data_3N1P
# 
_entry.id   3N1P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3N1P         
RCSB  RCSB059268   
WWPDB D_1000059268 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3d1m . unspecified 
PDB 3N1F . unspecified 
PDB 3N1G . unspecified 
PDB 3n1m . unspecified 
PDB 3n1o . unspecified 
PDB 3N1Q . unspecified 
PDB 3N1R . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3N1P 
_pdbx_database_status.recvd_initial_deposition_date   2010-05-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kavran, J.M.' 1 
'Leahy, D.J.'  2 
# 
_citation.id                        primary 
_citation.title                     'All mammalian hedgehog proteins interact with CDO and BOC in a conserved manner.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      2010 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20519495 
_citation.pdbx_database_id_DOI      10.1074/jbc.M110.131680 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kavran, J.M.'  1 
primary 'Ward, M.D.'    2 
primary 'Oladosu, O.O.' 3 
primary 'Mulepati, S.'  4 
primary 'Leahy, D.J.'   5 
# 
_cell.entry_id           3N1P 
_cell.length_a           38.913 
_cell.length_b           63.228 
_cell.length_c           106.312 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3N1P 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Indian hedgehog protein' 19122.406 1 ? ? 'N-terminal Domain' ? 
2 polymer     man 'Brother of CDO'          12736.038 1 ? ? 'Third FN3 domain'  ? 
3 non-polymer syn 'ZINC ION'                65.409    1 ? ? ?                   ? 
4 non-polymer syn 'CALCIUM ION'             40.078    2 ? ? ?                   ? 
5 water       nat water                     18.015    3 ? ? ?                   ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'IHH, HHG-2, Indian hedgehog protein N-product, Indian hedgehog protein C-product' 
2 'Protein BOC'                                                                      
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSGPGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMT
QRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKA
HVHCSVKSE
;
;GSGPGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMT
QRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKA
HVHCSVKSE
;
B ? 
2 'polypeptide(L)' no no 
;GSTERPVAGPYITFTDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDKYWHSISHLQPETSY
DIKMQCFNEGGESEFSNVMICETKARKSSGQ
;
;GSTERPVAGPYITFTDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDKYWHSISHLQPETSY
DIKMQCFNEGGESEFSNVMICETKARKSSGQ
;
C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   GLY n 
1 4   PRO n 
1 5   GLY n 
1 6   PRO n 
1 7   GLY n 
1 8   ARG n 
1 9   VAL n 
1 10  VAL n 
1 11  GLY n 
1 12  SER n 
1 13  ARG n 
1 14  ARG n 
1 15  ARG n 
1 16  PRO n 
1 17  PRO n 
1 18  ARG n 
1 19  LYS n 
1 20  LEU n 
1 21  VAL n 
1 22  PRO n 
1 23  LEU n 
1 24  ALA n 
1 25  TYR n 
1 26  LYS n 
1 27  GLN n 
1 28  PHE n 
1 29  SER n 
1 30  PRO n 
1 31  ASN n 
1 32  VAL n 
1 33  PRO n 
1 34  GLU n 
1 35  LYS n 
1 36  THR n 
1 37  LEU n 
1 38  GLY n 
1 39  ALA n 
1 40  SER n 
1 41  GLY n 
1 42  ARG n 
1 43  TYR n 
1 44  GLU n 
1 45  GLY n 
1 46  LYS n 
1 47  ILE n 
1 48  ALA n 
1 49  ARG n 
1 50  SER n 
1 51  SER n 
1 52  GLU n 
1 53  ARG n 
1 54  PHE n 
1 55  LYS n 
1 56  GLU n 
1 57  LEU n 
1 58  THR n 
1 59  PRO n 
1 60  ASN n 
1 61  TYR n 
1 62  ASN n 
1 63  PRO n 
1 64  ASP n 
1 65  ILE n 
1 66  ILE n 
1 67  PHE n 
1 68  LYS n 
1 69  ASP n 
1 70  GLU n 
1 71  GLU n 
1 72  ASN n 
1 73  THR n 
1 74  GLY n 
1 75  ALA n 
1 76  ASP n 
1 77  ARG n 
1 78  LEU n 
1 79  MET n 
1 80  THR n 
1 81  GLN n 
1 82  ARG n 
1 83  CYS n 
1 84  LYS n 
1 85  ASP n 
1 86  ARG n 
1 87  LEU n 
1 88  ASN n 
1 89  SER n 
1 90  LEU n 
1 91  ALA n 
1 92  ILE n 
1 93  SER n 
1 94  VAL n 
1 95  MET n 
1 96  ASN n 
1 97  GLN n 
1 98  TRP n 
1 99  PRO n 
1 100 GLY n 
1 101 VAL n 
1 102 LYS n 
1 103 LEU n 
1 104 ARG n 
1 105 VAL n 
1 106 THR n 
1 107 GLU n 
1 108 GLY n 
1 109 TRP n 
1 110 ASP n 
1 111 GLU n 
1 112 ASP n 
1 113 GLY n 
1 114 HIS n 
1 115 HIS n 
1 116 SER n 
1 117 GLU n 
1 118 GLU n 
1 119 SER n 
1 120 LEU n 
1 121 HIS n 
1 122 TYR n 
1 123 GLU n 
1 124 GLY n 
1 125 ARG n 
1 126 ALA n 
1 127 VAL n 
1 128 ASP n 
1 129 ILE n 
1 130 THR n 
1 131 THR n 
1 132 SER n 
1 133 ASP n 
1 134 ARG n 
1 135 ASP n 
1 136 ARG n 
1 137 ASN n 
1 138 LYS n 
1 139 TYR n 
1 140 GLY n 
1 141 LEU n 
1 142 LEU n 
1 143 ALA n 
1 144 ARG n 
1 145 LEU n 
1 146 ALA n 
1 147 VAL n 
1 148 GLU n 
1 149 ALA n 
1 150 GLY n 
1 151 PHE n 
1 152 ASP n 
1 153 TRP n 
1 154 VAL n 
1 155 TYR n 
1 156 TYR n 
1 157 GLU n 
1 158 SER n 
1 159 LYS n 
1 160 ALA n 
1 161 HIS n 
1 162 VAL n 
1 163 HIS n 
1 164 CYS n 
1 165 SER n 
1 166 VAL n 
1 167 LYS n 
1 168 SER n 
1 169 GLU n 
2 1   GLY n 
2 2   SER n 
2 3   THR n 
2 4   GLU n 
2 5   ARG n 
2 6   PRO n 
2 7   VAL n 
2 8   ALA n 
2 9   GLY n 
2 10  PRO n 
2 11  TYR n 
2 12  ILE n 
2 13  THR n 
2 14  PHE n 
2 15  THR n 
2 16  ASP n 
2 17  ALA n 
2 18  VAL n 
2 19  ASN n 
2 20  GLU n 
2 21  THR n 
2 22  THR n 
2 23  ILE n 
2 24  MET n 
2 25  LEU n 
2 26  LYS n 
2 27  TRP n 
2 28  MET n 
2 29  TYR n 
2 30  ILE n 
2 31  PRO n 
2 32  ALA n 
2 33  SER n 
2 34  ASN n 
2 35  ASN n 
2 36  ASN n 
2 37  THR n 
2 38  PRO n 
2 39  ILE n 
2 40  HIS n 
2 41  GLY n 
2 42  PHE n 
2 43  TYR n 
2 44  ILE n 
2 45  TYR n 
2 46  TYR n 
2 47  ARG n 
2 48  PRO n 
2 49  THR n 
2 50  ASP n 
2 51  SER n 
2 52  ASP n 
2 53  ASN n 
2 54  ASP n 
2 55  SER n 
2 56  ASP n 
2 57  TYR n 
2 58  LYS n 
2 59  LYS n 
2 60  ASP n 
2 61  MET n 
2 62  VAL n 
2 63  GLU n 
2 64  GLY n 
2 65  ASP n 
2 66  LYS n 
2 67  TYR n 
2 68  TRP n 
2 69  HIS n 
2 70  SER n 
2 71  ILE n 
2 72  SER n 
2 73  HIS n 
2 74  LEU n 
2 75  GLN n 
2 76  PRO n 
2 77  GLU n 
2 78  THR n 
2 79  SER n 
2 80  TYR n 
2 81  ASP n 
2 82  ILE n 
2 83  LYS n 
2 84  MET n 
2 85  GLN n 
2 86  CYS n 
2 87  PHE n 
2 88  ASN n 
2 89  GLU n 
2 90  GLY n 
2 91  GLY n 
2 92  GLU n 
2 93  SER n 
2 94  GLU n 
2 95  PHE n 
2 96  SER n 
2 97  ASN n 
2 98  VAL n 
2 99  MET n 
2 100 ILE n 
2 101 CYS n 
2 102 GLU n 
2 103 THR n 
2 104 LYS n 
2 105 ALA n 
2 106 ARG n 
2 107 LYS n 
2 108 SER n 
2 109 SER n 
2 110 GLY n 
2 111 GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? IHH                   ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human ? 'BOC, UNQ604/PRO1190' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP IHH_HUMAN Q14623 1 
;GPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCK
DRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHC
SVKSE
;
29  ? 
2 UNP BOC_HUMAN Q9BWV1 2 
;ERPVAGPYITFTDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDKYWHSISHLQPETSYDIK
MQCFNEGGESEFSNVMICETKARKSSGQ
;
710 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3N1P B 5 ? 169 ? Q14623 29  ? 193 ? 29  193 
2 2 3N1P C 4 ? 111 ? Q9BWV1 710 ? 817 ? 710 817 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3N1P GLY B 1 ? UNP Q14623 ? ? 'EXPRESSION TAG' 25  1 
1 3N1P SER B 2 ? UNP Q14623 ? ? 'EXPRESSION TAG' 26  2 
1 3N1P GLY B 3 ? UNP Q14623 ? ? 'EXPRESSION TAG' 27  3 
1 3N1P PRO B 4 ? UNP Q14623 ? ? 'EXPRESSION TAG' 28  4 
2 3N1P GLY C 1 ? UNP Q9BWV1 ? ? 'EXPRESSION TAG' 707 5 
2 3N1P SER C 2 ? UNP Q9BWV1 ? ? 'EXPRESSION TAG' 708 6 
2 3N1P THR C 3 ? UNP Q9BWV1 ? ? 'EXPRESSION TAG' 709 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          3N1P 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.05 
_exptl_crystal.density_percent_sol   40.08 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '15% PEG 3350, 100mM Ca(OAc), VAPOR DIFFUSION, temperature 298K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RIGAKU SATURN 944+' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-E SUPERBRIGHT' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3N1P 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             25 
_reflns.d_resolution_high            2.7 
_reflns.number_obs                   7209 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3N1P 
_refine.ls_number_reflns_obs                     6718 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.06 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             22.278 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    88.05 
_refine.ls_R_factor_obs                          0.2368 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2347 
_refine.ls_R_factor_R_free                       0.2787 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.66 
_refine.ls_number_reflns_R_free                  313 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            0.1370 
_refine.aniso_B[2][2]                            -5.1254 
_refine.aniso_B[3][3]                            4.9883 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.352 
_refine.solvent_model_param_bsol                 6.391 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            2.40 
_refine.pdbx_overall_phase_error                 26.13 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2042 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             3 
_refine_hist.number_atoms_total               2048 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        22.278 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.002  ? ? 2095 'X-RAY DIFFRACTION' ? 
f_angle_d          0.617  ? ? 2836 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 14.076 ? ? 765  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.046  ? ? 294  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 369  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.700  .       2925 0.2827 82.00 0.3330 . . 138 . . . . 
'X-RAY DIFFRACTION' . 3.4006 22.2787 3480 0.2104 94.00 0.2518 . . 175 . . . . 
# 
_struct.entry_id                  3N1P 
_struct.title                     'Crystal Structure of IhhN bound to BOCFn3' 
_struct.pdbx_descriptor           'Indian hedgehog protein, Brother of CDO' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3N1P 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            
;Binding Sites, Calcium, Cell Adhesion Molecules, Cell Cycle Proteins, Cell Line, Conserved Sequence, Fibronectins, Hedgehog Proteins, Immunoglobulin G, Membrane Glycoproteins, Membrane Proteins, Protein Binding, Tertiary, Receptors, Cell Surface, Sequence Homology, Signal Transduction, Tumor Suppressor Proteins
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 51  ? LEU A 57  ? SER B 75  LEU B 81  5 ? 7  
HELX_P HELX_P2 2 GLY A 74  ? ASP A 76  ? GLY B 98  ASP B 100 5 ? 3  
HELX_P HELX_P3 3 THR A 80  ? TRP A 98  ? THR B 104 TRP B 122 1 ? 19 
HELX_P HELX_P4 4 ASP A 135 ? ASN A 137 ? ASP B 159 ASN B 161 5 ? 3  
HELX_P HELX_P5 5 LYS A 138 ? ALA A 149 ? LYS B 162 ALA B 173 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 128 OD1 ? ? ? 1_555 C ZN  . ZN ? ? B ASP 152 B ZN  194 1_555 ? ? ? ? ? ? ? 2.341 ? 
metalc2  metalc ? ? A HIS 163 ND1 ? ? ? 1_555 C ZN  . ZN ? ? B HIS 187 B ZN  194 1_555 ? ? ? ? ? ? ? 2.600 ? 
metalc3  metalc ? ? A THR 106 O   ? ? ? 1_555 D CA  . CA ? ? B THR 130 B CA  195 1_555 ? ? ? ? ? ? ? 2.668 ? 
metalc4  metalc ? ? A HIS 121 NE2 ? ? ? 1_555 C ZN  . ZN ? ? B HIS 145 B ZN  194 1_555 ? ? ? ? ? ? ? 2.685 ? 
metalc5  metalc ? ? A ASP 110 OD1 ? ? ? 1_555 E CA  . CA ? ? B ASP 134 B CA  196 1_555 ? ? ? ? ? ? ? 2.731 ? 
metalc6  metalc ? ? A GLU 71  OE2 ? ? ? 1_555 D CA  . CA ? ? B GLU 95  B CA  195 1_555 ? ? ? ? ? ? ? 2.747 ? 
metalc7  metalc ? ? A ASP 112 OD2 ? ? ? 1_555 E CA  . CA ? ? B ASP 136 B CA  196 1_555 ? ? ? ? ? ? ? 2.768 ? 
metalc8  metalc ? ? A ASP 76  OD1 ? ? ? 1_555 D CA  . CA ? ? B ASP 100 B CA  195 1_555 ? ? ? ? ? ? ? 2.787 ? 
metalc9  metalc ? ? A GLU 71  OE2 ? ? ? 1_555 E CA  . CA ? ? B GLU 95  B CA  196 1_555 ? ? ? ? ? ? ? 2.803 ? 
metalc10 metalc ? ? A GLU 70  OE1 ? ? ? 1_555 D CA  . CA ? ? B GLU 94  B CA  195 1_555 ? ? ? ? ? ? ? 2.808 ? 
metalc11 metalc ? ? A ASP 76  OD2 ? ? ? 1_555 D CA  . CA ? ? B ASP 100 B CA  195 1_555 ? ? ? ? ? ? ? 2.811 ? 
metalc12 metalc ? ? A GLU 107 OE2 ? ? ? 1_555 E CA  . CA ? ? B GLU 131 B CA  196 1_555 ? ? ? ? ? ? ? 2.822 ? 
metalc13 metalc ? ? A GLU 70  OE2 ? ? ? 1_555 D CA  . CA ? ? B GLU 94  B CA  195 1_555 ? ? ? ? ? ? ? 2.842 ? 
metalc14 metalc ? ? A GLU 107 OE1 ? ? ? 1_555 E CA  . CA ? ? B GLU 131 B CA  196 1_555 ? ? ? ? ? ? ? 2.940 ? 
metalc15 metalc ? ? A GLU 107 OE2 ? ? ? 1_555 D CA  . CA ? ? B GLU 131 B CA  195 1_555 ? ? ? ? ? ? ? 2.973 ? 
metalc16 metalc ? ? E CA  .   CA  ? ? ? 1_555 G HOH . O  ? ? B CA  196 C HOH 1   1_555 ? ? ? ? ? ? ? 2.930 ? 
metalc17 metalc ? ? E CA  .   CA  ? ? ? 1_555 F HOH . O  ? ? B CA  196 B HOH 2   1_555 ? ? ? ? ? ? ? 2.930 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           29 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            53 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    30 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     54 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       4.96 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 3 ? 
D ? 4 ? 
E ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 28  ? SER A 29  ? PHE B 52  SER B 53  
A 2 TRP A 153 ? TYR A 155 ? TRP B 177 TYR B 179 
A 3 VAL A 162 ? SER A 165 ? VAL B 186 SER B 189 
A 4 ALA A 126 ? THR A 131 ? ALA B 150 THR B 155 
A 5 LEU A 103 ? GLU A 107 ? LEU B 127 GLU B 131 
A 6 ILE A 65  ? PHE A 67  ? ILE B 89  PHE B 91  
B 1 THR A 58  ? PRO A 59  ? THR B 82  PRO B 83  
B 2 LEU A 78  ? MET A 79  ? LEU B 102 MET B 103 
C 1 TYR B 11  ? ALA B 17  ? TYR C 717 ALA C 723 
C 2 ILE B 23  ? MET B 28  ? ILE C 729 MET C 734 
C 3 TRP B 68  ? ILE B 71  ? TRP C 774 ILE C 777 
D 1 LYS B 58  ? VAL B 62  ? LYS C 764 VAL C 768 
D 2 PHE B 42  ? PRO B 48  ? PHE C 748 PRO C 754 
D 3 SER B 79  ? ASN B 88  ? SER C 785 ASN C 794 
D 4 GLY B 91  ? GLU B 92  ? GLY C 797 GLU C 798 
E 1 LYS B 58  ? VAL B 62  ? LYS C 764 VAL C 768 
E 2 PHE B 42  ? PRO B 48  ? PHE C 748 PRO C 754 
E 3 SER B 79  ? ASN B 88  ? SER C 785 ASN C 794 
E 4 MET B 99  ? GLU B 102 ? MET C 805 GLU C 808 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 29  ? N SER B 53  O VAL A 154 ? O VAL B 178 
A 2 3 N TYR A 155 ? N TYR B 179 O HIS A 163 ? O HIS B 187 
A 3 4 O VAL A 162 ? O VAL B 186 N ILE A 129 ? N ILE B 153 
A 4 5 O ASP A 128 ? O ASP B 152 N THR A 106 ? N THR B 130 
A 5 6 O VAL A 105 ? O VAL B 129 N ILE A 66  ? N ILE B 90  
B 1 2 N THR A 58  ? N THR B 82  O MET A 79  ? O MET B 103 
C 1 2 N ASP B 16  ? N ASP C 722 O MET B 24  ? O MET C 730 
C 2 3 N ILE B 23  ? N ILE C 729 O ILE B 71  ? O ILE C 777 
D 1 2 O LYS B 58  ? O LYS C 764 N TYR B 46  ? N TYR C 752 
D 2 3 N ARG B 47  ? N ARG C 753 O ASP B 81  ? O ASP C 787 
D 3 4 N ASN B 88  ? N ASN C 794 O GLY B 91  ? O GLY C 797 
E 1 2 O LYS B 58  ? O LYS C 764 N TYR B 46  ? N TYR C 752 
E 2 3 N ARG B 47  ? N ARG C 753 O ASP B 81  ? O ASP C 787 
E 3 4 N ILE B 82  ? N ILE C 788 O MET B 99  ? O MET C 805 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 194' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA B 195' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA B 196' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 HIS A 121 ? HIS B 145 . ? 1_555 ? 
2  AC1 4 ASP A 128 ? ASP B 152 . ? 1_555 ? 
3  AC1 4 GLU A 157 ? GLU B 181 . ? 1_555 ? 
4  AC1 4 HIS A 163 ? HIS B 187 . ? 1_555 ? 
5  AC2 5 GLU A 70  ? GLU B 94  . ? 1_555 ? 
6  AC2 5 GLU A 71  ? GLU B 95  . ? 1_555 ? 
7  AC2 5 ASP A 76  ? ASP B 100 . ? 1_555 ? 
8  AC2 5 THR A 106 ? THR B 130 . ? 1_555 ? 
9  AC2 5 GLU A 107 ? GLU B 131 . ? 1_555 ? 
10 AC3 6 HOH F .   ? HOH B 2   . ? 1_555 ? 
11 AC3 6 GLU A 71  ? GLU B 95  . ? 1_555 ? 
12 AC3 6 GLU A 107 ? GLU B 131 . ? 1_555 ? 
13 AC3 6 ASP A 110 ? ASP B 134 . ? 1_555 ? 
14 AC3 6 ASP A 112 ? ASP B 136 . ? 1_555 ? 
15 AC3 6 HOH G .   ? HOH C 1   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3N1P 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3N1P 
_atom_sites.fract_transf_matrix[1][1]   0.025698 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015816 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009406 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 16  ? 19.128  -34.882 -31.886 1.00 24.19 ? 40  PRO B N   1 
ATOM   2    C  CA  . PRO A 1 16  ? 20.589  -34.756 -31.810 1.00 24.37 ? 40  PRO B CA  1 
ATOM   3    C  C   . PRO A 1 16  ? 21.027  -33.294 -31.850 1.00 25.67 ? 40  PRO B C   1 
ATOM   4    O  O   . PRO A 1 16  ? 20.915  -32.656 -32.898 1.00 26.47 ? 40  PRO B O   1 
ATOM   5    C  CB  . PRO A 1 16  ? 21.072  -35.476 -33.074 1.00 24.01 ? 40  PRO B CB  1 
ATOM   6    C  CG  . PRO A 1 16  ? 19.953  -36.390 -33.452 1.00 23.72 ? 40  PRO B CG  1 
ATOM   7    C  CD  . PRO A 1 16  ? 18.697  -35.680 -33.046 1.00 24.24 ? 40  PRO B CD  1 
ATOM   8    N  N   . PRO A 1 17  ? 21.521  -32.765 -30.720 1.00 25.07 ? 41  PRO B N   1 
ATOM   9    C  CA  . PRO A 1 17  ? 21.974  -31.373 -30.648 1.00 23.81 ? 41  PRO B CA  1 
ATOM   10   C  C   . PRO A 1 17  ? 22.927  -31.030 -31.790 1.00 25.80 ? 41  PRO B C   1 
ATOM   11   O  O   . PRO A 1 17  ? 23.585  -31.916 -32.336 1.00 26.85 ? 41  PRO B O   1 
ATOM   12   C  CB  . PRO A 1 17  ? 22.701  -31.313 -29.293 1.00 23.60 ? 41  PRO B CB  1 
ATOM   13   C  CG  . PRO A 1 17  ? 22.902  -32.766 -28.895 1.00 24.85 ? 41  PRO B CG  1 
ATOM   14   C  CD  . PRO A 1 17  ? 21.685  -33.441 -29.426 1.00 24.27 ? 41  PRO B CD  1 
ATOM   15   N  N   . ARG A 1 18  ? 22.986  -29.753 -32.152 1.00 25.64 ? 42  ARG B N   1 
ATOM   16   C  CA  . ARG A 1 18  ? 23.806  -29.312 -33.272 1.00 25.64 ? 42  ARG B CA  1 
ATOM   17   C  C   . ARG A 1 18  ? 24.898  -28.362 -32.797 1.00 27.32 ? 42  ARG B C   1 
ATOM   18   O  O   . ARG A 1 18  ? 24.755  -27.710 -31.760 1.00 27.42 ? 42  ARG B O   1 
ATOM   19   C  CB  . ARG A 1 18  ? 22.929  -28.628 -34.320 1.00 25.58 ? 42  ARG B CB  1 
ATOM   20   C  CG  . ARG A 1 18  ? 21.956  -27.621 -33.732 1.00 25.76 ? 42  ARG B CG  1 
ATOM   21   C  CD  . ARG A 1 18  ? 20.848  -27.264 -34.711 1.00 27.17 ? 42  ARG B CD  1 
ATOM   22   N  NE  . ARG A 1 18  ? 21.374  -26.703 -35.952 1.00 29.57 ? 42  ARG B NE  1 
ATOM   23   C  CZ  . ARG A 1 18  ? 20.634  -26.080 -36.864 1.00 30.10 ? 42  ARG B CZ  1 
ATOM   24   N  NH1 . ARG A 1 18  ? 19.330  -25.928 -36.674 1.00 30.12 ? 42  ARG B NH1 1 
ATOM   25   N  NH2 . ARG A 1 18  ? 21.200  -25.603 -37.964 1.00 30.12 ? 42  ARG B NH2 1 
ATOM   26   N  N   . LYS A 1 19  ? 25.994  -28.288 -33.548 1.00 26.69 ? 43  LYS B N   1 
ATOM   27   C  CA  . LYS A 1 19  ? 27.080  -27.381 -33.192 1.00 27.26 ? 43  LYS B CA  1 
ATOM   28   C  C   . LYS A 1 19  ? 26.800  -25.987 -33.737 1.00 27.81 ? 43  LYS B C   1 
ATOM   29   O  O   . LYS A 1 19  ? 26.590  -25.806 -34.937 1.00 28.56 ? 43  LYS B O   1 
ATOM   30   C  CB  . LYS A 1 19  ? 28.436  -27.905 -33.679 1.00 27.41 ? 43  LYS B CB  1 
ATOM   31   C  CG  . LYS A 1 19  ? 28.624  -27.892 -35.185 1.00 29.60 ? 43  LYS B CG  1 
ATOM   32   C  CD  . LYS A 1 19  ? 30.086  -28.101 -35.543 1.00 29.30 ? 43  LYS B CD  1 
ATOM   33   C  CE  . LYS A 1 19  ? 30.310  -28.040 -37.046 1.00 32.13 ? 43  LYS B CE  1 
ATOM   34   N  NZ  . LYS A 1 19  ? 31.748  -28.221 -37.398 1.00 31.06 ? 43  LYS B NZ  1 
ATOM   35   N  N   . LEU A 1 20  ? 26.788  -25.004 -32.844 1.00 27.31 ? 44  LEU B N   1 
ATOM   36   C  CA  . LEU A 1 20  ? 26.392  -23.652 -33.214 1.00 26.45 ? 44  LEU B CA  1 
ATOM   37   C  C   . LEU A 1 20  ? 27.427  -22.608 -32.826 1.00 26.66 ? 44  LEU B C   1 
ATOM   38   O  O   . LEU A 1 20  ? 28.360  -22.882 -32.071 1.00 27.24 ? 44  LEU B O   1 
ATOM   39   C  CB  . LEU A 1 20  ? 25.048  -23.300 -32.573 1.00 26.29 ? 44  LEU B CB  1 
ATOM   40   C  CG  . LEU A 1 20  ? 23.824  -24.034 -33.120 1.00 26.59 ? 44  LEU B CG  1 
ATOM   41   C  CD1 . LEU A 1 20  ? 22.631  -23.823 -32.207 1.00 24.12 ? 44  LEU B CD1 1 
ATOM   42   C  CD2 . LEU A 1 20  ? 23.514  -23.574 -34.538 1.00 27.20 ? 44  LEU B CD2 1 
ATOM   43   N  N   . VAL A 1 21  ? 27.246  -21.406 -33.362 1.00 26.30 ? 45  VAL B N   1 
ATOM   44   C  CA  . VAL A 1 21  ? 28.067  -20.262 -33.003 1.00 24.46 ? 45  VAL B CA  1 
ATOM   45   C  C   . VAL A 1 21  ? 27.295  -19.375 -32.034 1.00 24.00 ? 45  VAL B C   1 
ATOM   46   O  O   . VAL A 1 21  ? 26.355  -18.683 -32.427 1.00 24.43 ? 45  VAL B O   1 
ATOM   47   C  CB  . VAL A 1 21  ? 28.464  -19.450 -34.246 1.00 24.61 ? 45  VAL B CB  1 
ATOM   48   C  CG1 . VAL A 1 21  ? 29.741  -20.003 -34.856 1.00 25.55 ? 45  VAL B CG1 1 
ATOM   49   C  CG2 . VAL A 1 21  ? 27.333  -19.456 -35.267 1.00 24.51 ? 45  VAL B CG2 1 
ATOM   50   N  N   . PRO A 1 22  ? 27.684  -19.405 -30.753 1.00 22.99 ? 46  PRO B N   1 
ATOM   51   C  CA  . PRO A 1 22  ? 27.015  -18.614 -29.715 1.00 21.46 ? 46  PRO B CA  1 
ATOM   52   C  C   . PRO A 1 22  ? 27.039  -17.131 -30.048 1.00 21.16 ? 46  PRO B C   1 
ATOM   53   O  O   . PRO A 1 22  ? 27.986  -16.665 -30.682 1.00 21.41 ? 46  PRO B O   1 
ATOM   54   C  CB  . PRO A 1 22  ? 27.879  -18.867 -28.474 1.00 21.44 ? 46  PRO B CB  1 
ATOM   55   C  CG  . PRO A 1 22  ? 28.572  -20.156 -28.742 1.00 23.79 ? 46  PRO B CG  1 
ATOM   56   C  CD  . PRO A 1 22  ? 28.812  -20.186 -30.218 1.00 24.47 ? 46  PRO B CD  1 
ATOM   57   N  N   . LEU A 1 23  ? 26.009  -16.401 -29.634 1.00 20.61 ? 47  LEU B N   1 
ATOM   58   C  CA  . LEU A 1 23  ? 26.048  -14.948 -29.705 1.00 19.54 ? 47  LEU B CA  1 
ATOM   59   C  C   . LEU A 1 23  ? 26.813  -14.432 -28.494 1.00 19.22 ? 47  LEU B C   1 
ATOM   60   O  O   . LEU A 1 23  ? 26.712  -14.993 -27.404 1.00 18.82 ? 47  LEU B O   1 
ATOM   61   C  CB  . LEU A 1 23  ? 24.640  -14.346 -29.726 1.00 18.67 ? 47  LEU B CB  1 
ATOM   62   C  CG  . LEU A 1 23  ? 23.795  -14.462 -30.996 1.00 18.39 ? 47  LEU B CG  1 
ATOM   63   C  CD1 . LEU A 1 23  ? 22.691  -13.423 -30.973 1.00 17.49 ? 47  LEU B CD1 1 
ATOM   64   C  CD2 . LEU A 1 23  ? 24.641  -14.288 -32.237 1.00 19.57 ? 47  LEU B CD2 1 
ATOM   65   N  N   . ALA A 1 24  ? 27.590  -13.373 -28.691 1.00 19.55 ? 48  ALA B N   1 
ATOM   66   C  CA  . ALA A 1 24  ? 28.308  -12.748 -27.590 1.00 19.37 ? 48  ALA B CA  1 
ATOM   67   C  C   . ALA A 1 24  ? 27.378  -11.811 -26.829 1.00 19.48 ? 48  ALA B C   1 
ATOM   68   O  O   . ALA A 1 24  ? 26.382  -11.336 -27.374 1.00 19.57 ? 48  ALA B O   1 
ATOM   69   C  CB  . ALA A 1 24  ? 29.519  -11.997 -28.104 1.00 20.26 ? 48  ALA B CB  1 
ATOM   70   N  N   . TYR A 1 25  ? 27.705  -11.550 -25.568 1.00 19.06 ? 49  TYR B N   1 
ATOM   71   C  CA  . TYR A 1 25  ? 26.876  -10.694 -24.730 1.00 18.93 ? 49  TYR B CA  1 
ATOM   72   C  C   . TYR A 1 25  ? 26.690  -9.310  -25.347 1.00 19.53 ? 49  TYR B C   1 
ATOM   73   O  O   . TYR A 1 25  ? 27.658  -8.673  -25.761 1.00 20.32 ? 49  TYR B O   1 
ATOM   74   C  CB  . TYR A 1 25  ? 27.468  -10.581 -23.323 1.00 19.18 ? 49  TYR B CB  1 
ATOM   75   C  CG  . TYR A 1 25  ? 26.742  -9.598  -22.437 1.00 19.58 ? 49  TYR B CG  1 
ATOM   76   C  CD1 . TYR A 1 25  ? 25.406  -9.785  -22.109 1.00 19.64 ? 49  TYR B CD1 1 
ATOM   77   C  CD2 . TYR A 1 25  ? 27.392  -8.482  -21.925 1.00 20.13 ? 49  TYR B CD2 1 
ATOM   78   C  CE1 . TYR A 1 25  ? 24.735  -8.886  -21.298 1.00 20.64 ? 49  TYR B CE1 1 
ATOM   79   C  CE2 . TYR A 1 25  ? 26.731  -7.577  -21.112 1.00 20.45 ? 49  TYR B CE2 1 
ATOM   80   C  CZ  . TYR A 1 25  ? 25.402  -7.784  -20.802 1.00 20.76 ? 49  TYR B CZ  1 
ATOM   81   O  OH  . TYR A 1 25  ? 24.737  -6.889  -19.994 1.00 20.21 ? 49  TYR B OH  1 
ATOM   82   N  N   . LYS A 1 26  ? 25.437  -8.862  -25.405 1.00 19.69 ? 50  LYS B N   1 
ATOM   83   C  CA  . LYS A 1 26  ? 25.077  -7.558  -25.965 1.00 19.55 ? 50  LYS B CA  1 
ATOM   84   C  C   . LYS A 1 26  ? 25.094  -7.534  -27.494 1.00 19.23 ? 50  LYS B C   1 
ATOM   85   O  O   . LYS A 1 26  ? 24.933  -6.478  -28.104 1.00 19.86 ? 50  LYS B O   1 
ATOM   86   C  CB  . LYS A 1 26  ? 25.969  -6.446  -25.400 1.00 20.03 ? 50  LYS B CB  1 
ATOM   87   C  CG  . LYS A 1 26  ? 25.643  -6.039  -23.973 1.00 19.96 ? 50  LYS B CG  1 
ATOM   88   C  CD  . LYS A 1 26  ? 24.323  -5.292  -23.903 1.00 20.39 ? 50  LYS B CD  1 
ATOM   89   C  CE  . LYS A 1 26  ? 24.066  -4.749  -22.507 1.00 20.79 ? 50  LYS B CE  1 
ATOM   90   N  NZ  . LYS A 1 26  ? 22.739  -4.074  -22.412 1.00 21.35 ? 50  LYS B NZ  1 
ATOM   91   N  N   . GLN A 1 27  ? 25.284  -8.700  -28.106 1.00 18.77 ? 51  GLN B N   1 
ATOM   92   C  CA  . GLN A 1 27  ? 25.252  -8.823  -29.562 1.00 18.59 ? 51  GLN B CA  1 
ATOM   93   C  C   . GLN A 1 27  ? 23.825  -9.044  -30.063 1.00 17.84 ? 51  GLN B C   1 
ATOM   94   O  O   . GLN A 1 27  ? 22.979  -9.563  -29.336 1.00 17.85 ? 51  GLN B O   1 
ATOM   95   C  CB  . GLN A 1 27  ? 26.147  -9.975  -30.023 1.00 18.84 ? 51  GLN B CB  1 
ATOM   96   C  CG  . GLN A 1 27  ? 26.077  -10.258 -31.514 1.00 18.35 ? 51  GLN B CG  1 
ATOM   97   C  CD  . GLN A 1 27  ? 26.806  -11.529 -31.907 1.00 18.74 ? 51  GLN B CD  1 
ATOM   98   O  OE1 . GLN A 1 27  ? 27.473  -12.158 -31.085 1.00 19.05 ? 51  GLN B OE1 1 
ATOM   99   N  NE2 . GLN A 1 27  ? 26.681  -11.913 -33.171 1.00 18.33 ? 51  GLN B NE2 1 
ATOM   100  N  N   . PHE A 1 28  ? 23.564  -8.651  -31.306 1.00 17.45 ? 52  PHE B N   1 
ATOM   101  C  CA  . PHE A 1 28  ? 22.236  -8.813  -31.894 1.00 17.55 ? 52  PHE B CA  1 
ATOM   102  C  C   . PHE A 1 28  ? 22.300  -9.288  -33.345 1.00 17.98 ? 52  PHE B C   1 
ATOM   103  O  O   . PHE A 1 28  ? 23.269  -9.017  -34.054 1.00 18.35 ? 52  PHE B O   1 
ATOM   104  C  CB  . PHE A 1 28  ? 21.428  -7.513  -31.786 1.00 17.15 ? 52  PHE B CB  1 
ATOM   105  C  CG  . PHE A 1 28  ? 22.187  -6.285  -32.207 1.00 17.79 ? 52  PHE B CG  1 
ATOM   106  C  CD1 . PHE A 1 28  ? 23.019  -5.628  -31.314 1.00 17.74 ? 52  PHE B CD1 1 
ATOM   107  C  CD2 . PHE A 1 28  ? 22.064  -5.782  -33.493 1.00 17.91 ? 52  PHE B CD2 1 
ATOM   108  C  CE1 . PHE A 1 28  ? 23.718  -4.500  -31.697 1.00 17.67 ? 52  PHE B CE1 1 
ATOM   109  C  CE2 . PHE A 1 28  ? 22.760  -4.653  -33.882 1.00 17.22 ? 52  PHE B CE2 1 
ATOM   110  C  CZ  . PHE A 1 28  ? 23.587  -4.012  -32.983 1.00 17.49 ? 52  PHE B CZ  1 
ATOM   111  N  N   . SER A 1 29  ? 21.264  -10.004 -33.773 1.00 17.80 ? 53  SER B N   1 
ATOM   112  C  CA  . SER A 1 29  ? 21.184  -10.527 -35.134 1.00 17.89 ? 53  SER B CA  1 
ATOM   113  C  C   . SER A 1 29  ? 19.745  -10.474 -35.642 1.00 17.64 ? 53  SER B C   1 
ATOM   114  O  O   . SER A 1 29  ? 18.839  -10.997 -34.993 1.00 17.19 ? 53  SER B O   1 
ATOM   115  C  CB  . SER A 1 29  ? 21.711  -11.963 -35.191 1.00 17.92 ? 53  SER B CB  1 
ATOM   116  O  OG  . SER A 1 29  ? 21.638  -12.485 -36.508 1.00 17.65 ? 53  SER B OG  1 
ATOM   117  N  N   . PRO A 1 30  ? 19.529  -9.855  -36.815 1.00 17.32 ? 54  PRO B N   1 
ATOM   118  C  CA  . PRO A 1 30  ? 20.554  -9.309  -37.713 1.00 17.36 ? 54  PRO B CA  1 
ATOM   119  C  C   . PRO A 1 30  ? 21.349  -8.182  -37.068 1.00 17.57 ? 54  PRO B C   1 
ATOM   120  O  O   . PRO A 1 30  ? 20.923  -7.632  -36.053 1.00 18.38 ? 54  PRO B O   1 
ATOM   121  C  CB  . PRO A 1 30  ? 19.736  -8.747  -38.885 1.00 16.81 ? 54  PRO B CB  1 
ATOM   122  C  CG  . PRO A 1 30  ? 18.384  -9.360  -38.764 1.00 17.44 ? 54  PRO B CG  1 
ATOM   123  C  CD  . PRO A 1 30  ? 18.171  -9.573  -37.305 1.00 17.45 ? 54  PRO B CD  1 
ATOM   124  N  N   . ASN A 1 31  ? 22.489  -7.842  -37.659 1.00 17.51 ? 55  ASN B N   1 
