data_3N1Q
# 
_entry.id   3N1Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3N1Q         
RCSB  RCSB059269   
WWPDB D_1000059269 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3d1m . unspecified 
PDB 3N1F . unspecified 
PDB 3N1G . unspecified 
PDB 3n1m . unspecified 
PDB 3n1o . unspecified 
PDB 3n1p . unspecified 
PDB 3N1R . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3N1Q 
_pdbx_database_status.recvd_initial_deposition_date   2010-05-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kavran, J.M.' 1 
'Leahy, D.J.'  2 
# 
_citation.id                        primary 
_citation.title                     'All mammalian hedgehog proteins interact with CDO and BOC in a conserved manner.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      2010 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20519495 
_citation.pdbx_database_id_DOI      10.1074/jbc.M110.131680 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kavran, J.M.'  1 
primary 'Ward, M.D.'    2 
primary 'Oladosu, O.O.' 3 
primary 'Mulepati, S.'  4 
primary 'Leahy, D.J.'   5 
# 
_cell.entry_id           3N1Q 
_cell.length_a           45.715 
_cell.length_b           100.265 
_cell.length_c           97.260 
_cell.angle_alpha        90.00 
_cell.angle_beta         98.98 
_cell.angle_gamma        90.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3N1Q 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Desert hedgehog protein'                                    19133.469 3 ? ? 'N-terminal Domain' ? 
2 polymer     man 'Cell adhesion molecule-related/down-regulated by oncogenes' 11660.819 3 ? ? 'Third FN3 domain'  ? 
3 non-polymer syn 'ZINC ION'                                                   65.409    3 ? ? ?                   ? 
4 non-polymer syn 'CALCIUM ION'                                                40.078    6 ? ? ?                   ? 
5 water       nat water                                                        18.015    1 ? ? ?                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'DHH, HHG-3, Desert hedgehog protein N-product, Desert hedgehog protein C-product' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSGPGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLM
TERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESR
NHVHVSVKAD
;
;GSGPGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLM
TERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESR
NHVHVSVKAD
;
B,A,E ? 
2 'polypeptide(L)' no no 
;GSTPITGPHIAYTEAVSDTQIMLKWTYIPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVVEGSKQWHMIGHLQPETSYDI
KMQCFNEGGESEFSNVMICETK
;
;GSTPITGPHIAYTEAVSDTQIMLKWTYIPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVVEGSKQWHMIGHLQPETSYDI
KMQCFNEGGESEFSNVMICETK
;
C,D,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   GLY n 
1 4   PRO n 
1 5   GLY n 
1 6   PRO n 
1 7   GLY n 
1 8   ARG n 
1 9   GLY n 
1 10  PRO n 
1 11  VAL n 
1 12  GLY n 
1 13  ARG n 
1 14  ARG n 
1 15  ARG n 
1 16  TYR n 
1 17  ALA n 
1 18  ARG n 
1 19  LYS n 
1 20  GLN n 
1 21  LEU n 
1 22  VAL n 
1 23  PRO n 
1 24  LEU n 
1 25  LEU n 
1 26  TYR n 
1 27  LYS n 
1 28  GLN n 
1 29  PHE n 
1 30  VAL n 
1 31  PRO n 
1 32  GLY n 
1 33  VAL n 
1 34  PRO n 
1 35  GLU n 
1 36  ARG n 
1 37  THR n 
1 38  LEU n 
1 39  GLY n 
1 40  ALA n 
1 41  SER n 
1 42  GLY n 
1 43  PRO n 
1 44  ALA n 
1 45  GLU n 
1 46  GLY n 
1 47  ARG n 
1 48  VAL n 
1 49  ALA n 
1 50  ARG n 
1 51  GLY n 
1 52  SER n 
1 53  GLU n 
1 54  ARG n 
1 55  PHE n 
1 56  ARG n 
1 57  ASP n 
1 58  LEU n 
1 59  VAL n 
1 60  PRO n 
1 61  ASN n 
1 62  TYR n 
1 63  ASN n 
1 64  PRO n 
1 65  ASP n 
1 66  ILE n 
1 67  ILE n 
1 68  PHE n 
1 69  LYS n 
1 70  ASP n 
1 71  GLU n 
1 72  GLU n 
1 73  ASN n 
1 74  SER n 
1 75  GLY n 
1 76  ALA n 
1 77  ASP n 
1 78  ARG n 
1 79  LEU n 
1 80  MET n 
1 81  THR n 
1 82  GLU n 
1 83  ARG n 
1 84  CYS n 
1 85  LYS n 
1 86  GLU n 
1 87  ARG n 
1 88  VAL n 
1 89  ASN n 
1 90  ALA n 
1 91  LEU n 
1 92  ALA n 
1 93  ILE n 
1 94  ALA n 
1 95  VAL n 
1 96  MET n 
1 97  ASN n 
1 98  MET n 
1 99  TRP n 
1 100 PRO n 
1 101 GLY n 
1 102 VAL n 
1 103 ARG n 
1 104 LEU n 
1 105 ARG n 
1 106 VAL n 
1 107 THR n 
1 108 GLU n 
1 109 GLY n 
1 110 TRP n 
1 111 ASP n 
1 112 GLU n 
1 113 ASP n 
1 114 GLY n 
1 115 HIS n 
1 116 HIS n 
1 117 ALA n 
1 118 GLN n 
1 119 ASP n 
1 120 SER n 
1 121 LEU n 
1 122 HIS n 
1 123 TYR n 
1 124 GLU n 
1 125 GLY n 
1 126 ARG n 
1 127 ALA n 
1 128 LEU n 
1 129 ASP n 
1 130 ILE n 
1 131 THR n 
1 132 THR n 
1 133 SER n 
1 134 ASP n 
1 135 ARG n 
1 136 ASP n 
1 137 ARG n 
1 138 ASN n 
1 139 LYS n 
1 140 TYR n 
1 141 GLY n 
1 142 LEU n 
1 143 LEU n 
1 144 ALA n 
1 145 ARG n 
1 146 LEU n 
1 147 ALA n 
1 148 VAL n 
1 149 GLU n 
1 150 ALA n 
1 151 GLY n 
1 152 PHE n 
1 153 ASP n 
1 154 TRP n 
1 155 VAL n 
1 156 TYR n 
1 157 TYR n 
1 158 GLU n 
1 159 SER n 
1 160 ARG n 
1 161 ASN n 
1 162 HIS n 
1 163 VAL n 
1 164 HIS n 
1 165 VAL n 
1 166 SER n 
1 167 VAL n 
1 168 LYS n 
1 169 ALA n 
1 170 ASP n 
2 1   GLY n 
2 2   SER n 
2 3   THR n 
2 4   PRO n 
2 5   ILE n 
2 6   THR n 
2 7   GLY n 
2 8   PRO n 
2 9   HIS n 
2 10  ILE n 
2 11  ALA n 
2 12  TYR n 
2 13  THR n 
2 14  GLU n 
2 15  ALA n 
2 16  VAL n 
2 17  SER n 
2 18  ASP n 
2 19  THR n 
2 20  GLN n 
2 21  ILE n 
2 22  MET n 
2 23  LEU n 
2 24  LYS n 
2 25  TRP n 
2 26  THR n 
2 27  TYR n 
2 28  ILE n 
2 29  PRO n 
2 30  SER n 
2 31  SER n 
2 32  ASN n 
2 33  ASN n 
2 34  ASN n 
2 35  THR n 
2 36  PRO n 
2 37  ILE n 
2 38  GLN n 
2 39  GLY n 
2 40  PHE n 
2 41  TYR n 
2 42  ILE n 
2 43  TYR n 
2 44  TYR n 
2 45  ARG n 
2 46  PRO n 
2 47  THR n 
2 48  ASP n 
2 49  SER n 
2 50  ASP n 
2 51  ASN n 
2 52  ASP n 
2 53  SER n 
2 54  ASP n 
2 55  TYR n 
2 56  LYS n 
2 57  ARG n 
2 58  ASP n 
2 59  VAL n 
2 60  VAL n 
2 61  GLU n 
2 62  GLY n 
2 63  SER n 
2 64  LYS n 
2 65  GLN n 
2 66  TRP n 
2 67  HIS n 
2 68  MET n 
2 69  ILE n 
2 70  GLY n 
2 71  HIS n 
2 72  LEU n 
2 73  GLN n 
2 74  PRO n 
2 75  GLU n 
2 76  THR n 
2 77  SER n 
2 78  TYR n 
2 79  ASP n 
2 80  ILE n 
2 81  LYS n 
2 82  MET n 
2 83  GLN n 
2 84  CYS n 
2 85  PHE n 
2 86  ASN n 
2 87  GLU n 
2 88  GLY n 
2 89  GLY n 
2 90  GLU n 
2 91  SER n 
2 92  GLU n 
2 93  PHE n 
2 94  SER n 
2 95  ASN n 
2 96  VAL n 
2 97  MET n 
2 98  ILE n 
2 99  CYS n 
2 100 GLU n 
2 101 THR n 
2 102 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? DHH         ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human ? 'CDON, CDO' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DHH_HUMAN  O43323 1 
;GPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERC
KERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVH
VSVKAD
;
24  ? 
2 UNP CDON_HUMAN Q4KMG0 2 
;PITGPHIAYTEAVSDTQIMLKWTYIPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVVEGSKQWHMIGHLQPETSYDIKMQ
CFNEGGESEFSNVMICETK
;
826 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3N1Q B 5 ? 170 ? O43323 24  ? 189 ? 24  189 
2 2 3N1Q C 4 ? 102 ? Q4KMG0 826 ? 924 ? 826 924 
3 1 3N1Q A 5 ? 170 ? O43323 24  ? 189 ? 24  189 
4 2 3N1Q D 4 ? 102 ? Q4KMG0 826 ? 924 ? 826 924 
5 1 3N1Q E 5 ? 170 ? O43323 24  ? 189 ? 24  189 
6 2 3N1Q F 4 ? 102 ? Q4KMG0 826 ? 924 ? 826 924 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3N1Q GLY B 1 ? UNP O43323 ? ? 'EXPRESSION TAG' 20  1  
1 3N1Q SER B 2 ? UNP O43323 ? ? 'EXPRESSION TAG' 21  2  
1 3N1Q GLY B 3 ? UNP O43323 ? ? 'EXPRESSION TAG' 22  3  
1 3N1Q PRO B 4 ? UNP O43323 ? ? 'EXPRESSION TAG' 23  4  
2 3N1Q GLY C 1 ? UNP Q4KMG0 ? ? 'EXPRESSION TAG' 823 5  
2 3N1Q SER C 2 ? UNP Q4KMG0 ? ? 'EXPRESSION TAG' 824 6  
2 3N1Q THR C 3 ? UNP Q4KMG0 ? ? 'EXPRESSION TAG' 825 7  
3 3N1Q GLY A 1 ? UNP O43323 ? ? 'EXPRESSION TAG' 20  8  
3 3N1Q SER A 2 ? UNP O43323 ? ? 'EXPRESSION TAG' 21  9  
3 3N1Q GLY A 3 ? UNP O43323 ? ? 'EXPRESSION TAG' 22  10 
3 3N1Q PRO A 4 ? UNP O43323 ? ? 'EXPRESSION TAG' 23  11 
4 3N1Q GLY D 1 ? UNP Q4KMG0 ? ? 'EXPRESSION TAG' 823 12 
4 3N1Q SER D 2 ? UNP Q4KMG0 ? ? 'EXPRESSION TAG' 824 13 
4 3N1Q THR D 3 ? UNP Q4KMG0 ? ? 'EXPRESSION TAG' 825 14 
5 3N1Q GLY E 1 ? UNP O43323 ? ? 'EXPRESSION TAG' 20  15 
5 3N1Q SER E 2 ? UNP O43323 ? ? 'EXPRESSION TAG' 21  16 
5 3N1Q GLY E 3 ? UNP O43323 ? ? 'EXPRESSION TAG' 22  17 
5 3N1Q PRO E 4 ? UNP O43323 ? ? 'EXPRESSION TAG' 23  18 
6 3N1Q GLY F 1 ? UNP Q4KMG0 ? ? 'EXPRESSION TAG' 823 19 
6 3N1Q SER F 2 ? UNP Q4KMG0 ? ? 'EXPRESSION TAG' 824 20 
6 3N1Q THR F 3 ? UNP Q4KMG0 ? ? 'EXPRESSION TAG' 825 21 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          3N1Q 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.38 
_exptl_crystal.density_percent_sol   48.39 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '20% peg3350, 200 mM Na(OAc), VAPOR DIFFUSION, temperature 298K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RIGAKU SATURN 944+' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-E SUPERBRIGHT' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3N1Q 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             25 
_reflns.d_resolution_high            2.89 
_reflns.number_obs                   19402 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3N1Q 
_refine.ls_number_reflns_obs                     17416 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.03 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             22.726 
_refine.ls_d_res_high                            2.89 
_refine.ls_percent_reflns_obs                    89.62 
_refine.ls_R_factor_obs                          0.2396 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2370 
_refine.ls_R_factor_R_free                       0.2876 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.14 
_refine.ls_number_reflns_R_free                  895 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -10.3481 
_refine.aniso_B[2][2]                            -11.0669 
_refine.aniso_B[3][3]                            -10.9192 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -5.1789 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.287 
_refine.solvent_model_param_bsol                 0.001 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            2.18 
_refine.pdbx_overall_phase_error                 26.78 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5757 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         9 
_refine_hist.number_atoms_solvent             1 
_refine_hist.number_atoms_total               5767 
_refine_hist.d_res_high                       2.89 
_refine_hist.d_res_low                        22.726 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.003  ? ? 5892 'X-RAY DIFFRACTION' ? 
f_angle_d          0.573  ? ? 7974 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 14.567 ? ? 2141 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.037  ? ? 824  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004  ? ? 1054 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.89   3.0727  1898 0.3457 62.00  0.3958 . . 106 . . . . 
'X-RAY DIFFRACTION' . 3.0727 3.3093  2838 0.2769 93.00  0.3124 . . 175 . . . . 
'X-RAY DIFFRACTION' . 3.3093 3.6411  3007 0.2408 100.00 0.2579 . . 170 . . . . 
'X-RAY DIFFRACTION' . 3.6411 4.1652  2850 0.2321 92.00  0.3402 . . 141 . . . . 
'X-RAY DIFFRACTION' . 4.1652 5.2371  2875 0.1864 93.00  0.2248 . . 143 . . . . 
'X-RAY DIFFRACTION' . 5.2371 22.7269 3053 0.1823 98.00  0.2120 . . 160 . . . . 
# 
_struct.entry_id                  3N1Q 
_struct.title                     'Crystal Structure of DhhN bound to CDOFn3' 
_struct.pdbx_descriptor           'Desert hedgehog protein, Cell adhesion molecule-related/down-regulated by oncogenes' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3N1Q 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            
;Binding Sites, Calcium, Cell Adhesion Molecules, Cell Cycle Proteins, Cell Line, Conserved Sequence, Fibronectins, Hedgehog Proteins, Immunoglobulin G, Membrane Glycoproteins, Membrane Proteins, Protein Binding, Tertiary, Receptors, Cell Surface, Sequence Homology, Signal Transduction, Tumor Suppressor Proteins
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
J N N 3 ? 
K N N 4 ? 
L N N 4 ? 
M N N 3 ? 
N N N 4 ? 
O N N 4 ? 
P N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 53  ? LEU A 58  ? GLU B 72  LEU B 77  5 ? 6  
HELX_P HELX_P2  2  THR A 81  ? TRP A 99  ? THR B 100 TRP B 118 1 ? 19 
HELX_P HELX_P3  3  SER A 120 ? GLY A 125 ? SER B 139 GLY B 144 5 ? 6  
HELX_P HELX_P4  4  ASP A 136 ? ASN A 138 ? ASP B 155 ASN B 157 5 ? 3  
HELX_P HELX_P5  5  LYS A 139 ? GLY A 151 ? LYS B 158 GLY B 170 1 ? 13 
HELX_P HELX_P6  6  ASN B 51  ? TYR B 55  ? ASN C 873 TYR C 877 5 ? 5  
HELX_P HELX_P7  7  SER C 52  ? ARG C 56  ? SER A 71  ARG A 75  5 ? 5  
HELX_P HELX_P8  8  THR C 81  ? TRP C 99  ? THR A 100 TRP A 118 1 ? 19 
HELX_P HELX_P9  9  SER C 120 ? GLY C 125 ? SER A 139 GLY A 144 5 ? 6  
HELX_P HELX_P10 10 ASP C 136 ? ASN C 138 ? ASP A 155 ASN A 157 5 ? 3  
HELX_P HELX_P11 11 LYS C 139 ? GLY C 151 ? LYS A 158 GLY A 170 1 ? 13 
HELX_P HELX_P12 12 ASN D 51  ? TYR D 55  ? ASN D 873 TYR D 877 5 ? 5  
HELX_P HELX_P13 13 THR E 81  ? TRP E 99  ? THR E 100 TRP E 118 1 ? 19 
HELX_P HELX_P14 14 SER E 120 ? GLY E 125 ? SER E 139 GLY E 144 5 ? 6  
HELX_P HELX_P15 15 ASP E 136 ? ASN E 138 ? ASP E 155 ASN E 157 5 ? 3  
HELX_P HELX_P16 16 LYS E 139 ? GLY E 151 ? LYS E 158 GLY E 170 1 ? 13 
HELX_P HELX_P17 17 ASN F 51  ? TYR F 55  ? ASN F 873 TYR F 877 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 129 OD1 ? ? ? 1_555 G ZN . ZN ? ? B ASP 148 B ZN 190 1_555 ? ? ? ? ? ? ? 2.290 ? 
metalc2  metalc ? ? C ASP 129 OD1 ? ? ? 1_555 J ZN . ZN ? ? A ASP 148 A ZN 190 1_555 ? ? ? ? ? ? ? 2.363 ? 
metalc3  metalc ? ? A HIS 122 NE2 ? ? ? 1_555 G ZN . ZN ? ? B HIS 141 B ZN 190 1_555 ? ? ? ? ? ? ? 2.382 ? 
metalc4  metalc ? ? C HIS 164 ND1 ? ? ? 1_555 J ZN . ZN ? ? A HIS 183 A ZN 190 1_555 ? ? ? ? ? ? ? 2.421 ? 
metalc5  metalc ? ? A HIS 164 ND1 ? ? ? 1_555 G ZN . ZN ? ? B HIS 183 B ZN 190 1_555 ? ? ? ? ? ? ? 2.422 ? 
metalc6  metalc ? ? E HIS 164 ND1 ? ? ? 1_555 M ZN . ZN ? ? E HIS 183 E ZN 190 1_555 ? ? ? ? ? ? ? 2.455 ? 
metalc7  metalc ? ? E ASP 129 OD1 ? ? ? 1_555 M ZN . ZN ? ? E ASP 148 E ZN 190 1_555 ? ? ? ? ? ? ? 2.476 ? 
metalc8  metalc ? ? E HIS 122 NE2 ? ? ? 1_555 M ZN . ZN ? ? E HIS 141 E ZN 190 1_555 ? ? ? ? ? ? ? 2.575 ? 
metalc9  metalc ? ? C HIS 122 NE2 ? ? ? 1_555 J ZN . ZN ? ? A HIS 141 A ZN 190 1_555 ? ? ? ? ? ? ? 2.604 ? 
metalc10 metalc ? ? E THR 107 O   ? ? ? 1_555 N CA . CA ? ? E THR 126 E CA 192 1_555 ? ? ? ? ? ? ? 2.657 ? 
metalc11 metalc ? ? A GLU 72  OE2 ? ? ? 1_555 I CA . CA ? ? B GLU 91  B CA 192 1_555 ? ? ? ? ? ? ? 2.670 ? 
metalc12 metalc ? ? C GLU 72  OE2 ? ? ? 1_555 K CA . CA ? ? A GLU 91  A CA 191 1_555 ? ? ? ? ? ? ? 2.734 ? 
metalc13 metalc ? ? A THR 107 O   ? ? ? 1_555 I CA . CA ? ? B THR 126 B CA 192 1_555 ? ? ? ? ? ? ? 2.744 ? 
metalc14 metalc ? ? C GLU 71  OE1 ? ? ? 1_555 L CA . CA ? ? A GLU 90  A CA 192 1_555 ? ? ? ? ? ? ? 2.746 ? 
metalc15 metalc ? ? E GLU 72  OE2 ? ? ? 1_555 N CA . CA ? ? E GLU 91  E CA 192 1_555 ? ? ? ? ? ? ? 2.748 ? 
metalc16 metalc ? ? A ASP 113 OD2 ? ? ? 1_555 H CA . CA ? ? B ASP 132 B CA 191 1_555 ? ? ? ? ? ? ? 2.749 ? 
metalc17 metalc ? ? C THR 107 O   ? ? ? 1_555 L CA . CA ? ? A THR 126 A CA 192 1_555 ? ? ? ? ? ? ? 2.754 ? 
metalc18 metalc ? ? E ASP 77  OD2 ? ? ? 1_555 N CA . CA ? ? E ASP 96  E CA 192 1_555 ? ? ? ? ? ? ? 2.756 ? 
metalc19 metalc ? ? C GLU 108 OE2 ? ? ? 1_555 K CA . CA ? ? A GLU 127 A CA 191 1_555 ? ? ? ? ? ? ? 2.772 ? 
metalc20 metalc ? ? A GLU 71  OE1 ? ? ? 1_555 I CA . CA ? ? B GLU 90  B CA 192 1_555 ? ? ? ? ? ? ? 2.784 ? 
metalc21 metalc ? ? E GLU 72  OE2 ? ? ? 1_555 O CA . CA ? ? E GLU 91  E CA 191 1_555 ? ? ? ? ? ? ? 2.784 ? 
metalc22 metalc ? ? E ASP 111 OD1 ? ? ? 1_555 O CA . CA ? ? E ASP 130 E CA 191 1_555 ? ? ? ? ? ? ? 2.785 ? 
metalc23 metalc ? ? A GLU 108 OE2 ? ? ? 1_555 H CA . CA ? ? B GLU 127 B CA 191 1_555 ? ? ? ? ? ? ? 2.788 ? 
metalc24 metalc ? ? A GLU 72  OE2 ? ? ? 1_555 H CA . CA ? ? B GLU 91  B CA 191 1_555 ? ? ? ? ? ? ? 2.806 ? 
metalc25 metalc ? ? A ASP 77  OD2 ? ? ? 1_555 I CA . CA ? ? B ASP 96  B CA 192 1_555 ? ? ? ? ? ? ? 2.808 ? 
metalc26 metalc ? ? C ASP 77  OD2 ? ? ? 1_555 L CA . CA ? ? A ASP 96  A CA 192 1_555 ? ? ? ? ? ? ? 2.812 ? 
metalc27 metalc ? ? C ASP 111 OD1 ? ? ? 1_555 K CA . CA ? ? A ASP 130 A CA 191 1_555 ? ? ? ? ? ? ? 2.830 ? 
metalc28 metalc ? ? A ASP 77  OD1 ? ? ? 1_555 I CA . CA ? ? B ASP 96  B CA 192 1_555 ? ? ? ? ? ? ? 2.830 ? 
metalc29 metalc ? ? E GLU 108 OE2 ? ? ? 1_555 O CA . CA ? ? E GLU 127 E CA 191 1_555 ? ? ? ? ? ? ? 2.856 ? 
metalc30 metalc ? ? C GLU 72  OE2 ? ? ? 1_555 L CA . CA ? ? A GLU 91  A CA 192 1_555 ? ? ? ? ? ? ? 2.860 ? 
metalc31 metalc ? ? E ASP 113 OD2 ? ? ? 1_555 O CA . CA ? ? E ASP 132 E CA 191 1_555 ? ? ? ? ? ? ? 2.862 ? 
metalc32 metalc ? ? E ASP 77  OD1 ? ? ? 1_555 N CA . CA ? ? E ASP 96  E CA 192 1_555 ? ? ? ? ? ? ? 2.880 ? 
metalc33 metalc ? ? A ASP 111 OD1 ? ? ? 1_555 H CA . CA ? ? B ASP 130 B CA 191 1_555 ? ? ? ? ? ? ? 2.881 ? 
metalc34 metalc ? ? C GLU 71  OE2 ? ? ? 1_555 L CA . CA ? ? A GLU 90  A CA 192 1_555 ? ? ? ? ? ? ? 2.886 ? 
metalc35 metalc ? ? A GLU 108 OE1 ? ? ? 1_555 H CA . CA ? ? B GLU 127 B CA 191 1_555 ? ? ? ? ? ? ? 2.896 ? 
metalc36 metalc ? ? A GLU 71  OE2 ? ? ? 1_555 I CA . CA ? ? B GLU 90  B CA 192 1_555 ? ? ? ? ? ? ? 2.904 ? 
metalc37 metalc ? ? E GLU 71  OE1 ? ? ? 1_555 N CA . CA ? ? E GLU 90  E CA 192 1_555 ? ? ? ? ? ? ? 2.911 ? 
metalc38 metalc ? ? E GLU 71  OE2 ? ? ? 1_555 N CA . CA ? ? E GLU 90  E CA 192 1_555 ? ? ? ? ? ? ? 2.913 ? 
metalc39 metalc ? ? C ASP 77  OD1 ? ? ? 1_555 L CA . CA ? ? A ASP 96  A CA 192 1_555 ? ? ? ? ? ? ? 2.923 ? 
metalc40 metalc ? ? C GLU 108 OE1 ? ? ? 1_555 K CA . CA ? ? A GLU 127 A CA 191 1_555 ? ? ? ? ? ? ? 2.957 ? 
metalc41 metalc ? ? E GLU 108 OE1 ? ? ? 1_555 O CA . CA ? ? E GLU 127 E CA 191 1_555 ? ? ? ? ? ? ? 2.980 ? 
metalc42 metalc ? ? A GLU 108 OE2 ? ? ? 1_555 I CA . CA ? ? B GLU 127 B CA 192 1_555 ? ? ? ? ? ? ? 3.013 ? 
metalc43 metalc ? ? C GLU 108 OE2 ? ? ? 1_555 L CA . CA ? ? A GLU 127 A CA 192 1_555 ? ? ? ? ? ? ? 3.025 ? 
metalc44 metalc ? ? C ASP 113 OD2 ? ? ? 1_555 K CA . CA ? ? A ASP 132 A CA 191 1_555 ? ? ? ? ? ? ? 3.082 ? 
metalc45 metalc ? ? E GLU 108 OE2 ? ? ? 1_555 N CA . CA ? ? E GLU 127 E CA 192 1_555 ? ? ? ? ? ? ? 3.083 ? 
metalc46 metalc ? ? E GLU 72  OE1 ? ? ? 1_555 N CA . CA ? ? E GLU 91  E CA 192 1_555 ? ? ? ? ? ? ? 3.150 ? 
metalc47 metalc ? ? C GLU 72  OE1 ? ? ? 1_555 L CA . CA ? ? A GLU 91  A CA 192 1_555 ? ? ? ? ? ? ? 3.175 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 VAL 30 A . ? VAL 49 B PRO 31 A ? PRO 50 B 1 0.81  
2 VAL 30 C . ? VAL 49 A PRO 31 C ? PRO 50 A 1 1.57  
3 VAL 30 E . ? VAL 49 E PRO 31 E ? PRO 50 E 1 -0.36 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 3 ? 
D ? 4 ? 
E ? 6 ? 
F ? 2 ? 
G ? 3 ? 
H ? 4 ? 
I ? 6 ? 
J ? 2 ? 
K ? 3 ? 
L ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? parallel      
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
I 4 5 ? anti-parallel 
I 5 6 ? parallel      
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 29  ? VAL A 30  ? PHE B 48  VAL B 49  
A 2 TRP A 154 ? SER A 159 ? TRP B 173 SER B 178 
A 3 HIS A 162 ? SER A 166 ? HIS B 181 SER B 185 
A 4 ALA A 127 ? THR A 132 ? ALA B 146 THR B 151 
A 5 LEU A 104 ? GLU A 108 ? LEU B 123 GLU B 127 
A 6 ILE A 67  ? PHE A 68  ? ILE B 86  PHE B 87  
B 1 VAL A 59  ? PRO A 60  ? VAL B 78  PRO B 79  
B 2 LEU A 79  ? MET A 80  ? LEU B 98  MET B 99  
C 1 HIS B 9   ? ALA B 15  ? HIS C 831 ALA C 837 
C 2 ILE B 21  ? THR B 26  ? ILE C 843 THR C 848 
C 3 TRP B 66  ? ILE B 69  ? TRP C 888 ILE C 891 
D 1 LYS B 56  ? GLU B 61  ? LYS C 878 GLU C 883 
D 2 GLY B 39  ? PRO B 46  ? GLY C 861 PRO C 868 
D 3 SER B 77  ? PHE B 85  ? SER C 899 PHE C 907 
D 4 MET B 97  ? GLU B 100 ? MET C 919 GLU C 922 
E 1 PHE C 29  ? VAL C 30  ? PHE A 48  VAL A 49  
E 2 TRP C 154 ? TYR C 156 ? TRP A 173 TYR A 175 
E 3 VAL C 163 ? SER C 166 ? VAL A 182 SER A 185 
E 4 ALA C 127 ? THR C 132 ? ALA A 146 THR A 151 
E 5 LEU C 104 ? GLU C 108 ? LEU A 123 GLU A 127 
E 6 ILE C 66  ? PHE C 68  ? ILE A 85  PHE A 87  
F 1 VAL C 59  ? PRO C 60  ? VAL A 78  PRO A 79  
F 2 LEU C 79  ? MET C 80  ? LEU A 98  MET A 99  
G 1 HIS D 9   ? ALA D 15  ? HIS D 831 ALA D 837 
G 2 ILE D 21  ? THR D 26  ? ILE D 843 THR D 848 
G 3 TRP D 66  ? ILE D 69  ? TRP D 888 ILE D 891 
H 1 LYS D 56  ? GLU D 61  ? LYS D 878 GLU D 883 
H 2 GLY D 39  ? PRO D 46  ? GLY D 861 PRO D 868 
H 3 SER D 77  ? PHE D 85  ? SER D 899 PHE D 907 
H 4 MET D 97  ? GLU D 100 ? MET D 919 GLU D 922 
I 1 PHE E 29  ? VAL E 30  ? PHE E 48  VAL E 49  
I 2 TRP E 154 ? SER E 159 ? TRP E 173 SER E 178 
I 3 HIS E 162 ? SER E 166 ? HIS E 181 SER E 185 
I 4 ALA E 127 ? THR E 132 ? ALA E 146 THR E 151 
I 5 LEU E 104 ? GLU E 108 ? LEU E 123 GLU E 127 
I 6 ILE E 66  ? PHE E 68  ? ILE E 85  PHE E 87  
J 1 VAL E 59  ? PRO E 60  ? VAL E 78  PRO E 79  
J 2 LEU E 79  ? MET E 80  ? LEU E 98  MET E 99  
K 1 ILE F 10  ? ALA F 15  ? ILE F 832 ALA F 837 
K 2 ILE F 21  ? TRP F 25  ? ILE F 843 TRP F 847 
K 3 TRP F 66  ? ILE F 69  ? TRP F 888 ILE F 891 
L 1 LYS F 56  ? VAL F 59  ? LYS F 878 VAL F 881 
L 2 GLY F 39  ? PRO F 46  ? GLY F 861 PRO F 868 
L 3 SER F 77  ? PHE F 85  ? SER F 899 PHE F 907 
L 4 MET F 97  ? GLU F 100 ? MET F 919 GLU F 922 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 30  ? N VAL B 49  O VAL A 155 ? O VAL B 174 
A 2 3 N TYR A 156 ? N TYR B 175 O HIS A 164 ? O HIS B 183 
A 3 4 O VAL A 165 ? O VAL B 184 N LEU A 128 ? N LEU B 147 
A 4 5 O ASP A 129 ? O ASP B 148 N THR A 107 ? N THR B 126 
A 5 6 O VAL A 106 ? O VAL B 125 N ILE A 67  ? N ILE B 86  
B 1 2 N VAL A 59  ? N VAL B 78  O MET A 80  ? O MET B 99  
C 1 2 N GLU B 14  ? N GLU C 836 O MET B 22  ? O MET C 844 
C 2 3 N ILE B 21  ? N ILE C 843 O ILE B 69  ? O ILE C 891 
D 1 2 O LYS B 56  ? O LYS C 878 N TYR B 44  ? N TYR C 866 
D 2 3 N TYR B 41  ? N TYR C 863 O GLN B 83  ? O GLN C 905 
D 3 4 N ILE B 80  ? N ILE C 902 O MET B 97  ? O MET C 919 
E 1 2 N VAL C 30  ? N VAL A 49  O VAL C 155 ? O VAL A 174 
E 2 3 N TYR C 156 ? N TYR A 175 O HIS C 164 ? O HIS A 183 
E 3 4 O VAL C 165 ? O VAL A 184 N LEU C 128 ? N LEU A 147 
E 4 5 O ASP C 129 ? O ASP A 148 N THR C 107 ? N THR A 126 
E 5 6 O LEU C 104 ? O LEU A 123 N ILE C 67  ? N ILE A 86  
F 1 2 N VAL C 59  ? N VAL A 78  O MET C 80  ? O MET A 99  
G 1 2 N GLU D 14  ? N GLU D 836 O MET D 22  ? O MET D 844 
G 2 3 N ILE D 21  ? N ILE D 843 O ILE D 69  ? O ILE D 891 
H 1 2 O ASP D 58  ? O ASP D 880 N ILE D 42  ? N ILE D 864 
H 2 3 N ARG D 45  ? N ARG D 867 O ASP D 79  ? O ASP D 901 
H 3 4 N ILE D 80  ? N ILE D 902 O MET D 97  ? O MET D 919 
I 1 2 N VAL E 30  ? N VAL E 49  O VAL E 155 ? O VAL E 174 
I 2 3 N TYR E 156 ? N TYR E 175 O HIS E 164 ? O HIS E 183 
I 3 4 O VAL E 163 ? O VAL E 182 N ILE E 130 ? N ILE E 149 
I 4 5 O ASP E 129 ? O ASP E 148 N THR E 107 ? N THR E 126 
I 5 6 O VAL E 106 ? O VAL E 125 N ILE E 67  ? N ILE E 86  
J 1 2 N VAL E 59  ? N VAL E 78  O MET E 80  ? O MET E 99  
K 1 2 N GLU F 14  ? N GLU F 836 O MET F 22  ? O MET F 844 
K 2 3 N ILE F 21  ? N ILE F 843 O ILE F 69  ? O ILE F 891 
L 1 2 O LYS F 56  ? O LYS F 878 N TYR F 44  ? N TYR F 866 
L 2 3 N ARG F 45  ? N ARG F 867 O ASP F 79  ? O ASP F 901 
L 3 4 N TYR F 78  ? N TYR F 900 O CYS F 99  ? O CYS F 921 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 190' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CA B 191' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA B 192' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 190' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CA A 191' 
AC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA A 192' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN E 190' 
AC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA E 192' 
AC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CA E 191' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 HIS A 122 ? HIS B 141 . ? 1_555 ? 
2  AC1 4 ASP A 129 ? ASP B 148 . ? 1_555 ? 
3  AC1 4 GLU A 158 ? GLU B 177 . ? 1_555 ? 
4  AC1 4 HIS A 164 ? HIS B 183 . ? 1_555 ? 
5  AC2 4 GLU A 72  ? GLU B 91  . ? 1_555 ? 
6  AC2 4 GLU A 108 ? GLU B 127 . ? 1_555 ? 
7  AC2 4 ASP A 111 ? ASP B 130 . ? 1_555 ? 
8  AC2 4 ASP A 113 ? ASP B 132 . ? 1_555 ? 
9  AC3 5 GLU A 71  ? GLU B 90  . ? 1_555 ? 
10 AC3 5 GLU A 72  ? GLU B 91  . ? 1_555 ? 
11 AC3 5 ASP A 77  ? ASP B 96  . ? 1_555 ? 
12 AC3 5 THR A 107 ? THR B 126 . ? 1_555 ? 
13 AC3 5 GLU A 108 ? GLU B 127 . ? 1_555 ? 
14 AC4 4 HIS C 122 ? HIS A 141 . ? 1_555 ? 
15 AC4 4 ASP C 129 ? ASP A 148 . ? 1_555 ? 
16 AC4 4 GLU C 158 ? GLU A 177 . ? 1_555 ? 
17 AC4 4 HIS C 164 ? HIS A 183 . ? 1_555 ? 
18 AC5 4 GLU C 72  ? GLU A 91  . ? 1_555 ? 
19 AC5 4 GLU C 108 ? GLU A 127 . ? 1_555 ? 
20 AC5 4 ASP C 111 ? ASP A 130 . ? 1_555 ? 
21 AC5 4 ASP C 113 ? ASP A 132 . ? 1_555 ? 
22 AC6 5 GLU C 71  ? GLU A 90  . ? 1_555 ? 
23 AC6 5 GLU C 72  ? GLU A 91  . ? 1_555 ? 
24 AC6 5 ASP C 77  ? ASP A 96  . ? 1_555 ? 
25 AC6 5 THR C 107 ? THR A 126 . ? 1_555 ? 
26 AC6 5 GLU C 108 ? GLU A 127 . ? 1_555 ? 
27 AC7 4 HIS E 122 ? HIS E 141 . ? 1_555 ? 
28 AC7 4 ASP E 129 ? ASP E 148 . ? 1_555 ? 
29 AC7 4 GLU E 158 ? GLU E 177 . ? 1_555 ? 
30 AC7 4 HIS E 164 ? HIS E 183 . ? 1_555 ? 
31 AC8 5 GLU E 71  ? GLU E 90  . ? 1_555 ? 
32 AC8 5 GLU E 72  ? GLU E 91  . ? 1_555 ? 
33 AC8 5 ASP E 77  ? ASP E 96  . ? 1_555 ? 
34 AC8 5 THR E 107 ? THR E 126 . ? 1_555 ? 
35 AC8 5 GLU E 108 ? GLU E 127 . ? 1_555 ? 
36 AC9 4 GLU E 72  ? GLU E 91  . ? 1_555 ? 
37 AC9 4 GLU E 108 ? GLU E 127 . ? 1_555 ? 
38 AC9 4 ASP E 111 ? ASP E 130 . ? 1_555 ? 
39 AC9 4 ASP E 113 ? ASP E 132 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3N1Q 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3N1Q 
_atom_sites.fract_transf_matrix[1][1]   0.021875 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003457 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009974 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010409 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLN A 1 20  ? -20.706 -17.022 -46.276 1.00 63.55  ? 39  GLN B N   1 
ATOM   2    C  CA  . GLN A 1 20  ? -20.011 -18.248 -45.896 1.00 65.51  ? 39  GLN B CA  1 
ATOM   3    C  C   . GLN A 1 20  ? -19.492 -18.187 -44.461 1.00 62.98  ? 39  GLN B C   1 
ATOM   4    O  O   . GLN A 1 20  ? -19.579 -19.167 -43.722 1.00 62.24  ? 39  GLN B O   1 
ATOM   5    C  CB  . GLN A 1 20  ? -18.860 -18.537 -46.863 1.00 69.60  ? 39  GLN B CB  1 
ATOM   6    C  CG  . GLN A 1 20  ? -19.310 -18.886 -48.280 1.00 74.23  ? 39  GLN B CG  1 
ATOM   7    C  CD  . GLN A 1 20  ? -18.147 -19.216 -49.197 1.00 79.72  ? 39  GLN B CD  1 
ATOM   8    O  OE1 . GLN A 1 20  ? -16.994 -18.888 -48.903 1.00 79.96  ? 39  GLN B OE1 1 
ATOM   9    N  NE2 . GLN A 1 20  ? -18.444 -19.864 -50.320 1.00 80.03  ? 39  GLN B NE2 1 
ATOM   10   N  N   . LEU A 1 21  ? -18.948 -17.035 -44.076 1.00 47.91  ? 40  LEU B N   1 
ATOM   11   C  CA  . LEU A 1 21  ? -18.433 -16.837 -42.723 1.00 45.50  ? 40  LEU B CA  1 
ATOM   12   C  C   . LEU A 1 21  ? -19.573 -16.647 -41.732 1.00 43.50  ? 40  LEU B C   1 
ATOM   13   O  O   . LEU A 1 21  ? -20.556 -15.967 -42.029 1.00 43.14  ? 40  LEU B O   1 
ATOM   14   C  CB  . LEU A 1 21  ? -17.494 -15.629 -42.670 1.00 45.78  ? 40  LEU B CB  1 
ATOM   15   C  CG  . LEU A 1 21  ? -16.166 -15.718 -43.424 1.00 46.48  ? 40  LEU B CG  1 
ATOM   16   C  CD1 . LEU A 1 21  ? -15.431 -14.388 -43.346 1.00 44.61  ? 40  LEU B CD1 1 
ATOM   17   C  CD2 . LEU A 1 21  ? -15.296 -16.848 -42.881 1.00 46.25  ? 40  LEU B CD2 1 
ATOM   18   N  N   . VAL A 1 22  ? -19.435 -17.243 -40.552 1.00 24.67  ? 41  VAL B N   1 
ATOM   19   C  CA  . VAL A 1 22  ? -20.486 -17.184 -39.543 1.00 24.15  ? 41  VAL B CA  1 
ATOM   20   C  C   . VAL A 1 22  ? -20.079 -16.336 -38.345 1.00 22.88  ? 41  VAL B C   1 
ATOM   21   O  O   . VAL A 1 22  ? -19.230 -16.741 -37.551 1.00 22.61  ? 41  VAL B O   1 
ATOM   22   C  CB  . VAL A 1 22  ? -20.870 -18.588 -39.043 1.00 23.86  ? 41  VAL B CB  1 
ATOM   23   C  CG1 . VAL A 1 22  ? -21.932 -18.489 -37.961 1.00 22.70  ? 41  VAL B CG1 1 
ATOM   24   C  CG2 . VAL A 1 22  ? -21.353 -19.450 -40.198 1.00 24.88  ? 41  VAL B CG2 1 
ATOM   25   N  N   . PRO A 1 23  ? -20.696 -15.154 -38.206 1.00 22.08  ? 42  PRO B N   1 
ATOM   26   C  CA  . PRO A 1 23  ? -20.425 -14.245 -37.088 1.00 21.61  ? 42  PRO B CA  1 
ATOM   27   C  C   . PRO A 1 23  ? -20.613 -14.941 -35.745 1.00 21.41  ? 42  PRO B C   1 
ATOM   28   O  O   . PRO A 1 23  ? -21.450 -15.838 -35.632 1.00 20.83  ? 42  PRO B O   1 
ATOM   29   C  CB  . PRO A 1 23  ? -21.490 -13.149 -37.272 1.00 20.81  ? 42  PRO B CB  1 
ATOM   30   C  CG  . PRO A 1 23  ? -22.526 -13.773 -38.175 1.00 21.21  ? 42  PRO B CG  1 
ATOM   31   C  CD  . PRO A 1 23  ? -21.709 -14.592 -39.111 1.00 22.29  ? 42  PRO B CD  1 
ATOM   32   N  N   . LEU A 1 24  ? -19.835 -14.538 -34.744 1.00 28.54  ? 43  LEU B N   1 
ATOM   33   C  CA  . LEU A 1 24  ? -19.982 -15.086 -33.403 1.00 27.80  ? 43  LEU B CA  1 
ATOM   34   C  C   . LEU A 1 24  ? -21.144 -14.408 -32.697 1.00 28.02  ? 43  LEU B C   1 
ATOM   35   O  O   . LEU A 1 24  ? -21.478 -13.261 -32.993 1.00 28.25  ? 43  LEU B O   1 
ATOM   36   C  CB  . LEU A 1 24  ? -18.709 -14.879 -32.583 1.00 27.28  ? 43  LEU B CB  1 
ATOM   37   C  CG  . LEU A 1 24  ? -17.376 -15.353 -33.155 1.00 27.58  ? 43  LEU B CG  1 
ATOM   38   C  CD1 . LEU A 1 24  ? -16.322 -15.344 -32.059 1.00 27.63  ? 43  LEU B CD1 1 
ATOM   39   C  CD2 . LEU A 1 24  ? -17.506 -16.736 -33.753 1.00 28.21  ? 43  LEU B CD2 1 
ATOM   40   N  N   . LEU A 1 25  ? -21.757 -15.119 -31.760 1.00 23.10  ? 44  LEU B N   1 
ATOM   41   C  CA  . LEU A 1 25  ? -22.819 -14.539 -30.955 1.00 23.31  ? 44  LEU B CA  1 
ATOM   42   C  C   . LEU A 1 25  ? -22.213 -13.697 -29.843 1.00 23.08  ? 44  LEU B C   1 
ATOM   43   O  O   . LEU A 1 25  ? -21.009 -13.759 -29.589 1.00 23.07  ? 44  LEU B O   1 
ATOM   44   C  CB  . LEU A 1 25  ? -23.708 -15.635 -30.366 1.00 23.66  ? 44  LEU B CB  1 
ATOM   45   C  CG  . LEU A 1 25  ? -24.516 -16.442 -31.383 1.00 23.40  ? 44  LEU B CG  1 
ATOM   46   C  CD1 . LEU A 1 25  ? -25.287 -17.558 -30.698 1.00 24.77  ? 44  LEU B CD1 1 
ATOM   47   C  CD2 . LEU A 1 25  ? -25.460 -15.533 -32.151 1.00 23.74  ? 44  LEU B CD2 1 
ATOM   48   N  N   . TYR A 1 26  ? -23.047 -12.899 -29.189 1.00 24.76  ? 45  TYR B N   1 
ATOM   49   C  CA  . TYR A 1 26  ? -22.598 -12.124 -28.046 1.00 24.72  ? 45  TYR B CA  1 
ATOM   50   C  C   . TYR A 1 26  ? -22.268 -13.065 -26.891 1.00 25.66  ? 45  TYR B C   1 
ATOM   51   O  O   . TYR A 1 26  ? -23.056 -13.951 -26.558 1.00 25.56  ? 45  TYR B O   1 
ATOM   52   C  CB  . TYR A 1 26  ? -23.666 -11.111 -27.632 1.00 24.77  ? 45  TYR B CB  1 
ATOM   53   C  CG  . TYR A 1 26  ? -23.331 -10.358 -26.369 1.00 26.36  ? 45  TYR B CG  1 
ATOM   54   C  CD1 . TYR A 1 26  ? -22.168 -9.607  -26.275 1.00 25.55  ? 45  TYR B CD1 1 
ATOM   55   C  CD2 . TYR A 1 26  ? -24.181 -10.393 -25.271 1.00 27.22  ? 45  TYR B CD2 1 
ATOM   56   C  CE1 . TYR A 1 26  ? -21.856 -8.917  -25.120 1.00 26.06  ? 45  TYR B CE1 1 
ATOM   57   C  CE2 . TYR A 1 26  ? -23.879 -9.705  -24.112 1.00 27.00  ? 45  TYR B CE2 1 
ATOM   58   C  CZ  . TYR A 1 26  ? -22.714 -8.968  -24.043 1.00 27.01  ? 45  TYR B CZ  1 
ATOM   59   O  OH  . TYR A 1 26  ? -22.403 -8.279  -22.894 1.00 26.98  ? 45  TYR B OH  1 
ATOM   60   N  N   . LYS A 1 27  ? -21.092 -12.877 -26.298 1.00 25.02  ? 46  LYS B N   1 
ATOM   61   C  CA  . LYS A 1 27  ? -20.642 -13.715 -25.189 1.00 24.64  ? 46  LYS B CA  1 
ATOM   62   C  C   . LYS A 1 27  ? -20.186 -15.095 -25.672 1.00 24.95  ? 46  LYS B C   1 
ATOM   63   O  O   . LYS A 1 27  ? -19.981 -16.009 -24.870 1.00 25.20  ? 46  LYS B O   1 
ATOM   64   C  CB  . LYS A 1 27  ? -21.731 -13.830 -24.115 1.00 24.81  ? 46  LYS B CB  1 
ATOM   65   C  CG  . LYS A 1 27  ? -21.882 -12.584 -23.261 1.00 25.04  ? 46  LYS B CG  1 
ATOM   66   C  CD  . LYS A 1 27  ? -20.635 -12.362 -22.428 1.00 25.40  ? 46  LYS B CD  1 
ATOM   67   C  CE  . LYS A 1 27  ? -20.734 -11.114 -21.581 1.00 25.45  ? 46  LYS B CE  1 
ATOM   68   N  NZ  . LYS A 1 27  ? -19.549 -11.009 -20.688 1.00 23.89  ? 46  LYS B NZ  1 
ATOM   69   N  N   . GLN A 1 28  ? -20.023 -15.235 -26.986 1.00 21.67  ? 47  GLN B N   1 
ATOM   70   C  CA  . GLN A 1 28  ? -19.493 -16.465 -27.566 1.00 21.94  ? 47  GLN B CA  1 
ATOM   71   C  C   . GLN A 1 28  ? -17.980 -16.373 -27.740 1.00 21.10  ? 47  GLN B C   1 
ATOM   72   O  O   . GLN A 1 28  ? -17.466 -15.400 -28.286 1.00 21.18  ? 47  GLN B O   1 
ATOM   73   C  CB  . GLN A 1 28  ? -20.162 -16.774 -28.911 1.00 21.83  ? 47  GLN B CB  1 
ATOM   74   C  CG  . GLN A 1 28  ? -19.627 -18.031 -29.591 1.00 21.63  ? 47  GLN B CG  1 
ATOM   75   C  CD  . GLN A 1 28  ? -20.299 -18.324 -30.925 1.00 21.58  ? 47  GLN B CD  1 
ATOM   76   O  OE1 . GLN A 1 28  ? -21.362 -17.791 -31.230 1.00 22.00  ? 47  GLN B OE1 1 
ATOM   77   N  NE2 . GLN A 1 28  ? -19.676 -19.181 -31.724 1.00 21.58  ? 47  GLN B NE2 1 
ATOM   78   N  N   . PHE A 1 29  ? -17.268 -17.391 -27.271 1.00 20.50  ? 48  PHE B N   1 
ATOM   79   C  CA  . PHE A 1 29  ? -15.819 -17.430 -27.426 1.00 20.89  ? 48  PHE B CA  1 
ATOM   80   C  C   . PHE A 1 29  ? -15.394 -18.607 -28.292 1.00 20.38  ? 48  PHE B C   1 
ATOM   81   O  O   . PHE A 1 29  ? -15.960 -19.694 -28.196 1.00 21.21  ? 48  PHE B O   1 
ATOM   82   C  CB  . PHE A 1 29  ? -15.120 -17.480 -26.064 1.00 20.55  ? 48  PHE B CB  1 
ATOM   83   C  CG  . PHE A 1 29  ? -15.731 -18.455 -25.103 1.00 21.47  ? 48  PHE B CG  1 
ATOM   84   C  CD1 . PHE A 1 29  ? -16.806 -18.084 -24.313 1.00 21.79  ? 48  PHE B CD1 1 
ATOM   85   C  CD2 . PHE A 1 29  ? -15.231 -19.741 -24.986 1.00 22.31  ? 48  PHE B CD2 1 
ATOM   86   C  CE1 . PHE A 1 29  ? -17.374 -18.976 -23.426 1.00 22.38  ? 48  PHE B CE1 1 
ATOM   87   C  CE2 . PHE A 1 29  ? -15.795 -20.640 -24.098 1.00 22.68  ? 48  PHE B CE2 1 
ATOM   88   C  CZ  . PHE A 1 29  ? -16.867 -20.257 -23.318 1.00 22.91  ? 48  PHE B CZ  1 
ATOM   89   N  N   . VAL A 1 30  ? -14.401 -18.378 -29.144 1.00 16.27  ? 49  VAL B N   1 
ATOM   90   C  CA  . VAL A 1 30  ? -13.893 -19.417 -30.031 1.00 17.47  ? 49  VAL B CA  1 
ATOM   91   C  C   . VAL A 1 30  ? -12.376 -19.532 -29.909 1.00 18.03  ? 49  VAL B C   1 
ATOM   92   O  O   . VAL A 1 30  ? -11.663 -18.536 -30.029 1.00 17.88  ? 49  VAL B O   1 
ATOM   93   C  CB  . VAL A 1 30  ? -14.272 -19.135 -31.499 1.00 17.06  ? 49  VAL B CB  1 
ATOM   94   C  CG1 . VAL A 1 30  ? -13.648 -20.171 -32.418 1.00 18.07  ? 49  VAL B CG1 1 
ATOM   95   C  CG2 . VAL A 1 30  ? -15.785 -19.113 -31.661 1.00 16.92  ? 49  VAL B CG2 1 
ATOM   96   N  N   . PRO A 1 31  ? -11.874 -20.753 -29.666 1.00 18.51  ? 50  PRO B N   1 
ATOM   97   C  CA  . PRO A 1 31  ? -12.665 -21.983 -29.526 1.00 18.95  ? 50  PRO B CA  1 
ATOM   98   C  C   . PRO A 1 31  ? -13.504 -21.999 -28.250 1.00 19.74  ? 50  PRO B C   1 
ATOM   99   O  O   . PRO A 1 31  ? -13.322 -21.143 -27.385 1.00 19.77  ? 50  PRO B O   1 
ATOM   100  C  CB  . PRO A 1 31  ? -11.602 -23.082 -29.471 1.00 20.79  ? 50  PRO B CB  1 
ATOM   101  C  CG  . PRO A 1 31  ? -10.356 -22.404 -29.035 1.00 20.77  ? 50  PRO B CG  1 
ATOM   102  C  CD  . PRO A 1 31  ? -10.428 -20.996 -29.531 1.00 19.72  ? 50  PRO B CD  1 
ATOM   103  N  N   . GLY A 1 32  ? -14.407 -22.970 -28.142 1.00 21.39  ? 51  GLY B N   1 
ATOM   104  C  CA  . GLY A 1 32  ? -15.338 -23.037 -27.030 1.00 21.59  ? 51  GLY B CA  1 
ATOM   105  C  C   . GLY A 1 32  ? -14.758 -23.601 -25.746 1.00 22.51  ? 51  GLY B C   1 
ATOM   106  O  O   . GLY A 1 32  ? -15.273 -24.578 -25.200 1.00 22.95  ? 51  GLY B O   1 
ATOM   107  N  N   . VAL A 1 33  ? -13.688 -22.979 -25.260 1.00 32.33  ? 52  VAL B N   1 
ATOM   108  C  CA  . VAL A 1 33  ? -13.068 -23.372 -23.999 1.00 32.31  ? 52  VAL B CA  1 
ATOM   109  C  C   . VAL A 1 33  ? -12.523 -22.146 -23.273 1.00 32.20  ? 52  VAL B C   1 
ATOM   110  O  O   . VAL A 1 33  ? -12.355 -21.088 -23.881 1.00 31.86  ? 52  VAL B O   1 
ATOM   111  C  CB  . VAL A 1 33  ? -11.918 -24.372 -24.221 1.00 32.62  ? 52  VAL B CB  1 
ATOM   112  C  CG1 . VAL A 1 33  ? -12.461 -25.726 -24.646 1.00 33.44  ? 52  VAL B CG1 1 
ATOM   113  C  CG2 . VAL A 1 33  ? -10.938 -23.832 -25.248 1.00 33.51  ? 52  VAL B CG2 1 
ATOM   114  N  N   . PRO A 1 34  ? -12.252 -22.282 -21.966 1.00 33.88  ? 53  PRO B N   1 
ATOM   115  C  CA  . PRO A 1 34  ? -11.636 -21.195 -21.195 1.00 34.33  ? 53  PRO B CA  1 
ATOM   116  C  C   . PRO A 1 34  ? -10.368 -20.667 -21.868 1.00 33.78  ? 53  PRO B C   1 
ATOM   117  O  O   . PRO A 1 34  ? -9.658  -21.419 -22.538 1.00 33.91  ? 53  PRO B O   1 
ATOM   118  C  CB  . PRO A 1 34  ? -11.297 -21.867 -19.863 1.00 34.75  ? 53  PRO B CB  1 
ATOM   119  C  CG  . PRO A 1 34  ? -12.321 -22.943 -19.728 1.00 35.23  ? 53  PRO B CG  1 
ATOM   120  C  CD  . PRO A 1 34  ? -12.578 -23.445 -21.122 1.00 34.53  ? 53  PRO B CD  1 
ATOM   121  N  N   . GLU A 1 35  ? -10.093 -19.381 -21.683 1.00 23.83  ? 54  GLU B N   1 
ATOM   122  C  CA  . GLU A 1 35  ? -8.995  -18.718 -22.376 1.00 23.97  ? 54  GLU B CA  1 
ATOM   123  C  C   . GLU A 1 35  ? -7.615  -19.236 -21.972 1.00 25.97  ? 54  GLU B C   1 
ATOM   124  O  O   . GLU A 1 35  ? -6.689  -19.242 -22.781 1.00 26.48  ? 54  GLU B O   1 
ATOM   125  C  CB  . GLU A 1 35  ? -9.065  -17.206 -22.155 1.00 23.17  ? 54  GLU B CB  1 
ATOM   126  C  CG  . GLU A 1 35  ? -7.974  -16.425 -22.864 1.00 22.67  ? 54  GLU B CG  1 
ATOM   127  C  CD  . GLU A 1 35  ? -8.029  -14.943 -22.561 1.00 22.10  ? 54  GLU B CD  1 
ATOM   128  O  OE1 . GLU A 1 35  ? -8.444  -14.579 -21.440 1.00 21.98  ? 54  GLU B OE1 1 
ATOM   129  O  OE2 . GLU A 1 35  ? -7.655  -14.140 -23.442 1.00 21.88  ? 54  GLU B OE2 1 
ATOM   130  N  N   . ARG A 1 36  ? -7.480  -19.668 -20.722 1.00 49.43  ? 55  ARG B N   1 
ATOM   131  C  CA  . ARG A 1 36  ? -6.175  -20.070 -20.201 1.00 50.62  ? 55  ARG B CA  1 
ATOM   132  C  C   . ARG A 1 36  ? -5.872  -21.560 -20.360 1.00 51.18  ? 55  ARG B C   1 
ATOM   133  O  O   . ARG A 1 36  ? -4.876  -22.052 -19.828 1.00 52.59  ? 55  ARG B O   1 
ATOM   134  C  CB  . ARG A 1 36  ? -6.026  -19.655 -18.737 1.00 51.76  ? 55  ARG B CB  1 
ATOM   135  C  CG  . ARG A 1 36  ? -6.104  -18.153 -18.509 1.00 53.51  ? 55  ARG B CG  1 
ATOM   136  C  CD  . ARG A 1 36  ? -6.104  -17.832 -17.026 1.00 55.04  ? 55  ARG B CD  1 
ATOM   137  N  NE  . ARG A 1 36  ? -6.830  -16.600 -16.735 1.00 56.20  ? 55  ARG B NE  1 
ATOM   138  C  CZ  . ARG A 1 36  ? -7.237  -16.245 -15.519 1.00 57.92  ? 55  ARG B CZ  1 
ATOM   139  N  NH1 . ARG A 1 36  ? -6.989  -17.029 -14.476 1.00 57.28  ? 55  ARG B NH1 1 
ATOM   140  N  NH2 . ARG A 1 36  ? -7.896  -15.106 -15.345 1.00 57.76  ? 55  ARG B NH2 1 
ATOM   141  N  N   . THR A 1 37  ? -6.723  -22.276 -21.088 1.00 42.21  ? 56  THR B N   1 
ATOM   142  C  CA  . THR A 1 37  ? -6.459  -23.681 -21.380 1.00 43.22  ? 56  THR B CA  1 
ATOM   143  C  C   . THR A 1 37  ? -5.441  -23.792 -22.513 1.00 43.61  ? 56  THR B C   1 
ATOM   144  O  O   . THR A 1 37  ? -5.079  -22.790 -23.128 1.00 42.84  ? 56  THR B O   1 
ATOM   145  C  CB  . THR A 1 37  ? -7.746  -24.459 -21.744 1.00 42.54  ? 56  THR B CB  1 
ATOM   146  O  OG1 . THR A 1 37  ? -8.328  -23.915 -22.935 1.00 41.49  ? 56  THR B OG1 1 
ATOM   147  C  CG2 . THR A 1 37  ? -8.755  -24.386 -20.607 1.00 40.89  ? 56  THR B CG2 1 
ATOM   148  N  N   . LEU A 1 38  ? -4.978  -25.009 -22.781 1.00 25.40  ? 57  LEU B N   1 
ATOM   149  C  CA  . LEU A 1 38  ? -3.977  -25.230 -23.819 1.00 25.36  ? 57  LEU B CA  1 
ATOM   150  C  C   . LEU A 1 38  ? -4.581  -25.154 -25.218 1.00 24.88  ? 57  LEU B C   1 
ATOM   151  O  O   . LEU A 1 38  ? -3.907  -24.767 -26.175 1.00 24.31  ? 57  LEU B O   1 
ATOM   152  C  CB  . LEU A 1 38  ? -3.271  -26.571 -23.614 1.00 26.18  ? 57  LEU B CB  1 
ATOM   153  C  CG  . LEU A 1 38  ? -2.419  -26.683 -22.349 1.00 27.26  ? 57  LEU B CG  1 
ATOM   154  C  CD1 . LEU A 1 38  ? -1.623  -27.979 -22.359 1.00 30.25  ? 57  LEU B CD1 1 
ATOM   155  C  CD2 . LEU A 1 38  ? -1.493  -25.485 -22.219 1.00 26.80  ? 57  LEU B CD2 1 
ATOM   156  N  N   . GLY A 1 39  ? -5.853  -25.521 -25.333 1.00 32.48  ? 58  GLY B N   1 
ATOM   157  C  CA  . GLY A 1 39  ? -6.540  -25.469 -26.610 1.00 32.47  ? 58  GLY B CA  1 
ATOM   158  C  C   . GLY A 1 39  ? -6.635  -24.049 -27.132 1.00 31.20  ? 58  GLY B C   1 
ATOM   159  O  O   . GLY A 1 39  ? -6.715  -23.825 -28.342 1.00 29.83  ? 58  GLY B O   1 
ATOM   160  N  N   . ALA A 1 40  ? -6.619  -23.090 -26.210 1.00 21.86  ? 59  ALA B N   1 
ATOM   161  C  CA  . ALA A 1 40  ? -6.734  -21.680 -26.557 1.00 20.44  ? 59  ALA B CA  1 
ATOM   162  C  C   . ALA A 1 40  ? -5.389  -20.961 -26.472 1.00 21.90  ? 59  ALA B C   1 
ATOM   163  O  O   . ALA A 1 40  ? -4.389  -21.430 -27.019 1.00 22.51  ? 59  ALA B O   1 
ATOM   164  C  CB  . ALA A 1 40  ? -7.759  -21.000 -25.662 1.00 19.67  ? 59  ALA B CB  1 
ATOM   165  N  N   . SER A 1 41  ? -5.371  -19.823 -25.783 1.00 28.14  ? 60  SER B N   1 
ATOM   166  C  CA  . SER A 1 41  ? -4.175  -18.990 -25.698 1.00 28.10  ? 60  SER B CA  1 
ATOM   167  C  C   . SER A 1 41  ? -3.130  -19.560 -24.738 1.00 29.22  ? 60  SER B C   1 
ATOM   168  O  O   . SER A 1 41  ? -1.928  -19.360 -24.923 1.00 29.83  ? 60  SER B O   1 
ATOM   169  C  CB  . SER A 1 41  ? -4.551  -17.567 -25.286 1.00 26.42  ? 60  SER B CB  1 
ATOM   170  O  OG  . SER A 1 41  ? -5.376  -16.958 -26.265 1.00 25.21  ? 60  SER B OG  1 
ATOM   171  N  N   . GLY A 1 42  ? -3.590  -20.268 -23.713 1.00 26.13  ? 61  GLY B N   1 
ATOM   172  C  CA  . GLY A 1 42  ? -2.685  -20.846 -22.739 1.00 26.58  ? 61  GLY B CA  1 
ATOM   173  C  C   . GLY A 1 42  ? -2.684  -20.090 -21.426 1.00 27.33  ? 61  GLY B C   1 
ATOM   174  O  O   . GLY A 1 42  ? -3.404  -19.104 -21.270 1.00 26.82  ? 61  GLY B O   1 
ATOM   175  N  N   . PRO A 1 43  ? -1.871  -20.552 -20.468 1.00 26.39  ? 62  PRO B N   1 
ATOM   176  C  CA  . PRO A 1 43  ? -1.791  -19.951 -19.134 1.00 26.01  ? 62  PRO B CA  1 
ATOM   177  C  C   . PRO A 1 43  ? -1.162  -18.564 -19.169 1.00 24.77  ? 62  PRO B C   1 
ATOM   178  O  O   . PRO A 1 43  ? -0.434  -18.239 -20.108 1.00 23.90  ? 62  PRO B O   1 
ATOM   179  C  CB  . PRO A 1 43  ? -0.878  -20.919 -18.369 1.00 28.11  ? 62  PRO B CB  1 
ATOM   180  C  CG  . PRO A 1 43  ? -0.872  -22.186 -19.179 1.00 29.24  ? 62  PRO B CG  1 
ATOM   181  C  CD  . PRO A 1 43  ? -1.009  -21.738 -20.593 1.00 27.75  ? 62  PRO B CD  1 
ATOM   182  N  N   . ALA A 1 44  ? -1.450  -17.762 -18.150 1.00 21.74  ? 63  ALA B N   1 
ATOM   183  C  CA  . ALA A 1 44  ? -0.832  -16.450 -18.003 1.00 21.28  ? 63  ALA B CA  1 
ATOM   184  C  C   . ALA A 1 44  ? 0.480   -16.577 -17.231 1.00 21.81  ? 63  ALA B C   1 
ATOM   185  O  O   . ALA A 1 44  ? 0.522   -17.178 -16.158 1.00 21.24  ? 63  ALA B O   1 
ATOM   186  C  CB  . ALA A 1 44  ? -1.780  -15.496 -17.298 1.00 20.85  ? 63  ALA B CB  1 
ATOM   187  N  N   . GLU A 1 45  ? 1.547   -16.007 -17.784 1.00 36.98  ? 64  GLU B N   1 
ATOM   188  C  CA  . GLU A 1 45  ? 2.878   -16.138 -17.200 1.00 37.39  ? 64  GLU B CA  1 
ATOM   189  C  C   . GLU A 1 45  ? 3.212   -15.011 -16.227 1.00 37.52  ? 64  GLU B C   1 
ATOM   190  O  O   . GLU A 1 45  ? 4.382   -14.746 -15.952 1.00 38.38  ? 64  GLU B O   1 
ATOM   191  C  CB  . GLU A 1 45  ? 3.938   -16.183 -18.301 1.00 37.76  ? 64  GLU B CB  1 
ATOM   192  C  CG  . GLU A 1 45  ? 3.706   -17.253 -19.347 1.00 37.90  ? 64  GLU B CG  1 
ATOM   193  C  CD  . GLU A 1 45  ? 4.771   -17.243 -20.423 1.00 40.00  ? 64  GLU B CD  1 
ATOM   194  O  OE1 . GLU A 1 45  ? 5.711   -16.426 -20.322 1.00 40.69  ? 64  GLU B OE1 1 
ATOM   195  O  OE2 . GLU A 1 45  ? 4.673   -18.052 -21.368 1.00 41.60  ? 64  GLU B OE2 1 
ATOM   196  N  N   . GLY A 1 46  ? 2.185   -14.349 -15.707 1.00 31.93  ? 65  GLY B N   1 
ATOM   197  C  CA  . GLY A 1 46  ? 2.392   -13.245 -14.790 1.00 31.38  ? 65  GLY B CA  1 
ATOM   198  C  C   . GLY A 1 46  ? 2.303   -11.902 -15.488 1.00 31.82  ? 65  GLY B C   1 
ATOM   199  O  O   . GLY A 1 46  ? 2.336   -11.822 -16.716 1.00 32.11  ? 65  GLY B O   1 
ATOM   200  N  N   . ARG A 1 47  ? 2.199   -10.842 -14.695 1.00 38.05  ? 66  ARG B N   1 
ATOM   201  C  CA  . ARG A 1 47  ? 2.005   -9.499  -15.222 1.00 37.66  ? 66  ARG B CA  1 
ATOM   202  C  C   . ARG A 1 47  ? 3.329   -8.830  -15.594 1.00 39.12  ? 66  ARG B C   1 
ATOM   203  O  O   . ARG A 1 47  ? 4.347   -9.027  -14.930 1.00 40.10  ? 66  ARG B O   1 
ATOM   204  C  CB  . ARG A 1 47  ? 1.242   -8.656  -14.199 1.00 37.33  ? 66  ARG B CB  1 
ATOM   205  C  CG  . ARG A 1 47  ? 0.897   -7.252  -14.654 1.00 37.22  ? 66  ARG B CG  1 
ATOM   206  C  CD  . ARG A 1 47  ? -0.144  -6.641  -13.729 1.00 37.09  ? 66  ARG B CD  1 
ATOM   207  N  NE  . ARG A 1 47  ? -0.325  -5.212  -13.966 1.00 37.02  ? 66  ARG B NE  1 
ATOM   208  C  CZ  . ARG A 1 47  ? -1.300  -4.486  -13.428 1.00 36.61  ? 66  ARG B CZ  1 
ATOM   209  N  NH1 . ARG A 1 47  ? -2.190  -5.061  -12.627 1.00 36.76  ? 66  ARG B NH1 1 
ATOM   210  N  NH2 . ARG A 1 47  ? -1.390  -3.190  -13.696 1.00 35.61  ? 66  ARG B NH2 1 
ATOM   211  N  N   . VAL A 1 48  ? 3.308   -8.041  -16.664 1.00 28.45  ? 67  VAL B N   1 
ATOM   212  C  CA  . VAL A 1 48  ? 4.501   -7.341  -17.125 1.00 28.83  ? 67  VAL B CA  1 
ATOM   213  C  C   . VAL A 1 48  ? 4.414   -5.849  -16.818 1.00 30.04  ? 67  VAL B C   1 
ATOM   214  O  O   . VAL A 1 48  ? 3.458   -5.179  -17.216 1.00 29.11  ? 67  VAL B O   1 
ATOM   215  C  CB  . VAL A 1 48  ? 4.715   -7.527  -18.638 1.00 28.91  ? 67  VAL B CB  1 
ATOM   216  C  CG1 . VAL A 1 48  ? 5.963   -6.785  -19.094 1.00 31.01  ? 67  VAL B CG1 1 
ATOM   217  C  CG2 . VAL A 1 48  ? 4.812   -9.003  -18.979 1.00 28.95  ? 67  VAL B CG2 1 
ATOM   218  N  N   . ALA A 1 49  ? 5.416   -5.335  -16.110 1.00 22.58  ? 68  ALA B N   1 
ATOM   219  C  CA  . ALA A 1 49  ? 5.470   -3.916  -15.774 1.00 21.94  ? 68  ALA B CA  1 
ATOM   220  C  C   . ALA A 1 49  ? 6.401   -3.162  -16.718 1.00 23.89  ? 68  ALA B C   1 
ATOM   221  O  O   . ALA A 1 49  ? 7.276   -3.755  -17.348 1.00 24.08  ? 68  ALA B O   1 
ATOM   222  C  CB  . ALA A 1 49  ? 5.903   -3.725  -14.333 1.00 22.08  ? 68  ALA B CB  1 
ATOM   223  N  N   . ARG A 1 50  ? 6.208   -1.850  -16.803 1.00 36.97  ? 69  ARG B N   1 
ATOM   224  C  CA  . ARG A 1 50  ? 6.951   -1.016  -17.743 1.00 37.07  ? 69  ARG B CA  1 
ATOM   225  C  C   . ARG A 1 50  ? 8.467   -1.105  -17.559 1.00 39.10  ? 69  ARG B C   1 
ATOM   226  O  O   . ARG A 1 50  ? 9.214   -1.202  -18.532 1.00 39.87  ? 69  ARG B O   1 
ATOM   227  C  CB  . ARG A 1 50  ? 6.488   0.440   -17.640 1.00 35.50  ? 69  ARG B CB  1 
ATOM   228  C  CG  . ARG A 1 50  ? 7.175   1.389   -18.607 1.00 35.34  ? 69  ARG B CG  1 
ATOM   229  C  CD  . ARG A 1 50  ? 6.454   2.725   -18.667 1.00 34.34  ? 69  ARG B CD  1 
ATOM   230  N  NE  . ARG A 1 50  ? 5.140   2.607   -19.295 1.00 34.81  ? 69  ARG B NE  1 
ATOM   231  C  CZ  . ARG A 1 50  ? 4.897   2.871   -20.575 1.00 34.37  ? 69  ARG B CZ  1 
ATOM   232  N  NH1 . ARG A 1 50  ? 5.879   3.273   -21.370 1.00 34.99  ? 69  ARG B NH1 1 
ATOM   233  N  NH2 . ARG A 1 50  ? 3.671   2.736   -21.062 1.00 33.00  ? 69  ARG B NH2 1 
ATOM   234  N  N   . GLY A 1 51  ? 8.919   -1.076  -16.312 1.00 54.55  ? 70  GLY B N   1 
ATOM   235  C  CA  . GLY A 1 51  ? 10.343  -1.074  -16.036 1.00 56.37  ? 70  GLY B CA  1 
ATOM   236  C  C   . GLY A 1 51  ? 10.979  -2.449  -16.084 1.00 58.22  ? 70  GLY B C   1 
ATOM   237  O  O   . GLY A 1 51  ? 12.179  -2.590  -15.847 1.00 60.19  ? 70  GLY B O   1 
ATOM   238  N  N   . SER A 1 52  ? 10.179  -3.465  -16.397 1.00 43.17  ? 71  SER B N   1 
ATOM   239  C  CA  . SER A 1 52  ? 10.653  -4.847  -16.356 1.00 43.92  ? 71  SER B CA  1 
ATOM   240  C  C   . SER A 1 52  ? 11.447  -5.237  -17.602 1.00 44.21  ? 71  SER B C   1 
ATOM   241  O  O   . SER A 1 52  ? 11.569  -4.459  -18.547 1.00 43.40  ? 71  SER B O   1 
ATOM   242  C  CB  . SER A 1 52  ? 9.487   -5.818  -16.146 1.00 42.09  ? 71  SER B CB  1 
ATOM   243  O  OG  . SER A 1 52  ? 8.661   -5.884  -17.294 1.00 41.56  ? 71  SER B OG  1 
ATOM   244  N  N   . GLU A 1 53  ? 11.986  -6.453  -17.584 1.00 55.05  ? 72  GLU B N   1 
ATOM   245  C  CA  . GLU A 1 53  ? 12.783  -6.965  -18.693 1.00 55.95  ? 72  GLU B CA  1 
ATOM   246  C  C   . GLU A 1 53  ? 11.890  -7.570  -19.773 1.00 54.71  ? 72  GLU B C   1 
ATOM   247  O  O   . GLU A 1 53  ? 12.224  -7.542  -20.957 1.00 55.36  ? 72  GLU B O   1 
ATOM   248  C  CB  . GLU A 1 53  ? 13.788  -8.007  -18.188 1.00 57.74  ? 72  GLU B CB  1 
ATOM   249  C  CG  . GLU A 1 53  ? 14.711  -8.568  -19.265 1.00 59.55  ? 72  GLU B CG  1 
ATOM   250  C  CD  . GLU A 1 53  ? 15.755  -7.567  -19.729 1.00 60.01  ? 72  GLU B CD  1 
ATOM   251  O  OE1 . GLU A 1 53  ? 16.093  -6.650  -18.949 1.00 60.50  ? 72  GLU B OE1 1 
ATOM   252  O  OE2 . GLU A 1 53  ? 16.241  -7.700  -20.873 1.00 59.40  ? 72  GLU B OE2 1 
ATOM   253  N  N   . ARG A 1 54  ? 10.752  -8.117  -19.356 1.00 43.49  ? 73  ARG B N   1 
ATOM   254  C  CA  . ARG A 1 54  ? 9.784   -8.675  -20.295 1.00 42.77  ? 73  ARG B CA  1 
ATOM   255  C  C   . ARG A 1 54  ? 9.127   -7.570  -21.117 1.00 41.79  ? 73  ARG B C   1 
ATOM   256  O  O   . ARG A 1 54  ? 8.677   -7.800  -22.239 1.00 41.02  ? 73  ARG B O   1 
ATOM   257  C  CB  . ARG A 1 54  ? 8.717   -9.484  -19.555 1.00 40.81  ? 73  ARG B CB  1 
ATOM   258  C  CG  . ARG A 1 54  ? 9.236   -10.755 -18.899 1.00 40.66  ? 73  ARG B CG  1 
ATOM   259  C  CD  . ARG A 1 54  ? 8.125   -11.475 -18.151 1.00 40.61  ? 73  ARG B CD  1 
ATOM   260  N  NE  . ARG A 1 54  ? 7.035   -11.875 -19.039 1.00 39.83  ? 73  ARG B NE  1 
ATOM   261  C  CZ  . ARG A 1 54  ? 5.801   -12.152 -18.629 1.00 38.20  ? 73  ARG B CZ  1 
ATOM   262  N  NH1 . ARG A 1 54  ? 5.491   -12.066 -17.342 1.00 38.49  ? 73  ARG B NH1 1 
ATOM   263  N  NH2 . ARG A 1 54  ? 4.872   -12.507 -19.507 1.00 36.17  ? 73  ARG B NH2 1 
ATOM   264  N  N   . PHE A 1 55  ? 9.077   -6.369  -20.550 1.00 28.00  ? 74  PHE B N   1 
ATOM   265  C  CA  . PHE A 1 55  ? 8.519   -5.216  -21.241 1.00 26.74  ? 74  PHE B CA  1 
ATOM   266  C  C   . PHE A 1 55  ? 9.335   -4.882  -22.483 1.00 27.87  ? 74  PHE B C   1 
ATOM   267  O  O   . PHE A 1 55  ? 8.804   -4.363  -23.465 1.00 27.12  ? 74  PHE B O   1 
ATOM   268  C  CB  . PHE A 1 55  ? 8.479   -4.008  -20.306 1.00 27.11  ? 74  PHE B CB  1 
ATOM   269  C  CG  . PHE A 1 55  ? 7.953   -2.758  -20.953 1.00 26.48  ? 74  PHE B CG  1 
ATOM   270  C  CD1 . PHE A 1 55  ? 6.602   -2.459  -20.914 1.00 25.17  ? 74  PHE B CD1 1 
ATOM   271  C  CD2 . PHE A 1 55  ? 8.811   -1.878  -21.595 1.00 27.32  ? 74  PHE B CD2 1 
ATOM   272  C  CE1 . PHE A 1 55  ? 6.114   -1.308  -21.505 1.00 24.67  ? 74  PHE B CE1 1 
ATOM   273  C  CE2 . PHE A 1 55  ? 8.330   -0.727  -22.189 1.00 26.73  ? 74  PHE B CE2 1 
ATOM   274  C  CZ  . PHE A 1 55  ? 6.979   -0.441  -22.144 1.00 25.05  ? 74  PHE B CZ  1 
ATOM   275  N  N   . ARG A 1 56  ? 10.628  -5.183  -22.433 1.00 47.70  ? 75  ARG B N   1 
ATOM   276  C  CA  . ARG A 1 56  ? 11.544  -4.853  -23.522 1.00 47.25  ? 75  ARG B CA  1 
ATOM   277  C  C   . ARG A 1 56  ? 11.331  -5.736  -24.746 1.00 46.96  ? 75  ARG B C   1 
ATOM   278  O  O   . ARG A 1 56  ? 11.725  -5.377  -25.855 1.00 46.75  ? 75  ARG B O   1 
ATOM   279  C  CB  . ARG A 1 56  ? 12.996  -4.937  -23.045 1.00 48.19  ? 75  ARG B CB  1 
ATOM   280  C  CG  . ARG A 1 56  ? 13.362  -3.859  -22.038 1.00 49.85  ? 75  ARG B CG  1 
ATOM   281  C  CD  . ARG A 1 56  ? 14.821  -3.936  -21.615 1.00 51.56  ? 75  ARG B CD  1 
ATOM   282  N  NE  . ARG A 1 56  ? 15.193  -2.803  -20.770 1.00 51.08  ? 75  ARG B NE  1 
ATOM   283  C  CZ  . ARG A 1 56  ? 16.290  -2.753  -20.023 1.00 50.25  ? 75  ARG B CZ  1 
ATOM   284  N  NH1 . ARG A 1 56  ? 17.133  -3.778  -20.008 1.00 51.09  ? 75  ARG B NH1 1 
ATOM   285  N  NH2 . ARG A 1 56  ? 16.543  -1.680  -19.285 1.00 48.55  ? 75  ARG B NH2 1 
ATOM   286  N  N   . ASP A 1 57  ? 10.705  -6.890  -24.538 1.00 45.20  ? 76  ASP B N   1 
ATOM   287  C  CA  . ASP A 1 57  ? 10.374  -7.791  -25.636 1.00 44.85  ? 76  ASP B CA  1 
ATOM   288  C  C   . ASP A 1 57  ? 9.167   -7.268  -26.405 1.00 42.84  ? 76  ASP B C   1 
ATOM   289  O  O   . ASP A 1 57  ? 8.979   -7.586  -27.579 1.00 42.95  ? 76  ASP B O   1 
ATOM   290  C  CB  . ASP A 1 57  ? 10.088  -9.198  -25.113 1.00 45.22  ? 76  ASP B CB  1 
ATOM   291  C  CG  . ASP A 1 57  ? 11.290  -9.824  -24.437 1.00 47.39  ? 76  ASP B CG  1 
ATOM   292  O  OD1 . ASP A 1 57  ? 12.419  -9.336  -24.657 1.00 48.33  ? 76  ASP B OD1 1 
ATOM   293  O  OD2 . ASP A 1 57  ? 11.105  -10.807 -23.688 1.00 47.28  ? 76  ASP B OD2 1 
ATOM   294  N  N   . LEU A 1 58  ? 8.348   -6.468  -25.732 1.00 24.89  ? 77  LEU B N   1 
ATOM   295  C  CA  . LEU A 1 58  ? 7.177   -5.883  -26.365 1.00 24.14  ? 77  LEU B CA  1 
ATOM   296  C  C   . LEU A 1 58  ? 7.590   -4.798  -27.353 1.00 25.27  ? 77  LEU B C   1 
ATOM   297  O  O   . LEU A 1 58  ? 8.254   -3.827  -26.985 1.00 25.57  ? 77  LEU B O   1 
ATOM   298  C  CB  . LEU A 1 58  ? 6.228   -5.312  -25.312 1.00 23.11  ? 77  LEU B CB  1 
ATOM   299  C  CG  . LEU A 1 58  ? 5.721   -6.330  -24.291 1.00 23.26  ? 77  LEU B CG  1 
ATOM   300  C  CD1 . LEU A 1 58  ? 4.719   -5.692  -23.342 1.00 22.47  ? 77  LEU B CD1 1 
ATOM   301  C  CD2 . LEU A 1 58  ? 5.109   -7.527  -24.999 1.00 22.00  ? 77  LEU B CD2 1 
ATOM   302  N  N   . VAL A 1 59  ? 7.194   -4.970  -28.609 1.00 44.58  ? 78  VAL B N   1 
ATOM   303  C  CA  . VAL A 1 59  ? 7.535   -4.011  -29.651 1.00 43.97  ? 78  VAL B CA  1 
ATOM   304  C  C   . VAL A 1 59  ? 6.305   -3.221  -30.082 1.00 42.37  ? 78  VAL B C   1 
ATOM   305  O  O   . VAL A 1 59  ? 5.250   -3.799  -30.337 1.00 42.01  ? 78  VAL B O   1 
ATOM   306  C  CB  . VAL A 1 59  ? 8.144   -4.711  -30.876 1.00 43.97  ? 78  VAL B CB  1 
ATOM   307  C  CG1 . VAL A 1 59  ? 8.828   -3.698  -31.781 1.00 44.01  ? 78  VAL B CG1 1 
ATOM   308  C  CG2 . VAL A 1 59  ? 9.130   -5.777  -30.430 1.00 45.31  ? 78  VAL B CG2 1 
ATOM   309  N  N   . PRO A 1 60  ? 6.438   -1.888  -30.152 1.00 20.47  ? 79  PRO B N   1 
ATOM   310  C  CA  . PRO A 1 60  ? 5.342   -1.011  -30.578 1.00 18.50  ? 79  PRO B CA  1 
ATOM   311  C  C   . PRO A 1 60  ? 4.891   -1.315  -32.001 1.00 18.16  ? 79  PRO B C   1 
ATOM   312  O  O   . PRO A 1 60  ? 5.719   -1.401  -32.906 1.00 18.89  ? 79  PRO B O   1 
ATOM   313  C  CB  . PRO A 1 60  ? 5.968   0.385   -30.521 1.00 18.86  ? 79  PRO B CB  1 
ATOM   314  C  CG  . PRO A 1 60  ? 7.105   0.259   -29.569 1.00 19.80  ? 79  PRO B CG  1 
ATOM   315  C  CD  . PRO A 1 60  ? 7.635   -1.125  -29.761 1.00 20.87  ? 79  PRO B CD  1 
ATOM   316  N  N   . ASN A 1 61  ? 3.588   -1.482  -32.186 1.00 19.34  ? 80  ASN B N   1 
ATOM   317  C  CA  . ASN A 1 61  ? 3.019   -1.681  -33.510 1.00 19.00  ? 80  ASN B CA  1 
ATOM   318  C  C   . ASN A 1 61  ? 2.569   -0.345  -34.085 1.00 18.10  ? 80  ASN B C   1 
ATOM   319  O  O   . ASN A 1 61  ? 1.723   0.333   -33.504 1.00 17.31  ? 80  ASN B O   1 
ATOM   320  C  CB  . ASN A 1 61  ? 1.843   -2.658  -33.439 1.00 18.43  ? 80  ASN B CB  1 
ATOM   321  C  CG  . ASN A 1 61  ? 1.296   -3.024  -34.809 1.00 17.49  ? 80  ASN B CG  1 
ATOM   322  O  OD1 . ASN A 1 61  ? 1.649   -2.415  -35.815 1.00 18.43  ? 80  ASN B OD1 1 
ATOM   323  N  ND2 . ASN A 1 61  ? 0.425   -4.024  -34.850 1.00 17.31  ? 80  ASN B ND2 1 
ATOM   324  N  N   . TYR A 1 62  ? 3.144   0.040   -35.219 1.00 18.09  ? 81  TYR B N   1 
ATOM   325  C  CA  . TYR A 1 62  ? 2.809   1.317   -35.844 1.00 18.99  ? 81  TYR B CA  1 
ATOM   326  C  C   . TYR A 1 62  ? 2.065   1.143   -37.168 1.00 18.46  ? 81  TYR B C   1 
ATOM   327  O  O   . TYR A 1 62  ? 1.931   2.094   -37.941 1.00 17.63  ? 81  TYR B O   1 
ATOM   328  C  CB  . TYR A 1 62  ? 4.067   2.169   -36.048 1.00 19.52  ? 81  TYR B CB  1 
ATOM   329  C  CG  . TYR A 1 62  ? 4.621   2.763   -34.771 1.00 19.29  ? 81  TYR B CG  1 
ATOM   330  C  CD1 . TYR A 1 62  ? 3.968   3.806   -34.127 1.00 19.01  ? 81  TYR B CD1 1 
ATOM   331  C  CD2 . TYR A 1 62  ? 5.802   2.286   -34.213 1.00 19.73  ? 81  TYR B CD2 1 
ATOM   332  C  CE1 . TYR A 1 62  ? 4.469   4.355   -32.961 1.00 19.43  ? 81  TYR B CE1 1 
ATOM   333  C  CE2 . TYR A 1 62  ? 6.312   2.829   -33.046 1.00 19.81  ? 81  TYR B CE2 1 
ATOM   334  C  CZ  . TYR A 1 62  ? 5.641   3.864   -32.424 1.00 19.89  ? 81  TYR B CZ  1 
ATOM   335  O  OH  . TYR A 1 62  ? 6.140   4.409   -31.262 1.00 19.71  ? 81  TYR B OH  1 
ATOM   336  N  N   . ASN A 1 63  ? 1.583   -0.070  -37.420 1.00 34.17  ? 82  ASN B N   1 
ATOM   337  C  CA  . ASN A 1 63  ? 0.850   -0.377  -38.645 1.00 33.52  ? 82  ASN B CA  1 
ATOM   338  C  C   . ASN A 1 63  ? -0.252  0.641   -38.922 1.00 33.47  ? 82  ASN B C   1 
ATOM   339  O  O   . ASN A 1 63  ? -1.246  0.703   -38.197 1.00 33.29  ? 82  ASN B O   1 
ATOM   340  C  CB  . ASN A 1 63  ? 0.258   -1.788  -38.572 1.00 33.15  ? 82  ASN B CB  1 
ATOM   341  C  CG  . ASN A 1 63  ? -0.418  -2.207  -39.866 1.00 33.32  ? 82  ASN B CG  1 
ATOM   342  O  OD1 . ASN A 1 63  ? -0.379  -1.487  -40.864 1.00 33.46  ? 82  ASN B OD1 1 
ATOM   343  N  ND2 . ASN A 1 63  ? -1.040  -3.380  -39.853 1.00 32.74  ? 82  ASN B ND2 1 
ATOM   344  N  N   . PRO A 1 64  ? -0.076  1.446   -39.981 1.00 20.79  ? 83  PRO B N   1 
ATOM   345  C  CA  . PRO A 1 64  ? -1.022  2.502   -40.356 1.00 20.25  ? 83  PRO B CA  1 
ATOM   346  C  C   . PRO A 1 64  ? -2.405  1.937   -40.653 1.00 20.06  ? 83  PRO B C   1 
ATOM   347  O  O   . PRO A 1 64  ? -3.383  2.685   -40.689 1.00 20.25  ? 83  PRO B O   1 
ATOM   348  C  CB  . PRO A 1 64  ? -0.400  3.078   -41.635 1.00 21.67  ? 83  PRO B CB  1 
ATOM   349  C  CG  . PRO A 1 64  ? 0.497   1.980   -42.138 1.00 21.72  ? 83  PRO B CG  1 
ATOM   350  C  CD  . PRO A 1 64  ? 1.080   1.421   -40.890 1.00 21.32  ? 83  PRO B CD  1 
ATOM   351  N  N   . ASP A 1 65  ? -2.475  0.626   -40.863 1.00 22.14  ? 84  ASP B N   1 
ATOM   352  C  CA  . ASP A 1 65  ? -3.731  -0.046  -41.175 1.00 21.93  ? 84  ASP B CA  1 
ATOM   353  C  C   . ASP A 1 65  ? -4.646  -0.131  -39.960 1.00 21.46  ? 84  ASP B C   1 
ATOM   354  O  O   . ASP A 1 65  ? -5.822  -0.480  -40.078 1.00 20.98  ? 84  ASP B O   1 
ATOM   355  C  CB  . ASP A 1 65  ? -3.462  -1.454  -41.710 1.00 22.09  ? 84  ASP B CB  1 
ATOM   356  C  CG  . ASP A 1 65  ? -2.964  -1.449  -43.139 1.00 22.17  ? 84  ASP B CG  1 
ATOM   357  O  OD1 . ASP A 1 65  ? -3.224  -0.460  -43.857 1.00 23.08  ? 84  ASP B OD1 1 
ATOM   358  O  OD2 . ASP A 1 65  ? -2.321  -2.437  -43.546 1.00 21.53  ? 84  ASP B OD2 1 
ATOM   359  N  N   . ILE A 1 66  ? -4.103  0.189   -38.791 1.00 16.78  ? 85  ILE B N   1 
ATOM   360  C  CA  . ILE A 1 66  ? -4.844  0.043   -37.546 1.00 15.33  ? 85  ILE B CA  1 
ATOM   361  C  C   . ILE A 1 66  ? -4.940  1.355   -36.780 1.00 14.79  ? 85  ILE B C   1 
ATOM   362  O  O   . ILE A 1 66  ? -3.970  2.104   -36.686 1.00 15.20  ? 85  ILE B O   1 
ATOM   363  C  CB  . ILE A 1 66  ? -4.197  -1.015  -36.635 1.00 15.80  ? 85  ILE B CB  1 
ATOM   364  C  CG1 . ILE A 1 66  ? -3.947  -2.307  -37.416 1.00 16.15  ? 85  ILE B CG1 1 
ATOM   365  C  CG2 . ILE A 1 66  ? -5.069  -1.278  -35.417 1.00 15.66  ? 85  ILE B CG2 1 
ATOM   366  C  CD1 . ILE A 1 66  ? -3.258  -3.383  -36.612 1.00 16.29  ? 85  ILE B CD1 1 
ATOM   367  N  N   . ILE A 1 67  ? -6.120  1.623   -36.234 1.00 20.38  ? 86  ILE B N   1 
ATOM   368  C  CA  . ILE A 1 67  ? -6.332  2.786   -35.387 1.00 20.11  ? 86  ILE B CA  1 
ATOM   369  C  C   . ILE A 1 67  ? -6.101  2.402   -33.934 1.00 20.54  ? 86  ILE B C   1 
ATOM   370  O  O   . ILE A 1 67  ? -6.631  1.398   -33.462 1.00 20.41  ? 86  ILE B O   1 
ATOM   371  C  CB  . ILE A 1 67  ? -7.761  3.333   -35.531 1.00 19.94  ? 86  ILE B CB  1 
ATOM   372  C  CG1 . ILE A 1 67  ? -8.004  3.826   -36.958 1.00 20.40  ? 86  ILE B CG1 1 
ATOM   373  C  CG2 . ILE A 1 67  ? -8.010  4.447   -34.525 1.00 19.73  ? 86  ILE B CG2 1 
ATOM   374  C  CD1 . ILE A 1 67  ? -9.407  4.334   -37.193 1.00 19.73  ? 86  ILE B CD1 1 
ATOM   375  N  N   . PHE A 1 68  ? -5.305  3.198   -33.229 1.00 19.83  ? 87  PHE B N   1 
ATOM   376  C  CA  . PHE A 1 68  ? -5.042  2.946   -31.819 1.00 19.94  ? 87  PHE B CA  1 
ATOM   377  C  C   . PHE A 1 68  ? -5.583  4.074   -30.952 1.00 21.15  ? 87  PHE B C   1 
ATOM   378  O  O   . PHE A 1 68  ? -5.078  5.197   -30.984 1.00 21.77  ? 87  PHE B O   1 
ATOM   379  C  CB  . PHE A 1 68  ? -3.546  2.745   -31.569 1.00 21.08  ? 87  PHE B CB  1 
ATOM   380  C  CG  . PHE A 1 68  ? -3.013  1.448   -32.104 1.00 21.22  ? 87  PHE B CG  1 
ATOM   381  C  CD1 . PHE A 1 68  ? -3.091  0.289   -31.350 1.00 21.63  ? 87  PHE B CD1 1 
ATOM   382  C  CD2 . PHE A 1 68  ? -2.434  1.384   -33.360 1.00 21.44  ? 87  PHE B CD2 1 
ATOM   383  C  CE1 . PHE A 1 68  ? -2.600  -0.908  -31.839 1.00 22.01  ? 87  PHE B CE1 1 
ATOM   384  C  CE2 . PHE A 1 68  ? -1.942  0.192   -33.855 1.00 21.62  ? 87  PHE B CE2 1 
ATOM   385  C  CZ  . PHE A 1 68  ? -2.025  -0.956  -33.094 1.00 21.99  ? 87  PHE B CZ  1 
ATOM   386  N  N   . LYS A 1 69  ? -6.618  3.758   -30.180 1.00 21.46  ? 88  LYS B N   1 
ATOM   387  C  CA  . LYS A 1 69  ? -7.259  4.715   -29.287 1.00 21.43  ? 88  LYS B CA  1 
ATOM   388  C  C   . LYS A 1 69  ? -6.231  5.526   -28.505 1.00 22.13  ? 88  LYS B C   1 
ATOM   389  O  O   . LYS A 1 69  ? -6.197  6.753   -28.595 1.00 23.51  ? 88  LYS B O   1 
ATOM   390  C  CB  . LYS A 1 69  ? -8.189  3.976   -28.325 1.00 20.71  ? 88  LYS B CB  1 
ATOM   391  C  CG  . LYS A 1 69  ? -9.050  4.872   -27.458 1.00 20.68  ? 88  LYS B CG  1 
ATOM   392  C  CD  . LYS A 1 69  ? -9.941  4.037   -26.555 1.00 20.61  ? 88  LYS B CD  1 
ATOM   393  C  CE  . LYS A 1 69  ? -10.860 4.907   -25.726 1.00 21.17  ? 88  LYS B CE  1 
ATOM   394  N  NZ  . LYS A 1 69  ? -11.650 5.832   -26.582 1.00 21.75  ? 88  LYS B NZ  1 
ATOM   395  N  N   . ASP A 1 70  ? -5.396  4.827   -27.742 1.00 27.88  ? 89  ASP B N   1 
ATOM   396  C  CA  . ASP A 1 70  ? -4.363  5.459   -26.925 1.00 28.68  ? 89  ASP B CA  1 
ATOM   397  C  C   . ASP A 1 70  ? -4.886  6.660   -26.149 1.00 28.81  ? 89  ASP B C   1 
ATOM   398  O  O   . ASP A 1 70  ? -4.390  7.774   -26.309 1.00 29.54  ? 89  ASP B O   1 
ATOM   399  C  CB  . ASP A 1 70  ? -3.171  5.886   -27.784 1.00 29.67  ? 89  ASP B CB  1 
ATOM   400  C  CG  . ASP A 1 70  ? -2.019  6.420   -26.952 1.00 30.93  ? 89  ASP B CG  1 
ATOM   401  O  OD1 . ASP A 1 70  ? -1.701  5.798   -25.915 1.00 31.47  ? 89  ASP B OD1 1 
ATOM   402  O  OD2 . ASP A 1 70  ? -1.434  7.458   -27.332 1.00 30.73  ? 89  ASP B OD2 1 
ATOM   403  N  N   . GLU A 1 71  ? -5.890  6.434   -25.312 1.00 21.92  ? 90  GLU B N   1 
ATOM   404  C  CA  . GLU A 1 71  ? -6.431  7.501   -24.481 1.00 21.71  ? 90  GLU B CA  1 
ATOM   405  C  C   . GLU A 1 71  ? -5.459  7.821   -23.355 1.00 22.40  ? 90  GLU B C   1 
ATOM   406  O  O   . GLU A 1 71  ? -5.615  8.818   -22.652 1.00 23.94  ? 90  GLU B O   1 
ATOM   407  C  CB  . GLU A 1 71  ? -7.796  7.113   -23.910 1.00 21.10  ? 90  GLU B CB  1 
ATOM   408  C  CG  . GLU A 1 71  ? -7.751  6.070   -22.802 1.00 21.15  ? 90  GLU B CG  1 
ATOM   409  C  CD  . GLU A 1 71  ? -7.637  4.649   -23.324 1.00 20.76  ? 90  GLU B CD  1 
ATOM   410  O  OE1 . GLU A 1 71  ? -7.419  4.471   -24.540 1.00 20.23  ? 90  GLU B OE1 1 
ATOM   411  O  OE2 . GLU A 1 71  ? -7.770  3.707   -22.515 1.00 20.63  ? 90  GLU B OE2 1 
ATOM   412  N  N   . GLU A 1 72  ? -4.451  6.970   -23.193 1.00 25.07  ? 91  GLU B N   1 
ATOM   413  C  CA  . GLU A 1 72  ? -3.452  7.153   -22.149 1.00 25.33  ? 91  GLU B CA  1 
ATOM   414  C  C   . GLU A 1 72  ? -2.342  8.089   -22.598 1.00 25.96  ? 91  GLU B C   1 
ATOM   415  O  O   . GLU A 1 72  ? -1.531  8.530   -21.787 1.00 26.57  ? 91  GLU B O   1 
ATOM   416  C  CB  . GLU A 1 72  ? -2.835  5.814   -21.746 1.00 26.74  ? 91  GLU B CB  1 
ATOM   417  C  CG  . GLU A 1 72  ? -3.825  4.779   -21.255 1.00 26.14  ? 91  GLU B CG  1 
ATOM   418  C  CD  . GLU A 1 72  ? -4.363  3.911   -22.370 1.00 24.70  ? 91  GLU B CD  1 
ATOM   419  O  OE1 . GLU A 1 72  ? -3.896  4.046   -23.523 1.00 24.52  ? 91  GLU B OE1 1 
ATOM   420  O  OE2 . GLU A 1 72  ? -5.255  3.089   -22.085 1.00 24.76  ? 91  GLU B OE2 1 
ATOM   421  N  N   . ASN A 1 73  ? -2.302  8.380   -23.893 1.00 36.69  ? 92  ASN B N   1 
ATOM   422  C  CA  . ASN A 1 73  ? -1.241  9.208   -24.450 1.00 37.64  ? 92  ASN B CA  1 
ATOM   423  C  C   . ASN A 1 73  ? 0.129   8.659   -24.064 1.00 38.40  ? 92  ASN B C   1 
ATOM   424  O  O   . ASN A 1 73  ? 1.090   9.411   -23.894 1.00 38.51  ? 92  ASN B O   1 
ATOM   425  C  CB  . ASN A 1 73  ? -1.389  10.654  -23.978 1.00 37.53  ? 92  ASN B CB  1 
ATOM   426  C  CG  . ASN A 1 73  ? -2.788  11.198  -24.201 1.00 37.94  ? 92  ASN B CG  1 
ATOM   427  O  OD1 . ASN A 1 73  ? -3.257  11.301  -25.337 1.00 37.61  ? 92  ASN B OD1 1 
ATOM   428  N  ND2 . ASN A 1 73  ? -3.463  11.554  -23.112 1.00 37.92  ? 92  ASN B ND2 1 
ATOM   429  N  N   . SER A 1 74  ? 0.203   7.339   -23.920 1.00 30.21  ? 93  SER B N   1 
ATOM   430  C  CA  . SER A 1 74  ? 1.443   6.672   -23.546 1.00 30.89  ? 93  SER B CA  1 
ATOM   431  C  C   . SER A 1 74  ? 1.940   5.763   -24.665 1.00 30.87  ? 93  SER B C   1 
ATOM   432  O  O   . SER A 1 74  ? 3.146   5.620   -24.870 1.00 31.72  ? 93  SER B O   1 
ATOM   433  C  CB  . SER A 1 74  ? 1.245   5.862   -22.265 1.00 30.69  ? 93  SER B CB  1 
ATOM   434  O  OG  . SER A 1 74  ? 0.258   4.861   -22.445 1.00 30.75  ? 93  SER B OG  1 
ATOM   435  N  N   . GLY A 1 75  ? 1.004   5.160   -25.390 1.00 19.51  ? 94  GLY B N   1 
ATOM   436  C  CA  . GLY A 1 75  ? 1.339   4.231   -26.454 1.00 19.31  ? 94  GLY B CA  1 
ATOM   437  C  C   . GLY A 1 75  ? 1.247   2.794   -25.981 1.00 19.71  ? 94  GLY B C   1 
ATOM   438  O  O   . GLY A 1 75  ? 1.825   1.888   -26.577 1.00 19.27  ? 94  GLY B O   1 
ATOM   439  N  N   . ALA A 1 76  ? 0.504   2.593   -24.898 1.00 41.69  ? 95  ALA B N   1 
ATOM   440  C  CA  . ALA A 1 76  ? 0.359   1.281   -24.284 1.00 40.58  ? 95  ALA B CA  1 
ATOM   441  C  C   . ALA A 1 76  ? -0.306  0.282   -25.225 1.00 40.64  ? 95  ALA B C   1 
ATOM   442  O  O   . ALA A 1 76  ? -0.046  -0.919  -25.157 1.00 41.21  ? 95  ALA B O   1 
ATOM   443  C  CB  . ALA A 1 76  ? -0.429  1.394   -22.985 1.00 40.06  ? 95  ALA B CB  1 
ATOM   444  N  N   . ASP A 1 77  ? -1.165  0.785   -26.105 1.00 28.58  ? 96  ASP B N   1 
ATOM   445  C  CA  . ASP A 1 77  ? -1.952  -0.073  -26.984 1.00 27.32  ? 96  ASP B CA  1 
ATOM   446  C  C   . ASP A 1 77  ? -1.134  -0.653  -28.131 1.00 28.09  ? 96  ASP B C   1 
ATOM   447  O  O   . ASP A 1 77  ? -1.368  -1.783  -28.555 1.00 29.38  ? 96  ASP B O   1 
ATOM   448  C  CB  . ASP A 1 77  ? -3.154  0.693   -27.531 1.00 27.55  ? 96  ASP B CB  1 
ATOM   449  C  CG  . ASP A 1 77  ? -4.057  1.209   -26.435 1.00 27.48  ? 96  ASP B CG  1 
ATOM   450  O  OD1 . ASP A 1 77  ? -3.934  0.718   -25.292 1.00 27.94  ? 96  ASP B OD1 1 
ATOM   451  O  OD2 . ASP A 1 77  ? -4.888  2.100   -26.714 1.00 26.22  ? 96  ASP B OD2 1 
ATOM   452  N  N   . ARG A 1 78  ? -0.179  0.120   -28.635 1.00 20.70  ? 97  ARG B N   1 
ATOM   453  C  CA  . ARG A 1 78  ? 0.653   -0.339  -29.741 1.00 20.73  ? 97  ARG B CA  1 
ATOM   454  C  C   . ARG A 1 78  ? 1.581   -1.462  -29.296 1.00 21.46  ? 97  ARG B C   1 
ATOM   455  O  O   . ARG A 1 78  ? 2.053   -2.250  -30.114 1.00 22.10  ? 97  ARG B O   1 
ATOM   456  C  CB  . ARG A 1 78  ? 1.452   0.823   -30.334 1.00 21.03  ? 97  ARG B CB  1 
ATOM   457  C  CG  . ARG A 1 78  ? 0.578   1.903   -30.951 1.00 20.95  ? 97  ARG B CG  1 
ATOM   458  C  CD  . ARG A 1 78  ? 1.396   2.982   -31.639 1.00 20.69  ? 97  ARG B CD  1 
ATOM   459  N  NE  . ARG A 1 78  ? 0.536   3.973   -32.278 1.00 20.47  ? 97  ARG B NE  1 
ATOM   460  C  CZ  . ARG A 1 78  ? 0.068   3.867   -33.518 1.00 21.17  ? 97  ARG B CZ  1 
ATOM   461  N  NH1 . ARG A 1 78  ? 0.379   2.812   -34.260 1.00 21.54  ? 97  ARG B NH1 1 
ATOM   462  N  NH2 . ARG A 1 78  ? -0.711  4.815   -34.020 1.00 20.62  ? 97  ARG B NH2 1 
ATOM   463  N  N   . LEU A 1 79  ? 1.829   -1.536  -27.993 1.00 25.16  ? 98  LEU B N   1 
ATOM   464  C  CA  . LEU A 1 79  ? 2.713   -2.555  -27.438 1.00 26.95  ? 98  LEU B CA  1 
ATOM   465  C  C   . LEU A 1 79  ? 2.046   -3.928  -27.370 1.00 27.69  ? 98  LEU B C   1 
ATOM   466  O  O   . LEU A 1 79  ? 0.941   -4.072  -26.841 1.00 26.58  ? 98  LEU B O   1 
ATOM   467  C  CB  . LEU A 1 79  ? 3.215   -2.135  -26.056 1.00 26.95  ? 98  LEU B CB  1 
ATOM   468  C  CG  . LEU A 1 79  ? 4.273   -1.034  -26.070 1.00 27.08  ? 98  LEU B CG  1 
ATOM   469  C  CD1 . LEU A 1 79  ? 4.568   -0.543  -24.663 1.00 28.39  ? 98  LEU B CD1 1 
ATOM   470  C  CD2 . LEU A 1 79  ? 5.537   -1.539  -26.742 1.00 28.40  ? 98  LEU B CD2 1 
ATOM   471  N  N   . MET A 1 80  ? 2.730   -4.932  -27.908 1.00 26.96  ? 99  MET B N   1 
ATOM   472  C  CA  . MET A 1 80  ? 2.204   -6.289  -27.945 1.00 27.03  ? 99  MET B CA  1 
ATOM   473  C  C   . MET A 1 80  ? 3.319   -7.268  -28.279 1.00 28.46  ? 99  MET B C   1 
ATOM   474  O  O   . MET A 1 80  ? 4.358   -6.875  -28.811 1.00 29.18  ? 99  MET B O   1 
ATOM   475  C  CB  . MET A 1 80  ? 1.085   -6.395  -28.985 1.00 26.01  ? 99  MET B CB  1 
ATOM   476  C  CG  . MET A 1 80  ? 1.558   -6.207  -30.420 1.00 26.85  ? 99  MET B CG  1 
ATOM   477  S  SD  . MET A 1 80  ? 0.206   -6.073  -31.606 1.00 25.69  ? 99  MET B SD  1 
ATOM   478  C  CE  . MET A 1 80  ? -0.608  -4.590  -31.019 1.00 23.50  ? 99  MET B CE  1 
ATOM   479  N  N   . THR A 1 81  ? 3.105   -8.542  -27.963 1.00 21.23  ? 100 THR B N   1 
ATOM   480  C  CA  . THR A 1 81  ? 4.082   -9.579  -28.277 1.00 21.65  ? 100 THR B CA  1 
ATOM   481  C  C   . THR A 1 81  ? 4.204   -9.746  -29.787 1.00 21.71  ? 100 THR B C   1 
ATOM   482  O  O   . THR A 1 81  ? 3.336   -9.304  -30.540 1.00 21.18  ? 100 THR B O   1 
ATOM   483  C  CB  . THR A 1 81  ? 3.705   -10.930 -27.641 1.00 20.75  ? 100 THR B CB  1 
ATOM   484  O  OG1 . THR A 1 81  ? 2.547   -11.465 -28.292 1.00 21.04  ? 100 THR B OG1 1 
ATOM   485  C  CG2 . THR A 1 81  ? 3.416   -10.757 -26.161 1.00 20.04  ? 100 THR B CG2 1 
ATOM   486  N  N   . GLU A 1 82  ? 5.284   -10.383 -30.228 1.00 46.79  ? 101 GLU B N   1 
ATOM   487  C  CA  . GLU A 1 82  ? 5.544   -10.539 -31.655 1.00 48.60  ? 101 GLU B CA  1 
ATOM   488  C  C   . GLU A 1 82  ? 4.427   -11.313 -32.351 1.00 47.40  ? 101 GLU B C   1 
ATOM   489  O  O   . GLU A 1 82  ? 3.945   -10.903 -33.407 1.00 45.97  ? 101 GLU B O   1 
ATOM   490  C  CB  . GLU A 1 82  ? 6.891   -11.226 -31.888 1.00 50.43  ? 101 GLU B CB  1 
ATOM   491  C  CG  . GLU A 1 82  ? 7.423   -11.062 -33.302 1.00 53.03  ? 101 GLU B CG  1 
ATOM   492  C  CD  . GLU A 1 82  ? 8.652   -11.910 -33.566 1.00 58.18  ? 101 GLU B CD  1 
ATOM   493  O  OE1 . GLU A 1 82  ? 8.606   -13.131 -33.297 1.00 58.71  ? 101 GLU B OE1 1 
ATOM   494  O  OE2 . GLU A 1 82  ? 9.663   -11.356 -34.049 1.00 60.27  ? 101 GLU B OE2 1 
ATOM   495  N  N   . ARG A 1 83  ? 4.022   -12.430 -31.753 1.00 48.20  ? 102 ARG B N   1 
ATOM   496  C  CA  . ARG A 1 83  ? 2.952   -13.252 -32.308 1.00 46.61  ? 102 ARG B CA  1 
ATOM   497  C  C   . ARG A 1 83  ? 1.664   -12.451 -32.437 1.00 45.69  ? 102 ARG B C   1 
ATOM   498  O  O   . ARG A 1 83  ? 0.911   -12.619 -33.398 1.00 45.17  ? 102 ARG B O   1 
ATOM   499  C  CB  . ARG A 1 83  ? 2.714   -14.490 -31.442 1.00 47.05  ? 102 ARG B CB  1 
ATOM   500  C  CG  . ARG A 1 83  ? 1.559   -15.360 -31.912 1.00 46.58  ? 102 ARG B CG  1 
ATOM   501  C  CD  . ARG A 1 83  ? 1.411   -16.610 -31.058 1.00 46.82  ? 102 ARG B CD  1 
ATOM   502  N  NE  . ARG A 1 83  ? 0.358   -17.485 -31.564 1.00 47.67  ? 102 ARG B NE  1 
ATOM   503  C  CZ  . ARG A 1 83  ? 0.547   -18.426 -32.485 1.00 50.07  ? 102 ARG B CZ  1 
ATOM   504  N  NH1 . ARG A 1 83  ? 1.754   -18.618 -33.003 1.00 50.48  ? 102 ARG B NH1 1 
ATOM   505  N  NH2 . ARG A 1 83  ? -0.470  -19.178 -32.889 1.00 49.19  ? 102 ARG B NH2 1 
ATOM   506  N  N   . CYS A 1 84  ? 1.413   -11.580 -31.463 1.00 26.44  ? 103 CYS B N   1 
ATOM   507  C  CA  . CYS A 1 84  ? 0.239   -10.722 -31.508 1.00 25.17  ? 103 CYS B CA  1 
ATOM   508  C  C   . CYS A 1 84  ? 0.256   -9.886  -32.786 1.00 25.09  ? 103 CYS B C   1 
