239  1.00 35.55  ? 42  PRO A CG  1 
ATOM   2102 C  CD  . PRO C 1 23  ? 24.767 -21.029 -3.682  1.00 30.21  ? 42  PRO A CD  1 
ATOM   2103 N  N   . LEU C 1 24  ? 27.402 -24.317 -1.539  1.00 18.70  ? 43  LEU A N   1 
ATOM   2104 C  CA  . LEU C 1 24  ? 27.238 -25.686 -1.055  1.00 23.81  ? 43  LEU A CA  1 
ATOM   2105 C  C   . LEU C 1 24  ? 26.239 -25.666 0.090   1.00 22.87  ? 43  LEU A C   1 
ATOM   2106 O  O   . LEU C 1 24  ? 26.054 -24.642 0.754   1.00 19.08  ? 43  LEU A O   1 
ATOM   2107 C  CB  . LEU C 1 24  ? 28.549 -26.318 -0.555  1.00 20.86  ? 43  LEU A CB  1 
ATOM   2108 C  CG  . LEU C 1 24  ? 29.882 -26.378 -1.308  1.00 28.49  ? 43  LEU A CG  1 
ATOM   2109 C  CD1 . LEU C 1 24  ? 30.650 -27.628 -0.849  1.00 20.99  ? 43  LEU A CD1 1 
ATOM   2110 C  CD2 . LEU C 1 24  ? 29.765 -26.339 -2.813  1.00 29.12  ? 43  LEU A CD2 1 
ATOM   2111 N  N   . LEU C 1 25  ? 25.609 -26.810 0.317   1.00 22.26  ? 44  LEU A N   1 
ATOM   2112 C  CA  . LEU C 1 25  ? 24.658 -26.983 1.400   1.00 27.32  ? 44  LEU A CA  1 
ATOM   2113 C  C   . LEU C 1 25  ? 25.379 -27.504 2.638   1.00 24.52  ? 44  LEU A C   1 
ATOM   2114 O  O   . LEU C 1 25  ? 26.424 -28.131 2.524   1.00 20.54  ? 44  LEU A O   1 
ATOM   2115 C  CB  . LEU C 1 25  ? 23.581 -27.983 0.960   1.00 30.59  ? 44  LEU A CB  1 
ATOM   2116 C  CG  . LEU C 1 25  ? 22.805 -27.543 -0.283  1.00 38.80  ? 44  LEU A CG  1 
ATOM   2117 C  CD1 . LEU C 1 25  ? 22.013 -28.690 -0.916  1.00 44.43  ? 44  LEU A CD1 1 
ATOM   2118 C  CD2 . LEU C 1 25  ? 21.892 -26.389 0.082   1.00 41.93  ? 44  LEU A CD2 1 
ATOM   2119 N  N   . TYR C 1 26  ? 24.824 -27.250 3.820   1.00 25.63  ? 45  TYR A N   1 
ATOM   2120 C  CA  . TYR C 1 26  ? 25.392 -27.788 5.053   1.00 24.51  ? 45  TYR A CA  1 
ATOM   2121 C  C   . TYR C 1 26  ? 25.630 -29.296 4.921   1.00 23.62  ? 45  TYR A C   1 
ATOM   2122 O  O   . TYR C 1 26  ? 24.770 -30.021 4.424   1.00 21.71  ? 45  TYR A O   1 
ATOM   2123 C  CB  . TYR C 1 26  ? 24.477 -27.465 6.242   1.00 27.68  ? 45  TYR A CB  1 
ATOM   2124 C  CG  . TYR C 1 26  ? 24.846 -28.151 7.540   1.00 25.98  ? 45  TYR A CG  1 
ATOM   2125 C  CD1 . TYR C 1 26  ? 26.046 -27.883 8.181   1.00 30.79  ? 45  TYR A CD1 1 
ATOM   2126 C  CD2 . TYR C 1 26  ? 23.978 -29.060 8.132   1.00 29.72  ? 45  TYR A CD2 1 
ATOM   2127 C  CE1 . TYR C 1 26  ? 26.378 -28.516 9.381   1.00 30.06  ? 45  TYR A CE1 1 
ATOM   2128 C  CE2 . TYR C 1 26  ? 24.299 -29.688 9.322   1.00 33.27  ? 45  TYR A CE2 1 
ATOM   2129 C  CZ  . TYR C 1 26  ? 25.495 -29.415 9.941   1.00 32.69  ? 45  TYR A CZ  1 
ATOM   2130 O  OH  . TYR C 1 26  ? 25.801 -30.052 11.126  1.00 37.71  ? 45  TYR A OH  1 
ATOM   2131 N  N   . LYS C 1 27  ? 26.825 -29.737 5.326   1.00 17.62  ? 46  LYS A N   1 
ATOM   2132 C  CA  . LYS C 1 27  ? 27.262 -31.142 5.269   1.00 24.46  ? 46  LYS A CA  1 
ATOM   2133 C  C   . LYS C 1 27  ? 27.588 -31.682 3.864   1.00 25.04  ? 46  LYS A C   1 
ATOM   2134 O  O   . LYS C 1 27  ? 28.032 -32.818 3.712   1.00 22.81  ? 46  LYS A O   1 
ATOM   2135 C  CB  . LYS C 1 27  ? 26.300 -32.069 6.021   1.00 27.86  ? 46  LYS A CB  1 
ATOM   2136 C  CG  . LYS C 1 27  ? 26.385 -31.934 7.535   1.00 32.88  ? 46  LYS A CG  1 
ATOM   2137 C  CD  . LYS C 1 27  ? 27.783 -32.244 8.027   1.00 33.14  ? 46  LYS A CD  1 
ATOM   2138 C  CE  . LYS C 1 27  ? 27.855 -32.324 9.538   1.00 34.31  ? 46  LYS A CE  1 
ATOM   2139 N  NZ  . LYS C 1 27  ? 29.214 -32.772 9.974   1.00 34.04  ? 46  LYS A NZ  1 
ATOM   2140 N  N   . GLN C 1 28  ? 27.398 -30.861 2.841   1.00 24.46  ? 47  GLN A N   1 
ATOM   2141 C  CA  . GLN C 1 28  ? 27.832 -31.248 1.502   1.00 21.96  ? 47  GLN A CA  1 
ATOM   2142 C  C   . GLN C 1 28  ? 29.370 -31.216 1.362   1.00 17.13  ? 47  GLN A C   1 
ATOM   2143 O  O   . GLN C 1 28  ? 30.035 -30.374 1.968   1.00 18.70  ? 47  GLN A O   1 
ATOM   2144 C  CB  . GLN C 1 28  ? 27.163 -30.331 0.474   1.00 22.68  ? 47  GLN A CB  1 
ATOM   2145 C  CG  . GLN C 1 28  ? 27.597 -30.541 -0.943  1.00 30.21  ? 47  GLN A CG  1 
ATOM   2146 C  CD  . GLN C 1 28  ? 26.686 -29.838 -1.941  1.00 42.04  ? 47  GLN A CD  1 
ATOM   2147 O  OE1 . GLN C 1 28  ? 25.944 -28.911 -1.587  1.00 35.50  ? 47  GLN A OE1 1 
ATOM   2148 N  NE2 . GLN C 1 28  ? 26.735 -30.282 -3.196  1.00 41.13  ? 47  GLN A NE2 1 
ATOM   2149 N  N   . PHE C 1 29  ? 29.934 -32.159 0.599   1.00 16.18  ? 48  PHE A N   1 
ATOM   2150 C  CA  . PHE C 1 29  ? 31.350 -32.110 0.237   1.00 15.77  ? 48  PHE A CA  1 
ATOM   2151 C  C   . PHE C 1 29  ? 31.539 -32.269 -1.267  1.00 20.34  ? 48  PHE A C   1 
ATOM   2152 O  O   . PHE C 1 29  ? 30.823 -33.041 -1.900  1.00 18.18  ? 48  PHE A O   1 
ATOM   2153 C  CB  . PHE C 1 29  ? 32.188 -33.137 1.024   1.00 19.30  ? 48  PHE A CB  1 
ATOM   2154 C  CG  . PHE C 1 29  ? 31.571 -34.508 1.101   1.00 20.04  ? 48  PHE A CG  1 
ATOM   2155 C  CD1 . PHE C 1 29  ? 30.593 -34.786 2.034   1.00 26.06  ? 48  PHE A CD1 1 
ATOM   2156 C  CD2 . PHE C 1 29  ? 31.977 -35.517 0.248   1.00 25.02  ? 48  PHE A CD2 1 
ATOM   2157 C  CE1 . PHE C 1 29  ? 30.022 -36.042 2.109   1.00 26.28  ? 48  PHE A CE1 1 
ATOM   2158 C  CE2 . PHE C 1 29  ? 31.405 -36.784 0.320   1.00 28.53  ? 48  PHE A CE2 1 
ATOM   2159 C  CZ  . PHE C 1 29  ? 30.429 -37.038 1.250   1.00 27.85  ? 48  PHE A CZ  1 
ATOM   2160 N  N   . VAL C 1 30  ? 32.488 -31.517 -1.829  1.00 15.92  ? 49  VAL A N   1 
ATOM   2161 C  CA  . VAL C 1 30  ? 32.735 -31.518 -3.270  1.00 17.39  ? 49  VAL A CA  1 
ATOM   2162 C  C   . VAL C 1 30  ? 34.225 -31.697 -3.551  1.00 17.08  ? 49  VAL A C   1 
ATOM   2163 O  O   . VAL C 1 30  ? 35.032 -30.995 -2.980  1.00 17.74  ? 49  VAL A O   1 
ATOM   2164 C  CB  . VAL C 1 30  ? 32.287 -30.190 -3.894  1.00 17.98  ? 49  VAL A CB  1 
ATOM   2165 C  CG1 . VAL C 1 30  ? 32.786 -30.077 -5.348  1.00 19.84  ? 49  VAL A CG1 1 
ATOM   2166 C  CG2 . VAL C 1 30  ? 30.770 -30.056 -3.812  1.00 15.94  ? 49  VAL A CG2 1 
ATOM   2167 N  N   . PRO C 1 31  ? 34.599 -32.677 -4.398  1.00 20.96  ? 50  PRO A N   1 
ATOM   2168 C  CA  . PRO C 1 31  ? 33.751 -33.699 -5.018  1.00 19.78  ? 50  PRO A CA  1 
ATOM   2169 C  C   . PRO C 1 31  ? 33.097 -34.589 -3.971  1.00 20.98  ? 50  PRO A C   1 
ATOM   2170 O  O   . PRO C 1 31  ? 33.652 -34.760 -2.879  1.00 19.05  ? 50  PRO A O   1 
ATOM   2171 C  CB  . PRO C 1 31  ? 34.747 -34.538 -5.827  1.00 24.97  ? 50  PRO A CB  1 
ATOM   2172 C  CG  . PRO C 1 31  ? 36.102 -34.259 -5.147  1.00 24.09  ? 50  PRO A CG  1 
ATOM   2173 C  CD  . PRO C 1 31  ? 36.002 -32.801 -4.820  1.00 16.90  ? 50  PRO A CD  1 
ATOM   2174 N  N   . GLY C 1 32  ? 31.950 -35.164 -4.322  1.00 23.99  ? 51  GLY A N   1 
ATOM   2175 C  CA  . GLY C 1 32  ? 31.179 -35.994 -3.415  1.00 21.63  ? 51  GLY A CA  1 
ATOM   2176 C  C   . GLY C 1 32  ? 31.742 -37.400 -3.262  1.00 22.58  ? 51  GLY A C   1 
ATOM   2177 O  O   . GLY C 1 32  ? 31.032 -38.393 -3.467  1.00 23.51  ? 51  GLY A O   1 
ATOM   2178 N  N   . VAL C 1 33  ? 33.023 -37.473 -2.914  1.00 24.05  ? 52  VAL A N   1 
ATOM   2179 C  CA  . VAL C 1 33  ? 33.681 -38.721 -2.534  1.00 23.13  ? 52  VAL A CA  1 
ATOM   2180 C  C   . VAL C 1 33  ? 34.429 -38.467 -1.221  1.00 26.49  ? 52  VAL A C   1 
ATOM   2181 O  O   . VAL C 1 33  ? 34.608 -37.312 -0.828  1.00 26.83  ? 52  VAL A O   1 
ATOM   2182 C  CB  . VAL C 1 33  ? 34.671 -39.185 -3.619  1.00 24.54  ? 52  VAL A CB  1 
ATOM   2183 C  CG1 . VAL C 1 33  ? 33.926 -39.500 -4.931  1.00 24.67  ? 52  VAL A CG1 1 
ATOM   2184 C  CG2 . VAL C 1 33  ? 35.746 -38.132 -3.851  1.00 25.91  ? 52  VAL A CG2 1 
ATOM   2185 N  N   . PRO C 1 34  ? 34.875 -39.537 -0.534  1.00 25.17  ? 53  PRO A N   1 
ATOM   2186 C  CA  . PRO C 1 34  ? 35.614 -39.330 0.722   1.00 29.72  ? 53  PRO A CA  1 
ATOM   2187 C  C   . PRO C 1 34  ? 36.876 -38.507 0.504   1.00 21.93  ? 53  PRO A C   1 
ATOM   2188 O  O   . PRO C 1 34  ? 37.492 -38.595 -0.553  1.00 18.55  ? 53  PRO A O   1 
ATOM   2189 C  CB  . PRO C 1 34  ? 35.976 -40.747 1.157   1.00 26.18  ? 53  PRO A CB  1 
ATOM   2190 C  CG  . PRO C 1 34  ? 34.901 -41.616 0.512   1.00 28.03  ? 53  PRO A CG  1 
ATOM   2191 C  CD  . PRO C 1 34  ? 34.635 -40.966 -0.812  1.00 32.21  ? 53  PRO A CD  1 
ATOM   2192 N  N   . GLU C 1 35  ? 37.252 -37.724 1.507   1.00 24.20  ? 54  GLU A N   1 
ATOM   2193 C  CA  . GLU C 1 35  ? 38.345 -36.757 1.367   1.00 20.68  ? 54  GLU A CA  1 
ATOM   2194 C  C   . GLU C 1 35  ? 39.646 -37.364 0.876   1.00 22.71  ? 54  GLU A C   1 
ATOM   2195 O  O   . GLU C 1 35  ? 40.375 -36.758 0.092   1.00 17.91  ? 54  GLU A O   1 
ATOM   2196 C  CB  . GLU C 1 35  ? 38.604 -36.044 2.698   1.00 17.70  ? 54  GLU A CB  1 
ATOM   2197 C  CG  . GLU C 1 35  ? 39.782 -35.059 2.631   1.00 23.84  ? 54  GLU A CG  1 
ATOM   2198 C  CD  . GLU C 1 35  ? 39.999 -34.332 3.940   1.00 20.63  ? 54  GLU A CD  1 
ATOM   2199 O  OE1 . GLU C 1 35  ? 39.824 -34.972 4.992   1.00 22.71  ? 54  GLU A OE1 1 
ATOM   2200 O  OE2 . GLU C 1 35  ? 40.358 -33.136 3.920   1.00 19.74  ? 54  GLU A OE2 1 
ATOM   2201 N  N   . ARG C 1 36  ? 39.957 -38.560 1.350   1.00 20.19  ? 55  ARG A N   1 
ATOM   2202 C  CA  . ARG C 1 36  ? 41.286 -39.093 1.107   1.00 26.63  ? 55  ARG A CA  1 
ATOM   2203 C  C   . ARG C 1 36  ? 41.369 -40.017 -0.109  1.00 23.51  ? 55  ARG A C   1 
ATOM   2204 O  O   . ARG C 1 36  ? 42.411 -40.580 -0.390  1.00 22.69  ? 55  ARG A O   1 
ATOM   2205 C  CB  . ARG C 1 36  ? 41.871 -39.688 2.392   1.00 29.98  ? 55  ARG A CB  1 
ATOM   2206 C  CG  . ARG C 1 36  ? 42.298 -38.566 3.362   1.00 32.47  ? 55  ARG A CG  1 
ATOM   2207 C  CD  . ARG C 1 36  ? 42.688 -39.049 4.752   1.00 42.03  ? 55  ARG A CD  1 
ATOM   2208 N  NE  . ARG C 1 36  ? 41.572 -39.632 5.494   1.00 48.82  ? 55  ARG A NE  1 
ATOM   2209 C  CZ  . ARG C 1 36  ? 41.410 -40.937 5.683   1.00 58.99  ? 55  ARG A CZ  1 
ATOM   2210 N  NH1 . ARG C 1 36  ? 42.294 -41.789 5.185   1.00 64.49  ? 55  ARG A NH1 1 
ATOM   2211 N  NH2 . ARG C 1 36  ? 40.375 -41.394 6.375   1.00 59.22  ? 55  ARG A NH2 1 
ATOM   2212 N  N   . THR C 1 37  ? 40.269 -40.116 -0.852  1.00 24.86  ? 56  THR A N   1 
ATOM   2213 C  CA  . THR C 1 37  ? 40.287 -40.811 -2.126  1.00 29.98  ? 56  THR A CA  1 
ATOM   2214 C  C   . THR C 1 37  ? 41.034 -39.979 -3.164  1.00 27.29  ? 56  THR A C   1 
ATOM   2215 O  O   . THR C 1 37  ? 41.081 -38.757 -3.082  1.00 23.36  ? 56  THR A O   1 
ATOM   2216 C  CB  . THR C 1 37  ? 38.867 -41.156 -2.631  1.00 35.90  ? 56  THR A CB  1 
ATOM   2217 O  OG1 . THR C 1 37  ? 38.186 -39.967 -3.030  1.00 39.54  ? 56  THR A OG1 1 
ATOM   2218 C  CG2 . THR C 1 37  ? 38.069 -41.839 -1.536  1.00 39.57  ? 56  THR A CG2 1 
ATOM   2219 N  N   . LEU C 1 38  ? 41.609 -40.659 -4.147  1.00 27.44  ? 57  LEU A N   1 
ATOM   2220 C  CA  . LEU C 1 38  ? 42.510 -40.032 -5.100  1.00 29.35  ? 57  LEU A CA  1 
ATOM   2221 C  C   . LEU C 1 38  ? 41.878 -38.901 -5.921  1.00 31.22  ? 57  LEU A C   1 
ATOM   2222 O  O   . LEU C 1 38  ? 42.546 -37.938 -6.263  1.00 36.24  ? 57  LEU A O   1 
ATOM   2223 C  CB  . LEU C 1 38  ? 43.115 -41.094 -6.022  1.00 37.95  ? 57  LEU A CB  1 
ATOM   2224 C  CG  . LEU C 1 38  ? 44.243 -40.613 -6.935  1.00 51.12  ? 57  LEU A CG  1 
ATOM   2225 C  CD1 . LEU C 1 38  ? 45.338 -39.945 -6.117  1.00 55.49  ? 57  LEU A CD1 1 
ATOM   2226 C  CD2 . LEU C 1 38  ? 44.809 -41.757 -7.773  1.00 58.19  ? 57  LEU A CD2 1 
ATOM   2227 N  N   . GLY C 1 39  ? 40.595 -39.014 -6.247  1.00 35.03  ? 58  GLY A N   1 
ATOM   2228 C  CA  . GLY C 1 39  ? 39.936 -37.952 -6.995  1.00 27.71  ? 58  GLY A CA  1 
ATOM   2229 C  C   . GLY C 1 39  ? 39.779 -36.677 -6.182  1.00 27.62  ? 58  GLY A C   1 
ATOM   2230 O  O   . GLY C 1 39  ? 39.544 -35.601 -6.732  1.00 23.91  ? 58  GLY A O   1 
ATOM   2231 N  N   . ALA C 1 40  ? 39.902 -36.800 -4.865  1.00 24.21  ? 59  ALA A N   1 
ATOM   2232 C  CA  . ALA C 1 40  ? 39.768 -35.657 -3.972  1.00 20.18  ? 59  ALA A CA  1 
ATOM   2233 C  C   . ALA C 1 40  ? 41.157 -35.174 -3.524  1.00 15.04  ? 59  ALA A C   1 
ATOM   2234 O  O   . ALA C 1 40  ? 41.998 -34.830 -4.359  1.00 21.00  ? 59  ALA A O   1 
ATOM   2235 C  CB  . ALA C 1 40  ? 38.887 -36.024 -2.772  1.00 19.82  ? 59  ALA A CB  1 
ATOM   2236 N  N   . SER C 1 41  ? 41.408 -35.155 -2.217  1.00 15.74  ? 60  SER A N   1 
ATOM   2237 C  CA  . SER C 1 41  ? 42.721 -34.749 -1.702  1.00 16.31  ? 60  SER A CA  1 
ATOM   2238 C  C   . SER C 1 41  ? 43.729 -35.910 -1.591  1.00 25.92  ? 60  SER A C   1 
ATOM   2239 O  O   . SER C 1 41  ? 44.929 -35.687 -1.408  1.00 18.49  ? 60  SER A O   1 
ATOM   2240 C  CB  . SER C 1 41  ? 42.585 -34.029 -0.344  1.00 14.03  ? 60  SER A CB  1 
ATOM   2241 O  OG  . SER C 1 41  ? 42.032 -32.738 -0.541  1.00 20.88  ? 60  SER A OG  1 
ATOM   2242 N  N   . GLY C 1 42  ? 43.252 -37.143 -1.701  1.00 24.29  ? 61  GLY A N   1 
ATOM   2243 C  CA  . GLY C 1 42  ? 44.155 -38.282 -1.653  1.00 24.77  ? 61  GLY A CA  1 
ATOM   2244 C  C   . GLY C 1 42  ? 44.647 -38.609 -0.258  1.00 26.65  ? 61  GLY A C   1 
ATOM   2245 O  O   . GLY C 1 42  ? 44.366 -37.877 0.703   1.00 24.82  ? 61  GLY A O   1 
ATOM   2246 N  N   . PRO C 1 43  ? 45.414 -39.700 -0.138  1.00 26.66  ? 62  PRO A N   1 
ATOM   2247 C  CA  . PRO C 1 43  ? 45.811 -40.312 1.137   1.00 28.46  ? 62  PRO A CA  1 
ATOM   2248 C  C   . PRO C 1 43  ? 46.534 -39.374 2.100   1.00 23.76  ? 62  PRO A C   1 
ATOM   2249 O  O   . PRO C 1 43  ? 47.305 -38.511 1.678   1.00 25.30  ? 62  PRO A O   1 
ATOM   2250 C  CB  . PRO C 1 43  ? 46.764 -41.431 0.698   1.00 33.95  ? 62  PRO A CB  1 
ATOM   2251 C  CG  . PRO C 1 43  ? 46.362 -41.742 -0.695  1.00 35.90  ? 62  PRO A CG  1 
ATOM   2252 C  CD  . PRO C 1 43  ? 45.976 -40.425 -1.290  1.00 31.03  ? 62  PRO A CD  1 
ATOM   2253 N  N   . ALA C 1 44  ? 46.271 -39.536 3.393   1.00 25.61  ? 63  ALA A N   1 
ATOM   2254 C  CA  . ALA C 1 44  ? 47.134 -38.946 4.396   1.00 24.42  ? 63  ALA A CA  1 
ATOM   2255 C  C   . ALA C 1 44  ? 48.474 -39.643 4.238   1.00 27.38  ? 63  ALA A C   1 
ATOM   2256 O  O   . ALA C 1 44  ? 48.532 -40.780 3.774   1.00 30.11  ? 63  ALA A O   1 
ATOM   2257 C  CB  . ALA C 1 44  ? 46.574 -39.173 5.789   1.00 26.21  ? 63  ALA A CB  1 
ATOM   2258 N  N   . GLU C 1 45  ? 49.552 -38.964 4.602   1.00 29.01  ? 64  GLU A N   1 
ATOM   2259 C  CA  . GLU C 1 45  ? 50.874 -39.564 4.530   1.00 30.64  ? 64  GLU A CA  1 
ATOM   2260 C  C   . GLU C 1 45  ? 51.454 -39.681 5.926   1.00 31.77  ? 64  GLU A C   1 
ATOM   2261 O  O   . GLU C 1 45  ? 52.559 -40.183 6.112   1.00 33.41  ? 64  GLU A O   1 
ATOM   2262 C  CB  . GLU C 1 45  ? 51.787 -38.755 3.611   1.00 35.63  ? 64  GLU A CB  1 
ATOM   2263 C  CG  . GLU C 1 45  ? 51.142 -38.454 2.266   1.00 45.40  ? 64  GLU A CG  1 
ATOM   2264 C  CD  . GLU C 1 45  ? 52.134 -37.999 1.218   1.00 52.09  ? 64  GLU A CD  1 
ATOM   2265 O  OE1 . GLU C 1 45  ? 53.287 -37.694 1.579   1.00 57.02  ? 64  GLU A OE1 1 
ATOM   2266 O  OE2 . GLU C 1 45  ? 51.755 -37.946 0.029   1.00 53.26  ? 64  GLU A OE2 1 
ATOM   2267 N  N   . GLY C 1 46  ? 50.694 -39.222 6.911   1.00 29.18  ? 65  GLY A N   1 
ATOM   2268 C  CA  . GLY C 1 46  ? 51.117 -39.340 8.291   1.00 31.20  ? 65  GLY A CA  1 
ATOM   2269 C  C   . GLY C 1 46  ? 51.264 -37.999 8.975   1.00 28.63  ? 65  GLY A C   1 
ATOM   2270 O  O   . GLY C 1 46  ? 51.625 -36.998 8.350   1.00 23.38  ? 65  GLY A O   1 
ATOM   2271 N  N   . ARG C 1 47  ? 50.992 -37.983 10.274  1.00 26.81  ? 66  ARG A N   1 
ATOM   2272 C  CA  . ARG C 1 47  ? 51.075 -36.759 11.048  1.00 25.36  ? 66  ARG A CA  1 
ATOM   2273 C  C   . ARG C 1 47  ? 52.461 -36.130 10.948  1.00 30.52  ? 66  ARG A C   1 
ATOM   2274 O  O   . ARG C 1 47  ? 53.480 -36.808 11.090  1.00 23.71  ? 66  ARG A O   1 
ATOM   2275 C  CB  . ARG C 1 47  ? 50.680 -37.011 12.508  1.00 26.63  ? 66  ARG A CB  1 
ATOM   2276 C  CG  . ARG C 1 47  ? 50.707 -35.766 13.403  1.00 24.82  ? 66  ARG A CG  1 
ATOM   2277 C  CD  . ARG C 1 47  ? 49.842 -35.972 14.663  1.00 28.33  ? 66  ARG A CD  1 
ATOM   2278 N  NE  . ARG C 1 47  ? 50.009 -34.906 15.659  1.00 23.21  ? 66  ARG A NE  1 
ATOM   2279 C  CZ  . ARG C 1 47  ? 49.344 -34.841 16.813  1.00 28.29  ? 66  ARG A CZ  1 
ATOM   2280 N  NH1 . ARG C 1 47  ? 48.456 -35.773 17.124  1.00 25.17  ? 66  ARG A NH1 1 
ATOM   2281 N  NH2 . ARG C 1 47  ? 49.553 -33.828 17.653  1.00 24.54  ? 66  ARG A NH2 1 
ATOM   2282 N  N   . VAL C 1 48  ? 52.488 -34.829 10.681  1.00 31.59  ? 67  VAL A N   1 
ATOM   2283 C  CA  . VAL C 1 48  ? 53.737 -34.089 10.604  1.00 32.29  ? 67  VAL A CA  1 
ATOM   2284 C  C   . VAL C 1 48  ? 53.957 -33.381 11.931  1.00 26.43  ? 67  VAL A C   1 
ATOM   2285 O  O   . VAL C 1 48  ? 53.155 -32.542 12.327  1.00 19.77  ? 67  VAL A O   1 
ATOM   2286 C  CB  . VAL C 1 48  ? 53.707 -33.071 9.453   1.00 26.56  ? 67  VAL A CB  1 
ATOM   2287 C  CG1 . VAL C 1 48  ? 54.988 -32.234 9.433   1.00 21.48  ? 67  VAL A CG1 1 
ATOM   2288 C  CG2 . VAL C 1 48  ? 53.520 -33.801 8.122   1.00 29.82  ? 67  VAL A CG2 1 
ATOM   2289 N  N   . ALA C 1 49  ? 55.032 -33.739 12.624  1.00 25.83  ? 68  ALA A N   1 
ATOM   2290 C  CA  . ALA C 1 49  ? 55.321 -33.153 13.930  1.00 25.90  ? 68  ALA A CA  1 
ATOM   2291 C  C   . ALA C 1 49  ? 56.340 -32.022 13.806  1.00 27.72  ? 68  ALA A C   1 
ATOM   2292 O  O   . ALA C 1 49  ? 57.152 -32.004 12.883  1.00 30.54  ? 68  ALA A O   1 
ATOM   2293 C  CB  . ALA C 1 49  ? 55.821 -34.228 14.913  1.00 25.56  ? 68  ALA A CB  1 
ATOM   2294 N  N   . ARG C 1 50  ? 56.298 -31.081 14.743  1.00 23.47  ? 69  ARG A N   1 
ATOM   2295 C  CA  . ARG C 1 50  ? 57.195 -29.942 14.699  1.00 31.06  ? 69  ARG A CA  1 
ATOM   2296 C  C   . ARG C 1 50  ? 58.644 -30.431 14.623  1.00 37.21  ? 69  ARG A C   1 
ATOM   2297 O  O   . ARG C 1 50  ? 58.985 -31.483 15.169  1.00 30.61  ? 69  ARG A O   1 
ATOM   2298 C  CB  . ARG C 1 50  ? 56.962 -29.052 15.915  1.00 25.86  ? 69  ARG A CB  1 
ATOM   2299 C  CG  . ARG C 1 50  ? 57.768 -27.779 15.912  1.00 29.44  ? 69  ARG A CG  1 
ATOM   2300 C  CD  . ARG C 1 50  ? 57.409 -26.936 17.105  1.00 27.98  ? 69  ARG A CD  1 
ATOM   2301 N  NE  . ARG C 1 50  ? 56.069 -26.372 17.001  1.00 22.81  ? 69  ARG A NE  1 
ATOM   2302 C  CZ  . ARG C 1 50  ? 55.799 -25.248 16.349  1.00 32.52  ? 69  ARG A CZ  1 
ATOM   2303 N  NH1 . ARG C 1 50  ? 56.780 -24.591 15.737  1.00 24.28  ? 69  ARG A NH1 1 
ATOM   2304 N  NH2 . ARG C 1 50  ? 54.558 -24.778 16.302  1.00 32.48  ? 69  ARG A NH2 1 
ATOM   2305 N  N   . GLY C 1 51  ? 59.486 -29.696 13.912  1.00 41.78  ? 70  GLY A N   1 
ATOM   2306 C  CA  . GLY C 1 51  ? 60.891 -30.048 13.815  1.00 42.50  ? 70  GLY A CA  1 
ATOM   2307 C  C   . GLY C 1 51  ? 61.199 -31.298 13.013  1.00 42.71  ? 70  GLY A C   1 
ATOM   2308 O  O   . GLY C 1 51  ? 62.337 -31.734 12.978  1.00 37.43  ? 70  GLY A O   1 
ATOM   2309 N  N   . SER C 1 52  ? 60.188 -31.885 12.377  1.00 43.42  ? 71  SER A N   1 
ATOM   2310 C  CA  . SER C 1 52  ? 60.415 -32.997 11.452  1.00 41.42  ? 71  SER A CA  1 
ATOM   2311 C  C   . SER C 1 52  ? 60.848 -32.459 10.089  1.00 39.72  ? 71  SER A C   1 
ATOM   2312 O  O   . SER C 1 52  ? 60.732 -31.266 9.822   1.00 38.28  ? 71  SER A O   1 
ATOM   2313 C  CB  . SER C 1 52  ? 59.144 -33.836 11.291  1.00 42.01  ? 71  SER A CB  1 
ATOM   2314 O  OG  . SER C 1 52  ? 58.090 -33.059 10.743  1.00 32.37  ? 71  SER A OG  1 
ATOM   2315 N  N   . GLU C 1 53  ? 61.330 -33.328 9.209   1.00 44.84  ? 72  GLU A N   1 
ATOM   2316 C  CA  . GLU C 1 53  ? 61.715 -32.863 7.879   1.00 52.95  ? 72  GLU A CA  1 
ATOM   2317 C  C   . GLU C 1 53  ? 60.514 -32.447 7.031   1.00 45.45  ? 72  GLU A C   1 
ATOM   2318 O  O   . GLU C 1 53  ? 60.592 -31.487 6.264   1.00 42.46  ? 72  GLU A O   1 
ATOM   2319 C  CB  . GLU C 1 53  ? 62.584 -33.891 7.158   1.00 68.47  ? 72  GLU A CB  1 
ATOM   2320 C  CG  . GLU C 1 53  ? 63.979 -33.980 7.763   1.00 84.72  ? 72  GLU A CG  1 
ATOM   2321 C  CD  . GLU C 1 53  ? 64.543 -32.605 8.110   1.00 93.94  ? 72  GLU A CD  1 
ATOM   2322 O  OE1 . GLU C 1 53  ? 64.973 -31.885 7.181   1.00 94.84  ? 72  GLU A OE1 1 
ATOM   2323 O  OE2 . GLU C 1 53  ? 64.552 -32.246 9.310   1.00 96.98  ? 72  GLU A OE2 1 
ATOM   2324 N  N   . ARG C 1 54  ? 59.401 -33.160 7.166   1.00 37.22  ? 73  ARG A N   1 
ATOM   2325 C  CA  . ARG C 1 54  ? 58.178 -32.741 6.489   1.00 33.13  ? 73  ARG A CA  1 
ATOM   2326 C  C   . ARG C 1 54  ? 57.723 -31.385 7.033   1.00 31.71  ? 73  ARG A C   1 
ATOM   2327 O  O   . ARG C 1 54  ? 57.183 -30.560 6.302   1.00 29.71  ? 73  ARG A O   1 
ATOM   2328 C  CB  . ARG C 1 54  ? 57.083 -33.794 6.636   1.00 29.02  ? 73  ARG A CB  1 
ATOM   2329 C  CG  . ARG C 1 54  ? 57.261 -34.994 5.706   1.00 35.64  ? 73  ARG A CG  1 
ATOM   2330 C  CD  . ARG C 1 54  ? 56.120 -36.000 5.850   1.00 39.44  ? 73  ARG A CD  1 
ATOM   2331 N  NE  . ARG C 1 54  ? 54.865 -35.463 5.330   1.00 41.62  ? 73  ARG A NE  1 
ATOM   2332 C  CZ  . ARG C 1 54  ? 53.662 -35.911 5.670   1.00 35.04  ? 73  ARG A CZ  1 
ATOM   2333 N  NH1 . ARG C 1 54  ? 53.548 -36.901 6.535   1.00 36.87  ? 73  ARG A NH1 1 
ATOM   2334 N  NH2 . ARG C 1 54  ? 52.574 -35.361 5.154   1.00 31.40  ? 73  ARG A NH2 1 
ATOM   2335 N  N   . PHE C 1 55  ? 57.966 -31.153 8.318   1.00 29.17  ? 74  PHE A N   1 
ATOM   2336 C  CA  . PHE C 1 55  ? 57.635 -29.877 8.951   1.00 29.12  ? 74  PHE A CA  1 
ATOM   2337 C  C   . PHE C 1 55  ? 58.422 -28.713 8.348   1.00 30.89  ? 74  PHE A C   1 
ATOM   2338 O  O   . PHE C 1 55  ? 57.889 -27.619 8.162   1.00 30.80  ? 74  PHE A O   1 
ATOM   2339 C  CB  . PHE C 1 55  ? 57.890 -29.938 10.459  1.00 27.20  ? 74  PHE A CB  1 
ATOM   2340 C  CG  . PHE C 1 55  ? 57.595 -28.654 11.169  1.00 30.24  ? 74  PHE A CG  1 
ATOM   2341 C  CD1 . PHE C 1 55  ? 56.299 -28.337 11.547  1.00 26.76  ? 74  PHE A CD1 1 
ATOM   2342 C  CD2 . PHE C 1 55  ? 58.607 -27.755 11.447  1.00 29.61  ? 74  PHE A CD2 1 
ATOM   2343 C  CE1 . PHE C 1 55  ? 56.030 -27.151 12.194  1.00 23.86  ? 74  PHE A CE1 1 
ATOM   2344 C  CE2 . PHE C 1 55  ? 58.337 -26.569 12.093  1.00 30.09  ? 74  PHE A CE2 1 
ATOM   2345 C  CZ  . PHE C 1 55  ? 57.054 -26.267 12.467  1.00 29.69  ? 74  PHE A CZ  1 
ATOM   2346 N  N   . ARG C 1 56  ? 59.699 -28.953 8.073   1.00 28.90  ? 75  ARG A N   1 
ATOM   2347 C  CA  . ARG C 1 56  ? 60.552 -27.960 7.436   1.00 38.20  ? 75  ARG A CA  1 
ATOM   2348 C  C   . ARG C 1 56  ? 60.063 -27.599 6.034   1.00 32.25  ? 75  ARG A C   1 
ATOM   2349 O  O   . ARG C 1 56  ? 60.425 -26.555 5.499   1.00 38.98  ? 75  ARG A O   1 
ATOM   2350 C  CB  . ARG C 1 56  ? 61.995 -28.470 7.340   1.00 44.38  ? 75  ARG A CB  1 
ATOM   2351 C  CG  . ARG C 1 56  ? 62.690 -28.727 8.663   1.00 48.52  ? 75  ARG A CG  1 
ATOM   2352 C  CD  . ARG C 1 56  ? 64.119 -29.180 8.388   1.00 59.85  ? 75  ARG A CD  1 
ATOM   2353 N  NE  . ARG C 1 56  ? 64.929 -29.288 9.598   1.00 73.96  ? 75  ARG A NE  1 
ATOM   2354 C  CZ  . ARG C 1 56  ? 66.243 -29.501 9.599   1.00 86.13  ? 75  ARG A CZ  1 
ATOM   2355 N  NH1 . ARG C 1 56  ? 66.897 -29.627 8.451   1.00 89.75  ? 75  ARG A NH1 1 
ATOM   2356 N  NH2 . ARG C 1 56  ? 66.907 -29.585 10.747  1.00 89.14  ? 75  ARG A NH2 1 
ATOM   2357 N  N   . ASP C 1 57  ? 59.258 -28.468 5.435   1.00 26.66  ? 76  ASP A N   1 
ATOM   2358 C  CA  . ASP C 1 57  ? 58.754 -28.211 4.094   1.00 29.12  ? 76  ASP A CA  1 
ATOM   2359 C  C   . ASP C 1 57  ? 57.490 -27.357 4.120   1.00 28.27  ? 76  ASP A C   1 
ATOM   2360 O  O   . ASP C 1 57  ? 57.042 -26.880 3.080   1.00 35.72  ? 76  ASP A O   1 
ATOM   2361 C  CB  . ASP C 1 57  ? 58.471 -29.516 3.358   1.00 28.37  ? 76  ASP A CB  1 
ATOM   2362 C  CG  . ASP C 1 57  ? 59.741 -30.213 2.894   1.00 40.63  ? 76  ASP A CG  1 
ATOM   2363 O  OD1 . ASP C 1 57  ? 60.839 -29.615 3.006   1.00 36.57  ? 76  ASP A OD1 1 
ATOM   2364 O  OD2 . ASP C 1 57  ? 59.623 -31.362 2.418   1.00 42.05  ? 76  ASP A OD2 1 
ATOM   2365 N  N   . LEU C 1 58  ? 56.911 -27.177 5.301   1.00 25.85  ? 77  LEU A N   1 
ATOM   2366 C  CA  . LEU C 1 58  ? 55.725 -26.329 5.437   1.00 24.73  ? 77  LEU A CA  1 
ATOM   2367 C  C   . LEU C 1 58  ? 56.151 -24.868 5.428   1.00 30.59  ? 77  LEU A C   1 
ATOM   2368 O  O   . LEU C 1 58  ? 57.218 -24.533 5.933   1.00 31.90  ? 77  LEU A O   1 
ATOM   2369 C  CB  . LEU C 1 58  ? 54.986 -26.641 6.732   1.00 25.10  ? 77  LEU A CB  1 
ATOM   2370 C  CG  . LEU C 1 58  ? 54.455 -28.069 6.824   1.00 23.64  ? 77  LEU A CG  1 
ATOM   2371 C  CD1 . LEU C 1 58  ? 53.764 -28.330 8.156   1.00 24.44  ? 77  LEU A CD1 1 
ATOM   2372 C  CD2 . LEU C 1 58  ? 53.517 -28.351 5.655   1.00 22.67  ? 77  LEU A CD2 1 
ATOM   2373 N  N   . VAL C 1 59  ? 55.328 -23.994 4.861   1.00 20.29  ? 78  VAL A N   1 
ATOM   2374 C  CA  . VAL C 1 59  ? 55.689 -22.585 4.794   1.00 25.05  ? 78  VAL A CA  1 
ATOM   2375 C  C   . VAL C 1 59  ? 54.673 -21.762 5.560   1.00 20.71  ? 78  VAL A C   1 
ATOM   2376 O  O   . VAL C 1 59  ? 53.479 -22.060 5.510   1.00 19.72  ? 78  VAL A O   1 
ATOM   2377 C  CB  . VAL C 1 59  ? 55.758 -22.081 3.335   1.00 36.85  ? 78  VAL A CB  1 
ATOM   2378 C  CG1 . VAL C 1 59  ? 56.968 -22.661 2.634   1.00 45.16  ? 78  VAL A CG1 1 
ATOM   2379 C  CG2 . VAL C 1 59  ? 54.492 -22.452 2.582   1.00 39.07  ? 78  VAL A CG2 1 
ATOM   2380 N  N   . PRO C 1 60  ? 55.144 -20.729 6.289   1.00 23.26  ? 79  PRO A N   1 
ATOM   2381 C  CA  . PRO C 1 60  ? 54.205 -19.863 6.999   1.00 23.77  ? 79  PRO A CA  1 
ATOM   2382 C  C   . PRO C 1 60  ? 53.615 -18.899 5.989   1.00 22.37  ? 79  PRO A C   1 
ATOM   2383 O  O   . PRO C 1 60  ? 54.337 -18.246 5.239   1.00 22.71  ? 79  PRO A O   1 
ATOM   2384 C  CB  . PRO C 1 60  ? 55.086 -19.110 8.002   1.00 27.96  ? 79  PRO A CB  1 
ATOM   2385 C  CG  . PRO C 1 60  ? 56.508 -19.628 7.791   1.00 31.95  ? 79  PRO A CG  1 
ATOM   2386 C  CD  . PRO C 1 60  ? 56.533 -20.280 6.450   1.00 26.50  ? 79  PRO A CD  1 
ATOM   2387 N  N   . ASN C 1 61  ? 52.296 -18.857 5.952   1.00 17.00  ? 80  ASN A N   1 
ATOM   2388 C  CA  . ASN C 1 61  ? 51.584 -17.951 5.090   1.00 17.09  ? 80  ASN A CA  1 
ATOM   2389 C  C   . ASN C 1 61  ? 51.405 -16.615 5.788   1.00 23.02  ? 80  ASN A C   1 
ATOM   2390 O  O   . ASN C 1 61  ? 50.709 -16.534 6.807   1.00 22.13  ? 80  ASN A O   1 
ATOM   2391 C  CB  . ASN C 1 61  ? 50.232 -18.561 4.757   1.00 15.34  ? 80  ASN A CB  1 
ATOM   2392 C  CG  . ASN C 1 61  ? 49.524 -17.816 3.674   1.00 22.92  ? 80  ASN A CG  1 
ATOM   2393 O  OD1 . ASN C 1 61  ? 49.592 -16.588 3.616   1.00 20.27  ? 80  ASN A OD1 1 
ATOM   2394 N  ND2 . ASN C 1 61  ? 48.826 -18.552 2.798   1.00 16.82  ? 80  ASN A ND2 1 
ATOM   2395 N  N   . TYR C 1 62  ? 52.049 -15.576 5.254   1.00 18.78  ? 81  TYR A N   1 
ATOM   2396 C  CA  . TYR C 1 62  ? 52.026 -14.260 5.888   1.00 18.23  ? 81  TYR A CA  1 
ATOM   2397 C  C   . TYR C 1 62  ? 51.100 -13.289 5.157   1.00 22.23  ? 81  TYR A C   1 
ATOM   2398 O  O   . TYR C 1 62  ? 51.205 -12.074 5.316   1.00 23.21  ? 81  TYR A O   1 
ATOM   2399 C  CB  . TYR C 1 62  ? 53.445 -13.681 6.001   1.00 20.33  ? 81  TYR A CB  1 
ATOM   2400 C  CG  . TYR C 1 62  ? 54.334 -14.417 6.979   1.00 21.45  ? 81  TYR A CG  1 
ATOM   2401 C  CD1 . TYR C 1 62  ? 53.888 -14.722 8.260   1.00 22.52  ? 81  TYR A CD1 1 
ATOM   2402 C  CD2 . TYR C 1 62  ? 55.627 -14.794 6.632   1.00 30.89  ? 81  TYR A CD2 1 
ATOM   2403 C  CE1 . TYR C 1 62  ? 54.690 -15.394 9.157   1.00 22.66  ? 81  TYR A CE1 1 
ATOM   2404 C  CE2 . TYR C 1 62  ? 56.439 -15.463 7.527   1.00 32.12  ? 81  TYR A CE2 1 
ATOM   2405 C  CZ  . TYR C 1 62  ? 55.966 -15.758 8.788   1.00 28.41  ? 81  TYR A CZ  1 
ATOM   2406 O  OH  . TYR C 1 62  ? 56.765 -16.429 9.680   1.00 29.89  ? 81  TYR A OH  1 
ATOM   2407 N  N   . ASN C 1 63  ? 50.184 -13.835 4.362   1.00 22.14  ? 82  ASN A N   1 
ATOM   2408 C  CA  . ASN C 1 63  ? 49.243 -13.027 3.588   1.00 22.37  ? 82  ASN A CA  1 
ATOM   2409 C  C   . ASN C 1 63  ? 48.401 -12.131 4.498   1.00 19.19  ? 82  ASN A C   1 
ATOM   2410 O  O   . ASN C 1 63  ? 47.592 -12.637 5.274   1.00 20.76  ? 82  ASN A O   1 
ATOM   2411 C  CB  . ASN C 1 63  ? 48.326 -13.970 2.795   1.00 19.69  ? 82  ASN A CB  1 
ATOM   2412 C  CG  . ASN C 1 63  ? 47.454 -13.245 1.821   1.00 26.55  ? 82  ASN A CG  1 
ATOM   2413 O  OD1 . ASN C 1 63  ? 47.241 -12.040 1.945   1.00 25.60  ? 82  ASN A OD1 1 
ATOM   2414 N  ND2 . ASN C 1 63  ? 46.938 -13.973 0.833   1.00 22.11  ? 82  ASN A ND2 1 
ATOM   2415 N  N   . PRO C 1 64  ? 48.584 -10.799 4.412   1.00 19.44  ? 83  PRO A N   1 
ATOM   2416 C  CA  . PRO C 1 64  ? 47.855 -9.838  5.253   1.00 24.68  ? 83  PRO A CA  1 
ATOM   2417 C  C   . PRO C 1 64  ? 46.355 -9.874  5.009   1.00 27.91  ? 83  PRO A C   1 
ATOM   2418 O  O   . PRO C 1 64  ? 45.591 -9.397  5.850   1.00 31.37  ? 83  PRO A O   1 
ATOM   2419 C  CB  . PRO C 1 64  ? 48.400 -8.466  4.788   1.00 23.90  ? 83  PRO A CB  1 
ATOM   2420 C  CG  . PRO C 1 64  ? 49.680 -8.761  4.112   1.00 32.62  ? 83  PRO A CG  1 
ATOM   2421 C  CD  . PRO C 1 64  ? 49.501 -10.120 3.479   1.00 25.25  ? 83  PRO A CD  1 
ATOM   2422 N  N   . ASP C 1 65  ? 45.940 -10.416 3.870   1.00 20.20  ? 84  ASP A N   1 
ATOM   2423 C  CA  . ASP C 1 65  ? 44.518 -10.453 3.533   1.00 23.67  ? 84  ASP A CA  1 
ATOM   2424 C  C   . ASP C 1 65  ? 43.819 -11.695 4.097   1.00 19.57  ? 84  ASP A C   1 
ATOM   2425 O  O   . ASP C 1 65  ? 42.647 -11.933 3.809   1.00 24.32  ? 84  ASP A O   1 
ATOM   2426 C  CB  . ASP C 1 65  ? 44.310 -10.353 2.020   1.00 25.98  ? 84  ASP A CB  1 
ATOM   2427 C  CG  . ASP C 1 65  ? 44.928 -9.089  1.424   1.00 33.52  ? 84  ASP A CG  1 
ATOM   2428 O  OD1 . ASP C 1 65  ? 44.736 -7.997  1.994   1.00 28.27  ? 84  ASP A OD1 1 
ATOM   2429 O  OD2 . ASP C 1 65  ? 45.599 -9.197  0.375   1.00 41.15  ? 84  ASP A OD2 1 
ATOM   2430 N  N   . ILE C 1 66  ? 44.539 -12.477 4.905   1.00 16.52  ? 85  ILE A N   1 
ATOM   2431 C  CA  . ILE C 1 66  ? 43.946 -13.630 5.576   1.00 17.59  ? 85  ILE A CA  1 
ATOM   2432 C  C   . ILE C 1 66  ? 44.097 -13.476 7.084   1.00 20.25  ? 85  ILE A C   1 
ATOM   2433 O  O   . ILE C 1 66  ? 45.189 -13.169 7.591   1.00 19.22  ? 85  ILE A O   1 
ATOM   2434 C  CB  . ILE C 1 66  ? 44.598 -14.969 5.154   1.00 18.70  ? 85  ILE A CB  1 
ATOM   2435 C  CG1 . ILE C 1 66  ? 44.490 -15.189 3.642   1.00 18.68  ? 85  ILE A CG1 1 
ATOM   2436 C  CG2 . ILE C 1 66  ? 43.944 -16.127 5.881   1.00 20.61  ? 85  ILE A CG2 1 
ATOM   2437 C  CD1 . ILE C 1 66  ? 45.266 -16.407 3.156   1.00 17.58  ? 85  ILE A CD1 1 
ATOM   2438 N  N   . ILE C 1 67  ? 43.010 -13.694 7.811   1.00 19.04  ? 86  ILE A N   1 
ATOM   2439 C  CA  . ILE C 1 67  ? 43.079 -13.638 9.271   1.00 22.13  ? 86  ILE A CA  1 
ATOM   2440 C  C   . ILE C 1 67  ? 43.360 -15.019 9.831   1.00 20.72  ? 86  ILE A C   1 
ATOM   2441 O  O   . ILE C 1 67  ? 42.589 -15.940 9.621   1.00 19.92  ? 86  ILE A O   1 
ATOM   2442 C  CB  . ILE C 1 67  ? 41.763 -13.131 9.868   1.00 20.72  ? 86  ILE A CB  1 
ATOM   2443 C  CG1 . ILE C 1 67  ? 41.481 -11.695 9.421   1.00 22.90  ? 86  ILE A CG1 1 
ATOM   2444 C  CG2 . ILE C 1 67  ? 41.769 -13.237 11.399  1.00 26.29  ? 86  ILE A CG2 1 
ATOM   2445 C  CD1 . ILE C 1 67  ? 40.075 -11.231 9.776   1.00 24.42  ? 86  ILE A CD1 1 
ATOM   2446 N  N   . PHE C 1 68  ? 44.459 -15.165 10.564  1.00 19.61  ? 87  PHE A N   1 
ATOM   2447 C  CA  . PHE C 1 68  ? 44.763 -16.449 11.190  1.00 18.99  ? 87  PHE A CA  1 
ATOM   2448 C  C   . PHE C 1 68  ? 44.422 -16.402 12.683  1.00 23.04  ? 87  PHE A C   1 
ATOM   2449 O  O   . PHE C 1 68  ? 45.015 -15.640 13.441  1.00 18.93  ? 87  PHE A O   1 
ATOM   2450 C  CB  . PHE C 1 68  ? 46.227 -16.824 10.954  1.00 17.60  ? 87  PHE A CB  1 
ATOM   2451 C  CG  . PHE C 1 68  ? 46.515 -17.231 9.544   1.00 18.57  ? 87  PHE A CG  1 
ATOM   2452 C  CD1 . PHE C 1 68  ? 46.375 -18.554 9.152   1.00 14.66  ? 87  PHE A CD1 1 
ATOM   2453 C  CD2 . PHE C 1 68  ? 46.909 -16.291 8.602   1.00 18.94  ? 87  PHE A CD2 1 
ATOM   2454 C  CE1 . PHE C 1 68  ? 46.632 -18.939 7.827   1.00 18.14  ? 87  PHE A CE1 1 
ATOM   2455 C  CE2 . PHE C 1 68  ? 47.168 -16.665 7.297   1.00 15.74  ? 87  PHE A CE2 1 
ATOM   2456 C  CZ  . PHE C 1 68  ? 47.026 -17.989 6.908   1.00 20.69  ? 87  PHE A CZ  1 
ATOM   2457 N  N   . LYS C 1 69  ? 43.451 -17.212 13.094  1.00 16.33  ? 88  LYS A N   1 
ATOM   2458 C  CA  . LYS C 1 69  ? 42.907 -17.134 14.459  1.00 16.30  ? 88  LYS A CA  1 
ATOM   2459 C  C   . LYS C 1 69  ? 43.993 -17.259 15.533  1.00 18.54  ? 88  LYS A C   1 
ATOM   2460 O  O   . LYS C 1 69  ? 44.039 -16.482 16.499  1.00 20.07  ? 88  LYS A O   1 
ATOM   2461 C  CB  . LYS C 1 69  ? 41.832 -18.209 14.666  1.00 17.13  ? 88  LYS A CB  1 
ATOM   2462 C  CG  . LYS C 1 69  ? 41.256 -18.277 16.097  1.00 15.75  ? 88  LYS A CG  1 
ATOM   2463 C  CD  . LYS C 1 69  ? 40.186 -19.374 16.177  1.00 21.68  ? 88  LYS A CD  1 
ATOM   2464 C  CE  . LYS C 1 69  ? 39.718 -19.615 17.600  1.00 20.86  ? 88  LYS A CE  1 
ATOM   2465 N  NZ  . LYS C 1 69  ? 38.960 -18.453 18.144  1.00 18.46  ? 88  LYS A NZ  1 
ATOM   2466 N  N   . ASP C 1 70  ? 44.860 -18.244 15.359  1.00 13.98  ? 89  ASP A N   1 
ATOM   2467 C  CA  . ASP C 1 70  ? 46.019 -18.442 16.235  1.00 17.31  ? 89  ASP A CA  1 
ATOM   2468 C  C   . ASP C 1 70  ? 45.661 -18.410 17.710  1.00 17.73  ? 89  ASP A C   1 
ATOM   2469 O  O   . ASP C 1 70  ? 46.350 -17.776 18.517  1.00 16.61  ? 89  ASP A O   1 
ATOM   2470 C  CB  . ASP C 1 70  ? 47.116 -17.401 15.936  1.00 21.64  ? 89  ASP A CB  1 
ATOM   2471 C  CG  . ASP C 1 70  ? 48.432 -17.724 16.624  1.00 24.31  ? 89  ASP A CG  1 
ATOM   2472 O  OD1 . ASP C 1 70  ? 48.746 -18.921 16.768  1.00 23.91  ? 89  ASP A OD1 1 
ATOM   2473 O  OD2 . ASP C 1 70  ? 49.145 -16.786 17.041  1.00 26.75  ? 89  ASP A OD2 1 
ATOM   2474 N  N   . GLU C 1 71  ? 44.581 -19.091 18.076  1.00 21.90  ? 90  GLU A N   1 
ATOM   2475 C  CA  . GLU C 1 71  ? 44.250 -19.231 19.487  1.00 15.93  ? 90  GLU A CA  1 
ATOM   2476 C  C   . GLU C 1 71  ? 45.391 -19.947 20.223  1.00 20.51  ? 90  GLU A C   1 
ATOM   2477 O  O   . GLU C 1 71  ? 45.542 -19.827 21.442  1.00 19.67  ? 90  GLU A O   1 
ATOM   2478 C  CB  . GLU C 1 71  ? 42.913 -19.970 19.651  1.00 15.13  ? 90  GLU A CB  1 
ATOM   2479 C  CG  . GLU C 1 71  ? 42.973 -21.487 19.444  1.00 15.87  ? 90  GLU A CG  1 
ATOM   2480 C  CD  . GLU C 1 71  ? 42.928 -21.918 17.989  1.00 18.65  ? 90  GLU A CD  1 
ATOM   2481 O  OE1 . GLU C 1 71  ? 42.840 -21.040 17.100  1.00 17.29  ? 90  GLU A OE1 1 
ATOM   2482 O  OE2 . GLU C 1 71  ? 42.966 -23.146 17.743  1.00 16.96  ? 90  GLU A OE2 1 
ATOM   2483 N  N   . GLU C 1 72  ? 46.212 -20.684 19.474  1.00 15.59  ? 91  GLU A N   1 
ATOM   2484 C  CA  . GLU C 1 72  ? 47.352 -21.389 20.055  1.00 16.38  ? 91  GLU A CA  1 
ATOM   2485 C  C   . GLU C 1 72  ? 48.464 -20.438 20.476  1.00 22.42  ? 91  GLU A C   1 
ATOM   2486 O  O   . GLU C 1 72  ? 49.348 -20.811 21.258  1.00 24.61  ? 91  GLU A O   1 
ATOM   2487 C  CB  . GLU C 1 72  ? 47.927 -22.396 19.057  1.00 18.44  ? 91  GLU A CB  1 
ATOM   2488 C  CG  . GLU C 1 72  ? 46.907 -23.413 18.550  1.00 19.45  ? 91  GLU A CG  1 
ATOM   2489 C  CD  . GLU C 1 72  ? 46.159 -22.949 17.308  1.00 18.74  ? 91  GLU A CD  1 
ATOM   2490 O  OE1 . GLU C 1 72  ? 45.964 -21.733 17.076  1.00 16.46  ? 91  GLU A OE1 1 
ATOM   2491 O  OE2 . GLU C 1 72  ? 45.750 -23.827 16.545  1.00 15.29  ? 91  GLU A OE2 1 
ATOM   2492 N  N   . ASN C 1 73  ? 48.420 -19.214 19.952  1.00 19.82  ? 92  ASN A N   1 
ATOM   2493 C  CA  . ASN C 1 73  ? 49.508 -18.261 20.159  1.00 25.64  ? 92  ASN A CA  1 
ATOM   2494 C  C   . ASN C 1 73  ? 50.862 -18.885 19.822  1.00 26.46  ? 92  ASN A C   1 
ATOM   2495 O  O   . ASN C 1 73  ? 51.807 -18.808 20.609  1.00 21.19  ? 92  ASN A O   1 
ATOM   2496 C  CB  . ASN C 1 73  ? 49.482 -17.748 21.596  1.00 30.14  ? 92  ASN A CB  1 
ATOM   2497 C  CG  . ASN C 1 73  ? 48.303 -16.835 21.857  1.00 41.08  ? 92  ASN A CG  1 
ATOM   2498 O  OD1 . ASN C 1 73  ? 48.097 -15.859 21.140  1.00 42.86  ? 92  ASN A OD1 1 
ATOM   2499 N  ND2 . ASN C 1 73  ? 47.520 -17.147 22.886  1.00 41.42  ? 92  ASN A ND2 1 
ATOM   2500 N  N   . SER C 1 74  ? 50.940 -19.503 18.646  1.00 21.04  ? 93  SER A N   1 
ATOM   2501 C  CA  . SER C 1 74  ? 52.121 -20.251 18.237  1.00 22.48  ? 93  SER A CA  1 
ATOM   2502 C  C   . SER C 1 74  ? 52.407 -20.093 16.753  1.00 24.30  ? 93  SER A C   1 
ATOM   2503 O  O   . SER C 1 74  ? 53.469 -20.499 16.268  1.00 24.64  ? 93  SER A O   1 
ATOM   2504 C  CB  . SER C 1 74  ? 51.907 -21.731 18.504  1.00 24.43  ? 93  SER A CB  1 
ATOM   2505 O  OG  . SER C 1 74  ? 51.010 -22.260 17.544  1.00 23.91  ? 93  SER A OG  1 
ATOM   2506 N  N   . GLY C 1 75  ? 51.438 -19.544 16.030  1.00 21.34  ? 94  GLY A N   1 
ATOM   2507 C  CA  . GLY C 1 75  ? 51.555 -19.404 14.595  1.00 24.00  ? 94  GLY A CA  1 
ATOM   2508 C  C   . GLY C 1 75  ? 51.355 -20.697 13.819  1.00 23.66  ? 94  GLY A C   1 
ATOM   2509 O  O   . GLY C 1 75  ? 51.561 -20.720 12.610  1.00 18.77  ? 94  GLY A O   1 
ATOM   2510 N  N   . ALA C 1 76  ? 50.951 -21.775 14.494  1.00 16.75  ? 95  ALA A N   1 
ATOM   2511 C  CA  . ALA C 1 76  ? 50.689 -23.033 13.784  1.00 18.64  ? 95  ALA A CA  1 
ATOM   2512 C  C   . ALA C 1 76  ? 49.675 -22.878 12.637  1.00 20.83  ? 95  ALA A C   1 
ATOM   2513 O  O   . ALA C 1 76  ? 49.846 -23.456 11.571  1.00 18.93  ? 95  ALA A O   1 
ATOM   2514 C  CB  . ALA C 1 76  ? 50.240 -24.126 14.757  1.00 19.60  ? 95  ALA A CB  1 
ATOM   2515 N  N   . ASP C 1 77  ? 48.621 -22.098 12.844  1.00 17.09  ? 96  ASP A N   1 
ATOM   2516 C  CA  . ASP C 1 77  ? 47.586 -21.975 11.809  1.00 16.23  ? 96  ASP A CA  1 
ATOM   2517 C  C   . ASP C 1 77  ? 48.108 -21.487 10.452  1.00 24.09  ? 96  ASP A C   1 
ATOM   2518 O  O   . ASP C 1 77  ? 47.512 -21.806 9.416   1.00 17.39  ? 96  ASP A O   1 
ATOM   2519 C  CB  . ASP C 1 77  ? 46.472 -21.035 12.264  1.00 13.44  ? 96  ASP A CB  1 
ATOM   2520 C  CG  . ASP C 1 77  ? 45.596 -21.631 13.379  1.00 18.53  ? 96  ASP A CG  1 
ATOM   2521 O  OD1 . ASP C 1 77  ? 45.495 -22.863 13.487  1.00 18.22  ? 96  ASP A OD1 1 
ATOM   2522 O  OD2 . ASP C 1 77  ? 45.012 -20.846 14.160  1.00 17.11  ? 96  ASP A OD2 1 
ATOM   2523 N  N   . ARG C 1 78  ? 49.191 -20.701 10.452  1.00 21.15  ? 97  ARG A N   1 
ATOM   2524 C  CA  . ARG C 1 78  ? 49.774 -20.171 9.204   1.00 18.37  ? 97  ARG A CA  1 
ATOM   2525 C  C   . ARG C 1 78  ? 50.522 -21.232 8.412   1.00 19.80  ? 97  ARG A C   1 
ATOM   2526 O  O   . ARG C 1 78  ? 50.777 -21.071 7.210   1.00 16.54  ? 97  ARG A O   1 
ATOM   2527 C  CB  . ARG C 1 78  ? 50.777 -19.050 9.494   1.00 16.54  ? 97  ARG A CB  1 
ATOM   2528 C  CG  . ARG C 1 78  ? 50.231 -17.815 10.156  1.00 21.86  ? 97  ARG A CG  1 
ATOM   2529 C  CD  . ARG C 1 78  ? 51.314 -16.728 10.204  1.00 22.31  ? 97  ARG A CD  1 
ATOM   2530 N  NE  . ARG C 1 78  ? 50.793 -15.516 10.820  1.00 26.67  ? 97  ARG A NE  1 
ATOM   2531 C  CZ  . ARG C 1 78  ? 50.121 -14.584 10.158  1.00 28.07  ? 97  ARG A CZ  1 
ATOM   2532 N  NH1 . ARG C 1 78  ? 49.912 -14.722 8.857   1.00 18.66  ? 97  ARG A NH1 1 
ATOM   2533 N  NH2 . ARG C 1 78  ? 49.665 -13.511 10.789  1.00 30.18  ? 97  ARG A NH2 1 
ATOM   2534 N  N   . LEU C 1 79  ? 50.913 -22.303 9.088   1.00 17.06  ? 98  LEU A N   1 
ATOM   2535 C  CA  . LEU C 1 79  ? 51.788 -23.298 8.465   1.00 20.47  ? 98  LEU A CA  1 
ATOM   2536 C  C   . LEU C 1 79  ? 51.013 -24.256 7.553   1.00 19.75  ? 98  LEU A C   1 
ATOM   2537 O  O   . LEU C 1 79  ? 50.011 -24.851 7.956   1.00 23.34  ? 98  LEU A O   1 
ATOM   2538 C  CB  . LEU C 1 79  ? 52.565 -24.074 9.530   1.00 20.23  ? 98  LEU A CB  1 
ATOM   2539 C  CG  . LEU C 1 79  ? 53.696 -23.347 10.248  1.00 25.70  ? 98  LEU A CG  1 
ATOM   2540 C  CD1 . LEU C 1 79  ? 54.289 -24.270 11.297  1.00 29.69  ? 98  LEU A CD1 1 
ATOM   2541 C  CD2 . LEU C 1 79  ? 54.772 -22.918 9.265   1.00 32.78  ? 98  LEU A CD2 1 
ATOM   2542 N  N   . MET C 1 80  ? 51.487 -24.395 6.321   1.00 21.66  ? 99  MET A N   1 
ATOM   2543 C  CA  . MET C 1 80  ? 50.770 -25.160 5.315   1.00 24.43  ? 99  MET A CA  1 
ATOM   2544 C  C   . MET C 1 80  ? 51.695 -25.534 4.166   1.00 20.74  ? 99  MET A C   1 
ATOM   2545 O  O   . MET C 1 80  ? 52.817 -25.028 4.060   1.00 20.86  ? 99  MET A O   1 
ATOM   2546 C  CB  . MET C 1 80  ? 49.571 -24.356 4.792   1.00 20.78  ? 99  MET A CB  1 
ATOM   2547 C  CG  . MET C 1 80  ? 49.936 -23.024 4.139   1.00 19.26  ? 99  MET A CG  1 
ATOM   2548 S  SD  . MET C 1 80  ? 48.491 -22.021 3.707   1.00 20.19  ? 99  MET A SD  1 
ATOM   2549 C  CE  . MET C 1 80  ? 47.901 -21.587 5.346   1.00 18.12  ? 99  MET A CE  1 
ATOM   2550 N  N   . THR C 1 81  ? 51.229 -26.389 3.285   1.00 21.03  ? 100 THR A N   1 
ATOM   2551 C  CA  . THR C 1 81  ? 52.018 -26.853 2.166   1.00 21.74  ? 100 THR A CA  1 
ATOM   2552 C  C   . THR C 1 81  ? 51.994 -25.802 1.085   1.00 20.25  ? 100 THR A C   1 
ATOM   2553 O  O   . THR C 1 81  ? 51.230 -24.899 1.137   1.00 18.55  ? 100 THR A O   1 
ATOM   2554 C  CB  . THR C 1 81  ? 51.421 -28.135 1.556   1.00 20.00  ? 100 THR A CB  1 
ATOM   2555 O  OG1 . THR C 1 81  ? 50.102 -27.866 1.155   1.00 20.00  ? 100 THR A OG1 1 
ATOM   2556 C  CG2 . THR C 1 81  ? 51.422 -29.275 2.524   1.00 20.00  ? 100 THR A CG2 1 
ATOM   2557 N  N   . GLU C 1 82  ? 52.823 -25.982 0.081   1.00 18.90  ? 101 GLU A N   1 
ATOM   2558 C  CA  . GLU C 1 82  ? 52.916 -25.018 -1.000  1.00 29.97  ? 101 GLU A CA  1 
ATOM   2559 C  C   . GLU C 1 82  ? 51.590 -24.980 -1.746  1.00 28.33  ? 101 GLU A C   1 
ATOM   2560 O  O   . GLU C 1 82  ? 51.072 -23.918 -2.067  1.00 27.08  ? 101 GLU A O   1 
ATOM   2561 C  CB  . GLU C 1 82  ? 54.059 -25.388 -1.955  1.00 32.02  ? 101 GLU A CB  1 
ATOM   2562 C  CG  . GLU C 1 82  ? 54.416 -24.271 -2.896  1.00 45.79  ? 101 GLU A CG  1 
ATOM   2563 C  CD  . GLU C 1 82  ? 54.671 -22.968 -2.161  1.00 53.70  ? 101 GLU A CD  1 
ATOM   2564 O  OE1 . GLU C 1 82  ? 55.448 -22.977 -1.179  1.00 47.76  ? 101 GLU A OE1 1 
ATOM   2565 O  OE2 . GLU C 1 82  ? 54.090 -21.937 -2.563  1.00 63.96  ? 101 GLU A OE2 1 
ATOM   2566 N  N   . ARG C 1 83  ? 51.036 -26.149 -2.015  1.00 23.61  ? 102 ARG A N   1 
ATOM   2567 C  CA  . ARG C 1 83  ? 49.774 -26.214 -2.737  1.00 21.49  ? 102 ARG A CA  1 
ATOM   2568 C  C   . ARG C 1 83  ? 48.646 -25.571 -1.922  1.00 22.68  ? 102 ARG A C   1 
ATOM   2569 O  O   . ARG C 1 83  ? 47.788 -24.872 -2.475  1.00 22.59  ? 102 ARG A O   1 
ATOM   2570 C  CB  . ARG C 1 83  ? 49.427 -27.662 -3.096  1.00 24.98  ? 102 ARG A CB  1 
ATOM   2571 C  CG  . ARG C 1 83  ? 48.241 -27.781 -4.045  1.00 25.45  ? 102 ARG A CG  1 
ATOM   2572 C  CD  . ARG C 1 83  ? 47.892 -29.244 -4.322  1.00 31.26  ? 102 ARG A CD  1 
ATOM   2573 N  NE  . ARG C 1 83  ? 46.696 -29.358 -5.158  1.00 38.28  ? 102 ARG A NE  1 
ATOM   2574 C  CZ  . ARG C 1 83  ? 46.716 -29.646 -6.456  1.00 47.71  ? 102 ARG A CZ  1 
ATOM   2575 N  NH1 . ARG C 1 83  ? 47.877 -29.856 -7.066  1.00 50.90  ? 102 ARG A NH1 1 
ATOM   2576 N  NH2 . ARG C 1 83  ? 45.581 -29.728 -7.147  1.00 45.65  ? 102 ARG A NH2 1 
ATOM   2577 N  N   . CYS C 1 84  ? 48.652 -25.803 -0.611  1.00 19.47  ? 103 CYS A N   1 
ATOM   2578 C  CA  . CYS C 1 84  ? 47.644 -25.203 0.251   1.00 19.25  ? 103 CYS A CA  1 
ATOM   2579 C  C   . CYS C 1 84  ? 47.795 -23.686 0.233   1.00 22.71  ? 103 CYS A C   1 
ATOM   2580 O  O   . CYS C 1 84  ? 46.810 -22.943 0.155   1.00 23.53  ? 103 CYS A O   1 
ATOM   2581 C  CB  . CYS C 1 84  ? 47.750 -25.738 1.678   1.00 19.10  ? 103 CYS A CB  1 
ATOM   2582 S  SG  . CYS C 1 84  ? 46.338 -25.267 2.723   1.00 21.18  ? 103 CYS A SG  1 
ATOM   2583 N  N   . LYS C 1 85  ? 49.042 -23.232 0.296   1.00 24.12  ? 104 LYS A N   1 
ATOM   2584 C  CA  . LYS C 1 85  ? 49.338 -21.812 0.213   1.00 20.76  ? 104 LYS A CA  1 
ATOM   2585 C  C   . LYS C 1 85  ? 48.798 -21.180 -1.070  1.00 21.50  ? 104 LYS A C   1 
ATOM   2586 O  O   . LYS C 1 85  ? 48.144 -20.128 -1.036  1.00 21.43  ? 104 LYS A O   1 
ATOM   2587 C  CB  . LYS C 1 85  ? 50.847 -21.596 0.315   1.00 26.43  ? 104 LYS A CB  1 
ATOM   2588 C  CG  . LYS C 1 85  ? 51.279 -20.141 0.300   1.00 27.28  ? 104 LYS A CG  1 
ATOM   2589 C  CD  . LYS C 1 85  ? 52.799 -20.022 0.468   1.00 29.34  ? 104 LYS A CD  1 
ATOM   2590 C  CE  . LYS C 1 85  ? 53.281 -18.616 0.140   1.00 44.58  ? 104 LYS A CE  1 
ATOM   2591 N  NZ  . LYS C 1 85  ? 54.730 -18.445 0.450   1.00 53.12  ? 104 LYS A NZ  1 
ATOM   2592 N  N   . GLU C 1 86  ? 49.090 -21.805 -2.205  1.00 19.39  ? 105 GLU A N   1 
ATOM   2593 C  CA  . GLU C 1 86  ? 48.625 -21.283 -3.479  1.00 20.27  ? 105 GLU A CA  1 
ATOM   2594 C  C   . GLU C 1 86  ? 47.114 -21.147 -3.535  1.00 18.88  ? 105 GLU A C   1 
ATOM   2595 O  O   . GLU C 1 86  ? 46.596 -20.107 -3.945  1.00 19.43  ? 105 GLU A O   1 
ATOM   2596 C  CB  . GLU C 1 86  ? 49.103 -22.158 -4.633  1.00 24.12  ? 105 GLU A CB  1 
ATOM   2597 C  CG  . GLU C 1 86  ? 50.605 -22.146 -4.793  1.00 37.93  ? 105 GLU A CG  1 
ATOM   2598 C  CD  . GLU C 1 86  ? 51.065 -23.030 -5.933  1.00 56.93  ? 105 GLU A CD  1 
ATOM   2599 O  OE1 . GLU C 1 86  ? 50.226 -23.359 -6.811  1.00 58.87  ? 105 GLU A OE1 1 
ATOM   2600 O  OE2 . GLU C 1 86  ? 52.265 -23.394 -5.946  1.00 61.41  ? 105 GLU A OE2 1 
ATOM   2601 N  N   . ARG C 1 87  ? 46.411 -22.207 -3.154  1.00 21.26  ? 106 ARG A N   1 
ATOM   2602 C  CA  . ARG C 1 87  ? 44.956 -22.230 -3.253  1.00 17.38  ? 106 ARG A CA  1 
ATOM   2603 C  C   . ARG C 1 87  ? 44.319 -21.264 -2.252  1.00 16.70  ? 106 ARG A C   1 
ATOM   2604 O  O   . ARG C 1 87  ? 43.381 -20.546 -2.590  1.00 16.18  ? 106 ARG A O   1 
ATOM   2605 C  CB  . ARG C 1 87  ? 44.425 -23.637 -3.015  1.00 22.35  ? 106 ARG A CB  1 
ATOM   2606 C  CG  . ARG C 1 87  ? 44.939 -24.685 -4.008  1.00 30.15  ? 106 ARG A CG  1 
ATOM   2607 C  CD  . ARG C 1 87  ? 44.855 -24.202 -5.438  1.00 38.86  ? 106 ARG A CD  1 
ATOM   2608 N  NE  . ARG C 1 87  ? 44.919 -25.324 -6.373  1.00 53.51  ? 106 ARG A NE  1 
ATOM   2609 C  CZ  . ARG C 1 87  ? 46.045 -25.922 -6.760  1.00 55.84  ? 106 ARG A CZ  1 
ATOM   2610 N  NH1 . ARG C 1 87  ? 47.217 -25.505 -6.298  1.00 59.24  ? 106 ARG A NH1 1 
ATOM   2611 N  NH2 . ARG C 1 87  ? 45.996 -26.937 -7.614  1.00 52.65  ? 106 ARG A NH2 1 
ATOM   2612 N  N   . VAL C 1 88  ? 44.802 -21.251 -1.015  1.00 15.57  ? 107 VAL A N   1 
ATOM   2613 C  CA  . VAL C 1 88  ? 44.203 -20.317 -0.053  1.00 16.43  ? 107 VAL A CA  1 
ATOM   2614 C  C   . VAL C 1 88  ? 44.410 -18.857 -0.459  1.00 17.03  ? 107 VAL A C   1 
ATOM   2615 O  O   . VAL C 1 88  ? 43.530 -18.024 -0.243  1.00 16.50  ? 107 VAL A O   1 
ATOM   2616 C  CB  . VAL C 1 88  ? 44.663 -20.527 1.398   1.00 16.03  ? 107 VAL A CB  1 
ATOM   2617 C  CG1 . VAL C 1 88  ? 46.016 -19.845 1.650   1.00 17.59  ? 107 VAL A CG1 1 
ATOM   2618 C  CG2 . VAL C 1 88  ? 43.615 -19.964 2.337   1.00 12.05  ? 107 VAL A CG2 1 
ATOM   2619 N  N   . ASN C 1 89  ? 45.560 -18.556 -1.065  1.00 17.93  ? 108 ASN A N   1 
ATOM   2620 C  CA  . ASN C 1 89  ? 45.831 -17.190 -1.503  1.00 20.43  ? 108 ASN A CA  1 
ATOM   2621 C  C   . ASN C 1 89  ? 44.882 -16.773 -2.627  1.00 20.87  ? 108 ASN A C   1 
ATOM   2622 O  O   . ASN C 1 89  ? 44.432 -15.637 -2.689  1.00 16.75  ? 108 ASN A O   1 
ATOM   2623 C  CB  . ASN C 1 89  ? 47.298 -17.015 -1.900  1.00 26.56  ? 108 ASN A CB  1 
ATOM   2624 C  CG  . ASN C 1 89  ? 48.221 -16.948 -0.691  1.00 24.07  ? 108 ASN A CG  1 
ATOM   2625 O  OD1 . ASN C 1 89  ? 47.765 -16.806 0.435   1.00 19.90  ? 108 ASN A OD1 1 
ATOM   2626 N  ND2 . ASN C 1 89  ? 49.522 -17.040 -0.925  1.00 23.01  ? 108 ASN A ND2 1 
ATOM   2627 N  N   . ALA C 1 90  ? 44.557 -17.707 -3.503  1.00 21.04  ? 109 ALA A N   1 
ATOM   2628 C  CA  . ALA C 1 90  ? 43.535 -17.450 -4.516  1.00 24.01  ? 109 ALA A CA  1 
ATOM   2629 C  C   . ALA C 1 90  ? 42.149 -17.251 -3.884  1.00 19.14  ? 109 ALA A C   1 
ATOM   2630 O  O   . ALA C 1 90  ? 41.392 -16.361 -4.277  1.00 19.99  ? 109 ALA A O   1 
ATOM   2631 C  CB  . ALA C 1 90  ? 43.507 -18.588 -5.535  1.00 21.55  ? 109 ALA A CB  1 
ATOM   2632 N  N   . LEU C 1 91  ? 41.812 -18.079 -2.903  1.00 19.82  ? 110 LEU A N   1 
ATOM   2633 C  CA  . LEU C 1 91  ? 40.528 -17.922 -2.223  1.00 21.22  ? 110 LEU A CA  1 
ATOM   2634 C  C   . LEU C 1 91  ? 40.448 -16.560 -1.525  1.00 20.08  ? 110 LEU A C   1 
ATOM   2635 O  O   . LEU C 1 91  ? 39.397 -15.918 -1.509  1.00 21.70  ? 110 LEU A O   1 
ATOM   2636 C  CB  . LEU C 1 91  ? 40.313 -19.056 -1.210  1.00 17.60  ? 110 LEU A CB  1 
ATOM   2637 C  CG  . LEU C 1 91  ? 39.056 -18.991 -0.337  1.00 14.77  ? 110 LEU A CG  1 
ATOM   2638 C  CD1 . LEU C 1 91  ? 37.805 -18.971 -1.194  1.00 15.21  ? 110 LEU A CD1 1 
ATOM   2639 C  CD2 . LEU C 1 91  ? 39.037 -20.205 0.602   1.00 17.84  ? 110 LEU A CD2 1 
ATOM   2640 N  N   . ALA C 1 92  ? 41.566 -16.116 -0.960  1.00 12.89  ? 111 ALA A N   1 
ATOM   2641 C  CA  . ALA C 1 92  ? 41.583 -14.848 -0.228  1.00 14.80  ? 111 ALA A CA  1 
ATOM   2642 C  C   . ALA C 1 92  ? 41.166 -13.710 -1.147  1.00 15.90  ? 111 ALA A C   1 
ATOM   2643 O  O   . ALA C 1 92  ? 40.419 -12.802 -0.759  1.00 18.54  ? 111 ALA A O   1 
ATOM   2644 C  CB  . ALA C 1 92  ? 42.974 -14.574 0.352   1.00 17.80  ? 111 ALA A CB  1 
ATOM   2645 N  N   . ILE C 1 93  ? 41.672 -13.747 -2.372  1.00 13.25  ? 112 ILE A N   1 
ATOM   2646 C  CA  . ILE C 1 93  ? 41.314 -12.734 -3.367  1.00 20.04  ? 112 ILE A CA  1 
ATOM   2647 C  C   . ILE C 1 93  ? 39.821 -12.805 -3.722  1.00 22.52  ? 112 ILE A C   1 
ATOM   2648 O  O   . ILE C 1 93  ? 39.146 -11.782 -3.816  1.00 21.99  ? 112 ILE A O   1 
ATOM   2649 C  CB  . ILE C 1 93  ? 42.191 -12.881 -4.630  1.00 18.49  ? 112 ILE A CB  1 
ATOM   2650 C  CG1 . ILE C 1 93  ? 43.632 -12.468 -4.305  1.00 20.42  ? 112 ILE A CG1 1 
ATOM   2651 C  CG2 . ILE C 1 93  ? 41.612 -12.076 -5.792  1.00 24.09  ? 112 ILE A CG2 1 
ATOM   2652 C  CD1 . ILE C 1 93  ? 44.689 -13.050 -5.268  1.00 22.90  ? 112 ILE A CD1 1 
ATOM   2653 N  N   . ALA C 1 94  ? 39.310 -14.017 -3.911  1.00 17.37  ? 113 ALA A N   1 
ATOM   2654 C  CA  . ALA C 1 94  ? 37.914 -14.216 -4.265  1.00 20.23  ? 113 ALA A CA  1 
ATOM   2655 C  C   . ALA C 1 94  ? 36.965 -13.692 -3.193  1.00 15.57  ? 113 ALA A C   1 
ATOM   2656 O  O   . ALA C 1 94  ? 35.930 -13.101 -3.494  1.00 14.05  ? 113 ALA A O   1 
ATOM   2657 C  CB  . ALA C 1 94  ? 37.639 -15.693 -4.512  1.00 19.78  ? 113 ALA A CB  1 
ATOM   2658 N  N   . VAL C 1 95  ? 37.300 -13.937 -1.937  1.00 17.18  ? 114 VAL A N   1 
ATOM   2659 C  CA  . VAL C 1 95  ? 36.455 -13.492 -0.845  1.00 13.44  ? 114 VAL A CA  1 
ATOM   2660 C  C   . VAL C 1 95  ? 36.347 -11.963 -0.791  1.00 18.02  ? 114 VAL A C   1 
ATOM   2661 O  O   . VAL C 1 95  ? 35.251 -11.410 -0.658  1.00 22.84  ? 114 VAL A O   1 
ATOM   2662 C  CB  . VAL C 1 95  ? 36.998 -14.018 0.492   1.00 12.98  ? 114 VAL A CB  1 
ATOM   2663 C  CG1 . VAL C 1 95  ? 36.299 -13.337 1.652   1.00 18.26  ? 114 VAL A CG1 1 
ATOM   2664 C  CG2 . VAL C 1 95  ? 36.830 -15.535 0.573   1.00 14.27  ? 114 VAL A CG2 1 
ATOM   2665 N  N   . MET C 1 96  ? 37.489 -11.282 -0.884  1.00 18.54  ? 115 MET A N   1 
ATOM   2666 C  CA  . MET C 1 96  ? 37.494 -9.830  -0.841  1.00 16.24  ? 115 MET A CA  1 
ATOM   2667 C  C   . MET C 1 96  ? 36.760 -9.246  -2.037  1.00 19.37  ? 115 MET A C   1 
ATOM   2668 O  O   . MET C 1 96  ? 36.089 -8.231  -1.918  1.00 24.16  ? 115 MET A O   1 
ATOM   2669 C  CB  . MET C 1 96  ? 38.921 -9.307  -0.798  1.00 21.28  ? 115 MET A CB  1 
ATOM   2670 C  CG  . MET C 1 96  ? 39.704 -9.810  0.389   1.00 20.89  ? 115 MET A CG  1 
ATOM   2671 S  SD  . MET C 1 96  ? 41.360 -9.104  0.424   1.00 29.75  ? 115 MET A SD  1 
ATOM   2672 C  CE  . MET C 1 96  ? 40.980 -7.483  1.095   1.00 41.21  ? 115 MET A CE  1 
ATOM   2673 N  N   . ASN C 1 97  ? 36.887 -9.890  -3.187  1.00 17.65  ? 116 ASN A N   1 
ATOM   2674 C  CA  . ASN C 1 97  ? 36.152 -9.482  -4.370  1.00 20.50  ? 116 ASN A CA  1 
ATOM   2675 C  C   . ASN C 1 97  ? 34.638 -9.690  -4.216  1.00 19.82  ? 116 ASN A C   1 
ATOM   2676 O  O   . ASN C 1 97  ? 33.835 -8.865  -4.644  1.00 23.63  ? 116 ASN A O   1 
ATOM   2677 C  CB  . ASN C 1 97  ? 36.673 -10.243 -5.598  1.00 25.62  ? 116 ASN A CB  1 
ATOM   2678 C  CG  . ASN C 1 97  ? 37.983 -9.678  -6.116  1.00 32.72  ? 116 ASN A CG  1 
ATOM   2679 O  OD1 . ASN C 1 97  ? 38.360 -8.561  -5.771  1.00 37.09  ? 116 ASN A OD1 1 
ATOM   2680 N  ND2 . ASN C 1 97  ? 38.680 -10.447 -6.949  1.00 36.84  ? 116 ASN A ND2 1 
ATOM   2681 N  N   . MET C 1 98  ? 34.252 -10.797 -3.599  1.00 18.23  ? 117 MET A N   1 
ATOM   2682 C  CA  . MET C 1 98  ? 32.838 -11.118 -3.465  1.00 14.54  ? 117 MET A CA  1 
ATOM   2683 C  C   . MET C 1 98  ? 32.153 -10.165 -2.492  1.00 23.23  ? 117 MET A C   1 
ATOM   2684 O  O   . MET C 1 98  ? 31.061 -9.676  -2.766  1.00 23.95  ? 117 MET A O   1 
ATOM   2685 C  CB  . MET C 1 98  ? 32.666 -12.564 -3.007  1.00 15.98  ? 117 MET A CB  1 
ATOM   2686 C  CG  . MET C 1 98  ? 31.210 -13.002 -2.802  1.00 21.14  ? 117 MET A CG  1 
ATOM   2687 S  SD  . MET C 1 98  ? 30.211 -12.865 -4.295  1.00 27.94  ? 117 MET A SD  1 
ATOM   2688 C  CE  . MET C 1 98  ? 30.927 -14.135 -5.335  1.00 43.41  ? 117 MET A CE  1 
ATOM   2689 N  N   . TRP C 1 99  ? 32.808 -9.916  -1.359  1.00 17.09  ? 118 TRP A N   1 
ATOM   2690 C  CA  . TRP C 1 99  ? 32.251 -9.139  -0.258  1.00 20.67  ? 118 TRP A CA  1 
ATOM   2691 C  C   . TRP C 1 99  ? 33.266 -8.092  0.204   1.00 21.31  ? 118 TRP A C   1 
ATOM   2692 O  O   . TRP C 1 99  ? 34.028 -8.331  1.142   1.00 19.17  ? 118 TRP A O   1 
ATOM   2693 C  CB  . TRP C 1 99  ? 31.963 -10.055 0.931   1.00 15.31  ? 118 TRP A CB  1 
ATOM   2694 C  CG  . TRP C 1 99  ? 31.015 -11.208 0.683   1.00 18.78  ? 118 TRP A CG  1 
ATOM   2695 C  CD1 . TRP C 1 99  ? 29.670 -11.135 0.455   1.00 24.81  ? 118 TRP A CD1 1 
ATOM   2696 C  CD2 . TRP C 1 99  ? 31.342 -12.598 0.708   1.00 14.88  ? 118 TRP A CD2 1 
ATOM   2697 N  NE1 . TRP C 1 99  ? 29.144 -12.399 0.313   1.00 21.13  ? 118 TRP A NE1 1 
ATOM   2698 C  CE2 . TRP C 1 99  ? 30.150 -13.313 0.474   1.00 16.96  ? 118 TRP A CE2 1 
ATOM   2699 C  CE3 . TRP C 1 99  ? 32.531 -13.310 0.901   1.00 19.72  ? 118 TRP A CE3 1 
ATOM   2700 C  CZ2 . TRP C 1 99  ? 30.115 -14.702 0.413   1.00 19.89  ? 118 TRP A CZ2 1 
ATOM   2701 C  CZ3 . TRP C 1 99  ? 32.495 -14.693 0.848   1.00 23.74  ? 118 TRP A CZ3 1 
ATOM   2702 C  CH2 . TRP C 1 99  ? 31.291 -15.376 0.607   1.00 21.29  ? 118 TRP A CH2 1 
ATOM   2703 N  N   . PRO C 1 100 ? 33.297 -6.925  -0.450  1.00 18.52  ? 119 PRO A N   1 
ATOM   2704 C  CA  . PRO C 1 100 ? 34.298 -5.931  -0.041  1.00 22.39  ? 119 PRO A CA  1 
ATOM   2705 C  C   . PRO C 1 100 ? 34.200 -5.557  1.454   1.00 23.26  ? 119 PRO A C   1 
ATOM   2706 O  O   . PRO C 1 100 ? 33.105 -5.353  1.972   1.00 23.38  ? 119 PRO A O   1 
ATOM   2707 C  CB  . PRO C 1 100 ? 33.978 -4.732  -0.944  1.00 27.99  ? 119 PRO A CB  1 
ATOM   2708 C  CG  . PRO C 1 100 ? 33.345 -5.339  -2.142  1.00 24.95  ? 119 PRO A CG  1 
ATOM   2709 C  CD  . PRO C 1 100 ? 32.535 -6.496  -1.638  1.00 23.46  ? 119 PRO A CD  1 
ATOM   2710 N  N   . GLY C 1 101 ? 35.336 -5.504  2.141   1.00 19.58  ? 120 GLY A N   1 
ATOM   2711 C  CA  . GLY C 1 101 ? 35.345 -5.189  3.561   1.00 20.77  ? 120 GLY A CA  1 
ATOM   2712 C  C   . GLY C 1 101 ? 35.341 -6.453  4.413   1.00 22.03  ? 120 GLY A C   1 
ATOM   2713 O  O   . GLY C 1 101 ? 35.349 -6.390  5.651   1.00 22.38  ? 120 GLY A O   1 
ATOM   2714 N  N   . VAL C 1 102 ? 35.313 -7.600  3.737   1.00 20.96  ? 121 VAL A N   1 
ATOM   2715 C  CA  . VAL C 1 102 ? 35.335 -8.911  4.381   1.00 17.99  ? 121 VAL A CA  1 
ATOM   2716 C  C   . VAL C 1 102 ? 36.575 -9.648  3.895   1.00 21.04  ? 121 VAL A C   1 
ATOM   2717 O  O   . VAL C 1 102 ? 37.008 -9.451  2.748   1.00 20.38  ? 121 VAL A O   1 
ATOM   2718 C  CB  . VAL C 1 102 ? 34.084 -9.723  4.003   1.00 18.68  ? 121 VAL A CB  1 
ATOM   2719 C  CG1 . VAL C 1 102 ? 34.146 -11.118 4.598   1.00 14.29  ? 121 VAL A CG1 1 
ATOM   2720 C  CG2 . VAL C 1 102 ? 32.827 -8.993  4.443   1.00 23.78  ? 121 VAL A CG2 1 
ATOM   2721 N  N   . ARG C 1 103 ? 37.253 -10.430 4.814   1.00 16.90  ? 122 ARG A N   1 
ATOM   2722 C  CA  . ARG C 1 103 ? 38.354 -11.298 4.404   1.00 18.00  ? 122 ARG A CA  1 
ATOM   2723 C  C   . ARG C 1 103 ? 38.069 -12.740 4.799   1.00 18.32  ? 122 ARG A C   1 
ATOM   2724 O  O   . ARG C 1 103 ? 37.201 -12.990 5.641   1.00 17.36  ? 122 ARG A O   1 
ATOM   2725 C  CB  . ARG C 1 103 ? 39.652 -10.849 5.071   1.00 17.02  ? 122 ARG A CB  1 
ATOM   2726 C  CG  . ARG C 1 103 ? 40.147 -9.504  4.571   1.00 27.14  ? 122 ARG A CG  1 
ATOM   2727 C  CD  . ARG C 1 103 ? 41.343 -8.999  5.368   1.00 36.35  ? 122 ARG A CD  1 
ATOM   2728 N  NE  . ARG C 1 103 ? 41.020 -8.734  6.769   1.00 49.83  ? 122 ARG A NE  1 
ATOM   2729 C  CZ  . ARG C 1 103 ? 41.898 -8.286  7.666   1.00 56.49  ? 122 ARG A CZ  1 
ATOM   2730 N  NH1 . ARG C 1 103 ? 43.148 -8.033  7.302   1.00 66.11  ? 122 ARG A NH1 1 
ATOM   2731 N  NH2 . ARG C 1 103 ? 41.525 -8.073  8.921   1.00 49.71  ? 122 ARG A NH2 1 
ATOM   2732 N  N   . LEU C 1 104 ? 39.021 -13.568 4.234   1.00 13.68  ? 123 LEU A N   1 
ATOM   2733 C  CA  . LEU C 1 104 ? 39.085 -14.962 4.644   1.00 13.49  ? 123 LEU A CA  1 
ATOM   2734 C  C   . LEU C 1 104 ? 39.690 -15.048 6.040   1.00 15.00  ? 123 LEU A C   1 
ATOM   2735 O  O   . LEU C 1 104 ? 40.629 -14.313 6.355   1.00 19.58  ? 123 LEU A O   1 
ATOM   2736 C  CB  . LEU C 1 104 ? 39.970 -15.751 3.692   1.00 14.95  ? 123 LEU A CB  1 
ATOM   2737 C  CG  . LEU C 1 104 ? 40.110 -17.255 3.932   1.00 17.99  ? 123 LEU A CG  1 
ATOM   2738 C  CD1 . LEU C 1 104 ? 38.765 -17.962 3.800   1.00 13.86  ? 123 LEU A CD1 1 
ATOM   2739 C  CD2 . LEU C 1 104 ? 41.113 -17.848 2.951   1.00 15.85  ? 123 LEU A CD2 1 
ATOM   2740 N  N   . ARG C 1 105 ? 39.167 -15.963 6.854   1.00 13.28  ? 124 ARG A N   1 
ATOM   2741 C  CA  . ARG C 1 105 ? 39.694 -16.242 8.188   1.00 10.54  ? 124 ARG A CA  1 
ATOM   2742 C  C   . ARG C 1 105 ? 39.947 -17.746 8.351   1.00 18.45  ? 124 ARG A C   1 
ATOM   2743 O  O   . ARG C 1 105 ? 39.109 -18.564 7.973   1.00 17.18  ? 124 ARG A O   1 
ATOM   2744 C  CB  . ARG C 1 105 ? 38.695 -15.803 9.265   1.00 12.49  ? 124 ARG A CB  1 
ATOM   2745 C  CG  . ARG C 1 105 ? 39.051 -16.261 10.691  1.00 13.60  ? 124 ARG A CG  1 
ATOM   2746 C  CD  . ARG C 1 105 ? 38.280 -15.413 11.705  1.00 12.73  ? 124 ARG A CD  1 
ATOM   2747 N  NE  . ARG C 1 105 ? 38.279 -15.886 13.099  1.00 15.49  ? 124 ARG A NE  1 
ATOM   2748 C  CZ  . ARG C 1 105 ? 37.420 -16.775 13.587  1.00 16.32  ? 124 ARG A CZ  1 
ATOM   2749 N  NH1 . ARG C 1 105 ? 36.517 -17.336 12.782  1.00 14.13  ? 124 ARG A NH1 1 
ATOM   2750 N  NH2 . ARG C 1 105 ? 37.470 -17.125 14.874  1.00 14.84  ? 124 ARG A NH2 1 
ATOM   2751 N  N   . VAL C 1 106 ? 41.098 -18.094 8.917   1.00 13.34  ? 125 VAL A N   1 
ATOM   2752 C  CA  . VAL C 1 106 ? 41.464 -19.483 9.138   1.00 12.33  ? 125 VAL A CA  1 
ATOM   2753 C  C   . VAL C 1 106 ? 41.456 -19.731 10.644  1.00 11.84  ? 125 VAL A C   1 
ATOM   2754 O  O   . VAL C 1 106 ? 42.162 -19.059 11.384  1.00 15.77  ? 125 VAL A O   1 
ATOM   2755 C  CB  . VAL C 1 106 ? 42.869 -19.786 8.582   1.00 14.66  ? 125 VAL A CB  1 
ATOM   2756 C  CG1 . VAL C 1 106 ? 43.386 -21.138 9.121   1.00 15.25  ? 125 VAL A CG1 1 
ATOM   2757 C  CG2 . VAL C 1 106 ? 42.865 -19.775 7.061   1.00 12.25  ? 125 VAL A CG2 1 
ATOM   2758 N  N   . THR C 1 107 ? 40.630 -20.668 11.086  1.00 12.77  ? 126 THR A N   1 
ATOM   2759 C  CA  . THR C 1 107 ? 40.568 -21.010 12.506  1.00 12.96  ? 126 THR A CA  1 
ATOM   2760 C  C   . THR C 1 107 ? 41.556 -22.121 12.844  1.00 15.62  ? 126 THR A C   1 
ATOM   2761 O  O   . THR C 1 107 ? 42.045 -22.181 13.965  1.00 14.31  ? 126 THR A O   1 
ATOM   2762 C  CB  . THR C 1 107 ? 39.182 -21.487 12.892  1.00 15.60  ? 126 THR A CB  1 
ATOM   2763 O  OG1 . THR C 1 107 ? 38.824 -22.583 12.054  1.00 14.06  ? 126 THR A OG1 1 
ATOM   2764 C  CG2 . THR C 1 107 ? 38.173 -20.372 12.709  1.00 17.08  ? 126 THR A CG2 1 
ATOM   2765 N  N   . GLU C 1 108 ? 41.808 -23.013 11.889  1.00 13.77  ? 127 GLU A N   1 
ATOM   2766 C  CA  . GLU C 1 108 ? 42.693 -24.163 12.100  1.00 16.50  ? 127 GLU A CA  1 
ATOM   2767 C  C   . GLU C 1 108 ? 43.466 -24.417 10.821  1.00 21.09  ? 127 GLU A C   1 
ATOM   2768 O  O   . GLU C 1 108 ? 42.868 -24.609 9.767   1.00 19.92  ? 127 GLU A O   1 
ATOM   2769 C  CB  . GLU C 1 108 ? 41.889 -25.431 12.400  1.00 23.72  ? 127 GLU A CB  1 
ATOM   2770 C  CG  . GLU C 1 108 ? 41.674 -25.811 13.850  1.00 23.14  ? 127 GLU A CG  1 
ATOM   2771 C  CD  . GLU C 1 108 ? 42.953 -25.942 14.643  1.00 18.51  ? 127 GLU A CD  1 
ATOM   2772 O  OE1 . GLU C 1 108 ? 43.413 -27.073 14.932  1.00 21.18  ? 127 GLU A OE1 1 
ATOM   2773 O  OE2 . GLU C 1 108 ? 43.481 -24.893 15.018  1.00 18.64  ? 127 GLU A OE2 1 
ATOM   2774 N  N   . GLY C 1 109 ? 44.787 -24.433 10.906  1.00 23.02  ? 128 GLY A N   1 
ATOM   2775 C  CA  . GLY C 1 109 ? 45.583 -24.884 9.782   1.00 19.63  ? 128 GLY A CA  1 
ATOM   2776 C  C   . GLY C 1 109 ? 46.294 -26.162 10.160  1.00 19.25  ? 128 GLY A C   1 
ATOM   2777 O  O   . GLY C 1 109 ? 45.660 -27.162 10.529  1.00 16.60  ? 128 GLY A O   1 
ATOM   2778 N  N   . TRP C 1 110 ? 47.622 -26.130 10.085  1.00 17.07  ? 129 TRP A N   1 
ATOM   2779 C  CA  . TRP C 1 110 ? 48.416 -27.251 10.561  1.00 15.47  ? 129 TRP A CA  1 
ATOM   2780 C  C   . TRP C 1 110 ? 48.257 -27.351 12.082  1.00 17.14  ? 129 TRP A C   1 
ATOM   2781 O  O   . TRP C 1 110 ? 48.280 -26.335 12.769  1.00 16.88  ? 129 TRP A O   1 
ATOM   2782 C  CB  . TRP C 1 110 ? 49.898 -27.083 10.175  1.00 15.82  ? 129 TRP A CB  1 
ATOM   2783 C  CG  . TRP C 1 110 ? 50.766 -28.083 10.855  1.00 15.87  ? 129 TRP A CG  1 
ATOM   2784 C  CD1 . TRP C 1 110 ? 50.950 -29.386 10.498  1.00 21.99  ? 129 TRP A CD1 1 
ATOM   2785 C  CD2 . TRP C 1 110 ? 51.545 -27.879 12.045  1.00 17.78  ? 129 TRP A CD2 1 
ATOM   2786 N  NE1 . TRP C 1 110 ? 51.809 -30.003 11.378  1.00 22.73  ? 129 TRP A NE1 1 
ATOM   2787 C  CE2 . TRP C 1 110 ? 52.183 -29.101 12.340  1.00 19.09  ? 129 TRP A CE2 1 
ATOM   2788 C  CE3 . TRP C 1 110 ? 51.773 -26.784 12.876  1.00 15.63  ? 129 TRP A CE3 1 
ATOM   2789 C  CZ2 . TRP C 1 110 ? 53.038 -29.254 13.432  1.00 22.21  ? 129 TRP A CZ2 1 
ATOM   2790 C  CZ3 . TRP C 1 110 ? 52.620 -26.939 13.967  1.00 18.46  ? 129 TRP A CZ3 1 
ATOM   2791 C  CH2 . TRP C 1 110 ? 53.250 -28.159 14.225  1.00 22.42  ? 129 TRP A CH2 1 
ATOM   2792 N  N   . ASP C 1 111 ? 48.085 -28.570 12.597  1.00 19.24  ? 130 ASP A N   1 
ATOM   2793 C  CA  . ASP C 1 111 ? 47.746 -28.755 14.002  1.00 20.65  ? 130 ASP A CA  1 
ATOM   2794 C  C   . ASP C 1 111 ? 48.719 -29.645 14.769  1.00 21.19  ? 130 ASP A C   1 
ATOM   2795 O  O   . ASP C 1 111 ? 49.154 -30.687 14.277  1.00 18.56  ? 130 ASP A O   1 
ATOM   2796 C  CB  . ASP C 1 111 ? 46.348 -29.349 14.159  1.00 18.61  ? 130 ASP A CB  1 
ATOM   2797 C  CG  . ASP C 1 111 ? 45.981 -29.565 15.618  1.00 24.30  ? 130 ASP A CG  1 
ATOM   2798 O  OD1 . ASP C 1 111 ? 45.993 -28.570 16.365  1.00 20.35  ? 130 ASP A OD1 1 
ATOM   2799 O  OD2 . ASP C 1 111 ? 45.708 -30.711 16.029  1.00 22.08  ? 130 ASP A OD2 1 
ATOM   2800 N  N   . GLU C 1 112 ? 49.028 -29.225 15.993  1.00 19.65  ? 131 GLU A N   1 
ATOM   2801 C  CA  . GLU C 1 112 ? 49.757 -30.057 16.924  1.00 17.90  ? 131 GLU A CA  1 
ATOM   2802 C  C   . GLU C 1 112 ? 48.995 -30.136 18.247  1.00 22.20  ? 131 GLU A C   1 
ATOM   2803 O  O   . GLU C 1 112 ? 49.502 -30.711 19.198  1.00 19.27  ? 131 GLU A O   1 
ATOM   2804 C  CB  . GLU C 1 112 ? 51.173 -29.497 17.164  1.00 20.29  ? 131 GLU A CB  1 
ATOM   2805 C  CG  . GLU C 1 112 ? 51.185 -28.004 17.502  1.00 15.78  ? 131 GLU A CG  1 
ATOM   2806 C  CD  . GLU C 1 112 ? 52.584 -27.411 17.665  1.00 20.07  ? 131 GLU A CD  1 
ATOM   2807 O  OE1 . GLU C 1 112 ? 53.586 -28.160 17.709  1.00 25.91  ? 131 GLU A OE1 1 
ATOM   2808 O  OE2 . GLU C 1 112 ? 52.677 -26.176 17.768  1.00 20.18  ? 131 GLU A OE2 1 
ATOM   2809 N  N   . ASP C 1 113 ? 47.794 -29.550 18.322  1.00 19.77  ? 132 ASP A N   1 
ATOM   2810 C  CA  . ASP C 1 113 ? 47.005 -29.635 19.560  1.00 18.24  ? 132 ASP A CA  1 
ATOM   2811 C  C   . ASP C 1 113 ? 46.389 -31.012 19.822  1.00 22.69  ? 132 ASP A C   1 
ATOM   2812 O  O   . ASP C 1 113 ? 46.205 -31.404 20.977  1.00 26.41  ? 132 ASP A O   1 
ATOM   2813 C  CB  . ASP C 1 113 ? 45.924 -28.559 19.605  1.00 17.28  ? 132 ASP A CB  1 
ATOM   2814 C  CG  . ASP C 1 113 ? 46.508 -27.162 19.688  1.00 19.15  ? 132 ASP A CG  1 
ATOM   2815 O  OD1 . ASP C 1 113 ? 47.079 -26.791 20.734  1.00 20.63  ? 132 ASP A OD1 1 
ATOM   2816 O  OD2 . ASP C 1 113 ? 46.393 -26.434 18.696  1.00 16.09  ? 132 ASP A OD2 1 
ATOM   2817 N  N   . GLY C 1 114 ? 46.037 -31.727 18.755  1.00 17.60  ? 133 GLY A N   1 
ATOM   2818 C  CA  . GLY C 1 114 ? 45.644 -33.123 18.890  1.00 22.68  ? 133 GLY A CA  1 
ATOM   2819 C  C   . GLY C 1 114 ? 44.155 -33.412 18.919  1.00 24.07  ? 133 GLY A C   1 
ATOM   2820 O  O   . GLY C 1 114 ? 43.747 -34.534 19.219  1.00 23.71  ? 133 GLY A O   1 
ATOM   2821 N  N   . HIS C 1 115 ? 43.327 -32.422 18.608  1.00 23.78  ? 134 HIS A N   1 
ATOM   2822 C  CA  . HIS C 1 115 ? 41.893 -32.650 18.675  1.00 20.75  ? 134 HIS A CA  1 
ATOM   2823 C  C   . HIS C 1 115 ? 41.284 -33.215 17.390  1.00 29.44  ? 134 HIS A C   1 
ATOM   2824 O  O   . HIS C 1 115 ? 40.111 -33.584 17.374  1.00 28.90  ? 134 HIS A O   1 
ATOM   2825 C  CB  . HIS C 1 115 ? 41.128 -31.421 19.188  1.00 19.01  ? 134 HIS A CB  1 
ATOM   2826 C  CG  . HIS C 1 115 ? 41.335 -30.171 18.384  1.00 22.54  ? 134 HIS A CG  1 
ATOM   2827 N  ND1 . HIS C 1 115 ? 40.608 -29.891 17.247  1.00 21.58  ? 134 HIS A ND1 1 
ATOM   2828 C  CD2 . HIS C 1 115 ? 42.141 -29.100 18.585  1.00 25.88  ? 134 HIS A CD2 1 
ATOM   2829 C  CE1 . HIS C 1 115 ? 40.977 -28.714 16.767  1.00 22.96  ? 134 HIS A CE1 1 
ATOM   2830 N  NE2 . HIS C 1 115 ? 41.909 -28.214 17.557  1.00 20.44  ? 134 HIS A NE2 1 
ATOM   2831 N  N   . HIS C 1 116 ? 42.074 -33.303 16.321  1.00 25.18  ? 135 HIS A N   1 
ATOM   2832 C  CA  . HIS C 1 116 ? 41.566 -33.841 15.064  1.00 20.96  ? 135 HIS A CA  1 
ATOM   2833 C  C   . HIS C 1 116 ? 41.671 -35.363 15.027  1.00 26.93  ? 135 HIS A C   1 
ATOM   2834 O  O   . HIS C 1 116 ? 42.550 -35.955 15.665  1.00 22.36  ? 135 HIS A O   1 
ATOM   2835 C  CB  . HIS C 1 116 ? 42.310 -33.226 13.878  1.00 23.67  ? 135 HIS A CB  1 
ATOM   2836 C  CG  . HIS C 1 116 ? 42.208 -31.740 13.823  1.00 19.18  ? 135 HIS A CG  1 
ATOM   2837 N  ND1 . HIS C 1 116 ? 41.060 -31.091 13.417  1.00 17.67  ? 135 HIS A ND1 1 
ATOM   2838 C  CD2 . HIS C 1 116 ? 43.099 -30.768 14.137  1.00 18.23  ? 135 HIS A CD2 1 
ATOM   2839 C  CE1 . HIS C 1 116 ? 41.248 -29.786 13.479  1.00 17.70  ? 135 HIS A CE1 1 
ATOM   2840 N  NE2 . HIS C 1 116 ? 42.478 -29.563 13.918  1.00 20.62  ? 135 HIS A NE2 1 
ATOM   2841 N  N   . ALA C 1 117 ? 40.774 -35.993 14.270  1.00 27.74  ? 136 ALA A N   1 
ATOM   2842 C  CA  . ALA C 1 117 ? 40.749 -37.455 14.168  1.00 29.65  ? 136 ALA A CA  1 
ATOM   2843 C  C   . ALA C 1 117 ? 42.018 -37.982 13.512  1.00 28.44  ? 136 ALA A C   1 
ATOM   2844 O  O   . ALA C 1 117 ? 42.640 -37.283 12.704  1.00 26.04  ? 136 ALA A O   1 
ATOM   2845 C  CB  . ALA C 1 117 ? 39.508 -37.914 13.382  1.00 26.25  ? 136 ALA A CB  1 
ATOM   2846 N  N   . GLN C 1 118 ? 42.397 -39.212 13.849  1.00 30.75  ? 137 GLN A N   1 
ATOM   2847 C  CA  . GLN C 1 118 ? 43.530 -39.852 13.193  1.00 34.64  ? 137 GLN A CA  1 
ATOM   2848 C  C   . GLN C 1 118 ? 43.378 -39.731 11.676  1.00 30.67  ? 137 GLN A C   1 
ATOM   2849 O  O   . GLN C 1 118 ? 42.268 -39.824 11.152  1.00 33.32  ? 137 GLN A O   1 
ATOM   2850 C  CB  . GLN C 1 118 ? 43.640 -41.328 13.594  1.00 43.79  ? 137 GLN A CB  1 
ATOM   2851 C  CG  . GLN C 1 118 ? 44.737 -42.069 12.842  1.00 54.05  ? 137 GLN A CG  1 
ATOM   2852 C  CD  . GLN C 1 118 ? 44.861 -43.526 13.242  1.00 65.68  ? 137 GLN A CD  1 
ATOM   2853 O  OE1 . GLN C 1 118 ? 44.311 -43.955 14.258  1.00 71.97  ? 137 GLN A OE1 1 
ATOM   2854 N  NE2 . GLN C 1 118 ? 45.592 -44.296 12.442  1.00 64.83  ? 137 GLN A NE2 1 
ATOM   2855 N  N   . ASP C 1 119 ? 44.492 -39.509 10.980  1.00 27.11  ? 138 ASP A N   1 
ATOM   2856 C  CA  . ASP C 1 119 ? 44.507 -39.354 9.513   1.00 29.74  ? 138 ASP A CA  1 
ATOM   2857 C  C   . ASP C 1 119 ? 43.965 -38.015 9.004   1.00 28.16  ? 138 ASP A C   1 
ATOM   2858 O  O   . ASP C 1 119 ? 43.825 -37.816 7.793   1.00 25.47  ? 138 ASP A O   1 
ATOM   2859 C  CB  . ASP C 1 119 ? 43.776 -40.508 8.815   1.00 31.88  ? 138 ASP A CB  1 
ATOM   2860 C  CG  . ASP C 1 119 ? 44.447 -41.853 9.048   1.00 44.23  ? 138 ASP A CG  1 
ATOM   2861 O  OD1 . ASP C 1 119 ? 45.687 -41.931 8.944   1.00 45.34  ? 138 ASP A OD1 1 
ATOM   2862 O  OD2 . ASP C 1 119 ? 43.727 -42.831 9.331   1.00 51.10  ? 138 ASP A OD2 1 
ATOM   2863 N  N   . SER C 1 120 ? 43.673 -37.098 9.923   1.00 21.46  ? 139 SER A N   1 
ATOM   2864 C  CA  . SER C 1 120 ? 43.219 -35.764 9.554   1.00 23.12  ? 139 SER A CA  1 
ATOM   2865 C  C   . SER C 1 120 ? 44.298 -35.058 8.756   1.00 24.57  ? 139 SER A C   1 
ATOM   2866 O  O   . SER C 1 120 ? 45.480 -35.132 9.104   1.00 21.61  ? 139 SER A O   1 
ATOM   2867 C  CB  . SER C 1 120 ? 42.905 -34.940 10.809  1.00 19.26  ? 139 SER A CB  1 
ATOM   2868 O  OG  . SER C 1 120 ? 42.498 -33.634 10.447  1.00 21.89  ? 139 SER A OG  1 
ATOM   2869 N  N   . LEU C 1 121 ? 43.907 -34.360 7.694   1.00 15.72  ? 140 LEU A N   1 
ATOM   2870 C  CA  . LEU C 1 121 ? 44.900 -33.658 6.892   1.00 19.54  ? 140 LEU A CA  1 
ATOM   2871 C  C   . LEU C 1 121 ? 45.374 -32.363 7.574   1.00 24.28  ? 140 LEU A C   1 
ATOM   2872 O  O   . LEU C 1 121 ? 46.301 -31.713 7.107   1.00 22.18  ? 140 LEU A O   1 
ATOM   2873 C  CB  . LEU C 1 121 ? 44.396 -33.405 5.464   1.00 16.60  ? 140 LEU A CB  1 
ATOM   2874 C  CG  . LEU C 1 121 ? 44.155 -34.665 4.631   1.00 13.41  ? 140 LEU A CG  1 
ATOM   2875 C  CD1 . LEU C 1 121 ? 43.710 -34.313 3.211   1.00 19.40  ? 140 LEU A CD1 1 
ATOM   2876 C  CD2 . LEU C 1 121 ? 45.407 -35.527 4.598   1.00 17.67  ? 140 LEU A CD2 1 
ATOM   2877 N  N   . HIS C 1 122 ? 44.742 -32.006 8.693   1.00 24.34  ? 141 HIS A N   1 
ATOM   2878 C  CA  . HIS C 1 122 ? 45.203 -30.894 9.517   1.00 20.85  ? 141 HIS A CA  1 
ATOM   2879 C  C   . HIS C 1 122 ? 46.561 -31.199 10.125  1.00 21.82  ? 141 HIS A C   1 
ATOM   2880 O  O   . HIS C 1 122 ? 47.316 -30.287 10.470  1.00 21.61  ? 141 HIS A O   1 
ATOM   2881 C  CB  . HIS C 1 122 ? 44.220 -30.616 10.653  1.00 17.89  ? 141 HIS A CB  1 
ATOM   2882 C  CG  . HIS C 1 122 ? 42.977 -29.907 10.218  1.00 16.31  ? 141 HIS A CG  1 
ATOM   2883 N  ND1 . HIS C 1 122 ? 42.959 -28.563 9.913   1.00 18.21  ? 141 HIS A ND1 1 
ATOM   2884 C  CD2 . HIS C 1 122 ? 41.711 -30.353 10.042  1.00 18.33  ? 141 HIS A CD2 1 
ATOM   2885 C  CE1 . HIS C 1 122 ? 41.734 -28.214 9.562   1.00 19.92  ? 141 HIS A CE1 1 
ATOM   2886 N  NE2 . HIS C 1 122 ? 40.954 -29.277 9.641   1.00 16.42  ? 141 HIS A NE2 1 
ATOM   2887 N  N   . TYR C 1 123 ? 46.868 -32.484 10.273  1.00 15.81  ? 142 TYR A N   1 
ATOM   2888 C  CA  . TYR C 1 123 ? 48.170 -32.869 10.809  1.00 15.39  ? 142 TYR A CA  1 
ATOM   2889 C  C   . TYR C 1 123 ? 49.292 -32.747 9.776   1.00 21.28  ? 142 TYR A C   1 
ATOM   2890 O  O   . TYR C 1 123 ? 50.471 -32.934 10.091  1.00 23.70  ? 142 TYR A O   1 
ATOM   2891 C  CB  . TYR C 1 123 ? 48.113 -34.283 11.391  1.00 16.78  ? 142 TYR A CB  1 
ATOM   2892 C  CG  . TYR C 1 123 ? 47.252 -34.372 12.628  1.00 23.75  ? 142 TYR A CG  1 
ATOM   2893 C  CD1 . TYR C 1 123 ? 47.484 -33.542 13.715  1.00 21.02  ? 142 TYR A CD1 1 
ATOM   2894 C  CD2 . TYR C 1 123 ? 46.208 -35.285 12.708  1.00 24.30  ? 142 TYR A CD2 1 
ATOM   2895 C  CE1 . TYR C 1 123 ? 46.698 -33.609 14.853  1.00 24.78  ? 142 TYR A CE1 1 
ATOM   2896 C  CE2 . TYR C 1 123 ? 45.411 -35.362 13.844  1.00 27.74  ? 142 TYR A CE2 1 
ATOM   2897 C  CZ  . TYR C 1 123 ? 45.658 -34.521 14.911  1.00 24.46  ? 142 TYR A CZ  1 
ATOM   2898 O  OH  . TYR C 1 123 ? 44.872 -34.593 16.043  1.00 22.19  ? 142 TYR A OH  1 
ATOM   2899 N  N   . GLU C 1 124 ? 48.928 -32.426 8.541   1.00 14.41  ? 143 GLU A N   1 
ATOM   2900 C  CA  . GLU C 1 124 ? 49.900 -32.423 7.457   1.00 16.85  ? 143 GLU A CA  1 
ATOM   2901 C  C   . GLU C 1 124 ? 50.085 -31.080 6.753   1.00 21.09  ? 143 GLU A C   1 
ATOM   2902 O  O   . GLU C 1 124 ? 50.855 -30.975 5.806   1.00 25.84  ? 143 GLU A O   1 
ATOM   2903 C  CB  . GLU C 1 124 ? 49.544 -33.521 6.449   1.00 20.20  ? 143 GLU A CB  1 
ATOM   2904 C  CG  . GLU C 1 124 ? 49.498 -34.891 7.117   1.00 28.95  ? 143 GLU A CG  1 
ATOM   2905 C  CD  . GLU C 1 124 ? 49.343 -36.036 6.147   1.00 28.99  ? 143 GLU A CD  1 
ATOM   2906 O  OE1 . GLU C 1 124 ? 49.850 -35.934 5.013   1.00 29.26  ? 143 GLU A OE1 1 
ATOM   2907 O  OE2 . GLU C 1 124 ? 48.717 -37.042 6.532   1.00 30.13  ? 143 GLU A OE2 1 
ATOM   2908 N  N   . GLY C 1 125 ? 49.386 -30.057 7.217   1.00 20.50  ? 144 GLY A N   1 
ATOM   2909 C  CA  . GLY C 1 125 ? 49.434 -28.765 6.564   1.00 21.31  ? 144 GLY A CA  1 
ATOM   2910 C  C   . GLY C 1 125 ? 48.642 -28.762 5.271   1.00 20.98  ? 144 GLY A C   1 
ATOM   2911 O  O   . GLY C 1 125 ? 48.829 -27.882 4.434   1.00 19.65  ? 144 GLY A O   1 
ATOM   2912 N  N   . ARG C 1 126 ? 47.735 -29.726 5.118   1.00 16.69  ? 145 ARG A N   1 
ATOM   2913 C  CA  . ARG C 1 126 ? 46.938 -29.823 3.895   1.00 18.58  ? 145 ARG A CA  1 
ATOM   2914 C  C   . ARG C 1 126 ? 45.468 -29.464 4.020   1.00 18.84  ? 145 ARG A C   1 
ATOM   2915 O  O   . ARG C 1 126 ? 44.721 -29.605 3.057   1.00 19.84  ? 145 ARG A O   1 
ATOM   2916 C  CB  . ARG C 1 126 ? 47.014 -31.236 3.339   1.00 19.39  ? 145 ARG A CB  1 
ATOM   2917 C  CG  . ARG C 1 126 ? 48.275 -31.511 2.565   1.00 27.40  ? 145 ARG A CG  1 
ATOM   2918 C  CD  . ARG C 1 126 ? 48.018 -32.701 1.658   1.00 36.75  ? 145 ARG A CD  1 
ATOM   2919 N  NE  . ARG C 1 126 ? 48.330 -33.947 2.324   1.00 34.65  ? 145 ARG A NE  1 
ATOM   2920 C  CZ  . ARG C 1 126 ? 47.740 -35.112 2.071   1.00 31.94  ? 145 ARG A CZ  1 
ATOM   2921 N  NH1 . ARG C 1 126 ? 46.759 -35.206 1.181   1.00 29.22  ? 145 ARG A NH1 1 
ATOM   2922 N  NH2 . ARG C 1 126 ? 48.136 -36.188 2.731   1.00 25.02  ? 145 ARG A NH2 1 
ATOM   2923 N  N   . ALA C 1 127 ? 45.044 -29.019 5.195   1.00 14.87  ? 146 ALA A N   1 
ATOM   2924 C  CA  . ALA C 1 127 ? 43.632 -28.710 5.421   1.00 11.89  ? 146 ALA A CA  1 
ATOM   2925 C  C   . ALA C 1 127 ? 43.489 -27.452 6.275   1.00 14.49  ? 146 ALA A C   1 
ATOM   2926 O  O   . ALA C 1 127 ? 44.279 -27.231 7.202   1.00 18.01  ? 146 ALA A O   1 
ATOM   2927 C  CB  . ALA C 1 127 ? 42.949 -29.884 6.104   1.00 16.14  ? 146 ALA A CB  1 
ATOM   2928 N  N   . LEU C 1 128 ? 42.482 -26.640 5.970   1.00 11.78  ? 147 LEU A N   1 
ATOM   2929 C  CA  . LEU C 1 128 ? 42.176 -25.428 6.736   1.00 11.72  ? 147 LEU A CA  1 
ATOM   2930 C  C   . LEU C 1 128 ? 40.696 -25.428 7.096   1.00 14.25  ? 147 LEU A C   1 
ATOM   2931 O  O   . LEU C 1 128 ? 39.870 -25.843 6.286   1.00 18.15  ? 147 LEU A O   1 
ATOM   2932 C  CB  . LEU C 1 128 ? 42.441 -24.185 5.893   1.00 13.71  ? 147 LEU A CB  1 
ATOM   2933 C  CG  . LEU C 1 128 ? 43.781 -24.048 5.176   1.00 14.14  ? 147 LEU A CG  1 
ATOM   2934 C  CD1 . LEU C 1 128 ? 43.777 -22.831 4.289   1.00 14.80  ? 147 LEU A CD1 1 
ATOM   2935 C  CD2 . LEU C 1 128 ? 44.886 -23.949 6.195   1.00 16.93  ? 147 LEU A CD2 1 
ATOM   2936 N  N   . ASP C 1 129 ? 40.368 -24.973 8.300   1.00 13.99  ? 148 ASP A N   1 
ATOM   2937 C  CA  . ASP C 1 129 ? 38.989 -24.644 8.638   1.00 15.91  ? 148 ASP A CA  1 
ATOM   2938 C  C   . ASP C 1 129 ? 38.870 -23.149 8.482   1.00 18.33  ? 148 ASP A C   1 
ATOM   2939 O  O   . ASP C 1 129 ? 39.694 -22.413 9.006   1.00 16.47  ? 148 ASP A O   1 
ATOM   2940 C  CB  . ASP C 1 129 ? 38.647 -25.068 10.063  1.00 14.02  ? 148 ASP A CB  1 
ATOM   2941 C  CG  . ASP C 1 129 ? 38.550 -26.576 10.198  1.00 15.64  ? 148 ASP A CG  1 
ATOM   2942 O  OD1 . ASP C 1 129 ? 38.216 -27.208 9.181   1.00 15.64  ? 148 ASP A OD1 1 
ATOM   2943 O  OD2 . ASP C 1 129 ? 38.813 -27.110 11.282  1.00 19.00  ? 148 ASP A OD2 1 
ATOM   2944 N  N   . ILE C 1 130 ? 37.847 -22.708 7.754   1.00 13.46  ? 149 ILE A N   1 
ATOM   2945 C  CA  . ILE C 1 130 ? 37.708 -21.308 7.392   1.00 11.98  ? 149 ILE A CA  1 
ATOM   2946 C  C   . ILE C 1 130 ? 36.327 -20.716 7.684   1.00 14.03  ? 149 ILE A C   1 
ATOM   2947 O  O   . ILE C 1 130 ? 35.327 -21.426 7.736   1.00 14.39  ? 149 ILE A O   1 
ATOM   2948 C  CB  . ILE C 1 130 ? 38.040 -21.087 5.885   1.00 11.69  ? 149 ILE A CB  1 
ATOM   2949 C  CG1 . ILE C 1 130 ? 37.064 -21.861 4.995   1.00 12.69  ? 149 ILE A CG1 1 
ATOM   2950 C  CG2 . ILE C 1 130 ? 39.487 -21.471 5.601   1.00 14.38  ? 149 ILE A CG2 1 
ATOM   2951 C  CD1 . ILE C 1 130 ? 37.270 -21.612 3.485   1.00 21.79  ? 149 ILE A CD1 1 
ATOM   2952 N  N   . THR C 1 131 ? 36.302 -19.397 7.889   1.00 15.00  ? 150 THR A N   1 
ATOM   2953 C  CA  . THR C 1 131 ? 35.064 -18.636 7.966   1.00 19.38  ? 150 THR A CA  1 
ATOM   2954 C  C   . THR C 1 131 ? 35.295 -17.342 7.180   1.00 19.29  ? 150 THR A C   1 
ATOM   2955 O  O   . THR C 1 131 ? 36.393 -17.097 6.691   1.00 14.47  ? 150 THR A O   1 
ATOM   2956 C  CB  . THR C 1 131 ? 34.682 -18.301 9.431   1.00 16.93  ? 150 THR A CB  1 
ATOM   2957 O  OG1 . THR C 1 131 ? 35.538 -17.263 9.933   1.00 14.72  ? 150 THR A OG1 1 
ATOM   2958 C  CG2 . THR C 1 131 ? 34.823 -19.541 10.325  1.00 18.36  ? 150 THR A CG2 1 
ATOM   2959 N  N   . THR C 1 132 ? 34.259 -16.527 7.019   1.00 14.60  ? 151 THR A N   1 
ATOM   2960 C  CA  . THR C 1 132 ? 34.508 -15.141 6.617   1.00 13.56  ? 151 THR A CA  1 
ATOM   2961 C  C   . THR C 1 132 ? 34.872 -14.367 7.887   1.00 16.90  ? 151 THR A C   1 
ATOM   2962 O  O   . THR C 1 132 ? 34.587 -14.827 9.002   1.00 13.44  ? 151 THR A O   1 
ATOM   2963 C  CB  . THR C 1 132 ? 33.275 -14.527 5.927   1.00 16.50  ? 151 THR A CB  1 
ATOM   2964 O  OG1 . THR C 1 132 ? 32.132 -14.730 6.758   1.00 18.41  ? 151 THR A OG1 1 
ATOM   2965 C  CG2 . THR C 1 132 ? 33.023 -15.209 4.577   1.00 17.00  ? 151 THR A CG2 1 
ATOM   2966 N  N   . SER C 1 133 ? 35.506 -13.204 7.727   1.00 17.02  ? 152 SER A N   1 
ATOM   2967 C  CA  . SER C 1 133 ? 36.019 -12.449 8.862   1.00 15.62  ? 152 SER A CA  1 
ATOM   2968 C  C   . SER C 1 133 ? 34.903 -11.933 9.747   1.00 19.22  ? 152 SER A C   1 
ATOM   2969 O  O   . SER C 1 133 ? 35.105 -11.717 10.942  1.00 17.36  ? 152 SER A O   1 
ATOM   2970 C  CB  . SER C 1 133 ? 36.884 -11.269 8.381   1.00 16.15  ? 152 SER A CB  1 
ATOM   2971 O  OG  . SER C 1 133 ? 36.188 -10.461 7.442   1.00 18.44  ? 152 SER A OG  1 
ATOM   2972 N  N   . ASP C 1 134 ? 33.732 -11.701 9.158   1.00 19.90  ? 153 ASP A N   1 
ATOM   2973 C  CA  . ASP C 1 134 ? 32.602 -11.192 9.932   1.00 22.28  ? 153 ASP A CA  1 
ATOM   2974 C  C   . ASP C 1 134 ? 31.826 -12.290 10.664  1.00 19.68  ? 153 ASP A C   1 
ATOM   2975 O  O   . ASP C 1 134 ? 30.877 -11.998 11.388  1.00 16.81  ? 153 ASP A O   1 
ATOM   2976 C  CB  . ASP C 1 134 ? 31.672 -10.349 9.062   1.00 17.60  ? 153 ASP A CB  1 
ATOM   2977 C  CG  . ASP C 1 134 ? 31.144 -11.101 7.853   1.00 17.51  ? 153 ASP A CG  1 
ATOM   2978 O  OD1 . ASP C 1 134 ? 31.435 -12.301 7.703   1.00 18.98  ? 153 ASP A OD1 1 
ATOM   2979 O  OD2 . ASP C 1 134 ? 30.449 -10.465 7.033   1.00 17.98  ? 153 ASP A OD2 1 
ATOM   2980 N  N   . ARG C 1 135 ? 32.251 -13.540 10.492  1.00 16.24  ? 154 ARG A N   1 
ATOM   2981 C  CA  . ARG C 1 135 ? 31.540 -14.697 11.061  1.00 15.49  ? 154 ARG A CA  1 
ATOM   2982 C  C   . ARG C 1 135 ? 30.058 -14.713 10.692  1.00 18.98  ? 154 ARG A C   1 
ATOM   2983 O  O   . ARG C 1 135 ? 29.206 -15.104 11.497  1.00 19.62  ? 154 ARG A O   1 
ATOM   2984 C  CB  . ARG C 1 135 ? 31.703 -14.778 12.592  1.00 21.48  ? 154 ARG A CB  1 
ATOM   2985 C  CG  . ARG C 1 135 ? 33.109 -15.198 13.073  1.00 22.37  ? 154 ARG A CG  1 
ATOM   2986 C  CD  . ARG C 1 135 ? 34.127 -14.047 12.980  1.00 17.50  ? 154 ARG A CD  1 
ATOM   2987 N  NE  . ARG C 1 135 ? 35.072 -14.085 14.106  1.00 18.03  ? 154 ARG A NE  1 
ATOM   2988 C  CZ  . ARG C 1 135 ? 36.262 -13.493 14.127  1.00 17.36  ? 154 ARG A CZ  1 
ATOM   2989 N  NH1 . ARG C 1 135 ? 36.692 -12.811 13.063  1.00 15.20  ? 154 ARG A NH1 1 
ATOM   2990 N  NH2 . ARG C 1 135 ? 37.034 -13.589 15.211  1.00 12.55  ? 154 ARG A NH2 1 
ATOM   2991 N  N   . ASP C 1 136 ? 29.752 -14.272 9.476   1.00 16.09  ? 155 ASP A N   1 
ATOM   2992 C  CA  . ASP C 1 136 ? 28.380 -14.284 8.995   1.00 21.21  ? 155 ASP A CA  1 
ATOM   2993 C  C   . ASP C 1 136 ? 28.103 -15.650 8.362   1.00 19.69  ? 155 ASP A C   1 
ATOM   2994 O  O   . ASP C 1 136 ? 28.509 -15.900 7.236   1.00 17.30  ? 155 ASP A O   1 
ATOM   2995 C  CB  . ASP C 1 136 ? 28.182 -13.158 7.972   1.00 18.77  ? 155 ASP A CB  1 
ATOM   2996 C  CG  . ASP C 1 136 ? 26.787 -13.148 7.364   1.00 17.70  ? 155 ASP A CG  1 
ATOM   2997 O  OD1 . ASP C 1 136 ? 25.893 -13.875 7.859   1.00 13.30  ? 155 ASP A OD1 1 
ATOM   2998 O  OD2 . ASP C 1 136 ? 26.598 -12.392 6.387   1.00 17.77  ? 155 ASP A OD2 1 
ATOM   2999 N  N   . ARG C 1 137 ? 27.417 -16.536 9.081   1.00 15.85  ? 156 ARG A N   1 
ATOM   3000 C  CA  . ARG C 1 137 ? 27.189 -17.897 8.569   1.00 18.24  ? 156 ARG A CA  1 
ATOM   3001 C  C   . ARG C 1 137 ? 26.404 -17.979 7.260   1.00 16.86  ? 156 ARG A C   1 
ATOM   3002 O  O   . ARG C 1 137 ? 26.548 -18.947 6.501   1.00 20.49  ? 156 ARG A O   1 
ATOM   3003 C  CB  . ARG C 1 137 ? 26.518 -18.755 9.629   1.00 24.33  ? 156 ARG A CB  1 
ATOM   3004 C  CG  . ARG C 1 137 ? 27.469 -19.152 10.742  1.00 28.10  ? 156 ARG A CG  1 
ATOM   3005 C  CD  . ARG C 1 137 ? 26.679 -19.558 11.954  1.00 32.16  ? 156 ARG A CD  1 
ATOM   3006 N  NE  . ARG C 1 137 ? 27.527 -19.941 13.075  1.00 27.18  ? 156 ARG A NE  1 
ATOM   3007 C  CZ  . ARG C 1 137 ? 28.180 -19.078 13.842  1.00 29.66  ? 156 ARG A CZ  1 
ATOM   3008 N  NH1 . ARG C 1 137 ? 28.119 -17.773 13.589  1.00 35.33  ? 156 ARG A NH1 1 
ATOM   3009 N  NH2 . ARG C 1 137 ? 28.906 -19.521 14.861  1.00 24.35  ? 156 ARG A NH2 1 
ATOM   3010 N  N   . ASN C 1 138 ? 25.601 -16.955 6.992   1.00 16.57  ? 157 ASN A N   1 
ATOM   3011 C  CA  . ASN C 1 138 ? 24.858 -16.874 5.744   1.00 21.88  ? 157 ASN A CA  1 
ATOM   3012 C  C   . ASN C 1 138 ? 25.796 -16.867 4.542   1.00 22.49  ? 157 ASN A C   1 
ATOM   3013 O  O   . ASN C 1 138 ? 25.378 -17.150 3.418   1.00 23.14  ? 157 ASN A O   1 