ATOM   125  C  CA  . ASN A 1 31  ? 23.333  -6.779  -37.128 1.00 17.83 ? 55  ASN B CA  1 
ATOM   126  C  C   . ASN A 1 31  ? 22.820  -5.394  -37.511 1.00 18.07 ? 55  ASN B C   1 
ATOM   127  O  O   . ASN A 1 31  ? 23.472  -4.660  -38.255 1.00 17.98 ? 55  ASN B O   1 
ATOM   128  C  CB  . ASN A 1 31  ? 24.780  -6.957  -37.591 1.00 17.11 ? 55  ASN B CB  1 
ATOM   129  C  CG  . ASN A 1 31  ? 25.731  -5.998  -36.911 1.00 16.75 ? 55  ASN B CG  1 
ATOM   130  O  OD1 . ASN A 1 31  ? 25.402  -5.396  -35.888 1.00 17.78 ? 55  ASN B OD1 1 
ATOM   131  N  ND2 . ASN A 1 31  ? 26.922  -5.848  -37.476 1.00 17.05 ? 55  ASN B ND2 1 
ATOM   132  N  N   . VAL A 1 32  ? 21.642  -5.054  -36.998 1.00 18.31 ? 56  VAL B N   1 
ATOM   133  C  CA  . VAL A 1 32  ? 21.030  -3.747  -37.214 1.00 18.30 ? 56  VAL B CA  1 
ATOM   134  C  C   . VAL A 1 32  ? 20.087  -3.450  -36.056 1.00 17.92 ? 56  VAL B C   1 
ATOM   135  O  O   . VAL A 1 32  ? 19.679  -4.366  -35.342 1.00 17.82 ? 56  VAL B O   1 
ATOM   136  C  CB  . VAL A 1 32  ? 20.222  -3.704  -38.526 1.00 18.50 ? 56  VAL B CB  1 
ATOM   137  C  CG1 . VAL A 1 32  ? 21.147  -3.597  -39.725 1.00 20.68 ? 56  VAL B CG1 1 
ATOM   138  C  CG2 . VAL A 1 32  ? 19.324  -4.925  -38.637 1.00 18.03 ? 56  VAL B CG2 1 
ATOM   139  N  N   . PRO A 1 33  ? 19.744  -2.167  -35.858 1.00 17.50 ? 57  PRO B N   1 
ATOM   140  C  CA  . PRO A 1 33  ? 18.773  -1.805  -34.821 1.00 17.32 ? 57  PRO B CA  1 
ATOM   141  C  C   . PRO A 1 33  ? 17.468  -2.580  -34.980 1.00 17.31 ? 57  PRO B C   1 
ATOM   142  O  O   . PRO A 1 33  ? 17.079  -2.917  -36.097 1.00 17.45 ? 57  PRO B O   1 
ATOM   143  C  CB  . PRO A 1 33  ? 18.541  -0.314  -35.070 1.00 16.88 ? 57  PRO B CB  1 
ATOM   144  C  CG  . PRO A 1 33  ? 19.812  0.159   -35.675 1.00 16.46 ? 57  PRO B CG  1 
ATOM   145  C  CD  . PRO A 1 33  ? 20.310  -0.981  -36.523 1.00 17.57 ? 57  PRO B CD  1 
ATOM   146  N  N   . GLU A 1 34  ? 16.803  -2.853  -33.864 1.00 17.10 ? 58  GLU B N   1 
ATOM   147  C  CA  . GLU A 1 34  ? 15.585  -3.655  -33.860 1.00 17.05 ? 58  GLU B CA  1 
ATOM   148  C  C   . GLU A 1 34  ? 14.451  -3.042  -34.684 1.00 18.18 ? 58  GLU B C   1 
ATOM   149  O  O   . GLU A 1 34  ? 13.695  -3.759  -35.343 1.00 18.41 ? 58  GLU B O   1 
ATOM   150  C  CB  . GLU A 1 34  ? 15.117  -3.877  -32.419 1.00 17.19 ? 58  GLU B CB  1 
ATOM   151  C  CG  . GLU A 1 34  ? 13.830  -4.676  -32.290 1.00 16.96 ? 58  GLU B CG  1 
ATOM   152  C  CD  . GLU A 1 34  ? 13.352  -4.775  -30.857 1.00 16.54 ? 58  GLU B CD  1 
ATOM   153  O  OE1 . GLU A 1 34  ? 13.376  -3.747  -30.150 1.00 16.70 ? 58  GLU B OE1 1 
ATOM   154  O  OE2 . GLU A 1 34  ? 12.950  -5.879  -30.437 1.00 17.06 ? 58  GLU B OE2 1 
ATOM   155  N  N   . LYS A 1 35  ? 14.339  -1.717  -34.650 1.00 17.79 ? 59  LYS B N   1 
ATOM   156  C  CA  . LYS A 1 35  ? 13.206  -1.034  -35.267 1.00 18.62 ? 59  LYS B CA  1 
ATOM   157  C  C   . LYS A 1 35  ? 13.378  -0.785  -36.763 1.00 19.82 ? 59  LYS B C   1 
ATOM   158  O  O   . LYS A 1 35  ? 12.600  -0.046  -37.367 1.00 20.53 ? 59  LYS B O   1 
ATOM   159  C  CB  . LYS A 1 35  ? 12.920  0.286   -34.547 1.00 18.42 ? 59  LYS B CB  1 
ATOM   160  C  CG  . LYS A 1 35  ? 12.599  0.120   -33.074 1.00 18.36 ? 59  LYS B CG  1 
ATOM   161  C  CD  . LYS A 1 35  ? 11.395  -0.781  -32.873 1.00 18.49 ? 59  LYS B CD  1 
ATOM   162  C  CE  . LYS A 1 35  ? 11.277  -1.208  -31.423 1.00 18.20 ? 59  LYS B CE  1 
ATOM   163  N  NZ  . LYS A 1 35  ? 11.325  -0.039  -30.508 1.00 19.34 ? 59  LYS B NZ  1 
ATOM   164  N  N   . THR A 1 36  ? 14.394  -1.397  -37.361 1.00 19.44 ? 60  THR B N   1 
ATOM   165  C  CA  . THR A 1 36  ? 14.612  -1.252  -38.795 1.00 20.00 ? 60  THR B CA  1 
ATOM   166  C  C   . THR A 1 36  ? 13.848  -2.326  -39.564 1.00 20.80 ? 60  THR B C   1 
ATOM   167  O  O   . THR A 1 36  ? 13.406  -3.317  -38.983 1.00 20.44 ? 60  THR B O   1 
ATOM   168  C  CB  . THR A 1 36  ? 16.106  -1.308  -39.155 1.00 19.63 ? 60  THR B CB  1 
ATOM   169  O  OG1 . THR A 1 36  ? 16.688  -2.497  -38.607 1.00 19.66 ? 60  THR B OG1 1 
ATOM   170  C  CG2 . THR A 1 36  ? 16.830  -0.092  -38.598 1.00 18.20 ? 60  THR B CG2 1 
ATOM   171  N  N   . LEU A 1 37  ? 13.691  -2.122  -40.869 1.00 21.93 ? 61  LEU B N   1 
ATOM   172  C  CA  . LEU A 1 37  ? 12.928  -3.050  -41.699 1.00 23.20 ? 61  LEU B CA  1 
ATOM   173  C  C   . LEU A 1 37  ? 13.615  -4.403  -41.841 1.00 22.71 ? 61  LEU B C   1 
ATOM   174  O  O   . LEU A 1 37  ? 12.954  -5.426  -42.016 1.00 24.66 ? 61  LEU B O   1 
ATOM   175  C  CB  . LEU A 1 37  ? 12.658  -2.449  -43.081 1.00 25.59 ? 61  LEU B CB  1 
ATOM   176  C  CG  . LEU A 1 37  ? 11.584  -1.362  -43.134 1.00 25.92 ? 61  LEU B CG  1 
ATOM   177  C  CD1 . LEU A 1 37  ? 11.280  -0.979  -44.573 1.00 28.26 ? 61  LEU B CD1 1 
ATOM   178  C  CD2 . LEU A 1 37  ? 10.324  -1.835  -42.429 1.00 25.05 ? 61  LEU B CD2 1 
ATOM   179  N  N   . GLY A 1 38  ? 14.940  -4.404  -41.767 1.00 22.11 ? 62  GLY B N   1 
ATOM   180  C  CA  . GLY A 1 38  ? 15.702  -5.635  -41.867 1.00 21.17 ? 62  GLY B CA  1 
ATOM   181  C  C   . GLY A 1 38  ? 15.642  -6.449  -40.590 1.00 20.04 ? 62  GLY B C   1 
ATOM   182  O  O   . GLY A 1 38  ? 16.151  -7.568  -40.531 1.00 20.05 ? 62  GLY B O   1 
ATOM   183  N  N   . ALA A 1 39  ? 15.017  -5.880  -39.564 1.00 20.48 ? 63  ALA B N   1 
ATOM   184  C  CA  . ALA A 1 39  ? 14.891  -6.548  -38.273 1.00 19.30 ? 63  ALA B CA  1 
ATOM   185  C  C   . ALA A 1 39  ? 13.432  -6.837  -37.929 1.00 19.20 ? 63  ALA B C   1 
ATOM   186  O  O   . ALA A 1 39  ? 12.820  -7.740  -38.498 1.00 19.63 ? 63  ALA B O   1 
ATOM   187  C  CB  . ALA A 1 39  ? 15.546  -5.722  -37.179 1.00 18.08 ? 63  ALA B CB  1 
ATOM   188  N  N   . SER A 1 40  ? 12.877  -6.063  -37.002 1.00 18.47 ? 64  SER B N   1 
ATOM   189  C  CA  . SER A 1 40  ? 11.514  -6.300  -36.534 1.00 19.26 ? 64  SER B CA  1 
ATOM   190  C  C   . SER A 1 40  ? 10.530  -5.238  -37.015 1.00 19.76 ? 64  SER B C   1 
ATOM   191  O  O   . SER A 1 40  ? 9.315   -5.428  -36.942 1.00 20.32 ? 64  SER B O   1 
ATOM   192  C  CB  . SER A 1 40  ? 11.480  -6.392  -35.006 1.00 18.34 ? 64  SER B CB  1 
ATOM   193  O  OG  . SER A 1 40  ? 12.282  -7.463  -34.544 1.00 17.59 ? 64  SER B OG  1 
ATOM   194  N  N   . GLY A 1 41  ? 11.055  -4.120  -37.503 1.00 19.96 ? 65  GLY B N   1 
ATOM   195  C  CA  . GLY A 1 41  ? 10.212  -3.042  -37.985 1.00 20.42 ? 65  GLY B CA  1 
ATOM   196  C  C   . GLY A 1 41  ? 9.901   -2.020  -36.912 1.00 20.25 ? 65  GLY B C   1 
ATOM   197  O  O   . GLY A 1 41  ? 10.327  -2.159  -35.766 1.00 19.96 ? 65  GLY B O   1 
ATOM   198  N  N   . ARG A 1 42  ? 9.144   -0.993  -37.282 1.00 21.18 ? 66  ARG B N   1 
ATOM   199  C  CA  . ARG A 1 42  ? 8.886   0.126   -36.383 1.00 22.60 ? 66  ARG B CA  1 
ATOM   200  C  C   . ARG A 1 42  ? 7.843   -0.179  -35.314 1.00 22.47 ? 66  ARG B C   1 
ATOM   201  O  O   . ARG A 1 42  ? 7.096   -1.151  -35.410 1.00 21.75 ? 66  ARG B O   1 
ATOM   202  C  CB  . ARG A 1 42  ? 8.471   1.366   -37.177 1.00 24.71 ? 66  ARG B CB  1 
ATOM   203  C  CG  . ARG A 1 42  ? 9.563   1.916   -38.078 1.00 28.62 ? 66  ARG B CG  1 
ATOM   204  C  CD  . ARG A 1 42  ? 9.185   3.281   -38.627 1.00 35.06 ? 66  ARG B CD  1 
ATOM   205  N  NE  . ARG A 1 42  ? 10.223  3.828   -39.496 1.00 39.40 ? 66  ARG B NE  1 
ATOM   206  C  CZ  . ARG A 1 42  ? 10.213  5.065   -39.985 1.00 42.07 ? 66  ARG B CZ  1 
ATOM   207  N  NH1 . ARG A 1 42  ? 9.218   5.891   -39.687 1.00 41.74 ? 66  ARG B NH1 1 
ATOM   208  N  NH2 . ARG A 1 42  ? 11.199  5.479   -40.770 1.00 42.49 ? 66  ARG B NH2 1 
ATOM   209  N  N   . TYR A 1 43  ? 7.809   0.674   -34.296 1.00 22.61 ? 67  TYR B N   1 
ATOM   210  C  CA  . TYR A 1 43  ? 6.846   0.575   -33.208 1.00 22.99 ? 67  TYR B CA  1 
ATOM   211  C  C   . TYR A 1 43  ? 5.507   1.147   -33.666 1.00 23.30 ? 67  TYR B C   1 
ATOM   212  O  O   . TYR A 1 43  ? 5.452   2.250   -34.209 1.00 23.17 ? 67  TYR B O   1 
ATOM   213  C  CB  . TYR A 1 43  ? 7.378   1.341   -31.997 1.00 23.35 ? 67  TYR B CB  1 
ATOM   214  C  CG  . TYR A 1 43  ? 6.522   1.264   -30.756 1.00 24.54 ? 67  TYR B CG  1 
ATOM   215  C  CD1 . TYR A 1 43  ? 6.461   0.100   -30.001 1.00 24.08 ? 67  TYR B CD1 1 
ATOM   216  C  CD2 . TYR A 1 43  ? 5.797   2.367   -30.320 1.00 24.59 ? 67  TYR B CD2 1 
ATOM   217  C  CE1 . TYR A 1 43  ? 5.686   0.029   -28.856 1.00 24.16 ? 67  TYR B CE1 1 
ATOM   218  C  CE2 . TYR A 1 43  ? 5.021   2.307   -29.175 1.00 24.94 ? 67  TYR B CE2 1 
ATOM   219  C  CZ  . TYR A 1 43  ? 4.969   1.136   -28.448 1.00 25.26 ? 67  TYR B CZ  1 
ATOM   220  O  OH  . TYR A 1 43  ? 4.200   1.073   -27.308 1.00 25.43 ? 67  TYR B OH  1 
ATOM   221  N  N   . GLU A 1 44  ? 4.431   0.396   -33.449 1.00 22.85 ? 68  GLU B N   1 
ATOM   222  C  CA  . GLU A 1 44  ? 3.124   0.766   -33.987 1.00 24.02 ? 68  GLU B CA  1 
ATOM   223  C  C   . GLU A 1 44  ? 2.144   1.288   -32.938 1.00 23.92 ? 68  GLU B C   1 
ATOM   224  O  O   . GLU A 1 44  ? 1.022   1.677   -33.269 1.00 24.21 ? 68  GLU B O   1 
ATOM   225  C  CB  . GLU A 1 44  ? 2.507   -0.415  -34.742 1.00 25.05 ? 68  GLU B CB  1 
ATOM   226  C  CG  . GLU A 1 44  ? 3.321   -0.870  -35.945 1.00 25.12 ? 68  GLU B CG  1 
ATOM   227  C  CD  . GLU A 1 44  ? 2.738   -2.097  -36.618 1.00 27.05 ? 68  GLU B CD  1 
ATOM   228  O  OE1 . GLU A 1 44  ? 1.780   -2.682  -36.069 1.00 28.48 ? 68  GLU B OE1 1 
ATOM   229  O  OE2 . GLU A 1 44  ? 3.239   -2.477  -37.697 1.00 27.56 ? 68  GLU B OE2 1 
ATOM   230  N  N   . GLY A 1 45  ? 2.566   1.297   -31.678 1.00 23.60 ? 69  GLY B N   1 
ATOM   231  C  CA  . GLY A 1 45  ? 1.721   1.787   -30.604 1.00 23.45 ? 69  GLY B CA  1 
ATOM   232  C  C   . GLY A 1 45  ? 1.606   0.816   -29.445 1.00 23.26 ? 69  GLY B C   1 
ATOM   233  O  O   . GLY A 1 45  ? 1.728   -0.395  -29.622 1.00 23.89 ? 69  GLY B O   1 
ATOM   234  N  N   . LYS A 1 46  ? 1.361   1.353   -28.255 1.00 23.51 ? 70  LYS B N   1 
ATOM   235  C  CA  . LYS A 1 46  ? 1.275   0.541   -27.046 1.00 23.09 ? 70  LYS B CA  1 
ATOM   236  C  C   . LYS A 1 46  ? -0.088  -0.126  -26.900 1.00 23.67 ? 70  LYS B C   1 
ATOM   237  O  O   . LYS A 1 46  ? -1.122  0.543   -26.900 1.00 23.70 ? 70  LYS B O   1 
ATOM   238  C  CB  . LYS A 1 46  ? 1.585   1.392   -25.813 1.00 23.26 ? 70  LYS B CB  1 
ATOM   239  C  CG  . LYS A 1 46  ? 1.420   0.670   -24.486 1.00 23.36 ? 70  LYS B CG  1 
ATOM   240  C  CD  . LYS A 1 46  ? 2.320   1.291   -23.432 1.00 24.14 ? 70  LYS B CD  1 
ATOM   241  C  CE  . LYS A 1 46  ? 2.341   2.808   -23.557 1.00 26.89 ? 70  LYS B CE  1 
ATOM   242  N  NZ  . LYS A 1 46  ? 3.484   3.420   -22.824 1.00 28.16 ? 70  LYS B NZ  1 
ATOM   243  N  N   . ILE A 1 47  ? -0.078  -1.450  -26.776 1.00 23.35 ? 71  ILE B N   1 
ATOM   244  C  CA  . ILE A 1 47  ? -1.306  -2.216  -26.605 1.00 23.04 ? 71  ILE B CA  1 
ATOM   245  C  C   . ILE A 1 47  ? -1.653  -2.383  -25.130 1.00 23.68 ? 71  ILE B C   1 
ATOM   246  O  O   . ILE A 1 47  ? -0.902  -2.994  -24.368 1.00 23.85 ? 71  ILE B O   1 
ATOM   247  C  CB  . ILE A 1 47  ? -1.202  -3.613  -27.245 1.00 22.20 ? 71  ILE B CB  1 
ATOM   248  C  CG1 . ILE A 1 47  ? -0.927  -3.500  -28.744 1.00 22.19 ? 71  ILE B CG1 1 
ATOM   249  C  CG2 . ILE A 1 47  ? -2.473  -4.410  -26.996 1.00 23.02 ? 71  ILE B CG2 1 
ATOM   250  C  CD1 . ILE A 1 47  ? -0.784  -4.836  -29.436 1.00 21.91 ? 71  ILE B CD1 1 
ATOM   251  N  N   . ALA A 1 48  ? -2.790  -1.826  -24.734 1.00 23.73 ? 72  ALA B N   1 
ATOM   252  C  CA  . ALA A 1 48  ? -3.320  -2.035  -23.396 1.00 23.74 ? 72  ALA B CA  1 
ATOM   253  C  C   . ALA A 1 48  ? -4.444  -3.053  -23.495 1.00 24.91 ? 72  ALA B C   1 
ATOM   254  O  O   . ALA A 1 48  ? -4.778  -3.507  -24.589 1.00 25.55 ? 72  ALA B O   1 
ATOM   255  C  CB  . ALA A 1 48  ? -3.831  -0.727  -22.818 1.00 22.89 ? 72  ALA B CB  1 
ATOM   256  N  N   . ARG A 1 49  ? -5.030  -3.419  -22.361 1.00 24.34 ? 73  ARG B N   1 
ATOM   257  C  CA  . ARG A 1 49  ? -6.153  -4.346  -22.378 1.00 25.08 ? 73  ARG B CA  1 
ATOM   258  C  C   . ARG A 1 49  ? -7.338  -3.741  -23.128 1.00 25.38 ? 73  ARG B C   1 
ATOM   259  O  O   . ARG A 1 49  ? -8.034  -4.434  -23.874 1.00 25.79 ? 73  ARG B O   1 
ATOM   260  C  CB  . ARG A 1 49  ? -6.555  -4.741  -20.956 1.00 24.99 ? 73  ARG B CB  1 
ATOM   261  C  CG  . ARG A 1 49  ? -5.476  -5.511  -20.213 1.00 24.83 ? 73  ARG B CG  1 
ATOM   262  C  CD  . ARG A 1 49  ? -5.997  -6.099  -18.914 1.00 25.10 ? 73  ARG B CD  1 
ATOM   263  N  NE  . ARG A 1 49  ? -4.959  -6.838  -18.204 1.00 24.98 ? 73  ARG B NE  1 
ATOM   264  C  CZ  . ARG A 1 49  ? -4.616  -8.094  -18.476 1.00 24.83 ? 73  ARG B CZ  1 
ATOM   265  N  NH1 . ARG A 1 49  ? -5.230  -8.757  -19.446 1.00 22.67 ? 73  ARG B NH1 1 
ATOM   266  N  NH2 . ARG A 1 49  ? -3.656  -8.686  -17.778 1.00 24.52 ? 73  ARG B NH2 1 
ATOM   267  N  N   . SER A 1 50  ? -7.546  -2.441  -22.940 1.00 24.35 ? 74  SER B N   1 
ATOM   268  C  CA  . SER A 1 50  ? -8.653  -1.732  -23.576 1.00 24.40 ? 74  SER B CA  1 
ATOM   269  C  C   . SER A 1 50  ? -8.417  -1.484  -25.064 1.00 24.77 ? 74  SER B C   1 
ATOM   270  O  O   . SER A 1 50  ? -9.361  -1.242  -25.816 1.00 26.45 ? 74  SER B O   1 
ATOM   271  C  CB  . SER A 1 50  ? -8.903  -0.403  -22.864 1.00 23.80 ? 74  SER B CB  1 
ATOM   272  O  OG  . SER A 1 50  ? -7.712  0.358   -22.782 1.00 23.57 ? 74  SER B OG  1 
ATOM   273  N  N   . SER A 1 51  ? -7.157  -1.549  -25.483 1.00 23.56 ? 75  SER B N   1 
ATOM   274  C  CA  . SER A 1 51  ? -6.792  -1.271  -26.867 1.00 23.51 ? 75  SER B CA  1 
ATOM   275  C  C   . SER A 1 51  ? -7.457  -2.228  -27.847 1.00 24.36 ? 75  SER B C   1 
ATOM   276  O  O   . SER A 1 51  ? -7.513  -3.434  -27.610 1.00 25.57 ? 75  SER B O   1 
ATOM   277  C  CB  . SER A 1 51  ? -5.274  -1.327  -27.036 1.00 24.39 ? 75  SER B CB  1 
ATOM   278  O  OG  . SER A 1 51  ? -4.634  -0.420  -26.156 1.00 25.17 ? 75  SER B OG  1 
ATOM   279  N  N   . GLU A 1 52  ? -7.955  -1.684  -28.953 1.00 24.50 ? 76  GLU B N   1 
ATOM   280  C  CA  . GLU A 1 52  ? -8.617  -2.494  -29.971 1.00 25.75 ? 76  GLU B CA  1 
ATOM   281  C  C   . GLU A 1 52  ? -7.732  -3.637  -30.472 1.00 25.81 ? 76  GLU B C   1 
ATOM   282  O  O   . GLU A 1 52  ? -8.230  -4.709  -30.814 1.00 25.50 ? 76  GLU B O   1 
ATOM   283  C  CB  . GLU A 1 52  ? -9.078  -1.624  -31.147 1.00 25.75 ? 76  GLU B CB  1 
ATOM   284  C  CG  . GLU A 1 52  ? -9.469  -2.420  -32.387 1.00 27.84 ? 76  GLU B CG  1 
ATOM   285  C  CD  . GLU A 1 52  ? -10.291 -1.614  -33.375 1.00 31.19 ? 76  GLU B CD  1 
ATOM   286  O  OE1 . GLU A 1 52  ? -10.286 -1.964  -34.578 1.00 30.32 ? 76  GLU B OE1 1 
ATOM   287  O  OE2 . GLU A 1 52  ? -10.944 -0.636  -32.948 1.00 29.23 ? 76  GLU B OE2 1 
ATOM   288  N  N   . ARG A 1 53  ? -6.423  -3.404  -30.514 1.00 26.19 ? 77  ARG B N   1 
ATOM   289  C  CA  . ARG A 1 53  ? -5.483  -4.397  -31.033 1.00 25.79 ? 77  ARG B CA  1 
ATOM   290  C  C   . ARG A 1 53  ? -5.132  -5.476  -30.012 1.00 25.33 ? 77  ARG B C   1 
ATOM   291  O  O   . ARG A 1 53  ? -4.447  -6.445  -30.339 1.00 25.45 ? 77  ARG B O   1 
ATOM   292  C  CB  . ARG A 1 53  ? -4.210  -3.723  -31.561 1.00 25.83 ? 77  ARG B CB  1 
ATOM   293  C  CG  . ARG A 1 53  ? -4.317  -3.274  -33.014 1.00 27.53 ? 77  ARG B CG  1 
ATOM   294  C  CD  . ARG A 1 53  ? -3.203  -2.312  -33.426 1.00 29.39 ? 77  ARG B CD  1 
ATOM   295  N  NE  . ARG A 1 53  ? -1.892  -2.952  -33.527 1.00 28.53 ? 77  ARG B NE  1 
ATOM   296  C  CZ  . ARG A 1 53  ? -0.826  -2.594  -32.813 1.00 28.60 ? 77  ARG B CZ  1 
ATOM   297  N  NH1 . ARG A 1 53  ? -0.908  -1.595  -31.941 1.00 25.95 ? 77  ARG B NH1 1 
ATOM   298  N  NH2 . ARG A 1 53  ? 0.327   -3.232  -32.974 1.00 27.75 ? 77  ARG B NH2 1 
ATOM   299  N  N   . PHE A 1 54  ? -5.605  -5.310  -28.781 1.00 25.84 ? 78  PHE B N   1 
ATOM   300  C  CA  . PHE A 1 54  ? -5.372  -6.302  -27.735 1.00 25.34 ? 78  PHE B CA  1 
ATOM   301  C  C   . PHE A 1 54  ? -5.887  -7.672  -28.162 1.00 25.33 ? 78  PHE B C   1 
ATOM   302  O  O   . PHE A 1 54  ? -5.348  -8.702  -27.760 1.00 26.24 ? 78  PHE B O   1 
ATOM   303  C  CB  . PHE A 1 54  ? -6.042  -5.879  -26.425 1.00 25.05 ? 78  PHE B CB  1 
ATOM   304  C  CG  . PHE A 1 54  ? -5.932  -6.905  -25.329 1.00 26.11 ? 78  PHE B CG  1 
ATOM   305  C  CD1 . PHE A 1 54  ? -4.896  -6.849  -24.409 1.00 25.87 ? 78  PHE B CD1 1 
ATOM   306  C  CD2 . PHE A 1 54  ? -6.864  -7.927  -25.220 1.00 25.61 ? 78  PHE B CD2 1 
ATOM   307  C  CE1 . PHE A 1 54  ? -4.791  -7.792  -23.400 1.00 25.13 ? 78  PHE B CE1 1 
ATOM   308  C  CE2 . PHE A 1 54  ? -6.765  -8.874  -24.215 1.00 25.46 ? 78  PHE B CE2 1 
ATOM   309  C  CZ  . PHE A 1 54  ? -5.727  -8.806  -23.303 1.00 25.09 ? 78  PHE B CZ  1 
ATOM   310  N  N   . LYS A 1 55  ? -6.931  -7.675  -28.983 1.00 24.05 ? 79  LYS B N   1 
ATOM   311  C  CA  . LYS A 1 55  ? -7.557  -8.911  -29.432 1.00 23.27 ? 79  LYS B CA  1 
ATOM   312  C  C   . LYS A 1 55  ? -6.683  -9.642  -30.445 1.00 24.39 ? 79  LYS B C   1 
ATOM   313  O  O   . LYS A 1 55  ? -6.997  -10.758 -30.861 1.00 24.78 ? 79  LYS B O   1 
ATOM   314  C  CB  . LYS A 1 55  ? -8.938  -8.623  -30.030 1.00 23.50 ? 79  LYS B CB  1 
ATOM   315  C  CG  . LYS A 1 55  ? -9.942  -8.039  -29.039 1.00 22.48 ? 79  LYS B CG  1 
ATOM   316  C  CD  . LYS A 1 55  ? -9.640  -6.580  -28.712 1.00 24.25 ? 79  LYS B CD  1 
ATOM   317  C  CE  . LYS A 1 55  ? -10.377 -6.125  -27.459 1.00 23.07 ? 79  LYS B CE  1 
ATOM   318  N  NZ  . LYS A 1 55  ? -10.075 -4.711  -27.097 1.00 23.51 ? 79  LYS B NZ  1 
ATOM   319  N  N   . GLU A 1 56  ? -5.584  -9.008  -30.841 1.00 25.48 ? 80  GLU B N   1 
ATOM   320  C  CA  . GLU A 1 56  ? -4.649  -9.613  -31.782 1.00 25.16 ? 80  GLU B CA  1 
ATOM   321  C  C   . GLU A 1 56  ? -3.638  -10.486 -31.046 1.00 25.75 ? 80  GLU B C   1 
ATOM   322  O  O   . GLU A 1 56  ? -2.799  -11.141 -31.665 1.00 25.28 ? 80  GLU B O   1 
ATOM   323  C  CB  . GLU A 1 56  ? -3.923  -8.537  -32.591 1.00 25.76 ? 80  GLU B CB  1 
ATOM   324  C  CG  . GLU A 1 56  ? -4.849  -7.601  -33.354 1.00 26.81 ? 80  GLU B CG  1 
ATOM   325  C  CD  . GLU A 1 56  ? -4.111  -6.745  -34.367 1.00 29.94 ? 80  GLU B CD  1 
ATOM   326  O  OE1 . GLU A 1 56  ? -4.782  -6.095  -35.199 1.00 30.81 ? 80  GLU B OE1 1 
ATOM   327  O  OE2 . GLU A 1 56  ? -2.862  -6.725  -34.335 1.00 30.22 ? 80  GLU B OE2 1 
ATOM   328  N  N   . LEU A 1 57  ? -3.723  -10.489 -29.719 1.00 24.51 ? 81  LEU B N   1 
ATOM   329  C  CA  . LEU A 1 57  ? -2.815  -11.275 -28.897 1.00 23.18 ? 81  LEU B CA  1 
ATOM   330  C  C   . LEU A 1 57  ? -3.450  -12.585 -28.447 1.00 24.05 ? 81  LEU B C   1 
ATOM   331  O  O   . LEU A 1 57  ? -4.447  -12.584 -27.724 1.00 24.68 ? 81  LEU B O   1 
ATOM   332  C  CB  . LEU A 1 57  ? -2.376  -10.476 -27.669 1.00 22.46 ? 81  LEU B CB  1 
ATOM   333  C  CG  . LEU A 1 57  ? -1.582  -9.192  -27.903 1.00 22.70 ? 81  LEU B CG  1 
ATOM   334  C  CD1 . LEU A 1 57  ? -1.200  -8.575  -26.570 1.00 21.93 ? 81  LEU B CD1 1 
ATOM   335  C  CD2 . LEU A 1 57  ? -0.345  -9.457  -28.749 1.00 21.38 ? 81  LEU B CD2 1 
ATOM   336  N  N   . THR A 1 58  ? -2.867  -13.700 -28.878 1.00 23.40 ? 82  THR B N   1 
ATOM   337  C  CA  . THR A 1 58  ? -3.278  -15.015 -28.401 1.00 22.82 ? 82  THR B CA  1 
ATOM   338  C  C   . THR A 1 58  ? -2.346  -15.486 -27.290 1.00 21.77 ? 82  THR B C   1 
ATOM   339  O  O   . THR A 1 58  ? -1.136  -15.278 -27.360 1.00 21.87 ? 82  THR B O   1 
ATOM   340  C  CB  . THR A 1 58  ? -3.288  -16.070 -29.533 1.00 23.43 ? 82  THR B CB  1 
ATOM   341  O  OG1 . THR A 1 58  ? -2.078  -15.974 -30.298 1.00 22.85 ? 82  THR B OG1 1 
ATOM   342  C  CG2 . THR A 1 58  ? -4.480  -15.862 -30.454 1.00 24.39 ? 82  THR B CG2 1 
ATOM   343  N  N   . PRO A 1 59  ? -2.914  -16.106 -26.248 1.00 21.70 ? 83  PRO B N   1 
ATOM   344  C  CA  . PRO A 1 59  ? -2.109  -16.699 -25.176 1.00 21.60 ? 83  PRO B CA  1 
ATOM   345  C  C   . PRO A 1 59  ? -1.403  -17.958 -25.662 1.00 22.40 ? 83  PRO B C   1 
ATOM   346  O  O   . PRO A 1 59  ? -1.985  -18.740 -26.415 1.00 22.94 ? 83  PRO B O   1 
ATOM   347  C  CB  . PRO A 1 59  ? -3.152  -17.066 -24.112 1.00 21.38 ? 83  PRO B CB  1 
ATOM   348  C  CG  . PRO A 1 59  ? -4.374  -16.276 -24.464 1.00 22.78 ? 83  PRO B CG  1 
ATOM   349  C  CD  . PRO A 1 59  ? -4.353  -16.162 -25.951 1.00 22.48 ? 83  PRO B CD  1 
ATOM   350  N  N   . ASN A 1 60  ? -0.159  -18.148 -25.239 1.00 21.53 ? 84  ASN B N   1 
ATOM   351  C  CA  . ASN A 1 60  ? 0.591   -19.342 -25.595 1.00 20.55 ? 84  ASN B CA  1 
ATOM   352  C  C   . ASN A 1 60  ? 0.533   -20.354 -24.461 1.00 20.89 ? 84  ASN B C   1 
ATOM   353  O  O   . ASN A 1 60  ? 1.066   -20.114 -23.377 1.00 21.26 ? 84  ASN B O   1 
ATOM   354  C  CB  . ASN A 1 60  ? 2.041   -18.985 -25.925 1.00 20.48 ? 84  ASN B CB  1 
ATOM   355  C  CG  . ASN A 1 60  ? 2.788   -20.128 -26.583 1.00 20.58 ? 84  ASN B CG  1 
ATOM   356  O  OD1 . ASN A 1 60  ? 2.389   -21.288 -26.484 1.00 20.70 ? 84  ASN B OD1 1 
ATOM   357  N  ND2 . ASN A 1 60  ? 3.882   -19.803 -27.263 1.00 19.61 ? 84  ASN B ND2 1 
ATOM   358  N  N   . TYR A 1 61  ? -0.126  -21.481 -24.710 1.00 21.15 ? 85  TYR B N   1 
ATOM   359  C  CA  . TYR A 1 61  ? -0.291  -22.508 -23.687 1.00 20.47 ? 85  TYR B CA  1 
ATOM   360  C  C   . TYR A 1 61  ? 0.500   -23.777 -23.993 1.00 20.25 ? 85  TYR B C   1 
ATOM   361  O  O   . TYR A 1 61  ? 0.033   -24.886 -23.739 1.00 20.05 ? 85  TYR B O   1 
ATOM   362  C  CB  . TYR A 1 61  ? -1.773  -22.835 -23.488 1.00 20.77 ? 85  TYR B CB  1 
ATOM   363  C  CG  . TYR A 1 61  ? -2.486  -21.868 -22.569 1.00 21.22 ? 85  TYR B CG  1 
ATOM   364  C  CD1 . TYR A 1 61  ? -2.200  -21.837 -21.210 1.00 21.83 ? 85  TYR B CD1 1 
ATOM   365  C  CD2 . TYR A 1 61  ? -3.445  -20.989 -23.057 1.00 21.57 ? 85  TYR B CD2 1 
ATOM   366  C  CE1 . TYR A 1 61  ? -2.844  -20.956 -20.362 1.00 22.23 ? 85  TYR B CE1 1 
ATOM   367  C  CE2 . TYR A 1 61  ? -4.096  -20.104 -22.214 1.00 22.35 ? 85  TYR B CE2 1 
ATOM   368  C  CZ  . TYR A 1 61  ? -3.791  -20.093 -20.867 1.00 23.25 ? 85  TYR B CZ  1 
ATOM   369  O  OH  . TYR A 1 61  ? -4.433  -19.218 -20.019 1.00 24.66 ? 85  TYR B OH  1 
ATOM   370  N  N   . ASN A 1 62  ? 1.700   -23.603 -24.538 1.00 19.65 ? 86  ASN B N   1 
ATOM   371  C  CA  . ASN A 1 62  ? 2.593   -24.721 -24.806 1.00 19.14 ? 86  ASN B CA  1 
ATOM   372  C  C   . ASN A 1 62  ? 3.002   -25.395 -23.499 1.00 19.87 ? 86  ASN B C   1 
ATOM   373  O  O   . ASN A 1 62  ? 3.473   -24.731 -22.575 1.00 20.24 ? 86  ASN B O   1 
ATOM   374  C  CB  . ASN A 1 62  ? 3.826   -24.232 -25.568 1.00 19.37 ? 86  ASN B CB  1 
ATOM   375  C  CG  . ASN A 1 62  ? 4.662   -25.366 -26.132 1.00 19.57 ? 86  ASN B CG  1 
ATOM   376  O  OD1 . ASN A 1 62  ? 4.589   -26.505 -25.669 1.00 20.09 ? 86  ASN B OD1 1 
ATOM   377  N  ND2 . ASN A 1 62  ? 5.473   -25.054 -27.136 1.00 18.82 ? 86  ASN B ND2 1 
ATOM   378  N  N   . PRO A 1 63  ? 2.806   -26.719 -23.411 1.00 19.97 ? 87  PRO B N   1 
ATOM   379  C  CA  . PRO A 1 63  ? 3.153   -27.475 -22.202 1.00 19.96 ? 87  PRO B CA  1 
ATOM   380  C  C   . PRO A 1 63  ? 4.659   -27.532 -21.975 1.00 19.66 ? 87  PRO B C   1 
ATOM   381  O  O   . PRO A 1 63  ? 5.102   -27.734 -20.845 1.00 18.81 ? 87  PRO B O   1 
ATOM   382  C  CB  . PRO A 1 63  ? 2.621   -28.881 -22.502 1.00 20.39 ? 87  PRO B CB  1 
ATOM   383  C  CG  . PRO A 1 63  ? 1.614   -28.695 -23.591 1.00 21.07 ? 87  PRO B CG  1 
ATOM   384  C  CD  . PRO A 1 63  ? 2.131   -27.561 -24.412 1.00 19.95 ? 87  PRO B CD  1 
ATOM   385  N  N   . ASP A 1 64  ? 5.431   -27.354 -23.043 1.00 20.16 ? 88  ASP B N   1 
ATOM   386  C  CA  . ASP A 1 64  ? 6.884   -27.469 -22.967 1.00 20.44 ? 88  ASP B CA  1 
ATOM   387  C  C   . ASP A 1 64  ? 7.575   -26.106 -22.945 1.00 19.38 ? 88  ASP B C   1 
ATOM   388  O  O   . ASP A 1 64  ? 8.741   -25.983 -23.325 1.00 18.55 ? 88  ASP B O   1 
ATOM   389  C  CB  . ASP A 1 64  ? 7.412   -28.326 -24.121 1.00 20.30 ? 88  ASP B CB  1 
ATOM   390  C  CG  . ASP A 1 64  ? 6.861   -29.742 -24.095 1.00 20.73 ? 88  ASP B CG  1 
ATOM   391  O  OD1 . ASP A 1 64  ? 7.000   -30.423 -23.056 1.00 20.18 ? 88  ASP B OD1 1 
ATOM   392  O  OD2 . ASP A 1 64  ? 6.289   -30.173 -25.117 1.00 20.73 ? 88  ASP B OD2 1 
ATOM   393  N  N   . ILE A 1 65  ? 6.844   -25.088 -22.502 1.00 18.75 ? 89  ILE B N   1 
ATOM   394  C  CA  . ILE A 1 65  ? 7.417   -23.767 -22.273 1.00 18.78 ? 89  ILE B CA  1 
ATOM   395  C  C   . ILE A 1 65  ? 7.076   -23.305 -20.865 1.00 19.25 ? 89  ILE B C   1 
ATOM   396  O  O   . ILE A 1 65  ? 5.906   -23.259 -20.487 1.00 20.04 ? 89  ILE B O   1 
ATOM   397  C  CB  . ILE A 1 65  ? 6.888   -22.717 -23.268 1.00 19.02 ? 89  ILE B CB  1 
ATOM   398  C  CG1 . ILE A 1 65  ? 7.091   -23.185 -24.710 1.00 18.87 ? 89  ILE B CG1 1 
ATOM   399  C  CG2 . ILE A 1 65  ? 7.574   -21.379 -23.036 1.00 18.13 ? 89  ILE B CG2 1 
ATOM   400  C  CD1 . ILE A 1 65  ? 6.653   -22.173 -25.745 1.00 17.89 ? 89  ILE B CD1 1 
ATOM   401  N  N   . ILE A 1 66  ? 8.100   -22.970 -20.089 1.00 18.72 ? 90  ILE B N   1 
ATOM   402  C  CA  . ILE A 1 66  ? 7.894   -22.487 -18.730 1.00 18.81 ? 90  ILE B CA  1 
ATOM   403  C  C   . ILE A 1 66  ? 7.723   -20.973 -18.704 1.00 18.45 ? 90  ILE B C   1 
ATOM   404  O  O   . ILE A 1 66  ? 8.629   -20.230 -19.075 1.00 18.57 ? 90  ILE B O   1 
ATOM   405  C  CB  . ILE A 1 66  ? 9.060   -22.884 -17.807 1.00 18.72 ? 90  ILE B CB  1 
ATOM   406  C  CG1 . ILE A 1 66  ? 8.984   -24.376 -17.476 1.00 18.84 ? 90  ILE B CG1 1 
ATOM   407  C  CG2 . ILE A 1 66  ? 9.038   -22.055 -16.534 1.00 18.63 ? 90  ILE B CG2 1 
ATOM   408  C  CD1 . ILE A 1 66  ? 10.078  -24.849 -16.551 1.00 18.92 ? 90  ILE B CD1 1 
ATOM   409  N  N   . PHE A 1 67  ? 6.553   -20.519 -18.269 1.00 19.15 ? 91  PHE B N   1 
ATOM   410  C  CA  . PHE A 1 67  ? 6.279   -19.090 -18.192 1.00 19.08 ? 91  PHE B CA  1 
ATOM   411  C  C   . PHE A 1 67  ? 6.406   -18.574 -16.762 1.00 19.02 ? 91  PHE B C   1 
ATOM   412  O  O   . PHE A 1 67  ? 5.765   -19.085 -15.845 1.00 19.87 ? 91  PHE B O   1 
ATOM   413  C  CB  . PHE A 1 67  ? 4.897   -18.772 -18.765 1.00 18.99 ? 91  PHE B CB  1 
ATOM   414  C  CG  . PHE A 1 67  ? 4.826   -18.871 -20.263 1.00 18.89 ? 91  PHE B CG  1 
ATOM   415  C  CD1 . PHE A 1 67  ? 5.080   -17.763 -21.057 1.00 18.64 ? 91  PHE B CD1 1 
ATOM   416  C  CD2 . PHE A 1 67  ? 4.510   -20.072 -20.877 1.00 19.26 ? 91  PHE B CD2 1 
ATOM   417  C  CE1 . PHE A 1 67  ? 5.017   -17.851 -22.436 1.00 19.26 ? 91  PHE B CE1 1 
ATOM   418  C  CE2 . PHE A 1 67  ? 4.444   -20.167 -22.257 1.00 19.11 ? 91  PHE B CE2 1 
ATOM   419  C  CZ  . PHE A 1 67  ? 4.698   -19.055 -23.037 1.00 19.62 ? 91  PHE B CZ  1 
ATOM   420  N  N   . LYS A 1 68  ? 7.249   -17.562 -16.585 1.00 19.20 ? 92  LYS B N   1 
ATOM   421  C  CA  . LYS A 1 68  ? 7.519   -16.996 -15.269 1.00 20.02 ? 92  LYS B CA  1 
ATOM   422  C  C   . LYS A 1 68  ? 6.239   -16.518 -14.589 1.00 20.36 ? 92  LYS B C   1 
ATOM   423  O  O   . LYS A 1 68  ? 5.958   -16.884 -13.448 1.00 20.81 ? 92  LYS B O   1 
ATOM   424  C  CB  . LYS A 1 68  ? 8.520   -15.845 -15.386 1.00 19.39 ? 92  LYS B CB  1 
ATOM   425  C  CG  . LYS A 1 68  ? 8.924   -15.232 -14.059 1.00 19.50 ? 92  LYS B CG  1 
ATOM   426  C  CD  . LYS A 1 68  ? 9.957   -14.139 -14.260 1.00 19.56 ? 92  LYS B CD  1 
ATOM   427  C  CE  . LYS A 1 68  ? 10.346  -13.503 -12.943 1.00 20.67 ? 92  LYS B CE  1 
ATOM   428  N  NZ  . LYS A 1 68  ? 10.817  -14.522 -11.968 1.00 21.33 ? 92  LYS B NZ  1 