ATOM   509  O  O   . CYS A 1 84  ? -0.699  -9.911  -33.558 1.00 24.46  ? 103 CYS B O   1 
ATOM   510  C  CB  . CYS A 1 84  ? 0.172   -9.826  -30.270 1.00 25.27  ? 103 CYS B CB  1 
ATOM   511  S  SG  . CYS A 1 84  ? -1.440  -9.048  -29.995 1.00 21.56  ? 103 CYS B SG  1 
ATOM   512  N  N   . LYS A 1 85  ? 1.352   -9.164  -33.014 1.00 48.11  ? 104 LYS B N   1 
ATOM   513  C  CA  . LYS A 1 85  ? 1.507   -8.359  -34.225 1.00 47.67  ? 104 LYS B CA  1 
ATOM   514  C  C   . LYS A 1 85  ? 1.069   -9.107  -35.479 1.00 47.12  ? 104 LYS B C   1 
ATOM   515  O  O   . LYS A 1 85  ? 0.126   -8.701  -36.156 1.00 46.78  ? 104 LYS B O   1 
ATOM   516  C  CB  . LYS A 1 85  ? 2.959   -7.919  -34.401 1.00 49.26  ? 104 LYS B CB  1 
ATOM   517  C  CG  . LYS A 1 85  ? 3.393   -6.769  -33.520 1.00 50.51  ? 104 LYS B CG  1 
ATOM   518  C  CD  . LYS A 1 85  ? 4.723   -6.222  -34.005 1.00 51.80  ? 104 LYS B CD  1 
ATOM   519  C  CE  . LYS A 1 85  ? 5.252   -5.133  -33.090 1.00 52.67  ? 104 LYS B CE  1 
ATOM   520  N  NZ  . LYS A 1 85  ? 6.464   -4.487  -33.671 1.00 53.15  ? 104 LYS B NZ  1 
ATOM   521  N  N   . GLU A 1 86  ? 1.773   -10.193 -35.786 1.00 30.07  ? 105 GLU B N   1 
ATOM   522  C  CA  . GLU A 1 86  ? 1.479   -11.007 -36.960 1.00 30.59  ? 105 GLU B CA  1 
ATOM   523  C  C   . GLU A 1 86  ? -0.018  -11.235 -37.100 1.00 30.18  ? 105 GLU B C   1 
ATOM   524  O  O   . GLU A 1 86  ? -0.582  -11.102 -38.185 1.00 29.76  ? 105 GLU B O   1 
ATOM   525  C  CB  . GLU A 1 86  ? 2.190   -12.357 -36.852 1.00 32.10  ? 105 GLU B CB  1 
ATOM   526  C  CG  . GLU A 1 86  ? 3.683   -12.257 -36.588 1.00 33.93  ? 105 GLU B CG  1 
ATOM   527  C  CD  . GLU A 1 86  ? 4.505   -12.315 -37.857 1.00 35.08  ? 105 GLU B CD  1 
ATOM   528  O  OE1 . GLU A 1 86  ? 5.267   -11.360 -38.122 1.00 35.91  ? 105 GLU B OE1 1 
ATOM   529  O  OE2 . GLU A 1 86  ? 4.386   -13.318 -38.591 1.00 35.21  ? 105 GLU B OE2 1 
ATOM   530  N  N   . ARG A 1 87  ? -0.652  -11.572 -35.984 1.00 34.31  ? 106 ARG B N   1 
ATOM   531  C  CA  . ARG A 1 87  ? -2.073  -11.885 -35.966 1.00 32.95  ? 106 ARG B CA  1 
ATOM   532  C  C   . ARG A 1 87  ? -2.909  -10.650 -36.287 1.00 30.79  ? 106 ARG B C   1 
ATOM   533  O  O   . ARG A 1 87  ? -3.734  -10.664 -37.201 1.00 29.78  ? 106 ARG B O   1 
ATOM   534  C  CB  . ARG A 1 87  ? -2.462  -12.432 -34.595 1.00 33.02  ? 106 ARG B CB  1 
ATOM   535  C  CG  . ARG A 1 87  ? -3.433  -13.596 -34.636 1.00 33.15  ? 106 ARG B CG  1 
ATOM   536  C  CD  . ARG A 1 87  ? -2.712  -14.937 -34.618 1.00 33.22  ? 106 ARG B CD  1 
ATOM   537  N  NE  . ARG A 1 87  ? -2.016  -15.228 -35.869 1.00 35.09  ? 106 ARG B NE  1 
ATOM   538  C  CZ  . ARG A 1 87  ? -0.735  -15.575 -35.950 1.00 38.15  ? 106 ARG B CZ  1 
ATOM   539  N  NH1 . ARG A 1 87  ? -0.004  -15.681 -34.847 1.00 38.57  ? 106 ARG B NH1 1 
ATOM   540  N  NH2 . ARG A 1 87  ? -0.185  -15.826 -37.132 1.00 38.56  ? 106 ARG B NH2 1 
ATOM   541  N  N   . VAL A 1 88  ? -2.690  -9.581  -35.528 1.00 24.05  ? 107 VAL B N   1 
ATOM   542  C  CA  . VAL A 1 88  ? -3.440  -8.341  -35.705 1.00 23.61  ? 107 VAL B CA  1 
ATOM   543  C  C   . VAL A 1 88  ? -3.282  -7.795  -37.118 1.00 23.56  ? 107 VAL B C   1 
ATOM   544  O  O   . VAL A 1 88  ? -4.262  -7.454  -37.778 1.00 22.15  ? 107 VAL B O   1 
ATOM   545  C  CB  . VAL A 1 88  ? -2.980  -7.260  -34.717 1.00 22.72  ? 107 VAL B CB  1 
ATOM   546  C  CG1 . VAL A 1 88  ? -4.051  -6.197  -34.568 1.00 22.37  ? 107 VAL B CG1 1 
ATOM   547  C  CG2 . VAL A 1 88  ? -2.662  -7.878  -33.375 1.00 24.21  ? 107 VAL B CG2 1 
ATOM   548  N  N   . ASN A 1 89  ? -2.036  -7.705  -37.571 1.00 24.66  ? 108 ASN B N   1 
ATOM   549  C  CA  . ASN A 1 89  ? -1.740  -7.220  -38.911 1.00 23.77  ? 108 ASN B CA  1 
ATOM   550  C  C   . ASN A 1 89  ? -2.542  -7.974  -39.963 1.00 23.72  ? 108 ASN B C   1 
ATOM   551  O  O   . ASN A 1 89  ? -2.964  -7.399  -40.967 1.00 24.00  ? 108 ASN B O   1 
ATOM   552  C  CB  . ASN A 1 89  ? -0.242  -7.330  -39.200 1.00 24.73  ? 108 ASN B CB  1 
ATOM   553  C  CG  . ASN A 1 89  ? 0.592   -6.439  -38.297 1.00 24.90  ? 108 ASN B CG  1 
ATOM   554  O  OD1 . ASN A 1 89  ? 0.102   -5.444  -37.766 1.00 24.66  ? 108 ASN B OD1 1 
ATOM   555  N  ND2 . ASN A 1 89  ? 1.860   -6.791  -38.124 1.00 25.82  ? 108 ASN B ND2 1 
ATOM   556  N  N   . ALA A 1 90  ? -2.757  -9.263  -39.722 1.00 20.63  ? 109 ALA B N   1 
ATOM   557  C  CA  . ALA A 1 90  ? -3.552  -10.088 -40.621 1.00 20.05  ? 109 ALA B CA  1 
ATOM   558  C  C   . ALA A 1 90  ? -5.022  -9.691  -40.550 1.00 19.65  ? 109 ALA B C   1 
ATOM   559  O  O   . ALA A 1 90  ? -5.681  -9.532  -41.578 1.00 19.50  ? 109 ALA B O   1 
ATOM   560  C  CB  . ALA A 1 90  ? -3.379  -11.560 -40.281 1.00 19.92  ? 109 ALA B CB  1 
ATOM   561  N  N   . LEU A 1 91  ? -5.530  -9.532  -39.332 1.00 16.61  ? 110 LEU B N   1 
ATOM   562  C  CA  . LEU A 1 91  ? -6.908  -9.107  -39.128 1.00 15.50  ? 110 LEU B CA  1 
ATOM   563  C  C   . LEU A 1 91  ? -7.125  -7.696  -39.665 1.00 15.37  ? 110 LEU B C   1 
ATOM   564  O  O   . LEU A 1 91  ? -8.197  -7.377  -40.174 1.00 15.52  ? 110 LEU B O   1 
ATOM   565  C  CB  . LEU A 1 91  ? -7.273  -9.170  -37.642 1.00 15.86  ? 110 LEU B CB  1 
ATOM   566  C  CG  . LEU A 1 91  ? -8.569  -8.475  -37.212 1.00 14.94  ? 110 LEU B CG  1 
ATOM   567  C  CD1 . LEU A 1 91  ? -9.781  -9.102  -37.888 1.00 14.53  ? 110 LEU B CD1 1 
ATOM   568  C  CD2 . LEU A 1 91  ? -8.718  -8.508  -35.700 1.00 19.67  ? 110 LEU B CD2 1 
ATOM   569  N  N   . ALA A 1 92  ? -6.102  -6.856  -39.548 1.00 31.51  ? 111 ALA B N   1 
ATOM   570  C  CA  . ALA A 1 92  ? -6.186  -5.479  -40.019 1.00 31.82  ? 111 ALA B CA  1 
ATOM   571  C  C   . ALA A 1 92  ? -6.489  -5.447  -41.509 1.00 32.79  ? 111 ALA B C   1 
ATOM   572  O  O   . ALA A 1 92  ? -7.314  -4.659  -41.972 1.00 33.22  ? 111 ALA B O   1 
ATOM   573  C  CB  . ALA A 1 92  ? -4.896  -4.737  -39.725 1.00 32.27  ? 111 ALA B CB  1 
ATOM   574  N  N   . ILE A 1 93  ? -5.812  -6.312  -42.257 1.00 19.12  ? 112 ILE B N   1 
ATOM   575  C  CA  . ILE A 1 93  ? -6.044  -6.441  -43.688 1.00 19.21  ? 112 ILE B CA  1 
ATOM   576  C  C   . ILE A 1 93  ? -7.432  -7.014  -43.950 1.00 18.82  ? 112 ILE B C   1 
ATOM   577  O  O   . ILE A 1 93  ? -8.209  -6.459  -44.725 1.00 18.81  ? 112 ILE B O   1 
ATOM   578  C  CB  . ILE A 1 93  ? -4.991  -7.354  -44.335 1.00 19.95  ? 112 ILE B CB  1 
ATOM   579  C  CG1 . ILE A 1 93  ? -3.586  -6.787  -44.105 1.00 20.70  ? 112 ILE B CG1 1 
ATOM   580  C  CG2 . ILE A 1 93  ? -5.274  -7.529  -45.817 1.00 19.80  ? 112 ILE B CG2 1 
ATOM   581  C  CD1 . ILE A 1 93  ? -2.470  -7.717  -44.532 1.00 22.63  ? 112 ILE B CD1 1 
ATOM   582  N  N   . ALA A 1 94  ? -7.737  -8.125  -43.286 1.00 16.98  ? 113 ALA B N   1 
ATOM   583  C  CA  . ALA A 1 94  ? -9.018  -8.804  -43.449 1.00 16.35  ? 113 ALA B CA  1 
ATOM   584  C  C   . ALA A 1 94  ? -10.197 -7.865  -43.231 1.00 15.93  ? 113 ALA B C   1 
ATOM   585  O  O   . ALA A 1 94  ? -11.241 -8.014  -43.864 1.00 16.38  ? 113 ALA B O   1 
ATOM   586  C  CB  . ALA A 1 94  ? -9.110  -9.995  -42.505 1.00 15.86  ? 113 ALA B CB  1 
ATOM   587  N  N   . VAL A 1 95  ? -10.030 -6.902  -42.331 1.00 21.29  ? 114 VAL B N   1 
ATOM   588  C  CA  . VAL A 1 95  ? -11.088 -5.938  -42.059 1.00 21.61  ? 114 VAL B CA  1 
ATOM   589  C  C   . VAL A 1 95  ? -11.293 -5.027  -43.259 1.00 22.05  ? 114 VAL B C   1 
ATOM   590  O  O   . VAL A 1 95  ? -12.421 -4.802  -43.692 1.00 22.73  ? 114 VAL B O   1 
ATOM   591  C  CB  . VAL A 1 95  ? -10.779 -5.078  -40.819 1.00 21.61  ? 114 VAL B CB  1 
ATOM   592  C  CG1 . VAL A 1 95  ? -11.802 -3.961  -40.685 1.00 21.03  ? 114 VAL B CG1 1 
ATOM   593  C  CG2 . VAL A 1 95  ? -10.758 -5.937  -39.565 1.00 21.02  ? 114 VAL B CG2 1 
ATOM   594  N  N   . MET A 1 96  ? -10.193 -4.511  -43.795 1.00 24.66  ? 115 MET B N   1 
ATOM   595  C  CA  . MET A 1 96  ? -10.246 -3.604  -44.934 1.00 25.05  ? 115 MET B CA  1 
ATOM   596  C  C   . MET A 1 96  ? -10.817 -4.291  -46.172 1.00 25.55  ? 115 MET B C   1 
ATOM   597  O  O   . MET A 1 96  ? -11.709 -3.757  -46.831 1.00 26.21  ? 115 MET B O   1 
ATOM   598  C  CB  . MET A 1 96  ? -8.856  -3.046  -45.238 1.00 25.60  ? 115 MET B CB  1 
ATOM   599  C  CG  . MET A 1 96  ? -8.130  -2.492  -44.022 1.00 26.05  ? 115 MET B CG  1 
ATOM   600  S  SD  . MET A 1 96  ? -6.620  -1.608  -44.456 1.00 27.03  ? 115 MET B SD  1 
ATOM   601  C  CE  . MET A 1 96  ? -7.306  -0.191  -45.311 1.00 28.89  ? 115 MET B CE  1 
ATOM   602  N  N   . ASN A 1 97  ? -10.299 -5.474  -46.484 1.00 26.47  ? 116 ASN B N   1 
ATOM   603  C  CA  . ASN A 1 97  ? -10.780 -6.238  -47.629 1.00 27.26  ? 116 ASN B CA  1 
ATOM   604  C  C   . ASN A 1 97  ? -12.267 -6.516  -47.498 1.00 27.40  ? 116 ASN B C   1 
ATOM   605  O  O   . ASN A 1 97  ? -12.973 -6.708  -48.490 1.00 27.87  ? 116 ASN B O   1 
ATOM   606  C  CB  . ASN A 1 97  ? -10.008 -7.552  -47.761 1.00 27.43  ? 116 ASN B CB  1 
ATOM   607  C  CG  . ASN A 1 97  ? -8.529  -7.334  -48.008 1.00 29.00  ? 116 ASN B CG  1 
ATOM   608  O  OD1 . ASN A 1 97  ? -8.061  -6.196  -48.075 1.00 29.22  ? 116 ASN B OD1 1 
ATOM   609  N  ND2 . ASN A 1 97  ? -7.784  -8.426  -48.149 1.00 29.61  ? 116 ASN B ND2 1 
ATOM   610  N  N   . MET A 1 98  ? -12.732 -6.527  -46.255 1.00 25.53  ? 117 MET B N   1 
ATOM   611  C  CA  . MET A 1 98  ? -14.120 -6.820  -45.942 1.00 25.44  ? 117 MET B CA  1 
ATOM   612  C  C   . MET A 1 98  ? -14.996 -5.598  -46.180 1.00 26.17  ? 117 MET B C   1 
ATOM   613  O  O   . MET A 1 98  ? -16.119 -5.763  -46.840 1.00 28.01  ? 117 MET B O   1 
ATOM   614  C  CB  . MET A 1 98  ? -14.231 -7.248  -44.481 1.00 25.16  ? 117 MET B CB  1 
ATOM   615  C  CG  . MET A 1 98  ? -15.625 -7.633  -44.049 1.00 25.67  ? 117 MET B CG  1 
ATOM   616  S  SD  . MET A 1 98  ? -16.235 -9.066  -44.944 1.00 26.03  ? 117 MET B SD  1 
ATOM   617  C  CE  . MET A 1 98  ? -17.615 -9.539  -43.900 1.00 27.06  ? 117 MET B CE  1 
ATOM   618  N  N   . TRP A 1 99  ? -14.860 -4.610  -45.304 1.00 31.68  ? 118 TRP B N   1 
ATOM   619  C  CA  . TRP A 1 99  ? -15.602 -3.366  -45.424 1.00 32.11  ? 118 TRP B CA  1 
ATOM   620  C  C   . TRP A 1 99  ? -14.677 -2.261  -45.915 1.00 33.09  ? 118 TRP B C   1 
ATOM   621  O  O   . TRP A 1 99  ? -13.790 -1.818  -45.185 1.00 32.28  ? 118 TRP B O   1 
ATOM   622  C  CB  . TRP A 1 99  ? -16.218 -2.975  -44.080 1.00 31.91  ? 118 TRP B CB  1 
ATOM   623  C  CG  . TRP A 1 99  ? -16.947 -4.096  -43.403 1.00 31.53  ? 118 TRP B CG  1 
ATOM   624  C  CD1 . TRP A 1 99  ? -18.195 -4.563  -43.703 1.00 31.50  ? 118 TRP B CD1 1 
ATOM   625  C  CD2 . TRP A 1 99  ? -16.476 -4.890  -42.308 1.00 30.48  ? 118 TRP B CD2 1 
ATOM   626  N  NE1 . TRP A 1 99  ? -18.529 -5.599  -42.864 1.00 31.08  ? 118 TRP B NE1 1 
ATOM   627  C  CE2 . TRP A 1 99  ? -17.490 -5.818  -41.998 1.00 30.68  ? 118 TRP B CE2 1 
ATOM   628  C  CE3 . TRP A 1 99  ? -15.295 -4.907  -41.560 1.00 29.69  ? 118 TRP B CE3 1 
ATOM   629  C  CZ2 . TRP A 1 99  ? -17.357 -6.753  -40.972 1.00 30.47  ? 118 TRP B CZ2 1 
ATOM   630  C  CZ3 . TRP A 1 99  ? -15.167 -5.832  -40.545 1.00 29.46  ? 118 TRP B CZ3 1 
ATOM   631  C  CH2 . TRP A 1 99  ? -16.190 -6.742  -40.260 1.00 29.72  ? 118 TRP B CH2 1 
ATOM   632  N  N   . PRO A 1 100 ? -14.882 -1.817  -47.165 1.00 39.72  ? 119 PRO B N   1 
ATOM   633  C  CA  . PRO A 1 100 ? -14.085 -0.757  -47.796 1.00 40.00  ? 119 PRO B CA  1 
ATOM   634  C  C   . PRO A 1 100 ? -14.192 0.552   -47.017 1.00 39.91  ? 119 PRO B C   1 
ATOM   635  O  O   . PRO A 1 100 ? -15.274 0.900   -46.538 1.00 39.50  ? 119 PRO B O   1 
ATOM   636  C  CB  . PRO A 1 100 ? -14.736 -0.599  -49.177 1.00 40.76  ? 119 PRO B CB  1 
ATOM   637  C  CG  . PRO A 1 100 ? -15.435 -1.896  -49.424 1.00 42.25  ? 119 PRO B CG  1 
ATOM   638  C  CD  . PRO A 1 100 ? -15.901 -2.361  -48.077 1.00 40.73  ? 119 PRO B CD  1 
ATOM   639  N  N   . GLY A 1 101 ? -13.076 1.264   -46.887 1.00 26.75  ? 120 GLY B N   1 
ATOM   640  C  CA  . GLY A 1 101 ? -13.047 2.511   -46.146 1.00 25.79  ? 120 GLY B CA  1 
ATOM   641  C  C   . GLY A 1 101 ? -12.927 2.299   -44.649 1.00 26.49  ? 120 GLY B C   1 
ATOM   642  O  O   . GLY A 1 101 ? -12.734 3.252   -43.894 1.00 26.07  ? 120 GLY B O   1 
ATOM   643  N  N   . VAL A 1 102 ? -13.048 1.047   -44.219 1.00 28.67  ? 121 VAL B N   1 
ATOM   644  C  CA  . VAL A 1 102 ? -12.986 0.717   -42.801 1.00 27.04  ? 121 VAL B CA  1 
ATOM   645  C  C   . VAL A 1 102 ? -11.648 0.091   -42.422 1.00 26.28  ? 121 VAL B C   1 
ATOM   646  O  O   . VAL A 1 102 ? -11.015 -0.588  -43.232 1.00 26.58  ? 121 VAL B O   1 
ATOM   647  C  CB  . VAL A 1 102 ? -14.121 -0.242  -42.396 1.00 26.66  ? 121 VAL B CB  1 
ATOM   648  C  CG1 . VAL A 1 102 ? -14.083 -0.507  -40.898 1.00 25.17  ? 121 VAL B CG1 1 
ATOM   649  C  CG2 . VAL A 1 102 ? -15.470 0.328   -42.809 1.00 27.08  ? 121 VAL B CG2 1 
ATOM   650  N  N   . ARG A 1 103 ? -11.226 0.321   -41.183 1.00 42.78  ? 122 ARG B N   1 
ATOM   651  C  CA  . ARG A 1 103 ? -9.972  -0.227  -40.681 1.00 42.64  ? 122 ARG B CA  1 
ATOM   652  C  C   . ARG A 1 103 ? -10.114 -0.676  -39.230 1.00 41.45  ? 122 ARG B C   1 
ATOM   653  O  O   . ARG A 1 103 ? -10.890 -0.103  -38.466 1.00 40.46  ? 122 ARG B O   1 
ATOM   654  C  CB  . ARG A 1 103 ? -8.849  0.804   -40.804 1.00 39.77  ? 122 ARG B CB  1 
ATOM   655  C  CG  . ARG A 1 103 ? -8.330  0.991   -42.220 1.00 40.16  ? 122 ARG B CG  1 
ATOM   656  C  CD  . ARG A 1 103 ? -7.473  2.241   -42.334 1.00 40.49  ? 122 ARG B CD  1 
ATOM   657  N  NE  . ARG A 1 103 ? -7.909  3.288   -41.414 1.00 40.35  ? 122 ARG B NE  1 
ATOM   658  C  CZ  . ARG A 1 103 ? -7.087  4.132   -40.799 1.00 40.53  ? 122 ARG B CZ  1 
ATOM   659  N  NH1 . ARG A 1 103 ? -5.779  4.055   -41.004 1.00 40.85  ? 122 ARG B NH1 1 
ATOM   660  N  NH2 . ARG A 1 103 ? -7.572  5.054   -39.979 1.00 40.40  ? 122 ARG B NH2 1 
ATOM   661  N  N   . LEU A 1 104 ? -9.361  -1.706  -38.857 1.00 21.63  ? 123 LEU B N   1 
ATOM   662  C  CA  . LEU A 1 104 ? -9.405  -2.238  -37.500 1.00 21.06  ? 123 LEU B CA  1 
ATOM   663  C  C   . LEU A 1 104 ? -9.041  -1.168  -36.476 1.00 20.80  ? 123 LEU B C   1 
ATOM   664  O  O   . LEU A 1 104 ? -8.217  -0.294  -36.743 1.00 20.92  ? 123 LEU B O   1 
ATOM   665  C  CB  . LEU A 1 104 ? -8.465  -3.438  -37.364 1.00 20.86  ? 123 LEU B CB  1 
ATOM   666  C  CG  . LEU A 1 104 ? -8.331  -4.038  -35.963 1.00 20.84  ? 123 LEU B CG  1 
ATOM   667  C  CD1 . LEU A 1 104 ? -9.631  -4.703  -35.537 1.00 20.06  ? 123 LEU B CD1 1 
ATOM   668  C  CD2 . LEU A 1 104 ? -7.177  -5.027  -35.910 1.00 21.62  ? 123 LEU B CD2 1 
ATOM   669  N  N   . ARG A 1 105 ? -9.660  -1.244  -35.302 1.00 14.54  ? 124 ARG B N   1 
ATOM   670  C  CA  . ARG A 1 105 ? -9.402  -0.284  -34.237 1.00 14.60  ? 124 ARG B CA  1 
ATOM   671  C  C   . ARG A 1 105 ? -9.131  -1.002  -32.923 1.00 15.04  ? 124 ARG B C   1 
ATOM   672  O  O   . ARG A 1 105 ? -9.859  -1.919  -32.547 1.00 15.65  ? 124 ARG B O   1 
ATOM   673  C  CB  . ARG A 1 105 ? -10.579 0.683   -34.088 1.00 14.79  ? 124 ARG B CB  1 
ATOM   674  C  CG  . ARG A 1 105 ? -10.453 1.659   -32.930 1.00 14.28  ? 124 ARG B CG  1 
ATOM   675  C  CD  . ARG A 1 105 ? -11.452 2.794   -33.067 1.00 14.63  ? 124 ARG B CD  1 
ATOM   676  N  NE  . ARG A 1 105 ? -11.647 3.518   -31.815 1.00 14.82  ? 124 ARG B NE  1 
ATOM   677  C  CZ  . ARG A 1 105 ? -12.651 3.295   -30.973 1.00 15.41  ? 124 ARG B CZ  1 
ATOM   678  N  NH1 . ARG A 1 105 ? -13.554 2.364   -31.247 1.00 15.03  ? 124 ARG B NH1 1 
ATOM   679  N  NH2 . ARG A 1 105 ? -12.756 4.002   -29.856 1.00 16.45  ? 124 ARG B NH2 1 
ATOM   680  N  N   . VAL A 1 106 ? -8.074  -0.589  -32.233 1.00 19.56  ? 125 VAL B N   1 
ATOM   681  C  CA  . VAL A 1 106 ? -7.700  -1.191  -30.959 1.00 19.44  ? 125 VAL B CA  1 
ATOM   682  C  C   . VAL A 1 106 ? -7.947  -0.221  -29.812 1.00 13.58  ? 125 VAL B C   1 
ATOM   683  O  O   . VAL A 1 106 ? -7.466  0.911   -29.835 1.00 13.94  ? 125 VAL B O   1 
ATOM   684  C  CB  . VAL A 1 106 ? -6.218  -1.595  -30.942 1.00 14.45  ? 125 VAL B CB  1 
ATOM   685  C  CG1 . VAL A 1 106 ? -5.829  -2.127  -29.571 1.00 15.08  ? 125 VAL B CG1 1 
ATOM   686  C  CG2 . VAL A 1 106 ? -5.932  -2.624  -32.027 1.00 14.72  ? 125 VAL B CG2 1 
ATOM   687  N  N   . THR A 1 107 ? -8.696  -0.670  -28.809 1.00 24.18  ? 126 THR B N   1 
ATOM   688  C  CA  . THR A 1 107 ? -9.018  0.172   -27.663 1.00 24.23  ? 126 THR B CA  1 
ATOM   689  C  C   . THR A 1 107 ? -8.238  -0.245  -26.421 1.00 24.89  ? 126 THR B C   1 
ATOM   690  O  O   . THR A 1 107 ? -8.266  0.446   -25.410 1.00 25.76  ? 126 THR B O   1 
ATOM   691  C  CB  . THR A 1 107 ? -10.520 0.142   -27.334 1.00 23.83  ? 126 THR B CB  1 
ATOM   692  O  OG1 . THR A 1 107 ? -10.875 -1.146  -26.815 1.00 23.35  ? 126 THR B OG1 1 
ATOM   693  C  CG2 . THR A 1 107 ? -11.349 0.443   -28.577 1.00 23.33  ? 126 THR B CG2 1 
ATOM   694  N  N   . GLU A 1 108 ? -7.558  -1.385  -26.498 1.00 25.47  ? 127 GLU B N   1 
ATOM   695  C  CA  . GLU A 1 108 ? -6.727  -1.866  -25.396 1.00 25.55  ? 127 GLU B CA  1 
ATOM   696  C  C   . GLU A 1 108 ? -5.717  -2.908  -25.857 1.00 25.80  ? 127 GLU B C   1 
ATOM   697  O  O   . GLU A 1 108 ? -6.092  -3.974  -26.337 1.00 25.54  ? 127 GLU B O   1 
ATOM   698  C  CB  . GLU A 1 108 ? -7.582  -2.452  -24.265 1.00 25.33  ? 127 GLU B CB  1 
ATOM   699  C  CG  . GLU A 1 108 ? -8.010  -1.460  -23.189 1.00 25.76  ? 127 GLU B CG  1 
ATOM   700  C  CD  . GLU A 1 108 ? -6.840  -0.881  -22.415 1.00 27.20  ? 127 GLU B CD  1 
ATOM   701  O  OE1 . GLU A 1 108 ? -7.006  -0.571  -21.216 1.00 27.55  ? 127 GLU B OE1 1 
ATOM   702  O  OE2 . GLU A 1 108 ? -5.750  -0.733  -23.005 1.00 27.86  ? 127 GLU B OE2 1 
ATOM   703  N  N   . GLY A 1 109 ? -4.436  -2.593  -25.704 1.00 18.81  ? 128 GLY B N   1 
ATOM   704  C  CA  . GLY A 1 109 ? -3.379  -3.554  -25.952 1.00 18.98  ? 128 GLY B CA  1 
ATOM   705  C  C   . GLY A 1 109 ? -2.748  -3.975  -24.639 1.00 20.17  ? 128 GLY B C   1 
ATOM   706  O  O   . GLY A 1 109 ? -3.413  -4.548  -23.779 1.00 19.78  ? 128 GLY B O   1 
ATOM   707  N  N   . TRP A 1 110 ? -1.460  -3.683  -24.482 1.00 36.56  ? 129 TRP B N   1 
ATOM   708  C  CA  . TRP A 1 110 ? -0.772  -3.908  -23.214 1.00 37.05  ? 129 TRP B CA  1 
ATOM   709  C  C   . TRP A 1 110 ? -1.240  -2.877  -22.195 1.00 36.86  ? 129 TRP B C   1 
ATOM   710  O  O   . TRP A 1 110 ? -1.132  -1.673  -22.427 1.00 36.33  ? 129 TRP B O   1 
ATOM   711  C  CB  . TRP A 1 110 ? 0.744   -3.812  -23.394 1.00 37.86  ? 129 TRP B CB  1 
ATOM   712  C  CG  . TRP A 1 110 ? 1.506   -3.836  -22.100 1.00 38.39  ? 129 TRP B CG  1 
ATOM   713  C  CD1 . TRP A 1 110 ? 1.926   -4.940  -21.419 1.00 38.50  ? 129 TRP B CD1 1 
ATOM   714  C  CD2 . TRP A 1 110 ? 1.938   -2.702  -21.334 1.00 38.78  ? 129 TRP B CD2 1 
ATOM   715  N  NE1 . TRP A 1 110 ? 2.592   -4.566  -20.275 1.00 39.71  ? 129 TRP B NE1 1 
ATOM   716  C  CE2 . TRP A 1 110 ? 2.613   -3.198  -20.200 1.00 39.67  ? 129 TRP B CE2 1 
ATOM   717  C  CE3 . TRP A 1 110 ? 1.818   -1.318  -21.496 1.00 38.55  ? 129 TRP B CE3 1 
ATOM   718  C  CZ2 . TRP A 1 110 ? 3.168   -2.359  -19.235 1.00 40.17  ? 129 TRP B CZ2 1 
ATOM   719  C  CZ3 . TRP A 1 110 ? 2.369   -0.486  -20.535 1.00 39.19  ? 129 TRP B CZ3 1 
ATOM   720  C  CH2 . TRP A 1 110 ? 3.035   -1.010  -19.420 1.00 39.67  ? 129 TRP B CH2 1 
ATOM   721  N  N   . ASP A 1 111 ? -1.757  -3.352  -21.066 1.00 24.58  ? 130 ASP B N   1 
ATOM   722  C  CA  . ASP A 1 111 ? -2.359  -2.469  -20.072 1.00 24.37  ? 130 ASP B CA  1 
ATOM   723  C  C   . ASP A 1 111 ? -1.495  -2.295  -18.827 1.00 24.80  ? 130 ASP B C   1 
ATOM   724  O  O   . ASP A 1 111 ? -0.759  -3.199  -18.431 1.00 24.37  ? 130 ASP B O   1 
ATOM   725  C  CB  . ASP A 1 111 ? -3.746  -2.983  -19.677 1.00 24.23  ? 130 ASP B CB  1 
ATOM   726  C  CG  . ASP A 1 111 ? -4.362  -2.189  -18.540 1.00 24.49  ? 130 ASP B CG  1 
ATOM   727  O  OD1 . ASP A 1 111 ? -4.350  -0.943  -18.602 1.00 24.81  ? 130 ASP B OD1 1 
ATOM   728  O  OD2 . ASP A 1 111 ? -4.867  -2.813  -17.584 1.00 24.60  ? 130 ASP B OD2 1 
ATOM   729  N  N   . GLU A 1 112 ? -1.597  -1.117  -18.217 1.00 21.26  ? 131 GLU B N   1 
ATOM   730  C  CA  . GLU A 1 112 ? -0.904  -0.814  -16.972 1.00 20.68  ? 131 GLU B CA  1 
ATOM   731  C  C   . GLU A 1 112 ? -1.798  0.027   -16.066 1.00 20.70  ? 131 GLU B C   1 
ATOM   732  O  O   . GLU A 1 112 ? -1.371  0.493   -15.010 1.00 20.00  ? 131 GLU B O   1 
ATOM   733  C  CB  . GLU A 1 112 ? 0.407   -0.082  -17.250 1.00 21.34  ? 131 GLU B CB  1 
ATOM   734  C  CG  . GLU A 1 112 ? 0.246   1.221   -18.012 1.00 21.51  ? 131 GLU B CG  1 
ATOM   735  C  CD  . GLU A 1 112 ? 1.570   1.927   -18.239 1.00 22.77  ? 131 GLU B CD  1 
ATOM   736  O  OE1 . GLU A 1 112 ? 2.564   1.559   -17.578 1.00 23.02  ? 131 GLU B OE1 1 
ATOM   737  O  OE2 . GLU A 1 112 ? 1.616   2.851   -19.078 1.00 23.63  ? 131 GLU B OE2 1 
ATOM   738  N  N   . ASP A 1 113 ? -3.042  0.219   -16.494 1.00 36.32  ? 132 ASP B N   1 
ATOM   739  C  CA  . ASP A 1 113 ? -4.034  0.941   -15.702 1.00 36.16  ? 132 ASP B CA  1 
ATOM   740  C  C   . ASP A 1 113 ? -4.642  0.005   -14.663 1.00 36.05  ? 132 ASP B C   1 
ATOM   741  O  O   . ASP A 1 113 ? -5.055  0.436   -13.585 1.00 36.05  ? 132 ASP B O   1 
ATOM   742  C  CB  . ASP A 1 113 ? -5.129  1.512   -16.600 1.00 35.35  ? 132 ASP B CB  1 
ATOM   743  C  CG  . ASP A 1 113 ? -4.579  2.419   -17.685 1.00 35.66  ? 132 ASP B CG  1 
ATOM   744  O  OD1 . ASP A 1 113 ? -3.751  3.302   -17.371 1.00 36.21  ? 132 ASP B OD1 1 
ATOM   745  O  OD2 . ASP A 1 113 ? -4.984  2.256   -18.854 1.00 35.80  ? 132 ASP B OD2 1 
ATOM   746  N  N   . GLY A 1 114 ? -4.700  -1.279  -15.004 1.00 36.50  ? 133 GLY B N   1 
ATOM   747  C  CA  . GLY A 1 114 ? -5.094  -2.308  -14.059 1.00 36.71  ? 133 GLY B CA  1 
ATOM   748  C  C   . GLY A 1 114 ? -6.586  -2.482  -13.848 1.00 37.16  ? 133 GLY B C   1 
ATOM   749  O  O   . GLY A 1 114 ? -7.014  -2.900  -12.770 1.00 37.76  ? 133 GLY B O   1 
ATOM   750  N  N   . HIS A 1 115 ? -7.383  -2.173  -14.866 1.00 28.88  ? 134 HIS B N   1 
ATOM   751  C  CA  . HIS A 1 115 ? -8.827  -2.362  -14.765 1.00 27.76  ? 134 HIS B CA  1 
ATOM   752  C  C   . HIS A 1 115 ? -9.260  -3.724  -15.304 1.00 27.56  ? 134 HIS B C   1 
ATOM   753  O  O   . HIS A 1 115 ? -10.438 -4.078  -15.252 1.00 27.23  ? 134 HIS B O   1 
ATOM   754  C  CB  . HIS A 1 115 ? -9.590  -1.227  -15.456 1.00 28.01  ? 134 HIS B CB  1 
ATOM   755  C  CG  . HIS A 1 115 ? -9.346  -1.131  -16.930 1.00 27.23  ? 134 HIS B CG  1 
ATOM   756  N  ND1 . HIS A 1 115 ? -10.248 -1.592  -17.865 1.00 26.24  ? 134 HIS B ND1 1 
ATOM   757  C  CD2 . HIS A 1 115 ? -8.313  -0.607  -17.632 1.00 27.35  ? 134 HIS B CD2 1 
ATOM   758  C  CE1 . HIS A 1 115 ? -9.777  -1.365  -19.077 1.00 26.24  ? 134 HIS B CE1 1 
ATOM   759  N  NE2 . HIS A 1 115 ? -8.604  -0.767  -18.964 1.00 26.65  ? 134 HIS B NE2 1 
ATOM   760  N  N   . HIS A 1 116 ? -8.298  -4.487  -15.811 1.00 15.57  ? 135 HIS B N   1 
ATOM   761  C  CA  . HIS A 1 116 ? -8.572  -5.824  -16.320 1.00 15.72  ? 135 HIS B CA  1 
ATOM   762  C  C   . HIS A 1 116 ? -8.472  -6.851  -15.200 1.00 16.40  ? 135 HIS B C   1 
ATOM   763  O  O   . HIS A 1 116 ? -7.670  -6.702  -14.280 1.00 16.62  ? 135 HIS B O   1 
ATOM   764  C  CB  . HIS A 1 116 ? -7.612  -6.173  -17.460 1.00 15.10  ? 135 HIS B CB  1 
ATOM   765  C  CG  . HIS A 1 116 ? -7.740  -5.275  -18.652 1.00 13.75  ? 135 HIS B CG  1 
ATOM   766  N  ND1 . HIS A 1 116 ? -8.595  -5.546  -19.698 1.00 13.20  ? 135 HIS B ND1 1 
ATOM   767  C  CD2 . HIS A 1 116 ? -7.125  -4.110  -18.961 1.00 13.56  ? 135 HIS B CD2 1 
ATOM   768  C  CE1 . HIS A 1 116 ? -8.500  -4.585  -20.602 1.00 12.83  ? 135 HIS B CE1 1 
ATOM   769  N  NE2 . HIS A 1 116 ? -7.616  -3.702  -20.178 1.00 13.15  ? 135 HIS B NE2 1 
ATOM   770  N  N   . ALA A 1 117 ? -9.294  -7.892  -15.280 1.00 36.68  ? 136 ALA B N   1 
ATOM   771  C  CA  . ALA A 1 117 ? -9.347  -8.908  -14.234 1.00 38.27  ? 136 ALA B CA  1 
ATOM   772  C  C   . ALA A 1 117 ? -7.978  -9.520  -13.959 1.00 38.58  ? 136 ALA B C   1 
ATOM   773  O  O   . ALA A 1 117 ? -7.076  -9.453  -14.794 1.00 37.99  ? 136 ALA B O   1 
ATOM   774  C  CB  . ALA A 1 117 ? -10.351 -9.993  -14.598 1.00 38.15  ? 136 ALA B CB  1 
ATOM   775  N  N   . GLN A 1 118 ? -7.833  -10.117 -12.780 1.00 55.05  ? 137 GLN B N   1 
ATOM   776  C  CA  . GLN A 1 118 ? -6.580  -10.751 -12.388 1.00 57.15  ? 137 GLN B CA  1 
ATOM   777  C  C   . GLN A 1 118 ? -6.132  -11.773 -13.427 1.00 56.17  ? 137 GLN B C   1 
ATOM   778  O  O   . GLN A 1 118 ? -6.939  -12.554 -13.933 1.00 55.65  ? 137 GLN B O   1 
ATOM   779  C  CB  . GLN A 1 118 ? -6.722  -11.417 -11.017 1.00 59.42  ? 137 GLN B CB  1 
ATOM   780  C  CG  . GLN A 1 118 ? -7.086  -10.455 -9.897  1.00 63.27  ? 137 GLN B CG  1 
ATOM   781  C  CD  . GLN A 1 118 ? -7.233  -11.149 -8.555  1.00 68.70  ? 137 GLN B CD  1 
ATOM   782  O  OE1 . GLN A 1 118 ? -7.216  -12.378 -8.473  1.00 69.45  ? 137 GLN B OE1 1 
ATOM   783  N  NE2 . GLN A 1 118 ? -7.380  -10.361 -7.493  1.00 67.98  ? 137 GLN B NE2 1 
ATOM   784  N  N   . ASP A 1 119 ? -4.840  -11.757 -13.739 1.00 45.15  ? 138 ASP B N   1 
ATOM   785  C  CA  . ASP A 1 119 ? -4.260  -12.685 -14.708 1.00 44.61  ? 138 ASP B CA  1 
ATOM   786  C  C   . ASP A 1 119 ? -4.833  -12.510 -16.113 1.00 43.19  ? 138 ASP B C   1 
ATOM   787  O  O   . ASP A 1 119 ? -4.956  -13.476 -16.866 1.00 42.49  ? 138 ASP B O   1 
ATOM   788  C  CB  . ASP A 1 119 ? -4.424  -14.133 -14.240 1.00 45.64  ? 138 ASP B CB  1 
ATOM   789  C  CG  . ASP A 1 119 ? -3.430  -14.508 -13.157 1.00 47.97  ? 138 ASP B CG  1 
ATOM   790  O  OD1 . ASP A 1 119 ? -2.328  -13.918 -13.133 1.00 47.01  ? 138 ASP B OD1 1 
ATOM   791  O  OD2 . ASP A 1 119 ? -3.749  -15.395 -12.334 1.00 48.79  ? 138 ASP B OD2 1 
ATOM   792  N  N   . SER A 1 120 ? -5.176  -11.273 -16.459 1.00 15.30  ? 139 SER B N   1 
ATOM   793  C  CA  . SER A 1 120 ? -5.627  -10.954 -17.806 1.00 14.60  ? 139 SER B CA  1 
ATOM   794  C  C   . SER A 1 120 ? -4.438  -10.960 -18.759 1.00 25.28  ? 139 SER B C   1 
ATOM   795  O  O   . SER A 1 120 ? -3.335  -10.558 -18.386 1.00 25.31  ? 139 SER B O   1 
ATOM   796  C  CB  . SER A 1 120 ? -6.315  -9.587  -17.836 1.00 14.26  ? 139 SER B CB  1 
ATOM   797  O  OG  . SER A 1 120 ? -6.666  -9.215  -19.159 1.00 23.94  ? 139 SER B OG  1 
ATOM   798  N  N   . LEU A 1 121 ? -4.661  -11.417 -19.985 1.00 16.43  ? 140 LEU B N   1 
ATOM   799  C  CA  . LEU A 1 121 ? -3.595  -11.471 -20.978 1.00 16.63  ? 140 LEU B CA  1 
ATOM   800  C  C   . LEU A 1 121 ? -3.209  -10.078 -21.463 1.00 16.56  ? 140 LEU B C   1 
ATOM   801  O  O   . LEU A 1 121 ? -2.185  -9.902  -22.124 1.00 16.86  ? 140 LEU B O   1 
ATOM   802  C  CB  . LEU A 1 121 ? -3.994  -12.355 -22.159 1.00 16.14  ? 140 LEU B CB  1 
ATOM   803  C  CG  . LEU A 1 121 ? -4.028  -13.853 -21.855 1.00 16.54  ? 140 LEU B CG  1 
ATOM   804  C  CD1 . LEU A 1 121 ? -4.361  -14.652 -23.103 1.00 16.64  ? 140 LEU B CD1 1 
ATOM   805  C  CD2 . LEU A 1 121 ? -2.700  -14.301 -21.265 1.00 17.69  ? 140 LEU B CD2 1 
ATOM   806  N  N   . HIS A 1 122 ? -4.032  -9.090  -21.131 1.00 24.38  ? 141 HIS B N   1 
ATOM   807  C  CA  . HIS A 1 122 ? -3.730  -7.710  -21.479 1.00 24.12  ? 141 HIS B CA  1 
ATOM   808  C  C   . HIS A 1 122 ? -2.456  -7.247  -20.789 1.00 25.04  ? 141 HIS B C   1 
ATOM   809  O  O   . HIS A 1 122 ? -1.690  -6.461  -21.343 1.00 26.16  ? 141 HIS B O   1 
ATOM   810  C  CB  . HIS A 1 122 ? -4.893  -6.791  -21.105 1.00 23.64  ? 141 HIS B CB  1 
ATOM   811  C  CG  . HIS A 1 122 ? -5.996  -6.775  -22.116 1.00 23.35  ? 141 HIS B CG  1 
ATOM   812  N  ND1 . HIS A 1 122 ? -6.057  -5.849  -23.135 1.00 22.02  ? 141 HIS B ND1 1 
ATOM   813  C  CD2 . HIS A 1 122 ? -7.077  -7.576  -22.270 1.00 23.11  ? 141 HIS B CD2 1 
ATOM   814  C  CE1 . HIS A 1 122 ? -7.129  -6.078  -23.871 1.00 21.88  ? 141 HIS B CE1 1 
ATOM   815  N  NE2 . HIS A 1 122 ? -7.764  -7.121  -23.369 1.00 21.45  ? 141 HIS B NE2 1 
ATOM   816  N  N   . TYR A 1 123 ? -2.226  -7.749  -19.581 1.00 25.23  ? 142 TYR B N   1 
ATOM   817  C  CA  . TYR A 1 123 ? -1.092  -7.311  -18.779 1.00 25.70  ? 142 TYR B CA  1 
ATOM   818  C  C   . TYR A 1 123 ? 0.246   -7.817  -19.307 1.00 26.61  ? 142 TYR B C   1 
ATOM   819  O  O   . TYR A 1 123 ? 1.292   -7.534  -18.726 1.00 27.95  ? 142 TYR B O   1 
ATOM   820  C  CB  . TYR A 1 123 ? -1.280  -7.715  -17.318 1.00 26.45  ? 142 TYR B CB  1 
ATOM   821  C  CG  . TYR A 1 123 ? -2.457  -7.036  -16.664 1.00 26.55  ? 142 TYR B CG  1 
ATOM   822  C  CD1 . TYR A 1 123 ? -2.547  -5.652  -16.629 1.00 26.30  ? 142 TYR B CD1 1 
ATOM   823  C  CD2 . TYR A 1 123 ? -3.478  -7.775  -16.079 1.00 26.93  ? 142 TYR B CD2 1 
ATOM   824  C  CE1 . TYR A 1 123 ? -3.617  -5.021  -16.035 1.00 25.82  ? 142 TYR B CE1 1 
ATOM   825  C  CE2 . TYR A 1 123 ? -4.555  -7.149  -15.481 1.00 26.66  ? 142 TYR B CE2 1 
ATOM   826  C  CZ  . TYR A 1 123 ? -4.618  -5.771  -15.464 1.00 26.22  ? 142 TYR B CZ  1 
ATOM   827  O  OH  . TYR A 1 123 ? -5.682  -5.134  -14.873 1.00 26.32  ? 142 TYR B OH  1 
ATOM   828  N  N   . GLU A 1 124 ? 0.212   -8.560  -20.407 1.00 22.82  ? 143 GLU B N   1 
ATOM   829  C  CA  . GLU A 1 124 ? 1.442   -9.033  -21.033 1.00 23.88  ? 143 GLU B CA  1 
ATOM   830  C  C   . GLU A 1 124 ? 1.396   -8.939  -22.557 1.00 23.10  ? 143 GLU B C   1 
ATOM   831  O  O   . GLU A 1 124 ? 1.965   -9.774  -23.256 1.00 23.64  ? 143 GLU B O   1 
ATOM   832  C  CB  . GLU A 1 124 ? 1.784   -10.454 -20.574 1.00 24.11  ? 143 GLU B CB  1 
ATOM   833  C  CG  . GLU A 1 124 ? 0.587   -11.285 -20.146 1.00 24.31  ? 143 GLU B CG  1 
ATOM   834  C  CD  . GLU A 1 124 ? 0.989   -12.528 -19.369 1.00 26.42  ? 143 GLU B CD  1 
ATOM   835  O  OE1 . GLU A 1 124 ? 2.038   -13.125 -19.697 1.00 27.63  ? 143 GLU B OE1 1 
ATOM   836  O  OE2 . GLU A 1 124 ? 0.255   -12.910 -18.430 1.00 25.65  ? 143 GLU B OE2 1 
ATOM   837  N  N   . GLY A 1 125 ? 0.718   -7.911  -23.058 1.00 29.42  ? 144 GLY B N   1 
ATOM   838  C  CA  . GLY A 1 125 ? 0.649   -7.649  -24.485 1.00 29.67  ? 144 GLY B CA  1 
ATOM   839  C  C   . GLY A 1 125 ? 0.244   -8.849  -25.316 1.00 29.33  ? 144 GLY B C   1 
ATOM   840  O  O   . GLY A 1 125 ? 0.775   -9.068  -26.405 1.00 29.66  ? 144 GLY B O   1 
ATOM   841  N  N   . ARG A 1 126 ? -0.702  -9.630  -24.805 1.00 23.62  ? 145 ARG B N   1 
ATOM   842  C  CA  . ARG A 1 126 ? -1.162  -10.820 -25.505 1.00 23.42  ? 145 ARG B CA  1 
ATOM   843  C  C   . ARG A 1 126 ? -2.649  -10.750 -25.830 1.00 22.72  ? 145 ARG B C   1 
ATOM   844  O  O   . ARG A 1 126 ? -3.202  -11.664 -26.441 1.00 22.30  ? 145 ARG B O   1 
ATOM   845  C  CB  . ARG A 1 126 ? -0.866  -12.080 -24.686 1.00 24.37  ? 145 ARG B CB  1 
ATOM   846  C  CG  . ARG A 1 126 ? 0.577   -12.550 -24.763 1.00 24.92  ? 145 ARG B CG  1 
ATOM   847  C  CD  . ARG A 1 126 ? 0.670   -14.050 -24.543 1.00 26.36  ? 145 ARG B CD  1 
ATOM   848  N  NE  . ARG A 1 126 ? 0.471   -14.419 -23.146 1.00 27.00  ? 145 ARG B NE  1 
ATOM   849  C  CZ  . ARG A 1 126 ? 0.177   -15.647 -22.733 1.00 27.84  ? 145 ARG B CZ  1 
ATOM   850  N  NH1 . ARG A 1 126 ? 0.032   -16.629 -23.614 1.00 28.46  ? 145 ARG B NH1 1 
ATOM   851  N  NH2 . ARG A 1 126 ? 0.020   -15.894 -21.440 1.00 27.98  ? 145 ARG B NH2 1 
ATOM   852  N  N   . ALA A 1 127 ? -3.290  -9.661  -25.423 1.00 23.72  ? 146 ALA B N   1 
ATOM   853  C  CA  . ALA A 1 127 ? -4.722  -9.502  -25.639 1.00 22.40  ? 146 ALA B CA  1 
ATOM   854  C  C   . ALA A 1 127 ? -5.046  -8.122  -26.195 1.00 22.05  ? 146 ALA B C   1 
ATOM   855  O  O   . ALA A 1 127 ? -4.345  -7.151  -25.913 1.00 22.63  ? 146 ALA B O   1 
ATOM   856  C  CB  . ALA A 1 127 ? -5.480  -9.746  -24.346 1.00 22.49  ? 146 ALA B CB  1 
ATOM   857  N  N   . LEU A 1 128 ? -6.113  -8.041  -26.984 1.00 21.89  ? 147 LEU B N   1 
ATOM   858  C  CA  . LEU A 1 128 ? -6.540  -6.778  -27.570 1.00 21.08  ? 147 LEU B CA  1 
ATOM   859  C  C   . LEU A 1 128 ? -8.053  -6.629  -27.530 1.00 21.00  ? 147 LEU B C   1 
ATOM   860  O  O   . LEU A 1 128 ? -8.788  -7.609  -27.661 1.00 21.02  ? 147 LEU B O   1 
ATOM   861  C  CB  . LEU A 1 128 ? -6.068  -6.667  -29.019 1.00 20.88  ? 147 LEU B CB  1 
ATOM   862  C  CG  . LEU A 1 128 ? -4.585  -6.852  -29.318 1.00 21.41  ? 147 LEU B CG  1 
ATOM   863  C  CD1 . LEU A 1 128 ? -4.363  -6.760  -30.809 1.00 21.23  ? 147 LEU B CD1 1 
ATOM   864  C  CD2 . LEU A 1 128 ? -3.748  -5.817  -28.590 1.00 22.41  ? 147 LEU B CD2 1 
ATOM   865  N  N   . ASP A 1 129 ? -8.509  -5.394  -27.354 1.00 19.09  ? 148 ASP B N   1 
ATOM   866  C  CA  . ASP A 1 129 ? -9.924  -5.070  -27.461 1.00 18.37  ? 148 ASP B CA  1 
ATOM   867  C  C   . ASP A 1 129 ? -10.161 -4.329  -28.764 1.00 17.66  ? 148 ASP B C   1 
ATOM   868  O  O   . ASP A 1 129 ? -9.762  -3.176  -28.912 1.00 17.85  ? 148 ASP B O   1 
ATOM   869  C  CB  . ASP A 1 129 ? -10.372 -4.216  -26.278 1.00 18.13  ? 148 ASP B CB  1 
ATOM   870  C  CG  . ASP A 1 129 ? -10.513 -5.018  -25.009 1.00 18.24  ? 148 ASP B CG  1 
ATOM   871  O  OD1 . ASP A 1 129 ? -10.589 -6.259  -25.113 1.00 18.41  ? 148 ASP B OD1 1 
ATOM   872  O  OD2 . ASP A 1 129 ? -10.549 -4.414  -23.916 1.00 18.58  ? 148 ASP B OD2 1 
ATOM   873  N  N   . ILE A 1 130 ? -10.811 -4.998  -29.709 1.00 19.24  ? 149 ILE B N   1 
ATOM   874  C  CA  . ILE A 1 130 ? -10.954 -4.455  -31.053 1.00 19.06  ? 149 ILE B CA  1 
ATOM   875  C  C   . ILE A 1 130 ? -12.377 -4.035  -31.394 1.00 18.76  ? 149 ILE B C   1 
ATOM   876  O  O   . ILE A 1 130 ? -13.347 -4.602  -30.891 1.00 18.74  ? 149 ILE B O   1 
ATOM   877  C  CB  . ILE A 1 130 ? -10.476 -5.461  -32.112 1.00 18.95  ? 149 ILE B CB  1 
ATOM   878  C  CG1 . ILE A 1 130 ? -11.359 -6.712  -32.092 1.00 18.45  ? 149 ILE B CG1 1 
ATOM   879  C  CG2 . ILE A 1 130 ? -9.022  -5.823  -31.874 1.00 20.15  ? 149 ILE B CG2 1 
ATOM   880  C  CD1 . ILE A 1 130 ? -11.107 -7.657  -33.244 1.00 18.51  ? 149 ILE B CD1 1 
ATOM   881  N  N   . THR A 1 131 ? -12.482 -3.021  -32.248 1.00 18.85  ? 150 THR B N   1 
ATOM   882  C  CA  . THR A 1 131 ? -13.748 -2.625  -32.851 1.00 18.76  ? 150 THR B CA  1 
ATOM   883  C  C   . THR A 1 131 ? -13.477 -2.203  -34.288 1.00 18.97  ? 150 THR B C   1 
ATOM   884  O  O   . THR A 1 131 ? -12.335 -2.242  -34.749 1.00 18.98  ? 150 THR B O   1 
ATOM   885  C  CB  . THR A 1 131 ? -14.403 -1.441  -32.115 1.00 18.09  ? 150 THR B CB  1 
ATOM   886  O  OG1 . THR A 1 131 ? -13.799 -0.215  -32.542 1.00 17.90  ? 150 THR B OG1 1 
ATOM   887  C  CG2 . THR A 1 131 ? -14.258 -1.588  -30.608 1.00 18.30  ? 150 THR B CG2 1 
ATOM   888  N  N   . THR A 1 132 ? -14.525 -1.801  -34.995 1.00 23.34  ? 151 THR B N   1 
ATOM   889  C  CA  . THR A 1 132 ? -14.364 -1.271  -36.341 1.00 23.93  ? 151 THR B CA  1 
ATOM   890  C  C   . THR A 1 132 ? -14.249 0.247   -36.278 1.00 23.61  ? 151 THR B C   1 
ATOM   891  O  O   . THR A 1 132 ? -14.832 0.885   -35.402 1.00 23.72  ? 151 THR B O   1 
ATOM   892  C  CB  . THR A 1 132 ? -15.529 -1.677  -37.267 1.00 24.61  ? 151 THR B CB  1 
ATOM   893  O  OG1 . THR A 1 132 ? -16.776 -1.287  -36.673 1.00 24.50  ? 151 THR B OG1 1 
ATOM   894  C  CG2 . THR A 1 132 ? -15.525 -3.182  -37.496 1.00 23.33  ? 151 THR B CG2 1 
ATOM   895  N  N   . SER A 1 133 ? -13.488 0.817   -37.205 1.00 15.27  ? 152 SER B N   1 
ATOM   896  C  CA  . SER A 1 133 ? -13.215 2.248   -37.203 1.00 15.30  ? 152 SER B CA  1 
ATOM   897  C  C   . SER A 1 133 ? -14.486 3.089   -37.236 1.00 14.90  ? 152 SER B C   1 
ATOM   898  O  O   . SER A 1 133 ? -14.469 4.263   -36.872 1.00 15.22  ? 152 SER B O   1 
ATOM   899  C  CB  . SER A 1 133 ? -12.309 2.615   -38.380 1.00 15.58  ? 152 SER B CB  1 
ATOM   900  O  OG  . SER A 1 133 ? -12.774 2.024   -39.580 1.00 16.00  ? 152 SER B OG  1 
ATOM   901  N  N   . ASP A 1 134 ? -15.586 2.487   -37.671 1.00 24.26  ? 153 ASP B N   1 
ATOM   902  C  CA  . ASP A 1 134 ? -16.849 3.205   -37.778 1.00 24.81  ? 153 ASP B CA  1 
ATOM   903  C  C   . ASP A 1 134 ? -17.738 2.963   -36.564 1.00 25.21  ? 153 ASP B C   1 
ATOM   904  O  O   . ASP A 1 134 ? -18.864 3.459   -36.498 1.00 26.18  ? 153 ASP B O   1 
ATOM   905  C  CB  . ASP A 1 134 ? -17.587 2.817   -39.063 1.00 25.49  ? 153 ASP B CB  1 
ATOM   906  C  CG  . ASP A 1 134 ? -17.940 1.340   -39.115 1.00 25.67  ? 153 ASP B CG  1 
ATOM   907  O  OD1 . ASP A 1 134 ? -17.735 0.631   -38.105 1.00 24.50  ? 153 ASP B OD1 1 
ATOM   908  O  OD2 . ASP A 1 134 ? -18.427 0.889   -40.173 1.00 26.14  ? 153 ASP B OD2 1 
ATOM   909  N  N   . ARG A 1 135 ? -17.226 2.197   -35.607 1.00 20.02  ? 154 ARG B N   1 
ATOM   910  C  CA  . ARG A 1 135 ? -17.971 1.876   -34.395 1.00 19.88  ? 154 ARG B CA  1 
ATOM   911  C  C   . ARG A 1 135 ? -19.344 1.278   -34.698 1.00 19.83  ? 154 ARG B C   1 
ATOM   912  O  O   . ARG A 1 135 ? -20.277 1.432   -33.912 1.00 19.19  ? 154 ARG B O   1 
ATOM   913  C  CB  . ARG A 1 135 ? -18.133 3.114   -33.511 1.00 20.33  ? 154 ARG B CB  1 
ATOM   914  C  CG  . ARG A 1 135 ? -16.903 3.492   -32.699 1.00 19.92  ? 154 ARG B CG  1 
ATOM   915  C  CD  . ARG A 1 135 ? -15.863 4.222   -33.533 1.00 19.72  ? 154 ARG B CD  1 
ATOM   916  N  NE  . ARG A 1 135 ? -14.928 4.959   -32.688 1.00 20.50  ? 154 ARG B NE  1 
ATOM   917  C  CZ  . ARG A 1 135 ? -13.884 5.647   -33.141 1.00 21.27  ? 154 ARG B CZ  1 
ATOM   918  N  NH1 . ARG A 1 135 ? -13.628 5.692   -34.441 1.00 21.78  ? 154 ARG B NH1 1 
ATOM   919  N  NH2 . ARG A 1 135 ? -13.093 6.289   -32.293 1.00 21.42  ? 154 ARG B NH2 1 
ATOM   920  N  N   . ASP A 1 136 ? -19.465 0.602   -35.838 1.00 26.77  ? 155 ASP B N   1 
ATOM   921  C  CA  . ASP A 1 136 ? -20.711 -0.075  -36.187 1.00 26.79  ? 155 ASP B CA  1 
ATOM   922  C  C   . ASP A 1 136 ? -20.885 -1.336  -35.353 1.00 26.42  ? 155 ASP B C   1 
ATOM   923  O  O   . ASP A 1 136 ? -20.230 -2.349  -35.598 1.00 26.51  ? 155 ASP B O   1 
ATOM   924  C  CB  . ASP A 1 136 ? -20.757 -0.428  -37.675 1.00 27.39  ? 155 ASP B CB  1 
ATOM   925  C  CG  . ASP A 1 136 ? -22.056 -1.112  -38.072 1.00 27.46  ? 155 ASP B CG  1 
ATOM   926  O  OD1 . ASP A 1 136 ? -23.035 -1.024  -37.302 1.00 27.36  ? 155 ASP B OD1 1 
ATOM   927  O  OD2 . ASP A 1 136 ? -22.101 -1.738  -39.152 1.00 27.85  ? 155 ASP B OD2 1 
ATOM   928  N  N   . ARG A 1 137 ? -21.774 -1.264  -34.370 1.00 33.38  ? 156 ARG B N   1 
ATOM   929  C  CA  . ARG A 1 137 ? -22.022 -2.379  -33.466 1.00 33.15  ? 156 ARG B CA  1 
ATOM   930  C  C   . ARG A 1 137 ? -22.393 -3.639  -34.244 1.00 33.31  ? 156 ARG B C   1 
ATOM   931  O  O   . ARG A 1 137 ? -22.108 -4.755  -33.811 1.00 33.69  ? 156 ARG B O   1 
ATOM   932  C  CB  . ARG A 1 137 ? -23.152 -2.021  -32.503 1.00 34.14  ? 156 ARG B CB  1 
ATOM   933  C  CG  . ARG A 1 137 ? -22.875 -2.340  -31.044 1.00 34.91  ? 156 ARG B CG  1 
ATOM   934  C  CD  . ARG A 1 137 ? -22.502 -1.085  -30.262 1.00 33.78  ? 156 ARG B CD  1 
ATOM   935  N  NE  . ARG A 1 137 ? -21.117 -0.673  -30.472 1.00 34.08  ? 156 ARG B NE  1 
ATOM   936  C  CZ  . ARG A 1 137 ? -20.578 0.423   -29.944 1.00 34.82  ? 156 ARG B CZ  1 
ATOM   937  N  NH1 . ARG A 1 137 ? -21.312 1.221   -29.179 1.00 33.51  ? 156 ARG B NH1 1 
ATOM   938  N  NH2 . ARG A 1 137 ? -19.305 0.724   -30.180 1.00 34.99  ? 156 ARG B NH2 1 
ATOM   939  N  N   . ASN A 1 138 ? -23.028 -3.447  -35.398 1.00 30.48  ? 157 ASN B N   1 
ATOM   940  C  CA  . ASN A 1 138 ? -23.509 -4.557  -36.221 1.00 30.15  ? 157 ASN B CA  1 
ATOM   941  C  C   . ASN A 1 138 ? -22.406 -5.352  -36.914 1.00 30.42  ? 157 ASN B C   1 
ATOM   942  O  O   . ASN A 1 138 ? -22.663 -6.417  -37.479 1.00 30.28  ? 157 ASN B O   1 
ATOM   943  C  CB  . ASN A 1 138 ? -24.499 -4.052  -37.274 1.00 31.04  ? 157 ASN B CB  1 
ATOM   944  C  CG  . ASN A 1 138 ? -25.904 -3.900  -36.731 1.00 32.25  ? 157 ASN B CG  1 
ATOM   945  O  OD1 . ASN A 1 138 ? -26.166 -4.188  -35.563 1.00 32.81  ? 157 ASN B OD1 1 
ATOM   946  N  ND2 . ASN A 1 138 ? -26.820 -3.450  -37.579 1.00 33.72  ? 157 ASN B ND2 1 
ATOM   947  N  N   . LYS A 1 139 ? -21.182 -4.836  -36.882 1.00 16.48  ? 158 LYS B N   1 
ATOM   948  C  CA  . LYS A 1 139 ? -20.078 -5.478  -37.586 1.00 16.43  ? 158 LYS B CA  1 
ATOM   949  C  C   . LYS A 1 139 ? -19.204 -6.328  -36.672 1.00 15.98  ? 158 LYS B C   1 
ATOM   950  O  O   . LYS A 1 139 ? -18.299 -7.016  -37.144 1.00 16.43  ? 158 LYS B O   1 
ATOM   951  C  CB  . LYS A 1 139 ? -19.208 -4.435  -38.289 1.00 16.66  ? 158 LYS B CB  1 
ATOM   952  C  CG  . LYS A 1 139 ? -19.824 -3.826  -39.533 1.00 16.75  ? 158 LYS B CG  1 
ATOM   953  C  CD  . LYS A 1 139 ? -18.775 -3.055  -40.317 1.00 17.02  ? 158 LYS B CD  1 
ATOM   954  C  CE  . LYS A 1 139 ? -19.385 -2.307  -41.487 1.00 17.95  ? 158 LYS B CE  1 
ATOM   955  N  NZ  . LYS A 1 139 ? -20.168 -1.122  -41.046 1.00 17.76  ? 158 LYS B NZ  1 
ATOM   956  N  N   . TYR A 1 140 ? -19.473 -6.289  -35.371 1.00 15.24  ? 159 TYR B N   1 
ATOM   957  C  CA  . TYR A 1 140 ? -18.588 -6.935  -34.404 1.00 15.43  ? 159 TYR B CA  1 
ATOM   958  C  C   . TYR A 1 140 ? -18.631 -8.461  -34.443 1.00 15.59  ? 159 TYR B C   1 
ATOM   959  O  O   . TYR A 1 140 ? -17.608 -9.119  -34.256 1.00 15.49  ? 159 TYR B O   1 
ATOM   960  C  CB  . TYR A 1 140 ? -18.841 -6.412  -32.987 1.00 14.75  ? 159 TYR B CB  1 
ATOM   961  C  CG  . TYR A 1 140 ? -18.540 -4.938  -32.839 1.00 15.64  ? 159 TYR B CG  1 
ATOM   962  C  CD1 . TYR A 1 140 ? -17.766 -4.271  -33.782 1.00 16.02  ? 159 TYR B CD1 1 
ATOM   963  C  CD2 . TYR A 1 140 ? -19.006 -4.216  -31.750 1.00 16.24  ? 159 TYR B CD2 1 
ATOM   964  C  CE1 . TYR A 1 140 ? -17.483 -2.925  -33.655 1.00 15.37  ? 159 TYR B CE1 1 
ATOM   965  C  CE2 . TYR A 1 140 ? -18.724 -2.868  -31.612 1.00 15.99  ? 159 TYR B CE2 1 
ATOM   966  C  CZ  . TYR A 1 140 ? -17.962 -2.229  -32.567 1.00 15.36  ? 159 TYR B CZ  1 
ATOM   967  O  OH  . TYR A 1 140 ? -17.677 -0.890  -32.438 1.00 15.52  ? 159 TYR B OH  1 
ATOM   968  N  N   . GLY A 1 141 ? -19.810 -9.023  -34.686 1.00 16.92  ? 160 GLY B N   1 
ATOM   969  C  CA  . GLY A 1 141 ? -19.942 -10.464 -34.803 1.00 16.77  ? 160 GLY B CA  1 
ATOM   970  C  C   . GLY A 1 141 ? -19.090 -10.998 -35.938 1.00 17.23  ? 160 GLY B C   1 
ATOM   971  O  O   . GLY A 1 141 ? -18.416 -12.020 -35.801 1.00 16.74  ? 160 GLY B O   1 
ATOM   972  N  N   . LEU A 1 142 ? -19.125 -10.293 -37.066 1.00 46.31  ? 161 LEU B N   1 
ATOM   973  C  CA  . LEU A 1 142 ? -18.320 -10.651 -38.229 1.00 46.85  ? 161 LEU B CA  1 
ATOM   974  C  C   . LEU A 1 142 ? -16.849 -10.340 -37.985 1.00 46.18  ? 161 LEU B C   1 
ATOM   975  O  O   . LEU A 1 142 ? -15.965 -11.062 -38.448 1.00 46.39  ? 161 LEU B O   1 
ATOM   976  C  CB  . LEU A 1 142 ? -18.809 -9.902  -39.470 1.00 48.11  ? 161 LEU B CB  1 
ATOM   977  C  CG  . LEU A 1 142 ? -20.207 -10.255 -39.986 1.00 49.79  ? 161 LEU B CG  1 
ATOM   978  C  CD1 . LEU A 1 142 ? -20.755 -9.148  -40.883 1.00 49.33  ? 161 LEU B CD1 1 
ATOM   979  C  CD2 . LEU A 1 142 ? -20.197 -11.595 -40.713 1.00 50.06  ? 161 LEU B CD2 1 
ATOM   980  N  N   . LEU A 1 143 ? -16.594 -9.255  -37.262 1.00 13.96  ? 162 LEU B N   1 
ATOM   981  C  CA  . LEU A 1 143 ? -15.235 -8.886  -36.894 1.00 13.71  ? 162 LEU B CA  1 
ATOM   982  C  C   . LEU A 1 143 ? -14.601 -10.019 -36.105 1.00 13.75  ? 162 LEU B C   1 
ATOM   983  O  O   . LEU A 1 143 ? -13.487 -10.452 -36.400 1.00 13.84  ? 162 LEU B O   1 
ATOM   984  C  CB  . LEU A 1 143 ? -15.239 -7.609  -36.054 1.00 13.36  ? 162 LEU B CB  1 
ATOM   985  C  CG  . LEU A 1 143 ? -13.878 -7.085  -35.595 1.00 18.78  ? 162 LEU B CG  1 
ATOM   986  C  CD1 . LEU A 1 143 ? -13.011 -6.735  -36.792 1.00 13.21  ? 162 LEU B CD1 1 
ATOM   987  C  CD2 . LEU A 1 143 ? -14.053 -5.880  -34.685 1.00 12.77  ? 162 LEU B CD2 1 
ATOM   988  N  N   . ALA A 1 144 ? -15.329 -10.501 -35.104 1.00 17.01  ? 163 ALA B N   1 
ATOM   989  C  CA  . ALA A 1 144 ? -14.853 -11.582 -34.253 1.00 17.10  ? 163 ALA B CA  1 
ATOM   990  C  C   . ALA A 1 144 ? -14.468 -12.804 -35.078 1.00 17.49  ? 163 ALA B C   1 
ATOM   991  O  O   . ALA A 1 144 ? -13.416 -13.399 -34.858 1.00 17.83  ? 163 ALA B O   1 
ATOM   992  C  CB  . ALA A 1 144 ? -15.910 -11.947 -33.221 1.00 17.21  ? 163 ALA B CB  1 
ATOM   993  N  N   . ARG A 1 145 ? -15.320 -13.172 -36.029 1.00 17.51  ? 164 ARG B N   1 
ATOM   994  C  CA  . ARG A 1 145 ? -15.035 -14.307 -36.899 1.00 17.74  ? 164 ARG B CA  1 
ATOM   995  C  C   . ARG A 1 145 ? -13.779 -14.059 -37.727 1.00 17.77  ? 164 ARG B C   1 
ATOM   996  O  O   . ARG A 1 145 ? -12.981 -14.968 -37.948 1.00 18.59  ? 164 ARG B O   1 
ATOM   997  C  CB  . ARG A 1 145 ? -16.221 -14.602 -37.817 1.00 18.24  ? 164 ARG B CB  1 
ATOM   998  C  CG  . ARG A 1 145 ? -15.972 -15.741 -38.796 1.00 19.50  ? 164 ARG B CG  1 
ATOM   999  C  CD  . ARG A 1 145 ? -15.602 -17.030 -38.076 1.00 19.06  ? 164 ARG B CD  1 
ATOM   1000 N  NE  . ARG A 1 145 ? -16.682 -17.512 -37.219 1.00 19.24  ? 164 ARG B NE  1 
ATOM   1001 C  CZ  . ARG A 1 145 ? -16.617 -18.616 -36.480 1.00 19.80  ? 164 ARG B CZ  1 
ATOM   1002 N  NH1 . ARG A 1 145 ? -15.520 -19.362 -36.490 1.00 19.91  ? 164 ARG B NH1 1 
ATOM   1003 N  NH2 . ARG A 1 145 ? -17.651 -18.977 -35.731 1.00 19.26  ? 164 ARG B NH2 1 
ATOM   1004 N  N   . LEU A 1 146 ? -13.608 -12.824 -38.182 1.00 16.73  ? 165 LEU B N   1 
ATOM   1005 C  CA  . LEU A 1 146 ? -12.427 -12.460 -38.953 1.00 17.26  ? 165 LEU B CA  1 
ATOM   1006 C  C   . LEU A 1 146 ? -11.175 -12.622 -38.105 1.00 17.56  ? 165 LEU B C   1 
ATOM   1007 O  O   . LEU A 1 146 ? -10.095 -12.908 -38.621 1.00 17.57  ? 165 LEU B O   1 
ATOM   1008 C  CB  . LEU A 1 146 ? -12.542 -11.022 -39.462 1.00 17.06  ? 165 LEU B CB  1 
ATOM   1009 C  CG  . LEU A 1 146 ? -13.585 -10.814 -40.560 1.00 16.94  ? 165 LEU B CG  1 
ATOM   1010 C  CD1 . LEU A 1 146 ? -13.652 -9.355  -40.979 1.00 17.18  ? 165 LEU B CD1 1 
ATOM   1011 C  CD2 . LEU A 1 146 ? -13.272 -11.706 -41.752 1.00 16.65  ? 165 LEU B CD2 1 
ATOM   1012 N  N   . ALA A 1 147 ? -11.334 -12.438 -36.799 1.00 14.22  ? 166 ALA B N   1 
ATOM   1013 C  CA  . ALA A 1 147 ? -10.234 -12.588 -35.858 1.00 20.59  ? 166 ALA B CA  1 
ATOM   1014 C  C   . ALA A 1 147 ? -9.845  -14.053 -35.727 1.00 21.02  ? 166 ALA B C   1 
ATOM   1015 O  O   . ALA A 1 147 ? -8.697  -14.376 -35.433 1.00 14.68  ? 166 ALA B O   1 
ATOM   1016 C  CB  . ALA A 1 147 ? -10.618 -12.019 -34.506 1.00 19.94  ? 166 ALA B CB  1 
ATOM   1017 N  N   . VAL A 1 148 ? -10.811 -14.939 -35.947 1.00 14.38  ? 167 VAL B N   1 
ATOM   1018 C  CA  . VAL A 1 148 ? -10.548 -16.370 -35.895 1.00 15.11  ? 167 VAL B CA  1 
ATOM   1019 C  C   . VAL A 1 148 ? -9.745  -16.801 -37.114 1.00 15.79  ? 167 VAL B C   1 
ATOM   1020 O  O   . VAL A 1 148 ? -8.691  -17.422 -36.987 1.00 16.12  ? 167 VAL B O   1 
ATOM   1021 C  CB  . VAL A 1 148 ? -11.847 -17.193 -35.825 1.00 14.93  ? 167 VAL B CB  1 
ATOM   1022 C  CG1 . VAL A 1 148 ? -11.539 -18.671 -36.006 1.00 15.71  ? 167 VAL B CG1 1 
ATOM   1023 C  CG2 . VAL A 1 148 ? -12.560 -16.951 -34.507 1.00 14.48  ? 167 VAL B CG2 1 
ATOM   1024 N  N   . GLU A 1 149 ? -10.248 -16.464 -38.296 1.00 33.58  ? 168 GLU B N   1 
ATOM   1025 C  CA  . GLU A 1 149 ? -9.550  -16.777 -39.534 1.00 34.28  ? 168 GLU B CA  1 
ATOM   1026 C  C   . GLU A 1 149 ? -8.206  -16.062 -39.568 1.00 34.38  ? 168 GLU B C   1 
ATOM   1027 O  O   . GLU A 1 149 ? -7.291  -16.472 -40.284 1.00 34.52  ? 168 GLU B O   1 
ATOM   1028 C  CB  . GLU A 1 149 ? -10.394 -16.372 -40.747 1.00 34.32  ? 168 GLU B CB  1 
ATOM   1029 C  CG  . GLU A 1 149 ? -11.851 -16.807 -40.673 1.00 35.38  ? 168 GLU B CG  1 
ATOM   1030 C  CD  . GLU A 1 149 ? -12.012 -18.301 -40.433 1.00 37.86  ? 168 GLU B CD  1 
ATOM   1031 O  OE1 . GLU A 1 149 ? -11.075 -19.066 -40.756 1.00 39.88  ? 168 GLU B OE1 1 
ATOM   1032 O  OE2 . GLU A 1 149 ? -13.080 -18.712 -39.924 1.00 36.47  ? 168 GLU B OE2 1 
ATOM   1033 N  N   . ALA A 1 150 ? -8.096  -14.990 -38.789 1.00 20.67  ? 169 ALA B N   1 
ATOM   1034 C  CA  . ALA A 1 150 ? -6.862  -14.220 -38.708 1.00 20.57  ? 169 ALA B CA  1 
ATOM   1035 C  C   . ALA A 1 150 ? -5.791  -15.003 -37.961 1.00 21.13  ? 169 ALA B C   1 
ATOM   1036 O  O   . ALA A 1 150 ? -4.598  -14.815 -38.192 1.00 22.16  ? 169 ALA B O   1 
ATOM   1037 C  CB  . ALA A 1 150 ? -7.111  -12.880 -38.036 1.00 20.53  ? 169 ALA B CB  1 
ATOM   1038 N  N   . GLY A 1 151 ? -6.224  -15.877 -37.059 1.00 24.82  ? 170 GLY B N   1 
ATOM   1039 C  CA  . GLY A 1 151 ? -5.309  -16.778 -36.386 1.00 25.72  ? 170 GLY B CA  1 
ATOM   1040 C  C   . GLY A 1 151 ? -5.283  -16.658 -34.877 1.00 27.04  ? 170 GLY B C   1 
ATOM   1041 O  O   . GLY A 1 151 ? -4.620  -17.447 -34.204 1.00 28.85  ? 170 GLY B O   1 
ATOM   1042 N  N   . PHE A 1 152 ? -5.992  -15.670 -34.339 1.00 26.28  ? 171 PHE B N   1 
ATOM   1043 C  CA  . PHE A 1 152 ? -6.029  -15.473 -32.894 1.00 25.57  ? 171 PHE B CA  1 
ATOM   1044 C  C   . PHE A 1 152 ? -6.440  -16.754 -32.181 1.00 26.65  ? 171 PHE B C   1 
ATOM   1045 O  O   . PHE A 1 152 ? -7.439  -17.383 -32.534 1.00 26.50  ? 171 PHE B O   1 
ATOM   1046 C  CB  . PHE A 1 152 ? -6.964  -14.325 -32.521 1.00 25.02  ? 171 PHE B CB  1 
ATOM   1047 C  CG  . PHE A 1 152 ? -6.354  -12.968 -32.705 1.00 25.18  ? 171 PHE B CG  1 
ATOM   1048 C  CD1 . PHE A 1 152 ? -5.514  -12.439 -31.739 1.00 25.35  ? 171 PHE B CD1 1 
ATOM   1049 C  CD2 . PHE A 1 152 ? -6.612  -12.223 -33.844 1.00 24.59  ? 171 PHE B CD2 1 
ATOM   1050 C  CE1 . PHE A 1 152 ? -4.946  -11.191 -31.904 1.00 25.27  ? 171 PHE B CE1 1 
ATOM   1051 C  CE2 . PHE A 1 152 ? -6.046  -10.973 -34.014 1.00 24.56  ? 171 PHE B CE2 1 
ATOM   1052 C  CZ  . PHE A 1 152 ? -5.212  -10.456 -33.042 1.00 25.01  ? 171 PHE B CZ  1 
ATOM   1053 N  N   . ASP A 1 153 ? -5.657  -17.134 -31.178 1.00 29.68  ? 172 ASP B N   1 
ATOM   1054 C  CA  . ASP A 1 153 ? -5.849  -18.401 -30.483 1.00 30.58  ? 172 ASP B CA  1 
ATOM   1055 C  C   . ASP A 1 153 ? -7.091  -18.395 -29.600 1.00 29.74  ? 172 ASP B C   1 
ATOM   1056 O  O   . ASP A 1 153 ? -7.542  -19.443 -29.138 1.00 29.40  ? 172 ASP B O   1 
ATOM   1057 C  CB  . ASP A 1 153 ? -4.604  -18.736 -29.663 1.00 31.24  ? 172 ASP B CB  1 
ATOM   1058 C  CG  . ASP A 1 153 ? -3.353  -18.802 -30.516 1.00 32.59  ? 172 ASP B CG  1 
ATOM   1059 O  OD1 . ASP A 1 153 ? -3.347  -19.572 -31.502 1.00 32.21  ? 172 ASP B OD1 1 
ATOM   1060 O  OD2 . ASP A 1 153 ? -2.380  -18.083 -30.206 1.00 33.09  ? 172 ASP B OD2 1 
ATOM   1061 N  N   . TRP A 1 154 ? -7.640  -17.205 -29.376 1.00 18.83  ? 173 TRP B N   1 
ATOM   1062 C  CA  . TRP A 1 154 ? -8.870  -17.060 -28.613 1.00 17.50  ? 173 TRP B CA  1 
ATOM   1063 C  C   . TRP A 1 154 ? -9.582  -15.761 -28.979 1.00 16.70  ? 173 TRP B C   1 
ATOM   1064 O  O   . TRP A 1 154 ? -9.020  -14.671 -28.867 1.00 16.24  ? 173 TRP B O   1 
ATOM   1065 C  CB  . TRP A 1 154 ? -8.589  -17.111 -27.110 1.00 17.43  ? 173 TRP B CB  1 
ATOM   1066 C  CG  . TRP A 1 154 ? -9.797  -17.448 -26.281 1.00 17.09  ? 173 TRP B CG  1 
ATOM   1067 C  CD1 . TRP A 1 154 ? -10.454 -18.643 -26.240 1.00 17.29  ? 173 TRP B CD1 1 
ATOM   1068 C  CD2 . TRP A 1 154 ? -10.484 -16.582 -25.367 1.00 16.27  ? 173 TRP B CD2 1 
ATOM   1069 N  NE1 . TRP A 1 154 ? -11.509 -18.574 -25.361 1.00 16.63  ? 173 TRP B NE1 1 
ATOM   1070 C  CE2 . TRP A 1 154 ? -11.548 -17.320 -24.812 1.00 16.13  ? 173 TRP B CE2 1 
ATOM   1071 C  CE3 . TRP A 1 154 ? -10.304 -15.255 -24.966 1.00 15.86  ? 173 TRP B CE3 1 
ATOM   1072 C  CZ2 . TRP A 1 154 ? -12.427 -16.777 -23.878 1.00 16.22  ? 173 TRP B CZ2 1 
ATOM   1073 C  CZ3 . TRP A 1 154 ? -11.178 -14.718 -24.035 1.00 15.68  ? 173 TRP B CZ3 1 
ATOM   1074 C  CH2 . TRP A 1 154 ? -12.226 -15.478 -23.502 1.00 15.18  ? 173 TRP B CH2 1 
ATOM   1075 N  N   . VAL A 1 155 ? -10.822 -15.893 -29.431 1.00 21.55  ? 174 VAL B N   1 
ATOM   1076 C  CA  . VAL A 1 155 ? -11.650 -14.749 -29.774 1.00 20.66  ? 174 VAL B CA  1 
ATOM   1077 C  C   . VAL A 1 155 ? -12.892 -14.780 -28.910 1.00 20.17  ? 174 VAL B C   1 
ATOM   1078 O  O   . VAL A 1 155 ? -13.466 -15.842 -28.688 1.00 20.96  ? 174 VAL B O   1 
ATOM   1079 C  CB  . VAL A 1 155 ? -12.073 -14.790 -31.242 1.00 20.59  ? 174 VAL B CB  1 
ATOM   1080 C  CG1 . VAL A 1 155 ? -12.928 -13.579 -31.575 1.00 20.22  ? 174 VAL B CG1 1 
ATOM   1081 C  CG2 . VAL A 1 155 ? -10.852 -14.858 -32.137 1.00 20.67  ? 174 VAL B CG2 1 
ATOM   1082 N  N   . TYR A 1 156 ? -13.321 -13.621 -28.433 1.00 20.16  ? 175 TYR B N   1 
ATOM   1083 C  CA  . TYR A 1 156 ? -14.423 -13.587 -27.484 1.00 20.26  ? 175 TYR B CA  1 
ATOM   1084 C  C   . TYR A 1 156 ? -15.210 -12.291 -27.588 1.00 20.12  ? 175 TYR B C   1 
ATOM   1085 O  O   . TYR A 1 156 ? -14.666 -11.201 -27.421 1.00 20.25  ? 175 TYR B O   1 
ATOM   1086 C  CB  . TYR A 1 156 ? -13.894 -13.814 -26.062 1.00 20.78  ? 175 TYR B CB  1 
ATOM   1087 C  CG  . TYR A 1 156 ? -14.900 -13.624 -24.948 1.00 20.72  ? 175 TYR B CG  1 
ATOM   1088 C  CD1 . TYR A 1 156 ? -16.197 -14.114 -25.056 1.00 21.60  ? 175 TYR B CD1 1 
ATOM   1089 C  CD2 . TYR A 1 156 ? -14.538 -12.982 -23.766 1.00 19.60  ? 175 TYR B CD2 1 
ATOM   1090 C  CE1 . TYR A 1 156 ? -17.108 -13.944 -24.026 1.00 20.90  ? 175 TYR B CE1 1 
ATOM   1091 C  CE2 . TYR A 1 156 ? -15.443 -12.813 -22.738 1.00 20.05  ? 175 TYR B CE2 1 
ATOM   1092 C  CZ  . TYR A 1 156 ? -16.724 -13.295 -22.871 1.00 20.55  ? 175 TYR B CZ  1 
ATOM   1093 O  OH  . TYR A 1 156 ? -17.630 -13.126 -21.846 1.00 20.77  ? 175 TYR B OH  1 
ATOM   1094 N  N   . TYR A 1 157 ? -16.499 -12.426 -27.873 1.00 23.17  ? 176 TYR B N   1 
ATOM   1095 C  CA  . TYR A 1 157 ? -17.382 -11.282 -27.987 1.00 23.56  ? 176 TYR B CA  1 
ATOM   1096 C  C   . TYR A 1 157 ? -17.633 -10.732 -26.588 1.00 24.62  ? 176 TYR B C   1 
ATOM   1097 O  O   . TYR A 1 157 ? -18.765 -10.733 -26.101 1.00 26.03  ? 176 TYR B O   1 
ATOM   1098 C  CB  . TYR A 1 157 ? -18.700 -11.703 -28.635 1.00 23.71  ? 176 TYR B CB  1 
ATOM   1099 C  CG  . TYR A 1 157 ? -19.451 -10.569 -29.300 1.00 24.74  ? 176 TYR B CG  1 
ATOM   1100 C  CD1 . TYR A 1 157 ? -19.491 -9.305  -28.724 1.00 24.53  ? 176 TYR B CD1 1 
ATOM   1101 C  CD2 . TYR A 1 157 ? -20.137 -10.767 -30.493 1.00 24.77  ? 176 TYR B CD2 1 
ATOM   1102 C  CE1 . TYR A 1 157 ? -20.181 -8.267  -29.326 1.00 24.26  ? 176 TYR B CE1 1 
ATOM   1103 C  CE2 . TYR A 1 157 ? -20.830 -9.738  -31.099 1.00 23.56  ? 176 TYR B CE2 1 
ATOM   1104 C  CZ  . TYR A 1 157 ? -20.851 -8.491  -30.515 1.00 24.03  ? 176 TYR B CZ  1 
ATOM   1105 O  OH  . TYR A 1 157 ? -21.544 -7.470  -31.125 1.00 24.85  ? 176 TYR B OH  1 
ATOM   1106 N  N   . GLU A 1 158 ? -16.568 -10.262 -25.944 1.00 26.48  ? 177 GLU B N   1 
ATOM   1107 C  CA  . GLU A 1 158 ? -16.631 -9.867  -24.542 1.00 26.68  ? 177 GLU B CA  1 
ATOM   1108 C  C   . GLU A 1 158 ? -17.786 -8.920  -24.280 1.00 26.65  ? 177 GLU B C   1 
ATOM   1109 O  O   . GLU A 1 158 ? -18.684 -9.223  -23.498 1.00 27.18  ? 177 GLU B O   1 
ATOM   1110 C  CB  . GLU A 1 158 ? -15.319 -9.223  -24.088 1.00 26.18  ? 177 GLU B CB  1 
ATOM   1111 C  CG  . GLU A 1 158 ? -15.291 -8.893  -22.606 1.00 26.29  ? 177 GLU B CG  1 
ATOM   1112 C  CD  . GLU A 1 158 ? -13.888 -8.663  -22.082 1.00 28.69  ? 177 GLU B CD  1 
ATOM   1113 O  OE1 . GLU A 1 158 ? -13.042 -8.151  -22.843 1.00 28.59  ? 177 GLU B OE1 1 
ATOM   1114 O  OE2 . GLU A 1 158 ? -13.631 -8.996  -20.906 1.00 29.84  ? 177 GLU B OE2 1 
ATOM   1115 N  N   . SER A 1 159 ? -17.753 -7.771  -24.939 1.00 29.48  ? 178 SER B N   1 
ATOM   1116 C  CA  . SER A 1 159 ? -18.768 -6.752  -24.746 1.00 29.75  ? 178 SER B CA  1 
ATOM   1117 C  C   . SER A 1 159 ? -19.424 -6.395  -26.069 1.00 30.18  ? 178 SER B C   1 
ATOM   1118 O  O   . SER A 1 159 ? -18.827 -6.553  -27.134 1.00 30.22  ? 178 SER B O   1 
ATOM   1119 C  CB  . SER A 1 159 ? -18.145 -5.503  -24.121 1.00 29.56  ? 178 SER B CB  1 
ATOM   1120 O  OG  . SER A 1 159 ? -19.048 -4.408  -24.155 1.00 30.56  ? 178 SER B OG  1 
ATOM   1121 N  N   . ARG A 1 160 ? -20.656 -5.909  -25.994 1.00 38.89  ? 179 ARG B N   1 
ATOM   1122 C  CA  . ARG A 1 160 ? -21.366 -5.447  -27.175 1.00 39.04  ? 179 ARG B CA  1 
ATOM   1123 C  C   . ARG A 1 160 ? -20.666 -4.226  -27.748 1.00 38.10  ? 179 ARG B C   1 
ATOM   1124 O  O   . ARG A 1 160 ? -21.053 -3.707  -28.794 1.00 38.71  ? 179 ARG B O   1 
ATOM   1125 C  CB  . ARG A 1 160 ? -22.815 -5.118  -26.820 1.00 40.37  ? 179 ARG B CB  1 
ATOM   1126 C  CG  . ARG A 1 160 ? -23.690 -6.349  -26.643 1.00 41.84  ? 179 ARG B CG  1 
ATOM   1127 C  CD  . ARG A 1 160 ? -24.876 -6.073  -25.740 1.00 43.81  ? 179 ARG B CD  1 
ATOM   1128 N  NE  . ARG A 1 160 ? -25.831 -7.178  -25.748 1.00 45.17  ? 179 ARG B NE  1 
ATOM   1129 C  CZ  . ARG A 1 160 ? -26.729 -7.397  -24.791 1.00 46.94  ? 179 ARG B CZ  1 
ATOM   1130 N  NH1 . ARG A 1 160 ? -26.791 -6.591  -23.738 1.00 47.17  ? 179 ARG B NH1 1 
ATOM   1131 N  NH2 . ARG A 1 160 ? -27.559 -8.428  -24.884 1.00 46.77  ? 179 ARG B NH2 1 
ATOM   1132 N  N   . ASN A 1 161 ? -19.620 -3.781  -27.059 1.00 27.13  ? 180 ASN B N   1 
ATOM   1133 C  CA  . ASN A 1 161 ? -18.883 -2.592  -27.460 1.00 27.42  ? 180 ASN B CA  1 
ATOM   1134 C  C   . ASN A 1 161 ? -17.477 -2.904  -27.965 1.00 27.27  ? 180 ASN B C   1 
ATOM   1135 O  O   . ASN A 1 161 ? -16.788 -2.025  -28.481 1.00 27.25  ? 180 ASN B O   1 
ATOM   1136 C  CB  . ASN A 1 161 ? -18.813 -1.598  -26.299 1.00 27.91  ? 180 ASN B CB  1 
ATOM   1137 C  CG  . ASN A 1 161 ? -20.187 -1.153  -25.834 1.00 28.70  ? 180 ASN B CG  1 
ATOM   1138 O  OD1 . ASN A 1 161 ? -21.101 -0.980  -26.641 1.00 29.05  ? 180 ASN B OD1 1 
ATOM   1139 N  ND2 . ASN A 1 161 ? -20.339 -0.965  -24.528 1.00 28.97  ? 180 ASN B ND2 1 
ATOM   1140 N  N   . HIS A 1 162 ? -17.056 -4.157  -27.817 1.00 22.27  ? 181 HIS B N   1 
ATOM   1141 C  CA  . HIS A 1 162 ? -15.731 -4.570  -28.266 1.00 21.44  ? 181 HIS B CA  1 
ATOM   1142 C  C   . HIS A 1 162 ? -15.572 -6.085  -28.253 1.00 21.34  ? 181 HIS B C   1 
ATOM   1143 O  O   . HIS A 1 162 ? -16.265 -6.787  -27.521 1.00 21.81  ? 181 HIS B O   1 
ATOM   1144 C  CB  . HIS A 1 162 ? -14.645 -3.942  -27.390 1.00 21.51  ? 181 HIS B CB  1 
ATOM   1145 C  CG  . HIS A 1 162 ? -14.451 -4.639  -26.078 1.00 22.43  ? 181 HIS B CG  1 
ATOM   1146 N  ND1 . HIS A 1 162 ? -15.159 -4.302  -24.943 1.00 22.53  ? 181 HIS B ND1 1 
ATOM   1147 C  CD2 . HIS A 1 162 ? -13.630 -5.654  -25.721 1.00 22.34  ? 181 HIS B CD2 1 
ATOM   1148 C  CE1 . HIS A 1 162 ? -14.781 -5.079  -23.944 1.00 22.18  ? 181 HIS B CE1 1 
ATOM   1149 N  NE2 . HIS A 1 162 ? -13.855 -5.910  -24.390 1.00 22.21  ? 181 HIS B NE2 1 
ATOM   1150 N  N   . VAL A 1 163 ? -14.645 -6.577  -29.068 1.00 13.03  ? 182 VAL B N   1 
ATOM   1151 C  CA  . VAL A 1 163 ? -14.310 -7.993  -29.096 1.00 12.52  ? 182 VAL B CA  1 
ATOM   1152 C  C   . VAL A 1 163 ? -12.958 -8.201  -28.426 1.00 12.54  ? 182 VAL B C   1 
ATOM   1153 O  O   . VAL A 1 163 ? -12.080 -7.345  -28.510 1.00 12.61  ? 182 VAL B O   1 
ATOM   1154 C  CB  . VAL A 1 163 ? -14.252 -8.525  -30.540 1.00 18.92  ? 182 VAL B CB  1 
ATOM   1155 C  CG1 . VAL A 1 163 ? -13.823 -9.983  -30.559 1.00 12.65  ? 182 VAL B CG1 1 
ATOM   1156 C  CG2 . VAL A 1 163 ? -15.598 -8.350  -31.223 1.00 18.84  ? 182 VAL B CG2 1 
ATOM   1157 N  N   . HIS A 1 164 ? -12.793 -9.333  -27.753 1.00 22.68  ? 183 HIS B N   1 
ATOM   1158 C  CA  . HIS A 1 164 ? -11.536 -9.640  -27.088 1.00 23.40  ? 183 HIS B CA  1 
ATOM   1159 C  C   . HIS A 1 164 ? -10.770 -10.721 -27.837 1.00 23.68  ? 183 HIS B C   1 
ATOM   1160 O  O   . HIS A 1 164 ? -11.274 -11.823 -28.038 1.00 24.11  ? 183 HIS B O   1 
ATOM   1161 C  CB  . HIS A 1 164 ? -11.781 -10.083 -25.647 1.00 23.75  ? 183 HIS B CB  1 
ATOM   1162 C  CG  . HIS A 1 164 ? -10.531 -10.453 -24.912 1.00 24.17  ? 183 HIS B CG  1 
ATOM   1163 N  ND1 . HIS A 1 164 ? -9.676  -9.512  -24.380 1.00 24.61  ? 183 HIS B ND1 1 
ATOM   1164 C  CD2 . HIS A 1 164 ? -9.989  -11.659 -24.623 1.00 24.66  ? 183 HIS B CD2 1 
ATOM   1165 C  CE1 . HIS A 1 164 ? -8.662  -10.123 -23.793 1.00 25.15  ? 183 HIS B CE1 1 
ATOM   1166 N  NE2 . HIS A 1 164 ? -8.828  -11.427 -23.927 1.00 25.49  ? 183 HIS B NE2 1 
ATOM   1167 N  N   . VAL A 1 165 ? -9.548  -10.398 -28.245 1.00 22.18  ? 184 VAL B N   1 
ATOM   1168 C  CA  . VAL A 1 165 ? -8.707  -11.349 -28.959 1.00 22.80  ? 184 VAL B CA  1 
ATOM   1169 C  C   . VAL A 1 165 ? -7.386  -11.561 -28.225 1.00 23.73  ? 184 VAL B C   1 
ATOM   1170 O  O   . VAL A 1 165 ? -6.792  -10.611 -27.719 1.00 24.08  ? 184 VAL B O   1 
ATOM   1171 C  CB  . VAL A 1 165 ? -8.425  -10.872 -30.393 1.00 22.83  ? 184 VAL B CB  1 
ATOM   1172 C  CG1 . VAL A 1 165 ? -9.694  -10.935 -31.227 1.00 22.26  ? 184 VAL B CG1 1 
ATOM   1173 C  CG2 . VAL A 1 165 ? -7.865  -9.460  -30.379 1.00 22.35  ? 184 VAL B CG2 1 
ATOM   1174 N  N   . SER A 1 166 ? -6.933  -12.808 -28.164 1.00 18.39  ? 185 SER B N   1 
ATOM   1175 C  CA  . SER A 1 166 ? -5.684  -13.127 -27.478 1.00 18.85  ? 185 SER B CA  1 
ATOM   1176 C  C   . SER A 1 166 ? -4.870  -14.186 -28.216 1.00 20.25  ? 185 SER B C   1 
ATOM   1177 O  O   . SER A 1 166 ? -5.387  -14.890 -29.083 1.00 20.57  ? 185 SER B O   1 
ATOM   1178 C  CB  . SER A 1 166 ? -5.958  -13.571 -26.040 1.00 18.79  ? 185 SER B CB  1 
ATOM   1179 O  OG  . SER A 1 166 ? -6.874  -14.650 -26.004 1.00 19.05  ? 185 SER B OG  1 
ATOM   1180 N  N   . VAL A 1 167 ? -3.591  -14.291 -27.864 1.00 21.13  ? 186 VAL B N   1 
ATOM   1181 C  CA  . VAL A 1 167 ? -2.683  -15.221 -28.526 1.00 21.81  ? 186 VAL B CA  1 
ATOM   1182 C  C   . VAL A 1 167 ? -1.851  -16.018 -27.530 1.00 23.07  ? 186 VAL B C   1 
ATOM   1183 O  O   . VAL A 1 167 ? -1.748  -15.657 -26.358 1.00 22.66  ? 186 VAL B O   1 
ATOM   1184 C  CB  . VAL A 1 167 ? -1.715  -14.489 -29.472 1.00 22.31  ? 186 VAL B CB  1 
ATOM   1185 C  CG1 . VAL A 1 167 ? -2.483  -13.710 -30.529 1.00 21.65  ? 186 VAL B CG1 1 
ATOM   1186 C  CG2 . VAL A 1 167 ? -0.793  -13.570 -28.680 1.00 22.40  ? 186 VAL B CG2 1 
ATOM   1187 N  N   . LYS A 1 168 ? -1.254  -17.102 -28.016 1.00 38.83  ? 187 LYS B N   1 
ATOM   1188 C  CA  . LYS A 1 168 ? -0.367  -17.930 -27.212 1.00 39.50  ? 187 LYS B CA  1 
ATOM   1189 C  C   . LYS A 1 168 ? 0.883   -17.151 -26.830 1.00 40.58  ? 187 LYS B C   1 
ATOM   1190 O  O   . LYS A 1 168 ? 1.163   -16.090 -27.392 1.00 41.36  ? 187 LYS B O   1 
ATOM   1191 C  CB  . LYS A 1 168 ? 0.035   -19.188 -27.985 1.00 41.24  ? 187 LYS B CB  1 
ATOM   1192 C  CG  . LYS A 1 168 ? -1.066  -20.228 -28.134 1.00 40.78  ? 187 LYS B CG  1 
ATOM   1193 C  CD  . LYS A 1 168 ? -0.625  -21.360 -29.061 1.00 41.68  ? 187 LYS B CD  1 
ATOM   1194 C  CE  . LYS A 1 168 ? -1.546  -22.569 -28.953 1.00 42.54  ? 187 LYS B CE  1 
ATOM   1195 N  NZ  . LYS A 1 168 ? -2.958  -22.241 -29.299 1.00 40.41  ? 187 LYS B NZ  1 
ATOM   1196 N  N   . ALA A 1 169 ? 1.637   -17.682 -25.876 1.00 24.30  ? 188 ALA B N   1 
ATOM   1197 C  CA  . ALA A 1 169 ? 2.888   -17.057 -25.469 1.00 25.45  ? 188 ALA B CA  1 
ATOM   1198 C  C   . ALA A 1 169 ? 3.938   -17.224 -26.564 1.00 27.67  ? 188 ALA B C   1 
ATOM   1199 O  O   . ALA A 1 169 ? 3.717   -17.933 -27.548 1.00 26.53  ? 188 ALA B O   1 
ATOM   1200 C  CB  . ALA A 1 169 ? 3.379   -17.650 -24.162 1.00 25.63  ? 188 ALA B CB  1 
ATOM   1201 N  N   . ASP A 1 170 ? 5.080   -16.567 -26.387 1.00 72.10  ? 189 ASP B N   1 
ATOM   1202 C  CA  . ASP A 1 170 ? 6.165   -16.641 -27.358 1.00 73.17  ? 189 ASP B CA  1 
ATOM   1203 C  C   . ASP A 1 170 ? 7.278   -17.563 -26.873 1.00 76.33  ? 189 ASP B C   1 
ATOM   1204 O  O   . ASP A 1 170 ? 7.385   -17.848 -25.680 1.00 77.85  ? 189 ASP B O   1 
ATOM   1205 C  CB  . ASP A 1 170 ? 6.725   -15.245 -27.642 1.00 58.16  ? 189 ASP B CB  1 
ATOM   1206 C  CG  . ASP A 1 170 ? 6.030   -14.564 -28.803 1.00 57.78  ? 189 ASP B CG  1 
ATOM   1207 O  OD1 . ASP A 1 170 ? 4.879   -14.939 -29.112 1.00 57.41  ? 189 ASP B OD1 1 
ATOM   1208 O  OD2 . ASP A 1 170 ? 6.633   -13.653 -29.408 1.00 57.89  ? 189 ASP B OD2 1 
ATOM   1209 N  N   . GLY B 2 7   ? -0.156  13.527  -9.403  1.00 42.59  ? 829 GLY C N   1 
ATOM   1210 C  CA  . GLY B 2 7   ? -1.347  12.925  -9.975  1.00 41.01  ? 829 GLY C CA  1 
ATOM   1211 C  C   . GLY B 2 7   ? -1.860  11.746  -9.171  1.00 39.50  ? 829 GLY C C   1 
ATOM   1212 O  O   . GLY B 2 7   ? -1.072  10.964  -8.638  1.00 40.02  ? 829 GLY C O   1 
ATOM   1213 N  N   . PRO B 2 8   ? -3.191  11.613  -9.077  1.00 41.41  ? 830 PRO C N   1 
ATOM   1214 C  CA  . PRO B 2 8   ? -3.835  10.522  -8.336  1.00 41.03  ? 830 PRO C CA  1 
ATOM   1215 C  C   . PRO B 2 8   ? -3.721  9.184   -9.063  1.00 39.39  ? 830 PRO C C   1 
ATOM   1216 O  O   . PRO B 2 8   ? -3.210  9.123   -10.182 1.00 38.05  ? 830 PRO C O   1 
ATOM   1217 C  CB  . PRO B 2 8   ? -5.308  10.955  -8.281  1.00 39.89  ? 830 PRO C CB  1 
ATOM   1218 C  CG  . PRO B 2 8   ? -5.321  12.406  -8.671  1.00 40.31  ? 830 PRO C CG  1 
ATOM   1219 C  CD  . PRO B 2 8   ? -4.174  12.570  -9.608  1.00 40.82  ? 830 PRO C CD  1 
ATOM   1220 N  N   . HIS B 2 9   ? -4.194  8.121   -8.423  1.00 36.37  ? 831 HIS C N   1 
ATOM   1221 C  CA  . HIS B 2 9   ? -4.242  6.808   -9.053  1.00 35.16  ? 831 HIS C CA  1 
ATOM   1222 C  C   . HIS B 2 9   ? -5.540  6.099   -8.702  1.00 34.70  ? 831 HIS C C   1 
ATOM   1223 O  O   . HIS B 2 9   ? -5.823  5.850   -7.531  1.00 34.93  ? 831 HIS C O   1 
ATOM   1224 C  CB  . HIS B 2 9   ? -3.053  5.945   -8.632  1.00 34.62  ? 831 HIS C CB  1 
ATOM   1225 C  CG  . HIS B 2 9   ? -3.153  4.523   -9.093  1.00 33.76  ? 831 HIS C CG  1 
ATOM   1226 N  ND1 . HIS B 2 9   ? -2.645  4.093   -10.300 1.00 33.21  ? 831 HIS C ND1 1 
ATOM   1227 C  CD2 . HIS B 2 9   ? -3.715  3.435   -8.514  1.00 33.43  ? 831 HIS C CD2 1 
ATOM   1228 C  CE1 . HIS B 2 9   ? -2.884  2.801   -10.443 1.00 32.48  ? 831 HIS C CE1 1 
ATOM   1229 N  NE2 . HIS B 2 9   ? -3.532  2.378   -9.373  1.00 32.23  ? 831 HIS C NE2 1 
ATOM   1230 N  N   . ILE B 2 10  ? -6.325  5.775   -9.723  1.00 27.23  ? 832 ILE C N   1 
ATOM   1231 C  CA  . ILE B 2 10  ? -7.591  5.086   -9.521  1.00 26.16  ? 832 ILE C CA  1 
ATOM   1232 C  C   . ILE B 2 10  ? -7.358  3.610   -9.223  1.00 26.11  ? 832 ILE C C   1 
ATOM   1233 O  O   . ILE B 2 10  ? -6.820  2.875   -10.050 1.00 25.40  ? 832 ILE C O   1 
ATOM   1234 C  CB  . ILE B 2 10  ? -8.505  5.226   -10.744 1.00 25.34  ? 832 ILE C CB  1 
ATOM   1235 C  CG1 . ILE B 2 10  ? -8.563  6.688   -11.190 1.00 25.13  ? 832 ILE C CG1 1 
ATOM   1236 C  CG2 . ILE B 2 10  ? -9.894  4.689   -10.434 1.00 25.17  ? 832 ILE C CG2 1 
ATOM   1237 C  CD1 . ILE B 2 10  ? -9.191  6.890   -12.548 1.00 23.65  ? 832 ILE C CD1 1 
ATOM   1238 N  N   . ALA B 2 11  ? -7.760  3.189   -8.029  1.00 43.49  ? 833 ALA C N   1 
ATOM   1239 C  CA  . ALA B 2 11  ? -7.607  1.804   -7.608  1.00 43.59  ? 833 ALA C CA  1 
ATOM   1240 C  C   . ALA B 2 11  ? -8.474  0.878   -8.453  1.00 43.43  ? 833 ALA C C   1 
ATOM   1241 O  O   . ALA B 2 11  ? -8.021  -0.176  -8.900  1.00 43.70  ? 833 ALA C O   1 
ATOM   1242 C  CB  . ALA B 2 11  ? -7.949  1.656   -6.134  1.00 43.62  ? 833 ALA C CB  1 
ATOM   1243 N  N   . TYR B 2 12  ? -9.724  1.276   -8.669  1.00 46.02  ? 834 TYR C N   1 
ATOM   1244 C  CA  . TYR B 2 12  ? -10.643 0.470   -9.460  1.00 45.77  ? 834 TYR C CA  1 
ATOM   1245 C  C   . TYR B 2 12  ? -11.898 1.238   -9.849  1.00 45.64  ? 834 TYR C C   1 
ATOM   1246 O  O   . TYR B 2 12  ? -12.143 2.343   -9.365  1.00 45.55  ? 834 TYR C O   1 
ATOM   1247 C  CB  . TYR B 2 12  ? -11.033 -0.797  -8.698  1.00 45.72  ? 834 TYR C CB  1 
ATOM   1248 C  CG  . TYR B 2 12  ? -11.895 -0.546  -7.481  1.00 46.44  ? 834 TYR C CG  1 
ATOM   1249 C  CD1 . TYR B 2 12  ? -11.327 -0.391  -6.222  1.00 47.01  ? 834 TYR C CD1 1 
ATOM   1250 C  CD2 . TYR B 2 12  ? -13.278 -0.470  -7.589  1.00 46.50  ? 834 TYR C CD2 1 
ATOM   1251 C  CE1 . TYR B 2 12  ? -12.111 -0.165  -5.106  1.00 47.57  ? 834 TYR C CE1 1 
ATOM   1252 C  CE2 . TYR B 2 12  ? -14.072 -0.242  -6.479  1.00 47.29  ? 834 TYR C CE2 1 
ATOM   1253 C  CZ  . TYR B 2 12  ? -13.483 -0.091  -5.240  1.00 48.87  ? 834 TYR C CZ  1 
ATOM   1254 O  OH  . TYR B 2 12  ? -14.270 0.134   -4.132  1.00 49.23  ? 834 TYR C OH  1 
ATOM   1255 N  N   . THR B 2 13  ? -12.689 0.634   -10.730 1.00 33.04  ? 835 THR C N   1 
ATOM   1256 C  CA  . THR B 2 13  ? -13.971 1.189   -11.141 1.00 31.99  ? 835 THR C CA  1 
ATOM   1257 C  C   . THR B 2 13  ? -14.962 0.050   -11.343 1.00 31.12  ? 835 THR C C   1 
ATOM   1258 O  O   . THR B 2 13  ? -14.610 -1.000  -11.877 1.00 31.24  ? 835 THR C O   1 
ATOM   1259 C  CB  . THR B 2 13  ? -13.850 1.993   -12.447 1.00 30.92  ? 835 THR C CB  1 
ATOM   1260 O  OG1 . THR B 2 13  ? -13.156 1.212   -13.429 1.00 30.19  ? 835 THR C OG1 1 
ATOM   1261 C  CG2 . THR B 2 13  ? -13.086 3.287   -12.210 1.00 31.42  ? 835 THR C CG2 1 
ATOM   1262 N  N   . GLU B 2 14  ? -16.199 0.252   -10.906 1.00 40.87  ? 836 GLU C N   1 
ATOM   1263 C  CA  . GLU B 2 14  ? -17.214 -0.787  -11.015 1.00 40.93  ? 836 GLU C CA  1 
ATOM   1264 C  C   . GLU B 2 14  ? -18.604 -0.186  -11.183 1.00 40.62  ? 836 GLU C C   1 
ATOM   1265 O  O   . GLU B 2 14  ? -18.993 0.715   -10.441 1.00 41.39  ? 836 GLU C O   1 
ATOM   1266 C  CB  . GLU B 2 14  ? -17.176 -1.701  -9.789  1.00 41.89  ? 836 GLU C CB  1 
ATOM   1267 C  CG  . GLU B 2 14  ? -18.099 -2.907  -9.882  1.00 42.82  ? 836 GLU C CG  1 
ATOM   1268 C  CD  . GLU B 2 14  ? -17.909 -3.882  -8.733  1.00 45.31  ? 836 GLU C CD  1 
ATOM   1269 O  OE1 . GLU B 2 14  ? -17.168 -3.551  -7.781  1.00 45.27  ? 836 GLU C OE1 1 
ATOM   1270 O  OE2 . GLU B 2 14  ? -18.503 -4.981  -8.784  1.00 45.84  ? 836 GLU C OE2 1 
ATOM   1271 N  N   . ALA B 2 15  ? -19.345 -0.683  -12.166 1.00 20.56  ? 837 ALA C N   1 
ATOM   1272 C  CA  . ALA B 2 15  ? -20.700 -0.209  -12.406 1.00 19.88  ? 837 ALA C CA  1 
ATOM   1273 C  C   . ALA B 2 15  ? -21.617 -0.646  -11.272 1.00 20.46  ? 837 ALA C C   1 
ATOM   1274 O  O   . ALA B 2 15  ? -21.485 -1.753  -10.755 1.00 21.48  ? 837 ALA C O   1 
ATOM   1275 C  CB  . ALA B 2 15  ? -21.213 -0.734  -13.738 1.00 19.48  ? 837 ALA C CB  1 
ATOM   1276 N  N   . VAL B 2 16  ? -22.538 0.229   -10.884 1.00 32.02  ? 838 VAL C N   1 
ATOM   1277 C  CA  . VAL B 2 16  ? -23.500 -0.093  -9.837  1.00 32.68  ? 838 VAL C CA  1 
ATOM   1278 C  C   . VAL B 2 16  ? -24.901 -0.242  -10.412 1.00 32.39  ? 838 VAL C C   1 
ATOM   1279 O  O   . VAL B 2 16  ? -25.712 -1.018  -9.908  1.00 33.15  ? 838 VAL C O   1 
ATOM   1280 C  CB  . VAL B 2 16  ? -23.523 0.979   -8.740  1.00 34.32  ? 838 VAL C CB  1 
ATOM   1281 C  CG1 . VAL B 2 16  ? -22.303 0.852   -7.854  1.00 36.55  ? 838 VAL C CG1 1 
ATOM   1282 C  CG2 . VAL B 2 16  ? -23.587 2.359   -9.356  1.00 33.04  ? 838 VAL C CG2 1 
ATOM   1283 N  N   . SER B 2 17  ? -25.178 0.513   -11.468 1.00 26.17  ? 839 SER C N   1 
ATOM   1284 C  CA  . SER B 2 17  ? -26.455 0.430   -12.159 1.00 25.20  ? 839 SER C CA  1 
ATOM   1285 C  C   . SER B 2 17  ? -26.220 0.606   -13.647 1.00 24.93  ? 839 SER C C   1 
ATOM   1286 O  O   . SER B 2 17  ? -25.079 0.605   -14.108 1.00 25.12  ? 839 SER C O   1 
ATOM   1287 C  CB  . SER B 2 17  ? -27.415 1.506   -11.653 1.00 25.09  ? 839 SER C CB  1 
ATOM   1288 O  OG  . SER B 2 17  ? -26.952 2.801   -11.996 1.00 25.32  ? 839 SER C OG  1 
ATOM   1289 N  N   . ASP B 2 18  ? -27.303 0.763   -14.398 1.00 29.97  ? 840 ASP C N   1 
ATOM   1290 C  CA  . ASP B 2 18  ? -27.199 1.001   -15.831 1.00 29.63  ? 840 ASP C CA  1 
ATOM   1291 C  C   . ASP B 2 18  ? -26.848 2.457   -16.126 1.00 29.59  ? 840 ASP C C   1 
ATOM   1292 O  O   . ASP B 2 18  ? -26.695 2.845   -17.283 1.00 29.40  ? 840 ASP C O   1 
ATOM   1293 C  CB  . ASP B 2 18  ? -28.494 0.602   -16.547 1.00 29.68  ? 840 ASP C CB  1 
ATOM   1294 C  CG  . ASP B 2 18  ? -29.706 1.374   -16.051 1.00 29.54  ? 840 ASP C CG  1 
ATOM   1295 O  OD1 . ASP B 2 18  ? -29.633 1.985   -14.963 1.00 29.40  ? 840 ASP C OD1 1 
ATOM   1296 O  OD2 . ASP B 2 18  ? -30.740 1.366   -16.752 1.00 30.09  ? 840 ASP C OD2 1 
ATOM   1297 N  N   . THR B 2 19  ? -26.709 3.259   -15.074 1.00 25.52  ? 841 THR C N   1 
ATOM   1298 C  CA  . THR B 2 19  ? -26.453 4.687   -15.237 1.00 25.50  ? 841 THR C CA  1 
ATOM   1299 C  C   . THR B 2 19  ? -25.339 5.202   -14.331 1.00 25.81  ? 841 THR C C   1 
ATOM   1300 O  O   . THR B 2 19  ? -24.895 6.342   -14.477 1.00 25.63  ? 841 THR C O   1 
ATOM   1301 C  CB  . THR B 2 19  ? -27.719 5.521   -14.956 1.00 25.66  ? 841 THR C CB  1 
ATOM   1302 O  OG1 . THR B 2 19  ? -28.128 5.327   -13.597 1.00 26.40  ? 841 THR C OG1 1 
ATOM   1303 C  CG2 . THR B 2 19  ? -28.853 5.109   -15.884 1.00 25.90  ? 841 THR C CG2 1 