ATOM   3014 C  CB  . ASN C 1 138 ? 23.969 -15.631 5.728   1.00 20.00  ? 157 ASN A CB  1 
ATOM   3015 C  CG  . ASN C 1 138 ? 22.775 -15.755 6.654   1.00 20.00  ? 157 ASN A CG  1 
ATOM   3016 O  OD1 . ASN C 1 138 ? 22.815 -16.485 7.643   1.00 20.00  ? 157 ASN A OD1 1 
ATOM   3017 N  ND2 . ASN C 1 138 ? 21.703 -15.038 6.338   1.00 20.00  ? 157 ASN A ND2 1 
ATOM   3018 N  N   . LYS C 1 139 ? 27.063 -16.544 4.782   1.00 18.36  ? 158 LYS A N   1 
ATOM   3019 C  CA  . LYS C 1 139 ? 28.062 -16.522 3.696   1.00 17.58  ? 158 LYS A CA  1 
ATOM   3020 C  C   . LYS C 1 139 ? 28.810 -17.852 3.490   1.00 17.98  ? 158 LYS A C   1 
ATOM   3021 O  O   . LYS C 1 139 ? 29.508 -18.025 2.481   1.00 16.56  ? 158 LYS A O   1 
ATOM   3022 C  CB  . LYS C 1 139 ? 29.115 -15.427 3.931   1.00 17.75  ? 158 LYS A CB  1 
ATOM   3023 C  CG  . LYS C 1 139 ? 28.594 -13.978 3.918   1.00 17.46  ? 158 LYS A CG  1 
ATOM   3024 C  CD  . LYS C 1 139 ? 29.767 -13.023 4.166   1.00 17.65  ? 158 LYS A CD  1 
ATOM   3025 C  CE  . LYS C 1 139 ? 29.369 -11.569 3.952   1.00 17.00  ? 158 LYS A CE  1 
ATOM   3026 N  NZ  . LYS C 1 139 ? 28.661 -11.047 5.159   1.00 19.24  ? 158 LYS A NZ  1 
ATOM   3027 N  N   . TYR C 1 140 ? 28.703 -18.775 4.440   1.00 19.46  ? 159 TYR A N   1 
ATOM   3028 C  CA  . TYR C 1 140 ? 29.609 -19.938 4.434   1.00 16.95  ? 159 TYR A CA  1 
ATOM   3029 C  C   . TYR C 1 140 ? 29.402 -20.867 3.244   1.00 17.12  ? 159 TYR A C   1 
ATOM   3030 O  O   . TYR C 1 140 ? 30.366 -21.423 2.725   1.00 16.19  ? 159 TYR A O   1 
ATOM   3031 C  CB  . TYR C 1 140 ? 29.567 -20.722 5.752   1.00 14.21  ? 159 TYR A CB  1 
ATOM   3032 C  CG  . TYR C 1 140 ? 30.108 -19.966 6.968   1.00 14.74  ? 159 TYR A CG  1 
ATOM   3033 C  CD1 . TYR C 1 140 ? 30.573 -18.661 6.858   1.00 12.15  ? 159 TYR A CD1 1 
ATOM   3034 C  CD2 . TYR C 1 140 ? 30.098 -20.550 8.226   1.00 18.27  ? 159 TYR A CD2 1 
ATOM   3035 C  CE1 . TYR C 1 140 ? 31.037 -17.955 7.979   1.00 14.47  ? 159 TYR A CE1 1 
ATOM   3036 C  CE2 . TYR C 1 140 ? 30.574 -19.868 9.345   1.00 17.32  ? 159 TYR A CE2 1 
ATOM   3037 C  CZ  . TYR C 1 140 ? 31.022 -18.566 9.218   1.00 16.55  ? 159 TYR A CZ  1 
ATOM   3038 O  OH  . TYR C 1 140 ? 31.476 -17.896 10.330  1.00 15.14  ? 159 TYR A OH  1 
ATOM   3039 N  N   . GLY C 1 141 ? 28.153 -21.053 2.822   1.00 18.44  ? 160 GLY A N   1 
ATOM   3040 C  CA  . GLY C 1 141 ? 27.882 -21.906 1.672   1.00 18.13  ? 160 GLY A CA  1 
ATOM   3041 C  C   . GLY C 1 141 ? 28.555 -21.362 0.422   1.00 16.27  ? 160 GLY A C   1 
ATOM   3042 O  O   . GLY C 1 141 ? 29.102 -22.124 -0.385  1.00 16.84  ? 160 GLY A O   1 
ATOM   3043 N  N   . LEU C 1 142 ? 28.515 -20.037 0.261   1.00 14.10  ? 161 LEU A N   1 
ATOM   3044 C  CA  . LEU C 1 142 ? 29.127 -19.394 -0.895  1.00 20.79  ? 161 LEU A CA  1 
ATOM   3045 C  C   . LEU C 1 142 ? 30.643 -19.396 -0.747  1.00 17.52  ? 161 LEU A C   1 
ATOM   3046 O  O   . LEU C 1 142 ? 31.360 -19.611 -1.715  1.00 15.86  ? 161 LEU A O   1 
ATOM   3047 C  CB  . LEU C 1 142 ? 28.592 -17.967 -1.101  1.00 21.01  ? 161 LEU A CB  1 
ATOM   3048 C  CG  . LEU C 1 142 ? 29.218 -17.227 -2.293  1.00 25.96  ? 161 LEU A CG  1 
ATOM   3049 C  CD1 . LEU C 1 142 ? 29.218 -18.081 -3.565  1.00 25.75  ? 161 LEU A CD1 1 
ATOM   3050 C  CD2 . LEU C 1 142 ? 28.518 -15.885 -2.541  1.00 25.48  ? 161 LEU A CD2 1 
ATOM   3051 N  N   . LEU C 1 143 ? 31.124 -19.165 0.470   1.00 15.26  ? 162 LEU A N   1 
ATOM   3052 C  CA  . LEU C 1 143 ? 32.544 -19.331 0.770   1.00 15.79  ? 162 LEU A CA  1 
ATOM   3053 C  C   . LEU C 1 143 ? 33.028 -20.716 0.324   1.00 15.00  ? 162 LEU A C   1 
ATOM   3054 O  O   . LEU C 1 143 ? 34.080 -20.859 -0.310  1.00 13.98  ? 162 LEU A O   1 
ATOM   3055 C  CB  . LEU C 1 143 ? 32.783 -19.163 2.267   1.00 11.14  ? 162 LEU A CB  1 
ATOM   3056 C  CG  . LEU C 1 143 ? 34.229 -19.352 2.745   1.00 12.41  ? 162 LEU A CG  1 
ATOM   3057 C  CD1 . LEU C 1 143 ? 35.144 -18.296 2.099   1.00 15.64  ? 162 LEU A CD1 1 
ATOM   3058 C  CD2 . LEU C 1 143 ? 34.296 -19.281 4.269   1.00 14.99  ? 162 LEU A CD2 1 
ATOM   3059 N  N   . ALA C 1 144 ? 32.247 -21.736 0.654   1.00 16.24  ? 163 ALA A N   1 
ATOM   3060 C  CA  . ALA C 1 144 ? 32.611 -23.113 0.318   1.00 21.06  ? 163 ALA A CA  1 
ATOM   3061 C  C   . ALA C 1 144 ? 32.708 -23.279 -1.186  1.00 16.10  ? 163 ALA A C   1 
ATOM   3062 O  O   . ALA C 1 144 ? 33.649 -23.890 -1.683  1.00 18.43  ? 163 ALA A O   1 
ATOM   3063 C  CB  . ALA C 1 144 ? 31.610 -24.101 0.900   1.00 15.78  ? 163 ALA A CB  1 
ATOM   3064 N  N   . ARG C 1 145 ? 31.739 -22.721 -1.914  1.00 14.46  ? 164 ARG A N   1 
ATOM   3065 C  CA  . ARG C 1 145 ? 31.779 -22.769 -3.372  1.00 20.44  ? 164 ARG A CA  1 
ATOM   3066 C  C   . ARG C 1 145 ? 32.975 -21.971 -3.924  1.00 17.01  ? 164 ARG A C   1 
ATOM   3067 O  O   . ARG C 1 145 ? 33.646 -22.412 -4.860  1.00 14.99  ? 164 ARG A O   1 
ATOM   3068 C  CB  . ARG C 1 145 ? 30.444 -22.295 -3.965  1.00 15.10  ? 164 ARG A CB  1 
ATOM   3069 C  CG  . ARG C 1 145 ? 30.478 -21.972 -5.457  1.00 16.97  ? 164 ARG A CG  1 
ATOM   3070 C  CD  . ARG C 1 145 ? 30.736 -23.185 -6.333  1.00 20.31  ? 164 ARG A CD  1 
ATOM   3071 N  NE  . ARG C 1 145 ? 29.860 -24.323 -6.059  1.00 24.70  ? 164 ARG A NE  1 
ATOM   3072 C  CZ  . ARG C 1 145 ? 30.100 -25.549 -6.518  1.00 33.38  ? 164 ARG A CZ  1 
ATOM   3073 N  NH1 . ARG C 1 145 ? 31.178 -25.775 -7.267  1.00 31.27  ? 164 ARG A NH1 1 
ATOM   3074 N  NH2 . ARG C 1 145 ? 29.275 -26.547 -6.233  1.00 34.16  ? 164 ARG A NH2 1 
ATOM   3075 N  N   . LEU C 1 146 ? 33.272 -20.818 -3.329  1.00 16.45  ? 165 LEU A N   1 
ATOM   3076 C  CA  . LEU C 1 146 ? 34.454 -20.065 -3.740  1.00 13.94  ? 165 LEU A CA  1 
ATOM   3077 C  C   . LEU C 1 146 ? 35.714 -20.905 -3.562  1.00 16.75  ? 165 LEU A C   1 
ATOM   3078 O  O   . LEU C 1 146 ? 36.652 -20.811 -4.348  1.00 15.40  ? 165 LEU A O   1 
ATOM   3079 C  CB  . LEU C 1 146 ? 34.590 -18.752 -2.959  1.00 12.88  ? 165 LEU A CB  1 
ATOM   3080 C  CG  . LEU C 1 146 ? 33.616 -17.615 -3.291  1.00 16.23  ? 165 LEU A CG  1 
ATOM   3081 C  CD1 . LEU C 1 146 ? 33.919 -16.363 -2.444  1.00 17.65  ? 165 LEU A CD1 1 
ATOM   3082 C  CD2 . LEU C 1 146 ? 33.668 -17.274 -4.772  1.00 20.49  ? 165 LEU A CD2 1 
ATOM   3083 N  N   . ALA C 1 147 ? 35.756 -21.733 -2.523  1.00 15.75  ? 166 ALA A N   1 
ATOM   3084 C  CA  . ALA C 1 147 ? 36.957 -22.534 -2.307  1.00 17.34  ? 166 ALA A CA  1 
ATOM   3085 C  C   . ALA C 1 147 ? 37.103 -23.614 -3.392  1.00 17.84  ? 166 ALA A C   1 
ATOM   3086 O  O   . ALA C 1 147 ? 38.218 -23.929 -3.801  1.00 16.62  ? 166 ALA A O   1 
ATOM   3087 C  CB  . ALA C 1 147 ? 36.975 -23.141 -0.913  1.00 14.53  ? 166 ALA A CB  1 
ATOM   3088 N  N   . VAL C 1 148 ? 35.987 -24.163 -3.862  1.00 18.75  ? 167 VAL A N   1 
ATOM   3089 C  CA  . VAL C 1 148 ? 36.041 -25.090 -4.995  1.00 15.50  ? 167 VAL A CA  1 
ATOM   3090 C  C   . VAL C 1 148 ? 36.602 -24.357 -6.200  1.00 17.94  ? 167 VAL A C   1 
ATOM   3091 O  O   . VAL C 1 148 ? 37.494 -24.847 -6.897  1.00 21.02  ? 167 VAL A O   1 
ATOM   3092 C  CB  . VAL C 1 148 ? 34.649 -25.655 -5.343  1.00 14.92  ? 167 VAL A CB  1 
ATOM   3093 C  CG1 . VAL C 1 148 ? 34.708 -26.490 -6.620  1.00 20.29  ? 167 VAL A CG1 1 
ATOM   3094 C  CG2 . VAL C 1 148 ? 34.098 -26.493 -4.168  1.00 15.90  ? 167 VAL A CG2 1 
ATOM   3095 N  N   . GLU C 1 149 ? 36.090 -23.161 -6.437  1.00 19.78  ? 168 GLU A N   1 
ATOM   3096 C  CA  . GLU C 1 149 ? 36.511 -22.405 -7.602  1.00 21.02  ? 168 GLU A CA  1 
ATOM   3097 C  C   . GLU C 1 149 ? 37.984 -22.024 -7.499  1.00 20.60  ? 168 GLU A C   1 
ATOM   3098 O  O   . GLU C 1 149 ? 38.654 -21.923 -8.513  1.00 16.61  ? 168 GLU A O   1 
ATOM   3099 C  CB  . GLU C 1 149 ? 35.627 -21.174 -7.800  1.00 24.77  ? 168 GLU A CB  1 
ATOM   3100 C  CG  . GLU C 1 149 ? 34.148 -21.505 -7.855  1.00 35.96  ? 168 GLU A CG  1 
ATOM   3101 C  CD  . GLU C 1 149 ? 33.806 -22.473 -8.990  1.00 50.37  ? 168 GLU A CD  1 
ATOM   3102 O  OE1 . GLU C 1 149 ? 34.101 -22.138 -10.155 1.00 55.28  ? 168 GLU A OE1 1 
ATOM   3103 O  OE2 . GLU C 1 149 ? 33.243 -23.564 -8.724  1.00 51.97  ? 168 GLU A OE2 1 
ATOM   3104 N  N   . ALA C 1 150 ? 38.482 -21.843 -6.273  1.00 19.16  ? 169 ALA A N   1 
ATOM   3105 C  CA  . ALA C 1 150 ? 39.886 -21.483 -6.030  1.00 23.37  ? 169 ALA A CA  1 
ATOM   3106 C  C   . ALA C 1 150 ? 40.848 -22.665 -6.163  1.00 23.33  ? 169 ALA A C   1 
ATOM   3107 O  O   . ALA C 1 150 ? 42.055 -22.496 -6.087  1.00 18.98  ? 169 ALA A O   1 
ATOM   3108 C  CB  . ALA C 1 150 ? 40.056 -20.825 -4.643  1.00 20.68  ? 169 ALA A CB  1 
ATOM   3109 N  N   . GLY C 1 151 ? 40.310 -23.867 -6.331  1.00 20.82  ? 170 GLY A N   1 
ATOM   3110 C  CA  . GLY C 1 151 ? 41.143 -25.005 -6.662  1.00 18.61  ? 170 GLY A CA  1 
ATOM   3111 C  C   . GLY C 1 151 ? 41.416 -25.973 -5.531  1.00 18.36  ? 170 GLY A C   1 
ATOM   3112 O  O   . GLY C 1 151 ? 42.249 -26.873 -5.656  1.00 19.48  ? 170 GLY A O   1 
ATOM   3113 N  N   . PHE C 1 152 ? 40.731 -25.800 -4.412  1.00 13.20  ? 171 PHE A N   1 
ATOM   3114 C  CA  . PHE C 1 152 ? 40.894 -26.765 -3.347  1.00 13.30  ? 171 PHE A CA  1 
ATOM   3115 C  C   . PHE C 1 152 ? 40.397 -28.120 -3.815  1.00 17.97  ? 171 PHE A C   1 
ATOM   3116 O  O   . PHE C 1 152 ? 39.340 -28.222 -4.446  1.00 18.76  ? 171 PHE A O   1 
ATOM   3117 C  CB  . PHE C 1 152 ? 40.173 -26.323 -2.073  1.00 13.96  ? 171 PHE A CB  1 
ATOM   3118 C  CG  . PHE C 1 152 ? 40.956 -25.326 -1.271  1.00 17.51  ? 171 PHE A CG  1 
ATOM   3119 C  CD1 . PHE C 1 152 ? 41.974 -25.743 -0.416  1.00 15.48  ? 171 PHE A CD1 1 
ATOM   3120 C  CD2 . PHE C 1 152 ? 40.695 -23.970 -1.395  1.00 18.14  ? 171 PHE A CD2 1 
ATOM   3121 C  CE1 . PHE C 1 152 ? 42.712 -24.816 0.311   1.00 15.63  ? 171 PHE A CE1 1 
ATOM   3122 C  CE2 . PHE C 1 152 ? 41.423 -23.036 -0.667  1.00 24.26  ? 171 PHE A CE2 1 
ATOM   3123 C  CZ  . PHE C 1 152 ? 42.420 -23.459 0.196   1.00 18.70  ? 171 PHE A CZ  1 
ATOM   3124 N  N   . ASP C 1 153 ? 41.161 -29.154 -3.486  1.00 17.19  ? 172 ASP A N   1 
ATOM   3125 C  CA  . ASP C 1 153 ? 40.887 -30.509 -3.951  1.00 19.16  ? 172 ASP A CA  1 
ATOM   3126 C  C   . ASP C 1 153 ? 39.726 -31.184 -3.231  1.00 16.90  ? 172 ASP A C   1 
ATOM   3127 O  O   . ASP C 1 153 ? 39.176 -32.156 -3.725  1.00 15.35  ? 172 ASP A O   1 
ATOM   3128 C  CB  . ASP C 1 153 ? 42.160 -31.359 -3.850  1.00 22.93  ? 172 ASP A CB  1 
ATOM   3129 C  CG  . ASP C 1 153 ? 43.309 -30.766 -4.645  1.00 26.12  ? 172 ASP A CG  1 
ATOM   3130 O  OD1 . ASP C 1 153 ? 43.178 -30.659 -5.880  1.00 22.66  ? 172 ASP A OD1 1 
ATOM   3131 O  OD2 . ASP C 1 153 ? 44.336 -30.386 -4.035  1.00 21.63  ? 172 ASP A OD2 1 
ATOM   3132 N  N   . TRP C 1 154 ? 39.347 -30.678 -2.062  1.00 16.98  ? 173 TRP A N   1 
ATOM   3133 C  CA  . TRP C 1 154 ? 38.139 -31.172 -1.398  1.00 12.56  ? 173 TRP A CA  1 
ATOM   3134 C  C   . TRP C 1 154 ? 37.611 -30.044 -0.538  1.00 15.96  ? 173 TRP A C   1 
ATOM   3135 O  O   . TRP C 1 154 ? 38.392 -29.353 0.117   1.00 18.50  ? 173 TRP A O   1 
ATOM   3136 C  CB  . TRP C 1 154 ? 38.461 -32.402 -0.554  1.00 15.63  ? 173 TRP A CB  1 
ATOM   3137 C  CG  . TRP C 1 154 ? 37.279 -33.255 -0.116  1.00 17.69  ? 173 TRP A CG  1 
ATOM   3138 C  CD1 . TRP C 1 154 ? 36.507 -34.080 -0.906  1.00 16.16  ? 173 TRP A CD1 1 
ATOM   3139 C  CD2 . TRP C 1 154 ? 36.807 -33.434 1.225   1.00 17.37  ? 173 TRP A CD2 1 
ATOM   3140 N  NE1 . TRP C 1 154 ? 35.557 -34.719 -0.136  1.00 16.71  ? 173 TRP A NE1 1 
ATOM   3141 C  CE2 . TRP C 1 154 ? 35.723 -34.343 1.173   1.00 19.52  ? 173 TRP A CE2 1 
ATOM   3142 C  CE3 . TRP C 1 154 ? 37.176 -32.892 2.463   1.00 20.07  ? 173 TRP A CE3 1 
ATOM   3143 C  CZ2 . TRP C 1 154 ? 35.018 -34.727 2.313   1.00 19.67  ? 173 TRP A CZ2 1 
ATOM   3144 C  CZ3 . TRP C 1 154 ? 36.473 -33.279 3.596   1.00 19.81  ? 173 TRP A CZ3 1 
ATOM   3145 C  CH2 . TRP C 1 154 ? 35.409 -34.185 3.512   1.00 19.52  ? 173 TRP A CH2 1 
ATOM   3146 N  N   . VAL C 1 155 ? 36.298 -29.830 -0.584  1.00 15.06  ? 174 VAL A N   1 
ATOM   3147 C  CA  . VAL C 1 155 ? 35.650 -28.778 0.194   1.00 13.34  ? 174 VAL A CA  1 
ATOM   3148 C  C   . VAL C 1 155 ? 34.447 -29.402 0.892   1.00 17.74  ? 174 VAL A C   1 
ATOM   3149 O  O   . VAL C 1 155 ? 33.623 -30.027 0.245   1.00 17.09  ? 174 VAL A O   1 
ATOM   3150 C  CB  . VAL C 1 155 ? 35.205 -27.590 -0.706  1.00 14.84  ? 174 VAL A CB  1 
ATOM   3151 C  CG1 . VAL C 1 155 ? 34.429 -26.574 0.098   1.00 14.31  ? 174 VAL A CG1 1 
ATOM   3152 C  CG2 . VAL C 1 155 ? 36.412 -26.929 -1.379  1.00 14.77  ? 174 VAL A CG2 1 
ATOM   3153 N  N   . TYR C 1 156 ? 34.364 -29.235 2.211   1.00 14.44  ? 175 TYR A N   1 
ATOM   3154 C  CA  . TYR C 1 156 ? 33.345 -29.891 3.023   1.00 16.38  ? 175 TYR A CA  1 
ATOM   3155 C  C   . TYR C 1 156 ? 32.702 -28.866 3.946   1.00 19.20  ? 175 TYR A C   1 
ATOM   3156 O  O   . TYR C 1 156 ? 33.378 -28.253 4.771   1.00 16.18  ? 175 TYR A O   1 
ATOM   3157 C  CB  . TYR C 1 156 ? 34.004 -31.010 3.850   1.00 18.25  ? 175 TYR A CB  1 
ATOM   3158 C  CG  . TYR C 1 156 ? 33.118 -31.770 4.820   1.00 18.13  ? 175 TYR A CG  1 
ATOM   3159 C  CD1 . TYR C 1 156 ? 31.764 -31.978 4.570   1.00 19.72  ? 175 TYR A CD1 1 
ATOM   3160 C  CD2 . TYR C 1 156 ? 33.661 -32.320 5.974   1.00 21.98  ? 175 TYR A CD2 1 
ATOM   3161 C  CE1 . TYR C 1 156 ? 30.972 -32.691 5.465   1.00 22.76  ? 175 TYR A CE1 1 
ATOM   3162 C  CE2 . TYR C 1 156 ? 32.887 -33.035 6.869   1.00 28.98  ? 175 TYR A CE2 1 
ATOM   3163 C  CZ  . TYR C 1 156 ? 31.546 -33.223 6.612   1.00 28.94  ? 175 TYR A CZ  1 
ATOM   3164 O  OH  . TYR C 1 156 ? 30.782 -33.940 7.509   1.00 24.65  ? 175 TYR A OH  1 
ATOM   3165 N  N   . TYR C 1 157 ? 31.397 -28.659 3.799   1.00 11.94  ? 176 TYR A N   1 
ATOM   3166 C  CA  . TYR C 1 157 ? 30.704 -27.720 4.678   1.00 16.08  ? 176 TYR A CA  1 
ATOM   3167 C  C   . TYR C 1 157 ? 30.516 -28.477 5.986   1.00 18.97  ? 176 TYR A C   1 
ATOM   3168 O  O   . TYR C 1 157 ? 29.442 -28.995 6.270   1.00 20.85  ? 176 TYR A O   1 
ATOM   3169 C  CB  . TYR C 1 157 ? 29.377 -27.282 4.050   1.00 13.99  ? 176 TYR A CB  1 
ATOM   3170 C  CG  . TYR C 1 157 ? 28.706 -26.061 4.641   1.00 17.93  ? 176 TYR A CG  1 
ATOM   3171 C  CD1 . TYR C 1 157 ? 28.963 -25.646 5.942   1.00 14.93  ? 176 TYR A CD1 1 
ATOM   3172 C  CD2 . TYR C 1 157 ? 27.764 -25.354 3.904   1.00 17.36  ? 176 TYR A CD2 1 
ATOM   3173 C  CE1 . TYR C 1 157 ? 28.296 -24.541 6.484   1.00 18.34  ? 176 TYR A CE1 1 
ATOM   3174 C  CE2 . TYR C 1 157 ? 27.119 -24.245 4.427   1.00 15.13  ? 176 TYR A CE2 1 
ATOM   3175 C  CZ  . TYR C 1 157 ? 27.384 -23.853 5.723   1.00 18.60  ? 176 TYR A CZ  1 
ATOM   3176 O  OH  . TYR C 1 157 ? 26.736 -22.755 6.238   1.00 22.14  ? 176 TYR A OH  1 
ATOM   3177 N  N   . GLU C 1 158 ? 31.599 -28.549 6.758   1.00 20.49  ? 177 GLU A N   1 
ATOM   3178 C  CA  . GLU C 1 158 ? 31.754 -29.536 7.830   1.00 18.69  ? 177 GLU A CA  1 
ATOM   3179 C  C   . GLU C 1 158 ? 30.877 -29.251 9.050   1.00 27.34  ? 177 GLU A C   1 
ATOM   3180 O  O   . GLU C 1 158 ? 30.406 -30.172 9.718   1.00 26.79  ? 177 GLU A O   1 
ATOM   3181 C  CB  . GLU C 1 158 ? 33.238 -29.613 8.222   1.00 16.97  ? 177 GLU A CB  1 
ATOM   3182 C  CG  . GLU C 1 158 ? 33.588 -30.574 9.334   1.00 22.72  ? 177 GLU A CG  1 
ATOM   3183 C  CD  . GLU C 1 158 ? 35.097 -30.693 9.517   1.00 28.18  ? 177 GLU A CD  1 
ATOM   3184 O  OE1 . GLU C 1 158 ? 35.793 -29.650 9.521   1.00 28.92  ? 177 GLU A OE1 1 
ATOM   3185 O  OE2 . GLU C 1 158 ? 35.587 -31.834 9.652   1.00 32.58  ? 177 GLU A OE2 1 
ATOM   3186 N  N   . SER C 1 159 ? 30.650 -27.974 9.322   1.00 23.53  ? 178 SER A N   1 
ATOM   3187 C  CA  . SER C 1 159 ? 29.976 -27.551 10.532  1.00 15.80  ? 178 SER A CA  1 
ATOM   3188 C  C   . SER C 1 159 ? 29.127 -26.342 10.179  1.00 20.87  ? 178 SER A C   1 
ATOM   3189 O  O   . SER C 1 159 ? 29.368 -25.695 9.159   1.00 16.45  ? 178 SER A O   1 
ATOM   3190 C  CB  . SER C 1 159 ? 31.034 -27.150 11.572  1.00 19.56  ? 178 SER A CB  1 
ATOM   3191 O  OG  . SER C 1 159 ? 30.460 -26.488 12.681  1.00 25.79  ? 178 SER A OG  1 
ATOM   3192 N  N   . ARG C 1 160 ? 28.130 -26.013 10.997  1.00 15.63  ? 179 ARG A N   1 
ATOM   3193 C  CA  . ARG C 1 160 ? 27.466 -24.733 10.785  1.00 15.99  ? 179 ARG A CA  1 
ATOM   3194 C  C   . ARG C 1 160 ? 28.454 -23.611 11.109  1.00 16.08  ? 179 ARG A C   1 
ATOM   3195 O  O   . ARG C 1 160 ? 28.237 -22.460 10.739  1.00 17.90  ? 179 ARG A O   1 
ATOM   3196 C  CB  . ARG C 1 160 ? 26.207 -24.611 11.646  1.00 23.41  ? 179 ARG A CB  1 
ATOM   3197 C  CG  . ARG C 1 160 ? 25.230 -25.763 11.416  1.00 33.28  ? 179 ARG A CG  1 
ATOM   3198 C  CD  . ARG C 1 160 ? 23.807 -25.408 11.789  1.00 41.16  ? 179 ARG A CD  1 
ATOM   3199 N  NE  . ARG C 1 160 ? 22.921 -26.551 11.596  1.00 41.83  ? 179 ARG A NE  1 
ATOM   3200 C  CZ  . ARG C 1 160 ? 22.340 -26.855 10.441  1.00 44.92  ? 179 ARG A CZ  1 
ATOM   3201 N  NH1 . ARG C 1 160 ? 22.543 -26.093 9.373   1.00 43.89  ? 179 ARG A NH1 1 
ATOM   3202 N  NH2 . ARG C 1 160 ? 21.557 -27.918 10.354  1.00 48.61  ? 179 ARG A NH2 1 
ATOM   3203 N  N   . ASN C 1 161 ? 29.545 -23.957 11.793  1.00 15.59  ? 180 ASN A N   1 
ATOM   3204 C  CA  . ASN C 1 161 ? 30.507 -22.951 12.273  1.00 21.73  ? 180 ASN A CA  1 
ATOM   3205 C  C   . ASN C 1 161 ? 31.797 -22.747 11.464  1.00 16.75  ? 180 ASN A C   1 
ATOM   3206 O  O   . ASN C 1 161 ? 32.549 -21.801 11.718  1.00 17.08  ? 180 ASN A O   1 
ATOM   3207 C  CB  . ASN C 1 161 ? 30.817 -23.210 13.750  1.00 24.53  ? 180 ASN A CB  1 
ATOM   3208 C  CG  . ASN C 1 161 ? 29.555 -23.355 14.563  1.00 29.89  ? 180 ASN A CG  1 
ATOM   3209 O  OD1 . ASN C 1 161 ? 29.328 -24.376 15.224  1.00 29.81  ? 180 ASN A OD1 1 
ATOM   3210 N  ND2 . ASN C 1 161 ? 28.686 -22.354 14.462  1.00 22.59  ? 180 ASN A ND2 1 
ATOM   3211 N  N   . HIS C 1 162 ? 32.045 -23.603 10.477  1.00 19.93  ? 181 HIS A N   1 
ATOM   3212 C  CA  . HIS C 1 162 ? 33.200 -23.423 9.584   1.00 19.90  ? 181 HIS A CA  1 
ATOM   3213 C  C   . HIS C 1 162 ? 33.100 -24.328 8.354   1.00 18.67  ? 181 HIS A C   1 
ATOM   3214 O  O   . HIS C 1 162 ? 32.312 -25.271 8.335   1.00 18.11  ? 181 HIS A O   1 
ATOM   3215 C  CB  . HIS C 1 162 ? 34.513 -23.716 10.314  1.00 11.29  ? 181 HIS A CB  1 
ATOM   3216 C  CG  . HIS C 1 162 ? 34.681 -25.157 10.686  1.00 19.04  ? 181 HIS A CG  1 
ATOM   3217 N  ND1 . HIS C 1 162 ? 34.265 -25.662 11.898  1.00 19.99  ? 181 HIS A ND1 1 
ATOM   3218 C  CD2 . HIS C 1 162 ? 35.208 -26.203 10.002  1.00 16.60  ? 181 HIS A CD2 1 
ATOM   3219 C  CE1 . HIS C 1 162 ? 34.524 -26.958 11.942  1.00 24.29  ? 181 HIS A CE1 1 
ATOM   3220 N  NE2 . HIS C 1 162 ? 35.094 -27.313 10.803  1.00 18.16  ? 181 HIS A NE2 1 
ATOM   3221 N  N   . VAL C 1 163 ? 33.892 -24.013 7.332   1.00 19.59  ? 182 VAL A N   1 
ATOM   3222 C  CA  . VAL C 1 163 ? 34.041 -24.870 6.149   1.00 16.18  ? 182 VAL A CA  1 
ATOM   3223 C  C   . VAL C 1 163 ? 35.435 -25.481 6.229   1.00 20.48  ? 182 VAL A C   1 
ATOM   3224 O  O   . VAL C 1 163 ? 36.379 -24.829 6.689   1.00 13.73  ? 182 VAL A O   1 
ATOM   3225 C  CB  . VAL C 1 163 ? 33.863 -24.054 4.849   1.00 17.48  ? 182 VAL A CB  1 
ATOM   3226 C  CG1 . VAL C 1 163 ? 34.073 -24.922 3.608   1.00 11.95  ? 182 VAL A CG1 1 
ATOM   3227 C  CG2 . VAL C 1 163 ? 32.457 -23.401 4.813   1.00 16.48  ? 182 VAL A CG2 1 
ATOM   3228 N  N   . HIS C 1 164 ? 35.547 -26.750 5.844   1.00 15.72  ? 183 HIS A N   1 
ATOM   3229 C  CA  . HIS C 1 164 ? 36.818 -27.469 5.841   1.00 15.59  ? 183 HIS A CA  1 
ATOM   3230 C  C   . HIS C 1 164 ? 37.271 -27.584 4.396   1.00 17.25  ? 183 HIS A C   1 
ATOM   3231 O  O   . HIS C 1 164 ? 36.483 -27.999 3.542   1.00 16.22  ? 183 HIS A O   1 
ATOM   3232 C  CB  . HIS C 1 164 ? 36.596 -28.863 6.446   1.00 17.84  ? 183 HIS A CB  1 
ATOM   3233 C  CG  . HIS C 1 164 ? 37.753 -29.793 6.287   1.00 16.44  ? 183 HIS A CG  1 
ATOM   3234 N  ND1 . HIS C 1 164 ? 38.596 -30.113 7.325   1.00 14.54  ? 183 HIS A ND1 1 
ATOM   3235 C  CD2 . HIS C 1 164 ? 38.191 -30.497 5.216   1.00 16.77  ? 183 HIS A CD2 1 
ATOM   3236 C  CE1 . HIS C 1 164 ? 39.521 -30.956 6.901   1.00 16.59  ? 183 HIS A CE1 1 
ATOM   3237 N  NE2 . HIS C 1 164 ? 39.294 -31.213 5.625   1.00 17.88  ? 183 HIS A NE2 1 
ATOM   3238 N  N   . VAL C 1 165 ? 38.515 -27.197 4.110   1.00 12.95  ? 184 VAL A N   1 
ATOM   3239 C  CA  . VAL C 1 165 ? 39.050 -27.311 2.752   1.00 15.81  ? 184 VAL A CA  1 
ATOM   3240 C  C   . VAL C 1 165 ? 40.401 -27.988 2.832   1.00 18.01  ? 184 VAL A C   1 
ATOM   3241 O  O   . VAL C 1 165 ? 41.123 -27.831 3.822   1.00 17.87  ? 184 VAL A O   1 
ATOM   3242 C  CB  . VAL C 1 165 ? 39.163 -25.935 2.063   1.00 12.02  ? 184 VAL A CB  1 
ATOM   3243 C  CG1 . VAL C 1 165 ? 37.803 -25.239 2.083   1.00 12.11  ? 184 VAL A CG1 1 
ATOM   3244 C  CG2 . VAL C 1 165 ? 40.213 -25.049 2.769   1.00 13.63  ? 184 VAL A CG2 1 
ATOM   3245 N  N   . SER C 1 166 ? 40.746 -28.767 1.813   1.00 15.67  ? 185 SER A N   1 
ATOM   3246 C  CA  . SER C 1 166 ? 42.009 -29.478 1.837   1.00 15.82  ? 185 SER A CA  1 
ATOM   3247 C  C   . SER C 1 166 ? 42.585 -29.636 0.430   1.00 16.76  ? 185 SER A C   1 
ATOM   3248 O  O   . SER C 1 166 ? 41.865 -29.446 -0.568  1.00 17.42  ? 185 SER A O   1 
ATOM   3249 C  CB  . SER C 1 166 ? 41.838 -30.840 2.514   1.00 14.11  ? 185 SER A CB  1 
ATOM   3250 O  OG  . SER C 1 166 ? 41.004 -31.690 1.741   1.00 18.57  ? 185 SER A OG  1 
ATOM   3251 N  N   . VAL C 1 167 ? 43.871 -29.983 0.361   1.00 15.55  ? 186 VAL A N   1 
ATOM   3252 C  CA  . VAL C 1 167 ? 44.568 -30.190 -0.909  1.00 18.43  ? 186 VAL A CA  1 
ATOM   3253 C  C   . VAL C 1 167 ? 45.315 -31.526 -0.999  1.00 19.82  ? 186 VAL A C   1 
ATOM   3254 O  O   . VAL C 1 167 ? 45.677 -32.123 0.011   1.00 21.04  ? 186 VAL A O   1 
ATOM   3255 C  CB  . VAL C 1 167 ? 45.612 -29.087 -1.180  1.00 18.95  ? 186 VAL A CB  1 
ATOM   3256 C  CG1 . VAL C 1 167 ? 44.952 -27.717 -1.258  1.00 21.26  ? 186 VAL A CG1 1 
ATOM   3257 C  CG2 . VAL C 1 167 ? 46.700 -29.114 -0.109  1.00 18.72  ? 186 VAL A CG2 1 
ATOM   3258 N  N   . LYS C 1 168 ? 45.540 -31.978 -2.232  1.00 19.55  ? 187 LYS A N   1 
ATOM   3259 C  CA  . LYS C 1 168 ? 46.423 -33.105 -2.490  1.00 21.02  ? 187 LYS A CA  1 
ATOM   3260 C  C   . LYS C 1 168 ? 47.816 -32.763 -1.966  1.00 31.38  ? 187 LYS A C   1 
ATOM   3261 O  O   . LYS C 1 168 ? 48.170 -31.587 -1.838  1.00 28.13  ? 187 LYS A O   1 
ATOM   3262 C  CB  . LYS C 1 168 ? 46.546 -33.353 -3.993  1.00 22.79  ? 187 LYS A CB  1 
ATOM   3263 C  CG  . LYS C 1 168 ? 45.270 -33.738 -4.729  1.00 25.12  ? 187 LYS A CG  1 
ATOM   3264 C  CD  . LYS C 1 168 ? 45.562 -33.740 -6.237  1.00 30.30  ? 187 LYS A CD  1 
ATOM   3265 C  CE  . LYS C 1 168 ? 44.319 -34.025 -7.073  1.00 36.80  ? 187 LYS A CE  1 
ATOM   3266 N  NZ  . LYS C 1 168 ? 43.525 -35.160 -6.545  1.00 34.95  ? 187 LYS A NZ  1 
ATOM   3267 N  N   . ALA C 1 169 ? 48.609 -33.794 -1.696  1.00 28.77  ? 188 ALA A N   1 
ATOM   3268 C  CA  . ALA C 1 169 ? 49.982 -33.627 -1.208  1.00 30.72  ? 188 ALA A CA  1 
ATOM   3269 C  C   . ALA C 1 169 ? 50.896 -32.901 -2.199  1.00 34.96  ? 188 ALA A C   1 
ATOM   3270 O  O   . ALA C 1 169 ? 50.632 -32.887 -3.405  1.00 34.56  ? 188 ALA A O   1 
ATOM   3271 C  CB  . ALA C 1 169 ? 50.574 -34.982 -0.850  1.00 29.31  ? 188 ALA A CB  1 
ATOM   3272 N  N   . ASP C 1 170 ? 51.964 -32.302 -1.664  1.00 38.74  ? 189 ASP A N   1 
ATOM   3273 C  CA  . ASP C 1 170 ? 53.001 -31.629 -2.443  1.00 37.84  ? 189 ASP A CA  1 
ATOM   3274 C  C   . ASP C 1 170 ? 53.890 -32.667 -3.118  1.00 42.15  ? 189 ASP A C   1 
ATOM   3275 O  O   . ASP C 1 170 ? 53.676 -33.033 -4.270  1.00 53.00  ? 189 ASP A O   1 
ATOM   3276 C  CB  . ASP C 1 170 ? 53.883 -30.767 -1.525  1.00 43.40  ? 189 ASP A CB  1 
ATOM   3277 C  CG  . ASP C 1 170 ? 53.405 -29.316 -1.405  1.00 48.74  ? 189 ASP A CG  1 
ATOM   3278 O  OD1 . ASP C 1 170 ? 52.271 -28.985 -1.828  1.00 28.75  ? 189 ASP A OD1 1 
ATOM   3279 O  OD2 . ASP C 1 170 ? 54.192 -28.501 -0.867  1.00 55.13  ? 189 ASP A OD2 1 
ATOM   3280 N  N   . GLU D 2 4   ? 57.035 -18.559 43.141  1.00 47.64  ? 710 GLU D N   1 
ATOM   3281 C  CA  . GLU D 2 4   ? 57.573 -19.290 42.005  1.00 47.63  ? 710 GLU D CA  1 
ATOM   3282 C  C   . GLU D 2 4   ? 56.447 -19.994 41.269  1.00 40.26  ? 710 GLU D C   1 
ATOM   3283 O  O   . GLU D 2 4   ? 55.856 -20.943 41.790  1.00 30.63  ? 710 GLU D O   1 
ATOM   3284 C  CB  . GLU D 2 4   ? 58.613 -20.312 42.460  1.00 56.33  ? 710 GLU D CB  1 
ATOM   3285 C  CG  . GLU D 2 4   ? 59.929 -19.697 42.907  1.00 70.69  ? 710 GLU D CG  1 
ATOM   3286 C  CD  . GLU D 2 4   ? 61.080 -20.681 42.831  1.00 83.61  ? 710 GLU D CD  1 
ATOM   3287 O  OE1 . GLU D 2 4   ? 60.893 -21.847 43.239  1.00 89.03  ? 710 GLU D OE1 1 
ATOM   3288 O  OE2 . GLU D 2 4   ? 62.170 -20.290 42.359  1.00 87.98  ? 710 GLU D OE2 1 
ATOM   3289 N  N   . ARG D 2 5   ? 56.154 -19.530 40.061  1.00 39.37  ? 711 ARG D N   1 
ATOM   3290 C  CA  . ARG D 2 5   ? 55.061 -20.093 39.280  1.00 38.48  ? 711 ARG D CA  1 
ATOM   3291 C  C   . ARG D 2 5   ? 55.385 -21.475 38.741  1.00 38.44  ? 711 ARG D C   1 
ATOM   3292 O  O   . ARG D 2 5   ? 56.550 -21.800 38.499  1.00 35.32  ? 711 ARG D O   1 
ATOM   3293 C  CB  . ARG D 2 5   ? 54.708 -19.167 38.110  1.00 45.37  ? 711 ARG D CB  1 
ATOM   3294 C  CG  . ARG D 2 5   ? 54.249 -17.804 38.548  1.00 47.13  ? 711 ARG D CG  1 
ATOM   3295 C  CD  . ARG D 2 5   ? 54.072 -16.852 37.385  1.00 41.98  ? 711 ARG D CD  1 
ATOM   3296 N  NE  . ARG D 2 5   ? 54.128 -15.477 37.872  1.00 51.03  ? 711 ARG D NE  1 
ATOM   3297 C  CZ  . ARG D 2 5   ? 54.193 -14.403 37.097  1.00 58.39  ? 711 ARG D CZ  1 
ATOM   3298 N  NH1 . ARG D 2 5   ? 54.204 -14.538 35.778  1.00 59.82  ? 711 ARG D NH1 1 
ATOM   3299 N  NH2 . ARG D 2 5   ? 54.245 -13.194 37.642  1.00 60.39  ? 711 ARG D NH2 1 
ATOM   3300 N  N   . PRO D 2 6   ? 54.345 -22.300 38.537  1.00 37.27  ? 712 PRO D N   1 
ATOM   3301 C  CA  . PRO D 2 6   ? 54.556 -23.531 37.777  1.00 36.32  ? 712 PRO D CA  1 
ATOM   3302 C  C   . PRO D 2 6   ? 55.070 -23.150 36.402  1.00 44.32  ? 712 PRO D C   1 
ATOM   3303 O  O   . PRO D 2 6   ? 54.765 -22.060 35.918  1.00 47.82  ? 712 PRO D O   1 
ATOM   3304 C  CB  . PRO D 2 6   ? 53.145 -24.117 37.651  1.00 40.03  ? 712 PRO D CB  1 
ATOM   3305 C  CG  . PRO D 2 6   ? 52.338 -23.458 38.700  1.00 37.68  ? 712 PRO D CG  1 
ATOM   3306 C  CD  . PRO D 2 6   ? 52.935 -22.098 38.901  1.00 34.46  ? 712 PRO D CD  1 
ATOM   3307 N  N   . VAL D 2 7   ? 55.847 -24.022 35.782  1.00 49.57  ? 713 VAL D N   1 
ATOM   3308 C  CA  . VAL D 2 7   ? 56.317 -23.764 34.432  1.00 50.32  ? 713 VAL D CA  1 
ATOM   3309 C  C   . VAL D 2 7   ? 55.427 -24.478 33.421  1.00 44.75  ? 713 VAL D C   1 
ATOM   3310 O  O   . VAL D 2 7   ? 54.587 -23.852 32.768  1.00 37.37  ? 713 VAL D O   1 
ATOM   3311 C  CB  . VAL D 2 7   ? 57.790 -24.174 34.259  1.00 58.36  ? 713 VAL D CB  1 
ATOM   3312 C  CG1 . VAL D 2 7   ? 58.699 -23.094 34.826  1.00 63.22  ? 713 VAL D CG1 1 
ATOM   3313 C  CG2 . VAL D 2 7   ? 58.061 -25.508 34.945  1.00 64.77  ? 713 VAL D CG2 1 
ATOM   3314 N  N   . ALA D 2 8   ? 55.592 -25.791 33.308  1.00 42.88  ? 714 ALA D N   1 
ATOM   3315 C  CA  . ALA D 2 8   ? 54.802 -26.578 32.362  1.00 42.17  ? 714 ALA D CA  1 
ATOM   3316 C  C   . ALA D 2 8   ? 53.350 -26.660 32.805  1.00 35.85  ? 714 ALA D C   1 
ATOM   3317 O  O   . ALA D 2 8   ? 53.049 -26.713 33.995  1.00 32.20  ? 714 ALA D O   1 
ATOM   3318 C  CB  . ALA D 2 8   ? 55.390 -27.967 32.196  1.00 41.34  ? 714 ALA D CB  1 
ATOM   3319 N  N   . GLY D 2 9   ? 52.444 -26.670 31.842  1.00 33.96  ? 715 GLY D N   1 
ATOM   3320 C  CA  . GLY D 2 9   ? 51.037 -26.778 32.165  1.00 34.82  ? 715 GLY D CA  1 
ATOM   3321 C  C   . GLY D 2 9   ? 50.549 -28.195 31.944  1.00 33.65  ? 715 GLY D C   1 
ATOM   3322 O  O   . GLY D 2 9   ? 51.323 -29.068 31.562  1.00 27.42  ? 715 GLY D O   1 
ATOM   3323 N  N   . PRO D 2 10  ? 49.255 -28.429 32.188  1.00 24.52  ? 716 PRO D N   1 
ATOM   3324 C  CA  . PRO D 2 10  ? 48.638 -29.713 31.853  1.00 25.59  ? 716 PRO D CA  1 
ATOM   3325 C  C   . PRO D 2 10  ? 48.659 -29.893 30.345  1.00 24.70  ? 716 PRO D C   1 
ATOM   3326 O  O   . PRO D 2 10  ? 48.924 -28.939 29.607  1.00 24.13  ? 716 PRO D O   1 
ATOM   3327 C  CB  . PRO D 2 10  ? 47.182 -29.541 32.297  1.00 27.19  ? 716 PRO D CB  1 
ATOM   3328 C  CG  . PRO D 2 10  ? 47.118 -28.255 33.057  1.00 29.61  ? 716 PRO D CG  1 
ATOM   3329 C  CD  . PRO D 2 10  ? 48.273 -27.425 32.629  1.00 25.81  ? 716 PRO D CD  1 
ATOM   3330 N  N   . TYR D 2 11  ? 48.355 -31.097 29.890  1.00 20.75  ? 717 TYR D N   1 
ATOM   3331 C  CA  . TYR D 2 11  ? 48.144 -31.333 28.473  1.00 24.11  ? 717 TYR D CA  1 
ATOM   3332 C  C   . TYR D 2 11  ? 46.773 -31.976 28.287  1.00 27.06  ? 717 TYR D C   1 
ATOM   3333 O  O   . TYR D 2 11  ? 46.505 -33.038 28.856  1.00 27.05  ? 717 TYR D O   1 
ATOM   3334 C  CB  . TYR D 2 11  ? 49.235 -32.247 27.919  1.00 26.87  ? 717 TYR D CB  1 
ATOM   3335 C  CG  . TYR D 2 11  ? 48.990 -32.641 26.487  1.00 31.52  ? 717 TYR D CG  1 
ATOM   3336 C  CD1 . TYR D 2 11  ? 49.393 -31.821 25.437  1.00 28.36  ? 717 TYR D CD1 1 
ATOM   3337 C  CD2 . TYR D 2 11  ? 48.334 -33.824 26.186  1.00 35.90  ? 717 TYR D CD2 1 
ATOM   3338 C  CE1 . TYR D 2 11  ? 49.154 -32.189 24.115  1.00 28.00  ? 717 TYR D CE1 1 
ATOM   3339 C  CE2 . TYR D 2 11  ? 48.094 -34.193 24.887  1.00 38.61  ? 717 TYR D CE2 1 
ATOM   3340 C  CZ  . TYR D 2 11  ? 48.500 -33.379 23.855  1.00 34.51  ? 717 TYR D CZ  1 
ATOM   3341 O  OH  . TYR D 2 11  ? 48.242 -33.779 22.566  1.00 39.07  ? 717 TYR D OH  1 
ATOM   3342 N  N   . ILE D 2 12  ? 45.905 -31.337 27.502  1.00 22.31  ? 718 ILE D N   1 
ATOM   3343 C  CA  . ILE D 2 12  ? 44.547 -31.843 27.309  1.00 18.84  ? 718 ILE D CA  1 
ATOM   3344 C  C   . ILE D 2 12  ? 44.565 -33.018 26.330  1.00 22.95  ? 718 ILE D C   1 
ATOM   3345 O  O   . ILE D 2 12  ? 44.949 -32.868 25.163  1.00 23.12  ? 718 ILE D O   1 
ATOM   3346 C  CB  . ILE D 2 12  ? 43.575 -30.743 26.806  1.00 21.36  ? 718 ILE D CB  1 
ATOM   3347 C  CG1 . ILE D 2 12  ? 43.460 -29.606 27.824  1.00 22.32  ? 718 ILE D CG1 1 
ATOM   3348 C  CG2 . ILE D 2 12  ? 42.192 -31.327 26.549  1.00 19.36  ? 718 ILE D CG2 1 
ATOM   3349 C  CD1 . ILE D 2 12  ? 42.876 -28.321 27.220  1.00 23.75  ? 718 ILE D CD1 1 
ATOM   3350 N  N   . THR D 2 13  ? 44.133 -34.183 26.808  1.00 21.73  ? 719 THR D N   1 
ATOM   3351 C  CA  . THR D 2 13  ? 44.194 -35.414 26.033  1.00 22.02  ? 719 THR D CA  1 
ATOM   3352 C  C   . THR D 2 13  ? 42.894 -35.750 25.323  1.00 29.02  ? 719 THR D C   1 
ATOM   3353 O  O   . THR D 2 13  ? 42.881 -36.587 24.413  1.00 34.17  ? 719 THR D O   1 
ATOM   3354 C  CB  . THR D 2 13  ? 44.513 -36.601 26.942  1.00 25.69  ? 719 THR D CB  1 
ATOM   3355 O  OG1 . THR D 2 13  ? 43.576 -36.625 28.028  1.00 28.21  ? 719 THR D OG1 1 
ATOM   3356 C  CG2 . THR D 2 13  ? 45.948 -36.492 27.468  1.00 22.34  ? 719 THR D CG2 1 
ATOM   3357 N  N   . PHE D 2 14  ? 41.808 -35.112 25.746  1.00 21.88  ? 720 PHE D N   1 
ATOM   3358 C  CA  . PHE D 2 14  ? 40.475 -35.465 25.280  1.00 24.13  ? 720 PHE D CA  1 
ATOM   3359 C  C   . PHE D 2 14  ? 39.498 -34.312 25.462  1.00 23.00  ? 720 PHE D C   1 
ATOM   3360 O  O   . PHE D 2 14  ? 39.456 -33.690 26.519  1.00 23.55  ? 720 PHE D O   1 
ATOM   3361 C  CB  . PHE D 2 14  ? 39.980 -36.689 26.066  1.00 30.84  ? 720 PHE D CB  1 
ATOM   3362 C  CG  . PHE D 2 14  ? 38.530 -37.025 25.832  1.00 36.10  ? 720 PHE D CG  1 
ATOM   3363 C  CD1 . PHE D 2 14  ? 38.158 -37.849 24.777  1.00 42.21  ? 720 PHE D CD1 1 
ATOM   3364 C  CD2 . PHE D 2 14  ? 37.544 -36.534 26.672  1.00 34.47  ? 720 PHE D CD2 1 
ATOM   3365 C  CE1 . PHE D 2 14  ? 36.825 -38.168 24.555  1.00 44.21  ? 720 PHE D CE1 1 
ATOM   3366 C  CE2 . PHE D 2 14  ? 36.213 -36.849 26.460  1.00 45.71  ? 720 PHE D CE2 1 
ATOM   3367 C  CZ  . PHE D 2 14  ? 35.853 -37.669 25.394  1.00 45.05  ? 720 PHE D CZ  1 
ATOM   3368 N  N   . THR D 2 15  ? 38.736 -33.998 24.417  1.00 20.72  ? 721 THR D N   1 
ATOM   3369 C  CA  . THR D 2 15  ? 37.569 -33.135 24.567  1.00 19.04  ? 721 THR D CA  1 
ATOM   3370 C  C   . THR D 2 15  ? 36.452 -33.711 23.729  1.00 27.46  ? 721 THR D C   1 
ATOM   3371 O  O   . THR D 2 15  ? 36.700 -34.202 22.629  1.00 28.58  ? 721 THR D O   1 
ATOM   3372 C  CB  . THR D 2 15  ? 37.806 -31.663 24.133  1.00 28.07  ? 721 THR D CB  1 
ATOM   3373 O  OG1 . THR D 2 15  ? 38.085 -31.607 22.729  1.00 25.70  ? 721 THR D OG1 1 
ATOM   3374 C  CG2 . THR D 2 15  ? 38.950 -31.055 24.905  1.00 23.34  ? 721 THR D CG2 1 
ATOM   3375 N  N   . ASP D 2 16  ? 35.230 -33.669 24.256  1.00 25.90  ? 722 ASP D N   1 
ATOM   3376 C  CA  . ASP D 2 16  ? 34.062 -34.099 23.497  1.00 28.34  ? 722 ASP D CA  1 
ATOM   3377 C  C   . ASP D 2 16  ? 32.774 -33.545 24.106  1.00 26.09  ? 722 ASP D C   1 
ATOM   3378 O  O   . ASP D 2 16  ? 32.670 -33.362 25.318  1.00 21.62  ? 722 ASP D O   1 
ATOM   3379 C  CB  . ASP D 2 16  ? 33.993 -35.628 23.412  1.00 37.95  ? 722 ASP D CB  1 
ATOM   3380 C  CG  . ASP D 2 16  ? 33.020 -36.111 22.338  1.00 47.46  ? 722 ASP D CG  1 
ATOM   3381 O  OD1 . ASP D 2 16  ? 32.619 -35.295 21.476  1.00 43.98  ? 722 ASP D OD1 1 
ATOM   3382 O  OD2 . ASP D 2 16  ? 32.658 -37.310 22.354  1.00 54.82  ? 722 ASP D OD2 1 
ATOM   3383 N  N   . ALA D 2 17  ? 31.802 -33.271 23.255  1.00 22.11  ? 723 ALA D N   1 
ATOM   3384 C  CA  . ALA D 2 17  ? 30.509 -32.793 23.707  1.00 21.41  ? 723 ALA D CA  1 
ATOM   3385 C  C   . ALA D 2 17  ? 29.808 -33.919 24.460  1.00 27.92  ? 723 ALA D C   1 
ATOM   3386 O  O   . ALA D 2 17  ? 29.853 -35.072 24.032  1.00 28.25  ? 723 ALA D O   1 
ATOM   3387 C  CB  . ALA D 2 17  ? 29.685 -32.360 22.521  1.00 26.23  ? 723 ALA D CB  1 
ATOM   3388 N  N   . VAL D 2 18  ? 29.179 -33.598 25.586  1.00 21.41  ? 724 VAL D N   1 
ATOM   3389 C  CA  . VAL D 2 18  ? 28.383 -34.592 26.285  1.00 28.13  ? 724 VAL D CA  1 
ATOM   3390 C  C   . VAL D 2 18  ? 26.896 -34.416 25.947  1.00 29.26  ? 724 VAL D C   1 
ATOM   3391 O  O   . VAL D 2 18  ? 26.150 -35.390 25.852  1.00 35.67  ? 724 VAL D O   1 
ATOM   3392 C  CB  . VAL D 2 18  ? 28.615 -34.563 27.814  1.00 32.72  ? 724 VAL D CB  1 
ATOM   3393 C  CG1 . VAL D 2 18  ? 30.050 -34.166 28.130  1.00 29.73  ? 724 VAL D CG1 1 
ATOM   3394 C  CG2 . VAL D 2 18  ? 27.653 -33.626 28.484  1.00 43.49  ? 724 VAL D CG2 1 
ATOM   3395 N  N   . ASN D 2 19  ? 26.473 -33.170 25.778  1.00 23.44  ? 725 ASN D N   1 
ATOM   3396 C  CA  . ASN D 2 19  ? 25.117 -32.866 25.316  1.00 24.40  ? 725 ASN D CA  1 
ATOM   3397 C  C   . ASN D 2 19  ? 25.154 -31.489 24.680  1.00 25.68  ? 725 ASN D C   1 
ATOM   3398 O  O   . ASN D 2 19  ? 26.225 -31.023 24.309  1.00 22.99  ? 725 ASN D O   1 
ATOM   3399 C  CB  . ASN D 2 19  ? 24.094 -32.950 26.451  1.00 27.29  ? 725 ASN D CB  1 
ATOM   3400 C  CG  . ASN D 2 19  ? 24.494 -32.145 27.671  1.00 27.58  ? 725 ASN D CG  1 
ATOM   3401 O  OD1 . ASN D 2 19  ? 24.904 -30.983 27.562  1.00 24.64  ? 725 ASN D OD1 1 
ATOM   3402 N  ND2 . ASN D 2 19  ? 24.352 -32.752 28.856  1.00 20.81  ? 725 ASN D ND2 1 
ATOM   3403 N  N   . GLU D 2 20  ? 24.008 -30.831 24.571  1.00 23.13  ? 726 GLU D N   1 
ATOM   3404 C  CA  . GLU D 2 20  ? 23.942 -29.561 23.849  1.00 24.61  ? 726 GLU D CA  1 
ATOM   3405 C  C   . GLU D 2 20  ? 24.462 -28.342 24.644  1.00 25.43  ? 726 GLU D C   1 
ATOM   3406 O  O   . GLU D 2 20  ? 24.611 -27.252 24.091  1.00 24.11  ? 726 GLU D O   1 
ATOM   3407 C  CB  . GLU D 2 20  ? 22.529 -29.328 23.289  1.00 30.42  ? 726 GLU D CB  1 
ATOM   3408 C  CG  . GLU D 2 20  ? 21.467 -28.961 24.308  1.00 45.66  ? 726 GLU D CG  1 
ATOM   3409 C  CD  . GLU D 2 20  ? 21.063 -30.116 25.216  1.00 57.90  ? 726 GLU D CD  1 
ATOM   3410 O  OE1 . GLU D 2 20  ? 21.510 -31.262 24.989  1.00 57.30  ? 726 GLU D OE1 1 
ATOM   3411 O  OE2 . GLU D 2 20  ? 20.288 -29.866 26.166  1.00 63.66  ? 726 GLU D OE2 1 
ATOM   3412 N  N   . THR D 2 21  ? 24.768 -28.524 25.928  1.00 19.01  ? 727 THR D N   1 
ATOM   3413 C  CA  . THR D 2 21  ? 25.238 -27.396 26.735  1.00 20.37  ? 727 THR D CA  1 
ATOM   3414 C  C   . THR D 2 21  ? 26.511 -27.694 27.524  1.00 23.67  ? 727 THR D C   1 
ATOM   3415 O  O   . THR D 2 21  ? 26.961 -26.872 28.317  1.00 22.52  ? 727 THR D O   1 
ATOM   3416 C  CB  . THR D 2 21  ? 24.161 -26.941 27.746  1.00 23.13  ? 727 THR D CB  1 
ATOM   3417 O  OG1 . THR D 2 21  ? 23.963 -27.968 28.732  1.00 24.41  ? 727 THR D OG1 1 
ATOM   3418 C  CG2 . THR D 2 21  ? 22.839 -26.661 27.032  1.00 27.69  ? 727 THR D CG2 1 
ATOM   3419 N  N   . THR D 2 22  ? 27.080 -28.872 27.309  1.00 21.26  ? 728 THR D N   1 
ATOM   3420 C  CA  . THR D 2 22  ? 28.164 -29.355 28.149  1.00 22.57  ? 728 THR D CA  1 
ATOM   3421 C  C   . THR D 2 22  ? 29.247 -30.005 27.289  1.00 20.22  ? 728 THR D C   1 
ATOM   3422 O  O   . THR D 2 22  ? 28.930 -30.739 26.339  1.00 21.65  ? 728 THR D O   1 
ATOM   3423 C  CB  . THR D 2 22  ? 27.621 -30.386 29.169  1.00 25.68  ? 728 THR D CB  1 
ATOM   3424 O  OG1 . THR D 2 22  ? 26.398 -29.902 29.745  1.00 26.31  ? 728 THR D OG1 1 
ATOM   3425 C  CG2 . THR D 2 22  ? 28.623 -30.651 30.280  1.00 27.38  ? 728 THR D CG2 1 
ATOM   3426 N  N   . ILE D 2 23  ? 30.506 -29.714 27.615  1.00 15.43  ? 729 ILE D N   1 
ATOM   3427 C  CA  . ILE D 2 23  ? 31.657 -30.356 26.999  1.00 18.95  ? 729 ILE D CA  1 
ATOM   3428 C  C   . ILE D 2 23  ? 32.561 -30.889 28.094  1.00 17.47  ? 729 ILE D C   1 
ATOM   3429 O  O   . ILE D 2 23  ? 32.846 -30.189 29.067  1.00 23.30  ? 729 ILE D O   1 
ATOM   3430 C  CB  . ILE D 2 23  ? 32.472 -29.365 26.144  1.00 16.24  ? 729 ILE D CB  1 
ATOM   3431 C  CG1 . ILE D 2 23  ? 31.739 -29.044 24.838  1.00 18.42  ? 729 ILE D CG1 1 
ATOM   3432 C  CG2 . ILE D 2 23  ? 33.870 -29.934 25.842  1.00 16.81  ? 729 ILE D CG2 1 
ATOM   3433 C  CD1 . ILE D 2 23  ? 32.309 -27.835 24.121  1.00 22.08  ? 729 ILE D CD1 1 
ATOM   3434 N  N   . MET D 2 24  ? 33.020 -32.127 27.927  1.00 20.72  ? 730 MET D N   1 
ATOM   3435 C  CA  . MET D 2 24  ? 33.906 -32.768 28.880  1.00 19.13  ? 730 MET D CA  1 
ATOM   3436 C  C   . MET D 2 24  ? 35.330 -32.765 28.352  1.00 23.74  ? 730 MET D C   1 
ATOM   3437 O  O   . MET D 2 24  ? 35.554 -32.909 27.148  1.00 25.94  ? 730 MET D O   1 
ATOM   3438 C  CB  . MET D 2 24  ? 33.475 -34.213 29.123  1.00 20.78  ? 730 MET D CB  1 
ATOM   3439 C  CG  . MET D 2 24  ? 34.479 -35.013 29.935  1.00 32.87  ? 730 MET D CG  1 
ATOM   3440 S  SD  . MET D 2 24  ? 33.799 -36.622 30.367  1.00 53.34  ? 730 MET D SD  1 
ATOM   3441 C  CE  . MET D 2 24  ? 32.280 -36.103 31.174  1.00 40.83  ? 730 MET D CE  1 
ATOM   3442 N  N   . LEU D 2 25  ? 36.292 -32.588 29.255  1.00 19.04  ? 731 LEU D N   1 
ATOM   3443 C  CA  . LEU D 2 25  ? 37.691 -32.756 28.899  1.00 17.85  ? 731 LEU D CA  1 
ATOM   3444 C  C   . LEU D 2 25  ? 38.488 -33.531 29.940  1.00 21.86  ? 731 LEU D C   1 
ATOM   3445 O  O   . LEU D 2 25  ? 38.107 -33.610 31.110  1.00 22.82  ? 731 LEU D O   1 
ATOM   3446 C  CB  . LEU D 2 25  ? 38.372 -31.415 28.565  1.00 21.69  ? 731 LEU D CB  1 
ATOM   3447 C  CG  . LEU D 2 25  ? 38.396 -30.138 29.433  1.00 29.68  ? 731 LEU D CG  1 
ATOM   3448 C  CD1 . LEU D 2 25  ? 37.120 -29.873 30.227  1.00 31.38  ? 731 LEU D CD1 1 
ATOM   3449 C  CD2 . LEU D 2 25  ? 39.625 -30.024 30.305  1.00 34.28  ? 731 LEU D CD2 1 
ATOM   3450 N  N   . LYS D 2 26  ? 39.577 -34.129 29.480  1.00 20.78  ? 732 LYS D N   1 
ATOM   3451 C  CA  . LYS D 2 26  ? 40.518 -34.819 30.353  1.00 21.12  ? 732 LYS D CA  1 
ATOM   3452 C  C   . LYS D 2 26  ? 41.916 -34.280 30.095  1.00 25.13  ? 732 LYS D C   1 
ATOM   3453 O  O   . LYS D 2 26  ? 42.229 -33.839 28.986  1.00 25.48  ? 732 LYS D O   1 
ATOM   3454 C  CB  . LYS D 2 26  ? 40.511 -36.323 30.083  1.00 24.15  ? 732 LYS D CB  1 
ATOM   3455 C  CG  . LYS D 2 26  ? 39.179 -36.999 30.298  1.00 35.26  ? 732 LYS D CG  1 
ATOM   3456 C  CD  . LYS D 2 26  ? 39.296 -38.514 30.116  1.00 43.70  ? 732 LYS D CD  1 
ATOM   3457 C  CE  . LYS D 2 26  ? 37.969 -39.200 30.365  1.00 55.26  ? 732 LYS D CE  1 
ATOM   3458 N  NZ  . LYS D 2 26  ? 38.064 -40.665 30.148  1.00 61.30  ? 732 LYS D NZ  1 
ATOM   3459 N  N   . TRP D 2 27  ? 42.772 -34.342 31.107  1.00 25.55  ? 733 TRP D N   1 
ATOM   3460 C  CA  . TRP D 2 27  ? 44.137 -33.869 30.946  1.00 25.54  ? 733 TRP D CA  1 
ATOM   3461 C  C   . TRP D 2 27  ? 45.114 -34.708 31.747  1.00 29.93  ? 733 TRP D C   1 
ATOM   3462 O  O   . TRP D 2 27  ? 44.730 -35.440 32.663  1.00 28.60  ? 733 TRP D O   1 
ATOM   3463 C  CB  . TRP D 2 27  ? 44.260 -32.402 31.367  1.00 25.53  ? 733 TRP D CB  1 
ATOM   3464 C  CG  . TRP D 2 27  ? 43.898 -32.149 32.817  1.00 22.81  ? 733 TRP D CG  1 
ATOM   3465 C  CD1 . TRP D 2 27  ? 44.736 -32.191 33.895  1.00 28.42  ? 733 TRP D CD1 1 
ATOM   3466 C  CD2 . TRP D 2 27  ? 42.606 -31.801 33.328  1.00 23.88  ? 733 TRP D CD2 1 
ATOM   3467 N  NE1 . TRP D 2 27  ? 44.041 -31.900 35.045  1.00 25.69  ? 733 TRP D NE1 1 
ATOM   3468 C  CE2 . TRP D 2 27  ? 42.732 -31.661 34.724  1.00 25.48  ? 733 TRP D CE2 1 
ATOM   3469 C  CE3 . TRP D 2 27  ? 41.353 -31.608 32.739  1.00 27.17  ? 733 TRP D CE3 1 
ATOM   3470 C  CZ2 . TRP D 2 27  ? 41.655 -31.323 35.538  1.00 27.12  ? 733 TRP D CZ2 1 
ATOM   3471 C  CZ3 . TRP D 2 27  ? 40.278 -31.280 33.554  1.00 29.43  ? 733 TRP D CZ3 1 
ATOM   3472 C  CH2 . TRP D 2 27  ? 40.437 -31.141 34.934  1.00 30.39  ? 733 TRP D CH2 1 
ATOM   3473 N  N   . MET D 2 28  ? 46.381 -34.601 31.389  1.00 29.78  ? 734 MET D N   1 
ATOM   3474 C  CA  . MET D 2 28  ? 47.433 -35.227 32.167  1.00 30.64  ? 734 MET D CA  1 
ATOM   3475 C  C   . MET D 2 28  ? 48.372 -34.141 32.664  1.00 30.27  ? 734 MET D C   1 
ATOM   3476 O  O   . MET D 2 28  ? 48.711 -33.217 31.918  1.00 32.20  ? 734 MET D O   1 
ATOM   3477 C  CB  . MET D 2 28  ? 48.193 -36.234 31.312  1.00 27.21  ? 734 MET D CB  1 
ATOM   3478 C  CG  . MET D 2 28  ? 48.790 -35.643 30.059  1.00 34.17  ? 734 MET D CG  1 
ATOM   3479 S  SD  . MET D 2 28  ? 49.479 -36.927 28.994  1.00 64.54  ? 734 MET D SD  1 
ATOM   3480 C  CE  . MET D 2 28  ? 51.082 -37.165 29.759  1.00 48.69  ? 734 MET D CE  1 
ATOM   3481 N  N   . TYR D 2 29  ? 48.775 -34.243 33.928  1.00 28.00  ? 735 TYR D N   1 
ATOM   3482 C  CA  . TYR D 2 29  ? 49.707 -33.283 34.509  1.00 32.05  ? 735 TYR D CA  1 
ATOM   3483 C  C   . TYR D 2 29  ? 50.802 -33.986 35.314  1.00 43.03  ? 735 TYR D C   1 
ATOM   3484 O  O   . TYR D 2 29  ? 50.543 -34.983 35.986  1.00 40.92  ? 735 TYR D O   1 
ATOM   3485 C  CB  . TYR D 2 29  ? 48.957 -32.274 35.387  1.00 34.93  ? 735 TYR D CB  1 
ATOM   3486 C  CG  . TYR D 2 29  ? 49.872 -31.299 36.095  1.00 37.22  ? 735 TYR D CG  1 
ATOM   3487 C  CD1 . TYR D 2 29  ? 50.659 -30.407 35.374  1.00 40.22  ? 735 TYR D CD1 1 
ATOM   3488 C  CD2 . TYR D 2 29  ? 49.951 -31.273 37.483  1.00 44.79  ? 735 TYR D CD2 1 
ATOM   3489 C  CE1 . TYR D 2 29  ? 51.502 -29.519 36.014  1.00 38.15  ? 735 TYR D CE1 1 
ATOM   3490 C  CE2 . TYR D 2 29  ? 50.794 -30.384 38.136  1.00 42.46  ? 735 TYR D CE2 1 
ATOM   3491 C  CZ  . TYR D 2 29  ? 51.564 -29.512 37.395  1.00 44.65  ? 735 TYR D CZ  1 
ATOM   3492 O  OH  . TYR D 2 29  ? 52.399 -28.631 38.038  1.00 45.75  ? 735 TYR D OH  1 
ATOM   3493 N  N   . ILE D 2 30  ? 52.019 -33.458 35.247  1.00 48.05  ? 736 ILE D N   1 
ATOM   3494 C  CA  . ILE D 2 30  ? 53.152 -34.069 35.948  1.00 60.32  ? 736 ILE D CA  1 
ATOM   3495 C  C   . ILE D 2 30  ? 53.569 -33.275 37.187  1.00 60.46  ? 736 ILE D C   1 
ATOM   3496 O  O   . ILE D 2 30  ? 54.379 -32.348 37.099  1.00 60.12  ? 736 ILE D O   1 
ATOM   3497 C  CB  . ILE D 2 30  ? 54.364 -34.249 35.009  1.00 66.97  ? 736 ILE D CB  1 
ATOM   3498 C  CG1 . ILE D 2 30  ? 53.986 -35.143 33.820  1.00 63.97  ? 736 ILE D CG1 1 
ATOM   3499 C  CG2 . ILE D 2 30  ? 55.550 -34.835 35.768  1.00 72.81  ? 736 ILE D CG2 1 
ATOM   3500 C  CD1 . ILE D 2 30  ? 55.086 -35.285 32.780  1.00 62.37  ? 736 ILE D CD1 1 
ATOM   3501 N  N   . PRO D 2 31  ? 53.011 -33.637 38.354  1.00 59.32  ? 737 PRO D N   1 
ATOM   3502 C  CA  . PRO D 2 31  ? 53.272 -32.895 39.590  1.00 62.40  ? 737 PRO D CA  1 
ATOM   3503 C  C   . PRO D 2 31  ? 54.742 -32.935 39.977  1.00 71.01  ? 737 PRO D C   1 
ATOM   3504 O  O   . PRO D 2 31  ? 55.103 -32.228 40.915  1.00 80.23  ? 737 PRO D O   1 
ATOM   3505 C  CB  . PRO D 2 31  ? 52.424 -33.635 40.633  1.00 61.54  ? 737 PRO D CB  1 
ATOM   3506 C  CG  . PRO D 2 31  ? 51.370 -34.338 39.844  1.00 60.85  ? 737 PRO D CG  1 
ATOM   3507 C  CD  . PRO D 2 31  ? 52.043 -34.729 38.561  1.00 60.65  ? 737 PRO D CD  1 
ATOM   3508 N  N   . THR D 2 37  ? 57.134 -26.509 44.831  1.00 67.35  ? 743 THR D N   1 
ATOM   3509 C  CA  . THR D 2 37  ? 55.892 -26.289 45.565  1.00 64.87  ? 743 THR D CA  1 
ATOM   3510 C  C   . THR D 2 37  ? 54.721 -26.969 44.842  1.00 60.02  ? 743 THR D C   1 
ATOM   3511 O  O   . THR D 2 37  ? 54.752 -27.127 43.621  1.00 53.92  ? 743 THR D O   1 
ATOM   3512 C  CB  . THR D 2 37  ? 55.641 -24.773 45.786  1.00 70.69  ? 743 THR D CB  1 
ATOM   3513 O  OG1 . THR D 2 37  ? 56.795 -24.190 46.409  1.00 66.38  ? 743 THR D OG1 1 
ATOM   3514 C  CG2 . THR D 2 37  ? 54.442 -24.537 46.682  1.00 73.60  ? 743 THR D CG2 1 
ATOM   3515 N  N   . PRO D 2 38  ? 53.705 -27.418 45.605  1.00 57.91  ? 744 PRO D N   1 
ATOM   3516 C  CA  . PRO D 2 38  ? 52.537 -28.108 45.040  1.00 53.44  ? 744 PRO D CA  1 
ATOM   3517 C  C   . PRO D 2 38  ? 51.525 -27.169 44.392  1.00 47.96  ? 744 PRO D C   1 
ATOM   3518 O  O   . PRO D 2 38  ? 51.449 -25.989 44.739  1.00 39.47  ? 744 PRO D O   1 
ATOM   3519 C  CB  . PRO D 2 38  ? 51.891 -28.782 46.263  1.00 54.25  ? 744 PRO D CB  1 
ATOM   3520 C  CG  . PRO D 2 38  ? 52.926 -28.743 47.343  1.00 58.05  ? 744 PRO D CG  1 
ATOM   3521 C  CD  . PRO D 2 38  ? 53.738 -27.516 47.074  1.00 56.44  ? 744 PRO D CD  1 
ATOM   3522 N  N   . ILE D 2 39  ? 50.736 -27.701 43.467  1.00 46.22  ? 745 ILE D N   1 
ATOM   3523 C  CA  . ILE D 2 39  ? 49.703 -26.898 42.828  1.00 46.55  ? 745 ILE D CA  1 
ATOM   3524 C  C   . ILE D 2 39  ? 48.434 -26.870 43.672  1.00 41.19  ? 745 ILE D C   1 
ATOM   3525 O  O   . ILE D 2 39  ? 48.139 -27.807 44.421  1.00 44.43  ? 745 ILE D O   1 
ATOM   3526 C  CB  . ILE D 2 39  ? 49.373 -27.389 41.406  1.00 52.26  ? 745 ILE D CB  1 
ATOM   3527 C  CG1 . ILE D 2 39  ? 48.623 -28.719 41.459  1.00 55.04  ? 745 ILE D CG1 1 
ATOM   3528 C  CG2 . ILE D 2 39  ? 50.643 -27.494 40.566  1.00 53.54  ? 745 ILE D CG2 1 
ATOM   3529 C  CD1 . ILE D 2 39  ? 48.030 -29.122 40.140  1.00 55.56  ? 745 ILE D CD1 1 
ATOM   3530 N  N   . HIS D 2 40  ? 47.698 -25.776 43.543  1.00 33.21  ? 746 HIS D N   1 
ATOM   3531 C  CA  . HIS D 2 40  ? 46.481 -25.529 44.295  1.00 27.92  ? 746 HIS D CA  1 
ATOM   3532 C  C   . HIS D 2 40  ? 45.274 -25.992 43.502  1.00 33.60  ? 746 HIS D C   1 
ATOM   3533 O  O   . HIS D 2 40  ? 44.207 -26.228 44.063  1.00 32.02  ? 746 HIS D O   1 
ATOM   3534 C  CB  . HIS D 2 40  ? 46.360 -24.031 44.560  1.00 35.58  ? 746 HIS D CB  1 
ATOM   3535 C  CG  . HIS D 2 40  ? 47.356 -23.513 45.550  1.00 41.05  ? 746 HIS D CG  1 
ATOM   3536 N  ND1 . HIS D 2 40  ? 48.395 -24.278 46.028  1.00 45.94  ? 746 HIS D ND1 1 
ATOM   3537 C  CD2 . HIS D 2 40  ? 47.481 -22.299 46.138  1.00 44.48  ? 746 HIS D CD2 1 
ATOM   3538 C  CE1 . HIS D 2 40  ? 49.111 -23.566 46.883  1.00 47.07  ? 746 HIS D CE1 1 
ATOM   3539 N  NE2 . HIS D 2 40  ? 48.577 -22.360 46.965  1.00 48.77  ? 746 HIS D NE2 1 
ATOM   3540 N  N   . GLY D 2 41  ? 45.441 -26.088 42.185  1.00 29.77  ? 747 GLY D N   1 
ATOM   3541 C  CA  . GLY D 2 41  ? 44.369 -26.538 41.316  1.00 23.01  ? 747 GLY D CA  1 
ATOM   3542 C  C   . GLY D 2 41  ? 44.646 -26.220 39.859  1.00 26.73  ? 747 GLY D C   1 
ATOM   3543 O  O   . GLY D 2 41  ? 45.781 -25.916 39.481  1.00 32.69  ? 747 GLY D O   1 
ATOM   3544 N  N   . PHE D 2 42  ? 43.606 -26.306 39.040  1.00 26.01  ? 748 PHE D N   1 
ATOM   3545 C  CA  . PHE D 2 42  ? 43.708 -25.982 37.623  1.00 27.63  ? 748 PHE D CA  1 
ATOM   3546 C  C   . PHE D 2 42  ? 42.693 -24.916 37.267  1.00 24.42  ? 748 PHE D C   1 
ATOM   3547 O  O   . PHE D 2 42  ? 41.646 -24.812 37.904  1.00 24.73  ? 748 PHE D O   1 
ATOM   3548 C  CB  . PHE D 2 42  ? 43.431 -27.218 36.769  1.00 24.90  ? 748 PHE D CB  1 
ATOM   3549 C  CG  . PHE D 2 42  ? 44.359 -28.352 37.030  1.00 25.25  ? 748 PHE D CG  1 
ATOM   3550 C  CD1 . PHE D 2 42  ? 44.023 -29.346 37.939  1.00 27.25  ? 748 PHE D CD1 1 
ATOM   3551 C  CD2 . PHE D 2 42  ? 45.562 -28.449 36.346  1.00 27.94  ? 748 PHE D CD2 1 
ATOM   3552 C  CE1 . PHE D 2 42  ? 44.872 -30.407 38.171  1.00 27.06  ? 748 PHE D CE1 1 
ATOM   3553 C  CE2 . PHE D 2 42  ? 46.427 -29.519 36.584  1.00 27.73  ? 748 PHE D CE2 1 
ATOM   3554 C  CZ  . PHE D 2 42  ? 46.076 -30.492 37.502  1.00 27.26  ? 748 PHE D CZ  1 
ATOM   3555 N  N   . TYR D 2 43  ? 42.998 -24.135 36.239  1.00 21.99  ? 749 TYR D N   1 
ATOM   3556 C  CA  . TYR D 2 43  ? 42.004 -23.246 35.654  1.00 24.14  ? 749 TYR D CA  1 
ATOM   3557 C  C   . TYR D 2 43  ? 41.704 -23.763 34.267  1.00 28.45  ? 749 TYR D C   1 
ATOM   3558 O  O   . TYR D 2 43  ? 42.630 -24.037 33.492  1.00 24.09  ? 749 TYR D O   1 
ATOM   3559 C  CB  . TYR D 2 43  ? 42.520 -21.810 35.540  1.00 25.75  ? 749 TYR D CB  1 
ATOM   3560 C  CG  . TYR D 2 43  ? 42.724 -21.080 36.849  1.00 27.27  ? 749 TYR D CG  1 
ATOM   3561 C  CD1 . TYR D 2 43  ? 43.896 -20.368 37.087  1.00 26.34  ? 749 TYR D CD1 1 
ATOM   3562 C  CD2 . TYR D 2 43  ? 41.750 -21.088 37.838  1.00 26.71  ? 749 TYR D CD2 1 
ATOM   3563 C  CE1 . TYR D 2 43  ? 44.096 -19.692 38.270  1.00 30.94  ? 749 TYR D CE1 1 
ATOM   3564 C  CE2 . TYR D 2 43  ? 41.943 -20.406 39.044  1.00 31.63  ? 749 TYR D CE2 1 
ATOM   3565 C  CZ  . TYR D 2 43  ? 43.125 -19.711 39.247  1.00 36.49  ? 749 TYR D CZ  1 
ATOM   3566 O  OH  . TYR D 2 43  ? 43.345 -19.033 40.425  1.00 40.14  ? 749 TYR D OH  1 
ATOM   3567 N  N   . ILE D 2 44  ? 40.415 -23.901 33.959  1.00 25.16  ? 750 ILE D N   1 
ATOM   3568 C  CA  . ILE D 2 44  ? 39.986 -24.294 32.619  1.00 20.42  ? 750 ILE D CA  1 
ATOM   3569 C  C   . ILE D 2 44  ? 39.305 -23.127 31.937  1.00 20.70  ? 750 ILE D C   1 
ATOM   3570 O  O   . ILE D 2 44  ? 38.261 -22.655 32.399  1.00 23.30  ? 750 ILE D O   1 
ATOM   3571 C  CB  . ILE D 2 44  ? 39.004 -25.487 32.652  1.00 21.37  ? 750 ILE D CB  1 
ATOM   3572 C  CG1 . ILE D 2 44  ? 39.719 -26.757 33.110  1.00 32.29  ? 750 ILE D CG1 1 
ATOM   3573 C  CG2 . ILE D 2 44  ? 38.386 -25.713 31.283  1.00 22.14  ? 750 ILE D CG2 1 
ATOM   3574 C  CD1 . ILE D 2 44  ? 39.660 -26.990 34.586  1.00 39.68  ? 750 ILE D CD1 1 
ATOM   3575 N  N   . TYR D 2 45  ? 39.910 -22.660 30.846  1.00 19.89  ? 751 TYR D N   1 
ATOM   3576 C  CA  . TYR D 2 45  ? 39.432 -21.507 30.099  1.00 17.09  ? 751 TYR D CA  1 
ATOM   3577 C  C   . TYR D 2 45  ? 38.640 -21.956 28.886  1.00 20.93  ? 751 TYR D C   1 
ATOM   3578 O  O   . TYR D 2 45  ? 38.998 -22.940 28.228  1.00 23.33  ? 751 TYR D O   1 
ATOM   3579 C  CB  . TYR D 2 45  ? 40.609 -20.658 29.609  1.00 17.67  ? 751 TYR D CB  1 
ATOM   3580 C  CG  . TYR D 2 45  ? 41.467 -20.080 30.710  1.00 23.52  ? 751 TYR D CG  1 
ATOM   3581 C  CD1 . TYR D 2 45  ? 41.332 -18.756 31.084  1.00 29.90  ? 751 TYR D CD1 1 
ATOM   3582 C  CD2 . TYR D 2 45  ? 42.421 -20.854 31.372  1.00 27.33  ? 751 TYR D CD2 1 
ATOM   3583 C  CE1 . TYR D 2 45  ? 42.112 -18.210 32.079  1.00 32.29  ? 751 TYR D CE1 1 
ATOM   3584 C  CE2 . TYR D 2 45  ? 43.220 -20.306 32.383  1.00 25.44  ? 751 TYR D CE2 1 
ATOM   3585 C  CZ  . TYR D 2 45  ? 43.048 -18.980 32.725  1.00 30.70  ? 751 TYR D CZ  1 
ATOM   3586 O  OH  . TYR D 2 45  ? 43.814 -18.398 33.719  1.00 32.21  ? 751 TYR D OH  1 
ATOM   3587 N  N   . TYR D 2 46  ? 37.580 -21.217 28.564  1.00 17.15  ? 752 TYR D N   1 
ATOM   3588 C  CA  . TYR D 2 46  ? 36.775 -21.555 27.400  1.00 16.27  ? 752 TYR D CA  1 
ATOM   3589 C  C   . TYR D 2 46  ? 36.115 -20.309 26.838  1.00 21.24  ? 752 TYR D C   1 
ATOM   3590 O  O   . TYR D 2 46  ? 35.690 -19.413 27.573  1.00 20.88  ? 752 TYR D O   1 
ATOM   3591 C  CB  . TYR D 2 46  ? 35.739 -22.625 27.738  1.00 18.63  ? 752 TYR D CB  1 
ATOM   3592 C  CG  . TYR D 2 46  ? 34.793 -22.255 28.853  1.00 23.33  ? 752 TYR D CG  1 
ATOM   3593 C  CD1 . TYR D 2 46  ? 33.522 -21.759 28.578  1.00 28.11  ? 752 TYR D CD1 1 
ATOM   3594 C  CD2 . TYR D 2 46  ? 35.159 -22.424 30.185  1.00 28.06  ? 752 TYR D CD2 1 
ATOM   3595 C  CE1 . TYR D 2 46  ? 32.643 -21.435 29.596  1.00 32.87  ? 752 TYR D CE1 1 
ATOM   3596 C  CE2 . TYR D 2 46  ? 34.290 -22.092 31.209  1.00 30.19  ? 752 TYR D CE2 1 
ATOM   3597 C  CZ  . TYR D 2 46  ? 33.032 -21.602 30.903  1.00 34.54  ? 752 TYR D CZ  1 
ATOM   3598 O  OH  . TYR D 2 46  ? 32.158 -21.271 31.909  1.00 46.68  ? 752 TYR D OH  1 
ATOM   3599 N  N   . ARG D 2 47  ? 36.037 -20.264 25.519  1.00 16.40  ? 753 ARG D N   1 
ATOM   3600 C  CA  . ARG D 2 47  ? 35.623 -19.069 24.805  1.00 19.58  ? 753 ARG D CA  1 
ATOM   3601 C  C   . ARG D 2 47  ? 34.955 -19.536 23.528  1.00 19.20  ? 753 ARG D C   1 
ATOM   3602 O  O   . ARG D 2 47  ? 35.396 -20.525 22.935  1.00 17.15  ? 753 ARG D O   1 
ATOM   3603 C  CB  . ARG D 2 47  ? 36.866 -18.236 24.496  1.00 23.80  ? 753 ARG D CB  1 
ATOM   3604 C  CG  . ARG D 2 47  ? 36.735 -17.283 23.334  1.00 26.62  ? 753 ARG D CG  1 
ATOM   3605 C  CD  . ARG D 2 47  ? 38.048 -16.563 23.079  1.00 23.80  ? 753 ARG D CD  1 
ATOM   3606 N  NE  . ARG D 2 47  ? 38.948 -17.325 22.215  1.00 23.23  ? 753 ARG D NE  1 
ATOM   3607 C  CZ  . ARG D 2 47  ? 40.107 -16.858 21.752  1.00 18.68  ? 753 ARG D CZ  1 
ATOM   3608 N  NH1 . ARG D 2 47  ? 40.514 -15.641 22.082  1.00 19.91  ? 753 ARG D NH1 1 
ATOM   3609 N  NH2 . ARG D 2 47  ? 40.865 -17.605 20.965  1.00 17.69  ? 753 ARG D NH2 1 
ATOM   3610 N  N   . PRO D 2 48  ? 33.867 -18.865 23.114  1.00 19.23  ? 754 PRO D N   1 
ATOM   3611 C  CA  . PRO D 2 48  ? 33.316 -19.223 21.805  1.00 16.28  ? 754 PRO D CA  1 
ATOM   3612 C  C   . PRO D 2 48  ? 34.378 -19.073 20.715  1.00 13.41  ? 754 PRO D C   1 
ATOM   3613 O  O   . PRO D 2 48  ? 35.083 -18.068 20.652  1.00 16.01  ? 754 PRO D O   1 
ATOM   3614 C  CB  . PRO D 2 48  ? 32.181 -18.209 21.601  1.00 23.28  ? 754 PRO D CB  1 
ATOM   3615 C  CG  . PRO D 2 48  ? 31.771 -17.813 23.002  1.00 23.42  ? 754 PRO D CG  1 
ATOM   3616 C  CD  . PRO D 2 48  ? 33.035 -17.877 23.830  1.00 20.13  ? 754 PRO D CD  1 
ATOM   3617 N  N   . THR D 2 49  ? 34.487 -20.086 19.865  1.00 17.68  ? 755 THR D N   1 
ATOM   3618 C  CA  . THR D 2 49  ? 35.441 -20.078 18.760  1.00 16.68  ? 755 THR D CA  1 
ATOM   3619 C  C   . THR D 2 49  ? 35.282 -18.854 17.864  1.00 19.69  ? 755 THR D C   1 
ATOM   3620 O  O   . THR D 2 49  ? 36.259 -18.378 17.296  1.00 15.96  ? 755 THR D O   1 
ATOM   3621 C  CB  . THR D 2 49  ? 35.343 -21.387 17.936  1.00 14.43  ? 755 THR D CB  1 
ATOM   3622 O  OG1 . THR D 2 49  ? 35.649 -22.497 18.803  1.00 16.68  ? 755 THR D OG1 1 
ATOM   3623 C  CG2 . THR D 2 49  ? 36.287 -21.358 16.752  1.00 15.82  ? 755 THR D CG2 1 
ATOM   3624 N  N   . ASP D 2 50  ? 34.062 -18.330 17.745  1.00 14.56  ? 756 ASP D N   1 
ATOM   3625 C  CA  . ASP D 2 50  ? 33.865 -17.115 16.962  1.00 18.47  ? 756 ASP D CA  1 
ATOM   3626 C  C   . ASP D 2 50  ? 34.641 -15.892 17.489  1.00 17.22  ? 756 ASP D C   1 
ATOM   3627 O  O   . ASP D 2 50  ? 34.775 -14.883 16.785  1.00 18.91  ? 756 ASP D O   1 
ATOM   3628 C  CB  . ASP D 2 50  ? 32.377 -16.778 16.848  1.00 19.37  ? 756 ASP D CB  1 
ATOM   3629 C  CG  . ASP D 2 50  ? 31.650 -17.616 15.783  1.00 24.56  ? 756 ASP D CG  1 
ATOM   3630 O  OD1 . ASP D 2 50  ? 32.312 -18.272 14.940  1.00 18.16  ? 756 ASP D OD1 1 
ATOM   3631 O  OD2 . ASP D 2 50  ? 30.397 -17.605 15.786  1.00 22.85  ? 756 ASP D OD2 1 
ATOM   3632 N  N   . SER D 2 51  ? 35.127 -15.956 18.726  1.00 20.37  ? 757 SER D N   1 
ATOM   3633 C  CA  . SER D 2 51  ? 35.912 -14.847 19.277  1.00 18.04  ? 757 SER D CA  1 
ATOM   3634 C  C   . SER D 2 51  ? 37.394 -15.141 19.170  1.00 18.78  ? 757 SER D C   1 
ATOM   3635 O  O   . SER D 2 51  ? 37.841 -16.253 19.483  1.00 18.39  ? 757 SER D O   1 
ATOM   3636 C  CB  . SER D 2 51  ? 35.565 -14.578 20.746  1.00 21.89  ? 757 SER D CB  1 
ATOM   3637 O  OG  . SER D 2 51  ? 36.533 -13.704 21.332  1.00 22.51  ? 757 SER D OG  1 
ATOM   3638 N  N   . ASP D 2 52  ? 38.163 -14.157 18.709  1.00 16.77  ? 758 ASP D N   1 
ATOM   3639 C  CA  . ASP D 2 52  ? 39.620 -14.276 18.746  1.00 19.88  ? 758 ASP D CA  1 
ATOM   3640 C  C   . ASP D 2 52  ? 40.214 -13.361 19.814  1.00 25.49  ? 758 ASP D C   1 
ATOM   3641 O  O   . ASP D 2 52  ? 41.425 -13.145 19.851  1.00 21.51  ? 758 ASP D O   1 
ATOM   3642 C  CB  . ASP D 2 52  ? 40.228 -13.942 17.387  1.00 18.72  ? 758 ASP D CB  1 
ATOM   3643 C  CG  . ASP D 2 52  ? 39.768 -14.876 16.309  1.00 20.41  ? 758 ASP D CG  1 
ATOM   3644 O  OD1 . ASP D 2 52  ? 39.984 -14.570 15.115  1.00 15.91  ? 758 ASP D OD1 1 
ATOM   3645 O  OD2 . ASP D 2 52  ? 39.163 -15.910 16.664  1.00 16.84  ? 758 ASP D OD2 1 
ATOM   3646 N  N   . ASN D 2 53  ? 39.354 -12.830 20.676  1.00 26.37  ? 759 ASN D N   1 
ATOM   3647 C  CA  A ASN D 2 53  ? 39.772 -11.954 21.760  0.50 26.83  ? 759 ASN D CA  1 
ATOM   3648 C  CA  B ASN D 2 53  ? 39.786 -11.955 21.766  0.50 27.33  ? 759 ASN D CA  1 
ATOM   3649 C  C   . ASN D 2 53  ? 40.026 -12.743 23.045  1.00 21.84  ? 759 ASN D C   1 
ATOM   3650 O  O   . ASN D 2 53  ? 39.106 -13.340 23.592  1.00 21.71  ? 759 ASN D O   1 
ATOM   3651 C  CB  A ASN D 2 53  ? 38.684 -10.901 21.987  0.50 30.34  ? 759 ASN D CB  1 
ATOM   3652 C  CB  B ASN D 2 53  ? 38.729 -10.884 22.035  0.50 28.56  ? 759 ASN D CB  1 
ATOM   3653 C  CG  A ASN D 2 53  ? 39.082 -9.854  22.996  0.50 29.23  ? 759 ASN D CG  1 
ATOM   3654 C  CG  B ASN D 2 53  ? 38.629 -9.864  20.913  0.50 40.25  ? 759 ASN D CG  1 
ATOM   3655 O  OD1 A ASN D 2 53  ? 40.098 -9.980  23.676  0.50 28.82  ? 759 ASN D OD1 1 
ATOM   3656 O  OD1 B ASN D 2 53  ? 37.529 -9.460  20.515  0.50 42.45  ? 759 ASN D OD1 1 
ATOM   3657 N  ND2 A ASN D 2 53  ? 38.274 -8.807  23.104  0.50 29.23  ? 759 ASN D ND2 1 
ATOM   3658 N  ND2 B ASN D 2 53  ? 39.784 -9.441  20.395  0.50 48.76  ? 759 ASN D ND2 1 
ATOM   3659 N  N   . ASP D 2 54  ? 41.265 -12.731 23.532  1.00 22.56  ? 760 ASP D N   1 
ATOM   3660 C  CA  . ASP D 2 54  ? 41.592 -13.524 24.722  1.00 27.89  ? 760 ASP D CA  1 
ATOM   3661 C  C   . ASP D 2 54  ? 40.838 -13.043 25.966  1.00 24.08  ? 760 ASP D C   1 
ATOM   3662 O  O   . ASP D 2 54  ? 40.721 -13.764 26.954  1.00 23.29  ? 760 ASP D O   1 
ATOM   3663 C  CB  . ASP D 2 54  ? 43.107 -13.584 24.953  1.00 35.98  ? 760 ASP D CB  1 
ATOM   3664 C  CG  . ASP D 2 54  ? 43.829 -14.455 23.916  1.00 38.73  ? 760 ASP D CG  1 
ATOM   3665 O  OD1 . ASP D 2 54  ? 43.151 -15.110 23.085  1.00 35.83  ? 760 ASP D OD1 1 
ATOM   3666 O  OD2 . ASP D 2 54  ? 45.077 -14.493 23.927  1.00 39.72  ? 760 ASP D OD2 1 
ATOM   3667 N  N   . SER D 2 55  ? 40.295 -11.835 25.900  1.00 22.33  ? 761 SER D N   1 
ATOM   3668 C  CA  . SER D 2 55  ? 39.513 -11.293 27.005  1.00 33.06  ? 761 SER D CA  1 
ATOM   3669 C  C   . SER D 2 55  ? 38.154 -11.965 27.136  1.00 33.32  ? 761 SER D C   1 
ATOM   3670 O  O   . SER D 2 55  ? 37.455 -11.773 28.127  1.00 33.39  ? 761 SER D O   1 
ATOM   3671 C  CB  . SER D 2 55  ? 39.331 -9.791  26.821  1.00 42.12  ? 761 SER D CB  1 
ATOM   3672 O  OG  . SER D 2 55  ? 40.590 -9.163  26.665  1.00 51.94  ? 761 SER D OG  1 
ATOM   3673 N  N   . ASP D 2 56  ? 37.787 -12.759 26.133  1.00 23.75  ? 762 ASP D N   1 
ATOM   3674 C  CA  . ASP D 2 56  ? 36.489 -13.431 26.115  1.00 25.15  ? 762 ASP D CA  1 
ATOM   3675 C  C   . ASP D 2 56  ? 36.515 -14.831 26.728  1.00 24.00  ? 762 ASP D C   1 
ATOM   3676 O  O   . ASP D 2 56  ? 35.489 -15.514 26.752  1.00 27.65  ? 762 ASP D O   1 
ATOM   3677 C  CB  . ASP D 2 56  ? 35.959 -13.540 24.680  1.00 24.22  ? 762 ASP D CB  1 
ATOM   3678 C  CG  . ASP D 2 56  ? 35.367 -12.239 24.166  1.00 31.46  ? 762 ASP D CG  1 
ATOM   3679 O  OD1 . ASP D 2 56  ? 34.818 -11.460 24.980  1.00 33.82  ? 762 ASP D OD1 1 
ATOM   3680 O  OD2 . ASP D 2 56  ? 35.435 -12.003 22.941  1.00 20.91  ? 762 ASP D OD2 1 
ATOM   3681 N  N   . TYR D 2 57  ? 37.675 -15.292 27.183  1.00 21.93  ? 763 TYR D N   1 
ATOM   3682 C  CA  . TYR D 2 57  ? 37.709 -16.587 27.867  1.00 19.76  ? 763 TYR D CA  1 
ATOM   3683 C  C   . TYR D 2 57  ? 37.057 -16.493 29.239  1.00 27.95  ? 763 TYR D C   1 
ATOM   3684 O  O   . TYR D 2 57  ? 37.361 -15.584 30.017  1.00 26.25  ? 763 TYR D O   1 
ATOM   3685 C  CB  . TYR D 2 57  ? 39.138 -17.086 28.082  1.00 19.97  ? 763 TYR D CB  1 
ATOM   3686 C  CG  . TYR D 2 57  ? 39.778 -17.749 26.901  1.00 19.39  ? 763 TYR D CG  1 
ATOM   3687 C  CD1 . TYR D 2 57  ? 40.636 -17.039 26.072  1.00 22.94  ? 763 TYR D CD1 1 
ATOM   3688 C  CD2 . TYR D 2 57  ? 39.546 -19.093 26.618  1.00 21.86  ? 763 TYR D CD2 1 
ATOM   3689 C  CE1 . TYR D 2 57  ? 41.242 -17.643 24.984  1.00 20.88  ? 763 TYR D CE1 1 
ATOM   3690 C  CE2 . TYR D 2 57  ? 40.150 -19.705 25.532  1.00 21.08  ? 763 TYR D CE2 1 
ATOM   3691 C  CZ  . TYR D 2 57  ? 40.998 -18.976 24.727  1.00 18.30  ? 763 TYR D CZ  1 
ATOM   3692 O  OH  . TYR D 2 57  ? 41.593 -19.579 23.641  1.00 17.04  ? 763 TYR D OH  1 
ATOM   3693 N  N   . LYS D 2 58  ? 36.174 -17.439 29.531  1.00 22.92  ? 764 LYS D N   1 
ATOM   3694 C  CA  . LYS D 2 58  ? 35.681 -17.620 30.885  1.00 22.39  ? 764 LYS D CA  1 
ATOM   3695 C  C   . LYS D 2 58  ? 36.567 -18.674 31.508  1.00 26.60  ? 764 LYS D C   1 
ATOM   3696 O  O   . LYS D 2 58  ? 37.329 -19.340 30.806  1.00 22.68  ? 764 LYS D O   1 
ATOM   3697 C  CB  . LYS D 2 58  ? 34.227 -18.061 30.865  1.00 22.46  ? 764 LYS D CB  1 
ATOM   3698 C  CG  . LYS D 2 58  ? 33.286 -16.961 30.420  1.00 21.45  ? 764 LYS D CG  1 
ATOM   3699 C  CD  . LYS D 2 58  ? 31.887 -17.493 30.257  1.00 30.47  ? 764 LYS D CD  1 
ATOM   3700 C  CE  . LYS D 2 58  ? 30.921 -16.371 29.916  1.00 32.31  ? 764 LYS D CE  1 
ATOM   3701 N  NZ  . LYS D 2 58  ? 29.519 -16.890 29.896  1.00 42.17  ? 764 LYS D NZ  1 
ATOM   3702 N  N   . LYS D 2 59  ? 36.481 -18.834 32.818  1.00 22.62  ? 765 LYS D N   1 
ATOM   3703 C  CA  . LYS D 2 59  ? 37.385 -19.736 33.506  1.00 24.54  ? 765 LYS D CA  1 
ATOM   3704 C  C   . LYS D 2 59  ? 36.664 -20.499 34.612  1.00 30.52  ? 765 LYS D C   1 
ATOM   3705 O  O   . LYS D 2 59  ? 35.908 -19.903 35.379  1.00 36.75  ? 765 LYS D O   1 
ATOM   3706 C  CB  . LYS D 2 59  ? 38.539 -18.919 34.091  1.00 30.96  ? 765 LYS D CB  1 
ATOM   3707 C  CG  . LYS D 2 59  ? 39.487 -19.701 34.960  1.00 37.97  ? 765 LYS D CG  1 
ATOM   3708 C  CD  . LYS D 2 59  ? 40.530 -18.776 35.554  1.00 40.09  ? 765 LYS D CD  1 
ATOM   3709 C  CE  . LYS D 2 59  ? 39.876 -17.627 36.285  1.00 39.43  ? 765 LYS D CE  1 
ATOM   3710 N  NZ  . LYS D 2 59  ? 40.894 -16.796 36.959  1.00 40.55  ? 765 LYS D NZ  1 
ATOM   3711 N  N   . ASP D 2 60  ? 36.879 -21.812 34.677  1.00 27.33  ? 766 ASP D N   1 
ATOM   3712 C  CA  . ASP D 2 60  ? 36.402 -22.623 35.805  1.00 26.16  ? 766 ASP D CA  1 
ATOM   3713 C  C   . ASP D 2 60  ? 37.606 -23.055 36.640  1.00 28.25  ? 766 ASP D C   1 
ATOM   3714 O  O   . ASP D 2 60  ? 38.659 -23.363 36.085  1.00 28.59  ? 766 ASP D O   1 
ATOM   3715 C  CB  . ASP D 2 60  ? 35.701 -23.896 35.314  1.00 28.11  ? 766 ASP D CB  1 
ATOM   3716 C  CG  . ASP D 2 60  ? 34.358 -23.629 34.646  1.00 28.40  ? 766 ASP D CG  1 
ATOM   3717 O  OD1 . ASP D 2 60  ? 33.919 -22.462 34.601  1.00 32.23  ? 766 ASP D OD1 1 
ATOM   3718 O  OD2 . ASP D 2 60  ? 33.743 -24.607 34.173  1.00 28.05  ? 766 ASP D OD2 1 
ATOM   3719 N  N   . MET D 2 61  ? 37.447 -23.109 37.961  1.00 29.03  ? 767 MET D N   1 
ATOM   3720 C  CA  . MET D 2 61  ? 38.503 -23.627 38.837  1.00 27.98  ? 767 MET D CA  1 
ATOM   3721 C  C   . MET D 2 61  ? 38.199 -25.040 39.326  1.00 31.31  ? 767 MET D C   1 
ATOM   3722 O  O   . MET D 2 61  ? 37.109 -25.290 39.843  1.00 32.47  ? 767 MET D O   1 
ATOM   3723 C  CB  . MET D 2 61  ? 38.694 -22.707 40.047  1.00 31.21  ? 767 MET D CB  1 
ATOM   3724 C  CG  . MET D 2 61  ? 39.878 -23.096 40.942  1.00 33.00  ? 767 MET D CG  1 
ATOM   3725 S  SD  . MET D 2 61  ? 39.513 -24.316 42.234  1.00 48.29  ? 767 MET D SD  1 
ATOM   3726 C  CE  . MET D 2 61  ? 38.606 -23.296 43.403  1.00 41.02  ? 767 MET D CE  1 
ATOM   3727 N  N   . VAL D 2 62  ? 39.158 -25.958 39.179  1.00 26.31  ? 768 VAL D N   1 
ATOM   3728 C  CA  . VAL D 2 62  ? 39.019 -27.290 39.774  1.00 30.77  ? 768 VAL D CA  1 
ATOM   3729 C  C   . VAL D 2 62  ? 40.219 -27.628 40.667  1.00 33.64  ? 768 VAL D C   1 
ATOM   3730 O  O   . VAL D 2 62  ? 41.323 -27.122 40.454  1.00 30.25  ? 768 VAL D O   1 
ATOM   3731 C  CB  . VAL D 2 62  ? 38.814 -28.401 38.718  1.00 31.87  ? 768 VAL D CB  1 
ATOM   3732 C  CG1 . VAL D 2 62  ? 37.707 -28.016 37.736  1.00 33.95  ? 768 VAL D CG1 1 
ATOM   3733 C  CG2 . VAL D 2 62  ? 40.111 -28.676 37.983  1.00 35.16  ? 768 VAL D CG2 1 
ATOM   3734 N  N   . GLU D 2 63  ? 39.998 -28.476 41.673  1.00 33.94  ? 769 GLU D N   1 
ATOM   3735 C  CA  . GLU D 2 63  ? 41.059 -28.856 42.608  1.00 36.23  ? 769 GLU D CA  1 
ATOM   3736 C  C   . GLU D 2 63  ? 42.195 -29.606 41.916  1.00 37.00  ? 769 GLU D C   1 
ATOM   3737 O  O   . GLU D 2 63  ? 42.016 -30.159 40.829  1.00 35.74  ? 769 GLU D O   1 
ATOM   3738 C  CB  . GLU D 2 63  ? 40.500 -29.701 43.762  1.00 44.93  ? 769 GLU D CB  1 
ATOM   3739 C  CG  . GLU D 2 63  ? 39.609 -28.931 44.730  1.00 50.62  ? 769 GLU D CG  1 
ATOM   3740 C  CD  . GLU D 2 63  ? 40.331 -27.767 45.391  1.00 55.91  ? 769 GLU D CD  1 
ATOM   3741 O  OE1 . GLU D 2 63  ? 41.515 -27.925 45.756  1.00 58.00  ? 769 GLU D OE1 1 
ATOM   3742 O  OE2 . GLU D 2 63  ? 39.712 -26.691 45.548  1.00 56.30  ? 769 GLU D OE2 1 
ATOM   3743 N  N   . GLY D 2 64  ? 43.356 -29.638 42.565  1.00 39.78  ? 770 GLY D N   1 
ATOM   3744 C  CA  . GLY D 2 64  ? 44.567 -30.191 41.982  1.00 38.44  ? 770 GLY D CA  1 
ATOM   3745 C  C   . GLY D 2 64  ? 44.603 -31.698 41.835  1.00 47.37  ? 770 GLY D C   1 
ATOM   3746 O  O   . GLY D 2 64  ? 45.554 -32.242 41.271  1.00 50.02  ? 770 GLY D O   1 
ATOM   3747 N  N   . ASP D 2 65  ? 43.571 -32.373 42.332  1.00 48.52  ? 771 ASP D N   1 
ATOM   3748 C  CA  . ASP D 2 65  ? 43.517 -33.833 42.287  1.00 50.47  ? 771 ASP D CA  1 
ATOM   3749 C  C   . ASP D 2 65  ? 42.693 -34.354 41.110  1.00 45.97  ? 771 ASP D C   1 
ATOM   3750 O  O   . ASP D 2 65  ? 42.645 -35.558 40.865  1.00 51.99  ? 771 ASP D O   1 
ATOM   3751 C  CB  . ASP D 2 65  ? 42.970 -34.400 43.605  1.00 57.82  ? 771 ASP D CB  1 
ATOM   3752 C  CG  . ASP D 2 65  ? 41.533 -33.984 43.873  1.00 66.20  ? 771 ASP D CG  1 
ATOM   3753 O  OD1 . ASP D 2 65  ? 41.218 -32.786 43.715  1.00 69.22  ? 771 ASP D OD1 1 
ATOM   3754 O  OD2 . ASP D 2 65  ? 40.718 -34.852 44.252  1.00 69.25  ? 771 ASP D OD2 1 
ATOM   3755 N  N   . LYS D 2 66  ? 42.056 -33.447 40.380  1.00 37.54  ? 772 LYS D N   1 
ATOM   3756 C  CA  . LYS D 2 66  ? 41.177 -33.830 39.276  1.00 33.25  ? 772 LYS D CA  1 
ATOM   3757 C  C   . LYS D 2 66  ? 41.959 -34.073 37.987  1.00 36.02  ? 772 LYS D C   1 
ATOM   3758 O  O   . LYS D 2 66  ? 43.050 -33.540 37.808  1.00 39.11  ? 772 LYS D O   1 
ATOM   3759 C  CB  . LYS D 2 66  ? 40.129 -32.742 39.057  1.00 40.71  ? 772 LYS D CB  1 
ATOM   3760 C  CG  . LYS D 2 66  ? 39.392 -32.335 40.331  1.00 44.93  ? 772 LYS D CG  1 
ATOM   3761 C  CD  . LYS D 2 66  ? 38.582 -33.492 40.898  1.00 49.97  ? 772 LYS D CD  1 
ATOM   3762 C  CE  . LYS D 2 66  ? 37.723 -33.036 42.072  1.00 56.86  ? 772 LYS D CE  1 
ATOM   3763 N  NZ  . LYS D 2 66  ? 37.015 -34.168 42.729  1.00 60.94  ? 772 LYS D NZ  1 
ATOM   3764 N  N   . TYR D 2 67  ? 41.409 -34.884 37.087  1.00 30.86  ? 773 TYR D N   1 
ATOM   3765 C  CA  . TYR D 2 67  ? 42.052 -35.091 35.788  1.00 24.80  ? 773 TYR D CA  1 
ATOM   3766 C  C   . TYR D 2 67  ? 41.041 -35.025 34.638  1.00 27.52  ? 773 TYR D C   1 
ATOM   3767 O  O   . TYR D 2 67  ? 41.369 -35.322 33.488  1.00 28.15  ? 773 TYR D O   1 
ATOM   3768 C  CB  . TYR D 2 67  ? 42.832 -36.401 35.766  1.00 31.03  ? 773 TYR D CB  1 
ATOM   3769 C  CG  . TYR D 2 67  ? 41.966 -37.636 35.841  1.00 40.69  ? 773 TYR D CG  1 
ATOM   3770 C  CD1 . TYR D 2 67  ? 41.460 -38.220 34.685  1.00 50.53  ? 773 TYR D CD1 1 
ATOM   3771 C  CD2 . TYR D 2 67  ? 41.649 -38.216 37.065  1.00 44.13  ? 773 TYR D CD2 1 
ATOM   3772 C  CE1 . TYR D 2 67  ? 40.663 -39.343 34.739  1.00 53.20  ? 773 TYR D CE1 1 
ATOM   3773 C  CE2 . TYR D 2 67  ? 40.850 -39.344 37.127  1.00 50.97  ? 773 TYR D CE2 1 
ATOM   3774 C  CZ  . TYR D 2 67  ? 40.361 -39.901 35.959  1.00 54.07  ? 773 TYR D CZ  1 
ATOM   3775 O  OH  . TYR D 2 67  ? 39.568 -41.022 36.007  1.00 59.42  ? 773 TYR D OH  1 
ATOM   3776 N  N   . TRP D 2 68  ? 39.813 -34.631 34.973  1.00 24.21  ? 774 TRP D N   1 
ATOM   3777 C  CA  . TRP D 2 68  ? 38.755 -34.404 34.000  1.00 26.28  ? 774 TRP D CA  1 
ATOM   3778 C  C   . TRP D 2 68  ? 37.743 -33.422 34.580  1.00 27.60  ? 774 TRP D C   1 
ATOM   3779 O  O   . TRP D 2 68  ? 37.667 -33.222 35.795  1.00 26.47  ? 774 TRP D O   1 
ATOM   3780 C  CB  . TRP D 2 68  ? 38.062 -35.715 33.602  1.00 27.47  ? 774 TRP D CB  1 
ATOM   3781 C  CG  . TRP D 2 68  ? 37.288 -36.361 34.728  1.00 31.41  ? 774 TRP D CG  1 
ATOM   3782 C  CD1 . TRP D 2 68  ? 37.791 -37.146 35.731  1.00 36.25  ? 774 TRP D CD1 1 
ATOM   3783 C  CD2 . TRP D 2 68  ? 35.875 -36.282 34.957  1.00 38.16  ? 774 TRP D CD2 1 
ATOM   3784 N  NE1 . TRP D 2 68  ? 36.777 -37.556 36.566  1.00 33.57  ? 774 TRP D NE1 1 
ATOM   3785 C  CE2 . TRP D 2 68  ? 35.592 -37.038 36.113  1.00 37.45  ? 774 TRP D CE2 1 
ATOM   3786 C  CE3 . TRP D 2 68  ? 34.819 -35.642 34.296  1.00 44.52  ? 774 TRP D CE3 1 
ATOM   3787 C  CZ2 . TRP D 2 68  ? 34.298 -37.169 36.625  1.00 45.18  ? 774 TRP D CZ2 1 
ATOM   3788 C  CZ3 . TRP D 2 68  ? 33.535 -35.773 34.804  1.00 48.38  ? 774 TRP D CZ3 1 
ATOM   3789 C  CH2 . TRP D 2 68  ? 33.286 -36.534 35.955  1.00 44.23  ? 774 TRP D CH2 1 
ATOM   3790 N  N   . HIS D 2 69  ? 36.962 -32.812 33.699  1.00 18.35  ? 775 HIS D N   1 
ATOM   3791 C  CA  . HIS D 2 69  ? 36.042 -31.765 34.091  1.00 28.06  ? 775 HIS D CA  1 
ATOM   3792 C  C   . HIS D 2 69  ? 35.077 -31.569 32.936  1.00 29.16  ? 775 HIS D C   1 
ATOM   3793 O  O   . HIS D 2 69  ? 35.380 -31.952 31.805  1.00 30.41  ? 775 HIS D O   1 
ATOM   3794 C  CB  . HIS D 2 69  ? 36.814 -30.466 34.368  1.00 25.53  ? 775 HIS D CB  1 
ATOM   3795 C  CG  . HIS D 2 69  ? 35.938 -29.287 34.666  1.00 29.53  ? 775 HIS D CG  1 
ATOM   3796 N  ND1 . HIS D 2 69  ? 35.074 -29.253 35.742  1.00 29.84  ? 775 HIS D ND1 1 
ATOM   3797 C  CD2 . HIS D 2 69  ? 35.812 -28.086 34.047  1.00 30.23  ? 775 HIS D CD2 1 
ATOM   3798 C  CE1 . HIS D 2 69  ? 34.444 -28.091 35.763  1.00 27.96  ? 775 HIS D CE1 1 
ATOM   3799 N  NE2 . HIS D 2 69  ? 34.873 -27.365 34.747  1.00 30.01  ? 775 HIS D NE2 1 
ATOM   3800 N  N   . SER D 2 70  ? 33.921 -30.982 33.226  1.00 26.14  ? 776 SER D N   1 
ATOM   3801 C  CA  . SER D 2 70  ? 32.953 -30.628 32.196  1.00 24.31  ? 776 SER D CA  1 
ATOM   3802 C  C   . SER D 2 70  ? 32.635 -29.146 32.305  1.00 26.47  ? 776 SER D C   1 
ATOM   3803 O  O   . SER D 2 70  ? 32.348 -28.637 33.387  1.00 29.67  ? 776 SER D O   1 
ATOM   3804 C  CB  . SER D 2 70  ? 31.666 -31.440 32.348  1.00 28.85  ? 776 SER D CB  1 
ATOM   3805 O  OG  . SER D 2 70  ? 31.919 -32.837 32.267  1.00 31.65  ? 776 SER D OG  1 
ATOM   3806 N  N   . ILE D 2 71  ? 32.700 -28.449 31.181  1.00 21.13  ? 777 ILE D N   1 
ATOM   3807 C  CA  . ILE D 2 71  ? 32.281 -27.054 31.133  1.00 25.55  ? 777 ILE D CA  1 
ATOM   3808 C  C   . ILE D 2 71  ? 30.792 -27.029 30.810  1.00 23.97  ? 777 ILE D C   1 
ATOM   3809 O  O   . ILE D 2 71  ? 30.352 -27.677 29.868  1.00 31.30  ? 777 ILE D O   1 
ATOM   3810 C  CB  . ILE D 2 71  ? 33.051 -26.295 30.046  1.00 29.21  ? 777 ILE D CB  1 
ATOM   3811 C  CG1 . ILE D 2 71  ? 34.558 -26.488 30.227  1.00 34.43  ? 777 ILE D CG1 1 
ATOM   3812 C  CG2 . ILE D 2 71  ? 32.695 -24.826 30.082  1.00 36.99  ? 777 ILE D CG2 1 
ATOM   3813 C  CD1 . ILE D 2 71  ? 35.383 -26.026 29.036  1.00 30.39  ? 777 ILE D CD1 1 
ATOM   3814 N  N   . SER D 2 72  ? 30.015 -26.278 31.580  1.00 24.49  ? 778 SER D N   1 
ATOM   3815 C  CA  . SER D 2 72  ? 28.555 -26.342 31.457  1.00 23.19  ? 778 SER D CA  1 
ATOM   3816 C  C   . SER D 2 72  ? 27.899 -25.016 31.043  1.00 23.20  ? 778 SER D C   1 
ATOM   3817 O  O   . SER D 2 72  ? 28.557 -23.987 30.925  1.00 26.28  ? 778 SER D O   1 
ATOM   3818 C  CB  . SER D 2 72  ? 27.949 -26.843 32.778  1.00 27.44  ? 778 SER D CB  1 
ATOM   3819 O  OG  . SER D 2 72  ? 28.382 -28.161 33.060  1.00 26.70  ? 778 SER D OG  1 
ATOM   3820 N  N   . HIS D 2 73  ? 26.591 -25.067 30.819  1.00 23.55  ? 779 HIS D N   1 
ATOM   3821 C  CA  . HIS D 2 73  ? 25.790 -23.907 30.432  1.00 27.21  ? 779 HIS D CA  1 
ATOM   3822 C  C   . HIS D 2 73  ? 26.302 -23.235 29.176  1.00 30.19  ? 779 HIS D C   1 
ATOM   3823 O  O   . HIS D 2 73  ? 26.355 -22.004 29.093  1.00 26.45  ? 779 HIS D O   1 
ATOM   3824 C  CB  . HIS D 2 73  ? 25.669 -22.927 31.599  1.00 28.34  ? 779 HIS D CB  1 
ATOM   3825 C  CG  . HIS D 2 73  ? 25.212 -23.587 32.862  1.00 36.89  ? 779 HIS D CG  1 
ATOM   3826 N  ND1 . HIS D 2 73  ? 25.962 -23.589 34.015  1.00 41.81  ? 779 HIS D ND1 1 
ATOM   3827 C  CD2 . HIS D 2 73  ? 24.113 -24.334 33.123  1.00 38.99  ? 779 HIS D CD2 1 
ATOM   3828 C  CE1 . HIS D 2 73  ? 25.330 -24.285 34.947  1.00 41.34  ? 779 HIS D CE1 1 
ATOM   3829 N  NE2 . HIS D 2 73  ? 24.209 -24.749 34.432  1.00 36.19  ? 779 HIS D NE2 1 
ATOM   3830 N  N   . LEU D 2 74  ? 26.672 -24.061 28.199  1.00 26.45  ? 780 LEU D N   1 
ATOM   3831 C  CA  . LEU D 2 74  ? 27.129 -23.576 26.910  1.00 24.48  ? 780 LEU D CA  1 
ATOM   3832 C  C   . LEU D 2 74  ? 25.939 -23.518 25.962  1.00 29.10  ? 780 LEU D C   1 
ATOM   3833 O  O   . LEU D 2 74  ? 24.832 -23.915 26.327  1.00 24.02  ? 780 LEU D O   1 
ATOM   3834 C  CB  . LEU D 2 74  ? 28.229 -24.483 26.360  1.00 21.09  ? 780 LEU D CB  1 
ATOM   3835 C  CG  . LEU D 2 74  ? 29.390 -24.755 27.334  1.00 21.44  ? 780 LEU D CG  1 
ATOM   3836 C  CD1 . LEU D 2 74  ? 30.264 -25.903 26.847  1.00 24.50  ? 780 LEU D CD1 1 
ATOM   3837 C  CD2 . LEU D 2 74  ? 30.232 -23.502 27.584  1.00 20.14  ? 780 LEU D CD2 1 
ATOM   3838 N  N   . GLN D 2 75  ? 26.150 -22.998 24.757  1.00 26.43  ? 781 GLN D N   1 
ATOM   3839 C  CA  . GLN D 2 75  ? 25.072 -22.896 23.789  1.00 26.38  ? 781 GLN D CA  1 
ATOM   3840 C  C   . GLN D 2 75  ? 25.151 -24.077 22.838  1.00 26.20  ? 781 GLN D C   1 
ATOM   3841 O  O   . GLN D 2 75  ? 26.241 -24.507 22.485  1.00 24.01  ? 781 GLN D O   1 
ATOM   3842 C  CB  . GLN D 2 75  ? 25.177 -21.587 23.001  1.00 29.04  ? 781 GLN D CB  1 
ATOM   3843 C  CG  . GLN D 2 75  ? 25.057 -20.351 23.863  1.00 35.28  ? 781 GLN D CG  1 
ATOM   3844 C  CD  . GLN D 2 75  ? 23.729 -20.305 24.588  1.00 39.20  ? 781 GLN D CD  1 
ATOM   3845 O  OE1 . GLN D 2 75  ? 22.679 -20.498 23.982  1.00 41.23  ? 781 GLN D OE1 1 
ATOM   3846 N  NE2 . GLN D 2 75  ? 23.770 -20.057 25.894  1.00 36.66  ? 781 GLN D NE2 1 
ATOM   3847 N  N   . PRO D 2 76  ? 23.990 -24.593 22.411  1.00 27.61  ? 782 PRO D N   1 
ATOM   3848 C  CA  . PRO D 2 76  ? 23.930 -25.737 21.501  1.00 22.22  ? 782 PRO D CA  1 
ATOM   3849 C  C   . PRO D 2 76  ? 24.620 -25.464 20.172  1.00 23.59  ? 782 PRO D C   1 
ATOM   3850 O  O   . PRO D 2 76  ? 24.631 -24.327 19.699  1.00 24.99  ? 782 PRO D O   1 
ATOM   3851 C  CB  . PRO D 2 76  ? 22.429 -25.932 21.275  1.00 26.12  ? 782 PRO D CB  1 
ATOM   3852 C  CG  . PRO D 2 76  ? 21.776 -25.255 22.462  1.00 28.56  ? 782 PRO D CG  1 
ATOM   3853 C  CD  . PRO D 2 76  ? 22.649 -24.083 22.745  1.00 26.84  ? 782 PRO D CD  1 
ATOM   3854 N  N   . GLU D 2 77  ? 25.193 -26.513 19.588  1.00 20.86  ? 783 GLU D N   1 
ATOM   3855 C  CA  . GLU D 2 77  ? 25.767 -26.426 18.253  1.00 28.30  ? 783 GLU D CA  1 
ATOM   3856 C  C   . GLU D 2 77  ? 26.748 -25.252 18.146  1.00 27.67  ? 783 GLU D C   1 
ATOM   3857 O  O   . GLU D 2 77  ? 26.815 -24.572 17.128  1.00 24.07  ? 783 GLU D O   1 
ATOM   3858 C  CB  . GLU D 2 77  ? 24.640 -26.282 17.227  1.00 25.57  ? 783 GLU D CB  1 
ATOM   3859 C  CG  . GLU D 2 77  ? 25.007 -26.691 15.830  1.00 34.88  ? 783 GLU D CG  1 
ATOM   3860 C  CD  . GLU D 2 77  ? 23.784 -26.943 14.962  1.00 39.15  ? 783 GLU D CD  1 
ATOM   3861 O  OE1 . GLU D 2 77  ? 22.661 -26.553 15.358  1.00 38.63  ? 783 GLU D OE1 1 
ATOM   3862 O  OE2 . GLU D 2 77  ? 23.951 -27.538 13.882  1.00 43.11  ? 783 GLU D OE2 1 
ATOM   3863 N  N   . THR D 2 78  ? 27.500 -25.008 19.214  1.00 24.11  ? 784 THR D N   1 
ATOM   3864 C  CA  . THR D 2 78  ? 28.443 -23.904 19.221  1.00 16.98  ? 784 THR D CA  1 
ATOM   3865 C  C   . THR D 2 78  ? 29.845 -24.430 19.480  1.00 21.21  ? 784 THR D C   1 
ATOM   3866 O  O   . THR D 2 78  ? 30.045 -25.300 20.337  1.00 18.72  ? 784 THR D O   1 
ATOM   3867 C  CB  . THR D 2 78  ? 28.043 -22.860 20.281  1.00 22.28  ? 784 THR D CB  1 
ATOM   3868 O  OG1 . THR D 2 78  ? 26.750 -22.334 19.951  1.00 24.65  ? 784 THR D OG1 1 
ATOM   3869 C  CG2 . THR D 2 78  ? 29.047 -21.728 20.337  1.00 22.69  ? 784 THR D CG2 1 
ATOM   3870 N  N   . SER D 2 79  ? 30.810 -23.923 18.722  1.00 18.15  ? 785 SER D N   1 
ATOM   3871 C  CA  . SER D 2 79  ? 32.212 -24.304 18.886  1.00 20.28  ? 785 SER D CA  1 
ATOM   3872 C  C   . SER D 2 79  ? 32.883 -23.491 20.003  1.00 22.55  ? 785 SER D C   1 
ATOM   3873 O  O   . SER D 2 79  ? 32.653 -22.282 20.115  1.00 18.92  ? 785 SER D O   1 
ATOM   3874 C  CB  . SER D 2 79  ? 32.958 -24.090 17.566  1.00 20.31  ? 785 SER D CB  1 
ATOM   3875 O  OG  . SER D 2 79  ? 34.334 -24.398 17.697  1.00 19.77  ? 785 SER D OG  1 
ATOM   3876 N  N   . TYR D 2 80  ? 33.707 -24.160 20.818  1.00 19.13  ? 786 TYR D N   1 
ATOM   3877 C  CA  . TYR D 2 80  ? 34.469 -23.508 21.887  1.00 18.09  ? 786 TYR D CA  1 
ATOM   3878 C  C   . TYR D 2 80  ? 35.959 -23.776 21.780  1.00 18.67  ? 786 TYR D C   1 
ATOM   3879 O  O   . TYR D 2 80  ? 36.376 -24.866 21.371  1.00 16.34  ? 786 TYR D O   1 
ATOM   3880 C  CB  . TYR D 2 80  ? 33.964 -23.954 23.269  1.00 15.60  ? 786 TYR D CB  1 
ATOM   3881 C  CG  . TYR D 2 80  ? 32.589 -23.411 23.539  1.00 15.56  ? 786 TYR D CG  1 
ATOM   3882 C  CD1 . TYR D 2 80  ? 31.468 -24.100 23.121  1.00 16.79  ? 786 TYR D CD1 1 
ATOM   3883 C  CD2 . TYR D 2 80  ? 32.417 -22.167 24.149  1.00 16.58  ? 786 TYR D CD2 1 
ATOM   3884 C  CE1 . TYR D 2 80  ? 30.191 -23.586 23.320  1.00 18.43  ? 786 TYR D CE1 1 
ATOM   3885 C  CE2 . TYR D 2 80  ? 31.142 -21.642 24.360  1.00 22.63  ? 786 TYR D CE2 1 
ATOM   3886 C  CZ  . TYR D 2 80  ? 30.034 -22.359 23.944  1.00 23.35  ? 786 TYR D CZ  1 
ATOM   3887 O  OH  . TYR D 2 80  ? 28.754 -21.870 24.135  1.00 22.41  ? 786 TYR D OH  1 
ATOM   3888 N  N   . ASP D 2 81  ? 36.738 -22.759 22.133  1.00 16.03  ? 787 ASP D N   1 
ATOM   3889 C  CA  . ASP D 2 81  ? 38.175 -22.863 22.294  1.00 16.32  ? 787 ASP D CA  1 
ATOM   3890 C  C   . ASP D 2 81  ? 38.411 -23.219 23.750  1.00 22.29  ? 787 ASP D C   1 
ATOM   3891 O  O   . ASP D 2 81  ? 37.891 -22.549 24.641  1.00 17.67  ? 787 ASP D O   1 
ATOM   3892 C  CB  . ASP D 2 81  ? 38.847 -21.514 22.098  1.00 14.40  ? 787 ASP D CB  1 
ATOM   3893 C  CG  . ASP D 2 81  ? 38.603 -20.911 20.727  1.00 19.22  ? 787 ASP D CG  1 
ATOM   3894 O  OD1 . ASP D 2 81  ? 38.195 -21.639 19.794  1.00 15.00  ? 787 ASP D OD1 1 
ATOM   3895 O  OD2 . ASP D 2 81  ? 38.861 -19.693 20.596  1.00 16.20  ? 787 ASP D OD2 1 
ATOM   3896 N  N   . ILE D 2 82  ? 39.236 -24.228 23.996  1.00 14.90  ? 788 ILE D N   1 
ATOM   3897 C  CA  . ILE D 2 82  ? 39.419 -24.710 25.360  1.00 15.69  ? 788 ILE D CA  1 
ATOM   3898 C  C   . ILE D 2 82  ? 40.898 -24.897 25.692  1.00 18.06  ? 788 ILE D C   1 
ATOM   3899 O  O   . ILE D 2 82  ? 41.619 -25.550 24.950  1.00 20.63  ? 788 ILE D O   1 
ATOM   3900 C  CB  . ILE D 2 82  ? 38.662 -26.032 25.558  1.00 16.93  ? 788 ILE D CB  1 
ATOM   3901 C  CG1 . ILE D 2 82  ? 37.187 -25.850 25.144  1.00 17.07  ? 788 ILE D CG1 1 
ATOM   3902 C  CG2 . ILE D 2 82  ? 38.777 -26.477 27.003  1.00 18.71  ? 788 ILE D CG2 1 
ATOM   3903 C  CD1 . ILE D 2 82  ? 36.376 -27.146 25.126  1.00 16.11  ? 788 ILE D CD1 1 
ATOM   3904 N  N   . LYS D 2 83  ? 41.357 -24.283 26.782  1.00 16.93  ? 789 LYS D N   1 
ATOM   3905 C  CA  . LYS D 2 83  ? 42.733 -24.464 27.232  1.00 18.62  ? 789 LYS D CA  1 
ATOM   3906 C  C   . LYS D 2 83  ? 42.773 -24.381 28.742  1.00 18.82  ? 789 LYS D C   1 
ATOM   3907 O  O   . LYS D 2 83  ? 41.813 -23.942 29.367  1.00 18.60  ? 789 LYS D O   1 
ATOM   3908 C  CB  . LYS D 2 83  ? 43.668 -23.411 26.616  1.00 18.82  ? 789 LYS D CB  1 
ATOM   3909 C  CG  . LYS D 2 83  ? 43.375 -21.971 27.018  1.00 16.47  ? 789 LYS D CG  1 
ATOM   3910 C  CD  . LYS D 2 83  ? 44.276 -21.003 26.233  1.00 17.72  ? 789 LYS D CD  1 
ATOM   3911 C  CE  . LYS D 2 83  ? 44.080 -19.563 26.699  1.00 23.26  ? 789 LYS D CE  1 
ATOM   3912 N  NZ  . LYS D 2 83  ? 44.883 -18.623 25.858  1.00 24.51  ? 789 LYS D NZ  1 
ATOM   3913 N  N   . MET D 2 84  ? 43.885 -24.780 29.339  1.00 17.19  ? 790 MET D N   1 
ATOM   3914 C  CA  . MET D 2 84  ? 43.942 -24.776 30.798  1.00 19.98  ? 790 MET D CA  1 
ATOM   3915 C  C   . MET D 2 84  ? 45.348 -24.534 31.300  1.00 19.66  ? 790 MET D C   1 
ATOM   3916 O  O   . MET D 2 84  ? 46.310 -24.553 30.528  1.00 26.09  ? 790 MET D O   1 
ATOM   3917 C  CB  . MET D 2 84  ? 43.391 -26.098 31.352  1.00 23.09  ? 790 MET D CB  1 
ATOM   3918 C  CG  . MET D 2 84  ? 44.208 -27.324 30.998  1.00 23.69  ? 790 MET D CG  1 
ATOM   3919 S  SD  . MET D 2 84  ? 43.409 -28.854 31.552  1.00 27.69  ? 790 MET D SD  1 
ATOM   3920 C  CE  . MET D 2 84  ? 43.395 -28.582 33.336  1.00 30.20  ? 790 MET D CE  1 
ATOM   3921 N  N   . GLN D 2 85  ? 45.463 -24.291 32.599  1.00 21.94  ? 791 GLN D N   1 
ATOM   3922 C  CA  . GLN D 2 85  ? 46.764 -24.180 33.238  1.00 25.73  ? 791 GLN D CA  1 
ATOM   3923 C  C   . GLN D 2 85  ? 46.612 -24.710 34.655  1.00 29.58  ? 791 GLN D C   1 
ATOM   3924 O  O   . GLN D 2 85  ? 45.497 -24.966 35.119  1.00 28.81  ? 791 GLN D O   1 
ATOM   3925 C  CB  . GLN D 2 85  ? 47.251 -22.723 33.236  1.00 32.82  ? 791 GLN D CB  1 