ATOM   429  N  N   . ASP A 1 69  ? 5.473   -15.696 -15.301 1.00 19.98 ? 93  ASP B N   1 
ATOM   430  C  CA  . ASP A 1 69  ? 4.182   -15.216 -14.820 1.00 20.07 ? 93  ASP B CA  1 
ATOM   431  C  C   . ASP A 1 69  ? 4.211   -14.817 -13.349 1.00 20.64 ? 93  ASP B C   1 
ATOM   432  O  O   . ASP A 1 69  ? 3.364   -15.246 -12.565 1.00 21.15 ? 93  ASP B O   1 
ATOM   433  C  CB  . ASP A 1 69  ? 3.105   -16.278 -15.044 1.00 20.48 ? 93  ASP B CB  1 
ATOM   434  C  CG  . ASP A 1 69  ? 1.713   -15.769 -14.730 1.00 20.92 ? 93  ASP B CG  1 
ATOM   435  O  OD1 . ASP A 1 69  ? 1.476   -14.555 -14.904 1.00 21.24 ? 93  ASP B OD1 1 
ATOM   436  O  OD2 . ASP A 1 69  ? 0.860   -16.578 -14.309 1.00 20.78 ? 93  ASP B OD2 1 
ATOM   437  N  N   . GLU A 1 70  ? 5.185   -13.994 -12.975 1.00 20.29 ? 94  GLU B N   1 
ATOM   438  C  CA  . GLU A 1 70  ? 5.287   -13.531 -11.598 1.00 20.24 ? 94  GLU B CA  1 
ATOM   439  C  C   . GLU A 1 70  ? 4.198   -12.510 -11.296 1.00 20.76 ? 94  GLU B C   1 
ATOM   440  O  O   . GLU A 1 70  ? 4.008   -12.114 -10.146 1.00 20.89 ? 94  GLU B O   1 
ATOM   441  C  CB  . GLU A 1 70  ? 6.671   -12.940 -11.315 1.00 20.59 ? 94  GLU B CB  1 
ATOM   442  C  CG  . GLU A 1 70  ? 6.888   -11.541 -11.865 1.00 20.91 ? 94  GLU B CG  1 
ATOM   443  C  CD  . GLU A 1 70  ? 7.131   -11.528 -13.357 1.00 20.70 ? 94  GLU B CD  1 
ATOM   444  O  OE1 . GLU A 1 70  ? 7.172   -12.616 -13.963 1.00 20.59 ? 94  GLU B OE1 1 
ATOM   445  O  OE2 . GLU A 1 70  ? 7.285   -10.427 -13.925 1.00 21.29 ? 94  GLU B OE2 1 
ATOM   446  N  N   . GLU A 1 71  ? 3.482   -12.092 -12.336 1.00 21.19 ? 95  GLU B N   1 
ATOM   447  C  CA  . GLU A 1 71  ? 2.377   -11.154 -12.180 1.00 20.63 ? 95  GLU B CA  1 
ATOM   448  C  C   . GLU A 1 71  ? 1.089   -11.869 -11.790 1.00 21.25 ? 95  GLU B C   1 
ATOM   449  O  O   . GLU A 1 71  ? 0.183   -11.260 -11.223 1.00 21.92 ? 95  GLU B O   1 
ATOM   450  C  CB  . GLU A 1 71  ? 2.145   -10.370 -13.471 1.00 20.46 ? 95  GLU B CB  1 
ATOM   451  C  CG  . GLU A 1 71  ? 3.393   -9.760  -14.072 1.00 21.05 ? 95  GLU B CG  1 
ATOM   452  C  CD  . GLU A 1 71  ? 3.956   -10.588 -15.206 1.00 20.84 ? 95  GLU B CD  1 
ATOM   453  O  OE1 . GLU A 1 71  ? 3.810   -11.828 -15.181 1.00 20.82 ? 95  GLU B OE1 1 
ATOM   454  O  OE2 . GLU A 1 71  ? 4.540   -9.991  -16.131 1.00 21.32 ? 95  GLU B OE2 1 
ATOM   455  N  N   . ASN A 1 72  ? 1.012   -13.159 -12.102 1.00 21.04 ? 96  ASN B N   1 
ATOM   456  C  CA  . ASN A 1 72  ? -0.193  -13.944 -11.851 1.00 22.12 ? 96  ASN B CA  1 
ATOM   457  C  C   . ASN A 1 72  ? -1.364  -13.477 -12.711 1.00 21.63 ? 96  ASN B C   1 
ATOM   458  O  O   . ASN A 1 72  ? -2.526  -13.599 -12.322 1.00 21.43 ? 96  ASN B O   1 
ATOM   459  C  CB  . ASN A 1 72  ? -0.563  -13.908 -10.366 1.00 22.72 ? 96  ASN B CB  1 
ATOM   460  C  CG  . ASN A 1 72  ? 0.507   -14.523 -9.485  1.00 22.47 ? 96  ASN B CG  1 
ATOM   461  O  OD1 . ASN A 1 72  ? 0.909   -15.670 -9.687  1.00 22.79 ? 96  ASN B OD1 1 
ATOM   462  N  ND2 . ASN A 1 72  ? 0.972   -13.764 -8.498  1.00 22.37 ? 96  ASN B ND2 1 
ATOM   463  N  N   . THR A 1 73  ? -1.041  -12.944 -13.886 1.00 21.83 ? 97  THR B N   1 
ATOM   464  C  CA  . THR A 1 73  ? -2.043  -12.456 -14.825 1.00 21.78 ? 97  THR B CA  1 
ATOM   465  C  C   . THR A 1 73  ? -1.971  -13.235 -16.131 1.00 21.94 ? 97  THR B C   1 
ATOM   466  O  O   . THR A 1 73  ? -2.848  -13.115 -16.988 1.00 21.76 ? 97  THR B O   1 
ATOM   467  C  CB  . THR A 1 73  ? -1.832  -10.966 -15.144 1.00 22.10 ? 97  THR B CB  1 
ATOM   468  O  OG1 . THR A 1 73  ? -0.624  -10.804 -15.900 1.00 21.25 ? 97  THR B OG1 1 
ATOM   469  C  CG2 . THR A 1 73  ? -1.739  -10.151 -13.862 1.00 21.51 ? 97  THR B CG2 1 
ATOM   470  N  N   . GLY A 1 74  ? -0.914  -14.027 -16.278 1.00 21.65 ? 98  GLY B N   1 
ATOM   471  C  CA  . GLY A 1 74  ? -0.693  -14.790 -17.492 1.00 21.25 ? 98  GLY B CA  1 
ATOM   472  C  C   . GLY A 1 74  ? -0.370  -13.890 -18.667 1.00 21.46 ? 98  GLY B C   1 
ATOM   473  O  O   . GLY A 1 74  ? -0.544  -14.276 -19.823 1.00 21.63 ? 98  GLY B O   1 
ATOM   474  N  N   . ALA A 1 75  ? 0.103   -12.684 -18.369 1.00 21.18 ? 99  ALA B N   1 
ATOM   475  C  CA  . ALA A 1 75  ? 0.424   -11.710 -19.406 1.00 20.79 ? 99  ALA B CA  1 
ATOM   476  C  C   . ALA A 1 75  ? 1.546   -12.212 -20.307 1.00 20.71 ? 99  ALA B C   1 
ATOM   477  O  O   . ALA A 1 75  ? 1.566   -11.928 -21.504 1.00 20.79 ? 99  ALA B O   1 
ATOM   478  C  CB  . ALA A 1 75  ? 0.800   -10.375 -18.783 1.00 20.73 ? 99  ALA B CB  1 
ATOM   479  N  N   . ASP A 1 76  ? 2.477   -12.960 -19.722 1.00 20.33 ? 100 ASP B N   1 
ATOM   480  C  CA  . ASP A 1 76  ? 3.629   -13.473 -20.456 1.00 19.53 ? 100 ASP B CA  1 
ATOM   481  C  C   . ASP A 1 76  ? 3.220   -14.348 -21.630 1.00 19.74 ? 100 ASP B C   1 
ATOM   482  O  O   . ASP A 1 76  ? 3.876   -14.351 -22.670 1.00 19.25 ? 100 ASP B O   1 
ATOM   483  C  CB  . ASP A 1 76  ? 4.544   -14.264 -19.526 1.00 19.06 ? 100 ASP B CB  1 
ATOM   484  C  CG  . ASP A 1 76  ? 5.245   -13.385 -18.521 1.00 20.32 ? 100 ASP B CG  1 
ATOM   485  O  OD1 . ASP A 1 76  ? 5.119   -12.148 -18.636 1.00 19.87 ? 100 ASP B OD1 1 
ATOM   486  O  OD2 . ASP A 1 76  ? 5.921   -13.927 -17.621 1.00 20.41 ? 100 ASP B OD2 1 
ATOM   487  N  N   . ARG A 1 77  ? 2.134   -15.093 -21.451 1.00 20.37 ? 101 ARG B N   1 
ATOM   488  C  CA  . ARG A 1 77  ? 1.647   -16.006 -22.475 1.00 19.98 ? 101 ARG B CA  1 
ATOM   489  C  C   . ARG A 1 77  ? 1.073   -15.243 -23.661 1.00 20.13 ? 101 ARG B C   1 
ATOM   490  O  O   . ARG A 1 77  ? 0.948   -15.785 -24.757 1.00 20.36 ? 101 ARG B O   1 
ATOM   491  C  CB  . ARG A 1 77  ? 0.590   -16.941 -21.886 1.00 20.40 ? 101 ARG B CB  1 
ATOM   492  C  CG  . ARG A 1 77  ? 1.036   -17.635 -20.608 1.00 20.19 ? 101 ARG B CG  1 
ATOM   493  C  CD  . ARG A 1 77  ? -0.015  -18.603 -20.096 1.00 20.68 ? 101 ARG B CD  1 
ATOM   494  N  NE  . ARG A 1 77  ? 0.535   -19.518 -19.101 1.00 21.18 ? 101 ARG B NE  1 
ATOM   495  C  CZ  . ARG A 1 77  ? 1.167   -20.650 -19.398 1.00 20.97 ? 101 ARG B CZ  1 
ATOM   496  N  NH1 . ARG A 1 77  ? 1.328   -21.010 -20.665 1.00 20.14 ? 101 ARG B NH1 1 
ATOM   497  N  NH2 . ARG A 1 77  ? 1.639   -21.424 -18.429 1.00 21.48 ? 101 ARG B NH2 1 
ATOM   498  N  N   . LEU A 1 78  ? 0.733   -13.978 -23.437 1.00 20.39 ? 102 LEU B N   1 
ATOM   499  C  CA  . LEU A 1 78  ? 0.148   -13.147 -24.484 1.00 20.22 ? 102 LEU B CA  1 
ATOM   500  C  C   . LEU A 1 78  ? 1.188   -12.644 -25.480 1.00 19.94 ? 102 LEU B C   1 
ATOM   501  O  O   . LEU A 1 78  ? 2.170   -12.007 -25.103 1.00 19.91 ? 102 LEU B O   1 
ATOM   502  C  CB  . LEU A 1 78  ? -0.617  -11.975 -23.874 1.00 20.55 ? 102 LEU B CB  1 
ATOM   503  C  CG  . LEU A 1 78  ? -1.965  -12.359 -23.265 1.00 20.97 ? 102 LEU B CG  1 
ATOM   504  C  CD1 . LEU A 1 78  ? -2.658  -11.146 -22.673 1.00 21.82 ? 102 LEU B CD1 1 
ATOM   505  C  CD2 . LEU A 1 78  ? -2.842  -13.024 -24.316 1.00 21.42 ? 102 LEU B CD2 1 
ATOM   506  N  N   . MET A 1 79  ? 0.953   -12.935 -26.755 1.00 20.48 ? 103 MET B N   1 
ATOM   507  C  CA  . MET A 1 79  ? 1.868   -12.555 -27.824 1.00 20.59 ? 103 MET B CA  1 
ATOM   508  C  C   . MET A 1 79  ? 1.147   -12.619 -29.167 1.00 20.24 ? 103 MET B C   1 
ATOM   509  O  O   . MET A 1 79  ? -0.043  -12.924 -29.221 1.00 21.09 ? 103 MET B O   1 
ATOM   510  C  CB  . MET A 1 79  ? 3.086   -13.479 -27.828 1.00 20.09 ? 103 MET B CB  1 
ATOM   511  C  CG  . MET A 1 79  ? 2.742   -14.960 -27.938 1.00 19.91 ? 103 MET B CG  1 
ATOM   512  S  SD  . MET A 1 79  ? 4.150   -16.033 -27.586 1.00 17.47 ? 103 MET B SD  1 
ATOM   513  C  CE  . MET A 1 79  ? 4.401   -15.688 -25.848 1.00 18.62 ? 103 MET B CE  1 
ATOM   514  N  N   . THR A 1 80  ? 1.863   -12.329 -30.249 1.00 19.47 ? 104 THR B N   1 
ATOM   515  C  CA  . THR A 1 80  ? 1.266   -12.390 -31.582 1.00 20.95 ? 104 THR B CA  1 
ATOM   516  C  C   . THR A 1 80  ? 1.450   -13.767 -32.216 1.00 20.18 ? 104 THR B C   1 
ATOM   517  O  O   . THR A 1 80  ? 2.318   -14.539 -31.809 1.00 19.24 ? 104 THR B O   1 
ATOM   518  C  CB  . THR A 1 80  ? 1.830   -11.303 -32.524 1.00 20.04 ? 104 THR B CB  1 
ATOM   519  O  OG1 . THR A 1 80  ? 3.206   -11.578 -32.818 1.00 19.19 ? 104 THR B OG1 1 
ATOM   520  C  CG2 . THR A 1 80  ? 1.710   -9.931  -31.883 1.00 19.91 ? 104 THR B CG2 1 
ATOM   521  N  N   . GLN A 1 81  ? 0.626   -14.066 -33.216 1.00 20.77 ? 105 GLN B N   1 
ATOM   522  C  CA  . GLN A 1 81  ? 0.661   -15.366 -33.877 1.00 21.34 ? 105 GLN B CA  1 
ATOM   523  C  C   . GLN A 1 81  ? 2.054   -15.678 -34.410 1.00 20.76 ? 105 GLN B C   1 
ATOM   524  O  O   . GLN A 1 81  ? 2.478   -16.833 -34.431 1.00 20.76 ? 105 GLN B O   1 
ATOM   525  C  CB  . GLN A 1 81  ? -0.362  -15.422 -35.015 1.00 21.78 ? 105 GLN B CB  1 
ATOM   526  C  CG  . GLN A 1 81  ? -0.673  -16.830 -35.492 1.00 21.82 ? 105 GLN B CG  1 
ATOM   527  C  CD  . GLN A 1 81  ? -1.306  -17.680 -34.406 1.00 23.32 ? 105 GLN B CD  1 
ATOM   528  O  OE1 . GLN A 1 81  ? -2.186  -17.220 -33.676 1.00 23.82 ? 105 GLN B OE1 1 
ATOM   529  N  NE2 . GLN A 1 81  ? -0.861  -18.929 -34.295 1.00 22.84 ? 105 GLN B NE2 1 
ATOM   530  N  N   . ARG A 1 82  ? 2.760   -14.639 -34.839 1.00 20.27 ? 106 ARG B N   1 
ATOM   531  C  CA  . ARG A 1 82  ? 4.108   -14.796 -35.366 1.00 19.62 ? 106 ARG B CA  1 
ATOM   532  C  C   . ARG A 1 82  ? 5.099   -15.077 -34.241 1.00 19.45 ? 106 ARG B C   1 
ATOM   533  O  O   . ARG A 1 82  ? 5.887   -16.019 -34.311 1.00 19.43 ? 106 ARG B O   1 
ATOM   534  C  CB  . ARG A 1 82  ? 4.522   -13.541 -36.132 1.00 19.32 ? 106 ARG B CB  1 
ATOM   535  C  CG  . ARG A 1 82  ? 5.863   -13.655 -36.821 1.00 20.29 ? 106 ARG B CG  1 
ATOM   536  C  CD  . ARG A 1 82  ? 6.230   -12.357 -37.510 1.00 20.19 ? 106 ARG B CD  1 
ATOM   537  N  NE  . ARG A 1 82  ? 7.488   -12.477 -38.236 1.00 21.58 ? 106 ARG B NE  1 
ATOM   538  C  CZ  . ARG A 1 82  ? 7.588   -12.955 -39.472 1.00 23.11 ? 106 ARG B CZ  1 
ATOM   539  N  NH1 . ARG A 1 82  ? 6.502   -13.360 -40.117 1.00 22.70 ? 106 ARG B NH1 1 
ATOM   540  N  NH2 . ARG A 1 82  ? 8.774   -13.031 -40.061 1.00 23.29 ? 106 ARG B NH2 1 
ATOM   541  N  N   . CYS A 1 83  ? 5.057   -14.249 -33.204 1.00 19.67 ? 107 CYS B N   1 
ATOM   542  C  CA  . CYS A 1 83  ? 5.897   -14.448 -32.033 1.00 18.62 ? 107 CYS B CA  1 
ATOM   543  C  C   . CYS A 1 83  ? 5.636   -15.832 -31.458 1.00 18.83 ? 107 CYS B C   1 
ATOM   544  O  O   . CYS A 1 83  ? 6.527   -16.470 -30.901 1.00 18.28 ? 107 CYS B O   1 
ATOM   545  C  CB  . CYS A 1 83  ? 5.595   -13.376 -30.987 1.00 18.56 ? 107 CYS B CB  1 
ATOM   546  S  SG  . CYS A 1 83  ? 6.705   -13.361 -29.566 1.00 17.74 ? 107 CYS B SG  1 
ATOM   547  N  N   . LYS A 1 84  ? 4.400   -16.292 -31.616 1.00 19.75 ? 108 LYS B N   1 
ATOM   548  C  CA  . LYS A 1 84  ? 3.969   -17.582 -31.097 1.00 19.39 ? 108 LYS B CA  1 
ATOM   549  C  C   . LYS A 1 84  ? 4.567   -18.743 -31.891 1.00 19.78 ? 108 LYS B C   1 
ATOM   550  O  O   . LYS A 1 84  ? 5.021   -19.730 -31.315 1.00 19.63 ? 108 LYS B O   1 
ATOM   551  C  CB  . LYS A 1 84  ? 2.441   -17.656 -31.111 1.00 20.02 ? 108 LYS B CB  1 
ATOM   552  C  CG  . LYS A 1 84  ? 1.852   -18.887 -30.453 1.00 20.80 ? 108 LYS B CG  1 
ATOM   553  C  CD  . LYS A 1 84  ? 0.349   -18.730 -30.287 1.00 21.96 ? 108 LYS B CD  1 
ATOM   554  C  CE  . LYS A 1 84  ? -0.289  -19.992 -29.735 1.00 23.73 ? 108 LYS B CE  1 
ATOM   555  N  NZ  . LYS A 1 84  ? -1.721  -19.772 -29.391 1.00 24.20 ? 108 LYS B NZ  1 
ATOM   556  N  N   . ASP A 1 85  ? 4.565   -18.621 -33.215 1.00 19.62 ? 109 ASP B N   1 
ATOM   557  C  CA  . ASP A 1 85  ? 5.134   -19.650 -34.079 1.00 19.32 ? 109 ASP B CA  1 
ATOM   558  C  C   . ASP A 1 85  ? 6.642   -19.769 -33.877 1.00 19.30 ? 109 ASP B C   1 
ATOM   559  O  O   . ASP A 1 85  ? 7.171   -20.868 -33.711 1.00 19.45 ? 109 ASP B O   1 
ATOM   560  C  CB  . ASP A 1 85  ? 4.822   -19.351 -35.547 1.00 20.66 ? 109 ASP B CB  1 
ATOM   561  C  CG  . ASP A 1 85  ? 3.330   -19.340 -35.836 1.00 22.63 ? 109 ASP B CG  1 
ATOM   562  O  OD1 . ASP A 1 85  ? 2.549   -19.776 -34.964 1.00 22.06 ? 109 ASP B OD1 1 
ATOM   563  O  OD2 . ASP A 1 85  ? 2.938   -18.896 -36.936 1.00 22.79 ? 109 ASP B OD2 1 
ATOM   564  N  N   . ARG A 1 86  ? 7.327   -18.629 -33.894 1.00 19.46 ? 110 ARG B N   1 
ATOM   565  C  CA  . ARG A 1 86  ? 8.771   -18.589 -33.684 1.00 18.65 ? 110 ARG B CA  1 
ATOM   566  C  C   . ARG A 1 86  ? 9.134   -19.135 -32.310 1.00 18.05 ? 110 ARG B C   1 
ATOM   567  O  O   . ARG A 1 86  ? 10.125  -19.847 -32.157 1.00 17.69 ? 110 ARG B O   1 
ATOM   568  C  CB  . ARG A 1 86  ? 9.300   -17.157 -33.825 1.00 18.57 ? 110 ARG B CB  1 
ATOM   569  C  CG  . ARG A 1 86  ? 9.553   -16.703 -35.256 1.00 17.93 ? 110 ARG B CG  1 
ATOM   570  C  CD  . ARG A 1 86  ? 8.321   -16.877 -36.120 1.00 19.03 ? 110 ARG B CD  1 
ATOM   571  N  NE  . ARG A 1 86  ? 8.518   -16.341 -37.462 1.00 20.30 ? 110 ARG B NE  1 
ATOM   572  C  CZ  . ARG A 1 86  ? 7.760   -16.653 -38.509 1.00 22.06 ? 110 ARG B CZ  1 
ATOM   573  N  NH1 . ARG A 1 86  ? 6.755   -17.509 -38.370 1.00 21.99 ? 110 ARG B NH1 1 
ATOM   574  N  NH2 . ARG A 1 86  ? 8.011   -16.115 -39.696 1.00 21.93 ? 110 ARG B NH2 1 
ATOM   575  N  N   . LEU A 1 87  ? 8.328   -18.793 -31.311 1.00 18.16 ? 111 LEU B N   1 
ATOM   576  C  CA  . LEU A 1 87  ? 8.568   -19.248 -29.948 1.00 18.22 ? 111 LEU B CA  1 
ATOM   577  C  C   . LEU A 1 87  ? 8.337   -20.748 -29.828 1.00 18.34 ? 111 LEU B C   1 
ATOM   578  O  O   . LEU A 1 87  ? 9.168   -21.470 -29.276 1.00 18.23 ? 111 LEU B O   1 
ATOM   579  C  CB  . LEU A 1 87  ? 7.665   -18.505 -28.963 1.00 18.39 ? 111 LEU B CB  1 
ATOM   580  C  CG  . LEU A 1 87  ? 8.018   -18.663 -27.483 1.00 17.76 ? 111 LEU B CG  1 
ATOM   581  C  CD1 . LEU A 1 87  ? 9.287   -17.887 -27.159 1.00 17.41 ? 111 LEU B CD1 1 
ATOM   582  C  CD2 . LEU A 1 87  ? 6.872   -18.208 -26.596 1.00 17.29 ? 111 LEU B CD2 1 
ATOM   583  N  N   . ASN A 1 88  ? 7.204   -21.207 -30.354 1.00 18.49 ? 112 ASN B N   1 
ATOM   584  C  CA  . ASN A 1 88  ? 6.820   -22.614 -30.278 1.00 18.11 ? 112 ASN B CA  1 
ATOM   585  C  C   . ASN A 1 88  ? 7.829   -23.580 -30.897 1.00 17.89 ? 112 ASN B C   1 
ATOM   586  O  O   . ASN A 1 88  ? 7.963   -24.718 -30.445 1.00 17.76 ? 112 ASN B O   1 
ATOM   587  C  CB  . ASN A 1 88  ? 5.440   -22.829 -30.905 1.00 18.43 ? 112 ASN B CB  1 
ATOM   588  C  CG  . ASN A 1 88  ? 4.311   -22.521 -29.946 1.00 19.01 ? 112 ASN B CG  1 
ATOM   589  O  OD1 . ASN A 1 88  ? 4.539   -22.259 -28.764 1.00 18.79 ? 112 ASN B OD1 1 
ATOM   590  N  ND2 . ASN A 1 88  ? 3.083   -22.556 -30.448 1.00 19.45 ? 112 ASN B ND2 1 
ATOM   591  N  N   . SER A 1 89  ? 8.531   -23.131 -31.932 1.00 18.11 ? 113 SER B N   1 
ATOM   592  C  CA  . SER A 1 89  ? 9.521   -23.976 -32.591 1.00 18.31 ? 113 SER B CA  1 
ATOM   593  C  C   . SER A 1 89  ? 10.889  -23.858 -31.920 1.00 17.66 ? 113 SER B C   1 
ATOM   594  O  O   . SER A 1 89  ? 11.760  -24.707 -32.112 1.00 17.60 ? 113 SER B O   1 
ATOM   595  C  CB  . SER A 1 89  ? 9.618   -23.646 -34.082 1.00 17.79 ? 113 SER B CB  1 
ATOM   596  O  OG  . SER A 1 89  ? 10.258  -22.401 -34.287 1.00 18.63 ? 113 SER B OG  1 
ATOM   597  N  N   . LEU A 1 90  ? 11.074  -22.803 -31.134 1.00 17.78 ? 114 LEU B N   1 
ATOM   598  C  CA  . LEU A 1 90  ? 12.288  -22.661 -30.340 1.00 18.08 ? 114 LEU B CA  1 
ATOM   599  C  C   . LEU A 1 90  ? 12.234  -23.610 -29.151 1.00 18.06 ? 114 LEU B C   1 
ATOM   600  O  O   . LEU A 1 90  ? 13.261  -24.105 -28.691 1.00 18.12 ? 114 LEU B O   1 
ATOM   601  C  CB  . LEU A 1 90  ? 12.465  -21.223 -29.855 1.00 17.42 ? 114 LEU B CB  1 
ATOM   602  C  CG  . LEU A 1 90  ? 13.672  -20.998 -28.943 1.00 17.24 ? 114 LEU B CG  1 
ATOM   603  C  CD1 . LEU A 1 90  ? 14.933  -21.533 -29.593 1.00 17.71 ? 114 LEU B CD1 1 
ATOM   604  C  CD2 . LEU A 1 90  ? 13.830  -19.527 -28.592 1.00 17.49 ? 114 LEU B CD2 1 
ATOM   605  N  N   . ALA A 1 91  ? 11.024  -23.860 -28.661 1.00 18.05 ? 115 ALA B N   1 
ATOM   606  C  CA  . ALA A 1 91  ? 10.825  -24.773 -27.544 1.00 17.79 ? 115 ALA B CA  1 
ATOM   607  C  C   . ALA A 1 91  ? 11.296  -26.173 -27.913 1.00 17.95 ? 115 ALA B C   1 
ATOM   608  O  O   . ALA A 1 91  ? 11.811  -26.907 -27.071 1.00 17.94 ? 115 ALA B O   1 
ATOM   609  C  CB  . ALA A 1 91  ? 9.362   -24.791 -27.130 1.00 17.38 ? 115 ALA B CB  1 
ATOM   610  N  N   . ILE A 1 92  ? 11.114  -26.536 -29.180 1.00 18.05 ? 116 ILE B N   1 
ATOM   611  C  CA  . ILE A 1 92  ? 11.568  -27.827 -29.683 1.00 18.59 ? 116 ILE B CA  1 
ATOM   612  C  C   . ILE A 1 92  ? 13.079  -27.805 -29.864 1.00 18.34 ? 116 ILE B C   1 
ATOM   613  O  O   . ILE A 1 92  ? 13.770  -28.781 -29.573 1.00 18.59 ? 116 ILE B O   1 
ATOM   614  C  CB  . ILE A 1 92  ? 10.919  -28.166 -31.039 1.00 18.00 ? 116 ILE B CB  1 
ATOM   615  C  CG1 . ILE A 1 92  ? 9.399   -28.017 -30.964 1.00 17.14 ? 116 ILE B CG1 1 
ATOM   616  C  CG2 . ILE A 1 92  ? 11.295  -29.572 -31.474 1.00 18.28 ? 116 ILE B CG2 1 
ATOM   617  C  CD1 . ILE A 1 92  ? 8.713   -28.127 -32.308 1.00 16.64 ? 116 ILE B CD1 1 
ATOM   618  N  N   . SER A 1 93  ? 13.581  -26.675 -30.348 1.00 18.61 ? 117 SER B N   1 
ATOM   619  C  CA  . SER A 1 93  ? 15.004  -26.504 -30.596 1.00 18.13 ? 117 SER B CA  1 
ATOM   620  C  C   . SER A 1 93  ? 15.800  -26.625 -29.300 1.00 18.45 ? 117 SER B C   1 
ATOM   621  O  O   . SER A 1 93  ? 16.904  -27.168 -29.287 1.00 18.95 ? 117 SER B O   1 
ATOM   622  C  CB  . SER A 1 93  ? 15.255  -25.143 -31.247 1.00 18.40 ? 117 SER B CB  1 
ATOM   623  O  OG  . SER A 1 93  ? 16.498  -25.117 -31.923 1.00 20.48 ? 117 SER B OG  1 
ATOM   624  N  N   . VAL A 1 94  ? 15.227  -26.124 -28.210 1.00 18.42 ? 118 VAL B N   1 
ATOM   625  C  CA  . VAL A 1 94  ? 15.894  -26.132 -26.911 1.00 18.04 ? 118 VAL B CA  1 
ATOM   626  C  C   . VAL A 1 94  ? 15.944  -27.524 -26.275 1.00 18.66 ? 118 VAL B C   1 
ATOM   627  O  O   . VAL A 1 94  ? 16.977  -27.935 -25.751 1.00 18.60 ? 118 VAL B O   1 
ATOM   628  C  CB  . VAL A 1 94  ? 15.225  -25.149 -25.932 1.00 17.70 ? 118 VAL B CB  1 
ATOM   629  C  CG1 . VAL A 1 94  ? 15.805  -25.312 -24.536 1.00 17.97 ? 118 VAL B CG1 1 
ATOM   630  C  CG2 . VAL A 1 94  ? 15.395  -23.723 -26.420 1.00 17.74 ? 118 VAL B CG2 1 
ATOM   631  N  N   . MET A 1 95  ? 14.827  -28.244 -26.317 1.00 18.26 ? 119 MET B N   1 
ATOM   632  C  CA  . MET A 1 95  ? 14.778  -29.596 -25.770 1.00 18.25 ? 119 MET B CA  1 
ATOM   633  C  C   . MET A 1 95  ? 15.684  -30.534 -26.559 1.00 18.46 ? 119 MET B C   1 
ATOM   634  O  O   . MET A 1 95  ? 16.240  -31.487 -26.010 1.00 18.20 ? 119 MET B O   1 
ATOM   635  C  CB  . MET A 1 95  ? 13.349  -30.135 -25.792 1.00 19.28 ? 119 MET B CB  1 
ATOM   636  C  CG  . MET A 1 95  ? 12.325  -29.243 -25.126 1.00 19.57 ? 119 MET B CG  1 
ATOM   637  S  SD  . MET A 1 95  ? 10.663  -29.887 -25.373 1.00 23.35 ? 119 MET B SD  1 
ATOM   638  C  CE  . MET A 1 95  ? 10.760  -31.416 -24.446 1.00 24.37 ? 119 MET B CE  1 
ATOM   639  N  N   . ASN A 1 96  ? 15.820  -30.265 -27.854 1.00 18.98 ? 120 ASN B N   1 
ATOM   640  C  CA  . ASN A 1 96  ? 16.659  -31.085 -28.717 1.00 18.92 ? 120 ASN B CA  1 
ATOM   641  C  C   . ASN A 1 96  ? 18.133  -30.804 -28.477 1.00 19.32 ? 120 ASN B C   1 
ATOM   642  O  O   . ASN A 1 96  ? 18.983  -31.669 -28.680 1.00 21.05 ? 120 ASN B O   1 
ATOM   643  C  CB  . ASN A 1 96  ? 16.313  -30.849 -30.188 1.00 19.61 ? 120 ASN B CB  1 
ATOM   644  C  CG  . ASN A 1 96  ? 17.099  -31.748 -31.123 1.00 22.46 ? 120 ASN B CG  1 
ATOM   645  O  OD1 . ASN A 1 96  ? 16.873  -32.959 -31.178 1.00 22.68 ? 120 ASN B OD1 1 
ATOM   646  N  ND2 . ASN A 1 96  ? 18.027  -31.157 -31.871 1.00 21.91 ? 120 ASN B ND2 1 
ATOM   647  N  N   . GLN A 1 97  ? 18.429  -29.585 -28.039 1.00 19.33 ? 121 GLN B N   1 
ATOM   648  C  CA  . GLN A 1 97  ? 19.801  -29.182 -27.764 1.00 19.11 ? 121 GLN B CA  1 
ATOM   649  C  C   . GLN A 1 97  ? 20.253  -29.713 -26.412 1.00 18.39 ? 121 GLN B C   1 
ATOM   650  O  O   . GLN A 1 97  ? 21.297  -30.353 -26.299 1.00 19.20 ? 121 GLN B O   1 
ATOM   651  C  CB  . GLN A 1 97  ? 19.924  -27.657 -27.789 1.00 19.26 ? 121 GLN B CB  1 
ATOM   652  C  CG  . GLN A 1 97  ? 21.352  -27.154 -27.721 1.00 18.03 ? 121 GLN B CG  1 
ATOM   653  C  CD  . GLN A 1 97  ? 22.109  -27.422 -29.000 1.00 20.86 ? 121 GLN B CD  1 
ATOM   654  O  OE1 . GLN A 1 97  ? 21.542  -27.358 -30.091 1.00 21.64 ? 121 GLN B OE1 1 
ATOM   655  N  NE2 . GLN A 1 97  ? 23.396  -27.728 -28.877 1.00 22.07 ? 121 GLN B NE2 1 
ATOM   656  N  N   . TRP A 1 98  ? 19.458  -29.441 -25.385 1.00 17.95 ? 122 TRP B N   1 
ATOM   657  C  CA  . TRP A 1 98  ? 19.776  -29.878 -24.034 1.00 17.60 ? 122 TRP B CA  1 
ATOM   658  C  C   . TRP A 1 98  ? 18.652  -30.734 -23.466 1.00 17.33 ? 122 TRP B C   1 
ATOM   659  O  O   . TRP A 1 98  ? 17.854  -30.251 -22.664 1.00 17.21 ? 122 TRP B O   1 
ATOM   660  C  CB  . TRP A 1 98  ? 19.995  -28.671 -23.120 1.00 17.80 ? 122 TRP B CB  1 
ATOM   661  C  CG  . TRP A 1 98  ? 21.005  -27.682 -23.622 1.00 18.02 ? 122 TRP B CG  1 
ATOM   662  C  CD1 . TRP A 1 98  ? 22.362  -27.823 -23.619 1.00 18.30 ? 122 TRP B CD1 1 
ATOM   663  C  CD2 . TRP A 1 98  ? 20.737  -26.389 -24.178 1.00 17.44 ? 122 TRP B CD2 1 
ATOM   664  N  NE1 . TRP A 1 98  ? 22.956  -26.702 -24.147 1.00 18.50 ? 122 TRP B NE1 1 
ATOM   665  C  CE2 . TRP A 1 98  ? 21.980  -25.806 -24.497 1.00 18.52 ? 122 TRP B CE2 1 
ATOM   666  C  CE3 . TRP A 1 98  ? 19.568  -25.670 -24.442 1.00 17.60 ? 122 TRP B CE3 1 
ATOM   667  C  CZ2 . TRP A 1 98  ? 22.087  -24.537 -25.066 1.00 18.55 ? 122 TRP B CZ2 1 
ATOM   668  C  CZ3 . TRP A 1 98  ? 19.677  -24.410 -25.008 1.00 18.12 ? 122 TRP B CZ3 1 
ATOM   669  C  CH2 . TRP A 1 98  ? 20.926  -23.858 -25.314 1.00 18.49 ? 122 TRP B CH2 1 
ATOM   670  N  N   . PRO A 1 99  ? 18.582  -32.008 -23.882 1.00 17.23 ? 123 PRO B N   1 
ATOM   671  C  CA  . PRO A 1 99  ? 17.555  -32.918 -23.369 1.00 16.67 ? 123 PRO B CA  1 
ATOM   672  C  C   . PRO A 1 99  ? 17.464  -32.853 -21.848 1.00 16.94 ? 123 PRO B C   1 
ATOM   673  O  O   . PRO A 1 99  ? 18.448  -33.111 -21.156 1.00 17.11 ? 123 PRO B O   1 
ATOM   674  C  CB  . PRO A 1 99  ? 18.060  -34.289 -23.815 1.00 16.55 ? 123 PRO B CB  1 
ATOM   675  C  CG  . PRO A 1 99  ? 18.818  -34.010 -25.059 1.00 17.01 ? 123 PRO B CG  1 
ATOM   676  C  CD  . PRO A 1 99  ? 19.472  -32.671 -24.851 1.00 17.39 ? 123 PRO B CD  1 
ATOM   677  N  N   . GLY A 1 100 ? 16.287  -32.505 -21.340 1.00 16.76 ? 124 GLY B N   1 
ATOM   678  C  CA  . GLY A 1 100 ? 16.094  -32.341 -19.913 1.00 17.15 ? 124 GLY B CA  1 
ATOM   679  C  C   . GLY A 1 100 ? 15.953  -30.878 -19.542 1.00 17.07 ? 124 GLY B C   1 
ATOM   680  O  O   . GLY A 1 100 ? 15.714  -30.541 -18.384 1.00 18.28 ? 124 GLY B O   1 
ATOM   681  N  N   . VAL A 1 101 ? 16.100  -30.009 -20.537 1.00 16.94 ? 125 VAL B N   1 
ATOM   682  C  CA  . VAL A 1 101 ? 16.011  -28.569 -20.329 1.00 17.52 ? 125 VAL B CA  1 
ATOM   683  C  C   . VAL A 1 101 ? 14.952  -27.939 -21.232 1.00 17.33 ? 125 VAL B C   1 
ATOM   684  O  O   . VAL A 1 101 ? 14.882  -28.236 -22.424 1.00 17.16 ? 125 VAL B O   1 
ATOM   685  C  CB  . VAL A 1 101 ? 17.363  -27.886 -20.590 1.00 17.37 ? 125 VAL B CB  1 
ATOM   686  C  CG1 . VAL A 1 101 ? 17.211  -26.385 -20.513 1.00 16.22 ? 125 VAL B CG1 1 
ATOM   687  C  CG2 . VAL A 1 101 ? 18.405  -28.377 -19.598 1.00 17.17 ? 125 VAL B CG2 1 
ATOM   688  N  N   . LYS A 1 102 ? 14.130  -27.066 -20.658 1.00 17.48 ? 126 LYS B N   1 
ATOM   689  C  CA  . LYS A 1 102 ? 13.052  -26.433 -21.409 1.00 18.22 ? 126 LYS B CA  1 
ATOM   690  C  C   . LYS A 1 102 ? 13.281  -24.939 -21.606 1.00 17.94 ? 126 LYS B C   1 
ATOM   691  O  O   . LYS A 1 102 ? 14.086  -24.321 -20.909 1.00 17.76 ? 126 LYS B O   1 
ATOM   692  C  CB  . LYS A 1 102 ? 11.704  -26.662 -20.717 1.00 18.25 ? 126 LYS B CB  1 
ATOM   693  C  CG  . LYS A 1 102 ? 11.216  -28.097 -20.776 1.00 19.28 ? 126 LYS B CG  1 
ATOM   694  C  CD  . LYS A 1 102 ? 9.816   -28.237 -20.198 1.00 19.72 ? 126 LYS B CD  1 
ATOM   695  C  CE  . LYS A 1 102 ? 9.285   -29.649 -20.400 1.00 22.48 ? 126 LYS B CE  1 
ATOM   696  N  NZ  . LYS A 1 102 ? 7.964   -29.858 -19.749 1.00 23.05 ? 126 LYS B NZ  1 
ATOM   697  N  N   . LEU A 1 103 ? 12.563  -24.370 -22.568 1.00 17.71 ? 127 LEU B N   1 
ATOM   698  C  CA  . LEU A 1 103 ? 12.594  -22.934 -22.809 1.00 17.90 ? 127 LEU B CA  1 
ATOM   699  C  C   . LEU A 1 103 ? 11.800  -22.206 -21.731 1.00 17.50 ? 127 LEU B C   1 
ATOM   700  O  O   . LEU A 1 103 ? 10.715  -22.644 -21.350 1.00 18.54 ? 127 LEU B O   1 
ATOM   701  C  CB  . LEU A 1 103 ? 12.009  -22.626 -24.188 1.00 17.99 ? 127 LEU B CB  1 
ATOM   702  C  CG  . LEU A 1 103 ? 11.743  -21.162 -24.534 1.00 16.96 ? 127 LEU B CG  1 
ATOM   703  C  CD1 . LEU A 1 103 ? 13.047  -20.390 -24.624 1.00 16.95 ? 127 LEU B CD1 1 
ATOM   704  C  CD2 . LEU A 1 103 ? 10.965  -21.066 -25.836 1.00 16.93 ? 127 LEU B CD2 1 
ATOM   705  N  N   . ARG A 1 104 ? 12.342  -21.098 -21.240 1.00 17.35 ? 128 ARG B N   1 
ATOM   706  C  CA  . ARG A 1 104 ? 11.673  -20.324 -20.200 1.00 17.57 ? 128 ARG B CA  1 
ATOM   707  C  C   . ARG A 1 104 ? 11.435  -18.888 -20.644 1.00 18.04 ? 128 ARG B C   1 
ATOM   708  O  O   . ARG A 1 104 ? 12.324  -18.247 -21.206 1.00 18.17 ? 128 ARG B O   1 
ATOM   709  C  CB  . ARG A 1 104 ? 12.486  -20.350 -18.905 1.00 17.70 ? 128 ARG B CB  1 
ATOM   710  C  CG  . ARG A 1 104 ? 11.936  -19.464 -17.798 1.00 17.84 ? 128 ARG B CG  1 
ATOM   711  C  CD  . ARG A 1 104 ? 12.663  -19.720 -16.487 1.00 19.01 ? 128 ARG B CD  1 
ATOM   712  N  NE  . ARG A 1 104 ? 12.345  -18.726 -15.465 1.00 20.07 ? 128 ARG B NE  1 
ATOM   713  C  CZ  . ARG A 1 104 ? 13.123  -17.691 -15.161 1.00 19.90 ? 128 ARG B CZ  1 
ATOM   714  N  NH1 . ARG A 1 104 ? 14.273  -17.510 -15.799 1.00 19.74 ? 128 ARG B NH1 1 
ATOM   715  N  NH2 . ARG A 1 104 ? 12.755  -16.838 -14.216 1.00 19.78 ? 128 ARG B NH2 1 
ATOM   716  N  N   . VAL A 1 105 ? 10.229  -18.388 -20.392 1.00 18.15 ? 129 VAL B N   1 
ATOM   717  C  CA  . VAL A 1 105 ? 9.885   -17.009 -20.718 1.00 18.19 ? 129 VAL B CA  1 
ATOM   718  C  C   . VAL A 1 105 ? 9.746   -16.170 -19.455 1.00 18.32 ? 129 VAL B C   1 
ATOM   719  O  O   . VAL A 1 105 ? 9.013   -16.534 -18.536 1.00 18.67 ? 129 VAL B O   1 
ATOM   720  C  CB  . VAL A 1 105 ? 8.575   -16.925 -21.522 1.00 18.14 ? 129 VAL B CB  1 
ATOM   721  C  CG1 . VAL A 1 105 ? 8.128   -15.480 -21.657 1.00 17.66 ? 129 VAL B CG1 1 
ATOM   722  C  CG2 . VAL A 1 105 ? 8.751   -17.567 -22.889 1.00 18.75 ? 129 VAL B CG2 1 
ATOM   723  N  N   . THR A 1 106 ? 10.459  -15.048 -19.414 1.00 18.35 ? 130 THR B N   1 
ATOM   724  C  CA  . THR A 1 106 ? 10.405  -14.145 -18.270 1.00 18.14 ? 130 THR B CA  1 
ATOM   725  C  C   . THR A 1 106 ? 9.563   -12.916 -18.579 1.00 18.42 ? 130 THR B C   1 
ATOM   726  O  O   . THR A 1 106 ? 9.090   -12.242 -17.671 1.00 19.18 ? 130 THR B O   1 
ATOM   727  C  CB  . THR A 1 106 ? 11.811  -13.682 -17.840 1.00 18.00 ? 130 THR B CB  1 
ATOM   728  O  OG1 . THR A 1 106 ? 12.442  -12.992 -18.925 1.00 18.04 ? 130 THR B OG1 1 
ATOM   729  C  CG2 . THR A 1 106 ? 12.666  -14.870 -17.440 1.00 18.34 ? 130 THR B CG2 1 
ATOM   730  N  N   . GLU A 1 107 ? 9.384   -12.627 -19.863 1.00 18.40 ? 131 GLU B N   1 
ATOM   731  C  CA  . GLU A 1 107 ? 8.609   -11.468 -20.289 1.00 17.99 ? 131 GLU B CA  1 
ATOM   732  C  C   . GLU A 1 107 ? 8.023   -11.670 -21.679 1.00 18.22 ? 131 GLU B C   1 