ATOM   1304 N  N   . GLN B 2 20  ? -24.887 4.368   -13.400 1.00 29.90  ? 842 GLN C N   1 
ATOM   1305 C  CA  . GLN B 2 20  ? -23.926 4.811   -12.392 1.00 30.17  ? 842 GLN C CA  1 
ATOM   1306 C  C   . GLN B 2 20  ? -22.666 3.952   -12.318 1.00 29.89  ? 842 GLN C C   1 
ATOM   1307 O  O   . GLN B 2 20  ? -22.723 2.730   -12.453 1.00 30.21  ? 842 GLN C O   1 
ATOM   1308 C  CB  . GLN B 2 20  ? -24.596 4.873   -11.019 1.00 30.16  ? 842 GLN C CB  1 
ATOM   1309 C  CG  . GLN B 2 20  ? -25.713 5.890   -10.918 1.00 31.21  ? 842 GLN C CG  1 
ATOM   1310 C  CD  . GLN B 2 20  ? -26.573 5.683   -9.692  1.00 32.52  ? 842 GLN C CD  1 
ATOM   1311 O  OE1 . GLN B 2 20  ? -26.815 4.550   -9.270  1.00 31.72  ? 842 GLN C OE1 1 
ATOM   1312 N  NE2 . GLN B 2 20  ? -27.050 6.780   -9.114  1.00 34.02  ? 842 GLN C NE2 1 
ATOM   1313 N  N   . ILE B 2 21  ? -21.532 4.610   -12.097 1.00 14.37  ? 843 ILE C N   1 
ATOM   1314 C  CA  . ILE B 2 21  ? -20.249 3.928   -11.966 1.00 15.68  ? 843 ILE C CA  1 
ATOM   1315 C  C   . ILE B 2 21  ? -19.432 4.512   -10.814 1.00 16.61  ? 843 ILE C C   1 
ATOM   1316 O  O   . ILE B 2 21  ? -19.268 5.729   -10.709 1.00 16.60  ? 843 ILE C O   1 
ATOM   1317 C  CB  . ILE B 2 21  ? -19.419 4.020   -13.265 1.00 15.04  ? 843 ILE C CB  1 
ATOM   1318 C  CG1 . ILE B 2 21  ? -20.165 3.364   -14.428 1.00 26.78  ? 843 ILE C CG1 1 
ATOM   1319 C  CG2 . ILE B 2 21  ? -18.053 3.374   -13.075 1.00 14.46  ? 843 ILE C CG2 1 
ATOM   1320 C  CD1 . ILE B 2 21  ? -19.423 3.430   -15.743 1.00 24.76  ? 843 ILE C CD1 1 
ATOM   1321 N  N   . MET B 2 22  ? -18.923 3.637   -9.952  1.00 52.78  ? 844 MET C N   1 
ATOM   1322 C  CA  . MET B 2 22  ? -18.102 4.053   -8.820  1.00 53.90  ? 844 MET C CA  1 
ATOM   1323 C  C   . MET B 2 22  ? -16.637 4.139   -9.214  1.00 54.42  ? 844 MET C C   1 
ATOM   1324 O  O   . MET B 2 22  ? -16.237 3.642   -10.267 1.00 54.82  ? 844 MET C O   1 
ATOM   1325 C  CB  . MET B 2 22  ? -18.220 3.048   -7.673  1.00 54.80  ? 844 MET C CB  1 
ATOM   1326 C  CG  . MET B 2 22  ? -19.601 2.894   -7.077  1.00 55.71  ? 844 MET C CG  1 
ATOM   1327 S  SD  . MET B 2 22  ? -19.669 1.441   -6.012  1.00 59.99  ? 844 MET C SD  1 
ATOM   1328 C  CE  . MET B 2 22  ? -18.355 1.792   -4.853  1.00 57.02  ? 844 MET C CE  1 
ATOM   1329 N  N   . LEU B 2 23  ? -15.839 4.757   -8.351  1.00 30.10  ? 845 LEU C N   1 
ATOM   1330 C  CA  . LEU B 2 23  ? -14.390 4.745   -8.510  1.00 30.10  ? 845 LEU C CA  1 
ATOM   1331 C  C   . LEU B 2 23  ? -13.670 5.085   -7.207  1.00 30.55  ? 845 LEU C C   1 
ATOM   1332 O  O   . LEU B 2 23  ? -13.994 6.067   -6.540  1.00 31.34  ? 845 LEU C O   1 
ATOM   1333 C  CB  . LEU B 2 23  ? -13.945 5.678   -9.642  1.00 29.11  ? 845 LEU C CB  1 
ATOM   1334 C  CG  . LEU B 2 23  ? -14.120 7.188   -9.474  1.00 29.65  ? 845 LEU C CG  1 
ATOM   1335 C  CD1 . LEU B 2 23  ? -13.179 7.929   -10.408 1.00 29.71  ? 845 LEU C CD1 1 
ATOM   1336 C  CD2 . LEU B 2 23  ? -15.562 7.609   -9.715  1.00 29.83  ? 845 LEU C CD2 1 
ATOM   1337 N  N   . LYS B 2 24  ? -12.701 4.250   -6.845  1.00 36.41  ? 846 LYS C N   1 
ATOM   1338 C  CA  . LYS B 2 24  ? -11.858 4.492   -5.679  1.00 36.87  ? 846 LYS C CA  1 
ATOM   1339 C  C   . LYS B 2 24  ? -10.460 4.878   -6.128  1.00 36.84  ? 846 LYS C C   1 
ATOM   1340 O  O   . LYS B 2 24  ? -9.954  4.346   -7.115  1.00 36.80  ? 846 LYS C O   1 
ATOM   1341 C  CB  . LYS B 2 24  ? -11.792 3.246   -4.796  1.00 36.71  ? 846 LYS C CB  1 
ATOM   1342 C  CG  . LYS B 2 24  ? -12.795 3.231   -3.656  1.00 37.77  ? 846 LYS C CG  1 
ATOM   1343 C  CD  . LYS B 2 24  ? -12.273 4.006   -2.458  1.00 38.35  ? 846 LYS C CD  1 
ATOM   1344 C  CE  . LYS B 2 24  ? -11.033 3.342   -1.879  1.00 37.80  ? 846 LYS C CE  1 
ATOM   1345 N  NZ  . LYS B 2 24  ? -10.490 4.089   -0.712  1.00 39.51  ? 846 LYS C NZ  1 
ATOM   1346 N  N   . TRP B 2 25  ? -9.836  5.804   -5.408  1.00 31.89  ? 847 TRP C N   1 
ATOM   1347 C  CA  . TRP B 2 25  ? -8.490  6.241   -5.756  1.00 32.39  ? 847 TRP C CA  1 
ATOM   1348 C  C   . TRP B 2 25  ? -7.662  6.640   -4.538  1.00 34.25  ? 847 TRP C C   1 
ATOM   1349 O  O   . TRP B 2 25  ? -8.200  6.904   -3.462  1.00 35.13  ? 847 TRP C O   1 
ATOM   1350 C  CB  . TRP B 2 25  ? -8.535  7.391   -6.767  1.00 32.35  ? 847 TRP C CB  1 
ATOM   1351 C  CG  . TRP B 2 25  ? -9.049  8.685   -6.210  1.00 33.48  ? 847 TRP C CG  1 
ATOM   1352 C  CD1 . TRP B 2 25  ? -8.317  9.670   -5.613  1.00 34.14  ? 847 TRP C CD1 1 
ATOM   1353 C  CD2 . TRP B 2 25  ? -10.408 9.142   -6.211  1.00 33.53  ? 847 TRP C CD2 1 
ATOM   1354 N  NE1 . TRP B 2 25  ? -9.135  10.708  -5.237  1.00 34.50  ? 847 TRP C NE1 1 
ATOM   1355 C  CE2 . TRP B 2 25  ? -10.424 10.408  -5.592  1.00 34.60  ? 847 TRP C CE2 1 
ATOM   1356 C  CE3 . TRP B 2 25  ? -11.612 8.601   -6.672  1.00 32.84  ? 847 TRP C CE3 1 
ATOM   1357 C  CZ2 . TRP B 2 25  ? -11.597 11.142  -5.423  1.00 34.69  ? 847 TRP C CZ2 1 
ATOM   1358 C  CZ3 . TRP B 2 25  ? -12.776 9.332   -6.502  1.00 32.62  ? 847 TRP C CZ3 1 
ATOM   1359 C  CH2 . TRP B 2 25  ? -12.759 10.588  -5.883  1.00 33.52  ? 847 TRP C CH2 1 
ATOM   1360 N  N   . THR B 2 26  ? -6.347  6.674   -4.723  1.00 37.40  ? 848 THR C N   1 
ATOM   1361 C  CA  . THR B 2 26  ? -5.422  7.077   -3.672  1.00 38.01  ? 848 THR C CA  1 
ATOM   1362 C  C   . THR B 2 26  ? -4.580  8.256   -4.148  1.00 39.63  ? 848 THR C C   1 
ATOM   1363 O  O   . THR B 2 26  ? -4.537  8.555   -5.342  1.00 39.08  ? 848 THR C O   1 
ATOM   1364 C  CB  . THR B 2 26  ? -4.486  5.924   -3.270  1.00 37.78  ? 848 THR C CB  1 
ATOM   1365 O  OG1 . THR B 2 26  ? -3.605  5.620   -4.359  1.00 37.03  ? 848 THR C OG1 1 
ATOM   1366 C  CG2 . THR B 2 26  ? -5.292  4.684   -2.909  1.00 37.19  ? 848 THR C CG2 1 
ATOM   1367 N  N   . TYR B 2 27  ? -3.910  8.922   -3.213  1.00 78.54  ? 849 TYR C N   1 
ATOM   1368 C  CA  . TYR B 2 27  ? -3.109  10.095  -3.546  1.00 79.66  ? 849 TYR C CA  1 
ATOM   1369 C  C   . TYR B 2 27  ? -2.071  10.403  -2.468  1.00 79.44  ? 849 TYR C C   1 
ATOM   1370 O  O   . TYR B 2 27  ? -2.378  11.028  -1.453  1.00 79.36  ? 849 TYR C O   1 
ATOM   1371 C  CB  . TYR B 2 27  ? -4.017  11.307  -3.784  1.00 78.16  ? 849 TYR C CB  1 
ATOM   1372 C  CG  . TYR B 2 27  ? -3.266  12.583  -4.081  1.00 79.71  ? 849 TYR C CG  1 
ATOM   1373 C  CD1 . TYR B 2 27  ? -2.507  12.711  -5.237  1.00 79.04  ? 849 TYR C CD1 1 
ATOM   1374 C  CD2 . TYR B 2 27  ? -3.319  13.662  -3.207  1.00 81.86  ? 849 TYR C CD2 1 
ATOM   1375 C  CE1 . TYR B 2 27  ? -1.815  13.878  -5.513  1.00 81.08  ? 849 TYR C CE1 1 
ATOM   1376 C  CE2 . TYR B 2 27  ? -2.632  14.834  -3.473  1.00 82.58  ? 849 TYR C CE2 1 
ATOM   1377 C  CZ  . TYR B 2 27  ? -1.881  14.937  -4.627  1.00 83.28  ? 849 TYR C CZ  1 
ATOM   1378 O  OH  . TYR B 2 27  ? -1.196  16.101  -4.897  1.00 83.75  ? 849 TYR C OH  1 
ATOM   1379 N  N   . ILE B 2 37  ? -4.020  20.849  -1.523  1.00 56.35  ? 859 ILE C N   1 
ATOM   1380 C  CA  . ILE B 2 37  ? -4.999  20.400  -2.504  1.00 56.94  ? 859 ILE C CA  1 
ATOM   1381 C  C   . ILE B 2 37  ? -6.374  20.976  -2.186  1.00 57.19  ? 859 ILE C C   1 
ATOM   1382 O  O   . ILE B 2 37  ? -6.754  21.083  -1.020  1.00 56.62  ? 859 ILE C O   1 
ATOM   1383 C  CB  . ILE B 2 37  ? -5.099  18.857  -2.555  1.00 54.93  ? 859 ILE C CB  1 
ATOM   1384 C  CG1 . ILE B 2 37  ? -3.713  18.225  -2.713  1.00 57.03  ? 859 ILE C CG1 1 
ATOM   1385 C  CG2 . ILE B 2 37  ? -6.021  18.415  -3.685  1.00 52.76  ? 859 ILE C CG2 1 
ATOM   1386 C  CD1 . ILE B 2 37  ? -2.944  18.078  -1.410  1.00 57.03  ? 859 ILE C CD1 1 
ATOM   1387 N  N   . GLN B 2 38  ? -7.114  21.349  -3.226  1.00 57.57  ? 860 GLN C N   1 
ATOM   1388 C  CA  . GLN B 2 38  ? -8.452  21.906  -3.053  1.00 56.70  ? 860 GLN C CA  1 
ATOM   1389 C  C   . GLN B 2 38  ? -9.542  20.904  -3.424  1.00 54.53  ? 860 GLN C C   1 
ATOM   1390 O  O   . GLN B 2 38  ? -10.613 20.888  -2.815  1.00 53.85  ? 860 GLN C O   1 
ATOM   1391 C  CB  . GLN B 2 38  ? -8.612  23.189  -3.871  1.00 58.78  ? 860 GLN C CB  1 
ATOM   1392 C  CG  . GLN B 2 38  ? -7.860  24.381  -3.301  1.00 61.43  ? 860 GLN C CG  1 
ATOM   1393 C  CD  . GLN B 2 38  ? -8.006  25.623  -4.156  1.00 63.78  ? 860 GLN C CD  1 
ATOM   1394 O  OE1 . GLN B 2 38  ? -8.301  25.540  -5.349  1.00 63.06  ? 860 GLN C OE1 1 
ATOM   1395 N  NE2 . GLN B 2 38  ? -7.797  26.786  -3.550  1.00 65.35  ? 860 GLN C NE2 1 
ATOM   1396 N  N   . GLY B 2 39  ? -9.265  20.072  -4.424  1.00 48.66  ? 861 GLY C N   1 
ATOM   1397 C  CA  . GLY B 2 39  ? -10.220 19.071  -4.867  1.00 46.58  ? 861 GLY C CA  1 
ATOM   1398 C  C   . GLY B 2 39  ? -9.719  18.237  -6.030  1.00 44.65  ? 861 GLY C C   1 
ATOM   1399 O  O   . GLY B 2 39  ? -8.551  18.321  -6.407  1.00 45.19  ? 861 GLY C O   1 
ATOM   1400 N  N   . PHE B 2 40  ? -10.608 17.430  -6.600  1.00 29.43  ? 862 PHE C N   1 
ATOM   1401 C  CA  . PHE B 2 40  ? -10.259 16.571  -7.727  1.00 28.26  ? 862 PHE C CA  1 
ATOM   1402 C  C   . PHE B 2 40  ? -11.175 16.809  -8.925  1.00 27.92  ? 862 PHE C C   1 
ATOM   1403 O  O   . PHE B 2 40  ? -12.339 17.183  -8.769  1.00 27.38  ? 862 PHE C O   1 
ATOM   1404 C  CB  . PHE B 2 40  ? -10.345 15.095  -7.330  1.00 27.24  ? 862 PHE C CB  1 
ATOM   1405 C  CG  . PHE B 2 40  ? -9.357  14.686  -6.279  1.00 27.31  ? 862 PHE C CG  1 
ATOM   1406 C  CD1 . PHE B 2 40  ? -9.708  14.693  -4.940  1.00 28.00  ? 862 PHE C CD1 1 
ATOM   1407 C  CD2 . PHE B 2 40  ? -8.081  14.281  -6.629  1.00 27.03  ? 862 PHE C CD2 1 
ATOM   1408 C  CE1 . PHE B 2 40  ? -8.804  14.311  -3.971  1.00 28.60  ? 862 PHE C CE1 1 
ATOM   1409 C  CE2 . PHE B 2 40  ? -7.173  13.898  -5.665  1.00 27.80  ? 862 PHE C CE2 1 
ATOM   1410 C  CZ  . PHE B 2 40  ? -7.534  13.913  -4.334  1.00 28.99  ? 862 PHE C CZ  1 
ATOM   1411 N  N   . TYR B 2 41  ? -10.640 16.586  -10.120 1.00 43.37  ? 863 TYR C N   1 
ATOM   1412 C  CA  . TYR B 2 41  ? -11.447 16.580  -11.333 1.00 42.16  ? 863 TYR C CA  1 
ATOM   1413 C  C   . TYR B 2 41  ? -11.616 15.145  -11.817 1.00 40.35  ? 863 TYR C C   1 
ATOM   1414 O  O   . TYR B 2 41  ? -10.639 14.410  -11.953 1.00 39.25  ? 863 TYR C O   1 
ATOM   1415 C  CB  . TYR B 2 41  ? -10.796 17.421  -12.433 1.00 42.82  ? 863 TYR C CB  1 
ATOM   1416 C  CG  . TYR B 2 41  ? -10.718 18.902  -12.133 1.00 44.55  ? 863 TYR C CG  1 
ATOM   1417 C  CD1 . TYR B 2 41  ? -9.526  19.598  -12.291 1.00 45.89  ? 863 TYR C CD1 1 
ATOM   1418 C  CD2 . TYR B 2 41  ? -11.833 19.603  -11.693 1.00 44.90  ? 863 TYR C CD2 1 
ATOM   1419 C  CE1 . TYR B 2 41  ? -9.448  20.952  -12.023 1.00 47.80  ? 863 TYR C CE1 1 
ATOM   1420 C  CE2 . TYR B 2 41  ? -11.765 20.957  -11.422 1.00 46.53  ? 863 TYR C CE2 1 
ATOM   1421 C  CZ  . TYR B 2 41  ? -10.569 21.627  -11.588 1.00 48.43  ? 863 TYR C CZ  1 
ATOM   1422 O  OH  . TYR B 2 41  ? -10.493 22.976  -11.318 1.00 48.69  ? 863 TYR C OH  1 
ATOM   1423 N  N   . ILE B 2 42  ? -12.859 14.747  -12.065 1.00 32.14  ? 864 ILE C N   1 
ATOM   1424 C  CA  . ILE B 2 42  ? -13.141 13.409  -12.569 1.00 30.91  ? 864 ILE C CA  1 
ATOM   1425 C  C   . ILE B 2 42  ? -13.703 13.483  -13.983 1.00 29.03  ? 864 ILE C C   1 
ATOM   1426 O  O   . ILE B 2 42  ? -14.867 13.823  -14.178 1.00 29.65  ? 864 ILE C O   1 
ATOM   1427 C  CB  . ILE B 2 42  ? -14.127 12.647  -11.657 1.00 31.40  ? 864 ILE C CB  1 
ATOM   1428 C  CG1 . ILE B 2 42  ? -13.472 12.312  -10.315 1.00 31.03  ? 864 ILE C CG1 1 
ATOM   1429 C  CG2 . ILE B 2 42  ? -14.599 11.373  -12.331 1.00 30.05  ? 864 ILE C CG2 1 
ATOM   1430 C  CD1 . ILE B 2 42  ? -13.369 13.485  -9.367  1.00 33.21  ? 864 ILE C CD1 1 
ATOM   1431 N  N   . TYR B 2 43  ? -12.864 13.171  -14.964 1.00 43.75  ? 865 TYR C N   1 
ATOM   1432 C  CA  . TYR B 2 43  ? -13.258 13.242  -16.367 1.00 43.48  ? 865 TYR C CA  1 
ATOM   1433 C  C   . TYR B 2 43  ? -13.802 11.910  -16.874 1.00 42.01  ? 865 TYR C C   1 
ATOM   1434 O  O   . TYR B 2 43  ? -13.284 10.848  -16.530 1.00 41.47  ? 865 TYR C O   1 
ATOM   1435 C  CB  . TYR B 2 43  ? -12.075 13.682  -17.231 1.00 44.15  ? 865 TYR C CB  1 
ATOM   1436 C  CG  . TYR B 2 43  ? -11.497 15.022  -16.841 1.00 46.50  ? 865 TYR C CG  1 
ATOM   1437 C  CD1 . TYR B 2 43  ? -12.067 16.206  -17.292 1.00 47.07  ? 865 TYR C CD1 1 
ATOM   1438 C  CD2 . TYR B 2 43  ? -10.378 15.106  -16.020 1.00 47.92  ? 865 TYR C CD2 1 
ATOM   1439 C  CE1 . TYR B 2 43  ? -11.540 17.434  -16.937 1.00 49.10  ? 865 TYR C CE1 1 
ATOM   1440 C  CE2 . TYR B 2 43  ? -9.845  16.332  -15.660 1.00 49.51  ? 865 TYR C CE2 1 
ATOM   1441 C  CZ  . TYR B 2 43  ? -10.431 17.492  -16.121 1.00 50.02  ? 865 TYR C CZ  1 
ATOM   1442 O  OH  . TYR B 2 43  ? -9.904  18.714  -15.765 1.00 50.60  ? 865 TYR C OH  1 
ATOM   1443 N  N   . TYR B 2 44  ? -14.846 11.971  -17.696 1.00 27.62  ? 866 TYR C N   1 
ATOM   1444 C  CA  . TYR B 2 44  ? -15.424 10.763  -18.277 1.00 26.51  ? 866 TYR C CA  1 
ATOM   1445 C  C   . TYR B 2 44  ? -15.926 10.985  -19.704 1.00 26.31  ? 866 TYR C C   1 
ATOM   1446 O  O   . TYR B 2 44  ? -16.596 11.978  -19.993 1.00 26.80  ? 866 TYR C O   1 
ATOM   1447 C  CB  . TYR B 2 44  ? -16.530 10.194  -17.380 1.00 26.08  ? 866 TYR C CB  1 
ATOM   1448 C  CG  . TYR B 2 44  ? -17.565 11.201  -16.923 1.00 27.48  ? 866 TYR C CG  1 
ATOM   1449 C  CD1 . TYR B 2 44  ? -18.870 11.144  -17.396 1.00 27.27  ? 866 TYR C CD1 1 
ATOM   1450 C  CD2 . TYR B 2 44  ? -17.241 12.198  -16.012 1.00 27.87  ? 866 TYR C CD2 1 
ATOM   1451 C  CE1 . TYR B 2 44  ? -19.822 12.053  -16.981 1.00 27.17  ? 866 TYR C CE1 1 
ATOM   1452 C  CE2 . TYR B 2 44  ? -18.187 13.113  -15.593 1.00 28.77  ? 866 TYR C CE2 1 
ATOM   1453 C  CZ  . TYR B 2 44  ? -19.476 13.036  -16.080 1.00 28.61  ? 866 TYR C CZ  1 
ATOM   1454 O  OH  . TYR B 2 44  ? -20.425 13.944  -15.666 1.00 29.36  ? 866 TYR C OH  1 
ATOM   1455 N  N   . ARG B 2 45  ? -15.591 10.048  -20.587 1.00 22.43  ? 867 ARG C N   1 
ATOM   1456 C  CA  . ARG B 2 45  ? -15.889 10.172  -22.010 1.00 21.45  ? 867 ARG C CA  1 
ATOM   1457 C  C   . ARG B 2 45  ? -16.373 8.848   -22.595 1.00 20.57  ? 867 ARG C C   1 
ATOM   1458 O  O   . ARG B 2 45  ? -15.931 7.783   -22.170 1.00 20.39  ? 867 ARG C O   1 
ATOM   1459 C  CB  . ARG B 2 45  ? -14.637 10.638  -22.760 1.00 21.49  ? 867 ARG C CB  1 
ATOM   1460 C  CG  . ARG B 2 45  ? -14.712 10.497  -24.272 1.00 21.18  ? 867 ARG C CG  1 
ATOM   1461 C  CD  . ARG B 2 45  ? -13.371 10.785  -24.926 1.00 21.07  ? 867 ARG C CD  1 
ATOM   1462 N  NE  . ARG B 2 45  ? -12.401 9.721   -24.686 1.00 20.06  ? 867 ARG C NE  1 
ATOM   1463 C  CZ  . ARG B 2 45  ? -11.150 9.739   -25.136 1.00 20.92  ? 867 ARG C CZ  1 
ATOM   1464 N  NH1 . ARG B 2 45  ? -10.714 10.768  -25.847 1.00 21.55  ? 867 ARG C NH1 1 
ATOM   1465 N  NH2 . ARG B 2 45  ? -10.333 8.728   -24.876 1.00 20.39  ? 867 ARG C NH2 1 
ATOM   1466 N  N   . PRO B 2 46  ? -17.289 8.912   -23.574 1.00 20.08  ? 868 PRO C N   1 
ATOM   1467 C  CA  . PRO B 2 46  ? -17.713 7.710   -24.298 1.00 18.87  ? 868 PRO C CA  1 
ATOM   1468 C  C   . PRO B 2 46  ? -16.509 7.027   -24.928 1.00 19.22  ? 868 PRO C C   1 
ATOM   1469 O  O   . PRO B 2 46  ? -15.731 7.681   -25.622 1.00 19.54  ? 868 PRO C O   1 
ATOM   1470 C  CB  . PRO B 2 46  ? -18.621 8.264   -25.395 1.00 19.20  ? 868 PRO C CB  1 
ATOM   1471 C  CG  . PRO B 2 46  ? -19.101 9.564   -24.873 1.00 19.99  ? 868 PRO C CG  1 
ATOM   1472 C  CD  . PRO B 2 46  ? -17.999 10.118  -24.032 1.00 20.77  ? 868 PRO C CD  1 
ATOM   1473 N  N   . THR B 2 47  ? -16.358 5.729   -24.692 1.00 26.25  ? 869 THR C N   1 
ATOM   1474 C  CA  . THR B 2 47  ? -15.202 4.999   -25.197 1.00 25.61  ? 869 THR C CA  1 
ATOM   1475 C  C   . THR B 2 47  ? -15.118 5.043   -26.720 1.00 26.39  ? 869 THR C C   1 
ATOM   1476 O  O   . THR B 2 47  ? -14.049 4.848   -27.296 1.00 26.75  ? 869 THR C O   1 
ATOM   1477 C  CB  . THR B 2 47  ? -15.215 3.537   -24.731 1.00 25.55  ? 869 THR C CB  1 
ATOM   1478 O  OG1 . THR B 2 47  ? -15.417 3.490   -23.313 1.00 25.54  ? 869 THR C OG1 1 
ATOM   1479 C  CG2 . THR B 2 47  ? -13.899 2.861   -25.073 1.00 25.82  ? 869 THR C CG2 1 
ATOM   1480 N  N   . ASP B 2 48  ? -16.247 5.307   -27.371 1.00 28.04  ? 870 ASP C N   1 
ATOM   1481 C  CA  . ASP B 2 48  ? -16.286 5.387   -28.828 1.00 27.20  ? 870 ASP C CA  1 
ATOM   1482 C  C   . ASP B 2 48  ? -15.598 6.643   -29.350 1.00 27.66  ? 870 ASP C C   1 
ATOM   1483 O  O   . ASP B 2 48  ? -15.353 6.773   -30.550 1.00 27.82  ? 870 ASP C O   1 
ATOM   1484 C  CB  . ASP B 2 48  ? -17.726 5.330   -29.337 1.00 26.76  ? 870 ASP C CB  1 
ATOM   1485 C  CG  . ASP B 2 48  ? -18.225 3.912   -29.516 1.00 26.78  ? 870 ASP C CG  1 
ATOM   1486 O  OD1 . ASP B 2 48  ? -17.429 2.971   -29.306 1.00 26.66  ? 870 ASP C OD1 1 
ATOM   1487 O  OD2 . ASP B 2 48  ? -19.411 3.739   -29.875 1.00 26.02  ? 870 ASP C OD2 1 
ATOM   1488 N  N   . SER B 2 49  ? -15.286 7.566   -28.448 1.00 22.68  ? 871 SER C N   1 
ATOM   1489 C  CA  . SER B 2 49  ? -14.657 8.819   -28.840 1.00 23.38  ? 871 SER C CA  1 
ATOM   1490 C  C   . SER B 2 49  ? -13.160 8.800   -28.559 1.00 23.95  ? 871 SER C C   1 
ATOM   1491 O  O   . SER B 2 49  ? -12.738 8.574   -27.426 1.00 24.57  ? 871 SER C O   1 
ATOM   1492 C  CB  . SER B 2 49  ? -15.305 9.993   -28.109 1.00 23.60  ? 871 SER C CB  1 
ATOM   1493 O  OG  . SER B 2 49  ? -14.685 11.212  -28.469 1.00 24.89  ? 871 SER C OG  1 
ATOM   1494 N  N   . ASP B 2 50  ? -12.360 9.035   -29.593 1.00 26.06  ? 872 ASP C N   1 
ATOM   1495 C  CA  . ASP B 2 50  ? -10.912 9.099   -29.436 1.00 26.00  ? 872 ASP C CA  1 
ATOM   1496 C  C   . ASP B 2 50  ? -10.449 10.548  -29.344 1.00 26.57  ? 872 ASP C C   1 
ATOM   1497 O  O   . ASP B 2 50  ? -9.292  10.864  -29.615 1.00 26.77  ? 872 ASP C O   1 
ATOM   1498 C  CB  . ASP B 2 50  ? -10.207 8.381   -30.589 1.00 25.76  ? 872 ASP C CB  1 
ATOM   1499 C  CG  . ASP B 2 50  ? -10.472 6.887   -30.595 1.00 25.54  ? 872 ASP C CG  1 
ATOM   1500 O  OD1 . ASP B 2 50  ? -10.040 6.208   -31.550 1.00 25.28  ? 872 ASP C OD1 1 
ATOM   1501 O  OD2 . ASP B 2 50  ? -11.115 6.392   -29.645 1.00 25.18  ? 872 ASP C OD2 1 
ATOM   1502 N  N   . ASN B 2 51  ? -11.367 11.422  -28.950 1.00 22.94  ? 873 ASN C N   1 
ATOM   1503 C  CA  . ASN B 2 51  ? -11.073 12.841  -28.822 1.00 24.01  ? 873 ASN C CA  1 
ATOM   1504 C  C   . ASN B 2 51  ? -11.063 13.274  -27.360 1.00 24.26  ? 873 ASN C C   1 
ATOM   1505 O  O   . ASN B 2 51  ? -12.085 13.209  -26.677 1.00 23.69  ? 873 ASN C O   1 
ATOM   1506 C  CB  . ASN B 2 51  ? -12.094 13.663  -29.609 1.00 24.78  ? 873 ASN C CB  1 
ATOM   1507 C  CG  . ASN B 2 51  ? -11.697 15.116  -29.736 1.00 25.64  ? 873 ASN C CG  1 
ATOM   1508 O  OD1 . ASN B 2 51  ? -12.442 15.924  -30.289 1.00 26.52  ? 873 ASN C OD1 1 
ATOM   1509 N  ND2 . ASN B 2 51  ? -10.518 15.459  -29.228 1.00 25.38  ? 873 ASN C ND2 1 
ATOM   1510 N  N   . ASP B 2 52  ? -9.902  13.712  -26.883 1.00 34.72  ? 874 ASP C N   1 
ATOM   1511 C  CA  . ASP B 2 52  ? -9.752  14.118  -25.489 1.00 35.20  ? 874 ASP C CA  1 
ATOM   1512 C  C   . ASP B 2 52  ? -10.554 15.381  -25.174 1.00 35.74  ? 874 ASP C C   1 
ATOM   1513 O  O   . ASP B 2 52  ? -10.610 15.821  -24.024 1.00 36.13  ? 874 ASP C O   1 
ATOM   1514 C  CB  . ASP B 2 52  ? -8.272  14.308  -25.134 1.00 35.60  ? 874 ASP C CB  1 
ATOM   1515 C  CG  . ASP B 2 52  ? -7.537  12.987  -24.958 1.00 35.46  ? 874 ASP C CG  1 
ATOM   1516 O  OD1 . ASP B 2 52  ? -8.182  11.984  -24.587 1.00 35.26  ? 874 ASP C OD1 1 
ATOM   1517 O  OD2 . ASP B 2 52  ? -6.310  12.950  -25.190 1.00 35.51  ? 874 ASP C OD2 1 
ATOM   1518 N  N   . SER B 2 53  ? -11.177 15.955  -26.197 1.00 29.32  ? 875 SER C N   1 
ATOM   1519 C  CA  . SER B 2 53  ? -12.008 17.140  -26.022 1.00 29.12  ? 875 SER C CA  1 
ATOM   1520 C  C   . SER B 2 53  ? -13.406 16.744  -25.566 1.00 28.90  ? 875 SER C C   1 
ATOM   1521 O  O   . SER B 2 53  ? -14.182 17.586  -25.117 1.00 30.14  ? 875 SER C O   1 
ATOM   1522 C  CB  . SER B 2 53  ? -12.103 17.932  -27.329 1.00 29.56  ? 875 SER C CB  1 
ATOM   1523 O  OG  . SER B 2 53  ? -10.826 18.138  -27.910 1.00 30.54  ? 875 SER C OG  1 
ATOM   1524 N  N   . ASP B 2 54  ? -13.722 15.459  -25.683 1.00 25.42  ? 876 ASP C N   1 
ATOM   1525 C  CA  . ASP B 2 54  ? -15.073 14.973  -25.417 1.00 25.10  ? 876 ASP C CA  1 
ATOM   1526 C  C   . ASP B 2 54  ? -15.247 14.452  -23.994 1.00 25.09  ? 876 ASP C C   1 
ATOM   1527 O  O   . ASP B 2 54  ? -16.071 13.575  -23.741 1.00 24.58  ? 876 ASP C O   1 
ATOM   1528 C  CB  . ASP B 2 54  ? -15.451 13.891  -26.431 1.00 24.52  ? 876 ASP C CB  1 
ATOM   1529 C  CG  . ASP B 2 54  ? -15.524 14.425  -27.849 1.00 25.08  ? 876 ASP C CG  1 
ATOM   1530 O  OD1 . ASP B 2 54  ? -15.647 15.657  -28.013 1.00 25.61  ? 876 ASP C OD1 1 
ATOM   1531 O  OD2 . ASP B 2 54  ? -15.461 13.616  -28.799 1.00 24.80  ? 876 ASP C OD2 1 
ATOM   1532 N  N   . TYR B 2 55  ? -14.472 15.005  -23.068 1.00 28.30  ? 877 TYR C N   1 
ATOM   1533 C  CA  . TYR B 2 55  ? -14.539 14.597  -21.670 1.00 29.11  ? 877 TYR C CA  1 
ATOM   1534 C  C   . TYR B 2 55  ? -15.429 15.515  -20.842 1.00 30.53  ? 877 TYR C C   1 
ATOM   1535 O  O   . TYR B 2 55  ? -15.270 16.735  -20.876 1.00 31.01  ? 877 TYR C O   1 
ATOM   1536 C  CB  . TYR B 2 55  ? -13.141 14.579  -21.056 1.00 29.51  ? 877 TYR C CB  1 
ATOM   1537 C  CG  . TYR B 2 55  ? -12.381 13.290  -21.253 1.00 28.47  ? 877 TYR C CG  1 
ATOM   1538 C  CD1 . TYR B 2 55  ? -11.470 13.148  -22.290 1.00 27.38  ? 877 TYR C CD1 1 
ATOM   1539 C  CD2 . TYR B 2 55  ? -12.564 12.216  -20.390 1.00 27.62  ? 877 TYR C CD2 1 
ATOM   1540 C  CE1 . TYR B 2 55  ? -10.768 11.975  -22.464 1.00 27.25  ? 877 TYR C CE1 1 
ATOM   1541 C  CE2 . TYR B 2 55  ? -11.866 11.042  -20.558 1.00 26.82  ? 877 TYR C CE2 1 
ATOM   1542 C  CZ  . TYR B 2 55  ? -10.970 10.926  -21.596 1.00 26.59  ? 877 TYR C CZ  1 
ATOM   1543 O  OH  . TYR B 2 55  ? -10.270 9.755   -21.770 1.00 27.07  ? 877 TYR C OH  1 
ATOM   1544 N  N   . LYS B 2 56  ? -16.360 14.925  -20.099 1.00 43.38  ? 878 LYS C N   1 
ATOM   1545 C  CA  . LYS B 2 56  ? -17.164 15.676  -19.141 1.00 44.19  ? 878 LYS C CA  1 
ATOM   1546 C  C   . LYS B 2 56  ? -16.479 15.679  -17.783 1.00 44.96  ? 878 LYS C C   1 
ATOM   1547 O  O   . LYS B 2 56  ? -15.910 14.670  -17.366 1.00 44.45  ? 878 LYS C O   1 
ATOM   1548 C  CB  . LYS B 2 56  ? -18.573 15.092  -19.019 1.00 44.21  ? 878 LYS C CB  1 
ATOM   1549 C  CG  . LYS B 2 56  ? -19.539 15.572  -20.087 1.00 46.96  ? 878 LYS C CG  1 
ATOM   1550 C  CD  . LYS B 2 56  ? -20.958 15.096  -19.803 1.00 50.16  ? 878 LYS C CD  1 
ATOM   1551 C  CE  . LYS B 2 56  ? -21.902 15.468  -20.939 1.00 52.56  ? 878 LYS C CE  1 
ATOM   1552 N  NZ  . LYS B 2 56  ? -23.232 14.812  -20.795 1.00 52.25  ? 878 LYS C NZ  1 
ATOM   1553 N  N   . ARG B 2 57  ? -16.538 16.813  -17.093 1.00 35.84  ? 879 ARG C N   1 
ATOM   1554 C  CA  . ARG B 2 57  ? -15.836 16.961  -15.824 1.00 36.46  ? 879 ARG C CA  1 
ATOM   1555 C  C   . ARG B 2 57  ? -16.775 16.980  -14.625 1.00 36.06  ? 879 ARG C C   1 
ATOM   1556 O  O   . ARG B 2 57  ? -17.848 17.580  -14.666 1.00 35.48  ? 879 ARG C O   1 
ATOM   1557 C  CB  . ARG B 2 57  ? -14.975 18.227  -15.829 1.00 37.94  ? 879 ARG C CB  1 
ATOM   1558 C  CG  . ARG B 2 57  ? -13.991 18.303  -14.671 1.00 39.35  ? 879 ARG C CG  1 
ATOM   1559 C  CD  . ARG B 2 57  ? -13.079 19.518  -14.784 1.00 41.45  ? 879 ARG C CD  1 
ATOM   1560 N  NE  . ARG B 2 57  ? -13.705 20.731  -14.269 1.00 42.07  ? 879 ARG C NE  1 
ATOM   1561 C  CZ  . ARG B 2 57  ? -14.396 21.588  -15.012 1.00 44.69  ? 879 ARG C CZ  1 
ATOM   1562 N  NH1 . ARG B 2 57  ? -14.554 21.366  -16.311 1.00 46.92  ? 879 ARG C NH1 1 
ATOM   1563 N  NH2 . ARG B 2 57  ? -14.932 22.666  -14.456 1.00 44.82  ? 879 ARG C NH2 1 
ATOM   1564 N  N   . ASP B 2 58  ? -16.355 16.305  -13.561 1.00 33.35  ? 880 ASP C N   1 
ATOM   1565 C  CA  . ASP B 2 58  ? -17.019 16.396  -12.270 1.00 33.45  ? 880 ASP C CA  1 
ATOM   1566 C  C   . ASP B 2 58  ? -16.047 17.014  -11.274 1.00 35.33  ? 880 ASP C C   1 
ATOM   1567 O  O   . ASP B 2 58  ? -14.830 16.926  -11.448 1.00 34.93  ? 880 ASP C O   1 
ATOM   1568 C  CB  . ASP B 2 58  ? -17.476 15.019  -11.789 1.00 31.91  ? 880 ASP C CB  1 
ATOM   1569 C  CG  . ASP B 2 58  ? -18.756 14.564  -12.459 1.00 31.24  ? 880 ASP C CG  1 
ATOM   1570 O  OD1 . ASP B 2 58  ? -19.263 15.296  -13.335 1.00 31.14  ? 880 ASP C OD1 1 
ATOM   1571 O  OD2 . ASP B 2 58  ? -19.258 13.475  -12.107 1.00 30.92  ? 880 ASP C OD2 1 
ATOM   1572 N  N   . VAL B 2 59  ? -16.584 17.646  -10.236 1.00 39.34  ? 881 VAL C N   1 
ATOM   1573 C  CA  . VAL B 2 59  ? -15.748 18.320  -9.252  1.00 40.29  ? 881 VAL C CA  1 
ATOM   1574 C  C   . VAL B 2 59  ? -16.072 17.854  -7.837  1.00 41.22  ? 881 VAL C C   1 
ATOM   1575 O  O   . VAL B 2 59  ? -17.214 17.944  -7.389  1.00 41.53  ? 881 VAL C O   1 
ATOM   1576 C  CB  . VAL B 2 59  ? -15.898 19.850  -9.342  1.00 40.84  ? 881 VAL C CB  1 
ATOM   1577 C  CG1 . VAL B 2 59  ? -14.846 20.536  -8.488  1.00 42.41  ? 881 VAL C CG1 1 
ATOM   1578 C  CG2 . VAL B 2 59  ? -15.790 20.308  -10.789 1.00 40.49  ? 881 VAL C CG2 1 
ATOM   1579 N  N   . VAL B 2 60  ? -15.057 17.350  -7.140  1.00 31.50  ? 882 VAL C N   1 
ATOM   1580 C  CA  . VAL B 2 60  ? -15.221 16.880  -5.769  1.00 31.70  ? 882 VAL C CA  1 
ATOM   1581 C  C   . VAL B 2 60  ? -14.234 17.586  -4.849  1.00 32.87  ? 882 VAL C C   1 
ATOM   1582 O  O   . VAL B 2 60  ? -13.202 18.081  -5.301  1.00 33.44  ? 882 VAL C O   1 
ATOM   1583 C  CB  . VAL B 2 60  ? -15.007 15.357  -5.660  1.00 31.54  ? 882 VAL C CB  1 
ATOM   1584 C  CG1 . VAL B 2 60  ? -15.997 14.613  -6.543  1.00 31.18  ? 882 VAL C CG1 1 
ATOM   1585 C  CG2 . VAL B 2 60  ? -13.578 14.993  -6.031  1.00 31.22  ? 882 VAL C CG2 1 
ATOM   1586 N  N   . GLU B 2 61  ? -14.552 17.630  -3.558  1.00 55.75  ? 883 GLU C N   1 
ATOM   1587 C  CA  . GLU B 2 61  ? -13.690 18.301  -2.591  1.00 57.00  ? 883 GLU C CA  1 
ATOM   1588 C  C   . GLU B 2 61  ? -12.436 17.480  -2.288  1.00 56.49  ? 883 GLU C C   1 
ATOM   1589 O  O   . GLU B 2 61  ? -12.370 16.291  -2.597  1.00 55.26  ? 883 GLU C O   1 
ATOM   1590 C  CB  . GLU B 2 61  ? -14.464 18.650  -1.313  1.00 58.00  ? 883 GLU C CB  1 
ATOM   1591 C  CG  . GLU B 2 61  ? -15.080 17.465  -0.592  1.00 58.13  ? 883 GLU C CG  1 
ATOM   1592 C  CD  . GLU B 2 61  ? -14.143 16.857  0.434   1.00 59.11  ? 883 GLU C CD  1 
ATOM   1593 O  OE1 . GLU B 2 61  ? -13.501 17.624  1.186   1.00 58.86  ? 883 GLU C OE1 1 
ATOM   1594 O  OE2 . GLU B 2 61  ? -14.055 15.612  0.492   1.00 58.50  ? 883 GLU C OE2 1 
ATOM   1595 N  N   . GLY B 2 62  ? -11.446 18.128  -1.682  1.00 46.58  ? 884 GLY C N   1 
ATOM   1596 C  CA  . GLY B 2 62  ? -10.121 17.552  -1.535  1.00 46.38  ? 884 GLY C CA  1 
ATOM   1597 C  C   . GLY B 2 62  ? -9.952  16.418  -0.539  1.00 46.49  ? 884 GLY C C   1 
ATOM   1598 O  O   . GLY B 2 62  ? -8.883  15.810  -0.478  1.00 46.33  ? 884 GLY C O   1 
ATOM   1599 N  N   . SER B 2 63  ? -10.985 16.128  0.244   1.00 43.19  ? 885 SER C N   1 
ATOM   1600 C  CA  . SER B 2 63  ? -10.888 15.062  1.238   1.00 43.15  ? 885 SER C CA  1 
ATOM   1601 C  C   . SER B 2 63  ? -11.622 13.800  0.794   1.00 42.89  ? 885 SER C C   1 
ATOM   1602 O  O   . SER B 2 63  ? -11.873 12.902  1.599   1.00 42.73  ? 885 SER C O   1 
ATOM   1603 C  CB  . SER B 2 63  ? -11.410 15.533  2.601   1.00 44.60  ? 885 SER C CB  1 
ATOM   1604 O  OG  . SER B 2 63  ? -12.823 15.458  2.669   1.00 44.64  ? 885 SER C OG  1 
ATOM   1605 N  N   . LYS B 2 64  ? -11.962 13.736  -0.489  1.00 53.97  ? 886 LYS C N   1 
ATOM   1606 C  CA  . LYS B 2 64  ? -12.658 12.576  -1.035  1.00 53.38  ? 886 LYS C CA  1 
ATOM   1607 C  C   . LYS B 2 64  ? -11.721 11.627  -1.779  1.00 52.31  ? 886 LYS C C   1 
ATOM   1608 O  O   . LYS B 2 64  ? -10.839 12.058  -2.523  1.00 51.50  ? 886 LYS C O   1 
ATOM   1609 C  CB  . LYS B 2 64  ? -13.812 13.010  -1.942  1.00 52.49  ? 886 LYS C CB  1 
ATOM   1610 C  CG  . LYS B 2 64  ? -15.099 13.308  -1.190  1.00 52.70  ? 886 LYS C CG  1 
ATOM   1611 C  CD  . LYS B 2 64  ? -15.650 12.051  -0.533  1.00 52.15  ? 886 LYS C CD  1 
ATOM   1612 C  CE  . LYS B 2 64  ? -16.705 12.383  0.510   1.00 52.81  ? 886 LYS C CE  1 
ATOM   1613 N  NZ  . LYS B 2 64  ? -16.114 13.097  1.678   1.00 55.05  ? 886 LYS C NZ  1 
ATOM   1614 N  N   . GLN B 2 65  ? -11.924 10.330  -1.562  1.00 66.96  ? 887 GLN C N   1 
ATOM   1615 C  CA  . GLN B 2 65  ? -11.134 9.297   -2.219  1.00 66.01  ? 887 GLN C CA  1 
ATOM   1616 C  C   . GLN B 2 65  ? -12.041 8.340   -2.985  1.00 64.81  ? 887 GLN C C   1 
ATOM   1617 O  O   . GLN B 2 65  ? -11.589 7.314   -3.495  1.00 63.82  ? 887 GLN C O   1 
ATOM   1618 C  CB  . GLN B 2 65  ? -10.317 8.510   -1.194  1.00 67.52  ? 887 GLN C CB  1 
ATOM   1619 C  CG  . GLN B 2 65  ? -9.195  9.296   -0.539  1.00 69.01  ? 887 GLN C CG  1 
ATOM   1620 C  CD  . GLN B 2 65  ? -8.387  8.447   0.420   1.00 71.88  ? 887 GLN C CD  1 
ATOM   1621 O  OE1 . GLN B 2 65  ? -8.912  7.522   1.043   1.00 70.37  ? 887 GLN C OE1 1 
ATOM   1622 N  NE2 . GLN B 2 65  ? -7.101  8.755   0.542   1.00 73.47  ? 887 GLN C NE2 1 
ATOM   1623 N  N   . TRP B 2 66  ? -13.324 8.677   -3.051  1.00 41.72  ? 888 TRP C N   1 
ATOM   1624 C  CA  . TRP B 2 66  ? -14.301 7.849   -3.748  1.00 39.87  ? 888 TRP C CA  1 
ATOM   1625 C  C   . TRP B 2 66  ? -15.368 8.732   -4.376  1.00 39.70  ? 888 TRP C C   1 
ATOM   1626 O  O   . TRP B 2 66  ? -15.723 9.776   -3.829  1.00 40.26  ? 888 TRP C O   1 
ATOM   1627 C  CB  . TRP B 2 66  ? -14.935 6.839   -2.786  1.00 39.46  ? 888 TRP C CB  1 
ATOM   1628 C  CG  . TRP B 2 66  ? -16.098 6.077   -3.366  1.00 39.08  ? 888 TRP C CG  1 
ATOM   1629 C  CD1 . TRP B 2 66  ? -16.061 4.845   -3.955  1.00 38.33  ? 888 TRP C CD1 1 
ATOM   1630 C  CD2 . TRP B 2 66  ? -17.468 6.497   -3.404  1.00 38.90  ? 888 TRP C CD2 1 
ATOM   1631 N  NE1 . TRP B 2 66  ? -17.321 4.476   -4.359  1.00 38.02  ? 888 TRP C NE1 1 
ATOM   1632 C  CE2 . TRP B 2 66  ? -18.203 5.472   -4.031  1.00 38.46  ? 888 TRP C CE2 1 
ATOM   1633 C  CE3 . TRP B 2 66  ? -18.143 7.642   -2.971  1.00 39.05  ? 888 TRP C CE3 1 
ATOM   1634 C  CZ2 . TRP B 2 66  ? -19.580 5.558   -4.236  1.00 37.98  ? 888 TRP C CZ2 1 
ATOM   1635 C  CZ3 . TRP B 2 66  ? -19.510 7.725   -3.174  1.00 38.18  ? 888 TRP C CZ3 1 
ATOM   1636 C  CH2 . TRP B 2 66  ? -20.213 6.690   -3.801  1.00 37.61  ? 888 TRP C CH2 1 
ATOM   1637 N  N   . HIS B 2 67  ? -15.871 8.313   -5.532  1.00 47.21  ? 889 HIS C N   1 
ATOM   1638 C  CA  . HIS B 2 67  ? -16.903 9.074   -6.224  1.00 46.66  ? 889 HIS C CA  1 
ATOM   1639 C  C   . HIS B 2 67  ? -17.900 8.183   -6.961  1.00 46.36  ? 889 HIS C C   1 
ATOM   1640 O  O   . HIS B 2 67  ? -17.621 7.021   -7.262  1.00 45.60  ? 889 HIS C O   1 
ATOM   1641 C  CB  . HIS B 2 67  ? -16.281 10.082  -7.193  1.00 45.77  ? 889 HIS C CB  1 
ATOM   1642 C  CG  . HIS B 2 67  ? -17.281 10.987  -7.841  1.00 47.37  ? 889 HIS C CG  1 
ATOM   1643 N  ND1 . HIS B 2 67  ? -17.883 12.031  -7.172  1.00 47.79  ? 889 HIS C ND1 1 
ATOM   1644 C  CD2 . HIS B 2 67  ? -17.794 11.001  -9.095  1.00 47.11  ? 889 HIS C CD2 1 
ATOM   1645 C  CE1 . HIS B 2 67  ? -18.719 12.650  -7.986  1.00 46.97  ? 889 HIS C CE1 1 
ATOM   1646 N  NE2 . HIS B 2 67  ? -18.684 12.045  -9.159  1.00 46.10  ? 889 HIS C NE2 1 
ATOM   1647 N  N   . MET B 2 68  ? -19.069 8.748   -7.240  1.00 46.28  ? 890 MET C N   1 
ATOM   1648 C  CA  . MET B 2 68  ? -20.130 8.051   -7.951  1.00 44.91  ? 890 MET C CA  1 
ATOM   1649 C  C   . MET B 2 68  ? -20.569 8.884   -9.149  1.00 44.80  ? 890 MET C C   1 
ATOM   1650 O  O   . MET B 2 68  ? -21.160 9.952   -8.988  1.00 45.67  ? 890 MET C O   1 
ATOM   1651 C  CB  . MET B 2 68  ? -21.316 7.812   -7.013  1.00 45.23  ? 890 MET C CB  1 
ATOM   1652 C  CG  . MET B 2 68  ? -22.626 7.475   -7.708  1.00 43.60  ? 890 MET C CG  1 
ATOM   1653 S  SD  . MET B 2 68  ? -22.750 5.750   -8.212  1.00 44.77  ? 890 MET C SD  1 
ATOM   1654 C  CE  . MET B 2 68  ? -22.756 4.924   -6.624  1.00 44.97  ? 890 MET C CE  1 
ATOM   1655 N  N   . ILE B 2 69  ? -20.264 8.405   -10.351 1.00 26.94  ? 891 ILE C N   1 
ATOM   1656 C  CA  . ILE B 2 69  ? -20.703 9.086   -11.561 1.00 26.54  ? 891 ILE C CA  1 
ATOM   1657 C  C   . ILE B 2 69  ? -22.095 8.602   -11.942 1.00 25.51  ? 891 ILE C C   1 
ATOM   1658 O  O   . ILE B 2 69  ? -22.371 7.403   -11.914 1.00 25.52  ? 891 ILE C O   1 
ATOM   1659 C  CB  . ILE B 2 69  ? -19.744 8.844   -12.740 1.00 25.95  ? 891 ILE C CB  1 
ATOM   1660 C  CG1 . ILE B 2 69  ? -18.300 9.118   -12.322 1.00 26.36  ? 891 ILE C CG1 1 
ATOM   1661 C  CG2 . ILE B 2 69  ? -20.128 9.717   -13.924 1.00 25.05  ? 891 ILE C CG2 1 
ATOM   1662 C  CD1 . ILE B 2 69  ? -17.302 8.934   -13.442 1.00 24.92  ? 891 ILE C CD1 1 
ATOM   1663 N  N   . GLY B 2 70  ? -22.971 9.536   -12.294 1.00 18.72  ? 892 GLY C N   1 
ATOM   1664 C  CA  . GLY B 2 70  ? -24.332 9.193   -12.657 1.00 18.30  ? 892 GLY C CA  1 
ATOM   1665 C  C   . GLY B 2 70  ? -24.758 9.797   -13.980 1.00 18.42  ? 892 GLY C C   1 
ATOM   1666 O  O   . GLY B 2 70  ? -23.966 10.451  -14.662 1.00 18.24  ? 892 GLY C O   1 
ATOM   1667 N  N   . HIS B 2 71  ? -26.017 9.574   -14.342 1.00 43.07  ? 893 HIS C N   1 
ATOM   1668 C  CA  . HIS B 2 71  ? -26.568 10.105  -15.581 1.00 43.29  ? 893 HIS C CA  1 
ATOM   1669 C  C   . HIS B 2 71  ? -25.793 9.598   -16.793 1.00 42.93  ? 893 HIS C C   1 
ATOM   1670 O  O   . HIS B 2 71  ? -25.551 10.341  -17.749 1.00 42.53  ? 893 HIS C O   1 
ATOM   1671 C  CB  . HIS B 2 71  ? -26.578 11.634  -15.549 1.00 44.11  ? 893 HIS C CB  1 
ATOM   1672 C  CG  . HIS B 2 71  ? -27.279 12.205  -14.356 1.00 44.54  ? 893 HIS C CG  1 
ATOM   1673 N  ND1 . HIS B 2 71  ? -26.638 12.440  -13.158 1.00 45.19  ? 893 HIS C ND1 1 
ATOM   1674 C  CD2 . HIS B 2 71  ? -28.568 12.577  -14.172 1.00 45.03  ? 893 HIS C CD2 1 
ATOM   1675 C  CE1 . HIS B 2 71  ? -27.501 12.937  -12.290 1.00 46.06  ? 893 HIS C CE1 1 
ATOM   1676 N  NE2 . HIS B 2 71  ? -28.679 13.031  -12.880 1.00 47.46  ? 893 HIS C NE2 1 
ATOM   1677 N  N   . LEU B 2 72  ? -25.407 8.326   -16.740 1.00 13.62  ? 894 LEU C N   1 
ATOM   1678 C  CA  . LEU B 2 72  ? -24.708 7.681   -17.844 1.00 12.74  ? 894 LEU C CA  1 
ATOM   1679 C  C   . LEU B 2 72  ? -25.665 6.793   -18.630 1.00 12.04  ? 894 LEU C C   1 
ATOM   1680 O  O   . LEU B 2 72  ? -26.710 6.390   -18.120 1.00 11.82  ? 894 LEU C O   1 
ATOM   1681 C  CB  . LEU B 2 72  ? -23.531 6.853   -17.323 1.00 12.02  ? 894 LEU C CB  1 
ATOM   1682 C  CG  . LEU B 2 72  ? -22.512 7.595   -16.456 1.00 11.80  ? 894 LEU C CG  1 
ATOM   1683 C  CD1 . LEU B 2 72  ? -21.429 6.643   -15.989 1.00 11.88  ? 894 LEU C CD1 1 
ATOM   1684 C  CD2 . LEU B 2 72  ? -21.913 8.769   -17.213 1.00 11.83  ? 894 LEU C CD2 1 
ATOM   1685 N  N   . GLN B 2 73  ? -25.305 6.487   -19.871 1.00 37.76  ? 895 GLN C N   1 
ATOM   1686 C  CA  . GLN B 2 73  ? -26.180 5.709   -20.743 1.00 37.81  ? 895 GLN C CA  1 
ATOM   1687 C  C   . GLN B 2 73  ? -26.086 4.211   -20.491 1.00 37.70  ? 895 GLN C C   1 
ATOM   1688 O  O   . GLN B 2 73  ? -24.991 3.661   -20.389 1.00 38.02  ? 895 GLN C O   1 
ATOM   1689 C  CB  . GLN B 2 73  ? -25.901 6.027   -22.212 1.00 36.98  ? 895 GLN C CB  1 
ATOM   1690 C  CG  . GLN B 2 73  ? -26.411 7.391   -22.616 1.00 38.24  ? 895 GLN C CG  1 
ATOM   1691 C  CD  . GLN B 2 73  ? -27.805 7.649   -22.084 1.00 38.86  ? 895 GLN C CD  1 
ATOM   1692 O  OE1 . GLN B 2 73  ? -28.721 6.854   -22.298 1.00 38.83  ? 895 GLN C OE1 1 
ATOM   1693 N  NE2 . GLN B 2 73  ? -27.972 8.762   -21.377 1.00 39.09  ? 895 GLN C NE2 1 
ATOM   1694 N  N   . PRO B 2 74  ? -27.246 3.547   -20.393 1.00 16.28  ? 896 PRO C N   1 
ATOM   1695 C  CA  . PRO B 2 74  ? -27.299 2.113   -20.107 1.00 16.27  ? 896 PRO C CA  1 
ATOM   1696 C  C   . PRO B 2 74  ? -26.453 1.320   -21.089 1.00 16.16  ? 896 PRO C C   1 
ATOM   1697 O  O   . PRO B 2 74  ? -26.551 1.546   -22.294 1.00 16.17  ? 896 PRO C O   1 
ATOM   1698 C  CB  . PRO B 2 74  ? -28.779 1.776   -20.296 1.00 15.98  ? 896 PRO C CB  1 
ATOM   1699 C  CG  . PRO B 2 74  ? -29.492 3.056   -20.050 1.00 15.11  ? 896 PRO C CG  1 
ATOM   1700 C  CD  . PRO B 2 74  ? -28.589 4.124   -20.580 1.00 15.76  ? 896 PRO C CD  1 
ATOM   1701 N  N   . GLU B 2 75  ? -25.618 0.424   -20.573 1.00 40.27  ? 897 GLU C N   1 
ATOM   1702 C  CA  . GLU B 2 75  ? -24.875 -0.501  -21.418 1.00 40.45  ? 897 GLU C CA  1 
ATOM   1703 C  C   . GLU B 2 75  ? -23.802 0.217   -22.237 1.00 40.10  ? 897 GLU C C   1 
ATOM   1704 O  O   . GLU B 2 75  ? -23.388 -0.265  -23.293 1.00 39.92  ? 897 GLU C O   1 
ATOM   1705 C  CB  . GLU B 2 75  ? -25.852 -1.233  -22.342 1.00 41.28  ? 897 GLU C CB  1 
ATOM   1706 C  CG  . GLU B 2 75  ? -25.400 -2.598  -22.820 1.00 43.52  ? 897 GLU C CG  1 
ATOM   1707 C  CD  . GLU B 2 75  ? -26.546 -3.402  -23.407 1.00 45.76  ? 897 GLU C CD  1 
ATOM   1708 O  OE1 . GLU B 2 75  ? -26.444 -3.825  -24.577 1.00 46.80  ? 897 GLU C OE1 1 
ATOM   1709 O  OE2 . GLU B 2 75  ? -27.559 -3.599  -22.702 1.00 46.00  ? 897 GLU C OE2 1 
ATOM   1710 N  N   . THR B 2 76  ? -23.351 1.366   -21.744 1.00 28.33  ? 898 THR C N   1 
ATOM   1711 C  CA  . THR B 2 76  ? -22.376 2.179   -22.470 1.00 28.06  ? 898 THR C CA  1 
ATOM   1712 C  C   . THR B 2 76  ? -21.014 2.223   -21.781 1.00 27.99  ? 898 THR C C   1 
ATOM   1713 O  O   . THR B 2 76  ? -20.921 2.453   -20.575 1.00 28.61  ? 898 THR C O   1 
ATOM   1714 C  CB  . THR B 2 76  ? -22.882 3.620   -22.674 1.00 28.10  ? 898 THR C CB  1 
ATOM   1715 O  OG1 . THR B 2 76  ? -24.127 3.595   -23.381 1.00 29.36  ? 898 THR C OG1 1 
ATOM   1716 C  CG2 . THR B 2 76  ? -21.871 4.436   -23.466 1.00 27.53  ? 898 THR C CG2 1 
ATOM   1717 N  N   . SER B 2 77  ? -19.961 2.003   -22.561 1.00 15.98  ? 899 SER C N   1 
ATOM   1718 C  CA  . SER B 2 77  ? -18.602 2.025   -22.042 1.00 15.75  ? 899 SER C CA  1 
ATOM   1719 C  C   . SER B 2 77  ? -18.100 3.460   -21.902 1.00 16.11  ? 899 SER C C   1 
ATOM   1720 O  O   . SER B 2 77  ? -18.549 4.356   -22.615 1.00 16.03  ? 899 SER C O   1 
ATOM   1721 C  CB  . SER B 2 77  ? -17.673 1.223   -22.957 1.00 15.32  ? 899 SER C CB  1 
ATOM   1722 O  OG  . SER B 2 77  ? -16.384 1.078   -22.385 1.00 14.93  ? 899 SER C OG  1 
ATOM   1723 N  N   . TYR B 2 78  ? -17.168 3.671   -20.978 1.00 31.12  ? 900 TYR C N   1 
ATOM   1724 C  CA  . TYR B 2 78  ? -16.628 5.002   -20.726 1.00 30.33  ? 900 TYR C CA  1 
ATOM   1725 C  C   . TYR B 2 78  ? -15.132 4.981   -20.419 1.00 30.35  ? 900 TYR C C   1 
ATOM   1726 O  O   . TYR B 2 78  ? -14.607 4.012   -19.867 1.00 30.17  ? 900 TYR C O   1 
ATOM   1727 C  CB  . TYR B 2 78  ? -17.375 5.670   -19.568 1.00 30.36  ? 900 TYR C CB  1 
ATOM   1728 C  CG  . TYR B 2 78  ? -18.748 6.184   -19.935 1.00 31.36  ? 900 TYR C CG  1 
ATOM   1729 C  CD1 . TYR B 2 78  ? -19.871 5.380   -19.797 1.00 31.44  ? 900 TYR C CD1 1 
ATOM   1730 C  CD2 . TYR B 2 78  ? -18.921 7.475   -20.415 1.00 31.41  ? 900 TYR C CD2 1 
ATOM   1731 C  CE1 . TYR B 2 78  ? -21.132 5.849   -20.131 1.00 31.85  ? 900 TYR C CE1 1 
ATOM   1732 C  CE2 . TYR B 2 78  ? -20.175 7.952   -20.752 1.00 31.54  ? 900 TYR C CE2 1 
ATOM   1733 C  CZ  . TYR B 2 78  ? -21.277 7.136   -20.608 1.00 31.57  ? 900 TYR C CZ  1 
ATOM   1734 O  OH  . TYR B 2 78  ? -22.526 7.610   -20.942 1.00 31.44  ? 900 TYR C OH  1 
ATOM   1735 N  N   . ASP B 2 79  ? -14.452 6.061   -20.789 1.00 14.92  ? 901 ASP C N   1 
ATOM   1736 C  CA  . ASP B 2 79  ? -13.067 6.272   -20.396 1.00 14.99  ? 901 ASP C CA  1 
ATOM   1737 C  C   . ASP B 2 79  ? -13.060 7.154   -19.157 1.00 15.04  ? 901 ASP C C   1 
ATOM   1738 O  O   . ASP B 2 79  ? -13.762 8.163   -19.103 1.00 15.20  ? 901 ASP C O   1 
ATOM   1739 C  CB  . ASP B 2 79  ? -12.285 6.949   -21.520 1.00 14.66  ? 901 ASP C CB  1 
ATOM   1740 C  CG  . ASP B 2 79  ? -12.337 6.170   -22.816 1.00 13.96  ? 901 ASP C CG  1 
ATOM   1741 O  OD1 . ASP B 2 79  ? -12.498 4.934   -22.764 1.00 14.09  ? 901 ASP C OD1 1 
ATOM   1742 O  OD2 . ASP B 2 79  ? -12.214 6.796   -23.888 1.00 14.52  ? 901 ASP C OD2 1 
ATOM   1743 N  N   . ILE B 2 80  ? -12.272 6.772   -18.158 1.00 23.78  ? 902 ILE C N   1 
ATOM   1744 C  CA  . ILE B 2 80  ? -12.244 7.506   -16.899 1.00 24.44  ? 902 ILE C CA  1 
ATOM   1745 C  C   . ILE B 2 80  ? -10.829 7.837   -16.440 1.00 25.23  ? 902 ILE C C   1 
ATOM   1746 O  O   . ILE B 2 80  ? -10.049 6.948   -16.106 1.00 25.26  ? 902 ILE C O   1 
ATOM   1747 C  CB  . ILE B 2 80  ? -12.960 6.731   -15.778 1.00 23.89  ? 902 ILE C CB  1 
ATOM   1748 C  CG1 . ILE B 2 80  ? -14.428 6.498   -16.142 1.00 23.50  ? 902 ILE C CG1 1 
ATOM   1749 C  CG2 . ILE B 2 80  ? -12.851 7.482   -14.464 1.00 25.02  ? 902 ILE C CG2 1 
ATOM   1750 C  CD1 . ILE B 2 80  ? -15.199 5.726   -15.095 1.00 22.98  ? 902 ILE C CD1 1 
ATOM   1751 N  N   . LYS B 2 81  ? -10.506 9.126   -16.431 1.00 28.27  ? 903 LYS C N   1 
ATOM   1752 C  CA  . LYS B 2 81  ? -9.246  9.598   -15.869 1.00 29.63  ? 903 LYS C CA  1 
ATOM   1753 C  C   . LYS B 2 81  ? -9.503  10.818  -14.990 1.00 30.95  ? 903 LYS C C   1 
ATOM   1754 O  O   . LYS B 2 81  ? -10.494 11.525  -15.170 1.00 31.12  ? 903 LYS C O   1 
ATOM   1755 C  CB  . LYS B 2 81  ? -8.233  9.919   -16.971 1.00 29.05  ? 903 LYS C CB  1 
ATOM   1756 C  CG  . LYS B 2 81  ? -8.681  10.990  -17.952 1.00 29.54  ? 903 LYS C CG  1 
ATOM   1757 C  CD  . LYS B 2 81  ? -7.629  11.216  -19.029 1.00 29.82  ? 903 LYS C CD  1 
ATOM   1758 C  CE  . LYS B 2 81  ? -8.062  12.293  -20.012 1.00 30.78  ? 903 LYS C CE  1 
ATOM   1759 N  NZ  . LYS B 2 81  ? -7.071  12.475  -21.111 1.00 31.52  ? 903 LYS C NZ  1 
ATOM   1760 N  N   . MET B 2 82  ? -8.612  11.058  -14.035 1.00 32.75  ? 904 MET C N   1 
ATOM   1761 C  CA  . MET B 2 82  ? -8.804  12.146  -13.086 1.00 34.38  ? 904 MET C CA  1 
ATOM   1762 C  C   . MET B 2 82  ? -7.504  12.881  -12.787 1.00 35.04  ? 904 MET C C   1 
ATOM   1763 O  O   . MET B 2 82  ? -6.425  12.454  -13.200 1.00 34.92  ? 904 MET C O   1 
ATOM   1764 C  CB  . MET B 2 82  ? -9.397  11.612  -11.782 1.00 33.55  ? 904 MET C CB  1 
ATOM   1765 C  CG  . MET B 2 82  ? -8.430  10.764  -10.974 1.00 33.40  ? 904 MET C CG  1 
ATOM   1766 S  SD  . MET B 2 82  ? -9.111  10.266  -9.382  1.00 33.63  ? 904 MET C SD  1 
ATOM   1767 C  CE  . MET B 2 82  ? -9.553  11.860  -8.700  1.00 36.06  ? 904 MET C CE  1 
ATOM   1768 N  N   . GLN B 2 83  ? -7.622  13.990  -12.066 1.00 36.91  ? 905 GLN C N   1 
ATOM   1769 C  CA  . GLN B 2 83  ? -6.464  14.753  -11.621 1.00 39.11  ? 905 GLN C CA  1 
ATOM   1770 C  C   . GLN B 2 83  ? -6.851  15.626  -10.434 1.00 39.19  ? 905 GLN C C   1 
ATOM   1771 O  O   . GLN B 2 83  ? -8.023  15.953  -10.254 1.00 38.51  ? 905 GLN C O   1 
ATOM   1772 C  CB  . GLN B 2 83  ? -5.908  15.615  -12.758 1.00 39.34  ? 905 GLN C CB  1 
ATOM   1773 C  CG  . GLN B 2 83  ? -6.878  16.660  -13.285 1.00 39.23  ? 905 GLN C CG  1 
ATOM   1774 C  CD  . GLN B 2 83  ? -6.289  17.486  -14.414 1.00 40.19  ? 905 GLN C CD  1 
ATOM   1775 O  OE1 . GLN B 2 83  ? -6.880  18.473  -14.852 1.00 41.98  ? 905 GLN C OE1 1 
ATOM   1776 N  NE2 . GLN B 2 83  ? -5.120  17.083  -14.892 1.00 39.71  ? 905 GLN C NE2 1 
ATOM   1777 N  N   . CYS B 2 84  ? -5.868  15.992  -9.619  1.00 30.08  ? 906 CYS C N   1 
ATOM   1778 C  CA  . CYS B 2 84  ? -6.119  16.876  -8.488  1.00 31.21  ? 906 CYS C CA  1 
ATOM   1779 C  C   . CYS B 2 84  ? -5.743  18.304  -8.856  1.00 32.89  ? 906 CYS C C   1 
ATOM   1780 O  O   . CYS B 2 84  ? -4.989  18.529  -9.803  1.00 32.70  ? 906 CYS C O   1 
ATOM   1781 C  CB  . CYS B 2 84  ? -5.345  16.417  -7.249  1.00 31.35  ? 906 CYS C CB  1 
ATOM   1782 S  SG  . CYS B 2 84  ? -3.554  16.619  -7.353  1.00 33.24  ? 906 CYS C SG  1 
ATOM   1783 N  N   . PHE B 2 85  ? -6.272  19.266  -8.109  1.00 45.60  ? 907 PHE C N   1 
ATOM   1784 C  CA  . PHE B 2 85  ? -6.026  20.671  -8.404  1.00 47.93  ? 907 PHE C CA  1 
ATOM   1785 C  C   . PHE B 2 85  ? -6.001  21.541  -7.151  1.00 50.12  ? 907 PHE C C   1 
ATOM   1786 O  O   . PHE B 2 85  ? -6.691  21.262  -6.171  1.00 49.83  ? 907 PHE C O   1 
ATOM   1787 C  CB  . PHE B 2 85  ? -7.082  21.204  -9.375  1.00 47.23  ? 907 PHE C CB  1 
ATOM   1788 C  CG  . PHE B 2 85  ? -8.441  21.375  -8.757  1.00 46.05  ? 907 PHE C CG  1 
ATOM   1789 C  CD1 . PHE B 2 85  ? -8.807  22.581  -8.181  1.00 47.49  ? 907 PHE C CD1 1 
ATOM   1790 C  CD2 . PHE B 2 85  ? -9.351  20.332  -8.750  1.00 44.25  ? 907 PHE C CD2 1 
ATOM   1791 C  CE1 . PHE B 2 85  ? -10.055 22.743  -7.609  1.00 47.07  ? 907 PHE C CE1 1 
ATOM   1792 C  CE2 . PHE B 2 85  ? -10.601 20.488  -8.182  1.00 44.63  ? 907 PHE C CE2 1 
ATOM   1793 C  CZ  . PHE B 2 85  ? -10.954 21.695  -7.610  1.00 45.95  ? 907 PHE C CZ  1 
ATOM   1794 N  N   . ASN B 2 86  ? -5.194  22.594  -7.200  1.00 66.75  ? 908 ASN C N   1 
ATOM   1795 C  CA  . ASN B 2 86  ? -5.182  23.621  -6.167  1.00 68.83  ? 908 ASN C CA  1 
ATOM   1796 C  C   . ASN B 2 86  ? -5.150  25.000  -6.819  1.00 71.45  ? 908 ASN C C   1 
ATOM   1797 O  O   . ASN B 2 86  ? -5.350  25.122  -8.029  1.00 71.60  ? 908 ASN C O   1 
ATOM   1798 C  CB  . ASN B 2 86  ? -3.994  23.433  -5.219  1.00 69.61  ? 908 ASN C CB  1 
ATOM   1799 C  CG  . ASN B 2 86  ? -2.666  23.353  -5.951  1.00 71.53  ? 908 ASN C CG  1 
ATOM   1800 O  OD1 . ASN B 2 86  ? -2.561  23.736  -7.117  1.00 71.83  ? 908 ASN C OD1 1 
ATOM   1801 N  ND2 . ASN B 2 86  ? -1.642  22.855  -5.266  1.00 70.92  ? 908 ASN C ND2 1 
ATOM   1802 N  N   . GLU B 2 87  ? -4.898  26.038  -6.028  1.00 83.88  ? 909 GLU C N   1 
ATOM   1803 C  CA  . GLU B 2 87  ? -4.816  27.388  -6.576  1.00 85.15  ? 909 GLU C CA  1 
ATOM   1804 C  C   . GLU B 2 87  ? -3.693  27.495  -7.606  1.00 84.75  ? 909 GLU C C   1 
ATOM   1805 O  O   . GLU B 2 87  ? -3.763  28.299  -8.535  1.00 84.80  ? 909 GLU C O   1 
ATOM   1806 C  CB  . GLU B 2 87  ? -4.633  28.431  -5.468  1.00 86.10  ? 909 GLU C CB  1 
ATOM   1807 C  CG  . GLU B 2 87  ? -3.641  28.046  -4.380  1.00 87.51  ? 909 GLU C CG  1 
ATOM   1808 C  CD  . GLU B 2 87  ? -4.305  27.375  -3.188  1.00 88.23  ? 909 GLU C CD  1 
ATOM   1809 O  OE1 . GLU B 2 87  ? -5.175  26.502  -3.396  1.00 85.64  ? 909 GLU C OE1 1 
ATOM   1810 O  OE2 . GLU B 2 87  ? -3.952  27.721  -2.039  1.00 88.75  ? 909 GLU C OE2 1 
ATOM   1811 N  N   . GLY B 2 88  ? -2.663  26.670  -7.438  1.00 72.76  ? 910 GLY C N   1 
ATOM   1812 C  CA  . GLY B 2 88  ? -1.536  26.653  -8.354  1.00 73.68  ? 910 GLY C CA  1 
ATOM   1813 C  C   . GLY B 2 88  ? -1.913  26.178  -9.745  1.00 74.14  ? 910 GLY C C   1 
ATOM   1814 O  O   . GLY B 2 88  ? -1.633  26.852  -10.738 1.00 73.73  ? 910 GLY C O   1 
ATOM   1815 N  N   . GLY B 2 89  ? -2.549  25.012  -9.817  1.00 69.93  ? 911 GLY C N   1 
ATOM   1816 C  CA  . GLY B 2 89  ? -2.976  24.451  -11.086 1.00 66.12  ? 911 GLY C CA  1 
ATOM   1817 C  C   . GLY B 2 89  ? -3.551  23.055  -10.939 1.00 62.85  ? 911 GLY C C   1 
ATOM   1818 O  O   . GLY B 2 89  ? -4.210  22.747  -9.945  1.00 61.82  ? 911 GLY C O   1 
ATOM   1819 N  N   . GLU B 2 90  ? -3.303  22.209  -11.936 1.00 56.40  ? 912 GLU C N   1 
ATOM   1820 C  CA  . GLU B 2 90  ? -3.771  20.828  -11.905 1.00 53.60  ? 912 GLU C CA  1 
ATOM   1821 C  C   . GLU B 2 90  ? -2.616  19.864  -12.141 1.00 52.10  ? 912 GLU C C   1 
ATOM   1822 O  O   . GLU B 2 90  ? -1.724  20.140  -12.943 1.00 51.75  ? 912 GLU C O   1 
ATOM   1823 C  CB  . GLU B 2 90  ? -4.857  20.597  -12.958 1.00 52.97  ? 912 GLU C CB  1 
ATOM   1824 C  CG  . GLU B 2 90  ? -5.914  21.686  -13.029 1.00 54.05  ? 912 GLU C CG  1 
ATOM   1825 C  CD  . GLU B 2 90  ? -5.493  22.849  -13.907 1.00 55.68  ? 912 GLU C CD  1 
ATOM   1826 O  OE1 . GLU B 2 90  ? -4.499  22.703  -14.650 1.00 55.69  ? 912 GLU C OE1 1 
ATOM   1827 O  OE2 . GLU B 2 90  ? -6.160  23.905  -13.858 1.00 55.85  ? 912 GLU C OE2 1 
ATOM   1828 N  N   . SER B 2 91  ? -2.639  18.734  -11.440 1.00 53.80  ? 913 SER C N   1 
ATOM   1829 C  CA  . SER B 2 91  ? -1.622  17.702  -11.615 1.00 53.39  ? 913 SER C CA  1 
ATOM   1830 C  C   . SER B 2 91  ? -1.847  16.965  -12.927 1.00 51.60  ? 913 SER C C   1 
ATOM   1831 O  O   . SER B 2 91  ? -2.918  17.059  -13.521 1.00 51.22  ? 913 SER C O   1 
ATOM   1832 C  CB  . SER B 2 91  ? -1.661  16.705  -10.455 1.00 52.17  ? 913 SER C CB  1 
ATOM   1833 O  OG  . SER B 2 91  ? -2.817  15.887  -10.528 1.00 50.81  ? 913 SER C OG  1 
ATOM   1834 N  N   . GLU B 2 92  ? -0.838  16.227  -13.378 1.00 53.83  ? 914 GLU C N   1 
ATOM   1835 C  CA  . GLU B 2 92  ? -0.975  15.435  -14.591 1.00 53.77  ? 914 GLU C CA  1 
ATOM   1836 C  C   . GLU B 2 92  ? -2.089  14.410  -14.424 1.00 52.32  ? 914 GLU C C   1 
ATOM   1837 O  O   . GLU B 2 92  ? -2.472  14.077  -13.302 1.00 51.58  ? 914 GLU C O   1 
ATOM   1838 C  CB  . GLU B 2 92  ? 0.340   14.740  -14.940 1.00 53.91  ? 914 GLU C CB  1 
ATOM   1839 C  CG  . GLU B 2 92  ? 1.431   15.689  -15.400 1.00 55.99  ? 914 GLU C CG  1 
ATOM   1840 C  CD  . GLU B 2 92  ? 2.565   14.970  -16.099 1.00 60.24  ? 914 GLU C CD  1 
ATOM   1841 O  OE1 . GLU B 2 92  ? 2.573   13.720  -16.087 1.00 62.47  ? 914 GLU C OE1 1 
ATOM   1842 O  OE2 . GLU B 2 92  ? 3.445   15.652  -16.665 1.00 60.17  ? 914 GLU C OE2 1 
ATOM   1843 N  N   . PHE B 2 93  ? -2.611  13.916  -15.542 1.00 37.64  ? 915 PHE C N   1 
ATOM   1844 C  CA  . PHE B 2 93  ? -3.709  12.958  -15.503 1.00 34.99  ? 915 PHE C CA  1 
ATOM   1845 C  C   . PHE B 2 93  ? -3.311  11.649  -14.830 1.00 34.24  ? 915 PHE C C   1 
ATOM   1846 O  O   . PHE B 2 93  ? -2.146  11.250  -14.848 1.00 34.03  ? 915 PHE C O   1 
ATOM   1847 C  CB  . PHE B 2 93  ? -4.246  12.683  -16.909 1.00 33.56  ? 915 PHE C CB  1 
ATOM   1848 C  CG  . PHE B 2 93  ? -5.066  13.806  -17.475 1.00 34.87  ? 915 PHE C CG  1 
ATOM   1849 C  CD1 . PHE B 2 93  ? -4.677  14.448  -18.638 1.00 34.29  ? 915 PHE C CD1 1 
ATOM   1850 C  CD2 . PHE B 2 93  ? -6.224  14.224  -16.837 1.00 34.72  ? 915 PHE C CD2 1 
ATOM   1851 C  CE1 . PHE B 2 93  ? -5.430  15.482  -19.159 1.00 33.79  ? 915 PHE C CE1 1 
ATOM   1852 C  CE2 . PHE B 2 93  ? -6.981  15.258  -17.353 1.00 34.15  ? 915 PHE C CE2 1 
ATOM   1853 C  CZ  . PHE B 2 93  ? -6.583  15.888  -18.516 1.00 34.46  ? 915 PHE C CZ  1 
ATOM   1854 N  N   . SER B 2 94  ? -4.295  10.989  -14.232 1.00 21.46  ? 916 SER C N   1 
ATOM   1855 C  CA  . SER B 2 94  ? -4.083  9.701   -13.597 1.00 19.90  ? 916 SER C CA  1 
ATOM   1856 C  C   . SER B 2 94  ? -4.134  8.606   -14.646 1.00 18.56  ? 916 SER C C   1 
ATOM   1857 O  O   . SER B 2 94  ? -4.240  8.883   -15.841 1.00 18.23  ? 916 SER C O   1 
ATOM   1858 C  CB  . SER B 2 94  ? -5.171  9.447   -12.560 1.00 20.79  ? 916 SER C CB  1 
ATOM   1859 O  OG  . SER B 2 94  ? -6.437  9.340   -13.186 1.00 19.31  ? 916 SER C OG  1 
ATOM   1860 N  N   . ASN B 2 95  ? -4.056  7.360   -14.197 1.00 18.75  ? 917 ASN C N   1 
ATOM   1861 C  CA  . ASN B 2 95  ? -4.253  6.229   -15.088 1.00 18.38  ? 917 ASN C CA  1 
ATOM   1862 C  C   . ASN B 2 95  ? -5.679  6.236   -15.628 1.00 17.75  ? 917 ASN C C   1 
ATOM   1863 O  O   . ASN B 2 95  ? -6.622  6.549   -14.901 1.00 17.66  ? 917 ASN C O   1 
ATOM   1864 C  CB  . ASN B 2 95  ? -3.954  4.911   -14.370 1.00 31.91  ? 917 ASN C CB  1 
ATOM   1865 C  CG  . ASN B 2 95  ? -4.803  4.714   -13.130 1.00 18.14  ? 917 ASN C CG  1 
ATOM   1866 O  OD1 . ASN B 2 95  ? -5.063  5.657   -12.385 1.00 18.94  ? 917 ASN C OD1 1 
ATOM   1867 N  ND2 . ASN B 2 95  ? -5.232  3.480   -12.899 1.00 17.98  ? 917 ASN C ND2 1 
ATOM   1868 N  N   . VAL B 2 96  ? -5.833  5.902   -16.904 1.00 30.00  ? 918 VAL C N   1 
ATOM   1869 C  CA  . VAL B 2 96  ? -7.145  5.929   -17.538 1.00 29.30  ? 918 VAL C CA  1 
ATOM   1870 C  C   . VAL B 2 96  ? -7.836  4.569   -17.459 1.00 28.71  ? 918 VAL C C   1 
ATOM   1871 O  O   . VAL B 2 96  ? -7.343  3.575   -17.990 1.00 28.55  ? 918 VAL C O   1 
ATOM   1872 C  CB  . VAL B 2 96  ? -7.057  6.370   -19.012 1.00 29.12  ? 918 VAL C CB  1 
ATOM   1873 C  CG1 . VAL B 2 96  ? -8.439  6.711   -19.541 1.00 28.77  ? 918 VAL C CG1 1 
ATOM   1874 C  CG2 . VAL B 2 96  ? -6.125  7.563   -19.156 1.00 29.40  ? 918 VAL C CG2 1 
ATOM   1875 N  N   . MET B 2 97  ? -8.984  4.537   -16.791 1.00 25.80  ? 919 MET C N   1 
ATOM   1876 C  CA  . MET B 2 97  ? -9.759  3.312   -16.650 1.00 25.06  ? 919 MET C CA  1 
ATOM   1877 C  C   . MET B 2 97  ? -10.827 3.222   -17.730 1.00 24.30  ? 919 MET C C   1 
ATOM   1878 O  O   . MET B 2 97  ? -11.227 4.232   -18.307 1.00 24.14  ? 919 MET C O   1 
ATOM   1879 C  CB  . MET B 2 97  ? -10.413 3.261   -15.270 1.00 25.16  ? 919 MET C CB  1 
ATOM   1880 C  CG  . MET B 2 97  ? -9.426  3.323   -14.120 1.00 26.56  ? 919 MET C CG  1 
ATOM   1881 S  SD  . MET B 2 97  ? -8.622  1.737   -13.824 1.00 29.25  ? 919 MET C SD  1 
ATOM   1882 C  CE  . MET B 2 97  ? -9.934  0.863   -12.971 1.00 29.67  ? 919 MET C CE  1 
ATOM   1883 N  N   . ILE B 2 98  ? -11.283 2.006   -18.006 1.00 33.05  ? 920 ILE C N   1 
ATOM   1884 C  CA  . ILE B 2 98  ? -12.370 1.797   -18.954 1.00 33.00  ? 920 ILE C CA  1 
ATOM   1885 C  C   . ILE B 2 98  ? -13.446 0.928   -18.320 1.00 32.85  ? 920 ILE C C   1 
ATOM   1886 O  O   . ILE B 2 98  ? -13.280 -0.285  -18.189 1.00 33.31  ? 920 ILE C O   1 
ATOM   1887 C  CB  . ILE B 2 98  ? -11.880 1.132   -20.258 1.00 33.10  ? 920 ILE C CB  1 
ATOM   1888 C  CG1 . ILE B 2 98  ? -10.903 2.049   -20.994 1.00 32.76  ? 920 ILE C CG1 1 
ATOM   1889 C  CG2 . ILE B 2 98  ? -13.057 0.795   -21.159 1.00 32.30  ? 920 ILE C CG2 1 
ATOM   1890 C  CD1 . ILE B 2 98  ? -10.476 1.523   -22.344 1.00 31.39  ? 920 ILE C CD1 1 
ATOM   1891 N  N   . CYS B 2 99  ? -14.545 1.555   -17.916 1.00 11.78  ? 921 CYS C N   1 
ATOM   1892 C  CA  . CYS B 2 99  ? -15.642 0.833   -17.286 1.00 11.44  ? 921 CYS C CA  1 
ATOM   1893 C  C   . CYS B 2 99  ? -16.891 0.897   -18.155 1.00 22.05  ? 921 CYS C C   1 
ATOM   1894 O  O   . CYS B 2 99  ? -16.993 1.735   -19.049 1.00 21.11  ? 921 CYS C O   1 
ATOM   1895 C  CB  . CYS B 2 99  ? -15.929 1.397   -15.893 1.00 22.68  ? 921 CYS C CB  1 
ATOM   1896 S  SG  . CYS B 2 99  ? -16.896 0.302   -14.830 1.00 21.79  ? 921 CYS C SG  1 
ATOM   1897 N  N   . GLU B 2 100 ? -17.839 0.006   -17.889 1.00 37.36  ? 922 GLU C N   1 
ATOM   1898 C  CA  . GLU B 2 100 ? -19.064 -0.064  -18.675 1.00 37.66  ? 922 GLU C CA  1 
ATOM   1899 C  C   . GLU B 2 100 ? -20.291 -0.210  -17.784 1.00 37.62  ? 922 GLU C C   1 
ATOM   1900 O  O   . GLU B 2 100 ? -20.393 -1.157  -17.006 1.00 38.33  ? 922 GLU C O   1 
ATOM   1901 C  CB  . GLU B 2 100 ? -18.990 -1.230  -19.662 1.00 37.85  ? 922 GLU C CB  1 
ATOM   1902 C  CG  . GLU B 2 100 ? -20.279 -1.496  -20.416 1.00 38.24  ? 922 GLU C CG  1 
ATOM   1903 C  CD  . GLU B 2 100 ? -20.117 -2.568  -21.477 1.00 38.97  ? 922 GLU C CD  1 
ATOM   1904 O  OE1 . GLU B 2 100 ? -18.987 -2.735  -21.984 1.00 37.61  ? 922 GLU C OE1 1 
ATOM   1905 O  OE2 . GLU B 2 100 ? -21.120 -3.238  -21.807 1.00 40.37  ? 922 GLU C OE2 1 
ATOM   1906 N  N   . THR B 2 101 ? -21.221 0.732   -17.903 1.00 19.46  ? 923 THR C N   1 
ATOM   1907 C  CA  . THR B 2 101 ? -22.465 0.679   -17.143 1.00 20.37  ? 923 THR C CA  1 
ATOM   1908 C  C   . THR B 2 101 ? -23.204 -0.626  -17.419 1.00 20.62  ? 923 THR C C   1 
ATOM   1909 O  O   . THR B 2 101 ? -22.968 -1.282  -18.435 1.00 20.70  ? 923 THR C O   1 
ATOM   1910 C  CB  . THR B 2 101 ? -23.396 1.857   -17.488 1.00 19.86  ? 923 THR C CB  1 
ATOM   1911 O  OG1 . THR B 2 101 ? -23.760 1.794   -18.872 1.00 19.99  ? 923 THR C OG1 1 
ATOM   1912 C  CG2 . THR B 2 101 ? -22.708 3.182   -17.211 1.00 19.89  ? 923 THR C CG2 1 
ATOM   1913 N  N   . LYS B 2 102 ? -24.098 -0.999  -16.510 1.00 32.85  ? 924 LYS C N   1 
ATOM   1914 C  CA  . LYS B 2 102 ? -24.881 -2.218  -16.672 1.00 33.40  ? 924 LYS C CA  1 
ATOM   1915 C  C   . LYS B 2 102 ? -25.907 -2.067  -17.792 1.00 33.92  ? 924 LYS C C   1 
ATOM   1916 O  O   . LYS B 2 102 ? -26.349 -0.960  -18.105 1.00 33.49  ? 924 LYS C O   1 
ATOM   1917 C  CB  . LYS B 2 102 ? -25.585 -2.583  -15.364 1.00 34.23  ? 924 LYS C CB  1 
ATOM   1918 C  CG  . LYS B 2 102 ? -24.652 -2.929  -14.217 1.00 33.96  ? 924 LYS C CG  1 
ATOM   1919 C  CD  . LYS B 2 102 ? -25.447 -3.258  -12.962 1.00 35.44  ? 924 LYS C CD  1 
ATOM   1920 C  CE  . LYS B 2 102 ? -24.539 -3.650  -11.806 1.00 37.28  ? 924 LYS C CE  1 
ATOM   1921 N  NZ  . LYS B 2 102 ? -25.315 -3.919  -10.560 1.00 38.24  ? 924 LYS C NZ  1 
ATOM   1922 O  OXT . LYS B 2 102 ? -26.321 -3.049  -18.412 1.00 34.37  ? 924 LYS C OXT 1 
ATOM   1923 N  N   . GLN C 1 20  ? -20.124 36.564  26.213  1.00 45.27  ? 39  GLN A N   1 
ATOM   1924 C  CA  . GLN C 1 20  ? -19.121 35.546  26.495  1.00 45.53  ? 39  GLN A CA  1 
ATOM   1925 C  C   . GLN C 1 20  ? -19.599 34.155  26.079  1.00 46.15  ? 39  GLN A C   1 
ATOM   1926 O  O   . GLN C 1 20  ? -18.903 33.449  25.345  1.00 47.17  ? 39  GLN A O   1 
ATOM   1927 C  CB  . GLN C 1 20  ? -18.733 35.567  27.974  1.00 45.47  ? 39  GLN A CB  1 
ATOM   1928 C  CG  . GLN C 1 20  ? -18.419 36.960  28.501  1.00 46.99  ? 39  GLN A CG  1 
ATOM   1929 C  CD  . GLN C 1 20  ? -17.398 36.948  29.624  1.00 50.67  ? 39  GLN A CD  1 
ATOM   1930 O  OE1 . GLN C 1 20  ? -16.372 36.268  29.543  1.00 49.72  ? 39  GLN A OE1 1 
ATOM   1931 N  NE2 . GLN C 1 20  ? -17.670 37.711  30.676  1.00 52.15  ? 39  GLN A NE2 1 
ATOM   1932 N  N   . LEU C 1 21  ? -20.784 33.767  26.542  1.00 35.80  ? 40  LEU A N   1 
ATOM   1933 C  CA  . LEU C 1 21  ? -21.375 32.491  26.144  1.00 34.65  ? 40  LEU A CA  1 
ATOM   1934 C  C   . LEU C 1 21  ? -22.035 32.567  24.775  1.00 35.40  ? 40  LEU A C   1 
ATOM   1935 O  O   . LEU C 1 21  ? -23.249 32.393  24.652  1.00 35.63  ? 40  LEU A O   1 
ATOM   1936 C  CB  . LEU C 1 21  ? -22.397 32.011  27.176  1.00 34.34  ? 40  LEU A CB  1 
ATOM   1937 C  CG  . LEU C 1 21  ? -21.930 30.925  28.147  1.00 35.28  ? 40  LEU A CG  1 
ATOM   1938 C  CD1 . LEU C 1 21  ? -23.124 30.305  28.852  1.00 33.97  ? 40  LEU A CD1 1 
ATOM   1939 C  CD2 . LEU C 1 21  ? -21.131 29.858  27.418  1.00 34.74  ? 40  LEU A CD2 1 
ATOM   1940 N  N   . VAL C 1 22  ? -21.235 32.822  23.745  1.00 31.47  ? 41  VAL A N   1 
ATOM   1941 C  CA  . VAL C 1 22  ? -21.754 32.889  22.384  1.00 32.00  ? 41  VAL A CA  1 
ATOM   1942 C  C   . VAL C 1 22  ? -21.630 31.544  21.669  1.00 31.18  ? 41  VAL A C   1 
ATOM   1943 O  O   . VAL C 1 22  ? -20.526 31.082  21.378  1.00 30.85  ? 41  VAL A O   1 
ATOM   1944 C  CB  . VAL C 1 22  ? -21.057 33.996  21.559  1.00 31.55  ? 41  VAL A CB  1 
ATOM   1945 C  CG1 . VAL C 1 22  ? -19.544 33.863  21.651  1.00 32.30  ? 41  VAL A CG1 1 
ATOM   1946 C  CG2 . VAL C 1 22  ? -21.526 33.953  20.111  1.00 30.94  ? 41  VAL A CG2 1 
ATOM   1947 N  N   . PRO C 1 23  ? -22.776 30.908  21.391  1.00 22.44  ? 42  PRO A N   1 
ATOM   1948 C  CA  . PRO C 1 23  ? -22.823 29.618  20.697  1.00 22.64  ? 42  PRO A CA  1 
ATOM   1949 C  C   . PRO C 1 23  ? -22.038 29.656  19.390  1.00 22.84  ? 42  PRO A C   1 
ATOM   1950 O  O   . PRO C 1 23  ? -21.791 30.736  18.854  1.00 23.53  ? 42  PRO A O   1 
ATOM   1951 C  CB  . PRO C 1 23  ? -24.315 29.436  20.408  1.00 21.92  ? 42  PRO A CB  1 
ATOM   1952 C  CG  . PRO C 1 23  ? -25.001 30.222  21.470  1.00 33.58  ? 42  PRO A CG  1 
ATOM   1953 C  CD  . PRO C 1 23  ? -24.121 31.408  21.727  1.00 22.24  ? 42  PRO A CD  1 
ATOM   1954 N  N   . LEU C 1 24  ? -21.641 28.492  18.888  1.00 36.42  ? 43  LEU A N   1 
ATOM   1955 C  CA  . LEU C 1 24  ? -20.963 28.424  17.600  1.00 36.97  ? 43  LEU A CA  1 
ATOM   1956 C  C   . LEU C 1 24  ? -21.966 28.276  16.465  1.00 37.64  ? 43  LEU A C   1 
ATOM   1957 O  O   . LEU C 1 24  ? -23.115 27.885  16.681  1.00 37.06  ? 43  LEU A O   1 
ATOM   1958 C  CB  . LEU C 1 24  ? -19.950 27.276  17.562  1.00 36.08  ? 43  LEU A CB  1 
ATOM   1959 C  CG  . LEU C 1 24  ? -18.671 27.486  18.376  1.00 37.47  ? 43  LEU A CG  1 
ATOM   1960 C  CD1 . LEU C 1 24  ? -17.543 26.630  17.826  1.00 37.13  ? 43  LEU A CD1 1 
ATOM   1961 C  CD2 . LEU C 1 24  ? -18.276 28.953  18.373  1.00 39.17  ? 43  LEU A CD2 1 
ATOM   1962 N  N   . LEU C 1 25  ? -21.523 28.603  15.257  1.00 37.25  ? 44  LEU A N   1 
ATOM   1963 C  CA  . LEU C 1 25  ? -22.363 28.492  14.075  1.00 37.15  ? 44  LEU A CA  1 
ATOM   1964 C  C   . LEU C 1 25  ? -22.072 27.178  13.368  1.00 36.06  ? 44  LEU A C   1 
ATOM   1965 O  O   . LEU C 1 25  ? -21.021 26.574  13.575  1.00 35.76  ? 44  LEU A O   1 
ATOM   1966 C  CB  . LEU C 1 25  ? -22.107 29.667  13.131  1.00 37.72  ? 44  LEU A CB  1 
ATOM   1967 C  CG  . LEU C 1 25  ? -22.300 31.059  13.734  1.00 37.42  ? 44  LEU A CG  1 
ATOM   1968 C  CD1 . LEU C 1 25  ? -21.659 32.118  12.852  1.00 37.44  ? 44  LEU A CD1 1 
ATOM   1969 C  CD2 . LEU C 1 25  ? -23.779 31.350  13.957  1.00 37.58  ? 44  LEU A CD2 1 
ATOM   1970 N  N   . TYR C 1 26  ? -23.008 26.737  12.536  1.00 46.31  ? 45  TYR A N   1 
ATOM   1971 C  CA  . TYR C 1 26  ? -22.839 25.491  11.800  1.00 46.43  ? 45  TYR A CA  1 
ATOM   1972 C  C   . TYR C 1 26  ? -21.580 25.530  10.934  1.00 47.11  ? 45  TYR A C   1 
ATOM   1973 O  O   . TYR C 1 26  ? -21.329 26.507  10.225  1.00 47.34  ? 45  TYR A O   1 
ATOM   1974 C  CB  . TYR C 1 26  ? -24.077 25.203  10.947  1.00 46.49  ? 45  TYR A CB  1 
ATOM   1975 C  CG  . TYR C 1 26  ? -23.935 24.001  10.043  1.00 46.85  ? 45  TYR A CG  1 
ATOM   1976 C  CD1 . TYR C 1 26  ? -23.544 22.768  10.550  1.00 46.51  ? 45  TYR A CD1 1 
ATOM   1977 C  CD2 . TYR C 1 26  ? -24.205 24.096  8.685   1.00 47.53  ? 45  TYR A CD2 1 
ATOM   1978 C  CE1 . TYR C 1 26  ? -23.416 21.665  9.725   1.00 46.67  ? 45  TYR A CE1 1 
ATOM   1979 C  CE2 . TYR C 1 26  ? -24.081 23.001  7.853   1.00 48.35  ? 45  TYR A CE2 1 
ATOM   1980 C  CZ  . TYR C 1 26  ? -23.687 21.787  8.377   1.00 47.63  ? 45  TYR A CZ  1 
ATOM   1981 O  OH  . TYR C 1 26  ? -23.563 20.694  7.549   1.00 46.21  ? 45  TYR A OH  1 
ATOM   1982 N  N   . LYS C 1 27  ? -20.785 24.467  11.016  1.00 35.33  ? 46  LYS A N   1 
ATOM   1983 C  CA  . LYS C 1 27  ? -19.554 24.351  10.238  1.00 35.14  ? 46  LYS A CA  1 
ATOM   1984 C  C   . LYS C 1 27  ? -18.462 25.311  10.698  1.00 35.20  ? 46  LYS A C   1 
ATOM   1985 O  O   . LYS C 1 27  ? -17.451 25.479  10.016  1.00 35.68  ? 46  LYS A O   1 
ATOM   1986 C  CB  . LYS C 1 27  ? -19.834 24.542  8.744   1.00 35.52  ? 46  LYS A CB  1 
ATOM   1987 C  CG  . LYS C 1 27  ? -20.484 23.340  8.081   1.00 35.21  ? 46  LYS A CG  1 
ATOM   1988 C  CD  . LYS C 1 27  ? -19.590 22.114  8.180   1.00 33.26  ? 46  LYS A CD  1 
ATOM   1989 C  CE  . LYS C 1 27  ? -20.176 20.942  7.415   1.00 34.53  ? 46  LYS A CE  1 
ATOM   1990 N  NZ  . LYS C 1 27  ? -19.241 19.785  7.381   1.00 34.61  ? 46  LYS A NZ  1 
ATOM   1991 N  N   . GLN C 1 28  ? -18.666 25.936  11.853  1.00 32.56  ? 47  GLN A N   1 
ATOM   1992 C  CA  . GLN C 1 28  ? -17.654 26.817  12.423  1.00 32.94  ? 47  GLN A CA  1 
ATOM   1993 C  C   . GLN C 1 28  ? -16.713 26.021  13.316  1.00 32.46  ? 47  GLN A C   1 
ATOM   1994 O  O   . GLN C 1 28  ? -17.069 24.953  13.808  1.00 31.91  ? 47  GLN A O   1 
ATOM   1995 C  CB  . GLN C 1 28  ? -18.299 27.948  13.224  1.00 33.39  ? 47  GLN A CB  1 
ATOM   1996 C  CG  . GLN C 1 28  ? -17.321 29.038  13.644  1.00 34.88  ? 47  GLN A CG  1 
ATOM   1997 C  CD  . GLN C 1 28  ? -17.837 29.883  14.793  1.00 35.58  ? 47  GLN A CD  1 
ATOM   1998 O  OE1 . GLN C 1 28  ? -18.873 29.581  15.387  1.00 35.09  ? 47  GLN A OE1 1 
ATOM   1999 N  NE2 . GLN C 1 28  ? -17.111 30.948  15.116  1.00 35.74  ? 47  GLN A NE2 1 
ATOM   2000 N  N   . PHE C 1 29  ? -15.510 26.546  13.522  1.00 43.81  ? 48  PHE A N   1 
ATOM   2001 C  CA  . PHE C 1 29  ? -14.527 25.882  14.368  1.00 44.43  ? 48  PHE A CA  1 
ATOM   2002 C  C   . PHE C 1 29  ? -13.679 26.887  15.140  1.00 45.61  ? 48  PHE A C   1 
ATOM   2003 O  O   . PHE C 1 29  ? -13.257 27.907  14.596  1.00 45.80  ? 48  PHE A O   1 
ATOM   2004 C  CB  . PHE C 1 29  ? -13.638 24.952  13.536  1.00 43.95  ? 48  PHE A CB  1 
ATOM   2005 C  CG  . PHE C 1 29  ? -13.079 25.591  12.297  1.00 44.75  ? 48  PHE A CG  1 
ATOM   2006 C  CD1 . PHE C 1 29  ? -13.829 25.651  11.133  1.00 43.85  ? 48  PHE A CD1 1 
ATOM   2007 C  CD2 . PHE C 1 29  ? -11.800 26.124  12.292  1.00 45.22  ? 48  PHE A CD2 1 
ATOM   2008 C  CE1 . PHE C 1 29  ? -13.317 26.237  9.991   1.00 43.94  ? 48  PHE A CE1 1 
ATOM   2009 C  CE2 . PHE C 1 29  ? -11.282 26.710  11.153  1.00 45.25  ? 48  PHE A CE2 1 
ATOM   2010 C  CZ  . PHE C 1 29  ? -12.042 26.767  10.001  1.00 45.13  ? 48  PHE A CZ  1 
ATOM   2011 N  N   . VAL C 1 30  ? -13.440 26.591  16.414  1.00 49.56  ? 49  VAL A N   1 
ATOM   2012 C  CA  . VAL C 1 30  ? -12.640 27.458  17.269  1.00 50.21  ? 49  VAL A CA  1 
ATOM   2013 C  C   . VAL C 1 30  ? -11.524 26.669  17.944  1.00 50.79  ? 49  VAL A C   1 
ATOM   2014 O  O   . VAL C 1 30  ? -11.782 25.649  18.583  1.00 50.52  ? 49  VAL A O   1 
ATOM   2015 C  CB  . VAL C 1 30  ? -13.505 28.149  18.341  1.00 50.92  ? 49  VAL A CB  1 
ATOM   2016 C  CG1 . VAL C 1 30  ? -12.628 28.828  19.382  1.00 50.82  ? 49  VAL A CG1 1 
ATOM   2017 C  CG2 . VAL C 1 30  ? -14.452 29.150  17.692  1.00 50.95  ? 49  VAL A CG2 1 
ATOM   2018 N  N   . PRO C 1 31  ? -10.275 27.142  17.807  1.00 45.28  ? 50  PRO A N   1 
ATOM   2019 C  CA  . PRO C 1 31  ? -9.932  28.376  17.083  1.00 45.44  ? 50  PRO A CA  1 
ATOM   2020 C  C   . PRO C 1 31  ? -10.212 28.278  15.585  1.00 44.88  ? 50  PRO A C   1 
ATOM   2021 O  O   . PRO C 1 31  ? -10.399 27.176  15.068  1.00 44.33  ? 50  PRO A O   1 
ATOM   2022 C  CB  . PRO C 1 31  ? -8.428  28.530  17.330  1.00 46.02  ? 50  PRO A CB  1 
ATOM   2023 C  CG  . PRO C 1 31  ? -7.948  27.177  17.722  1.00 45.99  ? 50  PRO A CG  1 
ATOM   2024 C  CD  . PRO C 1 31  ? -9.090  26.474  18.375  1.00 44.48  ? 50  PRO A CD  1 
ATOM   2025 N  N   . GLY C 1 32  ? -10.240 29.423  14.909  1.00 35.22  ? 51  GLY A N   1 
ATOM   2026 C  CA  . GLY C 1 32  ? -10.544 29.475  13.489  1.00 34.86  ? 51  GLY A CA  1 
ATOM   2027 C  C   . GLY C 1 32  ? -9.372  29.097  12.604  1.00 34.29  ? 51  GLY A C   1 
ATOM   2028 O  O   . GLY C 1 32  ? -9.135  29.716  11.567  1.00 34.16  ? 51  GLY A O   1 
ATOM   2029 N  N   . VAL C 1 33  ? -8.639  28.072  13.024  1.00 31.42  ? 52  VAL A N   1 
ATOM   2030 C  CA  . VAL C 1 33  ? -7.510  27.562  12.259  1.00 31.91  ? 52  VAL A CA  1 
ATOM   2031 C  C   . VAL C 1 33  ? -7.681  26.064  12.040  1.00 31.21  ? 52  VAL A C   1 
ATOM   2032 O  O   . VAL C 1 33  ? -8.459  25.422  12.746  1.00 30.91  ? 52  VAL A O   1 
ATOM   2033 C  CB  . VAL C 1 33  ? -6.178  27.823  12.983  1.00 32.38  ? 52  VAL A CB  1 
ATOM   2034 C  CG1 . VAL C 1 33  ? -5.969  29.314  13.191  1.00 32.20  ? 52  VAL A CG1 1 
ATOM   2035 C  CG2 . VAL C 1 33  ? -6.143  27.085  14.313  1.00 33.04  ? 52  VAL A CG2 1 
ATOM   2036 N  N   . PRO C 1 34  ? -6.964  25.507  11.053  1.00 52.18  ? 53  PRO A N   1 
ATOM   2037 C  CA  . PRO C 1 34  ? -6.977  24.062  10.807  1.00 52.25  ? 53  PRO A CA  1 
ATOM   2038 C  C   . PRO C 1 34  ? -6.725  23.278  12.084  1.00 52.47  ? 53  PRO A C   1 
ATOM   2039 O  O   . PRO C 1 34  ? -5.974  23.721  12.951  1.00 53.31  ? 53  PRO A O   1 
ATOM   2040 C  CB  . PRO C 1 34  ? -5.818  23.869  9.834   1.00 53.47  ? 53  PRO A CB  1 
ATOM   2041 C  CG  . PRO C 1 34  ? -5.761  25.147  9.083   1.00 53.79  ? 53  PRO A CG  1 
ATOM   2042 C  CD  . PRO C 1 34  ? -6.139  26.224  10.065  1.00 53.44  ? 53  PRO A CD  1 
ATOM   2043 N  N   . GLU C 1 35  ? -7.342  22.109  12.183  1.00 40.72  ? 54  GLU A N   1 
ATOM   2044 C  CA  . GLU C 1 35  ? -7.321  21.350  13.423  1.00 40.35  ? 54  GLU A CA  1 
ATOM   2045 C  C   . GLU C 1 35  ? -5.919  21.003  13.887  1.00 41.44  ? 54  GLU A C   1 
ATOM   2046 O  O   . GLU C 1 35  ? -5.686  20.795  15.075  1.00 42.53  ? 54  GLU A O   1 
ATOM   2047 C  CB  . GLU C 1 35  ? -8.123  20.062  13.284  1.00 39.28  ? 54  GLU A CB  1 
ATOM   2048 C  CG  . GLU C 1 35  ? -8.165  19.270  14.567  1.00 38.53  ? 54  GLU A CG  1 
ATOM   2049 C  CD  . GLU C 1 35  ? -8.933  17.986  14.423  1.00 37.93  ? 54  GLU A CD  1 
ATOM   2050 O  OE1 . GLU C 1 35  ? -9.237  17.602  13.275  1.00 38.11  ? 54  GLU A OE1 1 
ATOM   2051 O  OE2 . GLU C 1 35  ? -9.234  17.360  15.459  1.00 37.60  ? 54  GLU A OE2 1 
ATOM   2052 N  N   . ARG C 1 36  ? -4.985  20.923  12.952  1.00 54.79  ? 55  ARG A N   1 
ATOM   2053 C  CA  . ARG C 1 36  ? -3.661  20.424  13.290  1.00 55.55  ? 55  ARG A CA  1 
ATOM   2054 C  C   . ARG C 1 36  ? -2.582  21.501  13.230  1.00 56.48  ? 55  ARG A C   1 
ATOM   2055 O  O   . ARG C 1 36  ? -1.392  21.199  13.121  1.00 56.27  ? 55  ARG A O   1 
ATOM   2056 C  CB  . ARG C 1 36  ? -3.310  19.209  12.429  1.00 56.03  ? 55  ARG A CB  1 
ATOM   2057 C  CG  . ARG C 1 36  ? -4.149  17.976  12.769  1.00 56.29  ? 55  ARG A CG  1 
ATOM   2058 C  CD  . ARG C 1 36  ? -3.970  16.888  11.735  1.00 57.39  ? 55  ARG A CD  1 
ATOM   2059 N  NE  . ARG C 1 36  ? -5.048  15.901  11.757  1.00 57.31  ? 55  ARG A NE  1 
ATOM   2060 C  CZ  . ARG C 1 36  ? -5.130  14.889  10.900  1.00 58.85  ? 55  ARG A CZ  1 
ATOM   2061 N  NH1 . ARG C 1 36  ? -4.198  14.746  9.967   1.00 58.40  ? 55  ARG A NH1 1 
ATOM   2062 N  NH2 . ARG C 1 36  ? -6.136  14.025  10.969  1.00 57.96  ? 55  ARG A NH2 1 
ATOM   2063 N  N   . THR C 1 37  ? -3.007  22.758  13.309  1.00 51.40  ? 56  THR A N   1 
ATOM   2064 C  CA  . THR C 1 37  ? -2.074  23.860  13.488  1.00 52.04  ? 56  THR A CA  1 
ATOM   2065 C  C   . THR C 1 37  ? -1.640  23.835  14.947  1.00 51.46  ? 56  THR A C   1 
ATOM   2066 O  O   . THR C 1 37  ? -2.363  23.322  15.801  1.00 51.50  ? 56  THR A O   1 
ATOM   2067 C  CB  . THR C 1 37  ? -2.726  25.215  13.157  1.00 51.81  ? 56  THR A CB  1 
ATOM   2068 O  OG1 . THR C 1 37  ? -3.592  25.071  12.023  1.00 50.56  ? 56  THR A OG1 1 
ATOM   2069 C  CG2 . THR C 1 37  ? -1.664  26.259  12.847  1.00 53.43  ? 56  THR A CG2 1 
ATOM   2070 N  N   . LEU C 1 38  ? -0.460  24.368  15.238  1.00 57.34  ? 57  LEU A N   1 
ATOM   2071 C  CA  . LEU C 1 38  ? 0.037   24.361  16.609  1.00 58.18  ? 57  LEU A CA  1 
ATOM   2072 C  C   . LEU C 1 38  ? -0.935  25.085  17.539  1.00 57.36  ? 57  LEU A C   1 
ATOM   2073 O  O   . LEU C 1 38  ? -0.990  24.801  18.739  1.00 56.97  ? 57  LEU A O   1 
ATOM   2074 C  CB  . LEU C 1 38  ? 1.434   24.982  16.687  1.00 59.42  ? 57  LEU A CB  1 
ATOM   2075 C  CG  . LEU C 1 38  ? 2.519   24.311  15.838  1.00 59.89  ? 57  LEU A CG  1 
ATOM   2076 C  CD1 . LEU C 1 38  ? 3.881   24.934  16.112  1.00 63.05  ? 57  LEU A CD1 1 
ATOM   2077 C  CD2 . LEU C 1 38  ? 2.557   22.810  16.087  1.00 59.40  ? 57  LEU A CD2 1 
ATOM   2078 N  N   . GLY C 1 39  ? -1.708  26.009  16.975  1.00 52.59  ? 58  GLY A N   1 
ATOM   2079 C  CA  . GLY C 1 39  ? -2.696  26.746  17.741  1.00 52.11  ? 58  GLY A CA  1 
ATOM   2080 C  C   . GLY C 1 39  ? -3.983  25.973  17.961  1.00 52.63  ? 58  GLY A C   1 
ATOM   2081 O  O   . GLY C 1 39  ? -4.830  26.385  18.751  1.00 53.45  ? 58  GLY A O   1 
ATOM   2082 N  N   . ALA C 1 40  ? -4.137  24.851  17.262  1.00 50.73  ? 59  ALA A N   1 
ATOM   2083 C  CA  . ALA C 1 40  ? -5.331  24.022  17.405  1.00 48.96  ? 59  ALA A CA  1 
ATOM   2084 C  C   . ALA C 1 40  ? -5.064  22.789  18.268  1.00 49.26  ? 59  ALA A C   1 
ATOM   2085 O  O   . ALA C 1 40  ? -5.142  22.860  19.495  1.00 49.74  ? 59  ALA A O   1 
ATOM   2086 C  CB  . ALA C 1 40  ? -5.871  23.624  16.047  1.00 48.58  ? 59  ALA A CB  1 
ATOM   2087 N  N   . SER C 1 41  ? -4.755  21.664  17.631  1.00 36.83  ? 60  SER A N   1 
ATOM   2088 C  CA  . SER C 1 41  ? -4.502  20.423  18.361  1.00 36.97  ? 60  SER A CA  1 
ATOM   2089 C  C   . SER C 1 41  ? -3.164  19.785  17.995  1.00 37.04  ? 60  SER A C   1 
ATOM   2090 O  O   . SER C 1 41  ? -2.796  18.740  18.534  1.00 36.84  ? 60  SER A O   1 
ATOM   2091 C  CB  . SER C 1 41  ? -5.639  19.422  18.141  1.00 34.80  ? 60  SER A CB  1 
ATOM   2092 O  OG  . SER C 1 41  ? -6.817  19.838  18.807  1.00 34.31  ? 60  SER A OG  1 
ATOM   2093 N  N   . GLY C 1 42  ? -2.438  20.416  17.078  1.00 42.42  ? 61  GLY A N   1 
ATOM   2094 C  CA  . GLY C 1 42  ? -1.155  19.897  16.645  1.00 43.82  ? 61  GLY A CA  1 
ATOM   2095 C  C   . GLY C 1 42  ? -1.291  18.757  15.653  1.00 43.40  ? 61  GLY A C   1 
ATOM   2096 O  O   . GLY C 1 42  ? -2.394  18.270  15.409  1.00 42.72  ? 61  GLY A O   1 
ATOM   2097 N  N   . PRO C 1 43  ? -0.161  18.320  15.080  1.00 49.69  ? 62  PRO A N   1 
ATOM   2098 C  CA  . PRO C 1 43  ? -0.110  17.283  14.041  1.00 49.43  ? 62  PRO A CA  1 