ATOM   3926 C  CG  . GLN D 2 85  ? 46.232 -21.752 33.768  1.00 38.48  ? 791 GLN D CG  1 
ATOM   3927 C  CD  . GLN D 2 85  ? 46.560 -20.289 33.485  1.00 30.68  ? 791 GLN D CD  1 
ATOM   3928 O  OE1 . GLN D 2 85  ? 45.929 -19.408 34.041  1.00 33.73  ? 791 GLN D OE1 1 
ATOM   3929 N  NE2 . GLN D 2 85  ? 47.531 -20.033 32.619  1.00 35.26  ? 791 GLN D NE2 1 
ATOM   3930 N  N   . CYS D 2 86  ? 47.727 -24.912 35.339  1.00 28.93  ? 792 CYS D N   1 
ATOM   3931 C  CA  . CYS D 2 86  ? 47.658 -25.206 36.759  1.00 25.19  ? 792 CYS D CA  1 
ATOM   3932 C  C   . CYS D 2 86  ? 48.124 -23.963 37.497  1.00 26.28  ? 792 CYS D C   1 
ATOM   3933 O  O   . CYS D 2 86  ? 48.618 -23.024 36.876  1.00 31.41  ? 792 CYS D O   1 
ATOM   3934 C  CB  . CYS D 2 86  ? 48.514 -26.417 37.107  1.00 27.50  ? 792 CYS D CB  1 
ATOM   3935 S  SG  . CYS D 2 86  ? 50.233 -26.219 36.683  1.00 34.30  ? 792 CYS D SG  1 
ATOM   3936 N  N   . PHE D 2 87  ? 47.948 -23.927 38.814  1.00 24.33  ? 793 PHE D N   1 
ATOM   3937 C  CA  . PHE D 2 87  ? 48.351 -22.740 39.547  1.00 30.19  ? 793 PHE D CA  1 
ATOM   3938 C  C   . PHE D 2 87  ? 48.677 -23.059 40.995  1.00 30.59  ? 793 PHE D C   1 
ATOM   3939 O  O   . PHE D 2 87  ? 48.340 -24.131 41.502  1.00 31.68  ? 793 PHE D O   1 
ATOM   3940 C  CB  . PHE D 2 87  ? 47.274 -21.646 39.481  1.00 28.05  ? 793 PHE D CB  1 
ATOM   3941 C  CG  . PHE D 2 87  ? 46.022 -21.980 40.260  1.00 30.77  ? 793 PHE D CG  1 
ATOM   3942 C  CD1 . PHE D 2 87  ? 45.864 -21.551 41.567  1.00 34.26  ? 793 PHE D CD1 1 
ATOM   3943 C  CD2 . PHE D 2 87  ? 45.011 -22.726 39.681  1.00 30.94  ? 793 PHE D CD2 1 
ATOM   3944 C  CE1 . PHE D 2 87  ? 44.718 -21.861 42.287  1.00 36.08  ? 793 PHE D CE1 1 
ATOM   3945 C  CE2 . PHE D 2 87  ? 43.866 -23.035 40.388  1.00 29.60  ? 793 PHE D CE2 1 
ATOM   3946 C  CZ  . PHE D 2 87  ? 43.716 -22.607 41.692  1.00 33.41  ? 793 PHE D CZ  1 
ATOM   3947 N  N   . ASN D 2 88  ? 49.344 -22.112 41.643  1.00 33.16  ? 794 ASN D N   1 
ATOM   3948 C  CA  . ASN D 2 88  ? 49.654 -22.213 43.059  1.00 36.68  ? 794 ASN D CA  1 
ATOM   3949 C  C   . ASN D 2 88  ? 49.794 -20.818 43.651  1.00 43.13  ? 794 ASN D C   1 
ATOM   3950 O  O   . ASN D 2 88  ? 49.312 -19.843 43.068  1.00 46.53  ? 794 ASN D O   1 
ATOM   3951 C  CB  . ASN D 2 88  ? 50.922 -23.037 43.277  1.00 45.26  ? 794 ASN D CB  1 
ATOM   3952 C  CG  . ASN D 2 88  ? 52.120 -22.498 42.513  1.00 51.15  ? 794 ASN D CG  1 
ATOM   3953 O  OD1 . ASN D 2 88  ? 52.224 -21.297 42.247  1.00 49.92  ? 794 ASN D OD1 1 
ATOM   3954 N  ND2 . ASN D 2 88  ? 53.040 -23.390 42.162  1.00 55.41  ? 794 ASN D ND2 1 
ATOM   3955 N  N   . GLU D 2 89  ? 50.449 -20.720 44.804  1.00 45.28  ? 795 GLU D N   1 
ATOM   3956 C  CA  . GLU D 2 89  ? 50.613 -19.429 45.455  1.00 44.92  ? 795 GLU D CA  1 
ATOM   3957 C  C   . GLU D 2 89  ? 51.346 -18.445 44.552  1.00 38.79  ? 795 GLU D C   1 
ATOM   3958 O  O   . GLU D 2 89  ? 51.009 -17.267 44.509  1.00 45.19  ? 795 GLU D O   1 
ATOM   3959 C  CB  . GLU D 2 89  ? 51.369 -19.575 46.773  1.00 56.85  ? 795 GLU D CB  1 
ATOM   3960 C  CG  . GLU D 2 89  ? 51.576 -18.255 47.494  1.00 71.40  ? 795 GLU D CG  1 
ATOM   3961 C  CD  . GLU D 2 89  ? 52.246 -18.420 48.845  1.00 85.66  ? 795 GLU D CD  1 
ATOM   3962 O  OE1 . GLU D 2 89  ? 52.713 -19.540 49.146  1.00 90.11  ? 795 GLU D OE1 1 
ATOM   3963 O  OE2 . GLU D 2 89  ? 52.306 -17.429 49.605  1.00 90.42  ? 795 GLU D OE2 1 
ATOM   3964 N  N   . GLY D 2 90  ? 52.344 -18.940 43.822  1.00 34.04  ? 796 GLY D N   1 
ATOM   3965 C  CA  . GLY D 2 90  ? 53.169 -18.086 42.983  1.00 31.40  ? 796 GLY D CA  1 
ATOM   3966 C  C   . GLY D 2 90  ? 52.466 -17.546 41.751  1.00 37.08  ? 796 GLY D C   1 
ATOM   3967 O  O   . GLY D 2 90  ? 52.724 -16.415 41.317  1.00 36.90  ? 796 GLY D O   1 
ATOM   3968 N  N   . GLY D 2 91  ? 51.578 -18.351 41.177  1.00 33.21  ? 797 GLY D N   1 
ATOM   3969 C  CA  . GLY D 2 91  ? 50.877 -17.932 39.980  1.00 31.18  ? 797 GLY D CA  1 
ATOM   3970 C  C   . GLY D 2 91  ? 50.462 -19.086 39.094  1.00 28.21  ? 797 GLY D C   1 
ATOM   3971 O  O   . GLY D 2 91  ? 50.290 -20.204 39.569  1.00 29.18  ? 797 GLY D O   1 
ATOM   3972 N  N   . GLU D 2 92  ? 50.305 -18.800 37.800  1.00 23.96  ? 798 GLU D N   1 
ATOM   3973 C  CA  . GLU D 2 92  ? 49.793 -19.767 36.832  1.00 21.12  ? 798 GLU D CA  1 
ATOM   3974 C  C   . GLU D 2 92  ? 50.880 -20.287 35.892  1.00 22.67  ? 798 GLU D C   1 
ATOM   3975 O  O   . GLU D 2 92  ? 51.833 -19.573 35.578  1.00 23.55  ? 798 GLU D O   1 
ATOM   3976 C  CB  . GLU D 2 92  ? 48.660 -19.137 36.020  1.00 29.14  ? 798 GLU D CB  1 
ATOM   3977 C  CG  . GLU D 2 92  ? 47.467 -18.720 36.863  1.00 34.90  ? 798 GLU D CG  1 
ATOM   3978 C  CD  . GLU D 2 92  ? 47.603 -17.313 37.407  1.00 40.48  ? 798 GLU D CD  1 
ATOM   3979 O  OE1 . GLU D 2 92  ? 47.848 -16.394 36.604  1.00 44.16  ? 798 GLU D OE1 1 
ATOM   3980 O  OE2 . GLU D 2 92  ? 47.450 -17.124 38.634  1.00 47.29  ? 798 GLU D OE2 1 
ATOM   3981 N  N   . SER D 2 93  ? 50.726 -21.536 35.455  1.00 23.54  ? 799 SER D N   1 
ATOM   3982 C  CA  . SER D 2 93  ? 51.641 -22.152 34.503  1.00 27.12  ? 799 SER D CA  1 
ATOM   3983 C  C   . SER D 2 93  ? 51.404 -21.565 33.115  1.00 32.23  ? 799 SER D C   1 
ATOM   3984 O  O   . SER D 2 93  ? 50.485 -20.779 32.913  1.00 28.43  ? 799 SER D O   1 
ATOM   3985 C  CB  . SER D 2 93  ? 51.382 -23.656 34.435  1.00 31.69  ? 799 SER D CB  1 
ATOM   3986 O  OG  . SER D 2 93  ? 50.115 -23.917 33.844  1.00 29.91  ? 799 SER D OG  1 
ATOM   3987 N  N   . GLU D 2 94  ? 52.235 -21.967 32.159  1.00 28.32  ? 800 GLU D N   1 
ATOM   3988 C  CA  . GLU D 2 94  ? 51.936 -21.745 30.757  1.00 28.71  ? 800 GLU D CA  1 
ATOM   3989 C  C   . GLU D 2 94  ? 50.638 -22.464 30.418  1.00 25.47  ? 800 GLU D C   1 
ATOM   3990 O  O   . GLU D 2 94  ? 50.254 -23.421 31.095  1.00 25.18  ? 800 GLU D O   1 
ATOM   3991 C  CB  . GLU D 2 94  ? 53.075 -22.281 29.898  1.00 34.47  ? 800 GLU D CB  1 
ATOM   3992 C  CG  . GLU D 2 94  ? 54.380 -21.567 30.162  1.00 50.44  ? 800 GLU D CG  1 
ATOM   3993 C  CD  . GLU D 2 94  ? 55.506 -22.047 29.277  1.00 63.66  ? 800 GLU D CD  1 
ATOM   3994 O  OE1 . GLU D 2 94  ? 55.260 -22.904 28.397  1.00 61.82  ? 800 GLU D OE1 1 
ATOM   3995 O  OE2 . GLU D 2 94  ? 56.643 -21.563 29.469  1.00 71.50  ? 800 GLU D OE2 1 
ATOM   3996 N  N   . PHE D 2 95  ? 49.958 -22.002 29.373  1.00 26.01  ? 801 PHE D N   1 
ATOM   3997 C  CA  . PHE D 2 95  ? 48.736 -22.661 28.922  1.00 26.49  ? 801 PHE D CA  1 
ATOM   3998 C  C   . PHE D 2 95  ? 49.046 -24.014 28.305  1.00 25.50  ? 801 PHE D C   1 
ATOM   3999 O  O   . PHE D 2 95  ? 50.147 -24.254 27.810  1.00 30.99  ? 801 PHE D O   1 
ATOM   4000 C  CB  . PHE D 2 95  ? 47.973 -21.804 27.918  1.00 23.11  ? 801 PHE D CB  1 
ATOM   4001 C  CG  . PHE D 2 95  ? 47.316 -20.616 28.525  1.00 27.06  ? 801 PHE D CG  1 
ATOM   4002 C  CD1 . PHE D 2 95  ? 47.819 -19.349 28.307  1.00 32.57  ? 801 PHE D CD1 1 
ATOM   4003 C  CD2 . PHE D 2 95  ? 46.207 -20.763 29.340  1.00 26.78  ? 801 PHE D CD2 1 
ATOM   4004 C  CE1 . PHE D 2 95  ? 47.214 -18.250 28.877  1.00 31.90  ? 801 PHE D CE1 1 
ATOM   4005 C  CE2 . PHE D 2 95  ? 45.608 -19.662 29.914  1.00 26.96  ? 801 PHE D CE2 1 
ATOM   4006 C  CZ  . PHE D 2 95  ? 46.110 -18.412 29.679  1.00 26.74  ? 801 PHE D CZ  1 
ATOM   4007 N  N   . SER D 2 96  ? 48.059 -24.893 28.367  1.00 21.09  ? 802 SER D N   1 
ATOM   4008 C  CA  . SER D 2 96  ? 48.102 -26.189 27.717  1.00 21.13  ? 802 SER D CA  1 
ATOM   4009 C  C   . SER D 2 96  ? 47.947 -25.998 26.215  1.00 24.46  ? 802 SER D C   1 
ATOM   4010 O  O   . SER D 2 96  ? 47.835 -24.873 25.734  1.00 21.14  ? 802 SER D O   1 
ATOM   4011 C  CB  . SER D 2 96  ? 46.907 -26.998 28.187  1.00 18.81  ? 802 SER D CB  1 
ATOM   4012 O  OG  . SER D 2 96  ? 45.707 -26.389 27.727  1.00 18.97  ? 802 SER D OG  1 
ATOM   4013 N  N   . ASN D 2 97  ? 47.919 -27.110 25.491  1.00 21.87  ? 803 ASN D N   1 
ATOM   4014 C  CA  . ASN D 2 97  ? 47.443 -27.121 24.122  1.00 19.88  ? 803 ASN D CA  1 
ATOM   4015 C  C   . ASN D 2 97  ? 46.016 -26.564 24.086  1.00 20.77  ? 803 ASN D C   1 
ATOM   4016 O  O   . ASN D 2 97  ? 45.338 -26.527 25.106  1.00 19.85  ? 803 ASN D O   1 
ATOM   4017 C  CB  . ASN D 2 97  ? 47.486 -28.541 23.556  1.00 24.19  ? 803 ASN D CB  1 
ATOM   4018 C  CG  . ASN D 2 97  ? 46.751 -29.538 24.428  1.00 24.60  ? 803 ASN D CG  1 
ATOM   4019 O  OD1 . ASN D 2 97  ? 46.845 -29.491 25.655  1.00 24.47  ? 803 ASN D OD1 1 
ATOM   4020 N  ND2 . ASN D 2 97  ? 46.021 -30.452 23.801  1.00 18.98  ? 803 ASN D ND2 1 
ATOM   4021 N  N   . VAL D 2 98  ? 45.570 -26.114 22.919  1.00 16.21  ? 804 VAL D N   1 
ATOM   4022 C  CA  . VAL D 2 98  ? 44.253 -25.499 22.817  1.00 16.57  ? 804 VAL D CA  1 
ATOM   4023 C  C   . VAL D 2 98  ? 43.367 -26.373 21.945  1.00 19.24  ? 804 VAL D C   1 
ATOM   4024 O  O   . VAL D 2 98  ? 43.684 -26.642 20.785  1.00 18.24  ? 804 VAL D O   1 
ATOM   4025 C  CB  . VAL D 2 98  ? 44.311 -24.056 22.259  1.00 13.81  ? 804 VAL D CB  1 
ATOM   4026 C  CG1 . VAL D 2 98  ? 42.944 -23.394 22.358  1.00 13.17  ? 804 VAL D CG1 1 
ATOM   4027 C  CG2 . VAL D 2 98  ? 45.343 -23.242 23.007  1.00 24.20  ? 804 VAL D CG2 1 
ATOM   4028 N  N   . MET D 2 99  ? 42.268 -26.839 22.526  1.00 14.30  ? 805 MET D N   1 
ATOM   4029 C  CA  . MET D 2 99  ? 41.340 -27.717 21.820  1.00 17.84  ? 805 MET D CA  1 
ATOM   4030 C  C   . MET D 2 99  ? 40.177 -26.899 21.290  1.00 20.65  ? 805 MET D C   1 
ATOM   4031 O  O   . MET D 2 99  ? 39.832 -25.868 21.862  1.00 20.57  ? 805 MET D O   1 
ATOM   4032 C  CB  . MET D 2 99  ? 40.800 -28.781 22.784  1.00 16.99  ? 805 MET D CB  1 
ATOM   4033 C  CG  . MET D 2 99  ? 41.900 -29.489 23.562  1.00 19.79  ? 805 MET D CG  1 
ATOM   4034 S  SD  . MET D 2 99  ? 42.827 -30.587 22.472  1.00 27.78  ? 805 MET D SD  1 
ATOM   4035 C  CE  . MET D 2 99  ? 41.756 -32.030 22.521  1.00 23.53  ? 805 MET D CE  1 
ATOM   4036 N  N   . ILE D 2 100 ? 39.590 -27.347 20.184  1.00 15.84  ? 806 ILE D N   1 
ATOM   4037 C  CA  . ILE D 2 100 ? 38.369 -26.749 19.680  1.00 11.85  ? 806 ILE D CA  1 
ATOM   4038 C  C   . ILE D 2 100 ? 37.349 -27.869 19.705  1.00 23.26  ? 806 ILE D C   1 
ATOM   4039 O  O   . ILE D 2 100 ? 37.639 -28.985 19.247  1.00 21.53  ? 806 ILE D O   1 
ATOM   4040 C  CB  . ILE D 2 100 ? 38.524 -26.220 18.249  1.00 14.76  ? 806 ILE D CB  1 
ATOM   4041 C  CG1 . ILE D 2 100 ? 39.567 -25.092 18.203  1.00 16.81  ? 806 ILE D CG1 1 
ATOM   4042 C  CG2 . ILE D 2 100 ? 37.190 -25.735 17.713  1.00 15.58  ? 806 ILE D CG2 1 
ATOM   4043 C  CD1 . ILE D 2 100 ? 39.978 -24.715 16.792  1.00 17.07  ? 806 ILE D CD1 1 
ATOM   4044 N  N   . CYS D 2 101 ? 36.178 -27.578 20.262  1.00 18.87  ? 807 CYS D N   1 
ATOM   4045 C  CA  . CYS D 2 101 ? 35.136 -28.593 20.444  1.00 24.70  ? 807 CYS D CA  1 
ATOM   4046 C  C   . CYS D 2 101 ? 33.749 -27.970 20.417  1.00 23.40  ? 807 CYS D C   1 
ATOM   4047 O  O   . CYS D 2 101 ? 33.508 -26.904 20.991  1.00 20.99  ? 807 CYS D O   1 
ATOM   4048 C  CB  . CYS D 2 101 ? 35.336 -29.365 21.755  1.00 25.36  ? 807 CYS D CB  1 
ATOM   4049 S  SG  . CYS D 2 101 ? 34.271 -30.853 21.921  1.00 28.18  ? 807 CYS D SG  1 
ATOM   4050 N  N   . GLU D 2 102 ? 32.829 -28.656 19.758  1.00 18.64  ? 808 GLU D N   1 
ATOM   4051 C  CA  . GLU D 2 102 ? 31.482 -28.140 19.551  1.00 19.35  ? 808 GLU D CA  1 
ATOM   4052 C  C   . GLU D 2 102 ? 30.504 -28.877 20.449  1.00 22.62  ? 808 GLU D C   1 
ATOM   4053 O  O   . GLU D 2 102 ? 30.630 -30.081 20.638  1.00 24.41  ? 808 GLU D O   1 
ATOM   4054 C  CB  . GLU D 2 102 ? 31.090 -28.389 18.094  1.00 27.00  ? 808 GLU D CB  1 
ATOM   4055 C  CG  . GLU D 2 102 ? 30.369 -27.259 17.410  1.00 35.58  ? 808 GLU D CG  1 
ATOM   4056 C  CD  . GLU D 2 102 ? 30.348 -27.432 15.894  1.00 32.27  ? 808 GLU D CD  1 
ATOM   4057 O  OE1 . GLU D 2 102 ? 31.173 -26.803 15.192  1.00 32.07  ? 808 GLU D OE1 1 
ATOM   4058 O  OE2 . GLU D 2 102 ? 29.520 -28.217 15.408  1.00 37.25  ? 808 GLU D OE2 1 
ATOM   4059 N  N   . THR D 2 103 ? 29.540 -28.159 21.017  1.00 18.66  ? 809 THR D N   1 
ATOM   4060 C  CA  . THR D 2 103 ? 28.470 -28.814 21.752  1.00 20.47  ? 809 THR D CA  1 
ATOM   4061 C  C   . THR D 2 103 ? 27.572 -29.559 20.779  1.00 22.35  ? 809 THR D C   1 
ATOM   4062 O  O   . THR D 2 103 ? 27.639 -29.342 19.572  1.00 27.43  ? 809 THR D O   1 
ATOM   4063 C  CB  . THR D 2 103 ? 27.625 -27.801 22.518  1.00 20.76  ? 809 THR D CB  1 
ATOM   4064 O  OG1 . THR D 2 103 ? 27.205 -26.771 21.622  1.00 21.12  ? 809 THR D OG1 1 
ATOM   4065 C  CG2 . THR D 2 103 ? 28.424 -27.179 23.650  1.00 20.87  ? 809 THR D CG2 1 
ATOM   4066 N  N   . LYS D 2 104 ? 26.723 -30.450 21.283  1.00 25.87  ? 810 LYS D N   1 
ATOM   4067 C  CA  . LYS D 2 104 ? 25.807 -31.150 20.389  1.00 26.08  ? 810 LYS D CA  1 
ATOM   4068 C  C   . LYS D 2 104 ? 24.711 -30.222 19.881  1.00 29.15  ? 810 LYS D C   1 
ATOM   4069 O  O   . LYS D 2 104 ? 24.454 -29.172 20.465  1.00 25.42  ? 810 LYS D O   1 
ATOM   4070 C  CB  . LYS D 2 104 ? 25.231 -32.402 21.060  1.00 27.40  ? 810 LYS D CB  1 
ATOM   4071 C  CG  . LYS D 2 104 ? 26.266 -33.512 21.125  1.00 30.16  ? 810 LYS D CG  1 
ATOM   4072 C  CD  . LYS D 2 104 ? 25.796 -34.732 21.861  1.00 45.91  ? 810 LYS D CD  1 
ATOM   4073 C  CE  . LYS D 2 104 ? 26.875 -35.799 21.798  1.00 52.15  ? 810 LYS D CE  1 
ATOM   4074 N  NZ  . LYS D 2 104 ? 26.548 -36.966 22.660  1.00 59.93  ? 810 LYS D NZ  1 
ATOM   4075 N  N   . ALA D 2 105 ? 24.072 -30.598 18.782  1.00 34.09  ? 811 ALA D N   1 
ATOM   4076 C  CA  . ALA D 2 105 ? 22.990 -29.786 18.258  1.00 38.64  ? 811 ALA D CA  1 
ATOM   4077 C  C   . ALA D 2 105 ? 21.753 -29.943 19.129  1.00 39.05  ? 811 ALA D C   1 
ATOM   4078 O  O   . ALA D 2 105 ? 21.555 -30.987 19.753  1.00 40.45  ? 811 ALA D O   1 
ATOM   4079 C  CB  . ALA D 2 105 ? 22.685 -30.160 16.815  1.00 20.00  ? 811 ALA D CB  1 
ATOM   4080 N  N   . ARG D 2 106 ? 20.924 -28.905 19.170  1.00 49.07  ? 812 ARG D N   1 
ATOM   4081 C  CA  . ARG D 2 106 ? 19.702 -28.931 19.965  1.00 64.06  ? 812 ARG D CA  1 
ATOM   4082 C  C   . ARG D 2 106 ? 18.709 -29.950 19.416  1.00 70.24  ? 812 ARG D C   1 
ATOM   4083 O  O   . ARG D 2 106 ? 18.685 -30.223 18.216  1.00 68.03  ? 812 ARG D O   1 
ATOM   4084 C  CB  . ARG D 2 106 ? 19.062 -27.543 20.009  1.00 20.00  ? 812 ARG D CB  1 
ATOM   4085 C  CG  . ARG D 2 106 ? 17.825 -27.458 20.888  1.00 20.00  ? 812 ARG D CG  1 
ATOM   4086 C  CD  . ARG D 2 106 ? 17.201 -26.073 20.830  1.00 20.00  ? 812 ARG D CD  1 
ATOM   4087 N  NE  . ARG D 2 106 ? 18.021 -25.075 21.510  1.00 20.00  ? 812 ARG D NE  1 
ATOM   4088 C  CZ  . ARG D 2 106 ? 18.025 -24.880 22.824  1.00 20.00  ? 812 ARG D CZ  1 
ATOM   4089 N  NH1 . ARG D 2 106 ? 17.249 -25.617 23.608  1.00 20.00  ? 812 ARG D NH1 1 
ATOM   4090 N  NH2 . ARG D 2 106 ? 18.804 -23.947 23.357  1.00 20.00  ? 812 ARG D NH2 1 
ATOM   4091 N  N   . LYS D 2 107 ? 17.889 -30.508 20.302  1.00 79.02  ? 813 LYS D N   1 
ATOM   4092 C  CA  . LYS D 2 107 ? 16.893 -31.497 19.907  1.00 87.29  ? 813 LYS D CA  1 
ATOM   4093 C  C   . LYS D 2 107 ? 15.485 -31.038 20.273  1.00 90.80  ? 813 LYS D C   1 
ATOM   4094 O  O   . LYS D 2 107 ? 15.294 -30.301 21.240  1.00 91.76  ? 813 LYS D O   1 
ATOM   4095 C  CB  . LYS D 2 107 ? 17.193 -32.848 20.559  1.00 20.00  ? 813 LYS D CB  1 
ATOM   4096 C  CG  . LYS D 2 107 ? 18.521 -33.458 20.142  1.00 20.00  ? 813 LYS D CG  1 
ATOM   4097 C  CD  . LYS D 2 107 ? 18.811 -34.732 20.917  1.00 20.00  ? 813 LYS D CD  1 
ATOM   4098 C  CE  . LYS D 2 107 ? 20.145 -35.335 20.510  1.00 20.00  ? 813 LYS D CE  1 
ATOM   4099 N  NZ  . LYS D 2 107 ? 20.450 -36.577 21.273  1.00 20.00  ? 813 LYS D NZ  1 
HETATM 4100 CA CA  . CA  E 3 .   ? 20.093 -4.843  27.987  1.00 19.70  ? 190 CA  B CA  1 
HETATM 4101 CA CA  . CA  F 3 .   ? 23.872 -3.837  26.980  1.00 17.69  ? 191 CA  B CA  1 
HETATM 4102 ZN ZN  . ZN  G 4 .   ? 17.656 2.413   21.564  1.00 41.51  ? 192 ZN  B ZN  1 
HETATM 4103 CA CA  . CA  H 3 .   ? 45.395 -26.240 16.424  1.00 20.54  ? 190 CA  A CA  1 
HETATM 4104 ZN ZN  . ZN  I 4 .   ? 38.514 -29.357 9.641   1.00 39.76  ? 191 ZN  A ZN  1 
HETATM 4105 CA CA  . CA  J 3 .   ? 43.857 -22.643 15.440  1.00 16.79  ? 192 CA  A CA  1 
HETATM 4106 MG MG  . MG  K 5 .   ? 50.044 -30.199 -0.528  1.00 30.00  ? 193 MG  A MG  1 
HETATM 4107 O  O   . HOH L 6 .   ? 24.772 -7.961  26.513  1.00 17.75  ? 1   HOH B O   1 
HETATM 4108 O  O   . HOH L 6 .   ? 33.513 -0.673  13.270  1.00 13.76  ? 2   HOH B O   1 
HETATM 4109 O  O   . HOH L 6 .   ? 17.160 5.673   7.848   1.00 19.17  ? 3   HOH B O   1 
HETATM 4110 O  O   . HOH L 6 .   ? 24.033 -12.030 13.944  1.00 14.89  ? 5   HOH B O   1 
HETATM 4111 O  O   . HOH L 6 .   ? 28.617 8.252   24.951  1.00 22.31  ? 6   HOH B O   1 
HETATM 4112 O  O   . HOH L 6 .   ? 20.867 -3.086  29.650  1.00 20.48  ? 7   HOH B O   1 
HETATM 4113 O  O   . HOH L 6 .   ? 27.480 3.850   5.858   1.00 16.20  ? 12  HOH B O   1 
HETATM 4114 O  O   . HOH L 6 .   ? 20.641 -5.613  25.665  1.00 15.49  ? 15  HOH B O   1 
HETATM 4115 O  O   . HOH L 6 .   ? 32.874 -9.085  18.334  1.00 21.03  ? 17  HOH B O   1 
HETATM 4116 O  O   . HOH L 6 .   ? 31.731 -5.504  9.073   1.00 19.71  ? 18  HOH B O   1 
HETATM 4117 O  O   . HOH L 6 .   ? 8.304  -17.291 20.042  1.00 35.06  ? 193 HOH B O   1 
HETATM 4118 O  O   . HOH L 6 .   ? 8.504  -1.031  6.999   1.00 52.52  ? 194 HOH B O   1 
HETATM 4119 O  O   . HOH L 6 .   ? 19.009 19.594  17.765  1.00 39.01  ? 195 HOH B O   1 
HETATM 4120 O  O   . HOH L 6 .   ? 13.139 1.876   21.895  1.00 19.50  ? 196 HOH B O   1 
HETATM 4121 O  O   . HOH L 6 .   ? 33.216 2.680   3.715   1.00 37.62  ? 197 HOH B O   1 
HETATM 4122 O  O   . HOH L 6 .   ? 13.512 3.639   6.064   1.00 24.39  ? 198 HOH B O   1 
HETATM 4123 O  O   . HOH L 6 .   ? 11.426 -1.125  33.329  1.00 27.65  ? 199 HOH B O   1 
HETATM 4124 O  O   . HOH L 6 .   ? 2.911  0.714   11.060  1.00 49.60  ? 200 HOH B O   1 
HETATM 4125 O  O   . HOH L 6 .   ? 38.676 -2.992  18.863  1.00 45.33  ? 201 HOH B O   1 
HETATM 4126 O  O   . HOH L 6 .   ? 8.964  -4.383  9.896   1.00 20.81  ? 202 HOH B O   1 
HETATM 4127 O  O   . HOH L 6 .   ? 34.617 -11.523 17.567  1.00 22.75  ? 203 HOH B O   1 
HETATM 4128 O  O   . HOH L 6 .   ? 8.751  -5.110  21.275  1.00 24.21  ? 204 HOH B O   1 
HETATM 4129 O  O   . HOH L 6 .   ? 6.840  4.529   16.439  1.00 23.67  ? 205 HOH B O   1 
HETATM 4130 O  O   . HOH L 6 .   ? 18.526 -10.404 33.305  1.00 34.18  ? 206 HOH B O   1 
HETATM 4131 O  O   . HOH L 6 .   ? 26.696 -9.292  6.862   1.00 25.62  ? 207 HOH B O   1 
HETATM 4132 O  O   . HOH L 6 .   ? 24.828 -12.265 4.333   1.00 26.04  ? 208 HOH B O   1 
HETATM 4133 O  O   . HOH L 6 .   ? 19.584 -7.683  27.998  1.00 21.58  ? 209 HOH B O   1 
HETATM 4134 O  O   . HOH L 6 .   ? 22.792 2.589   25.791  1.00 28.83  ? 210 HOH B O   1 
HETATM 4135 O  O   . HOH L 6 .   ? 27.321 1.464   4.191   1.00 22.38  ? 211 HOH B O   1 
HETATM 4136 O  O   . HOH L 6 .   ? 20.395 16.296  9.137   1.00 29.36  ? 212 HOH B O   1 
HETATM 4137 O  O   . HOH L 6 .   ? 40.649 8.050   14.191  1.00 44.78  ? 213 HOH B O   1 
HETATM 4138 O  O   . HOH L 6 .   ? 24.341 18.597  9.957   1.00 23.95  ? 214 HOH B O   1 
HETATM 4139 O  O   . HOH L 6 .   ? 38.626 3.502   19.803  1.00 26.43  ? 215 HOH B O   1 
HETATM 4140 O  O   . HOH L 6 .   ? 5.177  -7.765  23.554  1.00 32.89  ? 216 HOH B O   1 
HETATM 4141 O  O   . HOH L 6 .   ? 33.148 -6.916  22.261  1.00 28.39  ? 217 HOH B O   1 
HETATM 4142 O  O   . HOH L 6 .   ? 39.859 8.050   18.612  1.00 32.14  ? 218 HOH B O   1 
HETATM 4143 O  O   . HOH L 6 .   ? 20.819 -10.047 29.258  1.00 22.73  ? 219 HOH B O   1 
HETATM 4144 O  O   . HOH L 6 .   ? 25.299 -13.812 22.367  1.00 29.64  ? 220 HOH B O   1 
HETATM 4145 O  O   . HOH L 6 .   ? 7.812  -19.454 21.713  1.00 37.09  ? 221 HOH B O   1 
HETATM 4146 O  O   . HOH L 6 .   ? 14.763 -7.800  11.291  1.00 19.63  ? 222 HOH B O   1 
HETATM 4147 O  O   . HOH L 6 .   ? 26.010 5.723   25.980  1.00 18.45  ? 223 HOH B O   1 
HETATM 4148 O  O   . HOH L 6 .   ? 17.420 -5.301  19.280  1.00 23.76  ? 224 HOH B O   1 
HETATM 4149 O  O   . HOH L 6 .   ? 13.113 -9.429  25.970  1.00 19.76  ? 225 HOH B O   1 
HETATM 4150 O  O   . HOH L 6 .   ? 9.040  -1.715  28.985  1.00 45.82  ? 226 HOH B O   1 
HETATM 4151 O  O   . HOH L 6 .   ? 34.713 14.264  13.285  1.00 37.72  ? 227 HOH B O   1 
HETATM 4152 O  O   . HOH L 6 .   ? 32.898 5.662   5.803   1.00 21.03  ? 228 HOH B O   1 
HETATM 4153 O  O   . HOH L 6 .   ? 6.289  12.975  10.132  1.00 29.54  ? 229 HOH B O   1 
HETATM 4154 O  O   . HOH L 6 .   ? 12.590 -10.888 28.335  1.00 24.06  ? 230 HOH B O   1 
HETATM 4155 O  O   . HOH L 6 .   ? 8.644  -14.102 23.481  1.00 29.73  ? 231 HOH B O   1 
HETATM 4156 O  O   . HOH L 6 .   ? 32.546 -5.559  27.551  1.00 41.86  ? 232 HOH B O   1 
HETATM 4157 O  O   . HOH L 6 .   ? 26.243 -13.057 12.563  1.00 17.24  ? 233 HOH B O   1 
HETATM 4158 O  O   . HOH L 6 .   ? 39.047 10.665  10.085  1.00 30.50  ? 234 HOH B O   1 
HETATM 4159 O  O   . HOH L 6 .   ? 20.190 18.839  7.929   1.00 25.62  ? 235 HOH B O   1 
HETATM 4160 O  O   . HOH L 6 .   ? 30.384 -3.621  30.277  1.00 20.06  ? 236 HOH B O   1 
HETATM 4161 O  O   . HOH L 6 .   ? 8.683  1.952   21.928  1.00 35.94  ? 237 HOH B O   1 
HETATM 4162 O  O   . HOH L 6 .   ? 31.467 -8.188  24.431  1.00 29.73  ? 238 HOH B O   1 
HETATM 4163 O  O   . HOH L 6 .   ? 26.366 13.922  21.200  1.00 27.04  ? 239 HOH B O   1 
HETATM 4164 O  O   . HOH L 6 .   ? 20.489 -9.036  31.790  1.00 22.61  ? 240 HOH B O   1 
HETATM 4165 O  O   . HOH L 6 .   ? 19.302 -17.066 20.095  1.00 17.99  ? 241 HOH B O   1 
HETATM 4166 O  O   . HOH L 6 .   ? 29.234 -12.401 28.299  1.00 24.44  ? 242 HOH B O   1 
HETATM 4167 O  O   . HOH L 6 .   ? 22.006 14.321  3.028   1.00 32.78  ? 243 HOH B O   1 
HETATM 4168 O  O   . HOH L 6 .   ? 23.413 5.235   26.733  1.00 22.02  ? 244 HOH B O   1 
HETATM 4169 O  O   . HOH L 6 .   ? 21.622 14.857  7.843   1.00 32.22  ? 245 HOH B O   1 
HETATM 4170 O  O   . HOH L 6 .   ? 7.011  -5.527  11.155  1.00 24.89  ? 246 HOH B O   1 
HETATM 4171 O  O   . HOH L 6 .   ? 24.296 13.146  3.716   1.00 21.07  ? 247 HOH B O   1 
HETATM 4172 O  O   . HOH L 6 .   ? 34.534 -8.302  10.013  1.00 30.21  ? 248 HOH B O   1 
HETATM 4173 O  O   . HOH L 6 .   ? 29.622 -0.025  4.483   1.00 21.12  ? 249 HOH B O   1 
HETATM 4174 O  O   . HOH L 6 .   ? 20.232 2.023   26.082  1.00 28.55  ? 250 HOH B O   1 
HETATM 4175 O  O   . HOH L 6 .   ? 18.586 3.720   5.343   1.00 20.99  ? 251 HOH B O   1 
HETATM 4176 O  O   . HOH L 6 .   ? 13.502 -7.992  5.890   1.00 60.69  ? 252 HOH B O   1 
HETATM 4177 O  O   . HOH L 6 .   ? 29.231 14.348  13.944  1.00 20.19  ? 253 HOH B O   1 
HETATM 4178 O  O   . HOH L 6 .   ? 13.243 -13.438 16.050  1.00 29.66  ? 254 HOH B O   1 
HETATM 4179 O  O   . HOH L 6 .   ? 37.133 11.179  7.776   1.00 26.83  ? 255 HOH B O   1 
HETATM 4180 O  O   . HOH L 6 .   ? 21.528 -17.300 22.027  1.00 26.91  ? 256 HOH B O   1 
HETATM 4181 O  O   . HOH L 6 .   ? 9.773  9.435   16.689  1.00 40.62  ? 257 HOH B O   1 
HETATM 4182 O  O   . HOH L 6 .   ? 32.177 -14.132 23.823  1.00 35.23  ? 258 HOH B O   1 
HETATM 4183 O  O   . HOH L 6 .   ? 12.789 0.946   19.330  1.00 20.88  ? 259 HOH B O   1 
HETATM 4184 O  O   . HOH L 6 .   ? 32.143 20.015  20.828  1.00 49.10  ? 260 HOH B O   1 
HETATM 4185 O  O   . HOH L 6 .   ? 19.755 -5.935  4.665   1.00 40.11  ? 261 HOH B O   1 
HETATM 4186 O  O   . HOH L 6 .   ? 29.341 -10.151 24.339  1.00 28.13  ? 262 HOH B O   1 
HETATM 4187 O  O   . HOH L 6 .   ? 16.397 6.309   5.350   1.00 21.43  ? 263 HOH B O   1 
HETATM 4188 O  O   . HOH L 6 .   ? 13.425 14.269  12.906  1.00 29.70  ? 264 HOH B O   1 
HETATM 4189 O  O   . HOH L 6 .   ? 39.920 1.874   10.913  1.00 36.77  ? 265 HOH B O   1 
HETATM 4190 O  O   . HOH L 6 .   ? 8.040  -4.864  27.197  1.00 26.94  ? 266 HOH B O   1 
HETATM 4191 O  O   . HOH L 6 .   ? 22.351 -13.776 25.672  1.00 26.27  ? 267 HOH B O   1 
HETATM 4192 O  O   . HOH L 6 .   ? 9.064  6.908   16.779  1.00 22.21  ? 268 HOH B O   1 
HETATM 4193 O  O   . HOH L 6 .   ? 26.149 -6.526  5.436   1.00 29.69  ? 269 HOH B O   1 
HETATM 4194 O  O   . HOH L 6 .   ? 32.888 13.155  23.988  1.00 36.09  ? 270 HOH B O   1 
HETATM 4195 O  O   . HOH L 6 .   ? 36.957 -4.437  17.956  1.00 64.38  ? 271 HOH B O   1 
HETATM 4196 O  O   . HOH L 6 .   ? 31.487 14.081  2.769   1.00 31.54  ? 272 HOH B O   1 
HETATM 4197 O  O   . HOH L 6 .   ? 28.459 5.425   4.033   1.00 35.43  ? 273 HOH B O   1 
HETATM 4198 O  O   . HOH L 6 .   ? 7.392  11.177  15.951  1.00 42.69  ? 274 HOH B O   1 
HETATM 4199 O  O   . HOH L 6 .   ? 40.652 5.409   19.012  1.00 45.00  ? 275 HOH B O   1 
HETATM 4200 O  O   . HOH L 6 .   ? 34.086 -7.464  19.885  1.00 20.82  ? 276 HOH B O   1 
HETATM 4201 O  O   . HOH L 6 .   ? 20.151 -13.451 31.073  1.00 28.18  ? 277 HOH B O   1 
HETATM 4202 O  O   . HOH L 6 .   ? 17.675 3.474   24.451  1.00 30.95  ? 278 HOH B O   1 
HETATM 4203 O  O   . HOH L 6 .   ? 17.068 3.093   3.314   1.00 41.96  ? 279 HOH B O   1 
HETATM 4204 O  O   . HOH L 6 .   ? 36.585 -0.314  7.023   1.00 31.44  ? 280 HOH B O   1 
HETATM 4205 O  O   . HOH L 6 .   ? 22.700 -10.062 33.177  1.00 20.52  ? 281 HOH B O   1 
HETATM 4206 O  O   . HOH L 6 .   ? 14.300 14.166  9.970   1.00 34.37  ? 282 HOH B O   1 
HETATM 4207 O  O   . HOH L 6 .   ? 12.669 -10.691 16.045  1.00 29.20  ? 283 HOH B O   1 
HETATM 4208 O  O   . HOH L 6 .   ? 2.441  2.880   8.711   1.00 32.77  ? 284 HOH B O   1 
HETATM 4209 O  O   . HOH L 6 .   ? 14.200 -12.898 28.369  1.00 27.60  ? 285 HOH B O   1 
HETATM 4210 O  O   . HOH L 6 .   ? 21.955 -15.439 30.312  1.00 52.64  ? 286 HOH B O   1 
HETATM 4211 O  O   . HOH L 6 .   ? 23.852 -15.931 28.300  1.00 33.35  ? 287 HOH B O   1 
HETATM 4212 O  O   . HOH L 6 .   ? 24.995 16.969  14.569  1.00 31.27  ? 288 HOH B O   1 
HETATM 4213 O  O   . HOH L 6 .   ? 10.876 3.130   21.969  1.00 33.04  ? 289 HOH B O   1 
HETATM 4214 O  O   . HOH L 6 .   ? 36.232 -4.235  6.882   1.00 30.10  ? 290 HOH B O   1 
HETATM 4215 O  O   . HOH L 6 .   ? 7.825  -3.599  7.547   1.00 42.98  ? 291 HOH B O   1 
HETATM 4216 O  O   . HOH L 6 .   ? 31.430 1.020   2.822   1.00 40.53  ? 294 HOH B O   1 
HETATM 4217 O  O   . HOH L 6 .   ? 6.596  -5.215  22.462  1.00 48.53  ? 298 HOH B O   1 
HETATM 4218 O  O   . HOH L 6 .   ? 30.007 -1.998  2.648   1.00 32.11  ? 299 HOH B O   1 
HETATM 4219 O  O   . HOH L 6 .   ? 26.809 -9.026  24.275  1.00 37.60  ? 303 HOH B O   1 
HETATM 4220 O  O   . HOH L 6 .   ? 34.339 -4.285  9.359   1.00 29.95  ? 304 HOH B O   1 
HETATM 4221 O  O   . HOH L 6 .   ? 8.047  -14.563 20.985  1.00 47.44  ? 305 HOH B O   1 
HETATM 4222 O  O   . HOH L 6 .   ? 27.160 16.291  22.260  1.00 39.38  ? 307 HOH B O   1 
HETATM 4223 O  O   . HOH L 6 .   ? 32.175 14.367  12.974  1.00 44.96  ? 312 HOH B O   1 
HETATM 4224 O  O   . HOH L 6 .   ? 14.008 2.617   32.265  1.00 32.62  ? 315 HOH B O   1 
HETATM 4225 O  O   . HOH L 6 .   ? 39.294 0.448   17.694  1.00 35.33  ? 319 HOH B O   1 
HETATM 4226 O  O   . HOH L 6 .   ? 17.452 5.497   2.852   1.00 63.91  ? 323 HOH B O   1 
HETATM 4227 O  O   . HOH L 6 .   ? 26.514 -8.612  35.456  1.00 41.90  ? 324 HOH B O   1 
HETATM 4228 O  O   . HOH L 6 .   ? 10.674 4.973   18.849  1.00 48.49  ? 325 HOH B O   1 
HETATM 4229 O  O   . HOH L 6 .   ? 33.421 -4.834  25.370  1.00 46.91  ? 330 HOH B O   1 
HETATM 4230 O  O   . HOH L 6 .   ? 20.698 -17.936 31.101  1.00 49.24  ? 332 HOH B O   1 
HETATM 4231 O  O   . HOH L 6 .   ? 17.592 12.666  25.312  1.00 47.20  ? 337 HOH B O   1 
HETATM 4232 O  O   . HOH L 6 .   ? 23.523 21.445  6.306   1.00 28.77  ? 339 HOH B O   1 
HETATM 4233 O  O   . HOH L 6 .   ? 28.229 12.037  29.681  1.00 41.49  ? 340 HOH B O   1 
HETATM 4234 O  O   . HOH L 6 .   ? 20.645 16.000  4.785   1.00 31.47  ? 342 HOH B O   1 
HETATM 4235 O  O   . HOH L 6 .   ? 38.683 -0.364  19.910  1.00 42.97  ? 343 HOH B O   1 
HETATM 4236 O  O   . HOH L 6 .   ? 36.411 5.646   2.228   1.00 59.33  ? 347 HOH B O   1 
HETATM 4237 O  O   . HOH L 6 .   ? 7.654  -18.984 24.202  1.00 41.81  ? 349 HOH B O   1 
HETATM 4238 O  O   . HOH L 6 .   ? 25.297 -12.549 33.901  1.00 38.05  ? 351 HOH B O   1 
HETATM 4239 O  O   . HOH L 6 .   ? 31.555 4.769   3.674   1.00 34.85  ? 354 HOH B O   1 
HETATM 4240 O  O   . HOH L 6 .   ? 21.727 -14.227 10.700  1.00 32.39  ? 358 HOH B O   1 
HETATM 4241 O  O   . HOH L 6 .   ? 6.517  1.989   28.214  1.00 39.03  ? 359 HOH B O   1 
HETATM 4242 O  O   . HOH L 6 .   ? 27.563 14.788  17.312  1.00 25.71  ? 360 HOH B O   1 
HETATM 4243 O  O   . HOH L 6 .   ? 4.341  -5.096  20.882  1.00 52.48  ? 364 HOH B O   1 
HETATM 4244 O  O   . HOH L 6 .   ? 15.710 -10.203 32.684  1.00 34.58  ? 366 HOH B O   1 
HETATM 4245 O  O   . HOH L 6 .   ? 3.816  5.005   15.973  1.00 51.13  ? 369 HOH B O   1 
HETATM 4246 O  O   . HOH L 6 .   ? 19.509 -6.223  18.188  1.00 31.90  ? 371 HOH B O   1 
HETATM 4247 O  O   . HOH L 6 .   ? 20.559 18.736  5.108   1.00 24.97  ? 374 HOH B O   1 
HETATM 4248 O  O   . HOH L 6 .   ? 19.164 -18.897 26.368  1.00 28.95  ? 376 HOH B O   1 
HETATM 4249 O  O   . HOH L 6 .   ? 16.926 0.143   4.010   1.00 52.76  ? 378 HOH B O   1 
HETATM 4250 O  O   . HOH L 6 .   ? 37.906 -8.029  10.404  1.00 43.49  ? 379 HOH B O   1 
HETATM 4251 O  O   . HOH L 6 .   ? 19.082 -10.826 3.778   1.00 49.74  ? 381 HOH B O   1 
HETATM 4252 O  O   . HOH L 6 .   ? 36.128 15.703  20.283  1.00 44.12  ? 382 HOH B O   1 
HETATM 4253 O  O   . HOH L 6 .   ? 22.362 20.374  8.892   1.00 30.18  ? 387 HOH B O   1 
HETATM 4254 O  O   . HOH L 6 .   ? 6.687  -17.483 17.412  1.00 50.46  ? 388 HOH B O   1 
HETATM 4255 O  O   . HOH L 6 .   ? 15.004 8.691   4.617   1.00 32.50  ? 390 HOH B O   1 
HETATM 4256 O  O   . HOH L 6 .   ? 27.523 7.376   2.476   1.00 46.67  ? 394 HOH B O   1 
HETATM 4257 O  O   . HOH L 6 .   ? 28.739 -4.344  3.611   1.00 43.03  ? 396 HOH B O   1 
HETATM 4258 O  O   . HOH L 6 .   ? 39.081 0.738   12.884  1.00 40.08  ? 400 HOH B O   1 
HETATM 4259 O  O   . HOH L 6 .   ? 27.271 14.687  26.404  1.00 45.14  ? 401 HOH B O   1 
HETATM 4260 O  O   . HOH L 6 .   ? 6.963  -4.496  24.783  1.00 40.49  ? 403 HOH B O   1 
HETATM 4261 O  O   . HOH L 6 .   ? 29.039 -14.279 32.259  1.00 45.59  ? 405 HOH B O   1 
HETATM 4262 O  O   . HOH L 6 .   ? 41.337 -4.205  11.622  1.00 51.05  ? 411 HOH B O   1 
HETATM 4263 O  O   . HOH L 6 .   ? 27.930 18.532  5.792   1.00 31.01  ? 417 HOH B O   1 
HETATM 4264 O  O   . HOH L 6 .   ? 18.889 3.734   27.817  1.00 40.03  ? 418 HOH B O   1 
HETATM 4265 O  O   . HOH L 6 .   ? 17.492 10.549  26.887  1.00 50.58  ? 420 HOH B O   1 
HETATM 4266 O  O   . HOH L 6 .   ? 40.083 4.992   5.737   1.00 35.87  ? 422 HOH B O   1 
HETATM 4267 O  O   . HOH L 6 .   ? 15.301 2.899   25.266  1.00 36.20  ? 429 HOH B O   1 
HETATM 4268 O  O   . HOH L 6 .   ? 12.810 3.379   25.263  1.00 33.75  ? 432 HOH B O   1 
HETATM 4269 O  O   . HOH L 6 .   ? 32.669 -1.776  1.327   1.00 40.86  ? 433 HOH B O   1 
HETATM 4270 O  O   . HOH L 6 .   ? 12.013 -16.245 29.434  1.00 38.46  ? 437 HOH B O   1 
HETATM 4271 O  O   . HOH L 6 .   ? 12.191 15.553  8.466   1.00 34.92  ? 439 HOH B O   1 
HETATM 4272 O  O   . HOH L 6 .   ? 35.640 -1.711  2.395   1.00 41.41  ? 443 HOH B O   1 
HETATM 4273 O  O   . HOH L 6 .   ? 37.320 -2.355  4.441   1.00 48.36  ? 452 HOH B O   1 
HETATM 4274 O  O   . HOH L 6 .   ? 6.897  12.109  13.564  1.00 39.71  ? 453 HOH B O   1 
HETATM 4275 O  O   . HOH L 6 .   ? 17.450 19.302  8.146   1.00 40.12  ? 456 HOH B O   1 
HETATM 4276 O  O   . HOH L 6 .   ? 10.068 -14.356 29.752  1.00 51.94  ? 457 HOH B O   1 
HETATM 4277 O  O   . HOH L 6 .   ? 38.757 5.410   24.543  1.00 47.32  ? 460 HOH B O   1 
HETATM 4278 O  O   . HOH L 6 .   ? 37.720 -0.286  22.522  1.00 33.16  ? 463 HOH B O   1 
HETATM 4279 O  O   . HOH L 6 .   ? 40.949 -0.232  9.253   1.00 50.41  ? 465 HOH B O   1 
HETATM 4280 O  O   . HOH L 6 .   ? 24.799 17.289  1.095   1.00 44.73  ? 470 HOH B O   1 
HETATM 4281 O  O   . HOH L 6 .   ? 36.883 10.522  22.636  1.00 43.04  ? 474 HOH B O   1 
HETATM 4282 O  O   . HOH L 6 .   ? 36.637 5.020   26.112  1.00 66.36  ? 477 HOH B O   1 
HETATM 4283 O  O   . HOH L 6 .   ? 19.947 12.674  2.197   1.00 39.68  ? 479 HOH B O   1 
HETATM 4284 O  O   . HOH L 6 .   ? 38.941 -0.660  6.013   1.00 55.95  ? 481 HOH B O   1 
HETATM 4285 O  O   . HOH L 6 .   ? 24.775 -8.094  3.076   1.00 65.99  ? 482 HOH B O   1 
HETATM 4286 O  O   . HOH L 6 .   ? 22.069 22.642  10.546  1.00 38.35  ? 484 HOH B O   1 
HETATM 4287 O  O   . HOH L 6 .   ? 19.466 -20.810 16.484  1.00 40.99  ? 485 HOH B O   1 
HETATM 4288 O  O   . HOH L 6 .   ? 26.378 -4.772  1.980   1.00 49.12  ? 488 HOH B O   1 
HETATM 4289 O  O   . HOH L 6 .   ? 15.934 -10.126 6.719   1.00 45.98  ? 490 HOH B O   1 
HETATM 4290 O  O   . HOH L 6 .   ? 25.845 -10.323 2.496   1.00 51.94  ? 491 HOH B O   1 
HETATM 4291 O  O   . HOH L 6 .   ? 41.049 -0.583  14.724  1.00 52.94  ? 493 HOH B O   1 
HETATM 4292 O  O   . HOH L 6 .   ? 36.951 0.349   26.957  1.00 41.80  ? 495 HOH B O   1 
HETATM 4293 O  O   . HOH L 6 .   ? 34.348 4.037   1.493   1.00 41.74  ? 506 HOH B O   1 
HETATM 4294 O  O   . HOH L 6 .   ? 20.643 -18.768 17.284  1.00 48.00  ? 508 HOH B O   1 
HETATM 4295 O  O   . HOH L 6 .   ? 5.945  2.924   23.930  1.00 46.51  ? 509 HOH B O   1 
HETATM 4296 O  O   . HOH L 6 .   ? 15.247 3.348   22.860  1.00 40.76  ? 510 HOH B O   1 
HETATM 4297 O  O   . HOH L 6 .   ? 35.541 -0.282  24.574  1.00 47.48  ? 511 HOH B O   1 
HETATM 4298 O  O   . HOH L 6 .   ? 23.289 -19.233 16.879  1.00 44.46  ? 512 HOH B O   1 
HETATM 4299 O  O   . HOH L 6 .   ? 26.915 20.235  3.955   1.00 41.04  ? 515 HOH B O   1 
HETATM 4300 O  O   . HOH L 6 .   ? 27.797 -14.204 23.140  1.00 38.01  ? 516 HOH B O   1 
HETATM 4301 O  O   . HOH L 6 .   ? 31.643 -9.742  27.893  1.00 40.75  ? 517 HOH B O   1 
HETATM 4302 O  O   . HOH L 6 .   ? 9.706  -8.157  14.691  1.00 45.10  ? 520 HOH B O   1 
HETATM 4303 O  O   . HOH L 6 .   ? 37.918 2.673   26.428  1.00 54.39  ? 521 HOH B O   1 
HETATM 4304 O  O   . HOH L 6 .   ? 32.004 5.653   0.582   1.00 51.16  ? 522 HOH B O   1 
HETATM 4305 O  O   . HOH L 6 .   ? 3.631  1.628   22.744  1.00 53.02  ? 523 HOH B O   1 
HETATM 4306 O  O   . HOH L 6 .   ? 38.926 4.846   3.377   1.00 42.96  ? 526 HOH B O   1 
HETATM 4307 O  O   . HOH L 6 .   ? 22.284 -12.757 33.080  1.00 48.33  ? 527 HOH B O   1 
HETATM 4308 O  O   . HOH L 6 .   ? 39.520 -8.788  12.506  1.00 34.16  ? 529 HOH B O   1 
HETATM 4309 O  O   . HOH L 6 .   ? 35.072 -6.141  23.768  1.00 51.22  ? 530 HOH B O   1 
HETATM 4310 O  O   . HOH L 6 .   ? 9.716  -6.352  6.662   1.00 47.87  ? 534 HOH B O   1 
HETATM 4311 O  O   . HOH L 6 .   ? 16.464 17.030  6.933   1.00 47.81  ? 536 HOH B O   1 
HETATM 4312 O  O   . HOH L 6 .   ? 30.634 6.882   4.427   1.00 48.20  ? 542 HOH B O   1 
HETATM 4313 O  O   . HOH L 6 .   ? 11.952 -10.054 13.425  1.00 43.86  ? 557 HOH B O   1 
HETATM 4314 O  O   . HOH L 6 .   ? 42.449 -4.199  16.647  1.00 50.29  ? 561 HOH B O   1 
HETATM 4315 O  O   . HOH L 6 .   ? 14.173 5.329   20.299  1.00 46.24  ? 563 HOH B O   1 
HETATM 4316 O  O   . HOH L 6 .   ? 28.027 16.600  24.685  1.00 43.35  ? 572 HOH B O   1 
HETATM 4317 O  O   . HOH L 6 .   ? 25.376 -2.474  2.071   1.00 57.61  ? 576 HOH B O   1 
HETATM 4318 O  O   . HOH L 6 .   ? 22.445 -11.068 1.973   1.00 50.79  ? 586 HOH B O   1 
HETATM 4319 O  O   . HOH L 6 .   ? 22.174 -7.840  2.468   1.00 44.32  ? 590 HOH B O   1 
HETATM 4320 O  O   . HOH L 6 .   ? 34.913 6.782   4.453   1.00 44.17  ? 591 HOH B O   1 
HETATM 4321 O  O   . HOH L 6 .   ? 19.648 -15.670 10.202  1.00 55.45  ? 592 HOH B O   1 
HETATM 4322 O  O   . HOH L 6 .   ? 16.631 2.890   28.508  1.00 38.73  ? 601 HOH B O   1 
HETATM 4323 O  O   . HOH L 6 .   ? 15.729 -13.291 13.625  1.00 42.86  ? 607 HOH B O   1 
HETATM 4324 O  O   . HOH L 6 .   ? 13.402 -13.002 12.645  1.00 63.30  ? 609 HOH B O   1 
HETATM 4325 O  O   . HOH L 6 .   ? 9.984  -11.551 11.023  1.00 61.01  ? 613 HOH B O   1 
HETATM 4326 O  O   . HOH L 6 .   ? 8.261  -10.882 27.087  1.00 42.54  ? 616 HOH B O   1 
HETATM 4327 O  O   . HOH L 6 .   ? 12.427 -14.792 11.128  1.00 48.62  ? 618 HOH B O   1 
HETATM 4328 O  O   . HOH L 6 .   ? 39.560 10.428  12.828  1.00 47.69  ? 627 HOH B O   1 
HETATM 4329 O  O   . HOH L 6 .   ? 10.202 -11.581 28.767  1.00 48.33  ? 631 HOH B O   1 
HETATM 4330 O  O   . HOH L 6 .   ? 15.993 17.863  15.970  1.00 37.33  ? 632 HOH B O   1 
HETATM 4331 O  O   . HOH L 6 .   ? 21.606 -12.411 12.567  1.00 24.54  ? 633 HOH B O   1 
HETATM 4332 O  O   . HOH L 6 .   ? 12.816 1.177   5.383   1.00 58.59  ? 640 HOH B O   1 
HETATM 4333 O  O   . HOH L 6 .   ? 9.281  1.726   18.700  1.00 43.67  ? 645 HOH B O   1 
HETATM 4334 O  O   . HOH L 6 .   ? 14.578 4.177   28.446  1.00 42.54  ? 646 HOH B O   1 
HETATM 4335 O  O   . HOH L 6 .   ? 25.253 19.780  12.255  1.00 42.16  ? 648 HOH B O   1 
HETATM 4336 O  O   . HOH L 6 .   ? 29.605 -12.520 25.531  1.00 42.97  ? 652 HOH B O   1 
HETATM 4337 O  O   . HOH L 6 .   ? 43.605 -0.000  15.830  0.50 52.20  ? 656 HOH B O   1 
HETATM 4338 O  O   . HOH L 6 .   ? 29.965 1.697   0.414   1.00 41.15  ? 660 HOH B O   1 
HETATM 4339 O  O   . HOH L 6 .   ? 14.126 5.627   4.328   1.00 54.71  ? 663 HOH B O   1 
HETATM 4340 O  O   . HOH L 6 .   ? 39.035 11.751  15.293  1.00 50.90  ? 664 HOH B O   1 
HETATM 4341 O  O   . HOH L 6 .   ? 43.605 -0.000  13.205  0.50 42.67  ? 667 HOH B O   1 
HETATM 4342 O  O   . HOH L 6 .   ? 18.161 12.267  4.599   1.00 47.25  ? 668 HOH B O   1 
HETATM 4343 O  O   . HOH L 6 .   ? 12.690 9.615   22.456  1.00 46.38  ? 670 HOH B O   1 
HETATM 4344 O  O   . HOH L 6 .   ? 17.996 21.465  16.100  1.00 57.26  ? 673 HOH B O   1 
HETATM 4345 O  O   . HOH L 6 .   ? 31.064 -12.006 30.726  1.00 45.77  ? 679 HOH B O   1 
HETATM 4346 O  O   . HOH L 6 .   ? 15.110 1.747   2.699   1.00 48.91  ? 680 HOH B O   1 
HETATM 4347 O  O   . HOH L 6 .   ? 9.832  -3.516  30.848  1.00 34.32  ? 690 HOH B O   1 
HETATM 4348 O  O   . HOH L 6 .   ? 26.650 -14.562 32.854  1.00 49.35  ? 693 HOH B O   1 
HETATM 4349 O  O   . HOH L 6 .   ? 18.373 15.686  5.891   1.00 45.78  ? 695 HOH B O   1 
HETATM 4350 O  O   . HOH L 6 .   ? 28.166 -17.721 21.423  1.00 49.80  ? 703 HOH B O   1 
HETATM 4351 O  O   . HOH L 6 .   ? 43.829 1.686   11.017  1.00 49.54  ? 712 HOH B O   1 
HETATM 4352 O  O   . HOH L 6 .   ? 24.897 17.445  18.359  1.00 45.18  ? 714 HOH B O   1 
HETATM 4353 O  O   . HOH L 6 .   ? 24.515 -15.367 31.734  1.00 52.99  ? 715 HOH B O   1 
HETATM 4354 O  O   . HOH L 6 .   ? 20.042 -19.670 28.618  1.00 59.22  ? 716 HOH B O   1 
HETATM 4355 O  O   . HOH L 6 .   ? 9.579  -21.958 24.280  1.00 50.52  ? 721 HOH B O   1 
HETATM 4356 O  O   . HOH L 6 .   ? 24.451 18.651  20.365  1.00 53.37  ? 723 HOH B O   1 
HETATM 4357 O  O   . HOH L 6 .   ? 10.393 -12.779 14.573  1.00 53.33  ? 728 HOH B O   1 
HETATM 4358 O  O   . HOH L 6 .   ? 30.894 8.160   2.076   1.00 58.57  ? 729 HOH B O   1 
HETATM 4359 O  O   . HOH M 6 .   ? 27.006 9.288   29.650  1.00 22.31  ? 23  HOH C O   1 
HETATM 4360 O  O   . HOH M 6 .   ? 28.464 -4.898  34.354  1.00 27.64  ? 42  HOH C O   1 
HETATM 4361 O  O   . HOH M 6 .   ? 23.707 8.016   46.328  1.00 31.42  ? 51  HOH C O   1 
HETATM 4362 O  O   . HOH M 6 .   ? 32.205 4.875   39.063  1.00 34.60  ? 58  HOH C O   1 
HETATM 4363 O  O   . HOH M 6 .   ? 13.022 -3.549  34.367  1.00 23.12  ? 77  HOH C O   1 
HETATM 4364 O  O   . HOH M 6 .   ? 28.632 4.792   26.222  1.00 17.90  ? 80  HOH C O   1 
HETATM 4365 O  O   . HOH M 6 .   ? 35.889 0.830   29.349  1.00 33.88  ? 82  HOH C O   1 
HETATM 4366 O  O   . HOH M 6 .   ? 21.596 6.719   27.772  1.00 34.80  ? 85  HOH C O   1 
HETATM 4367 O  O   . HOH M 6 .   ? 26.777 15.803  41.308  1.00 37.31  ? 89  HOH C O   1 
HETATM 4368 O  O   . HOH M 6 .   ? 27.273 7.372   27.885  1.00 26.65  ? 91  HOH C O   1 
HETATM 4369 O  O   . HOH M 6 .   ? 29.416 12.262  40.085  1.00 33.82  ? 95  HOH C O   1 
HETATM 4370 O  O   . HOH M 6 .   ? 12.327 1.835   34.088  1.00 31.41  ? 99  HOH C O   1 
HETATM 4371 O  O   . HOH M 6 .   ? 28.977 7.790   30.595  1.00 22.29  ? 105 HOH C O   1 
HETATM 4372 O  O   . HOH M 6 .   ? 21.122 13.278  26.114  1.00 37.61  ? 113 HOH C O   1 
HETATM 4373 O  O   . HOH M 6 .   ? 22.228 14.806  44.069  1.00 33.91  ? 129 HOH C O   1 
HETATM 4374 O  O   . HOH M 6 .   ? 25.286 16.633  43.660  1.00 34.20  ? 133 HOH C O   1 
HETATM 4375 O  O   . HOH M 6 .   ? 12.694 -7.353  31.854  1.00 44.36  ? 166 HOH C O   1 
HETATM 4376 O  O   . HOH M 6 .   ? 17.641 7.158   30.164  1.00 27.40  ? 167 HOH C O   1 
HETATM 4377 O  O   . HOH M 6 .   ? 29.308 10.074  38.226  1.00 24.96  ? 188 HOH C O   1 
HETATM 4378 O  O   . HOH M 6 .   ? 31.139 9.355   31.708  1.00 39.84  ? 196 HOH C O   1 
HETATM 4379 O  O   . HOH M 6 .   ? 11.470 12.053  35.745  1.00 36.88  ? 198 HOH C O   1 
HETATM 4380 O  O   . HOH M 6 .   ? 34.005 5.859   34.525  1.00 32.49  ? 203 HOH C O   1 
HETATM 4381 O  O   . HOH M 6 .   ? 18.595 1.979   53.646  1.00 42.48  ? 222 HOH C O   1 
HETATM 4382 O  O   . HOH M 6 .   ? 23.821 -8.847  35.756  1.00 39.66  ? 224 HOH C O   1 
HETATM 4383 O  O   . HOH M 6 .   ? 33.598 6.052   37.209  1.00 44.97  ? 225 HOH C O   1 
HETATM 4384 O  O   . HOH M 6 .   ? 29.583 5.600   39.167  1.00 27.51  ? 236 HOH C O   1 
HETATM 4385 O  O   . HOH M 6 .   ? 17.864 -5.511  56.910  1.00 54.23  ? 238 HOH C O   1 
HETATM 4386 O  O   . HOH M 6 .   ? 33.352 6.775   32.304  1.00 46.95  ? 245 HOH C O   1 
HETATM 4387 O  O   . HOH M 6 .   ? 16.296 10.299  31.854  1.00 39.94  ? 246 HOH C O   1 
HETATM 4388 O  O   . HOH M 6 .   ? 29.592 8.139   40.147  1.00 27.68  ? 253 HOH C O   1 
HETATM 4389 O  O   . HOH M 6 .   ? 8.491  -2.731  41.979  1.00 47.75  ? 255 HOH C O   1 
HETATM 4390 O  O   . HOH M 6 .   ? 28.929 18.248  38.388  1.00 44.53  ? 263 HOH C O   1 
HETATM 4391 O  O   . HOH M 6 .   ? 26.725 8.771   44.610  1.00 35.13  ? 270 HOH C O   1 
HETATM 4392 O  O   . HOH M 6 .   ? 36.332 4.711   33.695  1.00 39.91  ? 273 HOH C O   1 
HETATM 4393 O  O   . HOH M 6 .   ? 11.828 1.142   50.333  1.00 48.72  ? 277 HOH C O   1 
HETATM 4394 O  O   . HOH M 6 .   ? 19.217 6.291   27.731  1.00 37.55  ? 292 HOH C O   1 
HETATM 4395 O  O   . HOH M 6 .   ? 30.019 16.623  41.331  1.00 28.73  ? 300 HOH C O   1 
HETATM 4396 O  O   . HOH M 6 .   ? 20.212 18.351  41.379  1.00 31.41  ? 301 HOH C O   1 
HETATM 4397 O  O   . HOH M 6 .   ? 36.490 -3.024  27.079  1.00 50.61  ? 309 HOH C O   1 
HETATM 4398 O  O   . HOH M 6 .   ? 28.878 9.206   42.686  1.00 34.44  ? 311 HOH C O   1 
HETATM 4399 O  O   . HOH M 6 .   ? 31.469 10.458  36.597  1.00 36.99  ? 338 HOH C O   1 
HETATM 4400 O  O   . HOH M 6 .   ? 10.016 -4.358  51.029  1.00 53.96  ? 341 HOH C O   1 
HETATM 4401 O  O   . HOH M 6 .   ? 36.735 -2.452  29.671  1.00 34.01  ? 346 HOH C O   1 
HETATM 4402 O  O   . HOH M 6 .   ? 34.839 6.858   30.120  1.00 56.24  ? 357 HOH C O   1 
HETATM 4403 O  O   . HOH M 6 .   ? 33.735 -6.115  30.101  1.00 55.42  ? 362 HOH C O   1 
HETATM 4404 O  O   . HOH M 6 .   ? 32.028 11.801  41.031  1.00 41.24  ? 367 HOH C O   1 
HETATM 4405 O  O   . HOH M 6 .   ? 34.255 -2.383  25.602  1.00 31.09  ? 380 HOH C O   1 
HETATM 4406 O  O   . HOH M 6 .   ? 30.573 -6.172  38.335  1.00 38.02  ? 384 HOH C O   1 
HETATM 4407 O  O   . HOH M 6 .   ? 26.055 3.377   50.989  1.00 44.56  ? 391 HOH C O   1 
HETATM 4408 O  O   . HOH M 6 .   ? 38.288 -4.940  35.549  1.00 49.30  ? 397 HOH C O   1 
HETATM 4409 O  O   . HOH M 6 .   ? 37.366 -4.552  31.312  1.00 57.47  ? 404 HOH C O   1 
HETATM 4410 O  O   . HOH M 6 .   ? 29.684 12.875  33.034  1.00 38.48  ? 406 HOH C O   1 
HETATM 4411 O  O   . HOH M 6 .   ? 13.442 17.275  37.503  1.00 55.10  ? 408 HOH C O   1 
HETATM 4412 O  O   . HOH M 6 .   ? 19.070 13.338  29.729  1.00 44.43  ? 409 HOH C O   1 
HETATM 4413 O  O   . HOH M 6 .   ? 26.254 14.261  28.410  1.00 38.46  ? 410 HOH C O   1 
HETATM 4414 O  O   . HOH M 6 .   ? 31.412 2.669   46.253  1.00 48.94  ? 413 HOH C O   1 
HETATM 4415 O  O   . HOH M 6 .   ? 35.055 -4.745  28.337  1.00 47.56  ? 419 HOH C O   1 
HETATM 4416 O  O   . HOH M 6 .   ? 16.151 4.199   32.281  1.00 36.99  ? 425 HOH C O   1 
HETATM 4417 O  O   . HOH M 6 .   ? 31.218 10.599  34.144  1.00 40.85  ? 430 HOH C O   1 
HETATM 4418 O  O   . HOH M 6 .   ? 11.259 -5.395  47.168  1.00 36.88  ? 434 HOH C O   1 
HETATM 4419 O  O   . HOH M 6 .   ? 12.623 -5.189  49.191  1.00 52.07  ? 436 HOH C O   1 
HETATM 4420 O  O   . HOH M 6 .   ? 35.418 -5.707  32.877  1.00 50.26  ? 445 HOH C O   1 
HETATM 4421 O  O   . HOH M 6 .   ? 31.147 -6.262  31.228  1.00 44.94  ? 450 HOH C O   1 
HETATM 4422 O  O   . HOH M 6 .   ? 33.801 3.517   44.967  1.00 49.22  ? 451 HOH C O   1 
HETATM 4423 O  O   . HOH M 6 .   ? 33.363 -2.584  40.774  1.00 47.78  ? 473 HOH C O   1 
HETATM 4424 O  O   . HOH M 6 .   ? 17.823 7.869   25.813  1.00 54.85  ? 476 HOH C O   1 
HETATM 4425 O  O   . HOH M 6 .   ? 28.812 14.956  43.087  1.00 46.48  ? 501 HOH C O   1 
HETATM 4426 O  O   . HOH M 6 .   ? 30.776 13.640  43.676  1.00 48.84  ? 502 HOH C O   1 
HETATM 4427 O  O   . HOH M 6 .   ? 33.305 8.646   37.682  1.00 35.91  ? 503 HOH C O   1 
HETATM 4428 O  O   . HOH M 6 .   ? 30.558 16.321  44.004  1.00 50.76  ? 550 HOH C O   1 
HETATM 4429 O  O   . HOH M 6 .   ? 37.159 2.759   30.823  1.00 47.38  ? 554 HOH C O   1 
HETATM 4430 O  O   . HOH M 6 .   ? 27.766 16.833  32.398  1.00 51.86  ? 577 HOH C O   1 
HETATM 4431 O  O   . HOH M 6 .   ? 22.502 4.777   50.944  1.00 45.26  ? 578 HOH C O   1 
HETATM 4432 O  O   . HOH M 6 .   ? 6.014  2.263   45.327  1.00 47.21  ? 579 HOH C O   1 
HETATM 4433 O  O   . HOH M 6 .   ? 16.058 18.565  36.753  1.00 50.99  ? 582 HOH C O   1 
HETATM 4434 O  O   . HOH M 6 .   ? 16.018 19.079  34.135  1.00 50.07  ? 589 HOH C O   1 
HETATM 4435 O  O   . HOH M 6 .   ? 32.064 -1.267  44.204  1.00 62.11  ? 593 HOH C O   1 
HETATM 4436 O  O   . HOH M 6 .   ? 13.447 -12.817 44.536  1.00 45.53  ? 594 HOH C O   1 
HETATM 4437 O  O   . HOH M 6 .   ? 28.326 20.613  37.121  1.00 49.37  ? 595 HOH C O   1 
HETATM 4438 O  O   . HOH M 6 .   ? 21.356 -4.222  58.087  1.00 46.74  ? 596 HOH C O   1 
HETATM 4439 O  O   . HOH M 6 .   ? 13.548 5.794   32.021  1.00 54.48  ? 598 HOH C O   1 
HETATM 4440 O  O   . HOH M 6 .   ? 36.522 5.183   30.753  1.00 59.64  ? 602 HOH C O   1 
HETATM 4441 O  O   . HOH M 6 .   ? 32.684 16.055  45.424  1.00 49.49  ? 605 HOH C O   1 
HETATM 4442 O  O   . HOH M 6 .   ? 31.119 15.175  48.229  1.00 49.06  ? 614 HOH C O   1 
HETATM 4443 O  O   . HOH M 6 .   ? 16.781 16.511  30.576  1.00 37.40  ? 623 HOH C O   1 
HETATM 4444 O  O   . HOH M 6 .   ? 33.043 -8.697  35.458  1.00 47.02  ? 625 HOH C O   1 
HETATM 4445 O  O   . HOH M 6 .   ? 16.805 9.599   29.325  1.00 47.85  ? 630 HOH C O   1 
HETATM 4446 O  O   . HOH M 6 .   ? 40.476 -2.257  36.687  1.00 47.07  ? 650 HOH C O   1 
HETATM 4447 O  O   . HOH M 6 .   ? 23.326 19.217  31.210  1.00 55.60  ? 657 HOH C O   1 
HETATM 4448 O  O   . HOH M 6 .   ? 32.502 10.014  29.722  1.00 59.17  ? 662 HOH C O   1 
HETATM 4449 O  O   . HOH M 6 .   ? 8.919  -2.053  44.365  1.00 55.13  ? 666 HOH C O   1 
HETATM 4450 O  O   . HOH M 6 .   ? 31.523 17.574  47.160  1.00 50.52  ? 685 HOH C O   1 
HETATM 4451 O  O   . HOH M 6 .   ? 25.791 -12.481 38.662  1.00 40.27  ? 689 HOH C O   1 
HETATM 4452 O  O   . HOH M 6 .   ? 31.378 5.172   46.657  1.00 64.65  ? 818 HOH C O   1 
HETATM 4453 O  O   . HOH M 6 .   ? 39.457 -1.879  30.291  1.00 54.19  ? 819 HOH C O   1 
HETATM 4454 O  O   . HOH M 6 .   ? 6.443  -1.206  42.647  1.00 60.51  ? 820 HOH C O   1 
HETATM 4455 O  O   . HOH M 6 .   ? 29.781 6.574   45.269  1.00 46.11  ? 821 HOH C O   1 
HETATM 4456 O  O   . HOH M 6 .   ? 29.287 -14.162 47.764  1.00 60.70  ? 822 HOH C O   1 
HETATM 4457 O  O   . HOH M 6 .   ? 19.156 22.142  29.366  1.00 52.59  ? 823 HOH C O   1 
HETATM 4458 O  O   . HOH N 6 .   ? 43.389 -25.850 18.113  1.00 16.05  ? 8   HOH A O   1 
HETATM 4459 O  O   . HOH N 6 .   ? 30.553 -7.772  6.822   1.00 20.64  ? 9   HOH A O   1 
HETATM 4460 O  O   . HOH N 6 .   ? 47.976 -21.097 15.334  1.00 21.73  ? 10  HOH A O   1 
HETATM 4461 O  O   . HOH N 6 .   ? 34.286 -21.722 13.871  1.00 16.76  ? 13  HOH A O   1 
HETATM 4462 O  O   . HOH N 6 .   ? 48.228 -26.399 16.638  1.00 17.94  ? 14  HOH A O   1 
HETATM 4463 O  O   . HOH N 6 .   ? 46.250 -25.543 14.235  1.00 17.72  ? 16  HOH A O   1 
HETATM 4464 O  O   . HOH N 6 .   ? 41.182 -33.931 7.121   1.00 22.56  ? 19  HOH A O   1 
HETATM 4465 O  O   . HOH N 6 .   ? 30.455 -34.035 -6.478  1.00 20.91  ? 194 HOH A O   1 
HETATM 4466 O  O   . HOH N 6 .   ? 25.693 -20.730 4.664   1.00 17.50  ? 195 HOH A O   1 
HETATM 4467 O  O   . HOH N 6 .   ? 28.180 -11.285 11.348  1.00 21.47  ? 196 HOH A O   1 
HETATM 4468 O  O   . HOH N 6 .   ? 35.226 -24.190 14.298  1.00 20.51  ? 197 HOH A O   1 
HETATM 4469 O  O   . HOH N 6 .   ? 34.853 -19.038 14.152  1.00 14.88  ? 198 HOH A O   1 
HETATM 4470 O  O   . HOH N 6 .   ? 37.842 -24.541 13.796  1.00 23.11  ? 199 HOH A O   1 
HETATM 4471 O  O   . HOH N 6 .   ? 26.130 -18.800 1.453   1.00 23.08  ? 200 HOH A O   1 
HETATM 4472 O  O   . HOH N 6 .   ? 51.069 -32.505 14.164  1.00 23.52  ? 201 HOH A O   1 
HETATM 4473 O  O   . HOH N 6 .   ? 23.864 -21.192 9.760   1.00 37.90  ? 202 HOH A O   1 
HETATM 4474 O  O   . HOH N 6 .   ? 23.940 -23.288 1.880   1.00 28.49  ? 203 HOH A O   1 
HETATM 4475 O  O   . HOH N 6 .   ? 48.696 -38.438 -0.611  1.00 33.02  ? 204 HOH A O   1 
HETATM 4476 O  O   . HOH N 6 .   ? 46.923 -21.467 -7.481  1.00 47.15  ? 205 HOH A O   1 
HETATM 4477 O  O   . HOH N 6 .   ? 47.403 -37.027 8.992   1.00 27.91  ? 206 HOH A O   1 
HETATM 4478 O  O   . HOH N 6 .   ? 38.539 -33.764 19.759  1.00 36.59  ? 207 HOH A O   1 
HETATM 4479 O  O   . HOH N 6 .   ? 56.427 -35.992 12.136  1.00 31.81  ? 208 HOH A O   1 
HETATM 4480 O  O   . HOH N 6 .   ? 39.459 -32.904 -6.314  1.00 21.44  ? 209 HOH A O   1 
HETATM 4481 O  O   . HOH N 6 .   ? 29.686 -29.152 -7.487  1.00 35.78  ? 210 HOH A O   1 
HETATM 4482 O  O   . HOH N 6 .   ? 43.592 -15.850 -8.184  1.00 38.68  ? 211 HOH A O   1 
HETATM 4483 O  O   . HOH N 6 .   ? 53.851 -19.484 11.638  1.00 24.89  ? 212 HOH A O   1 
HETATM 4484 O  O   . HOH N 6 .   ? 34.763 -13.429 -5.954  1.00 26.97  ? 213 HOH A O   1 
HETATM 4485 O  O   . HOH N 6 .   ? 39.723 -18.412 -7.517  1.00 24.59  ? 214 HOH A O   1 
HETATM 4486 O  O   . HOH N 6 .   ? 47.459 -19.484 24.581  1.00 44.99  ? 215 HOH A O   1 
HETATM 4487 O  O   . HOH N 6 .   ? 27.503 -35.411 4.701   1.00 31.64  ? 216 HOH A O   1 
HETATM 4488 O  O   . HOH N 6 .   ? 49.371 -25.462 20.530  1.00 19.80  ? 217 HOH A O   1 
HETATM 4489 O  O   . HOH N 6 .   ? 53.749 -15.869 2.897   1.00 21.56  ? 218 HOH A O   1 
HETATM 4490 O  O   . HOH N 6 .   ? 52.367 -32.915 1.542   1.00 33.85  ? 219 HOH A O   1 
HETATM 4491 O  O   . HOH N 6 .   ? 55.709 -21.270 17.664  1.00 31.69  ? 220 HOH A O   1 
HETATM 4492 O  O   . HOH N 6 .   ? 27.021 -26.119 -5.504  1.00 46.60  ? 221 HOH A O   1 
HETATM 4493 O  O   . HOH N 6 .   ? 54.200 -30.958 16.966  1.00 25.91  ? 222 HOH A O   1 
HETATM 4494 O  O   . HOH N 6 .   ? 52.727 -32.305 4.395   1.00 31.77  ? 223 HOH A O   1 
HETATM 4495 O  O   . HOH N 6 .   ? 45.811 -13.331 -1.625  1.00 23.45  ? 224 HOH A O   1 
HETATM 4496 O  O   . HOH N 6 .   ? 40.550 -12.435 2.110   1.00 18.84  ? 225 HOH A O   1 
HETATM 4497 O  O   . HOH N 6 .   ? 52.399 -32.771 16.604  1.00 20.77  ? 226 HOH A O   1 
HETATM 4498 O  O   . HOH N 6 .   ? 50.330 -24.880 17.907  1.00 22.04  ? 227 HOH A O   1 
HETATM 4499 O  O   . HOH N 6 .   ? 59.564 -23.330 4.968   1.00 36.03  ? 228 HOH A O   1 
HETATM 4500 O  O   . HOH N 6 .   ? 37.278 -18.563 -5.861  1.00 19.72  ? 229 HOH A O   1 
HETATM 4501 O  O   . HOH N 6 .   ? 32.128 -34.930 9.468   1.00 36.12  ? 230 HOH A O   1 
HETATM 4502 O  O   . HOH N 6 .   ? 39.110 -11.843 13.728  1.00 28.94  ? 231 HOH A O   1 
HETATM 4503 O  O   . HOH N 6 .   ? 36.624 -29.366 -4.671  1.00 20.49  ? 232 HOH A O   1 
HETATM 4504 O  O   . HOH N 6 .   ? 52.681 -19.844 -3.672  1.00 41.11  ? 233 HOH A O   1 
HETATM 4505 O  O   . HOH N 6 .   ? 26.337 -22.249 8.751   1.00 25.95  ? 234 HOH A O   1 
HETATM 4506 O  O   . HOH N 6 .   ? 47.657 -13.600 20.324  1.00 23.64  ? 235 HOH A O   1 
HETATM 4507 O  O   . HOH N 6 .   ? 41.124 -15.862 -6.783  1.00 27.21  ? 236 HOH A O   1 
HETATM 4508 O  O   . HOH N 6 .   ? 47.981 -12.774 8.140   1.00 20.78  ? 237 HOH A O   1 
HETATM 4509 O  O   . HOH N 6 .   ? 36.153 -29.942 -7.269  1.00 22.41  ? 238 HOH A O   1 
HETATM 4510 O  O   . HOH N 6 .   ? 44.714 -37.927 16.522  1.00 45.74  ? 239 HOH A O   1 
HETATM 4511 O  O   . HOH N 6 .   ? 33.297 -7.046  7.444   1.00 42.49  ? 240 HOH A O   1 
HETATM 4512 O  O   . HOH N 6 .   ? 40.034 -33.710 9.585   1.00 19.00  ? 241 HOH A O   1 
HETATM 4513 O  O   . HOH N 6 .   ? 50.736 -29.942 21.654  1.00 40.73  ? 242 HOH A O   1 
HETATM 4514 O  O   . HOH N 6 .   ? 47.358 -39.092 12.014  1.00 55.48  ? 243 HOH A O   1 
HETATM 4515 O  O   . HOH N 6 .   ? 38.649 -27.305 -6.929  1.00 23.41  ? 244 HOH A O   1 
HETATM 4516 O  O   . HOH N 6 .   ? 43.210 -27.397 -8.457  1.00 44.56  ? 245 HOH A O   1 
HETATM 4517 O  O   . HOH N 6 .   ? 21.931 -12.644 6.008   1.00 36.75  ? 246 HOH A O   1 
HETATM 4518 O  O   . HOH N 6 .   ? 49.932 -23.284 22.081  1.00 22.61  ? 247 HOH A O   1 
HETATM 4519 O  O   . HOH N 6 .   ? 54.207 -22.457 14.614  1.00 25.63  ? 248 HOH A O   1 
HETATM 4520 O  O   . HOH N 6 .   ? 51.949 -20.409 22.863  1.00 38.65  ? 249 HOH A O   1 
HETATM 4521 O  O   . HOH N 6 .   ? 58.621 -25.636 1.048   1.00 39.92  ? 250 HOH A O   1 
HETATM 4522 O  O   . HOH N 6 .   ? 50.180 -31.698 -5.819  1.00 50.79  ? 251 HOH A O   1 
HETATM 4523 O  O   . HOH N 6 .   ? 44.830 -13.819 16.705  1.00 33.34  ? 252 HOH A O   1 
HETATM 4524 O  O   . HOH N 6 .   ? 22.701 -24.116 -2.885  1.00 23.12  ? 253 HOH A O   1 
HETATM 4525 O  O   . HOH N 6 .   ? 28.840 -35.814 6.712   1.00 44.70  ? 254 HOH A O   1 
HETATM 4526 O  O   . HOH N 6 .   ? 46.068 -15.509 19.394  1.00 35.32  ? 255 HOH A O   1 
HETATM 4527 O  O   . HOH N 6 .   ? 38.044 -40.559 -6.710  1.00 50.46  ? 256 HOH A O   1 
HETATM 4528 O  O   . HOH N 6 .   ? 29.001 -6.445  5.156   1.00 33.43  ? 257 HOH A O   1 
HETATM 4529 O  O   . HOH N 6 .   ? 28.785 -7.672  0.848   1.00 37.15  ? 258 HOH A O   1 
HETATM 4530 O  O   . HOH N 6 .   ? 31.026 -41.586 -2.306  1.00 54.08  ? 259 HOH A O   1 
HETATM 4531 O  O   . HOH N 6 .   ? 51.275 -15.888 1.048   1.00 29.95  ? 260 HOH A O   1 
HETATM 4532 O  O   . HOH N 6 .   ? 28.268 -34.324 -0.714  1.00 31.11  ? 261 HOH A O   1 
HETATM 4533 O  O   . HOH N 6 .   ? 28.887 -8.385  -1.771  1.00 34.01  ? 262 HOH A O   1 
HETATM 4534 O  O   . HOH N 6 .   ? 35.956 -37.942 4.020   1.00 30.13  ? 263 HOH A O   1 
HETATM 4535 O  O   . HOH N 6 .   ? 56.678 -15.999 12.069  1.00 50.58  ? 264 HOH A O   1 
HETATM 4536 O  O   . HOH N 6 .   ? 47.712 -18.358 -5.612  1.00 35.18  ? 265 HOH A O   1 
HETATM 4537 O  O   . HOH N 6 .   ? 39.231 -35.495 -9.278  1.00 30.55  ? 266 HOH A O   1 
HETATM 4538 O  O   . HOH N 6 .   ? 58.260 -24.875 8.595   1.00 32.85  ? 267 HOH A O   1 
HETATM 4539 O  O   . HOH N 6 .   ? 47.654 -23.760 7.845   1.00 38.67  ? 268 HOH A O   1 
HETATM 4540 O  O   . HOH N 6 .   ? 44.692 -41.925 3.964   1.00 33.89  ? 269 HOH A O   1 
HETATM 4541 O  O   . HOH N 6 .   ? 25.634 -27.381 -3.689  1.00 28.34  ? 270 HOH A O   1 
HETATM 4542 O  O   . HOH N 6 .   ? 37.569 -36.117 6.061   1.00 32.60  ? 271 HOH A O   1 
HETATM 4543 O  O   . HOH N 6 .   ? 44.304 -21.836 -7.345  1.00 32.41  ? 272 HOH A O   1 
HETATM 4544 O  O   . HOH N 6 .   ? 47.511 -36.409 -2.138  1.00 31.81  ? 273 HOH A O   1 
HETATM 4545 O  O   . HOH N 6 .   ? 47.476 -36.603 19.705  1.00 43.81  ? 274 HOH A O   1 
HETATM 4546 O  O   . HOH N 6 .   ? 37.119 -13.029 -7.644  1.00 37.62  ? 275 HOH A O   1 
HETATM 4547 O  O   . HOH N 6 .   ? 56.279 -23.581 19.331  1.00 37.22  ? 276 HOH A O   1 
HETATM 4548 O  O   . HOH N 6 .   ? 38.590 -34.739 12.958  1.00 32.06  ? 277 HOH A O   1 
HETATM 4549 O  O   . HOH N 6 .   ? 40.338 -38.150 9.404   1.00 33.77  ? 278 HOH A O   1 
HETATM 4550 O  O   . HOH N 6 .   ? 38.943 -27.064 14.123  1.00 26.59  ? 279 HOH A O   1 
HETATM 4551 O  O   . HOH N 6 .   ? 51.013 -27.287 21.883  1.00 29.50  ? 280 HOH A O   1 
HETATM 4552 O  O   . HOH N 6 .   ? 40.413 -40.605 15.513  1.00 39.96  ? 281 HOH A O   1 
HETATM 4553 O  O   . HOH N 6 .   ? 49.638 -16.313 13.711  1.00 19.83  ? 282 HOH A O   1 
HETATM 4554 O  O   . HOH N 6 .   ? 28.412 -23.132 -8.797  1.00 40.49  ? 283 HOH A O   1 
HETATM 4555 O  O   . HOH N 6 .   ? 37.703 -21.864 -11.224 1.00 58.23  ? 284 HOH A O   1 
HETATM 4556 O  O   . HOH N 6 .   ? 38.480 -39.624 3.543   1.00 32.25  ? 285 HOH A O   1 
HETATM 4557 O  O   . HOH N 6 .   ? 38.996 -36.015 10.220  1.00 34.86  ? 286 HOH A O   1 
HETATM 4558 O  O   . HOH N 6 .   ? 58.194 -23.170 10.643  1.00 29.48  ? 288 HOH A O   1 
HETATM 4559 O  O   . HOH N 6 .   ? 26.374 -16.639 14.967  1.00 40.76  ? 289 HOH A O   1 
HETATM 4560 O  O   . HOH N 6 .   ? 54.030 -25.224 19.955  1.00 37.02  ? 290 HOH A O   1 
HETATM 4561 O  O   . HOH N 6 .   ? 26.050 -15.726 11.579  1.00 26.46  ? 291 HOH A O   1 
HETATM 4562 O  O   . HOH N 6 .   ? 28.577 -8.691  3.400   1.00 32.68  ? 292 HOH A O   1 
HETATM 4563 O  O   . HOH N 6 .   ? 37.988 -31.773 -8.344  1.00 32.65  ? 293 HOH A O   1 
HETATM 4564 O  O   . HOH N 6 .   ? 41.069 -21.966 -9.965  1.00 61.79  ? 294 HOH A O   1 
HETATM 4565 O  O   . HOH N 6 .   ? 21.145 -25.998 -4.119  1.00 27.91  ? 295 HOH A O   1 
HETATM 4566 O  O   . HOH N 6 .   ? 40.401 -8.984  -4.105  1.00 36.57  ? 296 HOH A O   1 
HETATM 4567 O  O   . HOH N 6 .   ? 45.116 -36.827 18.933  1.00 35.02  ? 297 HOH A O   1 
HETATM 4568 O  O   . HOH N 6 .   ? 47.110 -38.103 15.418  1.00 35.21  ? 298 HOH A O   1 
HETATM 4569 O  O   . HOH N 6 .   ? 38.582 -32.158 12.787  1.00 33.76  ? 299 HOH A O   1 
HETATM 4570 O  O   . HOH N 6 .   ? 55.423 -30.960 4.366   1.00 34.08  ? 300 HOH A O   1 
HETATM 4571 O  O   . HOH N 6 .   ? 54.156 -39.320 10.115  1.00 44.94  ? 301 HOH A O   1 
HETATM 4572 O  O   . HOH N 6 .   ? 30.586 -5.965  1.443   1.00 51.70  ? 302 HOH A O   1 
HETATM 4573 O  O   . HOH N 6 .   ? 42.577 -35.591 21.527  1.00 33.42  ? 303 HOH A O   1 
HETATM 4574 O  O   . HOH N 6 .   ? 41.428 -31.906 -7.590  1.00 40.70  ? 304 HOH A O   1 
HETATM 4575 O  O   . HOH N 6 .   ? 38.202 -31.746 10.288  1.00 21.57  ? 305 HOH A O   1 
HETATM 4576 O  O   . HOH N 6 .   ? 56.797 -36.399 9.428   1.00 40.70  ? 306 HOH A O   1 
HETATM 4577 O  O   . HOH N 6 .   ? 44.750 -10.829 -1.602  1.00 41.28  ? 307 HOH A O   1 
HETATM 4578 O  O   . HOH N 6 .   ? 59.362 -35.732 8.267   1.00 39.22  ? 308 HOH A O   1 
HETATM 4579 O  O   . HOH N 6 .   ? 28.558 -14.214 14.072  1.00 20.72  ? 309 HOH A O   1 
HETATM 4580 O  O   . HOH N 6 .   ? 21.714 -23.088 -0.587  1.00 30.86  ? 316 HOH A O   1 
HETATM 4581 O  O   . HOH N 6 .   ? 39.585 -28.668 -8.888  1.00 42.45  ? 317 HOH A O   1 
HETATM 4582 O  O   . HOH N 6 .   ? 52.809 -23.508 21.954  1.00 38.40  ? 318 HOH A O   1 
HETATM 4583 O  O   . HOH N 6 .   ? 54.545 -17.145 13.161  1.00 29.45  ? 322 HOH A O   1 
HETATM 4584 O  O   . HOH N 6 .   ? 37.951 -30.376 16.863  1.00 56.03  ? 327 HOH A O   1 
HETATM 4585 O  O   . HOH N 6 .   ? 22.822 -18.835 11.517  1.00 29.56  ? 328 HOH A O   1 
HETATM 4586 O  O   . HOH N 6 .   ? 34.066 -6.434  -5.898  1.00 43.97  ? 331 HOH A O   1 
HETATM 4587 O  O   . HOH N 6 .   ? 33.475 -11.618 -7.344  1.00 39.69  ? 333 HOH A O   1 
HETATM 4588 O  O   . HOH N 6 .   ? 46.907 -27.422 -10.327 1.00 56.87  ? 335 HOH A O   1 
HETATM 4589 O  O   . HOH N 6 .   ? 34.508 -25.618 -10.392 1.00 47.22  ? 336 HOH A O   1 
HETATM 4590 O  O   . HOH N 6 .   ? 21.035 -26.675 4.780   1.00 48.57  ? 344 HOH A O   1 
HETATM 4591 O  O   . HOH N 6 .   ? 41.478 -43.438 -4.096  1.00 39.57  ? 348 HOH A O   1 
HETATM 4592 O  O   . HOH N 6 .   ? 47.669 -37.095 -4.947  1.00 32.79  ? 350 HOH A O   1 
HETATM 4593 O  O   . HOH N 6 .   ? 39.282 -14.308 -8.093  1.00 39.16  ? 355 HOH A O   1 
HETATM 4594 O  O   . HOH N 6 .   ? 55.362 -38.381 8.127   1.00 49.91  ? 363 HOH A O   1 
HETATM 4595 O  O   . HOH N 6 .   ? 43.574 -25.171 -9.421  1.00 54.25  ? 365 HOH A O   1 
HETATM 4596 O  O   . HOH N 6 .   ? 50.128 -17.423 -3.848  1.00 38.15  ? 370 HOH A O   1 
HETATM 4597 O  O   . HOH N 6 .   ? 47.527 -14.600 13.378  1.00 26.57  ? 372 HOH A O   1 
HETATM 4598 O  O   . HOH N 6 .   ? 30.063 -8.780  -5.507  1.00 53.48  ? 375 HOH A O   1 
HETATM 4599 O  O   . HOH N 6 .   ? 23.410 -16.164 10.618  1.00 32.74  ? 383 HOH A O   1 
HETATM 4600 O  O   . HOH N 6 .   ? 68.645 -31.081 9.623   1.00 51.99  ? 385 HOH A O   1 
HETATM 4601 O  O   . HOH N 6 .   ? 51.675 -15.706 17.009  1.00 54.54  ? 386 HOH A O   1 
HETATM 4602 O  O   . HOH N 6 .   ? 22.914 -25.240 3.693   1.00 38.53  ? 389 HOH A O   1 
HETATM 4603 O  O   . HOH N 6 .   ? 33.717 -31.666 -8.084  1.00 30.40  ? 392 HOH A O   1 
HETATM 4604 O  O   . HOH N 6 .   ? 30.651 -37.511 10.059  1.00 58.56  ? 393 HOH A O   1 
HETATM 4605 O  O   . HOH N 6 .   ? 47.860 -13.987 17.502  1.00 55.28  ? 395 HOH A O   1 
HETATM 4606 O  O   . HOH N 6 .   ? 38.172 -18.131 -9.896  1.00 42.86  ? 399 HOH A O   1 
HETATM 4607 O  O   . HOH N 6 .   ? 61.571 -24.491 6.954   1.00 43.34  ? 407 HOH A O   1 
HETATM 4608 O  O   . HOH N 6 .   ? 26.390 -12.996 -0.131  1.00 42.21  ? 412 HOH A O   1 
HETATM 4609 O  O   . HOH N 6 .   ? 62.018 -27.243 2.578   1.00 55.61  ? 414 HOH A O   1 
HETATM 4610 O  O   . HOH N 6 .   ? 46.766 -28.377 7.750   1.00 22.37  ? 416 HOH A O   1 
HETATM 4611 O  O   . HOH N 6 .   ? 54.991 -28.767 2.249   1.00 44.79  ? 421 HOH A O   1 
HETATM 4612 O  O   . HOH N 6 .   ? 46.172 -12.387 18.794  1.00 43.64  ? 423 HOH A O   1 
HETATM 4613 O  O   . HOH N 6 .   ? 41.898 -29.386 -7.838  1.00 52.54  ? 424 HOH A O   1 
HETATM 4614 O  O   . HOH N 6 .   ? 42.990 -4.494  7.209   1.00 55.10  ? 426 HOH A O   1 
HETATM 4615 O  O   . HOH N 6 .   ? 31.196 -40.403 0.175   1.00 37.07  ? 431 HOH A O   1 
HETATM 4616 O  O   . HOH N 6 .   ? 44.827 -6.587  5.321   1.00 37.12  ? 438 HOH A O   1 
HETATM 4617 O  O   . HOH N 6 .   ? 27.332 -25.504 -9.828  1.00 38.91  ? 440 HOH A O   1 
HETATM 4618 O  O   . HOH N 6 .   ? 20.722 -15.191 2.823   1.00 43.76  ? 442 HOH A O   1 
HETATM 4619 O  O   . HOH N 6 .   ? 49.980 -42.763 2.298   1.00 47.76  ? 446 HOH A O   1 
HETATM 4620 O  O   . HOH N 6 .   ? 37.208 -5.893  -2.650  1.00 33.74  ? 447 HOH A O   1 
HETATM 4621 O  O   . HOH N 6 .   ? 44.353 -12.701 14.003  1.00 35.29  ? 448 HOH A O   1 
HETATM 4622 O  O   . HOH N 6 .   ? 56.072 -18.003 15.366  1.00 43.58  ? 449 HOH A O   1 
HETATM 4623 O  O   . HOH N 6 .   ? 40.593 -36.406 -11.178 1.00 34.09  ? 454 HOH A O   1 
HETATM 4624 O  O   . HOH N 6 .   ? 47.813 -40.744 8.990   1.00 47.27  ? 458 HOH A O   1 
HETATM 4625 O  O   . HOH N 6 .   ? 59.523 -25.015 15.577  1.00 39.46  ? 459 HOH A O   1 
HETATM 4626 O  O   . HOH N 6 .   ? 48.717 -11.437 20.515  1.00 42.10  ? 466 HOH A O   1 
HETATM 4627 O  O   . HOH N 6 .   ? 37.324 -26.145 -9.687  1.00 48.21  ? 468 HOH A O   1 
HETATM 4628 O  O   . HOH N 6 .   ? 53.112 -35.370 17.049  1.00 39.71  ? 469 HOH A O   1 
HETATM 4629 O  O   . HOH N 6 .   ? 49.965 -19.905 25.158  1.00 51.92  ? 475 HOH A O   1 
HETATM 4630 O  O   . HOH N 6 .   ? 22.416 -17.631 3.236   1.00 50.52  ? 489 HOH A O   1 
HETATM 4631 O  O   . HOH N 6 .   ? 36.493 -11.387 -9.797  1.00 49.44  ? 492 HOH A O   1 
HETATM 4632 O  O   . HOH N 6 .   ? 50.613 -28.581 -6.359  1.00 45.42  ? 497 HOH A O   1 
HETATM 4633 O  O   . HOH N 6 .   ? 37.145 -28.753 14.733  1.00 51.30  ? 498 HOH A O   1 
HETATM 4634 O  O   . HOH N 6 .   ? 35.669 -17.773 -7.886  1.00 31.87  ? 500 HOH A O   1 
HETATM 4635 O  O   . HOH N 6 .   ? 40.574 -37.387 6.243   1.00 44.89  ? 504 HOH A O   1 
HETATM 4636 O  O   . HOH N 6 .   ? 38.990 -7.461  8.196   1.00 34.29  ? 507 HOH A O   1 
HETATM 4637 O  O   . HOH N 6 .   ? 24.111 -20.263 1.357   1.00 44.98  ? 513 HOH A O   1 
HETATM 4638 O  O   . HOH N 6 .   ? 42.500 -9.376  -2.366  1.00 53.50  ? 514 HOH A O   1 
HETATM 4639 O  O   . HOH N 6 .   ? 31.816 -9.642  -7.205  1.00 50.19  ? 518 HOH A O   1 
HETATM 4640 O  O   . HOH N 6 .   ? 23.710 -24.014 8.334   1.00 50.99  ? 519 HOH A O   1 
HETATM 4641 O  O   . HOH N 6 .   ? 23.346 -23.790 5.734   1.00 55.11  ? 524 HOH A O   1 
HETATM 4642 O  O   . HOH N 6 .   ? 20.359 -27.041 7.553   1.00 45.70  ? 531 HOH A O   1 
HETATM 4643 O  O   . HOH N 6 .   ? 29.050 -39.233 -0.735  1.00 43.31  ? 533 HOH A O   1 
HETATM 4644 O  O   . HOH N 6 .   ? 52.846 -10.317 4.050   1.00 42.02  ? 537 HOH A O   1 
HETATM 4645 O  O   . HOH N 6 .   ? 34.556 -18.821 -9.620  1.00 39.07  ? 538 HOH A O   1 
HETATM 4646 O  O   . HOH N 6 .   ? 44.394 -39.027 20.762  1.00 42.03  ? 539 HOH A O   1 
HETATM 4647 O  O   . HOH N 6 .   ? 58.029 -32.374 17.476  1.00 44.94  ? 547 HOH A O   1 
HETATM 4648 O  O   . HOH N 6 .   ? 50.513 -13.612 0.216   1.00 36.67  ? 548 HOH A O   1 
HETATM 4649 O  O   . HOH N 6 .   ? 41.831 -7.445  11.325  1.00 42.57  ? 555 HOH A O   1 
HETATM 4650 O  O   . HOH N 6 .   ? 25.267 -17.013 -0.537  1.00 38.44  ? 564 HOH A O   1 
HETATM 4651 O  O   . HOH N 6 .   ? 43.016 -43.137 -0.612  1.00 44.30  ? 565 HOH A O   1 
HETATM 4652 O  O   . HOH N 6 .   ? 59.261 -23.256 13.074  1.00 44.59  ? 566 HOH A O   1 
HETATM 4653 O  O   . HOH N 6 .   ? 34.706 -34.366 10.271  1.00 40.45  ? 571 HOH A O   1 
HETATM 4654 O  O   . HOH N 6 .   ? 29.234 -27.821 -10.264 1.00 44.98  ? 575 HOH A O   1 
HETATM 4655 O  O   . HOH N 6 .   ? 48.312 -29.676 -10.337 1.00 50.36  ? 580 HOH A O   1 
HETATM 4656 O  O   . HOH N 6 .   ? 24.938 -35.700 5.913   1.00 43.82  ? 583 HOH A O   1 
HETATM 4657 O  O   . HOH N 6 .   ? 42.644 -17.303 -10.150 1.00 62.08  ? 584 HOH A O   1 
HETATM 4658 O  O   . HOH N 6 .   ? 61.916 -26.930 11.565  1.00 48.04  ? 585 HOH A O   1 
HETATM 4659 O  O   . HOH N 6 .   ? 31.679 -40.034 2.821   1.00 49.29  ? 587 HOH A O   1 
HETATM 4660 O  O   . HOH N 6 .   ? 24.038 -21.978 12.717  1.00 45.34  ? 588 HOH A O   1 
HETATM 4661 O  O   . HOH N 6 .   ? 50.867 -40.797 11.972  1.00 56.09  ? 597 HOH A O   1 
HETATM 4662 O  O   . HOH N 6 .   ? 37.559 -6.955  1.791   1.00 38.80  ? 599 HOH A O   1 
HETATM 4663 O  O   . HOH N 6 .   ? 23.107 -20.252 4.485   1.00 49.31  ? 600 HOH A O   1 
HETATM 4664 O  O   . HOH N 6 .   ? 26.543 -12.748 -3.123  1.00 45.43  ? 606 HOH A O   1 
HETATM 4665 O  O   . HOH N 6 .   ? 34.955 -9.078  -8.745  1.00 66.48  ? 610 HOH A O   1 
HETATM 4666 O  O   . HOH N 6 .   ? 38.164 -5.057  0.217   1.00 49.08  ? 611 HOH A O   1 
HETATM 4667 O  O   . HOH N 6 .   ? 27.930 -36.887 -1.172  1.00 43.85  ? 612 HOH A O   1 
HETATM 4668 O  O   . HOH N 6 .   ? 45.621 -10.756 9.140   1.00 34.69  ? 620 HOH A O   1 
HETATM 4669 O  O   . HOH N 6 .   ? 26.165 -36.240 8.372   1.00 50.78  ? 626 HOH A O   1 
HETATM 4670 O  O   . HOH N 6 .   ? 56.063 -21.346 13.120  1.00 50.90  ? 628 HOH A O   1 
HETATM 4671 O  O   . HOH N 6 .   ? 38.524 -4.691  8.024   1.00 48.81  ? 639 HOH A O   1 
HETATM 4672 O  O   . HOH N 6 .   ? 46.345 -13.166 10.936  1.00 30.69  ? 642 HOH A O   1 
HETATM 4673 O  O   . HOH N 6 .   ? 18.864 -26.298 -2.794  1.00 36.21  ? 651 HOH A O   1 
HETATM 4674 O  O   . HOH N 6 .   ? 43.315 -43.370 1.861   1.00 55.94  ? 654 HOH A O   1 
HETATM 4675 O  O   . HOH N 6 .   ? 53.707 -41.830 3.936   1.00 46.74  ? 655 HOH A O   1 
HETATM 4676 O  O   . HOH N 6 .   ? 36.791 -15.259 -8.787  1.00 48.38  ? 665 HOH A O   1 
HETATM 4677 O  O   . HOH N 6 .   ? 43.541 -19.952 -8.979  1.00 43.61  ? 675 HOH A O   1 
HETATM 4678 O  O   . HOH N 6 .   ? 20.623 -29.449 6.250   1.00 54.19  ? 677 HOH A O   1 
HETATM 4679 O  O   . HOH N 6 .   ? 28.403 -31.778 12.969  1.00 56.09  ? 678 HOH A O   1 
HETATM 4680 O  O   . HOH N 6 .   ? 40.290 -44.233 5.343   1.00 60.53  ? 682 HOH A O   1 
HETATM 4681 O  O   . HOH N 6 .   ? 53.146 -37.633 15.427  1.00 58.33  ? 684 HOH A O   1 
HETATM 4682 O  O   . HOH N 6 .   ? 46.472 -16.086 -6.000  1.00 34.11  ? 692 HOH A O   1 
HETATM 4683 O  O   . HOH N 6 .   ? 44.217 -9.217  10.657  1.00 47.75  ? 696 HOH A O   1 
HETATM 4684 O  O   . HOH N 6 .   ? 35.335 -4.173  -4.260  1.00 49.65  ? 699 HOH A O   1 
HETATM 4685 O  O   . HOH N 6 .   ? 34.359 -15.420 -7.473  1.00 41.90  ? 700 HOH A O   1 
HETATM 4686 O  O   . HOH N 6 .   ? 37.564 -35.235 16.715  1.00 49.41  ? 701 HOH A O   1 
HETATM 4687 O  O   . HOH N 6 .   ? 42.067 -44.921 13.178  1.00 58.96  ? 702 HOH A O   1 
HETATM 4688 O  O   . HOH N 6 .   ? 56.898 -20.391 -0.643  1.00 42.40  ? 704 HOH A O   1 
HETATM 4689 O  O   . HOH N 6 .   ? 44.913 -7.124  -1.480  1.00 52.84  ? 708 HOH A O   1 
HETATM 4690 O  O   . HOH N 6 .   ? 33.914 -39.585 4.154   1.00 55.12  ? 709 HOH A O   1 
HETATM 4691 O  O   . HOH N 6 .   ? 32.628 -27.778 -9.419  1.00 35.80  ? 710 HOH A O   1 
HETATM 4692 O  O   . HOH N 6 .   ? 25.946 -21.780 14.514  1.00 56.10  ? 711 HOH A O   1 
HETATM 4693 O  O   . HOH N 6 .   ? 33.142 -15.775 -9.759  1.00 49.09  ? 719 HOH A O   1 
HETATM 4694 O  O   . HOH N 6 .   ? 23.284 -14.839 1.756   1.00 63.57  ? 726 HOH A O   1 
HETATM 4695 O  O   . HOH N 6 .   ? 57.529 -39.413 6.596   1.00 69.25  ? 727 HOH A O   1 
HETATM 4696 O  O   . HOH N 6 .   ? 54.264 -41.969 1.296   1.00 54.41  ? 731 HOH A O   1 
HETATM 4697 O  O   . HOH O 6 .   ? 43.857 -18.313 23.062  1.00 19.59  ? 4   HOH D O   1 
HETATM 4698 O  O   . HOH O 6 .   ? 31.395 -19.384 12.621  1.00 16.73  ? 11  HOH D O   1 
HETATM 4699 O  O   . HOH O 6 .   ? 42.632 -16.357 19.107  1.00 18.58  ? 27  HOH D O   1 
HETATM 4700 O  O   . HOH O 6 .   ? 37.335 -11.635 17.849  1.00 20.21  ? 32  HOH D O   1 
HETATM 4701 O  O   . HOH O 6 .   ? 32.419 -21.200 15.742  1.00 21.28  ? 44  HOH D O   1 
HETATM 4702 O  O   . HOH O 6 .   ? 30.228 -21.621 17.145  1.00 18.78  ? 45  HOH D O   1 
HETATM 4703 O  O   . HOH O 6 .   ? 33.632 -30.578 17.706  1.00 27.57  ? 67  HOH D O   1 
HETATM 4704 O  O   . HOH O 6 .   ? 21.809 -30.022 28.379  1.00 30.94  ? 72  HOH D O   1 
HETATM 4705 O  O   . HOH O 6 .   ? 25.065 -27.502 30.939  1.00 29.31  ? 76  HOH D O   1 
HETATM 4706 O  O   . HOH O 6 .   ? 50.946 -16.101 36.947  1.00 30.80  ? 87  HOH D O   1 
HETATM 4707 O  O   . HOH O 6 .   ? 45.409 -34.406 37.071  1.00 36.45  ? 93  HOH D O   1 
HETATM 4708 O  O   . HOH O 6 .   ? 39.559 -35.103 21.854  1.00 32.09  ? 103 HOH D O   1 
HETATM 4709 O  O   . HOH O 6 .   ? 27.338 -29.827 16.878  1.00 38.30  ? 119 HOH D O   1 
HETATM 4710 O  O   . HOH O 6 .   ? 41.557 -12.527 14.699  1.00 25.46  ? 141 HOH D O   1 
HETATM 4711 O  O   . HOH O 6 .   ? 35.052 -16.675 34.269  1.00 40.65  ? 147 HOH D O   1 
HETATM 4712 O  O   . HOH O 6 .   ? 27.781 -14.894 28.215  1.00 44.09  ? 151 HOH D O   1 
HETATM 4713 O  O   . HOH O 6 .   ? 51.229 -20.013 27.755  1.00 33.97  ? 164 HOH D O   1 
HETATM 4714 O  O   . HOH O 6 .   ? 32.888 -18.692 27.277  1.00 28.02  ? 169 HOH D O   1 
HETATM 4715 O  O   . HOH O 6 .   ? 27.709 -27.821 13.434  1.00 40.09  ? 178 HOH D O   1 
HETATM 4716 O  O   . HOH O 6 .   ? 32.349 -11.404 24.240  1.00 26.84  ? 180 HOH D O   1 
HETATM 4717 O  O   . HOH O 6 .   ? 36.659 -7.318  18.985  1.00 35.45  ? 209 HOH D O   1 
HETATM 4718 O  O   . HOH O 6 .   ? 31.566 -19.491 18.667  1.00 22.43  ? 212 HOH D O   1 
HETATM 4719 O  O   . HOH O 6 .   ? 30.214 -19.408 27.799  1.00 43.22  ? 214 HOH D O   1 
HETATM 4720 O  O   . HOH O 6 .   ? 28.079 -16.594 16.764  1.00 41.61  ? 215 HOH D O   1 
HETATM 4721 O  O   . HOH O 6 .   ? 27.268 -20.860 17.217  1.00 47.80  ? 241 HOH D O   1 
HETATM 4722 O  O   . HOH O 6 .   ? 44.892 -33.448 22.452  1.00 34.28  ? 244 HOH D O   1 
HETATM 4723 O  O   . HOH O 6 .   ? 44.618 -16.276 26.969  1.00 27.95  ? 261 HOH D O   1 
HETATM 4724 O  O   . HOH O 6 .   ? 42.099 -8.880  24.615  1.00 44.64  ? 266 HOH D O   1 
HETATM 4725 O  O   . HOH O 6 .   ? 47.641 -16.516 33.611  1.00 48.40  ? 269 HOH D O   1 
HETATM 4726 O  O   . HOH O 6 .   ? 29.103 -32.035 18.323  1.00 55.06  ? 281 HOH D O   1 
HETATM 4727 O  O   . HOH O 6 .   ? 49.217 -33.152 20.229  1.00 27.21  ? 285 HOH D O   1 
HETATM 4728 O  O   . HOH O 6 .   ? 46.378 -35.878 22.215  1.00 46.96  ? 302 HOH D O   1 
HETATM 4729 O  O   . HOH O 6 .   ? 43.339 -11.312 22.274  1.00 44.32  ? 310 HOH D O   1 
HETATM 4730 O  O   . HOH O 6 .   ? 28.551 -19.769 25.757  1.00 33.01  ? 313 HOH D O   1 
HETATM 4731 O  O   . HOH O 6 .   ? 37.277 -29.512 41.843  1.00 36.01  ? 320 HOH D O   1 
HETATM 4732 O  O   . HOH O 6 .   ? 34.814 -10.127 21.326  1.00 37.98  ? 321 HOH D O   1 
HETATM 4733 O  O   . HOH O 6 .   ? 30.389 -27.839 35.035  1.00 34.04  ? 326 HOH D O   1 
HETATM 4734 O  O   . HOH O 6 .   ? 32.654 -15.831 26.681  1.00 44.20  ? 329 HOH D O   1 
HETATM 4735 O  O   . HOH O 6 .   ? 43.475 -12.462 18.419  1.00 44.65  ? 334 HOH D O   1 
HETATM 4736 O  O   . HOH O 6 .   ? 26.368 -19.975 27.166  1.00 32.36  ? 345 HOH D O   1 
HETATM 4737 O  O   . HOH O 6 .   ? 36.961 -31.557 20.173  1.00 30.96  ? 352 HOH D O   1 
HETATM 4738 O  O   . HOH O 6 .   ? 26.110 -19.705 19.902  1.00 29.86  ? 356 HOH D O   1 
HETATM 4739 O  O   . HOH O 6 .   ? 47.459 -34.480 38.792  1.00 49.03  ? 361 HOH D O   1 
HETATM 4740 O  O   . HOH O 6 .   ? 35.000 -22.223 39.071  1.00 44.05  ? 368 HOH D O   1 
HETATM 4741 O  O   . HOH O 6 .   ? 51.933 -25.967 24.272  1.00 43.91  ? 373 HOH D O   1 
HETATM 4742 O  O   . HOH O 6 .   ? 29.184 -18.363 18.610  1.00 46.55  ? 377 HOH D O   1 
HETATM 4743 O  O   . HOH O 6 .   ? 57.174 -23.234 26.818  1.00 58.11  ? 398 HOH D O   1 
HETATM 4744 O  O   . HOH O 6 .   ? 45.949 -35.758 35.156  1.00 52.38  ? 402 HOH D O   1 
HETATM 4745 O  O   . HOH O 6 .   ? 23.143 -18.857 20.107  1.00 39.37  ? 427 HOH D O   1 
HETATM 4746 O  O   . HOH O 6 .   ? 22.566 -24.838 30.534  1.00 37.87  ? 428 HOH D O   1 
HETATM 4747 O  O   . HOH O 6 .   ? 52.778 -31.240 33.113  1.00 39.28  ? 435 HOH D O   1 
HETATM 4748 O  O   . HOH O 6 .   ? 25.145 -33.005 17.689  1.00 55.33  ? 441 HOH D O   1 
HETATM 4749 O  O   . HOH O 6 .   ? 23.175 -23.331 28.154  1.00 31.40  ? 444 HOH D O   1 
HETATM 4750 O  O   . HOH O 6 .   ? 33.149 -20.362 36.273  1.00 50.30  ? 455 HOH D O   1 
HETATM 4751 O  O   . HOH O 6 .   ? 54.384 -22.113 23.250  1.00 60.96  ? 461 HOH D O   1 
HETATM 4752 O  O   . HOH O 6 .   ? 39.080 -9.661  17.609  1.00 40.09  ? 462 HOH D O   1 
HETATM 4753 O  O   . HOH O 6 .   ? 51.532 -26.299 26.823  1.00 37.46  ? 464 HOH D O   1 
HETATM 4754 O  O   . HOH O 6 .   ? 45.129 -37.775 23.604  1.00 47.09  ? 467 HOH D O   1 
HETATM 4755 O  O   . HOH O 6 .   ? 31.040 -24.775 33.647  1.00 35.67  ? 471 HOH D O   1 
HETATM 4756 O  O   . HOH O 6 .   ? 50.560 -14.091 38.939  1.00 52.89  ? 472 HOH D O   1 
HETATM 4757 O  O   . HOH O 6 .   ? 32.362 -32.852 35.118  1.00 54.95  ? 483 HOH D O   1 
HETATM 4758 O  O   . HOH O 6 .   ? 48.300 -37.393 34.430  1.00 52.39  ? 487 HOH D O   1 
HETATM 4759 O  O   . HOH O 6 .   ? 51.998 -23.510 45.937  1.00 39.89  ? 496 HOH D O   1 
HETATM 4760 O  O   . HOH O 6 .   ? 31.418 -32.006 16.897  1.00 61.35  ? 499 HOH D O   1 
HETATM 4761 O  O   . HOH O 6 .   ? 34.279 -26.404 15.504  1.00 40.36  ? 505 HOH D O   1 
HETATM 4762 O  O   . HOH O 6 .   ? 34.702 -28.811 15.732  1.00 40.71  ? 525 HOH D O   1 
HETATM 4763 O  O   . HOH O 6 .   ? 51.618 -30.400 42.506  1.00 53.55  ? 528 HOH D O   1 
HETATM 4764 O  O   . HOH O 6 .   ? 23.943 -36.475 24.468  1.00 38.97  ? 532 HOH D O   1 
HETATM 4765 O  O   . HOH O 6 .   ? 36.717 -39.313 38.685  1.00 49.28  ? 535 HOH D O   1 
HETATM 4766 O  O   . HOH O 6 .   ? 50.205 -23.502 24.564  1.00 39.85  ? 540 HOH D O   1 
HETATM 4767 O  O   . HOH O 6 .   ? 34.421 -24.924 38.552  1.00 51.85  ? 541 HOH D O   1 
HETATM 4768 O  O   . HOH O 6 .   ? 42.169 -10.847 16.741  1.00 48.99  ? 543 HOH D O   1 
HETATM 4769 O  O   . HOH O 6 .   ? 29.466 -16.774 33.196  1.00 61.65  ? 544 HOH D O   1 
HETATM 4770 O  O   . HOH O 6 .   ? 55.779 -20.813 25.004  1.00 46.45  ? 545 HOH D O   1 
HETATM 4771 O  O   . HOH O 6 .   ? 29.135 -20.608 30.368  1.00 34.62  ? 546 HOH D O   1 
HETATM 4772 O  O   . HOH O 6 .   ? 56.461 -33.994 42.527  1.00 56.21  ? 549 HOH D O   1 
HETATM 4773 O  O   . HOH O 6 .   ? 54.678 -25.750 41.427  1.00 41.49  ? 551 HOH D O   1 
HETATM 4774 O  O   . HOH O 6 .   ? 22.585 -22.443 19.244  1.00 53.56  ? 552 HOH D O   1 
HETATM 4775 O  O   . HOH O 6 .   ? 50.502 -17.696 29.448  1.00 44.76  ? 553 HOH D O   1 
HETATM 4776 O  O   . HOH O 6 .   ? 47.924 -32.382 40.329  1.00 48.10  ? 556 HOH D O   1 
HETATM 4777 O  O   . HOH O 6 .   ? 53.694 -27.030 28.808  1.00 44.07  ? 559 HOH D O   1 
HETATM 4778 O  O   . HOH O 6 .   ? 19.049 -30.033 15.485  1.00 59.68  ? 562 HOH D O   1 
HETATM 4779 O  O   . HOH O 6 .   ? 23.518 -34.904 18.530  1.00 49.98  ? 568 HOH D O   1 
HETATM 4780 O  O   . HOH O 6 .   ? 39.320 -7.004  24.525  1.00 41.36  ? 570 HOH D O   1 
HETATM 4781 O  O   . HOH O 6 .   ? 36.915 -19.047 38.367  1.00 56.89  ? 573 HOH D O   1 
HETATM 4782 O  O   . HOH O 6 .   ? 41.529 -14.348 29.690  1.00 58.17  ? 574 HOH D O   1 
HETATM 4783 O  O   . HOH O 6 .   ? 34.099 -30.529 38.189  1.00 45.69  ? 581 HOH D O   1 
HETATM 4784 O  O   . HOH O 6 .   ? 36.007 -33.301 38.094  1.00 55.42  ? 604 HOH D O   1 
HETATM 4785 O  O   . HOH O 6 .   ? 38.855 -32.358 45.520  1.00 52.00  ? 615 HOH D O   1 
HETATM 4786 O  O   . HOH O 6 .   ? 54.241 -29.016 40.357  1.00 45.83  ? 617 HOH D O   1 
HETATM 4787 O  O   . HOH O 6 .   ? 49.688 -18.504 31.847  1.00 58.47  ? 619 HOH D O   1 
HETATM 4788 O  O   . HOH O 6 .   ? 36.710 -29.921 44.727  1.00 55.85  ? 621 HOH D O   1 
HETATM 4789 O  O   . HOH O 6 .   ? 43.661 -8.626  16.032  1.00 39.88  ? 622 HOH D O   1 
HETATM 4790 O  O   . HOH O 6 .   ? 44.271 -28.735 45.626  1.00 57.30  ? 624 HOH D O   1 
HETATM 4791 O  O   . HOH O 6 .   ? 35.737 -35.394 20.287  1.00 50.88  ? 629 HOH D O   1 
HETATM 4792 O  O   . HOH O 6 .   ? 35.621 -40.908 29.485  1.00 37.78  ? 634 HOH D O   1 
HETATM 4793 O  O   . HOH O 6 .   ? 57.125 -31.733 37.849  1.00 44.44  ? 635 HOH D O   1 
HETATM 4794 O  O   . HOH O 6 .   ? 39.462 -41.995 31.907  1.00 39.23  ? 636 HOH D O   1 
HETATM 4795 O  O   . HOH O 6 .   ? 55.751 -26.665 37.119  1.00 39.94  ? 637 HOH D O   1 
HETATM 4796 O  O   . HOH O 6 .   ? 37.312 -41.291 27.585  1.00 38.79  ? 638 HOH D O   1 
HETATM 4797 O  O   . HOH O 6 .   ? 20.969 -26.735 17.388  1.00 38.29  ? 641 HOH D O   1 
HETATM 4798 O  O   . HOH O 6 .   ? 59.384 -27.277 43.731  1.00 53.04  ? 643 HOH D O   1 
HETATM 4799 O  O   . HOH O 6 .   ? 56.619 -19.334 45.590  1.00 54.20  ? 647 HOH D O   1 
HETATM 4800 O  O   . HOH O 6 .   ? 62.649 -19.819 39.146  1.00 50.62  ? 653 HOH D O   1 
HETATM 4801 O  O   . HOH O 6 .   ? 44.046 -14.217 20.495  1.00 65.15  ? 658 HOH D O   1 
HETATM 4802 O  O   . HOH O 6 .   ? 48.083 -22.140 24.414  1.00 61.71  ? 659 HOH D O   1 
HETATM 4803 O  O   . HOH O 6 .   ? 22.860 -37.073 26.973  1.00 32.41  ? 669 HOH D O   1 
HETATM 4804 O  O   . HOH O 6 .   ? 46.387 -18.127 40.789  1.00 54.80  ? 671 HOH D O   1 
HETATM 4805 O  O   . HOH O 6 .   ? 55.006 -30.887 35.185  1.00 46.33  ? 672 HOH D O   1 
HETATM 4806 O  O   . HOH O 6 .   ? 53.036 -29.599 29.290  1.00 53.64  ? 674 HOH D O   1 
HETATM 4807 O  O   . HOH O 6 .   ? 54.941 -19.611 34.455  1.00 58.58  ? 676 HOH D O   1 
HETATM 4808 O  O   . HOH O 6 .   ? 37.904 -5.651  20.788  1.00 51.77  ? 683 HOH D O   1 
HETATM 4809 O  O   . HOH O 6 .   ? 22.633 -37.060 20.337  1.00 59.39  ? 686 HOH D O   1 
HETATM 4810 O  O   . HOH O 6 .   ? 55.336 -23.849 25.317  1.00 54.37  ? 687 HOH D O   1 
HETATM 4811 O  O   . HOH O 6 .   ? 22.212 -34.474 23.519  1.00 52.26  ? 688 HOH D O   1 
HETATM 4812 O  O   . HOH O 6 .   ? 39.666 -41.116 26.824  1.00 51.05  ? 691 HOH D O   1 
HETATM 4813 O  O   . HOH O 6 .   ? 58.242 -29.807 43.186  1.00 40.20  ? 694 HOH D O   1 
HETATM 4814 O  O   . HOH O 6 .   ? 20.026 -24.368 18.598  1.00 62.02  ? 705 HOH D O   1 
HETATM 4815 O  O   . HOH O 6 .   ? 57.700 -24.313 38.938  1.00 53.91  ? 706 HOH D O   1 
HETATM 4816 O  O   . HOH O 6 .   ? 41.025 -38.416 22.947  1.00 53.10  ? 818 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLN A 20  ? 0.8027 0.7403 0.8261 0.0216  0.0877  0.1078  39  GLN B N   
2    C CA  . GLN A 20  ? 0.6153 0.5515 0.6654 0.0165  0.0861  0.1048  39  GLN B CA  
3    C C   . GLN A 20  ? 0.5099 0.4494 0.5607 0.0142  0.0741  0.0932  39  GLN B C   
4    O O   . GLN A 20  ? 0.4335 0.3719 0.4763 0.0170  0.0682  0.0938  39  GLN B O   
5    C CB  . GLN A 20  ? 0.6956 0.6242 0.7544 0.0185  0.0908  0.1158  39  GLN B CB  
6    C CG  . GLN A 20  ? 0.7315 0.6568 0.8202 0.0130  0.0959  0.1166  39  GLN B CG  
7    C CD  . GLN A 20  ? 0.6929 0.6216 0.7976 0.0071  0.0873  0.1028  39  GLN B CD  
8    O OE1 . GLN A 20  ? 0.7780 0.7074 0.8771 0.0080  0.0782  0.0961  39  GLN B OE1 
9    N NE2 . GLN A 20  ? 0.5631 0.4947 0.6879 0.0015  0.0903  0.0987  39  GLN B NE2 
10   N N   . LEU A 21  ? 0.3839 0.3282 0.4447 0.0096  0.0709  0.0831  40  LEU B N   
11   C CA  . LEU A 21  ? 0.2973 0.2454 0.3575 0.0077  0.0606  0.0724  40  LEU B CA  
12   C C   . LEU A 21  ? 0.3690 0.3142 0.4466 0.0057  0.0572  0.0700  40  LEU B C   
13   O O   . LEU A 21  ? 0.2896 0.2315 0.3866 0.0029  0.0616  0.0717  40  LEU B O   
14   C CB  . LEU A 21  ? 0.3203 0.2743 0.3842 0.0043  0.0588  0.0633  40  LEU B CB  
15   C CG  . LEU A 21  ? 0.4120 0.3683 0.4578 0.0065  0.0612  0.0634  40  LEU B CG  
16   C CD1 . LEU A 21  ? 0.4628 0.4241 0.5181 0.0035  0.0619  0.0570  40  LEU B CD1 
17   C CD2 . LEU A 21  ? 0.4575 0.4145 0.4829 0.0087  0.0538  0.0596  40  LEU B CD2 
18   N N   . VAL A 22  ? 0.3198 0.2662 0.3907 0.0073  0.0494  0.0659  41  VAL B N   
19   C CA  . VAL A 22  ? 0.3657 0.3096 0.4503 0.0065  0.0455  0.0620  41  VAL B CA  
20   C C   . VAL A 22  ? 0.2939 0.2441 0.3791 0.0040  0.0379  0.0500  41  VAL B C   
21   O O   . VAL A 22  ? 0.2639 0.2188 0.3349 0.0055  0.0329  0.0472  41  VAL B O   
22   C CB  . VAL A 22  ? 0.3088 0.2498 0.3857 0.0116  0.0433  0.0683  41  VAL B CB  