ATOM   733  O  O   . GLU A 1 107 ? 8.746   -11.964 -22.628 1.00 18.03 ? 131 GLU B O   1 
ATOM   734  C  CB  . GLU A 1 107 ? 9.477   -10.209 -20.288 1.00 18.30 ? 131 GLU B CB  1 
ATOM   735  C  CG  . GLU A 1 107 ? 9.675   -9.582  -18.923 1.00 19.49 ? 131 GLU B CG  1 
ATOM   736  C  CD  . GLU A 1 107 ? 8.436   -8.869  -18.426 1.00 20.59 ? 131 GLU B CD  1 
ATOM   737  O  OE1 . GLU A 1 107 ? 7.750   -8.224  -19.247 1.00 20.57 ? 131 GLU B OE1 1 
ATOM   738  O  OE2 . GLU A 1 107 ? 8.153   -8.944  -17.212 1.00 21.49 ? 131 GLU B OE2 1 
ATOM   739  N  N   . GLY A 1 108 ? 6.708   -11.514 -21.790 1.00 18.99 ? 132 GLY B N   1 
ATOM   740  C  CA  . GLY A 1 108 ? 6.040   -11.532 -23.078 1.00 18.89 ? 132 GLY B CA  1 
ATOM   741  C  C   . GLY A 1 108 ? 5.464   -10.156 -23.341 1.00 19.54 ? 132 GLY B C   1 
ATOM   742  O  O   . GLY A 1 108 ? 6.173   -9.155  -23.246 1.00 20.00 ? 132 GLY B O   1 
ATOM   743  N  N   . TRP A 1 109 ? 4.179   -10.097 -23.672 1.00 19.97 ? 133 TRP B N   1 
ATOM   744  C  CA  . TRP A 1 109 ? 3.486   -8.820  -23.716 1.00 20.30 ? 133 TRP B CA  1 
ATOM   745  C  C   . TRP A 1 109 ? 3.539   -8.224  -22.316 1.00 20.67 ? 133 TRP B C   1 
ATOM   746  O  O   . TRP A 1 109 ? 3.540   -8.959  -21.329 1.00 20.40 ? 133 TRP B O   1 
ATOM   747  C  CB  . TRP A 1 109 ? 2.038   -9.005  -24.165 1.00 20.31 ? 133 TRP B CB  1 
ATOM   748  C  CG  . TRP A 1 109 ? 1.212   -7.768  -24.023 1.00 20.88 ? 133 TRP B CG  1 
ATOM   749  C  CD1 . TRP A 1 109 ? 1.197   -6.691  -24.860 1.00 21.01 ? 133 TRP B CD1 1 
ATOM   750  C  CD2 . TRP A 1 109 ? 0.276   -7.477  -22.978 1.00 21.69 ? 133 TRP B CD2 1 
ATOM   751  N  NE1 . TRP A 1 109 ? 0.312   -5.746  -24.400 1.00 21.32 ? 133 TRP B NE1 1 
ATOM   752  C  CE2 . TRP A 1 109 ? -0.267  -6.205  -23.246 1.00 22.18 ? 133 TRP B CE2 1 
ATOM   753  C  CE3 . TRP A 1 109 ? -0.154  -8.168  -21.841 1.00 21.79 ? 133 TRP B CE3 1 
ATOM   754  C  CZ2 . TRP A 1 109 ? -1.218  -5.610  -22.420 1.00 22.98 ? 133 TRP B CZ2 1 
ATOM   755  C  CZ3 . TRP A 1 109 ? -1.098  -7.576  -21.022 1.00 22.36 ? 133 TRP B CZ3 1 
ATOM   756  C  CH2 . TRP A 1 109 ? -1.619  -6.310  -21.316 1.00 22.88 ? 133 TRP B CH2 1 
ATOM   757  N  N   . ASP A 1 110 ? 3.592   -6.900  -22.222 1.00 20.81 ? 134 ASP B N   1 
ATOM   758  C  CA  . ASP A 1 110 ? 3.749   -6.255  -20.922 1.00 21.16 ? 134 ASP B CA  1 
ATOM   759  C  C   . ASP A 1 110 ? 2.770   -5.112  -20.676 1.00 21.64 ? 134 ASP B C   1 
ATOM   760  O  O   . ASP A 1 110 ? 2.449   -4.343  -21.583 1.00 21.87 ? 134 ASP B O   1 
ATOM   761  C  CB  . ASP A 1 110 ? 5.180   -5.747  -20.749 1.00 20.86 ? 134 ASP B CB  1 
ATOM   762  C  CG  . ASP A 1 110 ? 5.374   -4.996  -19.450 1.00 21.66 ? 134 ASP B CG  1 
ATOM   763  O  OD1 . ASP A 1 110 ? 4.740   -5.375  -18.445 1.00 21.15 ? 134 ASP B OD1 1 
ATOM   764  O  OD2 . ASP A 1 110 ? 6.157   -4.025  -19.430 1.00 23.55 ? 134 ASP B OD2 1 
ATOM   765  N  N   . GLU A 1 111 ? 2.305   -5.008  -19.434 1.00 21.84 ? 135 GLU B N   1 
ATOM   766  C  CA  . GLU A 1 111 ? 1.473   -3.888  -19.010 1.00 22.17 ? 135 GLU B CA  1 
ATOM   767  C  C   . GLU A 1 111 ? 1.886   -3.386  -17.629 1.00 21.90 ? 135 GLU B C   1 
ATOM   768  O  O   . GLU A 1 111 ? 1.157   -2.630  -16.989 1.00 22.77 ? 135 GLU B O   1 
ATOM   769  C  CB  . GLU A 1 111 ? -0.007  -4.274  -19.011 1.00 23.02 ? 135 GLU B CB  1 
ATOM   770  C  CG  . GLU A 1 111 ? -0.368  -5.366  -18.025 1.00 23.49 ? 135 GLU B CG  1 
ATOM   771  C  CD  . GLU A 1 111 ? -1.862  -5.452  -17.781 1.00 24.17 ? 135 GLU B CD  1 
ATOM   772  O  OE1 . GLU A 1 111 ? -2.581  -4.505  -18.166 1.00 23.98 ? 135 GLU B OE1 1 
ATOM   773  O  OE2 . GLU A 1 111 ? -2.316  -6.463  -17.203 1.00 23.90 ? 135 GLU B OE2 1 
ATOM   774  N  N   . ASP A 1 112 ? 3.059   -3.816  -17.175 1.00 22.87 ? 136 ASP B N   1 
ATOM   775  C  CA  . ASP A 1 112 ? 3.606   -3.372  -15.896 1.00 23.26 ? 136 ASP B CA  1 
ATOM   776  C  C   . ASP A 1 112 ? 4.389   -2.075  -16.076 1.00 23.95 ? 136 ASP B C   1 
ATOM   777  O  O   . ASP A 1 112 ? 4.363   -1.202  -15.210 1.00 26.17 ? 136 ASP B O   1 
ATOM   778  C  CB  . ASP A 1 112 ? 4.486   -4.461  -15.278 1.00 23.37 ? 136 ASP B CB  1 
ATOM   779  C  CG  . ASP A 1 112 ? 3.684   -5.668  -14.823 1.00 23.41 ? 136 ASP B CG  1 
ATOM   780  O  OD1 . ASP A 1 112 ? 2.984   -5.566  -13.794 1.00 24.48 ? 136 ASP B OD1 1 
ATOM   781  O  OD2 . ASP A 1 112 ? 3.754   -6.721  -15.489 1.00 22.04 ? 136 ASP B OD2 1 
ATOM   782  N  N   . GLY A 1 113 ? 5.091   -1.960  -17.201 1.00 23.55 ? 137 GLY B N   1 
ATOM   783  C  CA  . GLY A 1 113 ? 5.640   -0.687  -17.638 1.00 24.01 ? 137 GLY B CA  1 
ATOM   784  C  C   . GLY A 1 113 ? 7.072   -0.344  -17.267 1.00 24.30 ? 137 GLY B C   1 
ATOM   785  O  O   . GLY A 1 113 ? 7.417   0.833   -17.174 1.00 24.31 ? 137 GLY B O   1 
ATOM   786  N  N   . HIS A 1 114 ? 7.914   -1.352  -17.069 1.00 24.33 ? 138 HIS B N   1 
ATOM   787  C  CA  . HIS A 1 114 ? 9.317   -1.103  -16.751 1.00 24.18 ? 138 HIS B CA  1 
ATOM   788  C  C   . HIS A 1 114 ? 10.192  -1.120  -18.003 1.00 24.35 ? 138 HIS B C   1 
ATOM   789  O  O   . HIS A 1 114 ? 11.419  -1.094  -17.913 1.00 25.08 ? 138 HIS B O   1 
ATOM   790  C  CB  . HIS A 1 114 ? 9.834   -2.121  -15.734 1.00 24.36 ? 138 HIS B CB  1 
ATOM   791  C  CG  . HIS A 1 114 ? 9.831   -3.531  -16.236 1.00 23.71 ? 138 HIS B CG  1 
ATOM   792  N  ND1 . HIS A 1 114 ? 8.757   -4.378  -16.068 1.00 22.67 ? 138 HIS B ND1 1 
ATOM   793  C  CD2 . HIS A 1 114 ? 10.772  -4.243  -16.900 1.00 22.88 ? 138 HIS B CD2 1 
ATOM   794  C  CE1 . HIS A 1 114 ? 9.036   -5.550  -16.608 1.00 22.32 ? 138 HIS B CE1 1 
ATOM   795  N  NE2 . HIS A 1 114 ? 10.252  -5.496  -17.119 1.00 23.01 ? 138 HIS B NE2 1 
ATOM   796  N  N   . HIS A 1 115 ? 9.554   -1.163  -19.169 1.00 23.75 ? 139 HIS B N   1 
ATOM   797  C  CA  . HIS A 1 115 ? 10.276  -1.183  -20.437 1.00 23.55 ? 139 HIS B CA  1 
ATOM   798  C  C   . HIS A 1 115 ? 10.346  0.202   -21.073 1.00 24.92 ? 139 HIS B C   1 
ATOM   799  O  O   . HIS A 1 115 ? 9.393   0.980   -20.998 1.00 24.62 ? 139 HIS B O   1 
ATOM   800  C  CB  . HIS A 1 115 ? 9.625   -2.168  -21.409 1.00 23.20 ? 139 HIS B CB  1 
ATOM   801  C  CG  . HIS A 1 115 ? 9.653   -3.589  -20.940 1.00 22.26 ? 139 HIS B CG  1 
ATOM   802  N  ND1 . HIS A 1 115 ? 10.737  -4.416  -21.135 1.00 20.46 ? 139 HIS B ND1 1 
ATOM   803  C  CD2 . HIS A 1 115 ? 8.728   -4.329  -20.286 1.00 21.54 ? 139 HIS B CD2 1 
ATOM   804  C  CE1 . HIS A 1 115 ? 10.480  -5.604  -20.619 1.00 20.93 ? 139 HIS B CE1 1 
ATOM   805  N  NE2 . HIS A 1 115 ? 9.266   -5.578  -20.098 1.00 20.35 ? 139 HIS B NE2 1 
ATOM   806  N  N   . SER A 1 116 ? 11.479  0.505   -21.700 1.00 25.31 ? 140 SER B N   1 
ATOM   807  C  CA  . SER A 1 116 ? 11.652  1.779   -22.386 1.00 25.84 ? 140 SER B CA  1 
ATOM   808  C  C   . SER A 1 116 ? 10.510  2.014   -23.367 1.00 26.02 ? 140 SER B C   1 
ATOM   809  O  O   . SER A 1 116 ? 10.138  1.116   -24.121 1.00 25.72 ? 140 SER B O   1 
ATOM   810  C  CB  . SER A 1 116 ? 12.993  1.819   -23.117 1.00 24.78 ? 140 SER B CB  1 
ATOM   811  O  OG  . SER A 1 116 ? 13.097  0.753   -24.042 1.00 25.35 ? 140 SER B OG  1 
ATOM   812  N  N   . GLU A 1 117 ? 9.951   3.219   -23.347 1.00 26.51 ? 141 GLU B N   1 
ATOM   813  C  CA  . GLU A 1 117 ? 8.841   3.558   -24.229 1.00 27.40 ? 141 GLU B CA  1 
ATOM   814  C  C   . GLU A 1 117 ? 9.119   3.123   -25.669 1.00 26.99 ? 141 GLU B C   1 
ATOM   815  O  O   . GLU A 1 117 ? 10.249  3.218   -26.153 1.00 26.36 ? 141 GLU B O   1 
ATOM   816  C  CB  . GLU A 1 117 ? 8.535   5.056   -24.157 1.00 29.33 ? 141 GLU B CB  1 
ATOM   817  C  CG  . GLU A 1 117 ? 7.978   5.495   -22.808 1.00 31.82 ? 141 GLU B CG  1 
ATOM   818  C  CD  . GLU A 1 117 ? 7.803   6.998   -22.699 1.00 35.50 ? 141 GLU B CD  1 
ATOM   819  O  OE1 . GLU A 1 117 ? 8.005   7.705   -23.711 1.00 36.70 ? 141 GLU B OE1 1 
ATOM   820  O  OE2 . GLU A 1 117 ? 7.461   7.475   -21.594 1.00 36.13 ? 141 GLU B OE2 1 
ATOM   821  N  N   . GLU A 1 118 ? 8.077   2.641   -26.340 1.00 25.78 ? 142 GLU B N   1 
ATOM   822  C  CA  . GLU A 1 118 ? 8.198   2.085   -27.684 1.00 24.78 ? 142 GLU B CA  1 
ATOM   823  C  C   . GLU A 1 118 ? 8.885   0.721   -27.669 1.00 23.87 ? 142 GLU B C   1 
ATOM   824  O  O   . GLU A 1 118 ? 9.507   0.316   -28.650 1.00 23.46 ? 142 GLU B O   1 
ATOM   825  C  CB  . GLU A 1 118 ? 8.925   3.051   -28.624 1.00 25.15 ? 142 GLU B CB  1 
ATOM   826  C  CG  . GLU A 1 118 ? 8.244   4.402   -28.762 1.00 26.65 ? 142 GLU B CG  1 
ATOM   827  C  CD  . GLU A 1 118 ? 8.638   5.130   -30.033 1.00 28.30 ? 142 GLU B CD  1 
ATOM   828  O  OE1 . GLU A 1 118 ? 8.836   4.459   -31.069 1.00 26.26 ? 142 GLU B OE1 1 
ATOM   829  O  OE2 . GLU A 1 118 ? 8.742   6.375   -29.996 1.00 30.40 ? 142 GLU B OE2 1 
ATOM   830  N  N   . SER A 1 119 ? 8.767   0.018   -26.548 1.00 23.74 ? 143 SER B N   1 
ATOM   831  C  CA  . SER A 1 119 ? 9.285   -1.340  -26.431 1.00 22.71 ? 143 SER B CA  1 
ATOM   832  C  C   . SER A 1 119 ? 8.337   -2.306  -27.132 1.00 21.24 ? 143 SER B C   1 
ATOM   833  O  O   . SER A 1 119 ? 7.118   -2.188  -27.006 1.00 21.60 ? 143 SER B O   1 
ATOM   834  C  CB  . SER A 1 119 ? 9.436   -1.725  -24.957 1.00 22.22 ? 143 SER B CB  1 
ATOM   835  O  OG  . SER A 1 119 ? 10.025  -3.005  -24.811 1.00 21.06 ? 143 SER B OG  1 
ATOM   836  N  N   . LEU A 1 120 ? 8.892   -3.258  -27.874 1.00 20.79 ? 144 LEU B N   1 
ATOM   837  C  CA  . LEU A 1 120 ? 8.064   -4.228  -28.586 1.00 20.20 ? 144 LEU B CA  1 
ATOM   838  C  C   . LEU A 1 120 ? 7.383   -5.212  -27.640 1.00 20.14 ? 144 LEU B C   1 
ATOM   839  O  O   . LEU A 1 120 ? 6.609   -6.064  -28.075 1.00 20.25 ? 144 LEU B O   1 
ATOM   840  C  CB  . LEU A 1 120 ? 8.876   -4.978  -29.642 1.00 18.85 ? 144 LEU B CB  1 
ATOM   841  C  CG  . LEU A 1 120 ? 9.243   -4.156  -30.878 1.00 18.66 ? 144 LEU B CG  1 
ATOM   842  C  CD1 . LEU A 1 120 ? 9.778   -5.053  -31.984 1.00 17.67 ? 144 LEU B CD1 1 
ATOM   843  C  CD2 . LEU A 1 120 ? 8.036   -3.372  -31.359 1.00 19.55 ? 144 LEU B CD2 1 
ATOM   844  N  N   . HIS A 1 121 ? 7.674   -5.093  -26.347 1.00 19.59 ? 145 HIS B N   1 
ATOM   845  C  CA  . HIS A 1 121 ? 6.985   -5.884  -25.335 1.00 19.65 ? 145 HIS B CA  1 
ATOM   846  C  C   . HIS A 1 121 ? 5.552   -5.395  -25.159 1.00 20.06 ? 145 HIS B C   1 
ATOM   847  O  O   . HIS A 1 121 ? 4.647   -6.181  -24.885 1.00 20.19 ? 145 HIS B O   1 
ATOM   848  C  CB  . HIS A 1 121 ? 7.725   -5.825  -23.997 1.00 19.91 ? 145 HIS B CB  1 
ATOM   849  C  CG  . HIS A 1 121 ? 8.924   -6.718  -23.927 1.00 19.15 ? 145 HIS B CG  1 
ATOM   850  N  ND1 . HIS A 1 121 ? 8.826   -8.080  -23.742 1.00 18.65 ? 145 HIS B ND1 1 
ATOM   851  C  CD2 . HIS A 1 121 ? 10.247  -6.445  -24.010 1.00 19.36 ? 145 HIS B CD2 1 
ATOM   852  C  CE1 . HIS A 1 121 ? 10.037  -8.609  -23.720 1.00 18.65 ? 145 HIS B CE1 1 
ATOM   853  N  NE2 . HIS A 1 121 ? 10.917  -7.637  -23.879 1.00 18.72 ? 145 HIS B NE2 1 
ATOM   854  N  N   . TYR A 1 122 ? 5.354   -4.090  -25.323 1.00 20.86 ? 146 TYR B N   1 
ATOM   855  C  CA  . TYR A 1 122 ? 4.033   -3.486  -25.176 1.00 21.00 ? 146 TYR B CA  1 
ATOM   856  C  C   . TYR A 1 122 ? 3.117   -3.849  -26.338 1.00 20.90 ? 146 TYR B C   1 
ATOM   857  O  O   . TYR A 1 122 ? 1.923   -3.553  -26.316 1.00 21.07 ? 146 TYR B O   1 
ATOM   858  C  CB  . TYR A 1 122 ? 4.147   -1.965  -25.054 1.00 22.04 ? 146 TYR B CB  1 
ATOM   859  C  CG  . TYR A 1 122 ? 4.909   -1.503  -23.833 1.00 22.27 ? 146 TYR B CG  1 
ATOM   860  C  CD1 . TYR A 1 122 ? 4.528   -1.907  -22.559 1.00 22.54 ? 146 TYR B CD1 1 
ATOM   861  C  CD2 . TYR A 1 122 ? 6.001   -0.655  -23.952 1.00 21.80 ? 146 TYR B CD2 1 
ATOM   862  C  CE1 . TYR A 1 122 ? 5.219   -1.487  -21.441 1.00 22.79 ? 146 TYR B CE1 1 
ATOM   863  C  CE2 . TYR A 1 122 ? 6.696   -0.227  -22.840 1.00 23.40 ? 146 TYR B CE2 1 
ATOM   864  C  CZ  . TYR A 1 122 ? 6.302   -0.646  -21.587 1.00 23.67 ? 146 TYR B CZ  1 
ATOM   865  O  OH  . TYR A 1 122 ? 6.993   -0.223  -20.475 1.00 23.20 ? 146 TYR B OH  1 
ATOM   866  N  N   . GLU A 1 123 ? 3.685   -4.489  -27.354 1.00 20.63 ? 147 GLU B N   1 
ATOM   867  C  CA  . GLU A 1 123 ? 2.912   -4.936  -28.504 1.00 20.64 ? 147 GLU B CA  1 
ATOM   868  C  C   . GLU A 1 123 ? 2.893   -6.455  -28.583 1.00 20.18 ? 147 GLU B C   1 
ATOM   869  O  O   . GLU A 1 123 ? 2.457   -7.025  -29.582 1.00 20.72 ? 147 GLU B O   1 
ATOM   870  C  CB  . GLU A 1 123 ? 3.494   -4.365  -29.794 1.00 20.92 ? 147 GLU B CB  1 
ATOM   871  C  CG  . GLU A 1 123 ? 3.691   -2.864  -29.773 1.00 21.85 ? 147 GLU B CG  1 
ATOM   872  C  CD  . GLU A 1 123 ? 3.956   -2.296  -31.151 1.00 23.28 ? 147 GLU B CD  1 
ATOM   873  O  OE1 . GLU A 1 123 ? 3.898   -3.063  -32.136 1.00 23.51 ? 147 GLU B OE1 1 
ATOM   874  O  OE2 . GLU A 1 123 ? 4.218   -1.081  -31.252 1.00 24.54 ? 147 GLU B OE2 1 
ATOM   875  N  N   . GLY A 1 124 ? 3.376   -7.108  -27.531 1.00 19.59 ? 148 GLY B N   1 
ATOM   876  C  CA  . GLY A 1 124 ? 3.432   -8.557  -27.499 1.00 19.81 ? 148 GLY B CA  1 
ATOM   877  C  C   . GLY A 1 124 ? 4.198   -9.128  -28.676 1.00 19.18 ? 148 GLY B C   1 
ATOM   878  O  O   . GLY A 1 124 ? 3.913   -10.233 -29.140 1.00 18.93 ? 148 GLY B O   1 
ATOM   879  N  N   . ARG A 1 125 ? 5.175   -8.365  -29.160 1.00 19.93 ? 149 ARG B N   1 
ATOM   880  C  CA  . ARG A 1 125 ? 6.000   -8.781  -30.290 1.00 18.47 ? 149 ARG B CA  1 
ATOM   881  C  C   . ARG A 1 125 ? 7.412   -9.162  -29.859 1.00 18.08 ? 149 ARG B C   1 
ATOM   882  O  O   . ARG A 1 125 ? 8.272   -9.428  -30.697 1.00 17.61 ? 149 ARG B O   1 
ATOM   883  C  CB  . ARG A 1 125 ? 6.076   -7.669  -31.335 1.00 18.41 ? 149 ARG B CB  1 
ATOM   884  C  CG  . ARG A 1 125 ? 4.892   -7.615  -32.276 1.00 18.95 ? 149 ARG B CG  1 
ATOM   885  C  CD  . ARG A 1 125 ? 5.299   -6.973  -33.584 1.00 19.18 ? 149 ARG B CD  1 
ATOM   886  N  NE  . ARG A 1 125 ? 5.405   -5.523  -33.481 1.00 19.06 ? 149 ARG B NE  1 
ATOM   887  C  CZ  . ARG A 1 125 ? 6.291   -4.793  -34.148 1.00 19.66 ? 149 ARG B CZ  1 
ATOM   888  N  NH1 . ARG A 1 125 ? 7.167   -5.379  -34.953 1.00 19.46 ? 149 ARG B NH1 1 
ATOM   889  N  NH2 . ARG A 1 125 ? 6.311   -3.477  -34.002 1.00 20.64 ? 149 ARG B NH2 1 
ATOM   890  N  N   . ALA A 1 126 ? 7.648   -9.183  -28.552 1.00 18.08 ? 150 ALA B N   1 
ATOM   891  C  CA  . ALA A 1 126 ? 8.968   -9.501  -28.028 1.00 17.21 ? 150 ALA B CA  1 
ATOM   892  C  C   . ALA A 1 126 ? 8.875   -10.394 -26.801 1.00 16.83 ? 150 ALA B C   1 
ATOM   893  O  O   . ALA A 1 126 ? 7.851   -10.419 -26.119 1.00 17.10 ? 150 ALA B O   1 
ATOM   894  C  CB  . ALA A 1 126 ? 9.729   -8.225  -27.699 1.00 17.81 ? 150 ALA B CB  1 
ATOM   895  N  N   . VAL A 1 127 ? 9.951   -11.126 -26.531 1.00 17.00 ? 151 VAL B N   1 
ATOM   896  C  CA  . VAL A 1 127 ? 10.033  -11.979 -25.351 1.00 17.33 ? 151 VAL B CA  1 
ATOM   897  C  C   . VAL A 1 127 ? 11.433  -11.976 -24.743 1.00 17.21 ? 151 VAL B C   1 
ATOM   898  O  O   . VAL A 1 127 ? 12.437  -11.962 -25.458 1.00 16.81 ? 151 VAL B O   1 
ATOM   899  C  CB  . VAL A 1 127 ? 9.625   -13.438 -25.660 1.00 16.56 ? 151 VAL B CB  1 
ATOM   900  C  CG1 . VAL A 1 127 ? 8.114   -13.579 -25.687 1.00 17.26 ? 151 VAL B CG1 1 
ATOM   901  C  CG2 . VAL A 1 127 ? 10.240  -13.901 -26.972 1.00 16.41 ? 151 VAL B CG2 1 
ATOM   902  N  N   . ASP A 1 128 ? 11.487  -11.975 -23.416 1.00 17.55 ? 152 ASP B N   1 
ATOM   903  C  CA  . ASP A 1 128 ? 12.733  -12.172 -22.694 1.00 17.13 ? 152 ASP B CA  1 
ATOM   904  C  C   . ASP A 1 128 ? 12.790  -13.631 -22.276 1.00 17.52 ? 152 ASP B C   1 
ATOM   905  O  O   . ASP A 1 128 ? 11.911  -14.111 -21.562 1.00 17.90 ? 152 ASP B O   1 
ATOM   906  C  CB  . ASP A 1 128 ? 12.797  -11.265 -21.465 1.00 17.95 ? 152 ASP B CB  1 
ATOM   907  C  CG  . ASP A 1 128 ? 13.048  -9.813  -21.824 1.00 18.22 ? 152 ASP B CG  1 
ATOM   908  O  OD1 . ASP A 1 128 ? 13.514  -9.551  -22.952 1.00 18.32 ? 152 ASP B OD1 1 
ATOM   909  O  OD2 . ASP A 1 128 ? 12.784  -8.933  -20.976 1.00 19.12 ? 152 ASP B OD2 1 
ATOM   910  N  N   . ILE A 1 129 ? 13.818  -14.339 -22.730 1.00 17.72 ? 153 ILE B N   1 
ATOM   911  C  CA  . ILE A 1 129 ? 13.886  -15.781 -22.531 1.00 17.22 ? 153 ILE B CA  1 
ATOM   912  C  C   . ILE A 1 129 ? 15.147  -16.231 -21.806 1.00 17.56 ? 153 ILE B C   1 
ATOM   913  O  O   . ILE A 1 129 ? 16.188  -15.576 -21.871 1.00 17.75 ? 153 ILE B O   1 
ATOM   914  C  CB  . ILE A 1 129 ? 13.805  -16.531 -23.870 1.00 16.99 ? 153 ILE B CB  1 
ATOM   915  C  CG1 . ILE A 1 129 ? 14.940  -16.087 -24.793 1.00 16.65 ? 153 ILE B CG1 1 
ATOM   916  C  CG2 . ILE A 1 129 ? 12.456  -16.298 -24.533 1.00 17.41 ? 153 ILE B CG2 1 
ATOM   917  C  CD1 . ILE A 1 129 ? 14.969  -16.820 -26.113 1.00 17.55 ? 153 ILE B CD1 1 
ATOM   918  N  N   . THR A 1 130 ? 15.036  -17.355 -21.108 1.00 17.47 ? 154 THR B N   1 
ATOM   919  C  CA  . THR A 1 130 ? 16.181  -17.992 -20.478 1.00 17.70 ? 154 THR B CA  1 
ATOM   920  C  C   . THR A 1 130 ? 16.039  -19.500 -20.607 1.00 17.92 ? 154 THR B C   1 
ATOM   921  O  O   . THR A 1 130 ? 15.142  -19.997 -21.285 1.00 17.44 ? 154 THR B O   1 
ATOM   922  C  CB  . THR A 1 130 ? 16.297  -17.641 -18.979 1.00 17.29 ? 154 THR B CB  1 
ATOM   923  O  OG1 . THR A 1 130 ? 15.289  -18.339 -18.238 1.00 17.85 ? 154 THR B OG1 1 
ATOM   924  C  CG2 . THR A 1 130 ? 16.145  -16.147 -18.757 1.00 17.60 ? 154 THR B CG2 1 
ATOM   925  N  N   . THR A 1 131 ? 16.932  -20.221 -19.945 1.00 17.91 ? 155 THR B N   1 
ATOM   926  C  CA  . THR A 1 131 ? 16.869  -21.669 -19.904 1.00 17.53 ? 155 THR B CA  1 
ATOM   927  C  C   . THR A 1 131 ? 16.332  -22.093 -18.542 1.00 18.12 ? 155 THR B C   1 
ATOM   928  O  O   . THR A 1 131 ? 16.728  -21.539 -17.519 1.00 18.43 ? 155 THR B O   1 
ATOM   929  C  CB  . THR A 1 131 ? 18.253  -22.275 -20.150 1.00 18.25 ? 155 THR B CB  1 
ATOM   930  O  OG1 . THR A 1 131 ? 18.480  -22.381 -21.562 1.00 18.69 ? 155 THR B OG1 1 
ATOM   931  C  CG2 . THR A 1 131 ? 18.348  -23.645 -19.532 1.00 19.14 ? 155 THR B CG2 1 
ATOM   932  N  N   . SER A 1 132 ? 15.422  -23.062 -18.529 1.00 17.51 ? 156 SER B N   1 
ATOM   933  C  CA  . SER A 1 132 ? 14.728  -23.438 -17.299 1.00 18.09 ? 156 SER B CA  1 
ATOM   934  C  C   . SER A 1 132 ? 15.662  -23.646 -16.101 1.00 18.61 ? 156 SER B C   1 
ATOM   935  O  O   . SER A 1 132 ? 15.253  -23.468 -14.952 1.00 18.34 ? 156 SER B O   1 
ATOM   936  C  CB  . SER A 1 132 ? 13.843  -24.672 -17.522 1.00 18.81 ? 156 SER B CB  1 
ATOM   937  O  OG  . SER A 1 132 ? 14.587  -25.767 -18.023 1.00 18.71 ? 156 SER B OG  1 
ATOM   938  N  N   . ASP A 1 133 ? 16.912  -24.013 -16.369 1.00 18.55 ? 157 ASP B N   1 
ATOM   939  C  CA  . ASP A 1 133 ? 17.882  -24.228 -15.299 1.00 18.46 ? 157 ASP B CA  1 
ATOM   940  C  C   . ASP A 1 133 ? 18.686  -22.962 -14.985 1.00 18.59 ? 157 ASP B C   1 
ATOM   941  O  O   . ASP A 1 133 ? 19.478  -22.936 -14.044 1.00 18.70 ? 157 ASP B O   1 
ATOM   942  C  CB  . ASP A 1 133 ? 18.808  -25.411 -15.621 1.00 18.70 ? 157 ASP B CB  1 
ATOM   943  C  CG  . ASP A 1 133 ? 19.702  -25.155 -16.826 1.00 18.90 ? 157 ASP B CG  1 
ATOM   944  O  OD1 . ASP A 1 133 ? 19.856  -23.983 -17.224 1.00 19.04 ? 157 ASP B OD1 1 
ATOM   945  O  OD2 . ASP A 1 133 ? 20.263  -26.131 -17.369 1.00 17.71 ? 157 ASP B OD2 1 
ATOM   946  N  N   . ARG A 1 134 ? 18.465  -21.919 -15.780 1.00 18.16 ? 158 ARG B N   1 
ATOM   947  C  CA  . ARG A 1 134 ? 19.124  -20.624 -15.594 1.00 18.69 ? 158 ARG B CA  1 
ATOM   948  C  C   . ARG A 1 134 ? 20.643  -20.682 -15.759 1.00 19.71 ? 158 ARG B C   1 
ATOM   949  O  O   . ARG A 1 134 ? 21.359  -19.819 -15.249 1.00 19.27 ? 158 ARG B O   1 
ATOM   950  C  CB  . ARG A 1 134 ? 18.773  -20.018 -14.233 1.00 19.48 ? 158 ARG B CB  1 
ATOM   951  C  CG  . ARG A 1 134 ? 17.454  -19.265 -14.188 1.00 19.29 ? 158 ARG B CG  1 
ATOM   952  C  CD  . ARG A 1 134 ? 16.292  -20.153 -14.588 1.00 19.75 ? 158 ARG B CD  1 
ATOM   953  N  NE  . ARG A 1 134 ? 15.108  -19.904 -13.771 1.00 19.72 ? 158 ARG B NE  1 
ATOM   954  C  CZ  . ARG A 1 134 ? 14.778  -20.626 -12.706 1.00 20.17 ? 158 ARG B CZ  1 
ATOM   955  N  NH1 . ARG A 1 134 ? 15.542  -21.643 -12.332 1.00 19.42 ? 158 ARG B NH1 1 
ATOM   956  N  NH2 . ARG A 1 134 ? 13.684  -20.335 -12.015 1.00 21.11 ? 158 ARG B NH2 1 
ATOM   957  N  N   . ASP A 1 135 ? 21.128  -21.697 -16.470 1.00 19.72 ? 159 ASP B N   1 
ATOM   958  C  CA  . ASP A 1 135 ? 22.558  -21.831 -16.737 1.00 19.00 ? 159 ASP B CA  1 
ATOM   959  C  C   . ASP A 1 135 ? 22.979  -20.829 -17.801 1.00 18.76 ? 159 ASP B C   1 
ATOM   960  O  O   . ASP A 1 135 ? 22.880  -21.103 -18.995 1.00 19.38 ? 159 ASP B O   1 
ATOM   961  C  CB  . ASP A 1 135 ? 22.895  -23.253 -17.190 1.00 19.12 ? 159 ASP B CB  1 
ATOM   962  C  CG  . ASP A 1 135 ? 24.383  -23.460 -17.405 1.00 19.65 ? 159 ASP B CG  1 
ATOM   963  O  OD1 . ASP A 1 135 ? 25.171  -22.588 -16.982 1.00 20.26 ? 159 ASP B OD1 1 
ATOM   964  O  OD2 . ASP A 1 135 ? 24.767  -24.493 -17.993 1.00 18.72 ? 159 ASP B OD2 1 
ATOM   965  N  N   . ARG A 1 136 ? 23.454  -19.670 -17.359 1.00 18.41 ? 160 ARG B N   1 
ATOM   966  C  CA  . ARG A 1 136 ? 23.784  -18.573 -18.263 1.00 18.63 ? 160 ARG B CA  1 
ATOM   967  C  C   . ARG A 1 136 ? 24.806  -18.949 -19.336 1.00 18.84 ? 160 ARG B C   1 
ATOM   968  O  O   . ARG A 1 136 ? 24.882  -18.302 -20.379 1.00 19.21 ? 160 ARG B O   1 
ATOM   969  C  CB  . ARG A 1 136 ? 24.253  -17.351 -17.470 1.00 19.57 ? 160 ARG B CB  1 
ATOM   970  C  CG  . ARG A 1 136 ? 23.165  -16.751 -16.591 1.00 19.73 ? 160 ARG B CG  1 
ATOM   971  C  CD  . ARG A 1 136 ? 23.680  -15.590 -15.762 1.00 20.47 ? 160 ARG B CD  1 
ATOM   972  N  NE  . ARG A 1 136 ? 22.606  -14.951 -15.008 1.00 21.30 ? 160 ARG B NE  1 
ATOM   973  C  CZ  . ARG A 1 136 ? 22.751  -13.836 -14.297 1.00 22.96 ? 160 ARG B CZ  1 
ATOM   974  N  NH1 . ARG A 1 136 ? 23.931  -13.231 -14.240 1.00 22.44 ? 160 ARG B NH1 1 
ATOM   975  N  NH2 . ARG A 1 136 ? 21.716  -13.325 -13.644 1.00 24.51 ? 160 ARG B NH2 1 
ATOM   976  N  N   . ASN A 1 137 ? 25.586  -19.995 -19.080 1.00 19.24 ? 161 ASN B N   1 
ATOM   977  C  CA  . ASN A 1 137 ? 26.536  -20.495 -20.071 1.00 19.30 ? 161 ASN B CA  1 
ATOM   978  C  C   . ASN A 1 137 ? 25.821  -20.997 -21.322 1.00 19.51 ? 161 ASN B C   1 
ATOM   979  O  O   . ASN A 1 137 ? 26.434  -21.167 -22.376 1.00 19.20 ? 161 ASN B O   1 
ATOM   980  C  CB  . ASN A 1 137 ? 27.392  -21.615 -19.478 1.00 19.23 ? 161 ASN B CB  1 
ATOM   981  C  CG  . ASN A 1 137 ? 28.113  -21.191 -18.214 1.00 21.19 ? 161 ASN B CG  1 
ATOM   982  O  OD1 . ASN A 1 137 ? 28.855  -20.207 -18.208 1.00 21.70 ? 161 ASN B OD1 1 
ATOM   983  N  ND2 . ASN A 1 137 ? 27.902  -21.937 -17.133 1.00 20.56 ? 161 ASN B ND2 1 
ATOM   984  N  N   . LYS A 1 138 ? 24.518  -21.231 -21.194 1.00 18.91 ? 162 LYS B N   1 
ATOM   985  C  CA  . LYS A 1 138 ? 23.706  -21.734 -22.295 1.00 18.33 ? 162 LYS B CA  1 
ATOM   986  C  C   . LYS A 1 138 ? 23.074  -20.603 -23.098 1.00 18.71 ? 162 LYS B C   1 
ATOM   987  O  O   . LYS A 1 138 ? 22.495  -20.838 -24.158 1.00 19.00 ? 162 LYS B O   1 
ATOM   988  C  CB  . LYS A 1 138 ? 22.593  -22.640 -21.762 1.00 18.65 ? 162 LYS B CB  1 
ATOM   989  C  CG  . LYS A 1 138 ? 23.036  -24.024 -21.316 1.00 18.39 ? 162 LYS B CG  1 
ATOM   990  C  CD  . LYS A 1 138 ? 21.836  -24.833 -20.843 1.00 17.75 ? 162 LYS B CD  1 
ATOM   991  C  CE  . LYS A 1 138 ? 22.169  -26.308 -20.682 1.00 17.84 ? 162 LYS B CE  1 
ATOM   992  N  NZ  . LYS A 1 138 ? 23.111  -26.563 -19.559 1.00 19.06 ? 162 LYS B NZ  1 
ATOM   993  N  N   . TYR A 1 139 ? 23.182  -19.378 -22.592 1.00 18.46 ? 163 TYR B N   1 
ATOM   994  C  CA  . TYR A 1 139 ? 22.465  -18.244 -23.174 1.00 17.93 ? 163 TYR B CA  1 
ATOM   995  C  C   . TYR A 1 139 ? 22.984  -17.841 -24.551 1.00 18.00 ? 163 TYR B C   1 
ATOM   996  O  O   . TYR A 1 139 ? 22.202  -17.485 -25.432 1.00 18.13 ? 163 TYR B O   1 
ATOM   997  C  CB  . TYR A 1 139 ? 22.476  -17.051 -22.217 1.00 18.09 ? 163 TYR B CB  1 
ATOM   998  C  CG  . TYR A 1 139 ? 21.590  -17.244 -21.006 1.00 18.49 ? 163 TYR B CG  1 
ATOM   999  C  CD1 . TYR A 1 139 ? 21.211  -18.517 -20.595 1.00 18.77 ? 163 TYR B CD1 1 
ATOM   1000 C  CD2 . TYR A 1 139 ? 21.149  -16.160 -20.262 1.00 18.31 ? 163 TYR B CD2 1 
ATOM   1001 C  CE1 . TYR A 1 139 ? 20.407  -18.703 -19.488 1.00 18.41 ? 163 TYR B CE1 1 
ATOM   1002 C  CE2 . TYR A 1 139 ? 20.347  -16.337 -19.149 1.00 18.84 ? 163 TYR B CE2 1 
ATOM   1003 C  CZ  . TYR A 1 139 ? 19.980  -17.611 -18.768 1.00 17.92 ? 163 TYR B CZ  1 
ATOM   1004 O  OH  . TYR A 1 139 ? 19.182  -17.791 -17.663 1.00 17.53 ? 163 TYR B OH  1 
ATOM   1005 N  N   . GLY A 1 140 ? 24.297  -17.897 -24.736 1.00 18.05 ? 164 GLY B N   1 
ATOM   1006 C  CA  . GLY A 1 140 ? 24.877  -17.629 -26.038 1.00 18.42 ? 164 GLY B CA  1 
ATOM   1007 C  C   . GLY A 1 140 ? 24.241  -18.518 -27.089 1.00 19.15 ? 164 GLY B C   1 
ATOM   1008 O  O   . GLY A 1 140 ? 23.682  -18.038 -28.075 1.00 18.35 ? 164 GLY B O   1 
ATOM   1009 N  N   . LEU A 1 141 ? 24.321  -19.826 -26.869 1.00 19.58 ? 165 LEU B N   1 
ATOM   1010 C  CA  . LEU A 1 141 ? 23.702  -20.792 -27.764 1.00 19.15 ? 165 LEU B CA  1 
ATOM   1011 C  C   . LEU A 1 141 ? 22.212  -20.512 -27.908 1.00 18.85 ? 165 LEU B C   1 
ATOM   1012 O  O   . LEU A 1 141 ? 21.678  -20.501 -29.016 1.00 19.55 ? 165 LEU B O   1 
ATOM   1013 C  CB  . LEU A 1 141 ? 23.912  -22.215 -27.244 1.00 20.21 ? 165 LEU B CB  1 
ATOM   1014 C  CG  . LEU A 1 141 ? 25.348  -22.739 -27.250 1.00 21.21 ? 165 LEU B CG  1 
ATOM   1015 C  CD1 . LEU A 1 141 ? 25.430  -24.077 -26.527 1.00 20.58 ? 165 LEU B CD1 1 
ATOM   1016 C  CD2 . LEU A 1 141 ? 25.868  -22.858 -28.676 1.00 22.63 ? 165 LEU B CD2 1 
ATOM   1017 N  N   . LEU A 1 142 ? 21.546  -20.288 -26.780 1.00 18.42 ? 166 LEU B N   1 
ATOM   1018 C  CA  . LEU A 1 142 ? 20.114  -20.015 -26.781 1.00 18.50 ? 166 LEU B CA  1 
ATOM   1019 C  C   . LEU A 1 142 ? 19.780  -18.912 -27.777 1.00 18.18 ? 166 LEU B C   1 
ATOM   1020 O  O   . LEU A 1 142 ? 18.817  -19.020 -28.538 1.00 17.57 ? 166 LEU B O   1 
ATOM   1021 C  CB  . LEU A 1 142 ? 19.641  -19.624 -25.380 1.00 17.96 ? 166 LEU B CB  1 
ATOM   1022 C  CG  . LEU A 1 142 ? 18.150  -19.319 -25.227 1.00 17.18 ? 166 LEU B CG  1 
ATOM   1023 C  CD1 . LEU A 1 142 ? 17.308  -20.495 -25.693 1.00 16.77 ? 166 LEU B CD1 1 
ATOM   1024 C  CD2 . LEU A 1 142 ? 17.824  -18.955 -23.788 1.00 17.45 ? 166 LEU B CD2 1 
ATOM   1025 N  N   . ALA A 1 143 ? 20.587  -17.856 -27.771 1.00 18.27 ? 167 ALA B N   1 
ATOM   1026 C  CA  . ALA A 1 143 ? 20.392  -16.735 -28.683 1.00 18.48 ? 167 ALA B CA  1 
ATOM   1027 C  C   . ALA A 1 143 ? 20.511  -17.185 -30.134 1.00 18.66 ? 167 ALA B C   1 
ATOM   1028 O  O   . ALA A 1 143 ? 19.678  -16.836 -30.971 1.00 18.52 ? 167 ALA B O   1 
ATOM   1029 C  CB  . ALA A 1 143 ? 21.389  -15.624 -28.384 1.00 17.71 ? 167 ALA B CB  1 
ATOM   1030 N  N   . ARG A 1 144 ? 21.547  -17.963 -30.428 1.00 18.63 ? 168 ARG B N   1 
ATOM   1031 C  CA  . ARG A 1 144 ? 21.742  -18.486 -31.774 1.00 19.67 ? 168 ARG B CA  1 
ATOM   1032 C  C   . ARG A 1 144 ? 20.526  -19.291 -32.217 1.00 19.14 ? 168 ARG B C   1 
ATOM   1033 O  O   . ARG A 1 144 ? 20.062  -19.159 -33.350 1.00 19.74 ? 168 ARG B O   1 
ATOM   1034 C  CB  . ARG A 1 144 ? 23.006  -19.346 -31.847 1.00 20.36 ? 168 ARG B CB  1 
ATOM   1035 C  CG  . ARG A 1 144 ? 23.259  -19.966 -33.213 1.00 22.28 ? 168 ARG B CG  1 
ATOM   1036 C  CD  . ARG A 1 144 ? 23.263  -18.917 -34.321 1.00 21.89 ? 168 ARG B CD  1 