ATOM   2099 C  C   . PRO C 1 43  ? -0.623  15.938  14.538  1.00 48.63  ? 62  PRO A C   1 
ATOM   2100 O  O   . PRO C 1 43  ? -0.623  15.682  15.741  1.00 48.87  ? 62  PRO A O   1 
ATOM   2101 C  CB  . PRO C 1 43  ? 1.387   17.173  13.727  1.00 51.15  ? 62  PRO A CB  1 
ATOM   2102 C  CG  . PRO C 1 43  ? 1.988   18.445  14.227  1.00 52.31  ? 62  PRO A CG  1 
ATOM   2103 C  CD  . PRO C 1 43  ? 1.178   18.825  15.419  1.00 51.37  ? 62  PRO A CD  1 
ATOM   2104 N  N   . ALA C 1 44  ? -1.053  15.089  13.611  1.00 43.93  ? 63  ALA A N   1 
ATOM   2105 C  CA  . ALA C 1 44  ? -1.485  13.740  13.951  1.00 44.33  ? 63  ALA A CA  1 
ATOM   2106 C  C   . ALA C 1 44  ? -0.275  12.835  14.165  1.00 44.70  ? 63  ALA A C   1 
ATOM   2107 O  O   . ALA C 1 44  ? 0.557   12.674  13.271  1.00 45.10  ? 63  ALA A O   1 
ATOM   2108 C  CB  . ALA C 1 44  ? -2.382  13.180  12.860  1.00 44.23  ? 63  ALA A CB  1 
ATOM   2109 N  N   . GLU C 1 45  ? -0.182  12.248  15.354  1.00 54.60  ? 64  GLU A N   1 
ATOM   2110 C  CA  . GLU C 1 45  ? 0.947   11.386  15.694  1.00 54.79  ? 64  GLU A CA  1 
ATOM   2111 C  C   . GLU C 1 45  ? 0.660   9.925   15.369  1.00 54.48  ? 64  GLU A C   1 
ATOM   2112 O  O   . GLU C 1 45  ? 0.692   9.066   16.251  1.00 55.47  ? 64  GLU A O   1 
ATOM   2113 C  CB  . GLU C 1 45  ? 1.306   11.532  17.174  1.00 56.23  ? 64  GLU A CB  1 
ATOM   2114 C  CG  . GLU C 1 45  ? 1.454   12.973  17.630  1.00 57.22  ? 64  GLU A CG  1 
ATOM   2115 C  CD  . GLU C 1 45  ? 2.144   13.093  18.973  1.00 57.83  ? 64  GLU A CD  1 
ATOM   2116 O  OE1 . GLU C 1 45  ? 2.382   12.049  19.619  1.00 57.05  ? 64  GLU A OE1 1 
ATOM   2117 O  OE2 . GLU C 1 45  ? 2.448   14.234  19.382  1.00 58.37  ? 64  GLU A OE2 1 
ATOM   2118 N  N   . GLY C 1 46  ? 0.377   9.649   14.100  1.00 40.93  ? 65  GLY A N   1 
ATOM   2119 C  CA  . GLY C 1 46  ? 0.101   8.295   13.658  1.00 40.49  ? 65  GLY A CA  1 
ATOM   2120 C  C   . GLY C 1 46  ? -1.191  7.738   14.222  1.00 39.57  ? 65  GLY A C   1 
ATOM   2121 O  O   . GLY C 1 46  ? -1.842  8.369   15.053  1.00 39.58  ? 65  GLY A O   1 
ATOM   2122 N  N   . ARG C 1 47  ? -1.559  6.547   13.763  1.00 41.17  ? 66  ARG A N   1 
ATOM   2123 C  CA  . ARG C 1 47  ? -2.770  5.884   14.229  1.00 40.31  ? 66  ARG A CA  1 
ATOM   2124 C  C   . ARG C 1 47  ? -2.441  4.818   15.267  1.00 41.01  ? 66  ARG A C   1 
ATOM   2125 O  O   . ARG C 1 47  ? -1.417  4.142   15.174  1.00 41.51  ? 66  ARG A O   1 
ATOM   2126 C  CB  . ARG C 1 47  ? -3.525  5.265   13.051  1.00 39.81  ? 66  ARG A CB  1 
ATOM   2127 C  CG  . ARG C 1 47  ? -4.648  4.317   13.443  1.00 39.18  ? 66  ARG A CG  1 
ATOM   2128 C  CD  . ARG C 1 47  ? -5.532  4.012   12.245  1.00 39.26  ? 66  ARG A CD  1 
ATOM   2129 N  NE  . ARG C 1 47  ? -6.480  2.931   12.502  1.00 38.65  ? 66  ARG A NE  1 
ATOM   2130 C  CZ  . ARG C 1 47  ? -7.393  2.522   11.627  1.00 38.10  ? 66  ARG A CZ  1 
ATOM   2131 N  NH1 . ARG C 1 47  ? -7.484  3.109   10.440  1.00 36.82  ? 66  ARG A NH1 1 
ATOM   2132 N  NH2 . ARG C 1 47  ? -8.217  1.530   11.936  1.00 38.08  ? 66  ARG A NH2 1 
ATOM   2133 N  N   . VAL C 1 48  ? -3.317  4.677   16.257  1.00 33.97  ? 67  VAL A N   1 
ATOM   2134 C  CA  . VAL C 1 48  ? -3.120  3.704   17.324  1.00 34.65  ? 67  VAL A CA  1 
ATOM   2135 C  C   . VAL C 1 48  ? -3.990  2.470   17.115  1.00 33.72  ? 67  VAL A C   1 
ATOM   2136 O  O   . VAL C 1 48  ? -5.217  2.553   17.151  1.00 33.20  ? 67  VAL A O   1 
ATOM   2137 C  CB  . VAL C 1 48  ? -3.448  4.306   18.698  1.00 34.76  ? 67  VAL A CB  1 
ATOM   2138 C  CG1 . VAL C 1 48  ? -3.236  3.273   19.791  1.00 35.87  ? 67  VAL A CG1 1 
ATOM   2139 C  CG2 . VAL C 1 48  ? -2.603  5.544   18.950  1.00 34.87  ? 67  VAL A CG2 1 
ATOM   2140 N  N   . ALA C 1 49  ? -3.348  1.326   16.899  1.00 36.73  ? 68  ALA A N   1 
ATOM   2141 C  CA  . ALA C 1 49  ? -4.064  0.069   16.714  1.00 37.87  ? 68  ALA A CA  1 
ATOM   2142 C  C   . ALA C 1 49  ? -4.347  -0.589  18.059  1.00 38.14  ? 68  ALA A C   1 
ATOM   2143 O  O   . ALA C 1 49  ? -3.800  -0.183  19.083  1.00 39.70  ? 68  ALA A O   1 
ATOM   2144 C  CB  . ALA C 1 49  ? -3.269  -0.869  15.822  1.00 39.26  ? 68  ALA A CB  1 
ATOM   2145 N  N   . ARG C 1 50  ? -5.199  -1.607  18.054  1.00 33.59  ? 69  ARG A N   1 
ATOM   2146 C  CA  . ARG C 1 50  ? -5.555  -2.295  19.290  1.00 35.18  ? 69  ARG A CA  1 
ATOM   2147 C  C   . ARG C 1 50  ? -4.350  -2.967  19.947  1.00 37.15  ? 69  ARG A C   1 
ATOM   2148 O  O   . ARG C 1 50  ? -4.163  -2.875  21.160  1.00 37.71  ? 69  ARG A O   1 
ATOM   2149 C  CB  . ARG C 1 50  ? -6.662  -3.321  19.043  1.00 33.62  ? 69  ARG A CB  1 
ATOM   2150 C  CG  . ARG C 1 50  ? -7.071  -4.085  20.289  1.00 33.44  ? 69  ARG A CG  1 
ATOM   2151 C  CD  . ARG C 1 50  ? -8.399  -4.793  20.092  1.00 33.45  ? 69  ARG A CD  1 
ATOM   2152 N  NE  . ARG C 1 50  ? -9.504  -3.849  19.959  1.00 32.19  ? 69  ARG A NE  1 
ATOM   2153 C  CZ  . ARG C 1 50  ? -10.177 -3.339  20.984  1.00 32.46  ? 69  ARG A CZ  1 
ATOM   2154 N  NH1 . ARG C 1 50  ? -9.861  -3.681  22.226  1.00 33.42  ? 69  ARG A NH1 1 
ATOM   2155 N  NH2 . ARG C 1 50  ? -11.168 -2.486  20.771  1.00 32.34  ? 69  ARG A NH2 1 
ATOM   2156 N  N   . GLY C 1 51  ? -3.535  -3.640  19.142  1.00 50.93  ? 70  GLY A N   1 
ATOM   2157 C  CA  . GLY C 1 51  ? -2.386  -4.357  19.661  1.00 52.34  ? 70  GLY A CA  1 
ATOM   2158 C  C   . GLY C 1 51  ? -1.229  -3.451  20.041  1.00 54.21  ? 70  GLY A C   1 
ATOM   2159 O  O   . GLY C 1 51  ? -0.446  -3.776  20.938  1.00 54.83  ? 70  GLY A O   1 
ATOM   2160 N  N   . SER C 1 52  ? -1.123  -2.313  19.360  1.00 49.11  ? 71  SER A N   1 
ATOM   2161 C  CA  . SER C 1 52  ? -0.012  -1.387  19.567  1.00 49.20  ? 71  SER A CA  1 
ATOM   2162 C  C   . SER C 1 52  ? 0.187   -1.028  21.039  1.00 50.76  ? 71  SER A C   1 
ATOM   2163 O  O   . SER C 1 52  ? -0.756  -1.051  21.833  1.00 50.06  ? 71  SER A O   1 
ATOM   2164 C  CB  . SER C 1 52  ? -0.224  -0.113  18.748  1.00 47.25  ? 71  SER A CB  1 
ATOM   2165 O  OG  . SER C 1 52  ? -1.282  0.662   19.288  1.00 46.71  ? 71  SER A OG  1 
ATOM   2166 N  N   . GLU C 1 53  ? 1.426   -0.704  21.397  1.00 70.19  ? 72  GLU A N   1 
ATOM   2167 C  CA  . GLU C 1 53  ? 1.755   -0.348  22.772  1.00 71.76  ? 72  GLU A CA  1 
ATOM   2168 C  C   . GLU C 1 53  ? 1.094   0.962   23.197  1.00 69.96  ? 72  GLU A C   1 
ATOM   2169 O  O   . GLU C 1 53  ? 0.628   1.093   24.328  1.00 70.44  ? 72  GLU A O   1 
ATOM   2170 C  CB  . GLU C 1 53  ? 3.273   -0.270  22.959  1.00 73.83  ? 72  GLU A CB  1 
ATOM   2171 C  CG  . GLU C 1 53  ? 3.956   -1.631  23.004  1.00 76.04  ? 72  GLU A CG  1 
ATOM   2172 C  CD  . GLU C 1 53  ? 3.505   -2.459  24.193  1.00 79.15  ? 72  GLU A CD  1 
ATOM   2173 O  OE1 . GLU C 1 53  ? 3.340   -1.881  25.289  1.00 78.83  ? 72  GLU A OE1 1 
ATOM   2174 O  OE2 . GLU C 1 53  ? 3.322   -3.686  24.035  1.00 80.14  ? 72  GLU A OE2 1 
ATOM   2175 N  N   . ARG C 1 54  ? 1.049   1.922   22.279  1.00 54.77  ? 73  ARG A N   1 
ATOM   2176 C  CA  . ARG C 1 54  ? 0.458   3.229   22.554  1.00 54.11  ? 73  ARG A CA  1 
ATOM   2177 C  C   . ARG C 1 54  ? -1.027  3.118   22.890  1.00 52.20  ? 73  ARG A C   1 
ATOM   2178 O  O   . ARG C 1 54  ? -1.648  4.082   23.343  1.00 50.75  ? 73  ARG A O   1 
ATOM   2179 C  CB  . ARG C 1 54  ? 0.676   4.171   21.366  1.00 53.25  ? 73  ARG A CB  1 
ATOM   2180 C  CG  . ARG C 1 54  ? 2.144   4.499   21.116  1.00 54.35  ? 73  ARG A CG  1 
ATOM   2181 C  CD  . ARG C 1 54  ? 2.369   5.243   19.806  1.00 54.07  ? 73  ARG A CD  1 
ATOM   2182 N  NE  . ARG C 1 54  ? 1.533   6.435   19.680  1.00 51.75  ? 73  ARG A NE  1 
ATOM   2183 C  CZ  . ARG C 1 54  ? 0.632   6.613   18.720  1.00 49.52  ? 73  ARG A CZ  1 
ATOM   2184 N  NH1 . ARG C 1 54  ? 0.454   5.681   17.794  1.00 48.92  ? 73  ARG A NH1 1 
ATOM   2185 N  NH2 . ARG C 1 54  ? -0.086  7.727   18.676  1.00 48.82  ? 73  ARG A NH2 1 
ATOM   2186 N  N   . PHE C 1 55  ? -1.587  1.934   22.670  1.00 45.59  ? 74  PHE A N   1 
ATOM   2187 C  CA  . PHE C 1 55  ? -2.987  1.675   22.978  1.00 44.89  ? 74  PHE A CA  1 
ATOM   2188 C  C   . PHE C 1 55  ? -3.185  1.411   24.466  1.00 45.06  ? 74  PHE A C   1 
ATOM   2189 O  O   . PHE C 1 55  ? -4.266  1.634   25.010  1.00 44.21  ? 74  PHE A O   1 
ATOM   2190 C  CB  . PHE C 1 55  ? -3.494  0.484   22.164  1.00 43.78  ? 74  PHE A CB  1 
ATOM   2191 C  CG  . PHE C 1 55  ? -4.840  -0.011  22.595  1.00 42.42  ? 74  PHE A CG  1 
ATOM   2192 C  CD1 . PHE C 1 55  ? -5.992  0.634   22.184  1.00 40.51  ? 74  PHE A CD1 1 
ATOM   2193 C  CD2 . PHE C 1 55  ? -4.953  -1.122  23.415  1.00 43.82  ? 74  PHE A CD2 1 
ATOM   2194 C  CE1 . PHE C 1 55  ? -7.233  0.181   22.581  1.00 40.09  ? 74  PHE A CE1 1 
ATOM   2195 C  CE2 . PHE C 1 55  ? -6.192  -1.581  23.814  1.00 43.49  ? 74  PHE A CE2 1 
ATOM   2196 C  CZ  . PHE C 1 55  ? -7.335  -0.928  23.396  1.00 41.65  ? 74  PHE A CZ  1 
ATOM   2197 N  N   . ARG C 1 56  ? -2.132  0.931   25.120  1.00 65.09  ? 75  ARG A N   1 
ATOM   2198 C  CA  . ARG C 1 56  ? -2.188  0.633   26.546  1.00 66.00  ? 75  ARG A CA  1 
ATOM   2199 C  C   . ARG C 1 56  ? -2.175  1.908   27.383  1.00 65.43  ? 75  ARG A C   1 
ATOM   2200 O  O   . ARG C 1 56  ? -2.629  1.912   28.528  1.00 65.24  ? 75  ARG A O   1 
ATOM   2201 C  CB  . ARG C 1 56  ? -1.027  -0.276  26.949  1.00 68.99  ? 75  ARG A CB  1 
ATOM   2202 C  CG  . ARG C 1 56  ? -1.000  -1.610  26.223  1.00 70.90  ? 75  ARG A CG  1 
ATOM   2203 C  CD  . ARG C 1 56  ? 0.054   -2.529  26.817  1.00 75.36  ? 75  ARG A CD  1 
ATOM   2204 N  NE  . ARG C 1 56  ? 0.047   -3.850  26.195  1.00 78.07  ? 75  ARG A NE  1 
ATOM   2205 C  CZ  . ARG C 1 56  ? 0.870   -4.837  26.532  1.00 79.83  ? 75  ARG A CZ  1 
ATOM   2206 N  NH1 . ARG C 1 56  ? 1.771   -4.655  27.489  1.00 79.59  ? 75  ARG A NH1 1 
ATOM   2207 N  NH2 . ARG C 1 56  ? 0.794   -6.007  25.911  1.00 81.16  ? 75  ARG A NH2 1 
ATOM   2208 N  N   . ASP C 1 57  ? -1.651  2.986   26.807  1.00 55.31  ? 76  ASP A N   1 
ATOM   2209 C  CA  . ASP C 1 57  ? -1.609  4.277   27.487  1.00 55.50  ? 76  ASP A CA  1 
ATOM   2210 C  C   . ASP C 1 57  ? -2.981  4.939   27.467  1.00 53.47  ? 76  ASP A C   1 
ATOM   2211 O  O   . ASP C 1 57  ? -3.172  6.016   28.032  1.00 52.67  ? 76  ASP A O   1 
ATOM   2212 C  CB  . ASP C 1 57  ? -0.574  5.196   26.839  1.00 56.77  ? 76  ASP A CB  1 
ATOM   2213 C  CG  . ASP C 1 57  ? 0.840   4.675   26.989  1.00 59.71  ? 76  ASP A CG  1 
ATOM   2214 O  OD1 . ASP C 1 57  ? 1.068   3.817   27.870  1.00 60.94  ? 76  ASP A OD1 1 
ATOM   2215 O  OD2 . ASP C 1 57  ? 1.724   5.125   26.229  1.00 61.49  ? 76  ASP A OD2 1 
ATOM   2216 N  N   . LEU C 1 58  ? -3.930  4.287   26.804  1.00 28.35  ? 77  LEU A N   1 
ATOM   2217 C  CA  . LEU C 1 58  ? -5.301  4.770   26.759  1.00 26.07  ? 77  LEU A CA  1 
ATOM   2218 C  C   . LEU C 1 58  ? -6.114  4.124   27.868  1.00 25.18  ? 77  LEU A C   1 
ATOM   2219 O  O   . LEU C 1 58  ? -6.182  2.900   27.967  1.00 25.89  ? 77  LEU A O   1 
ATOM   2220 C  CB  . LEU C 1 58  ? -5.936  4.463   25.403  1.00 25.20  ? 77  LEU A CB  1 
ATOM   2221 C  CG  . LEU C 1 58  ? -5.315  5.148   24.187  1.00 24.47  ? 77  LEU A CG  1 
ATOM   2222 C  CD1 . LEU C 1 58  ? -6.093  4.802   22.929  1.00 22.95  ? 77  LEU A CD1 1 
ATOM   2223 C  CD2 . LEU C 1 58  ? -5.266  6.653   24.394  1.00 23.35  ? 77  LEU A CD2 1 
ATOM   2224 N  N   . VAL C 1 59  ? -6.727  4.956   28.702  1.00 36.13  ? 78  VAL A N   1 
ATOM   2225 C  CA  . VAL C 1 59  ? -7.551  4.474   29.801  1.00 36.49  ? 78  VAL A CA  1 
ATOM   2226 C  C   . VAL C 1 59  ? -9.018  4.796   29.532  1.00 34.78  ? 78  VAL A C   1 
ATOM   2227 O  O   . VAL C 1 59  ? -9.342  5.899   29.095  1.00 34.11  ? 78  VAL A O   1 
ATOM   2228 C  CB  . VAL C 1 59  ? -7.119  5.104   31.139  1.00 37.06  ? 78  VAL A CB  1 
ATOM   2229 C  CG1 . VAL C 1 59  ? -7.820  4.420   32.302  1.00 36.54  ? 78  VAL A CG1 1 
ATOM   2230 C  CG2 . VAL C 1 59  ? -5.609  5.020   31.300  1.00 39.04  ? 78  VAL A CG2 1 
ATOM   2231 N  N   . PRO C 1 60  ? -9.910  3.822   29.778  1.00 25.24  ? 79  PRO A N   1 
ATOM   2232 C  CA  . PRO C 1 60  ? -11.350 4.012   29.581  1.00 23.92  ? 79  PRO A CA  1 
ATOM   2233 C  C   . PRO C 1 60  ? -11.931 5.050   30.534  1.00 24.57  ? 79  PRO A C   1 
ATOM   2234 O  O   . PRO C 1 60  ? -11.621 5.037   31.725  1.00 25.98  ? 79  PRO A O   1 
ATOM   2235 C  CB  . PRO C 1 60  ? -11.933 2.633   29.905  1.00 23.46  ? 79  PRO A CB  1 
ATOM   2236 C  CG  . PRO C 1 60  ? -10.804 1.688   29.755  1.00 25.25  ? 79  PRO A CG  1 
ATOM   2237 C  CD  . PRO C 1 60  ? -9.588  2.442   30.173  1.00 25.99  ? 79  PRO A CD  1 
ATOM   2238 N  N   . ASN C 1 61  ? -12.768 5.940   30.008  1.00 27.07  ? 80  ASN A N   1 
ATOM   2239 C  CA  . ASN C 1 61  ? -13.474 6.909   30.832  1.00 26.27  ? 80  ASN A CA  1 
ATOM   2240 C  C   . ASN C 1 61  ? -14.848 6.369   31.207  1.00 26.10  ? 80  ASN A C   1 
ATOM   2241 O  O   . ASN C 1 61  ? -15.744 6.291   30.369  1.00 25.89  ? 80  ASN A O   1 
ATOM   2242 C  CB  . ASN C 1 61  ? -13.605 8.245   30.097  1.00 25.95  ? 80  ASN A CB  1 
ATOM   2243 C  CG  . ASN C 1 61  ? -14.174 9.349   30.976  1.00 25.92  ? 80  ASN A CG  1 
ATOM   2244 O  OD1 . ASN C 1 61  ? -14.217 10.513  30.578  1.00 26.11  ? 80  ASN A OD1 1 
ATOM   2245 N  ND2 . ASN C 1 61  ? -14.609 8.988   32.175  1.00 26.36  ? 80  ASN A ND2 1 
ATOM   2246 N  N   . TYR C 1 62  ? -15.006 5.988   32.470  1.00 34.00  ? 81  TYR A N   1 
ATOM   2247 C  CA  . TYR C 1 62  ? -16.266 5.432   32.947  1.00 33.80  ? 81  TYR A CA  1 
ATOM   2248 C  C   . TYR C 1 62  ? -17.100 6.468   33.690  1.00 33.75  ? 81  TYR A C   1 
ATOM   2249 O  O   . TYR C 1 62  ? -17.911 6.121   34.550  1.00 34.26  ? 81  TYR A O   1 
ATOM   2250 C  CB  . TYR C 1 62  ? -16.013 4.229   33.853  1.00 35.09  ? 81  TYR A CB  1 
ATOM   2251 C  CG  . TYR C 1 62  ? -15.666 2.955   33.118  1.00 35.28  ? 81  TYR A CG  1 
ATOM   2252 C  CD1 . TYR C 1 62  ? -16.663 2.103   32.663  1.00 35.18  ? 81  TYR A CD1 1 
ATOM   2253 C  CD2 . TYR C 1 62  ? -14.344 2.599   32.888  1.00 35.50  ? 81  TYR A CD2 1 
ATOM   2254 C  CE1 . TYR C 1 62  ? -16.353 0.935   31.995  1.00 36.46  ? 81  TYR A CE1 1 
ATOM   2255 C  CE2 . TYR C 1 62  ? -14.024 1.432   32.221  1.00 35.90  ? 81  TYR A CE2 1 
ATOM   2256 C  CZ  . TYR C 1 62  ? -15.033 0.604   31.776  1.00 37.03  ? 81  TYR A CZ  1 
ATOM   2257 O  OH  . TYR C 1 62  ? -14.726 -0.561  31.107  1.00 37.85  ? 81  TYR A OH  1 
ATOM   2258 N  N   . ASN C 1 63  ? -16.895 7.738   33.359  1.00 25.00  ? 82  ASN A N   1 
ATOM   2259 C  CA  . ASN C 1 63  ? -17.656 8.817   33.976  1.00 24.50  ? 82  ASN A CA  1 
ATOM   2260 C  C   . ASN C 1 63  ? -19.150 8.518   33.927  1.00 24.73  ? 82  ASN A C   1 
ATOM   2261 O  O   . ASN C 1 63  ? -19.706 8.291   32.852  1.00 24.01  ? 82  ASN A O   1 
ATOM   2262 C  CB  . ASN C 1 63  ? -17.351 10.148  33.288  1.00 24.34  ? 82  ASN A CB  1 
ATOM   2263 C  CG  . ASN C 1 63  ? -17.794 11.344  34.108  1.00 24.69  ? 82  ASN A CG  1 
ATOM   2264 O  OD1 . ASN C 1 63  ? -18.820 11.302  34.789  1.00 24.53  ? 82  ASN A OD1 1 
ATOM   2265 N  ND2 . ASN C 1 63  ? -17.021 12.423  34.043  1.00 24.88  ? 82  ASN A ND2 1 
ATOM   2266 N  N   . PRO C 1 64  ? -19.801 8.501   35.101  1.00 35.49  ? 83  PRO A N   1 
ATOM   2267 C  CA  . PRO C 1 64  ? -21.225 8.157   35.212  1.00 34.60  ? 83  PRO A CA  1 
ATOM   2268 C  C   . PRO C 1 64  ? -22.144 9.242   34.656  1.00 33.57  ? 83  PRO A C   1 
ATOM   2269 O  O   . PRO C 1 64  ? -23.307 8.963   34.365  1.00 34.16  ? 83  PRO A O   1 
ATOM   2270 C  CB  . PRO C 1 64  ? -21.435 8.002   36.720  1.00 34.54  ? 83  PRO A CB  1 
ATOM   2271 C  CG  . PRO C 1 64  ? -20.343 8.785   37.352  1.00 34.71  ? 83  PRO A CG  1 
ATOM   2272 C  CD  . PRO C 1 64  ? -19.183 8.784   36.409  1.00 34.88  ? 83  PRO A CD  1 
ATOM   2273 N  N   . ASP C 1 65  ? -21.628 10.459  34.513  1.00 23.60  ? 84  ASP A N   1 
ATOM   2274 C  CA  . ASP C 1 65  ? -22.423 11.567  33.993  1.00 24.77  ? 84  ASP A CA  1 
ATOM   2275 C  C   . ASP C 1 65  ? -22.217 11.755  32.491  1.00 24.60  ? 84  ASP A C   1 
ATOM   2276 O  O   . ASP C 1 65  ? -22.514 12.818  31.937  1.00 23.45  ? 84  ASP A O   1 
ATOM   2277 C  CB  . ASP C 1 65  ? -22.103 12.861  34.745  1.00 25.13  ? 84  ASP A CB  1 
ATOM   2278 C  CG  . ASP C 1 65  ? -22.742 12.912  36.121  1.00 25.72  ? 84  ASP A CG  1 
ATOM   2279 O  OD1 . ASP C 1 65  ? -23.718 12.168  36.354  1.00 25.87  ? 84  ASP A OD1 1 
ATOM   2280 O  OD2 . ASP C 1 65  ? -22.272 13.700  36.968  1.00 26.73  ? 84  ASP A OD2 1 
ATOM   2281 N  N   . ILE C 1 66  ? -21.707 10.715  31.840  1.00 25.64  ? 85  ILE A N   1 
ATOM   2282 C  CA  . ILE C 1 66  ? -21.494 10.737  30.397  1.00 24.27  ? 85  ILE A CA  1 
ATOM   2283 C  C   . ILE C 1 66  ? -22.104 9.507   29.732  1.00 23.78  ? 85  ILE A C   1 
ATOM   2284 O  O   . ILE C 1 66  ? -21.953 8.385   30.218  1.00 23.65  ? 85  ILE A O   1 
ATOM   2285 C  CB  . ILE C 1 66  ? -19.995 10.810  30.045  1.00 23.81  ? 85  ILE A CB  1 
ATOM   2286 C  CG1 . ILE C 1 66  ? -19.375 12.085  30.617  1.00 23.95  ? 85  ILE A CG1 1 
ATOM   2287 C  CG2 . ILE C 1 66  ? -19.798 10.756  28.537  1.00 23.67  ? 85  ILE A CG2 1 
ATOM   2288 C  CD1 . ILE C 1 66  ? -17.930 12.284  30.233  1.00 24.40  ? 85  ILE A CD1 1 
ATOM   2289 N  N   . ILE C 1 67  ? -22.795 9.728   28.619  1.00 18.72  ? 86  ILE A N   1 
ATOM   2290 C  CA  . ILE C 1 67  ? -23.401 8.640   27.867  1.00 18.58  ? 86  ILE A CA  1 
ATOM   2291 C  C   . ILE C 1 67  ? -22.539 8.260   26.673  1.00 18.42  ? 86  ILE A C   1 
ATOM   2292 O  O   . ILE C 1 67  ? -22.275 9.086   25.803  1.00 18.62  ? 86  ILE A O   1 
ATOM   2293 C  CB  . ILE C 1 67  ? -24.798 9.020   27.361  1.00 29.77  ? 86  ILE A CB  1 
ATOM   2294 C  CG1 . ILE C 1 67  ? -25.708 9.369   28.539  1.00 30.21  ? 86  ILE A CG1 1 
ATOM   2295 C  CG2 . ILE C 1 67  ? -25.387 7.886   26.535  1.00 29.41  ? 86  ILE A CG2 1 
ATOM   2296 C  CD1 . ILE C 1 67  ? -27.073 9.861   28.125  1.00 18.97  ? 86  ILE A CD1 1 
ATOM   2297 N  N   . PHE C 1 68  ? -22.102 7.007   26.634  1.00 29.40  ? 87  PHE A N   1 
ATOM   2298 C  CA  . PHE C 1 68  ? -21.296 6.516   25.524  1.00 29.73  ? 87  PHE A CA  1 
ATOM   2299 C  C   . PHE C 1 68  ? -22.120 5.612   24.615  1.00 29.79  ? 87  PHE A C   1 
ATOM   2300 O  O   . PHE C 1 68  ? -22.576 4.548   25.033  1.00 30.10  ? 87  PHE A O   1 
ATOM   2301 C  CB  . PHE C 1 68  ? -20.068 5.769   26.043  1.00 30.32  ? 87  PHE A CB  1 
ATOM   2302 C  CG  . PHE C 1 68  ? -19.082 6.647   26.756  1.00 30.14  ? 87  PHE A CG  1 
ATOM   2303 C  CD1 . PHE C 1 68  ? -18.062 7.274   26.060  1.00 30.20  ? 87  PHE A CD1 1 
ATOM   2304 C  CD2 . PHE C 1 68  ? -19.175 6.847   28.122  1.00 30.80  ? 87  PHE A CD2 1 
ATOM   2305 C  CE1 . PHE C 1 68  ? -17.153 8.082   26.713  1.00 30.71  ? 87  PHE A CE1 1 
ATOM   2306 C  CE2 . PHE C 1 68  ? -18.268 7.654   28.781  1.00 31.31  ? 87  PHE A CE2 1 
ATOM   2307 C  CZ  . PHE C 1 68  ? -17.256 8.274   28.076  1.00 30.98  ? 87  PHE A CZ  1 
ATOM   2308 N  N   . LYS C 1 69  ? -22.308 6.046   23.372  1.00 21.38  ? 88  LYS A N   1 
ATOM   2309 C  CA  . LYS C 1 69  ? -23.100 5.297   22.402  1.00 21.41  ? 88  LYS A CA  1 
ATOM   2310 C  C   . LYS C 1 69  ? -22.649 3.842   22.330  1.00 21.52  ? 88  LYS A C   1 
ATOM   2311 O  O   . LYS C 1 69  ? -23.451 2.922   22.495  1.00 21.03  ? 88  LYS A O   1 
ATOM   2312 C  CB  . LYS C 1 69  ? -23.007 5.953   21.023  1.00 20.05  ? 88  LYS A CB  1 
ATOM   2313 C  CG  . LYS C 1 69  ? -23.822 5.265   19.947  1.00 20.08  ? 88  LYS A CG  1 
ATOM   2314 C  CD  . LYS C 1 69  ? -23.795 6.056   18.651  1.00 19.67  ? 88  LYS A CD  1 
ATOM   2315 C  CE  . LYS C 1 69  ? -24.544 5.328   17.551  1.00 19.44  ? 88  LYS A CE  1 
ATOM   2316 N  NZ  . LYS C 1 69  ? -25.929 4.983   17.970  1.00 20.32  ? 88  LYS A NZ  1 
ATOM   2317 N  N   . ASP C 1 70  ? -21.357 3.648   22.084  1.00 37.72  ? 89  ASP A N   1 
ATOM   2318 C  CA  . ASP C 1 70  ? -20.761 2.317   22.057  1.00 38.56  ? 89  ASP A CA  1 
ATOM   2319 C  C   . ASP C 1 70  ? -21.602 1.321   21.267  1.00 39.02  ? 89  ASP A C   1 
ATOM   2320 O  O   . ASP C 1 70  ? -22.065 0.320   21.813  1.00 39.77  ? 89  ASP A O   1 
ATOM   2321 C  CB  . ASP C 1 70  ? -20.550 1.799   23.479  1.00 38.84  ? 89  ASP A CB  1 
ATOM   2322 C  CG  . ASP C 1 70  ? -19.681 0.560   23.521  1.00 39.79  ? 89  ASP A CG  1 
ATOM   2323 O  OD1 . ASP C 1 70  ? -18.696 0.501   22.754  1.00 39.29  ? 89  ASP A OD1 1 
ATOM   2324 O  OD2 . ASP C 1 70  ? -19.981 -0.350  24.323  1.00 40.80  ? 89  ASP A OD2 1 
ATOM   2325 N  N   . GLU C 1 71  ? -21.798 1.595   19.982  1.00 34.41  ? 90  GLU A N   1 
ATOM   2326 C  CA  . GLU C 1 71  ? -22.561 0.692   19.133  1.00 34.01  ? 90  GLU A CA  1 
ATOM   2327 C  C   . GLU C 1 71  ? -21.699 -0.491  18.709  1.00 34.71  ? 90  GLU A C   1 
ATOM   2328 O  O   . GLU C 1 71  ? -22.213 -1.530  18.298  1.00 35.62  ? 90  GLU A O   1 
ATOM   2329 C  CB  . GLU C 1 71  ? -23.104 1.421   17.904  1.00 33.99  ? 90  GLU A CB  1 
ATOM   2330 C  CG  . GLU C 1 71  ? -22.055 1.757   16.860  1.00 33.77  ? 90  GLU A CG  1 
ATOM   2331 C  CD  . GLU C 1 71  ? -21.289 3.019   17.184  1.00 33.25  ? 90  GLU A CD  1 
ATOM   2332 O  OE1 . GLU C 1 71  ? -21.690 3.731   18.128  1.00 32.72  ? 90  GLU A OE1 1 
ATOM   2333 O  OE2 . GLU C 1 71  ? -20.290 3.304   16.490  1.00 33.43  ? 90  GLU A OE2 1 
ATOM   2334 N  N   . GLU C 1 72  ? -20.384 -0.327  18.814  1.00 36.73  ? 91  GLU A N   1 
ATOM   2335 C  CA  . GLU C 1 72  ? -19.457 -1.400  18.485  1.00 37.20  ? 91  GLU A CA  1 
ATOM   2336 C  C   . GLU C 1 72  ? -19.418 -2.423  19.611  1.00 37.69  ? 91  GLU A C   1 
ATOM   2337 O  O   . GLU C 1 72  ? -18.789 -3.472  19.483  1.00 37.80  ? 91  GLU A O   1 
ATOM   2338 C  CB  . GLU C 1 72  ? -18.048 -0.855  18.243  1.00 37.49  ? 91  GLU A CB  1 
ATOM   2339 C  CG  . GLU C 1 72  ? -17.996 0.521   17.605  1.00 36.92  ? 91  GLU A CG  1 
ATOM   2340 C  CD  . GLU C 1 72  ? -17.949 1.631   18.634  1.00 36.49  ? 91  GLU A CD  1 
ATOM   2341 O  OE1 . GLU C 1 72  ? -18.691 1.553   19.634  1.00 36.86  ? 91  GLU A OE1 1 
ATOM   2342 O  OE2 . GLU C 1 72  ? -17.166 2.583   18.444  1.00 36.34  ? 91  GLU A OE2 1 
ATOM   2343 N  N   . ASN C 1 73  ? -20.089 -2.106  20.714  1.00 39.90  ? 92  ASN A N   1 
ATOM   2344 C  CA  . ASN C 1 73  ? -20.103 -2.979  21.883  1.00 40.32  ? 92  ASN A CA  1 
ATOM   2345 C  C   . ASN C 1 73  ? -18.704 -3.463  22.244  1.00 40.71  ? 92  ASN A C   1 
ATOM   2346 O  O   . ASN C 1 73  ? -18.491 -4.652  22.482  1.00 41.43  ? 92  ASN A O   1 
ATOM   2347 C  CB  . ASN C 1 73  ? -21.037 -4.171  21.654  1.00 40.52  ? 92  ASN A CB  1 
ATOM   2348 C  CG  . ASN C 1 73  ? -22.496 -3.761  21.567  1.00 41.41  ? 92  ASN A CG  1 
ATOM   2349 O  OD1 . ASN C 1 73  ? -22.969 -2.939  22.351  1.00 41.70  ? 92  ASN A OD1 1 
ATOM   2350 N  ND2 . ASN C 1 73  ? -23.218 -4.339  20.612  1.00 41.16  ? 92  ASN A ND2 1 
ATOM   2351 N  N   . SER C 1 74  ? -17.753 -2.534  22.277  1.00 37.91  ? 93  SER A N   1 
ATOM   2352 C  CA  . SER C 1 74  ? -16.368 -2.859  22.594  1.00 37.82  ? 93  SER A CA  1 
ATOM   2353 C  C   . SER C 1 74  ? -15.803 -1.913  23.647  1.00 38.22  ? 93  SER A C   1 
ATOM   2354 O  O   . SER C 1 74  ? -14.691 -2.109  24.138  1.00 38.65  ? 93  SER A O   1 
ATOM   2355 C  CB  . SER C 1 74  ? -15.504 -2.809  21.332  1.00 37.11  ? 93  SER A CB  1 
ATOM   2356 O  OG  . SER C 1 74  ? -15.472 -1.501  20.789  1.00 36.96  ? 93  SER A OG  1 
ATOM   2357 N  N   . GLY C 1 75  ? -16.574 -0.886  23.989  1.00 33.86  ? 94  GLY A N   1 
ATOM   2358 C  CA  . GLY C 1 75  ? -16.149 0.097   24.968  1.00 33.31  ? 94  GLY A CA  1 
ATOM   2359 C  C   . GLY C 1 75  ? -15.040 0.986   24.442  1.00 33.04  ? 94  GLY A C   1 
ATOM   2360 O  O   . GLY C 1 75  ? -14.322 1.622   25.213  1.00 33.32  ? 94  GLY A O   1 
ATOM   2361 N  N   . ALA C 1 76  ? -14.904 1.030   23.121  1.00 24.13  ? 95  ALA A N   1 
ATOM   2362 C  CA  . ALA C 1 76  ? -13.860 1.821   22.480  1.00 23.67  ? 95  ALA A CA  1 
ATOM   2363 C  C   . ALA C 1 76  ? -14.023 3.310   22.763  1.00 22.93  ? 95  ALA A C   1 
ATOM   2364 O  O   . ALA C 1 76  ? -13.043 4.016   22.988  1.00 23.29  ? 95  ALA A O   1 
ATOM   2365 C  CB  . ALA C 1 76  ? -13.851 1.565   20.980  1.00 24.00  ? 95  ALA A CB  1 
ATOM   2366 N  N   . ASP C 1 77  ? -15.268 3.776   22.746  1.00 34.65  ? 96  ASP A N   1 
ATOM   2367 C  CA  . ASP C 1 77  ? -15.574 5.187   22.963  1.00 33.97  ? 96  ASP A CA  1 
ATOM   2368 C  C   . ASP C 1 77  ? -14.953 5.712   24.249  1.00 34.18  ? 96  ASP A C   1 
ATOM   2369 O  O   . ASP C 1 77  ? -14.472 6.844   24.303  1.00 34.05  ? 96  ASP A O   1 
ATOM   2370 C  CB  . ASP C 1 77  ? -17.085 5.402   23.009  1.00 34.10  ? 96  ASP A CB  1 
ATOM   2371 C  CG  . ASP C 1 77  ? -17.740 5.221   21.659  1.00 33.04  ? 96  ASP A CG  1 
ATOM   2372 O  OD1 . ASP C 1 77  ? -17.118 5.591   20.640  1.00 33.17  ? 96  ASP A OD1 1 
ATOM   2373 O  OD2 . ASP C 1 77  ? -18.881 4.715   21.617  1.00 32.20  ? 96  ASP A OD2 1 
ATOM   2374 N  N   . ARG C 1 78  ? -14.974 4.883   25.286  1.00 28.51  ? 97  ARG A N   1 
ATOM   2375 C  CA  . ARG C 1 78  ? -14.435 5.265   26.582  1.00 28.78  ? 97  ARG A CA  1 
ATOM   2376 C  C   . ARG C 1 78  ? -12.931 5.512   26.514  1.00 29.45  ? 97  ARG A C   1 
ATOM   2377 O  O   . ARG C 1 78  ? -12.423 6.445   27.130  1.00 30.61  ? 97  ARG A O   1 
ATOM   2378 C  CB  . ARG C 1 78  ? -14.755 4.193   27.623  1.00 28.87  ? 97  ARG A CB  1 
ATOM   2379 C  CG  . ARG C 1 78  ? -16.234 3.862   27.719  1.00 28.06  ? 97  ARG A CG  1 
ATOM   2380 C  CD  . ARG C 1 78  ? -16.511 2.911   28.868  1.00 29.77  ? 97  ARG A CD  1 
ATOM   2381 N  NE  . ARG C 1 78  ? -17.942 2.740   29.103  1.00 29.72  ? 97  ARG A NE  1 
ATOM   2382 C  CZ  . ARG C 1 78  ? -18.693 3.598   29.788  1.00 30.21  ? 97  ARG A CZ  1 
ATOM   2383 N  NH1 . ARG C 1 78  ? -18.150 4.695   30.302  1.00 29.37  ? 97  ARG A NH1 1 
ATOM   2384 N  NH2 . ARG C 1 78  ? -19.986 3.362   29.955  1.00 31.23  ? 97  ARG A NH2 1 
ATOM   2385 N  N   . LEU C 1 79  ? -12.226 4.676   25.758  1.00 23.99  ? 98  LEU A N   1 
ATOM   2386 C  CA  . LEU C 1 79  ? -10.779 4.813   25.613  1.00 24.49  ? 98  LEU A CA  1 
ATOM   2387 C  C   . LEU C 1 79  ? -10.400 6.196   25.098  1.00 24.87  ? 98  LEU A C   1 
ATOM   2388 O  O   . LEU C 1 79  ? -10.967 6.681   24.120  1.00 24.13  ? 98  LEU A O   1 
ATOM   2389 C  CB  . LEU C 1 79  ? -10.228 3.736   24.676  1.00 23.88  ? 98  LEU A CB  1 
ATOM   2390 C  CG  . LEU C 1 79  ? -10.519 2.287   25.072  1.00 24.61  ? 98  LEU A CG  1 
ATOM   2391 C  CD1 . LEU C 1 79  ? -10.109 1.336   23.962  1.00 24.72  ? 98  LEU A CD1 1 
ATOM   2392 C  CD2 . LEU C 1 79  ? -9.820  1.933   26.375  1.00 26.63  ? 98  LEU A CD2 1 
ATOM   2393 N  N   . MET C 1 80  ? -9.435  6.823   25.763  1.00 34.39  ? 99  MET A N   1 
ATOM   2394 C  CA  . MET C 1 80  ? -8.983  8.157   25.387  1.00 35.10  ? 99  MET A CA  1 
ATOM   2395 C  C   . MET C 1 80  ? -7.711  8.530   26.144  1.00 36.91  ? 99  MET A C   1 
ATOM   2396 O  O   . MET C 1 80  ? -7.319  7.847   27.092  1.00 36.64  ? 99  MET A O   1 
ATOM   2397 C  CB  . MET C 1 80  ? -10.078 9.186   25.670  1.00 34.56  ? 99  MET A CB  1 
ATOM   2398 C  CG  . MET C 1 80  ? -10.474 9.266   27.136  1.00 35.12  ? 99  MET A CG  1 
ATOM   2399 S  SD  . MET C 1 80  ? -11.905 10.320  27.431  1.00 34.88  ? 99  MET A SD  1 
ATOM   2400 C  CE  . MET C 1 80  ? -13.171 9.432   26.528  1.00 32.44  ? 99  MET A CE  1 
ATOM   2401 N  N   . THR C 1 81  ? -7.071  9.617   25.723  1.00 48.43  ? 100 THR A N   1 
ATOM   2402 C  CA  . THR C 1 81  ? -5.866  10.095  26.391  1.00 49.22  ? 100 THR A CA  1 
ATOM   2403 C  C   . THR C 1 81  ? -6.218  10.792  27.701  1.00 49.72  ? 100 THR A C   1 
ATOM   2404 O  O   . THR C 1 81  ? -7.392  10.990  28.013  1.00 49.38  ? 100 THR A O   1 
ATOM   2405 C  CB  . THR C 1 81  ? -5.058  11.065  25.500  1.00 49.77  ? 100 THR A CB  1 
ATOM   2406 O  OG1 . THR C 1 81  ? -5.760  12.308  25.374  1.00 48.99  ? 100 THR A OG1 1 
ATOM   2407 C  CG2 . THR C 1 81  ? -4.834  10.466  24.120  1.00 48.50  ? 100 THR A CG2 1 
ATOM   2408 N  N   . GLU C 1 82  ? -5.197  11.165  28.463  1.00 50.42  ? 101 GLU A N   1 
ATOM   2409 C  CA  . GLU C 1 82  ? -5.411  11.830  29.741  1.00 50.23  ? 101 GLU A CA  1 
ATOM   2410 C  C   . GLU C 1 82  ? -5.950  13.245  29.558  1.00 49.29  ? 101 GLU A C   1 
ATOM   2411 O  O   . GLU C 1 82  ? -6.913  13.634  30.218  1.00 49.36  ? 101 GLU A O   1 
ATOM   2412 C  CB  . GLU C 1 82  ? -4.119  11.845  30.563  1.00 50.77  ? 101 GLU A CB  1 
ATOM   2413 C  CG  . GLU C 1 82  ? -3.645  10.461  30.978  1.00 50.99  ? 101 GLU A CG  1 
ATOM   2414 C  CD  . GLU C 1 82  ? -4.689  9.705   31.779  1.00 51.97  ? 101 GLU A CD  1 
ATOM   2415 O  OE1 . GLU C 1 82  ? -5.463  10.357  32.516  1.00 52.16  ? 101 GLU A OE1 1 
ATOM   2416 O  OE2 . GLU C 1 82  ? -4.736  8.460   31.673  1.00 51.44  ? 101 GLU A OE2 1 
ATOM   2417 N  N   . ARG C 1 83  ? -5.331  14.006  28.661  1.00 37.82  ? 102 ARG A N   1 
ATOM   2418 C  CA  . ARG C 1 83  ? -5.756  15.379  28.404  1.00 38.00  ? 102 ARG A CA  1 
ATOM   2419 C  C   . ARG C 1 83  ? -7.214  15.416  27.959  1.00 37.04  ? 102 ARG A C   1 
ATOM   2420 O  O   . ARG C 1 83  ? -7.964  16.321  28.328  1.00 36.72  ? 102 ARG A O   1 
ATOM   2421 C  CB  . ARG C 1 83  ? -4.859  16.045  27.355  1.00 37.18  ? 102 ARG A CB  1 
ATOM   2422 C  CG  . ARG C 1 83  ? -5.128  17.532  27.167  1.00 36.84  ? 102 ARG A CG  1 
ATOM   2423 C  CD  . ARG C 1 83  ? -4.114  18.181  26.238  1.00 37.93  ? 102 ARG A CD  1 
ATOM   2424 N  NE  . ARG C 1 83  ? -4.411  19.595  26.013  1.00 38.17  ? 102 ARG A NE  1 
ATOM   2425 C  CZ  . ARG C 1 83  ? -3.837  20.597  26.672  1.00 38.87  ? 102 ARG A CZ  1 
ATOM   2426 N  NH1 . ARG C 1 83  ? -2.922  20.349  27.600  1.00 40.05  ? 102 ARG A NH1 1 
ATOM   2427 N  NH2 . ARG C 1 83  ? -4.174  21.852  26.401  1.00 38.33  ? 102 ARG A NH2 1 
ATOM   2428 N  N   . CYS C 1 84  ? -7.608  14.422  27.169  1.00 38.76  ? 103 CYS A N   1 
ATOM   2429 C  CA  . CYS C 1 84  ? -8.990  14.299  26.722  1.00 37.41  ? 103 CYS A CA  1 
ATOM   2430 C  C   . CYS C 1 84  ? -9.928  14.219  27.924  1.00 37.21  ? 103 CYS A C   1 
ATOM   2431 O  O   . CYS C 1 84  ? -10.855 15.017  28.047  1.00 36.66  ? 103 CYS A O   1 
ATOM   2432 C  CB  . CYS C 1 84  ? -9.155  13.064  25.832  1.00 37.54  ? 103 CYS A CB  1 
ATOM   2433 S  SG  . CYS C 1 84  ? -10.658 13.041  24.823  1.00 34.10  ? 103 CYS A SG  1 
ATOM   2434 N  N   . LYS C 1 85  ? -9.672  13.261  28.812  1.00 54.10  ? 104 LYS A N   1 
ATOM   2435 C  CA  . LYS C 1 85  ? -10.496 13.064  30.004  1.00 53.03  ? 104 LYS A CA  1 
ATOM   2436 C  C   . LYS C 1 85  ? -10.707 14.348  30.796  1.00 53.17  ? 104 LYS A C   1 
ATOM   2437 O  O   . LYS C 1 85  ? -11.837 14.691  31.142  1.00 52.87  ? 104 LYS A O   1 
ATOM   2438 C  CB  . LYS C 1 85  ? -9.885  11.997  30.914  1.00 54.20  ? 104 LYS A CB  1 
ATOM   2439 C  CG  . LYS C 1 85  ? -10.022 10.584  30.388  1.00 55.61  ? 104 LYS A CG  1 
ATOM   2440 C  CD  . LYS C 1 85  ? -9.566  9.566   31.416  1.00 56.12  ? 104 LYS A CD  1 
ATOM   2441 C  CE  . LYS C 1 85  ? -9.839  8.153   30.936  1.00 55.21  ? 104 LYS A CE  1 
ATOM   2442 N  NZ  . LYS C 1 85  ? -9.324  7.138   31.893  1.00 57.41  ? 104 LYS A NZ  1 
ATOM   2443 N  N   . GLU C 1 86  ? -9.617  15.050  31.089  1.00 50.46  ? 105 GLU A N   1 
ATOM   2444 C  CA  . GLU C 1 86  ? -9.693  16.300  31.836  1.00 51.24  ? 105 GLU A CA  1 
ATOM   2445 C  C   . GLU C 1 86  ? -10.706 17.241  31.202  1.00 50.17  ? 105 GLU A C   1 
ATOM   2446 O  O   . GLU C 1 86  ? -11.425 17.957  31.898  1.00 49.51  ? 105 GLU A O   1 
ATOM   2447 C  CB  . GLU C 1 86  ? -8.325  16.981  31.895  1.00 53.50  ? 105 GLU A CB  1 
ATOM   2448 C  CG  . GLU C 1 86  ? -7.307  16.296  32.794  1.00 54.67  ? 105 GLU A CG  1 
ATOM   2449 C  CD  . GLU C 1 86  ? -6.029  17.106  32.939  1.00 58.02  ? 105 GLU A CD  1 
ATOM   2450 O  OE1 . GLU C 1 86  ? -5.923  18.169  32.290  1.00 57.68  ? 105 GLU A OE1 1 
ATOM   2451 O  OE2 . GLU C 1 86  ? -5.133  16.682  33.701  1.00 59.28  ? 105 GLU A OE2 1 
ATOM   2452 N  N   . ARG C 1 87  ? -10.755 17.228  29.874  1.00 36.53  ? 106 ARG A N   1 
ATOM   2453 C  CA  . ARG C 1 87  ? -11.639 18.110  29.122  1.00 34.61  ? 106 ARG A CA  1 
ATOM   2454 C  C   . ARG C 1 87  ? -13.075 17.595  29.093  1.00 33.09  ? 106 ARG A C   1 
ATOM   2455 O  O   . ARG C 1 87  ? -14.017 18.347  29.339  1.00 32.68  ? 106 ARG A O   1 
ATOM   2456 C  CB  . ARG C 1 87  ? -11.117 18.285  27.696  1.00 34.84  ? 106 ARG A CB  1 
ATOM   2457 C  CG  . ARG C 1 87  ? -9.690  18.800  27.617  1.00 35.50  ? 106 ARG A CG  1 
ATOM   2458 C  CD  . ARG C 1 87  ? -9.561  20.146  28.303  1.00 36.52  ? 106 ARG A CD  1 
ATOM   2459 N  NE  . ARG C 1 87  ? -8.211  20.692  28.201  1.00 38.01  ? 106 ARG A NE  1 
ATOM   2460 C  CZ  . ARG C 1 87  ? -7.258  20.499  29.107  1.00 39.56  ? 106 ARG A CZ  1 
ATOM   2461 N  NH1 . ARG C 1 87  ? -7.505  19.766  30.186  1.00 39.30  ? 106 ARG A NH1 1 
ATOM   2462 N  NH2 . ARG C 1 87  ? -6.059  21.037  28.935  1.00 40.55  ? 106 ARG A NH2 1 
ATOM   2463 N  N   . VAL C 1 88  ? -13.236 16.312  28.784  1.00 26.41  ? 107 VAL A N   1 
ATOM   2464 C  CA  . VAL C 1 88  ? -14.558 15.703  28.715  1.00 25.93  ? 107 VAL A CA  1 
ATOM   2465 C  C   . VAL C 1 88  ? -15.243 15.773  30.071  1.00 25.64  ? 107 VAL A C   1 
ATOM   2466 O  O   . VAL C 1 88  ? -16.414 16.140  30.168  1.00 24.93  ? 107 VAL A O   1 
ATOM   2467 C  CB  . VAL C 1 88  ? -14.479 14.231  28.285  1.00 26.26  ? 107 VAL A CB  1 
ATOM   2468 C  CG1 . VAL C 1 88  ? -15.817 13.772  27.723  1.00 24.16  ? 107 VAL A CG1 1 
ATOM   2469 C  CG2 . VAL C 1 88  ? -13.383 14.043  27.260  1.00 26.98  ? 107 VAL A CG2 1 
ATOM   2470 N  N   . ASN C 1 89  ? -14.502 15.416  31.115  1.00 33.35  ? 108 ASN A N   1 
ATOM   2471 C  CA  . ASN C 1 89  ? -15.017 15.463  32.476  1.00 33.53  ? 108 ASN A CA  1 
ATOM   2472 C  C   . ASN C 1 89  ? -15.498 16.859  32.857  1.00 33.42  ? 108 ASN A C   1 
ATOM   2473 O  O   . ASN C 1 89  ? -16.527 17.012  33.514  1.00 33.20  ? 108 ASN A O   1 
ATOM   2474 C  CB  . ASN C 1 89  ? -13.953 14.985  33.463  1.00 34.39  ? 108 ASN A CB  1 
ATOM   2475 C  CG  . ASN C 1 89  ? -13.563 13.539  33.239  1.00 35.20  ? 108 ASN A CG  1 
ATOM   2476 O  OD1 . ASN C 1 89  ? -14.208 12.820  32.474  1.00 34.53  ? 108 ASN A OD1 1 
ATOM   2477 N  ND2 . ASN C 1 89  ? -12.502 13.102  33.910  1.00 36.08  ? 108 ASN A ND2 1 
ATOM   2478 N  N   . ALA C 1 90  ? -14.747 17.874  32.440  1.00 24.14  ? 109 ALA A N   1 
ATOM   2479 C  CA  . ALA C 1 90  ? -15.112 19.261  32.699  1.00 24.10  ? 109 ALA A CA  1 
ATOM   2480 C  C   . ALA C 1 90  ? -16.360 19.652  31.912  1.00 23.84  ? 109 ALA A C   1 
ATOM   2481 O  O   . ALA C 1 90  ? -17.261 20.305  32.439  1.00 23.58  ? 109 ALA A O   1 
ATOM   2482 C  CB  . ALA C 1 90  ? -13.955 20.187  32.359  1.00 24.46  ? 109 ALA A CB  1 
ATOM   2483 N  N   . LEU C 1 91  ? -16.404 19.248  30.646  1.00 25.62  ? 110 LEU A N   1 
ATOM   2484 C  CA  . LEU C 1 91  ? -17.554 19.519  29.792  1.00 24.82  ? 110 LEU A CA  1 
ATOM   2485 C  C   . LEU C 1 91  ? -18.805 18.833  30.331  1.00 24.44  ? 110 LEU A C   1 
ATOM   2486 O  O   . LEU C 1 91  ? -19.891 19.406  30.317  1.00 24.63  ? 110 LEU A O   1 
ATOM   2487 C  CB  . LEU C 1 91  ? -17.274 19.059  28.360  1.00 24.91  ? 110 LEU A CB  1 
ATOM   2488 C  CG  . LEU C 1 91  ? -18.359 19.320  27.313  1.00 23.68  ? 110 LEU A CG  1 
ATOM   2489 C  CD1 . LEU C 1 91  ? -18.688 20.801  27.233  1.00 24.43  ? 110 LEU A CD1 1 
ATOM   2490 C  CD2 . LEU C 1 91  ? -17.926 18.794  25.955  1.00 22.58  ? 110 LEU A CD2 1 
ATOM   2491 N  N   . ALA C 1 92  ? -18.643 17.603  30.808  1.00 26.00  ? 111 ALA A N   1 
ATOM   2492 C  CA  . ALA C 1 92  ? -19.747 16.852  31.392  1.00 25.84  ? 111 ALA A CA  1 
ATOM   2493 C  C   . ALA C 1 92  ? -20.393 17.644  32.522  1.00 26.65  ? 111 ALA A C   1 
ATOM   2494 O  O   . ALA C 1 92  ? -21.614 17.636  32.685  1.00 26.57  ? 111 ALA A O   1 
ATOM   2495 C  CB  . ALA C 1 92  ? -19.261 15.506  31.900  1.00 26.20  ? 111 ALA A CB  1 
ATOM   2496 N  N   . ILE C 1 93  ? -19.562 18.327  33.300  1.00 30.53  ? 112 ILE A N   1 
ATOM   2497 C  CA  . ILE C 1 93  ? -20.047 19.173  34.380  1.00 31.27  ? 112 ILE A CA  1 
ATOM   2498 C  C   . ILE C 1 93  ? -20.778 20.393  33.823  1.00 31.45  ? 112 ILE A C   1 
ATOM   2499 O  O   . ILE C 1 93  ? -21.844 20.768  34.311  1.00 31.87  ? 112 ILE A O   1 
ATOM   2500 C  CB  . ILE C 1 93  ? -18.892 19.629  35.293  1.00 31.80  ? 112 ILE A CB  1 
ATOM   2501 C  CG1 . ILE C 1 93  ? -18.377 18.452  36.125  1.00 32.56  ? 112 ILE A CG1 1 
ATOM   2502 C  CG2 . ILE C 1 93  ? -19.341 20.765  36.197  1.00 32.86  ? 112 ILE A CG2 1 
ATOM   2503 C  CD1 . ILE C 1 93  ? -17.269 18.820  37.089  1.00 33.27  ? 112 ILE A CD1 1 
ATOM   2504 N  N   . ALA C 1 94  ? -20.200 21.003  32.795  1.00 23.45  ? 113 ALA A N   1 
ATOM   2505 C  CA  . ALA C 1 94  ? -20.782 22.186  32.175  1.00 22.85  ? 113 ALA A CA  1 
ATOM   2506 C  C   . ALA C 1 94  ? -22.130 21.870  31.539  1.00 22.73  ? 113 ALA A C   1 
ATOM   2507 O  O   . ALA C 1 94  ? -23.038 22.702  31.538  1.00 22.85  ? 113 ALA A O   1 
ATOM   2508 C  CB  . ALA C 1 94  ? -19.828 22.765  31.141  1.00 22.47  ? 113 ALA A CB  1 
ATOM   2509 N  N   . VAL C 1 95  ? -22.253 20.662  31.000  1.00 29.64  ? 114 VAL A N   1 
ATOM   2510 C  CA  . VAL C 1 95  ? -23.471 20.250  30.313  1.00 29.18  ? 114 VAL A CA  1 
ATOM   2511 C  C   . VAL C 1 95  ? -24.651 20.127  31.269  1.00 29.44  ? 114 VAL A C   1 
ATOM   2512 O  O   . VAL C 1 95  ? -25.717 20.693  31.025  1.00 29.09  ? 114 VAL A O   1 
ATOM   2513 C  CB  . VAL C 1 95  ? -23.272 18.917  29.565  1.00 28.06  ? 114 VAL A CB  1 
ATOM   2514 C  CG1 . VAL C 1 95  ? -24.616 18.320  29.178  1.00 27.78  ? 114 VAL A CG1 1 
ATOM   2515 C  CG2 . VAL C 1 95  ? -22.394 19.124  28.339  1.00 26.71  ? 114 VAL A CG2 1 
ATOM   2516 N  N   . MET C 1 96  ? -24.454 19.389  32.358  1.00 32.11  ? 115 MET A N   1 
ATOM   2517 C  CA  . MET C 1 96  ? -25.503 19.202  33.354  1.00 32.57  ? 115 MET A CA  1 
ATOM   2518 C  C   . MET C 1 96  ? -25.918 20.542  33.947  1.00 32.81  ? 115 MET A C   1 
ATOM   2519 O  O   . MET C 1 96  ? -27.084 20.756  34.283  1.00 32.78  ? 115 MET A O   1 
ATOM   2520 C  CB  . MET C 1 96  ? -25.028 18.269  34.468  1.00 32.09  ? 115 MET A CB  1 
ATOM   2521 C  CG  . MET C 1 96  ? -24.365 16.998  33.976  1.00 32.65  ? 115 MET A CG  1 
ATOM   2522 S  SD  . MET C 1 96  ? -24.227 15.757  35.275  1.00 34.43  ? 115 MET A SD  1 
ATOM   2523 C  CE  . MET C 1 96  ? -25.948 15.296  35.478  1.00 34.80  ? 115 MET A CE  1 
ATOM   2524 N  N   . ASN C 1 97  ? -24.947 21.439  34.072  1.00 44.98  ? 116 ASN A N   1 
ATOM   2525 C  CA  . ASN C 1 97  ? -25.185 22.763  34.624  1.00 45.92  ? 116 ASN A CA  1 
ATOM   2526 C  C   . ASN C 1 97  ? -25.998 23.633  33.674  1.00 45.49  ? 116 ASN A C   1 
ATOM   2527 O  O   . ASN C 1 97  ? -26.856 24.403  34.101  1.00 45.91  ? 116 ASN A O   1 
ATOM   2528 C  CB  . ASN C 1 97  ? -23.855 23.442  34.948  1.00 47.32  ? 116 ASN A CB  1 
ATOM   2529 C  CG  . ASN C 1 97  ? -24.032 24.867  35.429  1.00 49.80  ? 116 ASN A CG  1 
ATOM   2530 O  OD1 . ASN C 1 97  ? -24.730 25.121  36.413  1.00 51.05  ? 116 ASN A OD1 1 
ATOM   2531 N  ND2 . ASN C 1 97  ? -23.394 25.807  34.740  1.00 50.55  ? 116 ASN A ND2 1 
ATOM   2532 N  N   . MET C 1 98  ? -25.722 23.501  32.382  1.00 31.98  ? 117 MET A N   1 
ATOM   2533 C  CA  . MET C 1 98  ? -26.406 24.294  31.368  1.00 31.41  ? 117 MET A CA  1 
ATOM   2534 C  C   . MET C 1 98  ? -27.852 23.852  31.185  1.00 31.14  ? 117 MET A C   1 
ATOM   2535 O  O   . MET C 1 98  ? -28.754 24.680  31.070  1.00 32.55  ? 117 MET A O   1 
ATOM   2536 C  CB  . MET C 1 98  ? -25.667 24.206  30.034  1.00 30.89  ? 117 MET A CB  1 
ATOM   2537 C  CG  . MET C 1 98  ? -26.318 25.001  28.919  1.00 30.52  ? 117 MET A CG  1 
ATOM   2538 S  SD  . MET C 1 98  ? -26.253 26.778  29.203  1.00 32.23  ? 117 MET A SD  1 
ATOM   2539 C  CE  . MET C 1 98  ? -24.482 27.048  29.185  1.00 30.54  ? 117 MET A CE  1 
ATOM   2540 N  N   . TRP C 1 99  ? -28.069 22.543  31.153  1.00 26.85  ? 118 TRP A N   1 
ATOM   2541 C  CA  . TRP C 1 99  ? -29.407 22.001  30.958  1.00 27.10  ? 118 TRP A CA  1 
ATOM   2542 C  C   . TRP C 1 99  ? -29.719 20.937  32.002  1.00 27.26  ? 118 TRP A C   1 
ATOM   2543 O  O   . TRP C 1 99  ? -29.265 19.800  31.888  1.00 26.64  ? 118 TRP A O   1 
ATOM   2544 C  CB  . TRP C 1 99  ? -29.547 21.418  29.550  1.00 27.19  ? 118 TRP A CB  1 
ATOM   2545 C  CG  . TRP C 1 99  ? -29.182 22.383  28.461  1.00 26.46  ? 118 TRP A CG  1 
ATOM   2546 C  CD1 . TRP C 1 99  ? -29.900 23.470  28.055  1.00 26.09  ? 118 TRP A CD1 1 
ATOM   2547 C  CD2 . TRP C 1 99  ? -28.012 22.344  27.633  1.00 25.79  ? 118 TRP A CD2 1 
ATOM   2548 N  NE1 . TRP C 1 99  ? -29.249 24.113  27.031  1.00 26.14  ? 118 TRP A NE1 1 
ATOM   2549 C  CE2 . TRP C 1 99  ? -28.088 23.441  26.752  1.00 26.11  ? 118 TRP A CE2 1 
ATOM   2550 C  CE3 . TRP C 1 99  ? -26.907 21.491  27.552  1.00 25.49  ? 118 TRP A CE3 1 
ATOM   2551 C  CZ2 . TRP C 1 99  ? -27.101 23.706  25.803  1.00 25.81  ? 118 TRP A CZ2 1 
ATOM   2552 C  CZ3 . TRP C 1 99  ? -25.930 21.757  26.609  1.00 24.37  ? 118 TRP A CZ3 1 
ATOM   2553 C  CH2 . TRP C 1 99  ? -26.034 22.854  25.749  1.00 24.79  ? 118 TRP A CH2 1 
ATOM   2554 N  N   . PRO C 1 100 ? -30.501 21.309  33.024  1.00 44.78  ? 119 PRO A N   1 
ATOM   2555 C  CA  . PRO C 1 100 ? -30.843 20.403  34.126  1.00 45.63  ? 119 PRO A CA  1 
ATOM   2556 C  C   . PRO C 1 100 ? -31.516 19.132  33.619  1.00 44.87  ? 119 PRO A C   1 
ATOM   2557 O  O   . PRO C 1 100 ? -32.517 19.206  32.905  1.00 44.57  ? 119 PRO A O   1 
ATOM   2558 C  CB  . PRO C 1 100 ? -31.829 21.227  34.962  1.00 46.79  ? 119 PRO A CB  1 
ATOM   2559 C  CG  . PRO C 1 100 ? -31.523 22.649  34.621  1.00 46.19  ? 119 PRO A CG  1 
ATOM   2560 C  CD  . PRO C 1 100 ? -31.128 22.632  33.177  1.00 45.17  ? 119 PRO A CD  1 
ATOM   2561 N  N   . GLY C 1 101 ? -30.964 17.979  33.982  1.00 31.74  ? 120 GLY A N   1 
ATOM   2562 C  CA  . GLY C 1 101 ? -31.509 16.706  33.550  1.00 30.70  ? 120 GLY A CA  1 
ATOM   2563 C  C   . GLY C 1 101 ? -30.831 16.175  32.303  1.00 29.77  ? 120 GLY A C   1 
ATOM   2564 O  O   . GLY C 1 101 ? -31.047 15.028  31.915  1.00 30.66  ? 120 GLY A O   1 
ATOM   2565 N  N   . VAL C 1 102 ? -30.011 17.011  31.676  1.00 25.66  ? 121 VAL A N   1 
ATOM   2566 C  CA  . VAL C 1 102 ? -29.293 16.619  30.469  1.00 24.39  ? 121 VAL A CA  1 
ATOM   2567 C  C   . VAL C 1 102 ? -27.886 16.133  30.801  1.00 24.95  ? 121 VAL A C   1 
ATOM   2568 O  O   . VAL C 1 102 ? -27.362 16.409  31.880  1.00 25.54  ? 121 VAL A O   1 
ATOM   2569 C  CB  . VAL C 1 102 ? -29.200 17.783  29.465  1.00 23.32  ? 121 VAL A CB  1 
ATOM   2570 C  CG1 . VAL C 1 102 ? -28.482 17.336  28.201  1.00 22.89  ? 121 VAL A CG1 1 
ATOM   2571 C  CG2 . VAL C 1 102 ? -30.588 18.314  29.139  1.00 23.68  ? 121 VAL A CG2 1 
ATOM   2572 N  N   . ARG C 1 103 ? -27.279 15.408  29.866  1.00 61.37  ? 122 ARG A N   1 
ATOM   2573 C  CA  . ARG C 1 103 ? -25.934 14.881  30.059  1.00 61.07  ? 122 ARG A CA  1 
ATOM   2574 C  C   . ARG C 1 103 ? -25.169 14.819  28.741  1.00 61.06  ? 122 ARG A C   1 
ATOM   2575 O  O   . ARG C 1 103 ? -25.767 14.827  27.665  1.00 59.97  ? 122 ARG A O   1 
ATOM   2576 C  CB  . ARG C 1 103 ? -25.990 13.492  30.699  1.00 53.98  ? 122 ARG A CB  1 
ATOM   2577 C  CG  . ARG C 1 103 ? -25.722 13.487  32.195  1.00 54.47  ? 122 ARG A CG  1 
ATOM   2578 C  CD  . ARG C 1 103 ? -25.363 12.094  32.687  1.00 54.53  ? 122 ARG A CD  1 
ATOM   2579 N  NE  . ARG C 1 103 ? -26.456 11.479  33.434  1.00 54.80  ? 122 ARG A NE  1 
ATOM   2580 C  CZ  . ARG C 1 103 ? -26.985 10.294  33.144  1.00 54.67  ? 122 ARG A CZ  1 
ATOM   2581 N  NH1 . ARG C 1 103 ? -26.522 9.591   32.119  1.00 54.27  ? 122 ARG A NH1 1 
ATOM   2582 N  NH2 . ARG C 1 103 ? -27.978 9.811   33.879  1.00 54.99  ? 122 ARG A NH2 1 
ATOM   2583 N  N   . LEU C 1 104 ? -23.845 14.758  28.833  1.00 28.70  ? 123 LEU A N   1 
ATOM   2584 C  CA  . LEU C 1 104 ? -22.997 14.692  27.649  1.00 26.67  ? 123 LEU A CA  1 
ATOM   2585 C  C   . LEU C 1 104 ? -23.047 13.306  27.014  1.00 26.40  ? 123 LEU A C   1 
ATOM   2586 O  O   . LEU C 1 104 ? -23.002 12.292  27.709  1.00 26.92  ? 123 LEU A O   1 
ATOM   2587 C  CB  . LEU C 1 104 ? -21.554 15.056  28.003  1.00 26.83  ? 123 LEU A CB  1 
ATOM   2588 C  CG  . LEU C 1 104 ? -20.557 15.082  26.842  1.00 26.90  ? 123 LEU A CG  1 
ATOM   2589 C  CD1 . LEU C 1 104 ? -20.816 16.276  25.937  1.00 26.92  ? 123 LEU A CD1 1 
ATOM   2590 C  CD2 . LEU C 1 104 ? -19.127 15.097  27.360  1.00 28.00  ? 123 LEU A CD2 1 
ATOM   2591 N  N   . ARG C 1 105 ? -23.140 13.271  25.689  1.00 29.42  ? 124 ARG A N   1 
ATOM   2592 C  CA  . ARG C 1 105 ? -23.199 12.009  24.957  1.00 28.92  ? 124 ARG A CA  1 
ATOM   2593 C  C   . ARG C 1 105 ? -22.108 11.917  23.898  1.00 28.53  ? 124 ARG A C   1 
ATOM   2594 O  O   . ARG C 1 105 ? -22.029 12.753  23.001  1.00 28.36  ? 124 ARG A O   1 
ATOM   2595 C  CB  . ARG C 1 105 ? -24.574 11.818  24.314  1.00 28.81  ? 124 ARG A CB  1 
ATOM   2596 C  CG  . ARG C 1 105 ? -24.671 10.614  23.384  1.00 28.47  ? 124 ARG A CG  1 
ATOM   2597 C  CD  . ARG C 1 105 ? -26.094 10.424  22.871  1.00 28.40  ? 124 ARG A CD  1 
ATOM   2598 N  NE  . ARG C 1 105 ? -26.198 9.328   21.911  1.00 28.35  ? 124 ARG A NE  1 
ATOM   2599 C  CZ  . ARG C 1 105 ? -26.226 9.488   20.592  1.00 28.38  ? 124 ARG A CZ  1 
ATOM   2600 N  NH1 . ARG C 1 105 ? -26.160 10.703  20.067  1.00 27.99  ? 124 ARG A NH1 1 
ATOM   2601 N  NH2 . ARG C 1 105 ? -26.323 8.432   19.795  1.00 16.28  ? 124 ARG A NH2 1 
ATOM   2602 N  N   . VAL C 1 106 ? -21.273 10.890  24.012  1.00 30.24  ? 125 VAL A N   1 
ATOM   2603 C  CA  . VAL C 1 106 ? -20.200 10.650  23.056  1.00 30.56  ? 125 VAL A CA  1 
ATOM   2604 C  C   . VAL C 1 106 ? -20.585 9.538   22.086  1.00 30.46  ? 125 VAL A C   1 
ATOM   2605 O  O   . VAL C 1 106 ? -20.976 8.449   22.505  1.00 30.82  ? 125 VAL A O   1 
ATOM   2606 C  CB  . VAL C 1 106 ? -18.896 10.254  23.775  1.00 31.32  ? 125 VAL A CB  1 
ATOM   2607 C  CG1 . VAL C 1 106 ? -17.842 9.819   22.770  1.00 31.49  ? 125 VAL A CG1 1 
ATOM   2608 C  CG2 . VAL C 1 106 ? -18.391 11.406  24.631  1.00 31.73  ? 125 VAL A CG2 1 
ATOM   2609 N  N   . THR C 1 107 ? -20.473 9.816   20.791  1.00 19.68  ? 126 THR A N   1 
ATOM   2610 C  CA  . THR C 1 107 ? -20.796 8.822   19.775  1.00 19.66  ? 126 THR A CA  1 
ATOM   2611 C  C   . THR C 1 107 ? -19.539 8.264   19.119  1.00 20.71  ? 126 THR A C   1 
ATOM   2612 O  O   . THR C 1 107 ? -19.601 7.272   18.400  1.00 21.54  ? 126 THR A O   1 
ATOM   2613 C  CB  . THR C 1 107 ? -21.716 9.395   18.683  1.00 19.05  ? 126 THR A CB  1 
ATOM   2614 O  OG1 . THR C 1 107 ? -21.038 10.448  17.987  1.00 18.80  ? 126 THR A OG1 1 
ATOM   2615 C  CG2 . THR C 1 107 ? -22.997 9.935   19.295  1.00 19.58  ? 126 THR A CG2 1 
ATOM   2616 N  N   . GLU C 1 108 ? -18.399 8.898   19.378  1.00 36.37  ? 127 GLU A N   1 
ATOM   2617 C  CA  . GLU C 1 108 ? -17.139 8.450   18.794  1.00 36.45  ? 127 GLU A CA  1 
ATOM   2618 C  C   . GLU C 1 108 ? -15.918 8.899   19.594  1.00 37.51  ? 127 GLU A C   1 
ATOM   2619 O  O   . GLU C 1 108 ? -15.537 10.070  19.562  1.00 37.34  ? 127 GLU A O   1 
ATOM   2620 C  CB  . GLU C 1 108 ? -17.021 8.934   17.347  1.00 37.02  ? 127 GLU A CB  1 
ATOM   2621 C  CG  . GLU C 1 108 ? -17.810 8.102   16.348  1.00 37.84  ? 127 GLU A CG  1 
ATOM   2622 C  CD  . GLU C 1 108 ? -17.258 6.700   16.194  1.00 38.26  ? 127 GLU A CD  1 
ATOM   2623 O  OE1 . GLU C 1 108 ? -16.031 6.559   16.006  1.00 38.69  ? 127 GLU A OE1 1 
ATOM   2624 O  OE2 . GLU C 1 108 ? -18.051 5.736   16.261  1.00 37.90  ? 127 GLU A OE2 1 
ATOM   2625 N  N   . GLY C 1 109 ? -15.305 7.957   20.304  1.00 32.56  ? 128 GLY A N   1 
ATOM   2626 C  CA  . GLY C 1 109 ? -14.071 8.215   21.025  1.00 32.86  ? 128 GLY A CA  1 
ATOM   2627 C  C   . GLY C 1 109 ? -12.899 7.679   20.226  1.00 33.72  ? 128 GLY A C   1 
ATOM   2628 O  O   . GLY C 1 109 ? -12.676 8.096   19.091  1.00 33.70  ? 128 GLY A O   1 
ATOM   2629 N  N   . TRP C 1 110 ? -12.153 6.745   20.809  1.00 24.66  ? 129 TRP A N   1 
ATOM   2630 C  CA  . TRP C 1 110 ? -11.093 6.075   20.074  1.00 24.83  ? 129 TRP A CA  1 
ATOM   2631 C  C   . TRP C 1 110 ? -11.744 5.198   19.013  1.00 24.55  ? 129 TRP A C   1 
ATOM   2632 O  O   . TRP C 1 110 ? -12.831 4.661   19.228  1.00 23.78  ? 129 TRP A O   1 
ATOM   2633 C  CB  . TRP C 1 110 ? -10.232 5.233   21.015  1.00 24.92  ? 129 TRP A CB  1 
ATOM   2634 C  CG  . TRP C 1 110 ? -9.266  4.348   20.299  1.00 25.54  ? 129 TRP A CG  1 
ATOM   2635 C  CD1 . TRP C 1 110 ? -8.090  4.720   19.715  1.00 26.39  ? 129 TRP A CD1 1 
ATOM   2636 C  CD2 . TRP C 1 110 ? -9.389  2.937   20.090  1.00 26.14  ? 129 TRP A CD2 1 
ATOM   2637 N  NE1 . TRP C 1 110 ? -7.473  3.627   19.154  1.00 27.10  ? 129 TRP A NE1 1 
ATOM   2638 C  CE2 . TRP C 1 110 ? -8.251  2.520   19.371  1.00 26.83  ? 129 TRP A CE2 1 
ATOM   2639 C  CE3 . TRP C 1 110 ? -10.351 1.985   20.441  1.00 25.88  ? 129 TRP A CE3 1 
ATOM   2640 C  CZ2 . TRP C 1 110 ? -8.050  1.193   18.997  1.00 27.76  ? 129 TRP A CZ2 1 
ATOM   2641 C  CZ3 . TRP C 1 110 ? -10.150 0.669   20.069  1.00 26.25  ? 129 TRP A CZ3 1 
ATOM   2642 C  CH2 . TRP C 1 110 ? -9.009  0.285   19.355  1.00 27.51  ? 129 TRP A CH2 1 
ATOM   2643 N  N   . ASP C 1 111 ? -11.087 5.055   17.868  1.00 49.28  ? 130 ASP A N   1 
ATOM   2644 C  CA  . ASP C 1 111 ? -11.697 4.358   16.742  1.00 49.58  ? 130 ASP A CA  1 
ATOM   2645 C  C   . ASP C 1 111 ? -10.797 3.291   16.124  1.00 50.15  ? 130 ASP A C   1 
ATOM   2646 O  O   . ASP C 1 111 ? -9.575  3.436   16.079  1.00 50.77  ? 130 ASP A O   1 
ATOM   2647 C  CB  . ASP C 1 111 ? -12.124 5.359   15.665  1.00 49.11  ? 130 ASP A CB  1 
ATOM   2648 C  CG  . ASP C 1 111 ? -12.979 4.722   14.589  1.00 49.58  ? 130 ASP A CG  1 
ATOM   2649 O  OD1 . ASP C 1 111 ? -13.704 3.755   14.904  1.00 49.44  ? 130 ASP A OD1 1 
ATOM   2650 O  OD2 . ASP C 1 111 ? -12.928 5.187   13.431  1.00 50.01  ? 130 ASP A OD2 1 
ATOM   2651 N  N   . GLU C 1 112 ? -11.423 2.220   15.646  1.00 42.63  ? 131 GLU A N   1 
ATOM   2652 C  CA  . GLU C 1 112 ? -10.722 1.158   14.936  1.00 43.37  ? 131 GLU A CA  1 
ATOM   2653 C  C   . GLU C 1 112 ? -11.564 0.668   13.762  1.00 42.52  ? 131 GLU A C   1 
ATOM   2654 O  O   . GLU C 1 112 ? -11.162 -0.235  13.028  1.00 41.60  ? 131 GLU A O   1 
ATOM   2655 C  CB  . GLU C 1 112 ? -10.396 -0.002  15.880  1.00 43.37  ? 131 GLU A CB  1 
ATOM   2656 C  CG  . GLU C 1 112 ? -11.604 -0.559  16.617  1.00 44.26  ? 131 GLU A CG  1 
ATOM   2657 C  CD  . GLU C 1 112 ? -11.260 -1.758  17.481  1.00 46.03  ? 131 GLU A CD  1 
ATOM   2658 O  OE1 . GLU C 1 112 ? -10.100 -2.222  17.424  1.00 46.56  ? 131 GLU A OE1 1 
ATOM   2659 O  OE2 . GLU C 1 112 ? -12.150 -2.236  18.217  1.00 45.44  ? 131 GLU A OE2 1 
ATOM   2660 N  N   . ASP C 1 113 ? -12.736 1.274   13.591  1.00 38.41  ? 132 ASP A N   1 
ATOM   2661 C  CA  . ASP C 1 113 ? -13.643 0.921   12.501  1.00 38.19  ? 132 ASP A CA  1 
ATOM   2662 C  C   . ASP C 1 113 ? -13.170 1.542   11.193  1.00 36.87  ? 132 ASP A C   1 
ATOM   2663 O  O   . ASP C 1 113 ? -13.382 0.988   10.114  1.00 36.37  ? 132 ASP A O   1 
ATOM   2664 C  CB  . ASP C 1 113 ? -15.073 1.368   12.818  1.00 37.46  ? 132 ASP A CB  1 
ATOM   2665 C  CG  . ASP C 1 113 ? -15.575 0.826   14.146  1.00 37.94  ? 132 ASP A CG  1 
ATOM   2666 O  OD1 . ASP C 1 113 ? -16.659 0.205   14.167  1.00 37.04  ? 132 ASP A OD1 1 
ATOM   2667 O  OD2 . ASP C 1 113 ? -14.885 1.016   15.171  1.00 38.74  ? 132 ASP A OD2 1 
ATOM   2668 N  N   . GLY C 1 114 ? -12.532 2.703   11.297  1.00 39.76  ? 133 GLY A N   1 
ATOM   2669 C  CA  . GLY C 1 114 ? -11.898 3.336   10.155  1.00 39.83  ? 133 GLY A CA  1 
ATOM   2670 C  C   . GLY C 1 114 ? -12.835 4.046   9.199   1.00 39.95  ? 133 GLY A C   1 
ATOM   2671 O  O   . GLY C 1 114 ? -12.611 4.035   7.989   1.00 40.48  ? 133 GLY A O   1 
ATOM   2672 N  N   . HIS C 1 115 ? -13.883 4.667   9.730   1.00 34.39  ? 134 HIS A N   1 
ATOM   2673 C  CA  . HIS C 1 115 ? -14.790 5.441   8.888   1.00 34.00  ? 134 HIS A CA  1 
ATOM   2674 C  C   . HIS C 1 115 ? -14.475 6.932   8.955   1.00 33.84  ? 134 HIS A C   1 
ATOM   2675 O  O   . HIS C 1 115 ? -15.085 7.739   8.252   1.00 33.08  ? 134 HIS A O   1 
ATOM   2676 C  CB  . HIS C 1 115 ? -16.255 5.172   9.246   1.00 33.36  ? 134 HIS A CB  1 
ATOM   2677 C  CG  . HIS C 1 115 ? -16.608 5.499   10.663  1.00 32.25  ? 134 HIS A CG  1 
ATOM   2678 N  ND1 . HIS C 1 115 ? -16.827 6.789   11.096  1.00 32.16  ? 134 HIS A ND1 1 
ATOM   2679 C  CD2 . HIS C 1 115 ? -16.803 4.703   11.739  1.00 32.64  ? 134 HIS A CD2 1 
ATOM   2680 C  CE1 . HIS C 1 115 ? -17.130 6.774   12.381  1.00 32.91  ? 134 HIS A CE1 1 
ATOM   2681 N  NE2 . HIS C 1 115 ? -17.124 5.520   12.796  1.00 33.63  ? 134 HIS A NE2 1 
ATOM   2682 N  N   . HIS C 1 116 ? -13.515 7.289   9.800   1.00 25.37  ? 135 HIS A N   1 
ATOM   2683 C  CA  . HIS C 1 116 ? -13.059 8.668   9.902   1.00 25.97  ? 135 HIS A CA  1 
ATOM   2684 C  C   . HIS C 1 116 ? -11.970 8.936   8.869   1.00 27.49  ? 135 HIS A C   1 
ATOM   2685 O  O   . HIS C 1 116 ? -11.301 8.011   8.408   1.00 27.35  ? 135 HIS A O   1 
ATOM   2686 C  CB  . HIS C 1 116 ? -12.538 8.963   11.310  1.00 26.05  ? 135 HIS A CB  1 
ATOM   2687 C  CG  . HIS C 1 116 ? -13.595 8.908   12.370  1.00 25.07  ? 135 HIS A CG  1 
ATOM   2688 N  ND1 . HIS C 1 116 ? -14.371 9.997   12.705  1.00 24.81  ? 135 HIS A ND1 1 
ATOM   2689 C  CD2 . HIS C 1 116 ? -14.004 7.896   13.172  1.00 24.80  ? 135 HIS A CD2 1 
ATOM   2690 C  CE1 . HIS C 1 116 ? -15.212 9.658   13.666  1.00 24.47  ? 135 HIS A CE1 1 
ATOM   2691 N  NE2 . HIS C 1 116 ? -15.009 8.388   13.968  1.00 23.78  ? 135 HIS A NE2 1 
ATOM   2692 N  N   . ALA C 1 117 ? -11.799 10.203  8.504   1.00 58.45  ? 136 ALA A N   1 
ATOM   2693 C  CA  . ALA C 1 117 ? -10.808 10.585  7.502   1.00 60.18  ? 136 ALA A CA  1 
ATOM   2694 C  C   . ALA C 1 117 ? -9.418  10.084  7.881   1.00 60.60  ? 136 ALA A C   1 
ATOM   2695 O  O   . ALA C 1 117 ? -9.185  9.677   9.018   1.00 60.35  ? 136 ALA A O   1 
ATOM   2696 C  CB  . ALA C 1 117 ? -10.800 12.095  7.316   1.00 60.66  ? 136 ALA A CB  1 
ATOM   2697 N  N   . GLN C 1 118 ? -8.500  10.117  6.921   1.00 62.43  ? 137 GLN A N   1 
ATOM   2698 C  CA  . GLN C 1 118 ? -7.133  9.666   7.152   1.00 64.15  ? 137 GLN A CA  1 
ATOM   2699 C  C   . GLN C 1 118 ? -6.388  10.620  8.079   1.00 63.93  ? 137 GLN A C   1 
ATOM   2700 O  O   . GLN C 1 118 ? -6.445  11.838  7.910   1.00 63.44  ? 137 GLN A O   1 
ATOM   2701 C  CB  . GLN C 1 118 ? -6.382  9.530   5.825   1.00 66.43  ? 137 GLN A CB  1 
ATOM   2702 C  CG  . GLN C 1 118 ? -6.974  8.497   4.881   1.00 68.86  ? 137 GLN A CG  1 
ATOM   2703 C  CD  . GLN C 1 118 ? -6.245  8.435   3.553   1.00 71.75  ? 137 GLN A CD  1 
ATOM   2704 O  OE1 . GLN C 1 118 ? -5.702  9.435   3.083   1.00 72.45  ? 137 GLN A OE1 1 
ATOM   2705 N  NE2 . GLN C 1 118 ? -6.228  7.257   2.941   1.00 71.12  ? 137 GLN A NE2 1 
ATOM   2706 N  N   . ASP C 1 119 ? -5.689  10.058  9.061   1.00 61.67  ? 138 ASP A N   1 
ATOM   2707 C  CA  . ASP C 1 119 ? -4.928  10.857  10.014  1.00 62.55  ? 138 ASP A CA  1 
ATOM   2708 C  C   . ASP C 1 119 ? -5.823  11.400  11.123  1.00 61.27  ? 138 ASP A C   1 
ATOM   2709 O  O   . ASP C 1 119 ? -5.353  12.080  12.035  1.00 61.01  ? 138 ASP A O   1 
ATOM   2710 C  CB  . ASP C 1 119 ? -4.217  12.008  9.301   1.00 63.86  ? 138 ASP A CB  1 
ATOM   2711 C  CG  . ASP C 1 119 ? -2.924  11.574  8.639   1.00 65.52  ? 138 ASP A CG  1 
ATOM   2712 O  OD1 . ASP C 1 119 ? -2.718  10.353  8.478   1.00 65.93  ? 138 ASP A OD1 1 
ATOM   2713 O  OD2 . ASP C 1 119 ? -2.113  12.454  8.280   1.00 63.99  ? 138 ASP A OD2 1 
ATOM   2714 N  N   . SER C 1 120 ? -7.114  11.096  11.039  1.00 30.51  ? 139 SER A N   1 
ATOM   2715 C  CA  . SER C 1 120 ? -8.075  11.552  12.036  1.00 29.23  ? 139 SER A CA  1 
ATOM   2716 C  C   . SER C 1 120 ? -7.569  11.289  13.450  1.00 28.31  ? 139 SER A C   1 
ATOM   2717 O  O   . SER C 1 120 ? -6.934  10.267  13.712  1.00 27.77  ? 139 SER A O   1 
ATOM   2718 C  CB  . SER C 1 120 ? -9.429  10.870  11.827  1.00 27.65  ? 139 SER A CB  1 
ATOM   2719 O  OG  . SER C 1 120 ? -10.398 11.373  12.729  1.00 25.83  ? 139 SER A OG  1 
ATOM   2720 N  N   . LEU C 1 121 ? -7.854  12.217  14.358  1.00 24.33  ? 140 LEU A N   1 
ATOM   2721 C  CA  . LEU C 1 121 ? -7.428  12.087  15.746  1.00 24.59  ? 140 LEU A CA  1 
ATOM   2722 C  C   . LEU C 1 121 ? -8.184  10.966  16.452  1.00 23.65  ? 140 LEU A C   1 
ATOM   2723 O  O   . LEU C 1 121 ? -7.695  10.392  17.425  1.00 23.82  ? 140 LEU A O   1 
ATOM   2724 C  CB  . LEU C 1 121 ? -7.627  13.408  16.493  1.00 24.41  ? 140 LEU A CB  1 
ATOM   2725 C  CG  . LEU C 1 121 ? -6.716  14.565  16.078  1.00 24.77  ? 140 LEU A CG  1 
ATOM   2726 C  CD1 . LEU C 1 121 ? -6.829  15.718  17.064  1.00 24.83  ? 140 LEU A CD1 1 
ATOM   2727 C  CD2 . LEU C 1 121 ? -5.274  14.097  15.957  1.00 25.80  ? 140 LEU A CD2 1 
ATOM   2728 N  N   . HIS C 1 122 ? -9.378  10.661  15.956  1.00 29.41  ? 141 HIS A N   1 
ATOM   2729 C  CA  . HIS C 1 122 ? -10.202 9.610   16.536  1.00 29.02  ? 141 HIS A CA  1 
ATOM   2730 C  C   . HIS C 1 122 ? -9.436  8.293   16.591  1.00 29.84  ? 141 HIS A C   1 
ATOM   2731 O  O   . HIS C 1 122 ? -9.743  7.422   17.404  1.00 29.94  ? 141 HIS A O   1 
ATOM   2732 C  CB  . HIS C 1 122 ? -11.495 9.434   15.739  1.00 27.99  ? 141 HIS A CB  1 
ATOM   2733 C  CG  . HIS C 1 122 ? -12.538 10.465  16.041  1.00 27.73  ? 141 HIS A CG  1 
ATOM   2734 N  ND1 . HIS C 1 122 ? -13.499 10.285  17.012  1.00 27.34  ? 141 HIS A ND1 1 
ATOM   2735 C  CD2 . HIS C 1 122 ? -12.775 11.683  15.498  1.00 27.89  ? 141 HIS A CD2 1 
ATOM   2736 C  CE1 . HIS C 1 122 ? -14.281 11.349  17.056  1.00 27.04  ? 141 HIS A CE1 1 
ATOM   2737 N  NE2 . HIS C 1 122 ? -13.863 12.213  16.148  1.00 26.91  ? 141 HIS A NE2 1 
ATOM   2738 N  N   . TYR C 1 123 ? -8.436  8.156   15.725  1.00 31.29  ? 142 TYR A N   1 
ATOM   2739 C  CA  . TYR C 1 123 ? -7.650  6.928   15.654  1.00 31.46  ? 142 TYR A CA  1 
ATOM   2740 C  C   . TYR C 1 123 ? -6.611  6.838   16.767  1.00 32.15  ? 142 TYR A C   1 
ATOM   2741 O  O   . TYR C 1 123 ? -6.154  5.749   17.111  1.00 32.57  ? 142 TYR A O   1 
ATOM   2742 C  CB  . TYR C 1 123 ? -6.986  6.789   14.284  1.00 31.83  ? 142 TYR A CB  1 
ATOM   2743 C  CG  . TYR C 1 123 ? -7.970  6.606   13.153  1.00 31.31  ? 142 TYR A CG  1 
ATOM   2744 C  CD1 . TYR C 1 123 ? -8.887  5.563   13.169  1.00 31.25  ? 142 TYR A CD1 1 
ATOM   2745 C  CD2 . TYR C 1 123 ? -7.981  7.470   12.067  1.00 31.75  ? 142 TYR A CD2 1 
ATOM   2746 C  CE1 . TYR C 1 123 ? -9.792  5.389   12.139  1.00 30.85  ? 142 TYR A CE1 1 
ATOM   2747 C  CE2 . TYR C 1 123 ? -8.880  7.305   11.031  1.00 32.54  ? 142 TYR A CE2 1 
ATOM   2748 C  CZ  . TYR C 1 123 ? -9.783  6.262   11.072  1.00 31.57  ? 142 TYR A CZ  1 
ATOM   2749 O  OH  . TYR C 1 123 ? -10.679 6.096   10.040  1.00 30.93  ? 142 TYR A OH  1 
ATOM   2750 N  N   . GLU C 1 124 ? -6.239  7.983   17.328  1.00 35.51  ? 143 GLU A N   1 
ATOM   2751 C  CA  . GLU C 1 124 ? -5.329  8.005   18.466  1.00 35.92  ? 143 GLU A CA  1 
ATOM   2752 C  C   . GLU C 1 124 ? -6.018  8.512   19.731  1.00 36.04  ? 143 GLU A C   1 
ATOM   2753 O  O   . GLU C 1 124 ? -5.397  9.156   20.575  1.00 36.77  ? 143 GLU A O   1 
ATOM   2754 C  CB  . GLU C 1 124 ? -4.079  8.831   18.153  1.00 36.73  ? 143 GLU A CB  1 
ATOM   2755 C  CG  . GLU C 1 124 ? -4.322  10.007  17.227  1.00 36.79  ? 143 GLU A CG  1 
ATOM   2756 C  CD  . GLU C 1 124 ? -3.029  10.611  16.713  1.00 38.58  ? 143 GLU A CD  1 
ATOM   2757 O  OE1 . GLU C 1 124 ? -2.069  10.725  17.505  1.00 39.38  ? 143 GLU A OE1 1 
ATOM   2758 O  OE2 . GLU C 1 124 ? -2.971  10.971  15.518  1.00 38.36  ? 143 GLU A OE2 1 
ATOM   2759 N  N   . GLY C 1 125 ? -7.309  8.212   19.847  1.00 36.85  ? 144 GLY A N   1 
ATOM   2760 C  CA  . GLY C 1 125 ? -8.082  8.530   21.035  1.00 36.34  ? 144 GLY A CA  1 
ATOM   2761 C  C   . GLY C 1 125 ? -7.935  9.952   21.540  1.00 36.62  ? 144 GLY A C   1 
ATOM   2762 O  O   . GLY C 1 125 ? -7.966  10.193  22.747  1.00 37.05  ? 144 GLY A O   1 
ATOM   2763 N  N   . ARG C 1 126 ? -7.778  10.897  20.620  1.00 34.15  ? 145 ARG A N   1 
ATOM   2764 C  CA  . ARG C 1 126 ? -7.648  12.302  20.989  1.00 34.05  ? 145 ARG A CA  1 
ATOM   2765 C  C   . ARG C 1 126 ? -8.838  13.123  20.511  1.00 33.65  ? 145 ARG A C   1 
ATOM   2766 O  O   . ARG C 1 126 ? -8.869  14.342  20.685  1.00 34.04  ? 145 ARG A O   1 
ATOM   2767 C  CB  . ARG C 1 126 ? -6.358  12.897  20.419  1.00 35.34  ? 145 ARG A CB  1 
ATOM   2768 C  CG  . ARG C 1 126 ? -5.119  12.648  21.260  1.00 35.30  ? 145 ARG A CG  1 
ATOM   2769 C  CD  . ARG C 1 126 ? -4.045  13.673  20.934  1.00 36.61  ? 145 ARG A CD  1 
ATOM   2770 N  NE  . ARG C 1 126 ? -3.532  13.519  19.577  1.00 36.43  ? 145 ARG A NE  1 
ATOM   2771 C  CZ  . ARG C 1 126 ? -3.052  14.517  18.842  1.00 37.07  ? 145 ARG A CZ  1 
ATOM   2772 N  NH1 . ARG C 1 126 ? -3.035  15.751  19.328  1.00 37.93  ? 145 ARG A NH1 1 
ATOM   2773 N  NH2 . ARG C 1 126 ? -2.599  14.285  17.618  1.00 37.46  ? 145 ARG A NH2 1 
ATOM   2774 N  N   . ALA C 1 127 ? -9.816  12.456  19.907  1.00 25.20  ? 146 ALA A N   1 
ATOM   2775 C  CA  . ALA C 1 127 ? -10.979 13.148  19.367  1.00 23.88  ? 146 ALA A CA  1 
ATOM   2776 C  C   . ALA C 1 127 ? -12.288 12.512  19.821  1.00 23.67  ? 146 ALA A C   1 
ATOM   2777 O  O   . ALA C 1 127 ? -12.349 11.309  20.084  1.00 23.18  ? 146 ALA A O   1 
ATOM   2778 C  CB  . ALA C 1 127 ? -10.907 13.195  17.851  1.00 23.86  ? 146 ALA A CB  1 
ATOM   2779 N  N   . LEU C 1 128 ? -13.332 13.332  19.910  1.00 27.59  ? 147 LEU A N   1 
ATOM   2780 C  CA  . LEU C 1 128 ? -14.652 12.864  20.317  1.00 26.20  ? 147 LEU A CA  1 
ATOM   2781 C  C   . LEU C 1 128 ? -15.759 13.496  19.482  1.00 25.20  ? 147 LEU A C   1 
ATOM   2782 O  O   . LEU C 1 128 ? -15.696 14.674  19.131  1.00 25.66  ? 147 LEU A O   1 
ATOM   2783 C  CB  . LEU C 1 128 ? -14.905 13.177  21.793  1.00 26.07  ? 147 LEU A CB  1 
ATOM   2784 C  CG  . LEU C 1 128 ? -13.952 12.607  22.842  1.00 26.70  ? 147 LEU A CG  1 
ATOM   2785 C  CD1 . LEU C 1 128 ? -14.306 13.169  24.203  1.00 26.37  ? 147 LEU A CD1 1 
ATOM   2786 C  CD2 . LEU C 1 128 ? -13.997 11.090  22.862  1.00 26.99  ? 147 LEU A CD2 1 
ATOM   2787 N  N   . ASP C 1 129 ? -16.776 12.701  19.171  1.00 22.75  ? 148 ASP A N   1 
ATOM   2788 C  CA  . ASP C 1 129 ? -17.992 13.215  18.560  1.00 21.87  ? 148 ASP A CA  1 
ATOM   2789 C  C   . ASP C 1 129 ? -19.077 13.234  19.621  1.00 21.37  ? 148 ASP A C   1 
ATOM   2790 O  O   . ASP C 1 129 ? -19.476 12.188  20.132  1.00 21.18  ? 148 ASP A O   1 
ATOM   2791 C  CB  . ASP C 1 129 ? -18.413 12.347  17.377  1.00 22.25  ? 148 ASP A CB  1 
ATOM   2792 C  CG  . ASP C 1 129 ? -17.445 12.442  16.220  1.00 23.10  ? 148 ASP A CG  1 
ATOM   2793 O  OD1 . ASP C 1 129 ? -16.527 13.286  16.290  1.00 23.32  ? 148 ASP A OD1 1 
ATOM   2794 O  OD2 . ASP C 1 129 ? -17.603 11.678  15.244  1.00 23.70  ? 148 ASP A OD2 1 
ATOM   2795 N  N   . ILE C 1 130 ? -19.547 14.429  19.959  1.00 20.03  ? 149 ILE A N   1 
ATOM   2796 C  CA  . ILE C 1 130 ? -20.461 14.591  21.081  1.00 19.03  ? 149 ILE A CA  1 
ATOM   2797 C  C   . ILE C 1 130 ? -21.806 15.186  20.685  1.00 18.37  ? 149 ILE A C   1 
ATOM   2798 O  O   . ILE C 1 130 ? -21.906 15.958  19.733  1.00 18.78  ? 149 ILE A O   1 
ATOM   2799 C  CB  . ILE C 1 130 ? -19.845 15.481  22.174  1.00 19.44  ? 149 ILE A CB  1 
ATOM   2800 C  CG1 . ILE C 1 130 ? -19.651 16.906  21.648  1.00 19.94  ? 149 ILE A CG1 1 
ATOM   2801 C  CG2 . ILE C 1 130 ? -18.525 14.902  22.649  1.00 20.23  ? 149 ILE A CG2 1 
ATOM   2802 C  CD1 . ILE C 1 130 ? -19.243 17.901  22.708  1.00 20.37  ? 149 ILE A CD1 1 
ATOM   2803 N  N   . THR C 1 131 ? -22.838 14.808  21.428  1.00 27.36  ? 150 THR A N   1 
ATOM   2804 C  CA  . THR C 1 131 ? -24.147 15.430  21.318  1.00 27.25  ? 150 THR A CA  1 
ATOM   2805 C  C   . THR C 1 131 ? -24.675 15.628  22.729  1.00 28.04  ? 150 THR A C   1 
ATOM   2806 O  O   . THR C 1 131 ? -23.952 15.420  23.702  1.00 28.33  ? 150 THR A O   1 
ATOM   2807 C  CB  . THR C 1 131 ? -25.145 14.550  20.536  1.00 26.69  ? 150 THR A CB  1 
ATOM   2808 O  OG1 . THR C 1 131 ? -25.668 13.531  21.396  1.00 26.94  ? 150 THR A OG1 1 
ATOM   2809 C  CG2 . THR C 1 131 ? -24.476 13.905  19.334  1.00 27.25  ? 150 THR A CG2 1 
ATOM   2810 N  N   . THR C 1 132 ? -25.933 16.032  22.841  1.00 22.70  ? 151 THR A N   1 
ATOM   2811 C  CA  . THR C 1 132 ? -26.583 16.111  24.140  1.00 22.54  ? 151 THR A CA  1 
ATOM   2812 C  C   . THR C 1 132 ? -27.466 14.886  24.323  1.00 22.78  ? 151 THR A C   1 
ATOM   2813 O  O   . THR C 1 132 ? -27.990 14.341  23.353  1.00 22.51  ? 151 THR A O   1 
ATOM   2814 C  CB  . THR C 1 132 ? -27.424 17.387  24.278  1.00 22.93  ? 151 THR A CB  1 
ATOM   2815 O  OG1 . THR C 1 132 ? -28.423 17.419  23.252  1.00 23.23  ? 151 THR A OG1 1 
ATOM   2816 C  CG2 . THR C 1 132 ? -26.539 18.613  24.149  1.00 18.90  ? 151 THR A CG2 1 
ATOM   2817 N  N   . SER C 1 133 ? -27.621 14.450  25.567  1.00 25.32  ? 152 SER A N   1 
ATOM   2818 C  CA  . SER C 1 133 ? -28.368 13.233  25.858  1.00 25.49  ? 152 SER A CA  1 
ATOM   2819 C  C   . SER C 1 133 ? -29.712 13.178  25.130  1.00 25.80  ? 152 SER A C   1 
ATOM   2820 O  O   . SER C 1 133 ? -30.134 12.113  24.681  1.00 25.63  ? 152 SER A O   1 
ATOM   2821 C  CB  . SER C 1 133 ? -28.568 13.074  27.366  1.00 26.12  ? 152 SER A CB  1 
ATOM   2822 O  OG  . SER C 1 133 ? -29.190 14.219  27.919  1.00 27.56  ? 152 SER A OG  1 
ATOM   2823 N  N   . ASP C 1 134 ? -30.375 14.325  25.005  1.00 21.29  ? 153 ASP A N   1 
ATOM   2824 C  CA  . ASP C 1 134 ? -31.712 14.376  24.416  1.00 20.50  ? 153 ASP A CA  1 
ATOM   2825 C  C   . ASP C 1 134 ? -31.698 14.553  22.899  1.00 20.47  ? 153 ASP A C   1 
ATOM   2826 O  O   . ASP C 1 134 ? -32.752 14.652  22.270  1.00 20.34  ? 153 ASP A O   1 
ATOM   2827 C  CB  . ASP C 1 134 ? -32.540 15.489  25.062  1.00 21.04  ? 153 ASP A CB  1 
ATOM   2828 C  CG  . ASP C 1 134 ? -32.035 16.874  24.710  1.00 20.90  ? 153 ASP A CG  1 
ATOM   2829 O  OD1 . ASP C 1 134 ? -30.971 16.980  24.071  1.00 21.13  ? 153 ASP A OD1 1 
ATOM   2830 O  OD2 . ASP C 1 134 ? -32.708 17.860  25.076  1.00 21.09  ? 153 ASP A OD2 1 
ATOM   2831 N  N   . ARG C 1 135 ? -30.501 14.597  22.321  1.00 22.29  ? 154 ARG A N   1 
ATOM   2832 C  CA  . ARG C 1 135 ? -30.338 14.738  20.875  1.00 21.81  ? 154 ARG A CA  1 
ATOM   2833 C  C   . ARG C 1 135 ? -31.014 15.987  20.312  1.00 22.11  ? 154 ARG A C   1 
ATOM   2834 O  O   . ARG C 1 135 ? -31.521 15.966  19.191  1.00 22.55  ? 154 ARG A O   1 
ATOM   2835 C  CB  . ARG C 1 135 ? -30.869 13.503  20.139  1.00 21.23  ? 154 ARG A CB  1 
ATOM   2836 C  CG  . ARG C 1 135 ? -29.952 12.292  20.154  1.00 21.28  ? 154 ARG A CG  1 
ATOM   2837 C  CD  . ARG C 1 135 ? -30.085 11.485  21.438  1.00 22.74  ? 154 ARG A CD  1 
ATOM   2838 N  NE  . ARG C 1 135 ? -29.768 10.075  21.220  1.00 23.61  ? 154 ARG A NE  1 
ATOM   2839 C  CZ  . ARG C 1 135 ? -29.508 9.200   22.187  1.00 23.57  ? 154 ARG A CZ  1 
ATOM   2840 N  NH1 . ARG C 1 135 ? -29.513 9.585   23.457  1.00 23.59  ? 154 ARG A NH1 1 
ATOM   2841 N  NH2 . ARG C 1 135 ? -29.233 7.940   21.884  1.00 23.96  ? 154 ARG A NH2 1 
ATOM   2842 N  N   . ASP C 1 136 ? -31.025 17.068  21.084  1.00 19.53  ? 155 ASP A N   1 
ATOM   2843 C  CA  . ASP C 1 136 ? -31.618 18.317  20.617  1.00 19.86  ? 155 ASP A CA  1 
ATOM   2844 C  C   . ASP C 1 136 ? -30.582 19.184  19.920  1.00 20.78  ? 155 ASP A C   1 
ATOM   2845 O  O   . ASP C 1 136 ? -29.733 19.800  20.563  1.00 21.13  ? 155 ASP A O   1 
ATOM   2846 C  CB  . ASP C 1 136 ? -32.256 19.094  21.768  1.00 20.81  ? 155 ASP A CB  1 
ATOM   2847 C  CG  . ASP C 1 136 ? -32.907 20.386  21.303  1.00 21.87  ? 155 ASP A CG  1 
ATOM   2848 O  OD1 . ASP C 1 136 ? -33.064 20.568  20.077  1.00 21.75  ? 155 ASP A OD1 1 
ATOM   2849 O  OD2 . ASP C 1 136 ? -33.262 21.222  22.160  1.00 22.30  ? 155 ASP A OD2 1 
ATOM   2850 N  N   . ARG C 1 137 ? -30.670 19.233  18.597  1.00 25.95  ? 156 ARG A N   1 
ATOM   2851 C  CA  . ARG C 1 137 ? -29.685 19.930  17.784  1.00 25.64  ? 156 ARG A CA  1 
ATOM   2852 C  C   . ARG C 1 137 ? -29.644 21.416  18.115  1.00 26.33  ? 156 ARG A C   1 
ATOM   2853 O  O   . ARG C 1 137 ? -28.612 22.069  17.954  1.00 26.54  ? 156 ARG A O   1 
ATOM   2854 C  CB  . ARG C 1 137 ? -29.985 19.705  16.304  1.00 25.84  ? 156 ARG A CB  1 
ATOM   2855 C  CG  . ARG C 1 137 ? -30.493 18.302  16.015  1.00 25.76  ? 156 ARG A CG  1 
ATOM   2856 C  CD  . ARG C 1 137 ? -30.033 17.806  14.661  1.00 26.92  ? 156 ARG A CD  1 
ATOM   2857 N  NE  . ARG C 1 137 ? -30.480 16.440  14.410  1.00 27.40  ? 156 ARG A NE  1 
ATOM   2858 C  CZ  . ARG C 1 137 ? -29.964 15.363  14.997  1.00 26.80  ? 156 ARG A CZ  1 
ATOM   2859 N  NH1 . ARG C 1 137 ? -28.982 15.488  15.879  1.00 27.30  ? 156 ARG A NH1 1 
ATOM   2860 N  NH2 . ARG C 1 137 ? -30.433 14.160  14.704  1.00 26.48  ? 156 ARG A NH2 1 
ATOM   2861 N  N   . ASN C 1 138 ? -30.769 21.942  18.589  1.00 34.72  ? 157 ASN A N   1 
ATOM   2862 C  CA  . ASN C 1 138 ? -30.846 23.333  19.023  1.00 35.01  ? 157 ASN A CA  1 
ATOM   2863 C  C   . ASN C 1 138 ? -29.908 23.635  20.185  1.00 35.38  ? 157 ASN A C   1 
ATOM   2864 O  O   . ASN C 1 138 ? -29.838 24.771  20.655  1.00 35.87  ? 157 ASN A O   1 
ATOM   2865 C  CB  . ASN C 1 138 ? -32.279 23.697  19.409  1.00 34.90  ? 157 ASN A CB  1 
ATOM   2866 C  CG  . ASN C 1 138 ? -33.162 23.922  18.205  1.00 35.38  ? 157 ASN A CG  1 
ATOM   2867 O  OD1 . ASN C 1 138 ? -32.682 23.966  17.073  1.00 35.55  ? 157 ASN A OD1 1 
ATOM   2868 N  ND2 . ASN C 1 138 ? -34.460 24.067  18.440  1.00 35.49  ? 157 ASN A ND2 1 
ATOM   2869 N  N   . LYS C 1 139 ? -29.192 22.617  20.649  1.00 26.23  ? 158 LYS A N   1 
ATOM   2870 C  CA  . LYS C 1 139 ? -28.240 22.797  21.737  1.00 26.93  ? 158 LYS A CA  1 
ATOM   2871 C  C   . LYS C 1 139 ? -26.803 22.606  21.269  1.00 26.92  ? 158 LYS A C   1 
ATOM   2872 O  O   . LYS C 1 139 ? -25.869 23.020  21.951  1.00 27.62  ? 158 LYS A O   1 
ATOM   2873 C  CB  . LYS C 1 139 ? -28.539 21.836  22.890  1.00 26.62  ? 158 LYS A CB  1 
ATOM   2874 C  CG  . LYS C 1 139 ? -29.873 22.061  23.579  1.00 27.09  ? 158 LYS A CG  1 
ATOM   2875 C  CD  . LYS C 1 139 ? -29.968 21.222  24.844  1.00 26.61  ? 158 LYS A CD  1 
ATOM   2876 C  CE  . LYS C 1 139 ? -31.314 21.387  25.522  1.00 26.29  ? 158 LYS A CE  1 
ATOM   2877 N  NZ  . LYS C 1 139 ? -32.412 20.804  24.711  1.00 25.29  ? 158 LYS A NZ  1 
ATOM   2878 N  N   . TYR C 1 140 ? -26.625 21.978  20.111  1.00 29.88  ? 159 TYR A N   1 
ATOM   2879 C  CA  . TYR C 1 140 ? -25.283 21.666  19.630  1.00 29.61  ? 159 TYR A CA  1 
ATOM   2880 C  C   . TYR C 1 140 ? -24.447 22.922  19.424  1.00 30.69  ? 159 TYR A C   1 
ATOM   2881 O  O   . TYR C 1 140 ? -23.228 22.902  19.606  1.00 30.23  ? 159 TYR A O   1 
ATOM   2882 C  CB  . TYR C 1 140 ? -25.327 20.836  18.344  1.00 29.82  ? 159 TYR A CB  1 
ATOM   2883 C  CG  . TYR C 1 140 ? -26.032 19.505  18.497  1.00 29.61  ? 159 TYR A CG  1 
ATOM   2884 C  CD1 . TYR C 1 140 ? -26.272 18.966  19.753  1.00 28.46  ? 159 TYR A CD1 1 
ATOM   2885 C  CD2 . TYR C 1 140 ? -26.435 18.779  17.384  1.00 28.89  ? 159 TYR A CD2 1 
ATOM   2886 C  CE1 . TYR C 1 140 ? -26.912 17.752  19.897  1.00 27.81  ? 159 TYR A CE1 1 
ATOM   2887 C  CE2 . TYR C 1 140 ? -27.072 17.565  17.520  1.00 28.51  ? 159 TYR A CE2 1 
ATOM   2888 C  CZ  . TYR C 1 140 ? -27.308 17.056  18.779  1.00 27.72  ? 159 TYR A CZ  1 
ATOM   2889 O  OH  . TYR C 1 140 ? -27.941 15.843  18.921  1.00 27.50  ? 159 TYR A OH  1 
ATOM   2890 N  N   . GLY C 1 141 ? -25.106 24.013  19.047  1.00 41.28  ? 160 GLY A N   1 
ATOM   2891 C  CA  . GLY C 1 141 ? -24.428 25.284  18.867  1.00 41.66  ? 160 GLY A CA  1 
ATOM   2892 C  C   . GLY C 1 141 ? -23.793 25.762  20.158  1.00 41.80  ? 160 GLY A C   1 
ATOM   2893 O  O   . GLY C 1 141 ? -22.619 26.131  20.187  1.00 42.19  ? 160 GLY A O   1 
ATOM   2894 N  N   . LEU C 1 142 ? -24.576 25.749  21.231  1.00 27.73  ? 161 LEU A N   1 