23   C CG1 . VAL A 22  ? 0.2805 0.2182 0.3718 0.0115  0.0399  0.0640  41  VAL B CG1 
24   C CG2 . VAL A 22  ? 0.2984 0.2335 0.3711 0.0153  0.0508  0.0815  41  VAL B CG2 
25   N N   . PRO A 23  ? 0.2776 0.2279 0.3792 0.0001  0.0369  0.0428  42  PRO B N   
26   C CA  . PRO A 23  ? 0.2061 0.1623 0.3067 -0.0014 0.0301  0.0321  42  PRO B CA  
27   C C   . PRO A 23  ? 0.2956 0.2519 0.3924 0.0015  0.0249  0.0297  42  PRO B C   
28   O O   . PRO A 23  ? 0.2332 0.1839 0.3346 0.0039  0.0263  0.0346  42  PRO B O   
29   C CB  . PRO A 23  ? 0.2477 0.2033 0.3674 -0.0054 0.0301  0.0258  42  PRO B CB  
30   C CG  . PRO A 23  ? 0.3472 0.2986 0.4773 -0.0071 0.0376  0.0332  42  PRO B CG  
31   C CD  . PRO A 23  ? 0.2803 0.2259 0.4019 -0.0031 0.0416  0.0439  42  PRO B CD  
32   N N   . LEU A 24  ? 0.2637 0.2263 0.3528 0.0015  0.0196  0.0229  43  LEU B N   
33   C CA  . LEU A 24  ? 0.2116 0.1760 0.2995 0.0040  0.0151  0.0198  43  LEU B CA  
34   C C   . LEU A 24  ? 0.2376 0.1989 0.3398 0.0031  0.0142  0.0130  43  LEU B C   
35   O O   . LEU A 24  ? 0.2265 0.1877 0.3367 -0.0002 0.0144  0.0079  43  LEU B O   
36   C CB  . LEU A 24  ? 0.2046 0.1767 0.2813 0.0037  0.0107  0.0149  43  LEU B CB  
37   C CG  . LEU A 24  ? 0.2240 0.1995 0.2866 0.0054  0.0090  0.0196  43  LEU B CG  
38   C CD1 . LEU A 24  ? 0.2420 0.2152 0.2964 0.0047  0.0126  0.0251  43  LEU B CD1 
39   C CD2 . LEU A 24  ? 0.2465 0.2289 0.3023 0.0043  0.0049  0.0138  43  LEU B CD2 
40   N N   . LEU A 25  ? 0.2201 0.1790 0.3255 0.0064  0.0128  0.0127  44  LEU B N   
41   C CA  . LEU A 25  ? 0.2888 0.2442 0.4058 0.0064  0.0116  0.0050  44  LEU B CA  
42   C C   . LEU A 25  ? 0.2972 0.2602 0.4082 0.0069  0.0071  -0.0036 44  LEU B C   
43   O O   . LEU A 25  ? 0.2589 0.2288 0.3589 0.0082  0.0053  -0.0020 44  LEU B O   
44   C CB  . LEU A 25  ? 0.3295 0.2781 0.4527 0.0107  0.0130  0.0090  44  LEU B CB  
45   C CG  . LEU A 25  ? 0.4477 0.3890 0.5740 0.0112  0.0180  0.0199  44  LEU B CG  
46   C CD1 . LEU A 25  ? 0.5299 0.4676 0.6559 0.0171  0.0188  0.0273  44  LEU B CD1 
47   C CD2 . LEU A 25  ? 0.4953 0.4282 0.6372 0.0072  0.0215  0.0181  44  LEU B CD2 
48   N N   . TYR A 26  ? 0.3361 0.2977 0.4543 0.0059  0.0054  -0.0128 45  TYR B N   
49   C CA  . TYR A 26  ? 0.3171 0.2854 0.4294 0.0072  0.0019  -0.0208 45  TYR B CA  
50   C C   . TYR A 26  ? 0.2817 0.2534 0.3880 0.0118  0.0016  -0.0182 45  TYR B C   
51   O O   . TYR A 26  ? 0.2215 0.1882 0.3332 0.0150  0.0031  -0.0151 45  TYR B O   
52   C CB  . TYR A 26  ? 0.2929 0.2571 0.4141 0.0069  0.0001  -0.0310 45  TYR B CB  
53   C CG  . TYR A 26  ? 0.3231 0.2930 0.4373 0.0097  -0.0029 -0.0393 45  TYR B CG  
54   C CD1 . TYR A 26  ? 0.3380 0.3169 0.4416 0.0091  -0.0047 -0.0405 45  TYR B CD1 
55   C CD2 . TYR A 26  ? 0.3787 0.3444 0.4967 0.0133  -0.0032 -0.0457 45  TYR B CD2 
56   C CE1 . TYR A 26  ? 0.3502 0.3343 0.4468 0.0122  -0.0066 -0.0471 45  TYR B CE1 
57   C CE2 . TYR A 26  ? 0.3578 0.3288 0.4682 0.0166  -0.0050 -0.0531 45  TYR B CE2 
58   C CZ  . TYR A 26  ? 0.4333 0.4137 0.5329 0.0160  -0.0066 -0.0533 45  TYR B CZ  
59   O OH  . TYR A 26  ? 0.5201 0.5057 0.6115 0.0197  -0.0076 -0.0596 45  TYR B OH  
60   N N   . LYS A 27  ? 0.2494 0.2298 0.3456 0.0121  -0.0002 -0.0190 46  LYS B N   
61   C CA  . LYS A 27  ? 0.2658 0.2519 0.3578 0.0158  -0.0006 -0.0166 46  LYS B CA  
62   C C   . LYS A 27  ? 0.2655 0.2531 0.3545 0.0164  -0.0003 -0.0072 46  LYS B C   
63   O O   . LYS A 27  ? 0.2120 0.2059 0.2991 0.0190  -0.0013 -0.0049 46  LYS B O   
64   C CB  . LYS A 27  ? 0.3221 0.3057 0.4207 0.0205  0.0000  -0.0212 46  LYS B CB  
65   C CG  . LYS A 27  ? 0.4329 0.4191 0.5290 0.0214  -0.0010 -0.0310 46  LYS B CG  
66   C CD  . LYS A 27  ? 0.4390 0.4354 0.5251 0.0208  -0.0017 -0.0304 46  LYS B CD  
67   C CE  . LYS A 27  ? 0.5207 0.5202 0.6025 0.0229  -0.0022 -0.0389 46  LYS B CE  
68   N NZ  . LYS A 27  ? 0.5875 0.5963 0.6603 0.0226  -0.0019 -0.0369 46  LYS B NZ  
69   N N   . GLN A 28  ? 0.2701 0.2529 0.3589 0.0143  0.0010  -0.0018 47  GLN B N   
70   C CA  . GLN A 28  ? 0.2368 0.2212 0.3200 0.0152  0.0007  0.0069  47  GLN B CA  
71   C C   . GLN A 28  ? 0.2043 0.1958 0.2763 0.0125  -0.0014 0.0072  47  GLN B C   
72   O O   . GLN A 28  ? 0.2034 0.1954 0.2719 0.0092  -0.0012 0.0032  47  GLN B O   
73   C CB  . GLN A 28  ? 0.2879 0.2644 0.3730 0.0143  0.0038  0.0130  47  GLN B CB  
74   C CG  . GLN A 28  ? 0.3184 0.2964 0.3947 0.0157  0.0035  0.0220  47  GLN B CG  
75   C CD  . GLN A 28  ? 0.3845 0.3541 0.4628 0.0161  0.0078  0.0293  47  GLN B CD  
76   O OE1 . GLN A 28  ? 0.3100 0.2734 0.3969 0.0138  0.0112  0.0274  47  GLN B OE1 
77   N NE2 . GLN A 28  ? 0.4501 0.4202 0.5209 0.0191  0.0077  0.0379  47  GLN B NE2 
78   N N   . PHE A 29  ? 0.2589 0.2559 0.3261 0.0138  -0.0037 0.0117  48  PHE B N   
79   C CA  . PHE A 29  ? 0.2473 0.2493 0.3041 0.0108  -0.0059 0.0122  48  PHE B CA  
80   C C   . PHE A 29  ? 0.2392 0.2409 0.2887 0.0115  -0.0073 0.0192  48  PHE B C   
81   O O   . PHE A 29  ? 0.2026 0.2047 0.2551 0.0153  -0.0081 0.0244  48  PHE B O   
82   C CB  . PHE A 29  ? 0.1840 0.1950 0.2410 0.0103  -0.0084 0.0089  48  PHE B CB  
83   C CG  . PHE A 29  ? 0.2229 0.2394 0.2876 0.0145  -0.0097 0.0108  48  PHE B CG  
84   C CD1 . PHE A 29  ? 0.2844 0.2995 0.3577 0.0178  -0.0076 0.0074  48  PHE B CD1 
85   C CD2 . PHE A 29  ? 0.1947 0.2182 0.2581 0.0154  -0.0133 0.0153  48  PHE B CD2 
86   C CE1 . PHE A 29  ? 0.3280 0.3482 0.4089 0.0225  -0.0081 0.0091  48  PHE B CE1 
87   C CE2 . PHE A 29  ? 0.2165 0.2466 0.2886 0.0198  -0.0145 0.0175  48  PHE B CE2 
88   C CZ  . PHE A 29  ? 0.2776 0.3058 0.3585 0.0236  -0.0114 0.0146  48  PHE B CZ  
89   N N   . VAL A 30  ? 0.2142 0.2148 0.2534 0.0084  -0.0074 0.0193  49  VAL B N   
90   C CA  . VAL A 30  ? 0.1989 0.1983 0.2278 0.0092  -0.0084 0.0249  49  VAL B CA  
91   C C   . VAL A 30  ? 0.2173 0.2210 0.2358 0.0058  -0.0120 0.0221  49  VAL B C   
92   O O   . VAL A 30  ? 0.2406 0.2422 0.2559 0.0025  -0.0104 0.0176  49  VAL B O   
93   C CB  . VAL A 30  ? 0.2131 0.2041 0.2390 0.0091  -0.0032 0.0279  49  VAL B CB  
94   C CG1 . VAL A 30  ? 0.2070 0.1967 0.2187 0.0101  -0.0037 0.0329  49  VAL B CG1 
95   C CG2 . VAL A 30  ? 0.2400 0.2257 0.2777 0.0117  0.0004  0.0309  49  VAL B CG2 
96   N N   . PRO A 31  ? 0.2599 0.2692 0.2733 0.0067  -0.0170 0.0246  50  PRO B N   
97   C CA  . PRO A 31  ? 0.2425 0.2554 0.2594 0.0114  -0.0195 0.0306  50  PRO B CA  
98   C C   . PRO A 31  ? 0.2531 0.2713 0.2845 0.0133  -0.0199 0.0294  50  PRO B C   
99   O O   . PRO A 31  ? 0.2326 0.2541 0.2689 0.0105  -0.0197 0.0237  50  PRO B O   
100  C CB  . PRO A 31  ? 0.3066 0.3263 0.3141 0.0105  -0.0262 0.0311  50  PRO B CB  
101  C CG  . PRO A 31  ? 0.2491 0.2710 0.2552 0.0046  -0.0275 0.0239  50  PRO B CG  
102  C CD  . PRO A 31  ? 0.2273 0.2397 0.2308 0.0030  -0.0211 0.0215  50  PRO B CD  
103  N N   . GLY A 32  ? 0.2571 0.2756 0.2947 0.0186  -0.0200 0.0349  51  GLY B N   
104  C CA  . GLY A 32  ? 0.2265 0.2485 0.2777 0.0218  -0.0194 0.0340  51  GLY B CA  
105  C C   . GLY A 32  ? 0.2122 0.2472 0.2687 0.0222  -0.0244 0.0332  51  GLY B C   
106  O O   . GLY A 32  ? 0.2076 0.2479 0.2721 0.0274  -0.0261 0.0374  51  GLY B O   
107  N N   . VAL A 33  ? 0.2316 0.2718 0.2848 0.0169  -0.0265 0.0283  52  VAL B N   
108  C CA  . VAL A 33  ? 0.2271 0.2803 0.2876 0.0159  -0.0305 0.0270  52  VAL B CA  
109  C C   . VAL A 33  ? 0.2459 0.2993 0.3084 0.0114  -0.0275 0.0206  52  VAL B C   
110  O O   . VAL A 33  ? 0.1650 0.2095 0.2208 0.0088  -0.0241 0.0175  52  VAL B O   
111  C CB  . VAL A 33  ? 0.1869 0.2469 0.2401 0.0131  -0.0375 0.0284  52  VAL B CB  
112  C CG1 . VAL A 33  ? 0.1946 0.2549 0.2432 0.0184  -0.0410 0.0355  52  VAL B CG1 
113  C CG2 . VAL A 33  ? 0.2224 0.2753 0.2628 0.0071  -0.0370 0.0242  52  VAL B CG2 
114  N N   . PRO A 34  ? 0.1916 0.2558 0.2636 0.0108  -0.0283 0.0192  53  PRO B N   
115  C CA  . PRO A 34  ? 0.2272 0.2915 0.3000 0.0070  -0.0248 0.0142  53  PRO B CA  
116  C C   . PRO A 34  ? 0.1954 0.2550 0.2575 0.0005  -0.0260 0.0117  53  PRO B C   
117  O O   . PRO A 34  ? 0.1705 0.2316 0.2272 -0.0019 -0.0309 0.0130  53  PRO B O   
118  C CB  . PRO A 34  ? 0.2628 0.3409 0.3478 0.0073  -0.0257 0.0149  53  PRO B CB  
119  C CG  . PRO A 34  ? 0.2953 0.3790 0.3885 0.0137  -0.0280 0.0196  53  PRO B CG  
120  C CD  . PRO A 34  ? 0.2097 0.2870 0.2927 0.0138  -0.0320 0.0227  53  PRO B CD  
121  N N   . GLU A 35  ? 0.2282 0.2822 0.2870 -0.0016 -0.0217 0.0080  54  GLU B N   
122  C CA  . GLU A 35  ? 0.1880 0.2353 0.2367 -0.0066 -0.0215 0.0056  54  GLU B CA  
123  C C   . GLU A 35  ? 0.2086 0.2611 0.2568 -0.0120 -0.0256 0.0051  54  GLU B C   
124  O O   . GLU A 35  ? 0.1900 0.2369 0.2285 -0.0152 -0.0279 0.0040  54  GLU B O   
125  C CB  . GLU A 35  ? 0.1604 0.2037 0.2082 -0.0072 -0.0165 0.0023  54  GLU B CB  
126  C CG  . GLU A 35  ? 0.2110 0.2469 0.2492 -0.0114 -0.0157 0.0003  54  GLU B CG  
127  C CD  . GLU A 35  ? 0.2465 0.2788 0.2834 -0.0108 -0.0111 -0.0020 54  GLU B CD  
128  O OE1 . GLU A 35  ? 0.1927 0.2306 0.2355 -0.0091 -0.0088 -0.0025 54  GLU B OE1 
129  O OE2 . GLU A 35  ? 0.1769 0.2015 0.2065 -0.0116 -0.0097 -0.0033 54  GLU B OE2 
130  N N   . ARG A 36  ? 0.1353 0.1982 0.1944 -0.0131 -0.0261 0.0055  55  ARG B N   
131  C CA  . ARG A 36  ? 0.2085 0.2767 0.2701 -0.0193 -0.0296 0.0046  55  ARG B CA  
132  C C   . ARG A 36  ? 0.2822 0.3584 0.3462 -0.0202 -0.0374 0.0061  55  ARG B C   
133  O O   . ARG A 36  ? 0.2420 0.3238 0.3098 -0.0257 -0.0417 0.0047  55  ARG B O   
134  C CB  . ARG A 36  ? 0.3867 0.4630 0.4600 -0.0210 -0.0258 0.0048  55  ARG B CB  
135  C CG  . ARG A 36  ? 0.5232 0.5913 0.5911 -0.0214 -0.0192 0.0031  55  ARG B CG  
136  C CD  . ARG A 36  ? 0.6474 0.7230 0.7252 -0.0231 -0.0149 0.0042  55  ARG B CD  
137  N NE  . ARG A 36  ? 0.6940 0.7809 0.7832 -0.0183 -0.0131 0.0064  55  ARG B NE  
138  C CZ  . ARG A 36  ? 0.6452 0.7314 0.7339 -0.0124 -0.0077 0.0062  55  ARG B CZ  
139  N NH1 . ARG A 36  ? 0.6372 0.7133 0.7152 -0.0111 -0.0043 0.0040  55  ARG B NH1 
140  N NH2 . ARG A 36  ? 0.6029 0.6989 0.7018 -0.0076 -0.0058 0.0077  55  ARG B NH2 
141  N N   . THR A 37  ? 0.1915 0.2677 0.2530 -0.0148 -0.0396 0.0090  56  THR B N   
142  C CA  . THR A 37  ? 0.2471 0.3312 0.3091 -0.0145 -0.0476 0.0111  56  THR B CA  
143  C C   . THR A 37  ? 0.2712 0.3473 0.3173 -0.0180 -0.0518 0.0086  56  THR B C   
144  O O   . THR A 37  ? 0.2618 0.3253 0.2962 -0.0181 -0.0476 0.0069  56  THR B O   
145  C CB  . THR A 37  ? 0.3490 0.4367 0.4147 -0.0066 -0.0483 0.0163  56  THR B CB  
146  O OG1 . THR A 37  ? 0.3975 0.4723 0.4519 -0.0031 -0.0446 0.0175  56  THR B OG1 
147  C CG2 . THR A 37  ? 0.4765 0.5716 0.5576 -0.0028 -0.0438 0.0178  56  THR B CG2 
148  N N   . LEU A 38  ? 0.2525 0.3363 0.2983 -0.0207 -0.0601 0.0079  57  LEU B N   
149  C CA  . LEU A 38  ? 0.2033 0.2798 0.2331 -0.0243 -0.0646 0.0041  57  LEU B CA  
150  C C   . LEU A 38  ? 0.3321 0.3966 0.3444 -0.0194 -0.0621 0.0060  57  LEU B C   
151  O O   . LEU A 38  ? 0.5562 0.6094 0.5553 -0.0218 -0.0600 0.0023  57  LEU B O   
152  C CB  . LEU A 38  ? 0.3247 0.4131 0.3568 -0.0270 -0.0755 0.0029  57  LEU B CB  
153  C CG  . LEU A 38  ? 0.4754 0.5705 0.5193 -0.0357 -0.0787 -0.0020 57  LEU B CG  
154  C CD1 . LEU A 38  ? 0.5314 0.6351 0.5733 -0.0393 -0.0906 -0.0052 57  LEU B CD1 
155  C CD2 . LEU A 38  ? 0.4886 0.5695 0.5258 -0.0411 -0.0726 -0.0070 57  LEU B CD2 
156  N N   . GLY A 39  ? 0.3816 0.4480 0.3941 -0.0123 -0.0615 0.0120  58  GLY B N   
157  C CA  . GLY A 39  ? 0.4087 0.4636 0.4064 -0.0080 -0.0577 0.0147  58  GLY B CA  
158  C C   . GLY A 39  ? 0.3303 0.3732 0.3260 -0.0085 -0.0485 0.0131  58  GLY B C   
159  O O   . GLY A 39  ? 0.2861 0.3190 0.2699 -0.0065 -0.0447 0.0143  58  GLY B O   
160  N N   . ALA A 40  ? 0.2841 0.3288 0.2918 -0.0109 -0.0450 0.0108  59  ALA B N   
161  C CA  . ALA A 40  ? 0.2587 0.2941 0.2659 -0.0110 -0.0373 0.0092  59  ALA B CA  
162  C C   . ALA A 40  ? 0.2302 0.2610 0.2335 -0.0169 -0.0361 0.0038  59  ALA B C   
163  O O   . ALA A 40  ? 0.2063 0.2327 0.1986 -0.0196 -0.0388 0.0011  59  ALA B O   
164  C CB  . ALA A 40  ? 0.2078 0.2471 0.2289 -0.0083 -0.0335 0.0106  59  ALA B CB  
165  N N   . SER A 41  ? 0.1783 0.2094 0.1899 -0.0183 -0.0319 0.0021  60  SER B N   
166  C CA  . SER A 41  ? 0.1913 0.2173 0.1997 -0.0233 -0.0302 -0.0020 60  SER B CA  
167  C C   . SER A 41  ? 0.2513 0.2848 0.2669 -0.0287 -0.0344 -0.0039 60  SER B C   
168  O O   . SER A 41  ? 0.1944 0.2228 0.2073 -0.0335 -0.0337 -0.0072 60  SER B O   
169  C CB  . SER A 41  ? 0.2293 0.2515 0.2413 -0.0221 -0.0236 -0.0025 60  SER B CB  
170  O OG  . SER A 41  ? 0.2235 0.2379 0.2289 -0.0187 -0.0201 -0.0019 60  SER B OG  
171  N N   . GLY A 42  ? 0.1678 0.2133 0.1937 -0.0278 -0.0385 -0.0016 61  GLY B N   
172  C CA  . GLY A 42  ? 0.1672 0.2220 0.2031 -0.0332 -0.0427 -0.0030 61  GLY B CA  
173  C C   . GLY A 42  ? 0.2114 0.2689 0.2583 -0.0358 -0.0374 -0.0030 61  GLY B C   
174  O O   . GLY A 42  ? 0.1959 0.2483 0.2416 -0.0329 -0.0308 -0.0023 61  GLY B O   
175  N N   . PRO A 43  ? 0.2534 0.3196 0.3116 -0.0412 -0.0403 -0.0037 62  PRO B N   
176  C CA  . PRO A 43  ? 0.2612 0.3333 0.3325 -0.0433 -0.0350 -0.0021 62  PRO B CA  
177  C C   . PRO A 43  ? 0.2368 0.2974 0.3022 -0.0449 -0.0280 -0.0031 62  PRO B C   
178  O O   . PRO A 43  ? 0.2340 0.2831 0.2890 -0.0481 -0.0287 -0.0062 62  PRO B O   
179  C CB  . PRO A 43  ? 0.3192 0.4006 0.4022 -0.0507 -0.0408 -0.0034 62  PRO B CB  
180  C CG  . PRO A 43  ? 0.4088 0.4950 0.4878 -0.0498 -0.0501 -0.0045 62  PRO B CG  
181  C CD  . PRO A 43  ? 0.2842 0.3566 0.3437 -0.0456 -0.0493 -0.0058 62  PRO B CD  
182  N N   . ALA A 44  ? 0.2290 0.2927 0.3003 -0.0419 -0.0212 -0.0003 63  ALA B N   
183  C CA  . ALA A 44  ? 0.2432 0.2995 0.3123 -0.0437 -0.0146 0.0001  63  ALA B CA  
184  C C   . ALA A 44  ? 0.3101 0.3675 0.3875 -0.0522 -0.0158 -0.0004 63  ALA B C   
185  O O   . ALA A 44  ? 0.2910 0.3601 0.3814 -0.0556 -0.0198 0.0002  63  ALA B O   
186  C CB  . ALA A 44  ? 0.2009 0.2634 0.2757 -0.0388 -0.0080 0.0035  63  ALA B CB  
187  N N   . GLU A 45  ? 0.3390 0.3844 0.4103 -0.0556 -0.0127 -0.0015 64  GLU B N   
188  C CA  . GLU A 45  ? 0.3741 0.4186 0.4544 -0.0641 -0.0131 -0.0021 64  GLU B CA  
189  C C   . GLU A 45  ? 0.3479 0.3922 0.4350 -0.0646 -0.0042 0.0028  64  GLU B C   
190  O O   . GLU A 45  ? 0.4121 0.4557 0.5090 -0.0717 -0.0026 0.0037  64  GLU B O   
191  C CB  . GLU A 45  ? 0.3904 0.4201 0.4595 -0.0686 -0.0167 -0.0074 64  GLU B CB  
192  C CG  . GLU A 45  ? 0.4708 0.5033 0.5355 -0.0698 -0.0263 -0.0122 64  GLU B CG  
193  C CD  . GLU A 45  ? 0.5572 0.5743 0.6063 -0.0717 -0.0291 -0.0179 64  GLU B CD  
194  O OE1 . GLU A 45  ? 0.5239 0.5277 0.5665 -0.0719 -0.0234 -0.0182 64  GLU B OE1 
195  O OE2 . GLU A 45  ? 0.6039 0.6224 0.6467 -0.0722 -0.0367 -0.0218 64  GLU B OE2 
196  N N   . GLY A 46  ? 0.2731 0.3182 0.3551 -0.0571 0.0017  0.0061  65  GLY B N   
197  C CA  . GLY A 46  ? 0.2726 0.3187 0.3589 -0.0559 0.0105  0.0115  65  GLY B CA  
198  C C   . GLY A 46  ? 0.2503 0.2835 0.3220 -0.0513 0.0152  0.0122  65  GLY B C   
199  O O   . GLY A 46  ? 0.2822 0.3031 0.3437 -0.0523 0.0126  0.0088  65  GLY B O   
200  N N   . ARG A 47  ? 0.2707 0.3073 0.3410 -0.0457 0.0221  0.0167  66  ARG B N   
201  C CA  . ARG A 47  ? 0.2773 0.3043 0.3338 -0.0400 0.0258  0.0178  66  ARG B CA  
202  C C   . ARG A 47  ? 0.2369 0.2501 0.2899 -0.0442 0.0282  0.0190  66  ARG B C   
203  O O   . ARG A 47  ? 0.2483 0.2606 0.3108 -0.0502 0.0313  0.0220  66  ARG B O   
204  C CB  . ARG A 47  ? 0.2849 0.3193 0.3409 -0.0335 0.0327  0.0226  66  ARG B CB  
205  C CG  . ARG A 47  ? 0.3215 0.3484 0.3637 -0.0270 0.0362  0.0242  66  ARG B CG  
206  C CD  . ARG A 47  ? 0.3591 0.3950 0.3971 -0.0188 0.0393  0.0253  66  ARG B CD  
207  N NE  . ARG A 47  ? 0.4405 0.4709 0.4657 -0.0125 0.0425  0.0275  66  ARG B NE  
208  C CZ  . ARG A 47  ? 0.4214 0.4576 0.4397 -0.0049 0.0458  0.0287  66  ARG B CZ  
209  N NH1 . ARG A 47  ? 0.4369 0.4839 0.4600 -0.0024 0.0471  0.0278  66  ARG B NH1 
210  N NH2 . ARG A 47  ? 0.4194 0.4508 0.4257 0.0007  0.0476  0.0307  66  ARG B NH2 
211  N N   . VAL A 48  ? 0.2140 0.2164 0.2546 -0.0409 0.0271  0.0168  67  VAL B N   
212  C CA  . VAL A 48  ? 0.2638 0.2517 0.3001 -0.0435 0.0297  0.0177  67  VAL B CA  
213  C C   . VAL A 48  ? 0.2737 0.2581 0.3027 -0.0368 0.0364  0.0234  67  VAL B C   
214  O O   . VAL A 48  ? 0.2552 0.2412 0.2750 -0.0296 0.0355  0.0226  67  VAL B O   
215  C CB  . VAL A 48  ? 0.2681 0.2462 0.2955 -0.0438 0.0244  0.0116  67  VAL B CB  
216  C CG1 . VAL A 48  ? 0.2976 0.2598 0.3193 -0.0448 0.0278  0.0124  67  VAL B CG1 
217  C CG2 . VAL A 48  ? 0.2859 0.2674 0.3188 -0.0503 0.0176  0.0063  67  VAL B CG2 
218  N N   . ALA A 49  ? 0.3138 0.2942 0.3475 -0.0392 0.0429  0.0295  68  ALA B N   
219  C CA  . ALA A 49  ? 0.3255 0.3034 0.3519 -0.0323 0.0498  0.0365  68  ALA B CA  
220  C C   . ALA A 49  ? 0.3977 0.3596 0.4168 -0.0312 0.0517  0.0378  68  ALA B C   
221  O O   . ALA A 49  ? 0.3351 0.2860 0.3579 -0.0379 0.0506  0.0351  68  ALA B O   
222  C CB  . ALA A 49  ? 0.3329 0.3163 0.3682 -0.0341 0.0574  0.0443  68  ALA B CB  
223  N N   . ARG A 50  ? 0.3772 0.3377 0.3857 -0.0225 0.0545  0.0418  69  ARG B N   
224  C CA  . ARG A 50  ? 0.3375 0.2837 0.3393 -0.0199 0.0570  0.0443  69  ARG B CA  
225  C C   . ARG A 50  ? 0.4138 0.3491 0.4234 -0.0262 0.0632  0.0494  69  ARG B C   
226  O O   . ARG A 50  ? 0.3969 0.3371 0.4130 -0.0279 0.0687  0.0558  69  ARG B O   
227  C CB  . ARG A 50  ? 0.3314 0.2806 0.3224 -0.0092 0.0595  0.0495  69  ARG B CB  
228  C CG  . ARG A 50  ? 0.3421 0.2779 0.3264 -0.0048 0.0618  0.0527  69  ARG B CG  
229  C CD  . ARG A 50  ? 0.3495 0.2912 0.3232 0.0062  0.0618  0.0565  69  ARG B CD  
230  N NE  . ARG A 50  ? 0.3020 0.2533 0.2726 0.0093  0.0543  0.0490  69  ARG B NE  
231  C CZ  . ARG A 50  ? 0.3616 0.3085 0.3303 0.0107  0.0503  0.0443  69  ARG B CZ  
232  N NH1 . ARG A 50  ? 0.3397 0.2726 0.3083 0.0099  0.0530  0.0458  69  ARG B NH1 
233  N NH2 . ARG A 50  ? 0.3064 0.2626 0.2741 0.0129  0.0442  0.0381  69  ARG B NH2 
234  N N   . GLY A 51  ? 0.4363 0.3564 0.4459 -0.0301 0.0625  0.0464  70  GLY B N   
235  C CA  . GLY A 51  ? 0.4749 0.3815 0.4919 -0.0362 0.0684  0.0506  70  GLY B CA  
236  C C   . GLY A 51  ? 0.4097 0.3163 0.4401 -0.0481 0.0657  0.0455  70  GLY B C   
237  O O   . GLY A 51  ? 0.4758 0.3703 0.5141 -0.0548 0.0694  0.0472  70  GLY B O   
238  N N   . SER A 52  ? 0.3650 0.2853 0.3987 -0.0507 0.0589  0.0394  71  SER B N   
239  C CA  . SER A 52  ? 0.3343 0.2564 0.3801 -0.0614 0.0543  0.0335  71  SER B CA  
240  C C   . SER A 52  ? 0.3978 0.3063 0.4383 -0.0650 0.0487  0.0245  71  SER B C   
241  O O   . SER A 52  ? 0.4614 0.3626 0.4891 -0.0585 0.0479  0.0224  71  SER B O   
242  C CB  . SER A 52  ? 0.3380 0.2792 0.3879 -0.0615 0.0486  0.0303  71  SER B CB  
243  O OG  . SER A 52  ? 0.3223 0.2650 0.3612 -0.0568 0.0420  0.0237  71  SER B OG  
244  N N   . GLU A 53  ? 0.4467 0.3524 0.4968 -0.0752 0.0446  0.0188  72  GLU B N   
245  C CA  . GLU A 53  ? 0.5509 0.4439 0.5943 -0.0785 0.0389  0.0091  72  GLU B CA  
246  C C   . GLU A 53  ? 0.4321 0.3334 0.4649 -0.0739 0.0316  0.0028  72  GLU B C   
247  O O   . GLU A 53  ? 0.4558 0.3467 0.4764 -0.0705 0.0299  -0.0021 72  GLU B O   
248  C CB  . GLU A 53  ? 0.7249 0.6140 0.7809 -0.0908 0.0350  0.0034  72  GLU B CB  
249  C CG  . GLU A 53  ? 0.8743 0.7498 0.9410 -0.0967 0.0424  0.0082  72  GLU B CG  
250  C CD  . GLU A 53  ? 0.9547 0.8095 1.0101 -0.0910 0.0487  0.0104  72  GLU B CD  
251  O OE1 . GLU A 53  ? 0.9590 0.8034 1.0014 -0.0880 0.0451  0.0029  72  GLU B OE1 
252  O OE2 . GLU A 53  ? 0.9899 0.8388 1.0495 -0.0889 0.0578  0.0201  72  GLU B OE2 
253  N N   . ARG A 54  ? 0.3568 0.2764 0.3945 -0.0734 0.0278  0.0035  73  ARG B N   
254  C CA  . ARG A 54  ? 0.3068 0.2339 0.3353 -0.0686 0.0217  -0.0012 73  ARG B CA  
255  C C   . ARG A 54  ? 0.3422 0.2660 0.3586 -0.0586 0.0254  0.0017  73  ARG B C   
256  O O   . ARG A 54  ? 0.3213 0.2422 0.3276 -0.0548 0.0223  -0.0027 73  ARG B O   
257  C CB  . ARG A 54  ? 0.3515 0.2981 0.3883 -0.0690 0.0179  -0.0002 73  ARG B CB  
258  C CG  . ARG A 54  ? 0.3855 0.3387 0.4342 -0.0782 0.0117  -0.0044 73  ARG B CG  
259  C CD  . ARG A 54  ? 0.3812 0.3543 0.4385 -0.0768 0.0087  -0.0023 73  ARG B CD  
260  N NE  . ARG A 54  ? 0.4435 0.4213 0.4904 -0.0705 0.0042  -0.0051 73  ARG B NE  
261  C CZ  . ARG A 54  ? 0.4512 0.4435 0.5018 -0.0662 0.0029  -0.0029 73  ARG B CZ  
262  N NH1 . ARG A 54  ? 0.3701 0.3743 0.4338 -0.0671 0.0059  0.0018  73  ARG B NH1 
263  N NH2 . ARG A 54  ? 0.4682 0.4624 0.5096 -0.0608 -0.0007 -0.0052 73  ARG B NH2 
264  N N   . PHE A 55  ? 0.3030 0.2277 0.3206 -0.0540 0.0321  0.0093  74  PHE B N   
265  C CA  . PHE A 55  ? 0.3540 0.2763 0.3613 -0.0446 0.0350  0.0122  74  PHE B CA  
266  C C   . PHE A 55  ? 0.4271 0.3327 0.4257 -0.0430 0.0360  0.0091  74  PHE B C   
267  O O   . PHE A 55  ? 0.3169 0.2219 0.3069 -0.0366 0.0351  0.0075  74  PHE B O   
268  C CB  . PHE A 55  ? 0.3071 0.2321 0.3162 -0.0402 0.0419  0.0212  74  PHE B CB  
269  C CG  . PHE A 55  ? 0.3654 0.2890 0.3645 -0.0304 0.0441  0.0243  74  PHE B CG  
270  C CD1 . PHE A 55  ? 0.3585 0.2945 0.3536 -0.0243 0.0411  0.0235  74  PHE B CD1 
271  C CD2 . PHE A 55  ? 0.3979 0.3076 0.3923 -0.0272 0.0489  0.0278  74  PHE B CD2 
272  C CE1 . PHE A 55  ? 0.3400 0.2758 0.3273 -0.0158 0.0421  0.0257  74  PHE B CE1 
273  C CE2 . PHE A 55  ? 0.3057 0.2157 0.2920 -0.0178 0.0502  0.0308  74  PHE B CE2 
274  C CZ  . PHE A 55  ? 0.2876 0.2113 0.2706 -0.0124 0.0464  0.0295  74  PHE B CZ  
275  N N   . ARG A 56  ? 0.3570 0.2489 0.3588 -0.0489 0.0383  0.0081  75  ARG B N   
276  C CA  . ARG A 56  ? 0.4385 0.3127 0.4325 -0.0472 0.0402  0.0051  75  ARG B CA  
277  C C   . ARG A 56  ? 0.4028 0.2747 0.3890 -0.0482 0.0343  -0.0041 75  ARG B C   
278  O O   . ARG A 56  ? 0.4902 0.3511 0.4675 -0.0439 0.0359  -0.0068 75  ARG B O   
279  C CB  . ARG A 56  ? 0.5381 0.3966 0.5381 -0.0536 0.0444  0.0060  75  ARG B CB  
280  C CG  . ARG A 56  ? 0.5612 0.4182 0.5660 -0.0506 0.0523  0.0167  75  ARG B CG  
281  C CD  . ARG A 56  ? 0.7049 0.5441 0.7164 -0.0570 0.0572  0.0179  75  ARG B CD  
282  N NE  . ARG A 56  ? 0.8686 0.7067 0.8847 -0.0539 0.0656  0.0295  75  ARG B NE  
283  C CZ  . ARG A 56  ? 0.9039 0.7527 0.9307 -0.0578 0.0681  0.0356  75  ARG B CZ  
284  N NH1 . ARG A 56  ? 0.8455 0.7073 0.8808 -0.0651 0.0625  0.0309  75  ARG B NH1 
285  N NH2 . ARG A 56  ? 0.9591 0.8058 0.9879 -0.0539 0.0765  0.0470  75  ARG B NH2 
286  N N   . ASP A 57  ? 0.3580 0.2409 0.3476 -0.0531 0.0278  -0.0085 76  ASP B N   
287  C CA  . ASP A 57  ? 0.4306 0.3136 0.4113 -0.0528 0.0222  -0.0159 76  ASP B CA  
288  C C   . ASP A 57  ? 0.4348 0.3275 0.4095 -0.0445 0.0218  -0.0141 76  ASP B C   
289  O O   . ASP A 57  ? 0.4505 0.3434 0.4175 -0.0430 0.0185  -0.0188 76  ASP B O   
290  C CB  . ASP A 57  ? 0.4234 0.3148 0.4094 -0.0605 0.0148  -0.0209 76  ASP B CB  
291  C CG  . ASP A 57  ? 0.5346 0.4162 0.5271 -0.0698 0.0137  -0.0248 76  ASP B CG  
292  O OD1 . ASP A 57  ? 0.4809 0.3448 0.4688 -0.0704 0.0173  -0.0272 76  ASP B OD1 
293  O OD2 . ASP A 57  ? 0.5818 0.4733 0.5848 -0.0767 0.0090  -0.0258 76  ASP B OD2 
294  N N   . LEU A 58  ? 0.4153 0.3163 0.3936 -0.0394 0.0250  -0.0074 77  LEU B N   
295  C CA  . LEU A 58  ? 0.3486 0.2584 0.3229 -0.0322 0.0243  -0.0063 77  LEU B CA  
296  C C   . LEU A 58  ? 0.3803 0.2800 0.3476 -0.0260 0.0284  -0.0057 77  LEU B C   
297  O O   . LEU A 58  ? 0.3212 0.2112 0.2886 -0.0248 0.0331  -0.0026 77  LEU B O   
298  C CB  . LEU A 58  ? 0.3021 0.2253 0.2822 -0.0289 0.0251  -0.0008 77  LEU B CB  
299  C CG  . LEU A 58  ? 0.2750 0.2103 0.2631 -0.0334 0.0217  -0.0007 77  LEU B CG  
300  C CD1 . LEU A 58  ? 0.3052 0.2520 0.2967 -0.0287 0.0234  0.0042  77  LEU B CD1 
301  C CD2 . LEU A 58  ? 0.2984 0.2391 0.2851 -0.0353 0.0158  -0.0057 77  LEU B CD2 
302  N N   . VAL A 59  ? 0.3683 0.2705 0.3304 -0.0218 0.0273  -0.0080 78  VAL B N   
303  C CA  . VAL A 59  ? 0.3568 0.2505 0.3135 -0.0157 0.0314  -0.0076 78  VAL B CA  
304  C C   . VAL A 59  ? 0.3171 0.2220 0.2757 -0.0089 0.0315  -0.0046 78  VAL B C   
305  O O   . VAL A 59  ? 0.2915 0.2061 0.2514 -0.0092 0.0281  -0.0062 78  VAL B O   
306  C CB  . VAL A 59  ? 0.4192 0.3026 0.3674 -0.0168 0.0313  -0.0139 78  VAL B CB  
307  C CG1 . VAL A 59  ? 0.3916 0.2669 0.3352 -0.0096 0.0366  -0.0131 78  VAL B CG1 
308  C CG2 . VAL A 59  ? 0.4715 0.3435 0.4180 -0.0241 0.0301  -0.0182 78  VAL B CG2 
309  N N   . PRO A 60  ? 0.2915 0.1950 0.2510 -0.0027 0.0352  -0.0003 79  PRO B N   
310  C CA  . PRO A 60  ? 0.2916 0.2065 0.2544 0.0036  0.0344  0.0021  79  PRO B CA  
311  C C   . PRO A 60  ? 0.2939 0.2089 0.2548 0.0059  0.0349  -0.0010 79  PRO B C   
312  O O   . PRO A 60  ? 0.2699 0.1745 0.2263 0.0083  0.0387  -0.0021 79  PRO B O   
313  C CB  . PRO A 60  ? 0.3299 0.2412 0.2930 0.0097  0.0383  0.0074  79  PRO B CB  
314  C CG  . PRO A 60  ? 0.4119 0.3101 0.3727 0.0062  0.0414  0.0087  79  PRO B CG  
315  C CD  . PRO A 60  ? 0.3471 0.2377 0.3049 -0.0010 0.0400  0.0025  79  PRO B CD  
316  N N   . ASN A 61  ? 0.2074 0.1338 0.1720 0.0056  0.0316  -0.0020 80  ASN B N   
317  C CA  . ASN A 61  ? 0.2058 0.1337 0.1701 0.0078  0.0327  -0.0037 80  ASN B CA  
318  C C   . ASN A 61  ? 0.2870 0.2208 0.2573 0.0146  0.0347  -0.0007 80  ASN B C   
319  O O   . ASN A 61  ? 0.3246 0.2696 0.3019 0.0163  0.0318  0.0010  80  ASN B O   
320  C CB  . ASN A 61  ? 0.2098 0.1468 0.1769 0.0045  0.0287  -0.0053 80  ASN B CB  
321  C CG  . ASN A 61  ? 0.2643 0.2008 0.2295 0.0057  0.0307  -0.0066 80  ASN B CG  
322  O OD1 . ASN A 61  ? 0.2888 0.2230 0.2542 0.0102  0.0350  -0.0057 80  ASN B OD1 
323  N ND2 . ASN A 61  ? 0.2213 0.1602 0.1847 0.0023  0.0282  -0.0080 80  ASN B ND2 
324  N N   . TYR A 62  ? 0.2211 0.1478 0.1890 0.0187  0.0395  -0.0005 81  TYR B N   
325  C CA  . TYR A 62  ? 0.2097 0.1430 0.1849 0.0255  0.0415  0.0025  81  TYR B CA  
326  C C   . TYR A 62  ? 0.2334 0.1712 0.2124 0.0273  0.0439  0.0017  81  TYR B C   
327  O O   . TYR A 62  ? 0.2674 0.2067 0.2510 0.0330  0.0478  0.0036  81  TYR B O   
328  C CB  . TYR A 62  ? 0.2619 0.1851 0.2340 0.0306  0.0460  0.0050  81  TYR B CB  
329  C CG  . TYR A 62  ? 0.2752 0.2015 0.2494 0.0325  0.0437  0.0090  81  TYR B CG  
330  C CD1 . TYR A 62  ? 0.3079 0.2461 0.2897 0.0384  0.0419  0.0126  81  TYR B CD1 
331  C CD2 . TYR A 62  ? 0.3022 0.2208 0.2710 0.0282  0.0432  0.0093  81  TYR B CD2 
332  C CE1 . TYR A 62  ? 0.3595 0.3010 0.3411 0.0409  0.0397  0.0166  81  TYR B CE1 
333  C CE2 . TYR A 62  ? 0.3708 0.2926 0.3407 0.0303  0.0421  0.0139  81  TYR B CE2 
334  C CZ  . TYR A 62  ? 0.3857 0.3187 0.3608 0.0371  0.0404  0.0176  81  TYR B CZ  
335  O OH  . TYR A 62  ? 0.4257 0.3621 0.3998 0.0401  0.0392  0.0225  81  TYR B OH  
336  N N   . ASN A 63  ? 0.2413 0.1813 0.2188 0.0226  0.0422  -0.0006 82  ASN B N   
337  C CA  . ASN A 63  ? 0.1718 0.1175 0.1540 0.0236  0.0445  -0.0004 82  ASN B CA  
338  C C   . ASN A 63  ? 0.1788 0.1386 0.1761 0.0265  0.0427  0.0021  82  ASN B C   
339  O O   . ASN A 63  ? 0.2185 0.1865 0.2215 0.0242  0.0371  0.0018  82  ASN B O   
340  C CB  . ASN A 63  ? 0.2603 0.2073 0.2395 0.0180  0.0415  -0.0022 82  ASN B CB  
341  C CG  . ASN A 63  ? 0.2779 0.2284 0.2598 0.0189  0.0450  -0.0011 82  ASN B CG  
342  O OD1 . ASN A 63  ? 0.2560 0.2118 0.2468 0.0229  0.0488  0.0012  82  ASN B OD1 
343  N ND2 . ASN A 63  ? 0.2363 0.1840 0.2111 0.0154  0.0441  -0.0021 82  ASN B ND2 
344  N N   . PRO A 64  ? 0.1884 0.1514 0.1924 0.0317  0.0473  0.0042  83  PRO B N   
345  C CA  . PRO A 64  ? 0.2172 0.1947 0.2372 0.0346  0.0449  0.0062  83  PRO B CA  
346  C C   . PRO A 64  ? 0.2574 0.2452 0.2881 0.0306  0.0422  0.0055  83  PRO B C   
347  O O   . PRO A 64  ? 0.2324 0.2325 0.2767 0.0314  0.0383  0.0058  83  PRO B O   
348  C CB  . PRO A 64  ? 0.2036 0.1811 0.2281 0.0410  0.0518  0.0087  83  PRO B CB  
349  C CG  . PRO A 64  ? 0.2568 0.2228 0.2699 0.0400  0.0581  0.0075  83  PRO B CG  
350  C CD  . PRO A 64  ? 0.2307 0.1851 0.2287 0.0352  0.0550  0.0044  83  PRO B CD  
351  N N   . ASP A 65  ? 0.2339 0.2166 0.2588 0.0266  0.0440  0.0047  84  ASP B N   
352  C CA  . ASP A 65  ? 0.2499 0.2403 0.2847 0.0229  0.0422  0.0047  84  ASP B CA  
353  C C   . ASP A 65  ? 0.2023 0.1938 0.2354 0.0183  0.0353  0.0022  84  ASP B C   
354  O O   . ASP A 65  ? 0.2108 0.2054 0.2494 0.0148  0.0340  0.0020  84  ASP B O   
355  C CB  . ASP A 65  ? 0.2738 0.2590 0.3041 0.0222  0.0486  0.0065  84  ASP B CB  
356  C CG  . ASP A 65  ? 0.3329 0.3195 0.3681 0.0273  0.0564  0.0093  84  ASP B CG  
357  O OD1 . ASP A 65  ? 0.3323 0.3286 0.3818 0.0302  0.0560  0.0105  84  ASP B OD1 
358  O OD2 . ASP A 65  ? 0.3073 0.2859 0.3319 0.0287  0.0629  0.0103  84  ASP B OD2 
359  N N   . ILE A 66  ? 0.1952 0.1839 0.2210 0.0185  0.0316  0.0007  85  ILE B N   
360  C CA  . ILE A 66  ? 0.2038 0.1951 0.2290 0.0152  0.0255  -0.0015 85  ILE B CA  
361  C C   . ILE A 66  ? 0.2241 0.2225 0.2537 0.0182  0.0214  -0.0021 85  ILE B C   
362  O O   . ILE A 66  ? 0.2439 0.2394 0.2692 0.0220  0.0231  -0.0003 85  ILE B O   
363  C CB  . ILE A 66  ? 0.2355 0.2173 0.2470 0.0125  0.0252  -0.0024 85  ILE B CB  
364  C CG1 . ILE A 66  ? 0.2105 0.1858 0.2155 0.0102  0.0284  -0.0021 85  ILE B CG1 
365  C CG2 . ILE A 66  ? 0.2243 0.2100 0.2364 0.0097  0.0198  -0.0042 85  ILE B CG2 
366  C CD1 . ILE A 66  ? 0.2729 0.2401 0.2656 0.0071  0.0271  -0.0035 85  ILE B CD1 
367  N N   . ILE A 67  ? 0.1871 0.1943 0.2250 0.0169  0.0161  -0.0044 86  ILE B N   
368  C CA  . ILE A 67  ? 0.1204 0.1348 0.1599 0.0200  0.0113  -0.0055 86  ILE B CA  
369  C C   . ILE A 67  ? 0.2230 0.2337 0.2521 0.0186  0.0089  -0.0065 86  ILE B C   
370  O O   . ILE A 67  ? 0.2256 0.2352 0.2540 0.0148  0.0076  -0.0086 86  ILE B O   
371  C CB  . ILE A 67  ? 0.1875 0.2133 0.2408 0.0193  0.0061  -0.0088 86  ILE B CB  
372  C CG1 . ILE A 67  ? 0.2668 0.2974 0.3336 0.0197  0.0089  -0.0074 86  ILE B CG1 
373  C CG2 . ILE A 67  ? 0.2331 0.2671 0.2863 0.0231  0.0001  -0.0106 86  ILE B CG2 
374  C CD1 . ILE A 67  ? 0.3163 0.3570 0.3989 0.0174  0.0041  -0.0110 86  ILE B CD1 
375  N N   . PHE A 68  ? 0.1951 0.2044 0.2168 0.0221  0.0088  -0.0045 87  PHE B N   
376  C CA  . PHE A 68  ? 0.1792 0.1868 0.1927 0.0211  0.0072  -0.0049 87  PHE B CA  
377  C C   . PHE A 68  ? 0.2162 0.2335 0.2305 0.0248  0.0022  -0.0064 87  PHE B C   
378  O O   . PHE A 68  ? 0.2354 0.2570 0.2500 0.0299  0.0010  -0.0045 87  PHE B O   
379  C CB  . PHE A 68  ? 0.2285 0.2258 0.2320 0.0212  0.0116  -0.0012 87  PHE B CB  
380  C CG  . PHE A 68  ? 0.1983 0.1860 0.1989 0.0172  0.0155  -0.0013 87  PHE B CG  
381  C CD1 . PHE A 68  ? 0.1841 0.1682 0.1812 0.0122  0.0151  -0.0026 87  PHE B CD1 
382  C CD2 . PHE A 68  ? 0.2460 0.2291 0.2475 0.0188  0.0192  -0.0002 87  PHE B CD2 
383  C CE1 . PHE A 68  ? 0.2095 0.1856 0.2028 0.0088  0.0176  -0.0031 87  PHE B CE1 
384  C CE2 . PHE A 68  ? 0.2158 0.1899 0.2124 0.0157  0.0225  -0.0009 87  PHE B CE2 
385  C CZ  . PHE A 68  ? 0.1968 0.1675 0.1889 0.0106  0.0212  -0.0025 87  PHE B CZ  
386  N N   . LYS A 69  ? 0.2190 0.2398 0.2331 0.0228  -0.0010 -0.0100 88  LYS B N   
387  C CA  . LYS A 69  ? 0.2114 0.2410 0.2245 0.0264  -0.0061 -0.0127 88  LYS B CA  
388  C C   . LYS A 69  ? 0.1579 0.1870 0.1604 0.0315  -0.0049 -0.0083 88  LYS B C   
389  O O   . LYS A 69  ? 0.2178 0.2538 0.2196 0.0368  -0.0082 -0.0079 88  LYS B O   
390  C CB  . LYS A 69  ? 0.2240 0.2549 0.2367 0.0237  -0.0082 -0.0173 88  LYS B CB  
391  C CG  . LYS A 69  ? 0.1945 0.2336 0.2038 0.0277  -0.0133 -0.0213 88  LYS B CG  
392  C CD  . LYS A 69  ? 0.1510 0.1907 0.1617 0.0253  -0.0150 -0.0268 88  LYS B CD  
393  C CE  . LYS A 69  ? 0.2137 0.2604 0.2178 0.0300  -0.0194 -0.0313 88  LYS B CE  
394  N NZ  . LYS A 69  ? 0.2115 0.2661 0.2221 0.0318  -0.0262 -0.0367 88  LYS B NZ  
395  N N   . ASP A 70  ? 0.1376 0.1588 0.1323 0.0298  -0.0002 -0.0046 89  ASP B N   
396  C CA  . ASP A 70  ? 0.2134 0.2319 0.1988 0.0341  0.0027  0.0012  89  ASP B CA  
397  C C   . ASP A 70  ? 0.2238 0.2515 0.2036 0.0401  -0.0012 0.0006  89  ASP B C   
398  O O   . ASP A 70  ? 0.2174 0.2468 0.1922 0.0461  -0.0011 0.0052  89  ASP B O   
399  C CB  . ASP A 70  ? 0.2366 0.2492 0.2224 0.0365  0.0060  0.0059  89  ASP B CB  
400  C CG  . ASP A 70  ? 0.3391 0.3455 0.3157 0.0402  0.0103  0.0129  89  ASP B CG  
401  O OD1 . ASP A 70  ? 0.3311 0.3339 0.3024 0.0379  0.0132  0.0147  89  ASP B OD1 
402  O OD2 . ASP A 70  ? 0.3457 0.3511 0.3216 0.0456  0.0113  0.0171  89  ASP B OD2 
403  N N   . GLU A 71  ? 0.2290 0.2624 0.2088 0.0391  -0.0046 -0.0048 90  GLU B N   
404  C CA  . GLU A 71  ? 0.1921 0.2336 0.1637 0.0449  -0.0080 -0.0061 90  GLU B CA  
405  C C   . GLU A 71  ? 0.2560 0.2937 0.2160 0.0483  -0.0024 0.0014  90  GLU B C   
406  O O   . GLU A 71  ? 0.3050 0.3483 0.2555 0.0549  -0.0039 0.0033  90  GLU B O   
407  C CB  . GLU A 71  ? 0.1926 0.2389 0.1656 0.0432  -0.0116 -0.0139 90  GLU B CB  
408  C CG  . GLU A 71  ? 0.1826 0.2244 0.1527 0.0399  -0.0068 -0.0131 90  GLU B CG  
409  C CD  . GLU A 71  ? 0.2339 0.2683 0.2127 0.0327  -0.0037 -0.0125 90  GLU B CD  
410  O OE1 . GLU A 71  ? 0.1970 0.2291 0.1833 0.0302  -0.0048 -0.0130 90  GLU B OE1 
411  O OE2 . GLU A 71  ? 0.2409 0.2725 0.2188 0.0298  -0.0002 -0.0115 90  GLU B OE2 
412  N N   . GLU A 72  ? 0.2422 0.2706 0.2030 0.0436  0.0040  0.0058  91  GLU B N   
413  C CA  . GLU A 72  ? 0.2472 0.2707 0.1999 0.0453  0.0103  0.0135  91  GLU B CA  
414  C C   . GLU A 72  ? 0.2974 0.3175 0.2459 0.0507  0.0120  0.0205  91  GLU B C   
415  O O   . GLU A 72  ? 0.2749 0.2923 0.2154 0.0544  0.0167  0.0277  91  GLU B O   
416  C CB  . GLU A 72  ? 0.2349 0.2493 0.1921 0.0379  0.0157  0.0155  91  GLU B CB  
417  C CG  . GLU A 72  ? 0.2504 0.2680 0.2121 0.0331  0.0146  0.0101  91  GLU B CG  
418  C CD  . GLU A 72  ? 0.2659 0.2826 0.2366 0.0284  0.0107  0.0041  91  GLU B CD  
419  O OE1 . GLU A 72  ? 0.2535 0.2706 0.2273 0.0298  0.0077  0.0024  91  GLU B OE1 
420  O OE2 . GLU A 72  ? 0.2336 0.2499 0.2089 0.0236  0.0111  0.0016  91  GLU B OE2 
421  N N   . ASN A 73  ? 0.2516 0.2719 0.2061 0.0516  0.0088  0.0188  92  ASN B N   
422  C CA  . ASN A 73  ? 0.2753 0.2913 0.2281 0.0567  0.0111  0.0255  92  ASN B CA  
423  C C   . ASN A 73  ? 0.3498 0.3522 0.2999 0.0540  0.0193  0.0324  92  ASN B C   
424  O O   . ASN A 73  ? 0.3442 0.3425 0.2878 0.0591  0.0232  0.0403  92  ASN B O   
425  C CB  . ASN A 73  ? 0.3178 0.3430 0.2621 0.0661  0.0076  0.0287  92  ASN B CB  
426  C CG  . ASN A 73  ? 0.3858 0.4242 0.3349 0.0686  -0.0016 0.0213  92  ASN B CG  
427  O OD1 . ASN A 73  ? 0.4343 0.4743 0.3939 0.0672  -0.0042 0.0185  92  ASN B OD1 
428  N ND2 . ASN A 73  ? 0.3732 0.4212 0.3149 0.0722  -0.0062 0.0179  92  ASN B ND2 
429  N N   . SER A 74  ? 0.2641 0.2593 0.2196 0.0458  0.0217  0.0294  93  SER B N   
430  C CA  . SER A 74  ? 0.3110 0.2939 0.2655 0.0415  0.0285  0.0341  93  SER B CA  
431  C C   . SER A 74  ? 0.2906 0.2636 0.2513 0.0352  0.0298  0.0309  93  SER B C   
432  O O   . SER A 74  ? 0.3473 0.3084 0.3077 0.0320  0.0348  0.0340  93  SER B O   
433  C CB  . SER A 74  ? 0.3374 0.3229 0.2907 0.0375  0.0305  0.0342  93  SER B CB  
434  O OG  . SER A 74  ? 0.3028 0.2903 0.2625 0.0307  0.0277  0.0272  93  SER B OG  
435  N N   . GLY A 75  ? 0.3001 0.2777 0.2661 0.0334  0.0254  0.0244  94  GLY B N   
436  C CA  . GLY A 75  ? 0.3188 0.2880 0.2888 0.0281  0.0265  0.0210  94  GLY B CA  
437  C C   . GLY A 75  ? 0.3154 0.2829 0.2873 0.0201  0.0263  0.0174  94  GLY B C   
438  O O   . GLY A 75  ? 0.2773 0.2378 0.2508 0.0155  0.0269  0.0144  94  GLY B O   
439  N N   . ALA A 76  ? 0.2197 0.1941 0.1912 0.0191  0.0254  0.0176  95  ALA B N   
440  C CA  . ALA A 76  ? 0.2856 0.2602 0.2603 0.0122  0.0251  0.0149  95  ALA B CA  
441  C C   . ALA A 76  ? 0.2451 0.2220 0.2239 0.0090  0.0212  0.0090  95  ALA B C   
442  O O   . ALA A 76  ? 0.1982 0.1711 0.1788 0.0034  0.0211  0.0070  95  ALA B O   
443  C CB  . ALA A 76  ? 0.1678 0.1513 0.1419 0.0132  0.0251  0.0162  95  ALA B CB  
444  N N   . ASP A 77  ? 0.1801 0.1641 0.1609 0.0126  0.0178  0.0064  96  ASP B N   
445  C CA  . ASP A 77  ? 0.2199 0.2065 0.2055 0.0100  0.0148  0.0018  96  ASP B CA  
446  C C   . ASP A 77  ? 0.2228 0.2006 0.2080 0.0072  0.0165  0.0011  96  ASP B C   
447  O O   . ASP A 77  ? 0.1897 0.1678 0.1772 0.0040  0.0150  -0.0016 96  ASP B O   
448  C CB  . ASP A 77  ? 0.2269 0.2220 0.2165 0.0140  0.0112  -0.0008 96  ASP B CB  
449  C CG  . ASP A 77  ? 0.2099 0.2138 0.1995 0.0160  0.0084  -0.0026 96  ASP B CG  
450  O OD1 . ASP A 77  ? 0.2203 0.2250 0.2089 0.0137  0.0091  -0.0026 96  ASP B OD1 
451  O OD2 . ASP A 77  ? 0.2441 0.2545 0.2350 0.0202  0.0053  -0.0043 96  ASP B OD2 
452  N N   . ARG A 78  ? 0.1910 0.1611 0.1728 0.0093  0.0198  0.0036  97  ARG B N   
453  C CA  . ARG A 78  ? 0.2144 0.1751 0.1940 0.0076  0.0221  0.0024  97  ARG B CA  
454  C C   . ARG A 78  ? 0.2366 0.1884 0.2125 0.0017  0.0232  0.0013  97  ARG B C   
455  O O   . ARG A 78  ? 0.2182 0.1629 0.1909 -0.0005 0.0240  -0.0012 97  ARG B O   
456  C CB  . ARG A 78  ? 0.2670 0.2217 0.2446 0.0127  0.0256  0.0051  97  ARG B CB  
457  C CG  . ARG A 78  ? 0.3066 0.2703 0.2890 0.0188  0.0242  0.0061  97  ARG B CG  
458  C CD  . ARG A 78  ? 0.2927 0.2501 0.2735 0.0245  0.0280  0.0096  97  ARG B CD  
459  N NE  . ARG A 78  ? 0.2720 0.2396 0.2590 0.0305  0.0261  0.0107  97  ARG B NE  
460  C CZ  . ARG A 78  ? 0.3031 0.2743 0.2963 0.0315  0.0264  0.0089  97  ARG B CZ  
461  N NH1 . ARG A 78  ? 0.2471 0.2117 0.2387 0.0277  0.0290  0.0064  97  ARG B NH1 
462  N NH2 . ARG A 78  ? 0.2884 0.2703 0.2894 0.0365  0.0242  0.0099  97  ARG B NH2 
463  N N   . LEU A 79  ? 0.2169 0.1692 0.1931 -0.0008 0.0234  0.0032  98  LEU B N   
464  C CA  . LEU A 79  ? 0.2170 0.1614 0.1919 -0.0069 0.0242  0.0022  98  LEU B CA  
465  C C   . LEU A 79  ? 0.1971 0.1464 0.1740 -0.0117 0.0201  -0.0014 98  LEU B C   
466  O O   . LEU A 79  ? 0.2650 0.2245 0.2462 -0.0116 0.0177  -0.0013 98  LEU B O   
467  C CB  . LEU A 79  ? 0.2117 0.1562 0.1886 -0.0082 0.0265  0.0063  98  LEU B CB  
468  C CG  . LEU A 79  ? 0.2917 0.2294 0.2658 -0.0037 0.0310  0.0113  98  LEU B CG  
469  C CD1 . LEU A 79  ? 0.2678 0.2072 0.2438 -0.0044 0.0339  0.0165  98  LEU B CD1 
470  C CD2 . LEU A 79  ? 0.3060 0.2286 0.2767 -0.0052 0.0338  0.0099  98  LEU B CD2 
471  N N   . MET A 80  ? 0.2089 0.1506 0.1820 -0.0154 0.0194  -0.0047 99  MET B N   
472  C CA  . MET A 80  ? 0.3103 0.2568 0.2841 -0.0190 0.0151  -0.0077 99  MET B CA  
473  C C   . MET A 80  ? 0.2845 0.2219 0.2533 -0.0242 0.0138  -0.0113 99  MET B C   
474  O O   . MET A 80  ? 0.2809 0.2067 0.2448 -0.0243 0.0168  -0.0124 99  MET B O   
475  C CB  . MET A 80  ? 0.2449 0.1958 0.2178 -0.0153 0.0142  -0.0084 99  MET B CB  
476  C CG  . MET A 80  ? 0.2213 0.1643 0.1885 -0.0118 0.0176  -0.0091 99  MET B CG  
477  S SD  . MET A 80  ? 0.2348 0.1845 0.2042 -0.0081 0.0174  -0.0088 99  MET B SD  
478  C CE  . MET A 80  ? 0.2274 0.1862 0.2054 -0.0038 0.0175  -0.0063 99  MET B CE  
479  N N   . THR A 81  ? 0.2014 0.1439 0.1716 -0.0282 0.0092  -0.0134 100 THR B N   
480  C CA  . THR A 81  ? 0.2627 0.1981 0.2277 -0.0332 0.0064  -0.0179 100 THR B CA  
481  C C   . THR A 81  ? 0.2854 0.2136 0.2393 -0.0303 0.0071  -0.0208 100 THR B C   
482  O O   . THR A 81  ? 0.2487 0.1792 0.2013 -0.0250 0.0096  -0.0188 100 THR B O   
483  C CB  . THR A 81  ? 0.2728 0.2179 0.2421 -0.0372 0.0003  -0.0190 100 THR B CB  
484  O OG1 . THR A 81  ? 0.2218 0.1743 0.1899 -0.0332 -0.0012 -0.0177 100 THR B OG1 
485  C CG2 . THR A 81  ? 0.2847 0.2385 0.2662 -0.0401 0.0001  -0.0160 100 THR B CG2 
486  N N   . GLU A 82  ? 0.2303 0.1500 0.1764 -0.0338 0.0049  -0.0259 101 GLU B N   
487  C CA  . GLU A 82  ? 0.2544 0.1666 0.1879 -0.0307 0.0061  -0.0290 101 GLU B CA  
488  C C   . GLU A 82  ? 0.2836 0.2051 0.2148 -0.0278 0.0039  -0.0272 101 GLU B C   
489  O O   . GLU A 82  ? 0.2370 0.1569 0.1630 -0.0227 0.0077  -0.0259 101 GLU B O   
490  C CB  . GLU A 82  ? 0.2852 0.1868 0.2097 -0.0353 0.0031  -0.0359 101 GLU B CB  
491  C CG  . GLU A 82  ? 0.4687 0.3613 0.3779 -0.0313 0.0053  -0.0396 101 GLU B CG  
492  C CD  . GLU A 82  ? 0.6693 0.5527 0.5677 -0.0359 0.0007  -0.0477 101 GLU B CD  
493  O OE1 . GLU A 82  ? 0.7725 0.6597 0.6617 -0.0356 -0.0039 -0.0500 101 GLU B OE1 
494  O OE2 . GLU A 82  ? 0.7090 0.5814 0.6083 -0.0398 0.0014  -0.0518 101 GLU B OE2 
495  N N   . ARG A 83  ? 0.2752 0.2064 0.2110 -0.0308 -0.0019 -0.0267 102 ARG B N   
496  C CA  . ARG A 83  ? 0.2331 0.1720 0.1670 -0.0278 -0.0038 -0.0242 102 ARG B CA  
497  C C   . ARG A 83  ? 0.2454 0.1903 0.1873 -0.0231 0.0004  -0.0191 102 ARG B C   
498  O O   . ARG A 83  ? 0.2624 0.2085 0.2011 -0.0192 0.0024  -0.0169 102 ARG B O   
499  C CB  . ARG A 83  ? 0.2402 0.1889 0.1790 -0.0313 -0.0109 -0.0241 102 ARG B CB  
500  C CG  . ARG A 83  ? 0.2506 0.2067 0.1879 -0.0276 -0.0126 -0.0206 102 ARG B CG  
501  C CD  . ARG A 83  ? 0.3360 0.3000 0.2741 -0.0305 -0.0205 -0.0214 102 ARG B CD  
502  N NE  . ARG A 83  ? 0.4444 0.4147 0.3812 -0.0261 -0.0216 -0.0169 102 ARG B NE  
503  C CZ  . ARG A 83  ? 0.6357 0.6028 0.5589 -0.0232 -0.0223 -0.0166 102 ARG B CZ  
504  N NH1 . ARG A 83  ? 0.5767 0.5345 0.4856 -0.0240 -0.0223 -0.0215 102 ARG B NH1 
505  N NH2 . ARG A 83  ? 0.7076 0.6801 0.6310 -0.0190 -0.0227 -0.0112 102 ARG B NH2 
506  N N   . CYS A 84  ? 0.2346 0.1832 0.1868 -0.0236 0.0016  -0.0173 103 CYS B N   
507  C CA  . CYS A 84  ? 0.2244 0.1790 0.1843 -0.0196 0.0044  -0.0138 103 CYS B CA  
508  C C   . CYS A 84  ? 0.2189 0.1673 0.1745 -0.0156 0.0096  -0.0134 103 CYS B C   
509  O O   . CYS A 84  ? 0.2407 0.1927 0.1993 -0.0122 0.0116  -0.0112 103 CYS B O   
510  C CB  . CYS A 84  ? 0.2158 0.1750 0.1848 -0.0204 0.0048  -0.0124 103 CYS B CB  
511  S SG  . CYS A 84  ? 0.2365 0.2047 0.2148 -0.0158 0.0062  -0.0095 103 CYS B SG  
512  N N   . LYS A 85  ? 0.2361 0.1749 0.1859 -0.0159 0.0121  -0.0155 104 LYS B N   
513  C CA  . LYS A 85  ? 0.2025 0.1354 0.1488 -0.0114 0.0176  -0.0151 104 LYS B CA  
514  C C   . LYS A 85  ? 0.2047 0.1361 0.1436 -0.0090 0.0194  -0.0153 104 LYS B C   
515  O O   . LYS A 85  ? 0.2230 0.1571 0.1653 -0.0050 0.0232  -0.0127 104 LYS B O   
516  C CB  . LYS A 85  ? 0.2313 0.1523 0.1716 -0.0119 0.0202  -0.0177 104 LYS B CB  
517  C CG  . LYS A 85  ? 0.2631 0.1772 0.1986 -0.0066 0.0263  -0.0177 104 LYS B CG  
518  C CD  . LYS A 85  ? 0.3464 0.2458 0.2717 -0.0074 0.0284  -0.0220 104 LYS B CD  
519  C CE  . LYS A 85  ? 0.3502 0.2456 0.2656 -0.0120 0.0240  -0.0270 104 LYS B CE  
520  N NZ  . LYS A 85  ? 0.3765 0.2565 0.2808 -0.0128 0.0258  -0.0328 104 LYS B NZ  
521  N N   . GLU A 86  ? 0.2826 0.2098 0.2113 -0.0114 0.0166  -0.0182 105 GLU B N   
522  C CA  A GLU A 86  ? 0.2708 0.1962 0.1898 -0.0086 0.0185  -0.0179 105 GLU B CA  
523  C CA  B GLU A 86  ? 0.2757 0.2011 0.1947 -0.0086 0.0185  -0.0179 105 GLU B CA  
524  C C   . GLU A 86  ? 0.2621 0.1972 0.1888 -0.0066 0.0187  -0.0129 105 GLU B C   
525  O O   . GLU A 86  ? 0.2187 0.1538 0.1443 -0.0028 0.0238  -0.0101 105 GLU B O   
526  C CB  A GLU A 86  ? 0.3004 0.2217 0.2069 -0.0117 0.0135  -0.0221 105 GLU B CB  
527  C CB  B GLU A 86  ? 0.3141 0.2351 0.2203 -0.0116 0.0138  -0.0222 105 GLU B CB  
528  C CG  A GLU A 86  ? 0.3557 0.2643 0.2515 -0.0127 0.0147  -0.0281 105 GLU B CG  
529  C CG  B GLU A 86  ? 0.3743 0.2829 0.2710 -0.0133 0.0143  -0.0283 105 GLU B CG  
530  C CD  A GLU A 86  ? 0.4913 0.3970 0.3772 -0.0171 0.0079  -0.0335 105 GLU B CD  
531  C CD  B GLU A 86  ? 0.4166 0.3165 0.3076 -0.0080 0.0223  -0.0287 105 GLU B CD  
532  O OE1 A GLU A 86  ? 0.5097 0.4247 0.4001 -0.0200 0.0016  -0.0322 105 GLU B OE1 
533  O OE1 B GLU A 86  ? 0.4989 0.4006 0.3860 -0.0033 0.0267  -0.0258 105 GLU B OE1 
534  O OE2 A GLU A 86  ? 0.6257 0.5198 0.4996 -0.0176 0.0086  -0.0396 105 GLU B OE2 
535  O OE2 B GLU A 86  ? 0.5204 0.4115 0.4115 -0.0084 0.0246  -0.0314 105 GLU B OE2 
536  N N   . ARG A 87  ? 0.2356 0.1788 0.1709 -0.0092 0.0138  -0.0115 106 ARG B N   
537  C CA  . ARG A 87  ? 0.2507 0.2015 0.1933 -0.0076 0.0138  -0.0071 106 ARG B CA  
538  C C   . ARG A 87  ? 0.2440 0.1984 0.1985 -0.0052 0.0178  -0.0049 106 ARG B C   
539  O O   . ARG A 87  ? 0.2115 0.1685 0.1705 -0.0030 0.0208  -0.0016 106 ARG B O   
540  C CB  . ARG A 87  ? 0.2403 0.1981 0.1887 -0.0103 0.0077  -0.0066 106 ARG B CB  
541  C CG  . ARG A 87  ? 0.2340 0.1908 0.1725 -0.0126 0.0025  -0.0085 106 ARG B CG  
542  C CD  . ARG A 87  ? 0.3102 0.2639 0.2366 -0.0095 0.0042  -0.0066 106 ARG B CD  
543  N NE  . ARG A 87  ? 0.4563 0.4006 0.3681 -0.0090 0.0063  -0.0105 106 ARG B NE  
544  C CZ  . ARG A 87  ? 0.4651 0.4043 0.3675 -0.0049 0.0121  -0.0090 106 ARG B CZ  
545  N NH1 . ARG A 87  ? 0.3898 0.3326 0.2975 -0.0015 0.0166  -0.0031 106 ARG B NH1 
546  N NH2 . ARG A 87  ? 0.4727 0.4028 0.3610 -0.0042 0.0139  -0.0136 106 ARG B NH2 
547  N N   . VAL A 88  ? 0.2177 0.1726 0.1778 -0.0058 0.0176  -0.0065 107 VAL B N   
548  C CA  . VAL A 88  ? 0.1674 0.1273 0.1389 -0.0034 0.0199  -0.0049 107 VAL B CA  
549  C C   . VAL A 88  ? 0.1987 0.1550 0.1684 0.0001  0.0260  -0.0038 107 VAL B C   
550  O O   . VAL A 88  ? 0.1997 0.1611 0.1792 0.0021  0.0284  -0.0016 107 VAL B O   
551  C CB  . VAL A 88  ? 0.1896 0.1521 0.1665 -0.0040 0.0179  -0.0063 107 VAL B CB  
552  C CG1 . VAL A 88  ? 0.2290 0.1844 0.2002 -0.0028 0.0207  -0.0074 107 VAL B CG1 
553  C CG2 . VAL A 88  ? 0.1873 0.1579 0.1764 -0.0021 0.0175  -0.0054 107 VAL B CG2 
554  N N   . ASN A 89  ? 0.2143 0.1620 0.1724 0.0009  0.0285  -0.0056 108 ASN B N   
555  C CA  . ASN A 89  ? 0.2038 0.1481 0.1599 0.0051  0.0351  -0.0044 108 ASN B CA  
556  C C   . ASN A 89  ? 0.2389 0.1854 0.1943 0.0065  0.0385  -0.0011 108 ASN B C   
557  O O   . ASN A 89  ? 0.2482 0.1976 0.2107 0.0096  0.0438  0.0018  108 ASN B O   
558  C CB  . ASN A 89  ? 0.2012 0.1342 0.1440 0.0061  0.0376  -0.0078 108 ASN B CB  
559  C CG  . ASN A 89  ? 0.2902 0.2202 0.2360 0.0061  0.0369  -0.0093 108 ASN B CG  
560  O OD1 . ASN A 89  ? 0.2250 0.1624 0.1821 0.0063  0.0351  -0.0075 108 ASN B OD1 
561  N ND2 . ASN A 89  ? 0.2049 0.1235 0.1400 0.0061  0.0385  -0.0128 108 ASN B ND2 
562  N N   . ALA A 90  ? 0.2287 0.1743 0.1767 0.0045  0.0353  -0.0009 109 ALA B N   
563  C CA  . ALA A 90  ? 0.2609 0.2085 0.2080 0.0061  0.0385  0.0035  109 ALA B CA  
564  C C   . ALA A 90  ? 0.2400 0.1961 0.2052 0.0055  0.0385  0.0071  109 ALA B C   
565  O O   . ALA A 90  ? 0.2080 0.1665 0.1800 0.0076  0.0441  0.0112  109 ALA B O   
566  C CB  . ALA A 90  ? 0.3062 0.2517 0.2413 0.0047  0.0342  0.0033  109 ALA B CB  
567  N N   . LEU A 91  ? 0.2087 0.1693 0.1820 0.0027  0.0325  0.0053  110 LEU B N   
568  C CA  . LEU A 91  ? 0.2281 0.1958 0.2179 0.0019  0.0317  0.0071  110 LEU B CA  
569  C C   . LEU A 91  ? 0.1859 0.1575 0.1874 0.0036  0.0355  0.0075  110 LEU B C   
570  O O   . LEU A 91  ? 0.2123 0.1878 0.2256 0.0038  0.0383  0.0104  110 LEU B O   
571  C CB  . LEU A 91  ? 0.1817 0.1533 0.1767 -0.0006 0.0250  0.0042  110 LEU B CB  
572  C CG  . LEU A 91  ? 0.1656 0.1434 0.1764 -0.0013 0.0233  0.0043  110 LEU B CG  
573  C CD1 . LEU A 91  ? 0.1179 0.0955 0.1337 -0.0012 0.0259  0.0088  110 LEU B CD1 
574  C CD2 . LEU A 91  ? 0.1436 0.1244 0.1558 -0.0029 0.0173  0.0011  110 LEU B CD2 
575  N N   . ALA A 92  ? 0.2224 0.1929 0.2216 0.0049  0.0356  0.0049  111 ALA B N   
576  C CA  . ALA A 92  ? 0.1809 0.1561 0.1912 0.0073  0.0385  0.0053  111 ALA B CA  
577  C C   . ALA A 92  ? 0.2553 0.2310 0.2694 0.0095  0.0461  0.0094  111 ALA B C   
578  O O   . ALA A 92  ? 0.2004 0.1836 0.2306 0.0099  0.0479  0.0111  111 ALA B O   
579  C CB  . ALA A 92  ? 0.1624 0.1341 0.1662 0.0094  0.0387  0.0029  111 ALA B CB  
580  N N   . ILE A 93  ? 0.2025 0.1709 0.2020 0.0111  0.0505  0.0109  112 ILE B N   
581  C CA  . ILE A 93  ? 0.2321 0.2003 0.2324 0.0139  0.0589  0.0155  112 ILE B CA  
582  C C   . ILE A 93  ? 0.2608 0.2337 0.2727 0.0119  0.0600  0.0201  112 ILE B C   
583  O O   . ILE A 93  ? 0.2201 0.1984 0.2463 0.0127  0.0655  0.0239  112 ILE B O   
584  C CB  . ILE A 93  ? 0.2447 0.2032 0.2235 0.0164  0.0628  0.0155  112 ILE B CB  
585  C CG1 . ILE A 93  ? 0.2347 0.1870 0.2037 0.0188  0.0635  0.0110  112 ILE B CG1 
586  C CG2 . ILE A 93  ? 0.3253 0.2840 0.3037 0.0197  0.0721  0.0212  112 ILE B CG2 
587  C CD1 . ILE A 93  ? 0.2711 0.2127 0.2177 0.0208  0.0659  0.0089  112 ILE B CD1 
588  N N   . ALA A 94  ? 0.2469 0.2177 0.2538 0.0093  0.0550  0.0199  113 ALA B N   
589  C CA  . ALA A 94  ? 0.2317 0.2049 0.2485 0.0075  0.0557  0.0244  113 ALA B CA  
590  C C   . ALA A 94  ? 0.1989 0.1798 0.2385 0.0050  0.0539  0.0235  113 ALA B C   
591  O O   . ALA A 94  ? 0.2158 0.1994 0.2691 0.0042  0.0583  0.0279  113 ALA B O   
592  C CB  . ALA A 94  ? 0.2476 0.2176 0.2555 0.0058  0.0496  0.0238  113 ALA B CB  
593  N N   . VAL A 95  ? 0.1880 0.1723 0.2317 0.0038  0.0475  0.0178  114 VAL B N   
594  C CA  . VAL A 95  ? 0.2466 0.2386 0.3100 0.0016  0.0440  0.0154  114 VAL B CA  
595  C C   . VAL A 95  ? 0.2252 0.2236 0.3037 0.0025  0.0492  0.0175  114 VAL B C   
596  O O   . VAL A 95  ? 0.2159 0.2195 0.3130 0.0000  0.0497  0.0185  114 VAL B O   
597  C CB  . VAL A 95  ? 0.2022 0.1967 0.2635 0.0011  0.0362  0.0091  114 VAL B CB  
598  C CG1 . VAL A 95  ? 0.2119 0.2151 0.2916 -0.0002 0.0324  0.0057  114 VAL B CG1 
599  C CG2 . VAL A 95  ? 0.1579 0.1482 0.2098 -0.0004 0.0311  0.0073  114 VAL B CG2 
600  N N   . MET A 96  ? 0.1990 0.1972 0.2708 0.0061  0.0531  0.0180  115 MET B N   
601  C CA  . MET A 96  ? 0.2418 0.2474 0.3285 0.0079  0.0584  0.0203  115 MET B CA  
602  C C   . MET A 96  ? 0.2766 0.2821 0.3702 0.0079  0.0675  0.0271  115 MET B C   
603  O O   . MET A 96  ? 0.2582 0.2720 0.3722 0.0070  0.0708  0.0294  115 MET B O   
604  C CB  . MET A 96  ? 0.1671 0.1710 0.2437 0.0127  0.0612  0.0195  115 MET B CB  
605  C CG  . MET A 96  ? 0.1945 0.2000 0.2682 0.0134  0.0535  0.0142  115 MET B CG  
606  S SD  . MET A 96  ? 0.3737 0.3754 0.4367 0.0195  0.0578  0.0141  115 MET B SD  
607  C CE  . MET A 96  ? 0.6795 0.6936 0.7651 0.0225  0.0635  0.0177  115 MET B CE  
608  N N   . ASN A 97  ? 0.2687 0.2654 0.3454 0.0090  0.0715  0.0306  116 ASN B N   
609  C CA  . ASN A 97  ? 0.2682 0.2636 0.3482 0.0096  0.0807  0.0382  116 ASN B CA  
610  C C   . ASN A 97  ? 0.2308 0.2287 0.3287 0.0048  0.0788  0.0403  116 ASN B C   
611  O O   . ASN A 97  ? 0.1906 0.1925 0.3053 0.0036  0.0855  0.0457  116 ASN B O   
612  C CB  . ASN A 97  ? 0.3485 0.3338 0.4030 0.0126  0.0841  0.0410  116 ASN B CB  
613  C CG  . ASN A 97  ? 0.5271 0.5088 0.5657 0.0179  0.0895  0.0402  116 ASN B CG  
614  O OD1 . ASN A 97  ? 0.5607 0.5477 0.6090 0.0200  0.0929  0.0396  116 ASN B OD1 
615  N ND2 . ASN A 97  ? 0.4703 0.4429 0.4845 0.0204  0.0901  0.0401  116 ASN B ND2 
616  N N   . MET A 98  ? 0.2163 0.2117 0.3117 0.0019  0.0700  0.0359  117 MET B N   
617  C CA  . MET A 98  ? 0.2415 0.2371 0.3525 -0.0022 0.0681  0.0371  117 MET B CA  
618  C C   . MET A 98  ? 0.2792 0.2841 0.4166 -0.0059 0.0658  0.0339  117 MET B C   
619  O O   . MET A 98  ? 0.2342 0.2405 0.3902 -0.0091 0.0693  0.0374  117 MET B O   
620  C CB  . MET A 98  ? 0.2023 0.1929 0.3036 -0.0035 0.0598  0.0330  117 MET B CB  
621  C CG  . MET A 98  ? 0.2262 0.2156 0.3432 -0.0072 0.0576  0.0333  117 MET B CG  
622  S SD  . MET A 98  ? 0.2830 0.2659 0.4032 -0.0069 0.0674  0.0447  117 MET B SD  
623  C CE  . MET A 98  ? 0.2818 0.2571 0.3717 -0.0022 0.0671  0.0480  117 MET B CE  
624  N N   . TRP A 99  ? 0.2433 0.2545 0.3826 -0.0054 0.0597  0.0272  118 TRP B N   
625  C CA  . TRP A 99  ? 0.2155 0.2367 0.3778 -0.0086 0.0550  0.0226  118 TRP B CA  
626  C C   . TRP A 99  ? 0.2250 0.2549 0.3910 -0.0053 0.0563  0.0219  118 TRP B C   
627  O O   . TRP A 99  ? 0.1813 0.2124 0.3367 -0.0027 0.0508  0.0172  118 TRP B O   
628  C CB  . TRP A 99  ? 0.2247 0.2459 0.3850 -0.0104 0.0439  0.0141  118 TRP B CB  
629  C CG  . TRP A 99  ? 0.2292 0.2422 0.3867 -0.0130 0.0415  0.0136  118 TRP B CG  
630  C CD1 . TRP A 99  ? 0.2605 0.2717 0.4350 -0.0170 0.0425  0.0146  118 TRP B CD1 
631  C CD2 . TRP A 99  ? 0.2138 0.2197 0.3519 -0.0114 0.0376  0.0117  118 TRP B CD2 
632  N NE1 . TRP A 99  ? 0.2516 0.2545 0.4176 -0.0173 0.0398  0.0138  118 TRP B NE1 
633  C CE2 . TRP A 99  ? 0.2566 0.2570 0.4006 -0.0139 0.0366  0.0121  118 TRP B CE2 
634  C CE3 . TRP A 99  ? 0.1809 0.1846 0.2986 -0.0082 0.0351  0.0100  118 TRP B CE3 
635  C CZ2 . TRP A 99  ? 0.1984 0.1926 0.3289 -0.0127 0.0331  0.0110  118 TRP B CZ2 
636  C CZ3 . TRP A 99  ? 0.1841 0.1819 0.2890 -0.0079 0.0315  0.0088  118 TRP B CZ3 
637  C CH2 . TRP A 99  ? 0.2266 0.2204 0.3381 -0.0099 0.0305  0.0094  118 TRP B CH2 
638  N N   . PRO A 100 ? 0.2565 0.2925 0.4379 -0.0051 0.0643  0.0272  119 PRO B N   
639  C CA  . PRO A 100 ? 0.2672 0.3120 0.4530 -0.0011 0.0661  0.0271  119 PRO B CA  
640  C C   . PRO A 100 ? 0.2569 0.3110 0.4512 -0.0016 0.0552  0.0194  119 PRO B C   
641  O O   . PRO A 100 ? 0.1916 0.2512 0.4026 -0.0063 0.0486  0.0151  119 PRO B O   
642  C CB  . PRO A 100 ? 0.3036 0.3561 0.5122 -0.0024 0.0752  0.0335  119 PRO B CB  
643  C CG  . PRO A 100 ? 0.3436 0.3861 0.5467 -0.0043 0.0822  0.0398  119 PRO B CG  
644  C CD  . PRO A 100 ? 0.3419 0.3769 0.5368 -0.0077 0.0730  0.0345  119 PRO B CD  
645  N N   . GLY A 101 ? 0.2615 0.3162 0.4430 0.0035  0.0532  0.0174  120 GLY B N   
646  C CA  . GLY A 101 ? 0.2911 0.3548 0.4783 0.0045  0.0435  0.0114  120 GLY B CA  
647  C C   . GLY A 101 ? 0.2021 0.2599 0.3739 0.0036  0.0345  0.0054  120 GLY B C   
648  O O   . GLY A 101 ? 0.2083 0.2717 0.3789 0.0056  0.0269  0.0009  120 GLY B O   
649  N N   . VAL A 102 ? 0.1146 0.1614 0.2743 0.0011  0.0355  0.0058  121 VAL B N   
650  C CA  . VAL A 102 ? 0.1416 0.1830 0.2878 0.0002  0.0282  0.0008  121 VAL B CA  
651  C C   . VAL A 102 ? 0.1839 0.2152 0.3059 0.0035  0.0308  0.0026  121 VAL B C   
652  O O   . VAL A 102 ? 0.2061 0.2309 0.3201 0.0046  0.0383  0.0074  121 VAL B O   
653  C CB  . VAL A 102 ? 0.1258 0.1624 0.2768 -0.0047 0.0268  -0.0003 121 VAL B CB  
654  C CG1 . VAL A 102 ? 0.1351 0.1658 0.2710 -0.0048 0.0207  -0.0048 121 VAL B CG1 
655  C CG2 . VAL A 102 ? 0.1737 0.2193 0.3497 -0.0088 0.0232  -0.0037 121 VAL B CG2 
656  N N   . ARG A 103 ? 0.1624 0.1925 0.2730 0.0050  0.0248  -0.0013 122 ARG B N   
657  C CA  . ARG A 103 ? 0.1857 0.2064 0.2753 0.0071  0.0264  -0.0004 122 ARG B CA  
658  C C   . ARG A 103 ? 0.2087 0.2251 0.2889 0.0050  0.0210  -0.0037 122 ARG B C   
659  O O   . ARG A 103 ? 0.1954 0.2166 0.2835 0.0032  0.0154  -0.0076 122 ARG B O   
660  C CB  . ARG A 103 ? 0.1471 0.1697 0.2315 0.0118  0.0260  -0.0005 122 ARG B CB  
661  C CG  . ARG A 103 ? 0.2883 0.3164 0.3834 0.0149  0.0313  0.0028  122 ARG B CG  
662  C CD  . ARG A 103 ? 0.4510 0.4783 0.5394 0.0206  0.0330  0.0040  122 ARG B CD  
663  N NE  . ARG A 103 ? 0.6187 0.6498 0.7168 0.0237  0.0402  0.0078  122 ARG B NE  
664  C CZ  . ARG A 103 ? 0.7554 0.7849 0.8497 0.0294  0.0447  0.0101  122 ARG B CZ  
665  N NH1 . ARG A 103 ? 0.7780 0.8013 0.8593 0.0325  0.0426  0.0091  122 ARG B NH1 
666  N NH2 . ARG A 103 ? 0.7390 0.7731 0.8437 0.0323  0.0519  0.0136  122 ARG B NH2 
667  N N   . LEU A 104 ? 0.1969 0.2046 0.2607 0.0053  0.0228  -0.0024 123 LEU B N   
668  C CA  . LEU A 104 ? 0.1963 0.2008 0.2511 0.0038  0.0184  -0.0049 123 LEU B CA  
669  C C   . LEU A 104 ? 0.2252 0.2337 0.2779 0.0059  0.0138  -0.0078 123 LEU B C   
670  O O   . LEU A 104 ? 0.1866 0.1960 0.2374 0.0090  0.0153  -0.0067 123 LEU B O   
671  C CB  . LEU A 104 ? 0.1798 0.1753 0.2190 0.0035  0.0212  -0.0029 123 LEU B CB  
672  C CG  . LEU A 104 ? 0.2203 0.2132 0.2512 0.0018  0.0171  -0.0048 123 LEU B CG  
673  C CD1 . LEU A 104 ? 0.1246 0.1191 0.1620 -0.0005 0.0150  -0.0052 123 LEU B CD1 
674  C CD2 . LEU A 104 ? 0.1668 0.1518 0.1834 0.0013  0.0191  -0.0036 123 LEU B CD2 
675  N N   . ARG A 105 ? 0.1698 0.1806 0.2224 0.0048  0.0089  -0.0112 124 ARG B N   
676  C CA  . ARG A 105 ? 0.1728 0.1873 0.2212 0.0072  0.0049  -0.0135 124 ARG B CA  
677  C C   . ARG A 105 ? 0.2015 0.2119 0.2397 0.0061  0.0038  -0.0141 124 ARG B C   
678  O O   . ARG A 105 ? 0.2504 0.2596 0.2903 0.0037  0.0029  -0.0152 124 ARG B O   
679  C CB  . ARG A 105 ? 0.1978 0.2215 0.2574 0.0078  -0.0004 -0.0178 124 ARG B CB  
680  C CG  . ARG A 105 ? 0.2014 0.2295 0.2545 0.0110  -0.0050 -0.0205 124 ARG B CG  
681  C CD  . ARG A 105 ? 0.2252 0.2632 0.2889 0.0123  -0.0108 -0.0252 124 ARG B CD  
682  N NE  . ARG A 105 ? 0.2021 0.2445 0.2585 0.0154  -0.0157 -0.0288 124 ARG B NE  
683  C CZ  . ARG A 105 ? 0.2489 0.2914 0.3039 0.0144  -0.0188 -0.0337 124 ARG B CZ  
684  N NH1 . ARG A 105 ? 0.1872 0.2253 0.2484 0.0103  -0.0176 -0.0354 124 ARG B NH1 
685  N NH2 . ARG A 105 ? 0.2159 0.2627 0.2626 0.0181  -0.0227 -0.0367 124 ARG B NH2 
686  N N   . VAL A 106 ? 0.1858 0.1943 0.2147 0.0080  0.0042  -0.0128 125 VAL B N   
687  C CA  . VAL A 106 ? 0.2196 0.2254 0.2403 0.0069  0.0038  -0.0128 125 VAL B CA  
688  C C   . VAL A 106 ? 0.1792 0.1908 0.1982 0.0098  0.0007  -0.0146 125 VAL B C   
689  O O   . VAL A 106 ? 0.2166 0.2300 0.2330 0.0132  0.0007  -0.0132 125 VAL B O   
690  C CB  . VAL A 106 ? 0.2204 0.2185 0.2319 0.0063  0.0074  -0.0095 125 VAL B CB  
691  C CG1 . VAL A 106 ? 0.2169 0.2139 0.2223 0.0051  0.0070  -0.0091 125 VAL B CG1 
692  C CG2 . VAL A 106 ? 0.1930 0.1849 0.2031 0.0037  0.0101  -0.0084 125 VAL B CG2 
693  N N   . THR A 107 ? 0.1599 0.1743 0.1796 0.0092  -0.0016 -0.0175 126 THR B N   
694  C CA  . THR A 107 ? 0.1607 0.1805 0.1765 0.0125  -0.0040 -0.0195 126 THR B CA  
695  C C   . THR A 107 ? 0.2261 0.2435 0.2330 0.0127  -0.0012 -0.0162 126 THR B C   
696  O O   . THR A 107 ? 0.1980 0.2184 0.1990 0.0164  -0.0012 -0.0152 126 THR B O   
697  C CB  . THR A 107 ? 0.1721 0.1959 0.1929 0.0124  -0.0074 -0.0250 126 THR B CB  
698  O OG1 . THR A 107 ? 0.1977 0.2177 0.2202 0.0093  -0.0057 -0.0245 126 THR B OG1 
699  C CG2 . THR A 107 ? 0.1854 0.2124 0.2169 0.0119  -0.0107 -0.0289 126 THR B CG2 
700  N N   . GLU A 108 ? 0.2244 0.2372 0.2309 0.0089  0.0011  -0.0143 127 GLU B N   
701  C CA  . GLU A 108 ? 0.2512 0.2619 0.2523 0.0078  0.0039  -0.0111 127 GLU B CA  
702  C C   . GLU A 108 ? 0.2544 0.2582 0.2551 0.0034  0.0058  -0.0089 127 GLU B C   
703  O O   . GLU A 108 ? 0.1977 0.2005 0.2020 0.0010  0.0047  -0.0101 127 GLU B O   
704  C CB  . GLU A 108 ? 0.2476 0.2627 0.2505 0.0075  0.0034  -0.0128 127 GLU B CB  
705  C CG  . GLU A 108 ? 0.2681 0.2894 0.2679 0.0121  0.0027  -0.0148 127 GLU B CG  
706  C CD  . GLU A 108 ? 0.1853 0.2067 0.1779 0.0142  0.0061  -0.0103 127 GLU B CD  
707  O OE1 . GLU A 108 ? 0.1995 0.2220 0.1911 0.0133  0.0092  -0.0077 127 GLU B OE1 
708  O OE2 . GLU A 108 ? 0.2139 0.2343 0.2025 0.0169  0.0059  -0.0088 127 GLU B OE2 
709  N N   . GLY A 109 ? 0.2591 0.2577 0.2550 0.0026  0.0086  -0.0056 128 GLY B N   
710  C CA  . GLY A 109 ? 0.2336 0.2252 0.2279 -0.0019 0.0100  -0.0045 128 GLY B CA  
711  C C   . GLY A 109 ? 0.1813 0.1735 0.1754 -0.0045 0.0115  -0.0025 128 GLY B C   
712  O O   . GLY A 109 ? 0.2227 0.2215 0.2202 -0.0047 0.0106  -0.0030 128 GLY B O   
713  N N   . TRP A 110 ? 0.1688 0.1540 0.1597 -0.0064 0.0143  0.0000  129 TRP B N   
714  C CA  . TRP A 110 ? 0.2314 0.2173 0.2239 -0.0090 0.0166  0.0028  129 TRP B CA  
715  C C   . TRP A 110 ? 0.2409 0.2333 0.2323 -0.0040 0.0185  0.0053  129 TRP B C   
716  O O   . TRP A 110 ? 0.2357 0.2277 0.2229 0.0009  0.0189  0.0061  129 TRP B O   
717  C CB  . TRP A 110 ? 0.2160 0.1914 0.2060 -0.0120 0.0195  0.0048  129 TRP B CB  
718  C CG  . TRP A 110 ? 0.2045 0.1805 0.1978 -0.0147 0.0229  0.0087  129 TRP B CG  
719  C CD1 . TRP A 110 ? 0.2486 0.2279 0.2485 -0.0203 0.0223  0.0086  129 TRP B CD1 
720  C CD2 . TRP A 110 ? 0.2507 0.2246 0.2416 -0.0115 0.0278  0.0141  129 TRP B CD2 
721  N NE1 . TRP A 110 ? 0.2807 0.2602 0.2838 -0.0214 0.0270  0.0135  129 TRP B NE1 
722  C CE2 . TRP A 110 ? 0.2381 0.2136 0.2348 -0.0158 0.0308  0.0173  129 TRP B CE2 
723  C CE3 . TRP A 110 ? 0.1954 0.1668 0.1802 -0.0051 0.0299  0.0170  129 TRP B CE3 
724  C CZ2 . TRP A 110 ? 0.2751 0.2489 0.2711 -0.0140 0.0367  0.0238  129 TRP B CZ2 
725  C CZ3 . TRP A 110 ? 0.2643 0.2341 0.2472 -0.0027 0.0350  0.0234  129 TRP B CZ3 
726  C CH2 . TRP A 110 ? 0.3127 0.2831 0.3008 -0.0072 0.0388  0.0270  129 TRP B CH2 
727  N N   . ASP A 111 ? 0.2116 0.2107 0.2066 -0.0049 0.0195  0.0064  130 ASP B N   
728  C CA  . ASP A 111 ? 0.2056 0.2115 0.1979 0.0005  0.0216  0.0083  130 ASP B CA  
729  C C   . ASP A 111 ? 0.2247 0.2310 0.2173 -0.0003 0.0272  0.0140  130 ASP B C   
730  O O   . ASP A 111 ? 0.2447 0.2512 0.2441 -0.0058 0.0286  0.0154  130 ASP B O   
731  C CB  . ASP A 111 ? 0.1775 0.1923 0.1729 0.0025  0.0190  0.0044  130 ASP B CB  
732  C CG  . ASP A 111 ? 0.2517 0.2731 0.2423 0.0086  0.0212  0.0053  130 ASP B CG  
733  O OD1 . ASP A 111 ? 0.2376 0.2584 0.2215 0.0133  0.0204  0.0052  130 ASP B OD1 
734  O OD2 . ASP A 111 ? 0.2230 0.2505 0.2162 0.0091  0.0238  0.0063  130 ASP B OD2 
735  N N   . GLU A 112 ? 0.2272 0.2346 0.2130 0.0054  0.0302  0.0177  131 GLU B N   
736  C CA  . GLU A 112 ? 0.2136 0.2230 0.1989 0.0063  0.0366  0.0241  131 GLU B CA  
737  C C   . GLU A 112 ? 0.2765 0.2947 0.2547 0.0140  0.0379  0.0245  131 GLU B C   
738  O O   . GLU A 112 ? 0.2578 0.2785 0.2333 0.0164  0.0439  0.0304  131 GLU B O   
739  C CB  . GLU A 112 ? 0.2386 0.2380 0.2206 0.0060  0.0409  0.0303  131 GLU B CB  
740  C CG  . GLU A 112 ? 0.2519 0.2486 0.2246 0.0130  0.0394  0.0309  131 GLU B CG  
741  C CD  . GLU A 112 ? 0.3525 0.3380 0.3226 0.0132  0.0439  0.0374  131 GLU B CD  
742  O OE1 . GLU A 112 ? 0.3322 0.3122 0.3068 0.0086  0.0493  0.0423  131 GLU B OE1 
743  O OE2 . GLU A 112 ? 0.3709 0.3529 0.3355 0.0180  0.0421  0.0376  131 GLU B OE2 
744  N N   . ASP A 113 ? 0.2670 0.2896 0.2419 0.0179  0.0325  0.0182  132 ASP B N   
745  C CA  . ASP A 113 ? 0.1985 0.2291 0.1655 0.0253  0.0326  0.0168  132 ASP B CA  
746  C C   . ASP A 113 ? 0.2790 0.3170 0.2502 0.0252  0.0351  0.0155  132 ASP B C   
747  O O   . ASP A 113 ? 0.3059 0.3497 0.2701 0.0310  0.0386  0.0168  132 ASP B O   
748  C CB  . ASP A 113 ? 0.2557 0.2881 0.2194 0.0289  0.0255  0.0097  132 ASP B CB  
749  C CG  . ASP A 113 ? 0.2342 0.2617 0.1936 0.0309  0.0235  0.0116  132 ASP B CG  
750  O OD1 . ASP A 113 ? 0.2580 0.2864 0.2082 0.0366  0.0257  0.0163  132 ASP B OD1 
751  O OD2 . ASP A 113 ? 0.2351 0.2579 0.2001 0.0272  0.0202  0.0091  132 ASP B OD2 
752  N N   . GLY A 114 ? 0.2527 0.2907 0.2348 0.0192  0.0333  0.0128  133 GLY B N   
753  C CA  . GLY A 114 ? 0.2487 0.2939 0.2379 0.0183  0.0363  0.0129  133 GLY B CA  
754  C C   . GLY A 114 ? 0.2560 0.3068 0.2454 0.0223  0.0332  0.0060  133 GLY B C   
755  O O   . GLY A 114 ? 0.2814 0.3391 0.2744 0.0242  0.0369  0.0064  133 GLY B O   
756  N N   . HIS A 115 ? 0.2327 0.2807 0.2197 0.0235  0.0270  -0.0003 134 HIS B N   
757  C CA  . HIS A 115 ? 0.2527 0.3043 0.2407 0.0270  0.0241  -0.0074 134 HIS B CA  
758  C C   . HIS A 115 ? 0.3068 0.3578 0.3066 0.0224  0.0214  -0.0096 134 HIS B C   
759  O O   . HIS A 115 ? 0.3180 0.3710 0.3207 0.0249  0.0198  -0.0147 134 HIS B O   
760  C CB  . HIS A 115 ? 0.3276 0.3775 0.3080 0.0311  0.0188  -0.0136 134 HIS B CB  
761  C CG  . HIS A 115 ? 0.3168 0.3608 0.2996 0.0273  0.0142  -0.0142 134 HIS B CG  
762  N ND1 . HIS A 115 ? 0.3426 0.3834 0.3338 0.0234  0.0102  -0.0177 134 HIS B ND1 
763  C CD2 . HIS A 115 ? 0.3813 0.4221 0.3591 0.0275  0.0135  -0.0111 134 HIS B CD2 
764  C CE1 . HIS A 115 ? 0.3507 0.3870 0.3420 0.0212  0.0076  -0.0170 134 HIS B CE1 
765  N NE2 . HIS A 115 ? 0.3021 0.3384 0.2858 0.0236  0.0094  -0.0133 134 HIS B NE2 
766  N N   . HIS A 116 ? 0.2365 0.2841 0.2425 0.0160  0.0209  -0.0058 135 HIS B N   
767  C CA  . HIS A 116 ? 0.1925 0.2400 0.2082 0.0121  0.0179  -0.0071 135 HIS B CA  
768  C C   . HIS A 116 ? 0.2600 0.3150 0.2842 0.0113  0.0213  -0.0041 135 HIS B C   
769  O O   . HIS A 116 ? 0.1868 0.2458 0.2111 0.0112  0.0265  0.0004  135 HIS B O   
770  C CB  . HIS A 116 ? 0.1894 0.2303 0.2065 0.0061  0.0151  -0.0054 135 HIS B CB  
771  C CG  . HIS A 116 ? 0.1830 0.2175 0.1937 0.0070  0.0125  -0.0076 135 HIS B CG  
772  N ND1 . HIS A 116 ? 0.2400 0.2723 0.2520 0.0080  0.0085  -0.0121 135 HIS B ND1 
773  C CD2 . HIS A 116 ? 0.1877 0.2180 0.1919 0.0072  0.0136  -0.0055 135 HIS B CD2 
774  C CE1 . HIS A 116 ? 0.2125 0.2408 0.2200 0.0086  0.0071  -0.0129 135 HIS B CE1 
775  N NE2 . HIS A 116 ? 0.2336 0.2606 0.2359 0.0085  0.0100  -0.0089 135 HIS B NE2 
776  N N   . ALA A 117 ? 0.2713 0.3287 0.3036 0.0110  0.0188  -0.0061 136 ALA B N   
777  C CA  . ALA A 117 ? 0.2531 0.3192 0.2955 0.0109  0.0214  -0.0034 136 ALA B CA  
778  C C   . ALA A 117 ? 0.3240 0.3927 0.3730 0.0043  0.0224  0.0020  136 ALA B C   
779  O O   . ALA A 117 ? 0.2877 0.3498 0.3340 -0.0007 0.0197  0.0028  136 ALA B O   
780  C CB  . ALA A 117 ? 0.3267 0.3940 0.3765 0.0120  0.0177  -0.0059 136 ALA B CB  
781  N N   . GLN A 118 ? 0.2743 0.3527 0.3328 0.0043  0.0263  0.0055  137 GLN B N   
782  C CA  . GLN A 118 ? 0.3062 0.3886 0.3745 -0.0026 0.0265  0.0100  137 GLN B CA  
783  C C   . GLN A 118 ? 0.1978 0.2768 0.2695 -0.0079 0.0190  0.0084  137 GLN B C   
784  O O   . GLN A 118 ? 0.2857 0.3650 0.3586 -0.0055 0.0148  0.0057  137 GLN B O   
785  C CB  . GLN A 118 ? 0.4584 0.5543 0.5401 -0.0013 0.0309  0.0133  137 GLN B CB  
786  C CG  . GLN A 118 ? 0.5926 0.6948 0.6883 -0.0092 0.0299  0.0174  137 GLN B CG  
787  C CD  . GLN A 118 ? 0.7179 0.8163 0.8123 -0.0142 0.0345  0.0215  137 GLN B CD  
788  O OE1 . GLN A 118 ? 0.7680 0.8628 0.8528 -0.0102 0.0405  0.0232  137 GLN B OE1 
789  N NE2 . GLN A 118 ? 0.7341 0.8329 0.8379 -0.0227 0.0315  0.0230  137 GLN B NE2 
790  N N   . ASP A 119 ? 0.2402 0.3148 0.3123 -0.0149 0.0174  0.0099  138 ASP B N   
791  C CA  . ASP A 119 ? 0.2285 0.2997 0.3016 -0.0198 0.0103  0.0081  138 ASP B CA  
792  C C   . ASP A 119 ? 0.2304 0.2909 0.2917 -0.0178 0.0068  0.0045  138 ASP B C   
793  O O   . ASP A 119 ? 0.2156 0.2735 0.2760 -0.0202 0.0013  0.0030  138 ASP B O   
794  C CB  . ASP A 119 ? 0.3456 0.4275 0.4304 -0.0195 0.0065  0.0085  138 ASP B CB  
795  C CG  . ASP A 119 ? 0.4437 0.5374 0.5434 -0.0233 0.0085  0.0121  138 ASP B CG  
796  O OD1 . ASP A 119 ? 0.5245 0.6159 0.6258 -0.0288 0.0110  0.0139  138 ASP B OD1 
797  O OD2 . ASP A 119 ? 0.4424 0.5477 0.5532 -0.0206 0.0079  0.0134  138 ASP B OD2 
798  N N   . SER A 120 ? 0.2007 0.2560 0.2531 -0.0132 0.0098  0.0032  139 SER B N   
799  C CA  . SER A 120 ? 0.2074 0.2535 0.2507 -0.0119 0.0069  0.0001  139 SER B CA  
800  C C   . SER A 120 ? 0.2435 0.2814 0.2821 -0.0172 0.0050  0.0002  139 SER B C   
801  O O   . SER A 120 ? 0.1987 0.2344 0.2371 -0.0206 0.0075  0.0022  139 SER B O   
802  C CB  . SER A 120 ? 0.1600 0.2031 0.1958 -0.0067 0.0099  -0.0014 139 SER B CB  
803  O OG  . SER A 120 ? 0.2025 0.2372 0.2310 -0.0065 0.0078  -0.0036 139 SER B OG  
804  N N   . LEU A 121 ? 0.1690 0.2015 0.2034 -0.0178 0.0010  -0.0018 140 LEU B N   
805  C CA  . LEU A 121 ? 0.2208 0.2447 0.2491 -0.0220 -0.0005 -0.0025 140 LEU B CA  
806  C C   . LEU A 121 ? 0.2181 0.2338 0.2385 -0.0203 0.0029  -0.0027 140 LEU B C   
807  O O   . LEU A 121 ? 0.1881 0.1957 0.2034 -0.0232 0.0032  -0.0030 140 LEU B O   
808  C CB  . LEU A 121 ? 0.2121 0.2335 0.2374 -0.0224 -0.0050 -0.0039 140 LEU B CB  
809  C CG  . LEU A 121 ? 0.2134 0.2426 0.2455 -0.0245 -0.0094 -0.0032 140 LEU B CG  
810  C CD1 . LEU A 121 ? 0.2274 0.2534 0.2540 -0.0242 -0.0137 -0.0038 140 LEU B CD1 
811  C CD2 . LEU A 121 ? 0.2565 0.2882 0.2933 -0.0306 -0.0105 -0.0030 140 LEU B CD2 
812  N N   . HIS A 122 ? 0.1773 0.1952 0.1967 -0.0153 0.0053  -0.0027 141 HIS B N   
813  C CA  . HIS A 122 ? 0.2290 0.2415 0.2418 -0.0130 0.0081  -0.0023 141 HIS B CA  
814  C C   . HIS A 122 ? 0.2552 0.2651 0.2674 -0.0155 0.0117  0.0009  141 HIS B C   
815  O O   . HIS A 122 ? 0.2328 0.2356 0.2394 -0.0147 0.0137  0.0020  141 HIS B O   
816  C CB  . HIS A 122 ? 0.1824 0.1993 0.1941 -0.0071 0.0091  -0.0034 141 HIS B CB  
817  C CG  . HIS A 122 ? 0.2055 0.2219 0.2175 -0.0048 0.0061  -0.0068 141 HIS B CG  
818  N ND1 . HIS A 122 ? 0.1931 0.2041 0.2016 -0.0041 0.0053  -0.0079 141 HIS B ND1 
819  C CD2 . HIS A 122 ? 0.1796 0.2002 0.1964 -0.0030 0.0042  -0.0090 141 HIS B CD2 
820  C CE1 . HIS A 122 ? 0.1556 0.1676 0.1674 -0.0026 0.0031  -0.0104 141 HIS B CE1 
821  N NE2 . HIS A 122 ? 0.2063 0.2233 0.2227 -0.0019 0.0024  -0.0113 141 HIS B NE2 
822  N N   . TYR A 123 ? 0.2281 0.2439 0.2472 -0.0182 0.0130  0.0030  142 TYR B N   
823  C CA  . TYR A 123 ? 0.2390 0.2529 0.2597 -0.0209 0.0174  0.0069  142 TYR B CA  
824  C C   . TYR A 123 ? 0.2319 0.2369 0.2527 -0.0273 0.0160  0.0062  142 TYR B C   
825  O O   . TYR A 123 ? 0.2687 0.2690 0.2910 -0.0303 0.0195  0.0090  142 TYR B O   
826  C CB  . TYR A 123 ? 0.1689 0.1933 0.1989 -0.0216 0.0201  0.0097  142 TYR B CB  
827  C CG  . TYR A 123 ? 0.2054 0.2366 0.2328 -0.0145 0.0229  0.0103  142 TYR B CG  
828  C CD1 . TYR A 123 ? 0.2618 0.2896 0.2800 -0.0094 0.0259  0.0117  142 TYR B CD1 
829  C CD2 . TYR A 123 ? 0.1597 0.2008 0.1934 -0.0123 0.0222  0.0091  142 TYR B CD2 
830  C CE1 . TYR A 123 ? 0.2624 0.2964 0.2764 -0.0026 0.0277  0.0112  142 TYR B CE1 
831  C CE2 . TYR A 123 ? 0.1700 0.2164 0.2001 -0.0053 0.0248  0.0085  142 TYR B CE2 
832  C CZ  . TYR A 123 ? 0.2577 0.3005 0.2774 -0.0007 0.0273  0.0091  142 TYR B CZ  
833  O OH  . TYR A 123 ? 0.3041 0.3519 0.3186 0.0063  0.0291  0.0075  142 TYR B OH  
834  N N   . GLU A 124 ? 0.1623 0.1644 0.1810 -0.0292 0.0110  0.0023  143 GLU B N   
835  C CA  . GLU A 124 ? 0.2329 0.2270 0.2506 -0.0352 0.0089  0.0003  143 GLU B CA  
836  C C   . GLU A 124 ? 0.2488 0.2320 0.2561 -0.0336 0.0080  -0.0026 143 GLU B C   
837  O O   . GLU A 124 ? 0.2476 0.2233 0.2518 -0.0377 0.0059  -0.0054 143 GLU B O   
838  C CB  . GLU A 124 ? 0.2576 0.2592 0.2821 -0.0394 0.0035  -0.0018 143 GLU B CB  
839  C CG  . GLU A 124 ? 0.3459 0.3600 0.3821 -0.0397 0.0048  0.0013  143 GLU B CG  
840  C CD  . GLU A 124 ? 0.3448 0.3671 0.3905 -0.0448 -0.0004 0.0001  143 GLU B CD  
841  O OE1 . GLU A 124 ? 0.3218 0.3390 0.3650 -0.0495 -0.0052 -0.0033 143 GLU B OE1 
842  O OE2 . GLU A 124 ? 0.3052 0.3396 0.3609 -0.0436 0.0001  0.0024  143 GLU B OE2 
843  N N   . GLY A 125 ? 0.2561 0.2389 0.2586 -0.0276 0.0096  -0.0021 144 GLY B N   
844  C CA  . GLY A 125 ? 0.2233 0.1976 0.2177 -0.0254 0.0095  -0.0041 144 GLY B CA  
845  C C   . GLY A 125 ? 0.2883 0.2642 0.2807 -0.0258 0.0054  -0.0070 144 GLY B C   
846  O O   . GLY A 125 ? 0.2313 0.1998 0.2168 -0.0251 0.0054  -0.0089 144 GLY B O   
847  N N   . ARG A 126 ? 0.1818 0.1671 0.1800 -0.0262 0.0024  -0.0068 145 ARG B N   
848  C CA  . ARG A 126 ? 0.2149 0.2020 0.2114 -0.0265 -0.0016 -0.0084 145 ARG B CA  
849  C C   . ARG A 126 ? 0.1984 0.1906 0.1972 -0.0218 -0.0018 -0.0076 145 ARG B C   
850  O O   . ARG A 126 ? 0.2161 0.2099 0.2143 -0.0212 -0.0044 -0.0077 145 ARG B O   
851  C CB  . ARG A 126 ? 0.1941 0.1873 0.1960 -0.0309 -0.0058 -0.0088 145 ARG B CB  
852  C CG  . ARG A 126 ? 0.1722 0.1592 0.1714 -0.0366 -0.0074 -0.0111 145 ARG B CG  
853  C CD  . ARG A 126 ? 0.2379 0.2338 0.2464 -0.0415 -0.0117 -0.0112 145 ARG B CD  
854  N NE  . ARG A 126 ? 0.2820 0.2866 0.2925 -0.0396 -0.0164 -0.0107 145 ARG B NE  
855  C CZ  . ARG A 126 ? 0.2895 0.3054 0.3102 -0.0415 -0.0201 -0.0097 145 ARG B CZ  
856  N NH1 . ARG A 126 ? 0.2111 0.2317 0.2419 -0.0461 -0.0195 -0.0091 145 ARG B NH1 
857  N NH2 . ARG A 126 ? 0.2976 0.3205 0.3193 -0.0386 -0.0241 -0.0086 145 ARG B NH2 
858  N N   . ALA A 127 ? 0.2243 0.2186 0.2256 -0.0183 0.0009  -0.0069 146 ALA B N   
859  C CA  . ALA A 127 ? 0.1919 0.1904 0.1966 -0.0144 0.0005  -0.0072 146 ALA B CA  
860  C C   . ALA A 127 ? 0.1446 0.1413 0.1481 -0.0108 0.0027  -0.0077 146 ALA B C   
861  O O   . ALA A 127 ? 0.2439 0.2396 0.2455 -0.0100 0.0048  -0.0071 146 ALA B O   
862  C CB  . ALA A 127 ? 0.2249 0.2321 0.2369 -0.0133 -0.0004 -0.0068 146 ALA B CB  
863  N N   . LEU A 128 ? 0.1712 0.1680 0.1767 -0.0087 0.0023  -0.0086 147 LEU B N   
864  C CA  . LEU A 128 ? 0.2039 0.2008 0.2105 -0.0056 0.0034  -0.0095 147 LEU B CA  
865  C C   . LEU A 128 ? 0.1689 0.1708 0.1826 -0.0035 0.0017  -0.0115 147 LEU B C   
866  O O   . LEU A 128 ? 0.2076 0.2096 0.2249 -0.0042 0.0007  -0.0113 147 LEU B O   
867  C CB  . LEU A 128 ? 0.1822 0.1737 0.1863 -0.0055 0.0050  -0.0089 147 LEU B CB  
868  C CG  . LEU A 128 ? 0.1790 0.1633 0.1753 -0.0074 0.0068  -0.0080 147 LEU B CG  
869  C CD1 . LEU A 128 ? 0.2678 0.2477 0.2619 -0.0062 0.0091  -0.0075 147 LEU B CD1 
870  C CD2 . LEU A 128 ? 0.1710 0.1536 0.1648 -0.0064 0.0085  -0.0074 147 LEU B CD2 
871  N N   . ASP A 129 ? 0.2065 0.2119 0.2220 -0.0008 0.0012  -0.0136 148 ASP B N   
872  C CA  . ASP A 129 ? 0.2208 0.2292 0.2434 0.0008  -0.0007 -0.0168 148 ASP B CA  
873  C C   . ASP A 129 ? 0.1962 0.2036 0.2219 0.0013  -0.0005 -0.0172 148 ASP B C   
874  O O   . ASP A 129 ? 0.1865 0.1944 0.2090 0.0028  0.0001  -0.0166 148 ASP B O   
875  C CB  . ASP A 129 ? 0.2167 0.2303 0.2391 0.0037  -0.0021 -0.0199 148 ASP B CB  
876  C CG  . ASP A 129 ? 0.2234 0.2392 0.2455 0.0036  -0.0016 -0.0195 148 ASP B CG  
877  O OD1 . ASP A 129 ? 0.1973 0.2112 0.2226 0.0016  -0.0016 -0.0180 148 ASP B OD1 
878  O OD2 . ASP A 129 ? 0.2213 0.2408 0.2401 0.0059  -0.0009 -0.0202 148 ASP B OD2 
879  N N   . ILE A 130 ? 0.1846 0.1909 0.2176 0.0003  -0.0006 -0.0176 149 ILE B N   
880  C CA  . ILE A 130 ? 0.1709 0.1767 0.2088 0.0001  0.0006  -0.0169 149 ILE B CA  
881  C C   . ILE A 130 ? 0.1540 0.1626 0.2038 -0.0001 -0.0013 -0.0202 149 ILE B C   
882  O O   . ILE A 130 ? 0.1699 0.1782 0.2239 -0.0005 -0.0028 -0.0225 149 ILE B O   
883  C CB  . ILE A 130 ? 0.2056 0.2058 0.2405 -0.0015 0.0042  -0.0126 149 ILE B CB  
884  C CG1 . ILE A 130 ? 0.2045 0.2025 0.2420 -0.0029 0.0042  -0.0112 149 ILE B CG1 
885  C CG2 . ILE A 130 ? 0.1966 0.1931 0.2202 -0.0018 0.0056  -0.0106 149 ILE B CG2 
886  C CD1 . ILE A 130 ? 0.1641 0.1572 0.1979 -0.0037 0.0075  -0.0067 149 ILE B CD1 
887  N N   . THR A 131 ? 0.1803 0.1917 0.2364 0.0003  -0.0012 -0.0206 150 THR B N   
888  C CA  . THR A 131 ? 0.1587 0.1727 0.2288 -0.0010 -0.0027 -0.0234 150 THR B CA  
889  C C   . THR A 131 ? 0.1940 0.2086 0.2699 -0.0016 0.0010  -0.0196 150 THR B C   
890  O O   . THR A 131 ? 0.1807 0.1929 0.2482 -0.0004 0.0043  -0.0158 150 THR B O   
891  C CB  . THR A 131 ? 0.2176 0.2385 0.2919 0.0006  -0.0082 -0.0298 150 THR B CB  
892  O OG1 . THR A 131 ? 0.1645 0.1904 0.2373 0.0028  -0.0086 -0.0287 150 THR B OG1 
893  C CG2 . THR A 131 ? 0.2378 0.2590 0.3030 0.0026  -0.0109 -0.0332 150 THR B CG2 
894  N N   . THR A 132 ? 0.1790 0.1965 0.2700 -0.0034 0.0008  -0.0209 151 THR B N   
895  C CA  . THR A 132 ? 0.1846 0.2055 0.2835 -0.0033 0.0041  -0.0178 151 THR B CA  
896  C C   . THR A 132 ? 0.1985 0.2282 0.3010 -0.0010 -0.0005 -0.0215 151 THR B C   
897  O O   . THR A 132 ? 0.2198 0.2530 0.3211 -0.0002 -0.0065 -0.0270 151 THR B O   
898  C CB  . THR A 132 ? 0.1813 0.2023 0.2971 -0.0066 0.0067  -0.0164 151 THR B CB  
899  O OG1 . THR A 132 ? 0.2128 0.2361 0.3394 -0.0088 0.0013  -0.0227 151 THR B OG1 
900  C CG2 . THR A 132 ? 0.1816 0.1941 0.2923 -0.0077 0.0125  -0.0105 151 THR B CG2 
901  N N   . SER A 133 ? 0.2126 0.2462 0.3188 0.0007  0.0023  -0.0183 152 SER B N   
902  C CA  . SER A 133 ? 0.2101 0.2529 0.3194 0.0039  -0.0021 -0.0207 152 SER B CA  
903  C C   . SER A 133 ? 0.2381 0.2901 0.3636 0.0021  -0.0088 -0.0268 152 SER B C   
904  O O   . SER A 133 ? 0.1696 0.2297 0.2953 0.0049  -0.0150 -0.0306 152 SER B O   
905  C CB  . SER A 133 ? 0.2156 0.2606 0.3276 0.0066  0.0031  -0.0155 152 SER B CB  
906  O OG  . SER A 133 ? 0.1948 0.2414 0.3217 0.0039  0.0078  -0.0129 152 SER B OG  
907  N N   . ASP A 134 ? 0.2040 0.2547 0.3432 -0.0025 -0.0077 -0.0278 153 ASP B N   
908  C CA  . ASP A 134 ? 0.2151 0.2734 0.3717 -0.0055 -0.0142 -0.0345 153 ASP B CA  
909  C C   . ASP A 134 ? 0.1921 0.2463 0.3443 -0.0069 -0.0197 -0.0418 153 ASP B C   
910  O O   . ASP A 134 ? 0.1579 0.2163 0.3231 -0.0096 -0.0256 -0.0488 153 ASP B O   
911  C CB  . ASP A 134 ? 0.2500 0.3096 0.4276 -0.0101 -0.0098 -0.0318 153 ASP B CB  
912  C CG  . ASP A 134 ? 0.2843 0.3324 0.4604 -0.0131 -0.0035 -0.0278 153 ASP B CG  
913  O OD1 . ASP A 134 ? 0.2519 0.2917 0.4116 -0.0118 -0.0034 -0.0279 153 ASP B OD1 
914  O OD2 . ASP A 134 ? 0.2243 0.2722 0.4162 -0.0166 0.0015  -0.0242 153 ASP B OD2 
915  N N   . ARG A 135 ? 0.1797 0.2260 0.3140 -0.0049 -0.0179 -0.0404 154 ARG B N   
916  C CA  . ARG A 135 ? 0.2676 0.3095 0.3963 -0.0052 -0.0216 -0.0463 154 ARG B CA  
917  C C   . ARG A 135 ? 0.2232 0.2606 0.3671 -0.0099 -0.0216 -0.0494 154 ARG B C   
918  O O   . ARG A 135 ? 0.2663 0.3028 0.4122 -0.0105 -0.0267 -0.0572 154 ARG B O   
919  C CB  . ARG A 135 ? 0.2568 0.3060 0.3797 -0.0019 -0.0296 -0.0538 154 ARG B CB  
920  C CG  . ARG A 135 ? 0.3088 0.3599 0.4134 0.0035  -0.0293 -0.0506 154 ARG B CG  
921  C CD  . ARG A 135 ? 0.2905 0.3481 0.3977 0.0056  -0.0282 -0.0458 154 ARG B CD  
922  N NE  . ARG A 135 ? 0.3175 0.3793 0.4109 0.0112  -0.0309 -0.0452 154 ARG B NE  
923  C CZ  . ARG A 135 ? 0.3520 0.4162 0.4415 0.0147  -0.0285 -0.0395 154 ARG B CZ  
924  N NH1 . ARG A 135 ? 0.2645 0.3277 0.3625 0.0133  -0.0233 -0.0343 154 ARG B NH1 
925  N NH2 . ARG A 135 ? 0.2980 0.3652 0.3749 0.0201  -0.0307 -0.0386 154 ARG B NH2 
926  N N   . ASP A 136 ? 0.2547 0.2886 0.4093 -0.0131 -0.0155 -0.0433 155 ASP B N   
927  C CA  . ASP A 136 ? 0.2819 0.3103 0.4519 -0.0176 -0.0144 -0.0449 155 ASP B CA  
928  C C   . ASP A 136 ? 0.2507 0.2680 0.4109 -0.0169 -0.0111 -0.0424 155 ASP B C   
929  O O   . ASP A 136 ? 0.2190 0.2313 0.3728 -0.0163 -0.0047 -0.0341 155 ASP B O   
930  C CB  . ASP A 136 ? 0.2527 0.2823 0.4393 -0.0211 -0.0084 -0.0384 155 ASP B CB  
931  C CG  . ASP A 136 ? 0.2703 0.2924 0.4729 -0.0258 -0.0058 -0.0382 155 ASP B CG  
932  O OD1 . ASP A 136 ? 0.2827 0.2986 0.4840 -0.0263 -0.0092 -0.0440 155 ASP B OD1 
933  O OD2 . ASP A 136 ? 0.2621 0.2842 0.4787 -0.0287 0.0003  -0.0319 155 ASP B OD2 
934  N N   . ARG A 137 ? 0.2153 0.2294 0.3743 -0.0166 -0.0156 -0.0498 156 ARG B N   
935  C CA  . ARG A 137 ? 0.2748 0.2800 0.4241 -0.0147 -0.0129 -0.0476 156 ARG B CA  
936  C C   . ARG A 137 ? 0.2431 0.2398 0.4010 -0.0171 -0.0065 -0.0403 156 ARG B C   
937  O O   . ARG A 137 ? 0.2782 0.2690 0.4268 -0.0150 -0.0030 -0.0349 156 ARG B O   
938  C CB  . ARG A 137 ? 0.3317 0.3349 0.4789 -0.0132 -0.0183 -0.0573 156 ARG B CB  
939  C CG  . ARG A 137 ? 0.3930 0.4030 0.5242 -0.0088 -0.0225 -0.0614 156 ARG B CG  
940  C CD  . ARG A 137 ? 0.5236 0.5351 0.6561 -0.0078 -0.0292 -0.0731 156 ARG B CD  
941  N NE  . ARG A 137 ? 0.5924 0.6103 0.7083 -0.0029 -0.0324 -0.0763 156 ARG B NE  
942  C CZ  . ARG A 137 ? 0.5442 0.5709 0.6545 -0.0012 -0.0350 -0.0754 156 ARG B CZ  
943  N NH1 . ARG A 137 ? 0.5158 0.5468 0.6362 -0.0040 -0.0346 -0.0717 156 ARG B NH1 
944  N NH2 . ARG A 137 ? 0.5095 0.5408 0.6043 0.0037  -0.0373 -0.0776 156 ARG B NH2 
945  N N   . ASN A 138 ? 0.2119 0.2085 0.3883 -0.0214 -0.0049 -0.0398 157 ASN B N   
946  C CA  . ASN A 138 ? 0.2865 0.2751 0.4718 -0.0235 0.0022  -0.0314 157 ASN B CA  
947  C C   . ASN A 138 ? 0.2614 0.2496 0.4350 -0.0213 0.0089  -0.0204 157 ASN B C   
948  O O   . ASN A 138 ? 0.2429 0.2238 0.4168 -0.0212 0.0147  -0.0127 157 ASN B O   
949  C CB  . ASN A 138 ? 0.3425 0.3321 0.5518 -0.0290 0.0032  -0.0326 157 ASN B CB  
950  C CG  . ASN A 138 ? 0.4912 0.4718 0.7139 -0.0318 0.0017  -0.0379 157 ASN B CG  
951  O OD1 . ASN A 138 ? 0.6206 0.5941 0.8580 -0.0351 0.0072  -0.0325 157 ASN B OD1 
952  N ND2 . ASN A 138 ? 0.4563 0.4359 0.6732 -0.0301 -0.0052 -0.0482 157 ASN B ND2 
953  N N   . LYS A 139 ? 0.2162 0.2117 0.3788 -0.0193 0.0080  -0.0200 158 LYS B N   
954  C CA  . LYS A 139 ? 0.1954 0.1901 0.3452 -0.0170 0.0137  -0.0112 158 LYS B CA  
955  C C   . LYS A 139 ? 0.1739 0.1654 0.3039 -0.0135 0.0128  -0.0098 158 LYS B C   
956  O O   . LYS A 139 ? 0.2382 0.2275 0.3567 -0.0118 0.0169  -0.0032 158 LYS B O   
957  C CB  . LYS A 139 ? 0.1685 0.1717 0.3169 -0.0162 0.0138  -0.0113 158 LYS B CB  
958  C CG  . LYS A 139 ? 0.2690 0.2778 0.4379 -0.0194 0.0158  -0.0110 158 LYS B CG  
959  C CD  . LYS A 139 ? 0.2230 0.2402 0.3897 -0.0174 0.0167  -0.0098 158 LYS B CD  
960  C CE  . LYS A 139 ? 0.1980 0.2222 0.3870 -0.0204 0.0198  -0.0080 158 LYS B CE  
961  N NZ  . LYS A 139 ? 0.2249 0.2563 0.4306 -0.0235 0.0118  -0.0168 158 LYS B NZ  
962  N N   . TYR A 140 ? 0.1682 0.1597 0.2939 -0.0123 0.0074  -0.0161 159 TYR B N   
963  C CA  . TYR A 140 ? 0.1553 0.1463 0.2638 -0.0093 0.0061  -0.0153 159 TYR B CA  
964  C C   . TYR A 140 ? 0.1774 0.1622 0.2806 -0.0081 0.0093  -0.0087 159 TYR B C   
965  O O   . TYR A 140 ? 0.2192 0.2041 0.3088 -0.0064 0.0100  -0.0050 159 TYR B O   
966  C CB  . TYR A 140 ? 0.1936 0.1875 0.2994 -0.0078 0.0005  -0.0232 159 TYR B CB  
967  C CG  . TYR A 140 ? 0.2106 0.2118 0.3164 -0.0075 -0.0034 -0.0291 159 TYR B CG  
968  C CD1 . TYR A 140 ? 0.1873 0.1927 0.2978 -0.0087 -0.0023 -0.0275 159 TYR B CD1 
969  C CD2 . TYR A 140 ? 0.1885 0.1928 0.2894 -0.0054 -0.0081 -0.0360 159 TYR B CD2 
970  C CE1 . TYR A 140 ? 0.1922 0.2051 0.3029 -0.0077 -0.0065 -0.0324 159 TYR B CE1 
971  C CE2 . TYR A 140 ? 0.2300 0.2412 0.3293 -0.0044 -0.0121 -0.0408 159 TYR B CE2 
972  C CZ  . TYR A 140 ? 0.2235 0.2392 0.3281 -0.0055 -0.0116 -0.0389 159 TYR B CZ  
973  O OH  . TYR A 140 ? 0.1632 0.1866 0.2664 -0.0037 -0.0161 -0.0433 159 TYR B OH  
974  N N   . GLY A 141 ? 0.2309 0.2101 0.3449 -0.0088 0.0109  -0.0073 160 GLY B N   
975  C CA  . GLY A 141 ? 0.1801 0.1535 0.2897 -0.0069 0.0140  0.0001  160 GLY B CA  
976  C C   . GLY A 141 ? 0.2276 0.2007 0.3291 -0.0066 0.0188  0.0082  160 GLY B C   
977  O O   . GLY A 141 ? 0.2415 0.2139 0.3298 -0.0043 0.0190  0.0127  160 GLY B O   