ATOM   1037 N  NE  . ARG A 1 144 ? 24.417  -18.026 -34.231 1.00 22.69 ? 168 ARG B NE  1 
ATOM   1038 C  CZ  . ARG A 1 144 ? 24.639  -17.000 -35.049 1.00 23.76 ? 168 ARG B CZ  1 
ATOM   1039 N  NH1 . ARG A 1 144 ? 23.784  -16.726 -36.026 1.00 22.37 ? 168 ARG B NH1 1 
ATOM   1040 N  NH2 . ARG A 1 144 ? 25.718  -16.244 -34.888 1.00 23.27 ? 168 ARG B NH2 1 
ATOM   1041 N  N   . LEU A 1 145 ? 20.008  -20.118 -31.316 1.00 18.53 ? 169 LEU B N   1 
ATOM   1042 C  CA  . LEU A 1 145 ? 18.827  -20.920 -31.610 1.00 18.37 ? 169 LEU B CA  1 
ATOM   1043 C  C   . LEU A 1 145 ? 17.637  -20.043 -31.985 1.00 18.50 ? 169 LEU B C   1 
ATOM   1044 O  O   . LEU A 1 145 ? 16.948  -20.309 -32.968 1.00 18.68 ? 169 LEU B O   1 
ATOM   1045 C  CB  . LEU A 1 145 ? 18.471  -21.812 -30.422 1.00 18.90 ? 169 LEU B CB  1 
ATOM   1046 C  CG  . LEU A 1 145 ? 19.362  -23.037 -30.205 1.00 18.82 ? 169 LEU B CG  1 
ATOM   1047 C  CD1 . LEU A 1 145 ? 18.909  -23.820 -28.985 1.00 18.17 ? 169 LEU B CD1 1 
ATOM   1048 C  CD2 . LEU A 1 145 ? 19.351  -23.918 -31.438 1.00 19.26 ? 169 LEU B CD2 1 
ATOM   1049 N  N   . ALA A 1 146 ? 17.403  -18.997 -31.198 1.00 19.33 ? 170 ALA B N   1 
ATOM   1050 C  CA  . ALA A 1 146 ? 16.305  -18.067 -31.455 1.00 18.49 ? 170 ALA B CA  1 
ATOM   1051 C  C   . ALA A 1 146 ? 16.392  -17.485 -32.860 1.00 18.52 ? 170 ALA B C   1 
ATOM   1052 O  O   . ALA A 1 146 ? 15.385  -17.372 -33.559 1.00 18.53 ? 170 ALA B O   1 
ATOM   1053 C  CB  . ALA A 1 146 ? 16.297  -16.955 -30.421 1.00 18.02 ? 170 ALA B CB  1 
ATOM   1054 N  N   . VAL A 1 147 ? 17.602  -17.114 -33.266 1.00 18.97 ? 171 VAL B N   1 
ATOM   1055 C  CA  . VAL A 1 147 ? 17.843  -16.613 -34.613 1.00 18.87 ? 171 VAL B CA  1 
ATOM   1056 C  C   . VAL A 1 147 ? 17.382  -17.628 -35.648 1.00 18.95 ? 171 VAL B C   1 
ATOM   1057 O  O   . VAL A 1 147 ? 16.653  -17.294 -36.582 1.00 19.55 ? 171 VAL B O   1 
ATOM   1058 C  CB  . VAL A 1 147 ? 19.340  -16.326 -34.847 1.00 18.71 ? 171 VAL B CB  1 
ATOM   1059 C  CG1 . VAL A 1 147 ? 19.602  -16.039 -36.317 1.00 18.00 ? 171 VAL B CG1 1 
ATOM   1060 C  CG2 . VAL A 1 147 ? 19.805  -15.170 -33.975 1.00 18.14 ? 171 VAL B CG2 1 
ATOM   1061 N  N   . GLU A 1 148 ? 17.811  -18.873 -35.471 1.00 19.04 ? 172 GLU B N   1 
ATOM   1062 C  CA  . GLU A 1 148 ? 17.497  -19.933 -36.419 1.00 19.81 ? 172 GLU B CA  1 
ATOM   1063 C  C   . GLU A 1 148 ? 16.051  -20.405 -36.299 1.00 19.31 ? 172 GLU B C   1 
ATOM   1064 O  O   . GLU A 1 148 ? 15.571  -21.178 -37.128 1.00 19.76 ? 172 GLU B O   1 
ATOM   1065 C  CB  . GLU A 1 148 ? 18.459  -21.108 -36.237 1.00 21.04 ? 172 GLU B CB  1 
ATOM   1066 C  CG  . GLU A 1 148 ? 19.916  -20.736 -36.457 1.00 22.66 ? 172 GLU B CG  1 
ATOM   1067 C  CD  . GLU A 1 148 ? 20.794  -21.944 -36.712 1.00 27.67 ? 172 GLU B CD  1 
ATOM   1068 O  OE1 . GLU A 1 148 ? 20.612  -22.969 -36.019 1.00 28.20 ? 172 GLU B OE1 1 
ATOM   1069 O  OE2 . GLU A 1 148 ? 21.666  -21.865 -37.605 1.00 28.05 ? 172 GLU B OE2 1 
ATOM   1070 N  N   . ALA A 1 149 ? 15.361  -19.938 -35.263 1.00 18.68 ? 173 ALA B N   1 
ATOM   1071 C  CA  . ALA A 1 149 ? 13.968  -20.305 -35.045 1.00 17.77 ? 173 ALA B CA  1 
ATOM   1072 C  C   . ALA A 1 149 ? 13.049  -19.396 -35.849 1.00 18.72 ? 173 ALA B C   1 
ATOM   1073 O  O   . ALA A 1 149 ? 11.843  -19.628 -35.929 1.00 18.70 ? 173 ALA B O   1 
ATOM   1074 C  CB  . ALA A 1 149 ? 13.627  -20.240 -33.567 1.00 17.46 ? 173 ALA B CB  1 
ATOM   1075 N  N   . GLY A 1 150 ? 13.629  -18.357 -36.441 1.00 18.62 ? 174 GLY B N   1 
ATOM   1076 C  CA  . GLY A 1 150 ? 12.880  -17.449 -37.288 1.00 18.42 ? 174 GLY B CA  1 
ATOM   1077 C  C   . GLY A 1 150 ? 12.600  -16.105 -36.647 1.00 18.65 ? 174 GLY B C   1 
ATOM   1078 O  O   . GLY A 1 150 ? 11.952  -15.250 -37.250 1.00 18.92 ? 174 GLY B O   1 
ATOM   1079 N  N   . PHE A 1 151 ? 13.080  -15.914 -35.423 1.00 18.51 ? 175 PHE B N   1 
ATOM   1080 C  CA  . PHE A 1 151 ? 12.901  -14.639 -34.739 1.00 18.24 ? 175 PHE B CA  1 
ATOM   1081 C  C   . PHE A 1 151 ? 13.541  -13.507 -35.532 1.00 18.68 ? 175 PHE B C   1 
ATOM   1082 O  O   . PHE A 1 151 ? 14.732  -13.549 -35.847 1.00 18.74 ? 175 PHE B O   1 
ATOM   1083 C  CB  . PHE A 1 151 ? 13.466  -14.689 -33.321 1.00 17.57 ? 175 PHE B CB  1 
ATOM   1084 C  CG  . PHE A 1 151 ? 12.509  -15.254 -32.312 1.00 17.78 ? 175 PHE B CG  1 
ATOM   1085 C  CD1 . PHE A 1 151 ? 11.498  -14.470 -31.786 1.00 17.13 ? 175 PHE B CD1 1 
ATOM   1086 C  CD2 . PHE A 1 151 ? 12.621  -16.569 -31.890 1.00 18.05 ? 175 PHE B CD2 1 
ATOM   1087 C  CE1 . PHE A 1 151 ? 10.614  -14.985 -30.857 1.00 17.36 ? 175 PHE B CE1 1 
ATOM   1088 C  CE2 . PHE A 1 151 ? 11.742  -17.090 -30.960 1.00 17.72 ? 175 PHE B CE2 1 
ATOM   1089 C  CZ  . PHE A 1 151 ? 10.736  -16.296 -30.443 1.00 17.73 ? 175 PHE B CZ  1 
ATOM   1090 N  N   . ASP A 1 152 ? 12.739  -12.497 -35.852 1.00 18.32 ? 176 ASP B N   1 
ATOM   1091 C  CA  . ASP A 1 152 ? 13.182  -11.406 -36.709 1.00 18.07 ? 176 ASP B CA  1 
ATOM   1092 C  C   . ASP A 1 152 ? 14.295  -10.574 -36.081 1.00 17.54 ? 176 ASP B C   1 
ATOM   1093 O  O   . ASP A 1 152 ? 15.025  -9.881  -36.784 1.00 17.68 ? 176 ASP B O   1 
ATOM   1094 C  CB  . ASP A 1 152 ? 11.997  -10.524 -37.100 1.00 18.48 ? 176 ASP B CB  1 
ATOM   1095 C  CG  . ASP A 1 152 ? 11.014  -11.244 -38.001 1.00 19.80 ? 176 ASP B CG  1 
ATOM   1096 O  OD1 . ASP A 1 152 ? 11.430  -12.197 -38.691 1.00 20.96 ? 176 ASP B OD1 1 
ATOM   1097 O  OD2 . ASP A 1 152 ? 9.828   -10.863 -38.024 1.00 20.35 ? 176 ASP B OD2 1 
ATOM   1098 N  N   . TRP A 1 153 ? 14.423  -10.647 -34.760 1.00 17.50 ? 177 TRP B N   1 
ATOM   1099 C  CA  . TRP A 1 153 ? 15.515  -9.974  -34.067 1.00 16.85 ? 177 TRP B CA  1 
ATOM   1100 C  C   . TRP A 1 153 ? 15.861  -10.690 -32.767 1.00 16.68 ? 177 TRP B C   1 
ATOM   1101 O  O   . TRP A 1 153 ? 14.983  -10.994 -31.961 1.00 16.19 ? 177 TRP B O   1 
ATOM   1102 C  CB  . TRP A 1 153 ? 15.166  -8.511  -33.790 1.00 16.82 ? 177 TRP B CB  1 
ATOM   1103 C  CG  . TRP A 1 153 ? 16.370  -7.624  -33.625 1.00 16.73 ? 177 TRP B CG  1 
ATOM   1104 C  CD1 . TRP A 1 153 ? 17.287  -7.302  -34.583 1.00 16.71 ? 177 TRP B CD1 1 
ATOM   1105 C  CD2 . TRP A 1 153 ? 16.777  -6.934  -32.436 1.00 16.74 ? 177 TRP B CD2 1 
ATOM   1106 N  NE1 . TRP A 1 153 ? 18.242  -6.463  -34.064 1.00 16.58 ? 177 TRP B NE1 1 
ATOM   1107 C  CE2 . TRP A 1 153 ? 17.951  -6.220  -32.748 1.00 16.61 ? 177 TRP B CE2 1 
ATOM   1108 C  CE3 . TRP A 1 153 ? 16.265  -6.854  -31.137 1.00 17.05 ? 177 TRP B CE3 1 
ATOM   1109 C  CZ2 . TRP A 1 153 ? 18.621  -5.435  -31.810 1.00 16.53 ? 177 TRP B CZ2 1 
ATOM   1110 C  CZ3 . TRP A 1 153 ? 16.932  -6.071  -30.207 1.00 16.85 ? 177 TRP B CZ3 1 
ATOM   1111 C  CH2 . TRP A 1 153 ? 18.097  -5.374  -30.549 1.00 16.07 ? 177 TRP B CH2 1 
ATOM   1112 N  N   . VAL A 1 154 ? 17.147  -10.963 -32.578 1.00 17.18 ? 178 VAL B N   1 
ATOM   1113 C  CA  . VAL A 1 154 ? 17.631  -11.605 -31.362 1.00 17.26 ? 178 VAL B CA  1 
ATOM   1114 C  C   . VAL A 1 154 ? 18.769  -10.785 -30.769 1.00 17.61 ? 178 VAL B C   1 
ATOM   1115 O  O   . VAL A 1 154 ? 19.680  -10.365 -31.480 1.00 17.11 ? 178 VAL B O   1 
ATOM   1116 C  CB  . VAL A 1 154 ? 18.111  -13.042 -31.630 1.00 17.40 ? 178 VAL B CB  1 
ATOM   1117 C  CG1 . VAL A 1 154 ? 18.627  -13.675 -30.346 1.00 17.41 ? 178 VAL B CG1 1 
ATOM   1118 C  CG2 . VAL A 1 154 ? 16.982  -13.875 -32.225 1.00 17.59 ? 178 VAL B CG2 1 
ATOM   1119 N  N   . TYR A 1 155 ? 18.714  -10.566 -29.460 1.00 18.02 ? 179 TYR B N   1 
ATOM   1120 C  CA  . TYR A 1 155 ? 19.619  -9.635  -28.803 1.00 17.45 ? 179 TYR B CA  1 
ATOM   1121 C  C   . TYR A 1 155 ? 19.961  -10.099 -27.392 1.00 17.97 ? 179 TYR B C   1 
ATOM   1122 O  O   . TYR A 1 155 ? 19.110  -10.092 -26.506 1.00 18.49 ? 179 TYR B O   1 
ATOM   1123 C  CB  . TYR A 1 155 ? 18.975  -8.244  -28.785 1.00 16.89 ? 179 TYR B CB  1 
ATOM   1124 C  CG  . TYR A 1 155 ? 19.666  -7.191  -27.941 1.00 17.96 ? 179 TYR B CG  1 
ATOM   1125 C  CD1 . TYR A 1 155 ? 21.029  -6.956  -28.053 1.00 17.85 ? 179 TYR B CD1 1 
ATOM   1126 C  CD2 . TYR A 1 155 ? 18.937  -6.402  -27.058 1.00 18.50 ? 179 TYR B CD2 1 
ATOM   1127 C  CE1 . TYR A 1 155 ? 21.650  -5.982  -27.288 1.00 18.01 ? 179 TYR B CE1 1 
ATOM   1128 C  CE2 . TYR A 1 155 ? 19.547  -5.428  -26.293 1.00 17.90 ? 179 TYR B CE2 1 
ATOM   1129 C  CZ  . TYR A 1 155 ? 20.902  -5.221  -26.411 1.00 18.43 ? 179 TYR B CZ  1 
ATOM   1130 O  OH  . TYR A 1 155 ? 21.507  -4.247  -25.646 1.00 19.12 ? 179 TYR B OH  1 
ATOM   1131 N  N   . TYR A 1 156 ? 21.208  -10.522 -27.198 1.00 17.94 ? 180 TYR B N   1 
ATOM   1132 C  CA  . TYR A 1 156 ? 21.706  -10.875 -25.875 1.00 18.36 ? 180 TYR B CA  1 
ATOM   1133 C  C   . TYR A 1 156 ? 21.678  -9.619  -25.006 1.00 18.48 ? 180 TYR B C   1 
ATOM   1134 O  O   . TYR A 1 156 ? 22.706  -8.981  -24.783 1.00 18.90 ? 180 TYR B O   1 
ATOM   1135 C  CB  . TYR A 1 156 ? 23.135  -11.414 -25.980 1.00 18.06 ? 180 TYR B CB  1 
ATOM   1136 C  CG  . TYR A 1 156 ? 23.566  -12.306 -24.836 1.00 17.95 ? 180 TYR B CG  1 
ATOM   1137 C  CD1 . TYR A 1 156 ? 24.332  -13.440 -25.069 1.00 17.98 ? 180 TYR B CD1 1 
ATOM   1138 C  CD2 . TYR A 1 156 ? 23.205  -12.019 -23.526 1.00 18.92 ? 180 TYR B CD2 1 
ATOM   1139 C  CE1 . TYR A 1 156 ? 24.733  -14.259 -24.029 1.00 18.33 ? 180 TYR B CE1 1 
ATOM   1140 C  CE2 . TYR A 1 156 ? 23.599  -12.833 -22.480 1.00 18.47 ? 180 TYR B CE2 1 
ATOM   1141 C  CZ  . TYR A 1 156 ? 24.363  -13.951 -22.737 1.00 18.20 ? 180 TYR B CZ  1 
ATOM   1142 O  OH  . TYR A 1 156 ? 24.757  -14.763 -21.697 1.00 18.43 ? 180 TYR B OH  1 
ATOM   1143 N  N   . GLU A 1 157 ? 20.491  -9.274  -24.517 1.00 17.72 ? 181 GLU B N   1 
ATOM   1144 C  CA  . GLU A 1 157 ? 20.253  -7.977  -23.889 1.00 18.65 ? 181 GLU B CA  1 
ATOM   1145 C  C   . GLU A 1 157 ? 20.822  -7.854  -22.482 1.00 19.11 ? 181 GLU B C   1 
ATOM   1146 O  O   . GLU A 1 157 ? 21.151  -6.757  -22.030 1.00 19.78 ? 181 GLU B O   1 
ATOM   1147 C  CB  . GLU A 1 157 ? 18.751  -7.676  -23.869 1.00 19.94 ? 181 GLU B CB  1 
ATOM   1148 C  CG  . GLU A 1 157 ? 18.367  -6.452  -23.052 1.00 21.05 ? 181 GLU B CG  1 
ATOM   1149 C  CD  . GLU A 1 157 ? 16.931  -6.025  -23.283 1.00 21.73 ? 181 GLU B CD  1 
ATOM   1150 O  OE1 . GLU A 1 157 ? 16.506  -5.975  -24.456 1.00 21.04 ? 181 GLU B OE1 1 
ATOM   1151 O  OE2 . GLU A 1 157 ? 16.229  -5.731  -22.293 1.00 23.95 ? 181 GLU B OE2 1 
ATOM   1152 N  N   . SER A 1 158 ? 20.935  -8.981  -21.791 1.00 19.18 ? 182 SER B N   1 
ATOM   1153 C  CA  . SER A 1 158 ? 21.348  -8.975  -20.396 1.00 19.18 ? 182 SER B CA  1 
ATOM   1154 C  C   . SER A 1 158 ? 21.977  -10.305 -20.012 1.00 19.50 ? 182 SER B C   1 
ATOM   1155 O  O   . SER A 1 158 ? 21.838  -11.295 -20.729 1.00 19.85 ? 182 SER B O   1 
ATOM   1156 C  CB  . SER A 1 158 ? 20.144  -8.683  -19.497 1.00 19.54 ? 182 SER B CB  1 
ATOM   1157 O  OG  . SER A 1 158 ? 20.404  -9.035  -18.152 1.00 20.77 ? 182 SER B OG  1 
ATOM   1158 N  N   . LYS A 1 159 ? 22.677  -10.320 -18.883 1.00 20.15 ? 183 LYS B N   1 
ATOM   1159 C  CA  . LYS A 1 159 ? 23.233  -11.556 -18.349 1.00 20.46 ? 183 LYS B CA  1 
ATOM   1160 C  C   . LYS A 1 159 ? 22.100  -12.453 -17.867 1.00 20.81 ? 183 LYS B C   1 
ATOM   1161 O  O   . LYS A 1 159 ? 22.273  -13.662 -17.711 1.00 20.68 ? 183 LYS B O   1 
ATOM   1162 C  CB  . LYS A 1 159 ? 24.189  -11.261 -17.191 1.00 20.59 ? 183 LYS B CB  1 
ATOM   1163 C  CG  . LYS A 1 159 ? 25.472  -10.559 -17.598 1.00 20.35 ? 183 LYS B CG  1 
ATOM   1164 C  CD  . LYS A 1 159 ? 26.284  -11.414 -18.554 1.00 21.22 ? 183 LYS B CD  1 
ATOM   1165 C  CE  . LYS A 1 159 ? 27.637  -10.785 -18.850 1.00 22.96 ? 183 LYS B CE  1 
ATOM   1166 N  NZ  . LYS A 1 159 ? 28.482  -10.669 -17.628 1.00 24.86 ? 183 LYS B NZ  1 
ATOM   1167 N  N   . ALA A 1 160 ? 20.936  -11.849 -17.646 1.00 20.72 ? 184 ALA B N   1 
ATOM   1168 C  CA  . ALA A 1 160 ? 19.800  -12.553 -17.059 1.00 20.32 ? 184 ALA B CA  1 
ATOM   1169 C  C   . ALA A 1 160 ? 18.767  -13.030 -18.080 1.00 18.70 ? 184 ALA B C   1 
ATOM   1170 O  O   . ALA A 1 160 ? 17.868  -13.795 -17.736 1.00 18.51 ? 184 ALA B O   1 
ATOM   1171 C  CB  . ALA A 1 160 ? 19.132  -11.685 -15.999 1.00 20.55 ? 184 ALA B CB  1 
ATOM   1172 N  N   . HIS A 1 161 ? 18.887  -12.583 -19.327 1.00 18.29 ? 185 HIS B N   1 
ATOM   1173 C  CA  . HIS A 1 161 ? 17.923  -12.981 -20.349 1.00 18.23 ? 185 HIS B CA  1 
ATOM   1174 C  C   . HIS A 1 161 ? 18.352  -12.634 -21.773 1.00 17.99 ? 185 HIS B C   1 
ATOM   1175 O  O   . HIS A 1 161 ? 19.180  -11.751 -21.991 1.00 17.61 ? 185 HIS B O   1 
ATOM   1176 C  CB  . HIS A 1 161 ? 16.551  -12.362 -20.064 1.00 17.71 ? 185 HIS B CB  1 
ATOM   1177 C  CG  . HIS A 1 161 ? 16.478  -10.893 -20.350 1.00 17.81 ? 185 HIS B CG  1 
ATOM   1178 N  ND1 . HIS A 1 161 ? 16.480  -9.940  -19.355 1.00 18.19 ? 185 HIS B ND1 1 
ATOM   1179 C  CD2 . HIS A 1 161 ? 16.399  -10.216 -21.519 1.00 18.26 ? 185 HIS B CD2 1 
ATOM   1180 C  CE1 . HIS A 1 161 ? 16.406  -8.738  -19.899 1.00 17.89 ? 185 HIS B CE1 1 
ATOM   1181 N  NE2 . HIS A 1 161 ? 16.355  -8.878  -21.211 1.00 18.51 ? 185 HIS B NE2 1 
ATOM   1182 N  N   . VAL A 1 162 ? 17.771  -13.348 -22.733 1.00 17.19 ? 186 VAL B N   1 
ATOM   1183 C  CA  . VAL A 1 162 ? 17.958  -13.065 -24.148 1.00 16.70 ? 186 VAL B CA  1 
ATOM   1184 C  C   . VAL A 1 162 ? 16.700  -12.385 -24.677 1.00 17.13 ? 186 VAL B C   1 
ATOM   1185 O  O   . VAL A 1 162 ? 15.591  -12.716 -24.265 1.00 17.52 ? 186 VAL B O   1 
ATOM   1186 C  CB  . VAL A 1 162 ? 18.224  -14.357 -24.950 1.00 17.27 ? 186 VAL B CB  1 
ATOM   1187 C  CG1 . VAL A 1 162 ? 18.238  -14.072 -26.444 1.00 17.41 ? 186 VAL B CG1 1 
ATOM   1188 C  CG2 . VAL A 1 162 ? 19.533  -15.001 -24.511 1.00 16.78 ? 186 VAL B CG2 1 
ATOM   1189 N  N   . HIS A 1 163 ? 16.874  -11.430 -25.583 1.00 17.27 ? 187 HIS B N   1 
ATOM   1190 C  CA  . HIS A 1 163 ? 15.751  -10.676 -26.127 1.00 17.12 ? 187 HIS B CA  1 
ATOM   1191 C  C   . HIS A 1 163 ? 15.411  -11.140 -27.542 1.00 17.54 ? 187 HIS B C   1 
ATOM   1192 O  O   . HIS A 1 163 ? 16.294  -11.260 -28.392 1.00 17.16 ? 187 HIS B O   1 
ATOM   1193 C  CB  . HIS A 1 163 ? 16.071  -9.179  -26.116 1.00 17.97 ? 187 HIS B CB  1 
ATOM   1194 C  CG  . HIS A 1 163 ? 14.959  -8.314  -26.626 1.00 17.82 ? 187 HIS B CG  1 
ATOM   1195 N  ND1 . HIS A 1 163 ? 13.916  -7.897  -25.827 1.00 18.41 ? 187 HIS B ND1 1 
ATOM   1196 C  CD2 . HIS A 1 163 ? 14.735  -7.778  -27.848 1.00 16.94 ? 187 HIS B CD2 1 
ATOM   1197 C  CE1 . HIS A 1 163 ? 13.093  -7.146  -26.537 1.00 17.65 ? 187 HIS B CE1 1 
ATOM   1198 N  NE2 . HIS A 1 163 ? 13.568  -7.057  -27.767 1.00 17.53 ? 187 HIS B NE2 1 
ATOM   1199 N  N   . CYS A 1 164 ? 14.130  -11.406 -27.786 1.00 17.03 ? 188 CYS B N   1 
ATOM   1200 C  CA  . CYS A 1 164 ? 13.673  -11.845 -29.101 1.00 16.92 ? 188 CYS B CA  1 
ATOM   1201 C  C   . CYS A 1 164 ? 12.442  -11.055 -29.527 1.00 16.64 ? 188 CYS B C   1 
ATOM   1202 O  O   . CYS A 1 164 ? 11.620  -10.691 -28.692 1.00 17.33 ? 188 CYS B O   1 
ATOM   1203 C  CB  . CYS A 1 164 ? 13.345  -13.340 -29.086 1.00 16.65 ? 188 CYS B CB  1 
ATOM   1204 S  SG  . CYS A 1 164 ? 14.706  -14.410 -28.567 1.00 16.59 ? 188 CYS B SG  1 
ATOM   1205 N  N   . SER A 1 165 ? 12.315  -10.790 -30.823 1.00 16.36 ? 189 SER B N   1 
ATOM   1206 C  CA  . SER A 1 165 ? 11.167  -10.045 -31.331 1.00 16.99 ? 189 SER B CA  1 
ATOM   1207 C  C   . SER A 1 165 ? 10.834  -10.409 -32.772 1.00 17.59 ? 189 SER B C   1 
ATOM   1208 O  O   . SER A 1 165 ? 11.638  -11.028 -33.470 1.00 18.08 ? 189 SER B O   1 
ATOM   1209 C  CB  . SER A 1 165 ? 11.399  -8.538  -31.211 1.00 17.18 ? 189 SER B CB  1 
ATOM   1210 O  OG  . SER A 1 165 ? 12.443  -8.116  -32.066 1.00 17.07 ? 189 SER B OG  1 
ATOM   1211 N  N   . VAL A 1 166 ? 9.642   -10.016 -33.212 1.00 17.78 ? 190 VAL B N   1 
ATOM   1212 C  CA  . VAL A 1 166 ? 9.160   -10.361 -34.544 1.00 18.31 ? 190 VAL B CA  1 
ATOM   1213 C  C   . VAL A 1 166 ? 8.507   -9.165  -35.232 1.00 18.68 ? 190 VAL B C   1 
ATOM   1214 O  O   . VAL A 1 166 ? 8.099   -8.205  -34.575 1.00 18.59 ? 190 VAL B O   1 
ATOM   1215 C  CB  . VAL A 1 166 ? 8.150   -11.527 -34.488 1.00 18.33 ? 190 VAL B CB  1 
ATOM   1216 C  CG1 . VAL A 1 166 ? 8.846   -12.818 -34.093 1.00 17.89 ? 190 VAL B CG1 1 
ATOM   1217 C  CG2 . VAL A 1 166 ? 7.028   -11.211 -33.514 1.00 18.19 ? 190 VAL B CG2 1 
ATOM   1218 N  N   . LYS A 1 167 ? 8.411   -9.230  -36.557 1.00 19.44 ? 191 LYS B N   1 
ATOM   1219 C  CA  . LYS A 1 167 ? 7.788   -8.171  -37.345 1.00 19.15 ? 191 LYS B CA  1 
ATOM   1220 C  C   . LYS A 1 167 ? 6.301   -8.039  -37.040 1.00 19.57 ? 191 LYS B C   1 
ATOM   1221 O  O   . LYS A 1 167 ? 5.778   -8.698  -36.142 1.00 19.55 ? 191 LYS B O   1 
ATOM   1222 C  CB  . LYS A 1 167 ? 7.979   -8.425  -38.842 1.00 19.19 ? 191 LYS B CB  1 
ATOM   1223 C  CG  . LYS A 1 167 ? 9.307   -7.953  -39.394 1.00 20.07 ? 191 LYS B CG  1 
ATOM   1224 C  CD  . LYS A 1 167 ? 9.378   -8.155  -40.900 1.00 21.77 ? 191 LYS B CD  1 
ATOM   1225 C  CE  . LYS A 1 167 ? 9.341   -9.633  -41.257 1.00 24.00 ? 191 LYS B CE  1 
ATOM   1226 N  NZ  . LYS A 1 167 ? 9.500   -9.861  -42.721 1.00 27.25 ? 191 LYS B NZ  1 
ATOM   1227 N  N   . SER A 1 168 ? 5.624   -7.187  -37.804 1.00 20.40 ? 192 SER B N   1 
ATOM   1228 C  CA  . SER A 1 168 ? 4.202   -6.935  -37.608 1.00 20.59 ? 192 SER B CA  1 
ATOM   1229 C  C   . SER A 1 168 ? 3.390   -7.365  -38.826 1.00 19.53 ? 192 SER B C   1 
ATOM   1230 O  O   . SER A 1 168 ? 2.886   -8.488  -38.886 1.00 18.60 ? 192 SER B O   1 
ATOM   1231 C  CB  . SER A 1 168 ? 3.966   -5.451  -37.312 1.00 22.13 ? 192 SER B CB  1 
ATOM   1232 O  OG  . SER A 1 168 ? 2.586   -5.161  -37.176 1.00 25.10 ? 192 SER B OG  1 
ATOM   1233 N  N   . PRO B 2 6   ? -7.849  -2.905  2.974   1.00 27.79 ? 712 PRO C N   1 
ATOM   1234 C  CA  . PRO B 2 6   ? -7.580  -2.358  1.640   1.00 29.83 ? 712 PRO C CA  1 
ATOM   1235 C  C   . PRO B 2 6   ? -7.642  -3.447  0.579   1.00 30.06 ? 712 PRO C C   1 
ATOM   1236 O  O   . PRO B 2 6   ? -7.254  -4.584  0.842   1.00 30.92 ? 712 PRO C O   1 
ATOM   1237 C  CB  . PRO B 2 6   ? -6.144  -1.829  1.757   1.00 28.94 ? 712 PRO C CB  1 
ATOM   1238 C  CG  . PRO B 2 6   ? -5.891  -1.691  3.220   1.00 29.43 ? 712 PRO C CG  1 
ATOM   1239 C  CD  . PRO B 2 6   ? -6.685  -2.780  3.865   1.00 29.48 ? 712 PRO C CD  1 
ATOM   1240 N  N   . VAL B 2 7   ? -8.123  -3.099  -0.609  1.00 29.49 ? 713 VAL C N   1 
ATOM   1241 C  CA  . VAL B 2 7   ? -8.251  -4.064  -1.692  1.00 29.89 ? 713 VAL C CA  1 
ATOM   1242 C  C   . VAL B 2 7   ? -7.362  -3.703  -2.875  1.00 30.05 ? 713 VAL C C   1 
ATOM   1243 O  O   . VAL B 2 7   ? -6.529  -4.501  -3.300  1.00 29.94 ? 713 VAL C O   1 
ATOM   1244 C  CB  . VAL B 2 7   ? -9.707  -4.181  -2.161  1.00 31.30 ? 713 VAL C CB  1 
ATOM   1245 C  CG1 . VAL B 2 7   ? -10.383 -5.375  -1.504  1.00 30.31 ? 713 VAL C CG1 1 
ATOM   1246 C  CG2 . VAL B 2 7   ? -10.459 -2.884  -1.867  1.00 31.37 ? 713 VAL C CG2 1 
ATOM   1247 N  N   . ALA B 2 8   ? -7.544  -2.500  -3.407  1.00 29.83 ? 714 ALA C N   1 
ATOM   1248 C  CA  . ALA B 2 8   ? -6.702  -2.016  -4.492  1.00 29.40 ? 714 ALA C CA  1 
ATOM   1249 C  C   . ALA B 2 8   ? -5.324  -1.646  -3.954  1.00 29.80 ? 714 ALA C C   1 
ATOM   1250 O  O   . ALA B 2 8   ? -5.209  -1.006  -2.909  1.00 30.42 ? 714 ALA C O   1 
ATOM   1251 C  CB  . ALA B 2 8   ? -7.348  -0.823  -5.173  1.00 31.13 ? 714 ALA C CB  1 
ATOM   1252 N  N   . GLY B 2 9   ? -4.280  -2.054  -4.668  1.00 28.63 ? 715 GLY C N   1 
ATOM   1253 C  CA  . GLY B 2 9   ? -2.921  -1.780  -4.242  1.00 28.61 ? 715 GLY C CA  1 
ATOM   1254 C  C   . GLY B 2 9   ? -2.351  -0.520  -4.864  1.00 29.27 ? 715 GLY C C   1 
ATOM   1255 O  O   . GLY B 2 9   ? -3.019  0.149   -5.653  1.00 27.99 ? 715 GLY C O   1 
ATOM   1256 N  N   . PRO B 2 10  ? -1.106  -0.180  -4.500  1.00 28.61 ? 716 PRO C N   1 
ATOM   1257 C  CA  . PRO B 2 10  ? -0.411  0.964   -5.094  1.00 28.33 ? 716 PRO C CA  1 
ATOM   1258 C  C   . PRO B 2 10  ? -0.073  0.680   -6.551  1.00 28.85 ? 716 PRO C C   1 
ATOM   1259 O  O   . PRO B 2 10  ? -0.405  -0.390  -7.064  1.00 27.72 ? 716 PRO C O   1 
ATOM   1260 C  CB  . PRO B 2 10  ? 0.880   1.058   -4.272  1.00 28.09 ? 716 PRO C CB  1 
ATOM   1261 C  CG  . PRO B 2 10  ? 0.622   0.265   -3.030  1.00 27.72 ? 716 PRO C CG  1 
ATOM   1262 C  CD  . PRO B 2 10  ? -0.306  -0.824  -3.446  1.00 27.24 ? 716 PRO C CD  1 
ATOM   1263 N  N   . TYR B 2 11  ? 0.581   1.631   -7.207  1.00 29.31 ? 717 TYR C N   1 
ATOM   1264 C  CA  . TYR B 2 11  ? 1.048   1.428   -8.571  1.00 28.72 ? 717 TYR C CA  1 
ATOM   1265 C  C   . TYR B 2 11  ? 2.471   1.948   -8.724  1.00 28.48 ? 717 TYR C C   1 
ATOM   1266 O  O   . TYR B 2 11  ? 2.703   3.155   -8.692  1.00 29.17 ? 717 TYR C O   1 
ATOM   1267 C  CB  . TYR B 2 11  ? 0.120   2.112   -9.577  1.00 28.41 ? 717 TYR C CB  1 
ATOM   1268 C  CG  . TYR B 2 11  ? 0.467   1.808   -11.018 1.00 28.90 ? 717 TYR C CG  1 
ATOM   1269 C  CD1 . TYR B 2 11  ? 0.342   0.519   -11.524 1.00 28.64 ? 717 TYR C CD1 1 
ATOM   1270 C  CD2 . TYR B 2 11  ? 0.917   2.806   -11.873 1.00 29.61 ? 717 TYR C CD2 1 
ATOM   1271 C  CE1 . TYR B 2 11  ? 0.659   0.230   -12.840 1.00 27.93 ? 717 TYR C CE1 1 
ATOM   1272 C  CE2 . TYR B 2 11  ? 1.236   2.528   -13.193 1.00 30.02 ? 717 TYR C CE2 1 
ATOM   1273 C  CZ  . TYR B 2 11  ? 1.104   1.238   -13.670 1.00 29.80 ? 717 TYR C CZ  1 
ATOM   1274 O  OH  . TYR B 2 11  ? 1.418   0.951   -14.980 1.00 29.25 ? 717 TYR C OH  1 
ATOM   1275 N  N   . ILE B 2 12  ? 3.420   1.030   -8.880  1.00 27.70 ? 718 ILE C N   1 
ATOM   1276 C  CA  . ILE B 2 12  ? 4.820   1.401   -9.042  1.00 28.18 ? 718 ILE C CA  1 
ATOM   1277 C  C   . ILE B 2 12  ? 5.019   2.170   -10.345 1.00 28.44 ? 718 ILE C C   1 
ATOM   1278 O  O   . ILE B 2 12  ? 4.689   1.678   -11.425 1.00 27.55 ? 718 ILE C O   1 
ATOM   1279 C  CB  . ILE B 2 12  ? 5.745   0.170   -9.016  1.00 27.26 ? 718 ILE C CB  1 
ATOM   1280 C  CG1 . ILE B 2 12  ? 5.360   -0.764  -7.867  1.00 25.89 ? 718 ILE C CG1 1 
ATOM   1281 C  CG2 . ILE B 2 12  ? 7.196   0.600   -8.889  1.00 28.23 ? 718 ILE C CG2 1 
ATOM   1282 C  CD1 . ILE B 2 12  ? 6.286   -1.946  -7.712  1.00 23.60 ? 718 ILE C CD1 1 
ATOM   1283 N  N   . THR B 2 13  ? 5.561   3.378   -10.233 1.00 29.56 ? 719 THR C N   1 
ATOM   1284 C  CA  . THR B 2 13  ? 5.672   4.281   -11.374 1.00 29.78 ? 719 THR C CA  1 
ATOM   1285 C  C   . THR B 2 13  ? 7.069   4.281   -11.989 1.00 29.65 ? 719 THR C C   1 
ATOM   1286 O  O   . THR B 2 13  ? 7.219   4.355   -13.208 1.00 30.04 ? 719 THR C O   1 
ATOM   1287 C  CB  . THR B 2 13  ? 5.271   5.719   -10.985 1.00 29.99 ? 719 THR C CB  1 
ATOM   1288 O  OG1 . THR B 2 13  ? 3.879   5.752   -10.644 1.00 29.49 ? 719 THR C OG1 1 
ATOM   1289 C  CG2 . THR B 2 13  ? 5.521   6.675   -12.138 1.00 32.69 ? 719 THR C CG2 1 
ATOM   1290 N  N   . PHE B 2 14  ? 8.090   4.200   -11.145 1.00 29.32 ? 720 PHE C N   1 
ATOM   1291 C  CA  . PHE B 2 14  ? 9.465   4.155   -11.628 1.00 30.40 ? 720 PHE C CA  1 
ATOM   1292 C  C   . PHE B 2 14  ? 10.333  3.260   -10.754 1.00 29.76 ? 720 PHE C C   1 
ATOM   1293 O  O   . PHE B 2 14  ? 10.184  3.236   -9.533  1.00 30.20 ? 720 PHE C O   1 
ATOM   1294 C  CB  . PHE B 2 14  ? 10.073  5.562   -11.695 1.00 32.28 ? 720 PHE C CB  1 
ATOM   1295 C  CG  . PHE B 2 14  ? 9.588   6.385   -12.861 1.00 34.66 ? 720 PHE C CG  1 
ATOM   1296 C  CD1 . PHE B 2 14  ? 10.006  6.098   -14.153 1.00 34.57 ? 720 PHE C CD1 1 
ATOM   1297 C  CD2 . PHE B 2 14  ? 8.726   7.456   -12.662 1.00 34.55 ? 720 PHE C CD2 1 
ATOM   1298 C  CE1 . PHE B 2 14  ? 9.565   6.856   -15.229 1.00 33.87 ? 720 PHE C CE1 1 
ATOM   1299 C  CE2 . PHE B 2 14  ? 8.281   8.217   -13.732 1.00 33.91 ? 720 PHE C CE2 1 
ATOM   1300 C  CZ  . PHE B 2 14  ? 8.702   7.917   -15.017 1.00 34.02 ? 720 PHE C CZ  1 
ATOM   1301 N  N   . THR B 2 15  ? 11.230  2.516   -11.391 1.00 28.86 ? 721 THR C N   1 
ATOM   1302 C  CA  . THR B 2 15  ? 12.244  1.753   -10.677 1.00 28.46 ? 721 THR C CA  1 
ATOM   1303 C  C   . THR B 2 15  ? 13.562  1.880   -11.421 1.00 28.22 ? 721 THR C C   1 
ATOM   1304 O  O   . THR B 2 15  ? 13.587  1.884   -12.651 1.00 28.81 ? 721 THR C O   1 
ATOM   1305 C  CB  . THR B 2 15  ? 11.881  0.259   -10.561 1.00 29.07 ? 721 THR C CB  1 
ATOM   1306 O  OG1 . THR B 2 15  ? 11.917  -0.350  -11.857 1.00 28.36 ? 721 THR C OG1 1 
ATOM   1307 C  CG2 . THR B 2 15  ? 10.498  0.084   -9.953  1.00 28.88 ? 721 THR C CG2 1 
ATOM   1308 N  N   . ASP B 2 16  ? 14.657  1.992   -10.679 1.00 28.57 ? 722 ASP C N   1 
ATOM   1309 C  CA  . ASP B 2 16  ? 15.970  2.094   -11.301 1.00 29.09 ? 722 ASP C CA  1 
ATOM   1310 C  C   . ASP B 2 16  ? 17.088  1.780   -10.316 1.00 27.52 ? 722 ASP C C   1 
ATOM   1311 O  O   . ASP B 2 16  ? 16.919  1.912   -9.105  1.00 27.27 ? 722 ASP C O   1 
ATOM   1312 C  CB  . ASP B 2 16  ? 16.173  3.485   -11.901 1.00 29.26 ? 722 ASP C CB  1 
ATOM   1313 C  CG  . ASP B 2 16  ? 17.340  3.536   -12.866 1.00 30.54 ? 722 ASP C CG  1 
ATOM   1314 O  OD1 . ASP B 2 16  ? 17.612  2.508   -13.523 1.00 30.62 ? 722 ASP C OD1 1 
ATOM   1315 O  OD2 . ASP B 2 16  ? 17.984  4.601   -12.967 1.00 30.46 ? 722 ASP C OD2 1 
ATOM   1316 N  N   . ALA B 2 17  ? 18.230  1.363   -10.847 1.00 27.95 ? 723 ALA C N   1 
ATOM   1317 C  CA  . ALA B 2 17  ? 19.386  1.052   -10.018 1.00 28.68 ? 723 ALA C CA  1 
ATOM   1318 C  C   . ALA B 2 17  ? 20.104  2.325   -9.588  1.00 29.16 ? 723 ALA C C   1 
ATOM   1319 O  O   . ALA B 2 17  ? 20.428  3.175   -10.416 1.00 29.85 ? 723 ALA C O   1 
ATOM   1320 C  CB  . ALA B 2 17  ? 20.339  0.132   -10.762 1.00 27.95 ? 723 ALA C CB  1 
ATOM   1321 N  N   . VAL B 2 18  ? 20.341  2.454   -8.287  1.00 28.64 ? 724 VAL C N   1 
ATOM   1322 C  CA  . VAL B 2 18  ? 21.091  3.583   -7.754  1.00 29.05 ? 724 VAL C CA  1 
ATOM   1323 C  C   . VAL B 2 18  ? 22.583  3.273   -7.802  1.00 30.41 ? 724 VAL C C   1 
ATOM   1324 O  O   . VAL B 2 18  ? 23.411  4.168   -7.976  1.00 31.31 ? 724 VAL C O   1 
ATOM   1325 C  CB  . VAL B 2 18  ? 20.672  3.906   -6.306  1.00 28.32 ? 724 VAL C CB  1 
ATOM   1326 C  CG1 . VAL B 2 18  ? 21.538  5.018   -5.736  1.00 28.05 ? 724 VAL C CG1 1 
ATOM   1327 C  CG2 . VAL B 2 18  ? 19.201  4.290   -6.254  1.00 28.08 ? 724 VAL C CG2 1 
ATOM   1328 N  N   . ASN B 2 19  ? 22.915  1.995   -7.651  1.00 30.23 ? 725 ASN C N   1 
ATOM   1329 C  CA  . ASN B 2 19  ? 24.299  1.541   -7.724  1.00 30.14 ? 725 ASN C CA  1 
ATOM   1330 C  C   . ASN B 2 19  ? 24.402  0.025   -7.870  1.00 29.18 ? 725 ASN C C   1 
ATOM   1331 O  O   . ASN B 2 19  ? 23.558  -0.600  -8.512  1.00 28.26 ? 725 ASN C O   1 
ATOM   1332 C  CB  . ASN B 2 19  ? 25.100  2.035   -6.515  1.00 31.22 ? 725 ASN C CB  1 
ATOM   1333 C  CG  . ASN B 2 19  ? 24.460  1.657   -5.196  1.00 30.40 ? 725 ASN C CG  1 
ATOM   1334 O  OD1 . ASN B 2 19  ? 24.460  0.491   -4.804  1.00 29.99 ? 725 ASN C OD1 1 
ATOM   1335 N  ND2 . ASN B 2 19  ? 23.919  2.647   -4.497  1.00 29.92 ? 725 ASN C ND2 1 
ATOM   1336 N  N   . GLU B 2 20  ? 25.433  -0.562  -7.273  1.00 29.15 ? 726 GLU C N   1 
ATOM   1337 C  CA  . GLU B 2 20  ? 25.696  -1.989  -7.433  1.00 28.92 ? 726 GLU C CA  1 
ATOM   1338 C  C   . GLU B 2 20  ? 24.886  -2.856  -6.473  1.00 28.85 ? 726 GLU C C   1 
ATOM   1339 O  O   . GLU B 2 20  ? 24.771  -4.064  -6.675  1.00 28.33 ? 726 GLU C O   1 
ATOM   1340 C  CB  . GLU B 2 20  ? 27.190  -2.291  -7.260  1.00 29.53 ? 726 GLU C CB  1 