ATOM   2895 C  CA  . LEU C 1 142 ? -24.088 26.142  22.545  1.00 28.14  ? 161 LEU A CA  1 
ATOM   2896 C  C   . LEU C 1 142 ? -23.104 25.101  23.068  1.00 28.00  ? 161 LEU A C   1 
ATOM   2897 O  O   . LEU C 1 142 ? -22.083 25.439  23.665  1.00 29.07  ? 161 LEU A O   1 
ATOM   2898 C  CB  . LEU C 1 142 ? -25.257 26.284  23.520  1.00 28.38  ? 161 LEU A CB  1 
ATOM   2899 C  CG  . LEU C 1 142 ? -25.172 27.379  24.583  1.00 28.90  ? 161 LEU A CG  1 
ATOM   2900 C  CD1 . LEU C 1 142 ? -26.158 27.091  25.703  1.00 28.79  ? 161 LEU A CD1 1 
ATOM   2901 C  CD2 . LEU C 1 142 ? -23.762 27.511  25.134  1.00 30.02  ? 161 LEU A CD2 1 
ATOM   2902 N  N   . LEU C 1 143 ? -23.425 23.831  22.838  1.00 31.37  ? 162 LEU A N   1 
ATOM   2903 C  CA  . LEU C 1 143 ? -22.580 22.723  23.271  1.00 31.31  ? 162 LEU A CA  1 
ATOM   2904 C  C   . LEU C 1 143 ? -21.145 22.903  22.791  1.00 31.72  ? 162 LEU A C   1 
ATOM   2905 O  O   . LEU C 1 143 ? -20.196 22.642  23.527  1.00 31.51  ? 162 LEU A O   1 
ATOM   2906 C  CB  . LEU C 1 143 ? -23.140 21.399  22.750  1.00 30.18  ? 162 LEU A CB  1 
ATOM   2907 C  CG  . LEU C 1 143 ? -22.434 20.132  23.228  1.00 29.13  ? 162 LEU A CG  1 
ATOM   2908 C  CD1 . LEU C 1 143 ? -22.552 20.009  24.735  1.00 29.91  ? 162 LEU A CD1 1 
ATOM   2909 C  CD2 . LEU C 1 143 ? -23.010 18.906  22.539  1.00 28.59  ? 162 LEU A CD2 1 
ATOM   2910 N  N   . ALA C 1 144 ? -20.998 23.351  21.548  1.00 39.21  ? 163 ALA A N   1 
ATOM   2911 C  CA  . ALA C 1 144 ? -19.686 23.597  20.966  1.00 39.21  ? 163 ALA A CA  1 
ATOM   2912 C  C   . ALA C 1 144 ? -18.940 24.659  21.762  1.00 40.87  ? 163 ALA A C   1 
ATOM   2913 O  O   . ALA C 1 144 ? -17.748 24.519  22.038  1.00 41.81  ? 163 ALA A O   1 
ATOM   2914 C  CB  . ALA C 1 144 ? -19.823 24.017  19.513  1.00 39.46  ? 163 ALA A CB  1 
ATOM   2915 N  N   . ARG C 1 145 ? -19.647 25.724  22.125  1.00 35.67  ? 164 ARG A N   1 
ATOM   2916 C  CA  . ARG C 1 145 ? -19.067 26.785  22.938  1.00 36.22  ? 164 ARG A CA  1 
ATOM   2917 C  C   . ARG C 1 145 ? -18.576 26.233  24.272  1.00 36.71  ? 164 ARG A C   1 
ATOM   2918 O  O   . ARG C 1 145 ? -17.464 26.535  24.707  1.00 37.49  ? 164 ARG A O   1 
ATOM   2919 C  CB  . ARG C 1 145 ? -20.084 27.909  23.167  1.00 36.48  ? 164 ARG A CB  1 
ATOM   2920 C  CG  . ARG C 1 145 ? -19.655 28.952  24.194  1.00 36.79  ? 164 ARG A CG  1 
ATOM   2921 C  CD  . ARG C 1 145 ? -18.284 29.530  23.878  1.00 37.29  ? 164 ARG A CD  1 
ATOM   2922 N  NE  . ARG C 1 145 ? -18.250 30.206  22.584  1.00 38.61  ? 164 ARG A NE  1 
ATOM   2923 C  CZ  . ARG C 1 145 ? -17.133 30.591  21.971  1.00 38.90  ? 164 ARG A CZ  1 
ATOM   2924 N  NH1 . ARG C 1 145 ? -15.953 30.364  22.532  1.00 38.60  ? 164 ARG A NH1 1 
ATOM   2925 N  NH2 . ARG C 1 145 ? -17.196 31.199  20.792  1.00 37.30  ? 164 ARG A NH2 1 
ATOM   2926 N  N   . LEU C 1 146 ? -19.405 25.412  24.911  1.00 32.04  ? 165 LEU A N   1 
ATOM   2927 C  CA  . LEU C 1 146 ? -19.049 24.820  26.198  1.00 32.47  ? 165 LEU A CA  1 
ATOM   2928 C  C   . LEU C 1 146 ? -17.797 23.956  26.100  1.00 32.09  ? 165 LEU A C   1 
ATOM   2929 O  O   . LEU C 1 146 ? -17.051 23.820  27.068  1.00 32.89  ? 165 LEU A O   1 
ATOM   2930 C  CB  . LEU C 1 146 ? -20.214 24.004  26.761  1.00 31.31  ? 165 LEU A CB  1 
ATOM   2931 C  CG  . LEU C 1 146 ? -21.404 24.834  27.245  1.00 31.39  ? 165 LEU A CG  1 
ATOM   2932 C  CD1 . LEU C 1 146 ? -22.421 23.956  27.957  1.00 30.55  ? 165 LEU A CD1 1 
ATOM   2933 C  CD2 . LEU C 1 146 ? -20.929 25.957  28.155  1.00 31.05  ? 165 LEU A CD2 1 
ATOM   2934 N  N   . ALA C 1 147 ? -17.572 23.379  24.925  1.00 26.51  ? 166 ALA A N   1 
ATOM   2935 C  CA  . ALA C 1 147 ? -16.396 22.552  24.693  1.00 26.60  ? 166 ALA A CA  1 
ATOM   2936 C  C   . ALA C 1 147 ? -15.138 23.412  24.651  1.00 28.24  ? 166 ALA A C   1 
ATOM   2937 O  O   . ALA C 1 147 ? -14.076 23.001  25.115  1.00 28.73  ? 166 ALA A O   1 
ATOM   2938 C  CB  . ALA C 1 147 ? -16.547 21.761  23.407  1.00 26.31  ? 166 ALA A CB  1 
ATOM   2939 N  N   . VAL C 1 148 ? -15.265 24.610  24.090  1.00 41.42  ? 167 VAL A N   1 
ATOM   2940 C  CA  . VAL C 1 148 ? -14.153 25.549  24.044  1.00 41.66  ? 167 VAL A CA  1 
ATOM   2941 C  C   . VAL C 1 148 ? -13.799 26.004  25.454  1.00 43.11  ? 167 VAL A C   1 
ATOM   2942 O  O   . VAL C 1 148 ? -12.626 26.068  25.823  1.00 43.88  ? 167 VAL A O   1 
ATOM   2943 C  CB  . VAL C 1 148 ? -14.493 26.789  23.200  1.00 42.22  ? 167 VAL A CB  1 
ATOM   2944 C  CG1 . VAL C 1 148 ? -13.293 27.718  23.124  1.00 43.28  ? 167 VAL A CG1 1 
ATOM   2945 C  CG2 . VAL C 1 148 ? -14.944 26.379  21.808  1.00 42.75  ? 167 VAL A CG2 1 
ATOM   2946 N  N   . GLU C 1 149 ? -14.826 26.314  26.239  1.00 35.62  ? 168 GLU A N   1 
ATOM   2947 C  CA  . GLU C 1 149 ? -14.643 26.769  27.611  1.00 35.70  ? 168 GLU A CA  1 
ATOM   2948 C  C   . GLU C 1 149 ? -14.217 25.617  28.515  1.00 35.20  ? 168 GLU A C   1 
ATOM   2949 O  O   . GLU C 1 149 ? -13.633 25.828  29.576  1.00 34.82  ? 168 GLU A O   1 
ATOM   2950 C  CB  . GLU C 1 149 ? -15.931 27.406  28.137  1.00 35.77  ? 168 GLU A CB  1 
ATOM   2951 C  CG  . GLU C 1 149 ? -16.565 28.409  27.184  1.00 35.75  ? 168 GLU A CG  1 
ATOM   2952 C  CD  . GLU C 1 149 ? -15.651 29.578  26.857  1.00 36.44  ? 168 GLU A CD  1 
ATOM   2953 O  OE1 . GLU C 1 149 ? -14.677 29.807  27.605  1.00 37.50  ? 168 GLU A OE1 1 
ATOM   2954 O  OE2 . GLU C 1 149 ? -15.911 30.273  25.852  1.00 36.07  ? 168 GLU A OE2 1 
ATOM   2955 N  N   . ALA C 1 150 ? -14.517 24.396  28.086  1.00 28.61  ? 169 ALA A N   1 
ATOM   2956 C  CA  . ALA C 1 150 ? -14.106 23.209  28.822  1.00 28.71  ? 169 ALA A CA  1 
ATOM   2957 C  C   . ALA C 1 150 ? -12.596 23.039  28.736  1.00 29.39  ? 169 ALA A C   1 
ATOM   2958 O  O   . ALA C 1 150 ? -11.991 22.344  29.553  1.00 30.07  ? 169 ALA A O   1 
ATOM   2959 C  CB  . ALA C 1 150 ? -14.810 21.978  28.280  1.00 28.37  ? 169 ALA A CB  1 
ATOM   2960 N  N   . GLY C 1 151 ? -11.993 23.677  27.739  1.00 38.39  ? 170 GLY A N   1 
ATOM   2961 C  CA  . GLY C 1 151 ? -10.556 23.615  27.557  1.00 39.28  ? 170 GLY A CA  1 
ATOM   2962 C  C   . GLY C 1 151 ? -10.141 22.744  26.388  1.00 39.18  ? 170 GLY A C   1 
ATOM   2963 O  O   . GLY C 1 151 ? -8.967  22.406  26.243  1.00 40.14  ? 170 GLY A O   1 
ATOM   2964 N  N   . PHE C 1 152 ? -11.103 22.372  25.551  1.00 32.13  ? 171 PHE A N   1 
ATOM   2965 C  CA  . PHE C 1 152 ? -10.801 21.572  24.370  1.00 32.15  ? 171 PHE A CA  1 
ATOM   2966 C  C   . PHE C 1 152 ? -9.989  22.374  23.358  1.00 33.05  ? 171 PHE A C   1 
ATOM   2967 O  O   . PHE C 1 152 ? -10.279 23.542  23.094  1.00 32.86  ? 171 PHE A O   1 
ATOM   2968 C  CB  . PHE C 1 152 ? -12.078 21.025  23.734  1.00 31.56  ? 171 PHE A CB  1 
ATOM   2969 C  CG  . PHE C 1 152 ? -12.556 19.738  24.345  1.00 30.97  ? 171 PHE A CG  1 
ATOM   2970 C  CD1 . PHE C 1 152 ? -11.939 18.538  24.032  1.00 31.30  ? 171 PHE A CD1 1 
ATOM   2971 C  CD2 . PHE C 1 152 ? -13.625 19.725  25.223  1.00 30.49  ? 171 PHE A CD2 1 
ATOM   2972 C  CE1 . PHE C 1 152 ? -12.376 17.351  24.588  1.00 31.16  ? 171 PHE A CE1 1 
ATOM   2973 C  CE2 . PHE C 1 152 ? -14.068 18.540  25.783  1.00 30.41  ? 171 PHE A CE2 1 
ATOM   2974 C  CZ  . PHE C 1 152 ? -13.442 17.352  25.464  1.00 30.65  ? 171 PHE A CZ  1 
ATOM   2975 N  N   . ASP C 1 153 ? -8.973  21.730  22.795  1.00 42.62  ? 172 ASP A N   1 
ATOM   2976 C  CA  . ASP C 1 153 ? -8.001  22.407  21.945  1.00 43.64  ? 172 ASP A CA  1 
ATOM   2977 C  C   . ASP C 1 153 ? -8.527  22.721  20.549  1.00 43.28  ? 172 ASP A C   1 
ATOM   2978 O  O   . ASP C 1 153 ? -7.966  23.557  19.842  1.00 45.21  ? 172 ASP A O   1 
ATOM   2979 C  CB  . ASP C 1 153 ? -6.720  21.578  21.858  1.00 43.72  ? 172 ASP A CB  1 
ATOM   2980 C  CG  . ASP C 1 153 ? -6.051  21.409  23.204  1.00 44.25  ? 172 ASP A CG  1 
ATOM   2981 O  OD1 . ASP C 1 153 ? -5.862  22.426  23.904  1.00 45.00  ? 172 ASP A OD1 1 
ATOM   2982 O  OD2 . ASP C 1 153 ? -5.718  20.262  23.563  1.00 44.15  ? 172 ASP A OD2 1 
ATOM   2983 N  N   . TRP C 1 154 ? -9.599  22.046  20.153  1.00 29.43  ? 173 TRP A N   1 
ATOM   2984 C  CA  . TRP C 1 154 ? -10.227 22.322  18.869  1.00 28.64  ? 173 TRP A CA  1 
ATOM   2985 C  C   . TRP C 1 154 ? -11.666 21.825  18.854  1.00 27.76  ? 173 TRP A C   1 
ATOM   2986 O  O   . TRP C 1 154 ? -11.923 20.627  18.963  1.00 27.29  ? 173 TRP A O   1 
ATOM   2987 C  CB  . TRP C 1 154 ? -9.429  21.699  17.721  1.00 29.32  ? 173 TRP A CB  1 
ATOM   2988 C  CG  . TRP C 1 154 ? -9.708  22.342  16.391  1.00 29.66  ? 173 TRP A CG  1 
ATOM   2989 C  CD1 . TRP C 1 154 ? -9.315  23.584  15.985  1.00 30.05  ? 173 TRP A CD1 1 
ATOM   2990 C  CD2 . TRP C 1 154 ? -10.439 21.775  15.296  1.00 28.30  ? 173 TRP A CD2 1 
ATOM   2991 N  NE1 . TRP C 1 154 ? -9.757  23.827  14.708  1.00 28.77  ? 173 TRP A NE1 1 
ATOM   2992 C  CE2 . TRP C 1 154 ? -10.449 22.732  14.263  1.00 28.21  ? 173 TRP A CE2 1 
ATOM   2993 C  CE3 . TRP C 1 154 ? -11.088 20.554  15.092  1.00 27.50  ? 173 TRP A CE3 1 
ATOM   2994 C  CZ2 . TRP C 1 154 ? -11.080 22.505  13.042  1.00 28.02  ? 173 TRP A CZ2 1 
ATOM   2995 C  CZ3 . TRP C 1 154 ? -11.711 20.329  13.878  1.00 26.87  ? 173 TRP A CZ3 1 
ATOM   2996 C  CH2 . TRP C 1 154 ? -11.704 21.300  12.869  1.00 27.26  ? 173 TRP A CH2 1 
ATOM   2997 N  N   . VAL C 1 155 ? -12.600 22.761  18.726  1.00 30.99  ? 174 VAL A N   1 
ATOM   2998 C  CA  . VAL C 1 155 ? -14.017 22.435  18.698  1.00 30.13  ? 174 VAL A CA  1 
ATOM   2999 C  C   . VAL C 1 155 ? -14.603 22.798  17.343  1.00 29.92  ? 174 VAL A C   1 
ATOM   3000 O  O   . VAL C 1 155 ? -14.529 23.950  16.915  1.00 30.36  ? 174 VAL A O   1 
ATOM   3001 C  CB  . VAL C 1 155 ? -14.787 23.194  19.787  1.00 30.51  ? 174 VAL A CB  1 
ATOM   3002 C  CG1 . VAL C 1 155 ? -16.250 22.780  19.784  1.00 29.47  ? 174 VAL A CG1 1 
ATOM   3003 C  CG2 . VAL C 1 155 ? -14.155 22.952  21.150  1.00 30.48  ? 174 VAL A CG2 1 
ATOM   3004 N  N   . TYR C 1 156 ? -15.192 21.813  16.675  1.00 26.23  ? 175 TYR A N   1 
ATOM   3005 C  CA  . TYR C 1 156 ? -15.713 22.007  15.326  1.00 26.00  ? 175 TYR A CA  1 
ATOM   3006 C  C   . TYR C 1 156 ? -17.150 21.508  15.174  1.00 25.54  ? 175 TYR A C   1 
ATOM   3007 O  O   . TYR C 1 156 ? -17.436 20.327  15.373  1.00 24.74  ? 175 TYR A O   1 
ATOM   3008 C  CB  . TYR C 1 156 ? -14.792 21.323  14.312  1.00 25.14  ? 175 TYR A CB  1 
ATOM   3009 C  CG  . TYR C 1 156 ? -15.294 21.322  12.886  1.00 25.20  ? 175 TYR A CG  1 
ATOM   3010 C  CD1 . TYR C 1 156 ? -15.859 22.456  12.322  1.00 25.50  ? 175 TYR A CD1 1 
ATOM   3011 C  CD2 . TYR C 1 156 ? -15.174 20.189  12.094  1.00 25.49  ? 175 TYR A CD2 1 
ATOM   3012 C  CE1 . TYR C 1 156 ? -16.308 22.455  11.017  1.00 24.98  ? 175 TYR A CE1 1 
ATOM   3013 C  CE2 . TYR C 1 156 ? -15.616 20.179  10.789  1.00 25.07  ? 175 TYR A CE2 1 
ATOM   3014 C  CZ  . TYR C 1 156 ? -16.183 21.313  10.255  1.00 24.91  ? 175 TYR A CZ  1 
ATOM   3015 O  OH  . TYR C 1 156 ? -16.625 21.301  8.953   1.00 26.78  ? 175 TYR A OH  1 
ATOM   3016 N  N   . TYR C 1 157 ? -18.050 22.425  14.830  1.00 25.82  ? 176 TYR A N   1 
ATOM   3017 C  CA  . TYR C 1 157 ? -19.435 22.081  14.544  1.00 25.15  ? 176 TYR A CA  1 
ATOM   3018 C  C   . TYR C 1 157 ? -19.468 21.343  13.209  1.00 24.91  ? 176 TYR A C   1 
ATOM   3019 O  O   . TYR C 1 157 ? -19.949 21.870  12.209  1.00 25.45  ? 176 TYR A O   1 
ATOM   3020 C  CB  . TYR C 1 157 ? -20.279 23.353  14.467  1.00 25.69  ? 176 TYR A CB  1 
ATOM   3021 C  CG  . TYR C 1 157 ? -21.751 23.160  14.757  1.00 25.42  ? 176 TYR A CG  1 
ATOM   3022 C  CD1 . TYR C 1 157 ? -22.463 22.113  14.187  1.00 25.45  ? 176 TYR A CD1 1 
ATOM   3023 C  CD2 . TYR C 1 157 ? -22.436 24.044  15.581  1.00 25.34  ? 176 TYR A CD2 1 
ATOM   3024 C  CE1 . TYR C 1 157 ? -23.811 21.941  14.445  1.00 24.92  ? 176 TYR A CE1 1 
ATOM   3025 C  CE2 . TYR C 1 157 ? -23.784 23.880  15.841  1.00 25.04  ? 176 TYR A CE2 1 
ATOM   3026 C  CZ  . TYR C 1 157 ? -24.466 22.827  15.271  1.00 24.24  ? 176 TYR A CZ  1 
ATOM   3027 O  OH  . TYR C 1 157 ? -25.807 22.659  15.528  1.00 23.48  ? 176 TYR A OH  1 
ATOM   3028 N  N   . GLU C 1 158 ? -19.210 20.068  13.229  1.00 46.99  ? 177 GLU A N   1 
ATOM   3029 C  CA  . GLU C 1 158 ? -18.743 19.347  11.985  1.00 47.10  ? 177 GLU A CA  1 
ATOM   3030 C  C   . GLU C 1 158 ? -20.038 19.048  11.238  1.00 46.84  ? 177 GLU A C   1 
ATOM   3031 O  O   . GLU C 1 158 ? -20.223 19.478  10.100  1.00 47.04  ? 177 GLU A O   1 
ATOM   3032 C  CB  . GLU C 1 158 ? -18.013 18.041  12.307  1.00 47.20  ? 177 GLU A CB  1 
ATOM   3033 C  CG  . GLU C 1 158 ? -17.542 17.269  11.088  1.00 48.07  ? 177 GLU A CG  1 
ATOM   3034 C  CD  . GLU C 1 158 ? -16.545 16.180  11.440  1.00 49.90  ? 177 GLU A CD  1 
ATOM   3035 O  OE1 . GLU C 1 158 ? -16.362 15.910  12.646  1.00 49.36  ? 177 GLU A OE1 1 
ATOM   3036 O  OE2 . GLU C 1 158 ? -15.943 15.597  10.513  1.00 50.84  ? 177 GLU A OE2 1 
ATOM   3037 N  N   . SER C 1 159 ? -20.925 18.298  11.880  1.00 26.34  ? 178 SER A N   1 
ATOM   3038 C  CA  . SER C 1 159 ? -22.191 17.922  11.268  1.00 25.54  ? 178 SER A CA  1 
ATOM   3039 C  C   . SER C 1 159 ? -23.352 18.579  11.997  1.00 25.47  ? 178 SER A C   1 
ATOM   3040 O  O   . SER C 1 159 ? -23.190 19.090  13.101  1.00 25.97  ? 178 SER A O   1 
ATOM   3041 C  CB  . SER C 1 159 ? -22.357 16.403  11.290  1.00 25.61  ? 178 SER A CB  1 
ATOM   3042 O  OG  . SER C 1 159 ? -23.637 16.023  10.819  1.00 26.68  ? 178 SER A OG  1 
ATOM   3043 N  N   . ARG C 1 160 ? -24.523 18.569  11.371  1.00 48.24  ? 179 ARG A N   1 
ATOM   3044 C  CA  . ARG C 1 160 ? -25.728 19.064  12.020  1.00 48.73  ? 179 ARG A CA  1 
ATOM   3045 C  C   . ARG C 1 160 ? -26.205 18.046  13.044  1.00 48.31  ? 179 ARG A C   1 
ATOM   3046 O  O   . ARG C 1 160 ? -27.136 18.303  13.806  1.00 48.17  ? 179 ARG A O   1 
ATOM   3047 C  CB  . ARG C 1 160 ? -26.825 19.331  10.991  1.00 49.98  ? 179 ARG A CB  1 
ATOM   3048 C  CG  . ARG C 1 160 ? -26.487 20.432  10.003  1.00 52.21  ? 179 ARG A CG  1 
ATOM   3049 C  CD  . ARG C 1 160 ? -27.693 20.818  9.174   1.00 55.43  ? 179 ARG A CD  1 
ATOM   3050 N  NE  . ARG C 1 160 ? -27.428 21.978  8.327   1.00 58.12  ? 179 ARG A NE  1 
ATOM   3051 C  CZ  . ARG C 1 160 ? -28.322 22.527  7.511   1.00 60.39  ? 179 ARG A CZ  1 
ATOM   3052 N  NH1 . ARG C 1 160 ? -29.547 22.023  7.430   1.00 61.17  ? 179 ARG A NH1 1 
ATOM   3053 N  NH2 . ARG C 1 160 ? -27.993 23.581  6.776   1.00 61.27  ? 179 ARG A NH2 1 
ATOM   3054 N  N   . ASN C 1 161 ? -25.547 16.891  13.058  1.00 35.26  ? 180 ASN A N   1 
ATOM   3055 C  CA  . ASN C 1 161 ? -25.928 15.791  13.935  1.00 34.88  ? 180 ASN A CA  1 
ATOM   3056 C  C   . ASN C 1 161 ? -24.943 15.547  15.076  1.00 35.57  ? 180 ASN A C   1 
ATOM   3057 O  O   . ASN C 1 161 ? -25.228 14.774  15.993  1.00 35.43  ? 180 ASN A O   1 
ATOM   3058 C  CB  . ASN C 1 161 ? -26.108 14.507  13.125  1.00 34.87  ? 180 ASN A CB  1 
ATOM   3059 C  CG  . ASN C 1 161 ? -27.243 14.604  12.127  1.00 35.72  ? 180 ASN A CG  1 
ATOM   3060 O  OD1 . ASN C 1 161 ? -28.067 15.518  12.192  1.00 35.61  ? 180 ASN A OD1 1 
ATOM   3061 N  ND2 . ASN C 1 161 ? -27.294 13.657  11.198  1.00 36.54  ? 180 ASN A ND2 1 
ATOM   3062 N  N   . HIS C 1 162 ? -23.783 16.195  15.018  1.00 31.30  ? 181 HIS A N   1 
ATOM   3063 C  CA  . HIS C 1 162 ? -22.779 16.041  16.068  1.00 30.90  ? 181 HIS A CA  1 
ATOM   3064 C  C   . HIS C 1 162 ? -21.727 17.147  16.035  1.00 31.48  ? 181 HIS A C   1 
ATOM   3065 O  O   . HIS C 1 162 ? -21.589 17.861  15.043  1.00 30.84  ? 181 HIS A O   1 
ATOM   3066 C  CB  . HIS C 1 162 ? -22.094 14.673  15.968  1.00 29.92  ? 181 HIS A CB  1 
ATOM   3067 C  CG  . HIS C 1 162 ? -20.951 14.638  15.002  1.00 30.49  ? 181 HIS A CG  1 
ATOM   3068 N  ND1 . HIS C 1 162 ? -21.084 14.188  13.706  1.00 30.98  ? 181 HIS A ND1 1 
ATOM   3069 C  CD2 . HIS C 1 162 ? -19.652 14.993  15.144  1.00 31.20  ? 181 HIS A CD2 1 
ATOM   3070 C  CE1 . HIS C 1 162 ? -19.917 14.270  13.091  1.00 31.29  ? 181 HIS A CE1 1 
ATOM   3071 N  NE2 . HIS C 1 162 ? -19.032 14.756  13.942  1.00 31.61  ? 181 HIS A NE2 1 
ATOM   3072 N  N   . VAL C 1 163 ? -20.986 17.274  17.132  1.00 27.35  ? 182 VAL A N   1 
ATOM   3073 C  CA  . VAL C 1 163 ? -19.893 18.234  17.227  1.00 27.31  ? 182 VAL A CA  1 
ATOM   3074 C  C   . VAL C 1 163 ? -18.570 17.505  17.444  1.00 27.04  ? 182 VAL A C   1 
ATOM   3075 O  O   . VAL C 1 163 ? -18.484 16.588  18.259  1.00 26.53  ? 182 VAL A O   1 
ATOM   3076 C  CB  . VAL C 1 163 ? -20.123 19.238  18.376  1.00 27.02  ? 182 VAL A CB  1 
ATOM   3077 C  CG1 . VAL C 1 163 ? -18.969 20.226  18.464  1.00 26.90  ? 182 VAL A CG1 1 
ATOM   3078 C  CG2 . VAL C 1 163 ? -21.443 19.967  18.184  1.00 26.66  ? 182 VAL A CG2 1 
ATOM   3079 N  N   . HIS C 1 164 ? -17.543 17.912  16.703  1.00 21.49  ? 183 HIS A N   1 
ATOM   3080 C  CA  . HIS C 1 164 ? -16.225 17.293  16.805  1.00 21.71  ? 183 HIS A CA  1 
ATOM   3081 C  C   . HIS C 1 164 ? -15.323 18.074  17.757  1.00 22.32  ? 183 HIS A C   1 
ATOM   3082 O  O   . HIS C 1 164 ? -15.177 19.289  17.632  1.00 22.68  ? 183 HIS A O   1 
ATOM   3083 C  CB  . HIS C 1 164 ? -15.576 17.193  15.423  1.00 21.96  ? 183 HIS A CB  1 
ATOM   3084 C  CG  . HIS C 1 164 ? -14.180 16.655  15.449  1.00 22.17  ? 183 HIS A CG  1 
ATOM   3085 N  ND1 . HIS C 1 164 ? -13.901 15.318  15.626  1.00 22.01  ? 183 HIS A ND1 1 
ATOM   3086 C  CD2 . HIS C 1 164 ? -12.983 17.274  15.315  1.00 22.74  ? 183 HIS A CD2 1 
ATOM   3087 C  CE1 . HIS C 1 164 ? -12.593 15.136  15.602  1.00 22.91  ? 183 HIS A CE1 1 
ATOM   3088 N  NE2 . HIS C 1 164 ? -12.013 16.307  15.415  1.00 23.17  ? 183 HIS A NE2 1 
ATOM   3089 N  N   . VAL C 1 165 ? -14.721 17.370  18.710  1.00 34.32  ? 184 VAL A N   1 
ATOM   3090 C  CA  . VAL C 1 165 ? -13.894 18.012  19.725  1.00 35.23  ? 184 VAL A CA  1 
ATOM   3091 C  C   . VAL C 1 165 ? -12.619 17.214  19.980  1.00 35.11  ? 184 VAL A C   1 
ATOM   3092 O  O   . VAL C 1 165 ? -12.681 16.036  20.327  1.00 34.88  ? 184 VAL A O   1 
ATOM   3093 C  CB  . VAL C 1 165 ? -14.658 18.154  21.053  1.00 34.77  ? 184 VAL A CB  1 
ATOM   3094 C  CG1 . VAL C 1 165 ? -14.217 19.401  21.773  1.00 35.68  ? 184 VAL A CG1 1 
ATOM   3095 C  CG2 . VAL C 1 165 ? -16.153 18.209  20.799  1.00 33.65  ? 184 VAL A CG2 1 
ATOM   3096 N  N   . SER C 1 166 ? -11.467 17.858  19.816  1.00 24.81  ? 185 SER A N   1 
ATOM   3097 C  CA  . SER C 1 166 ? -10.188 17.163  19.954  1.00 25.63  ? 185 SER A CA  1 
ATOM   3098 C  C   . SER C 1 166 ? -9.230  17.834  20.938  1.00 26.60  ? 185 SER A C   1 
ATOM   3099 O  O   . SER C 1 166 ? -9.483  18.942  21.417  1.00 26.38  ? 185 SER A O   1 
ATOM   3100 C  CB  . SER C 1 166 ? -9.512  17.006  18.589  1.00 25.00  ? 185 SER A CB  1 
ATOM   3101 O  OG  . SER C 1 166 ? -9.153  18.266  18.051  1.00 25.28  ? 185 SER A OG  1 
ATOM   3102 N  N   . VAL C 1 167 ? -8.127  17.147  21.227  1.00 38.66  ? 186 VAL A N   1 
ATOM   3103 C  CA  . VAL C 1 167 ? -7.120  17.640  22.163  1.00 39.68  ? 186 VAL A CA  1 
ATOM   3104 C  C   . VAL C 1 167 ? -5.700  17.452  21.627  1.00 40.53  ? 186 VAL A C   1 
ATOM   3105 O  O   . VAL C 1 167 ? -5.453  16.590  20.781  1.00 40.04  ? 186 VAL A O   1 
ATOM   3106 C  CB  . VAL C 1 167 ? -7.221  16.917  23.522  1.00 39.37  ? 186 VAL A CB  1 
ATOM   3107 C  CG1 . VAL C 1 167 ? -8.580  17.165  24.157  1.00 39.12  ? 186 VAL A CG1 1 
ATOM   3108 C  CG2 . VAL C 1 167 ? -6.970  15.428  23.350  1.00 39.18  ? 186 VAL A CG2 1 
ATOM   3109 N  N   . LYS C 1 168 ? -4.772  18.268  22.124  1.00 45.38  ? 187 LYS A N   1 
ATOM   3110 C  CA  . LYS C 1 168 ? -3.361  18.161  21.759  1.00 45.72  ? 187 LYS A CA  1 
ATOM   3111 C  C   . LYS C 1 168 ? -2.776  16.857  22.304  1.00 45.48  ? 187 LYS A C   1 
ATOM   3112 O  O   . LYS C 1 168 ? -3.352  16.239  23.199  1.00 45.52  ? 187 LYS A O   1 
ATOM   3113 C  CB  . LYS C 1 168 ? -2.567  19.360  22.303  1.00 45.95  ? 187 LYS A CB  1 
ATOM   3114 C  CG  . LYS C 1 168 ? -3.051  20.735  21.824  1.00 46.31  ? 187 LYS A CG  1 
ATOM   3115 C  CD  . LYS C 1 168 ? -2.283  21.868  22.517  1.00 46.93  ? 187 LYS A CD  1 
ATOM   3116 C  CE  . LYS C 1 168 ? -2.919  23.238  22.276  1.00 46.61  ? 187 LYS A CE  1 
ATOM   3117 N  NZ  . LYS C 1 168 ? -2.867  23.657  20.847  1.00 47.07  ? 187 LYS A NZ  1 
ATOM   3118 N  N   . ALA C 1 169 ? -1.634  16.449  21.758  1.00 45.83  ? 188 ALA A N   1 
ATOM   3119 C  CA  . ALA C 1 169 ? -0.974  15.224  22.191  1.00 46.02  ? 188 ALA A CA  1 
ATOM   3120 C  C   . ALA C 1 169 ? -0.636  15.275  23.677  1.00 47.34  ? 188 ALA A C   1 
ATOM   3121 O  O   . ALA C 1 169 ? -0.464  16.352  24.248  1.00 47.90  ? 188 ALA A O   1 
ATOM   3122 C  CB  . ALA C 1 169 ? 0.281   14.979  21.368  1.00 48.00  ? 188 ALA A CB  1 
ATOM   3123 N  N   . ASP C 1 170 ? -0.541  14.103  24.298  1.00 68.54  ? 189 ASP A N   1 
ATOM   3124 C  CA  . ASP C 1 170 ? -0.224  14.011  25.718  1.00 69.75  ? 189 ASP A CA  1 
ATOM   3125 C  C   . ASP C 1 170 ? 1.273   13.822  25.938  1.00 70.33  ? 189 ASP A C   1 
ATOM   3126 O  O   . ASP C 1 170 ? 1.979   14.760  26.309  1.00 70.69  ? 189 ASP A O   1 
ATOM   3127 C  CB  . ASP C 1 170 ? -1.000  12.864  26.368  1.00 50.64  ? 189 ASP A CB  1 
ATOM   3128 C  CG  . ASP C 1 170 ? -2.228  13.341  27.116  1.00 50.54  ? 189 ASP A CG  1 
ATOM   3129 O  OD1 . ASP C 1 170 ? -2.075  14.140  28.065  1.00 50.95  ? 189 ASP A OD1 1 
ATOM   3130 O  OD2 . ASP C 1 170 ? -3.347  12.919  26.757  1.00 50.07  ? 189 ASP A OD2 1 
ATOM   3131 N  N   . GLY D 2 7   ? -16.743 -12.994 10.848  1.00 54.59  ? 829 GLY D N   1 
ATOM   3132 C  CA  . GLY D 2 7   ? -17.479 -11.844 10.352  1.00 53.56  ? 829 GLY D CA  1 
ATOM   3133 C  C   . GLY D 2 7   ? -16.712 -11.069 9.296   1.00 51.97  ? 829 GLY D C   1 
ATOM   3134 O  O   . GLY D 2 7   ? -15.481 -11.092 9.282   1.00 51.92  ? 829 GLY D O   1 
ATOM   3135 N  N   . PRO D 2 8   ? -17.439 -10.378 8.402   1.00 50.24  ? 830 PRO D N   1 
ATOM   3136 C  CA  . PRO D 2 8   ? -16.849 -9.600  7.305   1.00 47.72  ? 830 PRO D CA  1 
ATOM   3137 C  C   . PRO D 2 8   ? -16.170 -8.331  7.805   1.00 45.64  ? 830 PRO D C   1 
ATOM   3138 O  O   . PRO D 2 8   ? -16.141 -8.078  9.008   1.00 45.57  ? 830 PRO D O   1 
ATOM   3139 C  CB  . PRO D 2 8   ? -18.062 -9.224  6.444   1.00 45.96  ? 830 PRO D CB  1 
ATOM   3140 C  CG  . PRO D 2 8   ? -19.179 -10.110 6.906   1.00 49.10  ? 830 PRO D CG  1 
ATOM   3141 C  CD  . PRO D 2 8   ? -18.909 -10.366 8.352   1.00 50.05  ? 830 PRO D CD  1 
ATOM   3142 N  N   . HIS D 2 9   ? -15.628 -7.544  6.883   1.00 55.85  ? 831 HIS D N   1 
ATOM   3143 C  CA  . HIS D 2 9   ? -15.029 -6.265  7.236   1.00 55.43  ? 831 HIS D CA  1 
ATOM   3144 C  C   . HIS D 2 9   ? -15.417 -5.183  6.239   1.00 54.37  ? 831 HIS D C   1 
ATOM   3145 O  O   . HIS D 2 9   ? -15.096 -5.275  5.055   1.00 54.42  ? 831 HIS D O   1 
ATOM   3146 C  CB  . HIS D 2 9   ? -13.505 -6.375  7.316   1.00 55.32  ? 831 HIS D CB  1 
ATOM   3147 C  CG  . HIS D 2 9   ? -12.821 -5.069  7.578   1.00 54.94  ? 831 HIS D CG  1 
ATOM   3148 N  ND1 . HIS D 2 9   ? -12.538 -4.617  8.850   1.00 55.28  ? 831 HIS D ND1 1 
ATOM   3149 C  CD2 . HIS D 2 9   ? -12.370 -4.113  6.732   1.00 54.47  ? 831 HIS D CD2 1 
ATOM   3150 C  CE1 . HIS D 2 9   ? -11.939 -3.442  8.775   1.00 55.29  ? 831 HIS D CE1 1 
ATOM   3151 N  NE2 . HIS D 2 9   ? -11.825 -3.113  7.501   1.00 55.94  ? 831 HIS D NE2 1 
ATOM   3152 N  N   . ILE D 2 10  ? -16.111 -4.159  6.723   1.00 35.13  ? 832 ILE D N   1 
ATOM   3153 C  CA  . ILE D 2 10  ? -16.512 -3.044  5.877   1.00 34.02  ? 832 ILE D CA  1 
ATOM   3154 C  C   . ILE D 2 10  ? -15.315 -2.148  5.587   1.00 33.83  ? 832 ILE D C   1 
ATOM   3155 O  O   . ILE D 2 10  ? -14.670 -1.640  6.505   1.00 33.34  ? 832 ILE D O   1 
ATOM   3156 C  CB  . ILE D 2 10  ? -17.635 -2.218  6.529   1.00 33.32  ? 832 ILE D CB  1 
ATOM   3157 C  CG1 . ILE D 2 10  ? -18.804 -3.126  6.915   1.00 33.67  ? 832 ILE D CG1 1 
ATOM   3158 C  CG2 . ILE D 2 10  ? -18.099 -1.113  5.592   1.00 32.58  ? 832 ILE D CG2 1 
ATOM   3159 C  CD1 . ILE D 2 10  ? -19.978 -2.390  7.517   1.00 32.99  ? 832 ILE D CD1 1 
ATOM   3160 N  N   . ALA D 2 11  ? -15.021 -1.967  4.304   1.00 34.94  ? 833 ALA D N   1 
ATOM   3161 C  CA  . ALA D 2 11  ? -13.883 -1.160  3.883   1.00 33.94  ? 833 ALA D CA  1 
ATOM   3162 C  C   . ALA D 2 11  ? -14.186 0.329   3.999   1.00 33.40  ? 833 ALA D C   1 
ATOM   3163 O  O   . ALA D 2 11  ? -13.366 1.102   4.493   1.00 33.77  ? 833 ALA D O   1 
ATOM   3164 C  CB  . ALA D 2 11  ? -13.485 -1.513  2.458   1.00 34.14  ? 833 ALA D CB  1 
ATOM   3165 N  N   . TYR D 2 12  ? -15.369 0.725   3.544   1.00 33.86  ? 834 TYR D N   1 
ATOM   3166 C  CA  . TYR D 2 12  ? -15.782 2.121   3.614   1.00 33.02  ? 834 TYR D CA  1 
ATOM   3167 C  C   . TYR D 2 12  ? -17.276 2.261   3.363   1.00 31.76  ? 834 TYR D C   1 
ATOM   3168 O  O   . TYR D 2 12  ? -17.909 1.368   2.802   1.00 31.28  ? 834 TYR D O   1 
ATOM   3169 C  CB  . TYR D 2 12  ? -15.004 2.968   2.603   1.00 32.95  ? 834 TYR D CB  1 
ATOM   3170 C  CG  . TYR D 2 12  ? -15.322 2.643   1.160   1.00 32.70  ? 834 TYR D CG  1 
ATOM   3171 C  CD1 . TYR D 2 12  ? -14.551 1.734   0.447   1.00 33.43  ? 834 TYR D CD1 1 
ATOM   3172 C  CD2 . TYR D 2 12  ? -16.393 3.244   0.512   1.00 32.24  ? 834 TYR D CD2 1 
ATOM   3173 C  CE1 . TYR D 2 12  ? -14.838 1.431   -0.870  1.00 33.06  ? 834 TYR D CE1 1 
ATOM   3174 C  CE2 . TYR D 2 12  ? -16.688 2.947   -0.807  1.00 32.89  ? 834 TYR D CE2 1 
ATOM   3175 C  CZ  . TYR D 2 12  ? -15.906 2.040   -1.492  1.00 33.06  ? 834 TYR D CZ  1 
ATOM   3176 O  OH  . TYR D 2 12  ? -16.192 1.741   -2.802  1.00 32.09  ? 834 TYR D OH  1 
ATOM   3177 N  N   . THR D 2 13  ? -17.831 3.390   3.787   1.00 22.94  ? 835 THR D N   1 
ATOM   3178 C  CA  . THR D 2 13  ? -19.222 3.715   3.511   1.00 22.72  ? 835 THR D CA  1 
ATOM   3179 C  C   . THR D 2 13  ? -19.308 5.156   3.030   1.00 22.33  ? 835 THR D C   1 
ATOM   3180 O  O   . THR D 2 13  ? -18.870 6.072   3.722   1.00 22.99  ? 835 THR D O   1 
ATOM   3181 C  CB  . THR D 2 13  ? -20.110 3.553   4.757   1.00 21.65  ? 835 THR D CB  1 
ATOM   3182 O  OG1 . THR D 2 13  ? -19.619 4.393   5.809   1.00 20.83  ? 835 THR D OG1 1 
ATOM   3183 C  CG2 . THR D 2 13  ? -20.117 2.107   5.226   1.00 22.74  ? 835 THR D CG2 1 
ATOM   3184 N  N   . GLU D 2 14  ? -19.859 5.351   1.837   1.00 26.65  ? 836 GLU D N   1 
ATOM   3185 C  CA  . GLU D 2 14  ? -20.028 6.693   1.297   1.00 27.60  ? 836 GLU D CA  1 
ATOM   3186 C  C   . GLU D 2 14  ? -21.432 6.911   0.748   1.00 27.98  ? 836 GLU D C   1 
ATOM   3187 O  O   . GLU D 2 14  ? -22.012 6.021   0.131   1.00 27.93  ? 836 GLU D O   1 
ATOM   3188 C  CB  . GLU D 2 14  ? -18.980 6.986   0.223   1.00 28.41  ? 836 GLU D CB  1 
ATOM   3189 C  CG  . GLU D 2 14  ? -17.573 7.152   0.767   1.00 28.91  ? 836 GLU D CG  1 
ATOM   3190 C  CD  . GLU D 2 14  ? -16.851 8.331   0.146   1.00 30.90  ? 836 GLU D CD  1 
ATOM   3191 O  OE1 . GLU D 2 14  ? -17.526 9.173   -0.484  1.00 31.19  ? 836 GLU D OE1 1 
ATOM   3192 O  OE2 . GLU D 2 14  ? -15.614 8.425   0.295   1.00 31.68  ? 836 GLU D OE2 1 
ATOM   3193 N  N   . ALA D 2 15  ? -21.969 8.105   0.980   1.00 55.36  ? 837 ALA D N   1 
ATOM   3194 C  CA  . ALA D 2 15  ? -23.321 8.439   0.549   1.00 56.17  ? 837 ALA D CA  1 
ATOM   3195 C  C   . ALA D 2 15  ? -23.373 8.731   -0.946  1.00 57.18  ? 837 ALA D C   1 
ATOM   3196 O  O   . ALA D 2 15  ? -22.488 9.395   -1.489  1.00 57.22  ? 837 ALA D O   1 
ATOM   3197 C  CB  . ALA D 2 15  ? -23.849 9.627   1.341   1.00 55.62  ? 837 ALA D CB  1 
ATOM   3198 N  N   . VAL D 2 16  ? -24.415 8.231   -1.607  1.00 43.41  ? 838 VAL D N   1 
ATOM   3199 C  CA  . VAL D 2 16  ? -24.579 8.444   -3.041  1.00 43.49  ? 838 VAL D CA  1 
ATOM   3200 C  C   . VAL D 2 16  ? -25.713 9.425   -3.324  1.00 44.34  ? 838 VAL D C   1 
ATOM   3201 O  O   . VAL D 2 16  ? -25.812 9.974   -4.423  1.00 44.69  ? 838 VAL D O   1 
ATOM   3202 C  CB  . VAL D 2 16  ? -24.850 7.126   -3.794  1.00 42.53  ? 838 VAL D CB  1 
ATOM   3203 C  CG1 . VAL D 2 16  ? -23.954 6.017   -3.262  1.00 42.08  ? 838 VAL D CG1 1 
ATOM   3204 C  CG2 . VAL D 2 16  ? -26.311 6.736   -3.674  1.00 41.85  ? 838 VAL D CG2 1 
ATOM   3205 N  N   . SER D 2 17  ? -26.567 9.643   -2.329  1.00 30.86  ? 839 SER D N   1 
ATOM   3206 C  CA  . SER D 2 17  ? -27.667 10.588  -2.467  1.00 30.26  ? 839 SER D CA  1 
ATOM   3207 C  C   . SER D 2 17  ? -28.167 11.046  -1.106  1.00 31.07  ? 839 SER D C   1 
ATOM   3208 O  O   . SER D 2 17  ? -27.511 10.830  -0.086  1.00 30.87  ? 839 SER D O   1 
ATOM   3209 C  CB  . SER D 2 17  ? -28.818 9.968   -3.260  1.00 29.84  ? 839 SER D CB  1 
ATOM   3210 O  OG  . SER D 2 17  ? -29.506 9.001   -2.487  1.00 29.86  ? 839 SER D OG  1 
ATOM   3211 N  N   . ASP D 2 18  ? -29.335 11.679  -1.103  1.00 37.05  ? 840 ASP D N   1 
ATOM   3212 C  CA  . ASP D 2 18  ? -29.954 12.151  0.128   1.00 36.35  ? 840 ASP D CA  1 
ATOM   3213 C  C   . ASP D 2 18  ? -30.758 11.039  0.791   1.00 35.76  ? 840 ASP D C   1 
ATOM   3214 O  O   . ASP D 2 18  ? -31.292 11.213  1.885   1.00 35.40  ? 840 ASP D O   1 
ATOM   3215 C  CB  . ASP D 2 18  ? -30.859 13.352  -0.155  1.00 36.72  ? 840 ASP D CB  1 
ATOM   3216 C  CG  . ASP D 2 18  ? -31.993 13.020  -1.116  1.00 37.31  ? 840 ASP D CG  1 
ATOM   3217 O  OD1 . ASP D 2 18  ? -31.944 11.946  -1.756  1.00 37.34  ? 840 ASP D OD1 1 
ATOM   3218 O  OD2 . ASP D 2 18  ? -32.933 13.835  -1.234  1.00 36.37  ? 840 ASP D OD2 1 
ATOM   3219 N  N   . THR D 2 19  ? -30.839 9.893   0.122   1.00 30.35  ? 841 THR D N   1 
ATOM   3220 C  CA  . THR D 2 19  ? -31.630 8.773   0.618   1.00 30.34  ? 841 THR D CA  1 
ATOM   3221 C  C   . THR D 2 19  ? -30.906 7.440   0.464   1.00 30.36  ? 841 THR D C   1 
ATOM   3222 O  O   . THR D 2 19  ? -31.486 6.382   0.709   1.00 30.18  ? 841 THR D O   1 
ATOM   3223 C  CB  . THR D 2 19  ? -32.981 8.670   -0.118  1.00 30.80  ? 841 THR D CB  1 
ATOM   3224 O  OG1 . THR D 2 19  ? -32.752 8.414   -1.510  1.00 31.42  ? 841 THR D OG1 1 
ATOM   3225 C  CG2 . THR D 2 19  ? -33.774 9.958   0.033   1.00 30.90  ? 841 THR D CG2 1 
ATOM   3226 N  N   . GLN D 2 20  ? -29.641 7.490   0.059   1.00 45.67  ? 842 GLN D N   1 
ATOM   3227 C  CA  . GLN D 2 20  ? -28.894 6.269   -0.223  1.00 45.67  ? 842 GLN D CA  1 
ATOM   3228 C  C   . GLN D 2 20  ? -27.467 6.293   0.311   1.00 45.92  ? 842 GLN D C   1 
ATOM   3229 O  O   . GLN D 2 20  ? -26.793 7.324   0.273   1.00 46.08  ? 842 GLN D O   1 
ATOM   3230 C  CB  . GLN D 2 20  ? -28.872 5.999   -1.727  1.00 45.95  ? 842 GLN D CB  1 
ATOM   3231 C  CG  . GLN D 2 20  ? -30.233 5.734   -2.336  1.00 46.00  ? 842 GLN D CG  1 
ATOM   3232 C  CD  . GLN D 2 20  ? -30.236 5.928   -3.834  1.00 45.61  ? 842 GLN D CD  1 
ATOM   3233 O  OE1 . GLN D 2 20  ? -29.618 6.859   -4.351  1.00 45.08  ? 842 GLN D OE1 1 
ATOM   3234 N  NE2 . GLN D 2 20  ? -30.938 5.053   -4.542  1.00 47.90  ? 842 GLN D NE2 1 
ATOM   3235 N  N   . ILE D 2 21  ? -27.016 5.141   0.798   1.00 38.79  ? 843 ILE D N   1 
ATOM   3236 C  CA  . ILE D 2 21  ? -25.654 4.981   1.298   1.00 38.96  ? 843 ILE D CA  1 
ATOM   3237 C  C   . ILE D 2 21  ? -25.019 3.700   0.756   1.00 39.19  ? 843 ILE D C   1 
ATOM   3238 O  O   . ILE D 2 21  ? -25.641 2.638   0.753   1.00 40.17  ? 843 ILE D O   1 
ATOM   3239 C  CB  . ILE D 2 21  ? -25.612 4.970   2.838   1.00 38.89  ? 843 ILE D CB  1 
ATOM   3240 C  CG1 . ILE D 2 21  ? -25.988 6.348   3.388   1.00 38.82  ? 843 ILE D CG1 1 
ATOM   3241 C  CG2 . ILE D 2 21  ? -24.235 4.560   3.334   1.00 38.63  ? 843 ILE D CG2 1 
ATOM   3242 C  CD1 . ILE D 2 21  ? -26.017 6.418   4.902   1.00 37.80  ? 843 ILE D CD1 1 
ATOM   3243 N  N   . MET D 2 22  ? -23.778 3.812   0.296   1.00 37.54  ? 844 MET D N   1 
ATOM   3244 C  CA  . MET D 2 22  ? -23.062 2.687   -0.294  1.00 37.57  ? 844 MET D CA  1 
ATOM   3245 C  C   . MET D 2 22  ? -22.015 2.132   0.668   1.00 38.45  ? 844 MET D C   1 
ATOM   3246 O  O   . MET D 2 22  ? -21.233 2.886   1.249   1.00 37.96  ? 844 MET D O   1 
ATOM   3247 C  CB  . MET D 2 22  ? -22.395 3.122   -1.603  1.00 37.72  ? 844 MET D CB  1 
ATOM   3248 C  CG  . MET D 2 22  ? -21.372 2.139   -2.155  1.00 37.92  ? 844 MET D CG  1 
ATOM   3249 S  SD  . MET D 2 22  ? -22.117 0.692   -2.931  1.00 38.25  ? 844 MET D SD  1 
ATOM   3250 C  CE  . MET D 2 22  ? -22.987 1.453   -4.297  1.00 38.59  ? 844 MET D CE  1 
ATOM   3251 N  N   . LEU D 2 23  ? -22.001 0.813   0.833   1.00 32.53  ? 845 LEU D N   1 
ATOM   3252 C  CA  . LEU D 2 23  ? -21.005 0.169   1.684   1.00 32.19  ? 845 LEU D CA  1 
ATOM   3253 C  C   . LEU D 2 23  ? -20.284 -0.961  0.955   1.00 32.26  ? 845 LEU D C   1 
ATOM   3254 O  O   . LEU D 2 23  ? -20.913 -1.857  0.395   1.00 33.06  ? 845 LEU D O   1 
ATOM   3255 C  CB  . LEU D 2 23  ? -21.636 -0.352  2.980   1.00 31.41  ? 845 LEU D CB  1 
ATOM   3256 C  CG  . LEU D 2 23  ? -22.565 -1.562  2.873   1.00 32.15  ? 845 LEU D CG  1 
ATOM   3257 C  CD1 . LEU D 2 23  ? -22.688 -2.263  4.216   1.00 33.11  ? 845 LEU D CD1 1 
ATOM   3258 C  CD2 . LEU D 2 23  ? -23.934 -1.158  2.342   1.00 33.30  ? 845 LEU D CD2 1 
ATOM   3259 N  N   . LYS D 2 24  ? -18.957 -0.903  0.962   1.00 36.70  ? 846 LYS D N   1 
ATOM   3260 C  CA  . LYS D 2 24  ? -18.141 -1.936  0.344   1.00 37.47  ? 846 LYS D CA  1 
ATOM   3261 C  C   . LYS D 2 24  ? -17.424 -2.726  1.430   1.00 39.65  ? 846 LYS D C   1 
ATOM   3262 O  O   . LYS D 2 24  ? -16.769 -2.147  2.296   1.00 39.09  ? 846 LYS D O   1 
ATOM   3263 C  CB  . LYS D 2 24  ? -17.133 -1.309  -0.622  1.00 37.28  ? 846 LYS D CB  1 
ATOM   3264 C  CG  . LYS D 2 24  ? -16.399 -2.307  -1.506  1.00 38.68  ? 846 LYS D CG  1 
ATOM   3265 C  CD  . LYS D 2 24  ? -15.260 -2.985  -0.761  1.00 40.02  ? 846 LYS D CD  1 
ATOM   3266 C  CE  . LYS D 2 24  ? -14.648 -4.098  -1.591  1.00 41.21  ? 846 LYS D CE  1 
ATOM   3267 N  NZ  . LYS D 2 24  ? -15.669 -5.103  -1.997  1.00 41.75  ? 846 LYS D NZ  1 
ATOM   3268 N  N   . TRP D 2 25  ? -17.554 -4.049  1.385   1.00 40.39  ? 847 TRP D N   1 
ATOM   3269 C  CA  . TRP D 2 25  ? -16.967 -4.904  2.410   1.00 40.42  ? 847 TRP D CA  1 
ATOM   3270 C  C   . TRP D 2 25  ? -16.097 -6.004  1.814   1.00 41.54  ? 847 TRP D C   1 
ATOM   3271 O  O   . TRP D 2 25  ? -16.098 -6.227  0.604   1.00 42.36  ? 847 TRP D O   1 
ATOM   3272 C  CB  . TRP D 2 25  ? -18.062 -5.530  3.272   1.00 41.19  ? 847 TRP D CB  1 
ATOM   3273 C  CG  . TRP D 2 25  ? -18.868 -6.560  2.549   1.00 41.42  ? 847 TRP D CG  1 
ATOM   3274 C  CD1 . TRP D 2 25  ? -18.555 -7.877  2.383   1.00 42.28  ? 847 TRP D CD1 1 
ATOM   3275 C  CD2 . TRP D 2 25  ? -20.125 -6.360  1.893   1.00 41.22  ? 847 TRP D CD2 1 
ATOM   3276 N  NE1 . TRP D 2 25  ? -19.540 -8.509  1.663   1.00 43.42  ? 847 TRP D NE1 1 
ATOM   3277 C  CE2 . TRP D 2 25  ? -20.515 -7.599  1.351   1.00 42.47  ? 847 TRP D CE2 1 
ATOM   3278 C  CE3 . TRP D 2 25  ? -20.959 -5.252  1.713   1.00 40.47  ? 847 TRP D CE3 1 
ATOM   3279 C  CZ2 . TRP D 2 25  ? -21.702 -7.763  0.641   1.00 43.15  ? 847 TRP D CZ2 1 
ATOM   3280 C  CZ3 . TRP D 2 25  ? -22.137 -5.417  1.008   1.00 40.10  ? 847 TRP D CZ3 1 
ATOM   3281 C  CH2 . TRP D 2 25  ? -22.498 -6.662  0.480   1.00 42.09  ? 847 TRP D CH2 1 
ATOM   3282 N  N   . THR D 2 26  ? -15.360 -6.693  2.680   1.00 41.92  ? 848 THR D N   1 
ATOM   3283 C  CA  . THR D 2 26  ? -14.474 -7.772  2.261   1.00 42.40  ? 848 THR D CA  1 
ATOM   3284 C  C   . THR D 2 26  ? -14.667 -9.013  3.132   1.00 44.12  ? 848 THR D C   1 
ATOM   3285 O  O   . THR D 2 26  ? -15.153 -8.924  4.260   1.00 44.21  ? 848 THR D O   1 
ATOM   3286 C  CB  . THR D 2 26  ? -12.998 -7.335  2.312   1.00 40.50  ? 848 THR D CB  1 
ATOM   3287 O  OG1 . THR D 2 26  ? -12.675 -6.882  3.632   1.00 39.93  ? 848 THR D OG1 1 
ATOM   3288 C  CG2 . THR D 2 26  ? -12.744 -6.208  1.324   1.00 40.79  ? 848 THR D CG2 1 
ATOM   3289 N  N   . TYR D 2 27  ? -14.284 -10.171 2.603   1.00 64.12  ? 849 TYR D N   1 
ATOM   3290 C  CA  . TYR D 2 27  ? -14.440 -11.429 3.324   1.00 65.53  ? 849 TYR D CA  1 
ATOM   3291 C  C   . TYR D 2 27  ? -13.257 -12.365 3.084   1.00 66.45  ? 849 TYR D C   1 
ATOM   3292 O  O   . TYR D 2 27  ? -13.373 -13.362 2.370   1.00 65.68  ? 849 TYR D O   1 
ATOM   3293 C  CB  . TYR D 2 27  ? -15.750 -12.111 2.920   1.00 66.82  ? 849 TYR D CB  1 
ATOM   3294 C  CG  . TYR D 2 27  ? -16.118 -13.292 3.786   1.00 69.45  ? 849 TYR D CG  1 
ATOM   3295 C  CD1 . TYR D 2 27  ? -16.543 -13.110 5.097   1.00 68.99  ? 849 TYR D CD1 1 
ATOM   3296 C  CD2 . TYR D 2 27  ? -16.045 -14.590 3.296   1.00 71.48  ? 849 TYR D CD2 1 
ATOM   3297 C  CE1 . TYR D 2 27  ? -16.882 -14.186 5.894   1.00 71.14  ? 849 TYR D CE1 1 
ATOM   3298 C  CE2 . TYR D 2 27  ? -16.383 -15.675 4.087   1.00 72.66  ? 849 TYR D CE2 1 
ATOM   3299 C  CZ  . TYR D 2 27  ? -16.800 -15.465 5.386   1.00 74.07  ? 849 TYR D CZ  1 
ATOM   3300 O  OH  . TYR D 2 27  ? -17.139 -16.536 6.181   1.00 76.52  ? 849 TYR D OH  1 
ATOM   3301 N  N   . ILE D 2 37  ? -21.427 -20.152 2.422   1.00 78.79  ? 859 ILE D N   1 
ATOM   3302 C  CA  . ILE D 2 37  ? -21.955 -18.816 2.674   1.00 80.74  ? 859 ILE D CA  1 
ATOM   3303 C  C   . ILE D 2 37  ? -23.205 -18.553 1.838   1.00 79.81  ? 859 ILE D C   1 
ATOM   3304 O  O   . ILE D 2 37  ? -23.155 -18.581 0.608   1.00 78.61  ? 859 ILE D O   1 
ATOM   3305 C  CB  . ILE D 2 37  ? -20.905 -17.720 2.377   1.00 81.64  ? 859 ILE D CB  1 
ATOM   3306 C  CG1 . ILE D 2 37  ? -19.671 -17.890 3.270   1.00 82.32  ? 859 ILE D CG1 1 
ATOM   3307 C  CG2 . ILE D 2 37  ? -21.513 -16.335 2.566   1.00 77.73  ? 859 ILE D CG2 1 
ATOM   3308 C  CD1 . ILE D 2 37  ? -18.698 -18.957 2.798   1.00 80.83  ? 859 ILE D CD1 1 
ATOM   3309 N  N   . GLN D 2 38  ? -24.321 -18.295 2.511   1.00 73.26  ? 860 GLN D N   1 
ATOM   3310 C  CA  . GLN D 2 38  ? -25.592 -18.062 1.829   1.00 73.08  ? 860 GLN D CA  1 
ATOM   3311 C  C   . GLN D 2 38  ? -25.796 -16.600 1.433   1.00 72.22  ? 860 GLN D C   1 
ATOM   3312 O  O   . GLN D 2 38  ? -26.439 -16.308 0.423   1.00 71.64  ? 860 GLN D O   1 
ATOM   3313 C  CB  . GLN D 2 38  ? -26.762 -18.540 2.692   1.00 74.85  ? 860 GLN D CB  1 
ATOM   3314 C  CG  . GLN D 2 38  ? -26.963 -20.047 2.689   1.00 77.18  ? 860 GLN D CG  1 
ATOM   3315 C  CD  . GLN D 2 38  ? -28.215 -20.468 3.435   1.00 78.35  ? 860 GLN D CD  1 
ATOM   3316 O  OE1 . GLN D 2 38  ? -28.558 -19.893 4.470   1.00 77.83  ? 860 GLN D OE1 1 
ATOM   3317 N  NE2 . GLN D 2 38  ? -28.903 -21.479 2.914   1.00 78.56  ? 860 GLN D NE2 1 
ATOM   3318 N  N   . GLY D 2 39  ? -25.250 -15.685 2.229   1.00 70.29  ? 861 GLY D N   1 
ATOM   3319 C  CA  . GLY D 2 39  ? -25.391 -14.265 1.957   1.00 67.35  ? 861 GLY D CA  1 
ATOM   3320 C  C   . GLY D 2 39  ? -24.943 -13.390 3.112   1.00 65.79  ? 861 GLY D C   1 
ATOM   3321 O  O   . GLY D 2 39  ? -24.139 -13.808 3.943   1.00 66.26  ? 861 GLY D O   1 
ATOM   3322 N  N   . PHE D 2 40  ? -25.470 -12.170 3.164   1.00 44.86  ? 862 PHE D N   1 
ATOM   3323 C  CA  . PHE D 2 40  ? -25.100 -11.223 4.209   1.00 43.79  ? 862 PHE D CA  1 
ATOM   3324 C  C   . PHE D 2 40  ? -26.316 -10.505 4.787   1.00 43.00  ? 862 PHE D C   1 
ATOM   3325 O  O   . PHE D 2 40  ? -27.316 -10.297 4.098   1.00 42.29  ? 862 PHE D O   1 
ATOM   3326 C  CB  . PHE D 2 40  ? -24.114 -10.186 3.670   1.00 42.05  ? 862 PHE D CB  1 
ATOM   3327 C  CG  . PHE D 2 40  ? -22.916 -10.778 2.992   1.00 42.35  ? 862 PHE D CG  1 
ATOM   3328 C  CD1 . PHE D 2 40  ? -22.879 -10.912 1.614   1.00 42.32  ? 862 PHE D CD1 1 
ATOM   3329 C  CD2 . PHE D 2 40  ? -21.819 -11.194 3.730   1.00 43.06  ? 862 PHE D CD2 1 
ATOM   3330 C  CE1 . PHE D 2 40  ? -21.774 -11.454 0.984   1.00 42.47  ? 862 PHE D CE1 1 
ATOM   3331 C  CE2 . PHE D 2 40  ? -20.712 -11.737 3.105   1.00 43.66  ? 862 PHE D CE2 1 
ATOM   3332 C  CZ  . PHE D 2 40  ? -20.689 -11.867 1.731   1.00 42.75  ? 862 PHE D CZ  1 
ATOM   3333 N  N   . TYR D 2 41  ? -26.215 -10.125 6.057   1.00 49.89  ? 863 TYR D N   1 
ATOM   3334 C  CA  . TYR D 2 41  ? -27.230 -9.302  6.703   1.00 49.00  ? 863 TYR D CA  1 
ATOM   3335 C  C   . TYR D 2 41  ? -26.672 -7.909  6.984   1.00 47.05  ? 863 TYR D C   1 
ATOM   3336 O  O   . TYR D 2 41  ? -25.763 -7.751  7.798   1.00 45.98  ? 863 TYR D O   1 
ATOM   3337 C  CB  . TYR D 2 41  ? -27.695 -9.937  8.014   1.00 49.60  ? 863 TYR D CB  1 
ATOM   3338 C  CG  . TYR D 2 41  ? -28.526 -11.188 7.855   1.00 50.70  ? 863 TYR D CG  1 
ATOM   3339 C  CD1 . TYR D 2 41  ? -28.193 -12.355 8.531   1.00 52.84  ? 863 TYR D CD1 1 
ATOM   3340 C  CD2 . TYR D 2 41  ? -29.647 -11.203 7.035   1.00 50.91  ? 863 TYR D CD2 1 
ATOM   3341 C  CE1 . TYR D 2 41  ? -28.954 -13.502 8.397   1.00 54.42  ? 863 TYR D CE1 1 
ATOM   3342 C  CE2 . TYR D 2 41  ? -30.414 -12.346 6.892   1.00 52.06  ? 863 TYR D CE2 1 
ATOM   3343 C  CZ  . TYR D 2 41  ? -30.062 -13.492 7.575   1.00 53.71  ? 863 TYR D CZ  1 
ATOM   3344 O  OH  . TYR D 2 41  ? -30.819 -14.633 7.438   1.00 53.71  ? 863 TYR D OH  1 
ATOM   3345 N  N   . ILE D 2 42  ? -27.215 -6.903  6.307   1.00 42.14  ? 864 ILE D N   1 
ATOM   3346 C  CA  . ILE D 2 42  ? -26.788 -5.525  6.525   1.00 40.55  ? 864 ILE D CA  1 
ATOM   3347 C  C   . ILE D 2 42  ? -27.769 -4.791  7.431   1.00 39.87  ? 864 ILE D C   1 
ATOM   3348 O  O   . ILE D 2 42  ? -28.937 -4.613  7.085   1.00 39.32  ? 864 ILE D O   1 
ATOM   3349 C  CB  . ILE D 2 42  ? -26.634 -4.749  5.201   1.00 39.55  ? 864 ILE D CB  1 
ATOM   3350 C  CG1 . ILE D 2 42  ? -25.328 -5.134  4.502   1.00 40.34  ? 864 ILE D CG1 1 
ATOM   3351 C  CG2 . ILE D 2 42  ? -26.655 -3.254  5.459   1.00 38.28  ? 864 ILE D CG2 1 
ATOM   3352 C  CD1 . ILE D 2 42  ? -25.305 -6.547  3.962   1.00 42.71  ? 864 ILE D CD1 1 
ATOM   3353 N  N   . TYR D 2 43  ? -27.287 -4.373  8.596   1.00 38.98  ? 865 TYR D N   1 
ATOM   3354 C  CA  . TYR D 2 43  ? -28.121 -3.678  9.567   1.00 38.11  ? 865 TYR D CA  1 
ATOM   3355 C  C   . TYR D 2 43  ? -27.824 -2.186  9.563   1.00 36.93  ? 865 TYR D C   1 
ATOM   3356 O  O   . TYR D 2 43  ? -26.663 -1.780  9.555   1.00 36.98  ? 865 TYR D O   1 
ATOM   3357 C  CB  . TYR D 2 43  ? -27.901 -4.253  10.965  1.00 38.06  ? 865 TYR D CB  1 
ATOM   3358 C  CG  . TYR D 2 43  ? -28.178 -5.735  11.065  1.00 40.80  ? 865 TYR D CG  1 
ATOM   3359 C  CD1 . TYR D 2 43  ? -29.459 -6.207  11.326  1.00 41.27  ? 865 TYR D CD1 1 
ATOM   3360 C  CD2 . TYR D 2 43  ? -27.158 -6.665  10.897  1.00 41.68  ? 865 TYR D CD2 1 
ATOM   3361 C  CE1 . TYR D 2 43  ? -29.716 -7.562  11.418  1.00 42.24  ? 865 TYR D CE1 1 
ATOM   3362 C  CE2 . TYR D 2 43  ? -27.406 -8.022  10.987  1.00 42.36  ? 865 TYR D CE2 1 
ATOM   3363 C  CZ  . TYR D 2 43  ? -28.685 -8.464  11.247  1.00 43.45  ? 865 TYR D CZ  1 
ATOM   3364 O  OH  . TYR D 2 43  ? -28.935 -9.814  11.336  1.00 44.38  ? 865 TYR D OH  1 
ATOM   3365 N  N   . TYR D 2 44  ? -28.875 -1.373  9.564   1.00 44.40  ? 866 TYR D N   1 
ATOM   3366 C  CA  . TYR D 2 44  ? -28.715 0.077   9.602   1.00 43.85  ? 866 TYR D CA  1 
ATOM   3367 C  C   . TYR D 2 44  ? -29.724 0.751   10.530  1.00 43.39  ? 866 TYR D C   1 
ATOM   3368 O  O   . TYR D 2 44  ? -30.911 0.423   10.527  1.00 43.86  ? 866 TYR D O   1 
ATOM   3369 C  CB  . TYR D 2 44  ? -28.768 0.680   8.193   1.00 43.19  ? 866 TYR D CB  1 
ATOM   3370 C  CG  . TYR D 2 44  ? -29.879 0.147   7.315   1.00 45.26  ? 866 TYR D CG  1 
ATOM   3371 C  CD1 . TYR D 2 44  ? -31.036 0.887   7.102   1.00 45.61  ? 866 TYR D CD1 1 
ATOM   3372 C  CD2 . TYR D 2 44  ? -29.767 -1.089  6.690   1.00 45.64  ? 866 TYR D CD2 1 
ATOM   3373 C  CE1 . TYR D 2 44  ? -32.051 0.407   6.296   1.00 45.37  ? 866 TYR D CE1 1 
ATOM   3374 C  CE2 . TYR D 2 44  ? -30.779 -1.576  5.884   1.00 45.33  ? 866 TYR D CE2 1 
ATOM   3375 C  CZ  . TYR D 2 44  ? -31.917 -0.825  5.691   1.00 45.38  ? 866 TYR D CZ  1 
ATOM   3376 O  OH  . TYR D 2 44  ? -32.928 -1.304  4.891   1.00 46.88  ? 866 TYR D OH  1 
ATOM   3377 N  N   . ARG D 2 45  ? -29.233 1.696   11.326  1.00 27.28  ? 867 ARG D N   1 
ATOM   3378 C  CA  . ARG D 2 45  ? -30.033 2.344   12.357  1.00 26.74  ? 867 ARG D CA  1 
ATOM   3379 C  C   . ARG D 2 45  ? -29.648 3.814   12.474  1.00 25.66  ? 867 ARG D C   1 
ATOM   3380 O  O   . ARG D 2 45  ? -28.472 4.156   12.373  1.00 25.27  ? 867 ARG D O   1 
ATOM   3381 C  CB  . ARG D 2 45  ? -29.806 1.640   13.698  1.00 27.14  ? 867 ARG D CB  1 
ATOM   3382 C  CG  . ARG D 2 45  ? -30.458 2.309   14.897  1.00 26.73  ? 867 ARG D CG  1 
ATOM   3383 C  CD  . ARG D 2 45  ? -29.961 1.701   16.203  1.00 26.23  ? 867 ARG D CD  1 
ATOM   3384 N  NE  . ARG D 2 45  ? -28.576 2.066   16.491  1.00 25.52  ? 867 ARG D NE  1 
ATOM   3385 C  CZ  . ARG D 2 45  ? -27.866 1.575   17.501  1.00 26.05  ? 867 ARG D CZ  1 
ATOM   3386 N  NH1 . ARG D 2 45  ? -28.407 0.689   18.326  1.00 26.86  ? 867 ARG D NH1 1 
ATOM   3387 N  NH2 . ARG D 2 45  ? -26.612 1.966   17.688  1.00 24.83  ? 867 ARG D NH2 1 
ATOM   3388 N  N   . PRO D 2 46  ? -30.642 4.693   12.676  1.00 36.49  ? 868 PRO D N   1 
ATOM   3389 C  CA  . PRO D 2 46  ? -30.353 6.113   12.900  1.00 35.33  ? 868 PRO D CA  1 
ATOM   3390 C  C   . PRO D 2 46  ? -29.403 6.295   14.080  1.00 35.08  ? 868 PRO D C   1 
ATOM   3391 O  O   . PRO D 2 46  ? -29.668 5.782   15.165  1.00 35.26  ? 868 PRO D O   1 
ATOM   3392 C  CB  . PRO D 2 46  ? -31.728 6.699   13.230  1.00 35.22  ? 868 PRO D CB  1 
ATOM   3393 C  CG  . PRO D 2 46  ? -32.692 5.793   12.541  1.00 35.37  ? 868 PRO D CG  1 
ATOM   3394 C  CD  . PRO D 2 46  ? -32.089 4.420   12.632  1.00 36.87  ? 868 PRO D CD  1 
ATOM   3395 N  N   . THR D 2 47  ? -28.307 7.015   13.863  1.00 22.10  ? 869 THR D N   1 
ATOM   3396 C  CA  . THR D 2 47  ? -27.280 7.183   14.887  1.00 21.19  ? 869 THR D CA  1 
ATOM   3397 C  C   . THR D 2 47  ? -27.839 7.795   16.172  1.00 21.06  ? 869 THR D C   1 
ATOM   3398 O  O   . THR D 2 47  ? -27.211 7.725   17.228  1.00 21.09  ? 869 THR D O   1 
ATOM   3399 C  CB  . THR D 2 47  ? -26.110 8.040   14.365  1.00 21.37  ? 869 THR D CB  1 
ATOM   3400 O  OG1 . THR D 2 47  ? -25.647 7.507   13.120  1.00 21.19  ? 869 THR D OG1 1 
ATOM   3401 C  CG2 . THR D 2 47  ? -24.960 8.046   15.360  1.00 21.84  ? 869 THR D CG2 1 
ATOM   3402 N  N   . ASP D 2 48  ? -29.025 8.387   16.080  1.00 30.55  ? 870 ASP D N   1 
ATOM   3403 C  CA  . ASP D 2 48  ? -29.668 8.995   17.240  1.00 29.38  ? 870 ASP D CA  1 
ATOM   3404 C  C   . ASP D 2 48  ? -30.177 7.950   18.229  1.00 29.80  ? 870 ASP D C   1 
ATOM   3405 O  O   . ASP D 2 48  ? -30.612 8.287   19.330  1.00 29.79  ? 870 ASP D O   1 
ATOM   3406 C  CB  . ASP D 2 48  ? -30.816 9.906   16.803  1.00 29.02  ? 870 ASP D CB  1 
ATOM   3407 C  CG  . ASP D 2 48  ? -30.354 11.312  16.472  1.00 28.93  ? 870 ASP D CG  1 
ATOM   3408 O  OD1 . ASP D 2 48  ? -29.128 11.550  16.434  1.00 29.36  ? 870 ASP D OD1 1 
ATOM   3409 O  OD2 . ASP D 2 48  ? -31.222 12.182  16.254  1.00 28.70  ? 870 ASP D OD2 1 
ATOM   3410 N  N   . SER D 2 49  ? -30.120 6.682   17.834  1.00 23.28  ? 871 SER D N   1 
ATOM   3411 C  CA  . SER D 2 49  ? -30.588 5.600   18.692  1.00 23.49  ? 871 SER D CA  1 
ATOM   3412 C  C   . SER D 2 49  ? -29.444 4.766   19.256  1.00 24.73  ? 871 SER D C   1 
ATOM   3413 O  O   . SER D 2 49  ? -28.516 4.396   18.536  1.00 24.82  ? 871 SER D O   1 
ATOM   3414 C  CB  . SER D 2 49  ? -31.558 4.694   17.935  1.00 24.64  ? 871 SER D CB  1 
ATOM   3415 O  OG  . SER D 2 49  ? -31.875 3.546   18.702  1.00 26.44  ? 871 SER D OG  1 
ATOM   3416 N  N   . ASP D 2 50  ? -29.520 4.472   20.550  1.00 30.53  ? 872 ASP D N   1 
ATOM   3417 C  CA  . ASP D 2 50  ? -28.549 3.600   21.201  1.00 30.65  ? 872 ASP D CA  1 
ATOM   3418 C  C   . ASP D 2 50  ? -29.202 2.264   21.539  1.00 31.81  ? 872 ASP D C   1 
ATOM   3419 O  O   . ASP D 2 50  ? -28.724 1.522   22.399  1.00 31.76  ? 872 ASP D O   1 
ATOM   3420 C  CB  . ASP D 2 50  ? -27.995 4.258   22.464  1.00 30.73  ? 872 ASP D CB  1 
ATOM   3421 C  CG  . ASP D 2 50  ? -27.243 5.538   22.167  1.00 29.60  ? 872 ASP D CG  1 
ATOM   3422 O  OD1 . ASP D 2 50  ? -26.775 6.193   23.123  1.00 28.98  ? 872 ASP D OD1 1 
ATOM   3423 O  OD2 . ASP D 2 50  ? -27.119 5.892   20.973  1.00 28.81  ? 872 ASP D OD2 1 
ATOM   3424 N  N   . ASN D 2 51  ? -30.301 1.972   20.850  1.00 41.61  ? 873 ASN D N   1 
ATOM   3425 C  CA  . ASN D 2 51  ? -31.023 0.720   21.026  1.00 42.58  ? 873 ASN D CA  1 
ATOM   3426 C  C   . ASN D 2 51  ? -30.795 -0.220  19.846  1.00 43.10  ? 873 ASN D C   1 
ATOM   3427 O  O   . ASN D 2 51  ? -31.171 0.089   18.717  1.00 43.14  ? 873 ASN D O   1 
ATOM   3428 C  CB  . ASN D 2 51  ? -32.516 0.989   21.202  1.00 42.94  ? 873 ASN D CB  1 
ATOM   3429 C  CG  . ASN D 2 51  ? -33.290 -0.257  21.581  1.00 44.82  ? 873 ASN D CG  1 
ATOM   3430 O  OD1 . ASN D 2 51  ? -34.449 -0.423  21.197  1.00 45.74  ? 873 ASN D OD1 1 
ATOM   3431 N  ND2 . ASN D 2 51  ? -32.652 -1.144  22.338  1.00 45.12  ? 873 ASN D ND2 1 
ATOM   3432 N  N   . ASP D 2 52  ? -30.181 -1.367  20.117  1.00 47.88  ? 874 ASP D N   1 
ATOM   3433 C  CA  . ASP D 2 52  ? -29.852 -2.334  19.073  1.00 47.49  ? 874 ASP D CA  1 
ATOM   3434 C  C   . ASP D 2 52  ? -31.089 -2.879  18.366  1.00 48.05  ? 874 ASP D C   1 
ATOM   3435 O  O   . ASP D 2 52  ? -30.984 -3.495  17.306  1.00 48.15  ? 874 ASP D O   1 
ATOM   3436 C  CB  . ASP D 2 52  ? -29.034 -3.490  19.653  1.00 48.04  ? 874 ASP D CB  1 
ATOM   3437 C  CG  . ASP D 2 52  ? -27.610 -3.089  19.989  1.00 49.62  ? 874 ASP D CG  1 
ATOM   3438 O  OD1 . ASP D 2 52  ? -27.269 -1.897  19.822  1.00 48.96  ? 874 ASP D OD1 1 
ATOM   3439 O  OD2 . ASP D 2 52  ? -26.830 -3.967  20.415  1.00 50.09  ? 874 ASP D OD2 1 
ATOM   3440 N  N   . SER D 2 53  ? -32.259 -2.652  18.954  1.00 43.99  ? 875 SER D N   1 
ATOM   3441 C  CA  . SER D 2 53  ? -33.506 -3.154  18.387  1.00 44.45  ? 875 SER D CA  1 
ATOM   3442 C  C   . SER D 2 53  ? -34.019 -2.264  17.259  1.00 44.85  ? 875 SER D C   1 
ATOM   3443 O  O   . SER D 2 53  ? -35.029 -2.572  16.626  1.00 45.30  ? 875 SER D O   1 
ATOM   3444 C  CB  . SER D 2 53  ? -34.575 -3.279  19.474  1.00 45.17  ? 875 SER D CB  1 
ATOM   3445 O  OG  . SER D 2 53  ? -34.113 -4.071  20.556  1.00 46.55  ? 875 SER D OG  1 
ATOM   3446 N  N   . ASP D 2 54  ? -33.321 -1.161  17.011  1.00 50.75  ? 876 ASP D N   1 
ATOM   3447 C  CA  . ASP D 2 54  ? -33.753 -0.203  15.998  1.00 50.19  ? 876 ASP D CA  1 
ATOM   3448 C  C   . ASP D 2 54  ? -33.027 -0.396  14.669  1.00 50.97  ? 876 ASP D C   1 
ATOM   3449 O  O   . ASP D 2 54  ? -33.143 0.433   13.762  1.00 51.27  ? 876 ASP D O   1 
ATOM   3450 C  CB  . ASP D 2 54  ? -33.581 1.231   16.503  1.00 49.53  ? 876 ASP D CB  1 
ATOM   3451 C  CG  . ASP D 2 54  ? -34.605 1.604   17.559  1.00 50.46  ? 876 ASP D CG  1 
ATOM   3452 O  OD1 . ASP D 2 54  ? -35.731 1.065   17.511  1.00 51.89  ? 876 ASP D OD1 1 
ATOM   3453 O  OD2 . ASP D 2 54  ? -34.289 2.438   18.434  1.00 49.93  ? 876 ASP D OD2 1 
ATOM   3454 N  N   . TYR D 2 55  ? -32.283 -1.492  14.554  1.00 38.46  ? 877 TYR D N   1 
ATOM   3455 C  CA  . TYR D 2 55  ? -31.605 -1.830  13.308  1.00 38.16  ? 877 TYR D CA  1 
ATOM   3456 C  C   . TYR D 2 55  ? -32.579 -2.427  12.297  1.00 39.46  ? 877 TYR D C   1 
ATOM   3457 O  O   . TYR D 2 55  ? -33.386 -3.291  12.638  1.00 40.83  ? 877 TYR D O   1 
ATOM   3458 C  CB  . TYR D 2 55  ? -30.473 -2.826  13.566  1.00 38.13  ? 877 TYR D CB  1 
ATOM   3459 C  CG  . TYR D 2 55  ? -29.184 -2.203  14.050  1.00 38.02  ? 877 TYR D CG  1 
ATOM   3460 C  CD1 . TYR D 2 55  ? -28.775 -2.345  15.369  1.00 37.82  ? 877 TYR D CD1 1 
ATOM   3461 C  CD2 . TYR D 2 55  ? -28.371 -1.481  13.185  1.00 37.45  ? 877 TYR D CD2 1 
ATOM   3462 C  CE1 . TYR D 2 55  ? -27.594 -1.781  15.815  1.00 37.27  ? 877 TYR D CE1 1 
ATOM   3463 C  CE2 . TYR D 2 55  ? -27.189 -0.913  13.622  1.00 36.31  ? 877 TYR D CE2 1 
ATOM   3464 C  CZ  . TYR D 2 55  ? -26.806 -1.066  14.937  1.00 36.10  ? 877 TYR D CZ  1 
ATOM   3465 O  OH  . TYR D 2 55  ? -25.631 -0.503  15.377  1.00 35.58  ? 877 TYR D OH  1 
ATOM   3466 N  N   . LYS D 2 56  ? -32.503 -1.967  11.053  1.00 30.35  ? 878 LYS D N   1 
ATOM   3467 C  CA  . LYS D 2 56  ? -33.268 -2.583  9.974   1.00 31.23  ? 878 LYS D CA  1 
ATOM   3468 C  C   . LYS D 2 56  ? -32.344 -3.410  9.087   1.00 32.29  ? 878 LYS D C   1 
ATOM   3469 O  O   . LYS D 2 56  ? -31.191 -3.040  8.867   1.00 31.35  ? 878 LYS D O   1 
ATOM   3470 C  CB  . LYS D 2 56  ? -34.027 -1.535  9.161   1.00 30.70  ? 878 LYS D CB  1 
ATOM   3471 C  CG  . LYS D 2 56  ? -35.235 -0.971  9.889   1.00 32.00  ? 878 LYS D CG  1 
ATOM   3472 C  CD  . LYS D 2 56  ? -36.071 -0.083  8.987   1.00 34.61  ? 878 LYS D CD  1 
ATOM   3473 C  CE  . LYS D 2 56  ? -37.265 0.484   9.739   1.00 35.21  ? 878 LYS D CE  1 
ATOM   3474 N  NZ  . LYS D 2 56  ? -38.006 1.493   8.935   1.00 35.69  ? 878 LYS D NZ  1 
ATOM   3475 N  N   . ARG D 2 57  ? -32.856 -4.530  8.584   1.00 53.44  ? 879 ARG D N   1 
ATOM   3476 C  CA  . ARG D 2 57  ? -32.018 -5.516  7.908   1.00 53.76  ? 879 ARG D CA  1 
ATOM   3477 C  C   . ARG D 2 57  ? -32.268 -5.614  6.405   1.00 53.14  ? 879 ARG D C   1 
ATOM   3478 O  O   . ARG D 2 57  ? -33.409 -5.560  5.945   1.00 52.67  ? 879 ARG D O   1 
ATOM   3479 C  CB  . ARG D 2 57  ? -32.209 -6.892  8.554   1.00 54.62  ? 879 ARG D CB  1 
ATOM   3480 C  CG  . ARG D 2 57  ? -31.114 -7.894  8.231   1.00 55.48  ? 879 ARG D CG  1 
ATOM   3481 C  CD  . ARG D 2 57  ? -31.313 -9.194  9.001   1.00 58.24  ? 879 ARG D CD  1 
ATOM   3482 N  NE  . ARG D 2 57  ? -32.230 -10.111 8.328   1.00 59.50  ? 879 ARG D NE  1 
ATOM   3483 C  CZ  . ARG D 2 57  ? -33.545 -10.138 8.522   1.00 59.52  ? 879 ARG D CZ  1 
ATOM   3484 N  NH1 . ARG D 2 57  ? -34.112 -9.293  9.372   1.00 59.68  ? 879 ARG D NH1 1 
ATOM   3485 N  NH2 . ARG D 2 57  ? -34.295 -11.012 7.864   1.00 59.57  ? 879 ARG D NH2 1 
ATOM   3486 N  N   . ASP D 2 58  ? -31.182 -5.759  5.651   1.00 33.88  ? 880 ASP D N   1 
ATOM   3487 C  CA  . ASP D 2 58  ? -31.250 -6.018  4.217   1.00 33.92  ? 880 ASP D CA  1 
ATOM   3488 C  C   . ASP D 2 58  ? -30.526 -7.322  3.907   1.00 35.77  ? 880 ASP D C   1 
ATOM   3489 O  O   . ASP D 2 58  ? -29.418 -7.555  4.396   1.00 35.96  ? 880 ASP D O   1 
ATOM   3490 C  CB  . ASP D 2 58  ? -30.617 -4.873  3.423   1.00 31.62  ? 880 ASP D CB  1 
ATOM   3491 C  CG  . ASP D 2 58  ? -31.551 -3.692  3.251   1.00 30.19  ? 880 ASP D CG  1 
ATOM   3492 O  OD1 . ASP D 2 58  ? -32.699 -3.761  3.737   1.00 31.29  ? 880 ASP D OD1 1 
ATOM   3493 O  OD2 . ASP D 2 58  ? -31.138 -2.696  2.623   1.00 29.12  ? 880 ASP D OD2 1 
ATOM   3494 N  N   . VAL D 2 59  ? -31.149 -8.173  3.099   1.00 44.17  ? 881 VAL D N   1 
ATOM   3495 C  CA  . VAL D 2 59  ? -30.541 -9.447  2.730   1.00 46.32  ? 881 VAL D CA  1 
ATOM   3496 C  C   . VAL D 2 59  ? -29.920 -9.378  1.336   1.00 46.61  ? 881 VAL D C   1 
ATOM   3497 O  O   . VAL D 2 59  ? -30.574 -8.971  0.377   1.00 46.98  ? 881 VAL D O   1 
ATOM   3498 C  CB  . VAL D 2 59  ? -31.564 -10.600 2.787   1.00 47.18  ? 881 VAL D CB  1 
ATOM   3499 C  CG1 . VAL D 2 59  ? -30.897 -11.919 2.429   1.00 47.60  ? 881 VAL D CG1 1 
ATOM   3500 C  CG2 . VAL D 2 59  ? -32.197 -10.676 4.167   1.00 46.66  ? 881 VAL D CG2 1 
ATOM   3501 N  N   . VAL D 2 60  ? -28.655 -9.771  1.232   1.00 51.07  ? 882 VAL D N   1 
ATOM   3502 C  CA  . VAL D 2 60  ? -27.956 -9.756  -0.049  1.00 51.52  ? 882 VAL D CA  1 
ATOM   3503 C  C   . VAL D 2 60  ? -27.323 -11.110 -0.357  1.00 52.58  ? 882 VAL D C   1 
ATOM   3504 O  O   . VAL D 2 60  ? -27.011 -11.881 0.551   1.00 52.77  ? 882 VAL D O   1 
ATOM   3505 C  CB  . VAL D 2 60  ? -26.862 -8.673  -0.088  1.00 50.63  ? 882 VAL D CB  1 
ATOM   3506 C  CG1 . VAL D 2 60  ? -27.439 -7.323  0.303   1.00 48.98  ? 882 VAL D CG1 1 
ATOM   3507 C  CG2 . VAL D 2 60  ? -25.711 -9.050  0.826   1.00 51.15  ? 882 VAL D CG2 1 
ATOM   3508 N  N   . GLU D 2 61  ? -27.133 -11.390 -1.642  1.00 70.98  ? 883 GLU D N   1 
ATOM   3509 C  CA  . GLU D 2 61  ? -26.565 -12.662 -2.071  1.00 71.21  ? 883 GLU D CA  1 
ATOM   3510 C  C   . GLU D 2 61  ? -25.084 -12.764 -1.709  1.00 70.85  ? 883 GLU D C   1 
ATOM   3511 O  O   . GLU D 2 61  ? -24.393 -11.753 -1.578  1.00 69.84  ? 883 GLU D O   1 
ATOM   3512 C  CB  . GLU D 2 61  ? -26.795 -12.878 -3.570  1.00 71.86  ? 883 GLU D CB  1 
ATOM   3513 C  CG  . GLU D 2 61  ? -26.146 -11.842 -4.472  1.00 72.10  ? 883 GLU D CG  1 
ATOM   3514 C  CD  . GLU D 2 61  ? -24.835 -12.325 -5.062  1.00 72.17  ? 883 GLU D CD  1 
ATOM   3515 O  OE1 . GLU D 2 61  ? -24.633 -13.557 -5.128  1.00 72.19  ? 883 GLU D OE1 1 
ATOM   3516 O  OE2 . GLU D 2 61  ? -24.012 -11.475 -5.466  1.00 70.63  ? 883 GLU D OE2 1 
ATOM   3517 N  N   . GLY D 2 62  ? -24.608 -13.995 -1.553  1.00 47.85  ? 884 GLY D N   1 
ATOM   3518 C  CA  . GLY D 2 62  ? -23.283 -14.251 -1.020  1.00 47.83  ? 884 GLY D CA  1 
ATOM   3519 C  C   . GLY D 2 62  ? -22.104 -13.770 -1.845  1.00 47.51  ? 884 GLY D C   1 
ATOM   3520 O  O   . GLY D 2 62  ? -21.046 -13.472 -1.293  1.00 48.39  ? 884 GLY D O   1 
ATOM   3521 N  N   . SER D 2 63  ? -22.271 -13.694 -3.161  1.00 49.62  ? 885 SER D N   1 
ATOM   3522 C  CA  . SER D 2 63  ? -21.153 -13.350 -4.037  1.00 49.44  ? 885 SER D CA  1 
ATOM   3523 C  C   . SER D 2 63  ? -20.990 -11.844 -4.231  1.00 49.56  ? 885 SER D C   1 
ATOM   3524 O  O   . SER D 2 63  ? -20.091 -11.398 -4.943  1.00 48.87  ? 885 SER D O   1 
ATOM   3525 C  CB  . SER D 2 63  ? -21.292 -14.049 -5.393  1.00 50.89  ? 885 SER D CB  1 
ATOM   3526 O  OG  . SER D 2 63  ? -22.320 -13.465 -6.175  1.00 49.96  ? 885 SER D OG  1 
ATOM   3527 N  N   . LYS D 2 64  ? -21.857 -11.064 -3.592  1.00 58.94  ? 886 LYS D N   1 
ATOM   3528 C  CA  . LYS D 2 64  ? -21.816 -9.611  -3.721  1.00 56.50  ? 886 LYS D CA  1 
ATOM   3529 C  C   . LYS D 2 64  ? -20.813 -9.008  -2.740  1.00 55.80  ? 886 LYS D C   1 
ATOM   3530 O  O   . LYS D 2 64  ? -20.633 -9.517  -1.635  1.00 56.41  ? 886 LYS D O   1 
ATOM   3531 C  CB  . LYS D 2 64  ? -23.211 -9.021  -3.504  1.00 55.79  ? 886 LYS D CB  1 
ATOM   3532 C  CG  . LYS D 2 64  ? -23.413 -7.649  -4.123  1.00 54.68  ? 886 LYS D CG  1 
ATOM   3533 C  CD  . LYS D 2 64  ? -24.895 -7.308  -4.231  1.00 53.77  ? 886 LYS D CD  1 
ATOM   3534 C  CE  . LYS D 2 64  ? -25.106 -5.920  -4.820  1.00 50.61  ? 886 LYS D CE  1 
ATOM   3535 N  NZ  . LYS D 2 64  ? -24.423 -5.756  -6.136  1.00 49.38  ? 886 LYS D NZ  1 
ATOM   3536 N  N   . GLN D 2 65  ? -20.159 -7.923  -3.148  1.00 60.00  ? 887 GLN D N   1 
ATOM   3537 C  CA  . GLN D 2 65  ? -19.125 -7.305  -2.322  1.00 58.94  ? 887 GLN D CA  1 
ATOM   3538 C  C   . GLN D 2 65  ? -19.389 -5.833  -2.011  1.00 57.19  ? 887 GLN D C   1 
ATOM   3539 O  O   . GLN D 2 65  ? -18.606 -5.189  -1.311  1.00 55.84  ? 887 GLN D O   1 
ATOM   3540 C  CB  . GLN D 2 65  ? -17.749 -7.469  -2.967  1.00 60.12  ? 887 GLN D CB  1 
ATOM   3541 C  CG  . GLN D 2 65  ? -17.099 -8.811  -2.691  1.00 61.54  ? 887 GLN D CG  1 
ATOM   3542 C  CD  . GLN D 2 65  ? -15.636 -8.830  -3.075  1.00 63.89  ? 887 GLN D CD  1 
ATOM   3543 O  OE1 . GLN D 2 65  ? -15.265 -8.411  -4.174  1.00 63.42  ? 887 GLN D OE1 1 
ATOM   3544 N  NE2 . GLN D 2 65  ? -14.791 -9.316  -2.168  1.00 62.76  ? 887 GLN D NE2 1 
ATOM   3545 N  N   . TRP D 2 66  ? -20.485 -5.304  -2.541  1.00 46.49  ? 888 TRP D N   1 
ATOM   3546 C  CA  . TRP D 2 66  ? -20.919 -3.956  -2.194  1.00 44.07  ? 888 TRP D CA  1 
ATOM   3547 C  C   . TRP D 2 66  ? -22.434 -3.855  -2.273  1.00 44.14  ? 888 TRP D C   1 
ATOM   3548 O  O   . TRP D 2 66  ? -23.059 -4.473  -3.133  1.00 44.67  ? 888 TRP D O   1 
ATOM   3549 C  CB  . TRP D 2 66  ? -20.254 -2.907  -3.092  1.00 42.99  ? 888 TRP D CB  1 
ATOM   3550 C  CG  . TRP D 2 66  ? -20.589 -3.025  -4.549  1.00 42.53  ? 888 TRP D CG  1 
ATOM   3551 C  CD1 . TRP D 2 66  ? -19.780 -3.506  -5.535  1.00 43.01  ? 888 TRP D CD1 1 
ATOM   3552 C  CD2 . TRP D 2 66  ? -21.816 -2.644  -5.186  1.00 42.95  ? 888 TRP D CD2 1 
ATOM   3553 N  NE1 . TRP D 2 66  ? -20.428 -3.452  -6.747  1.00 42.60  ? 888 TRP D NE1 1 
ATOM   3554 C  CE2 . TRP D 2 66  ? -21.679 -2.926  -6.559  1.00 41.46  ? 888 TRP D CE2 1 
ATOM   3555 C  CE3 . TRP D 2 66  ? -23.017 -2.092  -4.727  1.00 42.79  ? 888 TRP D CE3 1 
ATOM   3556 C  CZ2 . TRP D 2 66  ? -22.696 -2.679  -7.477  1.00 39.94  ? 888 TRP D CZ2 1 
ATOM   3557 C  CZ3 . TRP D 2 66  ? -24.027 -1.848  -5.640  1.00 42.14  ? 888 TRP D CZ3 1 
ATOM   3558 C  CH2 . TRP D 2 66  ? -23.859 -2.141  -7.000  1.00 40.95  ? 888 TRP D CH2 1 
ATOM   3559 N  N   . HIS D 2 67  ? -23.022 -3.077  -1.370  1.00 36.56  ? 889 HIS D N   1 
ATOM   3560 C  CA  . HIS D 2 67  ? -24.472 -2.952  -1.306  1.00 36.06  ? 889 HIS D CA  1 
ATOM   3561 C  C   . HIS D 2 67  ? -24.926 -1.498  -1.287  1.00 36.29  ? 889 HIS D C   1 
ATOM   3562 O  O   . HIS D 2 67  ? -24.225 -0.619  -0.783  1.00 35.78  ? 889 HIS D O   1 
ATOM   3563 C  CB  . HIS D 2 67  ? -25.020 -3.687  -0.081  1.00 37.30  ? 889 HIS D CB  1 
ATOM   3564 C  CG  . HIS D 2 67  ? -26.498 -3.545  0.100   1.00 37.54  ? 889 HIS D CG  1 
ATOM   3565 N  ND1 . HIS D 2 67  ? -27.413 -4.164  -0.728  1.00 37.63  ? 889 HIS D ND1 1 
ATOM   3566 C  CD2 . HIS D 2 67  ? -27.225 -2.862  1.016   1.00 37.43  ? 889 HIS D CD2 1 
ATOM   3567 C  CE1 . HIS D 2 67  ? -28.635 -3.864  -0.331  1.00 37.41  ? 889 HIS D CE1 1 
ATOM   3568 N  NE2 . HIS D 2 67  ? -28.550 -3.075  0.727   1.00 36.94  ? 889 HIS D NE2 1 
ATOM   3569 N  N   . MET D 2 68  ? -26.110 -1.259  -1.840  1.00 53.08  ? 890 MET D N   1 
ATOM   3570 C  CA  . MET D 2 68  ? -26.705 0.068   -1.859  1.00 52.27  ? 890 MET D CA  1 
ATOM   3571 C  C   . MET D 2 68  ? -27.897 0.109   -0.911  1.00 51.97  ? 890 MET D C   1 
ATOM   3572 O  O   . MET D 2 68  ? -28.893 -0.584  -1.125  1.00 52.25  ? 890 MET D O   1 
ATOM   3573 C  CB  . MET D 2 68  ? -27.161 0.421   -3.277  1.00 52.73  ? 890 MET D CB  1 
ATOM   3574 C  CG  . MET D 2 68  ? -27.795 1.798   -3.415  1.00 52.22  ? 890 MET D CG  1 
ATOM   3575 S  SD  . MET D 2 68  ? -26.591 3.098   -3.753  1.00 52.90  ? 890 MET D SD  1 
ATOM   3576 C  CE  . MET D 2 68  ? -26.096 2.671   -5.421  1.00 50.25  ? 890 MET D CE  1 
ATOM   3577 N  N   . ILE D 2 69  ? -27.792 0.911   0.142   1.00 26.93  ? 891 ILE D N   1 
ATOM   3578 C  CA  . ILE D 2 69  ? -28.902 1.087   1.071   1.00 26.98  ? 891 ILE D CA  1 
ATOM   3579 C  C   . ILE D 2 69  ? -29.789 2.232   0.602   1.00 26.30  ? 891 ILE D C   1 
ATOM   3580 O  O   . ILE D 2 69  ? -29.333 3.365   0.465   1.00 26.02  ? 891 ILE D O   1 
ATOM   3581 C  CB  . ILE D 2 69  ? -28.413 1.374   2.501   1.00 26.47  ? 891 ILE D CB  1 
ATOM   3582 C  CG1 . ILE D 2 69  ? -27.395 0.318   2.940   1.00 26.62  ? 891 ILE D CG1 1 
ATOM   3583 C  CG2 . ILE D 2 69  ? -29.589 1.425   3.466   1.00 26.04  ? 891 ILE D CG2 1 
ATOM   3584 C  CD1 . ILE D 2 69  ? -26.846 0.537   4.329   1.00 24.99  ? 891 ILE D CD1 1 
ATOM   3585 N  N   . GLY D 2 70  ? -31.057 1.929   0.348   1.00 33.65  ? 892 GLY D N   1 
ATOM   3586 C  CA  . GLY D 2 70  ? -31.984 2.923   -0.155  1.00 33.62  ? 892 GLY D CA  1 
ATOM   3587 C  C   . GLY D 2 70  ? -33.067 3.288   0.841   1.00 34.51  ? 892 GLY D C   1 
ATOM   3588 O  O   . GLY D 2 70  ? -33.162 2.697   1.920   1.00 33.81  ? 892 GLY D O   1 
ATOM   3589 N  N   . HIS D 2 71  ? -33.883 4.270   0.473   1.00 48.59  ? 893 HIS D N   1 
ATOM   3590 C  CA  . HIS D 2 71  ? -34.998 4.708   1.305   1.00 48.93  ? 893 HIS D CA  1 
ATOM   3591 C  C   . HIS D 2 71  ? -34.521 5.188   2.673   1.00 48.70  ? 893 HIS D C   1 
ATOM   3592 O  O   . HIS D 2 71  ? -34.954 4.678   3.708   1.00 49.42  ? 893 HIS D O   1 
ATOM   3593 C  CB  . HIS D 2 71  ? -36.028 3.584   1.465   1.00 49.74  ? 893 HIS D CB  1 
ATOM   3594 C  CG  . HIS D 2 71  ? -36.349 2.871   0.188   1.00 50.02  ? 893 HIS D CG  1 
ATOM   3595 N  ND1 . HIS D 2 71  ? -36.048 1.542   -0.018  1.00 48.57  ? 893 HIS D ND1 1 
ATOM   3596 C  CD2 . HIS D 2 71  ? -36.938 3.303   -0.953  1.00 50.32  ? 893 HIS D CD2 1 
ATOM   3597 C  CE1 . HIS D 2 71  ? -36.441 1.184   -1.227  1.00 49.53  ? 893 HIS D CE1 1 
ATOM   3598 N  NE2 . HIS D 2 71  ? -36.984 2.235   -1.815  1.00 50.93  ? 893 HIS D NE2 1 
ATOM   3599 N  N   . LEU D 2 72  ? -33.626 6.170   2.667   1.00 23.48  ? 894 LEU D N   1 
ATOM   3600 C  CA  . LEU D 2 72  ? -33.121 6.755   3.903   1.00 22.71  ? 894 LEU D CA  1 
ATOM   3601 C  C   . LEU D 2 72  ? -33.557 8.210   4.032   1.00 22.59  ? 894 LEU D C   1 
ATOM   3602 O  O   . LEU D 2 72  ? -33.824 8.878   3.035   1.00 22.72  ? 894 LEU D O   1 
ATOM   3603 C  CB  . LEU D 2 72  ? -31.595 6.663   3.955   1.00 22.21  ? 894 LEU D CB  1 
ATOM   3604 C  CG  . LEU D 2 72  ? -30.992 5.262   4.062   1.00 22.66  ? 894 LEU D CG  1 
ATOM   3605 C  CD1 . LEU D 2 72  ? -29.478 5.344   4.156   1.00 22.14  ? 894 LEU D CD1 1 
ATOM   3606 C  CD2 . LEU D 2 72  ? -31.566 4.522   5.260   1.00 22.29  ? 894 LEU D CD2 1 
ATOM   3607 N  N   . GLN D 2 73  ? -33.629 8.697   5.265   1.00 36.50  ? 895 GLN D N   1 
ATOM   3608 C  CA  . GLN D 2 73  ? -33.949 10.097  5.505   1.00 36.51  ? 895 GLN D CA  1 
ATOM   3609 C  C   . GLN D 2 73  ? -32.779 10.993  5.118   1.00 36.09  ? 895 GLN D C   1 
ATOM   3610 O  O   . GLN D 2 73  ? -31.622 10.658  5.371   1.00 35.59  ? 895 GLN D O   1 
ATOM   3611 C  CB  . GLN D 2 73  ? -34.348 10.321  6.967   1.00 37.13  ? 895 GLN D CB  1 
ATOM   3612 C  CG  . GLN D 2 73  ? -35.853 10.361  7.205   1.00 37.80  ? 895 GLN D CG  1 
ATOM   3613 C  CD  . GLN D 2 73  ? -36.644 9.664   6.112   1.00 37.24  ? 895 GLN D CD  1 
ATOM   3614 O  OE1 . GLN D 2 73  ? -36.947 8.473   6.210   1.00 36.93  ? 895 GLN D OE1 1 
ATOM   3615 N  NE2 . GLN D 2 73  ? -36.980 10.406  5.059   1.00 35.48  ? 895 GLN D NE2 1 
ATOM   3616 N  N   . PRO D 2 74  ? -33.082 12.137  4.495   1.00 28.95  ? 896 PRO D N   1 
ATOM   3617 C  CA  . PRO D 2 74  ? -32.065 13.077  4.016   1.00 29.05  ? 896 PRO D CA  1 
ATOM   3618 C  C   . PRO D 2 74  ? -31.308 13.723  5.166   1.00 29.20  ? 896 PRO D C   1 
ATOM   3619 O  O   . PRO D 2 74  ? -31.910 14.036  6.193   1.00 28.25  ? 896 PRO D O   1 
ATOM   3620 C  CB  . PRO D 2 74  ? -32.888 14.143  3.280   1.00 28.59  ? 896 PRO D CB  1 
ATOM   3621 C  CG  . PRO D 2 74  ? -34.221 13.512  3.028   1.00 29.65  ? 896 PRO D CG  1 
ATOM   3622 C  CD  . PRO D 2 74  ? -34.445 12.593  4.180   1.00 29.52  ? 896 PRO D CD  1 
ATOM   3623 N  N   . GLU D 2 75  ? -30.003 13.909  4.993   1.00 59.64  ? 897 GLU D N   1 
ATOM   3624 C  CA  . GLU D 2 75  ? -29.212 14.669  5.950   1.00 60.10  ? 897 GLU D CA  1 
ATOM   3625 C  C   . GLU D 2 75  ? -29.193 13.973  7.308   1.00 59.23  ? 897 GLU D C   1 
ATOM   3626 O  O   . GLU D 2 75  ? -29.040 14.617  8.348   1.00 59.19  ? 897 GLU D O   1 
ATOM   3627 C  CB  . GLU D 2 75  ? -29.798 16.076  6.074   1.00 62.28  ? 897 GLU D CB  1 
ATOM   3628 C  CG  . GLU D 2 75  ? -28.928 17.098  6.774   1.00 64.11  ? 897 GLU D CG  1 
ATOM   3629 C  CD  . GLU D 2 75  ? -29.607 18.453  6.855   1.00 67.16  ? 897 GLU D CD  1 
ATOM   3630 O  OE1 . GLU D 2 75  ? -29.706 19.007  7.970   1.00 68.73  ? 897 GLU D OE1 1 
ATOM   3631 O  OE2 . GLU D 2 75  ? -30.059 18.956  5.804   1.00 66.51  ? 897 GLU D OE2 1 
ATOM   3632 N  N   . THR D 2 76  ? -29.346 12.652  7.291   1.00 26.27  ? 898 THR D N   1 
ATOM   3633 C  CA  . THR D 2 76  ? -29.400 11.862  8.517   1.00 25.34  ? 898 THR D CA  1 
ATOM   3634 C  C   . THR D 2 76  ? -28.186 10.948  8.651   1.00 24.59  ? 898 THR D C   1 
ATOM   3635 O  O   . THR D 2 76  ? -27.626 10.495  7.654   1.00 24.41  ? 898 THR D O   1 
ATOM   3636 C  CB  . THR D 2 76  ? -30.686 11.009  8.578   1.00 25.71  ? 898 THR D CB  1 
ATOM   3637 O  OG1 . THR D 2 76  ? -31.834 11.856  8.442   1.00 26.28  ? 898 THR D OG1 1 
ATOM   3638 C  CG2 . THR D 2 76  ? -30.773 10.255  9.896   1.00 25.35  ? 898 THR D CG2 1 
ATOM   3639 N  N   . SER D 2 77  ? -27.783 10.686  9.890   1.00 32.65  ? 899 SER D N   1 
ATOM   3640 C  CA  . SER D 2 77  ? -26.660 9.797   10.168  1.00 31.90  ? 899 SER D CA  1 
ATOM   3641 C  C   . SER D 2 77  ? -27.155 8.373   10.408  1.00 31.38  ? 899 SER D C   1 
ATOM   3642 O  O   . SER D 2 77  ? -28.298 8.168   10.813  1.00 31.58  ? 899 SER D O   1 
ATOM   3643 C  CB  . SER D 2 77  ? -25.875 10.298  11.381  1.00 32.11  ? 899 SER D CB  1 
ATOM   3644 O  OG  . SER D 2 77  ? -24.702 9.532   11.588  1.00 32.51  ? 899 SER D OG  1 
ATOM   3645 N  N   . TYR D 2 78  ? -26.293 7.392   10.162  1.00 30.25  ? 900 TYR D N   1 
ATOM   3646 C  CA  . TYR D 2 78  ? -26.678 5.992   10.308  1.00 30.73  ? 900 TYR D CA  1 
ATOM   3647 C  C   . TYR D 2 78  ? -25.545 5.098   10.806  1.00 30.51  ? 900 TYR D C   1 
ATOM   3648 O  O   . TYR D 2 78  ? -24.393 5.244   10.396  1.00 30.64  ? 900 TYR D O   1 
ATOM   3649 C  CB  . TYR D 2 78  ? -27.216 5.446   8.982   1.00 31.13  ? 900 TYR D CB  1 
ATOM   3650 C  CG  . TYR D 2 78  ? -28.610 5.917   8.640   1.00 30.86  ? 900 TYR D CG  1 
ATOM   3651 C  CD1 . TYR D 2 78  ? -28.812 7.002   7.797   1.00 30.77  ? 900 TYR D CD1 1 
ATOM   3652 C  CD2 . TYR D 2 78  ? -29.726 5.273   9.156   1.00 30.88  ? 900 TYR D CD2 1 
ATOM   3653 C  CE1 . TYR D 2 78  ? -30.086 7.432   7.482   1.00 31.06  ? 900 TYR D CE1 1 
ATOM   3654 C  CE2 . TYR D 2 78  ? -31.002 5.695   8.846   1.00 30.70  ? 900 TYR D CE2 1 
ATOM   3655 C  CZ  . TYR D 2 78  ? -31.177 6.775   8.010   1.00 31.04  ? 900 TYR D CZ  1 
ATOM   3656 O  OH  . TYR D 2 78  ? -32.450 7.196   7.701   1.00 32.15  ? 900 TYR D OH  1 
ATOM   3657 N  N   . ASP D 2 79  ? -25.889 4.170   11.692  1.00 24.99  ? 901 ASP D N   1 
ATOM   3658 C  CA  . ASP D 2 79  ? -24.957 3.147   12.145  1.00 25.36  ? 901 ASP D CA  1 
ATOM   3659 C  C   . ASP D 2 79  ? -25.096 1.940   11.229  1.00 25.98  ? 901 ASP D C   1 
ATOM   3660 O  O   . ASP D 2 79  ? -26.182 1.376   11.098  1.00 25.88  ? 901 ASP D O   1 
ATOM   3661 C  CB  . ASP D 2 79  ? -25.270 2.738   13.585  1.00 25.63  ? 901 ASP D CB  1 
ATOM   3662 C  CG  . ASP D 2 79  ? -25.473 3.927   14.500  1.00 24.82  ? 901 ASP D CG  1 
ATOM   3663 O  OD1 . ASP D 2 79  ? -24.795 4.956   14.303  1.00 25.10  ? 901 ASP D OD1 1 
ATOM   3664 O  OD2 . ASP D 2 79  ? -26.311 3.830   15.423  1.00 24.54  ? 901 ASP D OD2 1 
ATOM   3665 N  N   . ILE D 2 80  ? -23.998 1.546   10.595  1.00 34.04  ? 902 ILE D N   1 
ATOM   3666 C  CA  . ILE D 2 80  ? -24.038 0.469   9.612   1.00 34.75  ? 902 ILE D CA  1 
ATOM   3667 C  C   . ILE D 2 80  ? -23.124 -0.697  9.981   1.00 35.45  ? 902 ILE D C   1 
ATOM   3668 O  O   . ILE D 2 80  ? -21.900 -0.575  9.942   1.00 35.42  ? 902 ILE D O   1 
ATOM   3669 C  CB  . ILE D 2 80  ? -23.650 0.981   8.209   1.00 33.51  ? 902 ILE D CB  1 
ATOM   3670 C  CG1 . ILE D 2 80  ? -24.365 2.298   7.902   1.00 32.56  ? 902 ILE D CG1 1 
ATOM   3671 C  CG2 . ILE D 2 80  ? -23.966 -0.069  7.156   1.00 33.93  ? 902 ILE D CG2 1 
ATOM   3672 C  CD1 . ILE D 2 80  ? -23.975 2.913   6.577   1.00 31.79  ? 902 ILE D CD1 1 
ATOM   3673 N  N   . LYS D 2 81  ? -23.726 -1.827  10.337  1.00 32.09  ? 903 LYS D N   1 
ATOM   3674 C  CA  . LYS D 2 81  ? -22.967 -3.043  10.604  1.00 33.70  ? 903 LYS D CA  1 
ATOM   3675 C  C   . LYS D 2 81  ? -23.580 -4.231  9.870   1.00 35.14  ? 903 LYS D C   1 
ATOM   3676 O  O   . LYS D 2 81  ? -24.776 -4.242  9.581   1.00 35.22  ? 903 LYS D O   1 
ATOM   3677 C  CB  . LYS D 2 81  ? -22.885 -3.320  12.108  1.00 33.89  ? 903 LYS D CB  1 
ATOM   3678 C  CG  . LYS D 2 81  ? -24.218 -3.607  12.778  1.00 33.55  ? 903 LYS D CG  1 
ATOM   3679 C  CD  . LYS D 2 81  ? -24.025 -3.896  14.262  1.00 33.83  ? 903 LYS D CD  1 
ATOM   3680 C  CE  . LYS D 2 81  ? -25.336 -4.263  14.939  1.00 33.36  ? 903 LYS D CE  1 
ATOM   3681 N  NZ  . LYS D 2 81  ? -25.159 -4.472  16.403  1.00 33.20  ? 903 LYS D NZ  1 
ATOM   3682 N  N   . MET D 2 82  ? -22.755 -5.229  9.565   1.00 40.60  ? 904 MET D N   1 
ATOM   3683 C  CA  . MET D 2 82  ? -23.216 -6.389  8.813   1.00 41.61  ? 904 MET D CA  1 
ATOM   3684 C  C   . MET D 2 82  ? -22.672 -7.704  9.369   1.00 42.96  ? 904 MET D C   1 
ATOM   3685 O  O   . MET D 2 82  ? -21.972 -7.725  10.382  1.00 42.20  ? 904 MET D O   1 
ATOM   3686 C  CB  . MET D 2 82  ? -22.836 -6.255  7.336   1.00 41.55  ? 904 MET D CB  1 
ATOM   3687 C  CG  . MET D 2 82  ? -21.342 -6.353  7.067   1.00 41.41  ? 904 MET D CG  1 
ATOM   3688 S  SD  . MET D 2 82  ? -20.933 -6.177  5.319   1.00 40.39  ? 904 MET D SD  1 
ATOM   3689 C  CE  . MET D 2 82  ? -21.918 -7.493  4.608   1.00 42.38  ? 904 MET D CE  1 