978  N N   . LEU A 142 ? 0.1540 0.1280 0.2634 -0.0088 0.0225  0.0098  161 LEU B N   
979  C CA  . LEU A 142 ? 0.1715 0.1452 0.2728 -0.0079 0.0280  0.0171  161 LEU B CA  
980  C C   . LEU A 142 ? 0.2425 0.2203 0.3280 -0.0065 0.0261  0.0150  161 LEU B C   
981  O O   . LEU A 142 ? 0.1925 0.1685 0.2641 -0.0046 0.0285  0.0197  161 LEU B O   
982  C CB  . LEU A 142 ? 0.2060 0.1802 0.3219 -0.0103 0.0336  0.0200  161 LEU B CB  
983  C CG  . LEU A 142 ? 0.2395 0.2137 0.3468 -0.0086 0.0405  0.0275  161 LEU B CG  
984  C CD1 . LEU A 142 ? 0.2544 0.2222 0.3500 -0.0057 0.0442  0.0359  161 LEU B CD1 
985  C CD2 . LEU A 142 ? 0.2912 0.2680 0.4160 -0.0111 0.0464  0.0300  161 LEU B CD2 
986  N N   . LEU A 143 ? 0.1630 0.1460 0.2506 -0.0074 0.0218  0.0078  162 LEU B N   
987  C CA  . LEU A 143 ? 0.1898 0.1755 0.2636 -0.0061 0.0199  0.0057  162 LEU B CA  
988  C C   . LEU A 143 ? 0.1839 0.1673 0.2439 -0.0047 0.0176  0.0070  162 LEU B C   
989  O O   . LEU A 143 ? 0.1786 0.1608 0.2254 -0.0038 0.0186  0.0090  162 LEU B O   
990  C CB  . LEU A 143 ? 0.2166 0.2078 0.2944 -0.0066 0.0150  -0.0016 162 LEU B CB  
991  C CG  . LEU A 143 ? 0.1932 0.1866 0.2584 -0.0052 0.0133  -0.0035 162 LEU B CG  
992  C CD1 . LEU A 143 ? 0.1744 0.1670 0.2351 -0.0044 0.0181  0.0000  162 LEU B CD1 
993  C CD2 . LEU A 143 ? 0.1840 0.1829 0.2531 -0.0049 0.0087  -0.0098 162 LEU B CD2 
994  N N   . ALA A 144 ? 0.2231 0.2060 0.2867 -0.0045 0.0145  0.0055  163 ALA B N   
995  C CA  . ALA A 144 ? 0.2315 0.2141 0.2850 -0.0031 0.0119  0.0067  163 ALA B CA  
996  C C   . ALA A 144 ? 0.2216 0.2006 0.2665 -0.0018 0.0149  0.0139  163 ALA B C   
997  O O   . ALA A 144 ? 0.2290 0.2084 0.2612 -0.0013 0.0134  0.0148  163 ALA B O   
998  C CB  . ALA A 144 ? 0.2348 0.2175 0.2959 -0.0022 0.0092  0.0046  163 ALA B CB  
999  N N   . ARG A 145 ? 0.1661 0.1412 0.2179 -0.0014 0.0191  0.0190  164 ARG B N   
1000 C CA  . ARG A 145 ? 0.2351 0.2067 0.2772 0.0007  0.0226  0.0266  164 ARG B CA  
1001 C C   . ARG A 145 ? 0.2447 0.2163 0.2741 0.0008  0.0251  0.0270  164 ARG B C   
1002 O O   . ARG A 145 ? 0.2569 0.2273 0.2715 0.0025  0.0245  0.0295  164 ARG B O   
1003 C CB  . ARG A 145 ? 0.2707 0.2376 0.3236 0.0012  0.0281  0.0330  164 ARG B CB  
1004 C CG  . ARG A 145 ? 0.2650 0.2283 0.3074 0.0040  0.0333  0.0421  164 ARG B CG  
1005 C CD  . ARG A 145 ? 0.2667 0.2303 0.2939 0.0071  0.0291  0.0449  164 ARG B CD  
1006 N NE  . ARG A 145 ? 0.2852 0.2486 0.3198 0.0085  0.0255  0.0457  164 ARG B NE  
1007 C CZ  . ARG A 145 ? 0.3605 0.3259 0.3860 0.0113  0.0210  0.0479  164 ARG B CZ  
1008 N NH1 . ARG A 145 ? 0.3583 0.3260 0.3667 0.0124  0.0188  0.0487  164 ARG B NH1 
1009 N NH2 . ARG A 145 ? 0.3148 0.2803 0.3486 0.0132  0.0183  0.0489  164 ARG B NH2 
1010 N N   . LEU A 146 ? 0.2095 0.1826 0.2447 -0.0006 0.0276  0.0241  165 LEU B N   
1011 C CA  . LEU A 146 ? 0.2536 0.2260 0.2775 0.0001  0.0305  0.0240  165 LEU B CA  
1012 C C   . LEU A 146 ? 0.2257 0.1985 0.2361 -0.0001 0.0254  0.0195  165 LEU B C   
1013 O O   . LEU A 146 ? 0.2083 0.1783 0.2043 0.0010  0.0265  0.0202  165 LEU B O   
1014 C CB  . LEU A 146 ? 0.1951 0.1704 0.2298 -0.0009 0.0333  0.0214  165 LEU B CB  
1015 C CG  . LEU A 146 ? 0.1813 0.1569 0.2305 -0.0013 0.0395  0.0260  165 LEU B CG  
1016 C CD1 . LEU A 146 ? 0.2856 0.2659 0.3446 -0.0020 0.0416  0.0233  165 LEU B CD1 
1017 C CD2 . LEU A 146 ? 0.1955 0.1665 0.2354 0.0012  0.0463  0.0341  165 LEU B CD2 
1018 N N   . ALA A 147 ? 0.1834 0.1596 0.1987 -0.0016 0.0199  0.0149  166 ALA B N   
1019 C CA  . ALA A 147 ? 0.2425 0.2196 0.2478 -0.0024 0.0155  0.0112  166 ALA B CA  
1020 C C   . ALA A 147 ? 0.2710 0.2469 0.2654 -0.0017 0.0130  0.0139  166 ALA B C   
1021 O O   . ALA A 147 ? 0.1997 0.1741 0.1822 -0.0023 0.0112  0.0121  166 ALA B O   
1022 C CB  . ALA A 147 ? 0.1961 0.1776 0.2093 -0.0037 0.0113  0.0068  166 ALA B CB  
1023 N N   . VAL A 148 ? 0.2061 0.1825 0.2049 -0.0002 0.0125  0.0181  167 VAL B N   
1024 C CA  . VAL A 148 ? 0.2176 0.1939 0.2062 0.0015  0.0100  0.0219  167 VAL B CA  
1025 C C   . VAL A 148 ? 0.2484 0.2201 0.2224 0.0031  0.0135  0.0247  167 VAL B C   
1026 O O   . VAL A 148 ? 0.2498 0.2212 0.2100 0.0031  0.0102  0.0233  167 VAL B O   
1027 C CB  . VAL A 148 ? 0.2666 0.2431 0.2635 0.0038  0.0103  0.0274  167 VAL B CB  
1028 C CG1 . VAL A 148 ? 0.2505 0.2277 0.2362 0.0066  0.0074  0.0323  167 VAL B CG1 
1029 C CG2 . VAL A 148 ? 0.2147 0.1950 0.2251 0.0030  0.0071  0.0239  167 VAL B CG2 
1030 N N   . GLU A 149 ? 0.2277 0.1962 0.2049 0.0044  0.0204  0.0283  168 GLU B N   
1031 C CA  . GLU A 149 ? 0.2751 0.2393 0.2380 0.0068  0.0252  0.0315  168 GLU B CA  
1032 C C   . GLU A 149 ? 0.2550 0.2171 0.2072 0.0057  0.0248  0.0254  168 GLU B C   
1033 O O   . GLU A 149 ? 0.2907 0.2491 0.2263 0.0076  0.0259  0.0256  168 GLU B O   
1034 C CB  . GLU A 149 ? 0.3334 0.2955 0.3045 0.0084  0.0339  0.0372  168 GLU B CB  
1035 C CG  . GLU A 149 ? 0.4149 0.3770 0.3976 0.0093  0.0351  0.0436  168 GLU B CG  
1036 C CD  . GLU A 149 ? 0.5826 0.5437 0.5530 0.0127  0.0327  0.0492  168 GLU B CD  
1037 O OE1 . GLU A 149 ? 0.6502 0.6086 0.6046 0.0159  0.0360  0.0533  168 GLU B OE1 
1038 O OE2 . GLU A 149 ? 0.5217 0.4850 0.4981 0.0128  0.0275  0.0498  168 GLU B OE2 
1039 N N   . ALA A 150 ? 0.2386 0.2025 0.1996 0.0030  0.0233  0.0199  169 ALA B N   
1040 C CA  . ALA A 150 ? 0.2678 0.2288 0.2207 0.0020  0.0231  0.0144  169 ALA B CA  
1041 C C   . ALA A 150 ? 0.2842 0.2448 0.2271 -0.0002 0.0161  0.0101  169 ALA B C   
1042 O O   . ALA A 150 ? 0.2643 0.2209 0.1995 -0.0014 0.0157  0.0054  169 ALA B O   
1043 C CB  . ALA A 150 ? 0.2019 0.1652 0.1679 0.0005  0.0241  0.0113  169 ALA B CB  
1044 N N   . GLY A 151 ? 0.2576 0.2225 0.2020 -0.0008 0.0107  0.0116  170 GLY B N   
1045 C CA  . GLY A 151 ? 0.3066 0.2729 0.2432 -0.0031 0.0037  0.0080  170 GLY B CA  
1046 C C   . GLY A 151 ? 0.2786 0.2499 0.2258 -0.0067 -0.0010 0.0044  170 GLY B C   
1047 O O   . GLY A 151 ? 0.2406 0.2131 0.1835 -0.0096 -0.0062 0.0008  170 GLY B O   
1048 N N   . PHE A 152 ? 0.2704 0.2449 0.2316 -0.0067 0.0008  0.0051  171 PHE B N   
1049 C CA  . PHE A 152 ? 0.2378 0.2178 0.2082 -0.0092 -0.0030 0.0026  171 PHE B CA  
1050 C C   . PHE A 152 ? 0.2166 0.2027 0.1889 -0.0091 -0.0083 0.0045  171 PHE B C   
1051 O O   . PHE A 152 ? 0.2310 0.2181 0.2041 -0.0061 -0.0080 0.0090  171 PHE B O   
1052 C CB  . PHE A 152 ? 0.2313 0.2137 0.2144 -0.0084 -0.0004 0.0024  171 PHE B CB  
1053 C CG  . PHE A 152 ? 0.2354 0.2145 0.2181 -0.0090 0.0028  -0.0004 171 PHE B CG  
1054 C CD1 . PHE A 152 ? 0.2113 0.1911 0.1944 -0.0112 0.0013  -0.0035 171 PHE B CD1 
1055 C CD2 . PHE A 152 ? 0.2524 0.2278 0.2345 -0.0071 0.0076  0.0008  171 PHE B CD2 
1056 C CE1 . PHE A 152 ? 0.1752 0.1516 0.1574 -0.0109 0.0043  -0.0051 171 PHE B CE1 
1057 C CE2 . PHE A 152 ? 0.2450 0.2181 0.2273 -0.0068 0.0103  -0.0013 171 PHE B CE2 
1058 C CZ  . PHE A 152 ? 0.1866 0.1599 0.1684 -0.0085 0.0085  -0.0042 171 PHE B CZ  
1059 N N   . ASP A 153 ? 0.2082 0.1987 0.1824 -0.0121 -0.0128 0.0018  172 ASP B N   
1060 C CA  . ASP A 153 ? 0.2443 0.2421 0.2207 -0.0121 -0.0186 0.0035  172 ASP B CA  
1061 C C   . ASP A 153 ? 0.2316 0.2361 0.2215 -0.0097 -0.0186 0.0061  172 ASP B C   
1062 O O   . ASP A 153 ? 0.2146 0.2247 0.2071 -0.0079 -0.0224 0.0091  172 ASP B O   
1063 C CB  . ASP A 153 ? 0.2315 0.2322 0.2064 -0.0168 -0.0234 -0.0006 172 ASP B CB  
1064 C CG  . ASP A 153 ? 0.3372 0.3299 0.2978 -0.0188 -0.0238 -0.0041 172 ASP B CG  
1065 O OD1 . ASP A 153 ? 0.3248 0.3156 0.2741 -0.0168 -0.0258 -0.0029 172 ASP B OD1 
1066 O OD2 . ASP A 153 ? 0.2446 0.2323 0.2044 -0.0219 -0.0218 -0.0079 172 ASP B OD2 
1067 N N   . TRP A 154 ? 0.2144 0.2180 0.2122 -0.0093 -0.0147 0.0048  173 TRP B N   
1068 C CA  . TRP A 154 ? 0.1788 0.1865 0.1883 -0.0065 -0.0139 0.0063  173 TRP B CA  
1069 C C   . TRP A 154 ? 0.1848 0.1880 0.1981 -0.0056 -0.0092 0.0047  173 TRP B C   
1070 O O   . TRP A 154 ? 0.2172 0.2180 0.2279 -0.0074 -0.0075 0.0017  173 TRP B O   
1071 C CB  . TRP A 154 ? 0.2159 0.2318 0.2334 -0.0077 -0.0162 0.0045  173 TRP B CB  
1072 C CG  . TRP A 154 ? 0.1892 0.2106 0.2175 -0.0040 -0.0164 0.0062  173 TRP B CG  
1073 C CD1 . TRP A 154 ? 0.1571 0.1822 0.1885 -0.0010 -0.0191 0.0103  173 TRP B CD1 
1074 C CD2 . TRP A 154 ? 0.1964 0.2201 0.2332 -0.0023 -0.0138 0.0039  173 TRP B CD2 
1075 N NE1 . TRP A 154 ? 0.2171 0.2459 0.2593 0.0025  -0.0179 0.0105  173 TRP B NE1 
1076 C CE2 . TRP A 154 ? 0.1514 0.1793 0.1965 0.0017  -0.0146 0.0061  173 TRP B CE2 
1077 C CE3 . TRP A 154 ? 0.2560 0.2785 0.2933 -0.0031 -0.0109 0.0001  173 TRP B CE3 
1078 C CZ2 . TRP A 154 ? 0.1963 0.2265 0.2496 0.0046  -0.0123 0.0039  173 TRP B CZ2 
1079 C CZ3 . TRP A 154 ? 0.2285 0.2540 0.2730 -0.0001 -0.0092 -0.0020 173 TRP B CZ3 
1080 C CH2 . TRP A 154 ? 0.1866 0.2156 0.2388 0.0036  -0.0097 -0.0005 173 TRP B CH2 
1081 N N   . VAL A 155 ? 0.1702 0.1720 0.1902 -0.0027 -0.0075 0.0067  174 VAL B N   
1082 C CA  . VAL A 155 ? 0.1370 0.1351 0.1624 -0.0021 -0.0040 0.0048  174 VAL B CA  
1083 C C   . VAL A 155 ? 0.2077 0.2077 0.2439 0.0003  -0.0041 0.0040  174 VAL B C   
1084 O O   . VAL A 155 ? 0.2140 0.2139 0.2532 0.0027  -0.0048 0.0077  174 VAL B O   
1085 C CB  . VAL A 155 ? 0.1746 0.1666 0.1971 -0.0017 -0.0006 0.0081  174 VAL B CB  
1086 C CG1 . VAL A 155 ? 0.1333 0.1229 0.1652 -0.0015 0.0024  0.0062  174 VAL B CG1 
1087 C CG2 . VAL A 155 ? 0.1989 0.1883 0.2096 -0.0034 0.0002  0.0080  174 VAL B CG2 
1088 N N   . TYR A 156 ? 0.2063 0.2077 0.2474 0.0004  -0.0036 -0.0008 175 TYR B N   
1089 C CA  . TYR A 156 ? 0.1773 0.1804 0.2272 0.0030  -0.0039 -0.0032 175 TYR B CA  
1090 C C   . TYR A 156 ? 0.2047 0.2049 0.2597 0.0030  -0.0026 -0.0079 175 TYR B C   
1091 O O   . TYR A 156 ? 0.2123 0.2142 0.2641 0.0018  -0.0027 -0.0113 175 TYR B O   
1092 C CB  . TYR A 156 ? 0.2027 0.2130 0.2519 0.0035  -0.0053 -0.0052 175 TYR B CB  
1093 C CG  . TYR A 156 ? 0.2056 0.2185 0.2620 0.0070  -0.0049 -0.0085 175 TYR B CG  
1094 C CD1 . TYR A 156 ? 0.2093 0.2183 0.2732 0.0099  -0.0043 -0.0081 175 TYR B CD1 
1095 C CD2 . TYR A 156 ? 0.2512 0.2698 0.3066 0.0077  -0.0045 -0.0116 175 TYR B CD2 
1096 C CE1 . TYR A 156 ? 0.2333 0.2438 0.3031 0.0136  -0.0037 -0.0119 175 TYR B CE1 
1097 C CE2 . TYR A 156 ? 0.2407 0.2618 0.3012 0.0116  -0.0035 -0.0148 175 TYR B CE2 
1098 C CZ  . TYR A 156 ? 0.2146 0.2314 0.2821 0.0146  -0.0032 -0.0154 175 TYR B CZ  
1099 O OH  . TYR A 156 ? 0.2173 0.2353 0.2892 0.0190  -0.0019 -0.0194 175 TYR B OH  
1100 N N   . TYR A 157 ? 0.1536 0.1493 0.2169 0.0042  -0.0016 -0.0080 176 TYR B N   
1101 C CA  . TYR A 157 ? 0.2179 0.2110 0.2880 0.0036  -0.0013 -0.0133 176 TYR B CA  
1102 C C   . TYR A 157 ? 0.2371 0.2335 0.3088 0.0061  -0.0029 -0.0196 176 TYR B C   
1103 O O   . TYR A 157 ? 0.2478 0.2410 0.3266 0.0083  -0.0028 -0.0223 176 TYR B O   
1104 C CB  . TYR A 157 ? 0.1685 0.1546 0.2480 0.0034  0.0008  -0.0107 176 TYR B CB  
1105 C CG  . TYR A 157 ? 0.2321 0.2155 0.3211 0.0014  0.0009  -0.0157 176 TYR B CG  
1106 C CD1 . TYR A 157 ? 0.1389 0.1263 0.2278 0.0011  -0.0018 -0.0234 176 TYR B CD1 
1107 C CD2 . TYR A 157 ? 0.1957 0.1728 0.2944 -0.0001 0.0036  -0.0125 176 TYR B CD2 
1108 C CE1 . TYR A 157 ? 0.1703 0.1564 0.2689 -0.0009 -0.0029 -0.0286 176 TYR B CE1 
1109 C CE2 . TYR A 157 ? 0.2485 0.2238 0.3586 -0.0027 0.0034  -0.0173 176 TYR B CE2 
1110 C CZ  . TYR A 157 ? 0.2267 0.2069 0.3370 -0.0032 -0.0004 -0.0257 176 TYR B CZ  
1111 O OH  . TYR A 157 ? 0.2124 0.1918 0.3349 -0.0061 -0.0016 -0.0310 176 TYR B OH  
1112 N N   . GLU A 158 ? 0.2349 0.2369 0.2993 0.0061  -0.0038 -0.0217 177 GLU B N   
1113 C CA  . GLU A 158 ? 0.2384 0.2452 0.3005 0.0090  -0.0042 -0.0253 177 GLU B CA  
1114 C C   . GLU A 158 ? 0.3244 0.3303 0.3897 0.0111  -0.0053 -0.0332 177 GLU B C   
1115 O O   . GLU A 158 ? 0.3371 0.3443 0.4032 0.0146  -0.0049 -0.0367 177 GLU B O   
1116 C CB  . GLU A 158 ? 0.2483 0.2604 0.3015 0.0078  -0.0041 -0.0238 177 GLU B CB  
1117 C CG  . GLU A 158 ? 0.3011 0.3190 0.3507 0.0105  -0.0035 -0.0267 177 GLU B CG  
1118 C CD  . GLU A 158 ? 0.3817 0.4037 0.4245 0.0086  -0.0025 -0.0230 177 GLU B CD  
1119 O OE1 . GLU A 158 ? 0.4054 0.4258 0.4433 0.0067  -0.0026 -0.0225 177 GLU B OE1 
1120 O OE2 . GLU A 158 ? 0.4311 0.4577 0.4744 0.0090  -0.0013 -0.0204 177 GLU B OE2 
1121 N N   . SER A 159 ? 0.2574 0.2614 0.3247 0.0090  -0.0067 -0.0362 178 SER B N   
1122 C CA  . SER A 159 ? 0.2703 0.2744 0.3397 0.0104  -0.0091 -0.0447 178 SER B CA  
1123 C C   . SER A 159 ? 0.2827 0.2822 0.3619 0.0072  -0.0103 -0.0464 178 SER B C   
1124 O O   . SER A 159 ? 0.2765 0.2744 0.3582 0.0043  -0.0087 -0.0405 178 SER B O   
1125 C CB  . SER A 159 ? 0.2930 0.3035 0.3527 0.0115  -0.0104 -0.0468 178 SER B CB  
1126 O OG  . SER A 159 ? 0.3056 0.3171 0.3666 0.0125  -0.0140 -0.0549 178 SER B OG  
1127 N N   . ARG A 160 ? 0.2445 0.2421 0.3300 0.0076  -0.0130 -0.0545 179 ARG B N   
1128 C CA  . ARG A 160 ? 0.2277 0.2227 0.3243 0.0037  -0.0146 -0.0567 179 ARG B CA  
1129 C C   . ARG A 160 ? 0.2414 0.2434 0.3343 0.0023  -0.0164 -0.0560 179 ARG B C   
1130 O O   . ARG A 160 ? 0.2655 0.2676 0.3676 -0.0011 -0.0167 -0.0549 179 ARG B O   
1131 C CB  . ARG A 160 ? 0.3810 0.3725 0.4858 0.0039  -0.0180 -0.0669 179 ARG B CB  
1132 C CG  . ARG A 160 ? 0.4357 0.4185 0.5457 0.0057  -0.0155 -0.0674 179 ARG B CG  
1133 C CD  . ARG A 160 ? 0.5848 0.5622 0.7035 0.0055  -0.0189 -0.0785 179 ARG B CD  
1134 N NE  . ARG A 160 ? 0.5724 0.5406 0.6956 0.0083  -0.0161 -0.0794 179 ARG B NE  
1135 C CZ  . ARG A 160 ? 0.5339 0.4939 0.6673 0.0068  -0.0123 -0.0726 179 ARG B CZ  
1136 N NH1 . ARG A 160 ? 0.5361 0.4963 0.6752 0.0025  -0.0103 -0.0644 179 ARG B NH1 
1137 N NH2 . ARG A 160 ? 0.4808 0.4324 0.6182 0.0102  -0.0099 -0.0736 179 ARG B NH2 
1138 N N   . ASN A 161 ? 0.1853 0.1932 0.2654 0.0051  -0.0172 -0.0559 180 ASN B N   
1139 C CA  . ASN A 161 ? 0.2014 0.2158 0.2774 0.0051  -0.0192 -0.0558 180 ASN B CA  
1140 C C   . ASN A 161 ? 0.1776 0.1929 0.2473 0.0043  -0.0157 -0.0472 180 ASN B C   
1141 O O   . ASN A 161 ? 0.1954 0.2148 0.2633 0.0043  -0.0166 -0.0461 180 ASN B O   
1142 C CB  . ASN A 161 ? 0.2383 0.2583 0.3040 0.0093  -0.0225 -0.0617 180 ASN B CB  
1143 C CG  . ASN A 161 ? 0.3271 0.3460 0.3973 0.0104  -0.0267 -0.0719 180 ASN B CG  
1144 O OD1 . ASN A 161 ? 0.3350 0.3535 0.3980 0.0142  -0.0267 -0.0761 180 ASN B OD1 
1145 N ND2 . ASN A 161 ? 0.2543 0.2726 0.3373 0.0070  -0.0301 -0.0762 180 ASN B ND2 
1146 N N   . HIS A 162 ? 0.2230 0.2346 0.2894 0.0038  -0.0120 -0.0414 181 HIS B N   
1147 C CA  . HIS A 162 ? 0.2404 0.2515 0.3009 0.0026  -0.0090 -0.0343 181 HIS B CA  
1148 C C   . HIS A 162 ? 0.2719 0.2785 0.3318 0.0016  -0.0062 -0.0291 181 HIS B C   
1149 O O   . HIS A 162 ? 0.2016 0.2068 0.2641 0.0028  -0.0064 -0.0304 181 HIS B O   
1150 C CB  . HIS A 162 ? 0.2394 0.2543 0.2884 0.0047  -0.0090 -0.0334 181 HIS B CB  
1151 C CG  . HIS A 162 ? 0.2916 0.3073 0.3350 0.0063  -0.0079 -0.0328 181 HIS B CG  
1152 N ND1 . HIS A 162 ? 0.3876 0.4066 0.4285 0.0095  -0.0092 -0.0375 181 HIS B ND1 
1153 C CD2 . HIS A 162 ? 0.2425 0.2568 0.2829 0.0052  -0.0057 -0.0280 181 HIS B CD2 
1154 C CE1 . HIS A 162 ? 0.3584 0.3783 0.3960 0.0105  -0.0070 -0.0351 181 HIS B CE1 
1155 N NE2 . HIS A 162 ? 0.2158 0.2332 0.2537 0.0076  -0.0053 -0.0294 181 HIS B NE2 
1156 N N   . VAL A 163 ? 0.2648 0.2695 0.3208 -0.0001 -0.0038 -0.0234 182 VAL B N   
1157 C CA  . VAL A 163 ? 0.2457 0.2474 0.2984 -0.0007 -0.0020 -0.0182 182 VAL B CA  
1158 C C   . VAL A 163 ? 0.2499 0.2536 0.2923 -0.0009 -0.0019 -0.0163 182 VAL B C   
1159 O O   . VAL A 163 ? 0.2240 0.2286 0.2616 -0.0010 -0.0015 -0.0166 182 VAL B O   
1160 C CB  . VAL A 163 ? 0.2034 0.2008 0.2579 -0.0024 0.0007  -0.0135 182 VAL B CB  
1161 C CG1 . VAL A 163 ? 0.1776 0.1727 0.2256 -0.0025 0.0017  -0.0082 182 VAL B CG1 
1162 C CG2 . VAL A 163 ? 0.2162 0.2111 0.2831 -0.0030 0.0014  -0.0144 182 VAL B CG2 
1163 N N   . HIS A 164 ? 0.1882 0.1927 0.2285 -0.0007 -0.0022 -0.0142 183 HIS B N   
1164 C CA  . HIS A 164 ? 0.2061 0.2126 0.2391 -0.0019 -0.0023 -0.0124 183 HIS B CA  
1165 C C   . HIS A 164 ? 0.1669 0.1703 0.1954 -0.0038 -0.0021 -0.0083 183 HIS B C   
1166 O O   . HIS A 164 ? 0.1961 0.1985 0.2271 -0.0033 -0.0026 -0.0059 183 HIS B O   
1167 C CB  . HIS A 164 ? 0.1607 0.1722 0.1959 -0.0004 -0.0031 -0.0132 183 HIS B CB  
1168 C CG  . HIS A 164 ? 0.1923 0.2068 0.2235 -0.0023 -0.0032 -0.0108 183 HIS B CG  
1169 N ND1 . HIS A 164 ? 0.2144 0.2319 0.2428 -0.0024 -0.0021 -0.0115 183 HIS B ND1 
1170 C CD2 . HIS A 164 ? 0.1664 0.1818 0.1969 -0.0042 -0.0046 -0.0078 183 HIS B CD2 
1171 C CE1 . HIS A 164 ? 0.1925 0.2121 0.2200 -0.0051 -0.0023 -0.0091 183 HIS B CE1 
1172 N NE2 . HIS A 164 ? 0.2110 0.2299 0.2398 -0.0063 -0.0045 -0.0073 183 HIS B NE2 
1173 N N   . VAL A 165 ? 0.1629 0.1642 0.1840 -0.0057 -0.0015 -0.0076 184 VAL B N   
1174 C CA  . VAL A 165 ? 0.1095 0.1074 0.1241 -0.0075 -0.0017 -0.0049 184 VAL B CA  
1175 C C   . VAL A 165 ? 0.2328 0.2311 0.2417 -0.0101 -0.0029 -0.0054 184 VAL B C   
1176 O O   . VAL A 165 ? 0.2019 0.2000 0.2098 -0.0106 -0.0016 -0.0068 184 VAL B O   
1177 C CB  . VAL A 165 ? 0.1598 0.1520 0.1705 -0.0072 0.0010  -0.0039 184 VAL B CB  
1178 C CG1 . VAL A 165 ? 0.1718 0.1639 0.1908 -0.0055 0.0026  -0.0031 184 VAL B CG1 
1179 C CG2 . VAL A 165 ? 0.1575 0.1478 0.1647 -0.0075 0.0028  -0.0057 184 VAL B CG2 
1180 N N   . SER A 166 ? 0.2069 0.2056 0.2123 -0.0118 -0.0054 -0.0040 185 SER B N   
1181 C CA  . SER A 166 ? 0.1717 0.1711 0.1741 -0.0153 -0.0070 -0.0051 185 SER B CA  
1182 C C   . SER A 166 ? 0.2181 0.2141 0.2122 -0.0174 -0.0096 -0.0050 185 SER B C   
1183 O O   . SER A 166 ? 0.1926 0.1874 0.1832 -0.0155 -0.0102 -0.0031 185 SER B O   
1184 C CB  . SER A 166 ? 0.1935 0.2013 0.2042 -0.0159 -0.0087 -0.0048 185 SER B CB  
1185 O OG  . SER A 166 ? 0.2187 0.2317 0.2334 -0.0147 -0.0118 -0.0029 185 SER B OG  
1186 N N   . VAL A 167 ? 0.2002 0.1944 0.1909 -0.0213 -0.0109 -0.0070 186 VAL B N   
1187 C CA  . VAL A 167 ? 0.1780 0.1684 0.1596 -0.0237 -0.0142 -0.0085 186 VAL B CA  
1188 C C   . VAL A 167 ? 0.2105 0.2063 0.1963 -0.0284 -0.0190 -0.0101 186 VAL B C   
1189 O O   . VAL A 167 ? 0.1787 0.1788 0.1734 -0.0304 -0.0182 -0.0099 186 VAL B O   
1190 C CB  . VAL A 167 ? 0.1254 0.1050 0.0969 -0.0243 -0.0110 -0.0111 186 VAL B CB  
1191 C CG1 . VAL A 167 ? 0.1731 0.1487 0.1415 -0.0198 -0.0063 -0.0093 186 VAL B CG1 
1192 C CG2 . VAL A 167 ? 0.2050 0.1816 0.1799 -0.0268 -0.0086 -0.0126 186 VAL B CG2 
1193 N N   . LYS A 168 ? 0.2401 0.2361 0.2193 -0.0300 -0.0242 -0.0114 187 LYS B N   
1194 C CA  . LYS A 168 ? 0.2257 0.2262 0.2086 -0.0355 -0.0296 -0.0141 187 LYS B CA  
1195 C C   . LYS A 168 ? 0.2824 0.2745 0.2643 -0.0401 -0.0270 -0.0176 187 LYS B C   
1196 O O   . LYS A 168 ? 0.3114 0.2934 0.2860 -0.0383 -0.0219 -0.0184 187 LYS B O   
1197 C CB  . LYS A 168 ? 0.2195 0.2194 0.1917 -0.0362 -0.0360 -0.0162 187 LYS B CB  
1198 C CG  . LYS A 168 ? 0.3254 0.3312 0.2952 -0.0310 -0.0385 -0.0121 187 LYS B CG  
1199 C CD  . LYS A 168 ? 0.4855 0.4887 0.4404 -0.0313 -0.0443 -0.0146 187 LYS B CD  
1200 C CE  . LYS A 168 ? 0.6178 0.6259 0.5678 -0.0254 -0.0465 -0.0094 187 LYS B CE  
1201 N NZ  . LYS A 168 ? 0.5944 0.6158 0.5584 -0.0241 -0.0506 -0.0052 187 LYS B NZ  
1202 N N   . ALA A 169 ? 0.2646 0.2610 0.2547 -0.0459 -0.0303 -0.0194 188 ALA B N   
1203 C CA  . ALA A 169 ? 0.2926 0.2798 0.2824 -0.0508 -0.0278 -0.0226 188 ALA B CA  
1204 C C   . ALA A 169 ? 0.3845 0.3601 0.3598 -0.0527 -0.0305 -0.0283 188 ALA B C   
1205 O O   . ALA A 169 ? 0.3850 0.3626 0.3519 -0.0514 -0.0357 -0.0301 188 ALA B O   
1206 C CB  . ALA A 169 ? 0.3666 0.3619 0.3712 -0.0571 -0.0303 -0.0226 188 ALA B CB  
1207 N N   . ASP A 170 ? 0.4138 0.3770 0.3854 -0.0550 -0.0265 -0.0312 189 ASP B N   
1208 C CA  . ASP A 170 ? 0.5310 0.4818 0.4893 -0.0572 -0.0287 -0.0379 189 ASP B CA  
1209 C C   . ASP A 170 ? 0.6474 0.6033 0.6078 -0.0637 -0.0378 -0.0429 189 ASP B C   
1210 O O   . ASP A 170 ? 0.7657 0.7201 0.7136 -0.0630 -0.0433 -0.0471 189 ASP B O   
1235 N N   . PRO B 6   ? 0.6904 0.8653 0.5891 0.0534  0.0158  0.1832  712 PRO C N   
1236 C CA  . PRO B 6   ? 0.6495 0.8048 0.5584 0.0492  0.0194  0.1745  712 PRO C CA  
1237 C C   . PRO B 6   ? 0.5656 0.7032 0.4843 0.0560  0.0158  0.1705  712 PRO C C   
1238 O O   . PRO B 6   ? 0.5723 0.7190 0.4919 0.0605  0.0118  0.1652  712 PRO C O   
1239 C CB  . PRO B 6   ? 0.6525 0.8233 0.5621 0.0420  0.0221  0.1584  712 PRO C CB  
1240 C CG  . PRO B 6   ? 0.6588 0.8526 0.5625 0.0444  0.0184  0.1553  712 PRO C CG  
1241 C CD  . PRO B 6   ? 0.6955 0.8962 0.5902 0.0500  0.0154  0.1719  712 PRO C CD  
1242 N N   . VAL B 7   ? 0.5677 0.6813 0.4939 0.0565  0.0173  0.1728  713 VAL C N   
1243 C CA  . VAL B 7   ? 0.6052 0.7014 0.5406 0.0628  0.0142  0.1687  713 VAL C CA  
1244 C C   . VAL B 7   ? 0.6198 0.7071 0.5635 0.0582  0.0166  0.1538  713 VAL C C   
1245 O O   . VAL B 7   ? 0.5644 0.6543 0.5118 0.0600  0.0146  0.1433  713 VAL C O   
1246 C CB  . VAL B 7   ? 0.7297 0.8043 0.6680 0.0683  0.0131  0.1816  713 VAL C CB  
1247 C CG1 . VAL B 7   ? 0.7465 0.8112 0.6840 0.0616  0.0181  0.1884  713 VAL C CG1 
1248 C CG2 . VAL B 7   ? 0.7207 0.7766 0.6696 0.0737  0.0108  0.1752  713 VAL C CG2 
1249 N N   . ALA B 8   ? 0.6566 0.7342 0.6034 0.0521  0.0210  0.1530  714 ALA C N   
1250 C CA  . ALA B 8   ? 0.6089 0.6795 0.5633 0.0479  0.0231  0.1390  714 ALA C CA  
1251 C C   . ALA B 8   ? 0.5239 0.6139 0.4751 0.0432  0.0241  0.1274  714 ALA C C   
1252 O O   . ALA B 8   ? 0.5153 0.6231 0.4591 0.0389  0.0260  0.1296  714 ALA C O   
1253 C CB  . ALA B 8   ? 0.5941 0.6529 0.5525 0.0422  0.0276  0.1407  714 ALA C CB  
1254 N N   . GLY B 9   ? 0.4309 0.5174 0.3874 0.0439  0.0227  0.1149  715 GLY C N   
1255 C CA  . GLY B 9   ? 0.4052 0.5077 0.3595 0.0401  0.0231  0.1034  715 GLY C CA  
1256 C C   . GLY B 9   ? 0.4021 0.5025 0.3607 0.0339  0.0266  0.0924  715 GLY C C   
1257 O O   . GLY B 9   ? 0.4048 0.4911 0.3689 0.0326  0.0285  0.0930  715 GLY C O   
1258 N N   . PRO B 10  ? 0.4005 0.5151 0.3574 0.0301  0.0272  0.0817  716 PRO C N   
1259 C CA  . PRO B 10  ? 0.3179 0.4297 0.2800 0.0253  0.0299  0.0699  716 PRO C CA  
1260 C C   . PRO B 10  ? 0.3185 0.4104 0.2883 0.0285  0.0279  0.0633  716 PRO C C   
1261 O O   . PRO B 10  ? 0.3427 0.4265 0.3130 0.0338  0.0247  0.0659  716 PRO C O   
1262 C CB  . PRO B 10  ? 0.3440 0.4745 0.3024 0.0219  0.0300  0.0601  716 PRO C CB  
1263 C CG  . PRO B 10  ? 0.3699 0.5156 0.3207 0.0240  0.0279  0.0676  716 PRO C CG  
1264 C CD  . PRO B 10  ? 0.4224 0.5550 0.3740 0.0305  0.0251  0.0788  716 PRO C CD  
1265 N N   . TYR B 11  ? 0.2330 0.3179 0.2086 0.0257  0.0298  0.0546  717 TYR C N   
1266 C CA  . TYR B 11  ? 0.2655 0.3334 0.2473 0.0287  0.0276  0.0474  717 TYR C CA  
1267 C C   . TYR B 11  ? 0.2696 0.3424 0.2530 0.0257  0.0281  0.0339  717 TYR C C   
1268 O O   . TYR B 11  ? 0.3213 0.4027 0.3059 0.0212  0.0310  0.0287  717 TYR C O   
1269 C CB  . TYR B 11  ? 0.2584 0.3104 0.2468 0.0294  0.0286  0.0496  717 TYR C CB  
1270 C CG  . TYR B 11  ? 0.3180 0.3542 0.3128 0.0320  0.0265  0.0408  717 TYR C CG  
1271 C CD1 . TYR B 11  ? 0.3503 0.3732 0.3462 0.0375  0.0233  0.0429  717 TYR C CD1 
1272 C CD2 . TYR B 11  ? 0.4090 0.4443 0.4087 0.0292  0.0277  0.0305  717 TYR C CD2 
1273 C CE1 . TYR B 11  ? 0.4155 0.4246 0.4160 0.0400  0.0213  0.0353  717 TYR C CE1 
1274 C CE2 . TYR B 11  ? 0.5037 0.5248 0.5086 0.0321  0.0254  0.0230  717 TYR C CE2 
1275 C CZ  . TYR B 11  ? 0.5208 0.5289 0.5256 0.0374  0.0222  0.0257  717 TYR C CZ  
1276 O OH  . TYR B 11  ? 0.5262 0.5208 0.5349 0.0404  0.0198  0.0186  717 TYR C OH  
1277 N N   . ILE B 12  ? 0.2861 0.3536 0.2696 0.0280  0.0254  0.0280  718 ILE C N   
1278 C CA  . ILE B 12  ? 0.2123 0.2822 0.1974 0.0254  0.0256  0.0154  718 ILE C CA  
1279 C C   . ILE B 12  ? 0.2912 0.3460 0.2830 0.0265  0.0253  0.0087  718 ILE C C   
1280 O O   . ILE B 12  ? 0.3103 0.3493 0.3045 0.0306  0.0230  0.0098  718 ILE C O   
1281 C CB  . ILE B 12  ? 0.2414 0.3113 0.2238 0.0267  0.0231  0.0119  718 ILE C CB  
1282 C CG1 . ILE B 12  ? 0.2363 0.3234 0.2126 0.0259  0.0231  0.0177  718 ILE C CG1 
1283 C CG2 . ILE B 12  ? 0.2350 0.3047 0.2193 0.0240  0.0233  -0.0010 718 ILE C CG2 
1284 C CD1 . ILE B 12  ? 0.2472 0.3353 0.2214 0.0272  0.0207  0.0158  718 ILE C CD1 
1285 N N   . THR B 13  ? 0.2544 0.3151 0.2494 0.0230  0.0274  0.0011  719 THR C N   
1286 C CA  . THR B 13  ? 0.2761 0.3248 0.2783 0.0242  0.0271  -0.0054 719 THR C CA  
1287 C C   . THR B 13  ? 0.3077 0.3502 0.3117 0.0252  0.0251  -0.0169 719 THR C C   
1288 O O   . THR B 13  ? 0.3465 0.3768 0.3558 0.0277  0.0235  -0.0222 719 THR C O   
1289 C CB  . THR B 13  ? 0.3092 0.3680 0.3150 0.0201  0.0307  -0.0077 719 THR C CB  
1290 O OG1 . THR B 13  ? 0.2991 0.3754 0.3019 0.0160  0.0328  -0.0135 719 THR C OG1 
1291 C CG2 . THR B 13  ? 0.3399 0.4012 0.3446 0.0189  0.0330  0.0044  719 THR C CG2 
1292 N N   . PHE B 14  ? 0.2432 0.2941 0.2431 0.0233  0.0250  -0.0209 720 PHE C N   
1293 C CA  . PHE B 14  ? 0.2757 0.3208 0.2774 0.0235  0.0234  -0.0320 720 PHE C CA  
1294 C C   . PHE B 14  ? 0.2896 0.3402 0.2861 0.0217  0.0228  -0.0337 720 PHE C C   
1295 O O   . PHE B 14  ? 0.3154 0.3828 0.3082 0.0183  0.0246  -0.0319 720 PHE C O   
1296 C CB  . PHE B 14  ? 0.2995 0.3534 0.3059 0.0209  0.0255  -0.0417 720 PHE C CB  
1297 C CG  . PHE B 14  ? 0.3376 0.3860 0.3463 0.0213  0.0239  -0.0536 720 PHE C CG  
1298 C CD1 . PHE B 14  ? 0.4657 0.4984 0.4795 0.0252  0.0214  -0.0591 720 PHE C CD1 
1299 C CD2 . PHE B 14  ? 0.3855 0.4445 0.3914 0.0178  0.0247  -0.0594 720 PHE C CD2 
1300 C CE1 . PHE B 14  ? 0.4782 0.5043 0.4938 0.0261  0.0197  -0.0695 720 PHE C CE1 
1301 C CE2 . PHE B 14  ? 0.4308 0.4831 0.4392 0.0181  0.0233  -0.0704 720 PHE C CE2 
1302 C CZ  . PHE B 14  ? 0.4800 0.5152 0.4931 0.0224  0.0207  -0.0750 720 PHE C CZ  
1303 N N   . THR B 15  ? 0.2863 0.3231 0.2825 0.0238  0.0203  -0.0371 721 THR C N   
1304 C CA  . THR B 15  ? 0.2728 0.3134 0.2658 0.0210  0.0200  -0.0418 721 THR C CA  
1305 C C   . THR B 15  ? 0.3573 0.3832 0.3527 0.0220  0.0183  -0.0510 721 THR C C   
1306 O O   . THR B 15  ? 0.3410 0.3501 0.3379 0.0262  0.0162  -0.0501 721 THR C O   
1307 C CB  . THR B 15  ? 0.3077 0.3471 0.2959 0.0219  0.0190  -0.0341 721 THR C CB  
1308 O OG1 . THR B 15  ? 0.3012 0.3218 0.2898 0.0263  0.0168  -0.0310 721 THR C OG1 
1309 C CG2 . THR B 15  ? 0.2496 0.3023 0.2353 0.0219  0.0201  -0.0244 721 THR C CG2 
1310 N N   . ASP B 16  ? 0.3112 0.3433 0.3069 0.0183  0.0191  -0.0600 722 ASP C N   
1311 C CA  . ASP B 16  ? 0.2860 0.3033 0.2838 0.0190  0.0174  -0.0686 722 ASP C CA  
1312 C C   . ASP B 16  ? 0.3633 0.3883 0.3598 0.0139  0.0184  -0.0756 722 ASP C C   
1313 O O   . ASP B 16  ? 0.3118 0.3561 0.3079 0.0099  0.0205  -0.0782 722 ASP C O   
1314 C CB  . ASP B 16  ? 0.3840 0.3975 0.3879 0.0215  0.0169  -0.0761 722 ASP C CB  
1315 C CG  . ASP B 16  ? 0.5141 0.5070 0.5200 0.0248  0.0140  -0.0821 722 ASP C CG  
1316 O OD1 . ASP B 16  ? 0.4780 0.4571 0.4798 0.0259  0.0123  -0.0781 722 ASP C OD1 
1317 O OD2 . ASP B 16  ? 0.6115 0.6024 0.6229 0.0266  0.0133  -0.0908 722 ASP C OD2 
1318 N N   . ALA B 17  ? 0.2828 0.2927 0.2782 0.0137  0.0169  -0.0786 723 ALA C N   
1319 C CA  . ALA B 17  ? 0.3060 0.3197 0.3013 0.0085  0.0178  -0.0867 723 ALA C CA  
1320 C C   . ALA B 17  ? 0.3519 0.3714 0.3526 0.0075  0.0185  -0.0984 723 ALA C C   
1321 O O   . ALA B 17  ? 0.3957 0.4065 0.4003 0.0118  0.0172  -0.1015 723 ALA C O   
1322 C CB  . ALA B 17  ? 0.3723 0.3651 0.3657 0.0086  0.0162  -0.0873 723 ALA C CB  
1323 N N   . VAL B 18  ? 0.3378 0.3733 0.3389 0.0022  0.0203  -0.1056 724 VAL C N   
1324 C CA  . VAL B 18  ? 0.3422 0.3827 0.3488 0.0011  0.0210  -0.1184 724 VAL C CA  
1325 C C   . VAL B 18  ? 0.3566 0.3861 0.3648 -0.0020 0.0204  -0.1279 724 VAL C C   
1326 O O   . VAL B 18  ? 0.2973 0.3200 0.3108 -0.0007 0.0197  -0.1384 724 VAL C O   
1327 C CB  . VAL B 18  ? 0.4876 0.5555 0.4942 -0.0025 0.0238  -0.1216 724 VAL C CB  
1328 C CG1 . VAL B 18  ? 0.5485 0.6270 0.5520 -0.0006 0.0247  -0.1098 724 VAL C CG1 
1329 C CG2 . VAL B 18  ? 0.4501 0.5313 0.4542 -0.0087 0.0249  -0.1252 724 VAL C CG2 
1330 N N   . ASN B 19  ? 0.3524 0.3802 0.3567 -0.0060 0.0206  -0.1244 725 ASN C N   
1331 C CA  . ASN B 19  ? 0.3063 0.3193 0.3115 -0.0094 0.0201  -0.1311 725 ASN C CA  
1332 C C   . ASN B 19  ? 0.3712 0.3807 0.3713 -0.0128 0.0205  -0.1229 725 ASN C C   
1333 O O   . ASN B 19  ? 0.3038 0.3165 0.3000 -0.0104 0.0203  -0.1117 725 ASN C O   
1334 C CB  . ASN B 19  ? 0.3658 0.3910 0.3756 -0.0145 0.0216  -0.1452 725 ASN C CB  
1335 C CG  . ASN B 19  ? 0.2922 0.3462 0.3000 -0.0197 0.0238  -0.1456 725 ASN C CG  
1336 O OD1 . ASN B 19  ? 0.3077 0.3690 0.3110 -0.0218 0.0242  -0.1370 725 ASN C OD1 
1337 N ND2 . ASN B 19  ? 0.2662 0.3375 0.2775 -0.0215 0.0251  -0.1560 725 ASN C ND2 
1338 N N   . GLU B 20  ? 0.3633 0.3666 0.3640 -0.0185 0.0212  -0.1286 726 GLU C N   
1339 C CA  . GLU B 20  ? 0.3235 0.3234 0.3199 -0.0221 0.0219  -0.1213 726 GLU C CA  
1340 C C   . GLU B 20  ? 0.3001 0.3259 0.2944 -0.0259 0.0234  -0.1174 726 GLU C C   
1341 O O   . GLU B 20  ? 0.3668 0.3924 0.3578 -0.0275 0.0239  -0.1101 726 GLU C O   
1342 C CB  . GLU B 20  ? 0.3263 0.3097 0.3238 -0.0275 0.0224  -0.1276 726 GLU C CB  
1343 C CG  . GLU B 20  ? 0.4701 0.4667 0.4722 -0.0348 0.0240  -0.1402 726 GLU C CG  
1344 C CD  . GLU B 20  ? 0.5803 0.5676 0.5879 -0.0331 0.0231  -0.1521 726 GLU C CD  
1345 O OE1 . GLU B 20  ? 0.6525 0.6249 0.6628 -0.0372 0.0234  -0.1597 726 GLU C OE1 
1346 O OE2 . GLU B 20  ? 0.5278 0.5220 0.5373 -0.0276 0.0222  -0.1538 726 GLU C OE2 
1347 N N   . THR B 21  ? 0.3422 0.3908 0.3382 -0.0269 0.0242  -0.1221 727 THR C N   
1348 C CA  . THR B 21  ? 0.3028 0.3768 0.2965 -0.0301 0.0251  -0.1185 727 THR C CA  
1349 C C   . THR B 21  ? 0.3179 0.4092 0.3096 -0.0257 0.0250  -0.1125 727 THR C C   
1350 O O   . THR B 21  ? 0.2908 0.4047 0.2802 -0.0274 0.0254  -0.1096 727 THR C O   
1351 C CB  . THR B 21  ? 0.2682 0.3587 0.2649 -0.0377 0.0265  -0.1307 727 THR C CB  
1352 O OG1 . THR B 21  ? 0.3007 0.4000 0.3003 -0.0371 0.0268  -0.1400 727 THR C OG1 
1353 C CG2 . THR B 21  ? 0.2968 0.3695 0.2962 -0.0431 0.0270  -0.1375 727 THR C CG2 
1354 N N   . THR B 22  ? 0.2865 0.3674 0.2791 -0.0201 0.0243  -0.1105 728 THR C N   
1355 C CA  . THR B 22  ? 0.2367 0.3335 0.2283 -0.0171 0.0247  -0.1065 728 THR C CA  
1356 C C   . THR B 22  ? 0.2878 0.3701 0.2787 -0.0103 0.0236  -0.0970 728 THR C C   
1357 O O   . THR B 22  ? 0.3064 0.3675 0.2996 -0.0073 0.0224  -0.0989 728 THR C O   
1358 C CB  . THR B 22  ? 0.3432 0.4501 0.3386 -0.0188 0.0259  -0.1188 728 THR C CB  
1359 O OG1 . THR B 22  ? 0.2824 0.4008 0.2793 -0.0253 0.0268  -0.1294 728 THR C OG1 
1360 C CG2 . THR B 22  ? 0.2858 0.4126 0.2792 -0.0173 0.0271  -0.1147 728 THR C CG2 
1361 N N   . ILE B 23  ? 0.2357 0.3292 0.2234 -0.0079 0.0238  -0.0868 729 ILE C N   
1362 C CA  . ILE B 23  ? 0.2593 0.3419 0.2469 -0.0020 0.0230  -0.0782 729 ILE C CA  
1363 C C   . ILE B 23  ? 0.2819 0.3813 0.2691 -0.0014 0.0245  -0.0754 729 ILE C C   
1364 O O   . ILE B 23  ? 0.2987 0.4182 0.2825 -0.0037 0.0254  -0.0723 729 ILE C O   
1365 C CB  . ILE B 23  ? 0.2981 0.3745 0.2822 0.0008  0.0218  -0.0663 729 ILE C CB  
1366 C CG1 . ILE B 23  ? 0.2694 0.3278 0.2533 0.0003  0.0207  -0.0677 729 ILE C CG1 
1367 C CG2 . ILE B 23  ? 0.3028 0.3715 0.2871 0.0065  0.0212  -0.0574 729 ILE C CG2 
1368 C CD1 . ILE B 23  ? 0.2787 0.3363 0.2592 0.0018  0.0201  -0.0580 729 ILE C CD1 
1369 N N   . MET B 24  ? 0.2469 0.3384 0.2375 0.0017  0.0246  -0.0764 730 MET C N   
1370 C CA  A MET B 24  ? 0.2892 0.3945 0.2799 0.0019  0.0266  -0.0735 730 MET C CA  
1371 C CA  B MET B 24  ? 0.2868 0.3924 0.2774 0.0019  0.0266  -0.0734 730 MET C CA  
1372 C C   . MET B 24  ? 0.3171 0.4158 0.3063 0.0060  0.0260  -0.0605 730 MET C C   
1373 O O   . MET B 24  ? 0.2899 0.3694 0.2807 0.0099  0.0241  -0.0575 730 MET C O   
1374 C CB  A MET B 24  ? 0.2997 0.4014 0.2964 0.0025  0.0273  -0.0836 730 MET C CB  
1375 C CB  B MET B 24  ? 0.3061 0.4092 0.3026 0.0022  0.0275  -0.0837 730 MET C CB  
1376 C CG  A MET B 24  ? 0.3488 0.4614 0.3467 0.0028  0.0296  -0.0808 730 MET C CG  
1377 C CG  B MET B 24  ? 0.3915 0.5131 0.3883 0.0006  0.0304  -0.0839 730 MET C CG  
1378 S SD  A MET B 24  ? 0.4554 0.5988 0.4495 -0.0028 0.0330  -0.0839 730 MET C SD  
1379 S SD  B MET B 24  ? 0.5858 0.6979 0.5907 0.0036  0.0308  -0.0907 730 MET C SD  
1380 C CE  A MET B 24  ? 0.3902 0.5358 0.3867 -0.0061 0.0323  -0.0996 730 MET C CE  
1381 C CE  B MET B 24  ? 0.4845 0.5716 0.4935 0.0069  0.0271  -0.0986 730 MET C CE  
1382 N N   . LEU B 25  ? 0.2878 0.4018 0.2736 0.0053  0.0276  -0.0527 731 LEU C N   
1383 C CA  . LEU B 25  ? 0.3167 0.4239 0.3021 0.0089  0.0274  -0.0409 731 LEU C CA  
1384 C C   . LEU B 25  ? 0.3161 0.4351 0.3019 0.0074  0.0302  -0.0386 731 LEU C C   
1385 O O   . LEU B 25  ? 0.2956 0.4326 0.2799 0.0035  0.0324  -0.0436 731 LEU C O   
1386 C CB  . LEU B 25  ? 0.2564 0.3659 0.2368 0.0106  0.0260  -0.0299 731 LEU C CB  
1387 C CG  . LEU B 25  ? 0.3123 0.4438 0.2870 0.0082  0.0268  -0.0251 731 LEU C CG  
1388 C CD1 . LEU B 25  ? 0.3986 0.5284 0.3701 0.0121  0.0254  -0.0115 731 LEU C CD1 
1389 C CD2 . LEU B 25  ? 0.3137 0.4551 0.2870 0.0047  0.0262  -0.0334 731 LEU C CD2 
1390 N N   . LYS B 26  ? 0.2733 0.3824 0.2614 0.0101  0.0304  -0.0313 732 LYS C N   
1391 C CA  . LYS B 26  ? 0.2800 0.3991 0.2684 0.0082  0.0336  -0.0272 732 LYS C CA  
1392 C C   . LYS B 26  ? 0.3065 0.4193 0.2928 0.0108  0.0332  -0.0130 732 LYS C C   
1393 O O   . LYS B 26  ? 0.3151 0.4115 0.3029 0.0149  0.0306  -0.0091 732 LYS C O   
1394 C CB  . LYS B 26  ? 0.2820 0.3949 0.2780 0.0081  0.0347  -0.0356 732 LYS C CB  
1395 C CG  . LYS B 26  ? 0.2852 0.3964 0.2852 0.0077  0.0338  -0.0502 732 LYS C CG  
1396 C CD  . LYS B 26  ? 0.3396 0.4480 0.3475 0.0081  0.0350  -0.0587 732 LYS C CD  
1397 C CE  . LYS B 26  ? 0.4314 0.5615 0.4399 0.0034  0.0390  -0.0649 732 LYS C CE  
1398 N NZ  . LYS B 26  ? 0.5235 0.6519 0.5410 0.0042  0.0398  -0.0757 732 LYS C NZ  
1399 N N   . TRP B 27  ? 0.2514 0.3768 0.2342 0.0084  0.0359  -0.0051 733 TRP C N   
1400 C CA  . TRP B 27  ? 0.2599 0.3786 0.2408 0.0108  0.0356  0.0088  733 TRP C CA  
1401 C C   . TRP B 27  ? 0.2964 0.4208 0.2776 0.0077  0.0394  0.0148  733 TRP C C   
1402 O O   . TRP B 27  ? 0.3345 0.4741 0.3151 0.0031  0.0428  0.0099  733 TRP C O   
1403 C CB  . TRP B 27  ? 0.2692 0.3955 0.2428 0.0126  0.0337  0.0174  733 TRP C CB  
1404 C CG  . TRP B 27  ? 0.2964 0.4464 0.2631 0.0087  0.0355  0.0183  733 TRP C CG  
1405 C CD1 . TRP B 27  ? 0.2853 0.4470 0.2466 0.0068  0.0378  0.0283  733 TRP C CD1 
1406 C CD2 . TRP B 27  ? 0.2909 0.4559 0.2550 0.0060  0.0352  0.0087  733 TRP C CD2 
1407 N NE1 . TRP B 27  ? 0.2595 0.4437 0.2144 0.0035  0.0388  0.0256  733 TRP C NE1 
1408 C CE2 . TRP B 27  ? 0.2745 0.4614 0.2315 0.0029  0.0372  0.0130  733 TRP C CE2 
1409 C CE3 . TRP B 27  ? 0.3260 0.4878 0.2930 0.0058  0.0335  -0.0030 733 TRP C CE3 
1410 C CZ2 . TRP B 27  ? 0.3646 0.5712 0.3178 -0.0003 0.0373  0.0050  733 TRP C CZ2 
1411 C CZ3 . TRP B 27  ? 0.3889 0.5689 0.3527 0.0022  0.0338  -0.0108 733 TRP C CZ3 
1412 C CH2 . TRP B 27  ? 0.3372 0.5398 0.2944 -0.0007 0.0356  -0.0072 733 TRP C CH2 
1413 N N   . MET B 28  ? 0.3143 0.4263 0.2969 0.0101  0.0391  0.0253  734 MET C N   
1414 C CA  . MET B 28  ? 0.3062 0.4215 0.2884 0.0070  0.0427  0.0337  734 MET C CA  
1415 C C   . MET B 28  ? 0.3397 0.4582 0.3142 0.0087  0.0420  0.0485  734 MET C C   
1416 O O   . MET B 28  ? 0.3471 0.4554 0.3208 0.0139  0.0384  0.0536  734 MET C O   
1417 C CB  . MET B 28  ? 0.3752 0.4723 0.3661 0.0081  0.0430  0.0338  734 MET C CB  
1418 C CG  . MET B 28  ? 0.4933 0.5878 0.4925 0.0068  0.0436  0.0198  734 MET C CG  
1419 S SD  . MET B 28  ? 1.6400 1.7567 1.6397 -0.0004 0.0491  0.0125  734 MET C SD  
1420 C CE  . MET B 28  ? 0.7097 0.8182 0.7213 0.0006  0.0484  -0.0032 734 MET C CE  
1421 N N   . TYR B 29  ? 0.3625 0.4962 0.3310 0.0044  0.0455  0.0551  735 TYR C N   
1422 C CA  . TYR B 29  ? 0.3571 0.4930 0.3182 0.0061  0.0450  0.0707  735 TYR C CA  
1423 C C   . TYR B 29  ? 0.4421 0.5840 0.4008 0.0006  0.0501  0.0786  735 TYR C C   
1424 O O   . TYR B 29  ? 0.4781 0.6368 0.4349 -0.0051 0.0539  0.0730  735 TYR C O   
1425 C CB  . TYR B 29  ? 0.2926 0.4458 0.2446 0.0075  0.0427  0.0724  735 TYR C CB  
1426 C CG  . TYR B 29  ? 0.3513 0.5076 0.2953 0.0097  0.0420  0.0890  735 TYR C CG  
1427 C CD1 . TYR B 29  ? 0.4247 0.5647 0.3701 0.0161  0.0385  0.0981  735 TYR C CD1 
1428 C CD2 . TYR B 29  ? 0.3892 0.5644 0.3242 0.0058  0.0448  0.0956  735 TYR C CD2 
1429 C CE1 . TYR B 29  ? 0.4672 0.6088 0.4058 0.0190  0.0374  0.1136  735 TYR C CE1 
1430 C CE2 . TYR B 29  ? 0.4476 0.6246 0.3746 0.0084  0.0438  0.1118  735 TYR C CE2 
1431 C CZ  . TYR B 29  ? 0.5075 0.6671 0.4366 0.0152  0.0399  0.1208  735 TYR C CZ  
1432 O OH  . TYR B 29  ? 0.4914 0.6517 0.4130 0.0186  0.0385  0.1369  735 TYR C OH  
1433 N N   . ILE B 30  ? 0.4147 0.5426 0.3740 0.0021  0.0503  0.0913  736 ILE C N   
1434 C CA  . ILE B 30  ? 0.4446 0.5747 0.4021 -0.0034 0.0553  0.1007  736 ILE C CA  
1435 C C   . ILE B 30  ? 0.4939 0.6297 0.4403 -0.0018 0.0547  0.1172  736 ILE C C   
1436 O O   . ILE B 30  ? 0.4967 0.6181 0.4428 0.0040  0.0512  0.1269  736 ILE C O   
1437 C CB  . ILE B 30  ? 0.4997 0.6076 0.4674 -0.0035 0.0563  0.1025  736 ILE C CB  
1438 C CG1 . ILE B 30  ? 0.5319 0.6346 0.5103 -0.0041 0.0561  0.0860  736 ILE C CG1 
1439 C CG2 . ILE B 30  ? 0.4274 0.5363 0.3937 -0.0101 0.0620  0.1128  736 ILE C CG2 
1440 C CD1 . ILE B 30  ? 0.6107 0.6953 0.5996 -0.0052 0.0575  0.0856  736 ILE C CD1 
1441 N N   . PRO B 31  ? 0.5018 0.6594 0.4387 -0.0064 0.0578  0.1202  737 PRO C N   
1442 C CA  . PRO B 31  ? 0.4533 0.6195 0.3780 -0.0047 0.0569  0.1359  737 PRO C CA  
1443 C C   . PRO B 31  ? 0.5535 0.7010 0.4785 -0.0039 0.0578  0.1522  737 PRO C C   
1444 O O   . PRO B 31  ? 0.5816 0.7245 0.5004 0.0018  0.0543  0.1651  737 PRO C O   
1445 C CB  . PRO B 31  ? 0.4816 0.6729 0.3982 -0.0121 0.0619  0.1344  737 PRO C CB  
1446 C CG  . PRO B 31  ? 0.4425 0.6420 0.3664 -0.0152 0.0632  0.1149  737 PRO C CG  
1447 C CD  . PRO B 31  ? 0.4462 0.6224 0.3834 -0.0133 0.0622  0.1083  737 PRO C CD  
1448 N N   . ALA B 32  ? 0.5798 0.7164 0.5124 -0.0093 0.0624  0.1510  738 ALA C N   
1449 C CA  . ALA B 32  ? 0.5790 0.6964 0.5133 -0.0098 0.0640  0.1651  738 ALA C CA  
1450 C C   . ALA B 32  ? 0.6735 0.7687 0.6127 -0.0007 0.0581  0.1696  738 ALA C C   
1451 O O   . ALA B 32  ? 0.7854 0.8655 0.7235 0.0012  0.0578  0.1837  738 ALA C O   
1452 C CB  . ALA B 32  ? 0.4549 0.5651 0.3992 -0.0174 0.0697  0.1595  738 ALA C CB  
1453 N N   . SER B 33  ? 0.6112 0.7043 0.5556 0.0047  0.0535  0.1575  739 SER C N   
1454 C CA  . SER B 33  ? 0.6422 0.7161 0.5918 0.0132  0.0481  0.1594  739 SER C CA  
1455 C C   . SER B 33  ? 0.6764 0.7545 0.6168 0.0202  0.0437  0.1715  739 SER C C   
1456 O O   . SER B 33  ? 0.7127 0.7759 0.6564 0.0278  0.0393  0.1757  739 SER C O   
1457 C CB  . SER B 33  ? 0.6071 0.6788 0.5643 0.0163  0.0450  0.1430  739 SER C CB  
1458 O OG  . SER B 33  ? 0.5825 0.6725 0.5333 0.0183  0.0424  0.1376  739 SER C OG  
1459 N N   . ASN B 34  ? 0.6519 0.7515 0.5809 0.0180  0.0447  0.1763  740 ASN C N   
1460 C CA  . ASN B 34  ? 0.6921 0.7983 0.6113 0.0242  0.0407  0.1891  740 ASN C CA  
1461 C C   . ASN B 34  ? 0.8198 0.9359 0.7277 0.0195  0.0444  0.2036  740 ASN C C   
1462 O O   . ASN B 34  ? 0.8439 0.9757 0.7406 0.0223  0.0422  0.2118  740 ASN C O   
1463 C CB  . ASN B 34  ? 0.6379 0.7630 0.5533 0.0280  0.0365  0.1803  740 ASN C CB  
1464 C CG  . ASN B 34  ? 0.6243 0.7376 0.5493 0.0341  0.0321  0.1701  740 ASN C CG  
1465 O OD1 . ASN B 34  ? 0.5346 0.6330 0.4626 0.0415  0.0284  0.1768  740 ASN C OD1 
1466 N ND2 . ASN B 34  ? 0.6167 0.7365 0.5463 0.0312  0.0327  0.1540  740 ASN C ND2 
1475 N N   . ASN B 36  ? 0.8373 0.9924 0.7160 0.0025  0.0565  0.2279  742 ASN C N   
1476 C CA  . ASN B 36  ? 0.7525 0.9200 0.6377 -0.0032 0.0594  0.2084  742 ASN C CA  
1477 C C   . ASN B 36  ? 0.6571 0.8497 0.5341 0.0000  0.0556  0.2023  742 ASN C C   
1478 O O   . ASN B 36  ? 0.5879 0.8041 0.4582 -0.0057 0.0588  0.1966  742 ASN C O   
1479 C CB  . ASN B 36  ? 0.7943 0.9710 0.6773 -0.0143 0.0677  0.2087  742 ASN C CB  
1480 C CG  . ASN B 36  ? 0.8127 0.9982 0.7051 -0.0198 0.0709  0.1882  742 ASN C CG  
1481 O OD1 . ASN B 36  ? 0.9115 1.1112 0.8043 -0.0178 0.0682  0.1749  742 ASN C OD1 
1482 N ND2 . ASN B 36  ? 0.6776 0.8546 0.5781 -0.0270 0.0767  0.1855  742 ASN C ND2 
1483 N N   . THR B 37  ? 0.6705 0.8581 0.5483 0.0093  0.0487  0.2034  743 THR C N   
1484 C CA  . THR B 37  ? 0.6679 0.8773 0.5365 0.0140  0.0439  0.2031  743 THR C CA  
1485 C C   . THR B 37  ? 0.6384 0.8696 0.5080 0.0101  0.0445  0.1845  743 THR C C   
1486 O O   . THR B 37  ? 0.6420 0.8658 0.5226 0.0086  0.0452  0.1695  743 THR C O   
1487 C CB  . THR B 37  ? 0.6560 0.8535 0.5279 0.0249  0.0365  0.2069  743 THR C CB  
1488 O OG1 . THR B 37  ? 0.6569 0.8771 0.5198 0.0293  0.0318  0.2078  743 THR C OG1 
1489 C CG2 . THR B 37  ? 0.6145 0.7983 0.5005 0.0268  0.0349  0.1916  743 THR C CG2 
1490 N N   . PRO B 38  ? 0.6654 0.9236 0.5231 0.0088  0.0441  0.1855  744 PRO C N   
1491 C CA  . PRO B 38  ? 0.6574 0.9386 0.5148 0.0051  0.0446  0.1682  744 PRO C CA  
1492 C C   . PRO B 38  ? 0.6907 0.9681 0.5569 0.0103  0.0393  0.1556  744 PRO C C   
1493 O O   . PRO B 38  ? 0.7066 0.9733 0.5745 0.0181  0.0342  0.1623  744 PRO C O   
1494 C CB  . PRO B 38  ? 0.6214 0.9297 0.4633 0.0054  0.0433  0.1763  744 PRO C CB  
1495 C CG  . PRO B 38  ? 0.6052 0.9019 0.4411 0.0127  0.0394  0.1966  744 PRO C CG  
1496 C CD  . PRO B 38  ? 0.6145 0.8831 0.4578 0.0108  0.0432  0.2036  744 PRO C CD  
1497 N N   . ILE B 39  ? 0.6588 0.9449 0.5307 0.0060  0.0408  0.1373  745 ILE C N   
1498 C CA  . ILE B 39  ? 0.6282 0.9116 0.5081 0.0095  0.0367  0.1243  745 ILE C CA  
1499 C C   . ILE B 39  ? 0.6761 0.9868 0.5517 0.0063  0.0362  0.1116  745 ILE C C   
1500 O O   . ILE B 39  ? 0.7410 1.0644 0.6155 -0.0004 0.0406  0.1028  745 ILE C O   
1501 C CB  . ILE B 39  ? 0.6119 0.8749 0.5049 0.0075  0.0388  0.1126  745 ILE C CB  
1502 C CG1 . ILE B 39  ? 0.5608 0.7967 0.4592 0.0105  0.0391  0.1234  745 ILE C CG1 
1503 C CG2 . ILE B 39  ? 0.6661 0.9276 0.5660 0.0099  0.0351  0.0988  745 ILE C CG2 
1504 C CD1 . ILE B 39  ? 0.4717 0.6953 0.3709 0.0192  0.0335  0.1326  745 ILE C CD1 
1505 N N   . HIS B 40  ? 0.6473 0.9679 0.5212 0.0109  0.0309  0.1100  746 HIS C N   
1506 C CA  . HIS B 40  ? 0.6272 0.9734 0.4980 0.0078  0.0300  0.0969  746 HIS C CA  
1507 C C   . HIS B 40  ? 0.5824 0.9222 0.4642 0.0044  0.0311  0.0778  746 HIS C C   
1508 O O   . HIS B 40  ? 0.5908 0.9484 0.4720 -0.0006 0.0326  0.0643  746 HIS C O   
1509 C CB  . HIS B 40  ? 0.6912 1.0514 0.5574 0.0136  0.0239  0.1010  746 HIS C CB  
1510 C CG  . HIS B 40  ? 0.7883 1.1545 0.6435 0.0184  0.0217  0.1202  746 HIS C CG  
1511 N ND1 . HIS B 40  ? 0.8059 1.1770 0.6517 0.0152  0.0256  0.1308  746 HIS C ND1 
1512 C CD2 . HIS B 40  ? 0.8119 1.1801 0.6638 0.0264  0.0160  0.1309  746 HIS C CD2 
1513 C CE1 . HIS B 40  ? 0.8439 1.2183 0.6807 0.0210  0.0222  0.1480  746 HIS C CE1 
1514 N NE2 . HIS B 40  ? 0.8529 1.2257 0.6934 0.0283  0.0162  0.1481  746 HIS C NE2 
1515 N N   . GLY B 41  ? 0.4256 0.7399 0.3174 0.0072  0.0302  0.0764  747 GLY C N   
1516 C CA  . GLY B 41  ? 0.3708 0.6761 0.2725 0.0045  0.0311  0.0598  747 GLY C CA  
1517 C C   . GLY B 41  ? 0.3849 0.6640 0.2951 0.0093  0.0288  0.0616  747 GLY C C   
1518 O O   . GLY B 41  ? 0.3279 0.5946 0.2372 0.0142  0.0274  0.0752  747 GLY C O   
1519 N N   . PHE B 42  ? 0.3098 0.5805 0.2281 0.0081  0.0284  0.0480  748 PHE C N   
1520 C CA  . PHE B 42  ? 0.3106 0.5583 0.2363 0.0125  0.0261  0.0484  748 PHE C CA  
1521 C C   . PHE B 42  ? 0.3949 0.6485 0.3228 0.0132  0.0229  0.0401  748 PHE C C   
1522 O O   . PHE B 42  ? 0.3903 0.6601 0.3171 0.0089  0.0233  0.0291  748 PHE C O   
1523 C CB  . PHE B 42  ? 0.3091 0.5372 0.2429 0.0104  0.0287  0.0406  748 PHE C CB  
1524 C CG  . PHE B 42  ? 0.3345 0.5586 0.2676 0.0083  0.0325  0.0464  748 PHE C CG  
1525 C CD1 . PHE B 42  ? 0.3595 0.5962 0.2916 0.0025  0.0363  0.0386  748 PHE C CD1 
1526 C CD2 . PHE B 42  ? 0.4536 0.6619 0.3873 0.0119  0.0324  0.0592  748 PHE C CD2 
1527 C CE1 . PHE B 42  ? 0.3878 0.6223 0.3197 -0.0001 0.0403  0.0437  748 PHE C CE1 
1528 C CE2 . PHE B 42  ? 0.4711 0.6758 0.4047 0.0091  0.0362  0.0645  748 PHE C CE2 
1529 C CZ  . PHE B 42  ? 0.4313 0.6496 0.3640 0.0029  0.0403  0.0569  748 PHE C CZ  
1530 N N   . TYR B 43  ? 0.3889 0.6297 0.3200 0.0186  0.0199  0.0450  749 TYR C N   
1531 C CA  . TYR B 43  ? 0.2773 0.5198 0.2120 0.0188  0.0175  0.0367  749 TYR C CA  
1532 C C   . TYR B 43  ? 0.3036 0.5223 0.2461 0.0186  0.0184  0.0299  749 TYR C C   
1533 O O   . TYR B 43  ? 0.2934 0.4929 0.2385 0.0225  0.0183  0.0368  749 TYR C O   
1534 C CB  . TYR B 43  ? 0.3144 0.5608 0.2476 0.0251  0.0136  0.0462  749 TYR C CB  
1535 C CG  . TYR B 43  ? 0.3957 0.6676 0.3211 0.0261  0.0116  0.0520  749 TYR C CG  
1536 C CD1 . TYR B 43  ? 0.4248 0.6979 0.3460 0.0327  0.0090  0.0669  749 TYR C CD1 
1537 C CD2 . TYR B 43  ? 0.4382 0.7331 0.3606 0.0208  0.0119  0.0425  749 TYR C CD2 
1538 C CE1 . TYR B 43  ? 0.4740 0.7708 0.3875 0.0343  0.0067  0.0730  749 TYR C CE1 
1539 C CE2 . TYR B 43  ? 0.5010 0.8207 0.4158 0.0219  0.0097  0.0477  749 TYR C CE2 
1540 C CZ  . TYR B 43  ? 0.5141 0.8347 0.4242 0.0289  0.0070  0.0633  749 TYR C CZ  
1541 O OH  . TYR B 43  ? 0.5297 0.8749 0.4316 0.0307  0.0043  0.0690  749 TYR C OH  
1542 N N   . ILE B 44  ? 0.3179 0.5373 0.2637 0.0141  0.0191  0.0165  750 ILE C N   
1543 C CA  . ILE B 44  ? 0.3641 0.5614 0.3164 0.0141  0.0195  0.0100  750 ILE C CA  
1544 C C   . ILE B 44  ? 0.3854 0.5827 0.3398 0.0145  0.0174  0.0062  750 ILE C C   
1545 O O   . ILE B 44  ? 0.3424 0.5543 0.2965 0.0102  0.0173  -0.0023 750 ILE C O   
1546 C CB  . ILE B 44  ? 0.3708 0.5647 0.3261 0.0089  0.0221  -0.0025 750 ILE C CB  
1547 C CG1 . ILE B 44  ? 0.3861 0.5763 0.3412 0.0087  0.0245  0.0007  750 ILE C CG1 
1548 C CG2 . ILE B 44  ? 0.4270 0.6001 0.3880 0.0090  0.0217  -0.0095 750 ILE C CG2 
1549 C CD1 . ILE B 44  ? 0.4388 0.6510 0.3878 0.0064  0.0260  0.0042  750 ILE C CD1 
1550 N N   . TYR B 45  ? 0.2891 0.4708 0.2459 0.0193  0.0159  0.0120  751 TYR C N   
1551 C CA  . TYR B 45  ? 0.2712 0.4526 0.2301 0.0201  0.0143  0.0098  751 TYR C CA  
1552 C C   . TYR B 45  ? 0.2208 0.3832 0.1839 0.0178  0.0153  0.0015  751 TYR C C   
1553 O O   . TYR B 45  ? 0.2481 0.3920 0.2131 0.0195  0.0161  0.0023  751 TYR C O   
1554 C CB  . TYR B 45  ? 0.2968 0.4733 0.2557 0.0273  0.0121  0.0212  751 TYR C CB  
1555 C CG  . TYR B 45  ? 0.3225 0.5160 0.2771 0.0308  0.0104  0.0309  751 TYR C CG  
1556 C CD1 . TYR B 45  ? 0.3259 0.5375 0.2794 0.0325  0.0079  0.0325  751 TYR C CD1 
1557 C CD2 . TYR B 45  ? 0.3050 0.4967 0.2566 0.0323  0.0111  0.0387  751 TYR C CD2 
1558 C CE1 . TYR B 45  ? 0.3153 0.5423 0.2643 0.0364  0.0058  0.0419  751 TYR C CE1 
1559 C CE2 . TYR B 45  ? 0.2902 0.4964 0.2367 0.0356  0.0095  0.0487  751 TYR C CE2 
1560 C CZ  . TYR B 45  ? 0.3617 0.5854 0.3068 0.0381  0.0065  0.0504  751 TYR C CZ  
1561 O OH  . TYR B 45  ? 0.3772 0.6154 0.3168 0.0421  0.0043  0.0608  751 TYR C OH  
1562 N N   . TYR B 46  ? 0.1912 0.3579 0.1558 0.0140  0.0153  -0.0061 752 TYR C N   
1563 C CA  . TYR B 46  ? 0.2248 0.3725 0.1924 0.0119  0.0163  -0.0128 752 TYR C CA  
1564 C C   . TYR B 46  ? 0.2851 0.4361 0.2540 0.0102  0.0158  -0.0149 752 TYR C C   
1565 O O   . TYR B 46  ? 0.3145 0.4853 0.2831 0.0074  0.0154  -0.0174 752 TYR C O   
1566 C CB  . TYR B 46  ? 0.2443 0.3886 0.2131 0.0063  0.0180  -0.0237 752 TYR C CB  
1567 C CG  . TYR B 46  ? 0.2825 0.4491 0.2504 0.0008  0.0186  -0.0309 752 TYR C CG  
1568 C CD1 . TYR B 46  ? 0.2678 0.4390 0.2377 -0.0051 0.0192  -0.0404 752 TYR C CD1 
1569 C CD2 . TYR B 46  ? 0.3140 0.4975 0.2790 0.0011  0.0187  -0.0283 752 TYR C CD2 
1570 C CE1 . TYR B 46  ? 0.3310 0.5234 0.3005 -0.0103 0.0195  -0.0481 752 TYR C CE1 
1571 C CE2 . TYR B 46  ? 0.3598 0.5651 0.3234 -0.0038 0.0191  -0.0354 752 TYR C CE2 
1572 C CZ  . TYR B 46  ? 0.3290 0.5389 0.2952 -0.0093 0.0194  -0.0457 752 TYR C CZ  
1573 O OH  . TYR B 46  ? 0.3643 0.5966 0.3296 -0.0143 0.0196  -0.0537 752 TYR C OH  
1574 N N   . ARG B 47  ? 0.2576 0.3898 0.2279 0.0120  0.0160  -0.0141 753 ARG C N   
1575 C CA  . ARG B 47  ? 0.3167 0.4504 0.2881 0.0105  0.0162  -0.0153 753 ARG C CA  
1576 C C   . ARG B 47  ? 0.2644 0.3763 0.2364 0.0082  0.0176  -0.0199 753 ARG C C   
1577 O O   . ARG B 47  ? 0.2566 0.3503 0.2282 0.0115  0.0173  -0.0178 753 ARG C O   
1578 C CB  . ARG B 47  ? 0.3247 0.4603 0.2962 0.0177  0.0145  -0.0055 753 ARG C CB  
1579 C CG  . ARG B 47  ? 0.3380 0.4715 0.3110 0.0174  0.0149  -0.0060 753 ARG C CG  
1580 C CD  . ARG B 47  ? 0.2491 0.3833 0.2226 0.0256  0.0131  0.0031  753 ARG C CD  
1581 N NE  . ARG B 47  ? 0.1881 0.3013 0.1611 0.0309  0.0127  0.0079  753 ARG C NE  
1582 C CZ  . ARG B 47  ? 0.2473 0.3569 0.2212 0.0384  0.0112  0.0153  753 ARG C CZ  
1583 N NH1 . ARG B 47  ? 0.2245 0.3498 0.1998 0.0420  0.0097  0.0193  753 ARG C NH1 
1584 N NH2 . ARG B 47  ? 0.2345 0.3252 0.2084 0.0424  0.0109  0.0184  753 ARG C NH2 
1585 N N   . PRO B 48  ? 0.2928 0.4063 0.2658 0.0022  0.0190  -0.0260 754 PRO C N   
1586 C CA  . PRO B 48  ? 0.2908 0.3820 0.2633 0.0006  0.0202  -0.0285 754 PRO C CA  
1587 C C   . PRO B 48  ? 0.3142 0.3932 0.2853 0.0074  0.0193  -0.0205 754 PRO C C   
1588 O O   . PRO B 48  ? 0.2599 0.3500 0.2316 0.0109  0.0186  -0.0151 754 PRO C O   
1589 C CB  . PRO B 48  ? 0.2378 0.3361 0.2115 -0.0069 0.0221  -0.0344 754 PRO C CB  
1590 C CG  . PRO B 48  ? 0.2840 0.4067 0.2596 -0.0107 0.0218  -0.0390 754 PRO C CG  
1591 C CD  . PRO B 48  ? 0.2473 0.3818 0.2219 -0.0036 0.0196  -0.0313 754 PRO C CD  
1592 N N   . THR B 49  ? 0.2579 0.3150 0.2275 0.0095  0.0192  -0.0202 755 THR C N   
1593 C CA  . THR B 49  ? 0.1968 0.2410 0.1652 0.0162  0.0182  -0.0136 755 THR C CA  
1594 C C   . THR B 49  ? 0.2550 0.2994 0.2223 0.0158  0.0193  -0.0117 755 THR C C   
1595 O O   . THR B 49  ? 0.2445 0.2868 0.2116 0.0217  0.0184  -0.0060 755 THR C O   
1596 C CB  . THR B 49  ? 0.2036 0.2256 0.1707 0.0182  0.0175  -0.0150 755 THR C CB  
1597 O OG1 . THR B 49  ? 0.2318 0.2565 0.2008 0.0193  0.0167  -0.0163 755 THR C OG1 
1598 C CG2 . THR B 49  ? 0.2044 0.2134 0.1700 0.0248  0.0163  -0.0092 755 THR C CG2 
1599 N N   . ASP B 50  ? 0.2810 0.3285 0.2480 0.0086  0.0214  -0.0169 756 ASP C N   
1600 C CA  . ASP B 50  ? 0.2982 0.3493 0.2646 0.0068  0.0231  -0.0158 756 ASP C CA  
1601 C C   . ASP B 50  ? 0.2735 0.3462 0.2430 0.0101  0.0224  -0.0120 756 ASP C C   
1602 O O   . ASP B 50  ? 0.2559 0.3315 0.2255 0.0118  0.0233  -0.0096 756 ASP C O   
1603 C CB  . ASP B 50  ? 0.3152 0.3664 0.2815 -0.0029 0.0259  -0.0225 756 ASP C CB  
1604 C CG  . ASP B 50  ? 0.3575 0.3840 0.3197 -0.0052 0.0269  -0.0241 756 ASP C CG  
1605 O OD1 . ASP B 50  ? 0.2933 0.3041 0.2528 0.0011  0.0252  -0.0204 756 ASP C OD1 
1606 O OD2 . ASP B 50  ? 0.3137 0.3363 0.2753 -0.0131 0.0293  -0.0288 756 ASP C OD2 
1607 N N   . SER B 51  ? 0.2080 0.2964 0.1797 0.0115  0.0208  -0.0115 757 SER C N   
1608 C CA  . SER B 51  ? 0.2607 0.3689 0.2352 0.0159  0.0194  -0.0072 757 SER C CA  
1609 C C   . SER B 51  ? 0.2811 0.3835 0.2554 0.0256  0.0169  0.0007  757 SER C C   
1610 O O   . SER B 51  ? 0.2761 0.3693 0.2493 0.0279  0.0158  0.0024  757 SER C O   
1611 C CB  . SER B 51  ? 0.2663 0.3966 0.2426 0.0126  0.0186  -0.0102 757 SER C CB  
1612 O OG  . SER B 51  ? 0.2990 0.4465 0.2772 0.0189  0.0163  -0.0045 757 SER C OG  
1613 N N   . ASP B 52  ? 0.2932 0.4015 0.2693 0.0311  0.0162  0.0050  758 ASP C N   
1614 C CA  . ASP B 52  ? 0.2726 0.3765 0.2495 0.0404  0.0137  0.0123  758 ASP C CA  
1615 C C   . ASP B 52  ? 0.3285 0.4534 0.3082 0.0448  0.0114  0.0165  758 ASP C C   
1616 O O   . ASP B 52  ? 0.3811 0.5045 0.3623 0.0529  0.0093  0.0229  758 ASP C O   
1617 C CB  . ASP B 52  ? 0.2406 0.3327 0.2176 0.0449  0.0142  0.0140  758 ASP C CB  
1618 C CG  . ASP B 52  ? 0.2352 0.3051 0.2085 0.0422  0.0156  0.0113  758 ASP C CG  
1619 O OD1 . ASP B 52  ? 0.2773 0.3382 0.2494 0.0444  0.0165  0.0116  758 ASP C OD1 
1620 O OD2 . ASP B 52  ? 0.2757 0.3377 0.2472 0.0384  0.0158  0.0088  758 ASP C OD2 
1621 N N   . ASN B 53  ? 0.3026 0.4465 0.2830 0.0396  0.0117  0.0128  759 ASN C N   
1622 C CA  . ASN B 53  ? 0.3294 0.4958 0.3118 0.0433  0.0091  0.0162  759 ASN C CA  
1623 C C   . ASN B 53  ? 0.3003 0.4699 0.2801 0.0439  0.0075  0.0195  759 ASN C C   
1624 O O   . ASN B 53  ? 0.2636 0.4353 0.2416 0.0370  0.0088  0.0142  759 ASN C O   
1625 C CB  . ASN B 53  ? 0.3493 0.5366 0.3340 0.0368  0.0102  0.0095  759 ASN C CB  
1626 C CG  . ASN B 53  ? 0.3604 0.5728 0.3479 0.0415  0.0072  0.0125  759 ASN C CG  
1627 O OD1 . ASN B 53  ? 0.4054 0.6208 0.3916 0.0482  0.0042  0.0196  759 ASN C OD1 
1628 N ND2 . ASN B 53  ? 0.3699 0.6007 0.3611 0.0379  0.0079  0.0072  759 ASN C ND2 
1629 N N   . ASP B 54  ? 0.2976 0.4675 0.2774 0.0520  0.0049  0.0280  760 ASP C N   
1630 C CA  . ASP B 54  ? 0.4302 0.6016 0.4068 0.0525  0.0038  0.0323  760 ASP C CA  
1631 C C   . ASP B 54  ? 0.4224 0.6186 0.3975 0.0490  0.0028  0.0303  760 ASP C C   
1632 O O   . ASP B 54  ? 0.4545 0.6551 0.4261 0.0481  0.0023  0.0327  760 ASP C O   
1633 C CB  . ASP B 54  ? 0.4305 0.5939 0.4073 0.0616  0.0015  0.0428  760 ASP C CB  
1634 C CG  . ASP B 54  ? 0.4694 0.6069 0.4468 0.0634  0.0027  0.0439  760 ASP C CG  
1635 O OD1 . ASP B 54  ? 0.4110 0.5370 0.3879 0.0581  0.0051  0.0372  760 ASP C OD1 
1636 O OD2 . ASP B 54  ? 0.4925 0.6209 0.4708 0.0703  0.0012  0.0515  760 ASP C OD2 
1637 N N   . SER B 55  ? 0.3912 0.6047 0.3690 0.0467  0.0025  0.0254  761 SER C N   
1638 C CA  A SER B 55  ? 0.3704 0.6092 0.3473 0.0430  0.0014  0.0219  761 SER C CA  
1639 C CA  B SER B 55  ? 0.3698 0.6087 0.3467 0.0430  0.0014  0.0218  761 SER C CA  
1640 C C   . SER B 55  ? 0.3527 0.5922 0.3288 0.0324  0.0043  0.0113  761 SER C C   
1641 O O   . SER B 55  ? 0.3944 0.6536 0.3696 0.0282  0.0037  0.0069  761 SER C O   
1642 C CB  A SER B 55  ? 0.3474 0.6070 0.3285 0.0454  -0.0005 0.0208  761 SER C CB  
1643 C CB  B SER B 55  ? 0.3480 0.6070 0.3293 0.0450  -0.0003 0.0203  761 SER C CB  
1644 O OG  A SER B 55  ? 0.3376 0.6000 0.3195 0.0560  -0.0039 0.0305  761 SER C OG  
1645 O OG  B SER B 55  ? 0.3186 0.5744 0.3034 0.0385  0.0028  0.0117  761 SER C OG  
1646 N N   . ASP B 56  ? 0.3005 0.5184 0.2770 0.0285  0.0072  0.0071  762 ASP C N   
1647 C CA  . ASP B 56  ? 0.2795 0.4947 0.2560 0.0188  0.0099  -0.0033 762 ASP C CA  
1648 C C   . ASP B 56  ? 0.3743 0.5809 0.3475 0.0166  0.0107  -0.0046 762 ASP C C   
1649 O O   . ASP B 56  ? 0.3785 0.5780 0.3520 0.0097  0.0129  -0.0130 762 ASP C O   
1650 C CB  . ASP B 56  ? 0.2961 0.4927 0.2744 0.0154  0.0126  -0.0074 762 ASP C CB  
1651 C CG  . ASP B 56  ? 0.4163 0.6253 0.3983 0.0134  0.0133  -0.0104 762 ASP C CG  
1652 O OD1 . ASP B 56  ? 0.4317 0.6652 0.4157 0.0127  0.0118  -0.0119 762 ASP C OD1 
1653 O OD2 . ASP B 56  ? 0.3467 0.5416 0.3295 0.0122  0.0154  -0.0113 762 ASP C OD2 
1654 N N   . TYR B 57  ? 0.2560 0.4624 0.2264 0.0225  0.0090  0.0036  763 TYR C N   
1655 C CA  . TYR B 57  ? 0.3014 0.5021 0.2691 0.0203  0.0101  0.0024  763 TYR C CA  
1656 C C   . TYR B 57  ? 0.3470 0.5705 0.3125 0.0156  0.0098  -0.0027 763 TYR C C   
1657 O O   . TYR B 57  ? 0.3345 0.5784 0.2984 0.0183  0.0076  0.0017  763 TYR C O   
1658 C CB  . TYR B 57  ? 0.3029 0.4958 0.2684 0.0274  0.0089  0.0133  763 TYR C CB  
1659 C CG  . TYR B 57  ? 0.3291 0.4961 0.2961 0.0310  0.0096  0.0165  763 TYR C CG  
1660 C CD1 . TYR B 57  ? 0.3677 0.5276 0.3367 0.0373  0.0082  0.0227  763 TYR C CD1 
1661 C CD2 . TYR B 57  ? 0.2854 0.4365 0.2524 0.0285  0.0114  0.0131  763 TYR C CD2 
1662 C CE1 . TYR B 57  ? 0.3349 0.4722 0.3053 0.0406  0.0087  0.0250  763 TYR C CE1 
1663 C CE2 . TYR B 57  ? 0.2305 0.3593 0.1990 0.0320  0.0116  0.0157  763 TYR C CE2 
1664 C CZ  . TYR B 57  ? 0.2611 0.3831 0.2311 0.0379  0.0103  0.0216  763 TYR C CZ  
1665 O OH  . TYR B 57  ? 0.2802 0.3811 0.2516 0.0413  0.0104  0.0234  763 TYR C OH  
1666 N N   . LYS B 58  ? 0.2291 0.4497 0.1947 0.0090  0.0120  -0.0120 764 LYS C N   
1667 C CA  . LYS B 58  ? 0.3103 0.5514 0.2734 0.0049  0.0120  -0.0169 764 LYS C CA  
1668 C C   . LYS B 58  ? 0.3457 0.5841 0.3048 0.0080  0.0122  -0.0106 764 LYS C C   
1669 O O   . LYS B 58  ? 0.2745 0.4922 0.2342 0.0112  0.0130  -0.0059 764 LYS C O   
1670 C CB  . LYS B 58  ? 0.4203 0.6611 0.3860 -0.0036 0.0142  -0.0309 764 LYS C CB  
1671 C CG  . LYS B 58  ? 0.5432 0.7947 0.5123 -0.0086 0.0141  -0.0382 764 LYS C CG  
1672 C CD  . LYS B 58  ? 0.6970 0.9411 0.6693 -0.0170 0.0166  -0.0515 764 LYS C CD  
1673 C CE  . LYS B 58  ? 0.8005 1.0473 0.7771 -0.0221 0.0173  -0.0572 764 LYS C CE  
1674 N NZ  . LYS B 58  ? 0.8348 1.0653 0.8146 -0.0295 0.0199  -0.0679 764 LYS C NZ  
1675 N N   . LYS B 59  ? 0.3136 0.5735 0.2687 0.0067  0.0117  -0.0107 765 LYS C N   
1676 C CA  . LYS B 59  ? 0.4041 0.6652 0.3544 0.0093  0.0121  -0.0032 765 LYS C CA  
1677 C C   . LYS B 59  ? 0.4349 0.7088 0.3831 0.0033  0.0141  -0.0121 765 LYS C C   
1678 O O   . LYS B 59  ? 0.4581 0.7523 0.4055 -0.0010 0.0136  -0.0201 765 LYS C O   
1679 C CB  . LYS B 59  ? 0.4445 0.7210 0.3902 0.0153  0.0091  0.0089  765 LYS C CB  
1680 C CG  . LYS B 59  ? 0.4821 0.7543 0.4230 0.0193  0.0095  0.0205  765 LYS C CG  
1681 C CD  . LYS B 59  ? 0.5216 0.8052 0.4584 0.0262  0.0061  0.0334  765 LYS C CD  
1682 C CE  . LYS B 59  ? 0.5691 0.8831 0.5015 0.0245  0.0040  0.0307  765 LYS C CE  
1683 N NZ  . LYS B 59  ? 0.6061 0.9315 0.5340 0.0321  0.0001  0.0439  765 LYS C NZ  
1684 N N   . ASP B 60  ? 0.4267 0.6892 0.3743 0.0030  0.0164  -0.0117 766 ASP C N   
1685 C CA  . ASP B 60  ? 0.4728 0.7483 0.4179 -0.0019 0.0186  -0.0190 766 ASP C CA  
1686 C C   . ASP B 60  ? 0.6060 0.8907 0.5445 0.0009  0.0190  -0.0078 766 ASP C C   
1687 O O   . ASP B 60  ? 0.6928 0.9682 0.6298 0.0065  0.0179  0.0052  766 ASP C O   
1688 C CB  . ASP B 60  ? 0.4996 0.7572 0.4497 -0.0049 0.0213  -0.0286 766 ASP C CB  
1689 C CG  . ASP B 60  ? 0.4405 0.6959 0.3957 -0.0101 0.0215  -0.0429 766 ASP C CG  
1690 O OD1 . ASP B 60  ? 0.3520 0.6170 0.3075 -0.0115 0.0199  -0.0451 766 ASP C OD1 
1691 O OD2 . ASP B 60  ? 0.4762 0.7198 0.4351 -0.0127 0.0234  -0.0520 766 ASP C OD2 
1692 N N   . MET B 61  ? 0.5874 0.8900 0.5221 -0.0032 0.0208  -0.0131 767 MET C N   
1693 C CA  . MET B 61  ? 0.5168 0.8321 0.4439 -0.0018 0.0216  -0.0029 767 MET C CA  
1694 C C   . MET B 61  ? 0.4780 0.7949 0.4049 -0.0063 0.0256  -0.0097 767 MET C C   
1695 O O   . MET B 61  ? 0.3887 0.7169 0.3171 -0.0113 0.0269  -0.0236 767 MET C O   
1696 C CB  . MET B 61  ? 0.6057 0.9497 0.5259 -0.0020 0.0191  -0.0015 767 MET C CB  
1697 C CG  . MET B 61  ? 0.7210 1.0836 0.6318 -0.0024 0.0203  0.0058  767 MET C CG  
1698 S SD  . MET B 61  ? 1.7436 2.1418 1.6470 -0.0030 0.0169  0.0041  767 MET C SD  
1699 C CE  . MET B 61  ? 1.0288 1.4437 0.9195 -0.0024 0.0184  0.0167  767 MET C CE  
1700 N N   . VAL B 62  ? 0.4883 0.7939 0.4141 -0.0045 0.0277  -0.0006 768 VAL C N   
1701 C CA  . VAL B 62  ? 0.4962 0.8041 0.4224 -0.0085 0.0319  -0.0061 768 VAL C CA  
1702 C C   . VAL B 62  ? 0.4833 0.8009 0.4013 -0.0079 0.0337  0.0074  768 VAL C C   
1703 O O   . VAL B 62  ? 0.4754 0.7876 0.3899 -0.0033 0.0318  0.0220  768 VAL C O   
1704 C CB  . VAL B 62  ? 0.5946 0.8764 0.5296 -0.0079 0.0335  -0.0104 768 VAL C CB  
1705 C CG1 . VAL B 62  ? 0.6095 0.8801 0.5516 -0.0086 0.0318  -0.0228 768 VAL C CG1 
1706 C CG2 . VAL B 62  ? 0.6197 0.8821 0.5553 -0.0029 0.0326  0.0041  768 VAL C CG2 
1707 N N   . GLU B 63  ? 0.4694 0.8015 0.3845 -0.0125 0.0375  0.0024  769 GLU C N   
1708 C CA  . GLU B 63  ? 0.5084 0.8522 0.4145 -0.0131 0.0399  0.0150  769 GLU C CA  
1709 C C   . GLU B 63  ? 0.4724 0.7948 0.3813 -0.0114 0.0421  0.0259  769 GLU C C   
1710 O O   . GLU B 63  ? 0.4813 0.7827 0.3996 -0.0107 0.0425  0.0207  769 GLU C O   
1711 C CB  . GLU B 63  ? 0.6022 0.9696 0.5044 -0.0192 0.0438  0.0054  769 GLU C CB  
1712 C CG  . GLU B 63  ? 0.7335 1.1243 0.6326 -0.0214 0.0418  -0.0061 769 GLU C CG  
1713 C CD  . GLU B 63  ? 0.8704 1.2748 0.7609 -0.0179 0.0375  0.0048  769 GLU C CD  
1714 O OE1 . GLU B 63  ? 0.9268 1.3322 0.8094 -0.0152 0.0374  0.0216  769 GLU C OE1 
1715 O OE2 . GLU B 63  ? 0.8939 1.3079 0.7857 -0.0178 0.0341  -0.0035 769 GLU C OE2 
1716 N N   . GLY B 64  ? 0.4625 0.7905 0.3632 -0.0110 0.0434  0.0410  770 GLY C N   
1717 C CA  . GLY B 64  ? 0.5129 0.8205 0.4158 -0.0093 0.0451  0.0533  770 GLY C CA  
1718 C C   . GLY B 64  ? 0.5073 0.8061 0.4173 -0.0136 0.0501  0.0467  770 GLY C C   
1719 O O   . GLY B 64  ? 0.4883 0.7671 0.4030 -0.0123 0.0512  0.0539  770 GLY C O   
1720 N N   . ASP B 65  ? 0.5187 0.8327 0.4301 -0.0186 0.0530  0.0324  771 ASP C N   
1721 C CA  . ASP B 65  ? 0.5894 0.8982 0.5079 -0.0226 0.0578  0.0251  771 ASP C CA  
1722 C C   . ASP B 65  ? 0.5798 0.8720 0.5107 -0.0212 0.0564  0.0103  771 ASP C C   
1723 O O   . ASP B 65  ? 0.6704 0.9571 0.6087 -0.0235 0.0595  0.0031  771 ASP C O   
1724 C CB  . ASP B 65  ? 0.6345 0.9699 0.5477 -0.0288 0.0626  0.0185  771 ASP C CB  
1725 C CG  . ASP B 65  ? 0.6737 1.0274 0.5860 -0.0300 0.0609  0.0032  771 ASP C CG  
1726 O OD1 . ASP B 65  ? 0.6046 0.9490 0.5211 -0.0266 0.0564  -0.0026 771 ASP C OD1 
1727 O OD2 . ASP B 65  ? 0.7655 1.1430 0.6728 -0.0347 0.0644  -0.0032 771 ASP C OD2 
1728 N N   . LYS B 66  ? 0.4905 0.7752 0.4235 -0.0175 0.0517  0.0061  772 LYS C N   
1729 C CA  . LYS B 66  ? 0.5213 0.7903 0.4646 -0.0161 0.0500  -0.0073 772 LYS C CA  
1730 C C   . LYS B 66  ? 0.4755 0.7170 0.4257 -0.0121 0.0485  -0.0016 772 LYS C C   
1731 O O   . LYS B 66  ? 0.5096 0.7419 0.4568 -0.0087 0.0468  0.0121  772 LYS C O   
1732 C CB  . LYS B 66  ? 0.5632 0.8352 0.5056 -0.0146 0.0459  -0.0139 772 LYS C CB  
1733 C CG  . LYS B 66  ? 0.6664 0.9653 0.6032 -0.0186 0.0467  -0.0222 772 LYS C CG  
1734 C CD  . LYS B 66  ? 0.6986 1.0042 0.6411 -0.0225 0.0499  -0.0386 772 LYS C CD  
1735 C CE  . LYS B 66  ? 0.7355 1.0677 0.6729 -0.0264 0.0504  -0.0483 772 LYS C CE  
1736 N NZ  . LYS B 66  ? 0.7711 1.1262 0.6974 -0.0285 0.0525  -0.0380 772 LYS C NZ  
1737 N N   . TYR B 67  ? 0.3301 0.5588 0.2896 -0.0119 0.0489  -0.0125 773 TYR C N   
1738 C CA  . TYR B 67  ? 0.2633 0.4668 0.2296 -0.0079 0.0472  -0.0090 773 TYR C CA  
1739 C C   . TYR B 67  ? 0.3326 0.5213 0.3051 -0.0050 0.0437  -0.0197 773 TYR C C   
1740 O O   . TYR B 67  ? 0.2982 0.4663 0.2764 -0.0016 0.0419  -0.0190 773 TYR C O   
1741 C CB  . TYR B 67  ? 0.4068 0.6061 0.3788 -0.0099 0.0508  -0.0093 773 TYR C CB  
1742 C CG  . TYR B 67  ? 0.5665 0.7700 0.5459 -0.0121 0.0527  -0.0256 773 TYR C CG  
1743 C CD1 . TYR B 67  ? 0.6369 0.8223 0.6252 -0.0088 0.0501  -0.0345 773 TYR C CD1 
1744 C CD2 . TYR B 67  ? 0.6197 0.8455 0.5972 -0.0171 0.0568  -0.0320 773 TYR C CD2 
1745 C CE1 . TYR B 67  ? 0.6631 0.8516 0.6584 -0.0098 0.0513  -0.0493 773 TYR C CE1 
1746 C CE2 . TYR B 67  ? 0.6628 0.8928 0.6480 -0.0185 0.0583  -0.0477 773 TYR C CE2 
1747 C CZ  . TYR B 67  ? 0.6941 0.9048 0.6884 -0.0145 0.0554  -0.0562 773 TYR C CZ  
1748 O OH  . TYR B 67  ? 0.6615 0.8755 0.6639 -0.0149 0.0564  -0.0717 773 TYR C OH  
1749 N N   . TRP B 68  ? 0.3398 0.5391 0.3108 -0.0067 0.0428  -0.0296 774 TRP C N   
1750 C CA  . TRP B 68  ? 0.3569 0.5427 0.3326 -0.0047 0.0397  -0.0391 774 TRP C CA  
1751 C C   . TRP B 68  ? 0.3592 0.5588 0.3307 -0.0070 0.0385  -0.0450 774 TRP C C   
1752 O O   . TRP B 68  ? 0.3482 0.5700 0.3147 -0.0104 0.0404  -0.0460 774 TRP C O   
1753 C CB  . TRP B 68  ? 0.3671 0.5447 0.3511 -0.0049 0.0406  -0.0520 774 TRP C CB  
1754 C CG  . TRP B 68  ? 0.4140 0.6107 0.3988 -0.0091 0.0434  -0.0640 774 TRP C CG  
1755 C CD1 . TRP B 68  ? 0.4754 0.6873 0.4601 -0.0122 0.0474  -0.0648 774 TRP C CD1 
1756 C CD2 . TRP B 68  ? 0.5250 0.7277 0.5111 -0.0110 0.0426  -0.0776 774 TRP C CD2 
1757 N NE1 . TRP B 68  ? 0.5312 0.7594 0.5170 -0.0155 0.0492  -0.0784 774 TRP C NE1 
1758 C CE2 . TRP B 68  ? 0.5554 0.7778 0.5424 -0.0147 0.0461  -0.0866 774 TRP C CE2 
1759 C CE3 . TRP B 68  ? 0.6620 0.8555 0.6489 -0.0102 0.0395  -0.0831 774 TRP C CE3 
1760 C CZ2 . TRP B 68  ? 0.6639 0.8965 0.6528 -0.0172 0.0463  -0.1015 774 TRP C CZ2 
1761 C CZ3 . TRP B 68  ? 0.7079 0.9105 0.6967 -0.0132 0.0398  -0.0974 774 TRP C CZ3 
1762 C CH2 . TRP B 68  ? 0.6849 0.9067 0.6750 -0.0164 0.0430  -0.1067 774 TRP C CH2 
1763 N N   . HIS B 69  ? 0.3127 0.4998 0.2864 -0.0053 0.0356  -0.0490 775 HIS C N   
1764 C CA  . HIS B 69  ? 0.3023 0.5009 0.2731 -0.0077 0.0343  -0.0543 775 HIS C CA  
1765 C C   . HIS B 69  ? 0.3435 0.5250 0.3194 -0.0072 0.0322  -0.0634 775 HIS C C   
1766 O O   . HIS B 69  ? 0.2945 0.4545 0.2742 -0.0038 0.0309  -0.0617 775 HIS C O   
1767 C CB  . HIS B 69  ? 0.2934 0.4988 0.2578 -0.0060 0.0325  -0.0416 775 HIS C CB  
1768 C CG  . HIS B 69  ? 0.3208 0.5383 0.2829 -0.0083 0.0308  -0.0466 775 HIS C CG  
1769 N ND1 . HIS B 69  ? 0.3411 0.5813 0.3006 -0.0128 0.0319  -0.0548 775 HIS C ND1 
1770 C CD2 . HIS B 69  ? 0.3357 0.5469 0.2979 -0.0070 0.0282  -0.0446 775 HIS C CD2 
1771 C CE1 . HIS B 69  ? 0.3186 0.5656 0.2771 -0.0143 0.0299  -0.0581 775 HIS C CE1 
1772 N NE2 . HIS B 69  ? 0.3174 0.5474 0.2777 -0.0110 0.0278  -0.0518 775 HIS C NE2 
1773 N N   . SER B 70  ? 0.3105 0.5016 0.2862 -0.0109 0.0319  -0.0732 776 SER C N   
1774 C CA  A SER B 70  ? 0.3159 0.4913 0.2956 -0.0114 0.0302  -0.0812 776 SER C CA  
1775 C CA  B SER B 70  ? 0.3182 0.4933 0.2979 -0.0113 0.0302  -0.0809 776 SER C CA  
1776 C C   . SER B 70  ? 0.2827 0.4652 0.2591 -0.0132 0.0287  -0.0787 776 SER C C   
1777 O O   . SER B 70  ? 0.3403 0.5445 0.3139 -0.0169 0.0292  -0.0823 776 SER C O   
1778 C CB  A SER B 70  ? 0.3283 0.5066 0.3128 -0.0147 0.0314  -0.0972 776 SER C CB  
1779 C CB  B SER B 70  ? 0.3247 0.5009 0.3094 -0.0144 0.0313  -0.0970 776 SER C CB  
1780 O OG  A SER B 70  ? 0.3469 0.5071 0.3353 -0.0151 0.0298  -0.1043 776 SER C OG  
1781 O OG  B SER B 70  ? 0.3269 0.4897 0.3166 -0.0115 0.0318  -0.1000 776 SER C OG  
1782 N N   . ILE B 71  ? 0.2304 0.3963 0.2073 -0.0107 0.0268  -0.0729 777 ILE C N   
1783 C CA  . ILE B 71  ? 0.2475 0.4198 0.2224 -0.0127 0.0256  -0.0714 777 ILE C CA  
1784 C C   . ILE B 71  ? 0.2584 0.4234 0.2372 -0.0171 0.0257  -0.0841 777 ILE C C   
1785 O O   . ILE B 71  ? 0.3210 0.4637 0.3030 -0.0159 0.0253  -0.0870 777 ILE C O   
1786 C CB  . ILE B 71  ? 0.2935 0.4521 0.2672 -0.0082 0.0239  -0.0600 777 ILE C CB  
1787 C CG1 . ILE B 71  ? 0.3299 0.4917 0.3005 -0.0034 0.0236  -0.0473 777 ILE C CG1 
1788 C CG2 . ILE B 71  ? 0.2605 0.4288 0.2329 -0.0106 0.0229  -0.0596 777 ILE C CG2 
1789 C CD1 . ILE B 71  ? 0.2742 0.4175 0.2451 0.0019  0.0221  -0.0376 777 ILE C CD1 
1790 N N   . SER B 72  ? 0.2683 0.4520 0.2466 -0.0224 0.0260  -0.0915 778 SER C N   
1791 C CA  . SER B 72  ? 0.2280 0.4067 0.2106 -0.0277 0.0265  -0.1051 778 SER C CA  
1792 C C   . SER B 72  ? 0.2381 0.4180 0.2210 -0.0313 0.0258  -0.1054 778 SER C C   
1793 O O   . SER B 72  ? 0.2949 0.4817 0.2747 -0.0294 0.0248  -0.0956 778 SER C O   
1794 C CB  . SER B 72  ? 0.2513 0.4502 0.2349 -0.0319 0.0278  -0.1169 778 SER C CB  
1795 O OG  . SER B 72  ? 0.3292 0.5244 0.3143 -0.0293 0.0290  -0.1196 778 SER C OG  
1796 N N   . HIS B 73  ? 0.3035 0.4761 0.2905 -0.0367 0.0265  -0.1169 779 HIS C N   
1797 C CA  . HIS B 73  ? 0.3211 0.4954 0.3093 -0.0418 0.0265  -0.1192 779 HIS C CA  
1798 C C   . HIS B 73  ? 0.3218 0.4809 0.3082 -0.0387 0.0258  -0.1077 779 HIS C C   
1799 O O   . HIS B 73  ? 0.3422 0.5124 0.3279 -0.0404 0.0255  -0.1040 779 HIS C O   
1800 C CB  . HIS B 73  ? 0.4934 0.6991 0.4803 -0.0455 0.0262  -0.1218 779 HIS C CB  
1801 C CG  . HIS B 73  ? 0.5664 0.7902 0.5537 -0.0480 0.0269  -0.1321 779 HIS C CG  
1802 N ND1 . HIS B 73  ? 0.6061 0.8510 0.5887 -0.0449 0.0265  -0.1271 779 HIS C ND1 
1803 C CD2 . HIS B 73  ? 0.5954 0.8192 0.5871 -0.0531 0.0280  -0.1471 779 HIS C CD2 
1804 C CE1 . HIS B 73  ? 0.6304 0.8888 0.6141 -0.0482 0.0276  -0.1388 779 HIS C CE1 
1805 N NE2 . HIS B 73  ? 0.6244 0.8705 0.6141 -0.0530 0.0284  -0.1516 779 HIS C NE2 
1806 N N   . LEU B 74  ? 0.2884 0.4233 0.2746 -0.0339 0.0255  -0.1028 780 LEU C N   
1807 C CA  . LEU B 74  ? 0.2607 0.3793 0.2453 -0.0311 0.0250  -0.0934 780 LEU C CA  
1808 C C   . LEU B 74  ? 0.3443 0.4434 0.3310 -0.0359 0.0259  -0.0995 780 LEU C C   
1809 O O   . LEU B 74  ? 0.3800 0.4772 0.3701 -0.0409 0.0268  -0.1108 780 LEU C O   
1810 C CB  . LEU B 74  ? 0.2097 0.3129 0.1924 -0.0234 0.0239  -0.0850 780 LEU C CB  
1811 C CG  . LEU B 74  ? 0.2468 0.3666 0.2274 -0.0191 0.0234  -0.0787 780 LEU C CG  
1812 C CD1 . LEU B 74  ? 0.3162 0.4205 0.2965 -0.0125 0.0227  -0.0724 780 LEU C CD1 
1813 C CD2 . LEU B 74  ? 0.2773 0.4139 0.2553 -0.0181 0.0227  -0.0702 780 LEU C CD2 
1814 N N   . GLN B 75  ? 0.2889 0.3733 0.2737 -0.0345 0.0259  -0.0922 781 GLN C N   
1815 C CA  . GLN B 75  ? 0.2663 0.3299 0.2519 -0.0388 0.0271  -0.0960 781 GLN C CA  
1816 C C   . GLN B 75  ? 0.3698 0.4065 0.3544 -0.0338 0.0260  -0.0945 781 GLN C C   
1817 O O   . GLN B 75  ? 0.3183 0.3507 0.3009 -0.0265 0.0245  -0.0872 781 GLN C O   
1818 C CB  . GLN B 75  ? 0.3063 0.3698 0.2900 -0.0409 0.0281  -0.0894 781 GLN C CB  
1819 C CG  . GLN B 75  ? 0.3159 0.4063 0.3016 -0.0462 0.0289  -0.0918 781 GLN C CG  
1820 C CD  . GLN B 75  ? 0.3034 0.4003 0.2934 -0.0551 0.0304  -0.1046 781 GLN C CD  
1821 O OE1 . GLN B 75  ? 0.3265 0.4062 0.3179 -0.0606 0.0320  -0.1096 781 GLN C OE1 
1822 N NE2 . GLN B 75  ? 0.3206 0.4422 0.3125 -0.0566 0.0298  -0.1102 781 GLN C NE2 
1823 N N   . PRO B 76  ? 0.3698 0.3882 0.3560 -0.0375 0.0265  -0.1016 782 PRO C N   
1824 C CA  . PRO B 76  ? 0.3551 0.3471 0.3402 -0.0325 0.0250  -0.1005 782 PRO C CA  
1825 C C   . PRO B 76  ? 0.3515 0.3291 0.3315 -0.0280 0.0244  -0.0891 782 PRO C C   
1826 O O   . PRO B 76  ? 0.3128 0.2945 0.2904 -0.0313 0.0259  -0.0842 782 PRO C O   
1827 C CB  . PRO B 76  ? 0.3476 0.3244 0.3351 -0.0389 0.0261  -0.1096 782 PRO C CB  
1828 C CG  . PRO B 76  ? 0.3467 0.3459 0.3385 -0.0462 0.0277  -0.1192 782 PRO C CG  
1829 C CD  . PRO B 76  ? 0.3619 0.3848 0.3518 -0.0465 0.0283  -0.1122 782 PRO C CD  
1830 N N   . GLU B 77  ? 0.3358 0.2983 0.3144 -0.0206 0.0222  -0.0856 783 GLU C N   
1831 C CA  . GLU B 77  ? 0.3837 0.3303 0.3572 -0.0158 0.0211  -0.0760 783 GLU C CA  
1832 C C   . GLU B 77  ? 0.3185 0.2794 0.2896 -0.0150 0.0220  -0.0675 783 GLU C C   
1833 O O   . GLU B 77  ? 0.2953 0.2479 0.2623 -0.0153 0.0227  -0.0616 783 GLU C O   
1834 C CB  . GLU B 77  ? 0.4491 0.3741 0.4196 -0.0195 0.0219  -0.0765 783 GLU C CB  
1835 C CG  . GLU B 77  ? 0.6332 0.5360 0.5987 -0.0130 0.0197  -0.0700 783 GLU C CG  
1836 C CD  . GLU B 77  ? 0.8201 0.6989 0.7831 -0.0159 0.0197  -0.0724 783 GLU C CD  
1837 O OE1 . GLU B 77  ? 0.8543 0.7331 0.8172 -0.0242 0.0225  -0.0749 783 GLU C OE1 
1838 O OE2 . GLU B 77  ? 0.9414 0.8016 0.9027 -0.0099 0.0168  -0.0718 783 GLU C OE2 
1839 N N   . THR B 78  ? 0.2876 0.2701 0.2610 -0.0139 0.0220  -0.0668 784 THR C N   
1840 C CA  . THR B 78  ? 0.3150 0.3124 0.2869 -0.0126 0.0224  -0.0591 784 THR C CA  
1841 C C   . THR B 78  ? 0.3442 0.3464 0.3161 -0.0050 0.0206  -0.0530 784 THR C C   
1842 O O   . THR B 78  ? 0.2939 0.3018 0.2682 -0.0034 0.0199  -0.0561 784 THR C O   
1843 C CB  . THR B 78  ? 0.3603 0.3818 0.3346 -0.0187 0.0240  -0.0631 784 THR C CB  
1844 O OG1 . THR B 78  ? 0.3234 0.3405 0.2983 -0.0266 0.0260  -0.0688 784 THR C OG1 
1845 C CG2 . THR B 78  ? 0.3475 0.3854 0.3207 -0.0160 0.0239  -0.0550 784 THR C CG2 
1846 N N   . SER B 79  ? 0.2879 0.2879 0.2573 -0.0006 0.0201  -0.0445 785 SER C N   
1847 C CA  . SER B 79  ? 0.2328 0.2362 0.2025 0.0063  0.0185  -0.0381 785 SER C CA  
1848 C C   . SER B 79  ? 0.2438 0.2706 0.2147 0.0062  0.0189  -0.0347 785 SER C C   
1849 O O   . SER B 79  ? 0.2757 0.3136 0.2462 0.0034  0.0198  -0.0336 785 SER C O   
1850 C CB  . SER B 79  ? 0.3329 0.3224 0.2998 0.0115  0.0176  -0.0312 785 SER C CB  
1851 O OG  . SER B 79  ? 0.3413 0.3327 0.3093 0.0179  0.0160  -0.0256 785 SER C OG  
1852 N N   . TYR B 80  ? 0.1942 0.2286 0.1666 0.0093  0.0181  -0.0329 786 TYR C N   
1853 C CA  . TYR B 80  ? 0.2146 0.2697 0.1871 0.0103  0.0180  -0.0281 786 TYR C CA  
1854 C C   . TYR B 80  ? 0.2523 0.3041 0.2248 0.0172  0.0167  -0.0195 786 TYR C C   
1855 O O   . TYR B 80  ? 0.2359 0.2748 0.2093 0.0201  0.0161  -0.0195 786 TYR C O   
1856 C CB  . TYR B 80  ? 0.2390 0.3097 0.2127 0.0064  0.0187  -0.0340 786 TYR C CB  
1857 C CG  . TYR B 80  ? 0.3214 0.3993 0.2957 -0.0007 0.0199  -0.0426 786 TYR C CG  
1858 C CD1 . TYR B 80  ? 0.3568 0.4207 0.3325 -0.0043 0.0206  -0.0510 786 TYR C CD1 
1859 C CD2 . TYR B 80  ? 0.2591 0.3573 0.2332 -0.0038 0.0202  -0.0425 786 TYR C CD2 
1860 C CE1 . TYR B 80  ? 0.2728 0.3416 0.2496 -0.0113 0.0219  -0.0592 786 TYR C CE1 
1861 C CE2 . TYR B 80  ? 0.3227 0.4277 0.2982 -0.0111 0.0215  -0.0513 786 TYR C CE2 
1862 C CZ  . TYR B 80  ? 0.2542 0.3439 0.2312 -0.0150 0.0225  -0.0595 786 TYR C CZ  
1863 O OH  . TYR B 80  ? 0.2436 0.3383 0.2226 -0.0227 0.0239  -0.0685 786 TYR C OH  
1864 N N   . ASP B 81  ? 0.2449 0.3084 0.2167 0.0199  0.0161  -0.0125 787 ASP C N   
1865 C CA  . ASP B 81  ? 0.2793 0.3428 0.2514 0.0259  0.0150  -0.0041 787 ASP C CA  
1866 C C   . ASP B 81  ? 0.2542 0.3342 0.2259 0.0243  0.0154  -0.0035 787 ASP C C   
1867 O O   . ASP B 81  ? 0.2500 0.3480 0.2207 0.0209  0.0157  -0.0055 787 ASP C O   
1868 C CB  . ASP B 81  ? 0.2295 0.2990 0.2012 0.0299  0.0140  0.0029  787 ASP C CB  
1869 C CG  . ASP B 81  ? 0.2867 0.3451 0.2581 0.0302  0.0142  0.0016  787 ASP C CG  
1870 O OD1 . ASP B 81  ? 0.2938 0.3348 0.2647 0.0298  0.0144  -0.0017 787 ASP C OD1 
1871 O OD2 . ASP B 81  ? 0.3158 0.3837 0.2873 0.0312  0.0140  0.0040  787 ASP C OD2 
1872 N N   . ILE B 82  ? 0.2581 0.3331 0.2307 0.0265  0.0155  -0.0008 788 ILE C N   
1873 C CA  . ILE B 82  ? 0.1890 0.2793 0.1605 0.0246  0.0164  0.0002  788 ILE C CA  
1874 C C   . ILE B 82  ? 0.2062 0.2958 0.1774 0.0293  0.0159  0.0105  788 ILE C C   
1875 O O   . ILE B 82  ? 0.3340 0.4079 0.3076 0.0324  0.0157  0.0128  788 ILE C O   
1876 C CB  . ILE B 82  ? 0.2089 0.2964 0.1820 0.0207  0.0179  -0.0086 788 ILE C CB  
1877 C CG1 . ILE B 82  ? 0.2929 0.3789 0.2665 0.0161  0.0183  -0.0189 788 ILE C CG1 
1878 C CG2 . ILE B 82  ? 0.2592 0.3642 0.2307 0.0184  0.0192  -0.0079 788 ILE C CG2 
1879 C CD1 . ILE B 82  ? 0.3043 0.3824 0.2805 0.0136  0.0192  -0.0283 788 ILE C CD1 
1880 N N   . LYS B 83  ? 0.2359 0.3425 0.2043 0.0298  0.0156  0.0166  789 LYS C N   
1881 C CA  . LYS B 83  ? 0.3075 0.4140 0.2750 0.0334  0.0155  0.0269  789 LYS C CA  
1882 C C   . LYS B 83  ? 0.2974 0.4251 0.2606 0.0308  0.0162  0.0295  789 LYS C C   
1883 O O   . LYS B 83  ? 0.2490 0.3922 0.2102 0.0269  0.0164  0.0234  789 LYS C O   
1884 C CB  . LYS B 83  ? 0.2286 0.3294 0.1967 0.0398  0.0133  0.0356  789 LYS C CB  
1885 C CG  . LYS B 83  ? 0.2474 0.3641 0.2134 0.0408  0.0116  0.0369  789 LYS C CG  
1886 C CD  . LYS B 83  ? 0.2176 0.3279 0.1854 0.0477  0.0094  0.0439  789 LYS C CD  
1887 C CE  . LYS B 83  ? 0.2666 0.3958 0.2329 0.0493  0.0075  0.0460  789 LYS C CE  
1888 N NZ  . LYS B 83  ? 0.2983 0.4211 0.2675 0.0557  0.0056  0.0501  789 LYS C NZ  
1889 N N   . MET B 84  ? 0.2873 0.4160 0.2488 0.0327  0.0168  0.0386  790 MET C N   
1890 C CA  . MET B 84  ? 0.3139 0.4627 0.2701 0.0300  0.0178  0.0418  790 MET C CA  
1891 C C   . MET B 84  ? 0.3098 0.4591 0.2629 0.0341  0.0172  0.0558  790 MET C C   
1892 O O   . MET B 84  ? 0.3099 0.4426 0.2661 0.0386  0.0164  0.0623  790 MET C O   
1893 C CB  . MET B 84  ? 0.2954 0.4474 0.2520 0.0243  0.0210  0.0342  790 MET C CB  
1894 C CG  . MET B 84  ? 0.2753 0.4115 0.2354 0.0247  0.0229  0.0369  790 MET C CG  
1895 S SD  . MET B 84  ? 0.3121 0.4542 0.2739 0.0183  0.0267  0.0265  790 MET C SD  
1896 C CE  . MET B 84  ? 0.2919 0.4617 0.2452 0.0149  0.0282  0.0313  790 MET C CE  
1897 N N   . GLN B 85  ? 0.2867 0.4551 0.2337 0.0325  0.0176  0.0605  791 GLN C N   
1898 C CA  . GLN B 85  ? 0.3554 0.5239 0.2984 0.0353  0.0177  0.0743  791 GLN C CA  
1899 C C   . GLN B 85  ? 0.3639 0.5519 0.3001 0.0305  0.0200  0.0756  791 GLN C C   
1900 O O   . GLN B 85  ? 0.3052 0.5081 0.2399 0.0258  0.0209  0.0654  791 GLN C O   
1901 C CB  . GLN B 85  ? 0.4907 0.6627 0.4317 0.0421  0.0138  0.0837  791 GLN C CB  
1902 C CG  . GLN B 85  ? 0.5331 0.7229 0.4725 0.0419  0.0114  0.0774  791 GLN C CG  
1903 C CD  . GLN B 85  ? 0.5098 0.7010 0.4497 0.0493  0.0073  0.0845  791 GLN C CD  
1904 O OE1 . GLN B 85  ? 0.6641 0.8387 0.6073 0.0549  0.0062  0.0915  791 GLN C OE1 
1905 N NE2 . GLN B 85  ? 0.4173 0.6294 0.3545 0.0495  0.0051  0.0819  791 GLN C NE2 
1906 N N   . CYS B 86  ? 0.3373 0.5246 0.2693 0.0316  0.0210  0.0880  792 CYS C N   
1907 C CA  . CYS B 86  ? 0.3363 0.5434 0.2599 0.0277  0.0230  0.0920  792 CYS C CA  
1908 C C   . CYS B 86  ? 0.4435 0.6616 0.3599 0.0331  0.0195  0.1048  792 CYS C C   
1909 O O   . CYS B 86  ? 0.4673 0.6742 0.3863 0.0398  0.0161  0.1115  792 CYS C O   
1910 C CB  . CYS B 86  ? 0.3523 0.5513 0.2758 0.0240  0.0275  0.0971  792 CYS C CB  
1911 S SG  . CYS B 86  ? 0.3939 0.5687 0.3200 0.0293  0.0269  0.1127  792 CYS C SG  
1912 N N   . PHE B 87  ? 0.4552 0.6960 0.3625 0.0305  0.0200  0.1077  793 PHE C N   
1913 C CA  . PHE B 87  ? 0.3942 0.6487 0.2937 0.0359  0.0161  0.1190  793 PHE C CA  
1914 C C   . PHE B 87  ? 0.4375 0.7108 0.3258 0.0326  0.0181  0.1267  793 PHE C C   
1915 O O   . PHE B 87  ? 0.4272 0.7093 0.3136 0.0254  0.0224  0.1196  793 PHE C O   
1916 C CB  . PHE B 87  ? 0.3906 0.6611 0.2911 0.0377  0.0122  0.1100  793 PHE C CB  
1917 C CG  . PHE B 87  ? 0.4057 0.6980 0.3037 0.0307  0.0139  0.0966  793 PHE C CG  
1918 C CD1 . PHE B 87  ? 0.5365 0.8549 0.4246 0.0294  0.0131  0.0995  793 PHE C CD1 
1919 C CD2 . PHE B 87  ? 0.4464 0.7327 0.3518 0.0256  0.0162  0.0810  793 PHE C CD2 
1920 C CE1 . PHE B 87  ? 0.5934 0.9323 0.4797 0.0229  0.0148  0.0861  793 PHE C CE1 
1921 C CE2 . PHE B 87  ? 0.4123 0.7174 0.3161 0.0193  0.0178  0.0681  793 PHE C CE2 
1922 C CZ  . PHE B 87  ? 0.5315 0.8632 0.4260 0.0179  0.0172  0.0702  793 PHE C CZ  
1923 N N   . ASN B 88  ? 0.4733 0.7525 0.3540 0.0383  0.0149  0.1414  794 ASN C N   
1924 C CA  . ASN B 88  ? 0.5779 0.8776 0.4459 0.0361  0.0158  0.1500  794 ASN C CA  
1925 C C   . ASN B 88  ? 0.7263 1.0421 0.5872 0.0435  0.0098  0.1588  794 ASN C C   
1926 O O   . ASN B 88  ? 0.6461 0.9648 0.5123 0.0482  0.0053  0.1531  794 ASN C O   
1927 C CB  . ASN B 88  ? 0.5433 0.8294 0.4074 0.0341  0.0199  0.1637  794 ASN C CB  
1928 C CG  . ASN B 88  ? 0.5656 0.8287 0.4322 0.0418  0.0171  0.1783  794 ASN C CG  
1929 O OD1 . ASN B 88  ? 0.5976 0.8599 0.4660 0.0498  0.0116  0.1812  794 ASN C OD1 
1930 N ND2 . ASN B 88  ? 0.6413 0.8859 0.5088 0.0394  0.0211  0.1872  794 ASN C ND2 
1931 N N   . GLU B 89  ? 0.8473 1.1740 0.6961 0.0445  0.0096  0.1729  795 GLU C N   
1932 C CA  . GLU B 89  ? 0.9540 1.2985 0.7943 0.0517  0.0036  0.1823  795 GLU C CA  
1933 C C   . GLU B 89  ? 0.8369 1.1633 0.6828 0.0621  -0.0016 0.1919  795 GLU C C   
1934 O O   . GLU B 89  ? 0.9278 1.2675 0.7704 0.0696  -0.0076 0.1969  795 GLU C O   
1935 C CB  . GLU B 89  ? 1.0842 1.4427 0.9092 0.0502  0.0049  0.1966  795 GLU C CB  
1936 C CG  . GLU B 89  ? 1.1953 1.5304 1.0176 0.0501  0.0084  0.2132  795 GLU C CG  
1937 C CD  . GLU B 89  ? 1.2501 1.5766 1.0751 0.0397  0.0165  0.2071  795 GLU C CD  
1938 O OE1 . GLU B 89  ? 1.2231 1.5605 1.0526 0.0332  0.0192  0.1897  795 GLU C OE1 
1939 O OE2 . GLU B 89  ? 1.3007 1.6096 1.1240 0.0381  0.0201  0.2196  795 GLU C OE2 
1940 N N   . GLY B 90  ? 0.6756 0.9727 0.5305 0.0627  0.0006  0.1937  796 GLY C N   
1941 C CA  . GLY B 90  ? 0.6432 0.9208 0.5032 0.0724  -0.0036 0.2038  796 GLY C CA  
1942 C C   . GLY B 90  ? 0.6808 0.9496 0.5536 0.0758  -0.0060 0.1918  796 GLY C C   
1943 O O   . GLY B 90  ? 0.7744 1.0389 0.6505 0.0850  -0.0111 0.1968  796 GLY C O   
1944 N N   . GLY B 91  ? 0.6025 0.8686 0.4822 0.0686  -0.0023 0.1759  797 GLY C N   
1945 C CA  . GLY B 91  ? 0.5578 0.8154 0.4488 0.0708  -0.0039 0.1643  797 GLY C CA  
1946 C C   . GLY B 91  ? 0.5525 0.7956 0.4510 0.0634  0.0011  0.1518  797 GLY C C   
1947 O O   . GLY B 91  ? 0.4904 0.7344 0.3858 0.0561  0.0057  0.1499  797 GLY C O   
1948 N N   . GLU B 92  ? 0.6177 0.8481 0.5260 0.0655  0.0001  0.1433  798 GLU C N   
1949 C CA  . GLU B 92  ? 0.5787 0.7954 0.4944 0.0594  0.0039  0.1309  798 GLU C CA  
1950 C C   . GLU B 92  ? 0.4952 0.6834 0.4172 0.0618  0.0053  0.1359  798 GLU C C   
1951 O O   . GLU B 92  ? 0.4355 0.6126 0.3597 0.0694  0.0024  0.1448  798 GLU C O   
1952 C CB  . GLU B 92  ? 0.6815 0.9030 0.6034 0.0593  0.0023  0.1174  798 GLU C CB  
1953 C CG  . GLU B 92  ? 0.7863 1.0350 0.7039 0.0552  0.0015  0.1089  798 GLU C CG  
1954 C CD  . GLU B 92  ? 0.9201 1.1883 0.8328 0.0614  -0.0034 0.1164  798 GLU C CD  
1955 O OE1 . GLU B 92  ? 0.9874 1.2467 0.9019 0.0696  -0.0066 0.1261  798 GLU C OE1 
1956 O OE2 . GLU B 92  ? 0.9601 1.2530 0.8674 0.0583  -0.0042 0.1120  798 GLU C OE2 
1957 N N   . SER B 93  ? 0.3952 0.5721 0.3206 0.0555  0.0097  0.1295  799 SER C N   
1958 C CA  . SER B 93  ? 0.4189 0.5696 0.3514 0.0570  0.0110  0.1316  799 SER C CA  
1959 C C   . SER B 93  ? 0.4222 0.5621 0.3625 0.0614  0.0085  0.1242  799 SER C C   
1960 O O   . SER B 93  ? 0.3180 0.4705 0.2584 0.0620  0.0064  0.1170  799 SER C O   
1961 C CB  . SER B 93  ? 0.4565 0.6006 0.3914 0.0492  0.0160  0.1247  799 SER C CB  
1962 O OG  . SER B 93  ? 0.4377 0.5838 0.3770 0.0457  0.0166  0.1095  799 SER C OG  
1963 N N   . GLU B 94  ? 0.4647 0.5818 0.4116 0.0640  0.0089  0.1257  800 GLU C N   
1964 C CA  . GLU B 94  ? 0.5461 0.6522 0.5001 0.0670  0.0073  0.1174  800 GLU C CA  
1965 C C   . GLU B 94  ? 0.4930 0.6013 0.4489 0.0601  0.0098  0.1034  800 GLU C C   