ATOM   1341 C  CG  . GLU B 2 20  ? 28.113  -1.528  -8.202  1.00 30.38 ? 726 GLU C CG  1 
ATOM   1342 C  CD  . GLU B 2 20  ? 28.369  -0.102  -7.745  1.00 33.32 ? 726 GLU C CD  1 
ATOM   1343 O  OE1 . GLU B 2 20  ? 28.077  0.210   -6.570  1.00 33.19 ? 726 GLU C OE1 1 
ATOM   1344 O  OE2 . GLU B 2 20  ? 28.867  0.705   -8.561  1.00 34.27 ? 726 GLU C OE2 1 
ATOM   1345 N  N   . THR B 2 21  ? 24.330  -2.249  -5.428  1.00 28.93 ? 727 THR C N   1 
ATOM   1346 C  CA  . THR B 2 21  ? 23.640  -3.024  -4.398  1.00 27.92 ? 727 THR C CA  1 
ATOM   1347 C  C   . THR B 2 21  ? 22.326  -2.417  -3.921  1.00 27.04 ? 727 THR C C   1 
ATOM   1348 O  O   . THR B 2 21  ? 21.753  -2.880  -2.936  1.00 27.04 ? 727 THR C O   1 
ATOM   1349 C  CB  . THR B 2 21  ? 24.536  -3.259  -3.166  1.00 28.07 ? 727 THR C CB  1 
ATOM   1350 O  OG1 . THR B 2 21  ? 24.931  -1.999  -2.608  1.00 28.68 ? 727 THR C OG1 1 
ATOM   1351 C  CG2 . THR B 2 21  ? 25.771  -4.056  -3.550  1.00 27.95 ? 727 THR C CG2 1 
ATOM   1352 N  N   . THR B 2 22  ? 21.847  -1.385  -4.604  1.00 26.81 ? 728 THR C N   1 
ATOM   1353 C  CA  . THR B 2 22  ? 20.561  -0.798  -4.240  1.00 26.58 ? 728 THR C CA  1 
ATOM   1354 C  C   . THR B 2 22  ? 19.732  -0.304  -5.425  1.00 26.42 ? 728 THR C C   1 
ATOM   1355 O  O   . THR B 2 22  ? 20.269  0.083   -6.464  1.00 26.21 ? 728 THR C O   1 
ATOM   1356 C  CB  . THR B 2 22  ? 20.702  0.309   -3.164  1.00 27.77 ? 728 THR C CB  1 
ATOM   1357 O  OG1 . THR B 2 22  ? 19.877  1.427   -3.509  1.00 27.24 ? 728 THR C OG1 1 
ATOM   1358 C  CG2 . THR B 2 22  ? 22.139  0.770   -3.051  1.00 28.91 ? 728 THR C CG2 1 
ATOM   1359 N  N   . ILE B 2 23  ? 18.414  -0.335  -5.246  1.00 26.93 ? 729 ILE C N   1 
ATOM   1360 C  CA  . ILE B 2 23  ? 17.465  0.064   -6.275  1.00 27.09 ? 729 ILE C CA  1 
ATOM   1361 C  C   . ILE B 2 23  ? 16.453  1.062   -5.719  1.00 26.46 ? 729 ILE C C   1 
ATOM   1362 O  O   . ILE B 2 23  ? 15.953  0.900   -4.607  1.00 26.36 ? 729 ILE C O   1 
ATOM   1363 C  CB  . ILE B 2 23  ? 16.703  -1.157  -6.828  1.00 26.87 ? 729 ILE C CB  1 
ATOM   1364 C  CG1 . ILE B 2 23  ? 17.676  -2.154  -7.458  1.00 25.56 ? 729 ILE C CG1 1 
ATOM   1365 C  CG2 . ILE B 2 23  ? 15.644  -0.726  -7.834  1.00 26.96 ? 729 ILE C CG2 1 
ATOM   1366 C  CD1 . ILE B 2 23  ? 17.009  -3.398  -7.988  1.00 25.65 ? 729 ILE C CD1 1 
ATOM   1367 N  N   . MET B 2 24  ? 16.157  2.095   -6.499  1.00 27.58 ? 730 MET C N   1 
ATOM   1368 C  CA  . MET B 2 24  ? 15.177  3.103   -6.114  1.00 28.18 ? 730 MET C CA  1 
ATOM   1369 C  C   . MET B 2 24  ? 13.846  2.830   -6.805  1.00 28.13 ? 730 MET C C   1 
ATOM   1370 O  O   . MET B 2 24  ? 13.818  2.447   -7.974  1.00 28.02 ? 730 MET C O   1 
ATOM   1371 C  CB  . MET B 2 24  ? 15.681  4.496   -6.499  1.00 29.88 ? 730 MET C CB  1 
ATOM   1372 C  CG  . MET B 2 24  ? 14.633  5.602   -6.424  1.00 31.73 ? 730 MET C CG  1 
ATOM   1373 S  SD  . MET B 2 24  ? 14.612  6.474   -4.844  1.00 37.35 ? 730 MET C SD  1 
ATOM   1374 C  CE  . MET B 2 24  ? 16.209  7.289   -4.886  1.00 32.89 ? 730 MET C CE  1 
ATOM   1375 N  N   . LEU B 2 25  ? 12.745  3.019   -6.085  1.00 28.58 ? 731 LEU C N   1 
ATOM   1376 C  CA  . LEU B 2 25  ? 11.422  2.896   -6.691  1.00 28.90 ? 731 LEU C CA  1 
ATOM   1377 C  C   . LEU B 2 25  ? 10.431  3.926   -6.150  1.00 29.50 ? 731 LEU C C   1 
ATOM   1378 O  O   . LEU B 2 25  ? 10.515  4.343   -4.994  1.00 29.39 ? 731 LEU C O   1 
ATOM   1379 C  CB  . LEU B 2 25  ? 10.860  1.481   -6.526  1.00 28.51 ? 731 LEU C CB  1 
ATOM   1380 C  CG  . LEU B 2 25  ? 10.259  1.108   -5.170  1.00 28.75 ? 731 LEU C CG  1 
ATOM   1381 C  CD1 . LEU B 2 25  ? 9.018   0.242   -5.350  1.00 28.09 ? 731 LEU C CD1 1 
ATOM   1382 C  CD2 . LEU B 2 25  ? 11.289  0.418   -4.286  1.00 28.27 ? 731 LEU C CD2 1 
ATOM   1383 N  N   . LYS B 2 26  ? 9.497   4.331   -7.004  1.00 29.89 ? 732 LYS C N   1 
ATOM   1384 C  CA  . LYS B 2 26  ? 8.457   5.280   -6.633  1.00 29.97 ? 732 LYS C CA  1 
ATOM   1385 C  C   . LYS B 2 26  ? 7.100   4.719   -7.042  1.00 30.09 ? 732 LYS C C   1 
ATOM   1386 O  O   . LYS B 2 26  ? 7.029   3.792   -7.850  1.00 29.48 ? 732 LYS C O   1 
ATOM   1387 C  CB  . LYS B 2 26  ? 8.704   6.632   -7.306  1.00 31.13 ? 732 LYS C CB  1 
ATOM   1388 C  CG  . LYS B 2 26  ? 10.118  7.165   -7.108  1.00 33.02 ? 732 LYS C CG  1 
ATOM   1389 C  CD  . LYS B 2 26  ? 10.238  8.625   -7.523  1.00 35.55 ? 732 LYS C CD  1 
ATOM   1390 C  CE  . LYS B 2 26  ? 11.550  9.230   -7.035  1.00 38.08 ? 732 LYS C CE  1 
ATOM   1391 N  NZ  . LYS B 2 26  ? 11.593  10.712  -7.199  1.00 40.42 ? 732 LYS C NZ  1 
ATOM   1392 N  N   . TRP B 2 27  ? 6.028   5.272   -6.483  1.00 30.60 ? 733 TRP C N   1 
ATOM   1393 C  CA  . TRP B 2 27  ? 4.688   4.761   -6.753  1.00 29.70 ? 733 TRP C CA  1 
ATOM   1394 C  C   . TRP B 2 27  ? 3.606   5.765   -6.371  1.00 30.44 ? 733 TRP C C   1 
ATOM   1395 O  O   . TRP B 2 27  ? 3.847   6.692   -5.598  1.00 30.91 ? 733 TRP C O   1 
ATOM   1396 C  CB  . TRP B 2 27  ? 4.458   3.449   -5.999  1.00 29.00 ? 733 TRP C CB  1 
ATOM   1397 C  CG  . TRP B 2 27  ? 4.437   3.621   -4.511  1.00 30.23 ? 733 TRP C CG  1 
ATOM   1398 C  CD1 . TRP B 2 27  ? 3.346   3.875   -3.729  1.00 30.00 ? 733 TRP C CD1 1 
ATOM   1399 C  CD2 . TRP B 2 27  ? 5.560   3.559   -3.623  1.00 29.93 ? 733 TRP C CD2 1 
ATOM   1400 N  NE1 . TRP B 2 27  ? 3.721   3.973   -2.411  1.00 29.76 ? 733 TRP C NE1 1 
ATOM   1401 C  CE2 . TRP B 2 27  ? 5.074   3.782   -2.319  1.00 30.30 ? 733 TRP C CE2 1 
ATOM   1402 C  CE3 . TRP B 2 27  ? 6.928   3.336   -3.804  1.00 29.42 ? 733 TRP C CE3 1 
ATOM   1403 C  CZ2 . TRP B 2 27  ? 5.908   3.788   -1.203  1.00 30.51 ? 733 TRP C CZ2 1 
ATOM   1404 C  CZ3 . TRP B 2 27  ? 7.753   3.342   -2.695  1.00 30.23 ? 733 TRP C CZ3 1 
ATOM   1405 C  CH2 . TRP B 2 27  ? 7.241   3.566   -1.411  1.00 30.86 ? 733 TRP C CH2 1 
ATOM   1406 N  N   . MET B 2 28  ? 2.412   5.564   -6.919  1.00 31.57 ? 734 MET C N   1 
ATOM   1407 C  CA  . MET B 2 28  ? 1.268   6.412   -6.613  1.00 32.19 ? 734 MET C CA  1 
ATOM   1408 C  C   . MET B 2 28  ? 0.184   5.586   -5.936  1.00 31.67 ? 734 MET C C   1 
ATOM   1409 O  O   . MET B 2 28  ? 0.206   4.356   -5.988  1.00 31.22 ? 734 MET C O   1 
ATOM   1410 C  CB  . MET B 2 28  ? 0.709   7.042   -7.891  1.00 33.23 ? 734 MET C CB  1 
ATOM   1411 C  CG  . MET B 2 28  ? -0.134  6.088   -8.725  1.00 34.36 ? 734 MET C CG  1 
ATOM   1412 S  SD  . MET B 2 28  ? -0.810  6.841   -10.217 1.00 41.76 ? 734 MET C SD  1 
ATOM   1413 C  CE  . MET B 2 28  ? -1.570  8.315   -9.540  1.00 40.45 ? 734 MET C CE  1 
ATOM   1414 N  N   . TYR B 2 29  ? -0.761  6.263   -5.297  1.00 33.06 ? 735 TYR C N   1 
ATOM   1415 C  CA  . TYR B 2 29  ? -1.893  5.583   -4.680  1.00 33.31 ? 735 TYR C CA  1 
ATOM   1416 C  C   . TYR B 2 29  ? -3.060  6.532   -4.444  1.00 34.18 ? 735 TYR C C   1 
ATOM   1417 O  O   . TYR B 2 29  ? -2.883  7.649   -3.960  1.00 33.89 ? 735 TYR C O   1 
ATOM   1418 C  CB  . TYR B 2 29  ? -1.490  4.911   -3.362  1.00 32.38 ? 735 TYR C CB  1 
ATOM   1419 C  CG  . TYR B 2 29  ? -2.677  4.422   -2.556  1.00 32.65 ? 735 TYR C CG  1 
ATOM   1420 C  CD1 . TYR B 2 29  ? -3.312  3.225   -2.869  1.00 32.32 ? 735 TYR C CD1 1 
ATOM   1421 C  CD2 . TYR B 2 29  ? -3.170  5.164   -1.491  1.00 33.06 ? 735 TYR C CD2 1 
ATOM   1422 C  CE1 . TYR B 2 29  ? -4.402  2.780   -2.139  1.00 32.85 ? 735 TYR C CE1 1 
ATOM   1423 C  CE2 . TYR B 2 29  ? -4.258  4.728   -0.758  1.00 32.79 ? 735 TYR C CE2 1 
ATOM   1424 C  CZ  . TYR B 2 29  ? -4.869  3.537   -1.084  1.00 32.63 ? 735 TYR C CZ  1 
ATOM   1425 O  OH  . TYR B 2 29  ? -5.950  3.103   -0.352  1.00 32.05 ? 735 TYR C OH  1 
ATOM   1426 N  N   . ILE B 2 30  ? -4.257  6.073   -4.788  1.00 34.26 ? 736 ILE C N   1 
ATOM   1427 C  CA  . ILE B 2 30  ? -5.464  6.852   -4.559  1.00 34.92 ? 736 ILE C CA  1 
ATOM   1428 C  C   . ILE B 2 30  ? -6.537  6.027   -3.853  1.00 35.41 ? 736 ILE C C   1 
ATOM   1429 O  O   . ILE B 2 30  ? -6.957  4.985   -4.355  1.00 35.94 ? 736 ILE C O   1 
ATOM   1430 C  CB  . ILE B 2 30  ? -6.034  7.439   -5.879  1.00 35.92 ? 736 ILE C CB  1 
ATOM   1431 C  CG1 . ILE B 2 30  ? -6.522  6.329   -6.816  1.00 36.07 ? 736 ILE C CG1 1 
ATOM   1432 C  CG2 . ILE B 2 30  ? -4.993  8.299   -6.588  1.00 35.95 ? 736 ILE C CG2 1 
ATOM   1433 C  CD1 . ILE B 2 30  ? -5.415  5.567   -7.507  1.00 35.64 ? 736 ILE C CD1 1 
ATOM   1434 N  N   . PRO B 2 31  ? -6.984  6.499   -2.680  1.00 36.19 ? 737 PRO C N   1 
ATOM   1435 C  CA  . PRO B 2 31  ? -8.092  5.838   -1.990  1.00 35.10 ? 737 PRO C CA  1 
ATOM   1436 C  C   . PRO B 2 31  ? -9.376  6.052   -2.773  1.00 37.08 ? 737 PRO C C   1 
ATOM   1437 O  O   . PRO B 2 31  ? -9.373  6.221   -3.988  1.00 38.53 ? 737 PRO C O   1 
ATOM   1438 C  CB  . PRO B 2 31  ? -8.205  6.599   -0.659  1.00 35.18 ? 737 PRO C CB  1 
ATOM   1439 C  CG  . PRO B 2 31  ? -7.104  7.642   -0.660  1.00 35.45 ? 737 PRO C CG  1 
ATOM   1440 C  CD  . PRO B 2 31  ? -6.678  7.810   -2.094  1.00 36.45 ? 737 PRO C CD  1 
ATOM   1441 N  N   . ALA B 2 32  ? -10.482 6.058   -2.041  1.00 37.12 ? 738 ALA C N   1 
ATOM   1442 C  CA  . ALA B 2 32  ? -11.816 6.130   -2.623  1.00 36.37 ? 738 ALA C CA  1 
ATOM   1443 C  C   . ALA B 2 32  ? -12.056 4.845   -3.402  1.00 36.66 ? 738 ALA C C   1 
ATOM   1444 O  O   . ALA B 2 32  ? -13.129 4.237   -3.332  1.00 38.21 ? 738 ALA C O   1 
ATOM   1445 C  CB  . ALA B 2 32  ? -11.929 7.352   -3.532  1.00 36.18 ? 738 ALA C CB  1 
ATOM   1446 N  N   . SER B 2 33  ? -11.026 4.427   -4.127  1.00 36.51 ? 739 SER C N   1 
ATOM   1447 C  CA  . SER B 2 33  ? -10.953 3.076   -4.648  1.00 36.70 ? 739 SER C CA  1 
ATOM   1448 C  C   . SER B 2 33  ? -10.887 2.118   -3.472  1.00 34.89 ? 739 SER C C   1 
ATOM   1449 O  O   . SER B 2 33  ? -11.223 0.938   -3.597  1.00 34.36 ? 739 SER C O   1 
ATOM   1450 C  CB  . SER B 2 33  ? -9.695  2.919   -5.497  1.00 35.96 ? 739 SER C CB  1 
ATOM   1451 O  OG  . SER B 2 33  ? -8.530  2.980   -4.686  1.00 34.60 ? 739 SER C OG  1 
ATOM   1452 N  N   . ASN B 2 34  ? -10.410 2.633   -2.341  1.00 34.69 ? 740 ASN C N   1 
ATOM   1453 C  CA  . ASN B 2 34  ? -10.441 1.896   -1.087  1.00 34.93 ? 740 ASN C CA  1 
ATOM   1454 C  C   . ASN B 2 34  ? -11.294 2.603   -0.029  1.00 34.92 ? 740 ASN C C   1 
ATOM   1455 O  O   . ASN B 2 34  ? -11.020 2.513   1.171   1.00 34.23 ? 740 ASN C O   1 
ATOM   1456 C  CB  . ASN B 2 34  ? -9.025  1.649   -0.559  1.00 34.10 ? 740 ASN C CB  1 
ATOM   1457 C  CG  . ASN B 2 34  ? -8.264  0.643   -1.387  1.00 33.01 ? 740 ASN C CG  1 
ATOM   1458 O  OD1 . ASN B 2 34  ? -8.856  -0.208  -2.045  1.00 33.21 ? 740 ASN C OD1 1 
ATOM   1459 N  ND2 . ASN B 2 34  ? -6.942  0.728   -1.352  1.00 32.85 ? 740 ASN C ND2 1 
ATOM   1460 N  N   . ASN B 2 35  ? -12.330 3.304   -0.484  1.00 35.71 ? 741 ASN C N   1 
ATOM   1461 C  CA  . ASN B 2 35  ? -13.250 4.007   0.412   1.00 35.75 ? 741 ASN C CA  1 
ATOM   1462 C  C   . ASN B 2 35  ? -12.554 5.000   1.343   1.00 35.25 ? 741 ASN C C   1 
ATOM   1463 O  O   . ASN B 2 35  ? -13.099 5.376   2.383   1.00 35.07 ? 741 ASN C O   1 
ATOM   1464 C  CB  . ASN B 2 35  ? -14.071 3.010   1.239   1.00 37.56 ? 741 ASN C CB  1 
ATOM   1465 C  CG  . ASN B 2 35  ? -15.045 2.201   0.393   1.00 35.53 ? 741 ASN C CG  1 
ATOM   1466 O  OD1 . ASN B 2 35  ? -15.356 2.565   -0.746  1.00 32.27 ? 741 ASN C OD1 1 
ATOM   1467 N  ND2 . ASN B 2 35  ? -15.536 1.099   0.953   1.00 34.18 ? 741 ASN C ND2 1 
ATOM   1468 N  N   . ASN B 2 36  ? -11.350 5.418   0.965   1.00 34.74 ? 742 ASN C N   1 
ATOM   1469 C  CA  . ASN B 2 36  ? -10.568 6.358   1.767   1.00 34.68 ? 742 ASN C CA  1 
ATOM   1470 C  C   . ASN B 2 36  ? -10.094 5.812   3.115   1.00 34.23 ? 742 ASN C C   1 
ATOM   1471 O  O   . ASN B 2 36  ? -9.746  6.583   4.011   1.00 33.69 ? 742 ASN C O   1 
ATOM   1472 C  CB  . ASN B 2 36  ? -11.332 7.670   1.974   1.00 35.12 ? 742 ASN C CB  1 
ATOM   1473 C  CG  . ASN B 2 36  ? -11.163 8.633   0.816   1.00 36.35 ? 742 ASN C CG  1 
ATOM   1474 O  OD1 . ASN B 2 36  ? -10.846 8.229   -0.302  1.00 36.26 ? 742 ASN C OD1 1 
ATOM   1475 N  ND2 . ASN B 2 36  ? -11.377 9.917   1.080   1.00 37.14 ? 742 ASN C ND2 1 
ATOM   1476 N  N   . THR B 2 37  ? -10.073 4.490   3.255   1.00 33.80 ? 743 THR C N   1 
ATOM   1477 C  CA  . THR B 2 37  ? -9.601  3.874   4.491   1.00 33.57 ? 743 THR C CA  1 
ATOM   1478 C  C   . THR B 2 37  ? -8.183  4.338   4.806   1.00 32.73 ? 743 THR C C   1 
ATOM   1479 O  O   . THR B 2 37  ? -7.438  4.714   3.902   1.00 33.17 ? 743 THR C O   1 
ATOM   1480 C  CB  . THR B 2 37  ? -9.642  2.333   4.421   1.00 33.49 ? 743 THR C CB  1 
ATOM   1481 O  OG1 . THR B 2 37  ? -9.005  1.885   3.219   1.00 33.26 ? 743 THR C OG1 1 
ATOM   1482 C  CG2 . THR B 2 37  ? -11.078 1.838   4.440   1.00 34.81 ? 743 THR C CG2 1 
ATOM   1483 N  N   . PRO B 2 38  ? -7.807  4.316   6.094   1.00 32.76 ? 744 PRO C N   1 
ATOM   1484 C  CA  . PRO B 2 38  ? -6.480  4.790   6.504   1.00 32.58 ? 744 PRO C CA  1 
ATOM   1485 C  C   . PRO B 2 38  ? -5.390  3.804   6.102   1.00 32.35 ? 744 PRO C C   1 
ATOM   1486 O  O   . PRO B 2 38  ? -5.643  2.601   6.054   1.00 32.22 ? 744 PRO C O   1 
ATOM   1487 C  CB  . PRO B 2 38  ? -6.589  4.861   8.029   1.00 32.40 ? 744 PRO C CB  1 
ATOM   1488 C  CG  . PRO B 2 38  ? -7.649  3.881   8.386   1.00 31.54 ? 744 PRO C CG  1 
ATOM   1489 C  CD  . PRO B 2 38  ? -8.591  3.783   7.223   1.00 32.24 ? 744 PRO C CD  1 
ATOM   1490 N  N   . ILE B 2 39  ? -4.194  4.309   5.814   1.00 31.63 ? 745 ILE C N   1 
ATOM   1491 C  CA  . ILE B 2 39  ? -3.080  3.448   5.433   1.00 31.54 ? 745 ILE C CA  1 
ATOM   1492 C  C   . ILE B 2 39  ? -1.879  3.626   6.354   1.00 31.66 ? 745 ILE C C   1 
ATOM   1493 O  O   . ILE B 2 39  ? -1.378  4.737   6.535   1.00 30.80 ? 745 ILE C O   1 
ATOM   1494 C  CB  . ILE B 2 39  ? -2.655  3.679   3.975   1.00 31.97 ? 745 ILE C CB  1 
ATOM   1495 C  CG1 . ILE B 2 39  ? -3.758  3.209   3.029   1.00 30.35 ? 745 ILE C CG1 1 
ATOM   1496 C  CG2 . ILE B 2 39  ? -1.351  2.951   3.675   1.00 31.15 ? 745 ILE C CG2 1 
ATOM   1497 C  CD1 . ILE B 2 39  ? -3.263  2.891   1.649   1.00 31.78 ? 745 ILE C CD1 1 
ATOM   1498 N  N   . HIS B 2 40  ? -1.419  2.518   6.928   1.00 31.48 ? 746 HIS C N   1 
ATOM   1499 C  CA  . HIS B 2 40  ? -0.348  2.554   7.915   1.00 31.59 ? 746 HIS C CA  1 
ATOM   1500 C  C   . HIS B 2 40  ? 1.003   2.142   7.339   1.00 31.90 ? 746 HIS C C   1 
ATOM   1501 O  O   . HIS B 2 40  ? 1.939   1.849   8.084   1.00 31.60 ? 746 HIS C O   1 
ATOM   1502 C  CB  . HIS B 2 40  ? -0.704  1.677   9.117   1.00 30.48 ? 746 HIS C CB  1 
ATOM   1503 C  CG  . HIS B 2 40  ? -2.045  1.981   9.705   1.00 30.56 ? 746 HIS C CG  1 
ATOM   1504 N  ND1 . HIS B 2 40  ? -2.997  1.010   9.932   1.00 31.37 ? 746 HIS C ND1 1 
ATOM   1505 C  CD2 . HIS B 2 40  ? -2.601  3.152   10.099  1.00 30.04 ? 746 HIS C CD2 1 
ATOM   1506 C  CE1 . HIS B 2 40  ? -4.077  1.569   10.450  1.00 31.42 ? 746 HIS C CE1 1 
ATOM   1507 N  NE2 . HIS B 2 40  ? -3.864  2.866   10.560  1.00 30.62 ? 746 HIS C NE2 1 
ATOM   1508 N  N   . GLY B 2 41  ? 1.105   2.122   6.014   1.00 32.43 ? 747 GLY C N   1 
ATOM   1509 C  CA  . GLY B 2 41  ? 2.372   1.836   5.367   1.00 31.79 ? 747 GLY C CA  1 
ATOM   1510 C  C   . GLY B 2 41  ? 2.267   0.974   4.126   1.00 30.66 ? 747 GLY C C   1 
ATOM   1511 O  O   . GLY B 2 41  ? 1.171   0.684   3.646   1.00 29.90 ? 747 GLY C O   1 
ATOM   1512 N  N   . PHE B 2 42  ? 3.421   0.568   3.606   1.00 30.59 ? 748 PHE C N   1 
ATOM   1513 C  CA  . PHE B 2 42  ? 3.486   -0.273  2.420   1.00 29.58 ? 748 PHE C CA  1 
ATOM   1514 C  C   . PHE B 2 42  ? 4.487   -1.402  2.619   1.00 28.80 ? 748 PHE C C   1 
ATOM   1515 O  O   . PHE B 2 42  ? 5.451   -1.263  3.369   1.00 28.39 ? 748 PHE C O   1 
ATOM   1516 C  CB  . PHE B 2 42  ? 3.903   0.547   1.197   1.00 29.39 ? 748 PHE C CB  1 
ATOM   1517 C  CG  . PHE B 2 42  ? 3.035   1.742   0.937   1.00 29.58 ? 748 PHE C CG  1 
ATOM   1518 C  CD1 . PHE B 2 42  ? 3.414   2.998   1.379   1.00 30.74 ? 748 PHE C CD1 1 
ATOM   1519 C  CD2 . PHE B 2 42  ? 1.845   1.613   0.242   1.00 29.74 ? 748 PHE C CD2 1 
ATOM   1520 C  CE1 . PHE B 2 42  ? 2.618   4.102   1.137   1.00 31.78 ? 748 PHE C CE1 1 
ATOM   1521 C  CE2 . PHE B 2 42  ? 1.044   2.714   -0.002  1.00 29.29 ? 748 PHE C CE2 1 
ATOM   1522 C  CZ  . PHE B 2 42  ? 1.431   3.959   0.446   1.00 29.94 ? 748 PHE C CZ  1 
ATOM   1523 N  N   . TYR B 2 43  ? 4.248   -2.521  1.944   1.00 28.99 ? 749 TYR C N   1 
ATOM   1524 C  CA  . TYR B 2 43  ? 5.220   -3.602  1.888   1.00 28.62 ? 749 TYR C CA  1 
ATOM   1525 C  C   . TYR B 2 43  ? 5.865   -3.610  0.510   1.00 27.71 ? 749 TYR C C   1 
ATOM   1526 O  O   . TYR B 2 43  ? 5.169   -3.660  -0.503  1.00 27.10 ? 749 TYR C O   1 
ATOM   1527 C  CB  . TYR B 2 43  ? 4.554   -4.956  2.143   1.00 28.34 ? 749 TYR C CB  1 
ATOM   1528 C  CG  . TYR B 2 43  ? 4.122   -5.192  3.572   1.00 29.38 ? 749 TYR C CG  1 
ATOM   1529 C  CD1 . TYR B 2 43  ? 2.789   -5.418  3.885   1.00 29.75 ? 749 TYR C CD1 1 
ATOM   1530 C  CD2 . TYR B 2 43  ? 5.047   -5.193  4.609   1.00 30.36 ? 749 TYR C CD2 1 
ATOM   1531 C  CE1 . TYR B 2 43  ? 2.386   -5.638  5.190   1.00 30.99 ? 749 TYR C CE1 1 
ATOM   1532 C  CE2 . TYR B 2 43  ? 4.654   -5.412  5.919   1.00 31.29 ? 749 TYR C CE2 1 
ATOM   1533 C  CZ  . TYR B 2 43  ? 3.321   -5.633  6.203   1.00 31.71 ? 749 TYR C CZ  1 
ATOM   1534 O  OH  . TYR B 2 43  ? 2.920   -5.851  7.503   1.00 32.05 ? 749 TYR C OH  1 
ATOM   1535 N  N   . ILE B 2 44  ? 7.192   -3.551  0.470   1.00 27.24 ? 750 ILE C N   1 
ATOM   1536 C  CA  . ILE B 2 44  ? 7.911   -3.672  -0.792  1.00 26.00 ? 750 ILE C CA  1 
ATOM   1537 C  C   . ILE B 2 44  ? 8.546   -5.052  -0.903  1.00 25.32 ? 750 ILE C C   1 
ATOM   1538 O  O   . ILE B 2 44  ? 9.461   -5.388  -0.154  1.00 25.67 ? 750 ILE C O   1 
ATOM   1539 C  CB  . ILE B 2 44  ? 8.999   -2.595  -0.952  1.00 26.19 ? 750 ILE C CB  1 
ATOM   1540 C  CG1 . ILE B 2 44  ? 8.370   -1.233  -1.246  1.00 27.40 ? 750 ILE C CG1 1 
ATOM   1541 C  CG2 . ILE B 2 44  ? 9.945   -2.966  -2.077  1.00 26.26 ? 750 ILE C CG2 1 
ATOM   1542 C  CD1 . ILE B 2 44  ? 7.780   -0.554  -0.039  1.00 28.66 ? 750 ILE C CD1 1 
ATOM   1543 N  N   . TYR B 2 45  ? 8.046   -5.851  -1.839  1.00 24.72 ? 751 TYR C N   1 
ATOM   1544 C  CA  . TYR B 2 45  ? 8.565   -7.193  -2.061  1.00 24.46 ? 751 TYR C CA  1 
ATOM   1545 C  C   . TYR B 2 45  ? 9.565   -7.210  -3.209  1.00 23.88 ? 751 TYR C C   1 
ATOM   1546 O  O   . TYR B 2 45  ? 9.373   -6.532  -4.219  1.00 23.28 ? 751 TYR C O   1 
ATOM   1547 C  CB  . TYR B 2 45  ? 7.420   -8.161  -2.359  1.00 24.78 ? 751 TYR C CB  1 
ATOM   1548 C  CG  . TYR B 2 45  ? 6.479   -8.378  -1.198  1.00 25.48 ? 751 TYR C CG  1 
ATOM   1549 C  CD1 . TYR B 2 45  ? 6.677   -9.426  -0.307  1.00 26.90 ? 751 TYR C CD1 1 
ATOM   1550 C  CD2 . TYR B 2 45  ? 5.392   -7.540  -0.992  1.00 25.59 ? 751 TYR C CD2 1 
ATOM   1551 C  CE1 . TYR B 2 45  ? 5.819   -9.634  0.756   1.00 27.64 ? 751 TYR C CE1 1 
ATOM   1552 C  CE2 . TYR B 2 45  ? 4.527   -7.740  0.070   1.00 27.54 ? 751 TYR C CE2 1 
ATOM   1553 C  CZ  . TYR B 2 45  ? 4.746   -8.789  0.942   1.00 28.36 ? 751 TYR C CZ  1 
ATOM   1554 O  OH  . TYR B 2 45  ? 3.893   -8.996  2.002   1.00 28.92 ? 751 TYR C OH  1 
ATOM   1555 N  N   . TYR B 2 46  ? 10.632  -7.985  -3.048  1.00 23.65 ? 752 TYR C N   1 
ATOM   1556 C  CA  . TYR B 2 46  ? 11.633  -8.140  -4.096  1.00 22.79 ? 752 TYR C CA  1 
ATOM   1557 C  C   . TYR B 2 46  ? 12.281  -9.521  -4.062  1.00 23.02 ? 752 TYR C C   1 
ATOM   1558 O  O   . TYR B 2 46  ? 12.408  -10.134 -3.002  1.00 22.92 ? 752 TYR C O   1 
ATOM   1559 C  CB  . TYR B 2 46  ? 12.690  -7.035  -4.017  1.00 23.13 ? 752 TYR C CB  1 
ATOM   1560 C  CG  . TYR B 2 46  ? 13.282  -6.821  -2.644  1.00 24.12 ? 752 TYR C CG  1 
ATOM   1561 C  CD1 . TYR B 2 46  ? 14.614  -7.113  -2.388  1.00 24.52 ? 752 TYR C CD1 1 
ATOM   1562 C  CD2 . TYR B 2 46  ? 12.513  -6.313  -1.605  1.00 25.26 ? 752 TYR C CD2 1 
ATOM   1563 C  CE1 . TYR B 2 46  ? 15.162  -6.910  -1.135  1.00 25.46 ? 752 TYR C CE1 1 
ATOM   1564 C  CE2 . TYR B 2 46  ? 13.052  -6.108  -0.348  1.00 25.51 ? 752 TYR C CE2 1 
ATOM   1565 C  CZ  . TYR B 2 46  ? 14.376  -6.408  -0.119  1.00 25.79 ? 752 TYR C CZ  1 
ATOM   1566 O  OH  . TYR B 2 46  ? 14.913  -6.202  1.131   1.00 26.29 ? 752 TYR C OH  1 
ATOM   1567 N  N   . ARG B 2 47  ? 12.688  -10.003 -5.231  1.00 22.75 ? 753 ARG C N   1 
ATOM   1568 C  CA  . ARG B 2 47  ? 13.195  -11.361 -5.371  1.00 22.15 ? 753 ARG C CA  1 
ATOM   1569 C  C   . ARG B 2 47  ? 14.084  -11.478 -6.603  1.00 21.92 ? 753 ARG C C   1 
ATOM   1570 O  O   . ARG B 2 47  ? 13.804  -10.862 -7.628  1.00 21.84 ? 753 ARG C O   1 
ATOM   1571 C  CB  . ARG B 2 47  ? 12.023  -12.338 -5.482  1.00 21.79 ? 753 ARG C CB  1 
ATOM   1572 C  CG  . ARG B 2 47  ? 12.419  -13.767 -5.796  1.00 22.43 ? 753 ARG C CG  1 
ATOM   1573 C  CD  . ARG B 2 47  ? 11.207  -14.591 -6.175  1.00 22.53 ? 753 ARG C CD  1 
ATOM   1574 N  NE  . ARG B 2 47  ? 10.528  -14.036 -7.341  1.00 22.40 ? 753 ARG C NE  1 
ATOM   1575 C  CZ  . ARG B 2 47  ? 9.401   -14.523 -7.850  1.00 22.23 ? 753 ARG C CZ  1 
ATOM   1576 N  NH1 . ARG B 2 47  ? 8.823   -15.577 -7.294  1.00 22.70 ? 753 ARG C NH1 1 
ATOM   1577 N  NH2 . ARG B 2 47  ? 8.853   -13.954 -8.916  1.00 21.62 ? 753 ARG C NH2 1 
ATOM   1578 N  N   . PRO B 2 48  ? 15.164  -12.268 -6.504  1.00 22.25 ? 754 PRO C N   1 
ATOM   1579 C  CA  . PRO B 2 48  ? 16.037  -12.519 -7.656  1.00 21.93 ? 754 PRO C CA  1 
ATOM   1580 C  C   . PRO B 2 48  ? 15.230  -13.069 -8.824  1.00 22.43 ? 754 PRO C C   1 
ATOM   1581 O  O   . PRO B 2 48  ? 14.571  -14.098 -8.676  1.00 22.40 ? 754 PRO C O   1 
ATOM   1582 C  CB  . PRO B 2 48  ? 17.001  -13.587 -7.137  1.00 21.65 ? 754 PRO C CB  1 
ATOM   1583 C  CG  . PRO B 2 48  ? 17.022  -13.390 -5.663  1.00 22.17 ? 754 PRO C CG  1 
ATOM   1584 C  CD  . PRO B 2 48  ? 15.637  -12.954 -5.290  1.00 21.94 ? 754 PRO C CD  1 
ATOM   1585 N  N   . THR B 2 49  ? 15.280  -12.388 -9.965  1.00 22.30 ? 755 THR C N   1 
ATOM   1586 C  CA  . THR B 2 49  ? 14.466  -12.762 -11.117 1.00 22.01 ? 755 THR C CA  1 
ATOM   1587 C  C   . THR B 2 49  ? 14.622  -14.236 -11.476 1.00 21.92 ? 755 THR C C   1 
ATOM   1588 O  O   . THR B 2 49  ? 13.677  -14.870 -11.945 1.00 21.92 ? 755 THR C O   1 
ATOM   1589 C  CB  . THR B 2 49  ? 14.792  -11.893 -12.348 1.00 21.44 ? 755 THR C CB  1 
ATOM   1590 O  OG1 . THR B 2 49  ? 14.648  -10.510 -12.008 1.00 21.88 ? 755 THR C OG1 1 
ATOM   1591 C  CG2 . THR B 2 49  ? 13.854  -12.222 -13.497 1.00 20.19 ? 755 THR C CG2 1 
ATOM   1592 N  N   . ASP B 2 50  ? 15.812  -14.781 -11.244 1.00 21.98 ? 756 ASP C N   1 
ATOM   1593 C  CA  . ASP B 2 50  ? 16.083  -16.182 -11.559 1.00 21.89 ? 756 ASP C CA  1 
ATOM   1594 C  C   . ASP B 2 50  ? 15.262  -17.142 -10.696 1.00 21.27 ? 756 ASP C C   1 
ATOM   1595 O  O   . ASP B 2 50  ? 15.425  -18.359 -10.779 1.00 20.55 ? 756 ASP C O   1 
ATOM   1596 C  CB  . ASP B 2 50  ? 17.580  -16.488 -11.440 1.00 21.30 ? 756 ASP C CB  1 
ATOM   1597 C  CG  . ASP B 2 50  ? 18.365  -16.043 -12.663 1.00 22.62 ? 756 ASP C CG  1 
ATOM   1598 O  OD1 . ASP B 2 50  ? 17.736  -15.591 -13.645 1.00 22.23 ? 756 ASP C OD1 1 
ATOM   1599 O  OD2 . ASP B 2 50  ? 19.610  -16.147 -12.647 1.00 23.93 ? 756 ASP C OD2 1 
ATOM   1600 N  N   . SER B 2 51  ? 14.378  -16.587 -9.874  1.00 22.13 ? 757 SER C N   1 
ATOM   1601 C  CA  . SER B 2 51  ? 13.468  -17.388 -9.065  1.00 22.16 ? 757 SER C CA  1 
ATOM   1602 C  C   . SER B 2 51  ? 12.026  -17.170 -9.506  1.00 21.97 ? 757 SER C C   1 
ATOM   1603 O  O   . SER B 2 51  ? 11.650  -16.067 -9.900  1.00 21.72 ? 757 SER C O   1 
ATOM   1604 C  CB  . SER B 2 51  ? 13.614  -17.040 -7.585  1.00 22.62 ? 757 SER C CB  1 
ATOM   1605 O  OG  . SER B 2 51  ? 12.543  -17.581 -6.831  1.00 23.73 ? 757 SER C OG  1 
ATOM   1606 N  N   . ASP B 2 52  ? 11.220  -18.225 -9.435  1.00 22.34 ? 758 ASP C N   1 
ATOM   1607 C  CA  . ASP B 2 52  ? 9.820   -18.145 -9.835  1.00 22.78 ? 758 ASP C CA  1 
ATOM   1608 C  C   . ASP B 2 52  ? 8.890   -18.534 -8.690  1.00 23.01 ? 758 ASP C C   1 
ATOM   1609 O  O   . ASP B 2 52  ? 7.672   -18.576 -8.856  1.00 22.78 ? 758 ASP C O   1 
ATOM   1610 C  CB  . ASP B 2 52  ? 9.558   -19.037 -11.050 1.00 21.68 ? 758 ASP C CB  1 
ATOM   1611 C  CG  . ASP B 2 52  ? 10.343  -18.602 -12.271 1.00 21.26 ? 758 ASP C CG  1 
ATOM   1612 O  OD1 . ASP B 2 52  ? 10.327  -19.334 -13.282 1.00 21.40 ? 758 ASP C OD1 1 
ATOM   1613 O  OD2 . ASP B 2 52  ? 10.976  -17.527 -12.221 1.00 21.19 ? 758 ASP C OD2 1 
ATOM   1614 N  N   . ASN B 2 53  ? 9.474   -18.817 -7.530  1.00 24.12 ? 759 ASN C N   1 
ATOM   1615 C  CA  . ASN B 2 53  ? 8.707   -19.220 -6.358  1.00 24.58 ? 759 ASN C CA  1 
ATOM   1616 C  C   . ASN B 2 53  ? 8.381   -18.028 -5.462  1.00 24.96 ? 759 ASN C C   1 
ATOM   1617 O  O   . ASN B 2 53  ? 9.280   -17.330 -4.993  1.00 24.38 ? 759 ASN C O   1 
ATOM   1618 C  CB  . ASN B 2 53  ? 9.464   -20.290 -5.569  1.00 24.81 ? 759 ASN C CB  1 
ATOM   1619 C  CG  . ASN B 2 53  ? 8.554   -21.107 -4.671  1.00 25.50 ? 759 ASN C CG  1 
ATOM   1620 O  OD1 . ASN B 2 53  ? 7.578   -20.596 -4.118  1.00 25.80 ? 759 ASN C OD1 1 
ATOM   1621 N  ND2 . ASN B 2 53  ? 8.873   -22.388 -4.520  1.00 25.12 ? 759 ASN C ND2 1 
ATOM   1622 N  N   . ASP B 2 54  ? 7.089   -17.811 -5.224  1.00 25.33 ? 760 ASP C N   1 
ATOM   1623 C  CA  . ASP B 2 54  ? 6.615   -16.648 -4.476  1.00 25.00 ? 760 ASP C CA  1 
ATOM   1624 C  C   . ASP B 2 54  ? 7.014   -16.678 -3.002  1.00 24.93 ? 760 ASP C C   1 
ATOM   1625 O  O   . ASP B 2 54  ? 6.661   -15.779 -2.240  1.00 25.09 ? 760 ASP C O   1 
ATOM   1626 C  CB  . ASP B 2 54  ? 5.094   -16.519 -4.597  1.00 25.46 ? 760 ASP C CB  1 
ATOM   1627 C  CG  . ASP B 2 54  ? 4.642   -16.239 -6.018  1.00 26.52 ? 760 ASP C CG  1 
ATOM   1628 O  OD1 . ASP B 2 54  ? 5.477   -15.799 -6.837  1.00 25.44 ? 760 ASP C OD1 1 
ATOM   1629 O  OD2 . ASP B 2 54  ? 3.447   -16.455 -6.316  1.00 27.99 ? 760 ASP C OD2 1 
ATOM   1630 N  N   . SER B 2 55  ? 7.743   -17.714 -2.604  1.00 25.45 ? 761 SER C N   1 
ATOM   1631 C  CA  . SER B 2 55  ? 8.209   -17.834 -1.228  1.00 25.43 ? 761 SER C CA  1 
ATOM   1632 C  C   . SER B 2 55  ? 9.611   -17.255 -1.089  1.00 26.14 ? 761 SER C C   1 
ATOM   1633 O  O   . SER B 2 55  ? 10.185  -17.243 0.001   1.00 28.23 ? 761 SER C O   1 
ATOM   1634 C  CB  . SER B 2 55  ? 8.206   -19.298 -0.791  1.00 25.45 ? 761 SER C CB  1 
ATOM   1635 O  OG  . SER B 2 55  ? 6.950   -19.902 -1.050  1.00 26.73 ? 761 SER C OG  1 
ATOM   1636 N  N   . ASP B 2 56  ? 10.157  -16.775 -2.202  1.00 24.67 ? 762 ASP C N   1 
ATOM   1637 C  CA  . ASP B 2 56  ? 11.526  -16.272 -2.227  1.00 25.17 ? 762 ASP C CA  1 
ATOM   1638 C  C   . ASP B 2 56  ? 11.586  -14.749 -2.151  1.00 24.22 ? 762 ASP C C   1 
ATOM   1639 O  O   . ASP B 2 56  ? 12.670  -14.164 -2.120  1.00 24.01 ? 762 ASP C O   1 
ATOM   1640 C  CB  . ASP B 2 56  ? 12.256  -16.770 -3.478  1.00 26.50 ? 762 ASP C CB  1 
ATOM   1641 C  CG  . ASP B 2 56  ? 12.440  -18.276 -3.486  1.00 27.03 ? 762 ASP C CG  1 
ATOM   1642 O  OD1 . ASP B 2 56  ? 12.088  -18.925 -2.477  1.00 28.01 ? 762 ASP C OD1 1 
ATOM   1643 O  OD2 . ASP B 2 56  ? 12.937  -18.810 -4.500  1.00 26.27 ? 762 ASP C OD2 1 
ATOM   1644 N  N   . TYR B 2 57  ? 10.422  -14.109 -2.126  1.00 23.15 ? 763 TYR C N   1 