ATOM   3690 N  N   . GLN D 2 83  ? -23.005 -8.795  8.688   1.00 46.56  ? 905 GLN D N   1 
ATOM   3691 C  CA  . GLN D 2 83  ? -22.553 -10.127 9.070   1.00 47.87  ? 905 GLN D CA  1 
ATOM   3692 C  C   . GLN D 2 83  ? -22.949 -11.133 7.996   1.00 48.99  ? 905 GLN D C   1 
ATOM   3693 O  O   . GLN D 2 83  ? -24.060 -11.083 7.469   1.00 48.62  ? 905 GLN D O   1 
ATOM   3694 C  CB  . GLN D 2 83  ? -23.154 -10.539 10.418  1.00 48.16  ? 905 GLN D CB  1 
ATOM   3695 C  CG  . GLN D 2 83  ? -24.674 -10.649 10.418  1.00 47.63  ? 905 GLN D CG  1 
ATOM   3696 C  CD  . GLN D 2 83  ? -25.235 -11.024 11.776  1.00 47.75  ? 905 GLN D CD  1 
ATOM   3697 O  OE1 . GLN D 2 83  ? -26.449 -11.100 11.958  1.00 48.16  ? 905 GLN D OE1 1 
ATOM   3698 N  NE2 . GLN D 2 83  ? -24.352 -11.260 12.739  1.00 47.71  ? 905 GLN D NE2 1 
ATOM   3699 N  N   . CYS D 2 84  ? -22.035 -12.039 7.662   1.00 56.87  ? 906 CYS D N   1 
ATOM   3700 C  CA  . CYS D 2 84  ? -22.335 -13.087 6.695   1.00 57.16  ? 906 CYS D CA  1 
ATOM   3701 C  C   . CYS D 2 84  ? -23.059 -14.232 7.391   1.00 58.70  ? 906 CYS D C   1 
ATOM   3702 O  O   . CYS D 2 84  ? -22.825 -14.502 8.569   1.00 59.39  ? 906 CYS D O   1 
ATOM   3703 C  CB  . CYS D 2 84  ? -21.059 -13.593 6.017   1.00 57.82  ? 906 CYS D CB  1 
ATOM   3704 S  SG  . CYS D 2 84  ? -20.061 -14.723 7.012   1.00 61.36  ? 906 CYS D SG  1 
ATOM   3705 N  N   . PHE D 2 85  ? -23.945 -14.902 6.661   1.00 67.27  ? 907 PHE D N   1 
ATOM   3706 C  CA  . PHE D 2 85  ? -24.743 -15.973 7.244   1.00 68.65  ? 907 PHE D CA  1 
ATOM   3707 C  C   . PHE D 2 85  ? -24.826 -17.196 6.337   1.00 70.74  ? 907 PHE D C   1 
ATOM   3708 O  O   . PHE D 2 85  ? -24.602 -17.111 5.128   1.00 70.13  ? 907 PHE D O   1 
ATOM   3709 C  CB  . PHE D 2 85  ? -26.155 -15.473 7.554   1.00 65.87  ? 907 PHE D CB  1 
ATOM   3710 C  CG  . PHE D 2 85  ? -27.009 -15.278 6.334   1.00 65.85  ? 907 PHE D CG  1 
ATOM   3711 C  CD1 . PHE D 2 85  ? -27.849 -16.287 5.889   1.00 68.06  ? 907 PHE D CD1 1 
ATOM   3712 C  CD2 . PHE D 2 85  ? -26.970 -14.088 5.628   1.00 64.25  ? 907 PHE D CD2 1 
ATOM   3713 C  CE1 . PHE D 2 85  ? -28.636 -16.112 4.767   1.00 67.13  ? 907 PHE D CE1 1 
ATOM   3714 C  CE2 . PHE D 2 85  ? -27.757 -13.907 4.503   1.00 64.50  ? 907 PHE D CE2 1 
ATOM   3715 C  CZ  . PHE D 2 85  ? -28.589 -14.921 4.073   1.00 65.05  ? 907 PHE D CZ  1 
ATOM   3716 N  N   . ASN D 2 86  ? -25.148 -18.336 6.940   1.00 63.82  ? 908 ASN D N   1 
ATOM   3717 C  CA  . ASN D 2 86  ? -25.450 -19.549 6.195   1.00 65.05  ? 908 ASN D CA  1 
ATOM   3718 C  C   . ASN D 2 86  ? -26.561 -20.327 6.893   1.00 66.59  ? 908 ASN D C   1 
ATOM   3719 O  O   . ASN D 2 86  ? -27.134 -19.853 7.876   1.00 65.47  ? 908 ASN D O   1 
ATOM   3720 C  CB  . ASN D 2 86  ? -24.200 -20.416 6.019   1.00 64.80  ? 908 ASN D CB  1 
ATOM   3721 C  CG  . ASN D 2 86  ? -23.557 -20.790 7.339   1.00 64.27  ? 908 ASN D CG  1 
ATOM   3722 O  OD1 . ASN D 2 86  ? -24.162 -20.652 8.401   1.00 64.17  ? 908 ASN D OD1 1 
ATOM   3723 N  ND2 . ASN D 2 86  ? -22.320 -21.271 7.277   1.00 63.77  ? 908 ASN D ND2 1 
ATOM   3724 N  N   . GLU D 2 87  ? -26.871 -21.514 6.383   1.00 86.98  ? 909 GLU D N   1 
ATOM   3725 C  CA  . GLU D 2 87  ? -27.911 -22.342 6.981   1.00 87.84  ? 909 GLU D CA  1 
ATOM   3726 C  C   . GLU D 2 87  ? -27.577 -22.675 8.432   1.00 87.56  ? 909 GLU D C   1 
ATOM   3727 O  O   . GLU D 2 87  ? -28.470 -22.932 9.241   1.00 87.06  ? 909 GLU D O   1 
ATOM   3728 C  CB  . GLU D 2 87  ? -28.127 -23.624 6.169   1.00 89.37  ? 909 GLU D CB  1 
ATOM   3729 C  CG  . GLU D 2 87  ? -26.855 -24.397 5.846   1.00 89.87  ? 909 GLU D CG  1 
ATOM   3730 C  CD  . GLU D 2 87  ? -26.227 -23.980 4.528   1.00 89.69  ? 909 GLU D CD  1 
ATOM   3731 O  OE1 . GLU D 2 87  ? -26.310 -22.786 4.172   1.00 88.04  ? 909 GLU D OE1 1 
ATOM   3732 O  OE2 . GLU D 2 87  ? -25.648 -24.853 3.845   1.00 91.58  ? 909 GLU D OE2 1 
ATOM   3733 N  N   . GLY D 2 88  ? -26.287 -22.662 8.754   1.00 68.01  ? 910 GLY D N   1 
ATOM   3734 C  CA  . GLY D 2 88  ? -25.824 -22.947 10.101  1.00 67.48  ? 910 GLY D CA  1 
ATOM   3735 C  C   . GLY D 2 88  ? -26.152 -21.844 11.092  1.00 68.11  ? 910 GLY D C   1 
ATOM   3736 O  O   . GLY D 2 88  ? -26.637 -22.115 12.191  1.00 67.59  ? 910 GLY D O   1 
ATOM   3737 N  N   . GLY D 2 89  ? -25.885 -20.599 10.708  1.00 74.82  ? 911 GLY D N   1 
ATOM   3738 C  CA  . GLY D 2 89  ? -26.157 -19.458 11.565  1.00 72.08  ? 911 GLY D CA  1 
ATOM   3739 C  C   . GLY D 2 89  ? -25.450 -18.192 11.119  1.00 70.85  ? 911 GLY D C   1 
ATOM   3740 O  O   . GLY D 2 89  ? -24.783 -18.174 10.083  1.00 70.29  ? 911 GLY D O   1 
ATOM   3741 N  N   . GLU D 2 90  ? -25.596 -17.128 11.906  1.00 72.97  ? 912 GLU D N   1 
ATOM   3742 C  CA  . GLU D 2 90  ? -24.979 -15.844 11.586  1.00 69.96  ? 912 GLU D CA  1 
ATOM   3743 C  C   . GLU D 2 90  ? -23.650 -15.665 12.311  1.00 69.21  ? 912 GLU D C   1 
ATOM   3744 O  O   . GLU D 2 90  ? -23.523 -16.004 13.487  1.00 68.80  ? 912 GLU D O   1 
ATOM   3745 C  CB  . GLU D 2 90  ? -25.915 -14.685 11.943  1.00 68.61  ? 912 GLU D CB  1 
ATOM   3746 C  CG  . GLU D 2 90  ? -27.327 -14.806 11.391  1.00 69.42  ? 912 GLU D CG  1 
ATOM   3747 C  CD  . GLU D 2 90  ? -28.269 -15.512 12.347  1.00 70.84  ? 912 GLU D CD  1 
ATOM   3748 O  OE1 . GLU D 2 90  ? -27.778 -16.185 13.277  1.00 72.46  ? 912 GLU D OE1 1 
ATOM   3749 O  OE2 . GLU D 2 90  ? -29.499 -15.390 12.169  1.00 69.92  ? 912 GLU D OE2 1 
ATOM   3750 N  N   . SER D 2 91  ? -22.663 -15.125 11.603  1.00 65.71  ? 913 SER D N   1 
ATOM   3751 C  CA  . SER D 2 91  ? -21.356 -14.859 12.192  1.00 64.83  ? 913 SER D CA  1 
ATOM   3752 C  C   . SER D 2 91  ? -21.435 -13.678 13.152  1.00 64.78  ? 913 SER D C   1 
ATOM   3753 O  O   . SER D 2 91  ? -22.518 -13.160 13.427  1.00 64.66  ? 913 SER D O   1 
ATOM   3754 C  CB  . SER D 2 91  ? -20.322 -14.570 11.101  1.00 64.29  ? 913 SER D CB  1 
ATOM   3755 O  OG  . SER D 2 91  ? -20.547 -13.304 10.503  1.00 61.92  ? 913 SER D OG  1 
ATOM   3756 N  N   . GLU D 2 92  ? -20.283 -13.256 13.660  1.00 72.45  ? 914 GLU D N   1 
ATOM   3757 C  CA  . GLU D 2 92  ? -20.219 -12.092 14.535  1.00 71.37  ? 914 GLU D CA  1 
ATOM   3758 C  C   . GLU D 2 92  ? -20.224 -10.808 13.711  1.00 69.31  ? 914 GLU D C   1 
ATOM   3759 O  O   . GLU D 2 92  ? -19.677 -10.765 12.608  1.00 69.21  ? 914 GLU D O   1 
ATOM   3760 C  CB  . GLU D 2 92  ? -18.974 -12.153 15.421  1.00 72.43  ? 914 GLU D CB  1 
ATOM   3761 C  CG  . GLU D 2 92  ? -17.673 -12.304 14.652  1.00 73.80  ? 914 GLU D CG  1 
ATOM   3762 C  CD  . GLU D 2 92  ? -16.473 -12.447 15.567  1.00 76.94  ? 914 GLU D CD  1 
ATOM   3763 O  OE1 . GLU D 2 92  ? -16.665 -12.432 16.802  1.00 78.20  ? 914 GLU D OE1 1 
ATOM   3764 O  OE2 . GLU D 2 92  ? -15.341 -12.575 15.053  1.00 76.69  ? 914 GLU D OE2 1 
ATOM   3765 N  N   . PHE D 2 93  ? -20.849 -9.766  14.251  1.00 37.07  ? 915 PHE D N   1 
ATOM   3766 C  CA  . PHE D 2 93  ? -20.985 -8.500  13.539  1.00 34.69  ? 915 PHE D CA  1 
ATOM   3767 C  C   . PHE D 2 93  ? -19.641 -7.943  13.084  1.00 33.76  ? 915 PHE D C   1 
ATOM   3768 O  O   . PHE D 2 93  ? -18.622 -8.121  13.752  1.00 34.06  ? 915 PHE D O   1 
ATOM   3769 C  CB  . PHE D 2 93  ? -21.703 -7.465  14.410  1.00 32.69  ? 915 PHE D CB  1 
ATOM   3770 C  CG  . PHE D 2 93  ? -23.177 -7.713  14.564  1.00 32.05  ? 915 PHE D CG  1 
ATOM   3771 C  CD1 . PHE D 2 93  ? -23.700 -8.130  15.777  1.00 32.98  ? 915 PHE D CD1 1 
ATOM   3772 C  CD2 . PHE D 2 93  ? -24.040 -7.523  13.497  1.00 32.24  ? 915 PHE D CD2 1 
ATOM   3773 C  CE1 . PHE D 2 93  ? -25.058 -8.355  15.924  1.00 33.65  ? 915 PHE D CE1 1 
ATOM   3774 C  CE2 . PHE D 2 93  ? -25.399 -7.746  13.637  1.00 32.90  ? 915 PHE D CE2 1 
ATOM   3775 C  CZ  . PHE D 2 93  ? -25.908 -8.162  14.853  1.00 33.64  ? 915 PHE D CZ  1 
ATOM   3776 N  N   . SER D 2 94  ? -19.649 -7.267  11.940  1.00 33.97  ? 916 SER D N   1 
ATOM   3777 C  CA  . SER D 2 94  ? -18.460 -6.589  11.451  1.00 33.17  ? 916 SER D CA  1 
ATOM   3778 C  C   . SER D 2 94  ? -18.344 -5.232  12.127  1.00 32.39  ? 916 SER D C   1 
ATOM   3779 O  O   . SER D 2 94  ? -19.247 -4.813  12.850  1.00 31.70  ? 916 SER D O   1 
ATOM   3780 C  CB  . SER D 2 94  ? -18.531 -6.406  9.936   1.00 33.40  ? 916 SER D CB  1 
ATOM   3781 O  OG  . SER D 2 94  ? -19.514 -5.446  9.588   1.00 32.47  ? 916 SER D OG  1 
ATOM   3782 N  N   . ASN D 2 95  ? -17.231 -4.548  11.889  1.00 40.19  ? 917 ASN D N   1 
ATOM   3783 C  CA  . ASN D 2 95  ? -17.035 -3.207  12.423  1.00 38.45  ? 917 ASN D CA  1 
ATOM   3784 C  C   . ASN D 2 95  ? -18.213 -2.305  12.082  1.00 37.72  ? 917 ASN D C   1 
ATOM   3785 O  O   . ASN D 2 95  ? -18.763 -2.385  10.985  1.00 38.12  ? 917 ASN D O   1 
ATOM   3786 C  CB  . ASN D 2 95  ? -15.733 -2.603  11.894  1.00 38.30  ? 917 ASN D CB  1 
ATOM   3787 C  CG  . ASN D 2 95  ? -15.627 -2.677  10.385  1.00 38.61  ? 917 ASN D CG  1 
ATOM   3788 O  OD1 . ASN D 2 95  ? -16.450 -3.308  9.723   1.00 38.77  ? 917 ASN D OD1 1 
ATOM   3789 N  ND2 . ASN D 2 95  ? -14.607 -2.030  9.832   1.00 39.18  ? 917 ASN D ND2 1 
ATOM   3790 N  N   . VAL D 2 96  ? -18.601 -1.452  13.023  1.00 36.19  ? 918 VAL D N   1 
ATOM   3791 C  CA  . VAL D 2 96  ? -19.732 -0.556  12.809  1.00 35.62  ? 918 VAL D CA  1 
ATOM   3792 C  C   . VAL D 2 96  ? -19.288 0.788   12.243  1.00 34.61  ? 918 VAL D C   1 
ATOM   3793 O  O   . VAL D 2 96  ? -18.470 1.489   12.840  1.00 34.95  ? 918 VAL D O   1 
ATOM   3794 C  CB  . VAL D 2 96  ? -20.533 -0.318  14.100  1.00 34.38  ? 918 VAL D CB  1 
ATOM   3795 C  CG1 . VAL D 2 96  ? -21.782 0.488   13.793  1.00 34.13  ? 918 VAL D CG1 1 
ATOM   3796 C  CG2 . VAL D 2 96  ? -20.900 -1.641  14.747  1.00 35.09  ? 918 VAL D CG2 1 
ATOM   3797 N  N   . MET D 2 97  ? -19.837 1.139   11.087  1.00 31.17  ? 919 MET D N   1 
ATOM   3798 C  CA  . MET D 2 97  ? -19.512 2.397   10.433  1.00 30.83  ? 919 MET D CA  1 
ATOM   3799 C  C   . MET D 2 97  ? -20.612 3.416   10.689  1.00 30.64  ? 919 MET D C   1 
ATOM   3800 O  O   . MET D 2 97  ? -21.766 3.054   10.916  1.00 30.21  ? 919 MET D O   1 
ATOM   3801 C  CB  . MET D 2 97  ? -19.340 2.184   8.927   1.00 31.06  ? 919 MET D CB  1 
ATOM   3802 C  CG  . MET D 2 97  ? -18.311 1.126   8.560   1.00 31.49  ? 919 MET D CG  1 
ATOM   3803 S  SD  . MET D 2 97  ? -16.612 1.724   8.639   1.00 31.27  ? 919 MET D SD  1 
ATOM   3804 C  CE  . MET D 2 97  ? -16.500 2.623   7.095   1.00 32.41  ? 919 MET D CE  1 
ATOM   3805 N  N   . ILE D 2 98  ? -20.248 4.693   10.658  1.00 29.32  ? 920 ILE D N   1 
ATOM   3806 C  CA  . ILE D 2 98  ? -21.226 5.766   10.765  1.00 28.58  ? 920 ILE D CA  1 
ATOM   3807 C  C   . ILE D 2 98  ? -21.199 6.605   9.495   1.00 27.59  ? 920 ILE D C   1 
ATOM   3808 O  O   . ILE D 2 98  ? -20.176 7.200   9.157   1.00 27.74  ? 920 ILE D O   1 
ATOM   3809 C  CB  . ILE D 2 98  ? -20.953 6.671   11.981  1.00 28.35  ? 920 ILE D CB  1 
ATOM   3810 C  CG1 . ILE D 2 98  ? -20.907 5.840   13.264  1.00 28.07  ? 920 ILE D CG1 1 
ATOM   3811 C  CG2 . ILE D 2 98  ? -22.013 7.756   12.083  1.00 27.80  ? 920 ILE D CG2 1 
ATOM   3812 C  CD1 . ILE D 2 98  ? -20.681 6.660   14.514  1.00 27.53  ? 920 ILE D CD1 1 
ATOM   3813 N  N   . CYS D 2 99  ? -22.321 6.645   8.786   1.00 23.59  ? 921 CYS D N   1 
ATOM   3814 C  CA  . CYS D 2 99  ? -22.386 7.384   7.534   1.00 23.54  ? 921 CYS D CA  1 
ATOM   3815 C  C   . CYS D 2 99  ? -23.600 8.305   7.479   1.00 23.95  ? 921 CYS D C   1 
ATOM   3816 O  O   . CYS D 2 99  ? -24.668 7.983   7.999   1.00 24.09  ? 921 CYS D O   1 
ATOM   3817 C  CB  . CYS D 2 99  ? -22.386 6.428   6.341   1.00 23.82  ? 921 CYS D CB  1 
ATOM   3818 S  SG  . CYS D 2 99  ? -21.745 7.160   4.825   1.00 23.32  ? 921 CYS D SG  1 
ATOM   3819 N  N   . GLU D 2 100 ? -23.425 9.453   6.837   1.00 31.81  ? 922 GLU D N   1 
ATOM   3820 C  CA  . GLU D 2 100 ? -24.457 10.477  6.794   1.00 32.26  ? 922 GLU D CA  1 
ATOM   3821 C  C   . GLU D 2 100 ? -24.944 10.689  5.364   1.00 33.18  ? 922 GLU D C   1 
ATOM   3822 O  O   . GLU D 2 100 ? -24.150 10.959  4.462   1.00 33.18  ? 922 GLU D O   1 
ATOM   3823 C  CB  . GLU D 2 100 ? -23.907 11.783  7.375   1.00 32.48  ? 922 GLU D CB  1 
ATOM   3824 C  CG  . GLU D 2 100 ? -24.926 12.896  7.550   1.00 33.71  ? 922 GLU D CG  1 
ATOM   3825 C  CD  . GLU D 2 100 ? -24.394 14.034  8.408   1.00 33.56  ? 922 GLU D CD  1 
ATOM   3826 O  OE1 . GLU D 2 100 ? -23.759 13.746  9.444   1.00 32.89  ? 922 GLU D OE1 1 
ATOM   3827 O  OE2 . GLU D 2 100 ? -24.612 15.211  8.050   1.00 33.43  ? 922 GLU D OE2 1 
ATOM   3828 N  N   . THR D 2 101 ? -26.250 10.551  5.159   1.00 27.21  ? 923 THR D N   1 
ATOM   3829 C  CA  . THR D 2 101 ? -26.842 10.784  3.849   1.00 26.77  ? 923 THR D CA  1 
ATOM   3830 C  C   . THR D 2 101 ? -26.681 12.246  3.460   1.00 28.13  ? 923 THR D C   1 
ATOM   3831 O  O   . THR D 2 101 ? -26.499 13.109  4.318   1.00 29.21  ? 923 THR D O   1 
ATOM   3832 C  CB  . THR D 2 101 ? -28.334 10.422  3.826   1.00 27.34  ? 923 THR D CB  1 
ATOM   3833 O  OG1 . THR D 2 101 ? -29.004 11.079  4.908   1.00 27.39  ? 923 THR D OG1 1 
ATOM   3834 C  CG2 . THR D 2 101 ? -28.520 8.919   3.959   1.00 27.67  ? 923 THR D CG2 1 
ATOM   3835 N  N   . LYS D 2 102 ? -26.751 12.522  2.164   1.00 48.24  ? 924 LYS D N   1 
ATOM   3836 C  CA  . LYS D 2 102 ? -26.553 13.878  1.669   1.00 49.23  ? 924 LYS D CA  1 
ATOM   3837 C  C   . LYS D 2 102 ? -27.709 14.800  2.052   1.00 50.25  ? 924 LYS D C   1 
ATOM   3838 O  O   . LYS D 2 102 ? -28.850 14.365  2.215   1.00 50.40  ? 924 LYS D O   1 
ATOM   3839 C  CB  . LYS D 2 102 ? -26.345 13.866  0.153   1.00 49.99  ? 924 LYS D CB  1 
ATOM   3840 C  CG  . LYS D 2 102 ? -25.148 13.035  -0.285  1.00 50.31  ? 924 LYS D CG  1 
ATOM   3841 C  CD  . LYS D 2 102 ? -24.790 13.284  -1.740  1.00 50.30  ? 924 LYS D CD  1 
ATOM   3842 C  CE  . LYS D 2 102 ? -23.493 12.579  -2.112  1.00 50.51  ? 924 LYS D CE  1 
ATOM   3843 N  NZ  . LYS D 2 102 ? -23.127 12.799  -3.539  1.00 52.95  ? 924 LYS D NZ  1 
ATOM   3844 O  OXT . LYS D 2 102 ? -27.524 16.005  2.219   1.00 50.57  ? 924 LYS D OXT 1 
ATOM   3845 N  N   . LEU E 1 21  ? -41.912 29.464  -24.242 1.00 69.27  ? 40  LEU E N   1 
ATOM   3846 C  CA  . LEU E 1 21  ? -41.501 29.159  -25.610 1.00 69.21  ? 40  LEU E CA  1 
ATOM   3847 C  C   . LEU E 1 21  ? -42.706 28.810  -26.476 1.00 68.98  ? 40  LEU E C   1 
ATOM   3848 O  O   . LEU E 1 21  ? -43.641 28.149  -26.020 1.00 68.79  ? 40  LEU E O   1 
ATOM   3849 C  CB  . LEU E 1 21  ? -40.498 28.003  -25.621 1.00 68.41  ? 40  LEU E CB  1 
ATOM   3850 C  CG  . LEU E 1 21  ? -39.256 28.145  -24.736 1.00 69.39  ? 40  LEU E CG  1 
ATOM   3851 C  CD1 . LEU E 1 21  ? -38.483 26.836  -24.695 1.00 68.22  ? 40  LEU E CD1 1 
ATOM   3852 C  CD2 . LEU E 1 21  ? -38.363 29.286  -25.207 1.00 68.65  ? 40  LEU E CD2 1 
ATOM   3853 N  N   . VAL E 1 22  ? -42.679 29.254  -27.728 1.00 59.67  ? 41  VAL E N   1 
ATOM   3854 C  CA  . VAL E 1 22  ? -43.770 28.983  -28.659 1.00 59.66  ? 41  VAL E CA  1 
ATOM   3855 C  C   . VAL E 1 22  ? -43.318 28.084  -29.805 1.00 58.17  ? 41  VAL E C   1 
ATOM   3856 O  O   . VAL E 1 22  ? -42.520 28.498  -30.647 1.00 57.49  ? 41  VAL E O   1 
ATOM   3857 C  CB  . VAL E 1 22  ? -44.347 30.284  -29.244 1.00 61.13  ? 41  VAL E CB  1 
ATOM   3858 C  CG1 . VAL E 1 22  ? -45.471 29.970  -30.221 1.00 59.93  ? 41  VAL E CG1 1 
ATOM   3859 C  CG2 . VAL E 1 22  ? -44.837 31.192  -28.126 1.00 63.28  ? 41  VAL E CG2 1 
ATOM   3860 N  N   . PRO E 1 23  ? -43.837 26.848  -29.842 1.00 39.88  ? 42  PRO E N   1 
ATOM   3861 C  CA  . PRO E 1 23  ? -43.498 25.853  -30.864 1.00 38.52  ? 42  PRO E CA  1 
ATOM   3862 C  C   . PRO E 1 23  ? -43.696 26.386  -32.280 1.00 38.66  ? 42  PRO E C   1 
ATOM   3863 O  O   . PRO E 1 23  ? -44.540 27.256  -32.494 1.00 39.28  ? 42  PRO E O   1 
ATOM   3864 C  CB  . PRO E 1 23  ? -44.496 24.717  -30.582 1.00 37.98  ? 42  PRO E CB  1 
ATOM   3865 C  CG  . PRO E 1 23  ? -45.565 25.349  -29.728 1.00 38.87  ? 42  PRO E CG  1 
ATOM   3866 C  CD  . PRO E 1 23  ? -44.806 26.305  -28.879 1.00 39.74  ? 42  PRO E CD  1 
ATOM   3867 N  N   . LEU E 1 24  ? -42.919 25.868  -33.228 1.00 39.08  ? 43  LEU E N   1 
ATOM   3868 C  CA  . LEU E 1 24  ? -43.055 26.259  -34.626 1.00 40.12  ? 43  LEU E CA  1 
ATOM   3869 C  C   . LEU E 1 24  ? -44.159 25.460  -35.307 1.00 40.12  ? 43  LEU E C   1 
ATOM   3870 O  O   . LEU E 1 24  ? -44.372 24.287  -34.998 1.00 38.77  ? 43  LEU E O   1 
ATOM   3871 C  CB  . LEU E 1 24  ? -41.737 26.062  -35.381 1.00 38.81  ? 43  LEU E CB  1 
ATOM   3872 C  CG  . LEU E 1 24  ? -40.527 26.887  -34.937 1.00 39.49  ? 43  LEU E CG  1 
ATOM   3873 C  CD1 . LEU E 1 24  ? -39.447 26.864  -36.010 1.00 38.66  ? 43  LEU E CD1 1 
ATOM   3874 C  CD2 . LEU E 1 24  ? -40.934 28.315  -34.624 1.00 41.85  ? 43  LEU E CD2 1 
ATOM   3875 N  N   . LEU E 1 25  ? -44.859 26.099  -36.237 1.00 46.89  ? 44  LEU E N   1 
ATOM   3876 C  CA  . LEU E 1 25  ? -45.913 25.428  -36.982 1.00 46.64  ? 44  LEU E CA  1 
ATOM   3877 C  C   . LEU E 1 25  ? -45.323 24.613  -38.117 1.00 45.06  ? 44  LEU E C   1 
ATOM   3878 O  O   . LEU E 1 25  ? -44.240 24.914  -38.613 1.00 44.82  ? 44  LEU E O   1 
ATOM   3879 C  CB  . LEU E 1 25  ? -46.907 26.442  -37.541 1.00 48.19  ? 44  LEU E CB  1 
ATOM   3880 C  CG  . LEU E 1 25  ? -47.856 27.080  -36.529 1.00 52.21  ? 44  LEU E CG  1 
ATOM   3881 C  CD1 . LEU E 1 25  ? -48.746 28.095  -37.220 1.00 57.36  ? 44  LEU E CD1 1 
ATOM   3882 C  CD2 . LEU E 1 25  ? -48.690 26.015  -35.837 1.00 51.27  ? 44  LEU E CD2 1 
ATOM   3883 N  N   . TYR E 1 26  ? -46.042 23.576  -38.523 1.00 41.32  ? 45  TYR E N   1 
ATOM   3884 C  CA  . TYR E 1 26  ? -45.604 22.751  -39.637 1.00 40.68  ? 45  TYR E CA  1 
ATOM   3885 C  C   . TYR E 1 26  ? -45.287 23.625  -40.857 1.00 41.96  ? 45  TYR E C   1 
ATOM   3886 O  O   . TYR E 1 26  ? -45.935 24.649  -41.119 1.00 43.78  ? 45  TYR E O   1 
ATOM   3887 C  CB  . TYR E 1 26  ? -46.649 21.671  -39.944 1.00 41.12  ? 45  TYR E CB  1 
ATOM   3888 C  CG  . TYR E 1 26  ? -46.366 20.849  -41.178 1.00 40.66  ? 45  TYR E CG  1 
ATOM   3889 C  CD1 . TYR E 1 26  ? -45.193 20.117  -41.302 1.00 39.26  ? 45  TYR E CD1 1 
ATOM   3890 C  CD2 . TYR E 1 26  ? -47.283 20.797  -42.218 1.00 41.70  ? 45  TYR E CD2 1 
ATOM   3891 C  CE1 . TYR E 1 26  ? -44.936 19.365  -42.437 1.00 39.68  ? 45  TYR E CE1 1 
ATOM   3892 C  CE2 . TYR E 1 26  ? -47.037 20.050  -43.351 1.00 41.62  ? 45  TYR E CE2 1 
ATOM   3893 C  CZ  . TYR E 1 26  ? -45.864 19.335  -43.456 1.00 40.86  ? 45  TYR E CZ  1 
ATOM   3894 O  OH  . TYR E 1 26  ? -45.622 18.592  -44.588 1.00 40.49  ? 45  TYR E OH  1 
ATOM   3895 N  N   . LYS E 1 27  ? -44.179 23.270  -41.474 1.00 42.37  ? 46  LYS E N   1 
ATOM   3896 C  CA  . LYS E 1 27  ? -43.709 24.001  -42.650 1.00 42.51  ? 46  LYS E CA  1 
ATOM   3897 C  C   . LYS E 1 27  ? -43.096 25.359  -42.304 1.00 44.04  ? 46  LYS E C   1 
ATOM   3898 O  O   . LYS E 1 27  ? -43.061 26.100  -43.284 1.00 45.76  ? 46  LYS E O   1 
ATOM   3899 C  CB  . LYS E 1 27  ? -44.816 24.144  -43.703 1.00 42.90  ? 46  LYS E CB  1 
ATOM   3900 C  CG  . LYS E 1 27  ? -45.095 22.863  -44.468 1.00 43.52  ? 46  LYS E CG  1 
ATOM   3901 C  CD  . LYS E 1 27  ? -43.844 22.405  -45.198 1.00 43.51  ? 46  LYS E CD  1 
ATOM   3902 C  CE  . LYS E 1 27  ? -44.053 21.083  -45.911 1.00 42.85  ? 46  LYS E CE  1 
ATOM   3903 N  NZ  . LYS E 1 27  ? -42.783 20.585  -46.507 1.00 42.42  ? 46  LYS E NZ  1 
ATOM   3904 N  N   . GLN E 1 28  ? -42.889 25.918  -40.988 1.00 32.46  ? 47  GLN E N   1 
ATOM   3905 C  CA  . GLN E 1 28  ? -42.393 27.190  -40.469 1.00 32.92  ? 47  GLN E CA  1 
ATOM   3906 C  C   . GLN E 1 28  ? -40.886 27.156  -40.242 1.00 32.78  ? 47  GLN E C   1 
ATOM   3907 O  O   . GLN E 1 28  ? -40.330 26.125  -39.871 1.00 32.01  ? 47  GLN E O   1 
ATOM   3908 C  CB  . GLN E 1 28  ? -43.109 27.565  -39.170 1.00 32.74  ? 47  GLN E CB  1 
ATOM   3909 C  CG  . GLN E 1 28  ? -42.645 28.882  -38.567 1.00 34.77  ? 47  GLN E CG  1 
ATOM   3910 C  CD  . GLN E 1 28  ? -43.399 29.243  -37.305 1.00 35.03  ? 47  GLN E CD  1 
ATOM   3911 O  OE1 . GLN E 1 28  ? -44.420 28.636  -36.985 1.00 35.41  ? 47  GLN E OE1 1 
ATOM   3912 N  NE2 . GLN E 1 28  ? -42.899 30.236  -36.580 1.00 34.13  ? 47  GLN E NE2 1 
ATOM   3913 N  N   . PHE E 1 29  ? -40.195 28.204  -40.669 1.00 49.03  ? 48  PHE E N   1 
ATOM   3914 C  CA  . PHE E 1 29  ? -38.744 28.272  -40.509 1.00 49.85  ? 48  PHE E CA  1 
ATOM   3915 C  C   . PHE E 1 29  ? -38.306 29.585  -39.859 1.00 51.75  ? 48  PHE E C   1 
ATOM   3916 O  O   . PHE E 1 29  ? -38.917 30.632  -40.076 1.00 52.84  ? 48  PHE E O   1 
ATOM   3917 C  CB  . PHE E 1 29  ? -38.026 28.057  -41.848 1.00 49.42  ? 48  PHE E CB  1 
ATOM   3918 C  CG  . PHE E 1 29  ? -38.640 28.805  -42.997 1.00 51.75  ? 48  PHE E CG  1 
ATOM   3919 C  CD1 . PHE E 1 29  ? -39.499 28.164  -43.878 1.00 51.97  ? 48  PHE E CD1 1 
ATOM   3920 C  CD2 . PHE E 1 29  ? -38.359 30.146  -43.202 1.00 53.89  ? 48  PHE E CD2 1 
ATOM   3921 C  CE1 . PHE E 1 29  ? -40.067 28.847  -44.939 1.00 52.31  ? 48  PHE E CE1 1 
ATOM   3922 C  CE2 . PHE E 1 29  ? -38.925 30.835  -44.261 1.00 55.21  ? 48  PHE E CE2 1 
ATOM   3923 C  CZ  . PHE E 1 29  ? -39.780 30.183  -45.131 1.00 54.35  ? 48  PHE E CZ  1 
ATOM   3924 N  N   . VAL E 1 30  ? -37.250 29.517  -39.054 1.00 51.25  ? 49  VAL E N   1 
ATOM   3925 C  CA  . VAL E 1 30  ? -36.751 30.685  -38.337 1.00 52.09  ? 49  VAL E CA  1 
ATOM   3926 C  C   . VAL E 1 30  ? -35.236 30.808  -38.471 1.00 52.79  ? 49  VAL E C   1 
ATOM   3927 O  O   . VAL E 1 30  ? -34.505 29.863  -38.177 1.00 52.20  ? 49  VAL E O   1 
ATOM   3928 C  CB  . VAL E 1 30  ? -37.123 30.629  -36.842 1.00 50.70  ? 49  VAL E CB  1 
ATOM   3929 C  CG1 . VAL E 1 30  ? -36.456 31.762  -36.081 1.00 51.51  ? 49  VAL E CG1 1 
ATOM   3930 C  CG2 . VAL E 1 30  ? -38.633 30.676  -36.670 1.00 51.09  ? 49  VAL E CG2 1 
ATOM   3931 N  N   . PRO E 1 31  ? -34.757 31.979  -38.920 1.00 57.59  ? 50  PRO E N   1 
ATOM   3932 C  CA  . PRO E 1 31  ? -35.597 33.125  -39.290 1.00 59.24  ? 50  PRO E CA  1 
ATOM   3933 C  C   . PRO E 1 31  ? -36.399 32.872  -40.565 1.00 58.92  ? 50  PRO E C   1 
ATOM   3934 O  O   . PRO E 1 31  ? -36.033 32.003  -41.356 1.00 57.96  ? 50  PRO E O   1 
ATOM   3935 C  CB  . PRO E 1 31  ? -34.581 34.247  -39.523 1.00 60.89  ? 50  PRO E CB  1 
ATOM   3936 C  CG  . PRO E 1 31  ? -33.297 33.559  -39.815 1.00 59.82  ? 50  PRO E CG  1 
ATOM   3937 C  CD  . PRO E 1 31  ? -33.319 32.259  -39.079 1.00 57.57  ? 50  PRO E CD  1 
ATOM   3938 N  N   . GLY E 1 32  ? -37.479 33.626  -40.749 1.00 48.37  ? 51  GLY E N   1 
ATOM   3939 C  CA  . GLY E 1 32  ? -38.345 33.468  -41.904 1.00 48.04  ? 51  GLY E CA  1 
ATOM   3940 C  C   . GLY E 1 32  ? -37.716 33.948  -43.199 1.00 49.94  ? 51  GLY E C   1 
ATOM   3941 O  O   . GLY E 1 32  ? -38.264 34.810  -43.888 1.00 51.36  ? 51  GLY E O   1 
ATOM   3942 N  N   . VAL E 1 33  ? -36.560 33.382  -43.530 1.00 43.28  ? 52  VAL E N   1 
ATOM   3943 C  CA  . VAL E 1 33  ? -35.850 33.721  -44.758 1.00 43.50  ? 52  VAL E CA  1 
ATOM   3944 C  C   . VAL E 1 33  ? -35.188 32.470  -45.318 1.00 42.19  ? 52  VAL E C   1 
ATOM   3945 O  O   . VAL E 1 33  ? -35.003 31.491  -44.597 1.00 41.17  ? 52  VAL E O   1 
ATOM   3946 C  CB  . VAL E 1 33  ? -34.775 34.798  -44.506 1.00 44.10  ? 52  VAL E CB  1 
ATOM   3947 C  CG1 . VAL E 1 33  ? -35.423 36.140  -44.195 1.00 43.85  ? 52  VAL E CG1 1 
ATOM   3948 C  CG2 . VAL E 1 33  ? -33.849 34.369  -43.379 1.00 43.61  ? 52  VAL E CG2 1 
ATOM   3949 N  N   . PRO E 1 34  ? -34.839 32.491  -46.613 1.00 63.88  ? 53  PRO E N   1 
ATOM   3950 C  CA  . PRO E 1 34  ? -34.166 31.348  -47.242 1.00 63.81  ? 53  PRO E CA  1 
ATOM   3951 C  C   . PRO E 1 34  ? -32.930 30.904  -46.465 1.00 63.27  ? 53  PRO E C   1 
ATOM   3952 O  O   . PRO E 1 34  ? -32.194 31.737  -45.932 1.00 63.51  ? 53  PRO E O   1 
ATOM   3953 C  CB  . PRO E 1 34  ? -33.759 31.897  -48.611 1.00 64.24  ? 53  PRO E CB  1 
ATOM   3954 C  CG  . PRO E 1 34  ? -34.782 32.937  -48.905 1.00 66.01  ? 53  PRO E CG  1 
ATOM   3955 C  CD  . PRO E 1 34  ? -35.125 33.565  -47.581 1.00 65.33  ? 53  PRO E CD  1 
ATOM   3956 N  N   . GLU E 1 35  ? -32.714 29.595  -46.407 1.00 57.36  ? 54  GLU E N   1 
ATOM   3957 C  CA  . GLU E 1 35  ? -31.582 29.023  -45.687 1.00 55.67  ? 54  GLU E CA  1 
ATOM   3958 C  C   . GLU E 1 35  ? -30.257 29.548  -46.229 1.00 57.18  ? 54  GLU E C   1 
ATOM   3959 O  O   . GLU E 1 35  ? -29.211 29.390  -45.600 1.00 57.05  ? 54  GLU E O   1 
ATOM   3960 C  CB  . GLU E 1 35  ? -31.621 27.496  -45.791 1.00 54.33  ? 54  GLU E CB  1 
ATOM   3961 C  CG  . GLU E 1 35  ? -30.593 26.772  -44.938 1.00 52.93  ? 54  GLU E CG  1 
ATOM   3962 C  CD  . GLU E 1 35  ? -30.575 25.277  -45.200 1.00 50.73  ? 54  GLU E CD  1 
ATOM   3963 O  OE1 . GLU E 1 35  ? -30.708 24.877  -46.377 1.00 50.42  ? 54  GLU E OE1 1 
ATOM   3964 O  OE2 . GLU E 1 35  ? -30.424 24.503  -44.232 1.00 48.80  ? 54  GLU E OE2 1 
ATOM   3965 N  N   . ARG E 1 36  ? -30.307 30.182  -47.397 1.00 84.22  ? 55  ARG E N   1 
ATOM   3966 C  CA  . ARG E 1 36  ? -29.096 30.633  -48.075 1.00 85.37  ? 55  ARG E CA  1 
ATOM   3967 C  C   . ARG E 1 36  ? -28.831 32.127  -47.910 1.00 85.74  ? 55  ARG E C   1 
ATOM   3968 O  O   . ARG E 1 36  ? -28.036 32.706  -48.649 1.00 87.54  ? 55  ARG E O   1 
ATOM   3969 C  CB  . ARG E 1 36  ? -29.160 30.279  -49.562 1.00 86.05  ? 55  ARG E CB  1 
ATOM   3970 C  CG  . ARG E 1 36  ? -29.330 28.797  -49.830 1.00 85.84  ? 55  ARG E CG  1 
ATOM   3971 C  CD  . ARG E 1 36  ? -28.235 27.992  -49.151 1.00 84.50  ? 55  ARG E CD  1 
ATOM   3972 N  NE  . ARG E 1 36  ? -28.356 26.567  -49.441 1.00 84.13  ? 55  ARG E NE  1 
ATOM   3973 C  CZ  . ARG E 1 36  ? -27.892 25.988  -50.543 1.00 84.43  ? 55  ARG E CZ  1 
ATOM   3974 N  NH1 . ARG E 1 36  ? -27.275 26.714  -51.467 1.00 84.74  ? 55  ARG E NH1 1 
ATOM   3975 N  NH2 . ARG E 1 36  ? -28.047 24.684  -50.725 1.00 83.37  ? 55  ARG E NH2 1 
ATOM   3976 N  N   . THR E 1 37  ? -29.493 32.747  -46.940 1.00 56.26  ? 56  THR E N   1 
ATOM   3977 C  CA  . THR E 1 37  ? -29.298 34.170  -46.689 1.00 58.25  ? 56  THR E CA  1 
ATOM   3978 C  C   . THR E 1 37  ? -28.316 34.391  -45.541 1.00 58.48  ? 56  THR E C   1 
ATOM   3979 O  O   . THR E 1 37  ? -28.104 33.501  -44.717 1.00 57.25  ? 56  THR E O   1 
ATOM   3980 C  CB  . THR E 1 37  ? -30.629 34.877  -46.377 1.00 58.34  ? 56  THR E CB  1 
ATOM   3981 O  OG1 . THR E 1 37  ? -31.219 34.297  -45.208 1.00 56.55  ? 56  THR E OG1 1 
ATOM   3982 C  CG2 . THR E 1 37  ? -31.590 34.734  -47.547 1.00 58.44  ? 56  THR E CG2 1 
ATOM   3983 N  N   . LEU E 1 38  ? -27.716 35.577  -45.495 1.00 74.81  ? 57  LEU E N   1 
ATOM   3984 C  CA  . LEU E 1 38  ? -26.740 35.900  -44.457 1.00 75.19  ? 57  LEU E CA  1 
ATOM   3985 C  C   . LEU E 1 38  ? -27.386 35.960  -43.077 1.00 74.12  ? 57  LEU E C   1 
ATOM   3986 O  O   . LEU E 1 38  ? -26.709 35.808  -42.058 1.00 74.14  ? 57  LEU E O   1 
ATOM   3987 C  CB  . LEU E 1 38  ? -26.032 37.220  -44.763 1.00 76.05  ? 57  LEU E CB  1 
ATOM   3988 C  CG  . LEU E 1 38  ? -25.151 37.246  -46.011 1.00 77.46  ? 57  LEU E CG  1 
ATOM   3989 C  CD1 . LEU E 1 38  ? -24.269 38.485  -46.000 1.00 77.59  ? 57  LEU E CD1 1 
ATOM   3990 C  CD2 . LEU E 1 38  ? -24.302 35.985  -46.107 1.00 73.74  ? 57  LEU E CD2 1 
ATOM   3991 N  N   . GLY E 1 39  ? -28.695 36.188  -43.050 1.00 62.72  ? 58  GLY E N   1 
ATOM   3992 C  CA  . GLY E 1 39  ? -29.440 36.213  -41.805 1.00 61.18  ? 58  GLY E CA  1 
ATOM   3993 C  C   . GLY E 1 39  ? -29.804 34.807  -41.371 1.00 60.18  ? 58  GLY E C   1 
ATOM   3994 O  O   . GLY E 1 39  ? -30.318 34.593  -40.272 1.00 59.46  ? 58  GLY E O   1 
ATOM   3995 N  N   . ALA E 1 40  ? -29.535 33.844  -42.247 1.00 53.89  ? 59  ALA E N   1 
ATOM   3996 C  CA  . ALA E 1 40  ? -29.806 32.442  -41.954 1.00 51.61  ? 59  ALA E CA  1 
ATOM   3997 C  C   . ALA E 1 40  ? -28.513 31.679  -41.700 1.00 50.79  ? 59  ALA E C   1 
ATOM   3998 O  O   . ALA E 1 40  ? -27.808 31.947  -40.728 1.00 50.32  ? 59  ALA E O   1 
ATOM   3999 C  CB  . ALA E 1 40  ? -30.588 31.801  -43.091 1.00 51.63  ? 59  ALA E CB  1 
ATOM   4000 N  N   . SER E 1 41  ? -28.205 30.729  -42.578 1.00 37.48  ? 60  SER E N   1 
ATOM   4001 C  CA  . SER E 1 41  ? -27.008 29.909  -42.426 1.00 35.89  ? 60  SER E CA  1 
ATOM   4002 C  C   . SER E 1 41  ? -25.990 30.184  -43.523 1.00 36.94  ? 60  SER E C   1 
ATOM   4003 O  O   . SER E 1 41  ? -24.976 29.492  -43.625 1.00 37.03  ? 60  SER E O   1 
ATOM   4004 C  CB  . SER E 1 41  ? -27.373 28.422  -42.409 1.00 33.60  ? 60  SER E CB  1 
ATOM   4005 O  OG  . SER E 1 41  ? -28.140 28.105  -41.259 1.00 32.99  ? 60  SER E OG  1 
ATOM   4006 N  N   . GLY E 1 42  ? -26.259 31.196  -44.339 1.00 46.35  ? 61  GLY E N   1 
ATOM   4007 C  CA  . GLY E 1 42  ? -25.365 31.546  -45.426 1.00 47.78  ? 61  GLY E CA  1 
ATOM   4008 C  C   . GLY E 1 42  ? -25.526 30.633  -46.626 1.00 48.27  ? 61  GLY E C   1 
ATOM   4009 O  O   . GLY E 1 42  ? -26.476 29.855  -46.699 1.00 48.33  ? 61  GLY E O   1 
ATOM   4010 N  N   . PRO E 1 43  ? -24.586 30.718  -47.576 1.00 52.24  ? 62  PRO E N   1 
ATOM   4011 C  CA  . PRO E 1 43  ? -24.639 29.956  -48.824 1.00 52.92  ? 62  PRO E CA  1 
ATOM   4012 C  C   . PRO E 1 43  ? -23.901 28.626  -48.729 1.00 52.01  ? 62  PRO E C   1 
ATOM   4013 O  O   . PRO E 1 43  ? -23.088 28.428  -47.826 1.00 51.30  ? 62  PRO E O   1 
ATOM   4014 C  CB  . PRO E 1 43  ? -23.912 30.883  -49.788 1.00 54.02  ? 62  PRO E CB  1 
ATOM   4015 C  CG  . PRO E 1 43  ? -22.808 31.451  -48.935 1.00 53.88  ? 62  PRO E CG  1 
ATOM   4016 C  CD  . PRO E 1 43  ? -23.379 31.563  -47.521 1.00 52.57  ? 62  PRO E CD  1 
ATOM   4017 N  N   . ALA E 1 44  ? -24.191 27.723  -49.660 1.00 52.34  ? 63  ALA E N   1 
ATOM   4018 C  CA  . ALA E 1 44  ? -23.503 26.442  -49.725 1.00 51.94  ? 63  ALA E CA  1 
ATOM   4019 C  C   . ALA E 1 44  ? -22.096 26.631  -50.281 1.00 52.13  ? 63  ALA E C   1 
ATOM   4020 O  O   . ALA E 1 44  ? -21.923 27.017  -51.437 1.00 52.33  ? 63  ALA E O   1 
ATOM   4021 C  CB  . ALA E 1 44  ? -24.288 25.461  -50.582 1.00 51.83  ? 63  ALA E CB  1 
ATOM   4022 N  N   . GLU E 1 45  ? -21.094 26.358  -49.453 1.00 65.64  ? 64  GLU E N   1 
ATOM   4023 C  CA  . GLU E 1 45  ? -19.705 26.556  -49.850 1.00 65.99  ? 64  GLU E CA  1 
ATOM   4024 C  C   . GLU E 1 45  ? -19.146 25.372  -50.636 1.00 65.10  ? 64  GLU E C   1 
ATOM   4025 O  O   . GLU E 1 45  ? -17.948 25.313  -50.912 1.00 65.45  ? 64  GLU E O   1 
ATOM   4026 C  CB  . GLU E 1 45  ? -18.835 26.851  -48.624 1.00 67.77  ? 64  GLU E CB  1 
ATOM   4027 C  CG  . GLU E 1 45  ? -19.228 28.126  -47.884 1.00 70.07  ? 64  GLU E CG  1 
ATOM   4028 C  CD  . GLU E 1 45  ? -18.227 28.521  -46.814 1.00 70.56  ? 64  GLU E CD  1 
ATOM   4029 O  OE1 . GLU E 1 45  ? -17.379 27.680  -46.448 1.00 71.01  ? 64  GLU E OE1 1 
ATOM   4030 O  OE2 . GLU E 1 45  ? -18.291 29.675  -46.337 1.00 70.57  ? 64  GLU E OE2 1 
ATOM   4031 N  N   . GLY E 1 46  ? -20.017 24.435  -50.999 1.00 59.07  ? 65  GLY E N   1 
ATOM   4032 C  CA  . GLY E 1 46  ? -19.610 23.278  -51.776 1.00 58.00  ? 65  GLY E CA  1 
ATOM   4033 C  C   . GLY E 1 46  ? -20.131 21.967  -51.218 1.00 57.05  ? 65  GLY E C   1 
ATOM   4034 O  O   . GLY E 1 46  ? -20.965 21.956  -50.313 1.00 56.11  ? 65  GLY E O   1 
ATOM   4035 N  N   . ARG E 1 47  ? -19.639 20.858  -51.763 1.00 61.87  ? 66  ARG E N   1 
ATOM   4036 C  CA  . ARG E 1 47  ? -20.057 19.532  -51.317 1.00 59.63  ? 66  ARG E CA  1 
ATOM   4037 C  C   . ARG E 1 47  ? -18.863 18.682  -50.887 1.00 58.24  ? 66  ARG E C   1 
ATOM   4038 O  O   . ARG E 1 47  ? -18.023 18.316  -51.707 1.00 57.83  ? 66  ARG E O   1 
ATOM   4039 C  CB  . ARG E 1 47  ? -20.850 18.821  -52.417 1.00 59.34  ? 66  ARG E CB  1 
ATOM   4040 C  CG  . ARG E 1 47  ? -21.266 17.402  -52.065 1.00 57.67  ? 66  ARG E CG  1 
ATOM   4041 C  CD  . ARG E 1 47  ? -22.318 16.878  -53.029 1.00 57.53  ? 66  ARG E CD  1 
ATOM   4042 N  NE  . ARG E 1 47  ? -22.581 15.454  -52.828 1.00 57.09  ? 66  ARG E NE  1 
ATOM   4043 C  CZ  . ARG E 1 47  ? -23.506 14.765  -53.490 1.00 57.03  ? 66  ARG E CZ  1 
ATOM   4044 N  NH1 . ARG E 1 47  ? -24.264 15.370  -54.397 1.00 57.43  ? 66  ARG E NH1 1 
ATOM   4045 N  NH2 . ARG E 1 47  ? -23.674 13.472  -53.244 1.00 54.15  ? 66  ARG E NH2 1 
ATOM   4046 N  N   . VAL E 1 48  ? -18.802 18.370  -49.595 1.00 30.84  ? 67  VAL E N   1 
ATOM   4047 C  CA  . VAL E 1 48  ? -17.690 17.611  -49.030 1.00 29.88  ? 67  VAL E CA  1 
ATOM   4048 C  C   . VAL E 1 48  ? -17.800 16.113  -49.311 1.00 28.80  ? 67  VAL E C   1 
ATOM   4049 O  O   . VAL E 1 48  ? -18.786 15.474  -48.948 1.00 28.19  ? 67  VAL E O   1 
ATOM   4050 C  CB  . VAL E 1 48  ? -17.597 17.814  -47.507 1.00 29.60  ? 67  VAL E CB  1 
ATOM   4051 C  CG1 . VAL E 1 48  ? -16.363 17.119  -46.954 1.00 30.30  ? 67  VAL E CG1 1 
ATOM   4052 C  CG2 . VAL E 1 48  ? -17.580 19.295  -47.170 1.00 30.50  ? 67  VAL E CG2 1 
ATOM   4053 N  N   . ALA E 1 49  ? -16.777 15.557  -49.953 1.00 42.41  ? 68  ALA E N   1 
ATOM   4054 C  CA  . ALA E 1 49  ? -16.738 14.128  -50.240 1.00 42.40  ? 68  ALA E CA  1 
ATOM   4055 C  C   . ALA E 1 49  ? -15.817 13.410  -49.258 1.00 43.41  ? 68  ALA E C   1 
ATOM   4056 O  O   . ALA E 1 49  ? -14.996 14.042  -48.592 1.00 43.96  ? 68  ALA E O   1 
ATOM   4057 C  CB  . ALA E 1 49  ? -16.292 13.883  -51.671 1.00 43.31  ? 68  ALA E CB  1 
ATOM   4058 N  N   . ARG E 1 50  ? -15.952 12.090  -49.178 1.00 63.98  ? 69  ARG E N   1 
ATOM   4059 C  CA  . ARG E 1 50  ? -15.221 11.299  -48.189 1.00 63.44  ? 69  ARG E CA  1 
ATOM   4060 C  C   . ARG E 1 50  ? -13.703 11.342  -48.365 1.00 64.19  ? 69  ARG E C   1 
ATOM   4061 O  O   . ARG E 1 50  ? -12.957 11.202  -47.395 1.00 64.90  ? 69  ARG E O   1 
ATOM   4062 C  CB  . ARG E 1 50  ? -15.713 9.849   -48.188 1.00 62.52  ? 69  ARG E CB  1 
ATOM   4063 C  CG  . ARG E 1 50  ? -14.960 8.944   -47.227 1.00 62.60  ? 69  ARG E CG  1 
ATOM   4064 C  CD  . ARG E 1 50  ? -15.632 7.589   -47.097 1.00 60.95  ? 69  ARG E CD  1 
ATOM   4065 N  NE  . ARG E 1 50  ? -16.978 7.706   -46.545 1.00 59.91  ? 69  ARG E NE  1 
ATOM   4066 C  CZ  . ARG E 1 50  ? -17.244 7.819   -45.248 1.00 60.72  ? 69  ARG E CZ  1 
ATOM   4067 N  NH1 . ARG E 1 50  ? -16.254 7.832   -44.363 1.00 61.18  ? 69  ARG E NH1 1 
ATOM   4068 N  NH2 . ARG E 1 50  ? -18.500 7.921   -44.835 1.00 57.92  ? 69  ARG E NH2 1 
ATOM   4069 N  N   . GLY E 1 51  ? -13.249 11.534  -49.597 1.00 41.30  ? 70  GLY E N   1 
ATOM   4070 C  CA  . GLY E 1 51  ? -11.823 11.574  -49.872 1.00 42.79  ? 70  GLY E CA  1 
ATOM   4071 C  C   . GLY E 1 51  ? -11.218 12.961  -49.746 1.00 43.24  ? 70  GLY E C   1 
ATOM   4072 O  O   . GLY E 1 51  ? -10.001 13.106  -49.611 1.00 42.23  ? 70  GLY E O   1 
ATOM   4073 N  N   . SER E 1 52  ? -12.072 13.980  -49.778 1.00 54.08  ? 71  SER E N   1 
ATOM   4074 C  CA  . SER E 1 52  ? -11.628 15.372  -49.819 1.00 55.14  ? 71  SER E CA  1 
ATOM   4075 C  C   . SER E 1 52  ? -10.768 15.780  -48.629 1.00 54.30  ? 71  SER E C   1 
ATOM   4076 O  O   . SER E 1 52  ? -10.556 15.002  -47.700 1.00 54.15  ? 71  SER E O   1 
ATOM   4077 C  CB  . SER E 1 52  ? -12.833 16.312  -49.922 1.00 55.20  ? 71  SER E CB  1 
ATOM   4078 O  OG  . SER E 1 52  ? -13.543 16.364  -48.695 1.00 54.05  ? 71  SER E OG  1 
ATOM   4079 N  N   . GLU E 1 53  ? -10.277 17.014  -48.672 1.00 70.95  ? 72  GLU E N   1 
ATOM   4080 C  CA  . GLU E 1 53  ? -9.491  17.576  -47.581 1.00 72.72  ? 72  GLU E CA  1 
ATOM   4081 C  C   . GLU E 1 53  ? -10.376 18.400  -46.654 1.00 72.52  ? 72  GLU E C   1 
ATOM   4082 O  O   . GLU E 1 53  ? -9.950  18.814  -45.576 1.00 72.74  ? 72  GLU E O   1 
ATOM   4083 C  CB  . GLU E 1 53  ? -8.352  18.437  -48.127 1.00 74.53  ? 72  GLU E CB  1 
ATOM   4084 C  CG  . GLU E 1 53  ? -7.170  17.636  -48.649 1.00 75.23  ? 72  GLU E CG  1 
ATOM   4085 C  CD  . GLU E 1 53  ? -6.414  16.930  -47.537 1.00 75.89  ? 72  GLU E CD  1 
ATOM   4086 O  OE1 . GLU E 1 53  ? -6.346  17.485  -46.418 1.00 74.86  ? 72  GLU E OE1 1 
ATOM   4087 O  OE2 . GLU E 1 53  ? -5.887  15.823  -47.782 1.00 74.85  ? 72  GLU E OE2 1 
ATOM   4088 N  N   . ARG E 1 54  ? -11.609 18.640  -47.087 1.00 63.11  ? 73  ARG E N   1 
ATOM   4089 C  CA  . ARG E 1 54  ? -12.593 19.319  -46.254 1.00 62.86  ? 73  ARG E CA  1 
ATOM   4090 C  C   . ARG E 1 54  ? -13.364 18.287  -45.440 1.00 60.98  ? 73  ARG E C   1 
ATOM   4091 O  O   . ARG E 1 54  ? -14.260 18.626  -44.666 1.00 59.81  ? 73  ARG E O   1 
ATOM   4092 C  CB  . ARG E 1 54  ? -13.542 20.155  -47.113 1.00 62.48  ? 73  ARG E CB  1 
ATOM   4093 C  CG  . ARG E 1 54  ? -12.875 21.352  -47.768 1.00 64.06  ? 73  ARG E CG  1 
ATOM   4094 C  CD  . ARG E 1 54  ? -13.774 22.022  -48.798 1.00 65.93  ? 73  ARG E CD  1 
ATOM   4095 N  NE  . ARG E 1 54  ? -15.035 22.488  -48.225 1.00 66.27  ? 73  ARG E NE  1 
ATOM   4096 C  CZ  . ARG E 1 54  ? -16.235 22.058  -48.605 1.00 64.47  ? 73  ARG E CZ  1 
ATOM   4097 N  NH1 . ARG E 1 54  ? -16.342 21.153  -49.570 1.00 62.61  ? 73  ARG E NH1 1 
ATOM   4098 N  NH2 . ARG E 1 54  ? -17.328 22.538  -48.026 1.00 63.09  ? 73  ARG E NH2 1 
ATOM   4099 N  N   . PHE E 1 55  ? -12.997 17.024  -45.624 1.00 55.97  ? 74  PHE E N   1 
ATOM   4100 C  CA  . PHE E 1 55  ? -13.605 15.922  -44.890 1.00 54.74  ? 74  PHE E CA  1 
ATOM   4101 C  C   . PHE E 1 55  ? -12.896 15.720  -43.555 1.00 55.87  ? 74  PHE E C   1 
ATOM   4102 O  O   . PHE E 1 55  ? -13.522 15.371  -42.552 1.00 54.28  ? 74  PHE E O   1 
ATOM   4103 C  CB  . PHE E 1 55  ? -13.538 14.641  -45.722 1.00 53.93  ? 74  PHE E CB  1 
ATOM   4104 C  CG  . PHE E 1 55  ? -14.134 13.442  -45.043 1.00 52.81  ? 74  PHE E CG  1 
ATOM   4105 C  CD1 . PHE E 1 55  ? -15.500 13.219  -45.079 1.00 51.83  ? 74  PHE E CD1 1 
ATOM   4106 C  CD2 . PHE E 1 55  ? -13.329 12.534  -44.377 1.00 53.34  ? 74  PHE E CD2 1 
ATOM   4107 C  CE1 . PHE E 1 55  ? -16.054 12.114  -44.459 1.00 50.75  ? 74  PHE E CE1 1 
ATOM   4108 C  CE2 . PHE E 1 55  ? -13.876 11.427  -43.754 1.00 53.06  ? 74  PHE E CE2 1 
ATOM   4109 C  CZ  . PHE E 1 55  ? -15.240 11.216  -43.795 1.00 50.95  ? 74  PHE E CZ  1 
ATOM   4110 N  N   . ARG E 1 56  ? -11.585 15.946  -43.551 1.00 90.82  ? 75  ARG E N   1 
ATOM   4111 C  CA  . ARG E 1 56  ? -10.782 15.787  -42.345 1.00 89.92  ? 75  ARG E CA  1 
ATOM   4112 C  C   . ARG E 1 56  ? -11.067 16.898  -41.340 1.00 89.55  ? 75  ARG E C   1 
ATOM   4113 O  O   . ARG E 1 56  ? -10.629 16.839  -40.191 1.00 89.63  ? 75  ARG E O   1 
ATOM   4114 C  CB  . ARG E 1 56  ? -9.292  15.753  -42.690 1.00 92.15  ? 75  ARG E CB  1 
ATOM   4115 C  CG  . ARG E 1 56  ? -8.889  14.573  -43.561 1.00 92.96  ? 75  ARG E CG  1 
ATOM   4116 C  CD  . ARG E 1 56  ? -7.384  14.531  -43.781 1.00 94.16  ? 75  ARG E CD  1 
ATOM   4117 N  NE  . ARG E 1 56  ? -6.978  13.341  -44.525 1.00 94.11  ? 75  ARG E NE  1 
ATOM   4118 C  CZ  . ARG E 1 56  ? -6.657  12.180  -43.962 1.00 92.71  ? 75  ARG E CZ  1 
ATOM   4119 N  NH1 . ARG E 1 56  ? -6.692  12.049  -42.642 1.00 91.91  ? 75  ARG E NH1 1 
ATOM   4120 N  NH2 . ARG E 1 56  ? -6.300  11.151  -44.717 1.00 89.25  ? 75  ARG E NH2 1 
ATOM   4121 N  N   . ASP E 1 57  ? -11.799 17.913  -41.785 1.00 53.43  ? 76  ASP E N   1 
ATOM   4122 C  CA  . ASP E 1 57  ? -12.219 18.993  -40.902 1.00 53.64  ? 76  ASP E CA  1 
ATOM   4123 C  C   . ASP E 1 57  ? -13.515 18.620  -40.195 1.00 51.84  ? 76  ASP E C   1 
ATOM   4124 O  O   . ASP E 1 57  ? -13.902 19.248  -39.210 1.00 50.02  ? 76  ASP E O   1 
ATOM   4125 C  CB  . ASP E 1 57  ? -12.396 20.292  -41.684 1.00 55.45  ? 76  ASP E CB  1 
ATOM   4126 C  CG  . ASP E 1 57  ? -11.076 20.888  -42.126 1.00 57.36  ? 76  ASP E CG  1 
ATOM   4127 O  OD1 . ASP E 1 57  ? -10.029 20.486  -41.575 1.00 57.85  ? 76  ASP E OD1 1 
ATOM   4128 O  OD2 . ASP E 1 57  ? -11.085 21.761  -43.019 1.00 58.44  ? 76  ASP E OD2 1 
ATOM   4129 N  N   . LEU E 1 58  ? -14.183 17.593  -40.708 1.00 52.33  ? 77  LEU E N   1 
ATOM   4130 C  CA  . LEU E 1 58  ? -15.395 17.084  -40.080 1.00 49.99  ? 77  LEU E CA  1 
ATOM   4131 C  C   . LEU E 1 58  ? -15.045 16.179  -38.904 1.00 49.27  ? 77  LEU E C   1 
ATOM   4132 O  O   . LEU E 1 58  ? -14.221 15.272  -39.028 1.00 49.80  ? 77  LEU E O   1 
ATOM   4133 C  CB  . LEU E 1 58  ? -16.251 16.327  -41.095 1.00 49.13  ? 77  LEU E CB  1 
ATOM   4134 C  CG  . LEU E 1 58  ? -16.956 17.194  -42.138 1.00 50.17  ? 77  LEU E CG  1 
ATOM   4135 C  CD1 . LEU E 1 58  ? -17.884 16.352  -42.998 1.00 48.23  ? 77  LEU E CD1 1 
ATOM   4136 C  CD2 . LEU E 1 58  ? -17.724 18.316  -41.457 1.00 49.48  ? 77  LEU E CD2 1 
ATOM   4137 N  N   . VAL E 1 59  ? -15.676 16.432  -37.763 1.00 42.72  ? 78  VAL E N   1 
ATOM   4138 C  CA  . VAL E 1 59  ? -15.400 15.662  -36.556 1.00 41.08  ? 78  VAL E CA  1 
ATOM   4139 C  C   . VAL E 1 59  ? -16.623 14.849  -36.136 1.00 39.84  ? 78  VAL E C   1 
ATOM   4140 O  O   . VAL E 1 59  ? -17.751 15.335  -36.211 1.00 39.56  ? 78  VAL E O   1 
ATOM   4141 C  CB  . VAL E 1 59  ? -14.958 16.581  -35.402 1.00 41.85  ? 78  VAL E CB  1 
ATOM   4142 C  CG1 . VAL E 1 59  ? -14.324 15.770  -34.283 1.00 40.65  ? 78  VAL E CG1 1 
ATOM   4143 C  CG2 . VAL E 1 59  ? -13.983 17.630  -35.911 1.00 44.66  ? 78  VAL E CG2 1 
ATOM   4144 N  N   . PRO E 1 60  ? -16.398 13.595  -35.711 1.00 29.05  ? 79  PRO E N   1 
ATOM   4145 C  CA  . PRO E 1 60  ? -17.461 12.686  -35.263 1.00 26.65  ? 79  PRO E CA  1 
ATOM   4146 C  C   . PRO E 1 60  ? -18.019 13.046  -33.888 1.00 25.46  ? 79  PRO E C   1 
ATOM   4147 O  O   . PRO E 1 60  ? -17.255 13.183  -32.934 1.00 25.99  ? 79  PRO E O   1 
ATOM   4148 C  CB  . PRO E 1 60  ? -16.752 11.327  -35.184 1.00 25.60  ? 79  PRO E CB  1 
ATOM   4149 C  CG  . PRO E 1 60  ? -15.492 11.484  -35.976 1.00 26.73  ? 79  PRO E CG  1 
ATOM   4150 C  CD  . PRO E 1 60  ? -15.099 12.911  -35.809 1.00 29.06  ? 79  PRO E CD  1 
ATOM   4151 N  N   . ASN E 1 61  ? -19.337 13.186  -33.791 1.00 24.09  ? 80  ASN E N   1 
ATOM   4152 C  CA  . ASN E 1 61  ? -19.986 13.431  -32.509 1.00 23.64  ? 80  ASN E CA  1 
ATOM   4153 C  C   . ASN E 1 61  ? -20.442 12.122  -31.870 1.00 22.29  ? 80  ASN E C   1 
ATOM   4154 O  O   . ASN E 1 61  ? -21.255 11.396  -32.441 1.00 21.42  ? 80  ASN E O   1 
ATOM   4155 C  CB  . ASN E 1 61  ? -21.171 14.386  -32.678 1.00 24.41  ? 80  ASN E CB  1 
ATOM   4156 C  CG  . ASN E 1 61  ? -21.707 14.900  -31.351 1.00 25.25  ? 80  ASN E CG  1 
ATOM   4157 O  OD1 . ASN E 1 61  ? -22.440 15.888  -31.307 1.00 26.67  ? 80  ASN E OD1 1 
ATOM   4158 N  ND2 . ASN E 1 61  ? -21.341 14.234  -30.263 1.00 24.03  ? 80  ASN E ND2 1 
ATOM   4159 N  N   . TYR E 1 62  ? -19.913 11.828  -30.685 1.00 31.71  ? 81  TYR E N   1 
ATOM   4160 C  CA  . TYR E 1 62  ? -20.210 10.571  -29.999 1.00 30.60  ? 81  TYR E CA  1 
ATOM   4161 C  C   . TYR E 1 62  ? -21.065 10.760  -28.746 1.00 30.15  ? 81  TYR E C   1 
ATOM   4162 O  O   . TYR E 1 62  ? -21.206 9.838   -27.943 1.00 30.20  ? 81  TYR E O   1 
ATOM   4163 C  CB  . TYR E 1 62  ? -18.916 9.837   -29.638 1.00 28.60  ? 81  TYR E CB  1 
ATOM   4164 C  CG  . TYR E 1 62  ? -18.200 9.235   -30.828 1.00 28.35  ? 81  TYR E CG  1 
ATOM   4165 C  CD1 . TYR E 1 62  ? -18.654 8.060   -31.413 1.00 27.66  ? 81  TYR E CD1 1 
ATOM   4166 C  CD2 . TYR E 1 62  ? -17.069 9.837   -31.361 1.00 28.79  ? 81  TYR E CD2 1 
ATOM   4167 C  CE1 . TYR E 1 62  ? -18.005 7.504   -32.498 1.00 27.46  ? 81  TYR E CE1 1 
ATOM   4168 C  CE2 . TYR E 1 62  ? -16.411 9.288   -32.445 1.00 28.69  ? 81  TYR E CE2 1 
ATOM   4169 C  CZ  . TYR E 1 62  ? -16.882 8.121   -33.011 1.00 28.24  ? 81  TYR E CZ  1 
ATOM   4170 O  OH  . TYR E 1 62  ? -16.232 7.573   -34.094 1.00 27.36  ? 81  TYR E OH  1 
ATOM   4171 N  N   . ASN E 1 63  ? -21.632 11.952  -28.589 1.00 22.43  ? 82  ASN E N   1 
ATOM   4172 C  CA  . ASN E 1 63  ? -22.480 12.264  -27.442 1.00 22.76  ? 82  ASN E CA  1 
ATOM   4173 C  C   . ASN E 1 63  ? -23.548 11.197  -27.196 1.00 22.22  ? 82  ASN E C   1 
ATOM   4174 O  O   . ASN E 1 63  ? -24.454 11.018  -28.009 1.00 22.39  ? 82  ASN E O   1 
ATOM   4175 C  CB  . ASN E 1 63  ? -23.133 13.638  -27.626 1.00 24.36  ? 82  ASN E CB  1 
ATOM   4176 C  CG  . ASN E 1 63  ? -23.801 14.147  -26.362 1.00 24.07  ? 82  ASN E CG  1 
ATOM   4177 O  OD1 . ASN E 1 63  ? -24.153 13.370  -25.473 1.00 23.67  ? 82  ASN E OD1 1 
ATOM   4178 N  ND2 . ASN E 1 63  ? -23.983 15.461  -26.278 1.00 24.34  ? 82  ASN E ND2 1 
ATOM   4179 N  N   . PRO E 1 64  ? -23.439 10.484  -26.064 1.00 21.61  ? 83  PRO E N   1 
ATOM   4180 C  CA  . PRO E 1 64  ? -24.357 9.401   -25.693 1.00 21.12  ? 83  PRO E CA  1 
ATOM   4181 C  C   . PRO E 1 64  ? -25.768 9.906   -25.419 1.00 21.69  ? 83  PRO E C   1 
ATOM   4182 O  O   . PRO E 1 64  ? -26.717 9.121   -25.440 1.00 22.22  ? 83  PRO E O   1 
ATOM   4183 C  CB  . PRO E 1 64  ? -23.745 8.849   -24.400 1.00 21.63  ? 83  PRO E CB  1 
ATOM   4184 C  CG  . PRO E 1 64  ? -22.333 9.323   -24.394 1.00 21.06  ? 83  PRO E CG  1 
ATOM   4185 C  CD  . PRO E 1 64  ? -22.360 10.651  -25.078 1.00 21.88  ? 83  PRO E CD  1 
ATOM   4186 N  N   . ASP E 1 65  ? -25.901 11.202  -25.159 1.00 27.43  ? 84  ASP E N   1 
ATOM   4187 C  CA  . ASP E 1 65  ? -27.207 11.793  -24.888 1.00 28.59  ? 84  ASP E CA  1 
ATOM   4188 C  C   . ASP E 1 65  ? -27.964 12.069  -26.186 1.00 28.73  ? 84  ASP E C   1 
ATOM   4189 O  O   . ASP E 1 65  ? -29.049 12.652  -26.173 1.00 29.23  ? 84  ASP E O   1 
ATOM   4190 C  CB  . ASP E 1 65  ? -27.056 13.073  -24.062 1.00 28.63  ? 84  ASP E CB  1 
ATOM   4191 C  CG  . ASP E 1 65  ? -26.514 12.806  -22.665 1.00 29.29  ? 84  ASP E CG  1 
ATOM   4192 O  OD1 . ASP E 1 65  ? -26.828 11.738  -22.095 1.00 28.18  ? 84  ASP E OD1 1 
ATOM   4193 O  OD2 . ASP E 1 65  ? -25.778 13.663  -22.133 1.00 30.30  ? 84  ASP E OD2 1 
ATOM   4194 N  N   . ILE E 1 66  ? -27.382 11.641  -27.304 1.00 26.18  ? 85  ILE E N   1 
ATOM   4195 C  CA  . ILE E 1 66  ? -28.006 11.789  -28.615 1.00 26.20  ? 85  ILE E CA  1 
ATOM   4196 C  C   . ILE E 1 66  ? -28.032 10.460  -29.363 1.00 25.90  ? 85  ILE E C   1 
ATOM   4197 O  O   . ILE E 1 66  ? -27.037 9.735   -29.396 1.00 25.10  ? 85  ILE E O   1 
ATOM   4198 C  CB  . ILE E 1 66  ? -27.259 12.814  -29.489 1.00 26.64  ? 85  ILE E CB  1 
ATOM   4199 C  CG1 . ILE E 1 66  ? -27.149 14.159  -28.770 1.00 27.60  ? 85  ILE E CG1 1 
ATOM   4200 C  CG2 . ILE E 1 66  ? -27.955 12.976  -30.835 1.00 26.32  ? 85  ILE E CG2 1 
ATOM   4201 C  CD1 . ILE E 1 66  ? -26.277 15.163  -29.493 1.00 28.31  ? 85  ILE E CD1 1 
ATOM   4202 N  N   . ILE E 1 67  ? -29.175 10.148  -29.964 1.00 20.90  ? 86  ILE E N   1 
ATOM   4203 C  CA  . ILE E 1 67  ? -29.319 8.933   -30.754 1.00 20.21  ? 86  ILE E CA  1 
ATOM   4204 C  C   . ILE E 1 67  ? -29.088 9.218   -32.233 1.00 20.59  ? 86  ILE E C   1 
ATOM   4205 O  O   . ILE E 1 67  ? -29.835 9.973   -32.850 1.00 21.14  ? 86  ILE E O   1 
ATOM   4206 C  CB  . ILE E 1 67  ? -30.719 8.317   -30.591 1.00 19.98  ? 86  ILE E CB  1 
ATOM   4207 C  CG1 . ILE E 1 67  ? -30.985 7.962   -29.128 1.00 19.64  ? 86  ILE E CG1 1 
ATOM   4208 C  CG2 . ILE E 1 67  ? -30.864 7.088   -31.476 1.00 19.71  ? 86  ILE E CG2 1 
ATOM   4209 C  CD1 . ILE E 1 67  ? -32.320 7.287   -28.902 1.00 19.00  ? 86  ILE E CD1 1 
ATOM   4210 N  N   . PHE E 1 68  ? -28.051 8.611   -32.799 1.00 21.04  ? 87  PHE E N   1 
ATOM   4211 C  CA  . PHE E 1 68  ? -27.773 8.753   -34.222 1.00 20.91  ? 87  PHE E CA  1 
ATOM   4212 C  C   . PHE E 1 68  ? -28.289 7.545   -34.993 1.00 21.42  ? 87  PHE E C   1 
ATOM   4213 O  O   . PHE E 1 68  ? -27.809 6.425   -34.808 1.00 21.25  ? 87  PHE E O   1 
ATOM   4214 C  CB  . PHE E 1 68  ? -26.275 8.934   -34.461 1.00 21.31  ? 87  PHE E CB  1 
ATOM   4215 C  CG  . PHE E 1 68  ? -25.732 10.220  -33.917 1.00 22.33  ? 87  PHE E CG  1 
ATOM   4216 C  CD1 . PHE E 1 68  ? -25.536 11.310  -34.747 1.00 23.58  ? 87  PHE E CD1 1 
ATOM   4217 C  CD2 . PHE E 1 68  ? -25.427 10.344  -32.573 1.00 21.92  ? 87  PHE E CD2 1 
ATOM   4218 C  CE1 . PHE E 1 68  ? -25.041 12.498  -34.248 1.00 23.62  ? 87  PHE E CE1 1 
ATOM   4219 C  CE2 . PHE E 1 68  ? -24.933 11.529  -32.067 1.00 22.36  ? 87  PHE E CE2 1 
ATOM   4220 C  CZ  . PHE E 1 68  ? -24.740 12.607  -32.906 1.00 23.08  ? 87  PHE E CZ  1 
ATOM   4221 N  N   . LYS E 1 69  ? -29.277 7.779   -35.850 1.00 20.77  ? 88  LYS E N   1 
ATOM   4222 C  CA  . LYS E 1 69  ? -29.883 6.707   -36.629 1.00 20.51  ? 88  LYS E CA  1 
ATOM   4223 C  C   . LYS E 1 69  ? -28.803 5.857   -37.282 1.00 20.16  ? 88  LYS E C   1 
ATOM   4224 O  O   . LYS E 1 69  ? -28.739 4.647   -37.071 1.00 20.21  ? 88  LYS E O   1 
ATOM   4225 C  CB  . LYS E 1 69  ? -30.823 7.285   -37.688 1.00 21.31  ? 88  LYS E CB  1 
ATOM   4226 C  CG  . LYS E 1 69  ? -31.649 6.247   -38.428 1.00 20.64  ? 88  LYS E CG  1 
ATOM   4227 C  CD  . LYS E 1 69  ? -32.626 6.913   -39.380 1.00 21.24  ? 88  LYS E CD  1 
ATOM   4228 C  CE  . LYS E 1 69  ? -33.329 5.892   -40.257 1.00 21.81  ? 88  LYS E CE  1 
ATOM   4229 N  NZ  . LYS E 1 69  ? -34.094 4.902   -39.452 1.00 21.80  ? 88  LYS E NZ  1 
ATOM   4230 N  N   . ASP E 1 70  ? -27.948 6.506   -38.065 1.00 23.05  ? 89  ASP E N   1 
ATOM   4231 C  CA  . ASP E 1 70  ? -26.831 5.834   -38.716 1.00 22.87  ? 89  ASP E CA  1 
ATOM   4232 C  C   . ASP E 1 70  ? -27.274 4.553   -39.409 1.00 22.38  ? 89  ASP E C   1 
ATOM   4233 O  O   . ASP E 1 70  ? -26.652 3.504   -39.252 1.00 21.68  ? 89  ASP E O   1 
ATOM   4234 C  CB  . ASP E 1 70  ? -25.726 5.529   -37.703 1.00 22.21  ? 89  ASP E CB  1 
ATOM   4235 C  CG  . ASP E 1 70  ? -24.454 5.036   -38.361 1.00 22.23  ? 89  ASP E CG  1 
ATOM   4236 O  OD1 . ASP E 1 70  ? -24.286 5.269   -39.577 1.00 22.24  ? 89  ASP E OD1 1 
ATOM   4237 O  OD2 . ASP E 1 70  ? -23.621 4.418   -37.663 1.00 22.59  ? 89  ASP E OD2 1 
ATOM   4238 N  N   . GLU E 1 71  ? -28.357 4.643   -40.173 1.00 25.11  ? 90  GLU E N   1 
ATOM   4239 C  CA  . GLU E 1 71  ? -28.851 3.498   -40.923 1.00 24.86  ? 90  GLU E CA  1 
ATOM   4240 C  C   . GLU E 1 71  ? -27.877 3.159   -42.041 1.00 24.48  ? 90  GLU E C   1 
ATOM   4241 O  O   . GLU E 1 71  ? -27.985 2.109   -42.675 1.00 24.63  ? 90  GLU E O   1 
ATOM   4242 C  CB  . GLU E 1 71  ? -30.239 3.780   -41.497 1.00 14.36  ? 90  GLU E CB  1 
ATOM   4243 C  CG  . GLU E 1 71  ? -30.246 4.696   -42.710 1.00 15.19  ? 90  GLU E CG  1 
ATOM   4244 C  CD  . GLU E 1 71  ? -30.129 6.162   -42.346 1.00 26.39  ? 90  GLU E CD  1 
ATOM   4245 O  OE1 . GLU E 1 71  ? -30.054 6.478   -41.140 1.00 25.77  ? 90  GLU E OE1 1 
ATOM   4246 O  OE2 . GLU E 1 71  ? -30.119 6.998   -43.271 1.00 15.41  ? 90  GLU E OE2 1 
ATOM   4247 N  N   . GLU E 1 72  ? -26.930 4.060   -42.279 1.00 18.25  ? 91  GLU E N   1 
ATOM   4248 C  CA  . GLU E 1 72  ? -25.860 3.811   -43.236 1.00 18.91  ? 91  GLU E CA  1 
ATOM   4249 C  C   . GLU E 1 72  ? -24.871 2.816   -42.651 1.00 18.25  ? 91  GLU E C   1 
ATOM   4250 O  O   . GLU E 1 72  ? -24.084 2.210   -43.377 1.00 18.26  ? 91  GLU E O   1 
ATOM   4251 C  CB  . GLU E 1 72  ? -25.120 5.106   -43.578 1.00 19.71  ? 91  GLU E CB  1 
ATOM   4252 C  CG  . GLU E 1 72  ? -25.960 6.156   -44.274 1.00 21.19  ? 91  GLU E CG  1 
ATOM   4253 C  CD  . GLU E 1 72  ? -26.830 6.935   -43.315 1.00 21.34  ? 91  GLU E CD  1 
ATOM   4254 O  OE1 . GLU E 1 72  ? -26.615 6.826   -42.090 1.00 20.26  ? 91  GLU E OE1 1 
ATOM   4255 O  OE2 . GLU E 1 72  ? -27.728 7.660   -43.788 1.00 22.29  ? 91  GLU E OE2 1 
ATOM   4256 N  N   . ASN E 1 73  ? -24.913 2.660   -41.331 1.00 28.43  ? 92  ASN E N   1 
ATOM   4257 C  CA  . ASN E 1 73  ? -23.957 1.816   -40.626 1.00 27.35  ? 92  ASN E CA  1 
ATOM   4258 C  C   . ASN E 1 73  ? -22.528 2.235   -40.952 1.00 28.06  ? 92  ASN E C   1 
ATOM   4259 O  O   . ASN E 1 73  ? -21.655 1.395   -41.174 1.00 27.99  ? 92  ASN E O   1 
ATOM   4260 C  CB  . ASN E 1 73  ? -24.182 0.344   -40.969 1.00 27.23  ? 92  ASN E CB  1 
ATOM   4261 C  CG  . ASN E 1 73  ? -25.486 -0.194  -40.405 1.00 27.97  ? 92  ASN E CG  1 
ATOM   4262 O  OD1 . ASN E 1 73  ? -25.938 0.231   -39.342 1.00 28.59  ? 92  ASN E OD1 1 
ATOM   4263 N  ND2 . ASN E 1 73  ? -26.095 -1.135  -41.115 1.00 28.09  ? 92  ASN E ND2 1 
ATOM   4264 N  N   . SER E 1 74  ? -22.301 3.545   -40.978 1.00 23.17  ? 93  SER E N   1 
ATOM   4265 C  CA  . SER E 1 74  ? -20.999 4.101   -41.325 1.00 23.12  ? 93  SER E CA  1 
ATOM   4266 C  C   . SER E 1 74  ? -20.650 5.284   -40.429 1.00 23.35  ? 93  SER E C   1 
ATOM   4267 O  O   . SER E 1 74  ? -19.549 5.828   -40.504 1.00 23.87  ? 93  SER E O   1 
ATOM   4268 C  CB  . SER E 1 74  ? -20.986 4.537   -42.792 1.00 25.07  ? 93  SER E CB  1 
ATOM   4269 O  OG  . SER E 1 74  ? -21.981 5.516   -43.043 1.00 25.65  ? 93  SER E OG  1 
ATOM   4270 N  N   . GLY E 1 75  ? -21.599 5.681   -39.588 1.00 24.06  ? 94  GLY E N   1 
ATOM   4271 C  CA  . GLY E 1 75  ? -21.391 6.779   -38.662 1.00 25.16  ? 94  GLY E CA  1 
ATOM   4272 C  C   . GLY E 1 75  ? -21.273 8.130   -39.339 1.00 14.22  ? 94  GLY E C   1 
ATOM   4273 O  O   . GLY E 1 75  ? -20.740 9.078   -38.762 1.00 14.31  ? 94  GLY E O   1 
ATOM   4274 N  N   . ALA E 1 76  ? -21.774 8.221   -40.566 1.00 25.51  ? 95  ALA E N   1 
ATOM   4275 C  CA  . ALA E 1 76  ? -21.704 9.462   -41.330 1.00 26.82  ? 95  ALA E CA  1 
ATOM   4276 C  C   . ALA E 1 76  ? -22.547 10.560  -40.692 1.00 27.03  ? 95  ALA E C   1 
ATOM   4277 O  O   . ALA E 1 76  ? -22.309 11.746  -40.911 1.00 28.20  ? 95  ALA E O   1 
ATOM   4278 C  CB  . ALA E 1 76  ? -22.137 9.225   -42.768 1.00 26.90  ? 95  ALA E CB  1 
ATOM   4279 N  N   . ASP E 1 77  ? -23.533 10.157  -39.898 1.00 25.78  ? 96  ASP E N   1 
ATOM   4280 C  CA  . ASP E 1 77  ? -24.425 11.108  -39.250 1.00 26.15  ? 96  ASP E CA  1 
ATOM   4281 C  C   . ASP E 1 77  ? -23.711 11.888  -38.156 1.00 27.17  ? 96  ASP E C   1 
ATOM   4282 O  O   . ASP E 1 77  ? -24.039 13.045  -37.890 1.00 28.24  ? 96  ASP E O   1 
ATOM   4283 C  CB  . ASP E 1 77  ? -25.636 10.387  -38.663 1.00 25.32  ? 96  ASP E CB  1 
ATOM   4284 C  CG  . ASP E 1 77  ? -26.434 9.649   -39.712 1.00 25.03  ? 96  ASP E CG  1 
ATOM   4285 O  OD1 . ASP E 1 77  ? -26.137 9.820   -40.913 1.00 25.94  ? 96  ASP E OD1 1 
ATOM   4286 O  OD2 . ASP E 1 77  ? -27.358 8.899   -39.337 1.00 24.14  ? 96  ASP E OD2 1 
ATOM   4287 N  N   . ARG E 1 78  ? -22.736 11.249  -37.521 1.00 29.46  ? 97  ARG E N   1 
ATOM   4288 C  CA  . ARG E 1 78  ? -22.001 11.872  -36.430 1.00 28.63  ? 97  ARG E CA  1 
ATOM   4289 C  C   . ARG E 1 78  ? -21.120 13.007  -36.937 1.00 30.71  ? 97  ARG E C   1 
ATOM   4290 O  O   . ARG E 1 78  ? -20.927 14.007  -36.246 1.00 32.05  ? 97  ARG E O   1 
ATOM   4291 C  CB  . ARG E 1 78  ? -21.159 10.831  -35.695 1.00 28.21  ? 97  ARG E CB  1 
ATOM   4292 C  CG  . ARG E 1 78  ? -21.961 9.638   -35.209 1.00 27.70  ? 97  ARG E CG  1 
ATOM   4293 C  CD  . ARG E 1 78  ? -21.085 8.625   -34.494 1.00 26.82  ? 97  ARG E CD  1 
ATOM   4294 N  NE  . ARG E 1 78  ? -21.867 7.501   -33.987 1.00 26.97  ? 97  ARG E NE  1 
ATOM   4295 C  CZ  . ARG E 1 78  ? -22.507 7.503   -32.821 1.00 27.06  ? 97  ARG E CZ  1 
ATOM   4296 N  NH1 . ARG E 1 78  ? -22.459 8.572   -32.037 1.00 26.39  ? 97  ARG E NH1 1 
ATOM   4297 N  NH2 . ARG E 1 78  ? -23.197 6.437   -32.440 1.00 26.86  ? 97  ARG E NH2 1 
ATOM   4298 N  N   . LEU E 1 79  ? -20.594 12.848  -38.148 1.00 25.35  ? 98  LEU E N   1 
ATOM   4299 C  CA  . LEU E 1 79  ? -19.726 13.857  -38.748 1.00 26.63  ? 98  LEU E CA  1 
ATOM   4300 C  C   . LEU E 1 79  ? -20.453 15.180  -38.948 1.00 27.94  ? 98  LEU E C   1 
ATOM   4301 O  O   . LEU E 1 79  ? -21.551 15.219  -39.504 1.00 27.35  ? 98  LEU E O   1 
ATOM   4302 C  CB  . LEU E 1 79  ? -19.170 13.365  -40.082 1.00 26.90  ? 98  LEU E CB  1 
ATOM   4303 C  CG  . LEU E 1 79  ? -18.218 12.177  -40.006 1.00 27.36  ? 98  LEU E CG  1 
ATOM   4304 C  CD1 . LEU E 1 79  ? -17.719 11.809  -41.392 1.00 29.34  ? 98  LEU E CD1 1 
ATOM   4305 C  CD2 . LEU E 1 79  ? -17.058 12.492  -39.079 1.00 27.81  ? 98  LEU E CD2 1 
ATOM   4306 N  N   . MET E 1 80  ? -19.826 16.261  -38.497 1.00 29.13  ? 99  MET E N   1 
ATOM   4307 C  CA  . MET E 1 80  ? -20.403 17.593  -38.614 1.00 30.13  ? 99  MET E CA  1 
ATOM   4308 C  C   . MET E 1 80  ? -19.333 18.654  -38.378 1.00 31.64  ? 99  MET E C   1 
ATOM   4309 O  O   . MET E 1 80  ? -18.179 18.330  -38.100 1.00 32.47  ? 99  MET E O   1 
ATOM   4310 C  CB  . MET E 1 80  ? -21.560 17.764  -37.624 1.00 29.30  ? 99  MET E CB  1 
ATOM   4311 C  CG  . MET E 1 80  ? -21.173 17.542  -36.171 1.00 29.16  ? 99  MET E CG  1 
ATOM   4312 S  SD  . MET E 1 80  ? -22.587 17.540  -35.050 1.00 28.21  ? 99  MET E SD  1 
ATOM   4313 C  CE  . MET E 1 80  ? -23.320 15.951  -35.426 1.00 26.30  ? 99  MET E CE  1 
ATOM   4314 N  N   . THR E 1 81  ? -19.714 19.921  -38.497 1.00 27.03  ? 100 THR E N   1 
ATOM   4315 C  CA  . THR E 1 81  ? -18.771 21.013  -38.300 1.00 28.06  ? 100 THR E CA  1 
ATOM   4316 C  C   . THR E 1 81  ? -18.674 21.382  -36.826 1.00 29.06  ? 100 THR E C   1 
ATOM   4317 O  O   . THR E 1 81  ? -19.584 21.098  -36.045 1.00 27.97  ? 100 THR E O   1 
ATOM   4318 C  CB  . THR E 1 81  ? -19.165 22.260  -39.111 1.00 28.66  ? 100 THR E CB  1 
ATOM   4319 O  OG1 . THR E 1 81  ? -20.338 22.854  -38.544 1.00 29.28  ? 100 THR E OG1 1 
ATOM   4320 C  CG2 . THR E 1 81  ? -19.432 21.885  -40.559 1.00 28.43  ? 100 THR E CG2 1 
ATOM   4321 N  N   . GLU E 1 82  ? -17.566 22.012  -36.451 1.00 48.41  ? 101 GLU E N   1 
ATOM   4322 C  CA  . GLU E 1 82  ? -17.338 22.390  -35.062 1.00 48.65  ? 101 GLU E CA  1 
ATOM   4323 C  C   . GLU E 1 82  ? -18.458 23.291  -34.554 1.00 48.45  ? 101 GLU E C   1 
ATOM   4324 O  O   . GLU E 1 82  ? -18.876 23.192  -33.400 1.00 47.91  ? 101 GLU E O   1 
ATOM   4325 C  CB  . GLU E 1 82  ? -15.988 23.091  -34.910 1.00 50.19  ? 101 GLU E CB  1 
ATOM   4326 C  CG  . GLU E 1 82  ? -15.522 23.210  -33.470 1.00 51.33  ? 101 GLU E CG  1 
ATOM   4327 C  CD  . GLU E 1 82  ? -15.261 21.857  -32.834 1.00 50.11  ? 101 GLU E CD  1 
ATOM   4328 O  OE1 . GLU E 1 82  ? -14.749 20.959  -33.537 1.00 47.20  ? 101 GLU E OE1 1 
ATOM   4329 O  OE2 . GLU E 1 82  ? -15.566 21.694  -31.633 1.00 49.61  ? 101 GLU E OE2 1 
ATOM   4330 N  N   . ARG E 1 83  ? -18.938 24.171  -35.426 1.00 54.58  ? 102 ARG E N   1 
ATOM   4331 C  CA  . ARG E 1 83  ? -20.039 25.059  -35.081 1.00 55.85  ? 102 ARG E CA  1 
ATOM   4332 C  C   . ARG E 1 83  ? -21.294 24.244  -34.799 1.00 54.85  ? 102 ARG E C   1 
ATOM   4333 O  O   . ARG E 1 83  ? -21.959 24.436  -33.780 1.00 54.23  ? 102 ARG E O   1 
ATOM   4334 C  CB  . ARG E 1 83  ? -20.297 26.051  -36.216 1.00 56.42  ? 102 ARG E CB  1 
ATOM   4335 C  CG  . ARG E 1 83  ? -21.320 27.121  -35.887 1.00 57.61  ? 102 ARG E CG  1 
ATOM   4336 C  CD  . ARG E 1 83  ? -21.263 28.250  -36.898 1.00 60.03  ? 102 ARG E CD  1 
ATOM   4337 N  NE  . ARG E 1 83  ? -22.115 29.371  -36.516 1.00 62.76  ? 102 ARG E NE  1 
ATOM   4338 C  CZ  . ARG E 1 83  ? -21.786 30.281  -35.604 1.00 65.03  ? 102 ARG E CZ  1 
ATOM   4339 N  NH1 . ARG E 1 83  ? -20.621 30.199  -34.973 1.00 64.89  ? 102 ARG E NH1 1 
ATOM   4340 N  NH2 . ARG E 1 83  ? -22.622 31.272  -35.318 1.00 65.37  ? 102 ARG E NH2 1 
ATOM   4341 N  N   . CYS E 1 84  ? -21.606 23.327  -35.710 1.00 37.60  ? 103 CYS E N   1 
ATOM   4342 C  CA  . CYS E 1 84  ? -22.784 22.481  -35.584 1.00 35.83  ? 103 CYS E CA  1 
ATOM   4343 C  C   . CYS E 1 84  ? -22.818 21.792  -34.224 1.00 35.18  ? 103 CYS E C   1 
ATOM   4344 O  O   . CYS E 1 84  ? -23.800 21.897  -33.492 1.00 34.95  ? 103 CYS E O   1 
ATOM   4345 C  CB  . CYS E 1 84  ? -22.809 21.439  -36.706 1.00 35.80  ? 103 CYS E CB  1 
ATOM   4346 S  SG  . CYS E 1 84  ? -24.393 20.591  -36.917 1.00 33.63  ? 103 CYS E SG  1 
ATOM   4347 N  N   . LYS E 1 85  ? -21.734 21.099  -33.890 1.00 64.50  ? 104 LYS E N   1 
ATOM   4348 C  CA  . LYS E 1 85  ? -21.646 20.353  -32.638 1.00 63.22  ? 104 LYS E CA  1 
ATOM   4349 C  C   . LYS E 1 85  ? -22.118 21.156  -31.437 1.00 63.26  ? 104 LYS E C   1 
ATOM   4350 O  O   . LYS E 1 85  ? -23.014 20.729  -30.712 1.00 62.24  ? 104 LYS E O   1 
ATOM   4351 C  CB  . LYS E 1 85  ? -20.214 19.892  -32.394 1.00 62.55  ? 104 LYS E CB  1 
ATOM   4352 C  CG  . LYS E 1 85  ? -19.689 18.961  -33.450 1.00 63.32  ? 104 LYS E CG  1 
ATOM   4353 C  CD  . LYS E 1 85  ? -18.536 18.146  -32.913 1.00 63.98  ? 104 LYS E CD  1 
ATOM   4354 C  CE  . LYS E 1 85  ? -18.104 17.106  -33.923 1.00 62.94  ? 104 LYS E CE  1 
ATOM   4355 N  NZ  . LYS E 1 85  ? -17.233 16.078  -33.296 1.00 63.21  ? 104 LYS E NZ  1 
ATOM   4356 N  N   . GLU E 1 86  ? -21.495 22.311  -31.226 1.00 63.09  ? 105 GLU E N   1 
ATOM   4357 C  CA  . GLU E 1 86  ? -21.813 23.162  -30.088 1.00 64.24  ? 105 GLU E CA  1 
ATOM   4358 C  C   . GLU E 1 86  ? -23.317 23.240  -29.865 1.00 63.27  ? 105 GLU E C   1 
ATOM   4359 O  O   . GLU E 1 86  ? -23.805 23.028  -28.754 1.00 62.26  ? 105 GLU E O   1 
ATOM   4360 C  CB  . GLU E 1 86  ? -21.254 24.568  -30.303 1.00 66.97  ? 105 GLU E CB  1 
ATOM   4361 C  CG  . GLU E 1 86  ? -19.756 24.615  -30.547 1.00 68.45  ? 105 GLU E CG  1 
ATOM   4362 C  CD  . GLU E 1 86  ? -19.252 26.029  -30.753 1.00 71.59  ? 105 GLU E CD  1 
ATOM   4363 O  OE1 . GLU E 1 86  ? -20.093 26.944  -30.884 1.00 72.54  ? 105 GLU E OE1 1 
ATOM   4364 O  OE2 . GLU E 1 86  ? -18.017 26.225  -30.783 1.00 71.87  ? 105 GLU E OE2 1 
ATOM   4365 N  N   . ARG E 1 87  ? -24.046 23.537  -30.935 1.00 52.42  ? 106 ARG E N   1 
ATOM   4366 C  CA  . ARG E 1 87  ? -25.490 23.707  -30.860 1.00 51.93  ? 106 ARG E CA  1 
ATOM   4367 C  C   . ARG E 1 87  ? -26.217 22.377  -30.723 1.00 50.23  ? 106 ARG E C   1 
ATOM   4368 O  O   . ARG E 1 87  ? -27.260 22.297  -30.074 1.00 49.47  ? 106 ARG E O   1 
ATOM   4369 C  CB  . ARG E 1 87  ? -25.988 24.463  -32.088 1.00 54.01  ? 106 ARG E CB  1 
ATOM   4370 C  CG  . ARG E 1 87  ? -25.486 25.891  -32.152 1.00 56.09  ? 106 ARG E CG  1 
ATOM   4371 C  CD  . ARG E 1 87  ? -25.551 26.439  -33.563 1.00 58.68  ? 106 ARG E CD  1 
ATOM   4372 N  NE  . ARG E 1 87  ? -25.456 27.895  -33.574 1.00 62.62  ? 106 ARG E NE  1 
ATOM   4373 C  CZ  . ARG E 1 87  ? -24.317 28.573  -33.464 1.00 63.82  ? 106 ARG E CZ  1 
ATOM   4374 N  NH1 . ARG E 1 87  ? -23.166 27.926  -33.334 1.00 62.72  ? 106 ARG E NH1 1 
ATOM   4375 N  NH2 . ARG E 1 87  ? -24.331 29.900  -33.482 1.00 63.21  ? 106 ARG E NH2 1 
ATOM   4376 N  N   . VAL E 1 88  ? -25.667 21.333  -31.334 1.00 38.37  ? 107 VAL E N   1 
ATOM   4377 C  CA  . VAL E 1 88  ? -26.242 20.002  -31.208 1.00 37.43  ? 107 VAL E CA  1 
ATOM   4378 C  C   . VAL E 1 88  ? -26.235 19.583  -29.746 1.00 36.28  ? 107 VAL E C   1 
ATOM   4379 O  O   . VAL E 1 88  ? -27.269 19.217  -29.188 1.00 35.20  ? 107 VAL E O   1 
ATOM   4380 C  CB  . VAL E 1 88  ? -25.461 18.957  -32.018 1.00 36.79  ? 107 VAL E CB  1 
ATOM   4381 C  CG1 . VAL E 1 88  ? -26.163 17.614  -31.951 1.00 35.22  ? 107 VAL E CG1 1 
ATOM   4382 C  CG2 . VAL E 1 88  ? -25.308 19.407  -33.457 1.00 38.02  ? 107 VAL E CG2 1 
ATOM   4383 N  N   . ASN E 1 89  ? -25.056 19.640  -29.133 1.00 36.75  ? 108 ASN E N   1 
ATOM   4384 C  CA  . ASN E 1 89  ? -24.901 19.298  -27.728 1.00 35.23  ? 108 ASN E CA  1 
ATOM   4385 C  C   . ASN E 1 89  ? -25.783 20.180  -26.862 1.00 35.85  ? 108 ASN E C   1 
ATOM   4386 O  O   . ASN E 1 89  ? -26.388 19.717  -25.894 1.00 35.09  ? 108 ASN E O   1 
ATOM   4387 C  CB  . ASN E 1 89  ? -23.441 19.449  -27.302 1.00 35.84  ? 108 ASN E CB  1 
ATOM   4388 C  CG  . ASN E 1 89  ? -22.486 18.708  -28.217 1.00 36.23  ? 108 ASN E CG  1 
ATOM   4389 O  OD1 . ASN E 1 89  ? -22.905 17.981  -29.117 1.00 35.41  ? 108 ASN E OD1 1 
ATOM   4390 N  ND2 . ASN E 1 89  ? -21.190 18.890  -27.988 1.00 36.62  ? 108 ASN E ND2 1 
ATOM   4391 N  N   . ALA E 1 90  ? -25.849 21.459  -27.221 1.00 30.33  ? 109 ALA E N   1 
ATOM   4392 C  CA  . ALA E 1 90  ? -26.683 22.417  -26.507 1.00 30.66  ? 109 ALA E CA  1 
ATOM   4393 C  C   . ALA E 1 90  ? -28.141 21.980  -26.538 1.00 30.31  ? 109 ALA E C   1 
ATOM   4394 O  O   . ALA E 1 90  ? -28.795 21.886  -25.499 1.00 30.27  ? 109 ALA E O   1 
ATOM   4395 C  CB  . ALA E 1 90  ? -26.531 23.801  -27.115 1.00 31.64  ? 109 ALA E CB  1 
ATOM   4396 N  N   . LEU E 1 91  ? -28.644 21.711  -27.738 1.00 25.72  ? 110 LEU E N   1 
ATOM   4397 C  CA  . LEU E 1 91  ? -30.013 21.247  -27.906 1.00 26.30  ? 110 LEU E CA  1 
ATOM   4398 C  C   . LEU E 1 91  ? -30.223 19.932  -27.164 1.00 25.14  ? 110 LEU E C   1 
ATOM   4399 O  O   . LEU E 1 91  ? -31.228 19.749  -26.479 1.00 24.60  ? 110 LEU E O   1 
ATOM   4400 C  CB  . LEU E 1 91  ? -30.341 21.078  -29.391 1.00 26.87  ? 110 LEU E CB  1 
ATOM   4401 C  CG  . LEU E 1 91  ? -31.760 20.616  -29.730 1.00 26.22  ? 110 LEU E CG  1 
ATOM   4402 C  CD1 . LEU E 1 91  ? -32.788 21.548  -29.113 1.00 27.13  ? 110 LEU E CD1 1 
ATOM   4403 C  CD2 . LEU E 1 91  ? -31.952 20.523  -31.237 1.00 25.54  ? 110 LEU E CD2 1 
ATOM   4404 N  N   . ALA E 1 92  ? -29.263 19.023  -27.306 1.00 39.59  ? 111 ALA E N   1 
ATOM   4405 C  CA  . ALA E 1 92  ? -29.317 17.730  -26.635 1.00 38.81  ? 111 ALA E CA  1 
ATOM   4406 C  C   . ALA E 1 92  ? -29.583 17.898  -25.143 1.00 39.28  ? 111 ALA E C   1 
ATOM   4407 O  O   . ALA E 1 92  ? -30.285 17.091  -24.533 1.00 39.15  ? 111 ALA E O   1 
ATOM   4408 C  CB  . ALA E 1 92  ? -28.026 16.963  -26.861 1.00 37.33  ? 111 ALA E CB  1 
ATOM   4409 N  N   . ILE E 1 93  ? -29.016 18.950  -24.561 1.00 32.52  ? 112 ILE E N   1 
ATOM   4410 C  CA  . ILE E 1 93  ? -29.228 19.250  -23.152 1.00 32.42  ? 112 ILE E CA  1 
ATOM   4411 C  C   . ILE E 1 93  ? -30.624 19.813  -22.931 1.00 33.08  ? 112 ILE E C   1 
ATOM   4412 O  O   . ILE E 1 93  ? -31.352 19.373  -22.039 1.00 33.47  ? 112 ILE E O   1 
ATOM   4413 C  CB  . ILE E 1 93  ? -28.198 20.265  -22.629 1.00 32.00  ? 112 ILE E CB  1 
ATOM   4414 C  CG1 . ILE E 1 93  ? -26.776 19.744  -22.847 1.00 31.60  ? 112 ILE E CG1 1 
ATOM   4415 C  CG2 . ILE E 1 93  ? -28.447 20.563  -21.159 1.00 30.65  ? 112 ILE E CG2 1 
ATOM   4416 C  CD1 . ILE E 1 93  ? -25.695 20.720  -22.443 1.00 29.82  ? 112 ILE E CD1 1 
ATOM   4417 N  N   . ALA E 1 94  ? -30.993 20.791  -23.754 1.00 29.60  ? 113 ALA E N   1 
ATOM   4418 C  CA  . ALA E 1 94  ? -32.289 21.447  -23.640 1.00 30.56  ? 113 ALA E CA  1 
ATOM   4419 C  C   . ALA E 1 94  ? -33.430 20.449  -23.783 1.00 30.20  ? 113 ALA E C   1 
ATOM   4420 O  O   . ALA E 1 94  ? -34.443 20.547  -23.093 1.00 30.66  ? 113 ALA E O   1 
ATOM   4421 C  CB  . ALA E 1 94  ? -32.414 22.551  -24.681 1.00 30.98  ? 113 ALA E CB  1 
ATOM   4422 N  N   . VAL E 1 95  ? -33.256 19.486  -24.682 1.00 25.52  ? 114 VAL E N   1 
ATOM   4423 C  CA  . VAL E 1 95  ? -34.273 18.470  -24.921 1.00 25.50  ? 114 VAL E CA  1 
ATOM   4424 C  C   . VAL E 1 95  ? -34.509 17.631  -23.673 1.00 25.17  ? 114 VAL E C   1 
ATOM   4425 O  O   . VAL E 1 95  ? -35.629 17.557  -23.169 1.00 25.29  ? 114 VAL E O   1 
ATOM   4426 C  CB  . VAL E 1 95  ? -33.885 17.538  -26.083 1.00 24.50  ? 114 VAL E CB  1 
ATOM   4427 C  CG1 . VAL E 1 95  ? -34.893 16.406  -26.213 1.00 23.60  ? 114 VAL E CG1 1 
ATOM   4428 C  CG2 . VAL E 1 95  ? -33.787 18.323  -27.382 1.00 25.14  ? 114 VAL E CG2 1 
ATOM   4429 N  N   . MET E 1 96  ? -33.449 16.998  -23.182 1.00 37.21  ? 115 MET E N   1 
ATOM   4430 C  CA  . MET E 1 96  ? -33.542 16.161  -21.994 1.00 36.73  ? 115 MET E CA  1 
ATOM   4431 C  C   . MET E 1 96  ? -34.178 16.936  -20.850 1.00 37.25  ? 115 MET E C   1 
ATOM   4432 O  O   . MET E 1 96  ? -34.953 16.387  -20.067 1.00 37.58  ? 115 MET E O   1 
ATOM   4433 C  CB  . MET E 1 96  ? -32.159 15.663  -21.577 1.00 36.46  ? 115 MET E CB  1 
ATOM   4434 C  CG  . MET E 1 96  ? -31.399 14.941  -22.675 1.00 35.75  ? 115 MET E CG  1 
ATOM   4435 S  SD  . MET E 1 96  ? -29.910 14.138  -22.054 1.00 33.91  ? 115 MET E SD  1 
ATOM   4436 C  CE  . MET E 1 96  ? -30.629 12.828  -21.069 1.00 33.29  ? 115 MET E CE  1 
ATOM   4437 N  N   . ASN E 1 97  ? -33.843 18.218  -20.763 1.00 46.55  ? 116 ASN E N   1 
ATOM   4438 C  CA  . ASN E 1 97  ? -34.390 19.084  -19.729 1.00 47.87  ? 116 ASN E CA  1 
ATOM   4439 C  C   . ASN E 1 97  ? -35.882 19.310  -19.936 1.00 47.95  ? 116 ASN E C   1 
ATOM   4440 O  O   . ASN E 1 97  ? -36.668 19.239  -18.991 1.00 48.09  ? 116 ASN E O   1 
ATOM   4441 C  CB  . ASN E 1 97  ? -33.647 20.421  -19.711 1.00 49.56  ? 116 ASN E CB  1 
ATOM   4442 C  CG  . ASN E 1 97  ? -33.818 21.165  -18.402 1.00 52.36  ? 116 ASN E CG  1 
ATOM   4443 O  OD1 . ASN E 1 97  ? -32.930 21.907  -17.979 1.00 53.32  ? 116 ASN E OD1 1 
ATOM   4444 N  ND2 . ASN E 1 97  ? -34.959 20.967  -17.748 1.00 52.13  ? 116 ASN E ND2 1 
ATOM   4445 N  N   . MET E 1 98  ? -36.262 19.578  -21.181 1.00 36.08  ? 117 MET E N   1 
ATOM   4446 C  CA  . MET E 1 98  ? -37.659 19.798  -21.536 1.00 35.36  ? 117 MET E CA  1 
ATOM   4447 C  C   . MET E 1 98  ? -38.488 18.538  -21.322 1.00 35.22  ? 117 MET E C   1 
ATOM   4448 O  O   . MET E 1 98  ? -39.551 18.581  -20.703 1.00 35.19  ? 117 MET E O   1 
ATOM   4449 C  CB  . MET E 1 98  ? -37.770 20.251  -22.989 1.00 36.03  ? 117 MET E CB  1 
ATOM   4450 C  CG  . MET E 1 98  ? -39.195 20.482  -23.455 1.00 37.63  ? 117 MET E CG  1 
ATOM   4451 S  SD  . MET E 1 98  ? -40.011 21.793  -22.530 1.00 41.08  ? 117 MET E SD  1 
ATOM   4452 C  CE  . MET E 1 98  ? -38.862 23.146  -22.773 1.00 39.56  ? 117 MET E CE  1 
ATOM   4453 N  N   . TRP E 1 99  ? -37.995 17.419  -21.845 1.00 46.57  ? 118 TRP E N   1 
ATOM   4454 C  CA  . TRP E 1 99  ? -38.645 16.125  -21.665 1.00 46.46  ? 118 TRP E CA  1 
ATOM   4455 C  C   . TRP E 1 99  ? -37.687 15.129  -21.022 1.00 46.23  ? 118 TRP E C   1 
ATOM   4456 O  O   . TRP E 1 99  ? -36.691 14.739  -21.632 1.00 46.09  ? 118 TRP E O   1 
ATOM   4457 C  CB  . TRP E 1 99  ? -39.130 15.568  -23.005 1.00 46.85  ? 118 TRP E CB  1 
ATOM   4458 C  CG  . TRP E 1 99  ? -40.051 16.480  -23.758 1.00 47.43  ? 118 TRP E CG  1 
ATOM   4459 C  CD1 . TRP E 1 99  ? -41.376 16.692  -23.514 1.00 47.37  ? 118 TRP E CD1 1 
ATOM   4460 C  CD2 . TRP E 1 99  ? -39.716 17.295  -24.888 1.00 47.16  ? 118 TRP E CD2 1 
ATOM   4461 N  NE1 . TRP E 1 99  ? -41.886 17.592  -24.417 1.00 48.31  ? 118 TRP E NE1 1 
ATOM   4462 C  CE2 . TRP E 1 99  ? -40.887 17.978  -25.271 1.00 48.31  ? 118 TRP E CE2 1 
ATOM   4463 C  CE3 . TRP E 1 99  ? -38.539 17.516  -25.610 1.00 46.58  ? 118 TRP E CE3 1 
ATOM   4464 C  CZ2 . TRP E 1 99  ? -40.914 18.865  -26.346 1.00 49.39  ? 118 TRP E CZ2 1 
ATOM   4465 C  CZ3 . TRP E 1 99  ? -38.568 18.397  -26.674 1.00 47.04  ? 118 TRP E CZ3 1 
ATOM   4466 C  CH2 . TRP E 1 99  ? -39.747 19.061  -27.032 1.00 48.73  ? 118 TRP E CH2 1 
ATOM   4467 N  N   . PRO E 1 100 ? -37.984 14.716  -19.781 1.00 50.90  ? 119 PRO E N   1 
ATOM   4468 C  CA  . PRO E 1 100 ? -37.174 13.720  -19.072 1.00 50.19  ? 119 PRO E CA  1 
ATOM   4469 C  C   . PRO E 1 100 ? -37.288 12.347  -19.725 1.00 49.55  ? 119 PRO E C   1 
ATOM   4470 O  O   . PRO E 1 100 ? -38.373 11.969  -20.167 1.00 49.40  ? 119 PRO E O   1 
ATOM   4471 C  CB  . PRO E 1 100 ? -37.804 13.683  -17.674 1.00 51.60  ? 119 PRO E CB  1 
ATOM   4472 C  CG  . PRO E 1 100 ? -38.585 14.954  -17.558 1.00 52.76  ? 119 PRO E CG  1 
ATOM   4473 C  CD  . PRO E 1 100 ? -39.075 15.237  -18.942 1.00 52.90  ? 119 PRO E CD  1 
ATOM   4474 N  N   . GLY E 1 101 ? -36.182 11.613  -19.778 1.00 47.86  ? 120 GLY E N   1 
ATOM   4475 C  CA  . GLY E 1 101 ? -36.176 10.292  -20.378 1.00 47.69  ? 120 GLY E CA  1 
ATOM   4476 C  C   . GLY E 1 101 ? -36.320 10.359  -21.886 1.00 47.10  ? 120 GLY E C   1 
ATOM   4477 O  O   . GLY E 1 101 ? -36.708 9.382   -22.529 1.00 46.79  ? 120 GLY E O   1 
ATOM   4478 N  N   . VAL E 1 102 ? -36.005 11.519  -22.453 1.00 29.48  ? 121 VAL E N   1 
ATOM   4479 C  CA  . VAL E 1 102 ? -36.096 11.718  -23.894 1.00 29.15  ? 121 VAL E CA  1 
ATOM   4480 C  C   . VAL E 1 102 ? -34.931 12.557  -24.409 1.00 28.74  ? 121 VAL E C   1 
ATOM   4481 O  O   . VAL E 1 102 ? -34.812 13.738  -24.083 1.00 29.66  ? 121 VAL E O   1 
ATOM   4482 C  CB  . VAL E 1 102 ? -37.420 12.399  -24.287 1.00 29.82  ? 121 VAL E CB  1 
ATOM   4483 C  CG1 . VAL E 1 102 ? -37.432 12.718  -25.774 1.00 29.36  ? 121 VAL E CG1 1 
ATOM   4484 C  CG2 . VAL E 1 102 ? -38.602 11.517  -23.914 1.00 29.72  ? 121 VAL E CG2 1 