1966 O O   . GLU B 94  ? 0.4211 0.5341 0.3747 0.0538  0.0130  0.1008  800 GLU C O   
1967 C CB  . GLU B 94  ? 0.6254 0.7073 0.5858 0.0710  0.0072  0.1215  800 GLU C CB  
1968 C CG  . GLU B 94  ? 0.7837 0.8538 0.7458 0.0655  0.0111  0.1220  800 GLU C CG  
1969 C CD  . GLU B 94  ? 0.9152 0.9624 0.8836 0.0694  0.0108  0.1270  800 GLU C CD  
1970 O OE1 . GLU B 94  ? 0.9031 0.9449 0.8723 0.0767  0.0078  0.1350  800 GLU C OE1 
1971 O OE2 . GLU B 94  ? 0.9816 1.0167 0.9547 0.0653  0.0135  0.1224  800 GLU C OE2 
1972 N N   . PHE B 95  ? 0.3853 0.4901 0.3452 0.0613  0.0085  0.0946  801 PHE C N   
1973 C CA  . PHE B 95  ? 0.3650 0.4702 0.3267 0.0555  0.0104  0.0817  801 PHE C CA  
1974 C C   . PHE B 95  ? 0.3357 0.4230 0.3017 0.0529  0.0128  0.0780  801 PHE C C   
1975 O O   . PHE B 95  ? 0.4381 0.5093 0.4078 0.0565  0.0125  0.0830  801 PHE C O   
1976 C CB  . PHE B 95  ? 0.3922 0.4964 0.3567 0.0575  0.0085  0.0747  801 PHE C CB  
1977 C CG  . PHE B 95  ? 0.4122 0.5373 0.3733 0.0577  0.0067  0.0738  801 PHE C CG  
1978 C CD1 . PHE B 95  ? 0.4053 0.5341 0.3674 0.0642  0.0037  0.0788  801 PHE C CD1 
1979 C CD2 . PHE B 95  ? 0.3851 0.5270 0.3428 0.0515  0.0080  0.0672  801 PHE C CD2 
1980 C CE1 . PHE B 95  ? 0.4109 0.5605 0.3707 0.0643  0.0019  0.0773  801 PHE C CE1 
1981 C CE2 . PHE B 95  ? 0.3680 0.5303 0.3232 0.0513  0.0062  0.0656  801 PHE C CE2 
1982 C CZ  . PHE B 95  ? 0.4036 0.5701 0.3600 0.0577  0.0031  0.0707  801 PHE C CZ  
1983 N N   . SER B 96  ? 0.2604 0.3513 0.2266 0.0468  0.0151  0.0686  802 SER C N   
1984 C CA  . SER B 96  ? 0.2768 0.3525 0.2479 0.0446  0.0170  0.0627  802 SER C CA  
1985 C C   . SER B 96  ? 0.2721 0.3317 0.2478 0.0480  0.0152  0.0576  802 SER C C   
1986 O O   . SER B 96  ? 0.3011 0.3617 0.2762 0.0516  0.0130  0.0583  802 SER C O   
1987 C CB  . SER B 96  ? 0.2330 0.3178 0.2034 0.0382  0.0192  0.0524  802 SER C CB  
1988 O OG  . SER B 96  ? 0.2312 0.3208 0.2009 0.0374  0.0179  0.0442  802 SER C OG  
1989 N N   . ASN B 97  ? 0.2541 0.2997 0.2342 0.0469  0.0161  0.0524  803 ASN C N   
1990 C CA  . ASN B 97  ? 0.2105 0.2432 0.1937 0.0488  0.0147  0.0452  803 ASN C CA  
1991 C C   . ASN B 97  ? 0.2614 0.3033 0.2416 0.0461  0.0144  0.0377  803 ASN C C   
1992 O O   . ASN B 97  ? 0.2468 0.3038 0.2241 0.0419  0.0157  0.0354  803 ASN C O   
1993 C CB  . ASN B 97  ? 0.2121 0.2325 0.1999 0.0472  0.0157  0.0393  803 ASN C CB  
1994 C CG  . ASN B 97  ? 0.2912 0.3215 0.2787 0.0414  0.0182  0.0338  803 ASN C CG  
1995 O OD1 . ASN B 97  ? 0.2877 0.3318 0.2721 0.0387  0.0199  0.0381  803 ASN C OD1 
1996 N ND2 . ASN B 97  ? 0.2911 0.3146 0.2816 0.0399  0.0183  0.0243  803 ASN C ND2 
1997 N N   . VAL B 98  ? 0.2689 0.3023 0.2498 0.0482  0.0129  0.0337  804 VAL C N   
1998 C CA  . VAL B 98  ? 0.2909 0.3315 0.2693 0.0452  0.0129  0.0271  804 VAL C CA  
1999 C C   . VAL B 98  ? 0.3087 0.3372 0.2886 0.0431  0.0131  0.0179  804 VAL C C   
2000 O O   . VAL B 98  ? 0.2453 0.2583 0.2271 0.0463  0.0120  0.0172  804 VAL C O   
2001 C CB  . VAL B 98  ? 0.2361 0.2786 0.2135 0.0486  0.0113  0.0300  804 VAL C CB  
2002 C CG1 . VAL B 98  ? 0.1940 0.2471 0.1691 0.0443  0.0118  0.0237  804 VAL C CG1 
2003 C CG2 . VAL B 98  ? 0.2686 0.3200 0.2454 0.0525  0.0104  0.0397  804 VAL C CG2 
2004 N N   . MET B 99  ? 0.2597 0.2954 0.2388 0.0381  0.0144  0.0108  805 MET C N   
2005 C CA  . MET B 99  ? 0.2576 0.2819 0.2382 0.0364  0.0143  0.0021  805 MET C CA  
2006 C C   . MET B 99  ? 0.2593 0.2826 0.2375 0.0345  0.0140  -0.0025 805 MET C C   
2007 O O   . MET B 99  ? 0.3068 0.3433 0.2829 0.0322  0.0144  -0.0016 805 MET C O   
2008 C CB  . MET B 99  ? 0.2853 0.3166 0.2673 0.0323  0.0159  -0.0041 805 MET C CB  
2009 C CG  . MET B 99  ? 0.3219 0.3575 0.3059 0.0329  0.0171  0.0005  805 MET C CG  
2010 S SD  . MET B 99  ? 0.3049 0.3213 0.2941 0.0370  0.0161  0.0010  805 MET C SD  
2011 C CE  . MET B 99  ? 0.3063 0.3194 0.2987 0.0343  0.0166  -0.0112 805 MET C CE  
2012 N N   . ILE B 100 ? 0.2183 0.2258 0.1968 0.0352  0.0131  -0.0071 806 ILE C N   
2013 C CA  . ILE B 100 ? 0.2223 0.2269 0.1985 0.0322  0.0133  -0.0120 806 ILE C CA  
2014 C C   . ILE B 100 ? 0.3210 0.3193 0.2985 0.0293  0.0135  -0.0207 806 ILE C C   
2015 O O   . ILE B 100 ? 0.2954 0.2827 0.2753 0.0321  0.0125  -0.0225 806 ILE C O   
2016 C CB  . ILE B 100 ? 0.2928 0.2833 0.2670 0.0356  0.0121  -0.0092 806 ILE C CB  
2017 C CG1 . ILE B 100 ? 0.3433 0.3411 0.3171 0.0390  0.0119  -0.0014 806 ILE C CG1 
2018 C CG2 . ILE B 100 ? 0.2791 0.2645 0.2505 0.0317  0.0127  -0.0141 806 ILE C CG2 
2019 C CD1 . ILE B 100 ? 0.2913 0.2767 0.2636 0.0432  0.0108  0.0013  806 ILE C CD1 
2020 N N   . CYS B 101 ? 0.2925 0.2987 0.2694 0.0240  0.0147  -0.0267 807 CYS C N   
2021 C CA  . CYS B 101 ? 0.2457 0.2467 0.2246 0.0214  0.0149  -0.0359 807 CYS C CA  
2022 C C   . CYS B 101 ? 0.2427 0.2429 0.2200 0.0163  0.0157  -0.0417 807 CYS C C   
2023 O O   . CYS B 101 ? 0.2650 0.2788 0.2410 0.0125  0.0169  -0.0411 807 CYS C O   
2024 C CB  . CYS B 101 ? 0.2536 0.2697 0.2352 0.0196  0.0161  -0.0390 807 CYS C CB  
2025 S SG  . CYS B 101 ? 0.3649 0.3757 0.3504 0.0178  0.0162  -0.0510 807 CYS C SG  
2026 N N   . GLU B 102 ? 0.2430 0.2270 0.2207 0.0161  0.0149  -0.0474 808 GLU C N   
2027 C CA  . GLU B 102 ? 0.3612 0.3410 0.3375 0.0108  0.0158  -0.0528 808 GLU C CA  
2028 C C   . GLU B 102 ? 0.3596 0.3445 0.3396 0.0070  0.0165  -0.0631 808 GLU C C   
2029 O O   . GLU B 102 ? 0.3983 0.3810 0.3815 0.0099  0.0156  -0.0667 808 GLU C O   
2030 C CB  . GLU B 102 ? 0.3443 0.3011 0.3178 0.0130  0.0144  -0.0517 808 GLU C CB  
2031 C CG  . GLU B 102 ? 0.4650 0.4168 0.4352 0.0079  0.0158  -0.0522 808 GLU C CG  
2032 C CD  . GLU B 102 ? 0.4828 0.4129 0.4485 0.0108  0.0145  -0.0485 808 GLU C CD  
2033 O OE1 . GLU B 102 ? 0.5201 0.4490 0.4829 0.0144  0.0141  -0.0411 808 GLU C OE1 
2034 O OE2 . GLU B 102 ? 0.5789 0.4932 0.5438 0.0097  0.0138  -0.0530 808 GLU C OE2 
2035 N N   . THR B 103 ? 0.3580 0.3510 0.3381 0.0006  0.0181  -0.0685 809 THR C N   
2036 C CA  . THR B 103 ? 0.3547 0.3506 0.3385 -0.0032 0.0187  -0.0796 809 THR C CA  
2037 C C   . THR B 103 ? 0.3773 0.3492 0.3615 -0.0026 0.0175  -0.0842 809 THR C C   
2038 O O   . THR B 103 ? 0.3828 0.3391 0.3632 -0.0016 0.0169  -0.0789 809 THR C O   
2039 C CB  . THR B 103 ? 0.3560 0.3677 0.3403 -0.0108 0.0207  -0.0848 809 THR C CB  
2040 O OG1 . THR B 103 ? 0.3573 0.3609 0.3388 -0.0139 0.0213  -0.0816 809 THR C OG1 
2041 C CG2 . THR B 103 ? 0.3225 0.3604 0.3063 -0.0115 0.0215  -0.0815 809 THR C CG2 
2042 N N   . LYS B 104 ? 0.3494 0.3185 0.3378 -0.0032 0.0172  -0.0941 810 LYS C N   
2043 C CA  . LYS B 104 ? 0.3752 0.3206 0.3643 -0.0019 0.0156  -0.0987 810 LYS C CA  
2044 C C   . LYS B 104 ? 0.4381 0.3733 0.4247 -0.0080 0.0168  -0.0999 810 LYS C C   
2045 O O   . LYS B 104 ? 0.3959 0.3452 0.3822 -0.0145 0.0191  -0.1007 810 LYS C O   
2046 C CB  . LYS B 104 ? 0.3239 0.2696 0.3190 -0.0005 0.0148  -0.1098 810 LYS C CB  
2047 C CG  . LYS B 104 ? 0.4352 0.3864 0.4330 0.0060  0.0136  -0.1083 810 LYS C CG  
2048 C CD  . LYS B 104 ? 0.5445 0.4942 0.5487 0.0082  0.0127  -0.1196 810 LYS C CD  
2049 C CE  . LYS B 104 ? 0.6574 0.6095 0.6644 0.0148  0.0113  -0.1174 810 LYS C CE  
2050 N NZ  . LYS B 104 ? 0.6915 0.6498 0.7058 0.0163  0.0112  -0.1291 810 LYS C NZ  
2051 N N   . ALA B 105 ? 0.4407 0.3512 0.4255 -0.0061 0.0151  -0.0999 811 ALA C N   
2052 C CA  . ALA B 105 ? 0.4655 0.3634 0.4483 -0.0124 0.0165  -0.1016 811 ALA C CA  
2053 C C   . ALA B 105 ? 0.5367 0.4394 0.5255 -0.0180 0.0177  -0.1144 811 ALA C C   
2054 O O   . ALA B 105 ? 0.5285 0.4350 0.5224 -0.0149 0.0165  -0.1222 811 ALA C O   
2056 N N   . ARG B 106 ? 0.6200 0.5236 0.6085 -0.0266 0.0202  -0.1170 812 ARG C N   
2057 C CA  . ARG B 106 ? 0.7709 0.6791 0.7653 -0.0328 0.0215  -0.1297 812 ARG C CA  
2058 C C   . ARG B 106 ? 0.8109 0.6977 0.8088 -0.0289 0.0191  -0.1373 812 ARG C C   
2059 O O   . ARG B 106 ? 0.8011 0.6619 0.7958 -0.0275 0.0179  -0.1339 812 ARG C O   
2067 N N   . LYS B 107 ? 0.8592 0.7576 0.8634 -0.0267 0.0184  -0.1474 813 LYS C N   
2068 C CA  . LYS B 107 ? 0.9899 0.8712 0.9989 -0.0222 0.0160  -0.1563 813 LYS C CA  
2069 C C   . LYS B 107 ? 1.0913 0.9456 1.0998 -0.0260 0.0159  -0.1587 813 LYS C C   
2070 O O   . LYS B 107 ? 1.1464 0.9877 1.1602 -0.0245 0.0144  -0.1687 813 LYS C O   
2076 N N   . GLN C 20  ? 1.0932 1.0717 0.9827 0.0216  -0.0515 -0.0205 39  GLN A N   
2077 C CA  . GLN C 20  ? 1.0353 1.0158 0.9333 0.0243  -0.0620 -0.0212 39  GLN A CA  
2078 C C   . GLN C 20  ? 0.9735 0.9525 0.8788 0.0257  -0.0621 -0.0144 39  GLN A C   
2079 O O   . GLN C 20  ? 1.0348 1.0089 0.9308 0.0293  -0.0688 -0.0105 39  GLN A O   
2080 C CB  . GLN C 20  ? 1.0111 0.9994 0.9283 0.0229  -0.0658 -0.0287 39  GLN A CB  
2081 N N   . LEU C 21  ? 0.7999 0.7818 0.7204 0.0235  -0.0554 -0.0132 40  LEU A N   
2082 C CA  . LEU C 21  ? 0.5827 0.5694 0.5143 0.0197  -0.0483 -0.0171 40  LEU A CA  
2083 C C   . LEU C 21  ? 0.4715 0.4662 0.4250 0.0193  -0.0506 -0.0207 40  LEU A C   
2084 O O   . LEU C 21  ? 0.4135 0.4105 0.3768 0.0214  -0.0526 -0.0183 40  LEU A O   
2085 C CB  . LEU C 21  ? 0.5134 0.4970 0.4442 0.0172  -0.0386 -0.0124 40  LEU A CB  
2086 C CG  . LEU C 21  ? 0.4816 0.4600 0.3947 0.0157  -0.0331 -0.0087 40  LEU A CG  
2087 C CD1 . LEU C 21  ? 0.5251 0.5010 0.4414 0.0130  -0.0258 -0.0034 40  LEU A CD1 
2088 C CD2 . LEU C 21  ? 0.5004 0.4818 0.4087 0.0146  -0.0298 -0.0144 40  LEU A CD2 
2089 N N   . VAL C 22  ? 0.3500 0.3487 0.3110 0.0167  -0.0501 -0.0265 41  VAL A N   
2090 C CA  . VAL C 22  ? 0.3209 0.3274 0.3025 0.0151  -0.0518 -0.0295 41  VAL A CA  
2091 C C   . VAL C 22  ? 0.2822 0.2893 0.2729 0.0121  -0.0427 -0.0282 41  VAL A C   
2092 O O   . VAL C 22  ? 0.2719 0.2757 0.2578 0.0100  -0.0379 -0.0297 41  VAL A O   
2093 C CB  . VAL C 22  ? 0.3387 0.3475 0.3234 0.0131  -0.0574 -0.0364 41  VAL A CB  
2094 C CG1 . VAL C 22  ? 0.3414 0.3587 0.3487 0.0101  -0.0588 -0.0386 41  VAL A CG1 
2095 C CG2 . VAL C 22  ? 0.4646 0.4717 0.4373 0.0162  -0.0673 -0.0383 41  VAL A CG2 
2096 N N   . PRO C 23  ? 0.2610 0.2724 0.2645 0.0126  -0.0406 -0.0256 42  PRO A N   
2097 C CA  . PRO C 23  ? 0.2512 0.2620 0.2607 0.0100  -0.0323 -0.0243 42  PRO A CA  
2098 C C   . PRO C 23  ? 0.2823 0.2957 0.3012 0.0060  -0.0314 -0.0283 42  PRO A C   
2099 O O   . PRO C 23  ? 0.2517 0.2700 0.2787 0.0048  -0.0370 -0.0317 42  PRO A O   
2100 C CB  . PRO C 23  ? 0.2891 0.3044 0.3095 0.0122  -0.0312 -0.0216 42  PRO A CB  
2101 C CG  . PRO C 23  ? 0.4339 0.4558 0.4609 0.0148  -0.0392 -0.0232 42  PRO A CG  
2102 C CD  . PRO C 23  ? 0.3736 0.3896 0.3847 0.0163  -0.0448 -0.0236 42  PRO A CD  
2103 N N   . LEU C 24  ? 0.2275 0.2373 0.2459 0.0038  -0.0251 -0.0279 43  LEU A N   
2104 C CA  . LEU C 24  ? 0.2888 0.2993 0.3165 0.0000  -0.0243 -0.0308 43  LEU A CA  
2105 C C   . LEU C 24  ? 0.2696 0.2868 0.3126 -0.0016 -0.0225 -0.0288 43  LEU A C   
2106 O O   . LEU C 24  ? 0.2203 0.2399 0.2648 0.0008  -0.0197 -0.0253 43  LEU A O   
2107 C CB  . LEU C 24  ? 0.2551 0.2595 0.2781 -0.0011 -0.0187 -0.0308 43  LEU A CB  
2108 C CG  . LEU C 24  ? 0.3578 0.3571 0.3675 0.0005  -0.0170 -0.0322 43  LEU A CG  
2109 C CD1 . LEU C 24  ? 0.2636 0.2586 0.2754 -0.0010 -0.0143 -0.0346 43  LEU A CD1 
2110 C CD2 . LEU C 24  ? 0.3695 0.3681 0.3689 0.0024  -0.0219 -0.0355 43  LEU A CD2 
2111 N N   . LEU C 25  ? 0.2574 0.2770 0.3113 -0.0057 -0.0238 -0.0310 44  LEU A N   
2112 C CA  . LEU C 25  ? 0.3140 0.3410 0.3832 -0.0083 -0.0210 -0.0288 44  LEU A CA  
2113 C C   . LEU C 25  ? 0.2804 0.3022 0.3490 -0.0106 -0.0137 -0.0260 44  LEU A C   
2114 O O   . LEU C 25  ? 0.2356 0.2488 0.2961 -0.0112 -0.0129 -0.0272 44  LEU A O   
2115 C CB  . LEU C 25  ? 0.3493 0.3816 0.4314 -0.0129 -0.0266 -0.0321 44  LEU A CB  
2116 C CG  . LEU C 25  ? 0.4513 0.4889 0.5341 -0.0106 -0.0354 -0.0353 44  LEU A CG  
2117 C CD1 . LEU C 25  ? 0.5185 0.5584 0.6113 -0.0156 -0.0427 -0.0400 44  LEU A CD1 
2118 C CD2 . LEU C 25  ? 0.4844 0.5327 0.5759 -0.0069 -0.0350 -0.0326 44  LEU A CD2 
2119 N N   . TYR C 26  ? 0.2899 0.3170 0.3668 -0.0112 -0.0085 -0.0225 45  TYR A N   
2120 C CA  . TYR C 26  ? 0.2779 0.2998 0.3535 -0.0134 -0.0021 -0.0194 45  TYR A CA  
2121 C C   . TYR C 26  ? 0.2682 0.2834 0.3457 -0.0186 -0.0038 -0.0210 45  TYR A C   
2122 O O   . TYR C 26  ? 0.2395 0.2583 0.3269 -0.0226 -0.0079 -0.0232 45  TYR A O   
2123 C CB  . TYR C 26  ? 0.3122 0.3424 0.3973 -0.0140 0.0035  -0.0159 45  TYR A CB  
2124 C CG  . TYR C 26  ? 0.2928 0.3178 0.3764 -0.0170 0.0099  -0.0121 45  TYR A CG  
2125 C CD1 . TYR C 26  ? 0.3611 0.3768 0.4318 -0.0143 0.0127  -0.0105 45  TYR A CD1 
2126 C CD2 . TYR C 26  ? 0.3349 0.3643 0.4300 -0.0227 0.0127  -0.0099 45  TYR A CD2 
2127 C CE1 . TYR C 26  ? 0.3548 0.3649 0.4226 -0.0166 0.0177  -0.0069 45  TYR A CE1 
2128 C CE2 . TYR C 26  ? 0.3829 0.4064 0.4747 -0.0255 0.0185  -0.0057 45  TYR A CE2 
2129 C CZ  . TYR C 26  ? 0.3837 0.3971 0.4611 -0.0220 0.0207  -0.0042 45  TYR A CZ  
2130 O OH  . TYR C 26  ? 0.4511 0.4579 0.5239 -0.0243 0.0255  0.0002  45  TYR A OH  
2131 N N   . LYS C 27  ? 0.1987 0.2039 0.2670 -0.0181 -0.0015 -0.0203 46  LYS A N   
2132 C CA  . LYS C 27  ? 0.2885 0.2845 0.3565 -0.0216 -0.0032 -0.0218 46  LYS A CA  
2133 C C   . LYS C 27  ? 0.2986 0.2903 0.3625 -0.0208 -0.0097 -0.0279 46  LYS A C   
2134 O O   . LYS C 27  ? 0.2738 0.2565 0.3362 -0.0225 -0.0118 -0.0303 46  LYS A O   
2135 C CB  . LYS C 27  ? 0.3273 0.3243 0.4070 -0.0280 -0.0016 -0.0190 46  LYS A CB  
2136 C CG  . LYS C 27  ? 0.3915 0.3877 0.4701 -0.0286 0.0057  -0.0129 46  LYS A CG  
2137 C CD  . LYS C 27  ? 0.4027 0.3870 0.4693 -0.0260 0.0070  -0.0119 46  LYS A CD  
2138 C CE  . LYS C 27  ? 0.4195 0.4008 0.4833 -0.0271 0.0131  -0.0059 46  LYS A CE  
2139 N NZ  . LYS C 27  ? 0.4237 0.3928 0.4768 -0.0245 0.0126  -0.0052 46  LYS A NZ  
2140 N N   . GLN C 28  ? 0.2906 0.2876 0.3512 -0.0178 -0.0131 -0.0305 47  GLN A N   
2141 C CA  . GLN C 28  ? 0.2629 0.2556 0.3159 -0.0160 -0.0184 -0.0363 47  GLN A CA  
2142 C C   . GLN C 28  ? 0.2081 0.1941 0.2487 -0.0119 -0.0156 -0.0371 47  GLN A C   
2143 O O   . GLN C 28  ? 0.2289 0.2162 0.2656 -0.0095 -0.0109 -0.0334 47  GLN A O   
2144 C CB  . GLN C 28  ? 0.2701 0.2701 0.3215 -0.0137 -0.0229 -0.0380 47  GLN A CB  
2145 C CG  . GLN C 28  ? 0.3706 0.3665 0.4109 -0.0112 -0.0280 -0.0435 47  GLN A CG  
2146 C CD  . GLN C 28  ? 0.5185 0.5207 0.5581 -0.0097 -0.0342 -0.0451 47  GLN A CD  
2147 O OE1 . GLN C 28  ? 0.4310 0.4410 0.4770 -0.0091 -0.0339 -0.0415 47  GLN A OE1 
2148 N NE2 . GLN C 28  ? 0.5111 0.5095 0.5421 -0.0085 -0.0403 -0.0508 47  GLN A NE2 
2149 N N   . PHE C 29  ? 0.2002 0.1792 0.2355 -0.0109 -0.0186 -0.0424 48  PHE A N   
2150 C CA  . PHE C 29  ? 0.1996 0.1751 0.2244 -0.0063 -0.0160 -0.0442 48  PHE A CA  
2151 C C   . PHE C 29  ? 0.2610 0.2355 0.2763 -0.0034 -0.0198 -0.0505 48  PHE A C   
2152 O O   . PHE C 29  ? 0.2343 0.2056 0.2510 -0.0051 -0.0257 -0.0553 48  PHE A O   
2153 C CB  . PHE C 29  ? 0.2467 0.2140 0.2728 -0.0061 -0.0140 -0.0443 48  PHE A CB  
2154 C CG  . PHE C 29  ? 0.2568 0.2158 0.2888 -0.0097 -0.0183 -0.0472 48  PHE A CG  
2155 C CD1 . PHE C 29  ? 0.3297 0.2887 0.3719 -0.0153 -0.0182 -0.0429 48  PHE A CD1 
2156 C CD2 . PHE C 29  ? 0.3241 0.2751 0.3514 -0.0076 -0.0223 -0.0541 48  PHE A CD2 
2157 C CE1 . PHE C 29  ? 0.3331 0.2839 0.3814 -0.0198 -0.0223 -0.0447 48  PHE A CE1 
2158 C CE2 . PHE C 29  ? 0.3701 0.3114 0.4027 -0.0114 -0.0272 -0.0568 48  PHE A CE2 
2159 C CZ  . PHE C 29  ? 0.3578 0.2989 0.4013 -0.0180 -0.0273 -0.0517 48  PHE A CZ  
2160 N N   . VAL C 30  ? 0.2073 0.1847 0.2127 0.0006  -0.0166 -0.0503 49  VAL A N   
2161 C CA  . VAL C 30  ? 0.2300 0.2071 0.2235 0.0039  -0.0188 -0.0555 49  VAL A CA  
2162 C C   . VAL C 30  ? 0.2288 0.2053 0.2148 0.0083  -0.0137 -0.0575 49  VAL A C   
2163 O O   . VAL C 30  ? 0.2355 0.2160 0.2224 0.0089  -0.0082 -0.0528 49  VAL A O   
2164 C CB  . VAL C 30  ? 0.2375 0.2208 0.2250 0.0044  -0.0195 -0.0522 49  VAL A CB  
2165 C CG1 . VAL C 30  ? 0.2664 0.2492 0.2381 0.0082  -0.0202 -0.0563 49  VAL A CG1 
2166 C CG2 . VAL C 30  ? 0.2081 0.1937 0.2038 0.0012  -0.0256 -0.0515 49  VAL A CG2 
2167 N N   . PRO C 31  ? 0.2819 0.2534 0.2612 0.0115  -0.0156 -0.0649 50  PRO A N   
2168 C CA  . PRO C 31  ? 0.2697 0.2340 0.2479 0.0107  -0.0231 -0.0717 50  PRO A CA  
2169 C C   . PRO C 31  ? 0.2825 0.2406 0.2742 0.0062  -0.0263 -0.0709 50  PRO A C   
2170 O O   . PRO C 31  ? 0.2562 0.2131 0.2546 0.0057  -0.0223 -0.0670 50  PRO A O   
2171 C CB  . PRO C 31  ? 0.3403 0.2998 0.3086 0.0165  -0.0221 -0.0794 50  PRO A CB  
2172 C CG  . PRO C 31  ? 0.3267 0.2909 0.2978 0.0194  -0.0138 -0.0758 50  PRO A CG  
2173 C CD  . PRO C 31  ? 0.2323 0.2055 0.2045 0.0166  -0.0101 -0.0675 50  PRO A CD  
2174 N N   . GLY C 32  ? 0.3207 0.2748 0.3159 0.0026  -0.0338 -0.0743 51  GLY A N   
2175 C CA  . GLY C 32  ? 0.2882 0.2370 0.2968 -0.0031 -0.0369 -0.0729 51  GLY A CA  
2176 C C   . GLY C 32  ? 0.3046 0.2403 0.3130 -0.0020 -0.0387 -0.0778 51  GLY A C   
2177 O O   . GLY C 32  ? 0.3179 0.2450 0.3303 -0.0055 -0.0456 -0.0821 51  GLY A O   
2178 N N   . VAL C 33  ? 0.3251 0.2592 0.3295 0.0031  -0.0331 -0.0773 52  VAL A N   
2179 C CA  . VAL C 33  ? 0.3173 0.2390 0.3227 0.0052  -0.0342 -0.0807 52  VAL A CA  
2180 C C   . VAL C 33  ? 0.3573 0.2809 0.3682 0.0057  -0.0280 -0.0733 52  VAL A C   
2181 O O   . VAL C 33  ? 0.3578 0.2923 0.3694 0.0055  -0.0229 -0.0674 52  VAL A O   
2182 C CB  . VAL C 33  ? 0.3403 0.2583 0.3338 0.0134  -0.0343 -0.0897 52  VAL A CB  
2183 C CG1 . VAL C 33  ? 0.3458 0.2601 0.3313 0.0134  -0.0414 -0.0978 52  VAL A CG1 
2184 C CG2 . VAL C 33  ? 0.3556 0.2860 0.3429 0.0188  -0.0264 -0.0875 52  VAL A CG2 
2185 N N   . PRO C 34  ? 0.3435 0.2554 0.3575 0.0066  -0.0293 -0.0737 53  PRO A N   
2186 C CA  . PRO C 34  ? 0.3995 0.3123 0.4174 0.0076  -0.0246 -0.0669 53  PRO A CA  
2187 C C   . PRO C 34  ? 0.2989 0.2222 0.3123 0.0142  -0.0190 -0.0671 53  PRO A C   
2188 O O   . PRO C 34  ? 0.2575 0.1831 0.2644 0.0198  -0.0186 -0.0739 53  PRO A O   
2189 C CB  . PRO C 34  ? 0.3597 0.2560 0.3789 0.0092  -0.0285 -0.0693 53  PRO A CB  
2190 C CG  . PRO C 34  ? 0.3863 0.2725 0.4064 0.0046  -0.0355 -0.0742 53  PRO A CG  
2191 C CD  . PRO C 34  ? 0.4380 0.3337 0.4520 0.0063  -0.0361 -0.0800 53  PRO A CD  
2192 N N   . GLU C 35  ? 0.3243 0.2541 0.3412 0.0133  -0.0147 -0.0599 54  GLU A N   
2193 C CA  . GLU C 35  ? 0.2765 0.2179 0.2912 0.0176  -0.0095 -0.0589 54  GLU A CA  
2194 C C   . GLU C 35  ? 0.3030 0.2441 0.3158 0.0255  -0.0085 -0.0649 54  GLU A C   
2195 O O   . GLU C 35  ? 0.2399 0.1914 0.2492 0.0291  -0.0045 -0.0673 54  GLU A O   
2196 C CB  . GLU C 35  ? 0.2361 0.1812 0.2552 0.0156  -0.0066 -0.0509 54  GLU A CB  
2197 C CG  . GLU C 35  ? 0.3101 0.2668 0.3289 0.0190  -0.0021 -0.0497 54  GLU A CG  
2198 C CD  . GLU C 35  ? 0.2675 0.2266 0.2897 0.0169  -0.0006 -0.0426 54  GLU A CD  
2199 O OE1 . GLU C 35  ? 0.2961 0.2464 0.3203 0.0159  -0.0028 -0.0397 54  GLU A OE1 
2200 O OE2 . GLU C 35  ? 0.2532 0.2217 0.2750 0.0161  0.0026  -0.0398 54  GLU A OE2 
2201 N N   . ARG C 36  ? 0.2743 0.2036 0.2894 0.0282  -0.0120 -0.0671 55  ARG A N   
2202 C CA  . ARG C 36  ? 0.3554 0.2854 0.3709 0.0368  -0.0110 -0.0722 55  ARG A CA  
2203 C C   . ARG C 36  ? 0.3200 0.2438 0.3296 0.0422  -0.0133 -0.0824 55  ARG A C   
2204 O O   . ARG C 36  ? 0.3095 0.2333 0.3193 0.0504  -0.0125 -0.0880 55  ARG A O   
2205 C CB  . ARG C 36  ? 0.3985 0.3208 0.4197 0.0388  -0.0132 -0.0685 55  ARG A CB  
2206 C CG  . ARG C 36  ? 0.4251 0.3581 0.4504 0.0365  -0.0096 -0.0605 55  ARG A CG  
2207 C CD  . ARG C 36  ? 0.5479 0.4724 0.5768 0.0374  -0.0126 -0.0556 55  ARG A CD  
2208 N NE  . ARG C 36  ? 0.6392 0.5494 0.6662 0.0313  -0.0161 -0.0511 55  ARG A NE  
2209 C CZ  . ARG C 36  ? 0.7739 0.6675 0.8001 0.0326  -0.0210 -0.0529 55  ARG A CZ  
2210 N NH1 . ARG C 36  ? 0.8449 0.7337 0.8716 0.0408  -0.0236 -0.0597 55  ARG A NH1 
2211 N NH2 . ARG C 36  ? 0.7810 0.6628 0.8062 0.0258  -0.0233 -0.0477 55  ARG A NH2 
2212 N N   . THR C 37  ? 0.3403 0.2596 0.3446 0.0380  -0.0164 -0.0852 56  THR A N   
2213 C CA  . THR C 37  ? 0.4096 0.3238 0.4057 0.0430  -0.0188 -0.0955 56  THR A CA  
2214 C C   . THR C 37  ? 0.3726 0.3023 0.3620 0.0479  -0.0122 -0.0985 56  THR A C   
2215 O O   . THR C 37  ? 0.3182 0.2610 0.3084 0.0446  -0.0073 -0.0923 56  THR A O   
2216 C CB  . THR C 37  ? 0.4888 0.3938 0.4814 0.0367  -0.0252 -0.0978 56  THR A CB  
2217 O OG1 . THR C 37  ? 0.5317 0.4486 0.5219 0.0317  -0.0230 -0.0939 56  THR A OG1 
2218 C CG2 . THR C 37  ? 0.5369 0.4289 0.5376 0.0300  -0.0303 -0.0929 56  THR A CG2 
2219 N N   . LEU C 38  ? 0.3777 0.3050 0.3600 0.0559  -0.0120 -0.1082 57  LEU A N   
2220 C CA  . LEU C 38  ? 0.3990 0.3412 0.3748 0.0617  -0.0044 -0.1114 57  LEU A CA  
2221 C C   . LEU C 38  ? 0.4227 0.3740 0.3894 0.0568  -0.0019 -0.1086 57  LEU A C   
2222 O O   . LEU C 38  ? 0.4820 0.4481 0.4469 0.0578  0.0057  -0.1054 57  LEU A O   
2223 C CB  . LEU C 38  ? 0.5126 0.4487 0.4808 0.0719  -0.0050 -0.1234 57  LEU A CB  
2224 C CG  . LEU C 38  ? 0.6757 0.6284 0.6384 0.0793  0.0044  -0.1271 57  LEU A CG  
2225 C CD1 . LEU C 38  ? 0.7214 0.6896 0.6974 0.0800  0.0113  -0.1201 57  LEU A CD1 
2226 C CD2 . LEU C 38  ? 0.7699 0.7158 0.7251 0.0905  0.0038  -0.1400 57  LEU A CD2 
2227 N N   . GLY C 39  ? 0.4756 0.4181 0.4371 0.0516  -0.0085 -0.1095 58  GLY A N   
2228 C CA  . GLY C 39  ? 0.3833 0.3333 0.3362 0.0474  -0.0075 -0.1066 58  GLY A CA  
2229 C C   . GLY C 39  ? 0.3762 0.3363 0.3369 0.0410  -0.0039 -0.0953 58  GLY A C   
2230 O O   . GLY C 39  ? 0.3287 0.2969 0.2828 0.0387  -0.0013 -0.0915 58  GLY A O   
2231 N N   . ALA C 40  ? 0.3294 0.2876 0.3029 0.0384  -0.0041 -0.0899 59  ALA A N   
2232 C CA  . ALA C 40  ? 0.2734 0.2393 0.2539 0.0328  -0.0013 -0.0800 59  ALA A CA  
2233 C C   . ALA C 40  ? 0.2031 0.1793 0.1889 0.0360  0.0057  -0.0769 59  ALA A C   
2234 O O   . ALA C 40  ? 0.2773 0.2627 0.2578 0.0400  0.0112  -0.0792 59  ALA A O   
2235 C CB  . ALA C 40  ? 0.2685 0.2259 0.2586 0.0273  -0.0062 -0.0757 59  ALA A CB  
2236 N N   . SER C 41  ? 0.2089 0.1841 0.2051 0.0341  0.0054  -0.0717 60  SER A N   
2237 C CA  . SER C 41  ? 0.2106 0.1955 0.2136 0.0368  0.0104  -0.0690 60  SER A CA  
2238 C C   . SER C 41  ? 0.3317 0.3140 0.3392 0.0445  0.0101  -0.0749 60  SER A C   
2239 O O   . SER C 41  ? 0.2321 0.2246 0.2460 0.0482  0.0142  -0.0745 60  SER A O   
2240 C CB  . SER C 41  ? 0.1789 0.1646 0.1896 0.0317  0.0098  -0.0605 60  SER A CB  
2241 O OG  . SER C 41  ? 0.2649 0.2563 0.2721 0.0265  0.0117  -0.0553 60  SER A OG  
2242 N N   . GLY C 42  ? 0.3164 0.2850 0.3216 0.0469  0.0047  -0.0806 61  GLY A N   
2243 C CA  . GLY C 42  ? 0.3229 0.2869 0.3315 0.0551  0.0035  -0.0869 61  GLY A CA  
2244 C C   . GLY C 42  ? 0.3446 0.3045 0.3634 0.0558  0.0009  -0.0823 61  GLY A C   
2245 O O   . GLY C 42  ? 0.3195 0.2813 0.3422 0.0497  0.0008  -0.0742 61  GLY A O   
2246 N N   . PRO C 43  ? 0.3457 0.2995 0.3679 0.0638  -0.0014 -0.0878 62  PRO A N   
2247 C CA  . PRO C 43  ? 0.3688 0.3140 0.3985 0.0656  -0.0060 -0.0844 62  PRO A CA  
2248 C C   . PRO C 43  ? 0.3023 0.2599 0.3404 0.0639  -0.0035 -0.0770 62  PRO A C   
2249 O O   . PRO C 43  ? 0.3148 0.2899 0.3567 0.0651  0.0023  -0.0769 62  PRO A O   
2250 C CB  . PRO C 43  ? 0.4389 0.3805 0.4706 0.0770  -0.0073 -0.0934 62  PRO A CB  
2251 C CG  . PRO C 43  ? 0.4674 0.4072 0.4894 0.0792  -0.0059 -0.1019 62  PRO A CG  
2252 C CD  . PRO C 43  ? 0.4023 0.3567 0.4201 0.0726  0.0001  -0.0982 62  PRO A CD  
2253 N N   . ALA C 44  ? 0.3282 0.2761 0.3686 0.0607  -0.0081 -0.0706 63  ALA A N   
2254 C CA  . ALA C 44  ? 0.3078 0.2642 0.3559 0.0613  -0.0080 -0.0653 63  ALA A CA  
2255 C C   . ALA C 44  ? 0.3411 0.3023 0.3970 0.0719  -0.0088 -0.0711 63  ALA A C   
2256 O O   . ALA C 44  ? 0.3797 0.3308 0.4337 0.0783  -0.0114 -0.0777 63  ALA A O   
2257 C CB  . ALA C 44  ? 0.3357 0.2783 0.3818 0.0570  -0.0132 -0.0581 63  ALA A CB  
2258 N N   . GLU C 45  ? 0.3532 0.3301 0.4188 0.0739  -0.0068 -0.0691 64  GLU A N   
2259 C CA  . GLU C 45  ? 0.3679 0.3524 0.4439 0.0843  -0.0076 -0.0743 64  GLU A CA  
2260 C C   . GLU C 45  ? 0.3812 0.3623 0.4638 0.0861  -0.0142 -0.0693 64  GLU A C   
2261 O O   . GLU C 45  ? 0.3966 0.3833 0.4894 0.0949  -0.0168 -0.0726 64  GLU A O   
2262 C CB  . GLU C 45  ? 0.4203 0.4291 0.5043 0.0861  0.0006  -0.0773 64  GLU A CB  
2263 C CG  . GLU C 45  ? 0.5462 0.5583 0.6206 0.0833  0.0072  -0.0808 64  GLU A CG  
2264 C CD  . GLU C 45  ? 0.6215 0.6556 0.7021 0.0874  0.0159  -0.0851 64  GLU A CD  
2265 O OE1 . GLU C 45  ? 0.6739 0.7238 0.7688 0.0904  0.0174  -0.0842 64  GLU A OE1 
2266 O OE2 . GLU C 45  ? 0.6388 0.6749 0.7101 0.0874  0.0212  -0.0893 64  GLU A OE2 
2267 N N   . GLY C 46  ? 0.3534 0.3254 0.4298 0.0781  -0.0172 -0.0614 65  GLY A N   
2268 C CA  . GLY C 46  ? 0.3802 0.3462 0.4591 0.0794  -0.0241 -0.0562 65  GLY A CA  
2269 C C   . GLY C 46  ? 0.3432 0.3202 0.4245 0.0726  -0.0230 -0.0500 65  GLY A C   
2270 O O   . GLY C 46  ? 0.2688 0.2635 0.3560 0.0698  -0.0173 -0.0508 65  GLY A O   
2271 N N   . ARG C 47  ? 0.3259 0.2913 0.4015 0.0701  -0.0288 -0.0437 66  ARG A N   
2272 C CA  . ARG C 47  ? 0.3052 0.2778 0.3807 0.0641  -0.0290 -0.0383 66  ARG A CA  
2273 C C   . ARG C 47  ? 0.3586 0.3516 0.4494 0.0673  -0.0293 -0.0404 66  ARG A C   
2274 O O   . ARG C 47  ? 0.2678 0.2646 0.3684 0.0755  -0.0336 -0.0436 66  ARG A O   
2275 C CB  . ARG C 47  ? 0.3301 0.2861 0.3957 0.0628  -0.0358 -0.0319 66  ARG A CB  
2276 C CG  . ARG C 47  ? 0.3064 0.2671 0.3694 0.0572  -0.0369 -0.0269 66  ARG A CG  
2277 C CD  . ARG C 47  ? 0.3622 0.3043 0.4098 0.0541  -0.0405 -0.0204 66  ARG A CD  
2278 N NE  . ARG C 47  ? 0.2978 0.2425 0.3414 0.0508  -0.0431 -0.0165 66  ARG A NE  
2279 C CZ  . ARG C 47  ? 0.3715 0.3026 0.4008 0.0481  -0.0455 -0.0110 66  ARG A CZ  
2280 N NH1 . ARG C 47  ? 0.3410 0.2559 0.3596 0.0476  -0.0450 -0.0077 66  ARG A NH1 
2281 N NH2 . ARG C 47  ? 0.3245 0.2582 0.3496 0.0458  -0.0482 -0.0087 66  ARG A NH2 
2282 N N   . VAL C 48  ? 0.3669 0.3729 0.4605 0.0606  -0.0247 -0.0387 67  VAL A N   
2283 C CA  . VAL C 48  ? 0.3639 0.3900 0.4729 0.0613  -0.0245 -0.0398 67  VAL A CA  
2284 C C   . VAL C 48  ? 0.2910 0.3143 0.3988 0.0579  -0.0314 -0.0348 67  VAL A C   
2285 O O   . VAL C 48  ? 0.2122 0.2291 0.3097 0.0506  -0.0306 -0.0307 67  VAL A O   
2286 C CB  . VAL C 48  ? 0.2850 0.3264 0.3978 0.0555  -0.0154 -0.0406 67  VAL A CB  
2287 C CG1 . VAL C 48  ? 0.2079 0.2704 0.3377 0.0544  -0.0150 -0.0406 67  VAL A CG1 
2288 C CG2 . VAL C 48  ? 0.3258 0.3696 0.4377 0.0597  -0.0089 -0.0461 67  VAL A CG2 
2289 N N   . ALA C 49  ? 0.2786 0.3064 0.3965 0.0638  -0.0389 -0.0357 68  ALA A N   
2290 C CA  . ALA C 49  ? 0.2814 0.3056 0.3972 0.0615  -0.0471 -0.0316 68  ALA A CA  
2291 C C   . ALA C 49  ? 0.2920 0.3371 0.4241 0.0577  -0.0472 -0.0322 68  ALA A C   
2292 O O   . ALA C 49  ? 0.3159 0.3798 0.4646 0.0597  -0.0425 -0.0359 68  ALA A O   
2293 C CB  . ALA C 49  ? 0.2807 0.2946 0.3957 0.0700  -0.0572 -0.0314 68  ALA A CB  
2294 N N   . ARG C 50  ? 0.2410 0.2825 0.3682 0.0522  -0.0524 -0.0287 69  ARG A N   
2295 C CA  . ARG C 50  ? 0.3263 0.3853 0.4684 0.0471  -0.0534 -0.0288 69  ARG A CA  
2296 C C   . ARG C 50  ? 0.3907 0.4678 0.5554 0.0537  -0.0579 -0.0324 69  ARG A C   
2297 O O   . ARG C 50  ? 0.3088 0.3801 0.4740 0.0625  -0.0648 -0.0338 69  ARG A O   
2298 C CB  . ARG C 50  ? 0.2675 0.3160 0.3990 0.0419  -0.0610 -0.0254 69  ARG A CB  
2299 C CG  . ARG C 50  ? 0.3033 0.3666 0.4486 0.0350  -0.0630 -0.0253 69  ARG A CG  
2300 C CD  . ARG C 50  ? 0.2940 0.3436 0.4254 0.0306  -0.0707 -0.0228 69  ARG A CD  
2301 N NE  . ARG C 50  ? 0.2396 0.2750 0.3519 0.0255  -0.0645 -0.0203 69  ARG A NE  
2302 C CZ  . ARG C 50  ? 0.3606 0.4007 0.4745 0.0178  -0.0587 -0.0194 69  ARG A CZ  
2303 N NH1 . ARG C 50  ? 0.2438 0.3019 0.3770 0.0133  -0.0577 -0.0202 69  ARG A NH1 
2304 N NH2 . ARG C 50  ? 0.3701 0.3970 0.4669 0.0144  -0.0540 -0.0174 69  ARG A NH2 
2305 N N   . GLY C 51  ? 0.4347 0.5342 0.6186 0.0498  -0.0535 -0.0338 70  GLY A N   
2306 C CA  . GLY C 51  ? 0.4286 0.5491 0.6371 0.0555  -0.0569 -0.0373 70  GLY A CA  
2307 C C   . GLY C 51  ? 0.4265 0.5535 0.6426 0.0659  -0.0522 -0.0421 70  GLY A C   
2308 O O   . GLY C 51  ? 0.3472 0.4912 0.5838 0.0727  -0.0553 -0.0456 70  GLY A O   
2309 N N   . SER C 52  ? 0.4453 0.5589 0.6454 0.0675  -0.0452 -0.0428 71  SER A N   
2310 C CA  . SER C 52  ? 0.4163 0.5353 0.6221 0.0769  -0.0396 -0.0482 71  SER A CA  
2311 C C   . SER C 52  ? 0.3828 0.5248 0.6015 0.0738  -0.0273 -0.0506 71  SER A C   
2312 O O   . SER C 52  ? 0.3620 0.5111 0.5812 0.0635  -0.0226 -0.0470 71  SER A O   
2313 C CB  . SER C 52  ? 0.4394 0.5341 0.6228 0.0791  -0.0377 -0.0482 71  SER A CB  
2314 O OG  . SER C 52  ? 0.3237 0.4127 0.4935 0.0697  -0.0300 -0.0454 71  SER A OG  
2315 N N   . GLU C 53  ? 0.4412 0.5936 0.6688 0.0828  -0.0218 -0.0565 72  GLU A N   
2316 C CA  . GLU C 53  ? 0.5335 0.7076 0.7709 0.0803  -0.0089 -0.0586 72  GLU A CA  
2317 C C   . GLU C 53  ? 0.4490 0.6118 0.6660 0.0732  -0.0001 -0.0566 72  GLU A C   
2318 O O   . GLU C 53  ? 0.4059 0.5818 0.6256 0.0654  0.0087  -0.0543 72  GLU A O   
2319 C CB  . GLU C 53  ? 0.7201 0.9095 0.9721 0.0929  -0.0048 -0.0662 72  GLU A CB  
2320 C CG  . GLU C 53  ? 0.9102 1.1200 1.1889 0.0984  -0.0113 -0.0680 72  GLU A CG  
2321 C CD  . GLU C 53  ? 1.0165 1.2433 1.3094 0.0867  -0.0119 -0.0625 72  GLU A CD  
2322 O OE1 . GLU C 53  ? 1.0170 1.2654 1.3211 0.0809  -0.0008 -0.0620 72  GLU A OE1 
2323 O OE2 . GLU C 53  ? 1.0583 1.2760 1.3504 0.0831  -0.0236 -0.0588 72  GLU A OE2 
2324 N N   . ARG C 54  ? 0.3596 0.4982 0.5564 0.0756  -0.0027 -0.0571 73  ARG A N   
2325 C CA  . ARG C 54  ? 0.3180 0.4450 0.4958 0.0687  0.0037  -0.0549 73  ARG A CA  
2326 C C   . ARG C 54  ? 0.3029 0.4265 0.4754 0.0567  0.0022  -0.0477 73  ARG A C   
2327 O O   . ARG C 54  ? 0.2796 0.4047 0.4446 0.0494  0.0092  -0.0452 73  ARG A O   
2328 C CB  . ARG C 54  ? 0.2802 0.3824 0.4399 0.0730  0.0001  -0.0567 73  ARG A CB  
2329 C CG  . ARG C 54  ? 0.3637 0.4667 0.5238 0.0833  0.0039  -0.0645 73  ARG A CG  
2330 C CD  . ARG C 54  ? 0.4264 0.5033 0.5689 0.0859  -0.0004 -0.0659 73  ARG A CD  
2331 N NE  . ARG C 54  ? 0.4625 0.5300 0.5888 0.0775  0.0040  -0.0632 73  ARG A NE  
2332 C CZ  . ARG C 54  ? 0.3914 0.4372 0.5027 0.0750  0.0001  -0.0615 73  ARG A CZ  
2333 N NH1 . ARG C 54  ? 0.4206 0.4505 0.5297 0.0798  -0.0078 -0.0616 73  ARG A NH1 
2334 N NH2 . ARG C 54  ? 0.3512 0.3915 0.4504 0.0677  0.0040  -0.0593 73  ARG A NH2 
2335 N N   . PHE C 55  ? 0.2713 0.3899 0.4471 0.0553  -0.0074 -0.0447 74  PHE A N   
2336 C CA  . PHE C 55  ? 0.2736 0.3882 0.4448 0.0451  -0.0101 -0.0388 74  PHE A CA  
2337 C C   . PHE C 55  ? 0.2841 0.4198 0.4697 0.0377  -0.0043 -0.0370 74  PHE A C   
2338 O O   . PHE C 55  ? 0.2866 0.4189 0.4647 0.0286  -0.0014 -0.0327 74  PHE A O   
2339 C CB  . PHE C 55  ? 0.2520 0.3577 0.4238 0.0464  -0.0223 -0.0370 74  PHE A CB  
2340 C CG  . PHE C 55  ? 0.2941 0.3946 0.4603 0.0368  -0.0259 -0.0321 74  PHE A CG  
2341 C CD1 . PHE C 55  ? 0.2635 0.3442 0.4091 0.0327  -0.0262 -0.0289 74  PHE A CD1 
2342 C CD2 . PHE C 55  ? 0.2756 0.3913 0.4581 0.0321  -0.0290 -0.0309 74  PHE A CD2 
2343 C CE1 . PHE C 55  ? 0.2304 0.3057 0.3703 0.0251  -0.0295 -0.0252 74  PHE A CE1 
2344 C CE2 . PHE C 55  ? 0.2860 0.3949 0.4625 0.0235  -0.0331 -0.0271 74  PHE A CE2 
2345 C CZ  . PHE C 55  ? 0.2950 0.3833 0.4497 0.0205  -0.0333 -0.0245 74  PHE A CZ  
2346 N N   . ARG C 56  ? 0.2446 0.4019 0.4517 0.0418  -0.0029 -0.0400 75  ARG A N   
2347 C CA  . ARG C 56  ? 0.3493 0.5294 0.5729 0.0348  0.0036  -0.0380 75  ARG A CA  
2348 C C   . ARG C 56  ? 0.2755 0.4595 0.4904 0.0308  0.0165  -0.0371 75  ARG A C   
2349 O O   . ARG C 56  ? 0.3542 0.5508 0.5759 0.0222  0.0225  -0.0333 75  ARG A O   
2350 C CB  . ARG C 56  ? 0.4105 0.6153 0.6604 0.0414  0.0037  -0.0421 75  ARG A CB  
2351 C CG  . ARG C 56  ? 0.4589 0.6639 0.7208 0.0452  -0.0098 -0.0429 75  ARG A CG  
2352 C CD  . ARG C 56  ? 0.5836 0.8165 0.8741 0.0520  -0.0085 -0.0472 75  ARG A CD  
2353 N NE  . ARG C 56  ? 0.7559 0.9928 1.0613 0.0550  -0.0220 -0.0477 75  ARG A NE  
2354 C CZ  . ARG C 56  ? 0.8921 1.1548 1.2258 0.0597  -0.0237 -0.0508 75  ARG A CZ  
2355 N NH1 . ARG C 56  ? 0.9242 1.2116 1.2744 0.0620  -0.0114 -0.0537 75  ARG A NH1 
2356 N NH2 . ARG C 56  ? 0.9256 1.1900 1.2712 0.0624  -0.0376 -0.0512 75  ARG A NH2 
2357 N N   . ASP C 57  ? 0.2136 0.3861 0.4131 0.0371  0.0202  -0.0405 76  ASP A N   
2358 C CA  . ASP C 57  ? 0.2476 0.4223 0.4365 0.0344  0.0314  -0.0403 76  ASP A CA  
2359 C C   . ASP C 57  ? 0.2496 0.4060 0.4187 0.0259  0.0308  -0.0350 76  ASP A C   
2360 O O   . ASP C 57  ? 0.3468 0.5041 0.5063 0.0219  0.0388  -0.0333 76  ASP A O   
2361 C CB  . ASP C 57  ? 0.2420 0.4128 0.4233 0.0450  0.0351  -0.0472 76  ASP A CB  
2362 C CG  . ASP C 57  ? 0.3835 0.5764 0.5839 0.0538  0.0397  -0.0529 76  ASP A CG  
2363 O OD1 . ASP C 57  ? 0.3181 0.5324 0.5390 0.0506  0.0415  -0.0510 76  ASP A OD1 
2364 O OD2 . ASP C 57  ? 0.4044 0.5933 0.5999 0.0639  0.0412  -0.0596 76  ASP A OD2 
2365 N N   . LEU C 58  ? 0.2266 0.3664 0.3890 0.0237  0.0213  -0.0326 77  LEU A N   
2366 C CA  . LEU C 58  ? 0.2237 0.3470 0.3689 0.0164  0.0202  -0.0280 77  LEU A CA  
2367 C C   . LEU C 58  ? 0.2932 0.4242 0.4448 0.0062  0.0215  -0.0224 77  LEU A C   
2368 O O   . LEU C 58  ? 0.3001 0.4434 0.4686 0.0042  0.0184  -0.0217 77  LEU A O   
2369 C CB  . LEU C 58  ? 0.2381 0.3419 0.3738 0.0181  0.0106  -0.0275 77  LEU A CB  
2370 C CG  . LEU C 58  ? 0.2258 0.3186 0.3540 0.0268  0.0086  -0.0318 77  LEU A CG  
2371 C CD1 . LEU C 58  ? 0.2452 0.3195 0.3638 0.0275  -0.0002 -0.0301 77  LEU A CD1 
2372 C CD2 . LEU C 58  ? 0.2195 0.3072 0.3348 0.0273  0.0155  -0.0334 77  LEU A CD2 
2373 N N   . VAL C 59  ? 0.1698 0.2930 0.3083 -0.0002 0.0253  -0.0184 78  VAL A N   
2374 C CA  . VAL C 59  ? 0.2269 0.3548 0.3702 -0.0102 0.0263  -0.0128 78  VAL A CA  
2375 C C   . VAL C 59  ? 0.1831 0.2910 0.3126 -0.0148 0.0198  -0.0095 78  VAL A C   
2376 O O   . VAL C 59  ? 0.1809 0.2741 0.2941 -0.0120 0.0194  -0.0102 78  VAL A O   
2377 C CB  . VAL C 59  ? 0.3741 0.5114 0.5145 -0.0144 0.0373  -0.0099 78  VAL A CB  
2378 C CG1 . VAL C 59  ? 0.4661 0.6269 0.6230 -0.0110 0.0447  -0.0127 78  VAL A CG1 
2379 C CG2 . VAL C 59  ? 0.4135 0.5378 0.5333 -0.0111 0.0406  -0.0111 78  VAL A CG2 
2380 N N   . PRO C 60  ? 0.2134 0.3208 0.3497 -0.0217 0.0145  -0.0062 79  PRO A N   
2381 C CA  . PRO C 60  ? 0.2307 0.3189 0.3534 -0.0255 0.0086  -0.0036 79  PRO A CA  
2382 C C   . PRO C 60  ? 0.2177 0.3016 0.3306 -0.0316 0.0145  0.0010  79  PRO A C   
2383 O O   . PRO C 60  ? 0.2156 0.3107 0.3367 -0.0379 0.0196  0.0045  79  PRO A O   
2384 C CB  . PRO C 60  ? 0.2792 0.3696 0.4137 -0.0308 0.0007  -0.0025 79  PRO A CB  
2385 C CG  . PRO C 60  ? 0.3147 0.4277 0.4715 -0.0298 0.0024  -0.0043 79  PRO A CG  
2386 C CD  . PRO C 60  ? 0.2417 0.3663 0.3990 -0.0265 0.0135  -0.0050 79  PRO A CD  
2387 N N   . ASN C 61  ? 0.1608 0.2290 0.2563 -0.0294 0.0140  0.0011  80  ASN A N   
2388 C CA  . ASN C 61  ? 0.1680 0.2292 0.2522 -0.0339 0.0178  0.0054  80  ASN A CA  
2389 C C   . ASN C 61  ? 0.2483 0.2972 0.3293 -0.0401 0.0117  0.0089  80  ASN A C   
2390 O O   . ASN C 61  ? 0.2440 0.2795 0.3175 -0.0375 0.0052  0.0070  80  ASN A O   
2391 C CB  . ASN C 61  ? 0.1544 0.2054 0.2232 -0.0280 0.0191  0.0033  80  ASN A CB  
2392 C CG  . ASN C 61  ? 0.2559 0.3017 0.3131 -0.0311 0.0232  0.0072  80  ASN A CG  
2393 O OD1 . ASN C 61  ? 0.2246 0.2653 0.2801 -0.0375 0.0221  0.0120  80  ASN A OD1 
2394 N ND2 . ASN C 61  ? 0.1815 0.2276 0.2301 -0.0265 0.0272  0.0051  80  ASN A ND2 
2395 N N   . TYR C 62  ? 0.1914 0.2445 0.2777 -0.0484 0.0139  0.0139  81  TYR A N   
2396 C CA  . TYR C 62  ? 0.1891 0.2298 0.2737 -0.0550 0.0074  0.0170  81  TYR A CA  
2397 C C   . TYR C 62  ? 0.2492 0.2764 0.3190 -0.0580 0.0092  0.0217  81  TYR A C   
2398 O O   . TYR C 62  ? 0.2652 0.2828 0.3338 -0.0648 0.0055  0.0257  81  TYR A O   
2399 C CB  . TYR C 62  ? 0.2057 0.2583 0.3085 -0.0634 0.0064  0.0196  81  TYR A CB  
2400 C CG  . TYR C 62  ? 0.2114 0.2745 0.3291 -0.0605 0.0013  0.0149  81  TYR A CG  
2401 C CD1 . TYR C 62  ? 0.2308 0.2823 0.3426 -0.0550 -0.0074 0.0104  81  TYR A CD1 
2402 C CD2 . TYR C 62  ? 0.3169 0.4020 0.4547 -0.0629 0.0050  0.0150  81  TYR A CD2 
2403 C CE1 . TYR C 62  ? 0.2259 0.2855 0.3495 -0.0520 -0.0130 0.0065  81  TYR A CE1 
2404 C CE2 . TYR C 62  ? 0.3246 0.4192 0.4765 -0.0595 -0.0008 0.0106  81  TYR A CE2 
2405 C CZ  . TYR C 62  ? 0.2849 0.3658 0.4289 -0.0540 -0.0103 0.0065  81  TYR A CZ  
2406 O OH  . TYR C 62  ? 0.2967 0.3859 0.4532 -0.0502 -0.0169 0.0025  81  TYR A OH  
2407 N N   . ASN C 63  ? 0.2525 0.2780 0.3108 -0.0527 0.0141  0.0212  82  ASN A N   
2408 C CA  . ASN C 63  ? 0.2643 0.2778 0.3080 -0.0541 0.0153  0.0254  82  ASN A CA  
2409 C C   . ASN C 63  ? 0.2334 0.2274 0.2684 -0.0537 0.0073  0.0253  82  ASN A C   
2410 O O   . ASN C 63  ? 0.2569 0.2448 0.2870 -0.0470 0.0037  0.0206  82  ASN A O   
2411 C CB  . ASN C 63  ? 0.2331 0.2483 0.2668 -0.0470 0.0198  0.0229  82  ASN A CB  
2412 C CG  . ASN C 63  ? 0.3280 0.3334 0.3472 -0.0480 0.0212  0.0274  82  ASN A CG  
2413 O OD1 . ASN C 63  ? 0.3217 0.3148 0.3361 -0.0523 0.0175  0.0317  82  ASN A OD1 
2414 N ND2 . ASN C 63  ? 0.2729 0.2827 0.2845 -0.0436 0.0259  0.0262  82  ASN A ND2 
2415 N N   . PRO C 64  ? 0.2406 0.2246 0.2736 -0.0607 0.0045  0.0303  83  PRO A N   
2416 C CA  . PRO C 64  ? 0.3163 0.2807 0.3409 -0.0600 -0.0035 0.0298  83  PRO A CA  
2417 C C   . PRO C 64  ? 0.3656 0.3194 0.3754 -0.0526 -0.0038 0.0286  83  PRO A C   
2418 O O   . PRO C 64  ? 0.4162 0.3563 0.4195 -0.0489 -0.0096 0.0260  83  PRO A O   
2419 C CB  . PRO C 64  ? 0.3089 0.2654 0.3338 -0.0697 -0.0048 0.0367  83  PRO A CB  
2420 C CG  . PRO C 64  ? 0.4087 0.3837 0.4470 -0.0767 0.0017  0.0402  83  PRO A CG  
2421 C CD  . PRO C 64  ? 0.3103 0.3005 0.3486 -0.0700 0.0091  0.0372  83  PRO A CD  
2422 N N   . ASP C 65  ? 0.2673 0.2278 0.2724 -0.0504 0.0022  0.0301  84  ASP A N   
2423 C CA  . ASP C 65  ? 0.3181 0.2702 0.3109 -0.0437 0.0014  0.0292  84  ASP A CA  
2424 C C   . ASP C 65  ? 0.2641 0.2217 0.2578 -0.0358 0.0017  0.0226  84  ASP A C   
2425 O O   . ASP C 65  ? 0.3278 0.2820 0.3142 -0.0304 0.0015  0.0212  84  ASP A O   
2426 C CB  . ASP C 65  ? 0.3492 0.3036 0.3342 -0.0451 0.0063  0.0341  84  ASP A CB  
2427 C CG  . ASP C 65  ? 0.4481 0.3953 0.4303 -0.0534 0.0064  0.0419  84  ASP A CG  
2428 O OD1 . ASP C 65  ? 0.3876 0.3195 0.3670 -0.0554 0.0002  0.0437  84  ASP A OD1 
2429 O OD2 . ASP C 65  ? 0.5416 0.4980 0.5239 -0.0580 0.0128  0.0464  84  ASP A OD2 
2430 N N   . ILE C 66  ? 0.2196 0.1854 0.2228 -0.0355 0.0018  0.0189  85  ILE A N   
2431 C CA  . ILE C 66  ? 0.2318 0.2008 0.2357 -0.0288 0.0016  0.0135  85  ILE A CA  
2432 C C   . ILE C 66  ? 0.2668 0.2298 0.2729 -0.0277 -0.0037 0.0105  85  ILE A C   
2433 O O   . ILE C 66  ? 0.2508 0.2155 0.2639 -0.0320 -0.0061 0.0110  85  ILE A O   
2434 C CB  . ILE C 66  ? 0.2385 0.2223 0.2499 -0.0277 0.0064  0.0113  85  ILE A CB  
2435 C CG1 . ILE C 66  ? 0.2374 0.2274 0.2449 -0.0282 0.0119  0.0133  85  ILE A CG1 
2436 C CG2 . ILE C 66  ? 0.2624 0.2467 0.2738 -0.0215 0.0056  0.0064  85  ILE A CG2 
2437 C CD1 . ILE C 66  ? 0.2163 0.2206 0.2309 -0.0268 0.0169  0.0107  85  ILE A CD1 
2438 N N   . ILE C 67  ? 0.2557 0.2120 0.2557 -0.0220 -0.0055 0.0075  86  ILE A N   
2439 C CA  . ILE C 67  ? 0.2972 0.2474 0.2964 -0.0200 -0.0099 0.0045  86  ILE A CA  
2440 C C   . ILE C 67  ? 0.2750 0.2334 0.2789 -0.0171 -0.0086 0.0016  86  ILE A C   
2441 O O   . ILE C 67  ? 0.2642 0.2260 0.2666 -0.0133 -0.0054 0.0003  86  ILE A O   
2442 C CB  . ILE C 67  ? 0.2862 0.2253 0.2758 -0.0149 -0.0118 0.0028  86  ILE A CB  
2443 C CG1 . ILE C 67  ? 0.3192 0.2474 0.3034 -0.0168 -0.0145 0.0054  86  ILE A CG1 
2444 C CG2 . ILE C 67  ? 0.3597 0.2931 0.3460 -0.0119 -0.0153 -0.0008 86  ILE A CG2 
2445 C CD1 . ILE C 67  ? 0.3443 0.2635 0.3202 -0.0104 -0.0157 0.0035  86  ILE A CD1 
2446 N N   . PHE C 68  ? 0.2582 0.2190 0.2679 -0.0190 -0.0118 0.0006  87  PHE A N   
2447 C CA  . PHE C 68  ? 0.2473 0.2139 0.2605 -0.0157 -0.0117 -0.0018 87  PHE A CA  
2448 C C   . PHE C 68  ? 0.3043 0.2612 0.3099 -0.0123 -0.0162 -0.0041 87  PHE A C   
2449 O O   . PHE C 68  ? 0.2545 0.2056 0.2591 -0.0142 -0.0218 -0.0048 87  PHE A O   
2450 C CB  . PHE C 68  ? 0.2217 0.1996 0.2474 -0.0188 -0.0122 -0.0016 87  PHE A CB  
2451 C CG  . PHE C 68  ? 0.2282 0.2174 0.2601 -0.0203 -0.0061 -0.0002 87  PHE A CG  
2452 C CD1 . PHE C 68  ? 0.1757 0.1717 0.2096 -0.0162 -0.0024 -0.0022 87  PHE A CD1 
2453 C CD2 . PHE C 68  ? 0.2311 0.2230 0.2655 -0.0259 -0.0040 0.0032  87  PHE A CD2 
2454 C CE1 . PHE C 68  ? 0.2152 0.2210 0.2531 -0.0168 0.0032  -0.0017 87  PHE A CE1 
2455 C CE2 . PHE C 68  ? 0.1859 0.1882 0.2238 -0.0269 0.0023  0.0045  87  PHE A CE2 
2456 C CZ  . PHE C 68  ? 0.2458 0.2552 0.2851 -0.0220 0.0059  0.0016  87  PHE A CZ  
2457 N N   . LYS C 69  ? 0.2220 0.1768 0.2217 -0.0075 -0.0138 -0.0053 88  LYS A N   
2458 C CA  . LYS C 69  ? 0.2281 0.1734 0.2177 -0.0039 -0.0164 -0.0069 88  LYS A CA  
2459 C C   . LYS C 69  ? 0.2571 0.2003 0.2469 -0.0040 -0.0225 -0.0082 88  LYS A C   
2460 O O   . LYS C 69  ? 0.2823 0.2161 0.2642 -0.0034 -0.0273 -0.0098 88  LYS A O   
2461 C CB  . LYS C 69  ? 0.2397 0.1859 0.2254 0.0002  -0.0119 -0.0070 88  LYS A CB  
2462 C CG  . LYS C 69  ? 0.2287 0.1664 0.2032 0.0040  -0.0129 -0.0081 88  LYS A CG  
2463 C CD  . LYS C 69  ? 0.3037 0.2436 0.2764 0.0065  -0.0074 -0.0072 88  LYS A CD  
2464 C CE  . LYS C 69  ? 0.2995 0.2323 0.2608 0.0099  -0.0072 -0.0073 88  LYS A CE  
2465 N NZ  . LYS C 69  ? 0.2742 0.2007 0.2266 0.0125  -0.0068 -0.0090 88  LYS A NZ  
2466 N N   . ASP C 70  ? 0.1936 0.1453 0.1921 -0.0043 -0.0228 -0.0079 89  ASP A N   
2467 C CA  . ASP C 70  ? 0.2348 0.1868 0.2362 -0.0044 -0.0295 -0.0090 89  ASP A CA  
2468 C C   . ASP C 70  ? 0.2486 0.1890 0.2361 -0.0006 -0.0337 -0.0104 89  ASP A C   
2469 O O   . ASP C 70  ? 0.2370 0.1722 0.2219 -0.0015 -0.0410 -0.0120 89  ASP A O   
2470 C CB  . ASP C 70  ? 0.2854 0.2408 0.2959 -0.0099 -0.0339 -0.0090 89  ASP A CB  
2471 C CG  . ASP C 70  ? 0.3151 0.2750 0.3335 -0.0103 -0.0410 -0.0103 89  ASP A CG  
2472 O OD1 . ASP C 70  ? 0.3070 0.2723 0.3290 -0.0067 -0.0408 -0.0105 89  ASP A OD1 
2473 O OD2 . ASP C 70  ? 0.3461 0.3034 0.3670 -0.0140 -0.0477 -0.0111 89  ASP A OD2 
2474 N N   . GLU C 71  ? 0.3059 0.2421 0.2840 0.0033  -0.0293 -0.0098 90  GLU A N   
2475 C CA  . GLU C 71  ? 0.2386 0.1646 0.2021 0.0071  -0.0320 -0.0105 90  GLU A CA  
2476 C C   . GLU C 71  ? 0.2961 0.2223 0.2610 0.0084  -0.0388 -0.0106 90  GLU A C   
2477 O O   . GLU C 71  ? 0.2924 0.2097 0.2452 0.0109  -0.0441 -0.0115 90  GLU A O   
2478 C CB  . GLU C 71  ? 0.2317 0.1557 0.1875 0.0102  -0.0247 -0.0088 90  GLU A CB  
2479 C CG  . GLU C 71  ? 0.2380 0.1664 0.1986 0.0110  -0.0222 -0.0065 90  GLU A CG  
2480 C CD  . GLU C 71  ? 0.2654 0.2037 0.2395 0.0087  -0.0180 -0.0062 90  GLU A CD  
2481 O OE1 . GLU C 71  ? 0.2450 0.1874 0.2245 0.0062  -0.0165 -0.0070 90  GLU A OE1 
2482 O OE2 . GLU C 71  ? 0.2418 0.1827 0.2199 0.0096  -0.0163 -0.0050 90  GLU A OE2 
2483 N N   . GLU C 72  ? 0.2255 0.1620 0.2048 0.0072  -0.0390 -0.0099 91  GLU A N   
2484 C CA  . GLU C 72  ? 0.2335 0.1719 0.2169 0.0090  -0.0460 -0.0102 91  GLU A CA  
2485 C C   . GLU C 72  ? 0.3083 0.2474 0.2963 0.0065  -0.0548 -0.0124 91  GLU A C   
2486 O O   . GLU C 72  ? 0.3360 0.2745 0.3245 0.0086  -0.0628 -0.0131 91  GLU A O   
2487 C CB  . GLU C 72  ? 0.2505 0.2007 0.2494 0.0093  -0.0433 -0.0096 91  GLU A CB  
2488 C CG  . GLU C 72  ? 0.2646 0.2139 0.2607 0.0112  -0.0357 -0.0079 91  GLU A CG  
2489 C CD  . GLU C 72  ? 0.2523 0.2068 0.2528 0.0080  -0.0282 -0.0080 91  GLU A CD  
2490 O OE1 . GLU C 72  ? 0.2238 0.1781 0.2234 0.0049  -0.0277 -0.0084 91  GLU A OE1 
2491 O OE2 . GLU C 72  ? 0.2061 0.1642 0.2105 0.0088  -0.0233 -0.0076 91  GLU A OE2 
2492 N N   . ASN C 73  ? 0.2739 0.2138 0.2655 0.0019  -0.0542 -0.0132 92  ASN A N   
2493 C CA  . ASN C 73  ? 0.3445 0.2861 0.3437 -0.0022 -0.0624 -0.0151 92  ASN A CA  
2494 C C   . ASN C 73  ? 0.3438 0.2997 0.3618 -0.0033 -0.0661 -0.0150 92  ASN A C   
2495 O O   . ASN C 73  ? 0.2760 0.2321 0.2971 -0.0031 -0.0757 -0.0167 92  ASN A O   
2496 C CB  . ASN C 73  ? 0.4115 0.3390 0.3946 0.0001  -0.0709 -0.0175 92  ASN A CB  
2497 C CG  . ASN C 73  ? 0.5597 0.4744 0.5267 0.0008  -0.0676 -0.0186 92  ASN A CG  
2498 O OD1 . ASN C 73  ? 0.5807 0.4954 0.5522 -0.0033 -0.0654 -0.0187 92  ASN A OD1 
2499 N ND2 . ASN C 73  ? 0.5739 0.4779 0.5220 0.0064  -0.0670 -0.0192 92  ASN A ND2 
2500 N N   . SER C 74  ? 0.2669 0.2351 0.2974 -0.0039 -0.0587 -0.0135 93  SER A N   
2501 C CA  . SER C 74  ? 0.2741 0.2573 0.3228 -0.0033 -0.0604 -0.0139 93  SER A CA  
2502 C C   . SER C 74  ? 0.2871 0.2849 0.3512 -0.0074 -0.0526 -0.0128 93  SER A C   
2503 O O   . SER C 74  ? 0.2806 0.2935 0.3621 -0.0077 -0.0528 -0.0133 93  SER A O   
2504 C CB  . SER C 74  ? 0.3006 0.2824 0.3452 0.0038  -0.0593 -0.0136 93  SER A CB  
2505 O OG  . SER C 74  ? 0.2942 0.2772 0.3369 0.0046  -0.0494 -0.0125 93  SER A OG  
2506 N N   . GLY C 75  ? 0.2535 0.2468 0.3105 -0.0100 -0.0455 -0.0113 94  GLY A N   
2507 C CA  . GLY C 75  ? 0.2799 0.2849 0.3472 -0.0135 -0.0375 -0.0098 94  GLY A CA  
2508 C C   . GLY C 75  ? 0.2721 0.2844 0.3424 -0.0087 -0.0308 -0.0103 94  GLY A C   
2509 O O   . GLY C 75  ? 0.2040 0.2269 0.2824 -0.0107 -0.0242 -0.0096 94  GLY A O   
2510 N N   . ALA C 76  ? 0.1894 0.1950 0.2522 -0.0025 -0.0326 -0.0114 95  ALA A N   
2511 C CA  . ALA C 76  ? 0.2113 0.2210 0.2760 0.0020  -0.0271 -0.0123 95  ALA A CA  
2512 C C   . ALA C 76  ? 0.2410 0.2501 0.3004 0.0002  -0.0188 -0.0115 95  ALA A C   
2513 O O   . ALA C 76  ? 0.2119 0.2299 0.2776 0.0014  -0.0136 -0.0126 95  ALA A O   
2514 C CB  . ALA C 76  ? 0.2303 0.2292 0.2854 0.0079  -0.0306 -0.0127 95  ALA A CB  
2515 N N   . ASP C 77  ? 0.2009 0.1998 0.2486 -0.0021 -0.0180 -0.0099 96  ASP A N   
2516 C CA  . ASP C 77  ? 0.1921 0.1901 0.2346 -0.0031 -0.0114 -0.0091 96  ASP A CA  
2517 C C   . ASP C 77  ? 0.2852 0.2943 0.3358 -0.0068 -0.0066 -0.0084 96  ASP A C   
2518 O O   . ASP C 77  ? 0.2006 0.2117 0.2486 -0.0061 -0.0013 -0.0086 96  ASP A O   
2519 C CB  . ASP C 77  ? 0.1646 0.1511 0.1951 -0.0047 -0.0119 -0.0077 96  ASP A CB  
2520 C CG  . ASP C 77  ? 0.2359 0.2120 0.2560 -0.0008 -0.0136 -0.0080 96  ASP A CG  
2521 O OD1 . ASP C 77  ? 0.2318 0.2080 0.2523 0.0025  -0.0128 -0.0086 96  ASP A OD1 
2522 O OD2 . ASP C 77  ? 0.2239 0.1912 0.2349 -0.0011 -0.0155 -0.0075 96  ASP A OD2 
2523 N N   . ARG C 78  ? 0.2425 0.2586 0.3024 -0.0110 -0.0086 -0.0074 97  ARG A N   
2524 C CA  . ARG C 78  ? 0.2010 0.2284 0.2686 -0.0154 -0.0033 -0.0057 97  ARG A CA  
2525 C C   . ARG C 78  ? 0.2110 0.2526 0.2887 -0.0121 0.0013  -0.0079 97  ARG A C   
2526 O O   . ARG C 78  ? 0.1656 0.2165 0.2465 -0.0141 0.0078  -0.0070 97  ARG A O   
2527 C CB  . ARG C 78  ? 0.1734 0.2049 0.2500 -0.0218 -0.0068 -0.0036 97  ARG A CB  
2528 C CG  . ARG C 78  ? 0.2485 0.2660 0.3160 -0.0256 -0.0116 -0.0017 97  ARG A CG  
2529 C CD  . ARG C 78  ? 0.2490 0.2713 0.3273 -0.0333 -0.0148 0.0005  97  ARG A CD  
2530 N NE  . ARG C 78  ? 0.3127 0.3194 0.3814 -0.0366 -0.0201 0.0017  97  ARG A NE  
2531 C CZ  . ARG C 78  ? 0.3357 0.3344 0.3964 -0.0400 -0.0175 0.0048  97  ARG A CZ  
2532 N NH1 . ARG C 78  ? 0.2143 0.2197 0.2749 -0.0409 -0.0097 0.0074  97  ARG A NH1 
2533 N NH2 . ARG C 78  ? 0.3705 0.3538 0.4224 -0.0419 -0.0230 0.0051  97  ARG A NH2 
2534 N N   . LEU C 79  ? 0.1743 0.2172 0.2566 -0.0065 -0.0021 -0.0110 98  LEU A N   
2535 C CA  . LEU C 79  ? 0.2091 0.2657 0.3028 -0.0023 0.0012  -0.0139 98  LEU A CA  
2536 C C   . LEU C 79  ? 0.2033 0.2576 0.2894 0.0022  0.0066  -0.0163 98  LEU A C   
2537 O O   . LEU C 79  ? 0.2564 0.2982 0.3321 0.0051  0.0046  -0.0171 98  LEU A O   
2538 C CB  . LEU C 79  ? 0.2029 0.2610 0.3047 0.0026  -0.0057 -0.0162 98  LEU A CB  
2539 C CG  . LEU C 79  ? 0.2655 0.3312 0.3798 -0.0010 -0.0115 -0.0152 98  LEU A CG  
2540 C CD1 . LEU C 79  ? 0.3146 0.3795 0.4340 0.0054  -0.0193 -0.0177 98  LEU A CD1 
2541 C CD2 . LEU C 79  ? 0.3431 0.4286 0.4739 -0.0047 -0.0060 -0.0147 98  LEU A CD2 
2542 N N   . MET C 80  ? 0.2218 0.2883 0.3129 0.0025  0.0134  -0.0175 99  MET A N   
2543 C CA  . MET C 80  ? 0.2604 0.3247 0.3431 0.0063  0.0183  -0.0202 99  MET A CA  
2544 C C   . MET C 80  ? 0.2055 0.2860 0.2964 0.0087  0.0253  -0.0229 99  MET A C   
2545 O O   . MET C 80  ? 0.1980 0.2928 0.3017 0.0062  0.0276  -0.0216 99  MET A O   
2546 C CB  . MET C 80  ? 0.2218 0.2770 0.2908 0.0018  0.0203  -0.0172 99  MET A CB  
2547 C CG  . MET C 80  ? 0.2000 0.2617 0.2700 -0.0050 0.0242  -0.0127 99  MET A CG  
2548 S SD  . MET C 80  ? 0.2217 0.2702 0.2754 -0.0092 0.0243  -0.0088 99  MET A SD  
2549 C CE  . MET C 80  ? 0.2008 0.2356 0.2521 -0.0101 0.0161  -0.0075 99  MET A CE  
2550 N N   . THR C 81  ? 0.2123 0.2908 0.2960 0.0137  0.0288  -0.0270 100 THR A N   
2551 C CA  . THR C 81  ? 0.2148 0.3076 0.3035 0.0174  0.0361  -0.0306 100 THR A CA  
2552 C C   . THR C 81  ? 0.1956 0.2950 0.2788 0.0113  0.0432  -0.0266 100 THR A C   
2553 O O   . THR C 81  ? 0.1801 0.2705 0.2541 0.0053  0.0418  -0.0218 100 THR A O   
2557 N N   . GLU C 82  ? 0.1717 0.2867 0.2599 0.0134  0.0512  -0.0286 101 GLU A N   
2558 C CA  . GLU C 82  ? 0.3114 0.4336 0.3938 0.0076  0.0590  -0.0241 101 GLU A CA  
2559 C C   . GLU C 82  ? 0.3022 0.4103 0.3639 0.0075  0.0589  -0.0241 101 GLU A C   
2560 O O   . GLU C 82  ? 0.2911 0.3940 0.3438 0.0010  0.0596  -0.0182 101 GLU A O   
2561 C CB  . GLU C 82  ? 0.3278 0.4703 0.4186 0.0111  0.0686  -0.0270 101 GLU A CB  
2562 C CG  . GLU C 82  ? 0.4998 0.6523 0.5877 0.0036  0.0773  -0.0206 101 GLU A CG  
2563 C CD  . GLU C 82  ? 0.5973 0.7494 0.6936 -0.0067 0.0740  -0.0126 101 GLU A CD  
2564 O OE1 . GLU C 82  ? 0.5138 0.6729 0.6281 -0.0074 0.0697  -0.0129 101 GLU A OE1 
2565 O OE2 . GLU C 82  ? 0.7340 0.8778 0.8183 -0.0138 0.0749  -0.0062 101 GLU A OE2 
2566 N N   . ARG C 83  ? 0.2472 0.3484 0.3016 0.0149  0.0573  -0.0307 102 ARG A N   
2567 C CA  . ARG C 83  ? 0.2305 0.3193 0.2667 0.0151  0.0562  -0.0315 102 ARG A CA  
2568 C C   . ARG C 83  ? 0.2522 0.3261 0.2833 0.0102  0.0489  -0.0271 102 ARG A C   
2569 O O   . ARG C 83  ? 0.2574 0.3246 0.2763 0.0068  0.0487  -0.0237 102 ARG A O   
2570 C CB  . ARG C 83  ? 0.2782 0.3617 0.3093 0.0236  0.0547  -0.0402 102 ARG A CB  
2571 C CG  . ARG C 83  ? 0.2937 0.3667 0.3064 0.0241  0.0537  -0.0420 102 ARG A CG  
2572 C CD  . ARG C 83  ? 0.3712 0.4370 0.3796 0.0318  0.0508  -0.0510 102 ARG A CD  
2573 N NE  . ARG C 83  ? 0.4691 0.5245 0.4610 0.0317  0.0482  -0.0531 102 ARG A NE  
2574 C CZ  . ARG C 83  ? 0.5920 0.6496 0.5712 0.0355  0.0522  -0.0577 102 ARG A CZ  
2575 N NH1 . ARG C 83  ? 0.6273 0.6981 0.6087 0.0399  0.0603  -0.0607 102 ARG A NH1 
2576 N NH2 . ARG C 83  ? 0.5742 0.6216 0.5386 0.0351  0.0481  -0.0595 102 ARG A NH2 
2577 N N   . CYS C 84  ? 0.2101 0.2792 0.2503 0.0104  0.0428  -0.0270 103 CYS A N   
2578 C CA  . CYS C 84  ? 0.2131 0.2693 0.2489 0.0065  0.0367  -0.0232 103 CYS A CA  
2579 C C   . CYS C 84  ? 0.2566 0.3145 0.2919 -0.0007 0.0380  -0.0162 103 CYS A C   
2580 O O   . CYS C 84  ? 0.2733 0.3218 0.2990 -0.0037 0.0358  -0.0129 103 CYS A O   
2581 C CB  . CYS C 84  ? 0.2100 0.2613 0.2543 0.0084  0.0308  -0.0242 103 CYS A CB  
2582 S SG  . CYS C 84  ? 0.2442 0.2795 0.2812 0.0053  0.0243  -0.0209 103 CYS A SG  
2583 N N   . LYS C 85  ? 0.2668 0.3367 0.3130 -0.0034 0.0413  -0.0141 104 LYS A N   
2584 C CA  . LYS C 85  ? 0.2235 0.2950 0.2703 -0.0111 0.0427  -0.0073 104 LYS A CA  
2585 C C   . LYS C 85  ? 0.2382 0.3076 0.2710 -0.0136 0.0473  -0.0039 104 LYS A C   
2586 O O   . LYS C 85  ? 0.2431 0.3028 0.2683 -0.0182 0.0447  0.0011  104 LYS A O   
2587 C CB  . LYS C 85  ? 0.2845 0.3721 0.3475 -0.0137 0.0464  -0.0060 104 LYS A CB  
2588 C CG  . LYS C 85  ? 0.2938 0.3830 0.3597 -0.0229 0.0473  0.0013  104 LYS A CG  
2589 C CD  . LYS C 85  ? 0.3074 0.4147 0.3927 -0.0259 0.0504  0.0021  104 LYS A CD  
2590 C CE  . LYS C 85  ? 0.4986 0.6087 0.5865 -0.0362 0.0532  0.0099  104 LYS A CE  
2591 N NZ  . LYS C 85  ? 0.5935 0.7217 0.7032 -0.0403 0.0550  0.0109  104 LYS A NZ  
2592 N N   . GLU C 86  ? 0.2102 0.2879 0.2388 -0.0102 0.0538  -0.0068 105 GLU A N   
2593 C CA  . GLU C 86  ? 0.2272 0.3028 0.2403 -0.0120 0.0580  -0.0037 105 GLU A CA  
2594 C C   . GLU C 86  ? 0.2196 0.2792 0.2187 -0.0109 0.0518  -0.0037 105 GLU A C   
2595 O O   . GLU C 86  ? 0.2320 0.2848 0.2213 -0.0150 0.0511  0.0020  105 GLU A O   
2596 C CB  . GLU C 86  ? 0.2739 0.3601 0.2826 -0.0068 0.0655  -0.0085 105 GLU A CB  
2597 C CG  . GLU C 86  ? 0.4379 0.5428 0.4605 -0.0080 0.0735  -0.0078 105 GLU A CG  
2598 C CD  . GLU C 86  ? 0.6766 0.7924 0.6941 -0.0016 0.0816  -0.0133 105 GLU A CD  
2599 O OE1 . GLU C 86  ? 0.7100 0.8176 0.7093 0.0019  0.0816  -0.0160 105 GLU A OE1 
2600 O OE2 . GLU C 86  ? 0.7230 0.8557 0.7546 0.0003  0.0877  -0.0155 105 GLU A OE2 
2601 N N   . ARG C 87  ? 0.2516 0.3057 0.2503 -0.0053 0.0473  -0.0099 106 ARG A N   
2602 C CA  . ARG C 87  ? 0.2104 0.2518 0.1981 -0.0039 0.0416  -0.0107 106 ARG A CA  
2603 C C   . ARG C 87  ? 0.2042 0.2364 0.1940 -0.0077 0.0360  -0.0060 106 ARG A C   
2604 O O   . ARG C 87  ? 0.2034 0.2276 0.1836 -0.0090 0.0332  -0.0030 106 ARG A O   
2605 C CB  . ARG C 87  ? 0.2740 0.3121 0.2631 0.0019  0.0382  -0.0182 106 ARG A CB  
2606 C CG  . ARG C 87  ? 0.3717 0.4165 0.3572 0.0070  0.0427  -0.0244 106 ARG A CG  
2607 C CD  . ARG C 87  ? 0.4863 0.5332 0.4570 0.0065  0.0470  -0.0228 106 ARG A CD  
2608 N NE  . ARG C 87  ? 0.6735 0.7226 0.6369 0.0126  0.0491  -0.0304 106 ARG A NE  
2609 C CZ  . ARG C 87  ? 0.6982 0.7581 0.6654 0.0164  0.0558  -0.0343 106 ARG A CZ  
2610 N NH1 . ARG C 87  ? 0.7330 0.8044 0.7133 0.0141  0.0609  -0.0309 106 ARG A NH1 
2611 N NH2 . ARG C 87  ? 0.6607 0.7203 0.6193 0.0228  0.0570  -0.0420 106 ARG A NH2 
2612 N N   . VAL C 88  ? 0.1857 0.2185 0.1872 -0.0088 0.0339  -0.0059 107 VAL A N   
2613 C CA  . VAL C 88  ? 0.1997 0.2230 0.2015 -0.0117 0.0288  -0.0022 107 VAL A CA  
2614 C C   . VAL C 88  ? 0.2096 0.2305 0.2069 -0.0173 0.0298  0.0045  107 VAL A C   
2615 O O   . VAL C 88  ? 0.2083 0.2190 0.1995 -0.0183 0.0258  0.0073  107 VAL A O   
2616 C CB  . VAL C 88  ? 0.1912 0.2141 0.2039 -0.0116 0.0256  -0.0033 107 VAL A CB  
2617 C CG1 . VAL C 88  ? 0.2054 0.2357 0.2273 -0.0161 0.0275  -0.0002 107 VAL A CG1 
2618 C CG2 . VAL C 88  ? 0.1457 0.1571 0.1550 -0.0118 0.0202  -0.0020 107 VAL A CG2 
2619 N N   . ASN C 89  ? 0.2168 0.2472 0.2174 -0.0208 0.0354  0.0072  108 ASN A N   
2620 C CA  . ASN C 89  ? 0.2508 0.2782 0.2471 -0.0272 0.0367  0.0145  108 ASN A CA  
2621 C C   . ASN C 89  ? 0.2643 0.2844 0.2441 -0.0265 0.0368  0.0172  108 ASN A C   
2622 O O   . ASN C 89  ? 0.2178 0.2277 0.1908 -0.0297 0.0339  0.0226  108 ASN A O   
2623 C CB  . ASN C 89  ? 0.3211 0.3621 0.3261 -0.0319 0.0435  0.0173  108 ASN A CB  
2624 C CG  . ASN C 89  ? 0.2823 0.3283 0.3041 -0.0344 0.0411  0.0166  108 ASN A CG  
2625 O OD1 . ASN C 89  ? 0.2317 0.2686 0.2557 -0.0335 0.0343  0.0151  108 ASN A OD1 
2626 N ND2 . ASN C 89  ? 0.2599 0.3209 0.2934 -0.0374 0.0466  0.0175  108 ASN A ND2 
2627 N N   . ALA C 90  ? 0.2676 0.2917 0.2403 -0.0218 0.0393  0.0131  109 ALA A N   
2628 C CA  . ALA C 90  ? 0.3130 0.3296 0.2695 -0.0200 0.0376  0.0146  109 ALA A CA  
2629 C C   . ALA C 90  ? 0.2560 0.2609 0.2104 -0.0173 0.0294  0.0134  109 ALA A C   
2630 O O   . ALA C 90  ? 0.2731 0.2688 0.2177 -0.0179 0.0259  0.0175  109 ALA A O   
2631 C CB  . ALA C 90  ? 0.2821 0.3053 0.2315 -0.0151 0.0412  0.0091  109 ALA A CB  
2632 N N   . LEU C 91  ? 0.2613 0.2668 0.2251 -0.0141 0.0264  0.0079  110 LEU A N   
2633 C CA  . LEU C 91  ? 0.2819 0.2787 0.2456 -0.0117 0.0199  0.0067  110 LEU A CA  
2634 C C   . LEU C 91  ? 0.2700 0.2584 0.2344 -0.0148 0.0169  0.0119  110 LEU A C   
2635 O O   . LEU C 91  ? 0.2951 0.2752 0.2542 -0.0131 0.0123  0.0134  110 LEU A O   
2636 C CB  . LEU C 91  ? 0.2320 0.2311 0.2056 -0.0087 0.0184  0.0009  110 LEU A CB  
2637 C CG  . LEU C 91  ? 0.1976 0.1901 0.1735 -0.0065 0.0131  -0.0003 110 LEU A CG  
2638 C CD1 . LEU C 91  ? 0.2068 0.1963 0.1750 -0.0040 0.0098  -0.0010 110 LEU A CD1 
2639 C CD2 . LEU C 91  ? 0.2327 0.2277 0.2173 -0.0045 0.0130  -0.0050 110 LEU A CD2 
2640 N N   . ALA C 92  ? 0.1760 0.1666 0.1473 -0.0190 0.0191  0.0144  111 ALA A N   
2641 C CA  . ALA C 92  ? 0.2031 0.1843 0.1751 -0.0222 0.0156  0.0185  111 ALA A CA  
2642 C C   . ALA C 92  ? 0.2238 0.1963 0.1841 -0.0241 0.0143  0.0245  111 ALA A C   
2643 O O   . ALA C 92  ? 0.2623 0.2233 0.2188 -0.0231 0.0091  0.0263  111 ALA A O   
2644 C CB  . ALA C 92  ? 0.2362 0.2222 0.2179 -0.0275 0.0178  0.0202  111 ALA A CB  
2645 N N   . ILE C 93  ? 0.1908 0.1681 0.1444 -0.0264 0.0190  0.0276  112 ILE A N   
2646 C CA  . ILE C 93  ? 0.2843 0.2527 0.2243 -0.0282 0.0180  0.0341  112 ILE A CA  
2647 C C   . ILE C 93  ? 0.3209 0.2825 0.2521 -0.0218 0.0122  0.0320  112 ILE A C   
2648 O O   . ILE C 93  ? 0.3206 0.2703 0.2447 -0.0212 0.0072  0.0360  112 ILE A O   
2649 C CB  . ILE C 93  ? 0.2642 0.2407 0.1975 -0.0317 0.0254  0.0378  112 ILE A CB  
2650 C CG1 . ILE C 93  ? 0.2832 0.2661 0.2266 -0.0392 0.0306  0.0416  112 ILE A CG1 
2651 C CG2 . ILE C 93  ? 0.3444 0.3111 0.2599 -0.0320 0.0239  0.0441  112 ILE A CG2 
2652 C CD1 . ILE C 93  ? 0.3098 0.3075 0.2529 -0.0415 0.0401  0.0425  112 ILE A CD1 
2653 N N   . ALA C 94  ? 0.2528 0.2218 0.1853 -0.0170 0.0124  0.0257  113 ALA A N   
2654 C CA  . ALA C 94  ? 0.2923 0.2574 0.2191 -0.0115 0.0067  0.0231  113 ALA A CA  
2655 C C   . ALA C 94  ? 0.2335 0.1915 0.1664 -0.0086 0.0007  0.0220  113 ALA A C   
2656 O O   . ALA C 94  ? 0.2186 0.1696 0.1457 -0.0052 -0.0048 0.0234  113 ALA A O   
2657 C CB  . ALA C 94  ? 0.2825 0.2568 0.2121 -0.0080 0.0078  0.0159  113 ALA A CB  
2658 N N   . VAL C 95  ? 0.2493 0.2095 0.1938 -0.0093 0.0018  0.0193  114 VAL A N   
2659 C CA  . VAL C 95  ? 0.2022 0.1566 0.1518 -0.0061 -0.0026 0.0177  114 VAL A CA  
2660 C C   . VAL C 95  ? 0.2665 0.2080 0.2100 -0.0069 -0.0063 0.0229  114 VAL A C   
2661 O O   . VAL C 95  ? 0.3304 0.2654 0.2719 -0.0022 -0.0114 0.0226  114 VAL A O   
2662 C CB  . VAL C 95  ? 0.1915 0.1496 0.1519 -0.0070 -0.0004 0.0142  114 VAL A CB  
2663 C CG1 . VAL C 95  ? 0.2599 0.2107 0.2231 -0.0041 -0.0041 0.0132  114 VAL A CG1 
2664 C CG2 . VAL C 95  ? 0.2026 0.1707 0.1690 -0.0051 0.0018  0.0089  114 VAL A CG2 
2665 N N   . MET C 96  ? 0.2751 0.2127 0.2165 -0.0128 -0.0041 0.0277  115 MET A N   
2666 C CA  . MET C 96  ? 0.2528 0.1760 0.1882 -0.0146 -0.0080 0.0331  115 MET A CA  
2667 C C   . MET C 96  ? 0.2991 0.2150 0.2219 -0.0124 -0.0113 0.0375  115 MET A C   
2668 O O   . MET C 96  ? 0.3656 0.2688 0.2836 -0.0095 -0.0171 0.0397  115 MET A O   
2669 C CB  . MET C 96  ? 0.3166 0.2384 0.2535 -0.0229 -0.0047 0.0378  115 MET A CB  
2670 C CG  . MET C 96  ? 0.3054 0.2339 0.2546 -0.0249 -0.0028 0.0336  115 MET A CG  
2671 S SD  . MET C 96  ? 0.4161 0.3442 0.3699 -0.0352 -0.0001 0.0391  115 MET A SD  
2672 C CE  . MET C 96  ? 0.5702 0.4767 0.5190 -0.0360 -0.0080 0.0420  115 MET A CE  
2673 N N   . ASN C 97  ? 0.2770 0.2003 0.1934 -0.0131 -0.0082 0.0385  116 ASN A N   
2674 C CA  . ASN C 97  ? 0.3197 0.2367 0.2225 -0.0103 -0.0120 0.0423  116 ASN A CA  
2675 C C   . ASN C 97  ? 0.3105 0.2273 0.2154 -0.0020 -0.0187 0.0375  116 ASN A C   
2676 O O   . ASN C 97  ? 0.3647 0.2714 0.2618 0.0019  -0.0250 0.0405  116 ASN A O   
2677 C CB  . ASN C 97  ? 0.3843 0.3102 0.2789 -0.0125 -0.0067 0.0433  116 ASN A CB  
2678 C CG  . ASN C 97  ? 0.4768 0.4011 0.3655 -0.0205 -0.0006 0.0507  116 ASN A CG  
2679 O OD1 . ASN C 97  ? 0.5359 0.4494 0.4241 -0.0247 -0.0020 0.0564  116 ASN A OD1 
2680 N ND2 . ASN C 97  ? 0.5267 0.4617 0.4112 -0.0226 0.0063  0.0505  116 ASN A ND2 
2681 N N   . MET C 98  ? 0.2828 0.2109 0.1990 0.0008  -0.0174 0.0302  117 MET A N   
2682 C CA  . MET C 98  ? 0.2335 0.1645 0.1543 0.0077  -0.0228 0.0256  117 MET A CA  
2683 C C   . MET C 98  ? 0.3447 0.2676 0.2705 0.0119  -0.0272 0.0254  117 MET A C   
2684 O O   . MET C 98  ? 0.3556 0.2747 0.2796 0.0177  -0.0334 0.0254  117 MET A O   
2685 C CB  . MET C 98  ? 0.2435 0.1880 0.1756 0.0083  -0.0197 0.0186  117 MET A CB  
2686 C CG  . MET C 98  ? 0.3045 0.2544 0.2445 0.0142  -0.0246 0.0137  117 MET A CG  
2687 S SD  . MET C 98  ? 0.3943 0.3430 0.3242 0.0183  -0.0321 0.0148  117 MET A SD  
2688 C CE  . MET C 98  ? 0.5901 0.5461 0.5131 0.0145  -0.0283 0.0125  117 MET A CE  
2689 N N   . TRP C 99  ? 0.2657 0.1861 0.1976 0.0093  -0.0242 0.0247  118 TRP A N   
2690 C CA  . TRP C 99  ? 0.3119 0.2250 0.2484 0.0137  -0.0273 0.0229  118 TRP A CA  
2691 C C   . TRP C 99  ? 0.3257 0.2261 0.2580 0.0090  -0.0271 0.0269  118 TRP A C   
2692 O O   . TRP C 99  ? 0.2959 0.1983 0.2340 0.0057  -0.0237 0.0248  118 TRP A O   
2693 C CB  . TRP C 99  ? 0.2364 0.1600 0.1853 0.0155  -0.0240 0.0165  118 TRP A CB  
2694 C CG  . TRP C 99  ? 0.2736 0.2105 0.2296 0.0187  -0.0237 0.0122  118 TRP A CG  
2695 C CD1 . TRP C 99  ? 0.3477 0.2878 0.3072 0.0249  -0.0281 0.0102  118 TRP A CD1 
2696 C CD2 . TRP C 99  ? 0.2184 0.1669 0.1802 0.0155  -0.0192 0.0091  118 TRP A CD2 
2697 N NE1 . TRP C 99  ? 0.2939 0.2473 0.2616 0.0249  -0.0267 0.0063  118 TRP A NE1 
2698 C CE2 . TRP C 99  ? 0.2395 0.1969 0.2079 0.0193  -0.0213 0.0055  118 TRP A CE2 
2699 C CE3 . TRP C 99  ? 0.2782 0.2302 0.2410 0.0101  -0.0140 0.0089  118 TRP A CE3 
2700 C CZ2 . TRP C 99  ? 0.2711 0.2388 0.2458 0.0172  -0.0186 0.0020  118 TRP A CZ2 
2701 C CZ3 . TRP C 99  ? 0.3238 0.2860 0.2924 0.0092  -0.0113 0.0051  118 TRP A CZ3 
2702 C CH2 . TRP C 99  ? 0.2886 0.2576 0.2626 0.0124  -0.0137 0.0018  118 TRP A CH2 
2703 N N   . PRO C 100 ? 0.2985 0.1847 0.2205 0.0085  -0.0314 0.0328  119 PRO A N   
2704 C CA  . PRO C 100 ? 0.3530 0.2261 0.2716 0.0028  -0.0317 0.0369  119 PRO A CA  
2705 C C   . PRO C 100 ? 0.3636 0.2314 0.2889 0.0057  -0.0333 0.0318  119 PRO A C   
2706 O O   . PRO C 100 ? 0.3650 0.2309 0.2924 0.0140  -0.0367 0.0276  119 PRO A O   
2707 C CB  . PRO C 100 ? 0.4336 0.2903 0.3397 0.0038  -0.0376 0.0437  119 PRO A CB  
2708 C CG  . PRO C 100 ? 0.3942 0.2589 0.2950 0.0066  -0.0379 0.0448  119 PRO A CG  
2709 C CD  . PRO C 100 ? 0.3661 0.2469 0.2783 0.0122  -0.0365 0.0366  119 PRO A CD  
2710 N N   . GLY C 101 ? 0.3162 0.1828 0.2448 -0.0008 -0.0309 0.0319  120 GLY A N   
2711 C CA  . GLY C 101 ? 0.3318 0.1929 0.2645 0.0016  -0.0327 0.0268  120 GLY A CA  
2712 C C   . GLY C 101 ? 0.3395 0.2162 0.2813 0.0031  -0.0279 0.0207  120 GLY A C   
2713 O O   . GLY C 101 ? 0.3439 0.2181 0.2883 0.0054  -0.0285 0.0161  120 GLY A O   
2714 N N   . VAL C 102 ? 0.3198 0.2114 0.2652 0.0020  -0.0234 0.0207  121 VAL A N   
2715 C CA  . VAL C 102 ? 0.2747 0.1804 0.2283 0.0027  -0.0189 0.0158  121 VAL A CA  
2716 C C   . VAL C 102 ? 0.3094 0.2239 0.2660 -0.0045 -0.0145 0.0179  121 VAL A C   
2717 O O   . VAL C 102 ? 0.3025 0.2171 0.2548 -0.0085 -0.0136 0.0226  121 VAL A O   
2718 C CB  . VAL C 102 ? 0.2792 0.1948 0.2359 0.0085  -0.0181 0.0130  121 VAL A CB  
2719 C CG1 . VAL C 102 ? 0.2166 0.1451 0.1813 0.0082  -0.0135 0.0089  121 VAL A CG1 
2720 C CG2 . VAL C 102 ? 0.3460 0.2555 0.3019 0.0164  -0.0220 0.0108  121 VAL A CG2 
2721 N N   . ARG C 103 ? 0.2524 0.1742 0.2157 -0.0059 -0.0118 0.0145  122 ARG A N   
2722 C CA  . ARG C 103 ? 0.2615 0.1929 0.2295 -0.0115 -0.0077 0.0155  122 ARG A CA  
2723 C C   . ARG C 103 ? 0.2596 0.2026 0.2338 -0.0089 -0.0045 0.0110  122 ARG A C   
2724 O O   . ARG C 103 ? 0.2471 0.1899 0.2225 -0.0042 -0.0052 0.0076  122 ARG A O   
2725 C CB  . ARG C 103 ? 0.2495 0.1765 0.2205 -0.0168 -0.0090 0.0166  122 ARG A CB  
2726 C CG  . ARG C 103 ? 0.3830 0.2991 0.3491 -0.0218 -0.0116 0.0221  122 ARG A CG  
2727 C CD  . ARG C 103 ? 0.4989 0.4121 0.4703 -0.0283 -0.0135 0.0230  122 ARG A CD  
2728 N NE  . ARG C 103 ? 0.6700 0.5797 0.6435 -0.0249 -0.0168 0.0176  122 ARG A NE  
2729 C CZ  . ARG C 103 ? 0.7577 0.6574 0.7314 -0.0280 -0.0218 0.0171  122 ARG A CZ  
2730 N NH1 . ARG C 103 ? 0.8821 0.7740 0.8556 -0.0351 -0.0241 0.0220  122 ARG A NH1 
2731 N NH2 . ARG C 103 ? 0.6729 0.5695 0.6462 -0.0242 -0.0247 0.0118  122 ARG A NH2 
2732 N N   . LEU C 104 ? 0.1963 0.1492 0.1744 -0.0120 -0.0007 0.0112  123 LEU A N   
2733 C CA  . LEU C 104 ? 0.1889 0.1508 0.1730 -0.0102 0.0018  0.0072  123 LEU A CA  
2734 C C   . LEU C 104 ? 0.2071 0.1673 0.1956 -0.0106 0.0005  0.0053  123 LEU A C   
2735 O O   . LEU C 104 ? 0.2658 0.2227 0.2556 -0.0144 -0.0010 0.0072  123 LEU A O   
2736 C CB  . LEU C 104 ? 0.2033 0.1749 0.1900 -0.0127 0.0058  0.0075  123 LEU A CB  
2737 C CG  . LEU C 104 ? 0.2371 0.2168 0.2296 -0.0105 0.0080  0.0032  123 LEU A CG  
2738 C CD1 . LEU C 104 ? 0.1855 0.1650 0.1762 -0.0064 0.0072  0.0004  123 LEU A CD1 
2739 C CD2 . LEU C 104 ? 0.2064 0.1951 0.2009 -0.0123 0.0121  0.0031  123 LEU A CD2 
2740 N N   . ARG C 105 ? 0.1838 0.1461 0.1746 -0.0071 0.0010  0.0020  124 ARG A N   
2741 C CA  . ARG C 105 ? 0.1489 0.1095 0.1419 -0.0067 -0.0003 0.0002  124 ARG A CA  
2742 C C   . ARG C 105 ? 0.2450 0.2131 0.2430 -0.0056 0.0019  -0.0019 124 ARG A C   
2743 O O   . ARG C 105 ? 0.2277 0.1989 0.2260 -0.0035 0.0039  -0.0032 124 ARG A O   
2744 C CB  . ARG C 105 ? 0.1778 0.1308 0.1659 -0.0028 -0.0021 -0.0013 124 ARG A CB  
2745 C CG  . ARG C 105 ? 0.1928 0.1437 0.1804 -0.0015 -0.0031 -0.0033 124 ARG A CG  
2746 C CD  . ARG C 105 ? 0.1872 0.1290 0.1676 0.0021  -0.0049 -0.0047 124 ARG A CD  
2747 N NE  . ARG C 105 ? 0.2244 0.1633 0.2008 0.0046  -0.0051 -0.0066 124 ARG A NE  
2748 C CZ  . ARG C 105 ? 0.2341 0.1761 0.2097 0.0076  -0.0016 -0.0072 124 ARG A CZ  
2749 N NH1 . ARG C 105 ? 0.2026 0.1514 0.1830 0.0081  0.0019  -0.0067 124 ARG A NH1 
2750 N NH2 . ARG C 105 ? 0.2185 0.1568 0.1884 0.0096  -0.0016 -0.0082 124 ARG A NH2 
2751 N N   . VAL C 106 ? 0.1780 0.1484 0.1803 -0.0070 0.0010  -0.0024 125 VAL A N   
2752 C CA  . VAL C 106 ? 0.1620 0.1376 0.1688 -0.0054 0.0022  -0.0044 125 VAL A CA  
2753 C C   . VAL C 106 ? 0.1585 0.1285 0.1628 -0.0034 -0.0005 -0.0052 125 VAL A C   
2754 O O   . VAL C 106 ? 0.2097 0.1762 0.2134 -0.0045 -0.0039 -0.0050 125 VAL A O   
2755 C CB  . VAL C 106 ? 0.1863 0.1702 0.2006 -0.0075 0.0029  -0.0044 125 VAL A CB  
2756 C CG1 . VAL C 106 ? 0.1911 0.1783 0.2102 -0.0048 0.0025  -0.0067 125 VAL A CG1 
2757 C CG2 . VAL C 106 ? 0.1535 0.1437 0.1684 -0.0089 0.0067  -0.0037 125 VAL A CG2 
2758 N N   . THR C 107 ? 0.1715 0.1400 0.1737 -0.0007 0.0010  -0.0061 126 THR A N   
2759 C CA  . THR C 107 ? 0.1773 0.1400 0.1750 0.0014  -0.0008 -0.0062 126 THR A CA  
2760 C C   . THR C 107 ? 0.2090 0.1738 0.2108 0.0021  -0.0024 -0.0067 126 THR A C   
2761 O O   . THR C 107 ? 0.1951 0.1553 0.1934 0.0033  -0.0057 -0.0065 126 THR A O   
2762 C CB  . THR C 107 ? 0.2130 0.1732 0.2066 0.0033  0.0022  -0.0060 126 THR A CB  
2763 O OG1 . THR C 107 ? 0.1901 0.1551 0.1889 0.0030  0.0046  -0.0064 126 THR A OG1 
2764 C CG2 . THR C 107 ? 0.2334 0.1920 0.2237 0.0040  0.0033  -0.0059 126 THR A CG2 
2765 N N   . GLU C 108 ? 0.1814 0.1523 0.1895 0.0021  -0.0005 -0.0076 127 GLU A N   
2766 C CA  . GLU C 108 ? 0.2139 0.1865 0.2266 0.0039  -0.0021 -0.0086 127 GLU A CA  
2767 C C   . GLU C 108 ? 0.2662 0.2481 0.2872 0.0036  -0.0004 -0.0103 127 GLU A C   
2768 O O   . GLU C 108 ? 0.2504 0.2349 0.2715 0.0031  0.0029  -0.0112 127 GLU A O   
2769 C CB  . GLU C 108 ? 0.3078 0.2755 0.3178 0.0058  -0.0009 -0.0084 127 GLU A CB  
2770 C CG  . GLU C 108 ? 0.3057 0.2649 0.3086 0.0072  -0.0029 -0.0065 127 GLU A CG  
2771 C CD  . GLU C 108 ? 0.2474 0.2051 0.2509 0.0092  -0.0080 -0.0065 127 GLU A CD  
2772 O OE1 . GLU C 108 ? 0.2815 0.2367 0.2864 0.0116  -0.0101 -0.0064 127 GLU A OE1 
2773 O OE2 . GLU C 108 ? 0.2490 0.2075 0.2516 0.0083  -0.0107 -0.0066 127 GLU A OE2 
2774 N N   . GLY C 109 ? 0.2864 0.2739 0.3144 0.0039  -0.0025 -0.0110 128 GLY A N   
2775 C CA  . GLY C 109 ? 0.2374 0.2349 0.2737 0.0047  0.0000  -0.0131 128 GLY A CA  
2776 C C   . GLY C 109 ? 0.2306 0.2289 0.2721 0.0092  -0.0023 -0.0152 128 GLY A C   
2777 O O   . GLY C 109 ? 0.2011 0.1915 0.2381 0.0117  -0.0031 -0.0157 128 GLY A O   
2778 N N   . TRP C 110 ? 0.1964 0.2042 0.2480 0.0101  -0.0036 -0.0163 129 TRP A N   
2779 C CA  . TRP C 110 ? 0.1739 0.1825 0.2315 0.0153  -0.0071 -0.0184 129 TRP A CA  
2780 C C   . TRP C 110 ? 0.2009 0.1985 0.2520 0.0163  -0.0133 -0.0162 129 TRP A C   
2781 O O   . TRP C 110 ? 0.1993 0.1947 0.2473 0.0132  -0.0159 -0.0142 129 TRP A O   
2782 C CB  . TRP C 110 ? 0.1685 0.1922 0.2405 0.0162  -0.0072 -0.0201 129 TRP A CB  
2783 C CG  . TRP C 110 ? 0.1665 0.1910 0.2455 0.0222  -0.0125 -0.0220 129 TRP A CG  
2784 C CD1 . TRP C 110 ? 0.2433 0.2673 0.3250 0.0286  -0.0121 -0.0254 129 TRP A CD1 
2785 C CD2 . TRP C 110 ? 0.1894 0.2135 0.2725 0.0230  -0.0200 -0.0209 129 TRP A CD2 
2786 N NE1 . TRP C 110 ? 0.2507 0.2744 0.3385 0.0337  -0.0189 -0.0261 129 TRP A NE1 
2787 C CE2 . TRP C 110 ? 0.2042 0.2283 0.2928 0.0303  -0.0240 -0.0233 129 TRP A CE2 
2788 C CE3 . TRP C 110 ? 0.1629 0.1860 0.2451 0.0186  -0.0245 -0.0185 129 TRP A CE3 
2789 C CZ2 . TRP C 110 ? 0.2422 0.2660 0.3356 0.0333  -0.0325 -0.0229 129 TRP A CZ2 
2790 C CZ3 . TRP C 110 ? 0.1975 0.2201 0.2839 0.0213  -0.0330 -0.0186 129 TRP A CZ3 
2791 C CH2 . TRP C 110 ? 0.2453 0.2690 0.3375 0.0286  -0.0370 -0.0206 129 TRP A CH2 
2792 N N   . ASP C 111 ? 0.2313 0.2206 0.2791 0.0207  -0.0159 -0.0166 130 ASP A N   
2793 C CA  . ASP C 111 ? 0.2565 0.2334 0.2946 0.0216  -0.0208 -0.0137 130 ASP A CA  
2794 C C   . ASP C 111 ? 0.2631 0.2376 0.3046 0.0270  -0.0274 -0.0141 130 ASP A C   
2795 O O   . ASP C 111 ? 0.2269 0.2033 0.2749 0.0315  -0.0277 -0.0166 130 ASP A O   
2796 C CB  . ASP C 111 ? 0.2382 0.2034 0.2654 0.0207  -0.0178 -0.0118 130 ASP A CB  
2797 C CG  . ASP C 111 ? 0.3183 0.2709 0.3339 0.0215  -0.0216 -0.0082 130 ASP A CG  
2798 O OD1 . ASP C 111 ? 0.2706 0.2220 0.2807 0.0197  -0.0234 -0.0068 130 ASP A OD1 
2799 O OD2 . ASP C 111 ? 0.2949 0.2381 0.3061 0.0238  -0.0229 -0.0067 130 ASP A OD2 
2800 N N   . GLU C 112 ? 0.2471 0.2164 0.2832 0.0271  -0.0334 -0.0120 131 GLU A N   
2801 C CA  . GLU C 112 ? 0.2270 0.1907 0.2624 0.0324  -0.0410 -0.0114 131 GLU A CA  
2802 C C   . GLU C 112 ? 0.2928 0.2404 0.3103 0.0322  -0.0438 -0.0072 131 GLU A C   
2803 O O   . GLU C 112 ? 0.2598 0.1999 0.2726 0.0363  -0.0508 -0.0057 131 GLU A O   
2804 C CB  . GLU C 112 ? 0.2494 0.2246 0.2971 0.0337  -0.0474 -0.0134 131 GLU A CB  
2805 C CG  . GLU C 112 ? 0.1919 0.1700 0.2375 0.0279  -0.0484 -0.0127 131 GLU A CG  
2806 C CD  . GLU C 112 ? 0.2372 0.2278 0.2974 0.0277  -0.0550 -0.0147 131 GLU A CD  
2807 O OE1 . GLU C 112 ? 0.3052 0.3026 0.3768 0.0328  -0.0597 -0.0164 131 GLU A OE1 
2808 O OE2 . GLU C 112 ? 0.2375 0.2309 0.2983 0.0223  -0.0558 -0.0145 131 GLU A OE2 
2809 N N   . ASP C 113 ? 0.2673 0.2097 0.2743 0.0278  -0.0383 -0.0053 132 ASP A N   
2810 C CA  . ASP C 113 ? 0.2585 0.1868 0.2479 0.0276  -0.0392 -0.0012 132 ASP A CA  
2811 C C   . ASP C 113 ? 0.3211 0.2378 0.3034 0.0295  -0.0380 0.0021  132 ASP A C   
2812 O O   . ASP C 113 ? 0.3768 0.2813 0.3454 0.0310  -0.0410 0.0061  132 ASP A O   
2813 C CB  . ASP C 113 ? 0.2491 0.1767 0.2307 0.0232  -0.0335 -0.0005 132 ASP A CB  
2814 C CG  . ASP C 113 ? 0.2699 0.2037 0.2542 0.0213  -0.0365 -0.0028 132 ASP A CG  
2815 O OD1 . ASP C 113 ? 0.2925 0.2215 0.2700 0.0229  -0.0433 -0.0027 132 ASP A OD1 
2816 O OD2 . ASP C 113 ? 0.2253 0.1679 0.2180 0.0182  -0.0325 -0.0048 132 ASP A OD2 
2817 N N   . GLY C 114 ? 0.2530 0.1724 0.2434 0.0290  -0.0336 0.0006  133 GLY A N   
2818 C CA  . GLY C 114 ? 0.3225 0.2303 0.3088 0.0306  -0.0338 0.0031  133 GLY A CA  
2819 C C   . GLY C 114 ? 0.3452 0.2457 0.3235 0.0259  -0.0271 0.0066  133 GLY A C   
2820 O O   . GLY C 114 ? 0.3462 0.2350 0.3195 0.0260  -0.0275 0.0099  133 GLY A O   
2821 N N   . HIS C 115 ? 0.3394 0.2468 0.3174 0.0216  -0.0213 0.0060  134 HIS A N   
2822 C CA  . HIS C 115 ? 0.3043 0.2071 0.2769 0.0172  -0.0150 0.0092  134 HIS A CA  
2823 C C   . HIS C 115 ? 0.4098 0.3164 0.3924 0.0148  -0.0114 0.0066  134 HIS A C   
2824 O O   . HIS C 115 ? 0.4047 0.3080 0.3854 0.0108  -0.0070 0.0091  134 HIS A O   
2825 C CB  . HIS C 115 ? 0.2835 0.1898 0.2490 0.0147  -0.0107 0.0104  134 HIS A CB  
2826 C CG  . HIS C 115 ? 0.3217 0.2400 0.2948 0.0141  -0.0097 0.0060  134 HIS A CG  
2827 N ND1 . HIS C 115 ? 0.3043 0.2304 0.2853 0.0113  -0.0051 0.0037  134 HIS A ND1 
2828 C CD2 . HIS C 115 ? 0.3626 0.2852 0.3356 0.0154  -0.0131 0.0038  134 HIS A CD2 
2829 C CE1 . HIS C 115 ? 0.3178 0.2519 0.3026 0.0112  -0.0054 0.0009  134 HIS A CE1 
2830 N NE2 . HIS C 115 ? 0.2879 0.2201 0.2687 0.0133  -0.0101 0.0009  134 HIS A NE2 
2831 N N   . HIS C 116 ? 0.3499 0.2638 0.3430 0.0172  -0.0133 0.0015  135 HIS A N   
2832 C CA  . HIS C 116 ? 0.2931 0.2097 0.2937 0.0156  -0.0108 -0.0019 135 HIS A CA  
2833 C C   . HIS C 116 ? 0.3724 0.2775 0.3734 0.0174  -0.0139 -0.0017 135 HIS A C   
2834 O O   . HIS C 116 ? 0.3176 0.2156 0.3164 0.0218  -0.0189 -0.0006 135 HIS A O   
2835 C CB  . HIS C 116 ? 0.3200 0.2496 0.3298 0.0175  -0.0104 -0.0075 135 HIS A CB  
2836 C CG  . HIS C 116 ? 0.2601 0.1991 0.2696 0.0152  -0.0079 -0.0074 135 HIS A CG  
2837 N ND1 . HIS C 116 ? 0.2403 0.1826 0.2485 0.0112  -0.0035 -0.0069 135 HIS A ND1 
2838 C CD2 . HIS C 116 ? 0.2458 0.1907 0.2562 0.0163  -0.0098 -0.0077 135 HIS A CD2 
2839 C CE1 . HIS C 116 ? 0.2388 0.1874 0.2463 0.0105  -0.0028 -0.0069 135 HIS A CE1 
2840 N NE2 . HIS C 116 ? 0.2749 0.2249 0.2837 0.0130  -0.0065 -0.0073 135 HIS A NE2 
2841 N N   . ALA C 117 ? 0.3825 0.2850 0.3865 0.0142  -0.0117 -0.0030 136 ALA A N   
2842 C CA  . ALA C 117 ? 0.4109 0.3003 0.4152 0.0152  -0.0149 -0.0031 136 ALA A CA  
2843 C C   . ALA C 117 ? 0.3934 0.2837 0.4035 0.0224  -0.0194 -0.0089 136 ALA A C   
2844 O O   . ALA C 117 ? 0.3566 0.2602 0.3727 0.0249  -0.0181 -0.0139 136 ALA A O   
2845 C CB  . ALA C 117 ? 0.3673 0.2550 0.3750 0.0096  -0.0123 -0.0043 136 ALA A CB  
2846 N N   . GLN C 118 ? 0.4280 0.3042 0.4363 0.0258  -0.0243 -0.0082 137 GLN A N   
2847 C CA  . GLN C 118 ? 0.4751 0.3515 0.4896 0.0337  -0.0284 -0.0145 137 GLN A CA  
2848 C C   . GLN C 118 ? 0.4193 0.3055 0.4406 0.0338  -0.0253 -0.0221 137 GLN A C   
2849 O O   . GLN C 118 ? 0.4539 0.3380 0.4741 0.0281  -0.0228 -0.0225 137 GLN A O   
2850 C CB  . GLN C 118 ? 0.5987 0.4552 0.6098 0.0367  -0.0342 -0.0131 137 GLN A CB  
2851 C CG  . GLN C 118 ? 0.7265 0.5827 0.7445 0.0460  -0.0385 -0.0207 137 GLN A CG  
2852 C CD  . GLN C 118 ? 0.8824 0.7166 0.8966 0.0498  -0.0452 -0.0195 137 GLN A CD  
2853 O OE1 . GLN C 118 ? 0.9699 0.7890 0.9755 0.0456  -0.0471 -0.0116 137 GLN A OE1 
2854 N NE2 . GLN C 118 ? 0.8705 0.7024 0.8905 0.0579  -0.0486 -0.0272 137 GLN A NE2 
2855 N N   . ASP C 119 ? 0.3681 0.2657 0.3962 0.0403  -0.0255 -0.0281 138 ASP A N   
2856 C CA  . ASP C 119 ? 0.3965 0.3042 0.4291 0.0415  -0.0220 -0.0354 138 ASP A CA  
2857 C C   . ASP C 119 ? 0.3719 0.2937 0.4044 0.0358  -0.0163 -0.0347 138 ASP A C   
2858 O O   . ASP C 119 ? 0.3349 0.2641 0.3687 0.0359  -0.0133 -0.0398 138 ASP A O   
2859 C CB  . ASP C 119 ? 0.4288 0.3233 0.4591 0.0410  -0.0239 -0.0394 138 ASP A CB  
2860 C CG  . ASP C 119 ? 0.5899 0.4699 0.6207 0.0482  -0.0299 -0.0419 138 ASP A CG  
2861 O OD1 . ASP C 119 ? 0.6000 0.4866 0.6361 0.0566  -0.0313 -0.0457 138 ASP A OD1 
2862 O OD2 . ASP C 119 ? 0.6843 0.5463 0.7109 0.0455  -0.0335 -0.0400 138 ASP A OD2 
2863 N N   . SER C 120 ? 0.2869 0.2115 0.3168 0.0314  -0.0150 -0.0285 139 SER A N   
2864 C CA  . SER C 120 ? 0.3041 0.2406 0.3336 0.0267  -0.0104 -0.0274 139 SER A CA  
2865 C C   . SER C 120 ? 0.3155 0.2670 0.3510 0.0301  -0.0082 -0.0313 139 SER A C   
2866 O O   . SER C 120 ? 0.2749 0.2306 0.3155 0.0348  -0.0102 -0.0320 139 SER A O   
2867 C CB  . SER C 120 ? 0.2570 0.1926 0.2822 0.0230  -0.0101 -0.0208 139 SER A CB  
2868 O OG  . SER C 120 ? 0.2870 0.2328 0.3120 0.0193  -0.0063 -0.0201 139 SER A OG  
2869 N N   . LEU C 121 ? 0.2006 0.1608 0.2357 0.0275  -0.0041 -0.0334 140 LEU A N   
2870 C CA  . LEU C 121 ? 0.2426 0.2172 0.2826 0.0298  -0.0009 -0.0361 140 LEU A CA  
2871 C C   . LEU C 121 ? 0.2993 0.2818 0.3415 0.0269  -0.0002 -0.0316 140 LEU A C   
2872 O O   . LEU C 121 ? 0.2667 0.2615 0.3146 0.0277  0.0022  -0.0326 140 LEU A O   
2873 C CB  . LEU C 121 ? 0.2047 0.1846 0.2416 0.0285  0.0030  -0.0397 140 LEU A CB  
2874 C CG  . LEU C 121 ? 0.1672 0.1403 0.2020 0.0322  0.0018  -0.0460 140 LEU A CG  
2875 C CD1 . LEU C 121 ? 0.2428 0.2216 0.2726 0.0313  0.0051  -0.0496 140 LEU A CD1 
2876 C CD2 . LEU C 121 ? 0.2188 0.1933 0.2594 0.0400  0.0006  -0.0505 140 LEU A CD2 
2877 N N   . HIS C 122 ? 0.3039 0.2792 0.3417 0.0235  -0.0022 -0.0267 141 HIS A N   
2878 C CA  . HIS C 122 ? 0.2580 0.2376 0.2965 0.0214  -0.0031 -0.0230 141 HIS A CA  
2879 C C   . HIS C 122 ? 0.2669 0.2497 0.3123 0.0257  -0.0070 -0.0237 141 HIS A C   
2880 O O   . HIS C 122 ? 0.2603 0.2507 0.3100 0.0245  -0.0080 -0.0223 141 HIS A O   
2881 C CB  . HIS C 122 ? 0.2265 0.1962 0.2569 0.0182  -0.0045 -0.0184 141 HIS A CB  
2882 C CG  . HIS C 122 ? 0.2080 0.1779 0.2338 0.0138  -0.0009 -0.0172 141 HIS A CG  
2883 N ND1 . HIS C 122 ? 0.2300 0.2065 0.2555 0.0111  0.0010  -0.0162 141 HIS A ND1 
2884 C CD2 . HIS C 122 ? 0.2366 0.2010 0.2589 0.0117  0.0004  -0.0168 141 HIS A CD2 
2885 C CE1 . HIS C 122 ? 0.2534 0.2283 0.2750 0.0084  0.0032  -0.0154 141 HIS A CE1 
2886 N NE2 . HIS C 122 ? 0.2117 0.1803 0.2320 0.0086  0.0030  -0.0158 141 HIS A NE2 
2887 N N   . TYR C 123 ? 0.1923 0.1690 0.2393 0.0308  -0.0099 -0.0258 142 TYR A N   
2888 C CA  . TYR C 123 ? 0.1833 0.1634 0.2380 0.0362  -0.0144 -0.0268 142 TYR A CA  
2889 C C   . TYR C 123 ? 0.2485 0.2450 0.3152 0.0395  -0.0115 -0.0315 142 TYR A C   
2890 O O   . TYR C 123 ? 0.2735 0.2772 0.3499 0.0441  -0.0148 -0.0329 142 TYR A O   
2891 C CB  . TYR C 123 ? 0.2067 0.1727 0.2582 0.0411  -0.0193 -0.0270 142 TYR A CB  
2892 C CG  . TYR C 123 ? 0.3036 0.2550 0.3438 0.0379  -0.0221 -0.0212 142 TYR A CG  
2893 C CD1 . TYR C 123 ? 0.2702 0.2217 0.3069 0.0361  -0.0249 -0.0173 142 TYR A CD1 
2894 C CD2 . TYR C 123 ? 0.3178 0.2551 0.3505 0.0366  -0.0218 -0.0197 142 TYR A CD2 
2895 C CE1 . TYR C 123 ? 0.3261 0.2647 0.3507 0.0337  -0.0265 -0.0121 142 TYR A CE1 
2896 C CE2 . TYR C 123 ? 0.3689 0.2940 0.3912 0.0332  -0.0231 -0.0138 142 TYR A CE2 
2897 C CZ  . TYR C 123 ? 0.3286 0.2546 0.3462 0.0322  -0.0250 -0.0100 142 TYR A CZ  
2898 O OH  . TYR C 123 ? 0.3077 0.2220 0.3133 0.0294  -0.0254 -0.0043 142 TYR A OH  
2899 N N   . GLU C 124 ? 0.1595 0.1626 0.2256 0.0374  -0.0054 -0.0338 143 GLU A N   
2900 C CA  . GLU C 124 ? 0.1821 0.2005 0.2576 0.0408  -0.0011 -0.0383 143 GLU A CA  
2901 C C   . GLU C 124 ? 0.2305 0.2623 0.3084 0.0352  0.0046  -0.0365 143 GLU A C   
2902 O O   . GLU C 124 ? 0.2837 0.3294 0.3686 0.0370  0.0095  -0.0394 143 GLU A O   
2903 C CB  . GLU C 124 ? 0.2272 0.2411 0.2991 0.0455  0.0011  -0.0440 143 GLU A CB  
2904 C CG  . GLU C 124 ? 0.3432 0.3428 0.4139 0.0512  -0.0050 -0.0456 143 GLU A CG  
2905 C CD  . GLU C 124 ? 0.3462 0.3405 0.4146 0.0568  -0.0039 -0.0523 143 GLU A CD  
2906 O OE1 . GLU C 124 ? 0.3444 0.3510 0.4163 0.0597  0.0014  -0.0573 143 GLU A OE1 
2907 O OE2 . GLU C 124 ? 0.3682 0.3457 0.4309 0.0582  -0.0085 -0.0527 143 GLU A OE2 
2908 N N   . GLY C 125 ? 0.2267 0.2540 0.2982 0.0285  0.0040  -0.0317 144 GLY A N   
2909 C CA  . GLY C 125 ? 0.2338 0.2702 0.3056 0.0228  0.0087  -0.0293 144 GLY A CA  
2910 C C   . GLY C 125 ? 0.2325 0.2686 0.2962 0.0218  0.0140  -0.0309 144 GLY A C   
2911 O O   . GLY C 125 ? 0.2128 0.2576 0.2764 0.0183  0.0188  -0.0295 144 GLY A O   
2912 N N   . ARG C 126 ? 0.1841 0.2095 0.2405 0.0244  0.0128  -0.0335 145 ARG A N   
2913 C CA  . ARG C 126 ? 0.2112 0.2353 0.2594 0.0239  0.0164  -0.0358 145 ARG A CA  
2914 C C   . ARG C 126 ? 0.2211 0.2350 0.2599 0.0195  0.0147  -0.0331 145 ARG A C   
2915 O O   . ARG C 126 ? 0.2366 0.2487 0.2687 0.0192  0.0163  -0.0352 145 ARG A O   
2916 C CB  . ARG C 126 ? 0.2228 0.2436 0.2705 0.0303  0.0161  -0.0422 145 ARG A CB  
2917 C CG  . ARG C 126 ? 0.3173 0.3515 0.3721 0.0355  0.0204  -0.0465 145 ARG A CG  
2918 C CD  . ARG C 126 ? 0.4394 0.4684 0.4887 0.0413  0.0209  -0.0537 145 ARG A CD  
2919 N NE  . ARG C 126 ? 0.4139 0.4348 0.4680 0.0474  0.0159  -0.0571 145 ARG A NE  
2920 C CZ  . ARG C 126 ? 0.3858 0.3937 0.4341 0.0510  0.0127  -0.0620 145 ARG A CZ  
2921 N NH1 . ARG C 126 ? 0.3567 0.3589 0.3948 0.0489  0.0134  -0.0644 145 ARG A NH1 
2922 N NH2 . ARG C 126 ? 0.2994 0.2991 0.3523 0.0566  0.0078  -0.0643 145 ARG A NH2 
2923 N N   . ALA C 127 ? 0.1731 0.1807 0.2113 0.0166  0.0115  -0.0289 146 ALA A N   
2924 C CA  . ALA C 127 ? 0.1405 0.1398 0.1715 0.0132  0.0104  -0.0265 146 ALA A CA  
2925 C C   . ALA C 127 ? 0.1740 0.1726 0.2039 0.0094  0.0095  -0.0216 146 ALA A C   
2926 O O   . ALA C 127 ? 0.2171 0.2164 0.2509 0.0097  0.0075  -0.0200 146 ALA A O   
2927 C CB  . ALA C 127 ? 0.1983 0.1869 0.2281 0.0146  0.0072  -0.0273 146 ALA A CB  
2928 N N   . LEU C 128 ? 0.1421 0.1388 0.1665 0.0064  0.0104  -0.0196 147 LEU A N   
2929 C CA  . LEU C 128 ? 0.1431 0.1372 0.1651 0.0036  0.0093  -0.0157 147 LEU A CA  
2930 C C   . LEU C 128 ? 0.1789 0.1665 0.1962 0.0028  0.0086  -0.0147 147 LEU A C   
2931 O O   . LEU C 128 ? 0.2287 0.2163 0.2445 0.0029  0.0093  -0.0163 147 LEU A O   
2932 C CB  . LEU C 128 ? 0.1670 0.1663 0.1877 0.0009  0.0113  -0.0138 147 LEU A CB  
2933 C CG  . LEU C 128 ? 0.1676 0.1763 0.1934 0.0005  0.0139  -0.0143 147 LEU A CG  
2934 C CD1 . LEU C 128 ? 0.1763 0.1878 0.1983 -0.0031 0.0162  -0.0113 147 LEU A CD1 
2935 C CD2 . LEU C 128 ? 0.1997 0.2107 0.2328 0.0003  0.0117  -0.0136 147 LEU A CD2 
2936 N N   . ASP C 129 ? 0.1779 0.1605 0.1931 0.0023  0.0072  -0.0123 148 ASP A N   