ATOM   1645 C  CA  . TYR B 2 57  ? 10.364  -12.659 -1.998  1.00 23.21 ? 763 TYR C CA  1 
ATOM   1646 C  C   . TYR B 2 57  ? 10.795  -12.222 -0.605  1.00 23.92 ? 763 TYR C C   1 
ATOM   1647 O  O   . TYR B 2 57  ? 10.331  -12.766 0.397   1.00 24.29 ? 763 TYR C O   1 
ATOM   1648 C  CB  . TYR B 2 57  ? 8.948   -12.145 -2.264  1.00 23.31 ? 763 TYR C CB  1 
ATOM   1649 C  CG  . TYR B 2 57  ? 8.597   -11.954 -3.723  1.00 23.16 ? 763 TYR C CG  1 
ATOM   1650 C  CD1 . TYR B 2 57  ? 9.067   -10.858 -4.435  1.00 22.82 ? 763 TYR C CD1 1 
ATOM   1651 C  CD2 . TYR B 2 57  ? 7.770   -12.856 -4.382  1.00 22.66 ? 763 TYR C CD2 1 
ATOM   1652 C  CE1 . TYR B 2 57  ? 8.738   -10.673 -5.765  1.00 21.93 ? 763 TYR C CE1 1 
ATOM   1653 C  CE2 . TYR B 2 57  ? 7.436   -12.680 -5.711  1.00 22.31 ? 763 TYR C CE2 1 
ATOM   1654 C  CZ  . TYR B 2 57  ? 7.922   -11.588 -6.397  1.00 21.58 ? 763 TYR C CZ  1 
ATOM   1655 O  OH  . TYR B 2 57  ? 7.591   -11.413 -7.720  1.00 20.79 ? 763 TYR C OH  1 
ATOM   1656 N  N   . LYS B 2 58  ? 11.687  -11.240 -0.544  1.00 24.36 ? 764 LYS C N   1 
ATOM   1657 C  CA  . LYS B 2 58  ? 12.019  -10.598 0.719   1.00 24.57 ? 764 LYS C CA  1 
ATOM   1658 C  C   . LYS B 2 58  ? 11.123  -9.370  0.862   1.00 25.60 ? 764 LYS C C   1 
ATOM   1659 O  O   . LYS B 2 58  ? 10.531  -8.914  -0.118  1.00 25.21 ? 764 LYS C O   1 
ATOM   1660 C  CB  . LYS B 2 58  ? 13.499  -10.217 0.762   1.00 24.83 ? 764 LYS C CB  1 
ATOM   1661 C  CG  . LYS B 2 58  ? 14.046  -10.004 2.166   1.00 27.08 ? 764 LYS C CG  1 
ATOM   1662 C  CD  . LYS B 2 58  ? 15.571  -9.935  2.173   1.00 28.44 ? 764 LYS C CD  1 
ATOM   1663 C  CE  . LYS B 2 58  ? 16.080  -8.852  1.234   1.00 28.39 ? 764 LYS C CE  1 
ATOM   1664 N  NZ  . LYS B 2 58  ? 17.565  -8.717  1.232   1.00 28.76 ? 764 LYS C NZ  1 
ATOM   1665 N  N   . LYS B 2 59  ? 11.018  -8.836  2.075   1.00 26.91 ? 765 LYS C N   1 
ATOM   1666 C  CA  . LYS B 2 59  ? 10.035  -7.794  2.359   1.00 26.95 ? 765 LYS C CA  1 
ATOM   1667 C  C   . LYS B 2 59  ? 10.627  -6.586  3.087   1.00 27.31 ? 765 LYS C C   1 
ATOM   1668 O  O   . LYS B 2 59  ? 11.466  -6.737  3.975   1.00 27.83 ? 765 LYS C O   1 
ATOM   1669 C  CB  . LYS B 2 59  ? 8.888   -8.392  3.177   1.00 27.60 ? 765 LYS C CB  1 
ATOM   1670 C  CG  . LYS B 2 59  ? 7.903   -7.389  3.746   1.00 28.28 ? 765 LYS C CG  1 
ATOM   1671 C  CD  . LYS B 2 59  ? 6.949   -8.081  4.709   1.00 28.40 ? 765 LYS C CD  1 
ATOM   1672 C  CE  . LYS B 2 59  ? 6.378   -9.351  4.088   1.00 29.57 ? 765 LYS C CE  1 
ATOM   1673 N  NZ  . LYS B 2 59  ? 5.600   -10.174 5.057   1.00 29.56 ? 765 LYS C NZ  1 
ATOM   1674 N  N   . ASP B 2 60  ? 10.185  -5.391  2.702   1.00 27.55 ? 766 ASP C N   1 
ATOM   1675 C  CA  . ASP B 2 60  ? 10.593  -4.154  3.370   1.00 28.09 ? 766 ASP C CA  1 
ATOM   1676 C  C   . ASP B 2 60  ? 9.378   -3.322  3.775   1.00 28.41 ? 766 ASP C C   1 
ATOM   1677 O  O   . ASP B 2 60  ? 8.361   -3.317  3.083   1.00 28.07 ? 766 ASP C O   1 
ATOM   1678 C  CB  . ASP B 2 60  ? 11.519  -3.321  2.477   1.00 27.62 ? 766 ASP C CB  1 
ATOM   1679 C  CG  . ASP B 2 60  ? 12.962  -3.802  2.512   1.00 28.97 ? 766 ASP C CG  1 
ATOM   1680 O  OD1 . ASP B 2 60  ? 13.240  -4.832  3.163   1.00 28.89 ? 766 ASP C OD1 1 
ATOM   1681 O  OD2 . ASP B 2 60  ? 13.822  -3.145  1.887   1.00 28.55 ? 766 ASP C OD2 1 
ATOM   1682 N  N   . MET B 2 61  ? 9.496   -2.616  4.897   1.00 29.61 ? 767 MET C N   1 
ATOM   1683 C  CA  . MET B 2 61  ? 8.406   -1.790  5.411   1.00 29.67 ? 767 MET C CA  1 
ATOM   1684 C  C   . MET B 2 61  ? 8.680   -0.293  5.291   1.00 29.21 ? 767 MET C C   1 
ATOM   1685 O  O   . MET B 2 61  ? 9.734   0.192   5.699   1.00 29.75 ? 767 MET C O   1 
ATOM   1686 C  CB  . MET B 2 61  ? 8.126   -2.122  6.878   1.00 31.10 ? 767 MET C CB  1 
ATOM   1687 C  CG  . MET B 2 61  ? 7.162   -3.270  7.104   1.00 33.04 ? 767 MET C CG  1 
ATOM   1688 S  SD  . MET B 2 61  ? 6.489   -3.214  8.777   1.00 38.69 ? 767 MET C SD  1 
ATOM   1689 C  CE  . MET B 2 61  ? 5.788   -1.566  8.791   1.00 32.40 ? 767 MET C CE  1 
ATOM   1690 N  N   . VAL B 2 62  ? 7.717   0.434   4.735   1.00 29.68 ? 768 VAL C N   1 
ATOM   1691 C  CA  . VAL B 2 62  ? 7.775   1.890   4.699   1.00 31.52 ? 768 VAL C CA  1 
ATOM   1692 C  C   . VAL B 2 62  ? 6.484   2.468   5.272   1.00 31.40 ? 768 VAL C C   1 
ATOM   1693 O  O   . VAL B 2 62  ? 5.477   1.769   5.375   1.00 30.44 ? 768 VAL C O   1 
ATOM   1694 C  CB  . VAL B 2 62  ? 7.992   2.423   3.266   1.00 32.80 ? 768 VAL C CB  1 
ATOM   1695 C  CG1 . VAL B 2 62  ? 9.394   2.085   2.774   1.00 30.94 ? 768 VAL C CG1 1 
ATOM   1696 C  CG2 . VAL B 2 62  ? 6.939   1.864   2.323   1.00 31.42 ? 768 VAL C CG2 1 
ATOM   1697 N  N   . GLU B 2 63  ? 6.516   3.740   5.655   1.00 33.00 ? 769 GLU C N   1 
ATOM   1698 C  CA  . GLU B 2 63  ? 5.333   4.392   6.210   1.00 33.97 ? 769 GLU C CA  1 
ATOM   1699 C  C   . GLU B 2 63  ? 4.414   4.918   5.108   1.00 34.89 ? 769 GLU C C   1 
ATOM   1700 O  O   . GLU B 2 63  ? 4.860   5.205   3.997   1.00 35.83 ? 769 GLU C O   1 
ATOM   1701 C  CB  . GLU B 2 63  ? 5.732   5.516   7.173   1.00 32.90 ? 769 GLU C CB  1 
ATOM   1702 C  CG  . GLU B 2 63  ? 6.995   6.256   6.769   1.00 35.31 ? 769 GLU C CG  1 
ATOM   1703 C  CD  . GLU B 2 63  ? 7.436   7.279   7.800   1.00 35.78 ? 769 GLU C CD  1 
ATOM   1704 O  OE1 . GLU B 2 63  ? 6.615   7.648   8.669   1.00 33.17 ? 769 GLU C OE1 1 
ATOM   1705 O  OE2 . GLU B 2 63  ? 8.605   7.717   7.739   1.00 36.24 ? 769 GLU C OE2 1 
ATOM   1706 N  N   . GLY B 2 64  ? 3.128   5.041   5.422   1.00 33.96 ? 770 GLY C N   1 
ATOM   1707 C  CA  . GLY B 2 64  ? 2.145   5.489   4.453   1.00 34.68 ? 770 GLY C CA  1 
ATOM   1708 C  C   . GLY B 2 64  ? 2.269   6.960   4.101   1.00 37.79 ? 770 GLY C C   1 
ATOM   1709 O  O   . GLY B 2 64  ? 1.350   7.547   3.529   1.00 38.63 ? 770 GLY C O   1 
ATOM   1710 N  N   . ASP B 2 65  ? 3.409   7.555   4.442   1.00 38.64 ? 771 ASP C N   1 
ATOM   1711 C  CA  . ASP B 2 65  ? 3.645   8.970   4.176   1.00 39.01 ? 771 ASP C CA  1 
ATOM   1712 C  C   . ASP B 2 65  ? 4.776   9.182   3.178   1.00 37.87 ? 771 ASP C C   1 
ATOM   1713 O  O   . ASP B 2 65  ? 5.273   10.296  3.022   1.00 38.51 ? 771 ASP C O   1 
ATOM   1714 C  CB  . ASP B 2 65  ? 3.951   9.722   5.476   1.00 39.19 ? 771 ASP C CB  1 
ATOM   1715 C  CG  . ASP B 2 65  ? 2.711   9.959   6.323   1.00 44.53 ? 771 ASP C CG  1 
ATOM   1716 O  OD1 . ASP B 2 65  ? 1.590   9.674   5.844   1.00 43.79 ? 771 ASP C OD1 1 
ATOM   1717 O  OD2 . ASP B 2 65  ? 2.859   10.433  7.471   1.00 47.18 ? 771 ASP C OD2 1 
ATOM   1718 N  N   . LYS B 2 66  ? 5.185   8.115   2.504   1.00 36.61 ? 772 LYS C N   1 
ATOM   1719 C  CA  . LYS B 2 66  ? 6.241   8.226   1.504   1.00 36.88 ? 772 LYS C CA  1 
ATOM   1720 C  C   . LYS B 2 66  ? 5.845   7.612   0.166   1.00 35.56 ? 772 LYS C C   1 
ATOM   1721 O  O   . LYS B 2 66  ? 5.163   6.589   0.114   1.00 35.26 ? 772 LYS C O   1 
ATOM   1722 C  CB  . LYS B 2 66  ? 7.549   7.623   2.021   1.00 36.85 ? 772 LYS C CB  1 
ATOM   1723 C  CG  . LYS B 2 66  ? 7.368   6.444   2.956   1.00 36.25 ? 772 LYS C CG  1 
ATOM   1724 C  CD  . LYS B 2 66  ? 8.674   6.103   3.653   1.00 36.22 ? 772 LYS C CD  1 
ATOM   1725 C  CE  . LYS B 2 66  ? 9.265   7.327   4.339   1.00 36.34 ? 772 LYS C CE  1 
ATOM   1726 N  NZ  . LYS B 2 66  ? 10.470  6.985   5.147   1.00 37.68 ? 772 LYS C NZ  1 
ATOM   1727 N  N   . TYR B 2 67  ? 6.280   8.253   -0.913  1.00 35.30 ? 773 TYR C N   1 
ATOM   1728 C  CA  . TYR B 2 67  ? 5.933   7.825   -2.261  1.00 34.30 ? 773 TYR C CA  1 
ATOM   1729 C  C   . TYR B 2 67  ? 7.126   7.179   -2.957  1.00 32.74 ? 773 TYR C C   1 
ATOM   1730 O  O   . TYR B 2 67  ? 7.058   6.843   -4.140  1.00 31.79 ? 773 TYR C O   1 
ATOM   1731 C  CB  . TYR B 2 67  ? 5.436   9.022   -3.078  1.00 37.05 ? 773 TYR C CB  1 
ATOM   1732 C  CG  . TYR B 2 67  ? 6.489   10.090  -3.306  1.00 38.09 ? 773 TYR C CG  1 
ATOM   1733 C  CD1 . TYR B 2 67  ? 6.777   11.033  -2.326  1.00 37.42 ? 773 TYR C CD1 1 
ATOM   1734 C  CD2 . TYR B 2 67  ? 7.194   10.154  -4.502  1.00 37.57 ? 773 TYR C CD2 1 
ATOM   1735 C  CE1 . TYR B 2 67  ? 7.739   12.009  -2.530  1.00 38.49 ? 773 TYR C CE1 1 
ATOM   1736 C  CE2 . TYR B 2 67  ? 8.158   11.126  -4.716  1.00 38.57 ? 773 TYR C CE2 1 
ATOM   1737 C  CZ  . TYR B 2 67  ? 8.426   12.050  -3.727  1.00 40.15 ? 773 TYR C CZ  1 
ATOM   1738 O  OH  . TYR B 2 67  ? 9.383   13.018  -3.936  1.00 39.92 ? 773 TYR C OH  1 
ATOM   1739 N  N   . TRP B 2 68  ? 8.218   7.010   -2.218  1.00 33.17 ? 774 TRP C N   1 
ATOM   1740 C  CA  . TRP B 2 68  ? 9.441   6.445   -2.777  1.00 32.06 ? 774 TRP C CA  1 
ATOM   1741 C  C   . TRP B 2 68  ? 10.258  5.705   -1.720  1.00 32.22 ? 774 TRP C C   1 
ATOM   1742 O  O   . TRP B 2 68  ? 10.038  5.870   -0.520  1.00 32.56 ? 774 TRP C O   1 
ATOM   1743 C  CB  . TRP B 2 68  ? 10.286  7.544   -3.423  1.00 33.20 ? 774 TRP C CB  1 
ATOM   1744 C  CG  . TRP B 2 68  ? 10.797  8.555   -2.446  1.00 34.86 ? 774 TRP C CG  1 
ATOM   1745 C  CD1 . TRP B 2 68  ? 10.113  9.617   -1.929  1.00 35.86 ? 774 TRP C CD1 1 
ATOM   1746 C  CD2 . TRP B 2 68  ? 12.106  8.602   -1.867  1.00 35.33 ? 774 TRP C CD2 1 
ATOM   1747 N  NE1 . TRP B 2 68  ? 10.915  10.321  -1.064  1.00 36.32 ? 774 TRP C NE1 1 
ATOM   1748 C  CE2 . TRP B 2 68  ? 12.144  9.719   -1.009  1.00 35.70 ? 774 TRP C CE2 1 
ATOM   1749 C  CE3 . TRP B 2 68  ? 13.251  7.807   -1.991  1.00 34.61 ? 774 TRP C CE3 1 
ATOM   1750 C  CZ2 . TRP B 2 68  ? 13.280  10.060  -0.279  1.00 36.92 ? 774 TRP C CZ2 1 
ATOM   1751 C  CZ3 . TRP B 2 68  ? 14.376  8.148   -1.266  1.00 35.36 ? 774 TRP C CZ3 1 
ATOM   1752 C  CH2 . TRP B 2 68  ? 14.383  9.264   -0.421  1.00 36.67 ? 774 TRP C CH2 1 
ATOM   1753 N  N   . HIS B 2 69  ? 11.206  4.892   -2.175  1.00 31.64 ? 775 HIS C N   1 
ATOM   1754 C  CA  . HIS B 2 69  ? 12.011  4.075   -1.276  1.00 30.16 ? 775 HIS C CA  1 
ATOM   1755 C  C   . HIS B 2 69  ? 13.259  3.555   -1.978  1.00 29.17 ? 775 HIS C C   1 
ATOM   1756 O  O   . HIS B 2 69  ? 13.341  3.566   -3.206  1.00 29.30 ? 775 HIS C O   1 
ATOM   1757 C  CB  . HIS B 2 69  ? 11.180  2.905   -0.747  1.00 29.76 ? 775 HIS C CB  1 
ATOM   1758 C  CG  . HIS B 2 69  ? 11.959  1.933   0.082   1.00 29.27 ? 775 HIS C CG  1 
ATOM   1759 N  ND1 . HIS B 2 69  ? 12.369  2.212   1.368   1.00 30.32 ? 775 HIS C ND1 1 
ATOM   1760 C  CD2 . HIS B 2 69  ? 12.398  0.680   -0.189  1.00 28.55 ? 775 HIS C CD2 1 
ATOM   1761 C  CE1 . HIS B 2 69  ? 13.029  1.175   1.852   1.00 29.92 ? 775 HIS C CE1 1 
ATOM   1762 N  NE2 . HIS B 2 69  ? 13.060  0.232   0.928   1.00 29.09 ? 775 HIS C NE2 1 
ATOM   1763 N  N   . SER B 2 70  ? 14.230  3.103   -1.192  1.00 28.97 ? 776 SER C N   1 
ATOM   1764 C  CA  . SER B 2 70  ? 15.454  2.524   -1.733  1.00 28.06 ? 776 SER C CA  1 
ATOM   1765 C  C   . SER B 2 70  ? 15.716  1.151   -1.123  1.00 27.52 ? 776 SER C C   1 
ATOM   1766 O  O   . SER B 2 70  ? 15.851  1.020   0.094   1.00 28.22 ? 776 SER C O   1 
ATOM   1767 C  CB  . SER B 2 70  ? 16.647  3.446   -1.471  1.00 27.28 ? 776 SER C CB  1 
ATOM   1768 O  OG  . SER B 2 70  ? 16.474  4.700   -2.104  1.00 28.81 ? 776 SER C OG  1 
ATOM   1769 N  N   . ILE B 2 71  ? 15.782  0.129   -1.971  1.00 26.49 ? 777 ILE C N   1 
ATOM   1770 C  CA  . ILE B 2 71  ? 16.067  -1.226  -1.512  1.00 26.67 ? 777 ILE C CA  1 
ATOM   1771 C  C   . ILE B 2 71  ? 17.567  -1.485  -1.510  1.00 26.61 ? 777 ILE C C   1 
ATOM   1772 O  O   . ILE B 2 71  ? 18.196  -1.519  -2.566  1.00 25.70 ? 777 ILE C O   1 
ATOM   1773 C  CB  . ILE B 2 71  ? 15.396  -2.282  -2.401  1.00 26.45 ? 777 ILE C CB  1 
ATOM   1774 C  CG1 . ILE B 2 71  ? 13.892  -2.026  -2.499  1.00 26.42 ? 777 ILE C CG1 1 
ATOM   1775 C  CG2 . ILE B 2 71  ? 15.674  -3.675  -1.865  1.00 24.84 ? 777 ILE C CG2 1 
ATOM   1776 C  CD1 . ILE B 2 71  ? 13.173  -2.999  -3.404  1.00 25.09 ? 777 ILE C CD1 1 
ATOM   1777 N  N   . SER B 2 72  ? 18.134  -1.677  -0.324  1.00 26.66 ? 778 SER C N   1 
ATOM   1778 C  CA  . SER B 2 72  ? 19.574  -1.857  -0.186  1.00 26.64 ? 778 SER C CA  1 
ATOM   1779 C  C   . SER B 2 72  ? 19.953  -3.308  0.096   1.00 26.22 ? 778 SER C C   1 
ATOM   1780 O  O   . SER B 2 72  ? 19.086  -4.162  0.277   1.00 25.90 ? 778 SER C O   1 
ATOM   1781 C  CB  . SER B 2 72  ? 20.116  -0.946  0.917   1.00 28.27 ? 778 SER C CB  1 
ATOM   1782 O  OG  . SER B 2 72  ? 19.269  -0.962  2.053   1.00 29.61 ? 778 SER C OG  1 
ATOM   1783 N  N   . HIS B 2 73  ? 21.256  -3.574  0.125   1.00 26.64 ? 779 HIS C N   1 
ATOM   1784 C  CA  . HIS B 2 73  ? 21.778  -4.904  0.427   1.00 26.51 ? 779 HIS C CA  1 
ATOM   1785 C  C   . HIS B 2 73  ? 21.382  -5.945  -0.615  1.00 26.92 ? 779 HIS C C   1 
ATOM   1786 O  O   . HIS B 2 73  ? 21.093  -7.095  -0.281  1.00 27.05 ? 779 HIS C O   1 
ATOM   1787 C  CB  . HIS B 2 73  ? 21.346  -5.352  1.825   1.00 27.02 ? 779 HIS C CB  1 
ATOM   1788 C  CG  . HIS B 2 73  ? 21.967  -4.555  2.931   1.00 27.73 ? 779 HIS C CG  1 
ATOM   1789 N  ND1 . HIS B 2 73  ? 21.649  -3.235  3.167   1.00 27.56 ? 779 HIS C ND1 1 
ATOM   1790 C  CD2 . HIS B 2 73  ? 22.888  -4.893  3.864   1.00 28.05 ? 779 HIS C CD2 1 
ATOM   1791 C  CE1 . HIS B 2 73  ? 22.347  -2.794  4.197   1.00 28.32 ? 779 HIS C CE1 1 
ATOM   1792 N  NE2 . HIS B 2 73  ? 23.108  -3.780  4.640   1.00 27.40 ? 779 HIS C NE2 1 
ATOM   1793 N  N   . LEU B 2 74  ? 21.372  -5.531  -1.879  1.00 27.45 ? 780 LEU C N   1 
ATOM   1794 C  CA  . LEU B 2 74  ? 21.112  -6.442  -2.987  1.00 25.99 ? 780 LEU C CA  1 
ATOM   1795 C  C   . LEU B 2 74  ? 22.425  -6.932  -3.587  1.00 25.94 ? 780 LEU C C   1 
ATOM   1796 O  O   . LEU B 2 74  ? 23.504  -6.551  -3.137  1.00 26.76 ? 780 LEU C O   1 
ATOM   1797 C  CB  . LEU B 2 74  ? 20.266  -5.760  -4.062  1.00 25.45 ? 780 LEU C CB  1 
ATOM   1798 C  CG  . LEU B 2 74  ? 18.859  -5.339  -3.643  1.00 24.85 ? 780 LEU C CG  1 
ATOM   1799 C  CD1 . LEU B 2 74  ? 18.108  -4.738  -4.822  1.00 24.80 ? 780 LEU C CD1 1 
ATOM   1800 C  CD2 . LEU B 2 74  ? 18.100  -6.521  -3.069  1.00 23.09 ? 780 LEU C CD2 1 
ATOM   1801 N  N   . GLN B 2 75  ? 22.329  -7.773  -4.609  1.00 26.15 ? 781 GLN C N   1 
ATOM   1802 C  CA  . GLN B 2 75  ? 23.516  -8.345  -5.225  1.00 26.25 ? 781 GLN C CA  1 
ATOM   1803 C  C   . GLN B 2 75  ? 23.883  -7.582  -6.492  1.00 26.71 ? 781 GLN C C   1 
ATOM   1804 O  O   . GLN B 2 75  ? 23.006  -7.197  -7.266  1.00 26.54 ? 781 GLN C O   1 
ATOM   1805 C  CB  . GLN B 2 75  ? 23.296  -9.828  -5.534  1.00 26.41 ? 781 GLN C CB  1 
ATOM   1806 C  CG  . GLN B 2 75  ? 24.522  -10.691 -5.296  1.00 27.76 ? 781 GLN C CG  1 
ATOM   1807 C  CD  . GLN B 2 75  ? 25.071  -10.537 -3.886  1.00 31.12 ? 781 GLN C CD  1 
ATOM   1808 O  OE1 . GLN B 2 75  ? 24.313  -10.442 -2.916  1.00 28.41 ? 781 GLN C OE1 1 
ATOM   1809 N  NE2 . GLN B 2 75  ? 26.397  -10.514 -3.766  1.00 30.92 ? 781 GLN C NE2 1 
ATOM   1810 N  N   . PRO B 2 76  ? 25.187  -7.355  -6.702  1.00 27.00 ? 782 PRO C N   1 
ATOM   1811 C  CA  . PRO B 2 76  ? 25.681  -6.614  -7.868  1.00 26.83 ? 782 PRO C CA  1 
ATOM   1812 C  C   . PRO B 2 76  ? 25.332  -7.307  -9.180  1.00 26.60 ? 782 PRO C C   1 
ATOM   1813 O  O   . PRO B 2 76  ? 25.417  -8.531  -9.272  1.00 26.87 ? 782 PRO C O   1 
ATOM   1814 C  CB  . PRO B 2 76  ? 27.201  -6.612  -7.666  1.00 27.16 ? 782 PRO C CB  1 
ATOM   1815 C  CG  . PRO B 2 76  ? 27.400  -6.857  -6.209  1.00 27.45 ? 782 PRO C CG  1 
ATOM   1816 C  CD  . PRO B 2 76  ? 26.279  -7.758  -5.801  1.00 27.52 ? 782 PRO C CD  1 
ATOM   1817 N  N   . GLU B 2 77  ? 24.938  -6.522  -10.177 1.00 26.69 ? 783 GLU C N   1 
ATOM   1818 C  CA  . GLU B 2 77  ? 24.666  -7.043  -11.512 1.00 27.20 ? 783 GLU C CA  1 
ATOM   1819 C  C   . GLU B 2 77  ? 23.634  -8.167  -11.471 1.00 26.66 ? 783 GLU C C   1 
ATOM   1820 O  O   . GLU B 2 77  ? 23.809  -9.213  -12.098 1.00 27.03 ? 783 GLU C O   1 
ATOM   1821 C  CB  . GLU B 2 77  ? 25.965  -7.525  -12.161 1.00 27.63 ? 783 GLU C CB  1 
ATOM   1822 C  CG  . GLU B 2 77  ? 25.928  -7.594  -13.679 1.00 28.02 ? 783 GLU C CG  1 
ATOM   1823 C  CD  . GLU B 2 77  ? 27.315  -7.721  -14.286 1.00 29.61 ? 783 GLU C CD  1 
ATOM   1824 O  OE1 . GLU B 2 77  ? 27.413  -7.926  -15.516 1.00 28.73 ? 783 GLU C OE1 1 
ATOM   1825 O  OE2 . GLU B 2 77  ? 28.308  -7.612  -13.531 1.00 28.70 ? 783 GLU C OE2 1 
ATOM   1826 N  N   . THR B 2 78  ? 22.556  -7.942  -10.728 1.00 26.32 ? 784 THR C N   1 
ATOM   1827 C  CA  . THR B 2 78  ? 21.514  -8.947  -10.568 1.00 25.73 ? 784 THR C CA  1 
ATOM   1828 C  C   . THR B 2 78  ? 20.135  -8.364  -10.853 1.00 25.88 ? 784 THR C C   1 
ATOM   1829 O  O   . THR B 2 78  ? 19.856  -7.213  -10.515 1.00 25.61 ? 784 THR C O   1 
ATOM   1830 C  CB  . THR B 2 78  ? 21.525  -9.540  -9.149  1.00 25.06 ? 784 THR C CB  1 
ATOM   1831 O  OG1 . THR B 2 78  ? 22.770  -10.210 -8.923  1.00 26.11 ? 784 THR C OG1 1 
ATOM   1832 C  CG2 . THR B 2 78  ? 20.384  -10.531 -8.972  1.00 24.08 ? 784 THR C CG2 1 
ATOM   1833 N  N   . SER B 2 79  ? 19.279  -9.166  -11.480 1.00 25.21 ? 785 SER C N   1 
ATOM   1834 C  CA  . SER B 2 79  ? 17.921  -8.741  -11.801 1.00 24.26 ? 785 SER C CA  1 
ATOM   1835 C  C   . SER B 2 79  ? 16.952  -9.100  -10.681 1.00 23.54 ? 785 SER C C   1 
ATOM   1836 O  O   . SER B 2 79  ? 17.066  -10.159 -10.063 1.00 23.16 ? 785 SER C O   1 
ATOM   1837 C  CB  . SER B 2 79  ? 17.460  -9.371  -13.115 1.00 22.86 ? 785 SER C CB  1 
ATOM   1838 O  OG  . SER B 2 79  ? 16.154  -8.938  -13.449 1.00 22.93 ? 785 SER C OG  1 
ATOM   1839 N  N   . TYR B 2 80  ? 15.993  -8.216  -10.427 1.00 23.04 ? 786 TYR C N   1 
ATOM   1840 C  CA  . TYR B 2 80  ? 15.043  -8.417  -9.340  1.00 22.65 ? 786 TYR C CA  1 
ATOM   1841 C  C   . TYR B 2 80  ? 13.597  -8.164  -9.758  1.00 22.90 ? 786 TYR C C   1 
ATOM   1842 O  O   . TYR B 2 80  ? 13.300  -7.197  -10.459 1.00 22.91 ? 786 TYR C O   1 
ATOM   1843 C  CB  . TYR B 2 80  ? 15.396  -7.521  -8.149  1.00 22.48 ? 786 TYR C CB  1 
ATOM   1844 C  CG  . TYR B 2 80  ? 16.585  -7.998  -7.347  1.00 22.67 ? 786 TYR C CG  1 
ATOM   1845 C  CD1 . TYR B 2 80  ? 17.868  -7.563  -7.644  1.00 23.25 ? 786 TYR C CD1 1 
ATOM   1846 C  CD2 . TYR B 2 80  ? 16.422  -8.883  -6.290  1.00 22.90 ? 786 TYR C CD2 1 
ATOM   1847 C  CE1 . TYR B 2 80  ? 18.956  -7.997  -6.911  1.00 23.80 ? 786 TYR C CE1 1 
ATOM   1848 C  CE2 . TYR B 2 80  ? 17.504  -9.323  -5.553  1.00 22.33 ? 786 TYR C CE2 1 
ATOM   1849 C  CZ  . TYR B 2 80  ? 18.768  -8.877  -5.866  1.00 22.75 ? 786 TYR C CZ  1 
ATOM   1850 O  OH  . TYR B 2 80  ? 19.845  -9.314  -5.132  1.00 23.23 ? 786 TYR C OH  1 
ATOM   1851 N  N   . ASP B 2 81  ? 12.704  -9.047  -9.324  1.00 22.25 ? 787 ASP C N   1 
ATOM   1852 C  CA  . ASP B 2 81  ? 11.275  -8.808  -9.445  1.00 22.10 ? 787 ASP C CA  1 
ATOM   1853 C  C   . ASP B 2 81  ? 10.857  -7.948  -8.265  1.00 23.07 ? 787 ASP C C   1 
ATOM   1854 O  O   . ASP B 2 81  ? 11.215  -8.237  -7.122  1.00 22.40 ? 787 ASP C O   1 
ATOM   1855 C  CB  . ASP B 2 81  ? 10.497  -10.123 -9.414  1.00 22.27 ? 787 ASP C CB  1 
ATOM   1856 C  CG  . ASP B 2 81  ? 11.026  -11.139 -10.403 1.00 22.70 ? 787 ASP C CG  1 
ATOM   1857 O  OD1 . ASP B 2 81  ? 11.627  -10.730 -11.420 1.00 22.94 ? 787 ASP C OD1 1 
ATOM   1858 O  OD2 . ASP B 2 81  ? 10.835  -12.350 -10.162 1.00 22.60 ? 787 ASP C OD2 1 
ATOM   1859 N  N   . ILE B 2 82  ? 10.103  -6.890  -8.537  1.00 23.21 ? 788 ILE C N   1 
ATOM   1860 C  CA  . ILE B 2 82  ? 9.677   -5.984  -7.483  1.00 22.63 ? 788 ILE C CA  1 
ATOM   1861 C  C   . ILE B 2 82  ? 8.187   -5.685  -7.565  1.00 22.69 ? 788 ILE C C   1 
ATOM   1862 O  O   . ILE B 2 82  ? 7.691   -5.216  -8.589  1.00 22.98 ? 788 ILE C O   1 
ATOM   1863 C  CB  . ILE B 2 82  ? 10.467  -4.661  -7.524  1.00 23.44 ? 788 ILE C CB  1 
ATOM   1864 C  CG1 . ILE B 2 82  ? 11.966  -4.930  -7.370  1.00 22.68 ? 788 ILE C CG1 1 
ATOM   1865 C  CG2 . ILE B 2 82  ? 9.976   -3.713  -6.438  1.00 23.64 ? 788 ILE C CG2 1 
ATOM   1866 C  CD1 . ILE B 2 82  ? 12.839  -3.728  -7.661  1.00 21.96 ? 788 ILE C CD1 1 
ATOM   1867 N  N   . LYS B 2 83  ? 7.477   -5.972  -6.480  1.00 22.77 ? 789 LYS C N   1 
ATOM   1868 C  CA  . LYS B 2 83  ? 6.072   -5.612  -6.364  1.00 23.10 ? 789 LYS C CA  1 
ATOM   1869 C  C   . LYS B 2 83  ? 5.789   -5.144  -4.943  1.00 23.90 ? 789 LYS C C   1 
ATOM   1870 O  O   . LYS B 2 83  ? 6.607   -5.346  -4.045  1.00 24.16 ? 789 LYS C O   1 
ATOM   1871 C  CB  . LYS B 2 83  ? 5.174   -6.793  -6.733  1.00 22.66 ? 789 LYS C CB  1 
ATOM   1872 C  CG  . LYS B 2 83  ? 5.370   -8.026  -5.876  1.00 21.94 ? 789 LYS C CG  1 
ATOM   1873 C  CD  . LYS B 2 83  ? 4.419   -9.129  -6.302  1.00 22.04 ? 789 LYS C CD  1 
ATOM   1874 C  CE  . LYS B 2 83  ? 4.686   -10.416 -5.545  1.00 22.37 ? 789 LYS C CE  1 
ATOM   1875 N  NZ  . LYS B 2 83  ? 3.819   -11.524 -6.032  1.00 23.21 ? 789 LYS C NZ  1 
ATOM   1876 N  N   . MET B 2 84  ? 4.635   -4.519  -4.739  1.00 24.43 ? 790 MET C N   1 
ATOM   1877 C  CA  . MET B 2 84  ? 4.303   -3.976  -3.429  1.00 25.41 ? 790 MET C CA  1 
ATOM   1878 C  C   . MET B 2 84  ? 2.808   -3.991  -3.138  1.00 25.72 ? 790 MET C C   1 
ATOM   1879 O  O   . MET B 2 84  ? 1.994   -4.330  -3.995  1.00 24.98 ? 790 MET C O   1 
ATOM   1880 C  CB  . MET B 2 84  ? 4.832   -2.549  -3.299  1.00 26.32 ? 790 MET C CB  1 
ATOM   1881 C  CG  . MET B 2 84  ? 4.168   -1.563  -4.239  1.00 25.81 ? 790 MET C CG  1 
ATOM   1882 S  SD  . MET B 2 84  ? 4.708   0.126   -3.941  1.00 28.67 ? 790 MET C SD  1 
ATOM   1883 C  CE  . MET B 2 84  ? 4.102   0.382   -2.276  1.00 28.70 ? 790 MET C CE  1 
ATOM   1884 N  N   . GLN B 2 85  ? 2.460   -3.609  -1.914  1.00 26.81 ? 791 GLN C N   1 
ATOM   1885 C  CA  . GLN B 2 85  ? 1.072   -3.557  -1.480  1.00 27.80 ? 791 GLN C CA  1 
ATOM   1886 C  C   . GLN B 2 85  ? 0.947   -2.621  -0.287  1.00 27.49 ? 791 GLN C C   1 
ATOM   1887 O  O   . GLN B 2 85  ? 1.871   -2.506  0.516   1.00 28.79 ? 791 GLN C O   1 
ATOM   1888 C  CB  . GLN B 2 85  ? 0.584   -4.958  -1.103  1.00 28.24 ? 791 GLN C CB  1 
ATOM   1889 C  CG  . GLN B 2 85  ? 1.488   -5.677  -0.114  1.00 27.70 ? 791 GLN C CG  1 
ATOM   1890 C  CD  . GLN B 2 85  ? 1.060   -7.109  0.141   1.00 27.81 ? 791 GLN C CD  1 
ATOM   1891 O  OE1 . GLN B 2 85  ? 1.597   -7.780  1.020   1.00 27.88 ? 791 GLN C OE1 1 
ATOM   1892 N  NE2 . GLN B 2 85  ? 0.087   -7.583  -0.628  1.00 27.92 ? 791 GLN C NE2 1 
ATOM   1893 N  N   . CYS B 2 86  ? -0.189  -1.941  -0.176  1.00 27.55 ? 792 CYS C N   1 
ATOM   1894 C  CA  . CYS B 2 86  ? -0.446  -1.096  0.983   1.00 28.50 ? 792 CYS C CA  1 
ATOM   1895 C  C   . CYS B 2 86  ? -1.218  -1.891  2.030   1.00 29.32 ? 792 CYS C C   1 
ATOM   1896 O  O   . CYS B 2 86  ? -1.721  -2.976  1.743   1.00 29.31 ? 792 CYS C O   1 
ATOM   1897 C  CB  . CYS B 2 86  ? -1.212  0.166   0.585   1.00 28.45 ? 792 CYS C CB  1 
ATOM   1898 S  SG  . CYS B 2 86  ? -2.792  -0.132  -0.231  1.00 28.26 ? 792 CYS C SG  1 
ATOM   1899 N  N   . PHE B 2 87  ? -1.311  -1.358  3.243   1.00 29.50 ? 793 PHE C N   1 
ATOM   1900 C  CA  . PHE B 2 87  ? -1.958  -2.093  4.321   1.00 29.98 ? 793 PHE C CA  1 
ATOM   1901 C  C   . PHE B 2 87  ? -2.385  -1.213  5.487   1.00 30.01 ? 793 PHE C C   1 
ATOM   1902 O  O   . PHE B 2 87  ? -1.904  -0.092  5.652   1.00 30.83 ? 793 PHE C O   1 
ATOM   1903 C  CB  . PHE B 2 87  ? -1.027  -3.191  4.839   1.00 30.12 ? 793 PHE C CB  1 
ATOM   1904 C  CG  . PHE B 2 87  ? 0.150   -2.669  5.613   1.00 29.62 ? 793 PHE C CG  1 
ATOM   1905 C  CD1 . PHE B 2 87  ? 0.044   -2.411  6.970   1.00 30.30 ? 793 PHE C CD1 1 
ATOM   1906 C  CD2 . PHE B 2 87  ? 1.360   -2.433  4.985   1.00 29.64 ? 793 PHE C CD2 1 
ATOM   1907 C  CE1 . PHE B 2 87  ? 1.124   -1.929  7.684   1.00 30.38 ? 793 PHE C CE1 1 
ATOM   1908 C  CE2 . PHE B 2 87  ? 2.443   -1.952  5.694   1.00 29.93 ? 793 PHE C CE2 1 
ATOM   1909 C  CZ  . PHE B 2 87  ? 2.324   -1.699  7.045   1.00 30.47 ? 793 PHE C CZ  1 
ATOM   1910 N  N   . ASN B 2 88  ? -3.299  -1.744  6.291   1.00 30.41 ? 794 ASN C N   1 
ATOM   1911 C  CA  . ASN B 2 88  ? -3.649  -1.159  7.577   1.00 30.16 ? 794 ASN C CA  1 
ATOM   1912 C  C   . ASN B 2 88  ? -3.861  -2.270  8.599   1.00 30.24 ? 794 ASN C C   1 
ATOM   1913 O  O   . ASN B 2 88  ? -3.457  -3.412  8.373   1.00 30.17 ? 794 ASN C O   1 
ATOM   1914 C  CB  . ASN B 2 88  ? -4.887  -0.266  7.464   1.00 29.54 ? 794 ASN C CB  1 
ATOM   1915 C  CG  . ASN B 2 88  ? -6.063  -0.972  6.825   1.00 29.83 ? 794 ASN C CG  1 
ATOM   1916 O  OD1 . ASN B 2 88  ? -6.270  -2.167  7.028   1.00 30.79 ? 794 ASN C OD1 1 
ATOM   1917 N  ND2 . ASN B 2 88  ? -6.845  -0.232  6.048   1.00 30.08 ? 794 ASN C ND2 1 
ATOM   1918 N  N   . GLU B 2 89  ? -4.495  -1.943  9.718   1.00 30.97 ? 795 GLU C N   1 
ATOM   1919 C  CA  . GLU B 2 89  ? -4.708  -2.924  10.776  1.00 30.36 ? 795 GLU C CA  1 
ATOM   1920 C  C   . GLU B 2 89  ? -5.599  -4.073  10.311  1.00 29.69 ? 795 GLU C C   1 
ATOM   1921 O  O   . GLU B 2 89  ? -5.737  -5.081  11.003  1.00 30.53 ? 795 GLU C O   1 
ATOM   1922 C  CB  . GLU B 2 89  ? -5.306  -2.252  12.013  1.00 29.82 ? 795 GLU C CB  1 
ATOM   1923 C  CG  . GLU B 2 89  ? -4.456  -1.119  12.559  1.00 31.33 ? 795 GLU C CG  1 
ATOM   1924 C  CD  . GLU B 2 89  ? -5.071  -0.461  13.776  1.00 34.02 ? 795 GLU C CD  1 
ATOM   1925 O  OE1 . GLU B 2 89  ? -6.240  -0.770  14.093  1.00 35.14 ? 795 GLU C OE1 1 
ATOM   1926 O  OE2 . GLU B 2 89  ? -4.384  0.367   14.415  1.00 31.94 ? 795 GLU C OE2 1 
ATOM   1927 N  N   . GLY B 2 90  ? -6.197  -3.919  9.133   1.00 30.12 ? 796 GLY C N   1 
ATOM   1928 C  CA  . GLY B 2 90  ? -7.115  -4.911  8.606   1.00 30.44 ? 796 GLY C CA  1 
ATOM   1929 C  C   . GLY B 2 90  ? -6.485  -5.902  7.644   1.00 29.96 ? 796 GLY C C   1 
ATOM   1930 O  O   . GLY B 2 90  ? -7.152  -6.821  7.167   1.00 29.32 ? 796 GLY C O   1 
ATOM   1931 N  N   . GLY B 2 91  ? -5.201  -5.716  7.354   1.00 29.60 ? 797 GLY C N   1 
ATOM   1932 C  CA  . GLY B 2 91  ? -4.492  -6.601  6.446   1.00 30.34 ? 797 GLY C CA  1 
ATOM   1933 C  C   . GLY B 2 91  ? -3.874  -5.878  5.263   1.00 30.60 ? 797 GLY C C   1 
ATOM   1934 O  O   . GLY B 2 91  ? -3.881  -4.647  5.201   1.00 29.50 ? 797 GLY C O   1 
ATOM   1935 N  N   . GLU B 2 92  ? -3.342  -6.647  4.318   1.00 30.14 ? 798 GLU C N   1 
ATOM   1936 C  CA  . GLU B 2 92  ? -2.669  -6.073  3.157   1.00 30.46 ? 798 GLU C CA  1 
ATOM   1937 C  C   . GLU B 2 92  ? -3.578  -6.009  1.931   1.00 30.03 ? 798 GLU C C   1 
ATOM   1938 O  O   . GLU B 2 92  ? -4.546  -6.762  1.819   1.00 29.10 ? 798 GLU C O   1 
ATOM   1939 C  CB  . GLU B 2 92  ? -1.396  -6.858  2.828   1.00 29.82 ? 798 GLU C CB  1 
ATOM   1940 C  CG  . GLU B 2 92  ? -0.475  -7.075  4.016   1.00 30.64 ? 798 GLU C CG  1 
ATOM   1941 C  CD  . GLU B 2 92  ? -0.828  -8.318  4.811   1.00 32.85 ? 798 GLU C CD  1 
ATOM   1942 O  OE1 . GLU B 2 92  ? -0.903  -9.407  4.203   1.00 34.18 ? 798 GLU C OE1 1 
ATOM   1943 O  OE2 . GLU B 2 92  ? -1.022  -8.209  6.041   1.00 32.61 ? 798 GLU C OE2 1 
ATOM   1944 N  N   . SER B 2 93  ? -3.256  -5.100  1.015   1.00 29.11 ? 799 SER C N   1 
ATOM   1945 C  CA  . SER B 2 93  ? -4.008  -4.953  -0.224  1.00 29.10 ? 799 SER C CA  1 
ATOM   1946 C  C   . SER B 2 93  ? -3.463  -5.898  -1.286  1.00 28.99 ? 799 SER C C   1 
ATOM   1947 O  O   . SER B 2 93  ? -2.498  -6.623  -1.046  1.00 29.37 ? 799 SER C O   1 
ATOM   1948 C  CB  . SER B 2 93  ? -3.921  -3.515  -0.734  1.00 28.85 ? 799 SER C CB  1 