ATOM   4485 N  N   . ARG E 1 103 ? -34.074 11.938  -25.215 1.00 53.97  ? 122 ARG E N   1 
ATOM   4486 C  CA  . ARG E 1 103 ? -32.917 12.626  -25.774 1.00 53.70  ? 122 ARG E CA  1 
ATOM   4487 C  C   . ARG E 1 103 ? -33.122 12.941  -27.252 1.00 53.71  ? 122 ARG E C   1 
ATOM   4488 O  O   . ARG E 1 103 ? -34.009 12.383  -27.898 1.00 53.46  ? 122 ARG E O   1 
ATOM   4489 C  CB  . ARG E 1 103 ? -31.652 11.786  -25.587 1.00 42.09  ? 122 ARG E CB  1 
ATOM   4490 C  CG  . ARG E 1 103 ? -31.909 10.386  -25.054 1.00 41.76  ? 122 ARG E CG  1 
ATOM   4491 C  CD  . ARG E 1 103 ? -30.705 9.854   -24.295 1.00 41.44  ? 122 ARG E CD  1 
ATOM   4492 N  NE  . ARG E 1 103 ? -30.223 8.592   -24.850 1.00 41.20  ? 122 ARG E NE  1 
ATOM   4493 C  CZ  . ARG E 1 103 ? -30.995 7.536   -25.085 1.00 41.13  ? 122 ARG E CZ  1 
ATOM   4494 N  NH1 . ARG E 1 103 ? -32.292 7.587   -24.813 1.00 41.29  ? 122 ARG E NH1 1 
ATOM   4495 N  NH2 . ARG E 1 103 ? -30.470 6.429   -25.592 1.00 40.95  ? 122 ARG E NH2 1 
ATOM   4496 N  N   . LEU E 1 104 ? -32.297 13.838  -27.782 1.00 28.05  ? 123 LEU E N   1 
ATOM   4497 C  CA  . LEU E 1 104 ? -32.385 14.227  -29.184 1.00 27.41  ? 123 LEU E CA  1 
ATOM   4498 C  C   . LEU E 1 104 ? -31.951 13.088  -30.100 1.00 26.97  ? 123 LEU E C   1 
ATOM   4499 O  O   . LEU E 1 104 ? -30.994 12.372  -29.806 1.00 26.57  ? 123 LEU E O   1 
ATOM   4500 C  CB  . LEU E 1 104 ? -31.532 15.469  -29.450 1.00 27.59  ? 123 LEU E CB  1 
ATOM   4501 C  CG  . LEU E 1 104 ? -31.313 15.840  -30.918 1.00 27.88  ? 123 LEU E CG  1 
ATOM   4502 C  CD1 . LEU E 1 104 ? -32.591 16.395  -31.529 1.00 28.86  ? 123 LEU E CD1 1 
ATOM   4503 C  CD2 . LEU E 1 104 ? -30.171 16.834  -31.057 1.00 28.80  ? 123 LEU E CD2 1 
ATOM   4504 N  N   . ARG E 1 105 ? -32.662 12.925  -31.211 1.00 15.95  ? 124 ARG E N   1 
ATOM   4505 C  CA  . ARG E 1 105 ? -32.353 11.872  -32.170 1.00 14.75  ? 124 ARG E CA  1 
ATOM   4506 C  C   . ARG E 1 105 ? -32.027 12.448  -33.545 1.00 15.21  ? 124 ARG E C   1 
ATOM   4507 O  O   . ARG E 1 105 ? -32.784 13.252  -34.089 1.00 15.83  ? 124 ARG E O   1 
ATOM   4508 C  CB  . ARG E 1 105 ? -33.513 10.878  -32.271 1.00 14.70  ? 124 ARG E CB  1 
ATOM   4509 C  CG  . ARG E 1 105 ? -33.326 9.819   -33.345 1.00 23.82  ? 124 ARG E CG  1 
ATOM   4510 C  CD  . ARG E 1 105 ? -34.471 8.822   -33.355 1.00 22.65  ? 124 ARG E CD  1 
ATOM   4511 N  NE  . ARG E 1 105 ? -34.415 7.952   -34.525 1.00 21.98  ? 124 ARG E NE  1 
ATOM   4512 C  CZ  . ARG E 1 105 ? -35.140 8.131   -35.625 1.00 22.75  ? 124 ARG E CZ  1 
ATOM   4513 N  NH1 . ARG E 1 105 ? -35.987 9.148   -35.704 1.00 23.90  ? 124 ARG E NH1 1 
ATOM   4514 N  NH2 . ARG E 1 105 ? -35.022 7.292   -36.644 1.00 21.96  ? 124 ARG E NH2 1 
ATOM   4515 N  N   . VAL E 1 106 ? -30.891 12.035  -34.097 1.00 18.34  ? 125 VAL E N   1 
ATOM   4516 C  CA  . VAL E 1 106 ? -30.462 12.492  -35.413 1.00 19.07  ? 125 VAL E CA  1 
ATOM   4517 C  C   . VAL E 1 106 ? -30.693 11.416  -36.467 1.00 18.98  ? 125 VAL E C   1 
ATOM   4518 O  O   . VAL E 1 106 ? -30.234 10.283  -36.322 1.00 17.90  ? 125 VAL E O   1 
ATOM   4519 C  CB  . VAL E 1 106 ? -28.972 12.883  -35.416 1.00 19.26  ? 125 VAL E CB  1 
ATOM   4520 C  CG1 . VAL E 1 106 ? -28.512 13.202  -36.828 1.00 19.85  ? 125 VAL E CG1 1 
ATOM   4521 C  CG2 . VAL E 1 106 ? -28.729 14.061  -34.486 1.00 19.12  ? 125 VAL E CG2 1 
ATOM   4522 N  N   . THR E 1 107 ? -31.403 11.776  -37.531 1.00 26.68  ? 126 THR E N   1 
ATOM   4523 C  CA  . THR E 1 107 ? -31.721 10.828  -38.592 1.00 25.64  ? 126 THR E CA  1 
ATOM   4524 C  C   . THR E 1 107 ? -30.918 11.106  -39.856 1.00 26.34  ? 126 THR E C   1 
ATOM   4525 O  O   . THR E 1 107 ? -30.965 10.327  -40.801 1.00 26.45  ? 126 THR E O   1 
ATOM   4526 C  CB  . THR E 1 107 ? -33.218 10.853  -38.944 1.00 25.80  ? 126 THR E CB  1 
ATOM   4527 O  OG1 . THR E 1 107 ? -33.520 12.042  -39.683 1.00 28.63  ? 126 THR E OG1 1 
ATOM   4528 C  CG2 . THR E 1 107 ? -34.063 10.816  -37.682 1.00 25.24  ? 126 THR E CG2 1 
ATOM   4529 N  N   . GLU E 1 108 ? -30.197 12.224  -39.872 1.00 31.01  ? 127 GLU E N   1 
ATOM   4530 C  CA  . GLU E 1 108 ? -29.345 12.583  -41.004 1.00 31.72  ? 127 GLU E CA  1 
ATOM   4531 C  C   . GLU E 1 108 ? -28.379 13.715  -40.669 1.00 32.03  ? 127 GLU E C   1 
ATOM   4532 O  O   . GLU E 1 108 ? -28.792 14.855  -40.468 1.00 33.00  ? 127 GLU E O   1 
ATOM   4533 C  CB  . GLU E 1 108 ? -30.182 12.972  -42.230 1.00 33.04  ? 127 GLU E CB  1 
ATOM   4534 C  CG  . GLU E 1 108 ? -30.415 11.845  -43.231 1.00 33.14  ? 127 GLU E CG  1 
ATOM   4535 C  CD  . GLU E 1 108 ? -29.140 11.385  -43.914 1.00 33.19  ? 127 GLU E CD  1 
ATOM   4536 O  OE1 . GLU E 1 108 ? -29.224 10.859  -45.042 1.00 33.06  ? 127 GLU E OE1 1 
ATOM   4537 O  OE2 . GLU E 1 108 ? -28.051 11.547  -43.325 1.00 34.05  ? 127 GLU E OE2 1 
ATOM   4538 N  N   . GLY E 1 109 ? -27.091 13.391  -40.612 1.00 27.66  ? 128 GLY E N   1 
ATOM   4539 C  CA  . GLY E 1 109 ? -26.057 14.389  -40.407 1.00 28.11  ? 128 GLY E CA  1 
ATOM   4540 C  C   . GLY E 1 109 ? -25.372 14.704  -41.721 1.00 29.28  ? 128 GLY E C   1 
ATOM   4541 O  O   . GLY E 1 109 ? -26.012 15.167  -42.663 1.00 31.62  ? 128 GLY E O   1 
ATOM   4542 N  N   . TRP E 1 110 ? -24.069 14.454  -41.792 1.00 22.42  ? 129 TRP E N   1 
ATOM   4543 C  CA  . TRP E 1 110 ? -23.363 14.566  -43.060 1.00 24.35  ? 129 TRP E CA  1 
ATOM   4544 C  C   . TRP E 1 110 ? -23.787 13.419  -43.969 1.00 24.84  ? 129 TRP E C   1 
ATOM   4545 O  O   . TRP E 1 110 ? -23.692 12.249  -43.592 1.00 24.08  ? 129 TRP E O   1 
ATOM   4546 C  CB  . TRP E 1 110 ? -21.848 14.547  -42.858 1.00 24.27  ? 129 TRP E CB  1 
ATOM   4547 C  CG  . TRP E 1 110 ? -21.091 14.508  -44.151 1.00 25.08  ? 129 TRP E CG  1 
ATOM   4548 C  CD1 . TRP E 1 110 ? -20.798 15.565  -44.963 1.00 26.79  ? 129 TRP E CD1 1 
ATOM   4549 C  CD2 . TRP E 1 110 ? -20.540 13.350  -44.789 1.00 25.20  ? 129 TRP E CD2 1 
ATOM   4550 N  NE1 . TRP E 1 110 ? -20.096 15.137  -46.063 1.00 27.02  ? 129 TRP E NE1 1 
ATOM   4551 C  CE2 . TRP E 1 110 ? -19.924 13.781  -45.980 1.00 26.56  ? 129 TRP E CE2 1 
ATOM   4552 C  CE3 . TRP E 1 110 ? -20.506 11.990  -44.466 1.00 24.96  ? 129 TRP E CE3 1 
ATOM   4553 C  CZ2 . TRP E 1 110 ? -19.280 12.902  -46.848 1.00 28.46  ? 129 TRP E CZ2 1 
ATOM   4554 C  CZ3 . TRP E 1 110 ? -19.867 11.118  -45.330 1.00 25.67  ? 129 TRP E CZ3 1 
ATOM   4555 C  CH2 . TRP E 1 110 ? -19.263 11.577  -46.506 1.00 27.23  ? 129 TRP E CH2 1 
ATOM   4556 N  N   . ASP E 1 111 ? -24.260 13.757  -45.163 1.00 28.52  ? 130 ASP E N   1 
ATOM   4557 C  CA  . ASP E 1 111 ? -24.765 12.752  -46.090 1.00 28.16  ? 130 ASP E CA  1 
ATOM   4558 C  C   . ASP E 1 111 ? -23.830 12.555  -47.273 1.00 28.69  ? 130 ASP E C   1 
ATOM   4559 O  O   . ASP E 1 111 ? -23.193 13.497  -47.741 1.00 29.85  ? 130 ASP E O   1 
ATOM   4560 C  CB  . ASP E 1 111 ? -26.162 13.138  -46.585 1.00 29.27  ? 130 ASP E CB  1 
ATOM   4561 C  CG  . ASP E 1 111 ? -26.685 12.198  -47.658 1.00 29.33  ? 130 ASP E CG  1 
ATOM   4562 O  OD1 . ASP E 1 111 ? -26.600 10.966  -47.476 1.00 28.26  ? 130 ASP E OD1 1 
ATOM   4563 O  OD2 . ASP E 1 111 ? -27.188 12.695  -48.687 1.00 30.66  ? 130 ASP E OD2 1 
ATOM   4564 N  N   . GLU E 1 112 ? -23.748 11.315  -47.745 1.00 47.69  ? 131 GLU E N   1 
ATOM   4565 C  CA  . GLU E 1 112 ? -23.001 10.994  -48.953 1.00 47.44  ? 131 GLU E CA  1 
ATOM   4566 C  C   . GLU E 1 112 ? -23.848 10.102  -49.854 1.00 47.37  ? 131 GLU E C   1 
ATOM   4567 O  O   . GLU E 1 112 ? -23.388 9.642   -50.897 1.00 48.40  ? 131 GLU E O   1 
ATOM   4568 C  CB  . GLU E 1 112 ? -21.678 10.305  -48.611 1.00 47.88  ? 131 GLU E CB  1 
ATOM   4569 C  CG  . GLU E 1 112 ? -21.832 8.987   -47.871 1.00 48.20  ? 131 GLU E CG  1 
ATOM   4570 C  CD  . GLU E 1 112 ? -20.518 8.242   -47.720 1.00 49.69  ? 131 GLU E CD  1 
ATOM   4571 O  OE1 . GLU E 1 112 ? -19.559 8.564   -48.454 1.00 51.39  ? 131 GLU E OE1 1 
ATOM   4572 O  OE2 . GLU E 1 112 ? -20.445 7.331   -46.868 1.00 48.61  ? 131 GLU E OE2 1 
ATOM   4573 N  N   . ASP E 1 113 ? -25.088 9.862   -49.438 1.00 37.55  ? 132 ASP E N   1 
ATOM   4574 C  CA  . ASP E 1 113 ? -26.022 9.057   -50.217 1.00 37.83  ? 132 ASP E CA  1 
ATOM   4575 C  C   . ASP E 1 113 ? -26.578 9.859   -51.387 1.00 38.99  ? 132 ASP E C   1 
ATOM   4576 O  O   . ASP E 1 113 ? -26.916 9.301   -52.432 1.00 39.09  ? 132 ASP E O   1 
ATOM   4577 C  CB  . ASP E 1 113 ? -27.163 8.560   -49.332 1.00 37.81  ? 132 ASP E CB  1 
ATOM   4578 C  CG  . ASP E 1 113 ? -26.683 7.651   -48.217 1.00 36.64  ? 132 ASP E CG  1 
ATOM   4579 O  OD1 . ASP E 1 113 ? -26.049 6.618   -48.519 1.00 36.39  ? 132 ASP E OD1 1 
ATOM   4580 O  OD2 . ASP E 1 113 ? -26.948 7.966   -47.038 1.00 34.93  ? 132 ASP E OD2 1 
ATOM   4581 N  N   . GLY E 1 114 ? -26.676 11.172  -51.197 1.00 49.64  ? 133 GLY E N   1 
ATOM   4582 C  CA  . GLY E 1 114 ? -27.075 12.080  -52.258 1.00 50.15  ? 133 GLY E CA  1 
ATOM   4583 C  C   . GLY E 1 114 ? -28.566 12.162  -52.526 1.00 50.35  ? 133 GLY E C   1 
ATOM   4584 O  O   . GLY E 1 114 ? -28.978 12.481  -53.641 1.00 52.05  ? 133 GLY E O   1 
ATOM   4585 N  N   . HIS E 1 115 ? -29.379 11.884  -51.511 1.00 37.72  ? 134 HIS E N   1 
ATOM   4586 C  CA  . HIS E 1 115 ? -30.828 11.955  -51.673 1.00 38.64  ? 134 HIS E CA  1 
ATOM   4587 C  C   . HIS E 1 115 ? -31.383 13.321  -51.278 1.00 39.52  ? 134 HIS E C   1 
ATOM   4588 O  O   . HIS E 1 115 ? -32.581 13.578  -51.412 1.00 39.97  ? 134 HIS E O   1 
ATOM   4589 C  CB  . HIS E 1 115 ? -31.535 10.832  -50.901 1.00 36.98  ? 134 HIS E CB  1 
ATOM   4590 C  CG  . HIS E 1 115 ? -31.350 10.896  -49.416 1.00 35.69  ? 134 HIS E CG  1 
ATOM   4591 N  ND1 . HIS E 1 115 ? -32.094 11.727  -48.607 1.00 35.31  ? 134 HIS E ND1 1 
ATOM   4592 C  CD2 . HIS E 1 115 ? -30.518 10.215  -48.591 1.00 34.57  ? 134 HIS E CD2 1 
ATOM   4593 C  CE1 . HIS E 1 115 ? -31.722 11.563  -47.350 1.00 34.26  ? 134 HIS E CE1 1 
ATOM   4594 N  NE2 . HIS E 1 115 ? -30.767 10.651  -47.313 1.00 33.64  ? 134 HIS E NE2 1 
ATOM   4595 N  N   . HIS E 1 116 ? -30.508 14.198  -50.799 1.00 37.95  ? 135 HIS E N   1 
ATOM   4596 C  CA  . HIS E 1 116 ? -30.917 15.548  -50.439 1.00 39.95  ? 135 HIS E CA  1 
ATOM   4597 C  C   . HIS E 1 116 ? -30.931 16.460  -51.662 1.00 43.17  ? 135 HIS E C   1 
ATOM   4598 O  O   . HIS E 1 116 ? -30.405 16.109  -52.719 1.00 43.87  ? 135 HIS E O   1 
ATOM   4599 C  CB  . HIS E 1 116 ? -30.001 16.123  -49.357 1.00 39.36  ? 135 HIS E CB  1 
ATOM   4600 C  CG  . HIS E 1 116 ? -30.112 15.424  -48.039 1.00 37.04  ? 135 HIS E CG  1 
ATOM   4601 N  ND1 . HIS E 1 116 ? -31.142 15.663  -47.156 1.00 36.69  ? 135 HIS E ND1 1 
ATOM   4602 C  CD2 . HIS E 1 116 ? -29.324 14.491  -47.454 1.00 35.74  ? 135 HIS E CD2 1 
ATOM   4603 C  CE1 . HIS E 1 116 ? -30.984 14.909  -46.084 1.00 36.05  ? 135 HIS E CE1 1 
ATOM   4604 N  NE2 . HIS E 1 116 ? -29.888 14.188  -46.239 1.00 35.59  ? 135 HIS E NE2 1 
ATOM   4605 N  N   . ALA E 1 117 ? -31.541 17.631  -51.509 1.00 50.16  ? 136 ALA E N   1 
ATOM   4606 C  CA  . ALA E 1 117 ? -31.641 18.600  -52.596 1.00 51.79  ? 136 ALA E CA  1 
ATOM   4607 C  C   . ALA E 1 117 ? -30.265 19.046  -53.091 1.00 51.95  ? 136 ALA E C   1 
ATOM   4608 O  O   . ALA E 1 117 ? -29.234 18.632  -52.555 1.00 50.44  ? 136 ALA E O   1 
ATOM   4609 C  CB  . ALA E 1 117 ? -32.469 19.800  -52.165 1.00 52.04  ? 136 ALA E CB  1 
ATOM   4610 N  N   . GLN E 1 118 ? -30.259 19.896  -54.113 1.00 55.75  ? 137 GLN E N   1 
ATOM   4611 C  CA  . GLN E 1 118 ? -29.016 20.397  -54.686 1.00 57.90  ? 137 GLN E CA  1 
ATOM   4612 C  C   . GLN E 1 118 ? -28.340 21.389  -53.749 1.00 57.45  ? 137 GLN E C   1 
ATOM   4613 O  O   . GLN E 1 118 ? -28.977 22.313  -53.242 1.00 57.27  ? 137 GLN E O   1 
ATOM   4614 C  CB  . GLN E 1 118 ? -29.278 21.051  -56.044 1.00 60.67  ? 137 GLN E CB  1 
ATOM   4615 C  CG  . GLN E 1 118 ? -29.740 20.080  -57.120 1.00 62.15  ? 137 GLN E CG  1 
ATOM   4616 C  CD  . GLN E 1 118 ? -30.351 20.780  -58.322 1.00 67.21  ? 137 GLN E CD  1 
ATOM   4617 O  OE1 . GLN E 1 118 ? -30.876 21.890  -58.211 1.00 68.39  ? 137 GLN E OE1 1 
ATOM   4618 N  NE2 . GLN E 1 118 ? -30.293 20.128  -59.478 1.00 67.28  ? 137 GLN E NE2 1 
ATOM   4619 N  N   . ASP E 1 119 ? -27.047 21.181  -53.522 1.00 73.21  ? 138 ASP E N   1 
ATOM   4620 C  CA  . ASP E 1 119 ? -26.248 22.075  -52.690 1.00 73.98  ? 138 ASP E CA  1 
ATOM   4621 C  C   . ASP E 1 119 ? -26.660 22.038  -51.219 1.00 73.04  ? 138 ASP E C   1 
ATOM   4622 O  O   . ASP E 1 119 ? -26.123 22.790  -50.402 1.00 73.56  ? 138 ASP E O   1 
ATOM   4623 C  CB  . ASP E 1 119 ? -26.313 23.513  -53.218 1.00 77.32  ? 138 ASP E CB  1 
ATOM   4624 C  CG  . ASP E 1 119 ? -25.859 23.628  -54.664 1.00 79.74  ? 138 ASP E CG  1 
ATOM   4625 O  OD1 . ASP E 1 119 ? -25.225 22.676  -55.172 1.00 79.49  ? 138 ASP E OD1 1 
ATOM   4626 O  OD2 . ASP E 1 119 ? -26.137 24.672  -55.293 1.00 79.77  ? 138 ASP E OD2 1 
ATOM   4627 N  N   . SER E 1 120 ? -27.605 21.162  -50.886 1.00 47.19  ? 139 SER E N   1 
ATOM   4628 C  CA  . SER E 1 120 ? -28.093 21.029  -49.514 1.00 44.75  ? 139 SER E CA  1 
ATOM   4629 C  C   . SER E 1 120 ? -26.955 21.081  -48.499 1.00 43.08  ? 139 SER E C   1 
ATOM   4630 O  O   . SER E 1 120 ? -25.879 20.526  -48.729 1.00 42.55  ? 139 SER E O   1 
ATOM   4631 C  CB  . SER E 1 120 ? -28.881 19.727  -49.345 1.00 43.32  ? 139 SER E CB  1 
ATOM   4632 O  OG  . SER E 1 120 ? -29.311 19.555  -48.003 1.00 40.83  ? 139 SER E OG  1 
ATOM   4633 N  N   . LEU E 1 121 ? -27.200 21.747  -47.376 1.00 28.70  ? 140 LEU E N   1 
ATOM   4634 C  CA  . LEU E 1 121 ? -26.180 21.898  -46.344 1.00 28.06  ? 140 LEU E CA  1 
ATOM   4635 C  C   . LEU E 1 121 ? -25.790 20.556  -45.732 1.00 26.32  ? 140 LEU E C   1 
ATOM   4636 O  O   . LEU E 1 121 ? -24.743 20.437  -45.095 1.00 26.01  ? 140 LEU E O   1 
ATOM   4637 C  CB  . LEU E 1 121 ? -26.654 22.860  -45.254 1.00 27.84  ? 140 LEU E CB  1 
ATOM   4638 C  CG  . LEU E 1 121 ? -26.949 24.285  -45.718 1.00 29.46  ? 140 LEU E CG  1 
ATOM   4639 C  CD1 . LEU E 1 121 ? -27.173 25.192  -44.525 1.00 30.89  ? 140 LEU E CD1 1 
ATOM   4640 C  CD2 . LEU E 1 121 ? -25.812 24.809  -46.579 1.00 31.91  ? 140 LEU E CD2 1 
ATOM   4641 N  N   . HIS E 1 122 ? -26.633 19.548  -45.928 1.00 32.92  ? 141 HIS E N   1 
ATOM   4642 C  CA  . HIS E 1 122 ? -26.343 18.207  -45.437 1.00 31.25  ? 141 HIS E CA  1 
ATOM   4643 C  C   . HIS E 1 122 ? -25.078 17.642  -46.077 1.00 31.82  ? 141 HIS E C   1 
ATOM   4644 O  O   . HIS E 1 122 ? -24.440 16.753  -45.521 1.00 31.17  ? 141 HIS E O   1 
ATOM   4645 C  CB  . HIS E 1 122 ? -27.526 17.269  -45.685 1.00 30.76  ? 141 HIS E CB  1 
ATOM   4646 C  CG  . HIS E 1 122 ? -28.617 17.388  -44.667 1.00 30.01  ? 141 HIS E CG  1 
ATOM   4647 N  ND1 . HIS E 1 122 ? -28.577 16.734  -43.454 1.00 27.73  ? 141 HIS E ND1 1 
ATOM   4648 C  CD2 . HIS E 1 122 ? -29.780 18.080  -44.682 1.00 29.75  ? 141 HIS E CD2 1 
ATOM   4649 C  CE1 . HIS E 1 122 ? -29.666 17.022  -42.765 1.00 27.54  ? 141 HIS E CE1 1 
ATOM   4650 N  NE2 . HIS E 1 122 ? -30.413 17.836  -43.488 1.00 27.84  ? 141 HIS E NE2 1 
ATOM   4651 N  N   . TYR E 1 123 ? -24.718 18.164  -47.247 1.00 33.59  ? 142 TYR E N   1 
ATOM   4652 C  CA  . TYR E 1 123 ? -23.522 17.712  -47.949 1.00 33.90  ? 142 TYR E CA  1 
ATOM   4653 C  C   . TYR E 1 123 ? -22.263 18.418  -47.442 1.00 34.56  ? 142 TYR E C   1 
ATOM   4654 O  O   . TYR E 1 123 ? -21.201 18.325  -48.057 1.00 35.06  ? 142 TYR E O   1 
ATOM   4655 C  CB  . TYR E 1 123 ? -23.661 17.927  -49.460 1.00 35.06  ? 142 TYR E CB  1 
ATOM   4656 C  CG  . TYR E 1 123 ? -24.812 17.185  -50.103 1.00 35.06  ? 142 TYR E CG  1 
ATOM   4657 C  CD1 . TYR E 1 123 ? -24.898 15.801  -50.036 1.00 33.99  ? 142 TYR E CD1 1 
ATOM   4658 C  CD2 . TYR E 1 123 ? -25.804 17.869  -50.794 1.00 36.09  ? 142 TYR E CD2 1 
ATOM   4659 C  CE1 . TYR E 1 123 ? -25.948 15.120  -50.629 1.00 33.40  ? 142 TYR E CE1 1 
ATOM   4660 C  CE2 . TYR E 1 123 ? -26.856 17.197  -51.390 1.00 35.81  ? 142 TYR E CE2 1 
ATOM   4661 C  CZ  . TYR E 1 123 ? -26.923 15.824  -51.304 1.00 34.14  ? 142 TYR E CZ  1 
ATOM   4662 O  OH  . TYR E 1 123 ? -27.967 15.152  -51.896 1.00 33.39  ? 142 TYR E OH  1 
ATOM   4663 N  N   . GLU E 1 124 ? -22.390 19.120  -46.319 1.00 50.59  ? 143 GLU E N   1 
ATOM   4664 C  CA  . GLU E 1 124 ? -21.275 19.873  -45.750 1.00 51.26  ? 143 GLU E CA  1 
ATOM   4665 C  C   . GLU E 1 124 ? -21.199 19.703  -44.235 1.00 50.13  ? 143 GLU E C   1 
ATOM   4666 O  O   . GLU E 1 124 ? -20.435 20.396  -43.561 1.00 50.50  ? 143 GLU E O   1 
ATOM   4667 C  CB  . GLU E 1 124 ? -21.409 21.358  -46.088 1.00 53.88  ? 143 GLU E CB  1 
ATOM   4668 C  CG  . GLU E 1 124 ? -21.815 21.639  -47.529 1.00 55.30  ? 143 GLU E CG  1 
ATOM   4669 C  CD  . GLU E 1 124 ? -21.793 23.120  -47.856 1.00 57.94  ? 143 GLU E CD  1 
ATOM   4670 O  OE1 . GLU E 1 124 ? -20.821 23.798  -47.456 1.00 58.53  ? 143 GLU E OE1 1 
ATOM   4671 O  OE2 . GLU E 1 124 ? -22.743 23.606  -48.508 1.00 59.09  ? 143 GLU E OE2 1 
ATOM   4672 N  N   . GLY E 1 125 ? -21.999 18.783  -43.704 1.00 31.05  ? 144 GLY E N   1 
ATOM   4673 C  CA  . GLY E 1 125 ? -22.057 18.561  -42.271 1.00 29.23  ? 144 GLY E CA  1 
ATOM   4674 C  C   . GLY E 1 125 ? -22.578 19.769  -41.513 1.00 29.32  ? 144 GLY E C   1 
ATOM   4675 O  O   . GLY E 1 125 ? -22.321 19.919  -40.319 1.00 28.13  ? 144 GLY E O   1 
ATOM   4676 N  N   . ARG E 1 126 ? -23.314 20.631  -42.209 1.00 43.56  ? 145 ARG E N   1 
ATOM   4677 C  CA  . ARG E 1 126 ? -23.886 21.824  -41.590 1.00 44.53  ? 145 ARG E CA  1 
ATOM   4678 C  C   . ARG E 1 126 ? -25.397 21.721  -41.401 1.00 43.62  ? 145 ARG E C   1 
ATOM   4679 O  O   . ARG E 1 126 ? -26.063 22.727  -41.157 1.00 44.60  ? 145 ARG E O   1 
ATOM   4680 C  CB  . ARG E 1 126 ? -23.564 23.074  -42.415 1.00 46.00  ? 145 ARG E CB  1 
ATOM   4681 C  CG  . ARG E 1 126 ? -22.170 23.642  -42.203 1.00 46.00  ? 145 ARG E CG  1 
ATOM   4682 C  CD  . ARG E 1 126 ? -22.108 25.094  -42.657 1.00 49.30  ? 145 ARG E CD  1 
ATOM   4683 N  NE  . ARG E 1 126 ? -22.233 25.227  -44.107 1.00 50.88  ? 145 ARG E NE  1 
ATOM   4684 C  CZ  . ARG E 1 126 ? -22.816 26.255  -44.715 1.00 51.60  ? 145 ARG E CZ  1 
ATOM   4685 N  NH1 . ARG E 1 126 ? -23.347 27.238  -44.001 1.00 51.34  ? 145 ARG E NH1 1 
ATOM   4686 N  NH2 . ARG E 1 126 ? -22.881 26.293  -46.039 1.00 53.23  ? 145 ARG E NH2 1 
ATOM   4687 N  N   . ALA E 1 127 ? -25.938 20.512  -41.515 1.00 36.07  ? 146 ALA E N   1 
ATOM   4688 C  CA  . ALA E 1 127 ? -27.380 20.315  -41.391 1.00 34.74  ? 146 ALA E CA  1 
ATOM   4689 C  C   . ALA E 1 127 ? -27.724 18.960  -40.781 1.00 32.75  ? 146 ALA E C   1 
ATOM   4690 O  O   . ALA E 1 127 ? -27.086 17.952  -41.084 1.00 32.05  ? 146 ALA E O   1 
ATOM   4691 C  CB  . ALA E 1 127 ? -28.055 20.474  -42.745 1.00 35.31  ? 146 ALA E CB  1 
ATOM   4692 N  N   . LEU E 1 128 ? -28.741 18.947  -39.923 1.00 22.87  ? 147 LEU E N   1 
ATOM   4693 C  CA  . LEU E 1 128 ? -29.179 17.723  -39.265 1.00 21.25  ? 147 LEU E CA  1 
ATOM   4694 C  C   . LEU E 1 128 ? -30.692 17.555  -39.343 1.00 20.84  ? 147 LEU E C   1 
ATOM   4695 O  O   . LEU E 1 128 ? -31.442 18.492  -39.076 1.00 21.90  ? 147 LEU E O   1 
ATOM   4696 C  CB  . LEU E 1 128 ? -28.762 17.719  -37.791 1.00 20.16  ? 147 LEU E CB  1 
ATOM   4697 C  CG  . LEU E 1 128 ? -27.299 17.922  -37.402 1.00 19.70  ? 147 LEU E CG  1 
ATOM   4698 C  CD1 . LEU E 1 128 ? -27.173 17.876  -35.891 1.00 18.73  ? 147 LEU E CD1 1 
ATOM   4699 C  CD2 . LEU E 1 128 ? -26.403 16.880  -38.045 1.00 19.68  ? 147 LEU E CD2 1 
ATOM   4700 N  N   . ASP E 1 129 ? -31.133 16.355  -39.703 1.00 18.80  ? 148 ASP E N   1 
ATOM   4701 C  CA  . ASP E 1 129 ? -32.543 16.007  -39.616 1.00 17.95  ? 148 ASP E CA  1 
ATOM   4702 C  C   . ASP E 1 129 ? -32.791 15.366  -38.260 1.00 16.97  ? 148 ASP E C   1 
ATOM   4703 O  O   . ASP E 1 129 ? -32.279 14.284  -37.976 1.00 30.58  ? 148 ASP E O   1 
ATOM   4704 C  CB  . ASP E 1 129 ? -32.937 15.051  -40.741 1.00 18.68  ? 148 ASP E CB  1 
ATOM   4705 C  CG  . ASP E 1 129 ? -32.981 15.733  -42.093 1.00 20.23  ? 148 ASP E CG  1 
ATOM   4706 O  OD1 . ASP E 1 129 ? -32.706 16.951  -42.152 1.00 21.08  ? 148 ASP E OD1 1 
ATOM   4707 O  OD2 . ASP E 1 129 ? -33.292 15.053  -43.093 1.00 19.91  ? 148 ASP E OD2 1 
ATOM   4708 N  N   . ILE E 1 130 ? -33.576 16.037  -37.425 1.00 25.75  ? 149 ILE E N   1 
ATOM   4709 C  CA  . ILE E 1 130 ? -33.730 15.622  -36.037 1.00 24.80  ? 149 ILE E CA  1 
ATOM   4710 C  C   . ILE E 1 130 ? -35.160 15.257  -35.656 1.00 24.27  ? 149 ILE E C   1 
ATOM   4711 O  O   . ILE E 1 130 ? -36.121 15.749  -36.244 1.00 24.78  ? 149 ILE E O   1 
ATOM   4712 C  CB  . ILE E 1 130 ? -33.251 16.725  -35.077 1.00 25.39  ? 149 ILE E CB  1 
ATOM   4713 C  CG1 . ILE E 1 130 ? -34.154 17.954  -35.196 1.00 17.33  ? 149 ILE E CG1 1 
ATOM   4714 C  CG2 . ILE E 1 130 ? -31.800 17.087  -35.358 1.00 25.33  ? 149 ILE E CG2 1 
ATOM   4715 C  CD1 . ILE E 1 130 ? -33.819 19.059  -34.223 1.00 18.64  ? 149 ILE E CD1 1 
ATOM   4716 N  N   . THR E 1 131 ? -35.278 14.380  -34.664 1.00 20.01  ? 150 THR E N   1 
ATOM   4717 C  CA  . THR E 1 131 ? -36.551 14.063  -34.029 1.00 20.81  ? 150 THR E CA  1 
ATOM   4718 C  C   . THR E 1 131 ? -36.284 13.796  -32.553 1.00 20.38  ? 150 THR E C   1 
ATOM   4719 O  O   . THR E 1 131 ? -35.188 14.068  -32.058 1.00 19.45  ? 150 THR E O   1 
ATOM   4720 C  CB  . THR E 1 131 ? -37.222 12.816  -34.647 1.00 20.12  ? 150 THR E CB  1 
ATOM   4721 O  OG1 . THR E 1 131 ? -36.411 11.659  -34.407 1.00 18.05  ? 150 THR E OG1 1 
ATOM   4722 C  CG2 . THR E 1 131 ? -37.423 12.991  -36.143 1.00 21.87  ? 150 THR E CG2 1 
ATOM   4723 N  N   . THR E 1 132 ? -37.277 13.263  -31.852 1.00 33.95  ? 151 THR E N   1 
ATOM   4724 C  CA  . THR E 1 132 ? -37.085 12.853  -30.466 1.00 33.73  ? 151 THR E CA  1 
ATOM   4725 C  C   . THR E 1 132 ? -36.860 11.348  -30.389 1.00 33.23  ? 151 THR E C   1 
ATOM   4726 O  O   . THR E 1 132 ? -37.127 10.621  -31.347 1.00 32.61  ? 151 THR E O   1 
ATOM   4727 C  CB  . THR E 1 132 ? -38.278 13.238  -29.573 1.00 34.29  ? 151 THR E CB  1 
ATOM   4728 O  OG1 . THR E 1 132 ? -39.495 12.765  -30.164 1.00 35.48  ? 151 THR E OG1 1 
ATOM   4729 C  CG2 . THR E 1 132 ? -38.352 14.747  -29.410 1.00 34.99  ? 151 THR E CG2 1 
ATOM   4730 N  N   . SER E 1 133 ? -36.367 10.883  -29.247 1.00 25.63  ? 152 SER E N   1 
ATOM   4731 C  CA  . SER E 1 133 ? -36.061 9.469   -29.070 1.00 24.77  ? 152 SER E CA  1 
ATOM   4732 C  C   . SER E 1 133 ? -37.325 8.612   -29.043 1.00 23.91  ? 152 SER E C   1 
ATOM   4733 O  O   . SER E 1 133 ? -37.278 7.415   -29.319 1.00 22.57  ? 152 SER E O   1 
ATOM   4734 C  CB  . SER E 1 133 ? -35.236 9.253   -27.798 1.00 24.26  ? 152 SER E CB  1 
ATOM   4735 O  OG  . SER E 1 133 ? -35.844 9.873   -26.680 1.00 25.20  ? 152 SER E OG  1 
ATOM   4736 N  N   . ASP E 1 134 ? -38.453 9.234   -28.716 1.00 27.75  ? 153 ASP E N   1 
ATOM   4737 C  CA  . ASP E 1 134 ? -39.723 8.521   -28.631 1.00 27.49  ? 153 ASP E CA  1 
ATOM   4738 C  C   . ASP E 1 134 ? -40.582 8.742   -29.873 1.00 29.12  ? 153 ASP E C   1 
ATOM   4739 O  O   . ASP E 1 134 ? -41.771 8.419   -29.880 1.00 29.59  ? 153 ASP E O   1 
ATOM   4740 C  CB  . ASP E 1 134 ? -40.490 8.939   -27.375 1.00 28.33  ? 153 ASP E CB  1 
ATOM   4741 C  CG  . ASP E 1 134 ? -40.734 10.435  -27.312 1.00 30.24  ? 153 ASP E CG  1 
ATOM   4742 O  OD1 . ASP E 1 134 ? -40.345 11.146  -28.262 1.00 30.14  ? 153 ASP E OD1 1 
ATOM   4743 O  OD2 . ASP E 1 134 ? -41.315 10.902  -26.308 1.00 31.09  ? 153 ASP E OD2 1 
ATOM   4744 N  N   . ARG E 1 135 ? -39.970 9.295   -30.917 1.00 23.05  ? 154 ARG E N   1 
ATOM   4745 C  CA  . ARG E 1 135 ? -40.654 9.551   -32.184 1.00 22.89  ? 154 ARG E CA  1 
ATOM   4746 C  C   . ARG E 1 135 ? -42.050 10.137  -31.994 1.00 24.36  ? 154 ARG E C   1 
ATOM   4747 O  O   . ARG E 1 135 ? -42.993 9.742   -32.680 1.00 24.47  ? 154 ARG E O   1 
ATOM   4748 C  CB  . ARG E 1 135 ? -40.740 8.276   -33.028 1.00 21.69  ? 154 ARG E CB  1 
ATOM   4749 C  CG  . ARG E 1 135 ? -39.431 7.846   -33.676 1.00 19.96  ? 154 ARG E CG  1 
ATOM   4750 C  CD  . ARG E 1 135 ? -38.475 7.246   -32.659 1.00 19.30  ? 154 ARG E CD  1 
ATOM   4751 N  NE  . ARG E 1 135 ? -37.419 6.465   -33.296 1.00 17.76  ? 154 ARG E NE  1 
ATOM   4752 C  CZ  . ARG E 1 135 ? -36.461 5.826   -32.633 1.00 17.52  ? 154 ARG E CZ  1 
ATOM   4753 N  NH1 . ARG E 1 135 ? -36.422 5.876   -31.310 1.00 17.29  ? 154 ARG E NH1 1 
ATOM   4754 N  NH2 . ARG E 1 135 ? -35.541 5.135   -33.292 1.00 17.66  ? 154 ARG E NH2 1 
ATOM   4755 N  N   . ASP E 1 136 ? -42.179 11.074  -31.058 1.00 35.53  ? 155 ASP E N   1 
ATOM   4756 C  CA  . ASP E 1 136 ? -43.451 11.752  -30.838 1.00 37.05  ? 155 ASP E CA  1 
ATOM   4757 C  C   . ASP E 1 136 ? -43.576 12.954  -31.766 1.00 38.03  ? 155 ASP E C   1 
ATOM   4758 O  O   . ASP E 1 136 ? -42.839 13.930  -31.633 1.00 38.16  ? 155 ASP E O   1 
ATOM   4759 C  CB  . ASP E 1 136 ? -43.593 12.192  -29.381 1.00 37.08  ? 155 ASP E CB  1 
ATOM   4760 C  CG  . ASP E 1 136 ? -44.929 12.855  -29.102 1.00 38.07  ? 155 ASP E CG  1 
ATOM   4761 O  OD1 . ASP E 1 136 ? -45.768 12.911  -30.025 1.00 38.45  ? 155 ASP E OD1 1 
ATOM   4762 O  OD2 . ASP E 1 136 ? -45.143 13.319  -27.962 1.00 38.10  ? 155 ASP E OD2 1 
ATOM   4763 N  N   . ARG E 1 137 ? -44.515 12.875  -32.704 1.00 35.87  ? 156 ARG E N   1 
ATOM   4764 C  CA  . ARG E 1 137 ? -44.696 13.924  -33.700 1.00 36.89  ? 156 ARG E CA  1 
ATOM   4765 C  C   . ARG E 1 137 ? -45.110 15.250  -33.068 1.00 37.75  ? 156 ARG E C   1 
ATOM   4766 O  O   . ARG E 1 137 ? -44.690 16.318  -33.512 1.00 38.26  ? 156 ARG E O   1 
ATOM   4767 C  CB  . ARG E 1 137 ? -45.735 13.495  -34.736 1.00 37.73  ? 156 ARG E CB  1 
ATOM   4768 C  CG  . ARG E 1 137 ? -45.423 12.166  -35.397 1.00 36.70  ? 156 ARG E CG  1 
ATOM   4769 C  CD  . ARG E 1 137 ? -44.158 12.258  -36.229 1.00 36.72  ? 156 ARG E CD  1 
ATOM   4770 N  NE  . ARG E 1 137 ? -43.649 10.940  -36.592 1.00 35.66  ? 156 ARG E NE  1 
ATOM   4771 C  CZ  . ARG E 1 137 ? -44.111 10.220  -37.606 1.00 35.69  ? 156 ARG E CZ  1 
ATOM   4772 N  NH1 . ARG E 1 137 ? -45.096 10.688  -38.360 1.00 37.95  ? 156 ARG E NH1 1 
ATOM   4773 N  NH2 . ARG E 1 137 ? -43.591 9.030   -37.866 1.00 34.76  ? 156 ARG E NH2 1 
ATOM   4774 N  N   . ASN E 1 138 ? -45.936 15.173  -32.031 1.00 41.54  ? 157 ASN E N   1 
ATOM   4775 C  CA  . ASN E 1 138 ? -46.436 16.366  -31.361 1.00 42.07  ? 157 ASN E CA  1 
ATOM   4776 C  C   . ASN E 1 138 ? -45.321 17.181  -30.712 1.00 42.60  ? 157 ASN E C   1 
ATOM   4777 O  O   . ASN E 1 138 ? -45.462 18.386  -30.503 1.00 43.56  ? 157 ASN E O   1 
ATOM   4778 C  CB  . ASN E 1 138 ? -47.489 15.986  -30.317 1.00 41.46  ? 157 ASN E CB  1 
ATOM   4779 C  CG  . ASN E 1 138 ? -48.605 15.138  -30.897 1.00 42.26  ? 157 ASN E CG  1 
ATOM   4780 O  OD1 . ASN E 1 138 ? -48.987 15.301  -32.056 1.00 41.73  ? 157 ASN E OD1 1 
ATOM   4781 N  ND2 . ASN E 1 138 ? -49.134 14.224  -30.089 1.00 42.03  ? 157 ASN E ND2 1 
ATOM   4782 N  N   . LYS E 1 139 ? -44.213 16.517  -30.400 1.00 40.65  ? 158 LYS E N   1 
ATOM   4783 C  CA  . LYS E 1 139 ? -43.097 17.171  -29.726 1.00 40.66  ? 158 LYS E CA  1 
ATOM   4784 C  C   . LYS E 1 139 ? -42.184 17.932  -30.683 1.00 41.01  ? 158 LYS E C   1 
ATOM   4785 O  O   . LYS E 1 139 ? -41.350 18.725  -30.247 1.00 41.64  ? 158 LYS E O   1 
ATOM   4786 C  CB  . LYS E 1 139 ? -42.268 16.154  -28.938 1.00 39.95  ? 158 LYS E CB  1 
ATOM   4787 C  CG  . LYS E 1 139 ? -42.920 15.640  -27.665 1.00 39.63  ? 158 LYS E CG  1 
ATOM   4788 C  CD  . LYS E 1 139 ? -41.876 15.000  -26.760 1.00 38.78  ? 158 LYS E CD  1 
ATOM   4789 C  CE  . LYS E 1 139 ? -42.506 14.305  -25.568 1.00 39.13  ? 158 LYS E CE  1 
ATOM   4790 N  NZ  . LYS E 1 139 ? -43.190 13.044  -25.960 1.00 38.75  ? 158 LYS E NZ  1 
ATOM   4791 N  N   . TYR E 1 140 ? -42.333 17.688  -31.981 1.00 25.16  ? 159 TYR E N   1 
ATOM   4792 C  CA  . TYR E 1 140 ? -41.452 18.316  -32.963 1.00 25.66  ? 159 TYR E CA  1 
ATOM   4793 C  C   . TYR E 1 140 ? -41.636 19.829  -32.996 1.00 27.05  ? 159 TYR E C   1 
ATOM   4794 O  O   . TYR E 1 140 ? -40.673 20.574  -33.174 1.00 26.66  ? 159 TYR E O   1 
ATOM   4795 C  CB  . TYR E 1 140 ? -41.660 17.730  -34.362 1.00 25.13  ? 159 TYR E CB  1 
ATOM   4796 C  CG  . TYR E 1 140 ? -41.396 16.244  -34.461 1.00 24.18  ? 159 TYR E CG  1 
ATOM   4797 C  CD1 . TYR E 1 140 ? -40.686 15.575  -33.473 1.00 23.41  ? 159 TYR E CD1 1 
ATOM   4798 C  CD2 . TYR E 1 140 ? -41.836 15.515  -35.555 1.00 24.10  ? 159 TYR E CD2 1 
ATOM   4799 C  CE1 . TYR E 1 140 ? -40.441 14.217  -33.564 1.00 22.15  ? 159 TYR E CE1 1 
ATOM   4800 C  CE2 . TYR E 1 140 ? -41.593 14.163  -35.657 1.00 23.62  ? 159 TYR E CE2 1 
ATOM   4801 C  CZ  . TYR E 1 140 ? -40.897 13.516  -34.660 1.00 22.28  ? 159 TYR E CZ  1 
ATOM   4802 O  OH  . TYR E 1 140 ? -40.657 12.165  -34.765 1.00 21.18  ? 159 TYR E OH  1 
ATOM   4803 N  N   . GLY E 1 141 ? -42.877 20.274  -32.828 1.00 38.66  ? 160 GLY E N   1 
ATOM   4804 C  CA  . GLY E 1 141 ? -43.174 21.694  -32.777 1.00 39.57  ? 160 GLY E CA  1 
ATOM   4805 C  C   . GLY E 1 141 ? -42.290 22.395  -31.765 1.00 40.07  ? 160 GLY E C   1 
ATOM   4806 O  O   . GLY E 1 141 ? -41.600 23.362  -32.090 1.00 40.57  ? 160 GLY E O   1 
ATOM   4807 N  N   . LEU E 1 142 ? -42.307 21.895  -30.533 1.00 58.11  ? 161 LEU E N   1 
ATOM   4808 C  CA  . LEU E 1 142 ? -41.467 22.439  -29.472 1.00 58.55  ? 161 LEU E CA  1 
ATOM   4809 C  C   . LEU E 1 142 ? -39.988 22.237  -29.779 1.00 57.58  ? 161 LEU E C   1 
ATOM   4810 O  O   . LEU E 1 142 ? -39.174 23.134  -29.564 1.00 57.87  ? 161 LEU E O   1 
ATOM   4811 C  CB  . LEU E 1 142 ? -41.808 21.793  -28.128 1.00 59.05  ? 161 LEU E CB  1 
ATOM   4812 C  CG  . LEU E 1 142 ? -43.172 22.133  -27.524 1.00 61.97  ? 161 LEU E CG  1 
ATOM   4813 C  CD1 . LEU E 1 142 ? -43.420 21.320  -26.263 1.00 61.28  ? 161 LEU E CD1 1 
ATOM   4814 C  CD2 . LEU E 1 142 ? -43.276 23.625  -27.235 1.00 62.18  ? 161 LEU E CD2 1 
ATOM   4815 N  N   . LEU E 1 143 ? -39.647 21.053  -30.279 1.00 31.45  ? 162 LEU E N   1 
ATOM   4816 C  CA  . LEU E 1 143 ? -38.262 20.723  -30.593 1.00 30.46  ? 162 LEU E CA  1 
ATOM   4817 C  C   . LEU E 1 143 ? -37.637 21.778  -31.495 1.00 30.97  ? 162 LEU E C   1 
ATOM   4818 O  O   . LEU E 1 143 ? -36.512 22.217  -31.263 1.00 31.23  ? 162 LEU E O   1 
ATOM   4819 C  CB  . LEU E 1 143 ? -38.171 19.346  -31.253 1.00 29.59  ? 162 LEU E CB  1 
ATOM   4820 C  CG  . LEU E 1 143 ? -36.765 18.873  -31.626 1.00 28.26  ? 162 LEU E CG  1 
ATOM   4821 C  CD1 . LEU E 1 143 ? -35.848 18.887  -30.413 1.00 27.13  ? 162 LEU E CD1 1 
ATOM   4822 C  CD2 . LEU E 1 143 ? -36.812 17.487  -32.247 1.00 27.27  ? 162 LEU E CD2 1 
ATOM   4823 N  N   . ALA E 1 144 ? -38.372 22.181  -32.524 1.00 36.63  ? 163 ALA E N   1 
ATOM   4824 C  CA  . ALA E 1 144 ? -37.907 23.227  -33.425 1.00 37.50  ? 163 ALA E CA  1 
ATOM   4825 C  C   . ALA E 1 144 ? -37.560 24.478  -32.630 1.00 38.43  ? 163 ALA E C   1 
ATOM   4826 O  O   . ALA E 1 144 ? -36.468 25.028  -32.763 1.00 38.77  ? 163 ALA E O   1 
ATOM   4827 C  CB  . ALA E 1 144 ? -38.962 23.534  -34.473 1.00 37.33  ? 163 ALA E CB  1 
ATOM   4828 N  N   . ARG E 1 145 ? -38.495 24.919  -31.796 1.00 41.73  ? 164 ARG E N   1 
ATOM   4829 C  CA  . ARG E 1 145 ? -38.277 26.087  -30.953 1.00 42.74  ? 164 ARG E CA  1 
ATOM   4830 C  C   . ARG E 1 145 ? -37.028 25.912  -30.093 1.00 42.06  ? 164 ARG E C   1 
ATOM   4831 O  O   . ARG E 1 145 ? -36.190 26.809  -30.015 1.00 42.96  ? 164 ARG E O   1 
ATOM   4832 C  CB  . ARG E 1 145 ? -39.500 26.351  -30.073 1.00 43.99  ? 164 ARG E CB  1 
ATOM   4833 C  CG  . ARG E 1 145 ? -39.328 27.501  -29.092 1.00 45.72  ? 164 ARG E CG  1 
ATOM   4834 C  CD  . ARG E 1 145 ? -38.894 28.775  -29.798 1.00 46.56  ? 164 ARG E CD  1 
ATOM   4835 N  NE  . ARG E 1 145 ? -39.859 29.205  -30.808 1.00 48.30  ? 164 ARG E NE  1 
ATOM   4836 C  CZ  . ARG E 1 145 ? -39.708 30.281  -31.575 1.00 49.01  ? 164 ARG E CZ  1 
ATOM   4837 N  NH1 . ARG E 1 145 ? -38.628 31.041  -31.449 1.00 48.75  ? 164 ARG E NH1 1 
ATOM   4838 N  NH2 . ARG E 1 145 ? -40.638 30.598  -32.467 1.00 48.04  ? 164 ARG E NH2 1 
ATOM   4839 N  N   . LEU E 1 146 ? -36.907 24.752  -29.454 1.00 33.57  ? 165 LEU E N   1 
ATOM   4840 C  CA  . LEU E 1 146 ? -35.747 24.457  -28.622 1.00 32.41  ? 165 LEU E CA  1 
ATOM   4841 C  C   . LEU E 1 146 ? -34.471 24.480  -29.451 1.00 33.39  ? 165 LEU E C   1 
ATOM   4842 O  O   . LEU E 1 146 ? -33.387 24.756  -28.934 1.00 33.57  ? 165 LEU E O   1 
ATOM   4843 C  CB  . LEU E 1 146 ? -35.902 23.101  -27.934 1.00 31.53  ? 165 LEU E CB  1 
ATOM   4844 C  CG  . LEU E 1 146 ? -36.960 23.008  -26.834 1.00 32.80  ? 165 LEU E CG  1 
ATOM   4845 C  CD1 . LEU E 1 146 ? -37.035 21.592  -26.283 1.00 30.72  ? 165 LEU E CD1 1 
ATOM   4846 C  CD2 . LEU E 1 146 ? -36.672 24.007  -25.720 1.00 32.71  ? 165 LEU E CD2 1 
ATOM   4847 N  N   . ALA E 1 147 ? -34.609 24.185  -30.739 1.00 32.18  ? 166 ALA E N   1 
ATOM   4848 C  CA  . ALA E 1 147 ? -33.480 24.216  -31.659 1.00 31.87  ? 166 ALA E CA  1 
ATOM   4849 C  C   . ALA E 1 147 ? -33.081 25.656  -31.959 1.00 33.25  ? 166 ALA E C   1 
ATOM   4850 O  O   . ALA E 1 147 ? -31.914 25.947  -32.219 1.00 33.54  ? 166 ALA E O   1 
ATOM   4851 C  CB  . ALA E 1 147 ? -33.823 23.480  -32.944 1.00 31.70  ? 166 ALA E CB  1 
ATOM   4852 N  N   . VAL E 1 148 ? -34.062 26.553  -31.922 1.00 36.24  ? 167 VAL E N   1 
ATOM   4853 C  CA  . VAL E 1 148 ? -33.814 27.974  -32.131 1.00 37.49  ? 167 VAL E CA  1 
ATOM   4854 C  C   . VAL E 1 148 ? -33.074 28.561  -30.934 1.00 38.39  ? 167 VAL E C   1 
ATOM   4855 O  O   . VAL E 1 148 ? -32.131 29.338  -31.092 1.00 38.34  ? 167 VAL E O   1 
ATOM   4856 C  CB  . VAL E 1 148 ? -35.128 28.750  -32.345 1.00 37.41  ? 167 VAL E CB  1 
ATOM   4857 C  CG1 . VAL E 1 148 ? -34.859 30.242  -32.417 1.00 38.68  ? 167 VAL E CG1 1 
ATOM   4858 C  CG2 . VAL E 1 148 ? -35.828 28.266  -33.604 1.00 38.18  ? 167 VAL E CG2 1 
ATOM   4859 N  N   . GLU E 1 149 ? -33.509 28.181  -29.737 1.00 64.89  ? 168 GLU E N   1 
ATOM   4860 C  CA  . GLU E 1 149 ? -32.874 28.633  -28.505 1.00 64.99  ? 168 GLU E CA  1 
ATOM   4861 C  C   . GLU E 1 149 ? -31.475 28.045  -28.374 1.00 65.02  ? 168 GLU E C   1 
ATOM   4862 O  O   . GLU E 1 149 ? -30.599 28.638  -27.743 1.00 65.74  ? 168 GLU E O   1 
ATOM   4863 C  CB  . GLU E 1 149 ? -33.718 28.240  -27.290 1.00 64.87  ? 168 GLU E CB  1 
ATOM   4864 C  CG  . GLU E 1 149 ? -35.154 28.733  -27.342 1.00 67.14  ? 168 GLU E CG  1 
ATOM   4865 C  CD  . GLU E 1 149 ? -35.255 30.245  -27.276 1.00 70.51  ? 168 GLU E CD  1 
ATOM   4866 O  OE1 . GLU E 1 149 ? -34.422 30.870  -26.585 1.00 70.36  ? 168 GLU E OE1 1 
ATOM   4867 O  OE2 . GLU E 1 149 ? -36.173 30.806  -27.914 1.00 71.72  ? 168 GLU E OE2 1 
ATOM   4868 N  N   . ALA E 1 150 ? -31.274 26.874  -28.970 1.00 47.96  ? 169 ALA E N   1 
ATOM   4869 C  CA  . ALA E 1 150 ? -29.979 26.204  -28.928 1.00 46.87  ? 169 ALA E CA  1 
ATOM   4870 C  C   . ALA E 1 150 ? -28.904 27.053  -29.598 1.00 48.41  ? 169 ALA E C   1 
ATOM   4871 O  O   . ALA E 1 150 ? -27.767 27.116  -29.130 1.00 49.58  ? 169 ALA E O   1 
ATOM   4872 C  CB  . ALA E 1 150 ? -30.065 24.838  -29.583 1.00 44.73  ? 169 ALA E CB  1 
ATOM   4873 N  N   . GLY E 1 151 ? -29.264 27.703  -30.698 1.00 47.87  ? 170 GLY E N   1 
ATOM   4874 C  CA  . GLY E 1 151 ? -28.332 28.573  -31.388 1.00 50.12  ? 170 GLY E CA  1 
ATOM   4875 C  C   . GLY E 1 151 ? -28.323 28.413  -32.896 1.00 51.34  ? 170 GLY E C   1 
ATOM   4876 O  O   . GLY E 1 151 ? -27.779 29.257  -33.608 1.00 53.58  ? 170 GLY E O   1 
ATOM   4877 N  N   . PHE E 1 152 ? -28.922 27.333  -33.388 1.00 37.12  ? 171 PHE E N   1 
ATOM   4878 C  CA  . PHE E 1 152 ? -28.945 27.076  -34.824 1.00 37.38  ? 171 PHE E CA  1 
ATOM   4879 C  C   . PHE E 1 152 ? -29.353 28.323  -35.600 1.00 38.41  ? 171 PHE E C   1 
ATOM   4880 O  O   . PHE E 1 152 ? -30.300 29.018  -35.232 1.00 38.09  ? 171 PHE E O   1 
ATOM   4881 C  CB  . PHE E 1 152 ? -29.869 25.907  -35.161 1.00 36.20  ? 171 PHE E CB  1 
ATOM   4882 C  CG  . PHE E 1 152 ? -29.323 24.571  -34.752 1.00 33.00  ? 171 PHE E CG  1 
ATOM   4883 C  CD1 . PHE E 1 152 ? -28.429 23.898  -35.565 1.00 32.73  ? 171 PHE E CD1 1 
ATOM   4884 C  CD2 . PHE E 1 152 ? -29.700 23.992  -33.554 1.00 30.82  ? 171 PHE E CD2 1 
ATOM   4885 C  CE1 . PHE E 1 152 ? -27.924 22.670  -35.192 1.00 31.53  ? 171 PHE E CE1 1 
ATOM   4886 C  CE2 . PHE E 1 152 ? -29.199 22.764  -33.175 1.00 29.68  ? 171 PHE E CE2 1 
ATOM   4887 C  CZ  . PHE E 1 152 ? -28.309 22.101  -33.995 1.00 29.65  ? 171 PHE E CZ  1 
ATOM   4888 N  N   . ASP E 1 153 ? -28.623 28.594  -36.675 1.00 52.73  ? 172 ASP E N   1 
ATOM   4889 C  CA  . ASP E 1 153 ? -28.811 29.807  -37.460 1.00 54.21  ? 172 ASP E CA  1 
ATOM   4890 C  C   . ASP E 1 153 ? -30.026 29.706  -38.378 1.00 54.41  ? 172 ASP E C   1 
ATOM   4891 O  O   . ASP E 1 153 ? -30.446 30.697  -38.977 1.00 56.10  ? 172 ASP E O   1 
ATOM   4892 C  CB  . ASP E 1 153 ? -27.551 30.093  -38.273 1.00 54.92  ? 172 ASP E CB  1 
ATOM   4893 C  CG  . ASP E 1 153 ? -26.298 30.075  -37.418 1.00 54.75  ? 172 ASP E CG  1 
ATOM   4894 O  OD1 . ASP E 1 153 ? -26.358 30.559  -36.265 1.00 54.97  ? 172 ASP E OD1 1 
ATOM   4895 O  OD2 . ASP E 1 153 ? -25.257 29.575  -37.892 1.00 53.50  ? 172 ASP E OD2 1 
ATOM   4896 N  N   . TRP E 1 154 ? -30.587 28.505  -38.482 1.00 40.69  ? 173 TRP E N   1 
ATOM   4897 C  CA  . TRP E 1 154 ? -31.774 28.284  -39.299 1.00 40.53  ? 173 TRP E CA  1 
ATOM   4898 C  C   . TRP E 1 154 ? -32.450 26.961  -38.946 1.00 38.47  ? 173 TRP E C   1 
ATOM   4899 O  O   . TRP E 1 154 ? -31.828 25.902  -38.986 1.00 36.90  ? 173 TRP E O   1 
ATOM   4900 C  CB  . TRP E 1 154 ? -31.418 28.319  -40.786 1.00 41.38  ? 173 TRP E CB  1 
ATOM   4901 C  CG  . TRP E 1 154 ? -32.603 28.534  -41.680 1.00 42.12  ? 173 TRP E CG  1 
ATOM   4902 C  CD1 . TRP E 1 154 ? -33.297 29.695  -41.852 1.00 43.31  ? 173 TRP E CD1 1 
ATOM   4903 C  CD2 . TRP E 1 154 ? -33.230 27.564  -42.529 1.00 41.54  ? 173 TRP E CD2 1 
ATOM   4904 N  NE1 . TRP E 1 154 ? -34.318 29.508  -42.751 1.00 44.01  ? 173 TRP E NE1 1 
ATOM   4905 C  CE2 . TRP E 1 154 ? -34.298 28.208  -43.182 1.00 42.40  ? 173 TRP E CE2 1 
ATOM   4906 C  CE3 . TRP E 1 154 ? -32.992 26.212  -42.796 1.00 40.91  ? 173 TRP E CE3 1 
ATOM   4907 C  CZ2 . TRP E 1 154 ? -35.127 27.549  -44.087 1.00 41.77  ? 173 TRP E CZ2 1 
ATOM   4908 C  CZ3 . TRP E 1 154 ? -33.816 25.559  -43.696 1.00 40.50  ? 173 TRP E CZ3 1 
ATOM   4909 C  CH2 . TRP E 1 154 ? -34.870 26.228  -44.330 1.00 40.60  ? 173 TRP E CH2 1 
ATOM   4910 N  N   . VAL E 1 155 ? -33.731 27.037  -38.601 1.00 42.33  ? 174 VAL E N   1 
ATOM   4911 C  CA  . VAL E 1 155 ? -34.513 25.857  -38.253 1.00 41.49  ? 174 VAL E CA  1 
ATOM   4912 C  C   . VAL E 1 155 ? -35.770 25.788  -39.117 1.00 42.31  ? 174 VAL E C   1 
ATOM   4913 O  O   . VAL E 1 155 ? -36.452 26.794  -39.310 1.00 43.53  ? 174 VAL E O   1 
ATOM   4914 C  CB  . VAL E 1 155 ? -34.914 25.865  -36.770 1.00 41.20  ? 174 VAL E CB  1 
ATOM   4915 C  CG1 . VAL E 1 155 ? -35.741 24.634  -36.437 1.00 39.08  ? 174 VAL E CG1 1 
ATOM   4916 C  CG2 . VAL E 1 155 ? -33.677 25.944  -35.886 1.00 40.13  ? 174 VAL E CG2 1 
ATOM   4917 N  N   . TYR E 1 156 ? -36.077 24.599  -39.625 1.00 30.72  ? 175 TYR E N   1 
ATOM   4918 C  CA  . TYR E 1 156 ? -37.203 24.430  -40.535 1.00 29.59  ? 175 TYR E CA  1 
ATOM   4919 C  C   . TYR E 1 156 ? -37.967 23.138  -40.260 1.00 28.13  ? 175 TYR E C   1 
ATOM   4920 O  O   . TYR E 1 156 ? -37.411 22.043  -40.342 1.00 27.04  ? 175 TYR E O   1 
ATOM   4921 C  CB  . TYR E 1 156 ? -36.714 24.471  -41.984 1.00 30.04  ? 175 TYR E CB  1 
ATOM   4922 C  CG  . TYR E 1 156 ? -37.773 24.166  -43.022 1.00 30.30  ? 175 TYR E CG  1 
ATOM   4923 C  CD1 . TYR E 1 156 ? -39.054 24.694  -42.918 1.00 31.87  ? 175 TYR E CD1 1 
ATOM   4924 C  CD2 . TYR E 1 156 ? -37.482 23.368  -44.123 1.00 29.00  ? 175 TYR E CD2 1 
ATOM   4925 C  CE1 . TYR E 1 156 ? -40.018 24.421  -43.872 1.00 31.49  ? 175 TYR E CE1 1 
ATOM   4926 C  CE2 . TYR E 1 156 ? -38.439 23.092  -45.080 1.00 29.47  ? 175 TYR E CE2 1 
ATOM   4927 C  CZ  . TYR E 1 156 ? -39.705 23.621  -44.951 1.00 30.47  ? 175 TYR E CZ  1 
ATOM   4928 O  OH  . TYR E 1 156 ? -40.663 23.349  -45.901 1.00 30.32  ? 175 TYR E OH  1 
ATOM   4929 N  N   . TYR E 1 157 ? -39.246 23.280  -39.928 1.00 32.72  ? 176 TYR E N   1 
ATOM   4930 C  CA  . TYR E 1 157 ? -40.124 22.139  -39.721 1.00 31.52  ? 176 TYR E CA  1 
ATOM   4931 C  C   . TYR E 1 157 ? -40.417 21.519  -41.083 1.00 31.70  ? 176 TYR E C   1 
ATOM   4932 O  O   . TYR E 1 157 ? -41.542 21.581  -41.579 1.00 32.28  ? 176 TYR E O   1 
ATOM   4933 C  CB  . TYR E 1 157 ? -41.422 22.594  -39.055 1.00 31.13  ? 176 TYR E CB  1 
ATOM   4934 C  CG  . TYR E 1 157 ? -42.153 21.511  -38.293 1.00 31.09  ? 176 TYR E CG  1 
ATOM   4935 C  CD1 . TYR E 1 157 ? -42.478 20.302  -38.897 1.00 31.20  ? 176 TYR E CD1 1 
ATOM   4936 C  CD2 . TYR E 1 157 ? -42.540 21.705  -36.973 1.00 31.36  ? 176 TYR E CD2 1 
ATOM   4937 C  CE1 . TYR E 1 157 ? -43.154 19.316  -38.202 1.00 30.27  ? 176 TYR E CE1 1 
ATOM   4938 C  CE2 . TYR E 1 157 ? -43.217 20.725  -36.273 1.00 30.61  ? 176 TYR E CE2 1 
ATOM   4939 C  CZ  . TYR E 1 157 ? -43.522 19.533  -36.891 1.00 30.43  ? 176 TYR E CZ  1 
ATOM   4940 O  OH  . TYR E 1 157 ? -44.196 18.556  -36.193 1.00 30.80  ? 176 TYR E OH  1 
ATOM   4941 N  N   . GLU E 1 158 ? -39.389 20.926  -41.682 1.00 37.76  ? 177 GLU E N   1 
ATOM   4942 C  CA  . GLU E 1 158 ? -39.459 20.446  -43.057 1.00 38.40  ? 177 GLU E CA  1 
ATOM   4943 C  C   . GLU E 1 158 ? -40.594 19.457  -43.265 1.00 38.91  ? 177 GLU E C   1 
ATOM   4944 O  O   . GLU E 1 158 ? -41.538 19.730  -44.006 1.00 40.63  ? 177 GLU E O   1 
ATOM   4945 C  CB  . GLU E 1 158 ? -38.129 19.813  -43.475 1.00 38.56  ? 177 GLU E CB  1 
ATOM   4946 C  CG  . GLU E 1 158 ? -38.007 19.570  -44.971 1.00 39.20  ? 177 GLU E CG  1 
ATOM   4947 C  CD  . GLU E 1 158 ? -36.565 19.490  -45.429 1.00 39.41  ? 177 GLU E CD  1 
ATOM   4948 O  OE1 . GLU E 1 158 ? -35.670 19.414  -44.562 1.00 37.95  ? 177 GLU E OE1 1 
ATOM   4949 O  OE2 . GLU E 1 158 ? -36.326 19.505  -46.655 1.00 40.54  ? 177 GLU E OE2 1 
ATOM   4950 N  N   . SER E 1 159 ? -40.490 18.303  -42.615 1.00 43.77  ? 178 SER E N   1 
ATOM   4951 C  CA  . SER E 1 159 ? -41.501 17.260  -42.733 1.00 42.70  ? 178 SER E CA  1 
ATOM   4952 C  C   . SER E 1 159 ? -42.261 17.083  -41.424 1.00 42.65  ? 178 SER E C   1 
ATOM   4953 O  O   . SER E 1 159 ? -41.765 17.439  -40.354 1.00 42.47  ? 178 SER E O   1 
ATOM   4954 C  CB  . SER E 1 159 ? -40.849 15.938  -43.143 1.00 41.28  ? 178 SER E CB  1 
ATOM   4955 O  OG  . SER E 1 159 ? -41.773 14.867  -43.083 1.00 41.01  ? 178 SER E OG  1 
ATOM   4956 N  N   . ARG E 1 160 ? -43.465 16.529  -41.513 1.00 40.77  ? 179 ARG E N   1 
ATOM   4957 C  CA  . ARG E 1 160 ? -44.239 16.197  -40.325 1.00 40.38  ? 179 ARG E CA  1 
ATOM   4958 C  C   . ARG E 1 160 ? -43.589 15.045  -39.575 1.00 38.79  ? 179 ARG E C   1 
ATOM   4959 O  O   . ARG E 1 160 ? -44.059 14.640  -38.512 1.00 39.64  ? 179 ARG E O   1 
ATOM   4960 C  CB  . ARG E 1 160 ? -45.681 15.845  -40.698 1.00 41.65  ? 179 ARG E CB  1 
ATOM   4961 C  CG  . ARG E 1 160 ? -46.602 17.052  -40.744 1.00 45.26  ? 179 ARG E CG  1 
ATOM   4962 C  CD  . ARG E 1 160 ? -47.984 16.724  -41.280 1.00 45.89  ? 179 ARG E CD  1 
ATOM   4963 N  NE  . ARG E 1 160 ? -48.848 17.899  -41.212 1.00 46.55  ? 179 ARG E NE  1 
ATOM   4964 C  CZ  . ARG E 1 160 ? -50.009 18.021  -41.847 1.00 49.46  ? 179 ARG E CZ  1 
ATOM   4965 N  NH1 . ARG E 1 160 ? -50.462 17.036  -42.612 1.00 50.54  ? 179 ARG E NH1 1 
ATOM   4966 N  NH2 . ARG E 1 160 ? -50.715 19.137  -41.718 1.00 51.87  ? 179 ARG E NH2 1 
ATOM   4967 N  N   . ASN E 1 161 ? -42.497 14.529  -40.129 1.00 35.68  ? 180 ASN E N   1 
ATOM   4968 C  CA  . ASN E 1 161 ? -41.813 13.379  -39.553 1.00 35.02  ? 180 ASN E CA  1 
ATOM   4969 C  C   . ASN E 1 161 ? -40.422 13.719  -39.017 1.00 34.80  ? 180 ASN E C   1 
ATOM   4970 O  O   . ASN E 1 161 ? -39.765 12.875  -38.406 1.00 34.36  ? 180 ASN E O   1 
ATOM   4971 C  CB  . ASN E 1 161 ? -41.720 12.249  -40.580 1.00 34.85  ? 180 ASN E CB  1 
ATOM   4972 C  CG  . ASN E 1 161 ? -43.051 11.966  -41.260 1.00 34.60  ? 180 ASN E CG  1 
ATOM   4973 O  OD1 . ASN E 1 161 ? -44.104 11.981  -40.625 1.00 34.67  ? 180 ASN E OD1 1 
ATOM   4974 N  ND2 . ASN E 1 161 ? -43.004 11.704  -42.561 1.00 34.36  ? 180 ASN E ND2 1 
ATOM   4975 N  N   . HIS E 1 162 ? -39.978 14.952  -39.251 1.00 27.22  ? 181 HIS E N   1 
ATOM   4976 C  CA  . HIS E 1 162 ? -38.686 15.409  -38.739 1.00 26.56  ? 181 HIS E CA  1 
ATOM   4977 C  C   . HIS E 1 162 ? -38.513 16.921  -38.864 1.00 27.25  ? 181 HIS E C   1 
ATOM   4978 O  O   . HIS E 1 162 ? -39.304 17.598  -39.518 1.00 28.06  ? 181 HIS E O   1 
ATOM   4979 C  CB  . HIS E 1 162 ? -37.535 14.698  -39.456 1.00 25.54  ? 181 HIS E CB  1 
ATOM   4980 C  CG  . HIS E 1 162 ? -37.193 15.294  -40.786 1.00 27.00  ? 181 HIS E CG  1 
ATOM   4981 N  ND1 . HIS E 1 162 ? -37.652 14.774  -41.976 1.00 26.81  ? 181 HIS E ND1 1 
ATOM   4982 C  CD2 . HIS E 1 162 ? -36.435 16.369  -41.113 1.00 27.45  ? 181 HIS E CD2 1 
ATOM   4983 C  CE1 . HIS E 1 162 ? -37.192 15.502  -42.979 1.00 28.17  ? 181 HIS E CE1 1 
ATOM   4984 N  NE2 . HIS E 1 162 ? -36.452 16.475  -42.483 1.00 28.08  ? 181 HIS E NE2 1 
ATOM   4985 N  N   . VAL E 1 163 ? -37.468 17.443  -38.231 1.00 26.36  ? 182 VAL E N   1 
ATOM   4986 C  CA  . VAL E 1 163 ? -37.139 18.859  -38.322 1.00 26.92  ? 182 VAL E CA  1 
ATOM   4987 C  C   . VAL E 1 163 ? -35.747 19.019  -38.916 1.00 26.75  ? 182 VAL E C   1 
ATOM   4988 O  O   . VAL E 1 163 ? -34.911 18.126  -38.797 1.00 26.32  ? 182 VAL E O   1 
ATOM   4989 C  CB  . VAL E 1 163 ? -37.185 19.538  -36.942 1.00 27.05  ? 182 VAL E CB  1 
ATOM   4990 C  CG1 . VAL E 1 163 ? -36.935 21.031  -37.074 1.00 28.92  ? 182 VAL E CG1 1 
ATOM   4991 C  CG2 . VAL E 1 163 ? -38.521 19.277  -36.266 1.00 27.23  ? 182 VAL E CG2 1 
ATOM   4992 N  N   . HIS E 1 164 ? -35.504 20.155  -39.559 1.00 24.11  ? 183 HIS E N   1 
ATOM   4993 C  CA  . HIS E 1 164 ? -34.223 20.408  -40.207 1.00 24.80  ? 183 HIS E CA  1 
ATOM   4994 C  C   . HIS E 1 164 ? -33.508 21.593  -39.568 1.00 26.34  ? 183 HIS E C   1 
ATOM   4995 O  O   . HIS E 1 164 ? -34.089 22.667  -39.415 1.00 28.24  ? 183 HIS E O   1 
ATOM   4996 C  CB  . HIS E 1 164 ? -34.435 20.662  -41.699 1.00 26.13  ? 183 HIS E CB  1 
ATOM   4997 C  CG  . HIS E 1 164 ? -33.178 20.986  -42.443 1.00 27.27  ? 183 HIS E CG  1 
ATOM   4998 N  ND1 . HIS E 1 164 ? -32.315 20.015  -42.901 1.00 25.90  ? 183 HIS E ND1 1 
ATOM   4999 C  CD2 . HIS E 1 164 ? -32.640 22.173  -42.810 1.00 28.80  ? 183 HIS E CD2 1 
ATOM   5000 C  CE1 . HIS E 1 164 ? -31.299 20.590  -43.520 1.00 27.17  ? 183 HIS E CE1 1 
ATOM   5001 N  NE2 . HIS E 1 164 ? -31.472 21.898  -43.477 1.00 29.10  ? 183 HIS E NE2 1 
ATOM   5002 N  N   . VAL E 1 165 ? -32.247 21.397  -39.197 1.00 28.64  ? 184 VAL E N   1 
ATOM   5003 C  CA  . VAL E 1 165 ? -31.472 22.442  -38.534 1.00 30.37  ? 184 VAL E CA  1 
ATOM   5004 C  C   . VAL E 1 165 ? -30.099 22.630  -39.172 1.00 31.06  ? 184 VAL E C   1 
ATOM   5005 O  O   . VAL E 1 165 ? -29.383 21.660  -39.420 1.00 29.85  ? 184 VAL E O   1 
ATOM   5006 C  CB  . VAL E 1 165 ? -31.291 22.139  -37.037 1.00 29.69  ? 184 VAL E CB  1 
ATOM   5007 C  CG1 . VAL E 1 165 ? -32.611 22.301  -36.301 1.00 29.44  ? 184 VAL E CG1 1 
ATOM   5008 C  CG2 . VAL E 1 165 ? -30.734 20.737  -36.845 1.00 27.36  ? 184 VAL E CG2 1 
ATOM   5009 N  N   . SER E 1 166 ? -29.733 23.884  -39.426 1.00 39.10  ? 185 SER E N   1 
ATOM   5010 C  CA  . SER E 1 166 ? -28.472 24.188  -40.097 1.00 40.39  ? 185 SER E CA  1 
ATOM   5011 C  C   . SER E 1 166 ? -27.682 25.286  -39.393 1.00 41.38  ? 185 SER E C   1 
ATOM   5012 O  O   . SER E 1 166 ? -28.227 26.041  -38.588 1.00 42.16  ? 185 SER E O   1 
ATOM   5013 C  CB  . SER E 1 166 ? -28.722 24.581  -41.555 1.00 42.10  ? 185 SER E CB  1 
ATOM   5014 O  OG  . SER E 1 166 ? -29.449 25.795  -41.642 1.00 43.84  ? 185 SER E OG  1 
ATOM   5015 N  N   . VAL E 1 167 ? -26.393 25.367  -39.709 1.00 37.00  ? 186 VAL E N   1 
ATOM   5016 C  CA  . VAL E 1 167 ? -25.507 26.346  -39.088 1.00 38.92  ? 186 VAL E CA  1 
ATOM   5017 C  C   . VAL E 1 167 ? -24.673 27.087  -40.132 1.00 40.46  ? 186 VAL E C   1 
ATOM   5018 O  O   . VAL E 1 167 ? -24.514 26.619  -41.261 1.00 39.71  ? 186 VAL E O   1 
ATOM   5019 C  CB  . VAL E 1 167 ? -24.562 25.681  -38.064 1.00 37.43  ? 186 VAL E CB  1 
ATOM   5020 C  CG1 . VAL E 1 167 ? -25.364 25.040  -36.943 1.00 35.71  ? 186 VAL E CG1 1 
ATOM   5021 C  CG2 . VAL E 1 167 ? -23.679 24.648  -38.747 1.00 36.59  ? 186 VAL E CG2 1 
ATOM   5022 N  N   . LYS E 1 168 ? -24.149 28.249  -39.748 1.00 48.98  ? 187 LYS E N   1 
ATOM   5023 C  CA  . LYS E 1 168 ? -23.291 29.039  -40.626 1.00 50.37  ? 187 LYS E CA  1 
ATOM   5024 C  C   . LYS E 1 168 ? -21.947 28.344  -40.809 1.00 50.51  ? 187 LYS E C   1 
ATOM   5025 O  O   . LYS E 1 168 ? -21.602 27.439  -40.049 1.00 50.72  ? 187 LYS E O   1 
ATOM   5026 C  CB  . LYS E 1 168 ? -23.083 30.448  -40.060 1.00 51.18  ? 187 LYS E CB  1 
ATOM   5027 C  CG  . LYS E 1 168 ? -24.298 31.366  -40.168 1.00 51.96  ? 187 LYS E CG  1 
ATOM   5028 C  CD  . LYS E 1 168 ? -23.988 32.757  -39.617 1.00 52.61  ? 187 LYS E CD  1 
ATOM   5029 C  CE  . LYS E 1 168 ? -25.152 33.723  -39.810 1.00 53.26  ? 187 LYS E CE  1 
ATOM   5030 N  NZ  . LYS E 1 168 ? -26.341 33.369  -38.983 1.00 52.84  ? 187 LYS E NZ  1 
ATOM   5031 N  N   . ALA E 1 169 ? -21.191 28.765  -41.819 1.00 61.99  ? 188 ALA E N   1 
ATOM   5032 C  CA  . ALA E 1 169 ? -19.874 28.188  -42.072 1.00 63.08  ? 188 ALA E CA  1 
ATOM   5033 C  C   . ALA E 1 169 ? -18.846 28.727  -41.077 1.00 63.63  ? 188 ALA E C   1 
ATOM   5034 O  O   . ALA E 1 169 ? -18.896 29.895  -40.691 1.00 63.77  ? 188 ALA E O   1 
ATOM   5035 C  CB  . ALA E 1 169 ? -19.436 28.464  -43.503 1.00 63.60  ? 188 ALA E CB  1 
ATOM   5036 N  N   . ASP E 1 170 ? -17.916 27.871  -40.666 1.00 70.90  ? 189 ASP E N   1 
ATOM   5037 C  CA  . ASP E 1 170 ? -16.902 28.256  -39.689 1.00 71.81  ? 189 ASP E CA  1 
ATOM   5038 C  C   . ASP E 1 170 ? -15.989 29.352  -40.232 1.00 73.77  ? 189 ASP E C   1 
ATOM   5039 O  O   . ASP E 1 170 ? -15.797 30.386  -39.591 1.00 74.76  ? 189 ASP E O   1 
ATOM   5040 C  CB  . ASP E 1 170 ? -16.072 27.041  -39.265 1.00 70.53  ? 189 ASP E CB  1 
ATOM   5041 C  CG  . ASP E 1 170 ? -16.897 25.996  -38.537 1.00 67.50  ? 189 ASP E CG  1 
ATOM   5042 O  OD1 . ASP E 1 170 ? -17.891 26.373  -37.884 1.00 66.62  ? 189 ASP E OD1 1 
ATOM   5043 O  OD2 . ASP E 1 170 ? -16.549 24.799  -38.615 1.00 65.25  ? 189 ASP E OD2 1 
ATOM   5044 N  N   . GLY F 2 7   ? -21.956 -4.263  -54.966 1.00 59.67  ? 829 GLY F N   1 
ATOM   5045 C  CA  . GLY F 2 7   ? -23.260 -3.668  -54.748 1.00 60.06  ? 829 GLY F CA  1 
ATOM   5046 C  C   . GLY F 2 7   ? -23.587 -2.539  -55.708 1.00 61.11  ? 829 GLY F C   1 
ATOM   5047 O  O   . GLY F 2 7   ? -22.719 -1.749  -56.076 1.00 61.76  ? 829 GLY F O   1 
ATOM   5048 N  N   . PRO F 2 8   ? -24.861 -2.448  -56.112 1.00 56.38  ? 830 PRO F N   1 
ATOM   5049 C  CA  . PRO F 2 8   ? -25.355 -1.414  -57.027 1.00 55.94  ? 830 PRO F CA  1 
ATOM   5050 C  C   . PRO F 2 8   ? -25.295 -0.030  -56.391 1.00 54.41  ? 830 PRO F C   1 
ATOM   5051 O  O   . PRO F 2 8   ? -24.609 0.156   -55.388 1.00 54.96  ? 830 PRO F O   1 
ATOM   5052 C  CB  . PRO F 2 8   ? -26.823 -1.811  -57.249 1.00 55.45  ? 830 PRO F CB  1 
ATOM   5053 C  CG  . PRO F 2 8   ? -26.905 -3.245  -56.853 1.00 56.04  ? 830 PRO F CG  1 
ATOM   5054 C  CD  . PRO F 2 8   ? -25.907 -3.421  -55.766 1.00 55.68  ? 830 PRO F CD  1 
ATOM   5055 N  N   . HIS F 2 9   ? -26.009 0.926   -56.979 1.00 47.78  ? 831 HIS F N   1 
ATOM   5056 C  CA  . HIS F 2 9   ? -26.099 2.270   -56.430 1.00 46.55  ? 831 HIS F CA  1 
ATOM   5057 C  C   . HIS F 2 9   ? -27.395 2.957   -56.851 1.00 46.71  ? 831 HIS F C   1 
ATOM   5058 O  O   . HIS F 2 9   ? -27.682 3.092   -58.041 1.00 47.51  ? 831 HIS F O   1 
ATOM   5059 C  CB  . HIS F 2 9   ? -24.898 3.110   -56.857 1.00 46.03  ? 831 HIS F CB  1 
ATOM   5060 C  CG  . HIS F 2 9   ? -25.018 4.559   -56.490 1.00 45.95  ? 831 HIS F CG  1 
ATOM   5061 N  ND1 . HIS F 2 9   ? -24.635 5.051   -55.260 1.00 45.46  ? 831 HIS F ND1 1 
ATOM   5062 C  CD2 . HIS F 2 9   ? -25.479 5.621   -57.190 1.00 46.34  ? 831 HIS F CD2 1 
ATOM   5063 C  CE1 . HIS F 2 9   ? -24.851 6.354   -55.220 1.00 45.46  ? 831 HIS F CE1 1 
ATOM   5064 N  NE2 . HIS F 2 9   ? -25.364 6.725   -56.379 1.00 46.97  ? 831 HIS F NE2 1 
ATOM   5065 N  N   . ILE F 2 10  ? -28.178 3.383   -55.864 1.00 43.53  ? 832 ILE F N   1 
ATOM   5066 C  CA  . ILE F 2 10  ? -29.436 4.071   -56.123 1.00 42.53  ? 832 ILE F CA  1 
ATOM   5067 C  C   . ILE F 2 10  ? -29.183 5.488   -56.630 1.00 42.42  ? 832 ILE F C   1 
ATOM   5068 O  O   . ILE F 2 10  ? -28.599 6.314   -55.928 1.00 41.89  ? 832 ILE F O   1 
ATOM   5069 C  CB  . ILE F 2 10  ? -30.308 4.123   -54.859 1.00 40.46  ? 832 ILE F CB  1 
ATOM   5070 C  CG1 . ILE F 2 10  ? -30.461 2.720   -54.265 1.00 39.85  ? 832 ILE F CG1 1 
ATOM   5071 C  CG2 . ILE F 2 10  ? -31.668 4.729   -55.168 1.00 39.98  ? 832 ILE F CG2 1 
ATOM   5072 C  CD1 . ILE F 2 10  ? -31.230 2.684   -52.967 1.00 39.06  ? 832 ILE F CD1 1 
ATOM   5073 N  N   . ALA F 2 11  ? -29.622 5.760   -57.855 1.00 35.23  ? 833 ALA F N   1 
ATOM   5074 C  CA  . ALA F 2 11  ? -29.448 7.076   -58.456 1.00 35.69  ? 833 ALA F CA  1 
ATOM   5075 C  C   . ALA F 2 11  ? -30.429 8.080   -57.865 1.00 33.77  ? 833 ALA F C   1 
ATOM   5076 O  O   . ALA F 2 11  ? -30.101 9.254   -57.684 1.00 32.70  ? 833 ALA F O   1 
ATOM   5077 C  CB  . ALA F 2 11  ? -29.611 6.997   -59.968 1.00 36.80  ? 833 ALA F CB  1 
ATOM   5078 N  N   . TYR F 2 12  ? -31.636 7.613   -57.567 1.00 30.37  ? 834 TYR F N   1 
ATOM   5079 C  CA  . TYR F 2 12  ? -32.655 8.471   -56.980 1.00 29.54  ? 834 TYR F CA  1 
ATOM   5080 C  C   . TYR F 2 12  ? -33.834 7.668   -56.448 1.00 29.23  ? 834 TYR F C   1 
ATOM   5081 O  O   . TYR F 2 12  ? -34.128 6.577   -56.934 1.00 29.80  ? 834 TYR F O   1 
ATOM   5082 C  CB  . TYR F 2 12  ? -33.153 9.495   -58.004 1.00 30.07  ? 834 TYR F CB  1 
ATOM   5083 C  CG  . TYR F 2 12  ? -34.092 8.925   -59.048 1.00 31.36  ? 834 TYR F CG  1 
ATOM   5084 C  CD1 . TYR F 2 12  ? -33.633 8.590   -60.316 1.00 33.01  ? 834 TYR F CD1 1 
ATOM   5085 C  CD2 . TYR F 2 12  ? -35.439 8.728   -58.768 1.00 31.03  ? 834 TYR F CD2 1 
ATOM   5086 C  CE1 . TYR F 2 12  ? -34.489 8.075   -61.273 1.00 32.99  ? 834 TYR F CE1 1 
ATOM   5087 C  CE2 . TYR F 2 12  ? -36.300 8.210   -59.716 1.00 31.14  ? 834 TYR F CE2 1 
ATOM   5088 C  CZ  . TYR F 2 12  ? -35.821 7.885   -60.966 1.00 33.20  ? 834 TYR F CZ  1 
ATOM   5089 O  OH  . TYR F 2 12  ? -36.680 7.372   -61.910 1.00 34.64  ? 834 TYR F OH  1 
ATOM   5090 N  N   . THR F 2 13  ? -34.500 8.223   -55.441 1.00 26.91  ? 835 THR F N   1 
ATOM   5091 C  CA  . THR F 2 13  ? -35.758 7.681   -54.945 1.00 25.11  ? 835 THR F CA  1 
ATOM   5092 C  C   . THR F 2 13  ? -36.793 8.796   -54.952 1.00 25.31  ? 835 THR F C   1 
ATOM   5093 O  O   . THR F 2 13  ? -36.564 9.872   -54.401 1.00 24.51  ? 835 THR F O   1 
ATOM   5094 C  CB  . THR F 2 13  ? -35.622 7.118   -53.521 1.00 24.56  ? 835 THR F CB  1 
ATOM   5095 O  OG1 . THR F 2 13  ? -34.970 8.082   -52.684 1.00 24.92  ? 835 THR F OG1 1 
ATOM   5096 C  CG2 . THR F 2 13  ? -34.812 5.831   -53.530 1.00 24.22  ? 835 THR F CG2 1 
ATOM   5097 N  N   . GLU F 2 14  ? -37.929 8.538   -55.588 1.00 59.82  ? 836 GLU F N   1 
ATOM   5098 C  CA  . GLU F 2 14  ? -38.952 9.559   -55.771 1.00 59.60  ? 836 GLU F CA  1 
ATOM   5099 C  C   . GLU F 2 14  ? -40.340 9.007   -55.468 1.00 57.78  ? 836 GLU F C   1 
ATOM   5100 O  O   . GLU F 2 14  ? -40.697 7.924   -55.925 1.00 58.21  ? 836 GLU F O   1 
ATOM   5101 C  CB  . GLU F 2 14  ? -38.900 10.097  -57.202 1.00 60.04  ? 836 GLU F CB  1 
ATOM   5102 C  CG  . GLU F 2 14  ? -39.919 11.181  -57.503 1.00 62.42  ? 836 GLU F CG  1 
ATOM   5103 C  CD  . GLU F 2 14  ? -39.755 11.760  -58.896 1.00 65.75  ? 836 GLU F CD  1 
ATOM   5104 O  OE1 . GLU F 2 14  ? -38.783 11.385  -59.588 1.00 66.02  ? 836 GLU F OE1 1 
ATOM   5105 O  OE2 . GLU F 2 14  ? -40.596 12.591  -59.298 1.00 67.95  ? 836 GLU F OE2 1 
ATOM   5106 N  N   . ALA F 2 15  ? -41.116 9.755   -54.691 1.00 23.02  ? 837 ALA F N   1 
ATOM   5107 C  CA  . ALA F 2 15  ? -42.484 9.364   -54.375 1.00 22.18  ? 837 ALA F CA  1 
ATOM   5108 C  C   . ALA F 2 15  ? -43.382 9.579   -55.586 1.00 23.59  ? 837 ALA F C   1 
ATOM   5109 O  O   . ALA F 2 15  ? -43.473 10.691  -56.110 1.00 24.82  ? 837 ALA F O   1 
ATOM   5110 C  CB  . ALA F 2 15  ? -43.000 10.152  -53.189 1.00 22.00  ? 837 ALA F CB  1 
ATOM   5111 N  N   . VAL F 2 16  ? -44.043 8.516   -56.031 1.00 28.51  ? 838 VAL F N   1 
ATOM   5112 C  CA  . VAL F 2 16  ? -44.910 8.595   -57.198 1.00 29.17  ? 838 VAL F CA  1 
ATOM   5113 C  C   . VAL F 2 16  ? -46.356 8.876   -56.793 1.00 28.91  ? 838 VAL F C   1 
ATOM   5114 O  O   . VAL F 2 16  ? -47.114 9.484   -57.548 1.00 29.68  ? 838 VAL F O   1 
ATOM   5115 C  CB  . VAL F 2 16  ? -44.832 7.316   -58.054 1.00 29.95  ? 838 VAL F CB  1 
ATOM   5116 C  CG1 . VAL F 2 16  ? -43.402 6.814   -58.109 1.00 28.71  ? 838 VAL F CG1 1 
ATOM   5117 C  CG2 . VAL F 2 16  ? -45.745 6.240   -57.499 1.00 29.17  ? 838 VAL F CG2 1 
ATOM   5118 N  N   . SER F 2 17  ? -46.727 8.435   -55.594 1.00 23.37  ? 839 SER F N   1 
ATOM   5119 C  CA  . SER F 2 17  ? -48.066 8.668   -55.066 1.00 23.22  ? 839 SER F CA  1 
ATOM   5120 C  C   . SER F 2 17  ? -48.027 8.778   -53.547 1.00 33.58  ? 839 SER F C   1 
ATOM   5121 O  O   . SER F 2 17  ? -46.993 9.099   -52.969 1.00 22.37  ? 839 SER F O   1 
ATOM   5122 C  CB  . SER F 2 17  ? -49.014 7.542   -55.481 1.00 23.45  ? 839 SER F CB  1 
ATOM   5123 O  OG  . SER F 2 17  ? -48.686 6.331   -54.821 1.00 33.35  ? 839 SER F OG  1 
ATOM   5124 N  N   . ASP F 2 18  ? -49.159 8.504   -52.908 1.00 28.07  ? 840 ASP F N   1 
ATOM   5125 C  CA  . ASP F 2 18  ? -49.258 8.560   -51.453 1.00 27.75  ? 840 ASP F CA  1 
ATOM   5126 C  C   . ASP F 2 18  ? -49.008 7.189   -50.831 1.00 26.96  ? 840 ASP F C   1 
ATOM   5127 O  O   . ASP F 2 18  ? -49.056 7.034   -49.610 1.00 26.34  ? 840 ASP F O   1 
ATOM   5128 C  CB  . ASP F 2 18  ? -50.633 9.087   -51.025 1.00 28.08  ? 840 ASP F CB  1 
ATOM   5129 C  CG  . ASP F 2 18  ? -51.769 8.159   -51.427 1.00 28.80  ? 840 ASP F CG  1 
ATOM   5130 O  OD1 . ASP F 2 18  ? -51.646 7.471   -52.463 1.00 28.33  ? 840 ASP F OD1 1 
ATOM   5131 O  OD2 . ASP F 2 18  ? -52.791 8.118   -50.708 1.00 29.20  ? 840 ASP F OD2 1 
ATOM   5132 N  N   . THR F 2 19  ? -48.735 6.201   -51.680 1.00 30.86  ? 841 THR F N   1 
ATOM   5133 C  CA  . THR F 2 19  ? -48.547 4.824   -51.235 1.00 29.72  ? 841 THR F CA  1 
ATOM   5134 C  C   . THR F 2 19  ? -47.436 4.123   -52.008 1.00 29.10  ? 841 THR F C   1 
ATOM   5135 O  O   . THR F 2 19  ? -47.159 2.947   -51.779 1.00 29.35  ? 841 THR F O   1 
ATOM   5136 C  CB  . THR F 2 19  ? -49.838 4.003   -51.415 1.00 30.69  ? 841 THR F CB  1 
ATOM   5137 O  OG1 . THR F 2 19  ? -50.225 4.022   -52.793 1.00 31.41  ? 841 THR F OG1 1 
ATOM   5138 C  CG2 . THR F 2 19  ? -50.962 4.583   -50.577 1.00 31.50  ? 841 THR F CG2 1 
ATOM   5139 N  N   . GLN F 2 20  ? -46.806 4.843   -52.928 1.00 26.22  ? 842 GLN F N   1 
ATOM   5140 C  CA  . GLN F 2 20  ? -45.809 4.240   -53.804 1.00 26.59  ? 842 GLN F CA  1 
ATOM   5141 C  C   . GLN F 2 20  ? -44.572 5.115   -53.974 1.00 27.27  ? 842 GLN F C   1 
ATOM   5142 O  O   . GLN F 2 20  ? -44.675 6.332   -54.135 1.00 27.51  ? 842 GLN F O   1 
ATOM   5143 C  CB  . GLN F 2 20  ? -46.413 3.958   -55.179 1.00 27.53  ? 842 GLN F CB  1 
ATOM   5144 C  CG  . GLN F 2 20  ? -47.673 3.120   -55.167 1.00 27.93  ? 842 GLN F CG  1 
ATOM   5145 C  CD  . GLN F 2 20  ? -48.436 3.229   -56.470 1.00 28.75  ? 842 GLN F CD  1 
ATOM   5146 O  OE1 . GLN F 2 20  ? -48.673 4.329   -56.972 1.00 29.03  ? 842 GLN F OE1 1 
ATOM   5147 N  NE2 . GLN F 2 20  ? -48.827 2.089   -57.025 1.00 29.37  ? 842 GLN F NE2 1 
ATOM   5148 N  N   . ILE F 2 21  ? -43.405 4.480   -53.951 1.00 23.27  ? 843 ILE F N   1 
ATOM   5149 C  CA  . ILE F 2 21  ? -42.138 5.162   -54.180 1.00 22.71  ? 843 ILE F CA  1 
ATOM   5150 C  C   . ILE F 2 21  ? -41.361 4.435   -55.270 1.00 23.29  ? 843 ILE F C   1 
ATOM   5151 O  O   . ILE F 2 21  ? -41.376 3.209   -55.336 1.00 24.67  ? 843 ILE F O   1 
ATOM   5152 C  CB  . ILE F 2 21  ? -41.287 5.214   -52.896 1.00 21.87  ? 843 ILE F CB  1 
ATOM   5153 C  CG1 . ILE F 2 21  ? -42.044 5.938   -51.781 1.00 21.38  ? 843 ILE F CG1 1 
ATOM   5154 C  CG2 . ILE F 2 21  ? -39.955 5.895   -53.162 1.00 22.46  ? 843 ILE F CG2 1 
ATOM   5155 C  CD1 . ILE F 2 21  ? -41.263 6.060   -50.496 1.00 20.69  ? 843 ILE F CD1 1 
ATOM   5156 N  N   . MET F 2 22  ? -40.689 5.194   -56.128 1.00 20.75  ? 844 MET F N   1 
ATOM   5157 C  CA  . MET F 2 22  ? -39.911 4.611   -57.215 1.00 21.82  ? 844 MET F CA  1 
ATOM   5158 C  C   . MET F 2 22  ? -38.422 4.848   -57.003 1.00 22.79  ? 844 MET F C   1 
ATOM   5159 O  O   . MET F 2 22  ? -38.018 5.895   -56.502 1.00 22.87  ? 844 MET F O   1 
ATOM   5160 C  CB  . MET F 2 22  ? -40.345 5.197   -58.559 1.00 22.48  ? 844 MET F CB  1 
ATOM   5161 C  CG  . MET F 2 22  ? -39.464 4.795   -59.731 1.00 24.02  ? 844 MET F CG  1 
ATOM   5162 S  SD  . MET F 2 22  ? -39.748 3.105   -60.287 1.00 26.37  ? 844 MET F SD  1 
ATOM   5163 C  CE  . MET F 2 22  ? -41.371 3.262   -61.027 1.00 25.91  ? 844 MET F CE  1 
ATOM   5164 N  N   . LEU F 2 23  ? -37.608 3.870   -57.385 1.00 30.33  ? 845 LEU F N   1 
ATOM   5165 C  CA  . LEU F 2 23  ? -36.161 4.005   -57.274 1.00 31.37  ? 845 LEU F CA  1 
ATOM   5166 C  C   . LEU F 2 23  ? -35.452 3.484   -58.517 1.00 33.33  ? 845 LEU F C   1 
ATOM   5167 O  O   . LEU F 2 23  ? -35.812 2.441   -59.063 1.00 33.43  ? 845 LEU F O   1 
ATOM   5168 C  CB  . LEU F 2 23  ? -35.636 3.298   -56.022 1.00 31.18  ? 845 LEU F CB  1 
ATOM   5169 C  CG  . LEU F 2 23  ? -35.981 1.820   -55.828 1.00 31.03  ? 845 LEU F CG  1 
ATOM   5170 C  CD1 . LEU F 2 23  ? -34.993 1.167   -54.874 1.00 30.90  ? 845 LEU F CD1 1 
ATOM   5171 C  CD2 . LEU F 2 23  ? -37.408 1.651   -55.324 1.00 29.81  ? 845 LEU F CD2 1 
ATOM   5172 N  N   . LYS F 2 24  ? -34.442 4.224   -58.961 1.00 54.11  ? 846 LYS F N   1 
ATOM   5173 C  CA  . LYS F 2 24  ? -33.667 3.844   -60.135 1.00 56.47  ? 846 LYS F CA  1 
ATOM   5174 C  C   . LYS F 2 24  ? -32.196 3.727   -59.763 1.00 57.69  ? 846 LYS F C   1 
ATOM   5175 O  O   . LYS F 2 24  ? -31.643 4.612   -59.112 1.00 56.71  ? 846 LYS F O   1 
ATOM   5176 C  CB  . LYS F 2 24  ? -33.858 4.871   -61.252 1.00 56.80  ? 846 LYS F CB  1 
ATOM   5177 C  CG  . LYS F 2 24  ? -33.301 4.452   -62.606 1.00 58.81  ? 846 LYS F CG  1 
ATOM   5178 C  CD  . LYS F 2 24  ? -31.821 4.772   -62.733 1.00 59.83  ? 846 LYS F CD  1 
ATOM   5179 C  CE  . LYS F 2 24  ? -31.362 4.688   -64.182 1.00 61.92  ? 846 LYS F CE  1 
ATOM   5180 N  NZ  . LYS F 2 24  ? -31.609 3.343   -64.775 1.00 62.18  ? 846 LYS F NZ  1 
ATOM   5181 N  N   . TRP F 2 25  ? -31.566 2.632   -60.177 1.00 48.23  ? 847 TRP F N   1 
ATOM   5182 C  CA  . TRP F 2 25  ? -30.176 2.373   -59.819 1.00 48.24  ? 847 TRP F CA  1 
ATOM   5183 C  C   . TRP F 2 25  ? -29.313 2.054   -61.031 1.00 49.79  ? 847 TRP F C   1 
ATOM   5184 O  O   . TRP F 2 25  ? -29.818 1.875   -62.138 1.00 51.14  ? 847 TRP F O   1 
ATOM   5185 C  CB  . TRP F 2 25  ? -30.092 1.221   -58.821 1.00 48.44  ? 847 TRP F CB  1 
ATOM   5186 C  CG  . TRP F 2 25  ? -30.594 -0.075  -59.369 1.00 48.69  ? 847 TRP F CG  1 
ATOM   5187 C  CD1 . TRP F 2 25  ? -29.900 -0.968  -60.132 1.00 49.42  ? 847 TRP F CD1 1 
ATOM   5188 C  CD2 . TRP F 2 25  ? -31.903 -0.628  -59.194 1.00 48.59  ? 847 TRP F CD2 1 
ATOM   5189 N  NE1 . TRP F 2 25  ? -30.696 -2.043  -60.443 1.00 49.95  ? 847 TRP F NE1 1 
ATOM   5190 C  CE2 . TRP F 2 25  ? -31.932 -1.859  -59.878 1.00 49.62  ? 847 TRP F CE2 1 
ATOM   5191 C  CE3 . TRP F 2 25  ? -33.054 -0.202  -58.522 1.00 46.79  ? 847 TRP F CE3 1 
ATOM   5192 C  CZ2 . TRP F 2 25  ? -33.066 -2.669  -59.911 1.00 49.52  ? 847 TRP F CZ2 1 
ATOM   5193 C  CZ3 . TRP F 2 25  ? -34.179 -1.007  -58.556 1.00 45.93  ? 847 TRP F CZ3 1 
ATOM   5194 C  CH2 . TRP F 2 25  ? -34.176 -2.226  -59.245 1.00 47.54  ? 847 TRP F CH2 1 
ATOM   5195 N  N   . THR F 2 26  ? -28.005 1.981   -60.807 1.00 58.71  ? 848 THR F N   1 
ATOM   5196 C  CA  . THR F 2 26  ? -27.053 1.661   -61.862 1.00 60.16  ? 848 THR F CA  1 
ATOM   5197 C  C   . THR F 2 26  ? -26.100 0.570   -61.391 1.00 60.21  ? 848 THR F C   1 
ATOM   5198 O  O   . THR F 2 26  ? -25.466 0.701   -60.343 1.00 59.34  ? 848 THR F O   1 
ATOM   5199 C  CB  . THR F 2 26  ? -26.232 2.900   -62.279 1.00 60.08  ? 848 THR F CB  1 
ATOM   5200 O  OG1 . THR F 2 26  ? -25.382 3.300   -61.197 1.00 57.56  ? 848 THR F OG1 1 
ATOM   5201 C  CG2 . THR F 2 26  ? -27.152 4.055   -62.649 1.00 60.37  ? 848 THR F CG2 1 
ATOM   5202 N  N   . TYR F 2 27  ? -26.002 -0.506  -62.165 1.00 80.04  ? 849 TYR F N   1 
ATOM   5203 C  CA  . TYR F 2 27  ? -25.138 -1.624  -61.803 1.00 81.56  ? 849 TYR F CA  1 
ATOM   5204 C  C   . TYR F 2 27  ? -23.982 -1.786  -62.789 1.00 81.95  ? 849 TYR F C   1 
ATOM   5205 O  O   . TYR F 2 27  ? -23.937 -2.746  -63.559 1.00 81.89  ? 849 TYR F O   1 
ATOM   5206 C  CB  . TYR F 2 27  ? -25.947 -2.920  -61.708 1.00 81.54  ? 849 TYR F CB  1 
ATOM   5207 C  CG  . TYR F 2 27  ? -25.189 -4.068  -61.082 1.00 82.98  ? 849 TYR F CG  1 
ATOM   5208 C  CD1 . TYR F 2 27  ? -24.805 -4.025  -59.746 1.00 81.61  ? 849 TYR F CD1 1 
ATOM   5209 C  CD2 . TYR F 2 27  ? -24.862 -5.198  -61.823 1.00 84.46  ? 849 TYR F CD2 1 
ATOM   5210 C  CE1 . TYR F 2 27  ? -24.110 -5.073  -59.168 1.00 81.71  ? 849 TYR F CE1 1 
ATOM   5211 C  CE2 . TYR F 2 27  ? -24.169 -6.250  -61.252 1.00 84.95  ? 849 TYR F CE2 1 
ATOM   5212 C  CZ  . TYR F 2 27  ? -23.796 -6.182  -59.925 1.00 84.18  ? 849 TYR F CZ  1 
ATOM   5213 O  OH  . TYR F 2 27  ? -23.106 -7.228  -59.353 1.00 84.34  ? 849 TYR F OH  1 
ATOM   5214 N  N   . ILE F 2 37  ? -26.499 -11.903 -63.045 1.00 71.24  ? 859 ILE F N   1 
ATOM   5215 C  CA  . ILE F 2 37  ? -27.202 -11.629 -61.797 1.00 70.92  ? 859 ILE F CA  1 
ATOM   5216 C  C   . ILE F 2 37  ? -28.594 -12.255 -61.812 1.00 70.11  ? 859 ILE F C   1 
ATOM   5217 O  O   . ILE F 2 37  ? -29.355 -12.073 -62.763 1.00 69.69  ? 859 ILE F O   1 
ATOM   5218 C  CB  . ILE F 2 37  ? -27.334 -10.110 -61.529 1.00 68.82  ? 859 ILE F CB  1 
ATOM   5219 C  CG1 . ILE F 2 37  ? -25.986 -9.404  -61.704 1.00 69.12  ? 859 ILE F CG1 1 
ATOM   5220 C  CG2 . ILE F 2 37  ? -27.895 -9.859  -60.135 1.00 65.83  ? 859 ILE F CG2 1 
ATOM   5221 C  CD1 . ILE F 2 37  ? -25.649 -9.058  -63.142 1.00 68.83  ? 859 ILE F CD1 1 
ATOM   5222 N  N   . GLN F 2 38  ? -28.918 -12.996 -60.756 1.00 80.06  ? 860 GLN F N   1 
ATOM   5223 C  CA  . GLN F 2 38  ? -30.228 -13.634 -60.630 1.00 79.88  ? 860 GLN F CA  1 
ATOM   5224 C  C   . GLN F 2 38  ? -31.335 -12.630 -60.302 1.00 77.67  ? 860 GLN F C   1 
ATOM   5225 O  O   . GLN F 2 38  ? -32.505 -12.863 -60.607 1.00 76.26  ? 860 GLN F O   1 
ATOM   5226 C  CB  . GLN F 2 38  ? -30.194 -14.724 -59.555 1.00 79.09  ? 860 GLN F CB  1 
ATOM   5227 C  CG  . GLN F 2 38  ? -29.389 -15.959 -59.916 1.00 79.99  ? 860 GLN F CG  1 
ATOM   5228 C  CD  . GLN F 2 38  ? -29.496 -17.028 -58.849 1.00 81.02  ? 860 GLN F CD  1 
ATOM   5229 O  OE1 . GLN F 2 38  ? -29.673 -16.723 -57.669 1.00 79.24  ? 860 GLN F OE1 1 
ATOM   5230 N  NE2 . GLN F 2 38  ? -29.393 -18.288 -59.256 1.00 79.64  ? 860 GLN F NE2 1 
ATOM   5231 N  N   . GLY F 2 39  ? -30.965 -11.523 -59.663 1.00 68.30  ? 861 GLY F N   1 
ATOM   5232 C  CA  . GLY F 2 39  ? -31.927 -10.493 -59.318 1.00 66.61  ? 861 GLY F CA  1 
ATOM   5233 C  C   . GLY F 2 39  ? -31.432 -9.485  -58.299 1.00 64.61  ? 861 GLY F C   1 
ATOM   5234 O  O   . GLY F 2 39  ? -30.247 -9.443  -57.968 1.00 64.88  ? 861 GLY F O   1 
ATOM   5235 N  N   . PHE F 2 40  ? -32.354 -8.665  -57.804 1.00 53.53  ? 862 PHE F N   1 
ATOM   5236 C  CA  . PHE F 2 40  ? -32.030 -7.662  -56.798 1.00 51.54  ? 862 PHE F CA  1 
ATOM   5237 C  C   . PHE F 2 40  ? -32.950 -7.764  -55.593 1.00 50.59  ? 862 PHE F C   1 
ATOM   5238 O  O   . PHE F 2 40  ? -34.106 -8.183  -55.702 1.00 50.42  ? 862 PHE F O   1 
ATOM   5239 C  CB  . PHE F 2 40  ? -32.122 -6.250  -57.378 1.00 50.65  ? 862 PHE F CB  1 
ATOM   5240 C  CG  . PHE F 2 40  ? -31.258 -6.033  -58.580 1.00 52.60  ? 862 PHE F CG  1 
ATOM   5241 C  CD1 . PHE F 2 40  ? -31.778 -6.175  -59.854 1.00 53.30  ? 862 PHE F CD1 1 
ATOM   5242 C  CD2 . PHE F 2 40  ? -29.925 -5.687  -58.439 1.00 52.82  ? 862 PHE F CD2 1 
ATOM   5243 C  CE1 . PHE F 2 40  ? -30.988 -5.975  -60.966 1.00 54.66  ? 862 PHE F CE1 1 
ATOM   5244 C  CE2 . PHE F 2 40  ? -29.126 -5.487  -59.549 1.00 54.09  ? 862 PHE F CE2 1 
ATOM   5245 C  CZ  . PHE F 2 40  ? -29.660 -5.630  -60.815 1.00 55.23  ? 862 PHE F CZ  1 
ATOM   5246 N  N   . TYR F 2 41  ? -32.412 -7.378  -54.443 1.00 52.88  ? 863 TYR F N   1 
ATOM   5247 C  CA  . TYR F 2 41  ? -33.172 -7.286  -53.209 1.00 50.28  ? 863 TYR F CA  1 
ATOM   5248 C  C   . TYR F 2 41  ? -33.364 -5.818  -52.863 1.00 47.69  ? 863 TYR F C   1 
ATOM   5249 O  O   . TYR F 2 41  ? -32.395 -5.063  -52.776 1.00 47.55  ? 863 TYR F O   1 
ATOM   5250 C  CB  . TYR F 2 41  ? -32.427 -7.981  -52.072 1.00 49.93  ? 863 TYR F CB  1 
ATOM   5251 C  CG  . TYR F 2 41  ? -32.440 -9.489  -52.144 1.00 50.60  ? 863 TYR F CG  1 
ATOM   5252 C  CD1 . TYR F 2 41  ? -31.275 -10.221 -51.966 1.00 51.78  ? 863 TYR F CD1 1 
ATOM   5253 C  CD2 . TYR F 2 41  ? -33.617 -10.181 -52.390 1.00 51.83  ? 863 TYR F CD2 1 
ATOM   5254 C  CE1 . TYR F 2 41  ? -31.282 -11.600 -52.023 1.00 53.81  ? 863 TYR F CE1 1 
ATOM   5255 C  CE2 . TYR F 2 41  ? -33.635 -11.560 -52.450 1.00 53.40  ? 863 TYR F CE2 1 
ATOM   5256 C  CZ  . TYR F 2 41  ? -32.463 -12.264 -52.266 1.00 54.58  ? 863 TYR F CZ  1 
ATOM   5257 O  OH  . TYR F 2 41  ? -32.471 -13.638 -52.327 1.00 56.39  ? 863 TYR F OH  1 
ATOM   5258 N  N   . ILE F 2 42  ? -34.614 -5.415  -52.670 1.00 27.70  ? 864 ILE F N   1 
ATOM   5259 C  CA  . ILE F 2 42  ? -34.913 -4.043  -52.281 1.00 26.21  ? 864 ILE F CA  1 
ATOM   5260 C  C   . ILE F 2 42  ? -35.513 -3.992  -50.880 1.00 24.70  ? 864 ILE F C   1 
ATOM   5261 O  O   . ILE F 2 42  ? -36.632 -4.451  -50.652 1.00 24.89  ? 864 ILE F O   1 
ATOM   5262 C  CB  . ILE F 2 42  ? -35.859 -3.354  -53.281 1.00 26.46  ? 864 ILE F CB  1 
ATOM   5263 C  CG1 . ILE F 2 42  ? -35.108 -2.993  -54.566 1.00 27.25  ? 864 ILE F CG1 1 
ATOM   5264 C  CG2 . ILE F 2 42  ? -36.460 -2.104  -52.664 1.00 24.91  ? 864 ILE F CG2 1 
ATOM   5265 C  CD1 . ILE F 2 42  ? -34.849 -4.164  -55.487 1.00 29.49  ? 864 ILE F CD1 1 
ATOM   5266 N  N   . TYR F 2 43  ? -34.757 -3.434  -49.942 1.00 31.94  ? 865 TYR F N   1 
ATOM   5267 C  CA  . TYR F 2 43  ? -35.196 -3.365  -48.556 1.00 30.43  ? 865 TYR F CA  1 
ATOM   5268 C  C   . TYR F 2 43  ? -35.746 -1.991  -48.199 1.00 29.38  ? 865 TYR F C   1 
ATOM   5269 O  O   . TYR F 2 43  ? -35.160 -0.964  -48.545 1.00 29.12  ? 865 TYR F O   1 
ATOM   5270 C  CB  . TYR F 2 43  ? -34.051 -3.732  -47.612 1.00 29.88  ? 865 TYR F CB  1 
ATOM   5271 C  CG  . TYR F 2 43  ? -33.471 -5.103  -47.860 1.00 31.44  ? 865 TYR F CG  1 
ATOM   5272 C  CD1 . TYR F 2 43  ? -33.953 -6.215  -47.183 1.00 31.31  ? 865 TYR F CD1 1 
ATOM   5273 C  CD2 . TYR F 2 43  ? -32.440 -5.284  -48.773 1.00 33.37  ? 865 TYR F CD2 1 
ATOM   5274 C  CE1 . TYR F 2 43  ? -33.423 -7.471  -47.408 1.00 32.84  ? 865 TYR F CE1 1 
ATOM   5275 C  CE2 . TYR F 2 43  ? -31.905 -6.536  -49.004 1.00 34.54  ? 865 TYR F CE2 1 
ATOM   5276 C  CZ  . TYR F 2 43  ? -32.400 -7.625  -48.322 1.00 34.75  ? 865 TYR F CZ  1 
ATOM   5277 O  OH  . TYR F 2 43  ? -31.867 -8.874  -48.551 1.00 35.46  ? 865 TYR F OH  1 
ATOM   5278 N  N   . TYR F 2 44  ? -36.879 -1.980  -47.507 1.00 16.75  ? 866 TYR F N   1 
ATOM   5279 C  CA  . TYR F 2 44  ? -37.478 -0.733  -47.053 1.00 16.02  ? 866 TYR F CA  1 
ATOM   5280 C  C   . TYR F 2 44  ? -38.002 -0.846  -45.626 1.00 26.35  ? 866 TYR F C   1 