2937 C CA  . ASP C 129 ? 0.2046 0.1835 0.2163 0.0017  0.0076  -0.0110 148 ASP A CA  
2938 C C   . ASP C 129 ? 0.2361 0.2154 0.2448 0.0006  0.0075  -0.0093 148 ASP A C   
2939 O O   . ASP C 129 ? 0.2132 0.1912 0.2212 0.0000  0.0062  -0.0081 148 ASP A O   
2940 C CB  . ASP C 129 ? 0.1834 0.1563 0.1929 0.0024  0.0071  -0.0095 148 ASP A CB  
2941 C CG  . ASP C 129 ? 0.2041 0.1743 0.2158 0.0029  0.0070  -0.0103 148 ASP A CG  
2942 O OD1 . ASP C 129 ? 0.2024 0.1748 0.2170 0.0026  0.0074  -0.0126 148 ASP A OD1 
2943 O OD2 . ASP C 129 ? 0.2491 0.2140 0.2587 0.0038  0.0059  -0.0088 148 ASP A OD2 
2944 N N   . ILE C 130 ? 0.1747 0.1550 0.1818 0.0004  0.0081  -0.0092 149 ILE A N   
2945 C CA  . ILE C 130 ? 0.1575 0.1367 0.1611 -0.0002 0.0074  -0.0075 149 ILE A CA  
2946 C C   . ILE C 130 ? 0.1848 0.1616 0.1865 0.0013  0.0070  -0.0069 149 ILE A C   
2947 O O   . ILE C 130 ? 0.1878 0.1667 0.1922 0.0022  0.0077  -0.0080 149 ILE A O   
2948 C CB  . ILE C 130 ? 0.1528 0.1361 0.1554 -0.0014 0.0080  -0.0074 149 ILE A CB  
2949 C CG1 . ILE C 130 ? 0.1645 0.1505 0.1672 -0.0004 0.0080  -0.0096 149 ILE A CG1 
2950 C CG2 . ILE C 130 ? 0.1844 0.1720 0.1899 -0.0026 0.0093  -0.0079 149 ILE A CG2 
2951 C CD1 . ILE C 130 ? 0.2802 0.2692 0.2787 -0.0009 0.0083  -0.0096 149 ILE A CD1 
2952 N N   . THR C 131 ? 0.1999 0.1725 0.1977 0.0017  0.0056  -0.0054 150 THR A N   
2953 C CA  . THR C 131 ? 0.2565 0.2272 0.2527 0.0043  0.0049  -0.0052 150 THR A CA  
2954 C C   . THR C 131 ? 0.2581 0.2248 0.2499 0.0038  0.0025  -0.0033 150 THR A C   
2955 O O   . THR C 131 ? 0.1977 0.1638 0.1882 0.0007  0.0023  -0.0018 150 THR A O   
2956 C CB  . THR C 131 ? 0.2276 0.1940 0.2217 0.0067  0.0054  -0.0057 150 THR A CB  
2957 O OG1 . THR C 131 ? 0.2037 0.1628 0.1928 0.0063  0.0031  -0.0050 150 THR A OG1 
2958 C CG2 . THR C 131 ? 0.2445 0.2126 0.2406 0.0062  0.0077  -0.0063 150 THR A CG2 
2959 N N   . THR C 132 ? 0.2002 0.1644 0.1901 0.0068  0.0008  -0.0030 151 THR A N   
2960 C CA  . THR C 132 ? 0.1915 0.1481 0.1758 0.0067  -0.0021 -0.0006 151 THR A CA  
2961 C C   . THR C 132 ? 0.2375 0.1858 0.2188 0.0076  -0.0032 -0.0012 151 THR A C   
2962 O O   . THR C 132 ? 0.1929 0.1423 0.1755 0.0097  -0.0016 -0.0034 151 THR A O   
2963 C CB  . THR C 132 ? 0.2293 0.1851 0.2124 0.0105  -0.0046 -0.0003 151 THR A CB  
2964 O OG1 . THR C 132 ? 0.2510 0.2100 0.2384 0.0150  -0.0037 -0.0029 151 THR A OG1 
2965 C CG2 . THR C 132 ? 0.2332 0.1957 0.2171 0.0094  -0.0048 0.0001  151 THR A CG2 
2966 N N   . SER C 133 ? 0.2435 0.1830 0.2201 0.0057  -0.0062 0.0010  152 SER A N   
2967 C CA  . SER C 133 ? 0.2300 0.1603 0.2032 0.0057  -0.0085 0.0000  152 SER A CA  
2968 C C   . SER C 133 ? 0.2783 0.2036 0.2482 0.0123  -0.0093 -0.0029 152 SER A C   
2969 O O   . SER C 133 ? 0.2578 0.1776 0.2243 0.0139  -0.0100 -0.0053 152 SER A O   
2970 C CB  . SER C 133 ? 0.2410 0.1620 0.2106 0.0014  -0.0121 0.0033  152 SER A CB  
2971 O OG  . SER C 133 ? 0.2730 0.1889 0.2386 0.0031  -0.0140 0.0057  152 SER A OG  
2972 N N   . ASP C 134 ? 0.2861 0.2132 0.2568 0.0166  -0.0094 -0.0029 153 ASP A N   
2973 C CA  . ASP C 134 ? 0.3176 0.2420 0.2869 0.0238  -0.0095 -0.0060 153 ASP A CA  
2974 C C   . ASP C 134 ? 0.2793 0.2147 0.2539 0.0264  -0.0044 -0.0085 153 ASP A C   
2975 O O   . ASP C 134 ? 0.2428 0.1786 0.2172 0.0324  -0.0029 -0.0112 153 ASP A O   
2976 C CB  . ASP C 134 ? 0.2594 0.1809 0.2283 0.0281  -0.0127 -0.0051 153 ASP A CB  
2977 C CG  . ASP C 134 ? 0.2528 0.1851 0.2275 0.0269  -0.0120 -0.0033 153 ASP A CG  
2978 O OD1 . ASP C 134 ? 0.2666 0.2085 0.2459 0.0231  -0.0086 -0.0033 153 ASP A OD1 
2979 O OD2 . ASP C 134 ? 0.2597 0.1898 0.2336 0.0302  -0.0155 -0.0021 153 ASP A OD2 
2980 N N   . ARG C 135 ? 0.2314 0.1752 0.2106 0.0219  -0.0015 -0.0076 154 ARG A N   
2981 C CA  . ARG C 135 ? 0.2167 0.1703 0.2014 0.0229  0.0033  -0.0089 154 ARG A CA  
2982 C C   . ARG C 135 ? 0.2559 0.2177 0.2474 0.0271  0.0045  -0.0098 154 ARG A C   
2983 O O   . ARG C 135 ? 0.2608 0.2287 0.2559 0.0300  0.0087  -0.0113 154 ARG A O   
2984 C CB  . ARG C 135 ? 0.2956 0.2455 0.2750 0.0248  0.0057  -0.0106 154 ARG A CB  
2985 C CG  . ARG C 135 ? 0.3099 0.2551 0.2851 0.0204  0.0045  -0.0098 154 ARG A CG  
2986 C CD  . ARG C 135 ? 0.2537 0.1881 0.2231 0.0189  -0.0008 -0.0096 154 ARG A CD  
2987 N NE  . ARG C 135 ? 0.2644 0.1927 0.2279 0.0178  -0.0024 -0.0107 154 ARG A NE  
2988 C CZ  . ARG C 135 ? 0.2590 0.1803 0.2202 0.0143  -0.0071 -0.0103 154 ARG A CZ  
2989 N NH1 . ARG C 135 ? 0.2313 0.1508 0.1953 0.0109  -0.0098 -0.0083 154 ARG A NH1 
2990 N NH2 . ARG C 135 ? 0.2014 0.1179 0.1576 0.0139  -0.0094 -0.0118 154 ARG A NH2 
2991 N N   . ASP C 136 ? 0.2185 0.1809 0.2120 0.0275  0.0009  -0.0088 155 ASP A N   
2992 C CA  . ASP C 136 ? 0.2778 0.2489 0.2792 0.0315  0.0005  -0.0098 155 ASP A CA  
2993 C C   . ASP C 136 ? 0.2521 0.2342 0.2618 0.0273  0.0020  -0.0095 155 ASP A C   
2994 O O   . ASP C 136 ? 0.2223 0.2042 0.2308 0.0242  -0.0009 -0.0083 155 ASP A O   
2995 C CB  . ASP C 136 ? 0.2501 0.2150 0.2481 0.0344  -0.0054 -0.0086 155 ASP A CB  
2996 C CG  . ASP C 136 ? 0.2304 0.2048 0.2373 0.0390  -0.0073 -0.0097 155 ASP A CG  
2997 O OD1 . ASP C 136 ? 0.1674 0.1537 0.1844 0.0403  -0.0036 -0.0117 155 ASP A OD1 
2998 O OD2 . ASP C 136 ? 0.2339 0.2035 0.2376 0.0412  -0.0129 -0.0083 155 ASP A OD2 
2999 N N   . ARG C 137 ? 0.1980 0.1890 0.2154 0.0271  0.0066  -0.0106 156 ARG A N   
3000 C CA  . ARG C 137 ? 0.2227 0.2223 0.2481 0.0224  0.0075  -0.0105 156 ARG A CA  
3001 C C   . ARG C 137 ? 0.2008 0.2070 0.2328 0.0227  0.0029  -0.0112 156 ARG A C   
3002 O O   . ARG C 137 ? 0.2449 0.2541 0.2796 0.0184  0.0015  -0.0115 156 ARG A O   
3003 C CB  . ARG C 137 ? 0.2950 0.3021 0.3275 0.0215  0.0134  -0.0107 156 ARG A CB  
3004 C CG  . ARG C 137 ? 0.3476 0.3478 0.3723 0.0194  0.0171  -0.0096 156 ARG A CG  
3005 C CD  . ARG C 137 ? 0.3959 0.4018 0.4241 0.0203  0.0235  -0.0092 156 ARG A CD  
3006 N NE  . ARG C 137 ? 0.3384 0.3369 0.3573 0.0189  0.0265  -0.0078 156 ARG A NE  
3007 C CZ  . ARG C 137 ? 0.3767 0.3660 0.3842 0.0222  0.0262  -0.0085 156 ARG A CZ  
3008 N NH1 . ARG C 137 ? 0.4510 0.4364 0.4551 0.0269  0.0230  -0.0104 156 ARG A NH1 
3009 N NH2 . ARG C 137 ? 0.3143 0.2974 0.3133 0.0209  0.0281  -0.0073 156 ARG A NH2 
3010 N N   . ASN C 138 ? 0.1959 0.2036 0.2300 0.0282  -0.0001 -0.0118 157 ASN A N   
3011 C CA  . ASN C 138 ? 0.2597 0.2728 0.2989 0.0294  -0.0059 -0.0123 157 ASN A CA  
3012 C C   . ASN C 138 ? 0.2735 0.2787 0.3022 0.0263  -0.0102 -0.0109 157 ASN A C   
3013 O O   . ASN C 138 ? 0.2800 0.2889 0.3104 0.0258  -0.0149 -0.0115 157 ASN A O   
3018 N N   . LYS C 139 ? 0.2282 0.2231 0.2462 0.0243  -0.0085 -0.0091 158 LYS A N   
3019 C CA  . LYS C 139 ? 0.2236 0.2124 0.2319 0.0211  -0.0109 -0.0073 158 LYS A CA  
3020 C C   . LYS C 139 ? 0.2276 0.2192 0.2364 0.0158  -0.0082 -0.0083 158 LYS A C   
3021 O O   . LYS C 139 ? 0.2126 0.2018 0.2147 0.0135  -0.0096 -0.0077 158 LYS A O   
3022 C CB  . LYS C 139 ? 0.2331 0.2102 0.2310 0.0209  -0.0107 -0.0045 158 LYS A CB  
3023 C CG  . LYS C 139 ? 0.2332 0.2030 0.2272 0.0261  -0.0146 -0.0032 158 LYS A CG  
3024 C CD  . LYS C 139 ? 0.2431 0.2003 0.2274 0.0241  -0.0146 -0.0003 158 LYS A CD  
3025 C CE  . LYS C 139 ? 0.2403 0.1869 0.2188 0.0287  -0.0196 0.0016  158 LYS A CE  
3026 N NZ  . LYS C 139 ? 0.2679 0.2130 0.2502 0.0346  -0.0190 -0.0015 158 LYS A NZ  
3027 N N   . TYR C 140 ? 0.2425 0.2384 0.2585 0.0140  -0.0043 -0.0098 159 TYR A N   
3028 C CA  . TYR C 140 ? 0.2111 0.2066 0.2263 0.0098  -0.0019 -0.0105 159 TYR A CA  
3029 C C   . TYR C 140 ? 0.2115 0.2108 0.2280 0.0079  -0.0047 -0.0127 159 TYR A C   
3030 O O   . TYR C 140 ? 0.2022 0.1991 0.2137 0.0058  -0.0041 -0.0134 159 TYR A O   
3031 C CB  . TYR C 140 ? 0.1740 0.1711 0.1947 0.0084  0.0025  -0.0108 159 TYR A CB  
3032 C CG  . TYR C 140 ? 0.1842 0.1757 0.2002 0.0099  0.0052  -0.0092 159 TYR A CG  
3033 C CD1 . TYR C 140 ? 0.1559 0.1410 0.1647 0.0120  0.0033  -0.0080 159 TYR A CD1 
3034 C CD2 . TYR C 140 ? 0.2282 0.2197 0.2461 0.0093  0.0091  -0.0090 159 TYR A CD2 
3035 C CE1 . TYR C 140 ? 0.1889 0.1678 0.1931 0.0134  0.0047  -0.0073 159 TYR A CE1 
3036 C CE2 . TYR C 140 ? 0.2202 0.2059 0.2321 0.0111  0.0107  -0.0081 159 TYR A CE2 
3037 C CZ  . TYR C 140 ? 0.2146 0.1941 0.2200 0.0132  0.0083  -0.0078 159 TYR A CZ  
3038 O OH  . TYR C 140 ? 0.2011 0.1738 0.2002 0.0150  0.0089  -0.0077 159 TYR A OH  
3039 N N   . GLY C 141 ? 0.2238 0.2294 0.2475 0.0089  -0.0080 -0.0143 160 GLY A N   
3040 C CA  . GLY C 141 ? 0.2188 0.2270 0.2429 0.0073  -0.0121 -0.0172 160 GLY A CA  
3041 C C   . GLY C 141 ? 0.2012 0.2045 0.2125 0.0084  -0.0149 -0.0166 160 GLY A C   
3042 O O   . GLY C 141 ? 0.2106 0.2127 0.2167 0.0068  -0.0156 -0.0189 160 GLY A O   
3043 N N   . LEU C 142 ? 0.1767 0.1767 0.1822 0.0113  -0.0163 -0.0135 161 LEU A N   
3044 C CA  . LEU C 142 ? 0.2677 0.2623 0.2598 0.0119  -0.0185 -0.0116 161 LEU A CA  
3045 C C   . LEU C 142 ? 0.2301 0.2202 0.2153 0.0092  -0.0132 -0.0098 161 LEU A C   
3046 O O   . LEU C 142 ? 0.2124 0.2013 0.1888 0.0080  -0.0127 -0.0099 161 LEU A O   
3047 C CB  . LEU C 142 ? 0.2732 0.2639 0.2612 0.0157  -0.0223 -0.0082 161 LEU A CB  
3048 C CG  . LEU C 142 ? 0.3435 0.3270 0.3160 0.0158  -0.0244 -0.0048 161 LEU A CG  
3049 C CD1 . LEU C 142 ? 0.3422 0.3282 0.3079 0.0149  -0.0269 -0.0074 161 LEU A CD1 
3050 C CD2 . LEU C 142 ? 0.3406 0.3185 0.3089 0.0201  -0.0297 -0.0014 161 LEU A CD2 
3051 N N   . LEU C 143 ? 0.2006 0.1891 0.1900 0.0083  -0.0093 -0.0085 162 LEU A N   
3052 C CA  . LEU C 143 ? 0.2091 0.1954 0.1956 0.0056  -0.0048 -0.0075 162 LEU A CA  
3053 C C   . LEU C 143 ? 0.1974 0.1875 0.1850 0.0041  -0.0032 -0.0111 162 LEU A C   
3054 O O   . LEU C 143 ? 0.1865 0.1766 0.1682 0.0029  -0.0008 -0.0110 162 LEU A O   
3055 C CB  . LEU C 143 ? 0.1489 0.1335 0.1410 0.0053  -0.0021 -0.0068 162 LEU A CB  
3056 C CG  . LEU C 143 ? 0.1657 0.1489 0.1570 0.0027  0.0014  -0.0061 162 LEU A CG  
3057 C CD1 . LEU C 143 ? 0.2103 0.1899 0.1942 0.0010  0.0016  -0.0025 162 LEU A CD1 
3058 C CD2 . LEU C 143 ? 0.1976 0.1786 0.1932 0.0030  0.0027  -0.0060 162 LEU A CD2 
3059 N N   . ALA C 144 ? 0.2095 0.2027 0.2048 0.0041  -0.0043 -0.0144 163 ALA A N   
3060 C CA  . ALA C 144 ? 0.2696 0.2643 0.2662 0.0030  -0.0036 -0.0184 163 ALA A CA  
3061 C C   . ALA C 144 ? 0.2097 0.2046 0.1974 0.0039  -0.0059 -0.0206 163 ALA A C   
3062 O O   . ALA C 144 ? 0.2407 0.2356 0.2240 0.0038  -0.0036 -0.0228 163 ALA A O   
3063 C CB  . ALA C 144 ? 0.1988 0.1955 0.2054 0.0021  -0.0052 -0.0209 163 ALA A CB  
3064 N N   . ARG C 145 ? 0.1899 0.1853 0.1744 0.0052  -0.0106 -0.0202 164 ARG A N   
3065 C CA  . ARG C 145 ? 0.2696 0.2642 0.2427 0.0064  -0.0135 -0.0219 164 ARG A CA  
3066 C C   . ARG C 145 ? 0.2309 0.2233 0.1922 0.0063  -0.0093 -0.0182 164 ARG A C   
3067 O O   . ARG C 145 ? 0.2081 0.2009 0.1604 0.0067  -0.0075 -0.0202 164 ARG A O   
3068 C CB  . ARG C 145 ? 0.2020 0.1975 0.1744 0.0083  -0.0206 -0.0219 164 ARG A CB  
3069 C CG  . ARG C 145 ? 0.2317 0.2246 0.1886 0.0101  -0.0242 -0.0220 164 ARG A CG  
3070 C CD  . ARG C 145 ? 0.2759 0.2689 0.2268 0.0102  -0.0253 -0.0281 164 ARG A CD  
3071 N NE  . ARG C 145 ? 0.3268 0.3223 0.2894 0.0092  -0.0297 -0.0337 164 ARG A NE  
3072 C CZ  . ARG C 145 ? 0.4380 0.4320 0.3984 0.0089  -0.0307 -0.0398 164 ARG A CZ  
3073 N NH1 . ARG C 145 ? 0.4166 0.4080 0.3636 0.0104  -0.0269 -0.0416 164 ARG A NH1 
3074 N NH2 . ARG C 145 ? 0.4437 0.4387 0.4154 0.0070  -0.0352 -0.0443 164 ARG A NH2 
3075 N N   . LEU C 146 ? 0.2244 0.2145 0.1861 0.0055  -0.0073 -0.0128 165 LEU A N   
3076 C CA  . LEU C 146 ? 0.1962 0.1845 0.1491 0.0039  -0.0030 -0.0086 165 LEU A CA  
3077 C C   . LEU C 146 ? 0.2295 0.2219 0.1852 0.0026  0.0029  -0.0109 165 LEU A C   
3078 O O   . LEU C 146 ? 0.2142 0.2086 0.1623 0.0018  0.0069  -0.0098 165 LEU A O   
3079 C CB  . LEU C 146 ? 0.1836 0.1674 0.1384 0.0027  -0.0026 -0.0030 165 LEU A CB  
3080 C CG  . LEU C 146 ? 0.2297 0.2078 0.1791 0.0047  -0.0079 0.0005  165 LEU A CG  
3081 C CD1 . LEU C 146 ? 0.2494 0.2211 0.2002 0.0036  -0.0074 0.0053  165 LEU A CD1 
3082 C CD2 . LEU C 146 ? 0.2895 0.2651 0.2240 0.0051  -0.0095 0.0029  165 LEU A CD2 
3083 N N   . ALA C 147 ? 0.2125 0.2066 0.1793 0.0025  0.0036  -0.0139 166 ALA A N   
3084 C CA  . ALA C 147 ? 0.2303 0.2280 0.2006 0.0021  0.0083  -0.0162 166 ALA A CA  
3085 C C   . ALA C 147 ? 0.2379 0.2376 0.2025 0.0044  0.0086  -0.0217 166 ALA A C   
3086 O O   . ALA C 147 ? 0.2217 0.2255 0.1841 0.0050  0.0133  -0.0229 166 ALA A O   
3087 C CB  . ALA C 147 ? 0.1911 0.1882 0.1728 0.0019  0.0083  -0.0174 166 ALA A CB  
3088 N N   . VAL C 148 ? 0.2508 0.2484 0.2134 0.0057  0.0035  -0.0253 167 VAL A N   
3089 C CA  . VAL C 148 ? 0.2123 0.2099 0.1668 0.0081  0.0026  -0.0311 167 VAL A CA  
3090 C C   . VAL C 148 ? 0.2475 0.2467 0.1875 0.0088  0.0055  -0.0288 167 VAL A C   
3091 O O   . VAL C 148 ? 0.2876 0.2897 0.2213 0.0106  0.0099  -0.0317 167 VAL A O   
3092 C CB  . VAL C 148 ? 0.2058 0.2005 0.1607 0.0087  -0.0049 -0.0351 167 VAL A CB  
3093 C CG1 . VAL C 148 ? 0.2780 0.2713 0.2217 0.0114  -0.0069 -0.0416 167 VAL A CG1 
3094 C CG2 . VAL C 148 ? 0.2137 0.2072 0.1831 0.0072  -0.0069 -0.0370 167 VAL A CG2 
3095 N N   . GLU C 149 ? 0.2733 0.2703 0.2078 0.0076  0.0034  -0.0232 168 GLU A N   
3096 C CA  . GLU C 149 ? 0.2944 0.2910 0.2132 0.0077  0.0058  -0.0196 168 GLU A CA  
3097 C C   . GLU C 149 ? 0.2873 0.2888 0.2066 0.0056  0.0145  -0.0160 168 GLU A C   
3098 O O   . GLU C 149 ? 0.2398 0.2440 0.1474 0.0060  0.0192  -0.0152 168 GLU A O   
3099 C CB  . GLU C 149 ? 0.3456 0.3370 0.2587 0.0071  0.0007  -0.0138 168 GLU A CB  
3100 C CG  . GLU C 149 ? 0.4872 0.4762 0.4029 0.0092  -0.0082 -0.0174 168 GLU A CG  
3101 C CD  . GLU C 149 ? 0.6731 0.6620 0.5789 0.0120  -0.0118 -0.0240 168 GLU A CD  
3102 O OE1 . GLU C 149 ? 0.7416 0.7286 0.6300 0.0132  -0.0111 -0.0226 168 GLU A OE1 
3103 O OE2 . GLU C 149 ? 0.6902 0.6799 0.6045 0.0126  -0.0156 -0.0305 168 GLU A OE2 
3104 N N   . ALA C 150 ? 0.2639 0.2672 0.1970 0.0033  0.0167  -0.0139 169 ALA A N   
3105 C CA  . ALA C 150 ? 0.3137 0.3230 0.2511 0.0007  0.0239  -0.0106 169 ALA A CA  
3106 C C   . ALA C 150 ? 0.3093 0.3263 0.2510 0.0033  0.0289  -0.0165 169 ALA A C   
3107 O O   . ALA C 150 ? 0.2501 0.2746 0.1965 0.0018  0.0352  -0.0147 169 ALA A O   
3108 C CB  . ALA C 150 ? 0.2761 0.2838 0.2260 -0.0025 0.0230  -0.0068 169 ALA A CB  
3109 N N   . GLY C 151 ? 0.2783 0.2934 0.2195 0.0073  0.0257  -0.0238 170 GLY A N   
3110 C CA  . GLY C 151 ? 0.2480 0.2685 0.1905 0.0111  0.0297  -0.0303 170 GLY A CA  
3111 C C   . GLY C 151 ? 0.2400 0.2606 0.1971 0.0126  0.0284  -0.0342 170 GLY A C   
3112 O O   . GLY C 151 ? 0.2516 0.2767 0.2120 0.0163  0.0317  -0.0393 170 GLY A O   
3113 N N   . PHE C 152 ? 0.1735 0.1889 0.1390 0.0103  0.0237  -0.0319 171 PHE A N   
3114 C CA  . PHE C 152 ? 0.1717 0.1852 0.1486 0.0117  0.0219  -0.0350 171 PHE A CA  
3115 C C   . PHE C 152 ? 0.2333 0.2420 0.2074 0.0154  0.0186  -0.0426 171 PHE A C   
3116 O O   . PHE C 152 ? 0.2473 0.2513 0.2143 0.0152  0.0144  -0.0445 171 PHE A O   
3117 C CB  . PHE C 152 ? 0.1792 0.1879 0.1635 0.0086  0.0181  -0.0309 171 PHE A CB  
3118 C CG  . PHE C 152 ? 0.2211 0.2332 0.2111 0.0058  0.0206  -0.0253 171 PHE A CG  
3119 C CD1 . PHE C 152 ? 0.1912 0.2065 0.1906 0.0067  0.0222  -0.0259 171 PHE A CD1 
3120 C CD2 . PHE C 152 ? 0.2308 0.2420 0.2165 0.0025  0.0207  -0.0197 171 PHE A CD2 
3121 C CE1 . PHE C 152 ? 0.1903 0.2086 0.1951 0.0037  0.0234  -0.0212 171 PHE A CE1 
3122 C CE2 . PHE C 152 ? 0.3060 0.3189 0.2967 -0.0005 0.0222  -0.0150 171 PHE A CE2 
3123 C CZ  . PHE C 152 ? 0.2310 0.2478 0.2316 -0.0001 0.0234  -0.0159 171 PHE A CZ  
3124 N N   . ASP C 153 ? 0.2212 0.2305 0.2015 0.0189  0.0198  -0.0470 172 ASP A N   
3125 C CA  . ASP C 153 ? 0.2491 0.2524 0.2266 0.0229  0.0167  -0.0549 172 ASP A CA  
3126 C C   . ASP C 153 ? 0.2221 0.2154 0.2045 0.0207  0.0099  -0.0557 172 ASP A C   
3127 O O   . ASP C 153 ? 0.2059 0.1924 0.1849 0.0224  0.0057  -0.0617 172 ASP A O   
3128 C CB  . ASP C 153 ? 0.2939 0.3008 0.2766 0.0282  0.0202  -0.0594 172 ASP A CB  
3129 C CG  . ASP C 153 ? 0.3314 0.3505 0.3107 0.0303  0.0280  -0.0589 172 ASP A CG  
3130 O OD1 . ASP C 153 ? 0.2911 0.3119 0.2578 0.0319  0.0301  -0.0616 172 ASP A OD1 
3131 O OD2 . ASP C 153 ? 0.2685 0.2960 0.2575 0.0300  0.0320  -0.0556 172 ASP A OD2 
3132 N N   . TRP C 154 ? 0.2210 0.2132 0.2110 0.0168  0.0089  -0.0498 173 TRP A N   
3133 C CA  . TRP C 154 ? 0.1660 0.1507 0.1607 0.0138  0.0036  -0.0494 173 TRP A CA  
3134 C C   . TRP C 154 ? 0.2069 0.1940 0.2054 0.0099  0.0041  -0.0423 173 TRP A C   
3135 O O   . TRP C 154 ? 0.2371 0.2278 0.2382 0.0096  0.0074  -0.0383 173 TRP A O   
3136 C CB  . TRP C 154 ? 0.2049 0.1827 0.2064 0.0152  0.0021  -0.0516 173 TRP A CB  
3137 C CG  . TRP C 154 ? 0.2326 0.2014 0.2381 0.0120  -0.0031 -0.0524 173 TRP A CG  
3138 C CD1 . TRP C 154 ? 0.2161 0.1790 0.2190 0.0116  -0.0079 -0.0579 173 TRP A CD1 
3139 C CD2 . TRP C 154 ? 0.2275 0.1920 0.2404 0.0085  -0.0039 -0.0475 173 TRP A CD2 
3140 N NE1 . TRP C 154 ? 0.2230 0.1790 0.2330 0.0072  -0.0115 -0.0562 173 TRP A NE1 
3141 C CE2 . TRP C 154 ? 0.2563 0.2134 0.2719 0.0054  -0.0086 -0.0496 173 TRP A CE2 
3142 C CE3 . TRP C 154 ? 0.2599 0.2260 0.2766 0.0075  -0.0013 -0.0415 173 TRP A CE3 
3143 C CZ2 . TRP C 154 ? 0.2576 0.2098 0.2800 0.0010  -0.0094 -0.0452 173 TRP A CZ2 
3144 C CZ3 . TRP C 154 ? 0.2569 0.2173 0.2783 0.0041  -0.0024 -0.0377 173 TRP A CZ3 
3145 C CH2 . TRP C 154 ? 0.2545 0.2084 0.2789 0.0007  -0.0059 -0.0392 173 TRP A CH2 
3146 N N   . VAL C 155 ? 0.1960 0.1813 0.1949 0.0071  0.0005  -0.0413 174 VAL A N   
3147 C CA  . VAL C 155 ? 0.1723 0.1597 0.1748 0.0043  0.0008  -0.0355 174 VAL A CA  
3148 C C   . VAL C 155 ? 0.2268 0.2108 0.2366 0.0016  -0.0023 -0.0353 174 VAL A C   
3149 O O   . VAL C 155 ? 0.2189 0.2013 0.2293 0.0006  -0.0063 -0.0389 174 VAL A O   
3150 C CB  . VAL C 155 ? 0.1923 0.1835 0.1879 0.0042  0.0001  -0.0336 174 VAL A CB  
3151 C CG1 . VAL C 155 ? 0.1840 0.1763 0.1836 0.0024  -0.0003 -0.0286 174 VAL A CG1 
3152 C CG2 . VAL C 155 ? 0.1928 0.1875 0.1809 0.0058  0.0042  -0.0326 174 VAL A CG2 
3153 N N   . TYR C 156 ? 0.1834 0.1665 0.1989 0.0000  -0.0004 -0.0311 175 TYR A N   
3154 C CA  . TYR C 156 ? 0.2064 0.1869 0.2292 -0.0031 -0.0017 -0.0299 175 TYR A CA  
3155 C C   . TYR C 156 ? 0.2399 0.2241 0.2657 -0.0042 0.0004  -0.0250 175 TYR A C   
3156 O O   . TYR C 156 ? 0.2025 0.1862 0.2261 -0.0031 0.0033  -0.0219 175 TYR A O   
3157 C CB  . TYR C 156 ? 0.2317 0.2051 0.2566 -0.0031 -0.0010 -0.0300 175 TYR A CB  
3158 C CG  . TYR C 156 ? 0.2295 0.1986 0.2609 -0.0069 -0.0013 -0.0275 175 TYR A CG  
3159 C CD1 . TYR C 156 ? 0.2467 0.2183 0.2843 -0.0107 -0.0034 -0.0279 175 TYR A CD1 
3160 C CD2 . TYR C 156 ? 0.2803 0.2431 0.3118 -0.0070 0.0003  -0.0245 175 TYR A CD2 
3161 C CE1 . TYR C 156 ? 0.2839 0.2526 0.3284 -0.0151 -0.0028 -0.0249 175 TYR A CE1 
3162 C CE2 . TYR C 156 ? 0.3690 0.3272 0.4050 -0.0110 0.0007  -0.0213 175 TYR A CE2 
3163 C CZ  . TYR C 156 ? 0.3651 0.3266 0.4079 -0.0154 -0.0003 -0.0213 175 TYR A CZ  
3164 O OH  . TYR C 156 ? 0.3101 0.2680 0.3584 -0.0203 0.0010  -0.0173 175 TYR A OH  
3165 N N   . TYR C 157 ? 0.1448 0.1331 0.1757 -0.0060 -0.0013 -0.0247 176 TYR A N   
3166 C CA  . TYR C 157 ? 0.1947 0.1872 0.2289 -0.0060 0.0011  -0.0207 176 TYR A CA  
3167 C C   . TYR C 157 ? 0.2307 0.2203 0.2696 -0.0085 0.0040  -0.0181 176 TYR A C   
3168 O O   . TYR C 157 ? 0.2509 0.2432 0.2980 -0.0116 0.0041  -0.0174 176 TYR A O   
3169 C CB  . TYR C 157 ? 0.1641 0.1636 0.2038 -0.0064 -0.0020 -0.0216 176 TYR A CB  
3170 C CG  . TYR C 157 ? 0.2116 0.2162 0.2535 -0.0044 -0.0001 -0.0186 176 TYR A CG  
3171 C CD1 . TYR C 157 ? 0.1744 0.1774 0.2153 -0.0036 0.0046  -0.0154 176 TYR A CD1 
3172 C CD2 . TYR C 157 ? 0.2014 0.2120 0.2463 -0.0027 -0.0037 -0.0195 176 TYR A CD2 
3173 C CE1 . TYR C 157 ? 0.2158 0.2228 0.2582 -0.0009 0.0062  -0.0136 176 TYR A CE1 
3174 C CE2 . TYR C 157 ? 0.1709 0.1858 0.2183 0.0002  -0.0023 -0.0173 176 TYR A CE2 
3175 C CZ  . TYR C 157 ? 0.2158 0.2288 0.2620 0.0012  0.0029  -0.0146 176 TYR A CZ  
3176 O OH  . TYR C 157 ? 0.2589 0.2755 0.3069 0.0049  0.0042  -0.0134 176 TYR A OH  
3177 N N   . GLU C 158 ? 0.2536 0.2377 0.2873 -0.0073 0.0063  -0.0164 177 GLU A N   
3178 C CA  . GLU C 158 ? 0.2324 0.2104 0.2672 -0.0092 0.0080  -0.0141 177 GLU A CA  
3179 C C   . GLU C 158 ? 0.3404 0.3207 0.3777 -0.0107 0.0120  -0.0098 177 GLU A C   
3180 O O   . GLU C 158 ? 0.3333 0.3106 0.3740 -0.0141 0.0136  -0.0075 177 GLU A O   
3181 C CB  . GLU C 158 ? 0.2147 0.1870 0.2429 -0.0064 0.0082  -0.0139 177 GLU A CB  
3182 C CG  . GLU C 158 ? 0.2907 0.2549 0.3176 -0.0073 0.0090  -0.0112 177 GLU A CG  
3183 C CD  . GLU C 158 ? 0.3628 0.3228 0.3851 -0.0038 0.0076  -0.0120 177 GLU A CD  
3184 O OE1 . GLU C 158 ? 0.3719 0.3356 0.3912 -0.0016 0.0080  -0.0120 177 GLU A OE1 
3185 O OE2 . GLU C 158 ? 0.4210 0.3737 0.4433 -0.0034 0.0057  -0.0126 177 GLU A OE2 
3186 N N   . SER C 159 ? 0.2912 0.2763 0.3264 -0.0082 0.0138  -0.0088 178 SER A N   
3187 C CA  . SER C 159 ? 0.1926 0.1799 0.2280 -0.0081 0.0183  -0.0054 178 SER A CA  
3188 C C   . SER C 159 ? 0.2529 0.2484 0.2915 -0.0056 0.0185  -0.0064 178 SER A C   
3189 O O   . SER C 159 ? 0.1970 0.1938 0.2343 -0.0037 0.0150  -0.0087 178 SER A O   
3190 C CB  . SER C 159 ? 0.2459 0.2262 0.2710 -0.0055 0.0197  -0.0035 178 SER A CB  
3191 O OG  . SER C 159 ? 0.3252 0.3073 0.3475 -0.0039 0.0239  -0.0011 178 SER A OG  
3192 N N   . ARG C 160 ? 0.1835 0.1846 0.2259 -0.0052 0.0227  -0.0045 179 ARG A N   
3193 C CA  . ARG C 160 ? 0.1852 0.1928 0.2294 -0.0011 0.0227  -0.0057 179 ARG A CA  
3194 C C   . ARG C 160 ? 0.1926 0.1931 0.2251 0.0032  0.0218  -0.0059 179 ARG A C   
3195 O O   . ARG C 160 ? 0.2156 0.2175 0.2469 0.0069  0.0201  -0.0072 179 ARG A O   
3196 C CB  . ARG C 160 ? 0.2739 0.2903 0.3253 -0.0006 0.0282  -0.0041 179 ARG A CB  
3197 C CG  . ARG C 160 ? 0.3918 0.4159 0.4567 -0.0062 0.0292  -0.0032 179 ARG A CG  
3198 C CD  . ARG C 160 ? 0.4830 0.5209 0.5599 -0.0053 0.0335  -0.0027 179 ARG A CD  
3199 N NE  . ARG C 160 ? 0.4842 0.5297 0.5755 -0.0121 0.0342  -0.0015 179 ARG A NE  
3200 C CZ  . ARG C 160 ? 0.5174 0.5691 0.6202 -0.0144 0.0283  -0.0042 179 ARG A CZ  
3201 N NH1 . ARG C 160 ? 0.5055 0.5567 0.6056 -0.0102 0.0218  -0.0078 179 ARG A NH1 
3202 N NH2 . ARG C 160 ? 0.5576 0.6154 0.6740 -0.0214 0.0286  -0.0030 179 ARG A NH2 
3203 N N   . ASN C 161 ? 0.1920 0.1842 0.2163 0.0025  0.0224  -0.0047 180 ASN A N   
3204 C CA  . ASN C 161 ? 0.2755 0.2607 0.2895 0.0056  0.0213  -0.0048 180 ASN A CA  
3205 C C   . ASN C 161 ? 0.2150 0.1958 0.2255 0.0051  0.0169  -0.0059 180 ASN A C   
3206 O O   . ASN C 161 ? 0.2230 0.1990 0.2271 0.0068  0.0152  -0.0060 180 ASN A O   
3207 C CB  . ASN C 161 ? 0.3153 0.2951 0.3218 0.0062  0.0245  -0.0028 180 ASN A CB  
3208 C CG  . ASN C 161 ? 0.3804 0.3657 0.3897 0.0067  0.0302  -0.0013 180 ASN A CG  
3209 O OD1 . ASN C 161 ? 0.3794 0.3643 0.3891 0.0039  0.0337  0.0015  180 ASN A OD1 
3210 N ND2 . ASN C 161 ? 0.2849 0.2761 0.2972 0.0103  0.0315  -0.0029 180 ASN A ND2 
3211 N N   . HIS C 162 ? 0.2533 0.2359 0.2682 0.0026  0.0151  -0.0069 181 HIS A N   
3212 C CA  . HIS C 162 ? 0.2544 0.2351 0.2667 0.0023  0.0121  -0.0080 181 HIS A CA  
3213 C C   . HIS C 162 ? 0.2362 0.2201 0.2529 0.0005  0.0105  -0.0101 181 HIS A C   
3214 O O   . HIS C 162 ? 0.2268 0.2125 0.2488 -0.0012 0.0110  -0.0106 181 HIS A O   
3215 C CB  . HIS C 162 ? 0.1486 0.1239 0.1566 0.0021  0.0117  -0.0073 181 HIS A CB  
3216 C CG  . HIS C 162 ? 0.2467 0.2200 0.2569 0.0008  0.0123  -0.0071 181 HIS A CG  
3217 N ND1 . HIS C 162 ? 0.2605 0.2304 0.2688 0.0006  0.0144  -0.0049 181 HIS A ND1 
3218 C CD2 . HIS C 162 ? 0.2148 0.1879 0.2280 -0.0001 0.0110  -0.0088 181 HIS A CD2 
3219 C CE1 . HIS C 162 ? 0.3154 0.2821 0.3255 -0.0009 0.0139  -0.0046 181 HIS A CE1 
3220 N NE2 . HIS C 162 ? 0.2361 0.2045 0.2495 -0.0009 0.0116  -0.0074 181 HIS A NE2 
3221 N N   . VAL C 163 ? 0.2487 0.2329 0.2628 0.0007  0.0088  -0.0112 182 VAL A N   
3222 C CA  . VAL C 163 ? 0.2044 0.1905 0.2199 -0.0001 0.0074  -0.0139 182 VAL A CA  
3223 C C   . VAL C 163 ? 0.2601 0.2440 0.2742 0.0001  0.0079  -0.0148 182 VAL A C   
3224 O O   . VAL C 163 ? 0.1755 0.1586 0.1875 0.0006  0.0085  -0.0132 182 VAL A O   
3225 C CB  . VAL C 163 ? 0.2210 0.2099 0.2331 0.0006  0.0056  -0.0146 182 VAL A CB  
3226 C CG1 . VAL C 163 ? 0.1509 0.1413 0.1619 0.0004  0.0042  -0.0180 182 VAL A CG1 
3227 C CG2 . VAL C 163 ? 0.2067 0.1983 0.2213 0.0014  0.0041  -0.0138 182 VAL A CG2 
3228 N N   . HIS C 164 ? 0.1994 0.1822 0.2158 0.0000  0.0072  -0.0175 183 HIS A N   
3229 C CA  . HIS C 164 ? 0.1982 0.1795 0.2146 0.0014  0.0073  -0.0191 183 HIS A CA  
3230 C C   . HIS C 164 ? 0.2188 0.2037 0.2329 0.0026  0.0072  -0.0226 183 HIS A C   
3231 O O   . HIS C 164 ? 0.2059 0.1909 0.2193 0.0022  0.0056  -0.0252 183 HIS A O   
3232 C CB  . HIS C 164 ? 0.2277 0.2032 0.2471 0.0010  0.0063  -0.0199 183 HIS A CB  
3233 C CG  . HIS C 164 ? 0.2105 0.1836 0.2305 0.0036  0.0056  -0.0226 183 HIS A CG  
3234 N ND1 . HIS C 164 ? 0.1874 0.1569 0.2080 0.0051  0.0051  -0.0209 183 HIS A ND1 
3235 C CD2 . HIS C 164 ? 0.2144 0.1882 0.2344 0.0057  0.0048  -0.0273 183 HIS A CD2 
3236 C CE1 . HIS C 164 ? 0.2131 0.1818 0.2355 0.0082  0.0041  -0.0243 183 HIS A CE1 
3237 N NE2 . HIS C 164 ? 0.2288 0.2000 0.2506 0.0087  0.0043  -0.0285 183 HIS A NE2 
3238 N N   . VAL C 165 ? 0.1635 0.1521 0.1766 0.0038  0.0090  -0.0227 184 VAL A N   
3239 C CA  . VAL C 165 ? 0.1993 0.1923 0.2092 0.0053  0.0103  -0.0258 184 VAL A CA  
3240 C C   . VAL C 165 ? 0.2251 0.2206 0.2385 0.0080  0.0118  -0.0281 184 VAL A C   
3241 O O   . VAL C 165 ? 0.2218 0.2175 0.2396 0.0081  0.0118  -0.0259 184 VAL A O   
3242 C CB  . VAL C 165 ? 0.1514 0.1488 0.1565 0.0038  0.0119  -0.0229 184 VAL A CB  
3243 C CG1 . VAL C 165 ? 0.1543 0.1489 0.1568 0.0023  0.0096  -0.0207 184 VAL A CG1 
3244 C CG2 . VAL C 165 ? 0.1701 0.1699 0.1780 0.0026  0.0137  -0.0192 184 VAL A CG2 
3245 N N   . SER C 166 ? 0.1955 0.1928 0.2070 0.0109  0.0127  -0.0329 185 SER A N   
3246 C CA  . SER C 166 ? 0.1948 0.1954 0.2107 0.0147  0.0142  -0.0359 185 SER A CA  
3247 C C   . SER C 166 ? 0.2060 0.2132 0.2176 0.0177  0.0177  -0.0402 185 SER A C   
3248 O O   . SER C 166 ? 0.2174 0.2238 0.2208 0.0169  0.0177  -0.0415 185 SER A O   
3249 C CB  . SER C 166 ? 0.1750 0.1669 0.1943 0.0171  0.0107  -0.0387 185 SER A CB  
3250 O OG  . SER C 166 ? 0.2349 0.2209 0.2499 0.0178  0.0085  -0.0432 185 SER A OG  
3251 N N   . VAL C 167 ? 0.1866 0.2007 0.2035 0.0214  0.0206  -0.0425 186 VAL A N   
3252 C CA  . VAL C 167 ? 0.2217 0.2437 0.2349 0.0251  0.0254  -0.0469 186 VAL A CA  
3253 C C   . VAL C 167 ? 0.2378 0.2597 0.2554 0.0321  0.0253  -0.0538 186 VAL A C   
3254 O O   . VAL C 167 ? 0.2519 0.2701 0.2776 0.0341  0.0221  -0.0539 186 VAL A O   
3255 C CB  . VAL C 167 ? 0.2228 0.2580 0.2393 0.0230  0.0313  -0.0429 186 VAL A CB  
3256 C CG1 . VAL C 167 ? 0.2543 0.2884 0.2652 0.0166  0.0314  -0.0363 186 VAL A CG1 
3257 C CG2 . VAL C 167 ? 0.2134 0.2543 0.2435 0.0238  0.0310  -0.0413 186 VAL A CG2 
3258 N N   . LYS C 168 ? 0.2356 0.2608 0.2464 0.0365  0.0285  -0.0597 187 LYS A N   
3259 C CA  . LYS C 168 ? 0.2523 0.2795 0.2669 0.0445  0.0297  -0.0670 187 LYS A CA  
3260 C C   . LYS C 168 ? 0.3745 0.4155 0.4024 0.0462  0.0338  -0.0647 187 LYS A C   
3261 O O   . LYS C 168 ? 0.3289 0.3796 0.3602 0.0410  0.0373  -0.0585 187 LYS A O   
3262 C CB  . LYS C 168 ? 0.2771 0.3084 0.2806 0.0489  0.0343  -0.0733 187 LYS A CB  
3263 C CG  . LYS C 168 ? 0.3153 0.3342 0.3049 0.0480  0.0298  -0.0770 187 LYS A CG  
3264 C CD  . LYS C 168 ? 0.3832 0.4083 0.3599 0.0523  0.0353  -0.0824 187 LYS A CD  
3265 C CE  . LYS C 168 ? 0.4744 0.4879 0.4360 0.0514  0.0299  -0.0863 187 LYS A CE  
3266 N NZ  . LYS C 168 ? 0.4553 0.4531 0.4197 0.0521  0.0210  -0.0909 187 LYS A NZ  
3267 N N   . ALA C 169 ? 0.3386 0.3803 0.3744 0.0536  0.0327  -0.0700 188 ALA A N   
3268 C CA  . ALA C 169 ? 0.3536 0.4096 0.4042 0.0565  0.0356  -0.0690 188 ALA A CA  
3269 C C   . ALA C 169 ? 0.4000 0.4756 0.4528 0.0566  0.0453  -0.0690 188 ALA A C   
3270 O O   . ALA C 169 ? 0.3982 0.4755 0.4393 0.0578  0.0502  -0.0722 188 ALA A O   
3271 C CB  . ALA C 169 ? 0.3348 0.3865 0.3924 0.0658  0.0319  -0.0757 188 ALA A CB  
3272 N N   . ASP C 170 ? 0.4380 0.5283 0.5057 0.0551  0.0477  -0.0652 189 ASP A N   
3273 C CA  . ASP C 170 ? 0.4173 0.5288 0.4915 0.0546  0.0574  -0.0642 189 ASP A CA  
3274 C C   . ASP C 170 ? 0.4669 0.5885 0.5461 0.0655  0.0622  -0.0731 189 ASP A C   
3275 O O   . ASP C 170 ? 0.6085 0.7299 0.6753 0.0696  0.0673  -0.0784 189 ASP A O   
3276 C CB  . ASP C 170 ? 0.4779 0.6017 0.5694 0.0493  0.0569  -0.0579 189 ASP A CB  
3277 C CG  . ASP C 170 ? 0.5477 0.6699 0.6344 0.0380  0.0574  -0.0489 189 ASP A CG  
3278 O OD1 . ASP C 170 ? 0.3039 0.4139 0.3744 0.0343  0.0566  -0.0470 189 ASP A OD1 
3279 O OD2 . ASP C 170 ? 0.6203 0.7537 0.7205 0.0329  0.0579  -0.0440 189 ASP A OD2 
3280 N N   . GLU D 4   ? 0.6276 0.6718 0.5108 -0.0948 -0.1384 0.0322  710 GLU D N   
3281 C CA  . GLU D 4   ? 0.6156 0.6716 0.5224 -0.0881 -0.1385 0.0341  710 GLU D CA  
3282 C C   . GLU D 4   ? 0.5254 0.5706 0.4338 -0.0803 -0.1303 0.0375  710 GLU D C   
3283 O O   . GLU D 4   ? 0.4078 0.4467 0.3094 -0.0749 -0.1321 0.0433  710 GLU D O   
3284 C CB  . GLU D 4   ? 0.7169 0.7888 0.6347 -0.0836 -0.1506 0.0390  710 GLU D CB  
3285 C CG  . GLU D 4   ? 0.8915 0.9795 0.8148 -0.0906 -0.1594 0.0350  710 GLU D CG  
3286 C CD  . GLU D 4   ? 1.0419 1.1496 0.9853 -0.0845 -0.1695 0.0390  710 GLU D CD  
3287 O OE1 . GLU D 4   ? 1.1114 1.2177 1.0537 -0.0764 -0.1744 0.0465  710 GLU D OE1 
3288 O OE2 . GLU D 4   ? 1.0859 1.2104 1.0466 -0.0878 -0.1722 0.0348  710 GLU D OE2 
3289 N N   . ARG D 5   ? 0.5119 0.5549 0.4289 -0.0801 -0.1214 0.0340  711 ARG D N   
3290 C CA  . ARG D 5   ? 0.5033 0.5368 0.4220 -0.0735 -0.1135 0.0364  711 ARG D CA  
3291 C C   . ARG D 5   ? 0.4945 0.5364 0.4295 -0.0649 -0.1167 0.0412  711 ARG D C   
3292 O O   . ARG D 5   ? 0.4450 0.5016 0.3953 -0.0637 -0.1226 0.0413  711 ARG D O   
3293 C CB  . ARG D 5   ? 0.5906 0.6199 0.5133 -0.0757 -0.1038 0.0314  711 ARG D CB  
3294 C CG  . ARG D 5   ? 0.6220 0.6403 0.5285 -0.0831 -0.0991 0.0268  711 ARG D CG  
3295 C CD  . ARG D 5   ? 0.5565 0.5712 0.4675 -0.0852 -0.0903 0.0223  711 ARG D CD  
3296 N NE  . ARG D 5   ? 0.6777 0.6851 0.5760 -0.0937 -0.0877 0.0172  711 ARG D NE  
3297 C CZ  . ARG D 5   ? 0.7719 0.7753 0.6714 -0.0976 -0.0810 0.0128  711 ARG D CZ  
3298 N NH1 . ARG D 5   ? 0.7848 0.7911 0.6968 -0.0938 -0.0763 0.0130  711 ARG D NH1 
3299 N NH2 . ARG D 5   ? 0.8041 0.7995 0.6911 -0.1056 -0.0786 0.0081  711 ARG D NH2 
3300 N N   . PRO D 6   ? 0.4839 0.5162 0.4160 -0.0590 -0.1124 0.0449  712 PRO D N   
3301 C CA  . PRO D 6   ? 0.4646 0.5027 0.4128 -0.0512 -0.1130 0.0483  712 PRO D CA  
3302 C C   . PRO D 6   ? 0.5576 0.6040 0.5222 -0.0513 -0.1085 0.0438  712 PRO D C   
3303 O O   . PRO D 6   ? 0.6047 0.6470 0.5653 -0.0560 -0.1023 0.0392  712 PRO D O   
3304 C CB  . PRO D 6   ? 0.5187 0.5430 0.4591 -0.0473 -0.1064 0.0509  712 PRO D CB  
3305 C CG  . PRO D 6   ? 0.4997 0.5125 0.4194 -0.0520 -0.1050 0.0508  712 PRO D CG  
3306 C CD  . PRO D 6   ? 0.4592 0.4754 0.3746 -0.0596 -0.1058 0.0455  712 PRO D CD  
3307 N N   . VAL D 7   ? 0.6146 0.6718 0.5970 -0.0460 -0.1111 0.0452  713 VAL D N   
3308 C CA  . VAL D 7   ? 0.6165 0.6812 0.6142 -0.0458 -0.1061 0.0411  713 VAL D CA  
3309 C C   . VAL D 7   ? 0.5472 0.6047 0.5485 -0.0402 -0.0989 0.0419  713 VAL D C   
3310 O O   . VAL D 7   ? 0.4583 0.5078 0.4536 -0.0422 -0.0914 0.0391  713 VAL D O   
3311 C CB  . VAL D 7   ? 0.7062 0.7886 0.7228 -0.0440 -0.1124 0.0409  713 VAL D CB  
3312 C CG1 . VAL D 7   ? 0.7651 0.8564 0.7806 -0.0519 -0.1170 0.0373  713 VAL D CG1 
3313 C CG2 . VAL D 7   ? 0.7849 0.8703 0.8056 -0.0369 -0.1199 0.0471  713 VAL D CG2 
3314 N N   . ALA D 8   ? 0.5194 0.5797 0.5303 -0.0332 -0.1014 0.0456  714 ALA D N   
3315 C CA  . ALA D 8   ? 0.5111 0.5651 0.5260 -0.0282 -0.0950 0.0460  714 ALA D CA  
3316 C C   . ALA D 8   ? 0.4414 0.4805 0.4403 -0.0284 -0.0914 0.0480  714 ALA D C   
3317 O O   . ALA D 8   ? 0.4011 0.4345 0.3877 -0.0295 -0.0953 0.0514  714 ALA D O   
3318 C CB  . ALA D 8   ? 0.4941 0.5536 0.5229 -0.0209 -0.0984 0.0493  714 ALA D CB  
3319 N N   . GLY D 9   ? 0.4195 0.4526 0.4182 -0.0275 -0.0840 0.0459  715 GLY D N   
3320 C CA  . GLY D 9   ? 0.4388 0.4595 0.4248 -0.0275 -0.0800 0.0474  715 GLY D CA  
3321 C C   . GLY D 9   ? 0.4237 0.4404 0.4144 -0.0220 -0.0790 0.0503  715 GLY D C   
3322 O O   . GLY D 9   ? 0.3387 0.3613 0.3420 -0.0178 -0.0813 0.0513  715 GLY D O   
3323 N N   . PRO D 10  ? 0.3148 0.3211 0.2958 -0.0220 -0.0750 0.0515  716 PRO D N   
3324 C CA  . PRO D 10  ? 0.3286 0.3299 0.3137 -0.0178 -0.0726 0.0534  716 PRO D CA  
3325 C C   . PRO D 10  ? 0.3119 0.3177 0.3089 -0.0160 -0.0680 0.0493  716 PRO D C   
3326 O O   . PRO D 10  ? 0.3021 0.3132 0.3015 -0.0183 -0.0659 0.0454  716 PRO D O   
3327 C CB  . PRO D 10  ? 0.3566 0.3476 0.3289 -0.0201 -0.0681 0.0539  716 PRO D CB  
3328 C CG  . PRO D 10  ? 0.3916 0.3814 0.3521 -0.0247 -0.0689 0.0530  716 PRO D CG  
3329 C CD  . PRO D 10  ? 0.3382 0.3374 0.3052 -0.0263 -0.0716 0.0502  716 PRO D CD  
3330 N N   . TYR D 11  ? 0.2607 0.2636 0.2640 -0.0123 -0.0660 0.0500  717 TYR D N   
3331 C CA  . TYR D 11  ? 0.2995 0.3049 0.3116 -0.0111 -0.0609 0.0457  717 TYR D CA  
3332 C C   . TYR D 11  ? 0.3411 0.3382 0.3488 -0.0111 -0.0563 0.0456  717 TYR D C   
3333 O O   . TYR D 11  ? 0.3435 0.3341 0.3503 -0.0091 -0.0569 0.0489  717 TYR D O   
3334 C CB  . TYR D 11  ? 0.3279 0.3389 0.3541 -0.0068 -0.0625 0.0455  717 TYR D CB  
3335 C CG  . TYR D 11  ? 0.3838 0.3962 0.4178 -0.0057 -0.0569 0.0409  717 TYR D CG  
3336 C CD1 . TYR D 11  ? 0.3399 0.3596 0.3782 -0.0074 -0.0543 0.0364  717 TYR D CD1 
3337 C CD2 . TYR D 11  ? 0.4407 0.4465 0.4768 -0.0034 -0.0540 0.0410  717 TYR D CD2 
3338 C CE1 . TYR D 11  ? 0.3332 0.3537 0.3770 -0.0066 -0.0493 0.0321  717 TYR D CE1 
3339 C CE2 . TYR D 11  ? 0.4726 0.4795 0.5148 -0.0029 -0.0490 0.0363  717 TYR D CE2 
3340 C CZ  . TYR D 11  ? 0.4171 0.4315 0.4627 -0.0044 -0.0469 0.0319  717 TYR D CZ  
3341 O OH  . TYR D 11  ? 0.4731 0.4881 0.5232 -0.0041 -0.0420 0.0272  717 TYR D OH  
3342 N N   . ILE D 12  ? 0.2818 0.2790 0.2869 -0.0133 -0.0517 0.0418  718 ILE D N   
3343 C CA  . ILE D 12  ? 0.2409 0.2322 0.2427 -0.0139 -0.0475 0.0411  718 ILE D CA  
3344 C C   . ILE D 12  ? 0.2896 0.2811 0.3012 -0.0115 -0.0451 0.0388  718 ILE D C   
3345 O O   . ILE D 12  ? 0.2876 0.2848 0.3059 -0.0109 -0.0435 0.0349  718 ILE D O   
3346 C CB  . ILE D 12  ? 0.2743 0.2667 0.2705 -0.0165 -0.0440 0.0380  718 ILE D CB  
3347 C CG1 . ILE D 12  ? 0.2906 0.2809 0.2764 -0.0189 -0.0454 0.0398  718 ILE D CG1 
3348 C CG2 . ILE D 12  ? 0.2506 0.2393 0.2458 -0.0170 -0.0400 0.0368  718 ILE D CG2 
3349 C CD1 . ILE D 12  ? 0.3095 0.3017 0.2913 -0.0206 -0.0424 0.0368  718 ILE D CD1 
3350 N N   . THR D 13  ? 0.2767 0.2610 0.2881 -0.0104 -0.0445 0.0412  719 THR D N   
3351 C CA  . THR D 13  ? 0.2781 0.2604 0.2982 -0.0082 -0.0421 0.0392  719 THR D CA  
3352 C C   . THR D 13  ? 0.3678 0.3478 0.3871 -0.0106 -0.0372 0.0354  719 THR D C   
3353 O O   . THR D 13  ? 0.4309 0.4104 0.4571 -0.0098 -0.0345 0.0321  719 THR D O   
3354 C CB  . THR D 13  ? 0.3271 0.3014 0.3477 -0.0055 -0.0440 0.0441  719 THR D CB  
3355 O OG1 . THR D 13  ? 0.3650 0.3317 0.3750 -0.0080 -0.0436 0.0477  719 THR D OG1 
3356 C CG2 . THR D 13  ? 0.2819 0.2604 0.3065 -0.0021 -0.0496 0.0475  719 THR D CG2 
3357 N N   . PHE D 14  ? 0.2803 0.2592 0.2917 -0.0137 -0.0359 0.0357  720 PHE D N   
3358 C CA  . PHE D 14  ? 0.3094 0.2869 0.3204 -0.0162 -0.0317 0.0326  720 PHE D CA  
3359 C C   . PHE D 14  ? 0.2963 0.2769 0.3006 -0.0187 -0.0306 0.0320  720 PHE D C   
3360 O O   . PHE D 14  ? 0.3065 0.2847 0.3035 -0.0193 -0.0320 0.0354  720 PHE D O   
3361 C CB  . PHE D 14  ? 0.3982 0.3659 0.4078 -0.0169 -0.0300 0.0354  720 PHE D CB  
3362 C CG  . PHE D 14  ? 0.4654 0.4319 0.4744 -0.0206 -0.0256 0.0325  720 PHE D CG  
3363 C CD1 . PHE D 14  ? 0.5403 0.5075 0.5561 -0.0216 -0.0227 0.0277  720 PHE D CD1 
3364 C CD2 . PHE D 14  ? 0.4476 0.4126 0.4494 -0.0232 -0.0242 0.0342  720 PHE D CD2 
3365 C CE1 . PHE D 14  ? 0.5654 0.5328 0.5814 -0.0255 -0.0190 0.0246  720 PHE D CE1 
3366 C CE2 . PHE D 14  ? 0.5894 0.5549 0.5923 -0.0267 -0.0201 0.0313  720 PHE D CE2 
3367 C CZ  . PHE D 14  ? 0.5781 0.5452 0.5884 -0.0280 -0.0177 0.0265  720 PHE D CZ  
3368 N N   . THR D 15  ? 0.2648 0.2510 0.2715 -0.0198 -0.0284 0.0275  721 THR D N   
3369 C CA  . THR D 15  ? 0.2442 0.2330 0.2462 -0.0216 -0.0267 0.0268  721 THR D CA  
3370 C C   . THR D 15  ? 0.3483 0.3403 0.3548 -0.0233 -0.0239 0.0226  721 THR D C   
3371 O O   . THR D 15  ? 0.3596 0.3546 0.3716 -0.0230 -0.0236 0.0190  721 THR D O   
3372 C CB  . THR D 15  ? 0.3578 0.3522 0.3566 -0.0205 -0.0280 0.0260  721 THR D CB  
3373 O OG1 . THR D 15  ? 0.3242 0.3244 0.3278 -0.0197 -0.0279 0.0223  721 THR D OG1 
3374 C CG2 . THR D 15  ? 0.3000 0.2921 0.2946 -0.0197 -0.0309 0.0294  721 THR D CG2 
3375 N N   . ASP D 16  ? 0.3293 0.3211 0.3338 -0.0255 -0.0215 0.0227  722 ASP D N   
3376 C CA  . ASP D 16  ? 0.3568 0.3537 0.3664 -0.0277 -0.0191 0.0183  722 ASP D CA  
3377 C C   . ASP D 16  ? 0.3281 0.3277 0.3356 -0.0292 -0.0168 0.0187  722 ASP D C   
3378 O O   . ASP D 16  ? 0.2752 0.2692 0.2772 -0.0298 -0.0157 0.0223  722 ASP D O   
3379 C CB  . ASP D 16  ? 0.4787 0.4703 0.4930 -0.0299 -0.0171 0.0169  722 ASP D CB  
3380 C CG  . ASP D 16  ? 0.5948 0.5930 0.6153 -0.0327 -0.0153 0.0110  722 ASP D CG  
3381 O OD1 . ASP D 16  ? 0.5473 0.5549 0.5687 -0.0319 -0.0167 0.0083  722 ASP D OD1 
3382 O OD2 . ASP D 16  ? 0.6884 0.6821 0.7124 -0.0357 -0.0127 0.0092  722 ASP D OD2 
3383 N N   . ALA D 17  ? 0.2732 0.2817 0.2850 -0.0298 -0.0162 0.0148  723 ALA D N   
3384 C CA  . ALA D 17  ? 0.2627 0.2758 0.2750 -0.0309 -0.0138 0.0145  723 ALA D CA  
3385 C C   . ALA D 17  ? 0.3459 0.3546 0.3605 -0.0352 -0.0100 0.0144  723 ALA D C   
3386 O O   . ALA D 17  ? 0.3492 0.3559 0.3683 -0.0377 -0.0093 0.0121  723 ALA D O   
3387 C CB  . ALA D 17  ? 0.3180 0.3430 0.3357 -0.0301 -0.0148 0.0103  723 ALA D CB  
3388 N N   . VAL D 18  ? 0.2654 0.2715 0.2765 -0.0362 -0.0070 0.0167  724 VAL D N   
3389 C CA  . VAL D 18  ? 0.3512 0.3534 0.3641 -0.0408 -0.0025 0.0165  724 VAL D CA  
3390 C C   . VAL D 18  ? 0.3591 0.3728 0.3799 -0.0429 0.0003  0.0124  724 VAL D C   
3391 O O   . VAL D 18  ? 0.4378 0.4529 0.4646 -0.0475 0.0034  0.0096  724 VAL D O   
3392 C CB  . VAL D 18  ? 0.4163 0.4074 0.4197 -0.0416 -0.0002 0.0217  724 VAL D CB  
3393 C CG1 . VAL D 18  ? 0.3833 0.3674 0.3789 -0.0382 -0.0044 0.0258  724 VAL D CG1 
3394 C CG2 . VAL D 18  ? 0.5520 0.5472 0.5534 -0.0417 0.0031  0.0219  724 VAL D CG2 
3395 N N   . ASN D 19  ? 0.2826 0.3045 0.3036 -0.0396 -0.0007 0.0121  725 ASN D N   
3396 C CA  . ASN D 19  ? 0.2873 0.3225 0.3173 -0.0401 0.0008  0.0083  725 ASN D CA  
3397 C C   . ASN D 19  ? 0.3013 0.3440 0.3306 -0.0344 -0.0026 0.0085  725 ASN D C   
3398 O O   . ASN D 19  ? 0.2706 0.3090 0.2940 -0.0312 -0.0062 0.0103  725 ASN D O   
3399 C CB  . ASN D 19  ? 0.3237 0.3584 0.3547 -0.0432 0.0069  0.0088  725 ASN D CB  
3400 C CG  . ASN D 19  ? 0.3341 0.3595 0.3543 -0.0411 0.0088  0.0134  725 ASN D CG  
3401 O OD1 . ASN D 19  ? 0.2981 0.3242 0.3139 -0.0363 0.0063  0.0149  725 ASN D OD1 
3402 N ND2 . ASN D 19  ? 0.2532 0.2692 0.2683 -0.0451 0.0136  0.0156  725 ASN D ND2 
3403 N N   . GLU D 20  ? 0.2633 0.3168 0.2987 -0.0328 -0.0013 0.0067  726 GLU D N   
3404 C CA  . GLU D 20  ? 0.2797 0.3403 0.3150 -0.0269 -0.0046 0.0070  726 GLU D CA  
3405 C C   . GLU D 20  ? 0.2962 0.3485 0.3217 -0.0228 -0.0036 0.0111  726 GLU D C   
3406 O O   . GLU D 20  ? 0.2794 0.3341 0.3027 -0.0178 -0.0061 0.0120  726 GLU D O   
3407 C CB  . GLU D 20  ? 0.3442 0.4209 0.3908 -0.0258 -0.0045 0.0036  726 GLU D CB  
3408 C CG  . GLU D 20  ? 0.5349 0.6147 0.5854 -0.0259 0.0011  0.0037  726 GLU D CG  
3409 C CD  . GLU D 20  ? 0.6903 0.7663 0.7434 -0.0329 0.0065  0.0026  726 GLU D CD  
3410 O OE1 . GLU D 20  ? 0.6843 0.7557 0.7372 -0.0376 0.0058  0.0015  726 GLU D OE1 
3411 O OE2 . GLU D 20  ? 0.7623 0.8391 0.8172 -0.0336 0.0121  0.0029  726 GLU D OE2 
3412 N N   . THR D 21  ? 0.2207 0.2623 0.2394 -0.0253 0.0000  0.0136  727 THR D N   
3413 C CA  . THR D 21  ? 0.2439 0.2772 0.2527 -0.0224 0.0012  0.0168  727 THR D CA  
3414 C C   . THR D 21  ? 0.2938 0.3137 0.2919 -0.0245 0.0004  0.0200  727 THR D C   
3415 O O   . THR D 21  ? 0.2848 0.2970 0.2737 -0.0233 0.0013  0.0224  727 THR D O   
3416 C CB  . THR D 21  ? 0.2783 0.3126 0.2878 -0.0225 0.0072  0.0166  727 THR D CB  
3417 O OG1 . THR D 21  ? 0.2968 0.3256 0.3049 -0.0280 0.0113  0.0170  727 THR D OG1 
3418 C CG2 . THR D 21  ? 0.3269 0.3764 0.3489 -0.0200 0.0079  0.0134  727 THR D CG2 
3419 N N   . THR D 22  ? 0.2638 0.2807 0.2632 -0.0275 -0.0014 0.0200  728 THR D N   
3420 C CA  . THR D 22  ? 0.2872 0.2924 0.2781 -0.0294 -0.0022 0.0233  728 THR D CA  
3421 C C   . THR D 22  ? 0.2571 0.2613 0.2499 -0.0291 -0.0068 0.0231  728 THR D C   
3422 O O   . THR D 22  ? 0.2705 0.2807 0.2714 -0.0300 -0.0075 0.0201  728 THR D O   
3423 C CB  . THR D 22  ? 0.3286 0.3284 0.3186 -0.0340 0.0023  0.0242  728 THR D CB  
3424 O OG1 . THR D 22  ? 0.3349 0.3384 0.3263 -0.0347 0.0075  0.0231  728 THR D OG1 
3425 C CG2 . THR D 22  ? 0.3582 0.3451 0.3369 -0.0353 0.0015  0.0286  728 THR D CG2 
3426 N N   . ILE D 23  ? 0.2011 0.1984 0.1868 -0.0279 -0.0097 0.0260  729 ILE D N   
3427 C CA  . ILE D 23  ? 0.2457 0.2411 0.2331 -0.0275 -0.0134 0.0262  729 ILE D CA  
3428 C C   . ILE D 23  ? 0.2325 0.2179 0.2133 -0.0287 -0.0144 0.0302  729 ILE D C   
3429 O O   . ILE D 23  ? 0.3108 0.2914 0.2831 -0.0286 -0.0145 0.0329  729 ILE D O   
3430 C CB  . ILE D 23  ? 0.2106 0.2094 0.1971 -0.0243 -0.0168 0.0257  729 ILE D CB  
3431 C CG1 . ILE D 23  ? 0.2328 0.2414 0.2257 -0.0228 -0.0169 0.0221  729 ILE D CG1 
3432 C CG2 . ILE D 23  ? 0.2186 0.2144 0.2058 -0.0240 -0.0202 0.0266  729 ILE D CG2 
3433 C CD1 . ILE D 23  ? 0.2795 0.2902 0.2693 -0.0196 -0.0191 0.0222  729 ILE D CD1 
3434 N N   . MET D 24  ? 0.2736 0.2557 0.2580 -0.0296 -0.0153 0.0306  730 MET D N   
3435 C CA  . MET D 24  ? 0.2583 0.2312 0.2374 -0.0299 -0.0168 0.0349  730 MET D CA  
3436 C C   . MET D 24  ? 0.3158 0.2893 0.2969 -0.0272 -0.0215 0.0355  730 MET D C   
3437 O O   . MET D 24  ? 0.3394 0.3185 0.3278 -0.0260 -0.0223 0.0322  730 MET D O   
3438 C CB  . MET D 24  ? 0.2802 0.2473 0.2619 -0.0324 -0.0142 0.0354  730 MET D CB  
3439 C CG  . MET D 24  ? 0.4383 0.3954 0.4152 -0.0317 -0.0164 0.0403  730 MET D CG  
3440 S SD  . MET D 24  ? 0.7004 0.6480 0.6782 -0.0350 -0.0120 0.0415  730 MET D SD  
3441 C CE  . MET D 24  ? 0.5435 0.4918 0.5162 -0.0391 -0.0062 0.0409  730 MET D CE  
3442 N N   . LEU D 25  ? 0.2602 0.2285 0.2348 -0.0264 -0.0246 0.0395  731 LEU D N   
3443 C CA  . LEU D 25  ? 0.2436 0.2129 0.2216 -0.0239 -0.0289 0.0404  731 LEU D CA  
3444 C C   . LEU D 25  ? 0.2982 0.2599 0.2723 -0.0232 -0.0317 0.0455  731 LEU D C   
3445 O O   . LEU D 25  ? 0.3155 0.2706 0.2808 -0.0249 -0.0310 0.0489  731 LEU D O   
3446 C CB  . LEU D 25  ? 0.2909 0.2658 0.2673 -0.0229 -0.0314 0.0393  731 LEU D CB  
3447 C CG  . LEU D 25  ? 0.3958 0.3693 0.3625 -0.0240 -0.0321 0.0408  731 LEU D CG  
3448 C CD1 . LEU D 25  ? 0.4209 0.3906 0.3808 -0.0261 -0.0280 0.0412  731 LEU D CD1 
3449 C CD2 . LEU D 25  ? 0.4565 0.4274 0.4186 -0.0239 -0.0367 0.0442  731 LEU D CD2 
3450 N N   . LYS D 26  ? 0.2819 0.2448 0.2627 -0.0205 -0.0348 0.0459  732 LYS D N   
3451 C CA  . LYS D 26  ? 0.2889 0.2460 0.2675 -0.0185 -0.0386 0.0510  732 LYS D CA  
3452 C C   . LYS D 26  ? 0.3360 0.2998 0.3189 -0.0160 -0.0436 0.0511  732 LYS D C   
3453 O O   . LYS D 26  ? 0.3356 0.3069 0.3256 -0.0153 -0.0432 0.0469  732 LYS D O   
3454 C CB  . LYS D 26  ? 0.3272 0.2784 0.3120 -0.0170 -0.0370 0.0518  732 LYS D CB  
3455 C CG  . LYS D 26  ? 0.4712 0.4156 0.4531 -0.0202 -0.0316 0.0514  732 LYS D CG  
3456 C CD  . LYS D 26  ? 0.5790 0.5155 0.5660 -0.0189 -0.0300 0.0524  732 LYS D CD  
3457 C CE  . LYS D 26  ? 0.7287 0.6581 0.7129 -0.0230 -0.0242 0.0518  732 LYS D CE  
3458 N NZ  . LYS D 26  ? 0.8067 0.7269 0.7954 -0.0222 -0.0219 0.0525  732 LYS D NZ  
3459 N N   . TRP D 27  ? 0.3436 0.3051 0.3220 -0.0148 -0.0485 0.0558  733 TRP D N   
3460 C CA  . TRP D 27  ? 0.3393 0.3083 0.3229 -0.0127 -0.0536 0.0558  733 TRP D CA  
3461 C C   . TRP D 27  ? 0.3955 0.3618 0.3800 -0.0093 -0.0589 0.0613  733 TRP D C   
3462 O O   . TRP D 27  ? 0.3842 0.3412 0.3614 -0.0091 -0.0592 0.0659  733 TRP D O   
3463 C CB  . TRP D 27  ? 0.3403 0.3134 0.3163 -0.0157 -0.0552 0.0549  733 TRP D CB  
3464 C CG  . TRP D 27  ? 0.3129 0.2790 0.2748 -0.0181 -0.0568 0.0589  733 TRP D CG  
3465 C CD1 . TRP D 27  ? 0.3862 0.3512 0.3424 -0.0177 -0.0627 0.0633  733 TRP D CD1 
3466 C CD2 . TRP D 27  ? 0.3319 0.2919 0.2837 -0.0213 -0.0522 0.0586  733 TRP D CD2 
3467 N NE1 . TRP D 27  ? 0.3590 0.3165 0.3007 -0.0207 -0.0619 0.0657  733 TRP D NE1 
3468 C CE2 . TRP D 27  ? 0.3583 0.3125 0.2974 -0.0230 -0.0550 0.0628  733 TRP D CE2 
3469 C CE3 . TRP D 27  ? 0.3735 0.3328 0.3259 -0.0228 -0.0460 0.0551  733 TRP D CE3 
3470 C CZ2 . TRP D 27  ? 0.3855 0.3327 0.3124 -0.0262 -0.0510 0.0633  733 TRP D CZ2 
3471 C CZ3 . TRP D 27  ? 0.4076 0.3611 0.3495 -0.0257 -0.0423 0.0558  733 TRP D CZ3 
3472 C CH2 . TRP D 27  ? 0.4261 0.3733 0.3554 -0.0275 -0.0444 0.0597  733 TRP D CH2 
3473 N N   . MET D 28  ? 0.3878 0.3624 0.3814 -0.0066 -0.0631 0.0608  734 MET D N   
3474 C CA  . MET D 28  ? 0.3980 0.3725 0.3935 -0.0028 -0.0694 0.0661  734 MET D CA  
3475 C C   . MET D 28  ? 0.3910 0.3743 0.3847 -0.0043 -0.0752 0.0663  734 MET D C   
3476 O O   . MET D 28  ? 0.4109 0.4028 0.4097 -0.0063 -0.0742 0.0615  734 MET D O   
3477 C CB  . MET D 28  ? 0.3487 0.3259 0.3593 0.0025  -0.0693 0.0653  734 MET D CB  
3478 C CG  . MET D 28  ? 0.4291 0.4177 0.4514 0.0025  -0.0676 0.0593  734 MET D CG  
3479 S SD  . MET D 28  ? 0.8078 0.7977 0.8468 0.0084  -0.0654 0.0575  734 MET D SD  
3480 C CE  . MET D 28  ? 0.6018 0.5992 0.6489 0.0137  -0.0738 0.0625  734 MET D CE  
3481 N N   . TYR D 29  ? 0.3658 0.3466 0.3514 -0.0039 -0.0812 0.0717  735 TYR D N   
3482 C CA  . TYR D 29  ? 0.4150 0.4044 0.3984 -0.0058 -0.0875 0.0719  735 TYR D CA  
3483 C C   . TYR D 29  ? 0.5521 0.5444 0.5384 -0.0013 -0.0959 0.0777  735 TYR D C   
3484 O O   . TYR D 29  ? 0.5303 0.5132 0.5111 0.0017  -0.0973 0.0834  735 TYR D O   
3485 C CB  . TYR D 29  ? 0.4589 0.4431 0.4250 -0.0117 -0.0867 0.0717  735 TYR D CB  
3486 C CG  . TYR D 29  ? 0.4868 0.4786 0.4487 -0.0147 -0.0933 0.0716  735 TYR D CG  
3487 C CD1 . TYR D 29  ? 0.5179 0.5210 0.4892 -0.0165 -0.0939 0.0667  735 TYR D CD1 
3488 C CD2 . TYR D 29  ? 0.5889 0.5761 0.5368 -0.0162 -0.0986 0.0762  735 TYR D CD2 
3489 C CE1 . TYR D 29  ? 0.4905 0.5007 0.4585 -0.0200 -0.0997 0.0661  735 TYR D CE1 
3490 C CE2 . TYR D 29  ? 0.5584 0.5529 0.5020 -0.0196 -0.1049 0.0756  735 TYR D CE2 
3491 C CZ  . TYR D 29  ? 0.5787 0.5848 0.5330 -0.0217 -0.1055 0.0703  735 TYR D CZ  
3492 O OH  . TYR D 29  ? 0.5914 0.6050 0.5419 -0.0258 -0.1115 0.0691  735 TYR D OH  
3493 N N   . ILE D 30  ? 0.6085 0.6138 0.6035 -0.0010 -0.1016 0.0764  736 ILE D N   
3494 C CA  . ILE D 30  ? 0.7603 0.7712 0.7605 0.0038  -0.1105 0.0817  736 ILE D CA  
3495 C C   . ILE D 30  ? 0.7650 0.7793 0.7530 -0.0002 -0.1181 0.0840  736 ILE D C   
3496 O O   . ILE D 30  ? 0.7548 0.7814 0.7480 -0.0033 -0.1215 0.0804  736 ILE D O   
3497 C CB  . ILE D 30  ? 0.8326 0.8577 0.8543 0.0080  -0.1121 0.0789  736 ILE D CB  
3498 C CG1 . ILE D 30  ? 0.7924 0.8131 0.8250 0.0121  -0.1047 0.0767  736 ILE D CG1 
3499 C CG2 . ILE D 30  ? 0.9019 0.9345 0.9301 0.0135  -0.1220 0.0846  736 ILE D CG2 
3500 C CD1 . ILE D 30  ? 0.7608 0.7947 0.8141 0.0158  -0.1044 0.0730  736 ILE D CD1 
3501 N N   . PRO D 31  ? 0.7599 0.7629 0.7311 -0.0006 -0.1204 0.0897  737 PRO D N   
3502 C CA  . PRO D 31  ? 0.8034 0.8077 0.7598 -0.0050 -0.1272 0.0916  737 PRO D CA  
3503 C C   . PRO D 31  ? 0.9045 0.9232 0.8703 -0.0022 -0.1380 0.0939  737 PRO D C   
3504 O O   . PRO D 31  ? 1.0236 1.0460 0.9787 -0.0065 -0.1444 0.0945  737 PRO D O   
3505 C CB  . PRO D 31  ? 0.8038 0.7921 0.7422 -0.0043 -0.1270 0.0983  737 PRO D CB  
3506 C CG  . PRO D 31  ? 0.7976 0.7754 0.7392 -0.0025 -0.1173 0.0974  737 PRO D CG  
3507 C CD  . PRO D 31  ? 0.7843 0.7718 0.7482 0.0023  -0.1161 0.0942  737 PRO D CD  
3508 N N   . THR D 37  ? 0.8697 0.9190 0.7702 -0.0459 -0.1697 0.0783  743 THR D N   
3509 C CA  . THR D 37  ? 0.8526 0.8833 0.7288 -0.0495 -0.1640 0.0791  743 THR D CA  
3510 C C   . THR D 37  ? 0.7948 0.8126 0.6729 -0.0445 -0.1534 0.0809  743 THR D C   
3511 O O   . THR D 37  ? 0.7101 0.7324 0.6063 -0.0412 -0.1482 0.0784  743 THR D O   
3512 C CB  . THR D 37  ? 0.9314 0.9591 0.7954 -0.0598 -0.1598 0.0712  743 THR D CB  
3513 O OG1 . THR D 37  ? 0.8725 0.9135 0.7362 -0.0650 -0.1699 0.0690  743 THR D OG1 
3514 C CG2 . THR D 37  ? 0.9828 0.9924 0.8213 -0.0636 -0.1544 0.0720  743 THR D CG2 
3515 N N   . PRO D 38  ? 0.7795 0.7816 0.6391 -0.0442 -0.1503 0.0853  744 PRO D N   
3516 C CA  . PRO D 38  ? 0.7267 0.7165 0.5872 -0.0402 -0.1405 0.0870  744 PRO D CA  
3517 C C   . PRO D 38  ? 0.6603 0.6436 0.5185 -0.0448 -0.1291 0.0801  744 PRO D C   
3518 O O   . PRO D 38  ? 0.5563 0.5389 0.4046 -0.0517 -0.1276 0.0750  744 PRO D O   
3519 C CB  . PRO D 38  ? 0.7486 0.7246 0.5879 -0.0398 -0.1417 0.0938  744 PRO D CB  
3520 C CG  . PRO D 38  ? 0.7973 0.7801 0.6282 -0.0410 -0.1542 0.0973  744 PRO D CG  
3521 C CD  . PRO D 38  ? 0.7701 0.7664 0.6080 -0.0468 -0.1572 0.0899  744 PRO D CD  
3522 N N   . ILE D 39  ? 0.6368 0.6153 0.5040 -0.0409 -0.1210 0.0799  745 ILE D N   
3523 C CA  . ILE D 39  ? 0.6434 0.6161 0.5091 -0.0441 -0.1105 0.0742  745 ILE D CA  
3524 C C   . ILE D 39  ? 0.5871 0.5449 0.4332 -0.0468 -0.1046 0.0755  745 ILE D C   
3525 O O   . ILE D 39  ? 0.6335 0.5839 0.4707 -0.0446 -0.1062 0.0815  745 ILE D O   
3526 C CB  . ILE D 39  ? 0.7089 0.6841 0.5927 -0.0393 -0.1045 0.0726  745 ILE D CB  
3527 C CG1 . ILE D 39  ? 0.7473 0.7137 0.6304 -0.0344 -0.1017 0.0779  745 ILE D CG1 
3528 C CG2 . ILE D 39  ? 0.7137 0.7034 0.6170 -0.0365 -0.1096 0.0713  745 ILE D CG2 
3529 C CD1 . ILE D 39  ? 0.7490 0.7156 0.6463 -0.0312 -0.0945 0.0755  745 ILE D CD1 
3530 N N   . HIS D 40  ? 0.4896 0.4429 0.3293 -0.0514 -0.0973 0.0699  746 HIS D N   
3531 C CA  . HIS D 40  ? 0.4327 0.3731 0.2549 -0.0545 -0.0904 0.0697  746 HIS D CA  
3532 C C   . HIS D 40  ? 0.5040 0.4393 0.3333 -0.0513 -0.0811 0.0693  746 HIS D C   
3533 O O   . HIS D 40  ? 0.4911 0.4163 0.3093 -0.0523 -0.0753 0.0706  746 HIS D O   
3534 C CB  . HIS D 40  ? 0.5336 0.4720 0.3462 -0.0608 -0.0872 0.0633  746 HIS D CB  
3535 C CG  . HIS D 40  ? 0.6056 0.5470 0.4070 -0.0657 -0.0956 0.0630  746 HIS D CG  
3536 N ND1 . HIS D 40  ? 0.6648 0.6130 0.4677 -0.0637 -0.1062 0.0681  746 HIS D ND1 
3537 C CD2 . HIS D 40  ? 0.6542 0.5930 0.4429 -0.0724 -0.0951 0.0581  746 HIS D CD2 
3538 C CE1 . HIS D 40  ? 0.6820 0.6327 0.4736 -0.0693 -0.1124 0.0663  746 HIS D CE1 
3539 N NE2 . HIS D 40  ? 0.7086 0.6532 0.4911 -0.0750 -0.1056 0.0599  746 HIS D NE2 
3540 N N   . GLY D 41  ? 0.4468 0.3897 0.2945 -0.0479 -0.0796 0.0670  747 GLY D N   
3541 C CA  . GLY D 41  ? 0.3594 0.2995 0.2154 -0.0450 -0.0717 0.0662  747 GLY D CA  
3542 C C   . GLY D 41  ? 0.3977 0.3467 0.2712 -0.0427 -0.0701 0.0621  747 GLY D C   
3543 O O   . GLY D 41  ? 0.4676 0.4254 0.3491 -0.0426 -0.0754 0.0609  747 GLY D O   
3544 N N   . PHE D 42  ? 0.3872 0.3344 0.2667 -0.0411 -0.0628 0.0600  748 PHE D N   
3545 C CA  . PHE D 42  ? 0.4005 0.3549 0.2944 -0.0391 -0.0605 0.0561  748 PHE D CA  
3546 C C   . PHE D 42  ? 0.3621 0.3134 0.2525 -0.0408 -0.0532 0.0518  748 PHE D C   
3547 O O   . PHE D 42  ? 0.3716 0.3156 0.2525 -0.0422 -0.0485 0.0520  748 PHE D O   
3548 C CB  . PHE D 42  ? 0.3611 0.3175 0.2675 -0.0347 -0.0591 0.0576  748 PHE D CB  
3549 C CG  . PHE D 42  ? 0.3633 0.3216 0.2745 -0.0318 -0.0655 0.0621  748 PHE D CG  
3550 C CD1 . PHE D 42  ? 0.3937 0.3442 0.2973 -0.0311 -0.0663 0.0672  748 PHE D CD1 
3551 C CD2 . PHE D 42  ? 0.3901 0.3578 0.3137 -0.0296 -0.0702 0.0614  748 PHE D CD2 
3552 C CE1 . PHE D 42  ? 0.3896 0.3410 0.2976 -0.0276 -0.0722 0.0719  748 PHE D CE1 
3553 C CE2 . PHE D 42  ? 0.3848 0.3547 0.3141 -0.0260 -0.0761 0.0657  748 PHE D CE2 
3554 C CZ  . PHE D 42  ? 0.3843 0.3458 0.3056 -0.0247 -0.0773 0.0712  748 PHE D CZ  
3555 N N   . TYR D 43  ? 0.3268 0.2836 0.2252 -0.0406 -0.0521 0.0481  749 TYR D N   
3556 C CA  . TYR D 43  ? 0.3551 0.3094 0.2527 -0.0406 -0.0453 0.0446  749 TYR D CA  
3557 C C   . TYR D 43  ? 0.4032 0.3633 0.3146 -0.0367 -0.0433 0.0436  749 TYR D C   
3558 O O   . TYR D 43  ? 0.3425 0.3093 0.2637 -0.0354 -0.0466 0.0433  749 TYR D O   
3559 C CB  . TYR D 43  ? 0.3768 0.3311 0.2705 -0.0435 -0.0449 0.0411  749 TYR D CB  
3560 C CG  . TYR D 43  ? 0.4032 0.3512 0.2819 -0.0481 -0.0460 0.0407  749 TYR D CG  
3561 C CD1 . TYR D 43  ? 0.3914 0.3418 0.2677 -0.0519 -0.0504 0.0391  749 TYR D CD1 
3562 C CD2 . TYR D 43  ? 0.4028 0.3425 0.2696 -0.0493 -0.0422 0.0414  749 TYR D CD2 
3563 C CE1 . TYR D 43  ? 0.4562 0.4010 0.3182 -0.0568 -0.0516 0.0381  749 TYR D CE1 
3564 C CE2 . TYR D 43  ? 0.4723 0.4056 0.3240 -0.0540 -0.0429 0.0406  749 TYR D CE2 
3565 C CZ  . TYR D 43  ? 0.5339 0.4697 0.3830 -0.0578 -0.0478 0.0388  749 TYR D CZ  
3566 O OH  . TYR D 43  ? 0.5874 0.5170 0.4208 -0.0630 -0.0488 0.0374  749 TYR D OH  
3567 N N   . ILE D 44  ? 0.3620 0.3198 0.2742 -0.0352 -0.0378 0.0428  750 ILE D N   
3568 C CA  . ILE D 44  ? 0.2962 0.2594 0.2202 -0.0320 -0.0357 0.0413  750 ILE D CA  
3569 C C   . ILE D 44  ? 0.2999 0.2632 0.2233 -0.0313 -0.0312 0.0382  750 ILE D C   
3570 O O   . ILE D 44  ? 0.3362 0.2953 0.2538 -0.0316 -0.0269 0.0376  750 ILE D O   
3571 C CB  . ILE D 44  ? 0.3074 0.2697 0.2349 -0.0307 -0.0332 0.0427  750 ILE D CB  
3572 C CG1 . ILE D 44  ? 0.4454 0.4068 0.3748 -0.0304 -0.0375 0.0461  750 ILE D CG1 
3573 C CG2 . ILE D 44  ? 0.3117 0.2797 0.2498 -0.0281 -0.0307 0.0402  750 ILE D CG2 
3574 C CD1 . ILE D 44  ? 0.5454 0.4994 0.4629 -0.0326 -0.0384 0.0495  750 ILE D CD1 
3575 N N   . TYR D 45  ? 0.2861 0.2541 0.2156 -0.0303 -0.0322 0.0365  751 TYR D N   
3576 C CA  . TYR D 45  ? 0.2511 0.2186 0.1797 -0.0292 -0.0285 0.0342  751 TYR D CA  
3577 C C   . TYR D 45  ? 0.2951 0.2678 0.2323 -0.0258 -0.0266 0.0333  751 TYR D C   
3578 O O   . TYR D 45  ? 0.3211 0.2989 0.2665 -0.0248 -0.0288 0.0333  751 TYR D O   
3579 C CB  . TYR D 45  ? 0.2580 0.2266 0.1866 -0.0308 -0.0303 0.0330  751 TYR D CB  
3580 C CG  . TYR D 45  ? 0.3363 0.3008 0.2566 -0.0349 -0.0326 0.0332  751 TYR D CG  
3581 C CD1 . TYR D 45  ? 0.4224 0.3802 0.3334 -0.0370 -0.0297 0.0315  751 TYR D CD1 
3582 C CD2 . TYR D 45  ? 0.3831 0.3505 0.3048 -0.0366 -0.0379 0.0348  751 TYR D CD2 
3583 C CE1 . TYR D 45  ? 0.4567 0.4108 0.3595 -0.0416 -0.0319 0.0310  751 TYR D CE1 
3584 C CE2 . TYR D 45  ? 0.3627 0.3275 0.2765 -0.0408 -0.0408 0.0347  751 TYR D CE2 
3585 C CZ  . TYR D 45  ? 0.4346 0.3929 0.3388 -0.0436 -0.0377 0.0325  751 TYR D CZ  
3586 O OH  . TYR D 45  ? 0.4575 0.4131 0.3533 -0.0485 -0.0405 0.0317  751 TYR D OH  
3587 N N   . TYR D 46  ? 0.2482 0.2197 0.1837 -0.0238 -0.0227 0.0322  752 TYR D N   
3588 C CA  . TYR D 46  ? 0.2325 0.2100 0.1757 -0.0206 -0.0215 0.0311  752 TYR D CA  
3589 C C   . TYR D 46  ? 0.2969 0.2730 0.2373 -0.0180 -0.0184 0.0303  752 TYR D C   
3590 O O   . TYR D 46  ? 0.2966 0.2667 0.2300 -0.0180 -0.0155 0.0303  752 TYR D O   
3591 C CB  . TYR D 46  ? 0.2602 0.2400 0.2076 -0.0203 -0.0202 0.0313  752 TYR D CB  
3592 C CG  . TYR D 46  ? 0.3233 0.2985 0.2647 -0.0209 -0.0165 0.0317  752 TYR D CG  
3593 C CD1 . TYR D 46  ? 0.3824 0.3598 0.3257 -0.0182 -0.0127 0.0305  752 TYR D CD1 
3594 C CD2 . TYR D 46  ? 0.3878 0.3567 0.3215 -0.0239 -0.0167 0.0333  752 TYR D CD2 
3595 C CE1 . TYR D 46  ? 0.4456 0.4192 0.3842 -0.0186 -0.0085 0.0305  752 TYR D CE1 
3596 C CE2 . TYR D 46  ? 0.4187 0.3827 0.3458 -0.0248 -0.0126 0.0333  752 TYR D CE2 
3597 C CZ  . TYR D 46  ? 0.4719 0.4384 0.4020 -0.0221 -0.0081 0.0317  752 TYR D CZ  
3598 O OH  . TYR D 46  ? 0.6290 0.5912 0.5536 -0.0228 -0.0032 0.0314  752 TYR D OH  
3599 N N   . ARG D 47  ? 0.2322 0.2134 0.1776 -0.0156 -0.0190 0.0295  753 ARG D N   
3600 C CA  . ARG D 47  ? 0.2740 0.2535 0.2164 -0.0125 -0.0169 0.0294  753 ARG D CA  
3601 C C   . ARG D 47  ? 0.2641 0.2518 0.2136 -0.0094 -0.0178 0.0287  753 ARG D C   
3602 O O   . ARG D 47  ? 0.2345 0.2274 0.1896 -0.0105 -0.0202 0.0279  753 ARG D O   
3603 C CB  . ARG D 47  ? 0.3307 0.3056 0.2681 -0.0144 -0.0175 0.0296  753 ARG D CB  
3604 C CG  . ARG D 47  ? 0.3675 0.3412 0.3027 -0.0115 -0.0161 0.0299  753 ARG D CG  
3605 C CD  . ARG D 47  ? 0.3349 0.3038 0.2655 -0.0145 -0.0161 0.0298  753 ARG D CD  
3606 N NE  . ARG D 47  ? 0.3236 0.2990 0.2601 -0.0159 -0.0185 0.0290  753 ARG D NE  
3607 C CZ  . ARG D 47  ? 0.2672 0.2408 0.2019 -0.0186 -0.0183 0.0286  753 ARG D CZ  
3608 N NH1 . ARG D 47  ? 0.2880 0.2533 0.2150 -0.0206 -0.0160 0.0289  753 ARG D NH1 
3609 N NH2 . ARG D 47  ? 0.2504 0.2304 0.1912 -0.0196 -0.0199 0.0276  753 ARG D NH2 
3610 N N   . PRO D 48  ? 0.2641 0.2531 0.2135 -0.0053 -0.0160 0.0289  754 PRO D N   
3611 C CA  . PRO D 48  ? 0.2221 0.2195 0.1771 -0.0025 -0.0177 0.0283  754 PRO D CA  
3612 C C   . PRO D 48  ? 0.1866 0.1836 0.1395 -0.0031 -0.0195 0.0283  754 PRO D C   
3613 O O   . PRO D 48  ? 0.2241 0.2141 0.1702 -0.0034 -0.0183 0.0294  754 PRO D O   
3614 C CB  . PRO D 48  ? 0.3112 0.3085 0.2647 0.0026  -0.0157 0.0293  754 PRO D CB  
3615 C CG  . PRO D 48  ? 0.3159 0.3073 0.2665 0.0021  -0.0123 0.0295  754 PRO D CG  
3616 C CD  . PRO D 48  ? 0.2787 0.2626 0.2236 -0.0030 -0.0124 0.0296  754 PRO D CD  
3617 N N   . THR D 49  ? 0.2363 0.2405 0.1950 -0.0039 -0.0217 0.0267  755 THR D N   
3618 C CA  . THR D 49  ? 0.2240 0.2287 0.1812 -0.0046 -0.0228 0.0261  755 THR D CA  
3619 C C   . THR D 49  ? 0.2653 0.2672 0.2157 -0.0014 -0.0220 0.0278  755 THR D C   
3620 O O   . THR D 49  ? 0.2209 0.2189 0.1666 -0.0027 -0.0214 0.0283  755 THR D O   
3621 C CB  . THR D 49  ? 0.1903 0.2033 0.1546 -0.0055 -0.0249 0.0235  755 THR D CB  
3622 O OG1 . THR D 49  ? 0.2169 0.2303 0.1867 -0.0085 -0.0252 0.0225  755 THR D OG1 
3623 C CG2 . THR D 49  ? 0.2084 0.2219 0.1706 -0.0063 -0.0253 0.0226  755 THR D CG2 
3624 N N   . ASP D 50  ? 0.1999 0.2035 0.1497 0.0029  -0.0218 0.0290  756 ASP D N   
3625 C CA  . ASP D 50  ? 0.2532 0.2527 0.1957 0.0069  -0.0211 0.0314  756 ASP D CA  
3626 C C   . ASP D 50  ? 0.2445 0.2316 0.1783 0.0059  -0.0179 0.0333  756 ASP D C   
3627 O O   . ASP D 50  ? 0.2703 0.2515 0.1966 0.0083  -0.0167 0.0355  756 ASP D O   
3628 C CB  . ASP D 50  ? 0.2623 0.2666 0.2072 0.0125  -0.0217 0.0325  756 ASP D CB  
3629 C CG  . ASP D 50  ? 0.3219 0.3385 0.2727 0.0140  -0.0255 0.0309  756 ASP D CG  
3630 O OD1 . ASP D 50  ? 0.2400 0.2594 0.1905 0.0113  -0.0271 0.0293  756 ASP D OD1 
3631 O OD2 . ASP D 50  ? 0.2962 0.3199 0.2520 0.0179  -0.0266 0.0310  756 ASP D OD2 
3632 N N   . SER D 51  ? 0.2857 0.2683 0.2198 0.0024  -0.0165 0.0326  757 SER D N   
3633 C CA  . SER D 51  ? 0.2628 0.2340 0.1887 0.0003  -0.0136 0.0336  757 SER D CA  
3634 C C   . SER D 51  ? 0.2725 0.2429 0.1983 -0.0052 -0.0142 0.0323  757 SER D C   
3635 O O   . SER D 51  ? 0.2633 0.2399 0.1957 -0.0080 -0.0163 0.0306  757 SER D O   
3636 C CB  . SER D 51  ? 0.3136 0.2798 0.2383 -0.0006 -0.0116 0.0333  757 SER D CB  
3637 O OG  . SER D 51  ? 0.3274 0.2834 0.2446 -0.0043 -0.0094 0.0332  757 SER D OG  
3638 N N   . ASP D 52  ? 0.2519 0.2148 0.1705 -0.0065 -0.0120 0.0333  758 ASP D N   
3639 C CA  . ASP D 52  ? 0.2913 0.2536 0.2105 -0.0122 -0.0119 0.0318  758 ASP D CA  
3640 C C   . ASP D 52  ? 0.3673 0.3203 0.2808 -0.0160 -0.0096 0.0316  758 ASP D C   
3641 O O   . ASP D 52  ? 0.3177 0.2692 0.2305 -0.0210 -0.0090 0.0304  758 ASP D O   
3642 C CB  . ASP D 52  ? 0.2779 0.2395 0.1938 -0.0126 -0.0106 0.0323  758 ASP D CB  
3643 C CG  . ASP D 52  ? 0.2948 0.2655 0.2152 -0.0098 -0.0129 0.0319  758 ASP D CG  
3644 O OD1 . ASP D 52  ? 0.2396 0.2094 0.1554 -0.0091 -0.0118 0.0326  758 ASP D OD1 
3645 O OD2 . ASP D 52  ? 0.2447 0.2229 0.1724 -0.0086 -0.0155 0.0306  758 ASP D OD2 
3646 N N   . ASN D 53  ? 0.3817 0.3290 0.2914 -0.0139 -0.0082 0.0323  759 ASN D N   
3647 C CA  A ASN D 53  ? 0.3929 0.3306 0.2959 -0.0176 -0.0058 0.0315  759 ASN D CA  
3648 C CA  B ASN D 53  ? 0.3992 0.3369 0.3023 -0.0177 -0.0058 0.0315  759 ASN D CA  
3649 C C   . ASN D 53  ? 0.3271 0.2688 0.2339 -0.0211 -0.0084 0.0298  759 ASN D C   
3650 O O   . ASN D 53  ? 0.3234 0.2684 0.2330 -0.0185 -0.0092 0.0301  759 ASN D O   
3651 C CB  A ASN D 53  ? 0.4428 0.3710 0.3388 -0.0131 -0.0022 0.0330  759 ASN D CB  
3652 C CB  B ASN D 53  ? 0.4204 0.3483 0.3163 -0.0134 -0.0021 0.0329  759 ASN D CB  
3653 C CG  A ASN D 53  ? 0.4357 0.3517 0.3232 -0.0169 0.0013  0.0317  759 ASN D CG  
3654 C CG  B ASN D 53  ? 0.5731 0.4936 0.4626 -0.0102 0.0008  0.0352  759 ASN D CG  
3655 O OD1 A ASN D 53  ? 0.4307 0.3467 0.3178 -0.0233 0.0001  0.0297  759 ASN D OD1 
3656 O OD1 B ASN D 53  ? 0.6022 0.5206 0.4900 -0.0037 0.0019  0.0373  759 ASN D OD1 
3657 N ND2 A ASN D 53  ? 0.4414 0.3471 0.3221 -0.0130 0.0054  0.0329  759 ASN D ND2 
3658 N ND2 B ASN D 53  ? 0.6833 0.5999 0.5693 -0.0148 0.0020  0.0348  759 ASN D ND2 
3659 N N   . ASP D 54  ? 0.3364 0.2779 0.2429 -0.0270 -0.0096 0.0283  760 ASP D N   
3660 C CA  . ASP D 54  ? 0.4016 0.3472 0.3110 -0.0301 -0.0128 0.0273  760 ASP D CA  
3661 C C   . ASP D 54  ? 0.3582 0.2963 0.2603 -0.0302 -0.0109 0.0270  760 ASP D C   
3662 O O   . ASP D 54  ? 0.3470 0.2878 0.2500 -0.0314 -0.0132 0.0269  760 ASP D O   
3663 C CB  . ASP D 54  ? 0.5023 0.4508 0.4138 -0.0362 -0.0152 0.0257  760 ASP D CB  
3664 C CG  . ASP D 54  ? 0.5306 0.4891 0.4520 -0.0359 -0.0174 0.0256  760 ASP D CG  
3665 O OD1 . ASP D 54  ? 0.4908 0.4539 0.4167 -0.0314 -0.0175 0.0266  760 ASP D OD1 
3666 O OD2 . ASP D 54  ? 0.5406 0.5030 0.4657 -0.0403 -0.0189 0.0243  760 ASP D OD2 
3667 N N   . SER D 55  ? 0.3421 0.2700 0.2363 -0.0285 -0.0064 0.0271  761 SER D N   
3668 C CA  . SER D 55  ? 0.4831 0.4029 0.3701 -0.0281 -0.0034 0.0265  761 SER D CA  
3669 C C   . SER D 55  ? 0.4834 0.4079 0.3748 -0.0226 -0.0030 0.0276  761 SER D C   
3670 O O   . SER D 55  ? 0.4873 0.4071 0.3742 -0.0222 -0.0005 0.0269  761 SER D O   
3671 C CB  . SER D 55  ? 0.6052 0.5119 0.4831 -0.0273 0.0020  0.0262  761 SER D CB  
3672 O OG  . SER D 55  ? 0.7323 0.6346 0.6064 -0.0333 0.0022  0.0248  761 SER D OG  
3673 N N   . ASP D 56  ? 0.3561 0.2900 0.2562 -0.0187 -0.0052 0.0290  762 ASP D N   
3674 C CA  . ASP D 56  ? 0.3699 0.3098 0.2757 -0.0140 -0.0049 0.0297  762 ASP D CA  
3675 C C   . ASP D 56  ? 0.3509 0.2986 0.2625 -0.0161 -0.0082 0.0295  762 ASP D C   
3676 O O   . ASP D 56  ? 0.3935 0.3467 0.3105 -0.0132 -0.0079 0.0297  762 ASP D O   
3677 C CB  . ASP D 56  ? 0.3542 0.3002 0.2658 -0.0088 -0.0057 0.0311  762 ASP D CB  
3678 C CG  . ASP D 56  ? 0.4503 0.3887 0.3564 -0.0042 -0.0020 0.0323  762 ASP D CG  
3679 O OD1 . ASP D 56  ? 0.4846 0.4150 0.3854 -0.0030 0.0019  0.0320  762 ASP D OD1 
3680 O OD2 . ASP D 56  ? 0.3159 0.2558 0.2227 -0.0014 -0.0027 0.0338  762 ASP D OD2 
3681 N N   . TYR D 57  ? 0.3245 0.2731 0.2358 -0.0210 -0.0114 0.0290  763 TYR D N   
3682 C CA  . TYR D 57  ? 0.2938 0.2478 0.2093 -0.0227 -0.0143 0.0294  763 TYR D CA  
3683 C C   . TYR D 57  ? 0.4016 0.3501 0.3104 -0.0239 -0.0119 0.0292  763 TYR D C   
3684 O O   . TYR D 57  ? 0.3858 0.3261 0.2854 -0.0266 -0.0102 0.0283  763 TYR D O   
3685 C CB  . TYR D 57  ? 0.2951 0.2517 0.2120 -0.0270 -0.0187 0.0294  763 TYR D CB  
3686 C CG  . TYR D 57  ? 0.2821 0.2465 0.2080 -0.0260 -0.0213 0.0294  763 TYR D CG  
3687 C CD1 . TYR D 57  ? 0.3273 0.2913 0.2531 -0.0272 -0.0211 0.0287  763 TYR D CD1 
3688 C CD2 . TYR D 57  ? 0.3083 0.2798 0.2425 -0.0244 -0.0235 0.0300  763 TYR D CD2 
3689 C CE1 . TYR D 57  ? 0.2962 0.2672 0.2298 -0.0265 -0.0228 0.0284  763 TYR D CE1 
3690 C CE2 . TYR D 57  ? 0.2937 0.2716 0.2357 -0.0237 -0.0254 0.0295  763 TYR D CE2 
3691 C CZ  . TYR D 57  ? 0.2586 0.2366 0.2002 -0.0247 -0.0250 0.0286  763 TYR D CZ  
3692 O OH  . TYR D 57  ? 0.2381 0.2224 0.1870 -0.0241 -0.0261 0.0278  763 TYR D OH  
3693 N N   . LYS D 58  ? 0.3350 0.2877 0.2481 -0.0224 -0.0115 0.0298  764 LYS D N   
3694 C CA  . LYS D 58  ? 0.3319 0.2800 0.2388 -0.0244 -0.0095 0.0299  764 LYS D CA  
3695 C C   . LYS D 58  ? 0.3847 0.3346 0.2915 -0.0280 -0.0141 0.0313  764 LYS D C   
3696 O O   . LYS D 58  ? 0.3307 0.2864 0.2445 -0.0280 -0.0182 0.0319  764 LYS D O   
3697 C CB  . LYS D 58  ? 0.3298 0.2816 0.2418 -0.0212 -0.0059 0.0298  764 LYS D CB  
3698 C CG  . LYS D 58  ? 0.3176 0.2677 0.2297 -0.0168 -0.0014 0.0288  764 LYS D CG  
3699 C CD  . LYS D 58  ? 0.4269 0.3837 0.3470 -0.0135 0.0014  0.0285  764 LYS D CD  
3700 C CE  . LYS D 58  ? 0.4504 0.4060 0.3711 -0.0084 0.0058  0.0277  764 LYS D CE  
3701 N NZ  . LYS D 58  ? 0.5697 0.5334 0.4993 -0.0055 0.0086  0.0271  764 LYS D NZ  
3702 N N   . LYS D 59  ? 0.3388 0.2835 0.2373 -0.0310 -0.0135 0.0318  765 LYS D N   
3703 C CA  . LYS D 59  ? 0.3635 0.3088 0.2602 -0.0341 -0.0184 0.0337  765 LYS D CA  
3704 C C   . LYS D 59  ? 0.4421 0.3841 0.3336 -0.0353 -0.0166 0.0353  765 LYS D C   
3705 O O   . LYS D 59  ? 0.5257 0.4616 0.4089 -0.0362 -0.0118 0.0342  765 LYS D O   
3706 C CB  . LYS D 59  ? 0.4491 0.3900 0.3371 -0.0381 -0.0212 0.0330  765 LYS D CB  
3707 C CG  . LYS D 59  ? 0.5388 0.4805 0.4235 -0.0412 -0.0269 0.0351  765 LYS D CG  
3708 C CD  . LYS D 59  ? 0.5695 0.5080 0.4457 -0.0457 -0.0296 0.0337  765 LYS D CD  
3709 C CE  . LYS D 59  ? 0.5685 0.4974 0.4322 -0.0478 -0.0241 0.0312  765 LYS D CE  
3710 N NZ  . LYS D 59  ? 0.5871 0.5123 0.4415 -0.0532 -0.0269 0.0293  765 LYS D NZ  
3711 N N   . ASP D 60  ? 0.3990 0.3442 0.2952 -0.0354 -0.0198 0.0377  766 ASP D N   
3712 C CA  . ASP D 60  ? 0.3879 0.3286 0.2776 -0.0372 -0.0186 0.0400  766 ASP D CA  
3713 C C   . ASP D 60  ? 0.4174 0.3556 0.3003 -0.0399 -0.0247 0.0428  766 ASP D C   
3714 O O   . ASP D 60  ? 0.4178 0.3611 0.3074 -0.0391 -0.0302 0.0436  766 ASP D O   
3715 C CB  . ASP D 60  ? 0.4079 0.3527 0.3074 -0.0354 -0.0174 0.0412  766 ASP D CB  
3716 C CG  . ASP D 60  ? 0.4081 0.3566 0.3145 -0.0331 -0.0116 0.0386  766 ASP D CG  
3717 O OD1 . ASP D 60  ? 0.4579 0.4052 0.3614 -0.0322 -0.0082 0.0363  766 ASP D OD1 
3718 O OD2 . ASP D 60  ? 0.3994 0.3521 0.3144 -0.0321 -0.0105 0.0388  766 ASP D OD2 
3719 N N   . MET D 61  ? 0.4341 0.3650 0.3039 -0.0430 -0.0239 0.0443  767 MET D N   
3720 C CA  . MET D 61  ? 0.4240 0.3527 0.2864 -0.0452 -0.0304 0.0477  767 MET D CA  
3721 C C   . MET D 61  ? 0.4673 0.3934 0.3291 -0.0447 -0.0309 0.0520  767 MET D C   
3722 O O   . MET D 61  ? 0.4855 0.4064 0.3420 -0.0457 -0.0250 0.0523  767 MET D O   
3723 C CB  . MET D 61  ? 0.4728 0.3945 0.3185 -0.0495 -0.0302 0.0467  767 MET D CB  
3724 C CG  . MET D 61  ? 0.4985 0.4193 0.3360 -0.0520 -0.0382 0.0500  767 MET D CG  
3725 S SD  . MET D 61  ? 0.6988 0.6119 0.5241 -0.0531 -0.0387 0.0556  767 MET D SD  
3726 C CE  . MET D 61  ? 0.6166 0.5193 0.4227 -0.0579 -0.0315 0.0526  767 MET D CE  
3727 N N   . VAL D 62  ? 0.4011 0.3303 0.2682 -0.0431 -0.0374 0.0554  768 VAL D N   
3728 C CA  . VAL D 62  ? 0.4602 0.3846 0.3245 -0.0427 -0.0384 0.0603  768 VAL D CA  
3729 C C   . VAL D 62  ? 0.4997 0.4224 0.3559 -0.0433 -0.0465 0.0646  768 VAL D C   
3730 O O   . VAL D 62  ? 0.4537 0.3824 0.3131 -0.0432 -0.0525 0.0637  768 VAL D O   
3731 C CB  . VAL D 62  ? 0.4677 0.3961 0.3472 -0.0392 -0.0377 0.0609  768 VAL D CB  
3732 C CG1 . VAL D 62  ? 0.4897 0.4221 0.3781 -0.0384 -0.0310 0.0563  768 VAL D CG1 
3733 C CG2 . VAL D 62  ? 0.5034 0.4391 0.3936 -0.0363 -0.0446 0.0614  768 VAL D CG2 
3734 N N   . GLU D 63  ? 0.5098 0.4244 0.3555 -0.0442 -0.0468 0.0695  769 GLU D N   
3735 C CA  . GLU D 63  ? 0.5425 0.4550 0.3791 -0.0444 -0.0550 0.0744  769 GLU D CA  
3736 C C   . GLU D 63  ? 0.5451 0.4650 0.3958 -0.0399 -0.0623 0.0768  769 GLU D C   
3737 O O   . GLU D 63  ? 0.5228 0.4466 0.3884 -0.0367 -0.0600 0.0756  769 GLU D O   
3738 C CB  . GLU D 63  ? 0.6614 0.5624 0.4832 -0.0459 -0.0531 0.0798  769 GLU D CB  
3739 C CG  . GLU D 63  ? 0.7419 0.6350 0.5464 -0.0509 -0.0470 0.0779  769 GLU D CG  
3740 C CD  . GLU D 63  ? 0.8122 0.7067 0.6054 -0.0543 -0.0515 0.0757  769 GLU D CD  
3741 O OE1 . GLU D 63  ? 0.8386 0.7361 0.6292 -0.0537 -0.0608 0.0788  769 GLU D OE1 
3742 O OE2 . GLU D 63  ? 0.8199 0.7123 0.6069 -0.0575 -0.0456 0.0707  769 GLU D OE2 
3743 N N   . GLY D 64  ? 0.5811 0.5033 0.4270 -0.0396 -0.0710 0.0801  770 GLY D N   
3744 C CA  . GLY D 64  ? 0.5565 0.4875 0.4164 -0.0351 -0.0784 0.0820  770 GLY D CA  
3745 C C   . GLY D 64  ? 0.6689 0.5959 0.5351 -0.0302 -0.0793 0.0874  770 GLY D C   
3746 O O   . GLY D 64  ? 0.6957 0.6297 0.5751 -0.0257 -0.0845 0.0888  770 GLY D O   
3747 N N   . ASP D 65  ? 0.6903 0.6058 0.5474 -0.0311 -0.0738 0.0903  771 ASP D N   
3748 C CA  . ASP D 65  ? 0.7160 0.6249 0.5769 -0.0270 -0.0738 0.0957  771 ASP D CA  
3749 C C   . ASP D 65  ? 0.6544 0.5633 0.5290 -0.0258 -0.0661 0.0921  771 ASP D C   
3750 O O   . ASP D 65  ? 0.7305 0.6341 0.6107 -0.0226 -0.0652 0.0954  771 ASP D O   
3751 C CB  . ASP D 65  ? 0.8201 0.7152 0.6617 -0.0291 -0.0725 0.1019  771 ASP D CB  
3752 C CG  . ASP D 65  ? 0.9317 0.8197 0.7638 -0.0344 -0.0626 0.0987  771 ASP D CG  
3753 O OD1 . ASP D 65  ? 0.9686 0.8619 0.7997 -0.0377 -0.0599 0.0929  771 ASP D OD1 
3754 O OD2 . ASP D 65  ? 0.9761 0.8532 0.8020 -0.0352 -0.0572 0.1021  771 ASP D OD2 
3755 N N   . LYS D 66  ? 0.5440 0.4585 0.4237 -0.0284 -0.0608 0.0855  772 LYS D N   
3756 C CA  . LYS D 66  ? 0.4854 0.4009 0.3770 -0.0279 -0.0537 0.0815  772 LYS D CA  
3757 C C   . LYS D 66  ? 0.5114 0.4363 0.4209 -0.0238 -0.0564 0.0789  772 LYS D C   
3758 O O   . LYS D 66  ? 0.5464 0.4793 0.4603 -0.0223 -0.0623 0.0782  772 LYS D O   
3759 C CB  . LYS D 66  ? 0.5799 0.4978 0.4690 -0.0317 -0.0473 0.0759  772 LYS D CB  
3760 C CG  . LYS D 66  ? 0.6421 0.5515 0.5135 -0.0360 -0.0440 0.0775  772 LYS D CG  
3761 C CD  . LYS D 66  ? 0.7115 0.6101 0.5770 -0.0371 -0.0393 0.0816  772 LYS D CD  
3762 C CE  . LYS D 66  ? 0.8072 0.6978 0.6555 -0.0418 -0.0343 0.0823  772 LYS D CE  
3763 N NZ  . LYS D 66  ? 0.8652 0.7442 0.7060 -0.0434 -0.0297 0.0868  772 LYS D NZ  
3764 N N   . TYR D 67  ? 0.4430 0.3669 0.3628 -0.0225 -0.0518 0.0771  773 TYR D N   
3765 C CA  . TYR D 67  ? 0.3580 0.2903 0.2940 -0.0190 -0.0530 0.0737  773 TYR D CA  
3766 C C   . TYR D 67  ? 0.3886 0.3241 0.3328 -0.0205 -0.0463 0.0678  773 TYR D C   
3767 O O   . TYR D 67  ? 0.3907 0.3317 0.3473 -0.0182 -0.0460 0.0646  773 TYR D O   
3768 C CB  . TYR D 67  ? 0.4361 0.3645 0.3783 -0.0144 -0.0563 0.0780  773 TYR D CB  
3769 C CG  . TYR D 67  ? 0.5626 0.4798 0.5037 -0.0147 -0.0510 0.0800  773 TYR D CG  
3770 C CD1 . TYR D 67  ? 0.6831 0.6012 0.6355 -0.0145 -0.0460 0.0755  773 TYR D CD1 
3771 C CD2 . TYR D 67  ? 0.6146 0.5198 0.5425 -0.0157 -0.0509 0.0862  773 TYR D CD2 
3772 C CE1 . TYR D 67  ? 0.7208 0.6284 0.6723 -0.0156 -0.0408 0.0767  773 TYR D CE1 
3773 C CE2 . TYR D 67  ? 0.7053 0.5993 0.6319 -0.0166 -0.0453 0.0879  773 TYR D CE2 
3774 C CZ  . TYR D 67  ? 0.7400 0.6354 0.6790 -0.0167 -0.0402 0.0830  773 TYR D CZ  
3775 O OH  . TYR D 67  ? 0.8118 0.6960 0.7499 -0.0185 -0.0344 0.0841  773 TYR D OH  
3776 N N   . TRP D 68  ? 0.3501 0.2824 0.2872 -0.0243 -0.0409 0.0663  774 TRP D N   
3777 C CA  . TRP D 68  ? 0.3727 0.3094 0.3165 -0.0259 -0.0352 0.0608  774 TRP D CA  
3778 C C   . TRP D 68  ? 0.3926 0.3288 0.3274 -0.0294 -0.0312 0.0594  774 TRP D C   
3779 O O   . TRP D 68  ? 0.3845 0.3143 0.3069 -0.0313 -0.0314 0.0628  774 TRP D O   
3780 C CB  . TRP D 68  ? 0.3875 0.3192 0.3371 -0.0263 -0.0309 0.0605  774 TRP D CB  
3781 C CG  . TRP D 68  ? 0.4444 0.3651 0.3839 -0.0292 -0.0272 0.0644  774 TRP D CG  
3782 C CD1 . TRP D 68  ? 0.5118 0.4222 0.4432 -0.0283 -0.0296 0.0708  774 TRP D CD1 
3783 C CD2 . TRP D 68  ? 0.5315 0.4504 0.4679 -0.0334 -0.0204 0.0624  774 TRP D CD2 
3784 N NE1 . TRP D 68  ? 0.4840 0.3853 0.4062 -0.0321 -0.0242 0.0729  774 TRP D NE1 
3785 C CE2 . TRP D 68  ? 0.5301 0.4369 0.4559 -0.0355 -0.0183 0.0676  774 TRP D CE2 
3786 C CE3 . TRP D 68  ? 0.6076 0.5344 0.5494 -0.0355 -0.0159 0.0568  774 TRP D CE3 
3787 C CZ2 . TRP D 68  ? 0.6311 0.5336 0.5520 -0.0400 -0.0111 0.0669  774 TRP D CZ2 
3788 C CZ3 . TRP D 68  ? 0.6588 0.5825 0.5970 -0.0395 -0.0094 0.0561  774 TRP D CZ3 
3789 C CH2 . TRP D 68  ? 0.6135 0.5253 0.5416 -0.0420 -0.0067 0.0609  774 TRP D CH2 
3790 N N   . HIS D 69  ? 0.2711 0.2141 0.2120 -0.0301 -0.0275 0.0543  775 HIS D N   
3791 C CA  . HIS D 69  ? 0.3959 0.3398 0.3305 -0.0323 -0.0237 0.0524  775 HIS D CA  
3792 C C   . HIS D 69  ? 0.4039 0.3554 0.3485 -0.0321 -0.0197 0.0473  775 HIS D C   
3793 O O   . HIS D 69  ? 0.4147 0.3715 0.3694 -0.0303 -0.0212 0.0451  775 HIS D O   
3794 C CB  . HIS D 69  ? 0.3652 0.3113 0.2937 -0.0319 -0.0272 0.0521  775 HIS D CB  
3795 C CG  . HIS D 69  ? 0.4176 0.3641 0.3402 -0.0336 -0.0229 0.0497  775 HIS D CG  
3796 N ND1 . HIS D 69  ? 0.4269 0.3670 0.3398 -0.0362 -0.0185 0.0508  775 HIS D ND1 
3797 C CD2 . HIS D 69  ? 0.4241 0.3758 0.3487 -0.0327 -0.0221 0.0462  775 HIS D CD2 
3798 C CE1 . HIS D 69  ? 0.4034 0.3453 0.3136 -0.0366 -0.0149 0.0479  775 HIS D CE1 
3799 N NE2 . HIS D 69  ? 0.4249 0.3735 0.3419 -0.0343 -0.0172 0.0452  775 HIS D NE2 
3800 N N   . SER D 70  ? 0.3663 0.3187 0.3082 -0.0339 -0.0148 0.0455  776 SER D N   
3801 C CA  . SER D 70  ? 0.3373 0.2982 0.2883 -0.0333 -0.0117 0.0409  776 SER D CA  
3802 C C   . SER D 70  ? 0.3651 0.3289 0.3119 -0.0323 -0.0104 0.0393  776 SER D C   
3803 O O   . SER D 70  ? 0.4106 0.3690 0.3478 -0.0339 -0.0079 0.0406  776 SER D O   
3804 C CB  . SER D 70  ? 0.3936 0.3544 0.3483 -0.0360 -0.0061 0.0398  776 SER D CB  
3805 O OG  . SER D 70  ? 0.4294 0.3857 0.3874 -0.0372 -0.0066 0.0412  776 SER D OG  
3806 N N   . ILE D 71  ? 0.2928 0.2640 0.2459 -0.0297 -0.0118 0.0365  777 ILE D N   
3807 C CA  . ILE D 71  ? 0.3490 0.3224 0.2992 -0.0282 -0.0100 0.0348  777 ILE D CA  
3808 C C   . ILE D 71  ? 0.3249 0.3043 0.2817 -0.0278 -0.0052 0.0322  777 ILE D C   
3809 O O   . ILE D 71  ? 0.4120 0.3984 0.3787 -0.0274 -0.0055 0.0302  777 ILE D O   
3810 C CB  . ILE D 71  ? 0.3930 0.3707 0.3462 -0.0254 -0.0136 0.0335  777 ILE D CB  
3811 C CG1 . ILE D 71  ? 0.4613 0.4355 0.4112 -0.0260 -0.0184 0.0356  777 ILE D CG1 
3812 C CG2 . ILE D 71  ? 0.4932 0.4706 0.4418 -0.0237 -0.0115 0.0325  777 ILE D CG2 
3813 C CD1 . ILE D 71  ? 0.4070 0.3860 0.3616 -0.0240 -0.0215 0.0342  777 ILE D CD1 
3814 N N   . SER D 72  ? 0.3337 0.3112 0.2856 -0.0280 -0.0008 0.0319  778 SER D N   
3815 C CA  . SER D 72  ? 0.3127 0.2967 0.2718 -0.0278 0.0042  0.0295  778 SER D CA  
3816 C C   . SER D 72  ? 0.3103 0.2995 0.2717 -0.0238 0.0062  0.0275  778 SER D C   
3817 O O   . SER D 72  ? 0.3524 0.3381 0.3080 -0.0215 0.0043  0.0281  778 SER D O   
3818 C CB  . SER D 72  ? 0.3704 0.3483 0.3238 -0.0316 0.0095  0.0306  778 SER D CB  
3819 O OG  . SER D 72  ? 0.3629 0.3362 0.3154 -0.0349 0.0082  0.0327  778 SER D OG  
3820 N N   . HIS D 73  ? 0.3091 0.3065 0.2793 -0.0229 0.0100  0.0252  779 HIS D N   
3821 C CA  . HIS D 73  ? 0.3522 0.3554 0.3262 -0.0183 0.0121  0.0235  779 HIS D CA  
3822 C C   . HIS D 73  ? 0.3879 0.3950 0.3643 -0.0139 0.0071  0.0234  779 HIS D C   
3823 O O   . HIS D 73  ? 0.3427 0.3472 0.3150 -0.0101 0.0077  0.0238  779 HIS D O   
3824 C CB  . HIS D 73  ? 0.3728 0.3673 0.3366 -0.0179 0.0170  0.0241  779 HIS D CB  
3825 C CG  . HIS D 73  ? 0.4841 0.4738 0.4436 -0.0226 0.0223  0.0244  779 HIS D CG  
3826 N ND1 . HIS D 73  ? 0.5552 0.5326 0.5006 -0.0260 0.0230  0.0265  779 HIS D ND1 
3827 C CD2 . HIS D 73  ? 0.5063 0.5019 0.4734 -0.0249 0.0270  0.0229  779 HIS D CD2 
3828 C CE1 . HIS D 73  ? 0.5508 0.5257 0.4941 -0.0299 0.0281  0.0267  779 HIS D CE1 
3829 N NE2 . HIS D 73  ? 0.4776 0.4633 0.4343 -0.0295 0.0310  0.0244  779 HIS D NE2 
3830 N N   . LEU D 74  ? 0.3367 0.3491 0.3190 -0.0147 0.0026  0.0229  780 LEU D N   
3831 C CA  . LEU D 74  ? 0.3098 0.3263 0.2942 -0.0112 -0.0019 0.0227  780 LEU D CA  
3832 C C   . LEU D 74  ? 0.3602 0.3897 0.3556 -0.0081 -0.0021 0.0204  780 LEU D C   
3833 O O   . LEU D 74  ? 0.2915 0.3273 0.2940 -0.0091 0.0012  0.0188  780 LEU D O   
3834 C CB  . LEU D 74  ? 0.2674 0.2824 0.2517 -0.0137 -0.0063 0.0230  780 LEU D CB  
3835 C CG  . LEU D 74  ? 0.2784 0.2824 0.2537 -0.0169 -0.0069 0.0253  780 LEU D CG  
3836 C CD1 . LEU D 74  ? 0.3163 0.3203 0.2944 -0.0191 -0.0104 0.0254  780 LEU D CD1 
3837 C CD2 . LEU D 74  ? 0.2675 0.2644 0.2334 -0.0152 -0.0076 0.0269  780 LEU D CD2 
3838 N N   . GLN D 75  ? 0.3245 0.3584 0.3212 -0.0043 -0.0060 0.0204  781 GLN D N   
3839 C CA  . GLN D 75  ? 0.3164 0.3633 0.3227 -0.0009 -0.0074 0.0186  781 GLN D CA  
3840 C C   . GLN D 75  ? 0.3094 0.3639 0.3221 -0.0040 -0.0111 0.0162  781 GLN D C   
3841 O O   . GLN D 75  ? 0.2850 0.3342 0.2932 -0.0061 -0.0137 0.0166  781 GLN D O   
3842 C CB  . GLN D 75  ? 0.3514 0.3981 0.3540 0.0053  -0.0095 0.0203  781 GLN D CB  
3843 C CG  . GLN D 75  ? 0.4352 0.4736 0.4315 0.0086  -0.0053 0.0222  781 GLN D CG  
3844 C CD  . GLN D 75  ? 0.4804 0.5249 0.4841 0.0099  -0.0007 0.0208  781 GLN D CD  
3845 O OE1 . GLN D 75  ? 0.4980 0.5558 0.5126 0.0124  -0.0017 0.0193  781 GLN D OE1 
3846 N NE2 . GLN D 75  ? 0.4532 0.4887 0.4512 0.0080  0.0046  0.0212  781 GLN D NE2 
3847 N N   . PRO D 76  ? 0.3194 0.3867 0.3430 -0.0043 -0.0113 0.0134  782 PRO D N   
3848 C CA  . PRO D 76  ? 0.2465 0.3214 0.2764 -0.0078 -0.0145 0.0102  782 PRO D CA  
3849 C C   . PRO D 76  ? 0.2647 0.3409 0.2909 -0.0054 -0.0197 0.0103  782 PRO D C   
3850 O O   . PRO D 76  ? 0.2835 0.3602 0.3059 0.0000  -0.0214 0.0124  782 PRO D O   
3851 C CB  . PRO D 76  ? 0.2867 0.3767 0.3290 -0.0075 -0.0139 0.0072  782 PRO D CB  
3852 C CG  . PRO D 76  ? 0.3181 0.4061 0.3610 -0.0056 -0.0086 0.0087  782 PRO D CG  
3853 C CD  . PRO D 76  ? 0.3041 0.3802 0.3354 -0.0013 -0.0084 0.0126  782 PRO D CD  
3854 N N   . GLU D 77  ? 0.2299 0.3058 0.2567 -0.0095 -0.0217 0.0081  783 GLU D N   
3855 C CA  . GLU D 77  ? 0.3245 0.4027 0.3481 -0.0081 -0.0261 0.0073  783 GLU D CA  
3856 C C   . GLU D 77  ? 0.3229 0.3922 0.3362 -0.0040 -0.0267 0.0111  783 GLU D C   
3857 O O   . GLU D 77  ? 0.2774 0.3497 0.2873 -0.0005 -0.0297 0.0118  783 GLU D O   
3858 C CB  . GLU D 77  ? 0.2828 0.3758 0.3130 -0.0059 -0.0295 0.0049  783 GLU D CB  
3859 C CG  . GLU D 77  ? 0.3998 0.4972 0.4283 -0.0068 -0.0338 0.0024  783 GLU D CG  
3860 C CD  . GLU D 77  ? 0.4457 0.5593 0.4824 -0.0067 -0.0373 -0.0012 783 GLU D CD  
3861 O OE1 . GLU D 77  ? 0.4337 0.5561 0.4778 -0.0043 -0.0369 -0.0009 783 GLU D OE1 
3862 O OE2 . GLU D 77  ? 0.4946 0.6127 0.5305 -0.0091 -0.0406 -0.0045 783 GLU D OE2 
3863 N N   . THR D 78  ? 0.2834 0.3414 0.2912 -0.0049 -0.0239 0.0137  784 THR D N   
3864 C CA  . THR D 78  ? 0.1992 0.2484 0.1975 -0.0021 -0.0240 0.0169  784 THR D CA  
3865 C C   . THR D 78  ? 0.2571 0.2977 0.2512 -0.0056 -0.0240 0.0173  784 THR D C   
3866 O O   . THR D 78  ? 0.2260 0.2632 0.2221 -0.0091 -0.0225 0.0170  784 THR D O   
3867 C CB  . THR D 78  ? 0.2691 0.3133 0.2642 0.0005  -0.0208 0.0195  784 THR D CB  
3868 O OG1 . THR D 78  ? 0.2944 0.3476 0.2947 0.0048  -0.0209 0.0192  784 THR D OG1 
3869 C CG2 . THR D 78  ? 0.2810 0.3150 0.2660 0.0025  -0.0205 0.0223  784 THR D CG2 
3870 N N   . SER D 79  ? 0.2213 0.2586 0.2098 -0.0045 -0.0256 0.0182  785 SER D N   
3871 C CA  . SER D 79  ? 0.2515 0.2820 0.2371 -0.0073 -0.0257 0.0185  785 SER D CA  
3872 C C   . SER D 79  ? 0.2854 0.3068 0.2647 -0.0074 -0.0240 0.0214  785 SER D C   
3873 O O   . SER D 79  ? 0.2422 0.2605 0.2163 -0.0047 -0.0229 0.0232  785 SER D O   
3874 C CB  . SER D 79  ? 0.2525 0.2842 0.2351 -0.0065 -0.0274 0.0177  785 SER D CB  
3875 O OG  . SER D 79  ? 0.2478 0.2742 0.2290 -0.0089 -0.0271 0.0178  785 SER D OG  
3876 N N   . TYR D 80  ? 0.2436 0.2602 0.2231 -0.0104 -0.0238 0.0218  786 TYR D N   
3877 C CA  . TYR D 80  ? 0.2352 0.2438 0.2085 -0.0114 -0.0231 0.0242  786 TYR D CA  
3878 C C   . TYR D 80  ? 0.2435 0.2495 0.2162 -0.0134 -0.0247 0.0244  786 TYR D C   
3879 O O   . TYR D 80  ? 0.2113 0.2200 0.1895 -0.0145 -0.0259 0.0230  786 TYR D O   
3880 C CB  . TYR D 80  ? 0.2047 0.2102 0.1778 -0.0131 -0.0215 0.0251  786 TYR D CB  
3881 C CG  . TYR D 80  ? 0.2034 0.2110 0.1767 -0.0111 -0.0189 0.0250  786 TYR D CG  
3882 C CD1 . TYR D 80  ? 0.2140 0.2293 0.1946 -0.0107 -0.0185 0.0231  786 TYR D CD1 
3883 C CD2 . TYR D 80  ? 0.2204 0.2226 0.1869 -0.0096 -0.0168 0.0264  786 TYR D CD2 
3884 C CE1 . TYR D 80  ? 0.2329 0.2520 0.2155 -0.0085 -0.0161 0.0228  786 TYR D CE1 
3885 C CE2 . TYR D 80  ? 0.2958 0.3004 0.2635 -0.0069 -0.0140 0.0261  786 TYR D CE2 
3886 C CZ  . TYR D 80  ? 0.2990 0.3128 0.2755 -0.0062 -0.0138 0.0244  786 TYR D CZ  
3887 O OH  . TYR D 80  ? 0.2845 0.3026 0.2642 -0.0034 -0.0111 0.0240  786 TYR D OH  
3888 N N   . ASP D 81  ? 0.2139 0.2147 0.1805 -0.0138 -0.0245 0.0258  787 ASP D N   
3889 C CA  . ASP D 81  ? 0.2183 0.2171 0.1847 -0.0160 -0.0260 0.0262  787 ASP D CA  
3890 C C   . ASP D 81  ? 0.2958 0.2906 0.2605 -0.0180 -0.0268 0.0278  787 ASP D C   
3891 O O   . ASP D 81  ? 0.2409 0.2311 0.1994 -0.0183 -0.0254 0.0289  787 ASP D O   
3892 C CB  . ASP D 81  ? 0.1975 0.1923 0.1575 -0.0164 -0.0252 0.0267  787 ASP D CB  
3893 C CG  . ASP D 81  ? 0.2583 0.2550 0.2170 -0.0142 -0.0240 0.0260  787 ASP D CG  
3894 O OD1 . ASP D 81  ? 0.2013 0.2038 0.1647 -0.0129 -0.0247 0.0246  787 ASP D OD1 
3895 O OD2 . ASP D 81  ? 0.2239 0.2157 0.1760 -0.0142 -0.0225 0.0269  787 ASP D OD2 