ATOM   1949 O  OG  . SER B 2 93  ? -2.630  -3.239  -1.253  1.00 28.08 ? 799 SER C OG  1 
ATOM   1950 N  N   . GLU B 2 94  ? -4.083  -5.889  -2.461  1.00 28.21 ? 800 GLU C N   1 
ATOM   1951 C  CA  . GLU B 2 94  ? -3.577  -6.667  -3.581  1.00 28.17 ? 800 GLU C CA  1 
ATOM   1952 C  C   . GLU B 2 94  ? -2.188  -6.168  -3.952  1.00 27.49 ? 800 GLU C C   1 
ATOM   1953 O  O   . GLU B 2 94  ? -1.799  -5.057  -3.589  1.00 27.43 ? 800 GLU C O   1 
ATOM   1954 C  CB  . GLU B 2 94  ? -4.513  -6.561  -4.786  1.00 29.18 ? 800 GLU C CB  1 
ATOM   1955 C  CG  . GLU B 2 94  ? -5.803  -7.352  -4.645  1.00 31.01 ? 800 GLU C CG  1 
ATOM   1956 C  CD  . GLU B 2 94  ? -6.618  -7.364  -5.923  1.00 34.20 ? 800 GLU C CD  1 
ATOM   1957 O  OE1 . GLU B 2 94  ? -6.328  -6.541  -6.818  1.00 33.76 ? 800 GLU C OE1 1 
ATOM   1958 O  OE2 . GLU B 2 94  ? -7.548  -8.195  -6.030  1.00 33.70 ? 800 GLU C OE2 1 
ATOM   1959 N  N   . PHE B 2 95  ? -1.437  -6.991  -4.673  1.00 27.07 ? 801 PHE C N   1 
ATOM   1960 C  CA  . PHE B 2 95  ? -0.106  -6.596  -5.106  1.00 26.23 ? 801 PHE C CA  1 
ATOM   1961 C  C   . PHE B 2 95  ? -0.197  -5.586  -6.239  1.00 25.34 ? 801 PHE C C   1 
ATOM   1962 O  O   . PHE B 2 95  ? -1.105  -5.644  -7.069  1.00 25.02 ? 801 PHE C O   1 
ATOM   1963 C  CB  . PHE B 2 95  ? 0.710   -7.814  -5.549  1.00 24.65 ? 801 PHE C CB  1 
ATOM   1964 C  CG  . PHE B 2 95  ? 1.071   -8.743  -4.426  1.00 24.05 ? 801 PHE C CG  1 
ATOM   1965 C  CD1 . PHE B 2 95  ? 0.424   -9.958  -4.279  1.00 24.49 ? 801 PHE C CD1 1 
ATOM   1966 C  CD2 . PHE B 2 95  ? 2.055   -8.399  -3.515  1.00 24.62 ? 801 PHE C CD2 1 
ATOM   1967 C  CE1 . PHE B 2 95  ? 0.754   -10.815 -3.245  1.00 24.31 ? 801 PHE C CE1 1 
ATOM   1968 C  CE2 . PHE B 2 95  ? 2.390   -9.252  -2.479  1.00 24.90 ? 801 PHE C CE2 1 
ATOM   1969 C  CZ  . PHE B 2 95  ? 1.739   -10.461 -2.344  1.00 24.49 ? 801 PHE C CZ  1 
ATOM   1970 N  N   . SER B 2 96  ? 0.745   -4.652  -6.258  1.00 24.66 ? 802 SER C N   1 
ATOM   1971 C  CA  . SER B 2 96  ? 0.850   -3.702  -7.348  1.00 24.61 ? 802 SER C CA  1 
ATOM   1972 C  C   . SER B 2 96  ? 1.389   -4.434  -8.562  1.00 24.76 ? 802 SER C C   1 
ATOM   1973 O  O   . SER B 2 96  ? 1.717   -5.616  -8.483  1.00 25.36 ? 802 SER C O   1 
ATOM   1974 C  CB  . SER B 2 96  ? 1.814   -2.582  -6.973  1.00 25.65 ? 802 SER C CB  1 
ATOM   1975 O  OG  . SER B 2 96  ? 3.144   -3.072  -6.912  1.00 24.82 ? 802 SER C OG  1 
ATOM   1976 N  N   . ASN B 2 97  ? 1.480   -3.733  -9.685  1.00 25.55 ? 803 ASN C N   1 
ATOM   1977 C  CA  . ASN B 2 97  ? 2.157   -4.272  -10.852 1.00 24.27 ? 803 ASN C CA  1 
ATOM   1978 C  C   . ASN B 2 97  ? 3.525   -4.795  -10.438 1.00 23.10 ? 803 ASN C C   1 
ATOM   1979 O  O   . ASN B 2 97  ? 4.085   -4.349  -9.437  1.00 23.58 ? 803 ASN C O   1 
ATOM   1980 C  CB  . ASN B 2 97  ? 2.306   -3.194  -11.926 1.00 24.24 ? 803 ASN C CB  1 
ATOM   1981 C  CG  . ASN B 2 97  ? 2.967   -1.932  -11.400 1.00 24.72 ? 803 ASN C CG  1 
ATOM   1982 O  OD1 . ASN B 2 97  ? 2.717   -1.508  -10.272 1.00 24.32 ? 803 ASN C OD1 1 
ATOM   1983 N  ND2 . ASN B 2 97  ? 3.812   -1.322  -12.222 1.00 25.11 ? 803 ASN C ND2 1 
ATOM   1984 N  N   . VAL B 2 98  ? 4.060   -5.748  -11.192 1.00 22.45 ? 804 VAL C N   1 
ATOM   1985 C  CA  . VAL B 2 98  ? 5.380   -6.288  -10.886 1.00 22.94 ? 804 VAL C CA  1 
ATOM   1986 C  C   . VAL B 2 98  ? 6.432   -5.742  -11.846 1.00 22.67 ? 804 VAL C C   1 
ATOM   1987 O  O   . VAL B 2 98  ? 6.349   -5.944  -13.058 1.00 22.46 ? 804 VAL C O   1 
ATOM   1988 C  CB  . VAL B 2 98  ? 5.394   -7.827  -10.921 1.00 22.49 ? 804 VAL C CB  1 
ATOM   1989 C  CG1 . VAL B 2 98  ? 6.736   -8.350  -10.435 1.00 22.46 ? 804 VAL C CG1 1 
ATOM   1990 C  CG2 . VAL B 2 98  ? 4.267   -8.385  -10.069 1.00 22.03 ? 804 VAL C CG2 1 
ATOM   1991 N  N   . MET B 2 99  ? 7.419   -5.047  -11.293 1.00 22.58 ? 805 MET C N   1 
ATOM   1992 C  CA  . MET B 2 99  ? 8.464   -4.420  -12.092 1.00 23.40 ? 805 MET C CA  1 
ATOM   1993 C  C   . MET B 2 99  ? 9.749   -5.239  -12.043 1.00 23.22 ? 805 MET C C   1 
ATOM   1994 O  O   . MET B 2 99  ? 10.122  -5.756  -10.992 1.00 23.67 ? 805 MET C O   1 
ATOM   1995 C  CB  . MET B 2 99  ? 8.737   -3.004  -11.582 1.00 24.32 ? 805 MET C CB  1 
ATOM   1996 C  CG  . MET B 2 99  ? 7.502   -2.124  -11.486 1.00 24.83 ? 805 MET C CG  1 
ATOM   1997 S  SD  . MET B 2 99  ? 7.083   -1.315  -13.041 1.00 28.38 ? 805 MET C SD  1 
ATOM   1998 C  CE  . MET B 2 99  ? 8.477   -0.205  -13.232 1.00 26.58 ? 805 MET C CE  1 
ATOM   1999 N  N   . ILE B 2 100 ? 10.422  -5.352  -13.183 1.00 22.47 ? 806 ILE C N   1 
ATOM   2000 C  CA  . ILE B 2 100 ? 11.701  -6.047  -13.246 1.00 22.81 ? 806 ILE C CA  1 
ATOM   2001 C  C   . ILE B 2 100 ? 12.836  -5.044  -13.410 1.00 23.89 ? 806 ILE C C   1 
ATOM   2002 O  O   . ILE B 2 100 ? 12.937  -4.376  -14.439 1.00 24.65 ? 806 ILE C O   1 
ATOM   2003 C  CB  . ILE B 2 100 ? 11.746  -7.049  -14.415 1.00 22.67 ? 806 ILE C CB  1 
ATOM   2004 C  CG1 . ILE B 2 100 ? 10.719  -8.164  -14.203 1.00 22.39 ? 806 ILE C CG1 1 
ATOM   2005 C  CG2 . ILE B 2 100 ? 13.146  -7.626  -14.570 1.00 21.06 ? 806 ILE C CG2 1 
ATOM   2006 C  CD1 . ILE B 2 100 ? 10.716  -9.210  -15.297 1.00 21.13 ? 806 ILE C CD1 1 
ATOM   2007 N  N   . CYS B 2 101 ? 13.684  -4.931  -12.394 1.00 23.68 ? 807 CYS C N   1 
ATOM   2008 C  CA  . CYS B 2 101 ? 14.809  -4.005  -12.463 1.00 24.26 ? 807 CYS C CA  1 
ATOM   2009 C  C   . CYS B 2 101 ? 16.124  -4.657  -12.054 1.00 25.21 ? 807 CYS C C   1 
ATOM   2010 O  O   . CYS B 2 101 ? 16.154  -5.557  -11.216 1.00 25.10 ? 807 CYS C O   1 
ATOM   2011 C  CB  . CYS B 2 101 ? 14.555  -2.760  -11.615 1.00 25.19 ? 807 CYS C CB  1 
ATOM   2012 S  SG  . CYS B 2 101 ? 15.688  -1.403  -11.988 1.00 27.73 ? 807 CYS C SG  1 
ATOM   2013 N  N   . GLU B 2 102 ? 17.209  -4.178  -12.650 1.00 25.70 ? 808 GLU C N   1 
ATOM   2014 C  CA  . GLU B 2 102 ? 18.525  -4.768  -12.467 1.00 25.62 ? 808 GLU C CA  1 
ATOM   2015 C  C   . GLU B 2 102 ? 19.446  -3.761  -11.784 1.00 26.61 ? 808 GLU C C   1 
ATOM   2016 O  O   . GLU B 2 102 ? 19.221  -2.554  -11.864 1.00 27.17 ? 808 GLU C O   1 
ATOM   2017 C  CB  . GLU B 2 102 ? 19.085  -5.159  -13.834 1.00 26.18 ? 808 GLU C CB  1 
ATOM   2018 C  CG  . GLU B 2 102 ? 20.027  -6.343  -13.840 1.00 26.05 ? 808 GLU C CG  1 
ATOM   2019 C  CD  . GLU B 2 102 ? 20.210  -6.913  -15.236 1.00 25.98 ? 808 GLU C CD  1 
ATOM   2020 O  OE1 . GLU B 2 102 ? 19.290  -6.749  -16.068 1.00 24.46 ? 808 GLU C OE1 1 
ATOM   2021 O  OE2 . GLU B 2 102 ? 21.267  -7.525  -15.504 1.00 26.97 ? 808 GLU C OE2 1 
ATOM   2022 N  N   . THR B 2 103 ? 20.478  -4.255  -11.109 1.00 27.22 ? 809 THR C N   1 
ATOM   2023 C  CA  . THR B 2 103 ? 21.448  -3.377  -10.460 1.00 27.70 ? 809 THR C CA  1 
ATOM   2024 C  C   . THR B 2 103 ? 22.617  -3.077  -11.395 1.00 28.09 ? 809 THR C C   1 
ATOM   2025 O  O   . THR B 2 103 ? 22.593  -3.443  -12.570 1.00 29.02 ? 809 THR C O   1 
ATOM   2026 C  CB  . THR B 2 103 ? 21.989  -3.985  -9.149  1.00 27.67 ? 809 THR C CB  1 
ATOM   2027 O  OG1 . THR B 2 103 ? 22.560  -5.272  -9.414  1.00 27.21 ? 809 THR C OG1 1 
ATOM   2028 C  CG2 . THR B 2 103 ? 20.875  -4.126  -8.122  1.00 26.29 ? 809 THR C CG2 1 
ATOM   2029 N  N   . LYS B 2 104 ? 23.639  -2.412  -10.866 1.00 28.26 ? 810 LYS C N   1 
ATOM   2030 C  CA  . LYS B 2 104 ? 24.818  -2.069  -11.654 1.00 28.85 ? 810 LYS C CA  1 
ATOM   2031 C  C   . LYS B 2 104 ? 25.850  -3.193  -11.663 1.00 28.60 ? 810 LYS C C   1 
ATOM   2032 O  O   . LYS B 2 104 ? 25.916  -3.996  -10.734 1.00 28.52 ? 810 LYS C O   1 
ATOM   2033 C  CB  . LYS B 2 104 ? 25.455  -0.777  -11.138 1.00 29.04 ? 810 LYS C CB  1 
ATOM   2034 C  CG  . LYS B 2 104 ? 24.633  0.466   -11.414 1.00 29.37 ? 810 LYS C CG  1 
ATOM   2035 C  CD  . LYS B 2 104 ? 25.470  1.723   -11.264 1.00 31.42 ? 810 LYS C CD  1 
ATOM   2036 C  CE  . LYS B 2 104 ? 24.738  2.941   -11.808 1.00 31.57 ? 810 LYS C CE  1 
ATOM   2037 N  NZ  . LYS B 2 104 ? 25.602  4.153   -11.796 1.00 34.08 ? 810 LYS C NZ  1 
ATOM   2038 N  N   . ALA B 2 105 ? 26.657  -3.237  -12.718 1.00 28.76 ? 811 ALA C N   1 
ATOM   2039 C  CA  . ALA B 2 105 ? 27.697  -4.250  -12.853 1.00 29.43 ? 811 ALA C CA  1 
ATOM   2040 C  C   . ALA B 2 105 ? 28.816  -4.044  -11.835 1.00 30.38 ? 811 ALA C C   1 
ATOM   2041 O  O   . ALA B 2 105 ? 29.262  -2.919  -11.607 1.00 31.56 ? 811 ALA C O   1 
ATOM   2042 C  CB  . ALA B 2 105 ? 28.256  -4.244  -14.264 1.00 29.88 ? 811 ALA C CB  1 
HETATM 2043 ZN ZN  . ZN  C 3 .   ? 13.518  -7.243  -23.342 1.00 25.87 ? 194 ZN  B ZN  1 
HETATM 2044 CA CA  . CA  D 4 .   ? 6.804   -11.499 -16.513 1.00 18.94 ? 195 CA  B CA  1 
HETATM 2045 CA CA  . CA  E 4 .   ? 5.631   -7.680  -17.283 1.00 19.21 ? 196 CA  B CA  1 
HETATM 2046 O  O   . HOH F 5 .   ? 4.378   -9.696  -19.001 1.00 20.23 ? 2   HOH B O   1 
HETATM 2047 O  O   . HOH F 5 .   ? 21.159  -32.950 -21.417 1.00 15.37 ? 3   HOH B O   1 
HETATM 2048 O  O   . HOH G 5 .   ? 7.136   -7.819  -14.773 1.00 21.39 ? 1   HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   25  ?   ?   ?   B . n 
A 1 2   SER 2   26  ?   ?   ?   B . n 
A 1 3   GLY 3   27  ?   ?   ?   B . n 
A 1 4   PRO 4   28  ?   ?   ?   B . n 
A 1 5   GLY 5   29  ?   ?   ?   B . n 
A 1 6   PRO 6   30  ?   ?   ?   B . n 
A 1 7   GLY 7   31  ?   ?   ?   B . n 
A 1 8   ARG 8   32  ?   ?   ?   B . n 
A 1 9   VAL 9   33  ?   ?   ?   B . n 
A 1 10  VAL 10  34  ?   ?   ?   B . n 
A 1 11  GLY 11  35  ?   ?   ?   B . n 
A 1 12  SER 12  36  ?   ?   ?   B . n 
A 1 13  ARG 13  37  ?   ?   ?   B . n 
A 1 14  ARG 14  38  ?   ?   ?   B . n 
A 1 15  ARG 15  39  ?   ?   ?   B . n 
A 1 16  PRO 16  40  40  PRO PRO B . n 
A 1 17  PRO 17  41  41  PRO PRO B . n 
A 1 18  ARG 18  42  42  ARG ARG B . n 
A 1 19  LYS 19  43  43  LYS LYS B . n 
A 1 20  LEU 20  44  44  LEU LEU B . n 
A 1 21  VAL 21  45  45  VAL VAL B . n 
A 1 22  PRO 22  46  46  PRO PRO B . n 
A 1 23  LEU 23  47  47  LEU LEU B . n 
A 1 24  ALA 24  48  48  ALA ALA B . n 
A 1 25  TYR 25  49  49  TYR TYR B . n 
A 1 26  LYS 26  50  50  LYS LYS B . n 
A 1 27  GLN 27  51  51  GLN GLN B . n 
A 1 28  PHE 28  52  52  PHE PHE B . n 
A 1 29  SER 29  53  53  SER SER B . n 
A 1 30  PRO 30  54  54  PRO PRO B . n 
A 1 31  ASN 31  55  55  ASN ASN B . n 
A 1 32  VAL 32  56  56  VAL VAL B . n 
A 1 33  PRO 33  57  57  PRO PRO B . n 
A 1 34  GLU 34  58  58  GLU GLU B . n 
A 1 35  LYS 35  59  59  LYS LYS B . n 
A 1 36  THR 36  60  60  THR THR B . n 
A 1 37  LEU 37  61  61  LEU LEU B . n 
A 1 38  GLY 38  62  62  GLY GLY B . n 
A 1 39  ALA 39  63  63  ALA ALA B . n 
A 1 40  SER 40  64  64  SER SER B . n 
A 1 41  GLY 41  65  65  GLY GLY B . n 
A 1 42  ARG 42  66  66  ARG ARG B . n 
A 1 43  TYR 43  67  67  TYR TYR B . n 
A 1 44  GLU 44  68  68  GLU GLU B . n 
A 1 45  GLY 45  69  69  GLY GLY B . n 
A 1 46  LYS 46  70  70  LYS LYS B . n 
A 1 47  ILE 47  71  71  ILE ILE B . n 
A 1 48  ALA 48  72  72  ALA ALA B . n 
A 1 49  ARG 49  73  73  ARG ARG B . n 
A 1 50  SER 50  74  74  SER SER B . n 
A 1 51  SER 51  75  75  SER SER B . n 
A 1 52  GLU 52  76  76  GLU GLU B . n 
A 1 53  ARG 53  77  77  ARG ARG B . n 
A 1 54  PHE 54  78  78  PHE PHE B . n 
A 1 55  LYS 55  79  79  LYS LYS B . n 
A 1 56  GLU 56  80  80  GLU GLU B . n 
A 1 57  LEU 57  81  81  LEU LEU B . n 
A 1 58  THR 58  82  82  THR THR B . n 
A 1 59  PRO 59  83  83  PRO PRO B . n 
A 1 60  ASN 60  84  84  ASN ASN B . n 
A 1 61  TYR 61  85  85  TYR TYR B . n 
A 1 62  ASN 62  86  86  ASN ASN B . n 
A 1 63  PRO 63  87  87  PRO PRO B . n 
A 1 64  ASP 64  88  88  ASP ASP B . n 
A 1 65  ILE 65  89  89  ILE ILE B . n 
A 1 66  ILE 66  90  90  ILE ILE B . n 
A 1 67  PHE 67  91  91  PHE PHE B . n 
A 1 68  LYS 68  92  92  LYS LYS B . n 
A 1 69  ASP 69  93  93  ASP ASP B . n 
A 1 70  GLU 70  94  94  GLU GLU B . n 
A 1 71  GLU 71  95  95  GLU GLU B . n 
A 1 72  ASN 72  96  96  ASN ASN B . n 
A 1 73  THR 73  97  97  THR THR B . n 
A 1 74  GLY 74  98  98  GLY GLY B . n 
A 1 75  ALA 75  99  99  ALA ALA B . n 
A 1 76  ASP 76  100 100 ASP ASP B . n 
A 1 77  ARG 77  101 101 ARG ARG B . n 
A 1 78  LEU 78  102 102 LEU LEU B . n 
A 1 79  MET 79  103 103 MET MET B . n 
A 1 80  THR 80  104 104 THR THR B . n 
A 1 81  GLN 81  105 105 GLN GLN B . n 
A 1 82  ARG 82  106 106 ARG ARG B . n 
A 1 83  CYS 83  107 107 CYS CYS B . n 
A 1 84  LYS 84  108 108 LYS LYS B . n 
A 1 85  ASP 85  109 109 ASP ASP B . n 
A 1 86  ARG 86  110 110 ARG ARG B . n 
A 1 87  LEU 87  111 111 LEU LEU B . n 
A 1 88  ASN 88  112 112 ASN ASN B . n 
A 1 89  SER 89  113 113 SER SER B . n 
A 1 90  LEU 90  114 114 LEU LEU B . n 
A 1 91  ALA 91  115 115 ALA ALA B . n 
A 1 92  ILE 92  116 116 ILE ILE B . n 
A 1 93  SER 93  117 117 SER SER B . n 
A 1 94  VAL 94  118 118 VAL VAL B . n 
A 1 95  MET 95  119 119 MET MET B . n 
A 1 96  ASN 96  120 120 ASN ASN B . n 
A 1 97  GLN 97  121 121 GLN GLN B . n 
A 1 98  TRP 98  122 122 TRP TRP B . n 
A 1 99  PRO 99  123 123 PRO PRO B . n 
A 1 100 GLY 100 124 124 GLY GLY B . n 
A 1 101 VAL 101 125 125 VAL VAL B . n 
A 1 102 LYS 102 126 126 LYS LYS B . n 
A 1 103 LEU 103 127 127 LEU LEU B . n 
A 1 104 ARG 104 128 128 ARG ARG B . n 
A 1 105 VAL 105 129 129 VAL VAL B . n 
A 1 106 THR 106 130 130 THR THR B . n 
A 1 107 GLU 107 131 131 GLU GLU B . n 
A 1 108 GLY 108 132 132 GLY GLY B . n 
A 1 109 TRP 109 133 133 TRP TRP B . n 
A 1 110 ASP 110 134 134 ASP ASP B . n 
A 1 111 GLU 111 135 135 GLU GLU B . n 
A 1 112 ASP 112 136 136 ASP ASP B . n 
A 1 113 GLY 113 137 137 GLY GLY B . n 
A 1 114 HIS 114 138 138 HIS HIS B . n 
A 1 115 HIS 115 139 139 HIS HIS B . n 
A 1 116 SER 116 140 140 SER SER B . n 
A 1 117 GLU 117 141 141 GLU GLU B . n 
A 1 118 GLU 118 142 142 GLU GLU B . n 
A 1 119 SER 119 143 143 SER SER B . n 
A 1 120 LEU 120 144 144 LEU LEU B . n 
A 1 121 HIS 121 145 145 HIS HIS B . n 
A 1 122 TYR 122 146 146 TYR TYR B . n 
A 1 123 GLU 123 147 147 GLU GLU B . n 
A 1 124 GLY 124 148 148 GLY GLY B . n 
A 1 125 ARG 125 149 149 ARG ARG B . n 
A 1 126 ALA 126 150 150 ALA ALA B . n 
A 1 127 VAL 127 151 151 VAL VAL B . n 
A 1 128 ASP 128 152 152 ASP ASP B . n 
A 1 129 ILE 129 153 153 ILE ILE B . n 
A 1 130 THR 130 154 154 THR THR B . n 
A 1 131 THR 131 155 155 THR THR B . n 
A 1 132 SER 132 156 156 SER SER B . n 
A 1 133 ASP 133 157 157 ASP ASP B . n 
A 1 134 ARG 134 158 158 ARG ARG B . n 
A 1 135 ASP 135 159 159 ASP ASP B . n 
A 1 136 ARG 136 160 160 ARG ARG B . n 
A 1 137 ASN 137 161 161 ASN ASN B . n 
A 1 138 LYS 138 162 162 LYS LYS B . n 
A 1 139 TYR 139 163 163 TYR TYR B . n 
A 1 140 GLY 140 164 164 GLY GLY B . n 
A 1 141 LEU 141 165 165 LEU LEU B . n 
A 1 142 LEU 142 166 166 LEU LEU B . n 
A 1 143 ALA 143 167 167 ALA ALA B . n 
A 1 144 ARG 144 168 168 ARG ARG B . n 
A 1 145 LEU 145 169 169 LEU LEU B . n 
A 1 146 ALA 146 170 170 ALA ALA B . n 
A 1 147 VAL 147 171 171 VAL VAL B . n 
A 1 148 GLU 148 172 172 GLU GLU B . n 
A 1 149 ALA 149 173 173 ALA ALA B . n 
A 1 150 GLY 150 174 174 GLY GLY B . n 
A 1 151 PHE 151 175 175 PHE PHE B . n 
A 1 152 ASP 152 176 176 ASP ASP B . n 
A 1 153 TRP 153 177 177 TRP TRP B . n 
A 1 154 VAL 154 178 178 VAL VAL B . n 
A 1 155 TYR 155 179 179 TYR TYR B . n 
A 1 156 TYR 156 180 180 TYR TYR B . n 
A 1 157 GLU 157 181 181 GLU GLU B . n 
A 1 158 SER 158 182 182 SER SER B . n 
A 1 159 LYS 159 183 183 LYS LYS B . n 
A 1 160 ALA 160 184 184 ALA ALA B . n 
A 1 161 HIS 161 185 185 HIS HIS B . n 
A 1 162 VAL 162 186 186 VAL VAL B . n 
A 1 163 HIS 163 187 187 HIS HIS B . n 
A 1 164 CYS 164 188 188 CYS CYS B . n 
A 1 165 SER 165 189 189 SER SER B . n 
A 1 166 VAL 166 190 190 VAL VAL B . n 
A 1 167 LYS 167 191 191 LYS LYS B . n 
A 1 168 SER 168 192 192 SER SER B . n 
A 1 169 GLU 169 193 ?   ?   ?   B . n 
B 2 1   GLY 1   707 ?   ?   ?   C . n 
B 2 2   SER 2   708 ?   ?   ?   C . n 
B 2 3   THR 3   709 ?   ?   ?   C . n 
B 2 4   GLU 4   710 ?   ?   ?   C . n 
B 2 5   ARG 5   711 ?   ?   ?   C . n 
B 2 6   PRO 6   712 712 PRO PRO C . n 
B 2 7   VAL 7   713 713 VAL VAL C . n 
B 2 8   ALA 8   714 714 ALA ALA C . n 
B 2 9   GLY 9   715 715 GLY GLY C . n 
B 2 10  PRO 10  716 716 PRO PRO C . n 
B 2 11  TYR 11  717 717 TYR TYR C . n 
B 2 12  ILE 12  718 718 ILE ILE C . n 
B 2 13  THR 13  719 719 THR THR C . n 
B 2 14  PHE 14  720 720 PHE PHE C . n 
B 2 15  THR 15  721 721 THR THR C . n 
B 2 16  ASP 16  722 722 ASP ASP C . n 
B 2 17  ALA 17  723 723 ALA ALA C . n 
B 2 18  VAL 18  724 724 VAL VAL C . n 
B 2 19  ASN 19  725 725 ASN ASN C . n 
B 2 20  GLU 20  726 726 GLU GLU C . n 
B 2 21  THR 21  727 727 THR THR C . n 
B 2 22  THR 22  728 728 THR THR C . n 
B 2 23  ILE 23  729 729 ILE ILE C . n 
B 2 24  MET 24  730 730 MET MET C . n 
B 2 25  LEU 25  731 731 LEU LEU C . n 
B 2 26  LYS 26  732 732 LYS LYS C . n 
B 2 27  TRP 27  733 733 TRP TRP C . n 
B 2 28  MET 28  734 734 MET MET C . n 
B 2 29  TYR 29  735 735 TYR TYR C . n 
B 2 30  ILE 30  736 736 ILE ILE C . n 
B 2 31  PRO 31  737 737 PRO PRO C . n 
B 2 32  ALA 32  738 738 ALA ALA C . n 
B 2 33  SER 33  739 739 SER SER C . n 
B 2 34  ASN 34  740 740 ASN ASN C . n 
B 2 35  ASN 35  741 741 ASN ASN C . n 
B 2 36  ASN 36  742 742 ASN ASN C . n 
B 2 37  THR 37  743 743 THR THR C . n 
B 2 38  PRO 38  744 744 PRO PRO C . n 
B 2 39  ILE 39  745 745 ILE ILE C . n 
B 2 40  HIS 40  746 746 HIS HIS C . n 
B 2 41  GLY 41  747 747 GLY GLY C . n 
B 2 42  PHE 42  748 748 PHE PHE C . n 
B 2 43  TYR 43  749 749 TYR TYR C . n 
B 2 44  ILE 44  750 750 ILE ILE C . n 
B 2 45  TYR 45  751 751 TYR TYR C . n 
B 2 46  TYR 46  752 752 TYR TYR C . n 
B 2 47  ARG 47  753 753 ARG ARG C . n 
B 2 48  PRO 48  754 754 PRO PRO C . n 
B 2 49  THR 49  755 755 THR THR C . n 
B 2 50  ASP 50  756 756 ASP ASP C . n 
B 2 51  SER 51  757 757 SER SER C . n 
B 2 52  ASP 52  758 758 ASP ASP C . n 
B 2 53  ASN 53  759 759 ASN ASN C . n 
B 2 54  ASP 54  760 760 ASP ASP C . n 
B 2 55  SER 55  761 761 SER SER C . n 
B 2 56  ASP 56  762 762 ASP ASP C . n 
B 2 57  TYR 57  763 763 TYR TYR C . n 
B 2 58  LYS 58  764 764 LYS LYS C . n 
B 2 59  LYS 59  765 765 LYS LYS C . n 
B 2 60  ASP 60  766 766 ASP ASP C . n 
B 2 61  MET 61  767 767 MET MET C . n 
B 2 62  VAL 62  768 768 VAL VAL C . n 
B 2 63  GLU 63  769 769 GLU GLU C . n 
B 2 64  GLY 64  770 770 GLY GLY C . n 
B 2 65  ASP 65  771 771 ASP ASP C . n 
B 2 66  LYS 66  772 772 LYS LYS C . n 
B 2 67  TYR 67  773 773 TYR TYR C . n 
B 2 68  TRP 68  774 774 TRP TRP C . n 
B 2 69  HIS 69  775 775 HIS HIS C . n 
B 2 70  SER 70  776 776 SER SER C . n 
B 2 71  ILE 71  777 777 ILE ILE C . n 
B 2 72  SER 72  778 778 SER SER C . n 
B 2 73  HIS 73  779 779 HIS HIS C . n 
B 2 74  LEU 74  780 780 LEU LEU C . n 
B 2 75  GLN 75  781 781 GLN GLN C . n 
B 2 76  PRO 76  782 782 PRO PRO C . n 
B 2 77  GLU 77  783 783 GLU GLU C . n 
B 2 78  THR 78  784 784 THR THR C . n 
B 2 79  SER 79  785 785 SER SER C . n 
B 2 80  TYR 80  786 786 TYR TYR C . n 
B 2 81  ASP 81  787 787 ASP ASP C . n 
B 2 82  ILE 82  788 788 ILE ILE C . n 
B 2 83  LYS 83  789 789 LYS LYS C . n 
B 2 84  MET 84  790 790 MET MET C . n 
B 2 85  GLN 85  791 791 GLN GLN C . n 
B 2 86  CYS 86  792 792 CYS CYS C . n 
B 2 87  PHE 87  793 793 PHE PHE C . n 
B 2 88  ASN 88  794 794 ASN ASN C . n 
B 2 89  GLU 89  795 795 GLU GLU C . n 
B 2 90  GLY 90  796 796 GLY GLY C . n 
B 2 91  GLY 91  797 797 GLY GLY C . n 
B 2 92  GLU 92  798 798 GLU GLU C . n 
B 2 93  SER 93  799 799 SER SER C . n 
B 2 94  GLU 94  800 800 GLU GLU C . n 
B 2 95  PHE 95  801 801 PHE PHE C . n 
B 2 96  SER 96  802 802 SER SER C . n 
B 2 97  ASN 97  803 803 ASN ASN C . n 
B 2 98  VAL 98  804 804 VAL VAL C . n 
B 2 99  MET 99  805 805 MET MET C . n 
B 2 100 ILE 100 806 806 ILE ILE C . n 
B 2 101 CYS 101 807 807 CYS CYS C . n 
B 2 102 GLU 102 808 808 GLU GLU C . n 
B 2 103 THR 103 809 809 THR THR C . n 
B 2 104 LYS 104 810 810 LYS LYS C . n 
B 2 105 ALA 105 811 811 ALA ALA C . n 
B 2 106 ARG 106 812 ?   ?   ?   C . n 
B 2 107 LYS 107 813 ?   ?   ?   C . n 
B 2 108 SER 108 814 ?   ?   ?   C . n 
B 2 109 SER 109 815 ?   ?   ?   C . n 
B 2 110 GLY 110 816 ?   ?   ?   C . n 
B 2 111 GLN 111 817 ?   ?   ?   C . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 128 ? B ASP 152 ? 1_555 ZN ? C ZN . ? B ZN 194 ? 1_555 ND1 ? A HIS 163 ? B HIS 187 ? 1_555 84.9  ? 
2  OD1 ? A ASP 128 ? B ASP 152 ? 1_555 ZN ? C ZN . ? B ZN 194 ? 1_555 NE2 ? A HIS 121 ? B HIS 145 ? 1_555 83.5  ? 
3  ND1 ? A HIS 163 ? B HIS 187 ? 1_555 ZN ? C ZN . ? B ZN 194 ? 1_555 NE2 ? A HIS 121 ? B HIS 145 ? 1_555 85.4  ? 
4  O   ? A THR 106 ? B THR 130 ? 1_555 CA ? D CA . ? B CA 195 ? 1_555 OE2 ? A GLU 71  ? B GLU 95  ? 1_555 156.8 ? 
5  O   ? A THR 106 ? B THR 130 ? 1_555 CA ? D CA . ? B CA 195 ? 1_555 OD1 ? A ASP 76  ? B ASP 100 ? 1_555 97.0  ? 
6  OE2 ? A GLU 71  ? B GLU 95  ? 1_555 CA ? D CA . ? B CA 195 ? 1_555 OD1 ? A ASP 76  ? B ASP 100 ? 1_555 74.7  ? 
7  O   ? A THR 106 ? B THR 130 ? 1_555 CA ? D CA . ? B CA 195 ? 1_555 OE1 ? A GLU 70  ? B GLU 94  ? 1_555 99.8  ? 
8  OE2 ? A GLU 71  ? B GLU 95  ? 1_555 CA ? D CA . ? B CA 195 ? 1_555 OE1 ? A GLU 70  ? B GLU 94  ? 1_555 101.5 ? 
9  OD1 ? A ASP 76  ? B ASP 100 ? 1_555 CA ? D CA . ? B CA 195 ? 1_555 OE1 ? A GLU 70  ? B GLU 94  ? 1_555 132.7 ? 
10 O   ? A THR 106 ? B THR 130 ? 1_555 CA ? D CA . ? B CA 195 ? 1_555 OD2 ? A ASP 76  ? B ASP 100 ? 1_555 81.8  ? 
11 OE2 ? A GLU 71  ? B GLU 95  ? 1_555 CA ? D CA . ? B CA 195 ? 1_555 OD2 ? A ASP 76  ? B ASP 100 ? 1_555 105.7 ? 
12 OD1 ? A ASP 76  ? B ASP 100 ? 1_555 CA ? D CA . ? B CA 195 ? 1_555 OD2 ? A ASP 76  ? B ASP 100 ? 1_555 46.3  ? 
13 OE1 ? A GLU 70  ? B GLU 94  ? 1_555 CA ? D CA . ? B CA 195 ? 1_555 OD2 ? A ASP 76  ? B ASP 100 ? 1_555 93.2  ? 
14 O   ? A THR 106 ? B THR 130 ? 1_555 CA ? D CA . ? B CA 195 ? 1_555 OE2 ? A GLU 70  ? B GLU 94  ? 1_555 110.8 ? 
15 OE2 ? A GLU 71  ? B GLU 95  ? 1_555 CA ? D CA . ? B CA 195 ? 1_555 OE2 ? A GLU 70  ? B GLU 94  ? 1_555 78.8  ? 
16 OD1 ? A ASP 76  ? B ASP 100 ? 1_555 CA ? D CA . ? B CA 195 ? 1_555 OE2 ? A GLU 70  ? B GLU 94  ? 1_555 152.1 ? 
17 OE1 ? A GLU 70  ? B GLU 94  ? 1_555 CA ? D CA . ? B CA 195 ? 1_555 OE2 ? A GLU 70  ? B GLU 94  ? 1_555 45.7  ? 
18 OD2 ? A ASP 76  ? B ASP 100 ? 1_555 CA ? D CA . ? B CA 195 ? 1_555 OE2 ? A GLU 70  ? B GLU 94  ? 1_555 137.5 ? 
19 O   ? A THR 106 ? B THR 130 ? 1_555 CA ? D CA . ? B CA 195 ? 1_555 OE2 ? A GLU 107 ? B GLU 131 ? 1_555 75.4  ? 
20 OE2 ? A GLU 71  ? B GLU 95  ? 1_555 CA ? D CA . ? B CA 195 ? 1_555 OE2 ? A GLU 107 ? B GLU 131 ? 1_555 86.3  ? 
21 OD1 ? A ASP 76  ? B ASP 100 ? 1_555 CA ? D CA . ? B CA 195 ? 1_555 OE2 ? A GLU 107 ? B GLU 131 ? 1_555 107.2 ? 
22 OE1 ? A GLU 70  ? B GLU 94  ? 1_555 CA ? D CA . ? B CA 195 ? 1_555 OE2 ? A GLU 107 ? B GLU 131 ? 1_555 119.7 ? 
23 OD2 ? A ASP 76  ? B ASP 100 ? 1_555 CA ? D CA . ? B CA 195 ? 1_555 OE2 ? A GLU 107 ? B GLU 131 ? 1_555 142.4 ? 
24 OE2 ? A GLU 70  ? B GLU 94  ? 1_555 CA ? D CA . ? B CA 195 ? 1_555 OE2 ? A GLU 107 ? B GLU 131 ? 1_555 79.2  ? 
25 OD1 ? A ASP 110 ? B ASP 134 ? 1_555 CA ? E CA . ? B CA 196 ? 1_555 OD2 ? A ASP 112 ? B ASP 136 ? 1_555 76.2  ? 
26 OD1 ? A ASP 110 ? B ASP 134 ? 1_555 CA ? E CA . ? B CA 196 ? 1_555 OE2 ? A GLU 71  ? B GLU 95  ? 1_555 138.1 ? 
27 OD2 ? A ASP 112 ? B ASP 136 ? 1_555 CA ? E CA . ? B CA 196 ? 1_555 OE2 ? A GLU 71  ? B GLU 95  ? 1_555 75.8  ? 
28 OD1 ? A ASP 110 ? B ASP 134 ? 1_555 CA ? E CA . ? B CA 196 ? 1_555 OE2 ? A GLU 107 ? B GLU 131 ? 1_555 132.9 ? 
29 OD2 ? A ASP 112 ? B ASP 136 ? 1_555 CA ? E CA . ? B CA 196 ? 1_555 OE2 ? A GLU 107 ? B GLU 131 ? 1_555 138.2 ? 
30 OE2 ? A GLU 71  ? B GLU 95  ? 1_555 CA ? E CA . ? B CA 196 ? 1_555 OE2 ? A GLU 107 ? B GLU 131 ? 1_555 88.2  ? 
31 OD1 ? A ASP 110 ? B ASP 134 ? 1_555 CA ? E CA . ? B CA 196 ? 1_555 OE1 ? A GLU 107 ? B GLU 131 ? 1_555 96.1  ? 
32 OD2 ? A ASP 112 ? B ASP 136 ? 1_555 CA ? E CA . ? B CA 196 ? 1_555 OE1 ? A GLU 107 ? B GLU 131 ? 1_555 170.4 ? 
33 OE2 ? A GLU 71  ? B GLU 95  ? 1_555 CA ? E CA . ? B CA 196 ? 1_555 OE1 ? A GLU 107 ? B GLU 131 ? 1_555 113.7 ? 
34 OE2 ? A GLU 107 ? B GLU 131 ? 1_555 CA ? E CA . ? B CA 196 ? 1_555 OE1 ? A GLU 107 ? B GLU 131 ? 1_555 44.7  ? 
35 OD1 ? A ASP 110 ? B ASP 134 ? 1_555 CA ? E CA . ? B CA 196 ? 1_555 O   ? G HOH .   ? C HOH 1   ? 1_555 124.9 ? 
36 OD2 ? A ASP 112 ? B ASP 136 ? 1_555 CA ? E CA . ? B CA 196 ? 1_555 O   ? G HOH .   ? C HOH 1   ? 1_555 79.0  ? 
37 OE2 ? A GLU 71  ? B GLU 95  ? 1_555 CA ? E CA . ? B CA 196 ? 1_555 O   ? G HOH .   ? C HOH 1   ? 1_555 79.0  ? 
38 OE2 ? A GLU 107 ? B GLU 131 ? 1_555 CA ? E CA . ? B CA 196 ? 1_555 O   ? G HOH .   ? C HOH 1   ? 1_555 59.9  ? 
39 OE1 ? A GLU 107 ? B GLU 131 ? 1_555 CA ? E CA . ? B CA 196 ? 1_555 O   ? G HOH .   ? C HOH 1   ? 1_555 101.1 ? 
40 OD1 ? A ASP 110 ? B ASP 134 ? 1_555 CA ? E CA . ? B CA 196 ? 1_555 O   ? F HOH .   ? B HOH 2   ? 1_555 101.1 ? 
41 OD2 ? A ASP 112 ? B ASP 136 ? 1_555 CA ? E CA . ? B CA 196 ? 1_555 O   ? F HOH .   ? B HOH 2   ? 1_555 109.2 ? 
42 OE2 ? A GLU 71  ? B GLU 95  ? 1_555 CA ? E CA . ? B CA 196 ? 1_555 O   ? F HOH .   ? B HOH 2   ? 1_555 60.5  ? 
43 OE2 ? A GLU 107 ? B GLU 131 ? 1_555 CA ? E CA . ? B CA 196 ? 1_555 O   ? F HOH .   ? B HOH 2   ? 1_555 95.1  ? 
44 OE1 ? A GLU 107 ? B GLU 131 ? 1_555 CA ? E CA . ? B CA 196 ? 1_555 O   ? F HOH .   ? B HOH 2   ? 1_555 77.8  ? 
45 O   ? G HOH .   ? C HOH 1   ? 1_555 CA ? E CA . ? B CA 196 ? 1_555 O   ? F HOH .   ? B HOH 2   ? 1_555 133.6 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-06-02 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                 ? 1 
PHASER   phasing           .                 ? 2 
PHENIX   refinement        '(phenix.refine)' ? 3 
HKL-2000 'data reduction'  .                 ? 4 
DPS      'data reduction'  .                 ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO B 41  ? ? -49.94  154.15  
2  1 ALA B 63  ? ? -116.13 -105.49 
3  1 TYR B 180 ? ? -63.45  78.47   
4  1 LYS B 191 ? ? -65.06  -173.74 
5  1 PRO C 716 ? ? -69.03  -178.96 
6  1 ASN C 725 ? ? -165.71 -145.54 
7  1 PRO C 737 ? ? -69.25  -151.20 
8  1 ALA C 738 ? ? 66.26   -42.29  
9  1 ASP C 756 ? ? -65.83  4.44    
10 1 ASP C 760 ? ? -67.66  1.27    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B GLY 25  ? A GLY 1   
2  1 Y 1 B SER 26  ? A SER 2   
3  1 Y 1 B GLY 27  ? A GLY 3   
4  1 Y 1 B PRO 28  ? A PRO 4   
5  1 Y 1 B GLY 29  ? A GLY 5   
6  1 Y 1 B PRO 30  ? A PRO 6   
7  1 Y 1 B GLY 31  ? A GLY 7   
8  1 Y 1 B ARG 32  ? A ARG 8   
9  1 Y 1 B VAL 33  ? A VAL 9   
10 1 Y 1 B VAL 34  ? A VAL 10  
11 1 Y 1 B GLY 35  ? A GLY 11  
12 1 Y 1 B SER 36  ? A SER 12  
13 1 Y 1 B ARG 37  ? A ARG 13  
14 1 Y 1 B ARG 38  ? A ARG 14  
15 1 Y 1 B ARG 39  ? A ARG 15  
16 1 Y 1 B GLU 193 ? A GLU 169 
17 1 Y 1 C GLY 707 ? B GLY 1   
18 1 Y 1 C SER 708 ? B SER 2   
19 1 Y 1 C THR 709 ? B THR 3   
20 1 Y 1 C GLU 710 ? B GLU 4   
21 1 Y 1 C ARG 711 ? B ARG 5   
22 1 Y 1 C ARG 812 ? B ARG 106 
23 1 Y 1 C LYS 813 ? B LYS 107 
24 1 Y 1 C SER 814 ? B SER 108 
25 1 Y 1 C SER 815 ? B SER 109 
26 1 Y 1 C GLY 816 ? B GLY 110 
27 1 Y 1 C GLN 817 ? B GLN 111 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'ZINC ION'    ZN  
4 'CALCIUM ION' CA  
5 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 ZN  1 194 193 ZN  ZN  B . 
D 4 CA  1 195 194 CA  CA  B . 
E 4 CA  1 196 195 CA  CA  B . 
F 5 HOH 1 2   2   HOH HOH B . 
F 5 HOH 2 3   3   HOH HOH B . 
G 5 HOH 1 1   1   HOH HOH C . 
#