3896 N N   . ILE D 82  ? 0.2003 0.1962 0.1695 -0.0193 -0.0291 0.0281  788 ILE D N   
3897 C CA  . ILE D 82  ? 0.2124 0.2044 0.1793 -0.0208 -0.0304 0.0302  788 ILE D CA  
3898 C C   . ILE D 82  ? 0.2417 0.2341 0.2103 -0.0221 -0.0337 0.0311  788 ILE D C   
3899 O O   . ILE D 82  ? 0.2704 0.2670 0.2464 -0.0214 -0.0349 0.0301  788 ILE D O   
3900 C CB  . ILE D 82  ? 0.2265 0.2190 0.1979 -0.0205 -0.0299 0.0304  788 ILE D CB  
3901 C CG1 . ILE D 82  ? 0.2274 0.2219 0.1992 -0.0194 -0.0269 0.0289  788 ILE D CG1 
3902 C CG2 . ILE D 82  ? 0.2523 0.2394 0.2192 -0.0221 -0.0310 0.0333  788 ILE D CG2 
3903 C CD1 . ILE D 82  ? 0.2128 0.2089 0.1903 -0.0199 -0.0258 0.0281  788 ILE D CD1 
3904 N N   . LYS D 83  ? 0.2310 0.2195 0.1928 -0.0242 -0.0351 0.0327  789 LYS D N   
3905 C CA  . LYS D 83  ? 0.2512 0.2414 0.2150 -0.0256 -0.0391 0.0337  789 LYS D CA  
3906 C C   . LYS D 83  ? 0.2580 0.2433 0.2137 -0.0276 -0.0412 0.0362  789 LYS D C   
3907 O O   . LYS D 83  ? 0.2597 0.2396 0.2074 -0.0283 -0.0386 0.0365  789 LYS D O   
3908 C CB  . LYS D 83  ? 0.2527 0.2456 0.2169 -0.0271 -0.0391 0.0319  789 LYS D CB  
3909 C CG  . LYS D 83  ? 0.2280 0.2154 0.1822 -0.0293 -0.0370 0.0314  789 LYS D CG  
3910 C CD  . LYS D 83  ? 0.2430 0.2323 0.1981 -0.0311 -0.0361 0.0294  789 LYS D CD  
3911 C CE  . LYS D 83  ? 0.3191 0.3011 0.2636 -0.0337 -0.0337 0.0288  789 LYS D CE  
3912 N NZ  . LYS D 83  ? 0.3346 0.3172 0.2795 -0.0358 -0.0320 0.0271  789 LYS D NZ  
3913 N N   . MET D 84  ? 0.2361 0.2234 0.1936 -0.0284 -0.0458 0.0378  790 MET D N   
3914 C CA  . MET D 84  ? 0.2761 0.2587 0.2245 -0.0304 -0.0484 0.0404  790 MET D CA  
3915 C C   . MET D 84  ? 0.2704 0.2570 0.2196 -0.0323 -0.0538 0.0411  790 MET D C   
3916 O O   . MET D 84  ? 0.3463 0.3400 0.3050 -0.0318 -0.0554 0.0397  790 MET D O   
3917 C CB  . MET D 84  ? 0.3165 0.2957 0.2651 -0.0286 -0.0489 0.0435  790 MET D CB  
3918 C CG  . MET D 84  ? 0.3192 0.3027 0.2783 -0.0257 -0.0523 0.0451  790 MET D CG  
3919 S SD  . MET D 84  ? 0.3722 0.3492 0.3306 -0.0238 -0.0515 0.0487  790 MET D SD  
3920 C CE  . MET D 84  ? 0.4115 0.3813 0.3546 -0.0265 -0.0543 0.0527  790 MET D CE  
3921 N N   . GLN D 85  ? 0.3040 0.2865 0.2430 -0.0349 -0.0566 0.0429  791 GLN D N   
3922 C CA  . GLN D 85  ? 0.3504 0.3376 0.2897 -0.0369 -0.0630 0.0438  791 GLN D CA  
3923 C C   . GLN D 85  ? 0.4043 0.3862 0.3334 -0.0376 -0.0666 0.0478  791 GLN D C   
3924 O O   . GLN D 85  ? 0.3998 0.3738 0.3209 -0.0373 -0.0630 0.0491  791 GLN D O   
3925 C CB  . GLN D 85  ? 0.4415 0.4294 0.3762 -0.0416 -0.0624 0.0403  791 GLN D CB  
3926 C CG  . GLN D 85  ? 0.5209 0.4993 0.4419 -0.0443 -0.0577 0.0389  791 GLN D CG  
3927 C CD  . GLN D 85  ? 0.4238 0.4009 0.3411 -0.0483 -0.0552 0.0350  791 GLN D CD  
3928 O OE1 . GLN D 85  ? 0.4691 0.4379 0.3747 -0.0508 -0.0518 0.0336  791 GLN D OE1 
3929 N NE2 . GLN D 85  ? 0.4762 0.4606 0.4031 -0.0490 -0.0563 0.0331  791 GLN D NE2 
3930 N N   . CYS D 86  ? 0.3943 0.3810 0.3239 -0.0384 -0.0736 0.0497  792 CYS D N   
3931 C CA  . CYS D 86  ? 0.3529 0.3342 0.2699 -0.0398 -0.0776 0.0535  792 CYS D CA  
3932 C C   . CYS D 86  ? 0.3702 0.3515 0.2769 -0.0457 -0.0798 0.0509  792 CYS D C   
3933 O O   . CYS D 86  ? 0.4321 0.4181 0.3434 -0.0482 -0.0787 0.0468  792 CYS D O   
3934 C CB  . CYS D 86  ? 0.3784 0.3644 0.3019 -0.0360 -0.0847 0.0582  792 CYS D CB  
3935 S SG  . CYS D 86  ? 0.4547 0.4558 0.3927 -0.0358 -0.0918 0.0568  792 CYS D SG  
3936 N N   . PHE D 87  ? 0.3526 0.3276 0.2442 -0.0483 -0.0825 0.0532  793 PHE D N   
3937 C CA  . PHE D 87  ? 0.4308 0.4050 0.3113 -0.0546 -0.0843 0.0501  793 PHE D CA  
3938 C C   . PHE D 87  ? 0.4413 0.4129 0.3082 -0.0567 -0.0909 0.0537  793 PHE D C   
3939 O O   . PHE D 87  ? 0.4576 0.4252 0.3210 -0.0534 -0.0926 0.0589  793 PHE D O   
3940 C CB  . PHE D 87  ? 0.4102 0.3748 0.2808 -0.0576 -0.0756 0.0460  793 PHE D CB  
3941 C CG  . PHE D 87  ? 0.4527 0.4061 0.3103 -0.0572 -0.0711 0.0481  793 PHE D CG  
3942 C CD1 . PHE D 87  ? 0.5053 0.4514 0.3449 -0.0617 -0.0719 0.0482  793 PHE D CD1 
3943 C CD2 . PHE D 87  ? 0.4539 0.4045 0.3171 -0.0527 -0.0658 0.0498  793 PHE D CD2 
3944 C CE1 . PHE D 87  ? 0.5358 0.4717 0.3633 -0.0616 -0.0669 0.0500  793 PHE D CE1 
3945 C CE2 . PHE D 87  ? 0.4436 0.3849 0.2960 -0.0528 -0.0611 0.0515  793 PHE D CE2 
3946 C CZ  . PHE D 87  ? 0.5004 0.4342 0.3350 -0.0572 -0.0613 0.0517  793 PHE D CZ  
3947 N N   . ASN D 88  ? 0.4758 0.4494 0.3347 -0.0626 -0.0947 0.0508  794 ASN D N   
3948 C CA  . ASN D 88  ? 0.5264 0.4974 0.3697 -0.0658 -0.1013 0.0534  794 ASN D CA  
3949 C C   . ASN D 88  ? 0.6137 0.5814 0.4438 -0.0739 -0.1004 0.0478  794 ASN D C   
3950 O O   . ASN D 88  ? 0.6581 0.6214 0.4884 -0.0762 -0.0927 0.0427  794 ASN D O   
3951 C CB  . ASN D 88  ? 0.6281 0.6112 0.4805 -0.0632 -0.1123 0.0575  794 ASN D CB  
3952 C CG  . ASN D 88  ? 0.6925 0.6898 0.5610 -0.0647 -0.1160 0.0536  794 ASN D CG  
3953 O OD1 . ASN D 88  ? 0.6774 0.6748 0.5444 -0.0704 -0.1125 0.0475  794 ASN D OD1 
3954 N ND2 . ASN D 88  ? 0.7374 0.7464 0.6217 -0.0597 -0.1226 0.0569  794 ASN D ND2 
3955 N N   . GLU D 89  ? 0.6444 0.6136 0.4626 -0.0781 -0.1082 0.0487  795 GLU D N   
3956 C CA  . GLU D 89  ? 0.6457 0.6111 0.4499 -0.0865 -0.1076 0.0429  795 GLU D CA  
3957 C C   . GLU D 89  ? 0.5613 0.5345 0.3781 -0.0900 -0.1065 0.0368  795 GLU D C   
3958 O O   . GLU D 89  ? 0.6473 0.6131 0.4566 -0.0952 -0.1001 0.0311  795 GLU D O   
3959 C CB  . GLU D 89  ? 0.8002 0.7687 0.5912 -0.0906 -0.1179 0.0449  795 GLU D CB  
3960 C CG  . GLU D 89  ? 0.9910 0.9553 0.7665 -0.1002 -0.1175 0.0382  795 GLU D CG  
3961 C CD  . GLU D 89  ? 1.1758 1.1428 0.9359 -0.1046 -0.1280 0.0402  795 GLU D CD  
3962 O OE1 . GLU D 89  ? 1.2285 1.2027 0.9925 -0.0996 -0.1367 0.0470  795 GLU D OE1 
3963 O OE2 . GLU D 89  ? 1.2434 1.2051 0.9872 -0.1129 -0.1277 0.0348  795 GLU D OE2 
3964 N N   . GLY D 90  ? 0.4898 0.4775 0.3259 -0.0869 -0.1121 0.0382  796 GLY D N   
3965 C CA  . GLY D 90  ? 0.4494 0.4458 0.2980 -0.0906 -0.1115 0.0327  796 GLY D CA  
3966 C C   . GLY D 90  ? 0.5209 0.5114 0.3766 -0.0889 -0.1008 0.0297  796 GLY D C   
3967 O O   . GLY D 90  ? 0.5187 0.5082 0.3751 -0.0941 -0.0968 0.0241  796 GLY D O   
3968 N N   . GLY D 91  ? 0.4718 0.4580 0.3322 -0.0816 -0.0961 0.0334  797 GLY D N   
3969 C CA  . GLY D 91  ? 0.4453 0.4269 0.3125 -0.0793 -0.0868 0.0311  797 GLY D CA  
3970 C C   . GLY D 91  ? 0.4024 0.3870 0.2826 -0.0711 -0.0852 0.0351  797 GLY D C   
3971 O O   . GLY D 91  ? 0.4147 0.3997 0.2944 -0.0671 -0.0889 0.0400  797 GLY D O   
3972 N N   . GLU D 92  ? 0.3444 0.3305 0.2355 -0.0691 -0.0795 0.0330  798 GLU D N   
3973 C CA  . GLU D 92  ? 0.3040 0.2918 0.2065 -0.0621 -0.0767 0.0356  798 GLU D CA  
3974 C C   . GLU D 92  ? 0.3132 0.3141 0.2341 -0.0596 -0.0801 0.0357  798 GLU D C   
3975 O O   . GLU D 92  ? 0.3202 0.3279 0.2466 -0.0636 -0.0814 0.0324  798 GLU D O   
3976 C CB  . GLU D 92  ? 0.4092 0.3885 0.3094 -0.0608 -0.0674 0.0334  798 GLU D CB  
3977 C CG  . GLU D 92  ? 0.4917 0.4585 0.3758 -0.0620 -0.0629 0.0333  798 GLU D CG  
3978 C CD  . GLU D 92  ? 0.5686 0.5289 0.4407 -0.0685 -0.0608 0.0291  798 GLU D CD  
3979 O OE1 . GLU D 92  ? 0.6140 0.5741 0.4898 -0.0702 -0.0572 0.0257  798 GLU D OE1 
3980 O OE2 . GLU D 92  ? 0.6614 0.6159 0.5196 -0.0719 -0.0623 0.0291  798 GLU D OE2 
3981 N N   . SER D 93  ? 0.3200 0.3241 0.2504 -0.0534 -0.0810 0.0392  799 SER D N   
3982 C CA  . SER D 93  ? 0.3555 0.3711 0.3038 -0.0501 -0.0830 0.0391  799 SER D CA  
3983 C C   . SER D 93  ? 0.4181 0.4336 0.3728 -0.0501 -0.0758 0.0354  799 SER D C   
3984 O O   . SER D 93  ? 0.3760 0.3825 0.3217 -0.0516 -0.0698 0.0337  799 SER D O   
3985 C CB  . SER D 93  ? 0.4111 0.4272 0.3659 -0.0433 -0.0848 0.0437  799 SER D CB  
3986 O OG  . SER D 93  ? 0.3922 0.3999 0.3445 -0.0406 -0.0779 0.0437  799 SER D OG  
3987 N N   . GLU D 94  ? 0.3602 0.3857 0.3303 -0.0479 -0.0763 0.0345  800 GLU D N   
3988 C CA  . GLU D 94  ? 0.3632 0.3883 0.3394 -0.0465 -0.0695 0.0320  800 GLU D CA  
3989 C C   . GLU D 94  ? 0.3257 0.3431 0.2989 -0.0417 -0.0656 0.0339  800 GLU D C   
3990 O O   . GLU D 94  ? 0.3234 0.3384 0.2948 -0.0387 -0.0684 0.0374  800 GLU D O   
3991 C CB  . GLU D 94  ? 0.4263 0.4638 0.4197 -0.0446 -0.0709 0.0308  800 GLU D CB  
3992 C CG  . GLU D 94  ? 0.6237 0.6707 0.6222 -0.0498 -0.0745 0.0284  800 GLU D CG  
3993 C CD  . GLU D 94  ? 0.7807 0.8408 0.7974 -0.0480 -0.0749 0.0268  800 GLU D CD  
3994 O OE1 . GLU D 94  ? 0.7545 0.8152 0.7790 -0.0427 -0.0719 0.0274  800 GLU D OE1 
3995 O OE2 . GLU D 94  ? 0.8743 0.9444 0.8978 -0.0522 -0.0779 0.0247  800 GLU D OE2 
3996 N N   . PHE D 95  ? 0.3340 0.3476 0.3065 -0.0412 -0.0593 0.0318  801 PHE D N   
3997 C CA  . PHE D 95  ? 0.3423 0.3506 0.3136 -0.0370 -0.0557 0.0330  801 PHE D CA  
3998 C C   . PHE D 95  ? 0.3236 0.3378 0.3074 -0.0325 -0.0569 0.0339  801 PHE D C   
3999 O O   . PHE D 95  ? 0.3868 0.4094 0.3814 -0.0321 -0.0586 0.0328  801 PHE D O   
4000 C CB  . PHE D 95  ? 0.3021 0.3060 0.2698 -0.0373 -0.0494 0.0306  801 PHE D CB  
4001 C CG  . PHE D 95  ? 0.3593 0.3547 0.3140 -0.0403 -0.0470 0.0300  801 PHE D CG  
4002 C CD1 . PHE D 95  ? 0.4309 0.4247 0.3818 -0.0443 -0.0450 0.0276  801 PHE D CD1 
4003 C CD2 . PHE D 95  ? 0.3611 0.3493 0.3071 -0.0393 -0.0461 0.0317  801 PHE D CD2 
4004 C CE1 . PHE D 95  ? 0.4296 0.4141 0.3683 -0.0468 -0.0422 0.0269  801 PHE D CE1 
4005 C CE2 . PHE D 95  ? 0.3700 0.3501 0.3043 -0.0418 -0.0432 0.0308  801 PHE D CE2 
4006 C CZ  . PHE D 95  ? 0.3692 0.3471 0.2998 -0.0453 -0.0414 0.0284  801 PHE D CZ  
4007 N N   . SER D 96  ? 0.2699 0.2793 0.2522 -0.0293 -0.0556 0.0358  802 SER D N   
4008 C CA  . SER D 96  ? 0.2660 0.2782 0.2585 -0.0251 -0.0554 0.0362  802 SER D CA  
4009 C C   . SER D 96  ? 0.3055 0.3204 0.3034 -0.0244 -0.0506 0.0327  802 SER D C   
4010 O O   . SER D 96  ? 0.2652 0.2794 0.2587 -0.0268 -0.0478 0.0306  802 SER D O   
4011 C CB  . SER D 96  ? 0.2408 0.2457 0.2282 -0.0232 -0.0543 0.0385  802 SER D CB  
4012 O OG  . SER D 96  ? 0.2463 0.2468 0.2275 -0.0241 -0.0494 0.0367  802 SER D OG  
4013 N N   . ASN D 97  ? 0.2693 0.2861 0.2757 -0.0210 -0.0495 0.0321  803 ASN D N   
4014 C CA  . ASN D 97  ? 0.2429 0.2605 0.2518 -0.0202 -0.0448 0.0289  803 ASN D CA  
4015 C C   . ASN D 97  ? 0.2595 0.2711 0.2586 -0.0211 -0.0419 0.0288  803 ASN D C   
4016 O O   . ASN D 97  ? 0.2519 0.2583 0.2440 -0.0216 -0.0429 0.0311  803 ASN D O   
4017 C CB  . ASN D 97  ? 0.2940 0.3129 0.3121 -0.0168 -0.0441 0.0282  803 ASN D CB  
4018 C CG  . ASN D 97  ? 0.3019 0.3148 0.3178 -0.0152 -0.0455 0.0312  803 ASN D CG  
4019 O OD1 . ASN D 97  ? 0.3029 0.3130 0.3140 -0.0157 -0.0489 0.0347  803 ASN D OD1 
4020 N ND2 . ASN D 97  ? 0.2307 0.2411 0.2492 -0.0137 -0.0427 0.0297  803 ASN D ND2 
4021 N N   . VAL D 98  ? 0.2017 0.2141 0.2000 -0.0211 -0.0383 0.0261  804 VAL D N   
4022 C CA  . VAL D 98  ? 0.2105 0.2186 0.2006 -0.0212 -0.0359 0.0261  804 VAL D CA  
4023 C C   . VAL D 98  ? 0.2428 0.2519 0.2363 -0.0193 -0.0339 0.0244  804 VAL D C   
4024 O O   . VAL D 98  ? 0.2274 0.2402 0.2255 -0.0186 -0.0324 0.0218  804 VAL D O   
4025 C CB  . VAL D 98  ? 0.1778 0.1850 0.1618 -0.0228 -0.0336 0.0251  804 VAL D CB  
4026 C CG1 . VAL D 98  ? 0.1740 0.1765 0.1500 -0.0220 -0.0316 0.0257  804 VAL D CG1 
4027 C CG2 . VAL D 98  ? 0.3104 0.3171 0.2921 -0.0257 -0.0353 0.0258  804 VAL D CG2 
4028 N N   . MET D 99  ? 0.1821 0.1880 0.1733 -0.0188 -0.0337 0.0255  805 MET D N   
4029 C CA  . MET D 99  ? 0.2253 0.2325 0.2200 -0.0178 -0.0321 0.0235  805 MET D CA  
4030 C C   . MET D 99  ? 0.2623 0.2703 0.2521 -0.0175 -0.0302 0.0225  805 MET D C   
4031 O O   . MET D 99  ? 0.2643 0.2697 0.2476 -0.0178 -0.0298 0.0241  805 MET D O   
4032 C CB  . MET D 99  ? 0.2153 0.2189 0.2112 -0.0179 -0.0326 0.0252  805 MET D CB  
4033 C CG  . MET D 99  ? 0.2503 0.2520 0.2496 -0.0175 -0.0352 0.0276  805 MET D CG  
4034 S SD  . MET D 99  ? 0.3467 0.3520 0.3568 -0.0156 -0.0349 0.0249  805 MET D SD  
4035 C CE  . MET D 99  ? 0.2935 0.2943 0.3061 -0.0156 -0.0330 0.0242  805 MET D CE  
4036 N N   . ILE D 100 ? 0.1991 0.2108 0.1918 -0.0168 -0.0290 0.0197  806 ILE D N   
4037 C CA  . ILE D 100 ? 0.1491 0.1629 0.1384 -0.0160 -0.0279 0.0189  806 ILE D CA  
4038 C C   . ILE D 100 ? 0.2913 0.3071 0.2854 -0.0165 -0.0275 0.0173  806 ILE D C   
4039 O O   . ILE D 100 ? 0.2673 0.2840 0.2668 -0.0173 -0.0274 0.0151  806 ILE D O   
4040 C CB  . ILE D 100 ? 0.1852 0.2027 0.1730 -0.0151 -0.0274 0.0169  806 ILE D CB  
4041 C CG1 . ILE D 100 ? 0.2136 0.2284 0.1966 -0.0153 -0.0271 0.0184  806 ILE D CG1 
4042 C CG2 . ILE D 100 ? 0.1954 0.2161 0.1805 -0.0135 -0.0272 0.0164  806 ILE D CG2 
4043 C CD1 . ILE D 100 ? 0.2167 0.2339 0.1978 -0.0150 -0.0260 0.0166  806 ILE D CD1 
4044 N N   . CYS D 101 ? 0.2362 0.2522 0.2286 -0.0164 -0.0267 0.0181  807 CYS D N   
4045 C CA  . CYS D 101 ? 0.3078 0.3257 0.3048 -0.0177 -0.0258 0.0166  807 CYS D CA  
4046 C C   . CYS D 101 ? 0.2901 0.3124 0.2865 -0.0167 -0.0248 0.0163  807 CYS D C   
4047 O O   . CYS D 101 ? 0.2618 0.2822 0.2534 -0.0152 -0.0242 0.0185  807 CYS D O   
4048 C CB  . CYS D 101 ? 0.3182 0.3298 0.3156 -0.0194 -0.0252 0.0189  807 CYS D CB  
4049 S SG  . CYS D 101 ? 0.3517 0.3637 0.3553 -0.0221 -0.0231 0.0168  807 CYS D SG  
4050 N N   . GLU D 102 ? 0.2260 0.2546 0.2278 -0.0177 -0.0247 0.0131  808 GLU D N   
4051 C CA  . GLU D 102 ? 0.2320 0.2676 0.2355 -0.0164 -0.0244 0.0122  808 GLU D CA  
4052 C C   . GLU D 102 ? 0.2716 0.3079 0.2798 -0.0190 -0.0220 0.0117  808 GLU D C   
4053 O O   . GLU D 102 ? 0.2939 0.3278 0.3057 -0.0222 -0.0211 0.0103  808 GLU D O   
4054 C CB  . GLU D 102 ? 0.3250 0.3691 0.3316 -0.0162 -0.0263 0.0086  808 GLU D CB  
4055 C CG  . GLU D 102 ? 0.4322 0.4829 0.4368 -0.0125 -0.0279 0.0091  808 GLU D CG  
4056 C CD  . GLU D 102 ? 0.3881 0.4455 0.3927 -0.0123 -0.0306 0.0060  808 GLU D CD  
4057 O OE1 . GLU D 102 ? 0.3886 0.4432 0.3868 -0.0105 -0.0316 0.0071  808 GLU D OE1 
4058 O OE2 . GLU D 102 ? 0.4466 0.5118 0.4571 -0.0143 -0.0315 0.0023  808 GLU D OE2 
4059 N N   . THR D 103 ? 0.2206 0.2595 0.2288 -0.0176 -0.0204 0.0128  809 THR D N   
4060 C CA  . THR D 103 ? 0.2410 0.2823 0.2545 -0.0203 -0.0175 0.0117  809 THR D CA  
4061 C C   . THR D 103 ? 0.2584 0.3102 0.2805 -0.0221 -0.0184 0.0073  809 THR D C   
4062 O O   . THR D 103 ? 0.3205 0.3785 0.3434 -0.0205 -0.0216 0.0054  809 THR D O   
4063 C CB  . THR D 103 ? 0.2447 0.2873 0.2568 -0.0180 -0.0151 0.0134  809 THR D CB  
4064 O OG1 . THR D 103 ? 0.2465 0.2964 0.2594 -0.0135 -0.0172 0.0131  809 THR D OG1 
4065 C CG2 . THR D 103 ? 0.2528 0.2842 0.2558 -0.0174 -0.0136 0.0172  809 THR D CG2 
4066 N N   . LYS D 104 ? 0.3003 0.3542 0.3285 -0.0261 -0.0156 0.0054  810 LYS D N   
4067 C CA  . LYS D 104 ? 0.2963 0.3613 0.3333 -0.0287 -0.0164 0.0005  810 LYS D CA  
4068 C C   . LYS D 104 ? 0.3292 0.4073 0.3709 -0.0253 -0.0181 -0.0005 810 LYS D C   
4069 O O   . LYS D 104 ? 0.2830 0.3607 0.3223 -0.0214 -0.0169 0.0024  810 LYS D O   
4070 C CB  . LYS D 104 ? 0.3118 0.3748 0.3543 -0.0347 -0.0124 -0.0015 810 LYS D CB  
4071 C CG  . LYS D 104 ? 0.3516 0.4033 0.3911 -0.0376 -0.0119 -0.0014 810 LYS D CG  
4072 C CD  . LYS D 104 ? 0.5516 0.5982 0.5946 -0.0433 -0.0075 -0.0025 810 LYS D CD  
4073 C CE  . LYS D 104 ? 0.6354 0.6704 0.6756 -0.0450 -0.0073 -0.0022 810 LYS D CE  
4074 N NZ  . LYS D 104 ? 0.7364 0.7628 0.7778 -0.0502 -0.0026 -0.0019 810 LYS D NZ  
4075 N N   . ALA D 105 ? 0.3858 0.4755 0.4340 -0.0265 -0.0209 -0.0048 811 ALA D N   
4076 C CA  . ALA D 105 ? 0.4369 0.5406 0.4906 -0.0228 -0.0232 -0.0057 811 ALA D CA  
4077 C C   . ALA D 105 ? 0.4368 0.5473 0.4997 -0.0248 -0.0193 -0.0068 811 ALA D C   
4078 O O   . ALA D 105 ? 0.4543 0.5617 0.5209 -0.0307 -0.0154 -0.0087 811 ALA D O   
4080 N N   . ARG D 106 ? 0.5595 0.6788 0.6261 -0.0196 -0.0197 -0.0055 812 ARG D N   
4081 C CA  . ARG D 106 ? 0.7432 0.8710 0.8199 -0.0209 -0.0156 -0.0069 812 ARG D CA  
4082 C C   . ARG D 106 ? 0.8125 0.9547 0.9016 -0.0265 -0.0167 -0.0128 812 ARG D C   
4083 O O   . ARG D 106 ? 0.7818 0.9309 0.8720 -0.0272 -0.0220 -0.0156 812 ARG D O   
4091 N N   . LYS D 107 ? 0.9193 1.0659 1.0173 -0.0309 -0.0114 -0.0148 813 LYS D N   
4092 C CA  . LYS D 107 ? 1.0157 1.1751 1.1260 -0.0377 -0.0113 -0.0209 813 LYS D CA  
4093 C C   . LYS D 107 ? 1.0493 1.2266 1.1741 -0.0366 -0.0095 -0.0230 813 LYS D C   
4094 O O   . LYS D 107 ? 1.0620 1.2371 1.1872 -0.0333 -0.0047 -0.0201 813 LYS D O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   20  ?   ?   ?   B . n 
A 1 2   SER 2   21  ?   ?   ?   B . n 
A 1 3   GLY 3   22  ?   ?   ?   B . n 
A 1 4   PRO 4   23  ?   ?   ?   B . n 
A 1 5   GLY 5   24  ?   ?   ?   B . n 
A 1 6   PRO 6   25  ?   ?   ?   B . n 
A 1 7   GLY 7   26  ?   ?   ?   B . n 
A 1 8   ARG 8   27  ?   ?   ?   B . n 
A 1 9   GLY 9   28  ?   ?   ?   B . n 
A 1 10  PRO 10  29  ?   ?   ?   B . n 
A 1 11  VAL 11  30  ?   ?   ?   B . n 
A 1 12  GLY 12  31  ?   ?   ?   B . n 
A 1 13  ARG 13  32  ?   ?   ?   B . n 
A 1 14  ARG 14  33  ?   ?   ?   B . n 
A 1 15  ARG 15  34  ?   ?   ?   B . n 
A 1 16  TYR 16  35  ?   ?   ?   B . n 
A 1 17  ALA 17  36  ?   ?   ?   B . n 
A 1 18  ARG 18  37  ?   ?   ?   B . n 
A 1 19  LYS 19  38  ?   ?   ?   B . n 
A 1 20  GLN 20  39  39  GLN GLN B . n 
A 1 21  LEU 21  40  40  LEU LEU B . n 
A 1 22  VAL 22  41  41  VAL VAL B . n 
A 1 23  PRO 23  42  42  PRO PRO B . n 
A 1 24  LEU 24  43  43  LEU LEU B . n 
A 1 25  LEU 25  44  44  LEU LEU B . n 
A 1 26  TYR 26  45  45  TYR TYR B . n 
A 1 27  LYS 27  46  46  LYS LYS B . n 
A 1 28  GLN 28  47  47  GLN GLN B . n 
A 1 29  PHE 29  48  48  PHE PHE B . n 
A 1 30  VAL 30  49  49  VAL VAL B . n 
A 1 31  PRO 31  50  50  PRO PRO B . n 
A 1 32  GLY 32  51  51  GLY GLY B . n 
A 1 33  VAL 33  52  52  VAL VAL B . n 
A 1 34  PRO 34  53  53  PRO PRO B . n 
A 1 35  GLU 35  54  54  GLU GLU B . n 
A 1 36  ARG 36  55  55  ARG ARG B . n 
A 1 37  THR 37  56  56  THR THR B . n 
A 1 38  LEU 38  57  57  LEU LEU B . n 
A 1 39  GLY 39  58  58  GLY GLY B . n 
A 1 40  ALA 40  59  59  ALA ALA B . n 
A 1 41  SER 41  60  60  SER SER B . n 
A 1 42  GLY 42  61  61  GLY GLY B . n 
A 1 43  PRO 43  62  62  PRO PRO B . n 
A 1 44  ALA 44  63  63  ALA ALA B . n 
A 1 45  GLU 45  64  64  GLU GLU B . n 
A 1 46  GLY 46  65  65  GLY GLY B . n 
A 1 47  ARG 47  66  66  ARG ARG B . n 
A 1 48  VAL 48  67  67  VAL VAL B . n 
A 1 49  ALA 49  68  68  ALA ALA B . n 
A 1 50  ARG 50  69  69  ARG ARG B . n 
A 1 51  GLY 51  70  70  GLY GLY B . n 
A 1 52  SER 52  71  71  SER SER B . n 
A 1 53  GLU 53  72  72  GLU GLU B . n 
A 1 54  ARG 54  73  73  ARG ARG B . n 
A 1 55  PHE 55  74  74  PHE PHE B . n 
A 1 56  ARG 56  75  75  ARG ARG B . n 
A 1 57  ASP 57  76  76  ASP ASP B . n 
A 1 58  LEU 58  77  77  LEU LEU B . n 
A 1 59  VAL 59  78  78  VAL VAL B . n 
A 1 60  PRO 60  79  79  PRO PRO B . n 
A 1 61  ASN 61  80  80  ASN ASN B . n 
A 1 62  TYR 62  81  81  TYR TYR B . n 
A 1 63  ASN 63  82  82  ASN ASN B . n 
A 1 64  PRO 64  83  83  PRO PRO B . n 
A 1 65  ASP 65  84  84  ASP ASP B . n 
A 1 66  ILE 66  85  85  ILE ILE B . n 
A 1 67  ILE 67  86  86  ILE ILE B . n 
A 1 68  PHE 68  87  87  PHE PHE B . n 
A 1 69  LYS 69  88  88  LYS LYS B . n 
A 1 70  ASP 70  89  89  ASP ASP B . n 
A 1 71  GLU 71  90  90  GLU GLU B . n 
A 1 72  GLU 72  91  91  GLU GLU B . n 
A 1 73  ASN 73  92  92  ASN ASN B . n 
A 1 74  SER 74  93  93  SER SER B . n 
A 1 75  GLY 75  94  94  GLY GLY B . n 
A 1 76  ALA 76  95  95  ALA ALA B . n 
A 1 77  ASP 77  96  96  ASP ASP B . n 
A 1 78  ARG 78  97  97  ARG ARG B . n 
A 1 79  LEU 79  98  98  LEU LEU B . n 
A 1 80  MET 80  99  99  MET MET B . n 
A 1 81  THR 81  100 100 THR THR B . n 
A 1 82  GLU 82  101 101 GLU GLU B . n 
A 1 83  ARG 83  102 102 ARG ARG B . n 
A 1 84  CYS 84  103 103 CYS CYS B . n 
A 1 85  LYS 85  104 104 LYS LYS B . n 
A 1 86  GLU 86  105 105 GLU GLU B . n 
A 1 87  ARG 87  106 106 ARG ARG B . n 
A 1 88  VAL 88  107 107 VAL VAL B . n 
A 1 89  ASN 89  108 108 ASN ASN B . n 
A 1 90  ALA 90  109 109 ALA ALA B . n 
A 1 91  LEU 91  110 110 LEU LEU B . n 
A 1 92  ALA 92  111 111 ALA ALA B . n 
A 1 93  ILE 93  112 112 ILE ILE B . n 
A 1 94  ALA 94  113 113 ALA ALA B . n 
A 1 95  VAL 95  114 114 VAL VAL B . n 
A 1 96  MET 96  115 115 MET MET B . n 
A 1 97  ASN 97  116 116 ASN ASN B . n 
A 1 98  MET 98  117 117 MET MET B . n 
A 1 99  TRP 99  118 118 TRP TRP B . n 
A 1 100 PRO 100 119 119 PRO PRO B . n 
A 1 101 GLY 101 120 120 GLY GLY B . n 
A 1 102 VAL 102 121 121 VAL VAL B . n 
A 1 103 ARG 103 122 122 ARG ARG B . n 
A 1 104 LEU 104 123 123 LEU LEU B . n 
A 1 105 ARG 105 124 124 ARG ARG B . n 
A 1 106 VAL 106 125 125 VAL VAL B . n 
A 1 107 THR 107 126 126 THR THR B . n 
A 1 108 GLU 108 127 127 GLU GLU B . n 
A 1 109 GLY 109 128 128 GLY GLY B . n 
A 1 110 TRP 110 129 129 TRP TRP B . n 
A 1 111 ASP 111 130 130 ASP ASP B . n 
A 1 112 GLU 112 131 131 GLU GLU B . n 
A 1 113 ASP 113 132 132 ASP ASP B . n 
A 1 114 GLY 114 133 133 GLY GLY B . n 
A 1 115 HIS 115 134 134 HIS HIS B . n 
A 1 116 HIS 116 135 135 HIS HIS B . n 
A 1 117 ALA 117 136 136 ALA ALA B . n 
A 1 118 GLN 118 137 137 GLN GLN B . n 
A 1 119 ASP 119 138 138 ASP ASP B . n 
A 1 120 SER 120 139 139 SER SER B . n 
A 1 121 LEU 121 140 140 LEU LEU B . n 
A 1 122 HIS 122 141 141 HIS HIS B . n 
A 1 123 TYR 123 142 142 TYR TYR B . n 
A 1 124 GLU 124 143 143 GLU GLU B . n 
A 1 125 GLY 125 144 144 GLY GLY B . n 
A 1 126 ARG 126 145 145 ARG ARG B . n 
A 1 127 ALA 127 146 146 ALA ALA B . n 
A 1 128 LEU 128 147 147 LEU LEU B . n 
A 1 129 ASP 129 148 148 ASP ASP B . n 
A 1 130 ILE 130 149 149 ILE ILE B . n 
A 1 131 THR 131 150 150 THR THR B . n 
A 1 132 THR 132 151 151 THR THR B . n 
A 1 133 SER 133 152 152 SER SER B . n 
A 1 134 ASP 134 153 153 ASP ASP B . n 
A 1 135 ARG 135 154 154 ARG ARG B . n 
A 1 136 ASP 136 155 155 ASP ASP B . n 
A 1 137 ARG 137 156 156 ARG ARG B . n 
A 1 138 ASN 138 157 157 ASN ASN B . n 
A 1 139 LYS 139 158 158 LYS LYS B . n 
A 1 140 TYR 140 159 159 TYR TYR B . n 
A 1 141 GLY 141 160 160 GLY GLY B . n 
A 1 142 LEU 142 161 161 LEU LEU B . n 
A 1 143 LEU 143 162 162 LEU LEU B . n 
A 1 144 ALA 144 163 163 ALA ALA B . n 
A 1 145 ARG 145 164 164 ARG ARG B . n 
A 1 146 LEU 146 165 165 LEU LEU B . n 
A 1 147 ALA 147 166 166 ALA ALA B . n 
A 1 148 VAL 148 167 167 VAL VAL B . n 
A 1 149 GLU 149 168 168 GLU GLU B . n 
A 1 150 ALA 150 169 169 ALA ALA B . n 
A 1 151 GLY 151 170 170 GLY GLY B . n 
A 1 152 PHE 152 171 171 PHE PHE B . n 
A 1 153 ASP 153 172 172 ASP ASP B . n 
A 1 154 TRP 154 173 173 TRP TRP B . n 
A 1 155 VAL 155 174 174 VAL VAL B . n 
A 1 156 TYR 156 175 175 TYR TYR B . n 
A 1 157 TYR 157 176 176 TYR TYR B . n 
A 1 158 GLU 158 177 177 GLU GLU B . n 
A 1 159 SER 159 178 178 SER SER B . n 
A 1 160 ARG 160 179 179 ARG ARG B . n 
A 1 161 ASN 161 180 180 ASN ASN B . n 
A 1 162 HIS 162 181 181 HIS HIS B . n 
A 1 163 VAL 163 182 182 VAL VAL B . n 
A 1 164 HIS 164 183 183 HIS HIS B . n 
A 1 165 VAL 165 184 184 VAL VAL B . n 
A 1 166 SER 166 185 185 SER SER B . n 
A 1 167 VAL 167 186 186 VAL VAL B . n 
A 1 168 LYS 168 187 187 LYS LYS B . n 
A 1 169 ALA 169 188 188 ALA ALA B . n 
A 1 170 ASP 170 189 189 ASP ASP B . n 
B 2 1   GLY 1   707 ?   ?   ?   C . n 
B 2 2   SER 2   708 ?   ?   ?   C . n 
B 2 3   THR 3   709 ?   ?   ?   C . n 
B 2 4   GLU 4   710 710 GLU GLU C . n 
B 2 5   ARG 5   711 711 ARG ARG C . n 
B 2 6   PRO 6   712 712 PRO PRO C . n 
B 2 7   VAL 7   713 713 VAL VAL C . n 
B 2 8   ALA 8   714 714 ALA ALA C . n 
B 2 9   GLY 9   715 715 GLY GLY C . n 
B 2 10  PRO 10  716 716 PRO PRO C . n 
B 2 11  TYR 11  717 717 TYR TYR C . n 
B 2 12  ILE 12  718 718 ILE ILE C . n 
B 2 13  THR 13  719 719 THR THR C . n 
B 2 14  PHE 14  720 720 PHE PHE C . n 
B 2 15  THR 15  721 721 THR THR C . n 
B 2 16  ASP 16  722 722 ASP ASP C . n 
B 2 17  ALA 17  723 723 ALA ALA C . n 
B 2 18  VAL 18  724 724 VAL VAL C . n 
B 2 19  ASN 19  725 725 ASN ASN C . n 
B 2 20  GLU 20  726 726 GLU GLU C . n 
B 2 21  THR 21  727 727 THR THR C . n 
B 2 22  THR 22  728 728 THR THR C . n 
B 2 23  ILE 23  729 729 ILE ILE C . n 
B 2 24  MET 24  730 730 MET MET C . n 
B 2 25  LEU 25  731 731 LEU LEU C . n 
B 2 26  LYS 26  732 732 LYS LYS C . n 
B 2 27  TRP 27  733 733 TRP TRP C . n 
B 2 28  MET 28  734 734 MET MET C . n 
B 2 29  TYR 29  735 735 TYR TYR C . n 
B 2 30  ILE 30  736 736 ILE ILE C . n 
B 2 31  PRO 31  737 737 PRO PRO C . n 
B 2 32  ALA 32  738 738 ALA ALA C . n 
B 2 33  SER 33  739 739 SER SER C . n 
B 2 34  ASN 34  740 740 ASN ASN C . n 
B 2 35  ASN 35  741 741 ASN ASN C . n 
B 2 36  ASN 36  742 742 ASN ASN C . n 
B 2 37  THR 37  743 743 THR THR C . n 
B 2 38  PRO 38  744 744 PRO PRO C . n 
B 2 39  ILE 39  745 745 ILE ILE C . n 
B 2 40  HIS 40  746 746 HIS HIS C . n 
B 2 41  GLY 41  747 747 GLY GLY C . n 
B 2 42  PHE 42  748 748 PHE PHE C . n 
B 2 43  TYR 43  749 749 TYR TYR C . n 
B 2 44  ILE 44  750 750 ILE ILE C . n 
B 2 45  TYR 45  751 751 TYR TYR C . n 
B 2 46  TYR 46  752 752 TYR TYR C . n 
B 2 47  ARG 47  753 753 ARG ARG C . n 
B 2 48  PRO 48  754 754 PRO PRO C . n 
B 2 49  THR 49  755 755 THR THR C . n 
B 2 50  ASP 50  756 756 ASP ASP C . n 
B 2 51  SER 51  757 757 SER SER C . n 
B 2 52  ASP 52  758 758 ASP ASP C . n 
B 2 53  ASN 53  759 759 ASN ASN C . n 
B 2 54  ASP 54  760 760 ASP ASP C . n 
B 2 55  SER 55  761 761 SER SER C . n 
B 2 56  ASP 56  762 762 ASP ASP C . n 
B 2 57  TYR 57  763 763 TYR TYR C . n 
B 2 58  LYS 58  764 764 LYS LYS C . n 
B 2 59  LYS 59  765 765 LYS LYS C . n 
B 2 60  ASP 60  766 766 ASP ASP C . n 
B 2 61  MET 61  767 767 MET MET C . n 
B 2 62  VAL 62  768 768 VAL VAL C . n 
B 2 63  GLU 63  769 769 GLU GLU C . n 
B 2 64  GLY 64  770 770 GLY GLY C . n 
B 2 65  ASP 65  771 771 ASP ASP C . n 
B 2 66  LYS 66  772 772 LYS LYS C . n 
B 2 67  TYR 67  773 773 TYR TYR C . n 
B 2 68  TRP 68  774 774 TRP TRP C . n 
B 2 69  HIS 69  775 775 HIS HIS C . n 
B 2 70  SER 70  776 776 SER SER C . n 
B 2 71  ILE 71  777 777 ILE ILE C . n 
B 2 72  SER 72  778 778 SER SER C . n 
B 2 73  HIS 73  779 779 HIS HIS C . n 
B 2 74  LEU 74  780 780 LEU LEU C . n 
B 2 75  GLN 75  781 781 GLN GLN C . n 
B 2 76  PRO 76  782 782 PRO PRO C . n 
B 2 77  GLU 77  783 783 GLU GLU C . n 
B 2 78  THR 78  784 784 THR THR C . n 
B 2 79  SER 79  785 785 SER SER C . n 
B 2 80  TYR 80  786 786 TYR TYR C . n 
B 2 81  ASP 81  787 787 ASP ASP C . n 
B 2 82  ILE 82  788 788 ILE ILE C . n 
B 2 83  LYS 83  789 789 LYS LYS C . n 
B 2 84  MET 84  790 790 MET MET C . n 
B 2 85  GLN 85  791 791 GLN GLN C . n 
B 2 86  CYS 86  792 792 CYS CYS C . n 
B 2 87  PHE 87  793 793 PHE PHE C . n 
B 2 88  ASN 88  794 794 ASN ASN C . n 
B 2 89  GLU 89  795 795 GLU GLU C . n 
B 2 90  GLY 90  796 796 GLY GLY C . n 
B 2 91  GLY 91  797 797 GLY GLY C . n 
B 2 92  GLU 92  798 798 GLU GLU C . n 
B 2 93  SER 93  799 799 SER SER C . n 
B 2 94  GLU 94  800 800 GLU GLU C . n 
B 2 95  PHE 95  801 801 PHE PHE C . n 
B 2 96  SER 96  802 802 SER SER C . n 
B 2 97  ASN 97  803 803 ASN ASN C . n 
B 2 98  VAL 98  804 804 VAL VAL C . n 
B 2 99  MET 99  805 805 MET MET C . n 
B 2 100 ILE 100 806 806 ILE ILE C . n 
B 2 101 CYS 101 807 807 CYS CYS C . n 
B 2 102 GLU 102 808 808 GLU GLU C . n 
B 2 103 THR 103 809 809 THR THR C . n 
B 2 104 LYS 104 810 810 LYS LYS C . n 
B 2 105 ALA 105 811 811 ALA ALA C . n 
B 2 106 ARG 106 812 812 ARG ARG C . n 
B 2 107 LYS 107 813 813 LYS LYS C . n 
B 2 108 SER 108 814 ?   ?   ?   C . n 
B 2 109 SER 109 815 ?   ?   ?   C . n 
B 2 110 GLY 110 816 ?   ?   ?   C . n 
B 2 111 GLN 111 817 ?   ?   ?   C . n 
C 1 1   GLY 1   20  ?   ?   ?   A . n 
C 1 2   SER 2   21  ?   ?   ?   A . n 
C 1 3   GLY 3   22  ?   ?   ?   A . n 
C 1 4   PRO 4   23  ?   ?   ?   A . n 
C 1 5   GLY 5   24  ?   ?   ?   A . n 
C 1 6   PRO 6   25  ?   ?   ?   A . n 
C 1 7   GLY 7   26  ?   ?   ?   A . n 
C 1 8   ARG 8   27  ?   ?   ?   A . n 
C 1 9   GLY 9   28  ?   ?   ?   A . n 
C 1 10  PRO 10  29  ?   ?   ?   A . n 
C 1 11  VAL 11  30  ?   ?   ?   A . n 
C 1 12  GLY 12  31  ?   ?   ?   A . n 
C 1 13  ARG 13  32  ?   ?   ?   A . n 
C 1 14  ARG 14  33  ?   ?   ?   A . n 
C 1 15  ARG 15  34  ?   ?   ?   A . n 
C 1 16  TYR 16  35  ?   ?   ?   A . n 
C 1 17  ALA 17  36  ?   ?   ?   A . n 
C 1 18  ARG 18  37  ?   ?   ?   A . n 
C 1 19  LYS 19  38  ?   ?   ?   A . n 
C 1 20  GLN 20  39  39  GLN GLN A . n 
C 1 21  LEU 21  40  40  LEU LEU A . n 
C 1 22  VAL 22  41  41  VAL VAL A . n 
C 1 23  PRO 23  42  42  PRO PRO A . n 
C 1 24  LEU 24  43  43  LEU LEU A . n 
C 1 25  LEU 25  44  44  LEU LEU A . n 
C 1 26  TYR 26  45  45  TYR TYR A . n 
C 1 27  LYS 27  46  46  LYS LYS A . n 
C 1 28  GLN 28  47  47  GLN GLN A . n 
C 1 29  PHE 29  48  48  PHE PHE A . n 
C 1 30  VAL 30  49  49  VAL VAL A . n 
C 1 31  PRO 31  50  50  PRO PRO A . n 
C 1 32  GLY 32  51  51  GLY GLY A . n 
C 1 33  VAL 33  52  52  VAL VAL A . n 
C 1 34  PRO 34  53  53  PRO PRO A . n 
C 1 35  GLU 35  54  54  GLU GLU A . n 
C 1 36  ARG 36  55  55  ARG ARG A . n 
C 1 37  THR 37  56  56  THR THR A . n 
C 1 38  LEU 38  57  57  LEU LEU A . n 
C 1 39  GLY 39  58  58  GLY GLY A . n 
C 1 40  ALA 40  59  59  ALA ALA A . n 
C 1 41  SER 41  60  60  SER SER A . n 
C 1 42  GLY 42  61  61  GLY GLY A . n 
C 1 43  PRO 43  62  62  PRO PRO A . n 
C 1 44  ALA 44  63  63  ALA ALA A . n 
C 1 45  GLU 45  64  64  GLU GLU A . n 
C 1 46  GLY 46  65  65  GLY GLY A . n 
C 1 47  ARG 47  66  66  ARG ARG A . n 
C 1 48  VAL 48  67  67  VAL VAL A . n 
C 1 49  ALA 49  68  68  ALA ALA A . n 
C 1 50  ARG 50  69  69  ARG ARG A . n 
C 1 51  GLY 51  70  70  GLY GLY A . n 
C 1 52  SER 52  71  71  SER SER A . n 
C 1 53  GLU 53  72  72  GLU GLU A . n 
C 1 54  ARG 54  73  73  ARG ARG A . n 
C 1 55  PHE 55  74  74  PHE PHE A . n 
C 1 56  ARG 56  75  75  ARG ARG A . n 
C 1 57  ASP 57  76  76  ASP ASP A . n 
C 1 58  LEU 58  77  77  LEU LEU A . n 
C 1 59  VAL 59  78  78  VAL VAL A . n 
C 1 60  PRO 60  79  79  PRO PRO A . n 
C 1 61  ASN 61  80  80  ASN ASN A . n 
C 1 62  TYR 62  81  81  TYR TYR A . n 
C 1 63  ASN 63  82  82  ASN ASN A . n 
C 1 64  PRO 64  83  83  PRO PRO A . n 
C 1 65  ASP 65  84  84  ASP ASP A . n 
C 1 66  ILE 66  85  85  ILE ILE A . n 
C 1 67  ILE 67  86  86  ILE ILE A . n 
C 1 68  PHE 68  87  87  PHE PHE A . n 
C 1 69  LYS 69  88  88  LYS LYS A . n 
C 1 70  ASP 70  89  89  ASP ASP A . n 
C 1 71  GLU 71  90  90  GLU GLU A . n 
C 1 72  GLU 72  91  91  GLU GLU A . n 
C 1 73  ASN 73  92  92  ASN ASN A . n 
C 1 74  SER 74  93  93  SER SER A . n 
C 1 75  GLY 75  94  94  GLY GLY A . n 
C 1 76  ALA 76  95  95  ALA ALA A . n 
C 1 77  ASP 77  96  96  ASP ASP A . n 
C 1 78  ARG 78  97  97  ARG ARG A . n 
C 1 79  LEU 79  98  98  LEU LEU A . n 
C 1 80  MET 80  99  99  MET MET A . n 
C 1 81  THR 81  100 100 THR THR A . n 
C 1 82  GLU 82  101 101 GLU GLU A . n 
C 1 83  ARG 83  102 102 ARG ARG A . n 
C 1 84  CYS 84  103 103 CYS CYS A . n 
C 1 85  LYS 85  104 104 LYS LYS A . n 
C 1 86  GLU 86  105 105 GLU GLU A . n 
C 1 87  ARG 87  106 106 ARG ARG A . n 
C 1 88  VAL 88  107 107 VAL VAL A . n 
C 1 89  ASN 89  108 108 ASN ASN A . n 
C 1 90  ALA 90  109 109 ALA ALA A . n 
C 1 91  LEU 91  110 110 LEU LEU A . n 
C 1 92  ALA 92  111 111 ALA ALA A . n 
C 1 93  ILE 93  112 112 ILE ILE A . n 
C 1 94  ALA 94  113 113 ALA ALA A . n 
C 1 95  VAL 95  114 114 VAL VAL A . n 
C 1 96  MET 96  115 115 MET MET A . n 
C 1 97  ASN 97  116 116 ASN ASN A . n 
C 1 98  MET 98  117 117 MET MET A . n 
C 1 99  TRP 99  118 118 TRP TRP A . n 
C 1 100 PRO 100 119 119 PRO PRO A . n 
C 1 101 GLY 101 120 120 GLY GLY A . n 
C 1 102 VAL 102 121 121 VAL VAL A . n 
C 1 103 ARG 103 122 122 ARG ARG A . n 
C 1 104 LEU 104 123 123 LEU LEU A . n 
C 1 105 ARG 105 124 124 ARG ARG A . n 
C 1 106 VAL 106 125 125 VAL VAL A . n 
C 1 107 THR 107 126 126 THR THR A . n 
C 1 108 GLU 108 127 127 GLU GLU A . n 
C 1 109 GLY 109 128 128 GLY GLY A . n 
C 1 110 TRP 110 129 129 TRP TRP A . n 
C 1 111 ASP 111 130 130 ASP ASP A . n 
C 1 112 GLU 112 131 131 GLU GLU A . n 
C 1 113 ASP 113 132 132 ASP ASP A . n 
C 1 114 GLY 114 133 133 GLY GLY A . n 
C 1 115 HIS 115 134 134 HIS HIS A . n 
C 1 116 HIS 116 135 135 HIS HIS A . n 
C 1 117 ALA 117 136 136 ALA ALA A . n 
C 1 118 GLN 118 137 137 GLN GLN A . n 
C 1 119 ASP 119 138 138 ASP ASP A . n 
C 1 120 SER 120 139 139 SER SER A . n 
C 1 121 LEU 121 140 140 LEU LEU A . n 
C 1 122 HIS 122 141 141 HIS HIS A . n 
C 1 123 TYR 123 142 142 TYR TYR A . n 
C 1 124 GLU 124 143 143 GLU GLU A . n 
C 1 125 GLY 125 144 144 GLY GLY A . n 
C 1 126 ARG 126 145 145 ARG ARG A . n 
C 1 127 ALA 127 146 146 ALA ALA A . n 
C 1 128 LEU 128 147 147 LEU LEU A . n 
C 1 129 ASP 129 148 148 ASP ASP A . n 
C 1 130 ILE 130 149 149 ILE ILE A . n 
C 1 131 THR 131 150 150 THR THR A . n 
C 1 132 THR 132 151 151 THR THR A . n 
C 1 133 SER 133 152 152 SER SER A . n 
C 1 134 ASP 134 153 153 ASP ASP A . n 
C 1 135 ARG 135 154 154 ARG ARG A . n 
C 1 136 ASP 136 155 155 ASP ASP A . n 
C 1 137 ARG 137 156 156 ARG ARG A . n 
C 1 138 ASN 138 157 157 ASN ASN A . n 
C 1 139 LYS 139 158 158 LYS LYS A . n 
C 1 140 TYR 140 159 159 TYR TYR A . n 
C 1 141 GLY 141 160 160 GLY GLY A . n 
C 1 142 LEU 142 161 161 LEU LEU A . n 
C 1 143 LEU 143 162 162 LEU LEU A . n 
C 1 144 ALA 144 163 163 ALA ALA A . n 
C 1 145 ARG 145 164 164 ARG ARG A . n 
C 1 146 LEU 146 165 165 LEU LEU A . n 
C 1 147 ALA 147 166 166 ALA ALA A . n 
C 1 148 VAL 148 167 167 VAL VAL A . n 
C 1 149 GLU 149 168 168 GLU GLU A . n 
C 1 150 ALA 150 169 169 ALA ALA A . n 
C 1 151 GLY 151 170 170 GLY GLY A . n 
C 1 152 PHE 152 171 171 PHE PHE A . n 
C 1 153 ASP 153 172 172 ASP ASP A . n 
C 1 154 TRP 154 173 173 TRP TRP A . n 
C 1 155 VAL 155 174 174 VAL VAL A . n 
C 1 156 TYR 156 175 175 TYR TYR A . n 
C 1 157 TYR 157 176 176 TYR TYR A . n 
C 1 158 GLU 158 177 177 GLU GLU A . n 
C 1 159 SER 159 178 178 SER SER A . n 
C 1 160 ARG 160 179 179 ARG ARG A . n 
C 1 161 ASN 161 180 180 ASN ASN A . n 
C 1 162 HIS 162 181 181 HIS HIS A . n 
C 1 163 VAL 163 182 182 VAL VAL A . n 
C 1 164 HIS 164 183 183 HIS HIS A . n 
C 1 165 VAL 165 184 184 VAL VAL A . n 
C 1 166 SER 166 185 185 SER SER A . n 
C 1 167 VAL 167 186 186 VAL VAL A . n 
C 1 168 LYS 168 187 187 LYS LYS A . n 
C 1 169 ALA 169 188 188 ALA ALA A . n 
C 1 170 ASP 170 189 189 ASP ASP A . n 
D 2 1   GLY 1   707 ?   ?   ?   D . n 
D 2 2   SER 2   708 ?   ?   ?   D . n 
D 2 3   THR 3   709 ?   ?   ?   D . n 
D 2 4   GLU 4   710 710 GLU GLU D . n 
D 2 5   ARG 5   711 711 ARG ARG D . n 
D 2 6   PRO 6   712 712 PRO PRO D . n 
D 2 7   VAL 7   713 713 VAL VAL D . n 
D 2 8   ALA 8   714 714 ALA ALA D . n 
D 2 9   GLY 9   715 715 GLY GLY D . n 
D 2 10  PRO 10  716 716 PRO PRO D . n 
D 2 11  TYR 11  717 717 TYR TYR D . n 
D 2 12  ILE 12  718 718 ILE ILE D . n 
D 2 13  THR 13  719 719 THR THR D . n 
D 2 14  PHE 14  720 720 PHE PHE D . n 
D 2 15  THR 15  721 721 THR THR D . n 
D 2 16  ASP 16  722 722 ASP ASP D . n 
D 2 17  ALA 17  723 723 ALA ALA D . n 
D 2 18  VAL 18  724 724 VAL VAL D . n 
D 2 19  ASN 19  725 725 ASN ASN D . n 
D 2 20  GLU 20  726 726 GLU GLU D . n 
D 2 21  THR 21  727 727 THR THR D . n 
D 2 22  THR 22  728 728 THR THR D . n 
D 2 23  ILE 23  729 729 ILE ILE D . n 
D 2 24  MET 24  730 730 MET MET D . n 
D 2 25  LEU 25  731 731 LEU LEU D . n 
D 2 26  LYS 26  732 732 LYS LYS D . n 
D 2 27  TRP 27  733 733 TRP TRP D . n 
D 2 28  MET 28  734 734 MET MET D . n 
D 2 29  TYR 29  735 735 TYR TYR D . n 
D 2 30  ILE 30  736 736 ILE ILE D . n 
D 2 31  PRO 31  737 737 PRO PRO D . n 
D 2 32  ALA 32  738 ?   ?   ?   D . n 
D 2 33  SER 33  739 ?   ?   ?   D . n 
D 2 34  ASN 34  740 ?   ?   ?   D . n 
D 2 35  ASN 35  741 ?   ?   ?   D . n 
D 2 36  ASN 36  742 ?   ?   ?   D . n 
D 2 37  THR 37  743 743 THR THR D . n 
D 2 38  PRO 38  744 744 PRO PRO D . n 
D 2 39  ILE 39  745 745 ILE ILE D . n 
D 2 40  HIS 40  746 746 HIS HIS D . n 
D 2 41  GLY 41  747 747 GLY GLY D . n 
D 2 42  PHE 42  748 748 PHE PHE D . n 
D 2 43  TYR 43  749 749 TYR TYR D . n 
D 2 44  ILE 44  750 750 ILE ILE D . n 
D 2 45  TYR 45  751 751 TYR TYR D . n 
D 2 46  TYR 46  752 752 TYR TYR D . n 
D 2 47  ARG 47  753 753 ARG ARG D . n 
D 2 48  PRO 48  754 754 PRO PRO D . n 
D 2 49  THR 49  755 755 THR THR D . n 
D 2 50  ASP 50  756 756 ASP ASP D . n 
D 2 51  SER 51  757 757 SER SER D . n 
D 2 52  ASP 52  758 758 ASP ASP D . n 
D 2 53  ASN 53  759 759 ASN ASN D . n 
D 2 54  ASP 54  760 760 ASP ASP D . n 
D 2 55  SER 55  761 761 SER SER D . n 
D 2 56  ASP 56  762 762 ASP ASP D . n 
D 2 57  TYR 57  763 763 TYR TYR D . n 
D 2 58  LYS 58  764 764 LYS LYS D . n 
D 2 59  LYS 59  765 765 LYS LYS D . n 
D 2 60  ASP 60  766 766 ASP ASP D . n 
D 2 61  MET 61  767 767 MET MET D . n 
D 2 62  VAL 62  768 768 VAL VAL D . n 
D 2 63  GLU 63  769 769 GLU GLU D . n 
D 2 64  GLY 64  770 770 GLY GLY D . n 
D 2 65  ASP 65  771 771 ASP ASP D . n 
D 2 66  LYS 66  772 772 LYS LYS D . n 
D 2 67  TYR 67  773 773 TYR TYR D . n 
D 2 68  TRP 68  774 774 TRP TRP D . n 
D 2 69  HIS 69  775 775 HIS HIS D . n 
D 2 70  SER 70  776 776 SER SER D . n 
D 2 71  ILE 71  777 777 ILE ILE D . n 
D 2 72  SER 72  778 778 SER SER D . n 
D 2 73  HIS 73  779 779 HIS HIS D . n 
D 2 74  LEU 74  780 780 LEU LEU D . n 
D 2 75  GLN 75  781 781 GLN GLN D . n 
D 2 76  PRO 76  782 782 PRO PRO D . n 
D 2 77  GLU 77  783 783 GLU GLU D . n 
D 2 78  THR 78  784 784 THR THR D . n 
D 2 79  SER 79  785 785 SER SER D . n 
D 2 80  TYR 80  786 786 TYR TYR D . n 
D 2 81  ASP 81  787 787 ASP ASP D . n 
D 2 82  ILE 82  788 788 ILE ILE D . n 
D 2 83  LYS 83  789 789 LYS LYS D . n 
D 2 84  MET 84  790 790 MET MET D . n 
D 2 85  GLN 85  791 791 GLN GLN D . n 
D 2 86  CYS 86  792 792 CYS CYS D . n 
D 2 87  PHE 87  793 793 PHE PHE D . n 
D 2 88  ASN 88  794 794 ASN ASN D . n 
D 2 89  GLU 89  795 795 GLU GLU D . n 
D 2 90  GLY 90  796 796 GLY GLY D . n 
D 2 91  GLY 91  797 797 GLY GLY D . n 
D 2 92  GLU 92  798 798 GLU GLU D . n 
D 2 93  SER 93  799 799 SER SER D . n 
D 2 94  GLU 94  800 800 GLU GLU D . n 
D 2 95  PHE 95  801 801 PHE PHE D . n 
D 2 96  SER 96  802 802 SER SER D . n 
D 2 97  ASN 97  803 803 ASN ASN D . n 
D 2 98  VAL 98  804 804 VAL VAL D . n 
D 2 99  MET 99  805 805 MET MET D . n 
D 2 100 ILE 100 806 806 ILE ILE D . n 
D 2 101 CYS 101 807 807 CYS CYS D . n 
D 2 102 GLU 102 808 808 GLU GLU D . n 
D 2 103 THR 103 809 809 THR THR D . n 
D 2 104 LYS 104 810 810 LYS LYS D . n 
D 2 105 ALA 105 811 811 ALA ALA D . n 
D 2 106 ARG 106 812 812 ARG ARG D . n 
D 2 107 LYS 107 813 813 LYS LYS D . n 
D 2 108 SER 108 814 ?   ?   ?   D . n 
D 2 109 SER 109 815 ?   ?   ?   D . n 
D 2 110 GLY 110 816 ?   ?   ?   D . n 
D 2 111 GLN 111 817 ?   ?   ?   D . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,G,L,M   
2 1 C,D,H,I,J,K,N,O 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1580  ? 
1 MORE         -52   ? 
1 'SSA (A^2)'  12280 ? 
2 'ABSA (A^2)' 1570  ? 
2 MORE         -52   ? 
2 'SSA (A^2)'  12200 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 B HOH 656 ? L HOH . 
2 1 B HOH 667 ? L HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   NE2 ? A HIS 122 ? B HIS 141 ? 1_555 ZN ? G ZN . ? B ZN 192 ? 1_555 OD1 ? A ASP 129 ? B ASP 148 ? 1_555 106.4 ? 
2   NE2 ? A HIS 122 ? B HIS 141 ? 1_555 ZN ? G ZN . ? B ZN 192 ? 1_555 ND1 ? A HIS 164 ? B HIS 183 ? 1_555 102.6 ? 
3   OD1 ? A ASP 129 ? B ASP 148 ? 1_555 ZN ? G ZN . ? B ZN 192 ? 1_555 ND1 ? A HIS 164 ? B HIS 183 ? 1_555 105.5 ? 
4   OD1 ? C ASP 129 ? A ASP 148 ? 1_555 ZN ? I ZN . ? A ZN 191 ? 1_555 ND1 ? C HIS 164 ? A HIS 183 ? 1_555 96.2  ? 
5   OD1 ? C ASP 129 ? A ASP 148 ? 1_555 ZN ? I ZN . ? A ZN 191 ? 1_555 NE2 ? C HIS 122 ? A HIS 141 ? 1_555 95.9  ? 
6   ND1 ? C HIS 164 ? A HIS 183 ? 1_555 ZN ? I ZN . ? A ZN 191 ? 1_555 NE2 ? C HIS 122 ? A HIS 141 ? 1_555 88.7  ? 
7   OD1 ? C ASP 129 ? A ASP 148 ? 1_555 ZN ? I ZN . ? A ZN 191 ? 1_555 O   ? N HOH .   ? A HOH 305 ? 1_555 164.8 ? 
8   ND1 ? C HIS 164 ? A HIS 183 ? 1_555 ZN ? I ZN . ? A ZN 191 ? 1_555 O   ? N HOH .   ? A HOH 305 ? 1_555 87.3  ? 
9   NE2 ? C HIS 122 ? A HIS 141 ? 1_555 ZN ? I ZN . ? A ZN 191 ? 1_555 O   ? N HOH .   ? A HOH 305 ? 1_555 99.0  ? 
10  OE2 ? C GLU 108 ? A GLU 127 ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 O   ? C THR 107 ? A THR 126 ? 1_555 87.3  ? 
11  OE2 ? C GLU 108 ? A GLU 127 ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OD2 ? C ASP 77  ? A ASP 96  ? 1_555 133.0 ? 
12  O   ? C THR 107 ? A THR 126 ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OD2 ? C ASP 77  ? A ASP 96  ? 1_555 83.9  ? 
13  OE2 ? C GLU 108 ? A GLU 127 ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OE2 ? C GLU 72  ? A GLU 91  ? 1_555 75.1  ? 
14  O   ? C THR 107 ? A THR 126 ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OE2 ? C GLU 72  ? A GLU 91  ? 1_555 160.9 ? 
15  OD2 ? C ASP 77  ? A ASP 96  ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OE2 ? C GLU 72  ? A GLU 91  ? 1_555 102.6 ? 
16  OE2 ? C GLU 108 ? A GLU 127 ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OE2 ? C GLU 71  ? A GLU 90  ? 1_555 85.1  ? 
17  O   ? C THR 107 ? A THR 126 ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OE2 ? C GLU 71  ? A GLU 90  ? 1_555 109.6 ? 
18  OD2 ? C ASP 77  ? A ASP 96  ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OE2 ? C GLU 71  ? A GLU 90  ? 1_555 141.1 ? 
19  OE2 ? C GLU 72  ? A GLU 91  ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OE2 ? C GLU 71  ? A GLU 90  ? 1_555 76.6  ? 
20  OE2 ? C GLU 108 ? A GLU 127 ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OE1 ? C GLU 71  ? A GLU 90  ? 1_555 132.1 ? 
21  O   ? C THR 107 ? A THR 126 ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OE1 ? C GLU 71  ? A GLU 90  ? 1_555 88.7  ? 
22  OD2 ? C ASP 77  ? A ASP 96  ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OE1 ? C GLU 71  ? A GLU 90  ? 1_555 93.8  ? 
23  OE2 ? C GLU 72  ? A GLU 91  ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OE1 ? C GLU 71  ? A GLU 90  ? 1_555 108.5 ? 
24  OE2 ? C GLU 71  ? A GLU 90  ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OE1 ? C GLU 71  ? A GLU 90  ? 1_555 51.9  ? 
25  OE2 ? C GLU 108 ? A GLU 127 ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OD1 ? C ASP 77  ? A ASP 96  ? 1_555 83.2  ? 
26  O   ? C THR 107 ? A THR 126 ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OD1 ? C ASP 77  ? A ASP 96  ? 1_555 91.8  ? 
27  OD2 ? C ASP 77  ? A ASP 96  ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OD1 ? C ASP 77  ? A ASP 96  ? 1_555 51.2  ? 
28  OE2 ? C GLU 72  ? A GLU 91  ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OD1 ? C ASP 77  ? A ASP 96  ? 1_555 79.1  ? 
29  OE2 ? C GLU 71  ? A GLU 90  ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OD1 ? C ASP 77  ? A ASP 96  ? 1_555 155.1 ? 
30  OE1 ? C GLU 71  ? A GLU 90  ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OD1 ? C ASP 77  ? A ASP 96  ? 1_555 144.6 ? 
31  OE2 ? C GLU 108 ? A GLU 127 ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OE1 ? C GLU 72  ? A GLU 91  ? 1_555 122.7 ? 
32  O   ? C THR 107 ? A THR 126 ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OE1 ? C GLU 72  ? A GLU 91  ? 1_555 150.0 ? 
33  OD2 ? C ASP 77  ? A ASP 96  ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OE1 ? C GLU 72  ? A GLU 91  ? 1_555 73.7  ? 
34  OE2 ? C GLU 72  ? A GLU 91  ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OE1 ? C GLU 72  ? A GLU 91  ? 1_555 47.8  ? 
35  OE2 ? C GLU 71  ? A GLU 90  ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OE1 ? C GLU 72  ? A GLU 91  ? 1_555 78.4  ? 
36  OE1 ? C GLU 71  ? A GLU 90  ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OE1 ? C GLU 72  ? A GLU 91  ? 1_555 73.4  ? 
37  OD1 ? C ASP 77  ? A ASP 96  ? 1_555 CA ? J CA . ? A CA 192 ? 1_555 OE1 ? C GLU 72  ? A GLU 91  ? 1_555 89.6  ? 
38  OE2 ? A GLU 72  ? B GLU 91  ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 OD1 ? A ASP 111 ? B ASP 130 ? 1_555 158.9 ? 
39  OE2 ? A GLU 72  ? B GLU 91  ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 OD2 ? A ASP 113 ? B ASP 132 ? 1_555 85.7  ? 
40  OD1 ? A ASP 111 ? B ASP 130 ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 OD2 ? A ASP 113 ? B ASP 132 ? 1_555 83.0  ? 
41  OE2 ? A GLU 72  ? B GLU 91  ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 OE2 ? A GLU 108 ? B GLU 127 ? 1_555 71.7  ? 
42  OD1 ? A ASP 111 ? B ASP 130 ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 OE2 ? A GLU 108 ? B GLU 127 ? 1_555 127.1 ? 
43  OD2 ? A ASP 113 ? B ASP 132 ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 OE2 ? A GLU 108 ? B GLU 127 ? 1_555 140.2 ? 
44  OE2 ? A GLU 72  ? B GLU 91  ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 OE1 ? A GLU 108 ? B GLU 127 ? 1_555 120.5 ? 
45  OD1 ? A ASP 111 ? B ASP 130 ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 OE1 ? A GLU 108 ? B GLU 127 ? 1_555 78.6  ? 
46  OD2 ? A ASP 113 ? B ASP 132 ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 OE1 ? A GLU 108 ? B GLU 127 ? 1_555 140.9 ? 
47  OE2 ? A GLU 108 ? B GLU 127 ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 OE1 ? A GLU 108 ? B GLU 127 ? 1_555 48.9  ? 
48  OE2 ? A GLU 72  ? B GLU 91  ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 O   ? L HOH .   ? B HOH 15  ? 1_555 75.5  ? 
49  OD1 ? A ASP 111 ? B ASP 130 ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 O   ? L HOH .   ? B HOH 15  ? 1_555 100.1 ? 
50  OD2 ? A ASP 113 ? B ASP 132 ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 O   ? L HOH .   ? B HOH 15  ? 1_555 134.5 ? 
51  OE2 ? A GLU 108 ? B GLU 127 ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 O   ? L HOH .   ? B HOH 15  ? 1_555 71.6  ? 
52  OE1 ? A GLU 108 ? B GLU 127 ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 O   ? L HOH .   ? B HOH 15  ? 1_555 83.0  ? 
53  OE2 ? A GLU 72  ? B GLU 91  ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 O   ? L HOH .   ? B HOH 7   ? 1_555 82.9  ? 
54  OD1 ? A ASP 111 ? B ASP 130 ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 O   ? L HOH .   ? B HOH 7   ? 1_555 111.6 ? 
55  OD2 ? A ASP 113 ? B ASP 132 ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 O   ? L HOH .   ? B HOH 7   ? 1_555 76.8  ? 
56  OE2 ? A GLU 108 ? B GLU 127 ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 O   ? L HOH .   ? B HOH 7   ? 1_555 68.4  ? 
57  OE1 ? A GLU 108 ? B GLU 127 ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 O   ? L HOH .   ? B HOH 7   ? 1_555 78.4  ? 
58  O   ? L HOH .   ? B HOH 15  ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 O   ? L HOH .   ? B HOH 7   ? 1_555 138.8 ? 
59  OE2 ? A GLU 72  ? B GLU 91  ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 O   ? L HOH .   ? B HOH 209 ? 1_555 83.2  ? 
60  OD1 ? A ASP 111 ? B ASP 130 ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 O   ? L HOH .   ? B HOH 209 ? 1_555 75.7  ? 
61  OD2 ? A ASP 113 ? B ASP 132 ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 O   ? L HOH .   ? B HOH 209 ? 1_555 61.8  ? 
62  OE2 ? A GLU 108 ? B GLU 127 ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 O   ? L HOH .   ? B HOH 209 ? 1_555 142.1 ? 
63  OE1 ? A GLU 108 ? B GLU 127 ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 O   ? L HOH .   ? B HOH 209 ? 1_555 142.2 ? 
64  O   ? L HOH .   ? B HOH 15  ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 O   ? L HOH .   ? B HOH 209 ? 1_555 74.9  ? 
65  O   ? L HOH .   ? B HOH 7   ? 1_555 CA ? E CA . ? B CA 190 ? 1_555 O   ? L HOH .   ? B HOH 209 ? 1_555 137.1 ? 
66  O   ? A THR 107 ? B THR 126 ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OE2 ? A GLU 71  ? B GLU 90  ? 1_555 109.1 ? 
67  O   ? A THR 107 ? B THR 126 ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OE2 ? A GLU 108 ? B GLU 127 ? 1_555 84.8  ? 
68  OE2 ? A GLU 71  ? B GLU 90  ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OE2 ? A GLU 108 ? B GLU 127 ? 1_555 82.5  ? 
69  O   ? A THR 107 ? B THR 126 ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OD2 ? A ASP 77  ? B ASP 96  ? 1_555 83.8  ? 
70  OE2 ? A GLU 71  ? B GLU 90  ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OD2 ? A ASP 77  ? B ASP 96  ? 1_555 141.8 ? 
71  OE2 ? A GLU 108 ? B GLU 127 ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OD2 ? A ASP 77  ? B ASP 96  ? 1_555 135.3 ? 
72  O   ? A THR 107 ? B THR 126 ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OE1 ? A GLU 71  ? B GLU 90  ? 1_555 90.7  ? 
73  OE2 ? A GLU 71  ? B GLU 90  ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OE1 ? A GLU 71  ? B GLU 90  ? 1_555 52.6  ? 
74  OE2 ? A GLU 108 ? B GLU 127 ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OE1 ? A GLU 71  ? B GLU 90  ? 1_555 130.5 ? 
75  OD2 ? A ASP 77  ? B ASP 96  ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OE1 ? A GLU 71  ? B GLU 90  ? 1_555 92.8  ? 
76  O   ? A THR 107 ? B THR 126 ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OD1 ? A ASP 77  ? B ASP 96  ? 1_555 90.2  ? 
77  OE2 ? A GLU 71  ? B GLU 90  ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OD1 ? A ASP 77  ? B ASP 96  ? 1_555 155.8 ? 
78  OE2 ? A GLU 108 ? B GLU 127 ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OD1 ? A ASP 77  ? B ASP 96  ? 1_555 84.9  ? 
79  OD2 ? A ASP 77  ? B ASP 96  ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OD1 ? A ASP 77  ? B ASP 96  ? 1_555 52.1  ? 
80  OE1 ? A GLU 71  ? B GLU 90  ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OD1 ? A ASP 77  ? B ASP 96  ? 1_555 144.5 ? 
81  O   ? A THR 107 ? B THR 126 ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OE2 ? A GLU 72  ? B GLU 91  ? 1_555 155.3 ? 
82  OE2 ? A GLU 71  ? B GLU 90  ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OE2 ? A GLU 72  ? B GLU 91  ? 1_555 74.3  ? 
83  OE2 ? A GLU 108 ? B GLU 127 ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OE2 ? A GLU 72  ? B GLU 91  ? 1_555 71.2  ? 
84  OD2 ? A ASP 77  ? B ASP 96  ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OE2 ? A GLU 72  ? B GLU 91  ? 1_555 108.9 ? 
85  OE1 ? A GLU 71  ? B GLU 90  ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OE2 ? A GLU 72  ? B GLU 91  ? 1_555 109.1 ? 
86  OD1 ? A ASP 77  ? B ASP 96  ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OE2 ? A GLU 72  ? B GLU 91  ? 1_555 82.1  ? 
87  O   ? A THR 107 ? B THR 126 ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OE1 ? A GLU 72  ? B GLU 91  ? 1_555 155.0 ? 
88  OE2 ? A GLU 71  ? B GLU 90  ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OE1 ? A GLU 72  ? B GLU 91  ? 1_555 77.9  ? 
89  OE2 ? A GLU 108 ? B GLU 127 ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OE1 ? A GLU 72  ? B GLU 91  ? 1_555 120.1 ? 
90  OD2 ? A ASP 77  ? B ASP 96  ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OE1 ? A GLU 72  ? B GLU 91  ? 1_555 77.2  ? 
91  OE1 ? A GLU 71  ? B GLU 90  ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OE1 ? A GLU 72  ? B GLU 91  ? 1_555 74.4  ? 
92  OD1 ? A ASP 77  ? B ASP 96  ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OE1 ? A GLU 72  ? B GLU 91  ? 1_555 90.7  ? 
93  OE2 ? A GLU 72  ? B GLU 91  ? 1_555 CA ? F CA . ? B CA 191 ? 1_555 OE1 ? A GLU 72  ? B GLU 91  ? 1_555 49.1  ? 
94  OD1 ? C ASP 111 ? A ASP 130 ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 OE2 ? C GLU 72  ? A GLU 91  ? 1_555 157.2 ? 
95  OD1 ? C ASP 111 ? A ASP 130 ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 OD2 ? C ASP 113 ? A ASP 132 ? 1_555 81.2  ? 
96  OE2 ? C GLU 72  ? A GLU 91  ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 OD2 ? C ASP 113 ? A ASP 132 ? 1_555 88.5  ? 
97  OD1 ? C ASP 111 ? A ASP 130 ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 OE1 ? C GLU 108 ? A GLU 127 ? 1_555 82.3  ? 
98  OE2 ? C GLU 72  ? A GLU 91  ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 OE1 ? C GLU 108 ? A GLU 127 ? 1_555 116.9 ? 
99  OD2 ? C ASP 113 ? A ASP 132 ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 OE1 ? C GLU 108 ? A GLU 127 ? 1_555 143.1 ? 
100 OD1 ? C ASP 111 ? A ASP 130 ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 OE2 ? C GLU 108 ? A GLU 127 ? 1_555 129.7 ? 
101 OE2 ? C GLU 72  ? A GLU 91  ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 OE2 ? C GLU 108 ? A GLU 127 ? 1_555 68.9  ? 
102 OD2 ? C ASP 113 ? A ASP 132 ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 OE2 ? C GLU 108 ? A GLU 127 ? 1_555 142.1 ? 
103 OE1 ? C GLU 108 ? A GLU 127 ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 OE2 ? C GLU 108 ? A GLU 127 ? 1_555 48.1  ? 
104 OD1 ? C ASP 111 ? A ASP 130 ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 O   ? N HOH .   ? A HOH 16  ? 1_555 99.6  ? 
105 OE2 ? C GLU 72  ? A GLU 91  ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 O   ? N HOH .   ? A HOH 16  ? 1_555 73.3  ? 
106 OD2 ? C ASP 113 ? A ASP 132 ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 O   ? N HOH .   ? A HOH 16  ? 1_555 134.2 ? 
107 OE1 ? C GLU 108 ? A GLU 127 ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 O   ? N HOH .   ? A HOH 16  ? 1_555 81.1  ? 
108 OE2 ? C GLU 108 ? A GLU 127 ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 O   ? N HOH .   ? A HOH 16  ? 1_555 69.2  ? 
109 OD1 ? C ASP 111 ? A ASP 130 ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 O   ? N HOH .   ? A HOH 8   ? 1_555 110.2 ? 
110 OE2 ? C GLU 72  ? A GLU 91  ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 O   ? N HOH .   ? A HOH 8   ? 1_555 86.2  ? 
111 OD2 ? C ASP 113 ? A ASP 132 ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 O   ? N HOH .   ? A HOH 8   ? 1_555 74.5  ? 
112 OE1 ? C GLU 108 ? A GLU 127 ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 O   ? N HOH .   ? A HOH 8   ? 1_555 80.6  ? 
113 OE2 ? C GLU 108 ? A GLU 127 ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 O   ? N HOH .   ? A HOH 8   ? 1_555 74.0  ? 
114 O   ? N HOH .   ? A HOH 16  ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 O   ? N HOH .   ? A HOH 8   ? 1_555 142.3 ? 
115 OD1 ? C ASP 111 ? A ASP 130 ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 O   ? N HOH .   ? A HOH 14  ? 1_555 72.6  ? 
116 OE2 ? C GLU 72  ? A GLU 91  ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 O   ? N HOH .   ? A HOH 14  ? 1_555 84.6  ? 
117 OD2 ? C ASP 113 ? A ASP 132 ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 O   ? N HOH .   ? A HOH 14  ? 1_555 61.8  ? 
118 OE1 ? C GLU 108 ? A GLU 127 ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 O   ? N HOH .   ? A HOH 14  ? 1_555 141.2 ? 
119 OE2 ? C GLU 108 ? A GLU 127 ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 O   ? N HOH .   ? A HOH 14  ? 1_555 139.8 ? 
120 O   ? N HOH .   ? A HOH 16  ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 O   ? N HOH .   ? A HOH 14  ? 1_555 74.7  ? 
121 O   ? N HOH .   ? A HOH 8   ? 1_555 CA ? H CA . ? A CA 190 ? 1_555 O   ? N HOH .   ? A HOH 14  ? 1_555 135.5 ? 
122 O   ? C LYS 168 ? A LYS 187 ? 1_555 MG ? K MG . ? A MG 193 ? 1_555 OD1 ? C ASP 170 ? A ASP 189 ? 1_555 123.0 ? 
123 O   ? C LYS 168 ? A LYS 187 ? 1_555 MG ? K MG . ? A MG 193 ? 1_555 OG1 ? C THR 81  ? A THR 100 ? 1_555 136.2 ? 
124 OD1 ? C ASP 170 ? A ASP 189 ? 1_555 MG ? K MG . ? A MG 193 ? 1_555 OG1 ? C THR 81  ? A THR 100 ? 1_555 84.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-06-02 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                 ? 1 
PHASER   phasing           .                 ? 2 
PHENIX   refinement        '(phenix.refine)' ? 3 
HKL-2000 'data reduction'  .                 ? 4 
HKL-2000 'data scaling'    .                 ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS B 46  ? ? 75.69   -1.87   
2  1 ALA B 59  ? ? -104.85 -125.72 
3  1 ASN C 725 ? ? -162.68 -160.88 
4  1 ASN C 741 ? ? 70.12   37.44   
5  1 ASN C 794 ? ? -144.00 -155.28 
6  1 ARG C 812 ? ? -35.98  103.34  
7  1 LYS A 46  ? ? 72.95   -2.56   
8  1 ALA A 59  ? ? -101.80 -121.70 
9  1 SER A 93  ? ? -143.00 -12.48  
10 1 VAL D 713 ? ? -97.22  -75.51  
11 1 ASN D 725 ? ? -156.12 -159.28 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A GLN 39 ? CG  ? C GLN 20 CG  
2 1 Y 1 A GLN 39 ? CD  ? C GLN 20 CD  
3 1 Y 1 A GLN 39 ? OE1 ? C GLN 20 OE1 
4 1 Y 1 A GLN 39 ? NE2 ? C GLN 20 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B GLY 20  ? A GLY 1   
2  1 Y 1 B SER 21  ? A SER 2   
3  1 Y 1 B GLY 22  ? A GLY 3   
4  1 Y 1 B PRO 23  ? A PRO 4   
5  1 Y 1 B GLY 24  ? A GLY 5   
6  1 Y 1 B PRO 25  ? A PRO 6   
7  1 Y 1 B GLY 26  ? A GLY 7   
8  1 Y 1 B ARG 27  ? A ARG 8   
9  1 Y 1 B GLY 28  ? A GLY 9   
10 1 Y 1 B PRO 29  ? A PRO 10  
11 1 Y 1 B VAL 30  ? A VAL 11  
12 1 Y 1 B GLY 31  ? A GLY 12  
13 1 Y 1 B ARG 32  ? A ARG 13  
14 1 Y 1 B ARG 33  ? A ARG 14  
15 1 Y 1 B ARG 34  ? A ARG 15  
16 1 Y 1 B TYR 35  ? A TYR 16  
17 1 Y 1 B ALA 36  ? A ALA 17  
18 1 Y 1 B ARG 37  ? A ARG 18  
19 1 Y 1 B LYS 38  ? A LYS 19  
20 1 Y 1 C GLY 707 ? B GLY 1   
21 1 Y 1 C SER 708 ? B SER 2   
22 1 Y 1 C THR 709 ? B THR 3   
23 1 Y 1 C SER 814 ? B SER 108 
24 1 Y 1 C SER 815 ? B SER 109 
25 1 Y 1 C GLY 816 ? B GLY 110 
26 1 Y 1 C GLN 817 ? B GLN 111 
27 1 Y 1 A GLY 20  ? C GLY 1   
28 1 Y 1 A SER 21  ? C SER 2   
29 1 Y 1 A GLY 22  ? C GLY 3   
30 1 Y 1 A PRO 23  ? C PRO 4   
31 1 Y 1 A GLY 24  ? C GLY 5   
32 1 Y 1 A PRO 25  ? C PRO 6   
33 1 Y 1 A GLY 26  ? C GLY 7   
34 1 Y 1 A ARG 27  ? C ARG 8   
35 1 Y 1 A GLY 28  ? C GLY 9   
36 1 Y 1 A PRO 29  ? C PRO 10  
37 1 Y 1 A VAL 30  ? C VAL 11  
38 1 Y 1 A GLY 31  ? C GLY 12  
39 1 Y 1 A ARG 32  ? C ARG 13  
40 1 Y 1 A ARG 33  ? C ARG 14  
41 1 Y 1 A ARG 34  ? C ARG 15  
42 1 Y 1 A TYR 35  ? C TYR 16  
43 1 Y 1 A ALA 36  ? C ALA 17  
44 1 Y 1 A ARG 37  ? C ARG 18  
45 1 Y 1 A LYS 38  ? C LYS 19  
46 1 Y 1 D GLY 707 ? D GLY 1   
47 1 Y 1 D SER 708 ? D SER 2   
48 1 Y 1 D THR 709 ? D THR 3   
49 1 Y 1 D ALA 738 ? D ALA 32  
50 1 Y 1 D SER 739 ? D SER 33  
51 1 Y 1 D ASN 740 ? D ASN 34  
52 1 Y 1 D ASN 741 ? D ASN 35  
53 1 Y 1 D ASN 742 ? D ASN 36  
54 1 Y 1 D SER 814 ? D SER 108 
55 1 Y 1 D SER 815 ? D SER 109 
56 1 Y 1 D GLY 816 ? D GLY 110 
57 1 Y 1 D GLN 817 ? D GLN 111 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'CALCIUM ION'   CA  
4 'ZINC ION'      ZN  
5 'MAGNESIUM ION' MG  
6 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 CA  1   190 190 CA  CA  B . 
F 3 CA  1   191 191 CA  CA  B . 
G 4 ZN  1   192 192 ZN  ZN  B . 
H 3 CA  1   190 190 CA  CA  A . 
I 4 ZN  1   191 191 ZN  ZN  A . 
J 3 CA  1   192 192 CA  CA  A . 
K 5 MG  1   193 193 MG  MG  A . 
L 6 HOH 1   1   1   HOH HOH B . 
L 6 HOH 2   2   2   HOH HOH B . 
L 6 HOH 3   3   3   HOH HOH B . 
L 6 HOH 4   5   5   HOH HOH B . 
L 6 HOH 5   6   6   HOH HOH B . 
L 6 HOH 6   7   7   HOH HOH B . 
L 6 HOH 7   12  12  HOH HOH B . 
L 6 HOH 8   15  15  HOH HOH B . 
L 6 HOH 9   17  17  HOH HOH B . 
L 6 HOH 10  18  18  HOH HOH B . 
L 6 HOH 11  193 193 HOH HOH B . 
L 6 HOH 12  194 194 HOH HOH B . 
L 6 HOH 13  195 195 HOH HOH B . 
L 6 HOH 14  196 22  HOH HOH B . 
L 6 HOH 15  197 197 HOH HOH B . 
L 6 HOH 16  198 24  HOH HOH B . 
L 6 HOH 17  199 199 HOH HOH B . 
L 6 HOH 18  200 200 HOH HOH B . 
L 6 HOH 19  201 201 HOH HOH B . 
L 6 HOH 20  202 26  HOH HOH B . 
L 6 HOH 21  203 33  HOH HOH B . 
L 6 HOH 22  204 35  HOH HOH B . 
L 6 HOH 23  205 36  HOH HOH B . 
L 6 HOH 24  206 206 HOH HOH B . 
L 6 HOH 25  207 37  HOH HOH B . 
L 6 HOH 26  208 39  HOH HOH B . 
L 6 HOH 27  209 43  HOH HOH B . 
L 6 HOH 28  210 46  HOH HOH B . 
L 6 HOH 29  211 47  HOH HOH B . 
L 6 HOH 30  212 50  HOH HOH B . 
L 6 HOH 31  213 213 HOH HOH B . 
L 6 HOH 32  214 53  HOH HOH B . 
L 6 HOH 33  215 54  HOH HOH B . 
L 6 HOH 34  216 55  HOH HOH B . 
L 6 HOH 35  217 217 HOH HOH B . 
L 6 HOH 36  218 218 HOH HOH B . 
L 6 HOH 37  219 57  HOH HOH B . 
L 6 HOH 38  220 59  HOH HOH B . 
L 6 HOH 39  221 221 HOH HOH B . 
L 6 HOH 40  222 61  HOH HOH B . 
L 6 HOH 41  223 62  HOH HOH B . 
L 6 HOH 42  224 63  HOH HOH B . 
L 6 HOH 43  225 64  HOH HOH B . 
L 6 HOH 44  226 226 HOH HOH B . 
L 6 HOH 45  227 227 HOH HOH B . 
L 6 HOH 46  228 65  HOH HOH B . 
L 6 HOH 47  229 229 HOH HOH B . 
L 6 HOH 48  230 66  HOH HOH B . 
L 6 HOH 49  231 231 HOH HOH B . 
L 6 HOH 50  232 232 HOH HOH B . 
L 6 HOH 51  233 69  HOH HOH B . 
L 6 HOH 52  234 234 HOH HOH B . 
L 6 HOH 53  235 235 HOH HOH B . 
L 6 HOH 54  236 70  HOH HOH B . 
L 6 HOH 55  237 237 HOH HOH B . 
L 6 HOH 56  238 71  HOH HOH B . 
L 6 HOH 57  239 75  HOH HOH B . 
L 6 HOH 58  240 90  HOH HOH B . 
L 6 HOH 59  241 92  HOH HOH B . 
L 6 HOH 60  242 94  HOH HOH B . 
L 6 HOH 61  243 97  HOH HOH B . 
L 6 HOH 62  244 98  HOH HOH B . 
L 6 HOH 63  245 100 HOH HOH B . 
L 6 HOH 64  246 104 HOH HOH B . 
L 6 HOH 65  247 108 HOH HOH B . 
L 6 HOH 66  248 248 HOH HOH B . 
L 6 HOH 67  249 109 HOH HOH B . 
L 6 HOH 68  250 115 HOH HOH B . 
L 6 HOH 69  251 117 HOH HOH B . 
L 6 HOH 70  252 252 HOH HOH B . 
L 6 HOH 71  253 118 HOH HOH B . 
L 6 HOH 72  254 121 HOH HOH B . 
L 6 HOH 73  255 131 HOH HOH B . 
L 6 HOH 74  256 132 HOH HOH B . 
L 6 HOH 75  257 257 HOH HOH B . 
L 6 HOH 76  258 134 HOH HOH B . 
L 6 HOH 77  259 136 HOH HOH B . 
L 6 HOH 78  260 260 HOH HOH B . 
L 6 HOH 79  261 137 HOH HOH B . 
L 6 HOH 80  262 262 HOH HOH B . 
L 6 HOH 81  263 138 HOH HOH B . 
L 6 HOH 82  264 143 HOH HOH B . 
L 6 HOH 83  265 144 HOH HOH B . 
L 6 HOH 84  266 146 HOH HOH B . 
L 6 HOH 85  267 152 HOH HOH B . 
L 6 HOH 86  268 153 HOH HOH B . 
L 6 HOH 87  269 155 HOH HOH B . 
L 6 HOH 88  270 160 HOH HOH B . 
L 6 HOH 89  271 271 HOH HOH B . 
L 6 HOH 90  272 162 HOH HOH B . 
L 6 HOH 91  273 163 HOH HOH B . 
L 6 HOH 92  274 168 HOH HOH B . 
L 6 HOH 93  275 275 HOH HOH B . 
L 6 HOH 94  276 276 HOH HOH B . 
L 6 HOH 95  277 172 HOH HOH B . 
L 6 HOH 96  278 278 HOH HOH B . 
L 6 HOH 97  279 173 HOH HOH B . 
L 6 HOH 98  280 174 HOH HOH B . 
L 6 HOH 99  281 175 HOH HOH B . 
L 6 HOH 100 282 179 HOH HOH B . 
L 6 HOH 101 283 283 HOH HOH B . 
L 6 HOH 102 284 284 HOH HOH B . 
L 6 HOH 103 285 181 HOH HOH B . 
L 6 HOH 104 286 183 HOH HOH B . 
L 6 HOH 105 287 184 HOH HOH B . 
L 6 HOH 106 288 190 HOH HOH B . 
L 6 HOH 107 289 192 HOH HOH B . 
L 6 HOH 108 290 287 HOH HOH B . 
L 6 HOH 109 291 291 HOH HOH B . 
L 6 HOH 110 294 294 HOH HOH B . 
L 6 HOH 111 298 298 HOH HOH B . 
L 6 HOH 112 299 299 HOH HOH B . 
L 6 HOH 113 303 303 HOH HOH B . 
L 6 HOH 114 304 304 HOH HOH B . 
L 6 HOH 115 305 305 HOH HOH B . 
L 6 HOH 116 307 307 HOH HOH B . 
L 6 HOH 117 312 312 HOH HOH B . 
L 6 HOH 118 315 315 HOH HOH B . 
L 6 HOH 119 319 319 HOH HOH B . 
L 6 HOH 120 323 323 HOH HOH B . 
L 6 HOH 121 324 324 HOH HOH B . 
L 6 HOH 122 325 325 HOH HOH B . 
L 6 HOH 123 330 330 HOH HOH B . 
L 6 HOH 124 332 332 HOH HOH B . 
L 6 HOH 125 337 337 HOH HOH B . 
L 6 HOH 126 339 339 HOH HOH B . 
L 6 HOH 127 340 340 HOH HOH B . 
L 6 HOH 128 342 342 HOH HOH B . 
L 6 HOH 129 343 343 HOH HOH B . 
L 6 HOH 130 347 347 HOH HOH B . 
L 6 HOH 131 349 349 HOH HOH B . 
L 6 HOH 132 351 351 HOH HOH B . 
L 6 HOH 133 354 354 HOH HOH B . 
L 6 HOH 134 358 358 HOH HOH B . 
L 6 HOH 135 359 359 HOH HOH B . 
L 6 HOH 136 360 360 HOH HOH B . 
L 6 HOH 137 364 364 HOH HOH B . 
L 6 HOH 138 366 366 HOH HOH B . 
L 6 HOH 139 369 369 HOH HOH B . 
L 6 HOH 140 371 371 HOH HOH B . 
L 6 HOH 141 374 374 HOH HOH B . 
L 6 HOH 142 376 376 HOH HOH B . 
L 6 HOH 143 378 378 HOH HOH B . 
L 6 HOH 144 379 379 HOH HOH B . 
L 6 HOH 145 381 381 HOH HOH B . 
L 6 HOH 146 382 382 HOH HOH B . 
L 6 HOH 147 387 387 HOH HOH B . 
L 6 HOH 148 388 388 HOH HOH B . 
L 6 HOH 149 390 390 HOH HOH B . 
L 6 HOH 150 394 394 HOH HOH B . 
L 6 HOH 151 396 396 HOH HOH B . 
L 6 HOH 152 400 400 HOH HOH B . 
L 6 HOH 153 401 401 HOH HOH B . 
L 6 HOH 154 403 403 HOH HOH B . 
L 6 HOH 155 405 405 HOH HOH B . 
L 6 HOH 156 411 411 HOH HOH B . 
L 6 HOH 157 417 417 HOH HOH B . 
L 6 HOH 158 418 418 HOH HOH B . 
L 6 HOH 159 420 420 HOH HOH B . 
L 6 HOH 160 422 422 HOH HOH B . 
L 6 HOH 161 429 429 HOH HOH B . 
L 6 HOH 162 432 432 HOH HOH B . 
L 6 HOH 163 433 433 HOH HOH B . 
L 6 HOH 164 437 437 HOH HOH B . 
L 6 HOH 165 439 439 HOH HOH B . 
L 6 HOH 166 443 443 HOH HOH B . 
L 6 HOH 167 452 452 HOH HOH B . 
L 6 HOH 168 453 453 HOH HOH B . 
L 6 HOH 169 456 456 HOH HOH B . 
L 6 HOH 170 457 457 HOH HOH B . 
L 6 HOH 171 460 460 HOH HOH B . 
L 6 HOH 172 463 463 HOH HOH B . 
L 6 HOH 173 465 465 HOH HOH B . 
L 6 HOH 174 470 470 HOH HOH B . 
L 6 HOH 175 474 474 HOH HOH B . 
L 6 HOH 176 477 477 HOH HOH B . 
L 6 HOH 177 479 479 HOH HOH B . 
L 6 HOH 178 481 481 HOH HOH B . 
L 6 HOH 179 482 482 HOH HOH B . 
L 6 HOH 180 484 484 HOH HOH B . 
L 6 HOH 181 485 485 HOH HOH B . 
L 6 HOH 182 488 488 HOH HOH B . 
L 6 HOH 183 490 490 HOH HOH B . 
L 6 HOH 184 491 491 HOH HOH B . 
L 6 HOH 185 493 493 HOH HOH B . 
L 6 HOH 186 495 495 HOH HOH B . 
L 6 HOH 187 506 506 HOH HOH B . 
L 6 HOH 188 508 508 HOH HOH B . 
L 6 HOH 189 509 509 HOH HOH B . 
L 6 HOH 190 510 510 HOH HOH B . 
L 6 HOH 191 511 511 HOH HOH B . 
L 6 HOH 192 512 512 HOH HOH B . 
L 6 HOH 193 515 515 HOH HOH B . 
L 6 HOH 194 516 516 HOH HOH B . 
L 6 HOH 195 517 517 HOH HOH B . 
L 6 HOH 196 520 520 HOH HOH B . 
L 6 HOH 197 521 521 HOH HOH B . 
L 6 HOH 198 522 522 HOH HOH B . 
L 6 HOH 199 523 523 HOH HOH B . 
L 6 HOH 200 526 526 HOH HOH B . 
L 6 HOH 201 527 527 HOH HOH B . 
L 6 HOH 202 529 529 HOH HOH B . 
L 6 HOH 203 530 530 HOH HOH B . 
L 6 HOH 204 534 534 HOH HOH B . 
L 6 HOH 205 536 536 HOH HOH B . 
L 6 HOH 206 542 542 HOH HOH B . 
L 6 HOH 207 557 557 HOH HOH B . 
L 6 HOH 208 561 561 HOH HOH B . 
L 6 HOH 209 563 563 HOH HOH B . 
L 6 HOH 210 572 572 HOH HOH B . 
L 6 HOH 211 576 576 HOH HOH B . 
L 6 HOH 212 586 586 HOH HOH B . 
L 6 HOH 213 590 590 HOH HOH B . 
L 6 HOH 214 591 591 HOH HOH B . 
L 6 HOH 215 592 592 HOH HOH B . 
L 6 HOH 216 601 601 HOH HOH B . 
L 6 HOH 217 607 607 HOH HOH B . 
L 6 HOH 218 609 609 HOH HOH B . 
L 6 HOH 219 613 613 HOH HOH B . 
L 6 HOH 220 616 616 HOH HOH B . 
L 6 HOH 221 618 618 HOH HOH B . 
L 6 HOH 222 627 627 HOH HOH B . 
L 6 HOH 223 631 631 HOH HOH B . 
L 6 HOH 224 632 632 HOH HOH B . 
L 6 HOH 225 633 633 HOH HOH B . 
L 6 HOH 226 640 640 HOH HOH B . 
L 6 HOH 227 645 645 HOH HOH B . 
L 6 HOH 228 646 646 HOH HOH B . 
L 6 HOH 229 648 648 HOH HOH B . 
L 6 HOH 230 652 652 HOH HOH B . 
L 6 HOH 231 656 656 HOH HOH B . 
L 6 HOH 232 660 660 HOH HOH B . 
L 6 HOH 233 663 663 HOH HOH B . 
L 6 HOH 234 664 664 HOH HOH B . 
L 6 HOH 235 667 667 HOH HOH B . 
L 6 HOH 236 668 668 HOH HOH B . 
L 6 HOH 237 670 670 HOH HOH B . 
L 6 HOH 238 673 673 HOH HOH B . 
L 6 HOH 239 679 679 HOH HOH B . 
L 6 HOH 240 680 680 HOH HOH B . 
L 6 HOH 241 690 690 HOH HOH B . 
L 6 HOH 242 693 693 HOH HOH B . 
L 6 HOH 243 695 695 HOH HOH B . 
L 6 HOH 244 703 703 HOH HOH B . 
L 6 HOH 245 712 712 HOH HOH B . 
L 6 HOH 246 714 714 HOH HOH B . 
L 6 HOH 247 715 715 HOH HOH B . 
L 6 HOH 248 716 716 HOH HOH B . 
L 6 HOH 249 721 721 HOH HOH B . 
L 6 HOH 250 723 723 HOH HOH B . 
L 6 HOH 251 728 728 HOH HOH B . 
L 6 HOH 252 729 729 HOH HOH B . 
M 6 HOH 1   23  23  HOH HOH C . 
M 6 HOH 2   42  42  HOH HOH C . 
M 6 HOH 3   51  51  HOH HOH C . 
M 6 HOH 4   58  58  HOH HOH C . 
M 6 HOH 5   77  77  HOH HOH C . 
M 6 HOH 6   80  80  HOH HOH C . 
M 6 HOH 7   82  82  HOH HOH C . 
M 6 HOH 8   85  85  HOH HOH C . 
M 6 HOH 9   89  89  HOH HOH C . 
M 6 HOH 10  91  91  HOH HOH C . 
M 6 HOH 11  95  95  HOH HOH C . 
M 6 HOH 12  99  99  HOH HOH C . 
M 6 HOH 13  105 105 HOH HOH C . 
M 6 HOH 14  113 113 HOH HOH C . 
M 6 HOH 15  129 129 HOH HOH C . 
M 6 HOH 16  133 133 HOH HOH C . 
M 6 HOH 17  166 166 HOH HOH C . 
M 6 HOH 18  167 167 HOH HOH C . 
M 6 HOH 19  188 188 HOH HOH C . 
M 6 HOH 20  196 196 HOH HOH C . 
M 6 HOH 21  198 198 HOH HOH C . 
M 6 HOH 22  203 203 HOH HOH C . 
M 6 HOH 23  222 222 HOH HOH C . 
M 6 HOH 24  224 224 HOH HOH C . 
M 6 HOH 25  225 225 HOH HOH C . 
M 6 HOH 26  236 236 HOH HOH C . 
M 6 HOH 27  238 238 HOH HOH C . 
M 6 HOH 28  245 245 HOH HOH C . 
M 6 HOH 29  246 246 HOH HOH C . 
M 6 HOH 30  253 253 HOH HOH C . 
M 6 HOH 31  255 255 HOH HOH C . 
M 6 HOH 32  263 263 HOH HOH C . 
M 6 HOH 33  270 270 HOH HOH C . 
M 6 HOH 34  273 273 HOH HOH C . 
M 6 HOH 35  277 277 HOH HOH C . 
M 6 HOH 36  292 292 HOH HOH C . 
M 6 HOH 37  300 300 HOH HOH C . 
M 6 HOH 38  301 301 HOH HOH C . 
M 6 HOH 39  309 309 HOH HOH C . 
M 6 HOH 40  311 311 HOH HOH C . 
M 6 HOH 41  338 338 HOH HOH C . 
M 6 HOH 42  341 341 HOH HOH C . 
M 6 HOH 43  346 346 HOH HOH C . 
M 6 HOH 44  357 357 HOH HOH C . 
M 6 HOH 45  362 362 HOH HOH C . 
M 6 HOH 46  367 367 HOH HOH C . 
M 6 HOH 47  380 380 HOH HOH C . 
M 6 HOH 48  384 384 HOH HOH C . 
M 6 HOH 49  391 391 HOH HOH C . 
M 6 HOH 50  397 397 HOH HOH C . 
M 6 HOH 51  404 404 HOH HOH C . 
M 6 HOH 52  406 406 HOH HOH C . 
M 6 HOH 53  408 408 HOH HOH C . 
M 6 HOH 54  409 409 HOH HOH C . 
M 6 HOH 55  410 410 HOH HOH C . 
M 6 HOH 56  413 413 HOH HOH C . 
M 6 HOH 57  419 419 HOH HOH C . 
M 6 HOH 58  425 425 HOH HOH C . 
M 6 HOH 59  430 430 HOH HOH C . 
M 6 HOH 60  434 434 HOH HOH C . 
M 6 HOH 61  436 436 HOH HOH C . 
M 6 HOH 62  445 445 HOH HOH C . 
M 6 HOH 63  450 450 HOH HOH C . 
M 6 HOH 64  451 451 HOH HOH C . 
M 6 HOH 65  473 473 HOH HOH C . 
M 6 HOH 66  476 476 HOH HOH C . 
M 6 HOH 67  501 501 HOH HOH C . 
M 6 HOH 68  502 502 HOH HOH C . 
M 6 HOH 69  503 503 HOH HOH C . 
M 6 HOH 70  550 550 HOH HOH C . 
M 6 HOH 71  554 554 HOH HOH C . 
M 6 HOH 72  577 577 HOH HOH C . 
M 6 HOH 73  578 578 HOH HOH C . 
M 6 HOH 74  579 579 HOH HOH C . 
M 6 HOH 75  582 582 HOH HOH C . 
M 6 HOH 76  589 589 HOH HOH C . 
M 6 HOH 77  593 593 HOH HOH C . 
M 6 HOH 78  594 594 HOH HOH C . 
M 6 HOH 79  595 595 HOH HOH C . 
M 6 HOH 80  596 596 HOH HOH C . 
M 6 HOH 81  598 598 HOH HOH C . 
M 6 HOH 82  602 602 HOH HOH C . 
M 6 HOH 83  605 605 HOH HOH C . 
M 6 HOH 84  614 614 HOH HOH C . 
M 6 HOH 85  623 623 HOH HOH C . 
M 6 HOH 86  625 625 HOH HOH C . 
M 6 HOH 87  630 630 HOH HOH C . 
M 6 HOH 88  650 650 HOH HOH C . 
M 6 HOH 89  657 657 HOH HOH C . 
M 6 HOH 90  662 662 HOH HOH C . 
M 6 HOH 91  666 666 HOH HOH C . 
M 6 HOH 92  685 685 HOH HOH C . 
M 6 HOH 93  689 689 HOH HOH C . 
M 6 HOH 94  818 707 HOH HOH C . 
M 6 HOH 95  819 713 HOH HOH C . 
M 6 HOH 96  820 717 HOH HOH C . 
M 6 HOH 97  821 722 HOH HOH C . 
M 6 HOH 98  822 724 HOH HOH C . 
M 6 HOH 99  823 732 HOH HOH C . 
N 6 HOH 1   8   8   HOH HOH A . 
N 6 HOH 2   9   9   HOH HOH A . 
N 6 HOH 3   10  10  HOH HOH A . 
N 6 HOH 4   13  13  HOH HOH A . 
N 6 HOH 5   14  14  HOH HOH A . 
N 6 HOH 6   16  16  HOH HOH A . 
N 6 HOH 7   19  19  HOH HOH A . 
N 6 HOH 8   194 20  HOH HOH A . 
N 6 HOH 9   195 21  HOH HOH A . 
N 6 HOH 10  196 25  HOH HOH A . 
N 6 HOH 11  197 28  HOH HOH A . 
N 6 HOH 12  198 29  HOH HOH A . 
N 6 HOH 13  199 30  HOH HOH A . 
N 6 HOH 14  200 31  HOH HOH A . 
N 6 HOH 15  201 34  HOH HOH A . 
N 6 HOH 16  202 202 HOH HOH A . 
N 6 HOH 17  203 38  HOH HOH A . 
N 6 HOH 18  204 204 HOH HOH A . 
N 6 HOH 19  205 205 HOH HOH A . 
N 6 HOH 20  206 40  HOH HOH A . 
N 6 HOH 21  207 207 HOH HOH A . 
N 6 HOH 22  208 208 HOH HOH A . 
N 6 HOH 23  209 41  HOH HOH A . 
N 6 HOH 24  210 210 HOH HOH A . 
N 6 HOH 25  211 211 HOH HOH A . 
N 6 HOH 26  212 48  HOH HOH A . 
N 6 HOH 27  213 49  HOH HOH A . 
N 6 HOH 28  214 52  HOH HOH A . 
N 6 HOH 29  215 56  HOH HOH A . 
N 6 HOH 30  216 216 HOH HOH A . 
N 6 HOH 31  217 60  HOH HOH A . 
N 6 HOH 32  218 68  HOH HOH A . 
N 6 HOH 33  219 219 HOH HOH A . 
N 6 HOH 34  220 220 HOH HOH A . 
N 6 HOH 35  221 73  HOH HOH A . 
N 6 HOH 36  222 74  HOH HOH A . 
N 6 HOH 37  223 223 HOH HOH A . 
N 6 HOH 38  224 78  HOH HOH A . 
N 6 HOH 39  225 79  HOH HOH A . 
N 6 HOH 40  226 81  HOH HOH A . 
N 6 HOH 41  227 83  HOH HOH A . 
N 6 HOH 42  228 228 HOH HOH A . 
N 6 HOH 43  229 84  HOH HOH A . 
N 6 HOH 44  230 230 HOH HOH A . 
N 6 HOH 45  231 86  HOH HOH A . 
N 6 HOH 46  232 88  HOH HOH A . 
N 6 HOH 47  233 233 HOH HOH A . 
N 6 HOH 48  234 96  HOH HOH A . 
N 6 HOH 49  235 101 HOH HOH A . 
N 6 HOH 50  236 102 HOH HOH A . 
N 6 HOH 51  237 106 HOH HOH A . 
N 6 HOH 52  238 107 HOH HOH A . 
N 6 HOH 53  239 239 HOH HOH A . 
N 6 HOH 54  240 240 HOH HOH A . 
N 6 HOH 55  241 110 HOH HOH A . 
N 6 HOH 56  242 242 HOH HOH A . 
N 6 HOH 57  243 243 HOH HOH A . 
N 6 HOH 58  244 111 HOH HOH A . 
N 6 HOH 59  245 112 HOH HOH A . 
N 6 HOH 60  246 114 HOH HOH A . 
N 6 HOH 61  247 247 HOH HOH A . 
N 6 HOH 62  248 116 HOH HOH A . 
N 6 HOH 63  249 249 HOH HOH A . 
N 6 HOH 64  250 250 HOH HOH A . 
N 6 HOH 65  251 251 HOH HOH A . 
N 6 HOH 66  252 120 HOH HOH A . 
N 6 HOH 67  253 122 HOH HOH A . 
N 6 HOH 68  254 254 HOH HOH A . 
N 6 HOH 69  255 123 HOH HOH A . 
N 6 HOH 70  256 256 HOH HOH A . 
N 6 HOH 71  257 124 HOH HOH A . 
N 6 HOH 72  258 258 HOH HOH A . 
N 6 HOH 73  259 259 HOH HOH A . 
N 6 HOH 74  260 125 HOH HOH A . 
N 6 HOH 75  261 126 HOH HOH A . 
N 6 HOH 76  262 127 HOH HOH A . 
N 6 HOH 77  263 128 HOH HOH A . 
N 6 HOH 78  264 264 HOH HOH A . 
N 6 HOH 79  265 265 HOH HOH A . 
N 6 HOH 80  266 130 HOH HOH A . 
N 6 HOH 81  267 267 HOH HOH A . 
N 6 HOH 82  268 268 HOH HOH A . 
N 6 HOH 83  269 135 HOH HOH A . 
N 6 HOH 84  270 139 HOH HOH A . 
N 6 HOH 85  271 140 HOH HOH A . 
N 6 HOH 86  272 272 HOH HOH A . 
N 6 HOH 87  273 142 HOH HOH A . 
N 6 HOH 88  274 274 HOH HOH A . 
N 6 HOH 89  275 145 HOH HOH A . 
N 6 HOH 90  276 148 HOH HOH A . 
N 6 HOH 91  277 149 HOH HOH A . 
N 6 HOH 92  278 150 HOH HOH A . 
N 6 HOH 93  279 279 HOH HOH A . 
N 6 HOH 94  280 280 HOH HOH A . 
N 6 HOH 95  281 154 HOH HOH A . 
N 6 HOH 96  282 282 HOH HOH A . 
N 6 HOH 97  283 156 HOH HOH A . 
N 6 HOH 98  284 157 HOH HOH A . 
N 6 HOH 99  285 158 HOH HOH A . 
N 6 HOH 100 286 286 HOH HOH A . 
N 6 HOH 101 288 288 HOH HOH A . 
N 6 HOH 102 289 289 HOH HOH A . 
N 6 HOH 103 290 290 HOH HOH A . 
N 6 HOH 104 291 159 HOH HOH A . 
N 6 HOH 105 292 161 HOH HOH A . 
N 6 HOH 106 293 293 HOH HOH A . 
N 6 HOH 107 294 165 HOH HOH A . 
N 6 HOH 108 295 295 HOH HOH A . 
N 6 HOH 109 296 296 HOH HOH A . 
N 6 HOH 110 297 297 HOH HOH A . 
N 6 HOH 111 298 170 HOH HOH A . 
N 6 HOH 112 299 171 HOH HOH A . 
N 6 HOH 113 300 176 HOH HOH A . 
N 6 HOH 114 301 177 HOH HOH A . 
N 6 HOH 115 302 182 HOH HOH A . 
N 6 HOH 116 303 185 HOH HOH A . 
N 6 HOH 117 304 186 HOH HOH A . 
N 6 HOH 118 305 187 HOH HOH A . 
N 6 HOH 119 306 306 HOH HOH A . 
N 6 HOH 120 307 189 HOH HOH A . 
N 6 HOH 121 308 308 HOH HOH A . 
N 6 HOH 122 309 191 HOH HOH A . 
N 6 HOH 123 316 316 HOH HOH A . 
N 6 HOH 124 317 317 HOH HOH A . 
N 6 HOH 125 318 318 HOH HOH A . 
N 6 HOH 126 322 322 HOH HOH A . 
N 6 HOH 127 327 327 HOH HOH A . 
N 6 HOH 128 328 328 HOH HOH A . 
N 6 HOH 129 331 331 HOH HOH A . 
N 6 HOH 130 333 333 HOH HOH A . 
N 6 HOH 131 335 335 HOH HOH A . 
N 6 HOH 132 336 336 HOH HOH A . 
N 6 HOH 133 344 344 HOH HOH A . 
N 6 HOH 134 348 348 HOH HOH A . 
N 6 HOH 135 350 350 HOH HOH A . 
N 6 HOH 136 355 355 HOH HOH A . 
N 6 HOH 137 363 363 HOH HOH A . 
N 6 HOH 138 365 365 HOH HOH A . 
N 6 HOH 139 370 370 HOH HOH A . 
N 6 HOH 140 372 372 HOH HOH A . 
N 6 HOH 141 375 375 HOH HOH A . 
N 6 HOH 142 383 383 HOH HOH A . 
N 6 HOH 143 385 385 HOH HOH A . 
N 6 HOH 144 386 386 HOH HOH A . 
N 6 HOH 145 389 389 HOH HOH A . 
N 6 HOH 146 392 392 HOH HOH A . 
N 6 HOH 147 393 393 HOH HOH A . 
N 6 HOH 148 395 395 HOH HOH A . 
N 6 HOH 149 399 399 HOH HOH A . 
N 6 HOH 150 407 407 HOH HOH A . 
N 6 HOH 151 412 412 HOH HOH A . 
N 6 HOH 152 414 414 HOH HOH A . 
N 6 HOH 153 416 416 HOH HOH A . 
N 6 HOH 154 421 421 HOH HOH A . 
N 6 HOH 155 423 423 HOH HOH A . 
N 6 HOH 156 424 424 HOH HOH A . 
N 6 HOH 157 426 426 HOH HOH A . 
N 6 HOH 158 431 431 HOH HOH A . 
N 6 HOH 159 438 438 HOH HOH A . 
N 6 HOH 160 440 440 HOH HOH A . 
N 6 HOH 161 442 442 HOH HOH A . 
N 6 HOH 162 446 446 HOH HOH A . 
N 6 HOH 163 447 447 HOH HOH A . 
N 6 HOH 164 448 448 HOH HOH A . 
N 6 HOH 165 449 449 HOH HOH A . 
N 6 HOH 166 454 454 HOH HOH A . 
N 6 HOH 167 458 458 HOH HOH A . 
N 6 HOH 168 459 459 HOH HOH A . 
N 6 HOH 169 466 466 HOH HOH A . 
N 6 HOH 170 468 468 HOH HOH A . 
N 6 HOH 171 469 469 HOH HOH A . 
N 6 HOH 172 475 475 HOH HOH A . 
N 6 HOH 173 489 489 HOH HOH A . 
N 6 HOH 174 492 492 HOH HOH A . 
N 6 HOH 175 497 497 HOH HOH A . 
N 6 HOH 176 498 498 HOH HOH A . 
N 6 HOH 177 500 500 HOH HOH A . 
N 6 HOH 178 504 504 HOH HOH A . 
N 6 HOH 179 507 507 HOH HOH A . 
N 6 HOH 180 513 513 HOH HOH A . 
N 6 HOH 181 514 514 HOH HOH A . 
N 6 HOH 182 518 518 HOH HOH A . 
N 6 HOH 183 519 519 HOH HOH A . 
N 6 HOH 184 524 524 HOH HOH A . 
N 6 HOH 185 531 531 HOH HOH A . 
N 6 HOH 186 533 533 HOH HOH A . 
N 6 HOH 187 537 537 HOH HOH A . 
N 6 HOH 188 538 538 HOH HOH A . 
N 6 HOH 189 539 539 HOH HOH A . 
N 6 HOH 190 547 547 HOH HOH A . 
N 6 HOH 191 548 548 HOH HOH A . 
N 6 HOH 192 555 555 HOH HOH A . 
N 6 HOH 193 564 564 HOH HOH A . 
N 6 HOH 194 565 565 HOH HOH A . 
N 6 HOH 195 566 566 HOH HOH A . 
N 6 HOH 196 571 571 HOH HOH A . 
N 6 HOH 197 575 575 HOH HOH A . 
N 6 HOH 198 580 580 HOH HOH A . 
N 6 HOH 199 583 583 HOH HOH A . 
N 6 HOH 200 584 584 HOH HOH A . 
N 6 HOH 201 585 585 HOH HOH A . 
N 6 HOH 202 587 587 HOH HOH A . 
N 6 HOH 203 588 588 HOH HOH A . 
N 6 HOH 204 597 597 HOH HOH A . 
N 6 HOH 205 599 599 HOH HOH A . 
N 6 HOH 206 600 600 HOH HOH A . 
N 6 HOH 207 606 606 HOH HOH A . 
N 6 HOH 208 610 610 HOH HOH A . 
N 6 HOH 209 611 611 HOH HOH A . 
N 6 HOH 210 612 612 HOH HOH A . 
N 6 HOH 211 620 620 HOH HOH A . 
N 6 HOH 212 626 626 HOH HOH A . 
N 6 HOH 213 628 628 HOH HOH A . 
N 6 HOH 214 639 639 HOH HOH A . 
N 6 HOH 215 642 642 HOH HOH A . 
N 6 HOH 216 651 651 HOH HOH A . 
N 6 HOH 217 654 654 HOH HOH A . 
N 6 HOH 218 655 655 HOH HOH A . 
N 6 HOH 219 665 665 HOH HOH A . 
N 6 HOH 220 675 675 HOH HOH A . 
N 6 HOH 221 677 677 HOH HOH A . 
N 6 HOH 222 678 678 HOH HOH A . 
N 6 HOH 223 682 682 HOH HOH A . 
N 6 HOH 224 684 684 HOH HOH A . 
N 6 HOH 225 692 692 HOH HOH A . 
N 6 HOH 226 696 696 HOH HOH A . 
N 6 HOH 227 699 699 HOH HOH A . 
N 6 HOH 228 700 700 HOH HOH A . 
N 6 HOH 229 701 701 HOH HOH A . 
N 6 HOH 230 702 702 HOH HOH A . 
N 6 HOH 231 704 704 HOH HOH A . 
N 6 HOH 232 708 708 HOH HOH A . 
N 6 HOH 233 709 709 HOH HOH A . 
N 6 HOH 234 710 710 HOH HOH A . 
N 6 HOH 235 711 711 HOH HOH A . 
N 6 HOH 236 719 719 HOH HOH A . 
N 6 HOH 237 726 726 HOH HOH A . 
N 6 HOH 238 727 727 HOH HOH A . 
N 6 HOH 239 731 731 HOH HOH A . 
O 6 HOH 1   4   4   HOH HOH D . 
O 6 HOH 2   11  11  HOH HOH D . 
O 6 HOH 3   27  27  HOH HOH D . 
O 6 HOH 4   32  32  HOH HOH D . 
O 6 HOH 5   44  44  HOH HOH D . 
O 6 HOH 6   45  45  HOH HOH D . 
O 6 HOH 7   67  67  HOH HOH D . 
O 6 HOH 8   72  72  HOH HOH D . 
O 6 HOH 9   76  76  HOH HOH D . 
O 6 HOH 10  87  87  HOH HOH D . 
O 6 HOH 11  93  93  HOH HOH D . 
O 6 HOH 12  103 103 HOH HOH D . 
O 6 HOH 13  119 119 HOH HOH D . 
O 6 HOH 14  141 141 HOH HOH D . 
O 6 HOH 15  147 147 HOH HOH D . 
O 6 HOH 16  151 151 HOH HOH D . 
O 6 HOH 17  164 164 HOH HOH D . 
O 6 HOH 18  169 169 HOH HOH D . 
O 6 HOH 19  178 178 HOH HOH D . 
O 6 HOH 20  180 180 HOH HOH D . 
O 6 HOH 21  209 209 HOH HOH D . 
O 6 HOH 22  212 212 HOH HOH D . 
O 6 HOH 23  214 214 HOH HOH D . 
O 6 HOH 24  215 215 HOH HOH D . 
O 6 HOH 25  241 241 HOH HOH D . 
O 6 HOH 26  244 244 HOH HOH D . 
O 6 HOH 27  261 261 HOH HOH D . 
O 6 HOH 28  266 266 HOH HOH D . 
O 6 HOH 29  269 269 HOH HOH D . 
O 6 HOH 30  281 281 HOH HOH D . 
O 6 HOH 31  285 285 HOH HOH D . 
O 6 HOH 32  302 302 HOH HOH D . 
O 6 HOH 33  310 310 HOH HOH D . 
O 6 HOH 34  313 313 HOH HOH D . 
O 6 HOH 35  320 320 HOH HOH D . 
O 6 HOH 36  321 321 HOH HOH D . 
O 6 HOH 37  326 326 HOH HOH D . 
O 6 HOH 38  329 329 HOH HOH D . 
O 6 HOH 39  334 334 HOH HOH D . 
O 6 HOH 40  345 345 HOH HOH D . 
O 6 HOH 41  352 352 HOH HOH D . 
O 6 HOH 42  356 356 HOH HOH D . 
O 6 HOH 43  361 361 HOH HOH D . 
O 6 HOH 44  368 368 HOH HOH D . 
O 6 HOH 45  373 373 HOH HOH D . 
O 6 HOH 46  377 377 HOH HOH D . 
O 6 HOH 47  398 398 HOH HOH D . 
O 6 HOH 48  402 402 HOH HOH D . 
O 6 HOH 49  427 427 HOH HOH D . 
O 6 HOH 50  428 428 HOH HOH D . 
O 6 HOH 51  435 435 HOH HOH D . 
O 6 HOH 52  441 441 HOH HOH D . 
O 6 HOH 53  444 444 HOH HOH D . 
O 6 HOH 54  455 455 HOH HOH D . 
O 6 HOH 55  461 461 HOH HOH D . 
O 6 HOH 56  462 462 HOH HOH D . 
O 6 HOH 57  464 464 HOH HOH D . 
O 6 HOH 58  467 467 HOH HOH D . 
O 6 HOH 59  471 471 HOH HOH D . 
O 6 HOH 60  472 472 HOH HOH D . 
O 6 HOH 61  483 483 HOH HOH D . 
O 6 HOH 62  487 487 HOH HOH D . 
O 6 HOH 63  496 496 HOH HOH D . 
O 6 HOH 64  499 499 HOH HOH D . 
O 6 HOH 65  505 505 HOH HOH D . 
O 6 HOH 66  525 525 HOH HOH D . 
O 6 HOH 67  528 528 HOH HOH D . 
O 6 HOH 68  532 532 HOH HOH D . 
O 6 HOH 69  535 535 HOH HOH D . 
O 6 HOH 70  540 540 HOH HOH D . 
O 6 HOH 71  541 541 HOH HOH D . 
O 6 HOH 72  543 543 HOH HOH D . 
O 6 HOH 73  544 544 HOH HOH D . 
O 6 HOH 74  545 545 HOH HOH D . 
O 6 HOH 75  546 546 HOH HOH D . 
O 6 HOH 76  549 549 HOH HOH D . 
O 6 HOH 77  551 551 HOH HOH D . 
O 6 HOH 78  552 552 HOH HOH D . 
O 6 HOH 79  553 553 HOH HOH D . 
O 6 HOH 80  556 556 HOH HOH D . 
O 6 HOH 81  559 559 HOH HOH D . 
O 6 HOH 82  562 562 HOH HOH D . 
O 6 HOH 83  568 568 HOH HOH D . 
O 6 HOH 84  570 570 HOH HOH D . 
O 6 HOH 85  573 573 HOH HOH D . 
O 6 HOH 86  574 574 HOH HOH D . 
O 6 HOH 87  581 581 HOH HOH D . 
O 6 HOH 88  604 604 HOH HOH D . 
O 6 HOH 89  615 615 HOH HOH D . 
O 6 HOH 90  617 617 HOH HOH D . 
O 6 HOH 91  619 619 HOH HOH D . 
O 6 HOH 92  621 621 HOH HOH D . 
O 6 HOH 93  622 622 HOH HOH D . 
O 6 HOH 94  624 624 HOH HOH D . 
O 6 HOH 95  629 629 HOH HOH D . 
O 6 HOH 96  634 634 HOH HOH D . 
O 6 HOH 97  635 635 HOH HOH D . 
O 6 HOH 98  636 636 HOH HOH D . 
O 6 HOH 99  637 637 HOH HOH D . 
O 6 HOH 100 638 638 HOH HOH D . 
O 6 HOH 101 641 641 HOH HOH D . 
O 6 HOH 102 643 643 HOH HOH D . 
O 6 HOH 103 647 647 HOH HOH D . 
O 6 HOH 104 653 653 HOH HOH D . 
O 6 HOH 105 658 658 HOH HOH D . 
O 6 HOH 106 659 659 HOH HOH D . 
O 6 HOH 107 669 669 HOH HOH D . 
O 6 HOH 108 671 671 HOH HOH D . 
O 6 HOH 109 672 672 HOH HOH D . 
O 6 HOH 110 674 674 HOH HOH D . 
O 6 HOH 111 676 676 HOH HOH D . 
O 6 HOH 112 683 683 HOH HOH D . 
O 6 HOH 113 686 686 HOH HOH D . 
O 6 HOH 114 687 687 HOH HOH D . 
O 6 HOH 115 688 688 HOH HOH D . 
O 6 HOH 116 691 691 HOH HOH D . 
O 6 HOH 117 694 694 HOH HOH D . 
O 6 HOH 118 705 705 HOH HOH D . 
O 6 HOH 119 706 706 HOH HOH D . 
O 6 HOH 120 818 730 HOH HOH D . 
#