ATOM   5281 O  O   . TYR F 2 44  ? -38.510 -1.889  -45.216 1.00 26.22  ? 866 TYR F O   1 
ATOM   5282 C  CB  . TYR F 2 44  ? -38.575 -0.265  -48.015 1.00 16.96  ? 866 TYR F CB  1 
ATOM   5283 C  CG  . TYR F 2 44  ? -39.541 -1.346  -48.446 1.00 17.40  ? 866 TYR F CG  1 
ATOM   5284 C  CD1 . TYR F 2 44  ? -40.800 -1.447  -47.871 1.00 27.63  ? 866 TYR F CD1 1 
ATOM   5285 C  CD2 . TYR F 2 44  ? -39.198 -2.256  -49.436 1.00 18.22  ? 866 TYR F CD2 1 
ATOM   5286 C  CE1 . TYR F 2 44  ? -41.687 -2.428  -48.264 1.00 17.34  ? 866 TYR F CE1 1 
ATOM   5287 C  CE2 . TYR F 2 44  ? -40.077 -3.241  -49.836 1.00 19.31  ? 866 TYR F CE2 1 
ATOM   5288 C  CZ  . TYR F 2 44  ? -41.322 -3.322  -49.246 1.00 18.62  ? 866 TYR F CZ  1 
ATOM   5289 O  OH  . TYR F 2 44  ? -42.204 -4.300  -49.641 1.00 20.65  ? 866 TYR F OH  1 
ATOM   5290 N  N   . ARG F 2 45  ? -37.870 0.240   -44.875 1.00 16.03  ? 867 ARG F N   1 
ATOM   5291 C  CA  . ARG F 2 45  ? -38.196 0.240   -43.456 1.00 28.31  ? 867 ARG F CA  1 
ATOM   5292 C  C   . ARG F 2 45  ? -38.643 1.630   -43.020 1.00 27.99  ? 867 ARG F C   1 
ATOM   5293 O  O   . ARG F 2 45  ? -38.203 2.629   -43.584 1.00 28.55  ? 867 ARG F O   1 
ATOM   5294 C  CB  . ARG F 2 45  ? -36.968 -0.192  -42.648 1.00 27.34  ? 867 ARG F CB  1 
ATOM   5295 C  CG  . ARG F 2 45  ? -37.073 0.045   -41.155 1.00 26.52  ? 867 ARG F CG  1 
ATOM   5296 C  CD  . ARG F 2 45  ? -35.724 -0.101  -40.474 1.00 26.56  ? 867 ARG F CD  1 
ATOM   5297 N  NE  . ARG F 2 45  ? -34.793 0.954   -40.865 1.00 26.50  ? 867 ARG F NE  1 
ATOM   5298 C  CZ  . ARG F 2 45  ? -33.562 1.079   -40.380 1.00 25.91  ? 867 ARG F CZ  1 
ATOM   5299 N  NH1 . ARG F 2 45  ? -33.111 0.216   -39.483 1.00 25.71  ? 867 ARG F NH1 1 
ATOM   5300 N  NH2 . ARG F 2 45  ? -32.781 2.066   -40.790 1.00 25.65  ? 867 ARG F NH2 1 
ATOM   5301 N  N   . PRO F 2 46  ? -39.530 1.699   -42.018 1.00 24.78  ? 868 PRO F N   1 
ATOM   5302 C  CA  . PRO F 2 46  ? -39.899 2.997   -41.449 1.00 25.36  ? 868 PRO F CA  1 
ATOM   5303 C  C   . PRO F 2 46  ? -38.658 3.767   -41.021 1.00 25.27  ? 868 PRO F C   1 
ATOM   5304 O  O   . PRO F 2 46  ? -37.815 3.220   -40.309 1.00 24.82  ? 868 PRO F O   1 
ATOM   5305 C  CB  . PRO F 2 46  ? -40.715 2.613   -40.213 1.00 24.13  ? 868 PRO F CB  1 
ATOM   5306 C  CG  . PRO F 2 46  ? -41.280 1.286   -40.533 1.00 23.66  ? 868 PRO F CG  1 
ATOM   5307 C  CD  . PRO F 2 46  ? -40.274 0.588   -41.399 1.00 24.74  ? 868 PRO F CD  1 
ATOM   5308 N  N   . THR F 2 47  ? -38.543 5.019   -41.449 1.00 22.18  ? 869 THR F N   1 
ATOM   5309 C  CA  . THR F 2 47  ? -37.419 5.849   -41.036 1.00 22.15  ? 869 THR F CA  1 
ATOM   5310 C  C   . THR F 2 47  ? -37.442 6.013   -39.521 1.00 21.62  ? 869 THR F C   1 
ATOM   5311 O  O   . THR F 2 47  ? -36.454 6.421   -38.914 1.00 21.58  ? 869 THR F O   1 
ATOM   5312 C  CB  . THR F 2 47  ? -37.451 7.235   -41.712 1.00 22.75  ? 869 THR F CB  1 
ATOM   5313 O  OG1 . THR F 2 47  ? -37.544 7.077   -43.133 1.00 23.40  ? 869 THR F OG1 1 
ATOM   5314 C  CG2 . THR F 2 47  ? -36.190 8.017   -41.381 1.00 21.84  ? 869 THR F CG2 1 
ATOM   5315 N  N   . ASP F 2 48  ? -38.581 5.684   -38.918 1.00 30.49  ? 870 ASP F N   1 
ATOM   5316 C  CA  . ASP F 2 48  ? -38.746 5.775   -37.473 1.00 29.46  ? 870 ASP F CA  1 
ATOM   5317 C  C   . ASP F 2 48  ? -38.015 4.655   -36.749 1.00 28.75  ? 870 ASP F C   1 
ATOM   5318 O  O   . ASP F 2 48  ? -37.692 4.775   -35.568 1.00 28.37  ? 870 ASP F O   1 
ATOM   5319 C  CB  . ASP F 2 48  ? -40.227 5.743   -37.100 1.00 30.05  ? 870 ASP F CB  1 
ATOM   5320 C  CG  . ASP F 2 48  ? -40.920 7.056   -37.369 1.00 32.09  ? 870 ASP F CG  1 
ATOM   5321 O  OD1 . ASP F 2 48  ? -40.415 7.837   -38.204 1.00 32.56  ? 870 ASP F OD1 1 
ATOM   5322 O  OD2 . ASP F 2 48  ? -41.970 7.306   -36.742 1.00 33.22  ? 870 ASP F OD2 1 
ATOM   5323 N  N   . SER F 2 49  ? -37.761 3.563   -37.459 1.00 25.61  ? 871 SER F N   1 
ATOM   5324 C  CA  . SER F 2 49  ? -37.076 2.424   -36.866 1.00 25.40  ? 871 SER F CA  1 
ATOM   5325 C  C   . SER F 2 49  ? -35.571 2.499   -37.094 1.00 25.56  ? 871 SER F C   1 
ATOM   5326 O  O   . SER F 2 49  ? -35.114 2.704   -38.217 1.00 25.93  ? 871 SER F O   1 
ATOM   5327 C  CB  . SER F 2 49  ? -37.625 1.115   -37.429 1.00 25.67  ? 871 SER F CB  1 
ATOM   5328 O  OG  . SER F 2 49  ? -36.987 0.001   -36.831 1.00 26.47  ? 871 SER F OG  1 
ATOM   5329 N  N   . ASP F 2 50  ? -34.807 2.334   -36.020 1.00 32.29  ? 872 ASP F N   1 
ATOM   5330 C  CA  . ASP F 2 50  ? -33.353 2.310   -36.114 1.00 31.90  ? 872 ASP F CA  1 
ATOM   5331 C  C   . ASP F 2 50  ? -32.840 0.883   -35.991 1.00 32.52  ? 872 ASP F C   1 
ATOM   5332 O  O   . ASP F 2 50  ? -31.686 0.656   -35.628 1.00 33.10  ? 872 ASP F O   1 
ATOM   5333 C  CB  . ASP F 2 50  ? -32.725 3.186   -35.034 1.00 32.02  ? 872 ASP F CB  1 
ATOM   5334 C  CG  . ASP F 2 50  ? -33.083 4.646   -35.195 1.00 32.46  ? 872 ASP F CG  1 
ATOM   5335 O  OD1 . ASP F 2 50  ? -32.736 5.444   -34.297 1.00 32.39  ? 872 ASP F OD1 1 
ATOM   5336 O  OD2 . ASP F 2 50  ? -33.712 4.994   -36.217 1.00 32.38  ? 872 ASP F OD2 1 
ATOM   5337 N  N   . ASN F 2 51  ? -33.710 -0.076  -36.289 1.00 34.80  ? 873 ASN F N   1 
ATOM   5338 C  CA  . ASN F 2 51  ? -33.338 -1.482  -36.264 1.00 34.24  ? 873 ASN F CA  1 
ATOM   5339 C  C   . ASN F 2 51  ? -33.265 -2.051  -37.674 1.00 34.72  ? 873 ASN F C   1 
ATOM   5340 O  O   . ASN F 2 51  ? -34.214 -1.934  -38.445 1.00 35.40  ? 873 ASN F O   1 
ATOM   5341 C  CB  . ASN F 2 51  ? -34.332 -2.286  -35.429 1.00 34.54  ? 873 ASN F CB  1 
ATOM   5342 C  CG  . ASN F 2 51  ? -33.864 -3.704  -35.182 1.00 36.66  ? 873 ASN F CG  1 
ATOM   5343 O  OD1 . ASN F 2 51  ? -34.521 -4.664  -35.582 1.00 37.66  ? 873 ASN F OD1 1 
ATOM   5344 N  ND2 . ASN F 2 51  ? -32.715 -3.843  -34.531 1.00 37.53  ? 873 ASN F ND2 1 
ATOM   5345 N  N   . ASP F 2 52  ? -32.137 -2.668  -38.004 1.00 26.11  ? 874 ASP F N   1 
ATOM   5346 C  CA  . ASP F 2 52  ? -31.924 -3.192  -39.348 1.00 26.37  ? 874 ASP F CA  1 
ATOM   5347 C  C   . ASP F 2 52  ? -32.709 -4.477  -39.606 1.00 26.98  ? 874 ASP F C   1 
ATOM   5348 O  O   . ASP F 2 52  ? -32.753 -4.966  -40.734 1.00 28.34  ? 874 ASP F O   1 
ATOM   5349 C  CB  . ASP F 2 52  ? -30.431 -3.412  -39.611 1.00 25.67  ? 874 ASP F CB  1 
ATOM   5350 C  CG  . ASP F 2 52  ? -29.666 -2.108  -39.763 1.00 25.84  ? 874 ASP F CG  1 
ATOM   5351 O  OD1 . ASP F 2 52  ? -30.307 -1.064  -39.999 1.00 26.42  ? 874 ASP F OD1 1 
ATOM   5352 O  OD2 . ASP F 2 52  ? -28.423 -2.126  -39.650 1.00 25.80  ? 874 ASP F OD2 1 
ATOM   5353 N  N   . SER F 2 53  ? -33.331 -5.018  -38.564 1.00 28.43  ? 875 SER F N   1 
ATOM   5354 C  CA  . SER F 2 53  ? -34.128 -6.232  -38.708 1.00 28.83  ? 875 SER F CA  1 
ATOM   5355 C  C   . SER F 2 53  ? -35.544 -5.911  -39.173 1.00 29.61  ? 875 SER F C   1 
ATOM   5356 O  O   . SER F 2 53  ? -36.316 -6.811  -39.504 1.00 30.03  ? 875 SER F O   1 
ATOM   5357 C  CB  . SER F 2 53  ? -34.183 -7.003  -37.387 1.00 29.60  ? 875 SER F CB  1 
ATOM   5358 O  OG  . SER F 2 53  ? -32.884 -7.335  -36.927 1.00 30.97  ? 875 SER F OG  1 
ATOM   5359 N  N   . ASP F 2 54  ? -35.879 -4.625  -39.192 1.00 28.33  ? 876 ASP F N   1 
ATOM   5360 C  CA  . ASP F 2 54  ? -37.222 -4.183  -39.550 1.00 27.79  ? 876 ASP F CA  1 
ATOM   5361 C  C   . ASP F 2 54  ? -37.327 -3.809  -41.026 1.00 28.73  ? 876 ASP F C   1 
ATOM   5362 O  O   . ASP F 2 54  ? -38.153 -2.978  -41.404 1.00 29.23  ? 876 ASP F O   1 
ATOM   5363 C  CB  . ASP F 2 54  ? -37.646 -2.997  -38.681 1.00 27.01  ? 876 ASP F CB  1 
ATOM   5364 C  CG  . ASP F 2 54  ? -37.778 -3.364  -37.216 1.00 27.70  ? 876 ASP F CG  1 
ATOM   5365 O  OD1 . ASP F 2 54  ? -37.902 -4.569  -36.913 1.00 27.94  ? 876 ASP F OD1 1 
ATOM   5366 O  OD2 . ASP F 2 54  ? -37.762 -2.449  -36.368 1.00 26.86  ? 876 ASP F OD2 1 
ATOM   5367 N  N   . TYR F 2 55  ? -36.489 -4.424  -41.856 1.00 31.53  ? 877 TYR F N   1 
ATOM   5368 C  CA  . TYR F 2 55  ? -36.511 -4.168  -43.293 1.00 32.33  ? 877 TYR F CA  1 
ATOM   5369 C  C   . TYR F 2 55  ? -37.347 -5.205  -44.037 1.00 33.34  ? 877 TYR F C   1 
ATOM   5370 O  O   . TYR F 2 55  ? -37.137 -6.407  -43.884 1.00 34.18  ? 877 TYR F O   1 
ATOM   5371 C  CB  . TYR F 2 55  ? -35.092 -4.162  -43.864 1.00 32.39  ? 877 TYR F CB  1 
ATOM   5372 C  CG  . TYR F 2 55  ? -34.369 -2.836  -43.768 1.00 32.57  ? 877 TYR F CG  1 
ATOM   5373 C  CD1 . TYR F 2 55  ? -33.576 -2.531  -42.668 1.00 31.40  ? 877 TYR F CD1 1 
ATOM   5374 C  CD2 . TYR F 2 55  ? -34.464 -1.895  -44.786 1.00 33.25  ? 877 TYR F CD2 1 
ATOM   5375 C  CE1 . TYR F 2 55  ? -32.906 -1.324  -42.581 1.00 31.67  ? 877 TYR F CE1 1 
ATOM   5376 C  CE2 . TYR F 2 55  ? -33.798 -0.683  -44.709 1.00 32.54  ? 877 TYR F CE2 1 
ATOM   5377 C  CZ  . TYR F 2 55  ? -33.021 -0.403  -43.604 1.00 32.54  ? 877 TYR F CZ  1 
ATOM   5378 O  OH  . TYR F 2 55  ? -32.356 0.798   -43.518 1.00 32.38  ? 877 TYR F OH  1 
ATOM   5379 N  N   . LYS F 2 56  ? -38.293 -4.737  -44.843 1.00 28.11  ? 878 LYS F N   1 
ATOM   5380 C  CA  . LYS F 2 56  ? -39.009 -5.618  -45.752 1.00 28.85  ? 878 LYS F CA  1 
ATOM   5381 C  C   . LYS F 2 56  ? -38.136 -5.878  -46.975 1.00 31.12  ? 878 LYS F C   1 
ATOM   5382 O  O   . LYS F 2 56  ? -37.135 -5.194  -47.182 1.00 30.89  ? 878 LYS F O   1 
ATOM   5383 C  CB  . LYS F 2 56  ? -40.342 -5.002  -46.176 1.00 29.08  ? 878 LYS F CB  1 
ATOM   5384 C  CG  . LYS F 2 56  ? -41.475 -5.218  -45.192 1.00 27.44  ? 878 LYS F CG  1 
ATOM   5385 C  CD  . LYS F 2 56  ? -42.817 -5.013  -45.872 1.00 28.95  ? 878 LYS F CD  1 
ATOM   5386 C  CE  . LYS F 2 56  ? -43.970 -5.372  -44.950 1.00 31.29  ? 878 LYS F CE  1 
ATOM   5387 N  NZ  . LYS F 2 56  ? -45.294 -5.119  -45.587 1.00 30.48  ? 878 LYS F NZ  1 
ATOM   5388 N  N   . ARG F 2 57  ? -38.508 -6.865  -47.781 1.00 42.01  ? 879 ARG F N   1 
ATOM   5389 C  CA  . ARG F 2 57  ? -37.725 -7.187  -48.966 1.00 43.44  ? 879 ARG F CA  1 
ATOM   5390 C  C   . ARG F 2 57  ? -38.603 -7.455  -50.179 1.00 44.90  ? 879 ARG F C   1 
ATOM   5391 O  O   . ARG F 2 57  ? -39.587 -8.188  -50.097 1.00 46.35  ? 879 ARG F O   1 
ATOM   5392 C  CB  . ARG F 2 57  ? -36.809 -8.388  -48.703 1.00 44.52  ? 879 ARG F CB  1 
ATOM   5393 C  CG  . ARG F 2 57  ? -35.835 -8.667  -49.836 1.00 45.95  ? 879 ARG F CG  1 
ATOM   5394 C  CD  . ARG F 2 57  ? -34.751 -9.655  -49.433 1.00 47.33  ? 879 ARG F CD  1 
ATOM   5395 N  NE  . ARG F 2 57  ? -35.197 -11.043 -49.505 1.00 50.01  ? 879 ARG F NE  1 
ATOM   5396 C  CZ  . ARG F 2 57  ? -35.246 -11.871 -48.466 1.00 49.43  ? 879 ARG F CZ  1 
ATOM   5397 N  NH1 . ARG F 2 57  ? -34.869 -11.455 -47.263 1.00 47.08  ? 879 ARG F NH1 1 
ATOM   5398 N  NH2 . ARG F 2 57  ? -35.665 -13.117 -48.632 1.00 49.79  ? 879 ARG F NH2 1 
ATOM   5399 N  N   . ASP F 2 58  ? -38.242 -6.850  -51.303 1.00 31.72  ? 880 ASP F N   1 
ATOM   5400 C  CA  . ASP F 2 58  ? -38.916 -7.114  -52.566 1.00 33.55  ? 880 ASP F CA  1 
ATOM   5401 C  C   . ASP F 2 58  ? -37.910 -7.664  -53.568 1.00 36.35  ? 880 ASP F C   1 
ATOM   5402 O  O   . ASP F 2 58  ? -36.793 -7.156  -53.678 1.00 36.21  ? 880 ASP F O   1 
ATOM   5403 C  CB  . ASP F 2 58  ? -39.580 -5.844  -53.104 1.00 32.56  ? 880 ASP F CB  1 
ATOM   5404 C  CG  . ASP F 2 58  ? -40.824 -5.457  -52.321 1.00 31.11  ? 880 ASP F CG  1 
ATOM   5405 O  OD1 . ASP F 2 58  ? -41.101 -6.094  -51.285 1.00 29.94  ? 880 ASP F OD1 1 
ATOM   5406 O  OD2 . ASP F 2 58  ? -41.527 -4.517  -52.746 1.00 30.92  ? 880 ASP F OD2 1 
ATOM   5407 N  N   . VAL F 2 59  ? -38.309 -8.699  -54.299 1.00 56.71  ? 881 VAL F N   1 
ATOM   5408 C  CA  . VAL F 2 59  ? -37.429 -9.324  -55.280 1.00 58.50  ? 881 VAL F CA  1 
ATOM   5409 C  C   . VAL F 2 59  ? -37.905 -9.080  -56.709 1.00 60.06  ? 881 VAL F C   1 
ATOM   5410 O  O   . VAL F 2 59  ? -38.912 -9.640  -57.142 1.00 60.03  ? 881 VAL F O   1 
ATOM   5411 C  CB  . VAL F 2 59  ? -37.309 -10.842 -55.044 1.00 58.92  ? 881 VAL F CB  1 
ATOM   5412 C  CG1 . VAL F 2 59  ? -36.075 -11.391 -55.744 1.00 59.53  ? 881 VAL F CG1 1 
ATOM   5413 C  CG2 . VAL F 2 59  ? -37.264 -11.144 -53.554 1.00 56.46  ? 881 VAL F CG2 1 
ATOM   5414 N  N   . VAL F 2 60  ? -37.173 -8.242  -57.437 1.00 88.14  ? 882 VAL F N   1 
ATOM   5415 C  CA  . VAL F 2 60  ? -37.496 -7.951  -58.828 1.00 90.48  ? 882 VAL F CA  1 
ATOM   5416 C  C   . VAL F 2 60  ? -36.948 -9.044  -59.739 1.00 91.85  ? 882 VAL F C   1 
ATOM   5417 O  O   . VAL F 2 60  ? -37.153 -10.231 -59.488 1.00 91.25  ? 882 VAL F O   1 
ATOM   5418 C  CB  . VAL F 2 60  ? -36.926 -6.591  -59.269 1.00 89.63  ? 882 VAL F CB  1 
ATOM   5419 C  CG1 . VAL F 2 60  ? -37.171 -6.369  -60.754 1.00 87.74  ? 882 VAL F CG1 1 
ATOM   5420 C  CG2 . VAL F 2 60  ? -37.539 -5.468  -58.447 1.00 89.26  ? 882 VAL F CG2 1 
ATOM   5421 N  N   . GLU F 2 61  ? -36.252 -8.636  -60.795 1.00 91.73  ? 883 GLU F N   1 
ATOM   5422 C  CA  . GLU F 2 61  ? -35.673 -9.581  -61.743 1.00 91.69  ? 883 GLU F CA  1 
ATOM   5423 C  C   . GLU F 2 61  ? -34.150 -9.535  -61.707 1.00 92.36  ? 883 GLU F C   1 
ATOM   5424 O  O   . GLU F 2 61  ? -33.544 -9.545  -60.636 1.00 92.23  ? 883 GLU F O   1 
ATOM   5425 C  CB  . GLU F 2 61  ? -36.175 -9.293  -63.160 1.00 93.66  ? 883 GLU F CB  1 
ATOM   5426 C  CG  . GLU F 2 61  ? -36.343 -10.534 -64.022 1.00 95.37  ? 883 GLU F CG  1 
ATOM   5427 C  CD  . GLU F 2 61  ? -37.561 -10.458 -64.921 1.00 99.61  ? 883 GLU F CD  1 
ATOM   5428 O  OE1 . GLU F 2 61  ? -38.667 -10.808 -64.457 1.00 100.88 ? 883 GLU F OE1 1 
ATOM   5429 O  OE2 . GLU F 2 61  ? -37.413 -10.048 -66.092 1.00 98.29  ? 883 GLU F OE2 1 
ATOM   5430 N  N   . GLY F 2 62  ? -33.536 -9.483  -62.885 1.00 80.39  ? 884 GLY F N   1 
ATOM   5431 C  CA  . GLY F 2 62  ? -32.090 -9.436  -62.990 1.00 80.58  ? 884 GLY F CA  1 
ATOM   5432 C  C   . GLY F 2 62  ? -31.615 -8.412  -64.002 1.00 80.92  ? 884 GLY F C   1 
ATOM   5433 O  O   . GLY F 2 62  ? -30.445 -8.028  -64.009 1.00 80.56  ? 884 GLY F O   1 
ATOM   5434 N  N   . SER F 2 63  ? -32.528 -7.967  -64.859 1.00 75.07  ? 885 SER F N   1 
ATOM   5435 C  CA  . SER F 2 63  ? -32.204 -6.978  -65.880 1.00 75.49  ? 885 SER F CA  1 
ATOM   5436 C  C   . SER F 2 63  ? -32.895 -5.649  -65.597 1.00 74.03  ? 885 SER F C   1 
ATOM   5437 O  O   . SER F 2 63  ? -32.621 -4.644  -66.252 1.00 73.43  ? 885 SER F O   1 
ATOM   5438 C  CB  . SER F 2 63  ? -32.597 -7.491  -67.267 1.00 76.87  ? 885 SER F CB  1 
ATOM   5439 O  OG  . SER F 2 63  ? -33.604 -6.678  -67.845 1.00 76.18  ? 885 SER F OG  1 
ATOM   5440 N  N   . LYS F 2 64  ? -33.793 -5.653  -64.617 1.00 72.58  ? 886 LYS F N   1 
ATOM   5441 C  CA  . LYS F 2 64  ? -34.524 -4.448  -64.243 1.00 70.55  ? 886 LYS F CA  1 
ATOM   5442 C  C   . LYS F 2 64  ? -33.624 -3.465  -63.502 1.00 68.76  ? 886 LYS F C   1 
ATOM   5443 O  O   . LYS F 2 64  ? -32.887 -3.847  -62.593 1.00 68.96  ? 886 LYS F O   1 
ATOM   5444 C  CB  . LYS F 2 64  ? -35.737 -4.804  -63.380 1.00 68.48  ? 886 LYS F CB  1 
ATOM   5445 C  CG  . LYS F 2 64  ? -36.896 -3.829  -63.507 1.00 64.64  ? 886 LYS F CG  1 
ATOM   5446 C  CD  . LYS F 2 64  ? -37.897 -4.012  -62.378 1.00 65.02  ? 886 LYS F CD  1 
ATOM   5447 C  CE  . LYS F 2 64  ? -39.200 -4.609  -62.885 1.00 64.49  ? 886 LYS F CE  1 
ATOM   5448 N  NZ  . LYS F 2 64  ? -39.886 -3.706  -63.850 1.00 63.08  ? 886 LYS F NZ  1 
ATOM   5449 N  N   . GLN F 2 65  ? -33.689 -2.198  -63.897 1.00 59.47  ? 887 GLN F N   1 
ATOM   5450 C  CA  . GLN F 2 65  ? -32.879 -1.159  -63.273 1.00 57.70  ? 887 GLN F CA  1 
ATOM   5451 C  C   . GLN F 2 65  ? -33.743 -0.195  -62.466 1.00 55.92  ? 887 GLN F C   1 
ATOM   5452 O  O   . GLN F 2 65  ? -33.276 0.861   -62.036 1.00 55.79  ? 887 GLN F O   1 
ATOM   5453 C  CB  . GLN F 2 65  ? -32.083 -0.392  -64.330 1.00 58.76  ? 887 GLN F CB  1 
ATOM   5454 C  CG  . GLN F 2 65  ? -30.921 -1.174  -64.921 1.00 60.07  ? 887 GLN F CG  1 
ATOM   5455 C  CD  . GLN F 2 65  ? -29.745 -0.288  -65.282 1.00 60.16  ? 887 GLN F CD  1 
ATOM   5456 O  OE1 . GLN F 2 65  ? -29.904 0.911   -65.508 1.00 59.37  ? 887 GLN F OE1 1 
ATOM   5457 N  NE2 . GLN F 2 65  ? -28.556 -0.877  -65.336 1.00 61.95  ? 887 GLN F NE2 1 
ATOM   5458 N  N   . TRP F 2 66  ? -35.003 -0.564  -62.263 1.00 40.77  ? 888 TRP F N   1 
ATOM   5459 C  CA  . TRP F 2 66  ? -35.930 0.266   -61.509 1.00 39.10  ? 888 TRP F CA  1 
ATOM   5460 C  C   . TRP F 2 66  ? -36.946 -0.606  -60.778 1.00 37.41  ? 888 TRP F C   1 
ATOM   5461 O  O   . TRP F 2 66  ? -37.129 -1.776  -61.114 1.00 37.51  ? 888 TRP F O   1 
ATOM   5462 C  CB  . TRP F 2 66  ? -36.635 1.257   -62.435 1.00 38.60  ? 888 TRP F CB  1 
ATOM   5463 C  CG  . TRP F 2 66  ? -37.403 0.597   -63.529 1.00 38.74  ? 888 TRP F CG  1 
ATOM   5464 C  CD1 . TRP F 2 66  ? -36.999 0.405   -64.818 1.00 39.11  ? 888 TRP F CD1 1 
ATOM   5465 C  CD2 . TRP F 2 66  ? -38.713 0.028   -63.429 1.00 38.82  ? 888 TRP F CD2 1 
ATOM   5466 N  NE1 . TRP F 2 66  ? -37.978 -0.245  -65.527 1.00 39.12  ? 888 TRP F NE1 1 
ATOM   5467 C  CE2 . TRP F 2 66  ? -39.041 -0.489  -64.697 1.00 39.05  ? 888 TRP F CE2 1 
ATOM   5468 C  CE3 . TRP F 2 66  ? -39.641 -0.093  -62.388 1.00 38.41  ? 888 TRP F CE3 1 
ATOM   5469 C  CZ2 . TRP F 2 66  ? -40.258 -1.116  -64.954 1.00 38.80  ? 888 TRP F CZ2 1 
ATOM   5470 C  CZ3 . TRP F 2 66  ? -40.847 -0.716  -62.645 1.00 38.35  ? 888 TRP F CZ3 1 
ATOM   5471 C  CH2 . TRP F 2 66  ? -41.146 -1.218  -63.917 1.00 38.59  ? 888 TRP F CH2 1 
ATOM   5472 N  N   . HIS F 2 67  ? -37.601 -0.031  -59.776 1.00 27.56  ? 889 HIS F N   1 
ATOM   5473 C  CA  . HIS F 2 67  ? -38.559 -0.776  -58.973 1.00 26.13  ? 889 HIS F CA  1 
ATOM   5474 C  C   . HIS F 2 67  ? -39.597 0.138   -58.333 1.00 25.22  ? 889 HIS F C   1 
ATOM   5475 O  O   . HIS F 2 67  ? -39.271 1.201   -57.808 1.00 24.56  ? 889 HIS F O   1 
ATOM   5476 C  CB  . HIS F 2 67  ? -37.840 -1.587  -57.893 1.00 25.71  ? 889 HIS F CB  1 
ATOM   5477 C  CG  . HIS F 2 67  ? -38.762 -2.383  -57.026 1.00 24.74  ? 889 HIS F CG  1 
ATOM   5478 N  ND1 . HIS F 2 67  ? -39.389 -3.530  -57.463 1.00 25.66  ? 889 HIS F ND1 1 
ATOM   5479 C  CD2 . HIS F 2 67  ? -39.167 -2.198  -55.747 1.00 24.24  ? 889 HIS F CD2 1 
ATOM   5480 C  CE1 . HIS F 2 67  ? -40.139 -4.018  -56.492 1.00 25.09  ? 889 HIS F CE1 1 
ATOM   5481 N  NE2 . HIS F 2 67  ? -40.022 -3.229  -55.439 1.00 24.30  ? 889 HIS F NE2 1 
ATOM   5482 N  N   . MET F 2 68  ? -40.851 -0.294  -58.380 1.00 48.78  ? 890 MET F N   1 
ATOM   5483 C  CA  . MET F 2 68  ? -41.957 0.457   -57.803 1.00 47.94  ? 890 MET F CA  1 
ATOM   5484 C  C   . MET F 2 68  ? -42.415 -0.191  -56.499 1.00 46.98  ? 890 MET F C   1 
ATOM   5485 O  O   . MET F 2 68  ? -43.141 -1.187  -56.514 1.00 47.64  ? 890 MET F O   1 
ATOM   5486 C  CB  . MET F 2 68  ? -43.117 0.524   -58.804 1.00 50.08  ? 890 MET F CB  1 
ATOM   5487 C  CG  . MET F 2 68  ? -44.473 0.896   -58.212 1.00 48.96  ? 890 MET F CG  1 
ATOM   5488 S  SD  . MET F 2 68  ? -44.749 2.669   -58.039 1.00 48.41  ? 890 MET F SD  1 
ATOM   5489 C  CE  . MET F 2 68  ? -44.618 3.203   -59.739 1.00 49.73  ? 890 MET F CE  1 
ATOM   5490 N  N   . ILE F 2 69  ? -41.977 0.363   -55.373 1.00 23.08  ? 891 ILE F N   1 
ATOM   5491 C  CA  . ILE F 2 69  ? -42.424 -0.114  -54.068 1.00 22.04  ? 891 ILE F CA  1 
ATOM   5492 C  C   . ILE F 2 69  ? -43.819 0.427   -53.779 1.00 20.51  ? 891 ILE F C   1 
ATOM   5493 O  O   . ILE F 2 69  ? -44.066 1.623   -53.915 1.00 20.51  ? 891 ILE F O   1 
ATOM   5494 C  CB  . ILE F 2 69  ? -41.473 0.322   -52.935 1.00 20.73  ? 891 ILE F CB  1 
ATOM   5495 C  CG1 . ILE F 2 69  ? -40.044 -0.136  -53.225 1.00 21.73  ? 891 ILE F CG1 1 
ATOM   5496 C  CG2 . ILE F 2 69  ? -41.939 -0.235  -51.600 1.00 19.42  ? 891 ILE F CG2 1 
ATOM   5497 C  CD1 . ILE F 2 69  ? -39.061 0.227   -52.135 1.00 21.32  ? 891 ILE F CD1 1 
ATOM   5498 N  N   . GLY F 2 70  ? -44.729 -0.455  -53.382 1.00 23.99  ? 892 GLY F N   1 
ATOM   5499 C  CA  . GLY F 2 70  ? -46.099 -0.053  -53.129 1.00 24.27  ? 892 GLY F CA  1 
ATOM   5500 C  C   . GLY F 2 70  ? -46.627 -0.511  -51.785 1.00 23.44  ? 892 GLY F C   1 
ATOM   5501 O  O   . GLY F 2 70  ? -45.903 -1.120  -50.998 1.00 23.35  ? 892 GLY F O   1 
ATOM   5502 N  N   . HIS F 2 71  ? -47.896 -0.205  -51.529 1.00 23.30  ? 893 HIS F N   1 
ATOM   5503 C  CA  . HIS F 2 71  ? -48.569 -0.607  -50.296 1.00 23.06  ? 893 HIS F CA  1 
ATOM   5504 C  C   . HIS F 2 71  ? -47.971 0.066   -49.067 1.00 22.07  ? 893 HIS F C   1 
ATOM   5505 O  O   . HIS F 2 71  ? -47.923 -0.515  -47.983 1.00 29.63  ? 893 HIS F O   1 
ATOM   5506 C  CB  . HIS F 2 71  ? -48.562 -2.129  -50.148 1.00 22.75  ? 893 HIS F CB  1 
ATOM   5507 C  CG  . HIS F 2 71  ? -49.228 -2.841  -51.281 1.00 23.62  ? 893 HIS F CG  1 
ATOM   5508 N  ND1 . HIS F 2 71  ? -48.523 -3.488  -52.272 1.00 24.50  ? 893 HIS F ND1 1 
ATOM   5509 C  CD2 . HIS F 2 71  ? -50.538 -2.989  -51.593 1.00 24.74  ? 893 HIS F CD2 1 
ATOM   5510 C  CE1 . HIS F 2 71  ? -49.370 -4.016  -53.139 1.00 26.40  ? 893 HIS F CE1 1 
ATOM   5511 N  NE2 . HIS F 2 71  ? -50.599 -3.726  -52.750 1.00 26.65  ? 893 HIS F NE2 1 
ATOM   5512 N  N   . LEU F 2 72  ? -47.526 1.304   -49.252 1.00 21.49  ? 894 LEU F N   1 
ATOM   5513 C  CA  . LEU F 2 72  ? -46.954 2.091   -48.169 1.00 20.61  ? 894 LEU F CA  1 
ATOM   5514 C  C   . LEU F 2 72  ? -47.978 3.105   -47.674 1.00 20.43  ? 894 LEU F C   1 
ATOM   5515 O  O   . LEU F 2 72  ? -49.008 3.318   -48.311 1.00 21.18  ? 894 LEU F O   1 
ATOM   5516 C  CB  . LEU F 2 72  ? -45.691 2.806   -48.650 1.00 20.30  ? 894 LEU F CB  1 
ATOM   5517 C  CG  . LEU F 2 72  ? -44.725 1.958   -49.483 1.00 19.96  ? 894 LEU F CG  1 
ATOM   5518 C  CD1 . LEU F 2 72  ? -43.488 2.760   -49.858 1.00 20.17  ? 894 LEU F CD1 1 
ATOM   5519 C  CD2 . LEU F 2 72  ? -44.341 0.689   -48.739 1.00 19.72  ? 894 LEU F CD2 1 
ATOM   5520 N  N   . GLN F 2 73  ? -47.693 3.728   -46.537 1.00 25.35  ? 895 GLN F N   1 
ATOM   5521 C  CA  . GLN F 2 73  ? -48.606 4.704   -45.955 1.00 26.17  ? 895 GLN F CA  1 
ATOM   5522 C  C   . GLN F 2 73  ? -48.313 6.118   -46.446 1.00 26.77  ? 895 GLN F C   1 
ATOM   5523 O  O   . GLN F 2 73  ? -47.162 6.463   -46.708 1.00 26.63  ? 895 GLN F O   1 
ATOM   5524 C  CB  . GLN F 2 73  ? -48.539 4.651   -44.428 1.00 26.18  ? 895 GLN F CB  1 
ATOM   5525 C  CG  . GLN F 2 73  ? -49.028 3.339   -43.837 1.00 25.37  ? 895 GLN F CG  1 
ATOM   5526 C  CD  . GLN F 2 73  ? -50.490 3.077   -44.141 1.00 25.71  ? 895 GLN F CD  1 
ATOM   5527 O  OE1 . GLN F 2 73  ? -51.294 4.007   -44.224 1.00 26.13  ? 895 GLN F OE1 1 
ATOM   5528 N  NE2 . GLN F 2 73  ? -50.842 1.807   -44.307 1.00 24.94  ? 895 GLN F NE2 1 
ATOM   5529 N  N   . PRO F 2 74  ? -49.364 6.939   -46.582 1.00 23.70  ? 896 PRO F N   1 
ATOM   5530 C  CA  . PRO F 2 74  ? -49.235 8.337   -47.012 1.00 24.45  ? 896 PRO F CA  1 
ATOM   5531 C  C   . PRO F 2 74  ? -48.418 9.174   -46.030 1.00 24.43  ? 896 PRO F C   1 
ATOM   5532 O  O   . PRO F 2 74  ? -48.477 8.941   -44.822 1.00 23.95  ? 896 PRO F O   1 
ATOM   5533 C  CB  . PRO F 2 74  ? -50.686 8.828   -47.049 1.00 24.74  ? 896 PRO F CB  1 
ATOM   5534 C  CG  . PRO F 2 74  ? -51.504 7.589   -47.207 1.00 24.25  ? 896 PRO F CG  1 
ATOM   5535 C  CD  . PRO F 2 74  ? -50.773 6.532   -46.441 1.00 23.57  ? 896 PRO F CD  1 
ATOM   5536 N  N   . GLU F 2 75  ? -47.664 10.135  -46.556 1.00 43.89  ? 897 GLU F N   1 
ATOM   5537 C  CA  . GLU F 2 75  ? -46.843 11.022  -45.737 1.00 44.42  ? 897 GLU F CA  1 
ATOM   5538 C  C   . GLU F 2 75  ? -45.938 10.262  -44.778 1.00 43.77  ? 897 GLU F C   1 
ATOM   5539 O  O   . GLU F 2 75  ? -45.688 10.717  -43.663 1.00 44.23  ? 897 GLU F O   1 
ATOM   5540 C  CB  . GLU F 2 75  ? -47.718 11.989  -44.940 1.00 47.38  ? 897 GLU F CB  1 
ATOM   5541 C  CG  . GLU F 2 75  ? -48.440 13.022  -45.778 1.00 52.07  ? 897 GLU F CG  1 
ATOM   5542 C  CD  . GLU F 2 75  ? -49.176 14.034  -44.926 1.00 57.70  ? 897 GLU F CD  1 
ATOM   5543 O  OE1 . GLU F 2 75  ? -48.873 14.118  -43.716 1.00 56.72  ? 897 GLU F OE1 1 
ATOM   5544 O  OE2 . GLU F 2 75  ? -50.056 14.741  -45.463 1.00 61.84  ? 897 GLU F OE2 1 
ATOM   5545 N  N   . THR F 2 76  ? -45.448 9.107   -45.209 1.00 23.96  ? 898 THR F N   1 
ATOM   5546 C  CA  . THR F 2 76  ? -44.586 8.299   -44.359 1.00 23.18  ? 898 THR F CA  1 
ATOM   5547 C  C   . THR F 2 76  ? -43.174 8.216   -44.927 1.00 23.17  ? 898 THR F C   1 
ATOM   5548 O  O   . THR F 2 76  ? -42.986 7.980   -46.120 1.00 22.79  ? 898 THR F O   1 
ATOM   5549 C  CB  . THR F 2 76  ? -45.154 6.884   -44.169 1.00 22.82  ? 898 THR F CB  1 
ATOM   5550 O  OG1 . THR F 2 76  ? -46.465 6.970   -43.598 1.00 22.82  ? 898 THR F OG1 1 
ATOM   5551 C  CG2 . THR F 2 76  ? -44.262 6.070   -43.246 1.00 22.59  ? 898 THR F CG2 1 
ATOM   5552 N  N   . SER F 2 77  ? -42.185 8.418   -44.063 1.00 35.08  ? 899 SER F N   1 
ATOM   5553 C  CA  . SER F 2 77  ? -40.787 8.375   -44.470 1.00 34.45  ? 899 SER F CA  1 
ATOM   5554 C  C   . SER F 2 77  ? -40.237 6.954   -44.386 1.00 34.48  ? 899 SER F C   1 
ATOM   5555 O  O   . SER F 2 77  ? -40.464 6.248   -43.401 1.00 33.88  ? 899 SER F O   1 
ATOM   5556 C  CB  . SER F 2 77  ? -39.951 9.319   -43.606 1.00 34.22  ? 899 SER F CB  1 
ATOM   5557 O  OG  . SER F 2 77  ? -38.632 9.438   -44.110 1.00 34.96  ? 899 SER F OG  1 
ATOM   5558 N  N   . TYR F 2 78  ? -39.513 6.541   -45.421 1.00 23.88  ? 900 TYR F N   1 
ATOM   5559 C  CA  . TYR F 2 78  ? -38.986 5.184   -45.491 1.00 22.88  ? 900 TYR F CA  1 
ATOM   5560 C  C   . TYR F 2 78  ? -37.482 5.157   -45.743 1.00 23.36  ? 900 TYR F C   1 
ATOM   5561 O  O   . TYR F 2 78  ? -36.920 6.086   -46.322 1.00 23.88  ? 900 TYR F O   1 
ATOM   5562 C  CB  . TYR F 2 78  ? -39.710 4.389   -46.577 1.00 22.86  ? 900 TYR F CB  1 
ATOM   5563 C  CG  . TYR F 2 78  ? -41.165 4.120   -46.269 1.00 23.95  ? 900 TYR F CG  1 
ATOM   5564 C  CD1 . TYR F 2 78  ? -42.143 5.068   -46.547 1.00 24.66  ? 900 TYR F CD1 1 
ATOM   5565 C  CD2 . TYR F 2 78  ? -41.562 2.918   -45.700 1.00 23.00  ? 900 TYR F CD2 1 
ATOM   5566 C  CE1 . TYR F 2 78  ? -43.475 4.826   -46.267 1.00 23.89  ? 900 TYR F CE1 1 
ATOM   5567 C  CE2 . TYR F 2 78  ? -42.891 2.667   -45.416 1.00 23.20  ? 900 TYR F CE2 1 
ATOM   5568 C  CZ  . TYR F 2 78  ? -43.843 3.623   -45.700 1.00 23.49  ? 900 TYR F CZ  1 
ATOM   5569 O  OH  . TYR F 2 78  ? -45.167 3.371   -45.417 1.00 23.24  ? 900 TYR F OH  1 
ATOM   5570 N  N   . ASP F 2 79  ? -36.839 4.083   -45.295 1.00 32.09  ? 901 ASP F N   1 
ATOM   5571 C  CA  . ASP F 2 79  ? -35.428 3.847   -45.568 1.00 32.04  ? 901 ASP F CA  1 
ATOM   5572 C  C   . ASP F 2 79  ? -35.316 2.878   -46.736 1.00 32.48  ? 901 ASP F C   1 
ATOM   5573 O  O   . ASP F 2 79  ? -36.049 1.893   -46.797 1.00 33.12  ? 901 ASP F O   1 
ATOM   5574 C  CB  . ASP F 2 79  ? -34.737 3.261   -44.337 1.00 31.21  ? 901 ASP F CB  1 
ATOM   5575 C  CG  . ASP F 2 79  ? -34.854 4.157   -43.120 1.00 30.96  ? 901 ASP F CG  1 
ATOM   5576 O  OD1 . ASP F 2 79  ? -35.281 5.319   -43.275 1.00 31.21  ? 901 ASP F OD1 1 
ATOM   5577 O  OD2 . ASP F 2 79  ? -34.516 3.698   -42.008 1.00 30.61  ? 901 ASP F OD2 1 
ATOM   5578 N  N   . ILE F 2 80  ? -34.406 3.153   -47.664 1.00 29.96  ? 902 ILE F N   1 
ATOM   5579 C  CA  . ILE F 2 80  ? -34.287 2.326   -48.858 1.00 31.39  ? 902 ILE F CA  1 
ATOM   5580 C  C   . ILE F 2 80  ? -32.840 2.003   -49.220 1.00 17.60  ? 902 ILE F C   1 
ATOM   5581 O  O   . ILE F 2 80  ? -32.044 2.897   -49.505 1.00 17.80  ? 902 ILE F O   1 
ATOM   5582 C  CB  . ILE F 2 80  ? -34.968 2.989   -50.074 1.00 18.02  ? 902 ILE F CB  1 
ATOM   5583 C  CG1 . ILE F 2 80  ? -36.349 3.527   -49.688 1.00 17.39  ? 902 ILE F CG1 1 
ATOM   5584 C  CG2 . ILE F 2 80  ? -35.071 2.004   -51.227 1.00 19.07  ? 902 ILE F CG2 1 
ATOM   5585 C  CD1 . ILE F 2 80  ? -37.052 4.265   -50.807 1.00 32.52  ? 902 ILE F CD1 1 
ATOM   5586 N  N   . LYS F 2 81  ? -32.513 0.714   -49.208 1.00 34.71  ? 903 LYS F N   1 
ATOM   5587 C  CA  . LYS F 2 81  ? -31.203 0.234   -49.638 1.00 36.51  ? 903 LYS F CA  1 
ATOM   5588 C  C   . LYS F 2 81  ? -31.365 -1.092  -50.377 1.00 37.85  ? 903 LYS F C   1 
ATOM   5589 O  O   . LYS F 2 81  ? -32.280 -1.863  -50.085 1.00 37.08  ? 903 LYS F O   1 
ATOM   5590 C  CB  . LYS F 2 81  ? -30.261 0.071   -48.442 1.00 36.14  ? 903 LYS F CB  1 
ATOM   5591 C  CG  . LYS F 2 81  ? -30.688 -0.995  -47.443 1.00 34.46  ? 903 LYS F CG  1 
ATOM   5592 C  CD  . LYS F 2 81  ? -29.757 -1.026  -46.240 1.00 33.65  ? 903 LYS F CD  1 
ATOM   5593 C  CE  . LYS F 2 81  ? -30.224 -2.035  -45.202 1.00 33.33  ? 903 LYS F CE  1 
ATOM   5594 N  NZ  . LYS F 2 81  ? -29.444 -1.944  -43.935 1.00 31.99  ? 903 LYS F NZ  1 
ATOM   5595 N  N   . MET F 2 82  ? -30.481 -1.356  -51.333 1.00 38.05  ? 904 MET F N   1 
ATOM   5596 C  CA  . MET F 2 82  ? -30.613 -2.548  -52.165 1.00 38.94  ? 904 MET F CA  1 
ATOM   5597 C  C   . MET F 2 82  ? -29.308 -3.320  -52.327 1.00 40.43  ? 904 MET F C   1 
ATOM   5598 O  O   . MET F 2 82  ? -28.230 -2.821  -52.006 1.00 39.85  ? 904 MET F O   1 
ATOM   5599 C  CB  . MET F 2 82  ? -31.158 -2.175  -53.544 1.00 39.67  ? 904 MET F CB  1 
ATOM   5600 C  CG  . MET F 2 82  ? -30.223 -1.297  -54.355 1.00 40.09  ? 904 MET F CG  1 
ATOM   5601 S  SD  . MET F 2 82  ? -30.773 -1.121  -56.059 1.00 41.53  ? 904 MET F SD  1 
ATOM   5602 C  CE  . MET F 2 82  ? -31.013 -2.840  -56.504 1.00 42.67  ? 904 MET F CE  1 
ATOM   5603 N  N   . GLN F 2 83  ? -29.425 -4.542  -52.836 1.00 29.67  ? 905 GLN F N   1 
ATOM   5604 C  CA  . GLN F 2 83  ? -28.273 -5.394  -53.097 1.00 30.84  ? 905 GLN F CA  1 
ATOM   5605 C  C   . GLN F 2 83  ? -28.626 -6.433  -54.155 1.00 32.58  ? 905 GLN F C   1 
ATOM   5606 O  O   . GLN F 2 83  ? -29.670 -7.080  -54.076 1.00 32.01  ? 905 GLN F O   1 
ATOM   5607 C  CB  . GLN F 2 83  ? -27.821 -6.090  -51.812 1.00 30.30  ? 905 GLN F CB  1 
ATOM   5608 C  CG  . GLN F 2 83  ? -28.890 -6.968  -51.179 1.00 29.38  ? 905 GLN F CG  1 
ATOM   5609 C  CD  . GLN F 2 83  ? -28.414 -7.664  -49.918 1.00 28.82  ? 905 GLN F CD  1 
ATOM   5610 O  OE1 . GLN F 2 83  ? -29.124 -8.493  -49.348 1.00 28.51  ? 905 GLN F OE1 1 
ATOM   5611 N  NE2 . GLN F 2 83  ? -27.206 -7.330  -49.475 1.00 29.27  ? 905 GLN F NE2 1 
ATOM   5612 N  N   . CYS F 2 84  ? -27.758 -6.586  -55.151 1.00 56.39  ? 906 CYS F N   1 
ATOM   5613 C  CA  . CYS F 2 84  ? -27.954 -7.605  -56.175 1.00 57.87  ? 906 CYS F CA  1 
ATOM   5614 C  C   . CYS F 2 84  ? -27.551 -8.963  -55.615 1.00 59.52  ? 906 CYS F C   1 
ATOM   5615 O  O   . CYS F 2 84  ? -26.696 -9.047  -54.733 1.00 59.11  ? 906 CYS F O   1 
ATOM   5616 C  CB  . CYS F 2 84  ? -27.127 -7.287  -57.418 1.00 58.34  ? 906 CYS F CB  1 
ATOM   5617 S  SG  . CYS F 2 84  ? -25.367 -7.640  -57.234 1.00 60.14  ? 906 CYS F SG  1 
ATOM   5618 N  N   . PHE F 2 85  ? -28.160 -10.028 -56.124 1.00 56.98  ? 907 PHE F N   1 
ATOM   5619 C  CA  . PHE F 2 85  ? -27.887 -11.360 -55.600 1.00 57.50  ? 907 PHE F CA  1 
ATOM   5620 C  C   . PHE F 2 85  ? -27.851 -12.438 -56.678 1.00 60.50  ? 907 PHE F C   1 
ATOM   5621 O  O   . PHE F 2 85  ? -28.527 -12.338 -57.703 1.00 60.36  ? 907 PHE F O   1 
ATOM   5622 C  CB  . PHE F 2 85  ? -28.913 -11.733 -54.525 1.00 56.46  ? 907 PHE F CB  1 
ATOM   5623 C  CG  . PHE F 2 85  ? -30.283 -12.030 -55.068 1.00 56.13  ? 907 PHE F CG  1 
ATOM   5624 C  CD1 . PHE F 2 85  ? -30.670 -13.334 -55.330 1.00 56.87  ? 907 PHE F CD1 1 
ATOM   5625 C  CD2 . PHE F 2 85  ? -31.184 -11.008 -55.312 1.00 55.07  ? 907 PHE F CD2 1 
ATOM   5626 C  CE1 . PHE F 2 85  ? -31.929 -13.612 -55.828 1.00 55.97  ? 907 PHE F CE1 1 
ATOM   5627 C  CE2 . PHE F 2 85  ? -32.446 -11.280 -55.809 1.00 54.69  ? 907 PHE F CE2 1 
ATOM   5628 C  CZ  . PHE F 2 85  ? -32.818 -12.584 -56.068 1.00 54.99  ? 907 PHE F CZ  1 
ATOM   5629 N  N   . ASN F 2 86  ? -27.046 -13.466 -56.427 1.00 76.92  ? 908 ASN F N   1 
ATOM   5630 C  CA  . ASN F 2 86  ? -26.995 -14.657 -57.267 1.00 77.45  ? 908 ASN F CA  1 
ATOM   5631 C  C   . ASN F 2 86  ? -26.952 -15.907 -56.391 1.00 78.07  ? 908 ASN F C   1 
ATOM   5632 O  O   . ASN F 2 86  ? -27.286 -15.847 -55.205 1.00 76.81  ? 908 ASN F O   1 
ATOM   5633 C  CB  . ASN F 2 86  ? -25.792 -14.606 -58.213 1.00 77.28  ? 908 ASN F CB  1 
ATOM   5634 C  CG  . ASN F 2 86  ? -24.506 -14.222 -57.504 1.00 76.72  ? 908 ASN F CG  1 
ATOM   5635 O  OD1 . ASN F 2 86  ? -24.186 -14.749 -56.438 1.00 75.34  ? 908 ASN F OD1 1 
ATOM   5636 N  ND2 . ASN F 2 86  ? -23.757 -13.301 -58.100 1.00 77.30  ? 908 ASN F ND2 1 
ATOM   5637 N  N   . GLU F 2 87  ? -26.544 -17.035 -56.963 1.00 87.58  ? 909 GLU F N   1 
ATOM   5638 C  CA  . GLU F 2 87  ? -26.465 -18.276 -56.198 1.00 87.07  ? 909 GLU F CA  1 
ATOM   5639 C  C   . GLU F 2 87  ? -25.388 -18.202 -55.119 1.00 86.44  ? 909 GLU F C   1 
ATOM   5640 O  O   . GLU F 2 87  ? -25.595 -18.649 -53.990 1.00 86.65  ? 909 GLU F O   1 
ATOM   5641 C  CB  . GLU F 2 87  ? -26.216 -19.480 -57.110 1.00 87.44  ? 909 GLU F CB  1 
ATOM   5642 C  CG  . GLU F 2 87  ? -25.011 -19.351 -58.030 1.00 88.66  ? 909 GLU F CG  1 
ATOM   5643 C  CD  . GLU F 2 87  ? -25.383 -18.860 -59.417 1.00 89.94  ? 909 GLU F CD  1 
ATOM   5644 O  OE1 . GLU F 2 87  ? -26.181 -17.904 -59.521 1.00 89.43  ? 909 GLU F OE1 1 
ATOM   5645 O  OE2 . GLU F 2 87  ? -24.876 -19.435 -60.404 1.00 89.96  ? 909 GLU F OE2 1 
ATOM   5646 N  N   . GLY F 2 88  ? -24.239 -17.636 -55.475 1.00 75.85  ? 910 GLY F N   1 
ATOM   5647 C  CA  . GLY F 2 88  ? -23.136 -17.493 -54.542 1.00 75.48  ? 910 GLY F CA  1 
ATOM   5648 C  C   . GLY F 2 88  ? -23.537 -16.762 -53.276 1.00 74.61  ? 910 GLY F C   1 
ATOM   5649 O  O   . GLY F 2 88  ? -23.168 -17.164 -52.173 1.00 74.11  ? 910 GLY F O   1 
ATOM   5650 N  N   . GLY F 2 89  ? -24.301 -15.687 -53.437 1.00 58.90  ? 911 GLY F N   1 
ATOM   5651 C  CA  . GLY F 2 89  ? -24.752 -14.895 -52.309 1.00 56.29  ? 911 GLY F CA  1 
ATOM   5652 C  C   . GLY F 2 89  ? -25.248 -13.526 -52.730 1.00 55.80  ? 911 GLY F C   1 
ATOM   5653 O  O   . GLY F 2 89  ? -25.750 -13.352 -53.842 1.00 56.17  ? 911 GLY F O   1 
ATOM   5654 N  N   . GLU F 2 90  ? -25.106 -12.549 -51.841 1.00 72.69  ? 912 GLU F N   1 
ATOM   5655 C  CA  . GLU F 2 90  ? -25.572 -11.194 -52.114 1.00 70.62  ? 912 GLU F CA  1 
ATOM   5656 C  C   . GLU F 2 90  ? -24.443 -10.182 -51.959 1.00 68.15  ? 912 GLU F C   1 
ATOM   5657 O  O   . GLU F 2 90  ? -23.607 -10.306 -51.066 1.00 68.76  ? 912 GLU F O   1 
ATOM   5658 C  CB  . GLU F 2 90  ? -26.731 -10.827 -51.182 1.00 69.23  ? 912 GLU F CB  1 
ATOM   5659 C  CG  . GLU F 2 90  ? -27.763 -11.932 -50.996 1.00 70.56  ? 912 GLU F CG  1 
ATOM   5660 C  CD  . GLU F 2 90  ? -27.340 -12.956 -49.959 1.00 72.58  ? 912 GLU F CD  1 
ATOM   5661 O  OE1 . GLU F 2 90  ? -26.505 -12.616 -49.094 1.00 72.16  ? 912 GLU F OE1 1 
ATOM   5662 O  OE2 . GLU F 2 90  ? -27.846 -14.099 -50.005 1.00 74.20  ? 912 GLU F OE2 1 
ATOM   5663 N  N   . SER F 2 91  ? -24.425 -9.181  -52.832 1.00 60.17  ? 913 SER F N   1 
ATOM   5664 C  CA  . SER F 2 91  ? -23.422 -8.125  -52.763 1.00 60.34  ? 913 SER F CA  1 
ATOM   5665 C  C   . SER F 2 91  ? -23.711 -7.187  -51.596 1.00 59.10  ? 913 SER F C   1 
ATOM   5666 O  O   . SER F 2 91  ? -24.817 -7.180  -51.056 1.00 59.59  ? 913 SER F O   1 
ATOM   5667 C  CB  . SER F 2 91  ? -23.385 -7.330  -54.070 1.00 61.59  ? 913 SER F CB  1 
ATOM   5668 O  OG  . SER F 2 91  ? -24.579 -6.587  -54.248 1.00 61.46  ? 913 SER F OG  1 
ATOM   5669 N  N   . GLU F 2 92  ? -22.716 -6.396  -51.208 1.00 67.87  ? 914 GLU F N   1 
ATOM   5670 C  CA  . GLU F 2 92  ? -22.884 -5.466  -50.097 1.00 67.79  ? 914 GLU F CA  1 
ATOM   5671 C  C   . GLU F 2 92  ? -23.940 -4.413  -50.424 1.00 67.88  ? 914 GLU F C   1 
ATOM   5672 O  O   . GLU F 2 92  ? -24.143 -4.065  -51.588 1.00 68.88  ? 914 GLU F O   1 
ATOM   5673 C  CB  . GLU F 2 92  ? -21.552 -4.806  -49.737 1.00 68.05  ? 914 GLU F CB  1 
ATOM   5674 C  CG  . GLU F 2 92  ? -20.886 -4.068  -50.884 1.00 68.68  ? 914 GLU F CG  1 
ATOM   5675 C  CD  . GLU F 2 92  ? -19.477 -3.621  -50.544 1.00 69.24  ? 914 GLU F CD  1 
ATOM   5676 O  OE1 . GLU F 2 92  ? -18.834 -4.277  -49.696 1.00 68.16  ? 914 GLU F OE1 1 
ATOM   5677 O  OE2 . GLU F 2 92  ? -19.012 -2.616  -51.123 1.00 69.56  ? 914 GLU F OE2 1 
ATOM   5678 N  N   . PHE F 2 93  ? -24.612 -3.915  -49.391 1.00 39.57  ? 915 PHE F N   1 
ATOM   5679 C  CA  . PHE F 2 93  ? -25.691 -2.947  -49.566 1.00 37.67  ? 915 PHE F CA  1 
ATOM   5680 C  C   . PHE F 2 93  ? -25.244 -1.699  -50.323 1.00 37.48  ? 915 PHE F C   1 
ATOM   5681 O  O   . PHE F 2 93  ? -24.075 -1.315  -50.281 1.00 37.84  ? 915 PHE F O   1 
ATOM   5682 C  CB  . PHE F 2 93  ? -26.288 -2.551  -48.213 1.00 35.31  ? 915 PHE F CB  1 
ATOM   5683 C  CG  . PHE F 2 93  ? -27.136 -3.622  -47.586 1.00 35.00  ? 915 PHE F CG  1 
ATOM   5684 C  CD1 . PHE F 2 93  ? -26.633 -4.419  -46.571 1.00 35.25  ? 915 PHE F CD1 1 
ATOM   5685 C  CD2 . PHE F 2 93  ? -28.437 -3.830  -48.009 1.00 35.60  ? 915 PHE F CD2 1 
ATOM   5686 C  CE1 . PHE F 2 93  ? -27.412 -5.405  -45.991 1.00 34.95  ? 915 PHE F CE1 1 
ATOM   5687 C  CE2 . PHE F 2 93  ? -29.222 -4.815  -47.435 1.00 34.99  ? 915 PHE F CE2 1 
ATOM   5688 C  CZ  . PHE F 2 93  ? -28.708 -5.603  -46.423 1.00 34.69  ? 915 PHE F CZ  1 
ATOM   5689 N  N   . SER F 2 94  ? -26.187 -1.075  -51.016 1.00 45.77  ? 916 SER F N   1 
ATOM   5690 C  CA  . SER F 2 94  ? -25.923 0.163   -51.734 1.00 45.65  ? 916 SER F CA  1 
ATOM   5691 C  C   . SER F 2 94  ? -26.162 1.341   -50.804 1.00 44.95  ? 916 SER F C   1 
ATOM   5692 O  O   . SER F 2 94  ? -26.467 1.155   -49.625 1.00 43.82  ? 916 SER F O   1 
ATOM   5693 C  CB  . SER F 2 94  ? -26.838 0.275   -52.952 1.00 47.08  ? 916 SER F CB  1 
ATOM   5694 O  OG  . SER F 2 94  ? -28.200 0.291   -52.559 1.00 46.61  ? 916 SER F OG  1 
ATOM   5695 N  N   . ASN F 2 95  ? -26.024 2.553   -51.333 1.00 33.46  ? 917 ASN F N   1 
ATOM   5696 C  CA  . ASN F 2 95  ? -26.313 3.747   -50.551 1.00 32.48  ? 917 ASN F CA  1 
ATOM   5697 C  C   . ASN F 2 95  ? -27.729 3.686   -49.989 1.00 32.21  ? 917 ASN F C   1 
ATOM   5698 O  O   . ASN F 2 95  ? -28.630 3.124   -50.615 1.00 32.41  ? 917 ASN F O   1 
ATOM   5699 C  CB  . ASN F 2 95  ? -26.112 5.018   -51.384 1.00 32.04  ? 917 ASN F CB  1 
ATOM   5700 C  CG  . ASN F 2 95  ? -26.892 4.996   -52.686 1.00 33.67  ? 917 ASN F CG  1 
ATOM   5701 O  OD1 . ASN F 2 95  ? -26.911 3.992   -53.396 1.00 34.99  ? 917 ASN F OD1 1 
ATOM   5702 N  ND2 . ASN F 2 95  ? -27.532 6.113   -53.010 1.00 33.23  ? 917 ASN F ND2 1 
ATOM   5703 N  N   . VAL F 2 96  ? -27.922 4.245   -48.800 1.00 34.92  ? 918 VAL F N   1 
ATOM   5704 C  CA  . VAL F 2 96  ? -29.233 4.229   -48.166 1.00 33.70  ? 918 VAL F CA  1 
ATOM   5705 C  C   . VAL F 2 96  ? -29.949 5.558   -48.371 1.00 34.24  ? 918 VAL F C   1 
ATOM   5706 O  O   . VAL F 2 96  ? -29.433 6.618   -48.016 1.00 33.86  ? 918 VAL F O   1 
ATOM   5707 C  CB  . VAL F 2 96  ? -29.140 3.920   -46.661 1.00 32.04  ? 918 VAL F CB  1 
ATOM   5708 C  CG1 . VAL F 2 96  ? -30.534 3.814   -46.060 1.00 31.19  ? 918 VAL F CG1 1 
ATOM   5709 C  CG2 . VAL F 2 96  ? -28.359 2.637   -46.431 1.00 31.64  ? 918 VAL F CG2 1 
ATOM   5710 N  N   . MET F 2 97  ? -31.144 5.489   -48.946 1.00 26.24  ? 919 MET F N   1 
ATOM   5711 C  CA  . MET F 2 97  ? -31.926 6.681   -49.230 1.00 25.40  ? 919 MET F CA  1 
ATOM   5712 C  C   . MET F 2 97  ? -33.082 6.813   -48.249 1.00 24.17  ? 919 MET F C   1 
ATOM   5713 O  O   . MET F 2 97  ? -33.615 5.818   -47.762 1.00 23.49  ? 919 MET F O   1 
ATOM   5714 C  CB  . MET F 2 97  ? -32.467 6.626   -50.660 1.00 26.92  ? 919 MET F CB  1 
ATOM   5715 C  CG  . MET F 2 97  ? -31.412 6.304   -51.705 1.00 28.27  ? 919 MET F CG  1 
ATOM   5716 S  SD  . MET F 2 97  ? -30.361 7.712   -52.103 1.00 29.64  ? 919 MET F SD  1 
ATOM   5717 C  CE  . MET F 2 97  ? -31.354 8.529   -53.348 1.00 30.64  ? 919 MET F CE  1 
ATOM   5718 N  N   . ILE F 2 98  ? -33.458 8.051   -47.954 1.00 21.30  ? 920 ILE F N   1 
ATOM   5719 C  CA  . ILE F 2 98  ? -34.646 8.314   -47.157 1.00 20.65  ? 920 ILE F CA  1 
ATOM   5720 C  C   . ILE F 2 98  ? -35.676 9.025   -48.024 1.00 21.06  ? 920 ILE F C   1 
ATOM   5721 O  O   . ILE F 2 98  ? -35.500 10.189  -48.384 1.00 21.60  ? 920 ILE F O   1 
ATOM   5722 C  CB  . ILE F 2 98  ? -34.334 9.181   -45.924 1.00 20.47  ? 920 ILE F CB  1 
ATOM   5723 C  CG1 . ILE F 2 98  ? -33.241 8.529   -45.073 1.00 19.59  ? 920 ILE F CG1 1 
ATOM   5724 C  CG2 . ILE F 2 98  ? -35.593 9.402   -45.098 1.00 19.25  ? 920 ILE F CG2 1 
ATOM   5725 C  CD1 . ILE F 2 98  ? -32.946 9.270   -43.784 1.00 18.38  ? 920 ILE F CD1 1 
ATOM   5726 N  N   . CYS F 2 99  ? -36.742 8.314   -48.374 1.00 24.68  ? 921 CYS F N   1 
ATOM   5727 C  CA  . CYS F 2 99  ? -37.785 8.881   -49.217 1.00 24.57  ? 921 CYS F CA  1 
ATOM   5728 C  C   . CYS F 2 99  ? -39.117 8.914   -48.480 1.00 24.52  ? 921 CYS F C   1 
ATOM   5729 O  O   . CYS F 2 99  ? -39.390 8.069   -47.629 1.00 24.36  ? 921 CYS F O   1 
ATOM   5730 C  CB  . CYS F 2 99  ? -37.918 8.087   -50.518 1.00 24.44  ? 921 CYS F CB  1 
ATOM   5731 S  SG  . CYS F 2 99  ? -38.754 8.984   -51.845 1.00 25.87  ? 921 CYS F SG  1 
ATOM   5732 N  N   . GLU F 2 100 ? -39.945 9.895   -48.815 1.00 32.06  ? 922 GLU F N   1 
ATOM   5733 C  CA  . GLU F 2 100 ? -41.221 10.079  -48.142 1.00 31.31  ? 922 GLU F CA  1 
ATOM   5734 C  C   . GLU F 2 100 ? -42.370 10.115  -49.148 1.00 32.28  ? 922 GLU F C   1 
ATOM   5735 O  O   . GLU F 2 100 ? -42.318 10.845  -50.137 1.00 32.41  ? 922 GLU F O   1 
ATOM   5736 C  CB  . GLU F 2 100 ? -41.187 11.366  -47.317 1.00 31.62  ? 922 GLU F CB  1 
ATOM   5737 C  CG  . GLU F 2 100 ? -42.437 11.639  -46.505 1.00 33.17  ? 922 GLU F CG  1 
ATOM   5738 C  CD  . GLU F 2 100 ? -42.252 12.796  -45.542 1.00 34.20  ? 922 GLU F CD  1 
ATOM   5739 O  OE1 . GLU F 2 100 ? -41.148 12.925  -44.970 1.00 33.01  ? 922 GLU F OE1 1 
ATOM   5740 O  OE2 . GLU F 2 100 ? -43.211 13.575  -45.354 1.00 36.41  ? 922 GLU F OE2 1 
ATOM   5741 N  N   . THR F 2 101 ? -43.402 9.317   -48.892 1.00 22.59  ? 923 THR F N   1 
ATOM   5742 C  CA  . THR F 2 101 ? -44.576 9.274   -49.758 1.00 22.02  ? 923 THR F CA  1 
ATOM   5743 C  C   . THR F 2 101 ? -45.351 10.586  -49.697 1.00 23.67  ? 923 THR F C   1 
ATOM   5744 O  O   . THR F 2 101 ? -45.220 11.352  -48.741 1.00 24.76  ? 923 THR F O   1 
ATOM   5745 C  CB  . THR F 2 101 ? -45.519 8.122   -49.373 1.00 21.94  ? 923 THR F CB  1 
ATOM   5746 O  OG1 . THR F 2 101 ? -45.920 8.271   -48.006 1.00 22.61  ? 923 THR F OG1 1 
ATOM   5747 C  CG2 . THR F 2 101 ? -44.826 6.782   -49.549 1.00 21.74  ? 923 THR F CG2 1 
ATOM   5748 N  N   . LYS F 2 102 ? -46.159 10.840  -50.722 1.00 22.33  ? 924 LYS F N   1 
ATOM   5749 C  CA  . LYS F 2 102 ? -46.962 12.057  -50.780 1.00 22.85  ? 924 LYS F CA  1 
ATOM   5750 C  C   . LYS F 2 102 ? -47.985 12.100  -49.650 1.00 23.40  ? 924 LYS F C   1 
ATOM   5751 O  O   . LYS F 2 102 ? -48.407 11.064  -49.138 1.00 22.71  ? 924 LYS F O   1 
ATOM   5752 C  CB  . LYS F 2 102 ? -47.676 12.163  -52.126 1.00 23.48  ? 924 LYS F CB  1 
ATOM   5753 C  CG  . LYS F 2 102 ? -46.753 12.331  -53.318 1.00 23.65  ? 924 LYS F CG  1 
ATOM   5754 C  CD  . LYS F 2 102 ? -47.557 12.554  -54.589 1.00 24.90  ? 924 LYS F CD  1 
ATOM   5755 C  CE  . LYS F 2 102 ? -46.656 12.762  -55.793 1.00 24.63  ? 924 LYS F CE  1 
ATOM   5756 N  NZ  . LYS F 2 102 ? -47.447 12.948  -57.039 1.00 25.38  ? 924 LYS F NZ  1 
ATOM   5757 O  OXT . LYS F 2 102 ? -48.418 13.174  -49.229 1.00 25.45  ? 924 LYS F OXT 1 
HETATM 5758 ZN ZN  . ZN  G 3 .   ? -10.119 -7.439  -23.208 1.00 46.46  ? 190 ZN  B ZN  1 
HETATM 5759 CA CA  . CA  H 4 .   ? -4.388  0.649   -21.003 1.00 33.12  ? 191 CA  B CA  1 
HETATM 5760 CA CA  . CA  I 4 .   ? -6.271  1.949   -24.275 1.00 23.64  ? 192 CA  B CA  1 
HETATM 5761 ZN ZN  . ZN  J 3 .   ? -15.155 13.648  14.401  1.00 50.06  ? 190 ZN  A ZN  1 
HETATM 5762 CA CA  . CA  K 4 .   ? -16.278 3.613   16.072  1.00 25.11  ? 191 CA  A CA  1 
HETATM 5763 CA CA  . CA  L 4 .   ? -19.174 4.584   18.823  1.00 22.89  ? 192 CA  A CA  1 
HETATM 5764 ZN ZN  . ZN  M 3 .   ? -32.828 18.096  -44.344 1.00 66.89  ? 190 ZN  E ZN  1 
HETATM 5765 CA CA  . CA  N 4 .   ? -28.805 9.052   -41.678 1.00 19.78  ? 192 CA  E CA  1 
HETATM 5766 CA CA  . CA  O 4 .   ? -26.427 9.837   -44.936 1.00 47.13  ? 191 CA  E CA  1 
HETATM 5767 O  O   . HOH P 5 .   ? -29.300 8.548   -46.048 1.00 29.38  ? 1   HOH E O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . GLN A 20  ? 0.7921 0.8259 0.7967 -0.0073 0.0420  -0.0384 39  GLN B N   
2    C  CA  . GLN A 20  ? 0.8207 0.8474 0.8211 -0.0036 0.0450  -0.0414 39  GLN B CA  
3    C  C   . GLN A 20  ? 0.7913 0.8105 0.7913 0.0000  0.0455  -0.0393 39  GLN B C   
4    O  O   . GLN A 20  ? 0.7864 0.7951 0.7831 0.0021  0.0480  -0.0414 39  GLN B O   
5    C  CB  . GLN A 20  ? 0.8705 0.9049 0.8690 -0.0017 0.0452  -0.0428 39  GLN B CB  
6    C  CG  . GLN A 20  ? 0.9274 0.9680 0.9250 -0.0048 0.0454  -0.0459 39  GLN B CG  
7    C  CD  . GLN A 20  ? 0.9950 1.0433 0.9905 -0.0027 0.0459  -0.0475 39  GLN B CD  
8    O  OE1 . GLN A 20  ? 0.9969 1.0488 0.9926 0.0003  0.0454  -0.0456 39  GLN B OE1 
9    N  NE2 . GLN A 20  ? 0.9986 1.0501 0.9921 -0.0045 0.0468  -0.0514 39  GLN B NE2 
10   N  N   . LEU A 21  ? 0.5976 0.6219 0.6007 0.0005  0.0431  -0.0350 40  LEU B N   
11   C  CA  . LEU A 21  ? 0.5691 0.5876 0.5721 0.0037  0.0432  -0.0328 40  LEU B CA  
12   C  C   . LEU A 21  ? 0.5460 0.5565 0.5504 0.0021  0.0433  -0.0319 40  LEU B C   
13   O  O   . LEU A 21  ? 0.5394 0.5527 0.5469 -0.0016 0.0418  -0.0309 40  LEU B O   
14   C  CB  . LEU A 21  ? 0.5688 0.5959 0.5747 0.0041  0.0406  -0.0288 40  LEU B CB  
15   C  CG  . LEU A 21  ? 0.5751 0.6111 0.5799 0.0059  0.0406  -0.0293 40  LEU B CG  
16   C  CD1 . LEU A 21  ? 0.5476 0.5919 0.5555 0.0049  0.0380  -0.0252 40  LEU B CD1 
17   C  CD2 . LEU A 21  ? 0.5750 0.6061 0.5762 0.0114  0.0429  -0.0320 40  LEU B CD2 
18   N  N   . VAL A 22  ? 0.3115 0.3123 0.3134 0.0051  0.0451  -0.0322 41  VAL B N   
19   C  CA  . VAL A 22  ? 0.3074 0.3001 0.3100 0.0037  0.0457  -0.0317 41  VAL B CA  
20   C  C   . VAL A 22  ? 0.2911 0.2826 0.2956 0.0056  0.0443  -0.0281 41  VAL B C   
21   O  O   . VAL A 22  ? 0.2901 0.2770 0.2918 0.0097  0.0453  -0.0277 41  VAL B O   
22   C  CB  . VAL A 22  ? 0.3094 0.2901 0.3069 0.0047  0.0493  -0.0351 41  VAL B CB  
23   C  CG1 . VAL A 22  ? 0.2971 0.2702 0.2953 0.0029  0.0500  -0.0345 41  VAL B CG1 
24   C  CG2 . VAL A 22  ? 0.3229 0.3041 0.3183 0.0023  0.0508  -0.0392 41  VAL B CG2 
25   N  N   . PRO A 23  ? 0.2782 0.2736 0.2871 0.0030  0.0419  -0.0254 42  PRO B N   
26   C  CA  . PRO A 23  ? 0.2719 0.2661 0.2828 0.0043  0.0404  -0.0221 42  PRO B CA  
27   C  C   . PRO A 23  ? 0.2740 0.2575 0.2821 0.0066  0.0426  -0.0228 42  PRO B C   
28   O  O   . PRO A 23  ? 0.2697 0.2462 0.2754 0.0054  0.0450  -0.0254 42  PRO B O   
29   C  CB  . PRO A 23  ? 0.2591 0.2569 0.2744 0.0006  0.0380  -0.0205 42  PRO B CB  
30   C  CG  . PRO A 23  ? 0.2641 0.2625 0.2792 -0.0023 0.0391  -0.0235 42  PRO B CG  
31   C  CD  . PRO A 23  ? 0.2779 0.2789 0.2899 -0.0012 0.0403  -0.0256 42  PRO B CD  
32   N  N   . LEU A 24  ? 0.3649 0.3469 0.3728 0.0095  0.0420  -0.0205 43  LEU B N   
33   C  CA  . LEU A 24  ? 0.3597 0.3318 0.3647 0.0118  0.0439  -0.0207 43  LEU B CA  
34   C  C   . LEU A 24  ? 0.3624 0.3320 0.3703 0.0091  0.0433  -0.0196 43  LEU B C   
35   O  O   . LEU A 24  ? 0.3616 0.3376 0.3741 0.0068  0.0407  -0.0178 43  LEU B O   
36   C  CB  . LEU A 24  ? 0.3535 0.3259 0.3573 0.0162  0.0431  -0.0188 43  LEU B CB  
37   C  CG  . LEU A 24  ? 0.3564 0.3334 0.3580 0.0197  0.0432  -0.0196 43  LEU B CG  
38   C  CD1 . LEU A 24  ? 0.3581 0.3337 0.3580 0.0244  0.0430  -0.0182 43  LEU B CD1 
39   C  CD2 . LEU A 24  ? 0.3677 0.3395 0.3647 0.0208  0.0459  -0.0230 43  LEU B CD2 
40   N  N   . LEU A 25  ? 0.3042 0.2642 0.3092 0.0094  0.0457  -0.0208 44  LEU B N   
41   C  CA  . LEU A 25  ? 0.3068 0.2645 0.3143 0.0071  0.0455  -0.0201 44  LEU B CA  
42   C  C   . LEU A 25  ? 0.3035 0.2613 0.3122 0.0097  0.0439  -0.0171 44  LEU B C   
43   O  O   . LEU A 25  ? 0.3038 0.2621 0.3105 0.0132  0.0434  -0.0160 44  LEU B O   
44   C  CB  . LEU A 25  ? 0.3159 0.2637 0.3194 0.0059  0.0490  -0.0225 44  LEU B CB  
45   C  CG  . LEU A 25  ? 0.3129 0.2604 0.3156 0.0025  0.0508  -0.0259 44  LEU B CG  
46   C  CD1 . LEU A 25  ? 0.3355 0.2721 0.3334 0.0010  0.0546  -0.0282 44  LEU B CD1 
47   C  CD2 . LEU A 25  ? 0.3123 0.2688 0.3210 -0.0013 0.0486  -0.0260 44  LEU B CD2 
48   N  N   . TYR A 26  ? 0.3237 0.2814 0.3355 0.0079  0.0429  -0.0162 45  TYR B N   
49   C  CA  . TYR A 26  ? 0.3232 0.2802 0.3359 0.0100  0.0416  -0.0138 45  TYR B CA  
50   C  C   . TYR A 26  ? 0.3400 0.2877 0.3472 0.0130  0.0442  -0.0142 45  TYR B C   
51   O  O   . TYR A 26  ? 0.3422 0.2826 0.3464 0.0118  0.0471  -0.0160 45  TYR B O   
52   C  CB  . TYR A 26  ? 0.3219 0.2804 0.3390 0.0076  0.0401  -0.0132 45  TYR B CB  
53   C  CG  . TYR A 26  ? 0.3423 0.2992 0.3600 0.0095  0.0390  -0.0112 45  TYR B CG  
54   C  CD1 . TYR A 26  ? 0.3305 0.2914 0.3490 0.0114  0.0367  -0.0089 45  TYR B CD1 
55   C  CD2 . TYR A 26  ? 0.3551 0.3068 0.3725 0.0091  0.0404  -0.0117 45  TYR B CD2 
56   C  CE1 . TYR A 26  ? 0.3372 0.2968 0.3562 0.0130  0.0357  -0.0073 45  TYR B CE1 
57   C  CE2 . TYR A 26  ? 0.3525 0.3028 0.3703 0.0108  0.0394  -0.0101 45  TYR B CE2 
58   C  CZ  . TYR A 26  ? 0.3511 0.3053 0.3697 0.0128  0.0370  -0.0079 45  TYR B CZ  
59   O  OH  . TYR A 26  ? 0.3511 0.3041 0.3700 0.0144  0.0359  -0.0066 45  TYR B OH  
60   N  N   . LYS A 27  ? 0.3323 0.2804 0.3380 0.0167  0.0433  -0.0125 46  LYS B N   
61   C  CA  . LYS A 27  ? 0.3321 0.2719 0.3322 0.0203  0.0454  -0.0125 46  LYS B CA  
62   C  C   . LYS A 27  ? 0.3396 0.2744 0.3341 0.0225  0.0477  -0.0143 46  LYS B C   
63   O  O   . LYS A 27  ? 0.3478 0.2735 0.3362 0.0254  0.0499  -0.0146 46  LYS B O   
64   C  CB  . LYS A 27  ? 0.3371 0.2696 0.3360 0.0187  0.0472  -0.0128 46  LYS B CB  
65   C  CG  . LYS A 27  ? 0.3376 0.2733 0.3405 0.0184  0.0450  -0.0109 46  LYS B CG  
66   C  CD  . LYS A 27  ? 0.3427 0.2787 0.3436 0.0226  0.0438  -0.0091 46  LYS B CD  
67   C  CE  . LYS A 27  ? 0.3410 0.2801 0.3457 0.0222  0.0417  -0.0075 46  LYS B CE  
68   N  NZ  . LYS A 27  ? 0.3221 0.2614 0.3244 0.0263  0.0408  -0.0061 46  LYS B NZ  
69   N  N   . GLN A 28  ? 0.2958 0.2359 0.2917 0.0213  0.0473  -0.0155 47  GLN B N   
70   C  CA  . GLN A 28  ? 0.3021 0.2385 0.2929 0.0237  0.0492  -0.0175 47  GLN B CA  
71   C  C   . GLN A 28  ? 0.2897 0.2320 0.2800 0.0283  0.0476  -0.0166 47  GLN B C   
72   O  O   . GLN A 28  ? 0.2855 0.2383 0.2808 0.0274  0.0450  -0.0154 47  GLN B O   
73   C  CB  . GLN A 28  ? 0.2993 0.2385 0.2916 0.0199  0.0498  -0.0198 47  GLN B CB  
74   C  CG  . GLN A 28  ? 0.2998 0.2351 0.2868 0.0223  0.0518  -0.0222 47  GLN B CG  
75   C  CD  . GLN A 28  ? 0.2976 0.2361 0.2861 0.0183  0.0524  -0.0247 47  GLN B CD  
76   O  OE1 . GLN A 28  ? 0.3006 0.2421 0.2931 0.0137  0.0518  -0.0249 47  GLN B OE1 
77   N  NE2 . GLN A 28  ? 0.2989 0.2370 0.2840 0.0204  0.0534  -0.0268 47  GLN B NE2 
78   N  N   . PHE A 29  ? 0.2863 0.2220 0.2705 0.0332  0.0492  -0.0174 48  PHE B N   
79   C  CA  . PHE A 29  ? 0.2895 0.2313 0.2730 0.0381  0.0479  -0.0171 48  PHE B CA  
80   C  C   . PHE A 29  ? 0.2854 0.2247 0.2644 0.0407  0.0496  -0.0198 48  PHE B C   
81   O  O   . PHE A 29  ? 0.3015 0.2296 0.2750 0.0410  0.0523  -0.0215 48  PHE B O   
82   C  CB  . PHE A 29  ? 0.2876 0.2256 0.2678 0.0430  0.0476  -0.0155 48  PHE B CB  
83   C  CG  . PHE A 29  ? 0.3063 0.2297 0.2797 0.0445  0.0503  -0.0159 48  PHE B CG  
84   C  CD1 . PHE A 29  ? 0.3118 0.2300 0.2860 0.0409  0.0510  -0.0148 48  PHE B CD1 
85   C  CD2 . PHE A 29  ? 0.3224 0.2372 0.2882 0.0496  0.0523  -0.0172 48  PHE B CD2 
86   C  CE1 . PHE A 29  ? 0.3260 0.2309 0.2935 0.0418  0.0538  -0.0150 48  PHE B CE1 
87   C  CE2 . PHE A 29  ? 0.3343 0.2346 0.2929 0.0506  0.0549  -0.0172 48  PHE B CE2 
88   C  CZ  . PHE A 29  ? 0.3386 0.2341 0.2980 0.0464  0.0558  -0.0161 48  PHE B CZ  
89   N  N   . VAL A 30  ? 0.2289 0.1789 0.2103 0.0423  0.0480  -0.0202 49  VAL B N   
90   C  CA  . VAL A 30  ? 0.2456 0.1949 0.2232 0.0452  0.0494  -0.0230 49  VAL B CA  
91   C  C   . VAL A 30  ? 0.2508 0.2068 0.2274 0.0515  0.0482  -0.0231 49  VAL B C   
92   O  O   . VAL A 30  ? 0.2432 0.2114 0.2249 0.0510  0.0458  -0.0217 49  VAL B O   
93   C  CB  . VAL A 30  ? 0.2364 0.1937 0.2181 0.0404  0.0490  -0.0244 49  VAL B CB  
94   C  CG1 . VAL A 30  ? 0.2503 0.2080 0.2283 0.0437  0.0503  -0.0275 49  VAL B CG1 
95   C  CG2 . VAL A 30  ? 0.2362 0.1876 0.2189 0.0346  0.0501  -0.0248 49  VAL B CG2 
96   N  N   . PRO A 31  ? 0.2619 0.2098 0.2316 0.0575  0.0499  -0.0250 50  PRO B N   
97   C  CA  . PRO A 31  ? 0.2751 0.2072 0.2377 0.0580  0.0529  -0.0267 50  PRO B CA  
98   C  C   . PRO A 31  ? 0.2900 0.2105 0.2498 0.0567  0.0540  -0.0248 50  PRO B C   
99   O  O   . PRO A 31  ? 0.2880 0.2124 0.2507 0.0568  0.0523  -0.0222 50  PRO B O   
100  C  CB  . PRO A 31  ? 0.3019 0.2300 0.2579 0.0660  0.0537  -0.0286 50  PRO B CB  
101  C  CG  . PRO A 31  ? 0.2967 0.2365 0.2558 0.0704  0.0511  -0.0271 50  PRO B CG  
102  C  CD  . PRO A 31  ? 0.2756 0.2298 0.2437 0.0645  0.0489  -0.0255 50  PRO B CD  
103  N  N   . GLY A 32  ? 0.3174 0.2239 0.2713 0.0552  0.0569  -0.0261 51  GLY B N   
104  C  CA  . GLY A 32  ? 0.3245 0.2201 0.2756 0.0529  0.0584  -0.0246 51  GLY B CA  
105  C  C   . GLY A 32  ? 0.3419 0.2277 0.2857 0.0593  0.0589  -0.0232 51  GLY B C   
106  O  O   . GLY A 32  ? 0.3552 0.2258 0.2911 0.0598  0.0616  -0.0236 51  GLY B O   
107  N  N   . VAL A 33  ? 0.4626 0.3571 0.4089 0.0638  0.0564  -0.0215 52  VAL B N   
108  C  CA  . VAL A 33  ? 0.4667 0.3540 0.4067 0.0702  0.0563  -0.0199 52  VAL B CA  
109  C  C   . VAL A 33  ? 0.4596 0.3582 0.4056 0.0708  0.0534  -0.0174 52  VAL B C   
110  O  O   . VAL A 33  ? 0.4480 0.3604 0.4023 0.0674  0.0513  -0.0172 52  VAL B O   
111  C  CB  . VAL A 33  ? 0.4735 0.3584 0.4073 0.0785  0.0564  -0.0216 52  VAL B CB  
112  C  CG1 . VAL A 33  ? 0.4919 0.3615 0.4174 0.0787  0.0596  -0.0239 52  VAL B CG1 
113  C  CG2 . VAL A 33  ? 0.4770 0.3788 0.4174 0.0798  0.0541  -0.0229 52  VAL B CG2 
114  N  N   . PRO A 34  ? 0.4845 0.3769 0.4257 0.0749  0.0533  -0.0156 53  PRO B N   
115  C  CA  . PRO A 34  ? 0.4852 0.3878 0.4312 0.0761  0.0505  -0.0135 53  PRO B CA  
116  C  C   . PRO A 34  ? 0.4712 0.3899 0.4225 0.0789  0.0478  -0.0143 53  PRO B C   
117  O  O   . PRO A 34  ? 0.4734 0.3932 0.4220 0.0834  0.0481  -0.0163 53  PRO B O   
118  C  CB  . PRO A 34  ? 0.4970 0.3890 0.4344 0.0823  0.0511  -0.0122 53  PRO B CB  
119  C  CG  . PRO A 34  ? 0.5115 0.3859 0.4411 0.0806  0.0546  -0.0126 53  PRO B CG  
120  C  CD  . PRO A 34  ? 0.5022 0.3769 0.4329 0.0782  0.0559  -0.0153 53  PRO B CD  
121  N  N   . GLU A 35  ? 0.3386 0.2696 0.2973 0.0762  0.0453  -0.0130 54  GLU B N   
122  C  CA  . GLU A 35  ? 0.3329 0.2802 0.2975 0.0771  0.0429  -0.0137 54  GLU B CA  
123  C  C   . GLU A 35  ? 0.3581 0.3096 0.3192 0.0856  0.0418  -0.0144 54  GLU B C   
124  O  O   . GLU A 35  ? 0.3600 0.3225 0.3235 0.0878  0.0408  -0.0161 54  GLU B O   
125  C  CB  . GLU A 35  ? 0.3168 0.2744 0.2892 0.0719  0.0406  -0.0119 54  GLU B CB  
126  C  CG  . GLU A 35  ? 0.3028 0.2773 0.2813 0.0715  0.0383  -0.0124 54  GLU B CG  
127  C  CD  . GLU A 35  ? 0.2906 0.2735 0.2757 0.0663  0.0361  -0.0106 54  GLU B CD  
128  O  OE1 . GLU A 35  ? 0.2910 0.2686 0.2754 0.0659  0.0358  -0.0091 54  GLU B OE1 
129  O  OE2 . GLU A 35  ? 0.2820 0.2765 0.2727 0.0625  0.0347  -0.0107 54  GLU B OE2 
130  N  N   . ARG A 36  ? 0.6599 0.6031 0.6150 0.0905  0.0420  -0.0133 55  ARG B N   
131  C  CA  . ARG A 36  ? 0.6746 0.6225 0.6263 0.0990  0.0406  -0.0139 55  ARG B CA  
132  C  C   . ARG A 36  ? 0.6881 0.6255 0.6309 0.1064  0.0422  -0.0155 55  ARG B C   
133  O  O   . ARG A 36  ? 0.7070 0.6458 0.6454 0.1146  0.0412  -0.0159 55  ARG B O   
134  C  CB  . ARG A 36  ? 0.6901 0.6365 0.6401 0.1012  0.0394  -0.0117 55  ARG B CB  
135  C  CG  . ARG A 36  ? 0.7056 0.6634 0.6642 0.0950  0.0373  -0.0104 55  ARG B CG  
136  C  CD  . ARG A 36  ? 0.7269 0.6813 0.6830 0.0968  0.0365  -0.0085 55  ARG B CD  
137  N  NE  . ARG A 36  ? 0.7386 0.6959 0.7008 0.0894  0.0358  -0.0071 55  ARG B NE  
138  C  CZ  . ARG A 36  ? 0.7628 0.7149 0.7232 0.0889  0.0356  -0.0054 55  ARG B CZ  
139  N  NH1 . ARG A 36  ? 0.7599 0.7039 0.7125 0.0952  0.0361  -0.0047 55  ARG B NH1 
140  N  NH2 . ARG A 36  ? 0.7578 0.7128 0.7240 0.0823  0.0349  -0.0044 55  ARG B NH2 
141  N  N   . THR A 37  ? 0.5791 0.5059 0.5189 0.1037  0.0448  -0.0165 56  THR B N   
142  C  CA  . THR A 37  ? 0.5982 0.5144 0.5295 0.1102  0.0464  -0.0184 56  THR B CA  
143  C  C   . THR A 37  ? 0.5977 0.5271 0.5323 0.1134  0.0453  -0.0213 56  THR B C   
144  O  O   . THR A 37  ? 0.5794 0.5252 0.5229 0.1094  0.0436  -0.0216 56  THR B O   
145  C  CB  . THR A 37  ? 0.5969 0.4964 0.5232 0.1057  0.0498  -0.0189 56  THR B CB  
146  O  OG1 . THR A 37  ? 0.5787 0.4856 0.5123 0.0981  0.0501  -0.0201 56  THR B OG1 
147  C  CG2 . THR A 37  ? 0.5814 0.4683 0.5040 0.1024  0.0511  -0.0163 56  THR B CG2 
148  N  N   . LEU A 38  ? 0.3720 0.2940 0.2992 0.1206  0.0464  -0.0234 57  LEU B N   
149  C  CA  . LEU A 38  ? 0.3665 0.3008 0.2962 0.1246  0.0455  -0.0265 57  LEU B CA  
150  C  C   . LEU A 38  ? 0.3581 0.2952 0.2922 0.1178  0.0469  -0.0284 57  LEU B C   
151  O  O   . LEU A 38  ? 0.3437 0.2963 0.2837 0.1173  0.0457  -0.0303 57  LEU B O   
152  C  CB  . LEU A 38  ? 0.3833 0.3083 0.3032 0.1354  0.0460  -0.0284 57  LEU B CB  
153  C  CG  . LEU A 38  ? 0.3983 0.3235 0.3140 0.1439  0.0441  -0.0270 57  LEU B CG  
154  C  CD1 . LEU A 38  ? 0.4417 0.3597 0.3481 0.1551  0.0443  -0.0292 57  LEU B CD1 
155  C  CD2 . LEU A 38  ? 0.3819 0.3295 0.3070 0.1433  0.0410  -0.0267 57  LEU B CD2 
156  N  N   . GLY A 39  ? 0.4602 0.3828 0.3911 0.1123  0.0493  -0.0279 58  GLY B N   
157  C  CA  . GLY A 39  ? 0.4582 0.3827 0.3928 0.1056  0.0506  -0.0297 58  GLY B CA  
158  C  C   . GLY A 39  ? 0.4329 0.3741 0.3784 0.0981  0.0488  -0.0286 58  GLY B C   
159  O  O   . GLY A 39  ? 0.4113 0.3607 0.3613 0.0941  0.0489  -0.0302 58  GLY B O   
160  N  N   . ALA A 40  ? 0.3119 0.2575 0.2611 0.0963  0.0471  -0.0257 59  ALA B N   
161  C  CA  . ALA A 40  ? 0.2861 0.2457 0.2448 0.0893  0.0453  -0.0242 59  ALA B CA  
162  C  C   . ALA A 40  ? 0.2972 0.2741 0.2607 0.0923  0.0427  -0.0242 59  ALA B C   
163  O  O   . ALA A 40  ? 0.3027 0.2872 0.2654 0.0975  0.0423  -0.0266 59  ALA B O   
164  C  CB  . ALA A 40  ? 0.2781 0.2311 0.2382 0.0840  0.0454  -0.0213 59  ALA B CB  
165  N  N   . SER A 41  ? 0.3725 0.3557 0.3409 0.0890  0.0409  -0.0218 60  SER B N   
166  C  CA  . SER A 41  ? 0.3646 0.3649 0.3381 0.0903  0.0384  -0.0217 60  SER B CA  
167  C  C   . SER A 41  ? 0.3800 0.3810 0.3491 0.0995  0.0375  -0.0224 60  SER B C   
168  O  O   . SER A 41  ? 0.3821 0.3976 0.3539 0.1030  0.0359  -0.0238 60  SER B O   
169  C  CB  . SER A 41  ? 0.3395 0.3452 0.3193 0.0833  0.0368  -0.0191 60  SER B CB  
170  O  OG  . SER A 41  ? 0.3221 0.3293 0.3064 0.0754  0.0371  -0.0186 60  SER B OG  
171  N  N   . GLY A 42  ? 0.3483 0.3340 0.3104 0.1034  0.0385  -0.0213 61  GLY B N   
172  C  CA  . GLY A 42  ? 0.3562 0.3408 0.3129 0.1125  0.0376  -0.0215 61  GLY B CA  
173  C  C   . GLY A 42  ? 0.3651 0.3504 0.3228 0.1119  0.0360  -0.0190 61  GLY B C   
174  O  O   . GLY A 42  ? 0.3568 0.3428 0.3193 0.1043  0.0358  -0.0171 61  GLY B O   
175  N  N   . PRO A 43  ? 0.3550 0.3399 0.3078 0.1202  0.0349  -0.0190 62  PRO B N   
176  C  CA  . PRO A 43  ? 0.3501 0.3354 0.3028 0.1207  0.0334  -0.0169 62  PRO B CA  
177  C  C   . PRO A 43  ? 0.3249 0.3290 0.2870 0.1161  0.0310  -0.0168 62  PRO B C   
178  O  O   . PRO A 43  ? 0.3073 0.3259 0.2747 0.1151  0.0301  -0.0187 62  PRO B O   
179  C  CB  . PRO A 43  ? 0.3802 0.3627 0.3253 0.1319  0.0327  -0.0176 62  PRO B CB  
180  C  CG  . PRO A 43  ? 0.3993 0.3732 0.3385 0.1367  0.0345  -0.0196 62  PRO B CG  
181  C  CD  . PRO A 43  ? 0.3749 0.3582 0.3214 0.1301  0.0351  -0.0213 62  PRO B CD  
182  N  N   . ALA A 44  ? 0.2864 0.2899 0.2499 0.1132  0.0299  -0.0147 63  ALA B N   
183  C  CA  . ALA A 44  ? 0.2724 0.2923 0.2438 0.1091  0.0276  -0.0146 63  ALA B CA  
184  C  C   . ALA A 44  ? 0.2761 0.3065 0.2461 0.1168  0.0254  -0.0158 63  ALA B C   
185  O  O   . ALA A 44  ? 0.2739 0.2959 0.2373 0.1230  0.0252  -0.0150 63  ALA B O   
186  C  CB  . ALA A 44  ? 0.2680 0.2824 0.2417 0.1022  0.0274  -0.0121 63  ALA B CB  
187  N  N   . GLU A 45  ? 0.4599 0.5091 0.4361 0.1161  0.0237  -0.0178 64  GLU B N   
188  C  CA  . GLU A 45  ? 0.4610 0.5230 0.4367 0.1235  0.0215  -0.0196 64  GLU B CA  
189  C  C   . GLU A 45  ? 0.4583 0.5292 0.4380 0.1204  0.0194  -0.0187 64  GLU B C   
190  O  O   . GLU A 45  ? 0.4631 0.5498 0.4453 0.1236  0.0173  -0.0206 64  GLU B O   
191  C  CB  . GLU A 45  ? 0.4584 0.5376 0.4386 0.1248  0.0210  -0.0227 64  GLU B CB  
192  C  CG  . GLU A 45  ? 0.4637 0.5358 0.4404 0.1279  0.0230  -0.0240 64  GLU B CG  
193  C  CD  . GLU A 45  ? 0.4827 0.5730 0.4641 0.1290  0.0225  -0.0273 64  GLU B CD  
194  O  OE1 . GLU A 45  ? 0.4835 0.5921 0.4706 0.1274  0.0206  -0.0285 64  GLU B OE1 
195  O  OE2 . GLU A 45  ? 0.5050 0.5916 0.4841 0.1313  0.0240  -0.0289 64  GLU B OE2 
196  N  N   . GLY A 46  ? 0.3906 0.4518 0.3708 0.1140  0.0199  -0.0162 65  GLY B N   
197  C  CA  . GLY A 46  ? 0.3801 0.4483 0.3639 0.1104  0.0180  -0.0155 65  GLY B CA  
198  C  C   . GLY A 46  ? 0.3797 0.4575 0.3718 0.1002  0.0174  -0.0154 65  GLY B C   
199  O  O   . GLY A 46  ? 0.3806 0.4632 0.3762 0.0966  0.0182  -0.0162 65  GLY B O   
200  N  N   . ARG A 47  ? 0.4569 0.5372 0.4519 0.0956  0.0161  -0.0145 66  ARG B N   
201  C  CA  . ARG A 47  ? 0.4475 0.5341 0.4493 0.0856  0.0155  -0.0140 66  ARG B CA  
202  C  C   . ARG A 47  ? 0.4574 0.5645 0.4647 0.0838  0.0137  -0.0163 66  ARG B C   
203  O  O   . ARG A 47  ? 0.4666 0.5839 0.4732 0.0892  0.0122  -0.0181 66  ARG B O   
204  C  CB  . ARG A 47  ? 0.4459 0.5247 0.4478 0.0814  0.0150  -0.0122 66  ARG B CB  
205  C  CG  . ARG A 47  ? 0.4413 0.5236 0.4494 0.0714  0.0144  -0.0114 66  ARG B CG  
206  C  CD  . ARG A 47  ? 0.4439 0.5145 0.4510 0.0682  0.0143  -0.0096 66  ARG B CD  
207  N  NE  . ARG A 47  ? 0.4399 0.5143 0.4523 0.0594  0.0133  -0.0091 66  ARG B NE  
208  C  CZ  . ARG A 47  ? 0.4378 0.5027 0.4504 0.0553  0.0132  -0.0076 66  ARG B CZ  
209  N  NH1 . ARG A 47  ? 0.4454 0.4975 0.4537 0.0587  0.0143  -0.0065 66  ARG B NH1 
210  N  NH2 . ARG A 47  ? 0.4226 0.4907 0.4396 0.0477  0.0121  -0.0072 66  ARG B NH2 
211  N  N   . VAL A 48  ? 0.3183 0.4317 0.3308 0.0759  0.0139  -0.0163 67  VAL B N   
212  C  CA  . VAL A 48  ? 0.3150 0.4477 0.3327 0.0726  0.0126  -0.0184 67  VAL B CA  
213  C  C   . VAL A 48  ? 0.3277 0.4638 0.3497 0.0636  0.0114  -0.0176 67  VAL B C   
214  O  O   . VAL A 48  ? 0.3187 0.4456 0.3418 0.0568  0.0120  -0.0154 67  VAL B O   
215  C  CB  . VAL A 48  ? 0.3130 0.4521 0.3332 0.0701  0.0138  -0.0193 67  VAL B CB  
216  C  CG1 . VAL A 48  ? 0.3310 0.4908 0.3564 0.0661  0.0127  -0.0216 67  VAL B CG1 
217  C  CG2 . VAL A 48  ? 0.3163 0.4517 0.3320 0.0790  0.0151  -0.0205 67  VAL B CG2 
218  N  N   . ALA A 49  ? 0.2283 0.3774 0.2522 0.0638  0.0096  -0.0194 68  ALA B N   
219  C  CA  . ALA A 49  ? 0.2177 0.3707 0.2453 0.0552  0.0083  -0.0190 68  ALA B CA  
220  C  C   . ALA A 49  ? 0.2352 0.4048 0.2678 0.0485  0.0080  -0.0206 68  ALA B C   
221  O  O   . ALA A 49  ? 0.2331 0.4151 0.2667 0.0518  0.0083  -0.0228 68  ALA B O   
222  C  CB  . ALA A 49  ? 0.2188 0.3749 0.2452 0.0585  0.0066  -0.0200 68  ALA B CB  
223  N  N   . ARG A 50  ? 0.4000 0.5695 0.4353 0.0391  0.0074  -0.0196 69  ARG B N   
224  C  CA  . ARG A 50  ? 0.3954 0.5783 0.4348 0.0311  0.0073  -0.0206 69  ARG B CA  
225  C  C   . ARG A 50  ? 0.4132 0.6174 0.4552 0.0331  0.0064  -0.0243 69  ARG B C   
226  O  O   . ARG A 50  ? 0.4177 0.6350 0.4621 0.0313  0.0070  -0.0259 69  ARG B O   
227  C  CB  . ARG A 50  ? 0.3769 0.5542 0.4178 0.0210  0.0067  -0.0188 69  ARG B CB  
228  C  CG  . ARG A 50  ? 0.3699 0.5589 0.4140 0.0117  0.0067  -0.0193 69  ARG B CG  
229  C  CD  . ARG A 50  ? 0.3607 0.5392 0.4049 0.0023  0.0063  -0.0168 69  ARG B CD  
230  N  NE  . ARG A 50  ? 0.3728 0.5347 0.4150 0.0018  0.0072  -0.0136 69  ARG B NE  
231  C  CZ  . ARG A 50  ? 0.3675 0.5284 0.4101 -0.0034 0.0082  -0.0119 69  ARG B CZ  
232  N  NH1 . ARG A 50  ? 0.3699 0.5450 0.4144 -0.0088 0.0084  -0.0131 69  ARG B NH1 
233  N  NH2 . ARG A 50  ? 0.3556 0.5018 0.3963 -0.0033 0.0088  -0.0092 69  ARG B NH2 
234  N  N   . GLY A 51  ? 0.6076 0.8161 0.6491 0.0368  0.0049  -0.0258 70  GLY B N   
235  C  CA  . GLY A 51  ? 0.6227 0.8522 0.6669 0.0385  0.0037  -0.0296 70  GLY B CA  
236  C  C   . GLY A 51  ? 0.6440 0.8815 0.6867 0.0496  0.0038  -0.0318 70  GLY B C   
237  O  O   . GLY A 51  ? 0.6620 0.9180 0.7068 0.0527  0.0027  -0.0353 70  GLY B O   
238  N  N   . SER A 52  ? 0.4593 0.6828 0.4982 0.0558  0.0051  -0.0300 71  SER B N   
239  C  CA  . SER A 52  ? 0.4685 0.6958 0.5046 0.0673  0.0052  -0.0318 71  SER B CA  
240  C  C   . SER A 52  ? 0.4663 0.7082 0.5052 0.0677  0.0061  -0.0342 71  SER B C   
241  O  O   . SER A 52  ? 0.4527 0.7010 0.4954 0.0587  0.0069  -0.0341 71  SER B O   
242  C  CB  . SER A 52  ? 0.4543 0.6602 0.4847 0.0736  0.0063  -0.0291 71  SER B CB  
243  O  OG  . SER A 52  ? 0.4508 0.6470 0.4812 0.0693  0.0083  -0.0271 71  SER B OG  
244  N  N   . GLU A 53  ? 0.6028 0.8495 0.6394 0.0784  0.0060  -0.0363 72  GLU B N   
245  C  CA  . GLU A 53  ? 0.6087 0.8697 0.6474 0.0804  0.0069  -0.0390 72  GLU B CA  
246  C  C   . GLU A 53  ? 0.5983 0.8457 0.6348 0.0804  0.0091  -0.0371 72  GLU B C   
247  O  O   . GLU A 53  ? 0.6026 0.8591 0.6418 0.0770  0.0103  -0.0383 72  GLU B O   
248  C  CB  . GLU A 53  ? 0.6280 0.9005 0.6651 0.0927  0.0056  -0.0425 72  GLU B CB  
249  C  CG  . GLU A 53  ? 0.6446 0.9339 0.6841 0.0959  0.0063  -0.0461 72  GLU B CG  
250  C  CD  . GLU A 53  ? 0.6402 0.9532 0.6867 0.0875  0.0059  -0.0489 72  GLU B CD  
251  O  OE1 . GLU A 53  ? 0.6433 0.9633 0.6923 0.0825  0.0045  -0.0493 72  GLU B OE1 
252  O  OE2 . GLU A 53  ? 0.6276 0.9523 0.6769 0.0857  0.0072  -0.0509 72  GLU B OE2 
253  N  N   . ARG A 54  ? 0.4651 0.6910 0.4964 0.0839  0.0097  -0.0342 73  ARG B N   
254  C  CA  . ARG A 54  ? 0.4616 0.6731 0.4904 0.0834  0.0118  -0.0323 73  ARG B CA  
255  C  C   . ARG A 54  ? 0.4491 0.6575 0.4813 0.0713  0.0127  -0.0300 73  ARG B C   
256  O  O   . ARG A 54  ? 0.4406 0.6450 0.4728 0.0688  0.0143  -0.0294 73  ARG B O   
257  C  CB  . ARG A 54  ? 0.4462 0.6359 0.4686 0.0894  0.0123  -0.0299 73  ARG B CB  
258  C  CG  . ARG A 54  ? 0.4461 0.6353 0.4634 0.1021  0.0118  -0.0317 73  ARG B CG  
259  C  CD  . ARG A 54  ? 0.4554 0.6219 0.4658 0.1067  0.0125  -0.0290 73  ARG B CD  
260  N  NE  . ARG A 54  ? 0.4511 0.6028 0.4596 0.1040  0.0148  -0.0272 73  ARG B NE  
261  C  CZ  . ARG A 54  ? 0.4385 0.5701 0.4426 0.1035  0.0160  -0.0244 73  ARG B CZ  
262  N  NH1 . ARG A 54  ? 0.4459 0.5695 0.4469 0.1057  0.0151  -0.0228 73  ARG B NH1 
263  N  NH2 . ARG A 54  ? 0.4171 0.5373 0.4199 0.1008  0.0180  -0.0232 73  ARG B NH2 
264  N  N   . PHE A 55  ? 0.2731 0.4829 0.3079 0.0639  0.0116  -0.0288 74  PHE B N   
265  C  CA  . PHE A 55  ? 0.2572 0.4640 0.2948 0.0525  0.0121  -0.0265 74  PHE B CA  
266  C  C   . PHE A 55  ? 0.2647 0.4880 0.3061 0.0472  0.0128  -0.0283 74  PHE B C   
267  O  O   . PHE A 55  ? 0.2563 0.4755 0.2985 0.0399  0.0138  -0.0264 74  PHE B O   
268  C  CB  . PHE A 55  ? 0.2615 0.4679 0.3007 0.0463  0.0105  -0.0255 74  PHE B CB  
269  C  CG  . PHE A 55  ? 0.2541 0.4566 0.2955 0.0349  0.0108  -0.0231 74  PHE B CG  
270  C  CD1 . PHE A 55  ? 0.2445 0.4281 0.2838 0.0319  0.0112  -0.0197 74  PHE B CD1 
271  C  CD2 . PHE A 55  ? 0.2583 0.4761 0.3035 0.0270  0.0107  -0.0244 74  PHE B CD2 
272  C  CE1 . PHE A 55  ? 0.2390 0.4186 0.2798 0.0220  0.0113  -0.0175 74  PHE B CE1 
273  C  CE2 . PHE A 55  ? 0.2522 0.4652 0.2983 0.0166  0.0109  -0.0219 74  PHE B CE2 
274  C  CZ  . PHE A 55  ? 0.2381 0.4318 0.2821 0.0144  0.0111  -0.0184 74  PHE B CZ  
275  N  N   . ARG A 56  ? 0.5090 0.7512 0.5524 0.0512  0.0122  -0.0320 75  ARG B N   
276  C  CA  . ARG A 56  ? 0.4958 0.7565 0.5431 0.0461  0.0129  -0.0342 75  ARG B CA  
277  C  C   . ARG A 56  ? 0.4931 0.7522 0.5391 0.0491  0.0147  -0.0346 75  ARG B C   
278  O  O   . ARG A 56  ? 0.4860 0.7557 0.5346 0.0431  0.0157  -0.0354 75  ARG B O   
279  C  CB  . ARG A 56  ? 0.4993 0.7821 0.5495 0.0499  0.0117  -0.0385 75  ARG B CB  
280  C  CG  . ARG A 56  ? 0.5179 0.8061 0.5703 0.0445  0.0100  -0.0386 75  ARG B CG  
281  C  CD  . ARG A 56  ? 0.5305 0.8423 0.5862 0.0479  0.0087  -0.0433 75  ARG B CD  
282  N  NE  . ARG A 56  ? 0.5215 0.8396 0.5796 0.0411  0.0072  -0.0436 75  ARG B NE  
283  C  CZ  . ARG A 56  ? 0.5043 0.8402 0.5648 0.0440  0.0057  -0.0474 75  ARG B CZ  
284  N  NH1 . ARG A 56  ? 0.5103 0.8597 0.5712 0.0542  0.0052  -0.0509 75  ARG B NH1 
285  N  NH2 . ARG A 56  ? 0.4807 0.8209 0.5431 0.0370  0.0044  -0.0477 75  ARG B NH2 
286  N  N   . ASP A 57  ? 0.4767 0.7223 0.5184 0.0581  0.0152  -0.0342 76  ASP B N   
287  C  CA  . ASP A 57  ? 0.4742 0.7157 0.5140 0.0612  0.0170  -0.0346 76  ASP B CA  
288  C  C   . ASP A 57  ? 0.4538 0.6811 0.4929 0.0530  0.0181  -0.0310 76  ASP B C   
289  O  O   . ASP A 57  ? 0.4551 0.6829 0.4941 0.0516  0.0196  -0.0312 76  ASP B O   
290  C  CB  . ASP A 57  ? 0.4843 0.7147 0.5190 0.0731  0.0172  -0.0354 76  ASP B CB  
291  C  CG  . ASP A 57  ? 0.5073 0.7516 0.5419 0.0825  0.0159  -0.0391 76  ASP B CG  
292  O  OD1 . ASP A 57  ? 0.5106 0.7759 0.5498 0.0801  0.0152  -0.0419 76  ASP B OD1 
293  O  OD2 . ASP A 57  ? 0.5107 0.7451 0.5406 0.0923  0.0155  -0.0393 76  ASP B OD2 
294  N  N   . LEU A 58  ? 0.2306 0.4456 0.2694 0.0481  0.0174  -0.0278 77  LEU B N   
295  C  CA  . LEU A 58  ? 0.2259 0.4275 0.2640 0.0406  0.0181  -0.0243 77  LEU B CA  
296  C  C   . LEU A 58  ? 0.2353 0.4481 0.2768 0.0304  0.0183  -0.0238 77  LEU B C   
297  O  O   . LEU A 58  ? 0.2349 0.4576 0.2791 0.0249  0.0173  -0.0241 77  LEU B O   
298  C  CB  . LEU A 58  ? 0.2183 0.4045 0.2551 0.0387  0.0171  -0.0213 77  LEU B CB  
299  C  CG  . LEU A 58  ? 0.2257 0.3994 0.2585 0.0479  0.0171  -0.0213 77  LEU B CG  
300  C  CD1 . LEU A 58  ? 0.2210 0.3800 0.2527 0.0451  0.0163  -0.0184 77  LEU B CD1 
301  C  CD2 . LEU A 58  ? 0.2140 0.3784 0.2435 0.0531  0.0188  -0.0215 77  LEU B CD2 
302  N  N   . VAL A 59  ? 0.4806 0.6917 0.5216 0.0276  0.0197  -0.0231 78  VAL B N   
303  C  CA  . VAL A 59  ? 0.4689 0.6897 0.5122 0.0179  0.0201  -0.0223 78  VAL B CA  
304  C  C   . VAL A 59  ? 0.4541 0.6597 0.4959 0.0106  0.0200  -0.0181 78  VAL B C   
305  O  O   . VAL A 59  ? 0.4550 0.6469 0.4944 0.0134  0.0206  -0.0167 78  VAL B O   
306  C  CB  . VAL A 59  ? 0.4646 0.6976 0.5083 0.0196  0.0216  -0.0249 78  VAL B CB  
307  C  CG1 . VAL A 59  ? 0.4597 0.7068 0.5058 0.0097  0.0220  -0.0248 78  VAL B CG1 
308  C  CG2 . VAL A 59  ? 0.4776 0.7220 0.5218 0.0295  0.0216  -0.0292 78  VAL B CG2 
309  N  N   . PRO A 60  ? 0.1755 0.3836 0.2186 0.0013  0.0192  -0.0162 79  PRO B N   
310  C  CA  . PRO A 60  ? 0.1556 0.3501 0.1972 -0.0058 0.0189  -0.0121 79  PRO B CA  
311  C  C   . PRO A 60  ? 0.1522 0.3454 0.1924 -0.0078 0.0202  -0.0112 79  PRO B C   
312  O  O   . PRO A 60  ? 0.1564 0.3636 0.1975 -0.0100 0.0212  -0.0128 79  PRO B O   
313  C  CB  . PRO A 60  ? 0.1573 0.3591 0.2003 -0.0152 0.0181  -0.0111 79  PRO B CB  
314  C  CG  . PRO A 60  ? 0.1640 0.3789 0.2094 -0.0121 0.0175  -0.0144 79  PRO B CG  
315  C  CD  . PRO A 60  ? 0.1745 0.3981 0.2203 -0.0030 0.0185  -0.0179 79  PRO B CD  
316  N  N   . ASN A 61  ? 0.1732 0.3504 0.2113 -0.0070 0.0202  -0.0088 80  ASN B N   
317  C  CA  . ASN A 61  ? 0.1702 0.3449 0.2068 -0.0093 0.0212  -0.0076 80  ASN B CA  
318  C  C   . ASN A 61  ? 0.1606 0.3307 0.1962 -0.0188 0.0203  -0.0038 80  ASN B C   
319  O  O   . ASN A 61  ? 0.1551 0.3125 0.1899 -0.0208 0.0190  -0.0012 80  ASN B O   
320  C  CB  . ASN A 61  ? 0.1684 0.3288 0.2030 -0.0031 0.0217  -0.0074 80  ASN B CB  
321  C  CG  . ASN A 61  ? 0.1575 0.3166 0.1906 -0.0046 0.0228  -0.0069 80  ASN B CG  
322  O  OD1 . ASN A 61  ? 0.1668 0.3336 0.2000 -0.0108 0.0230  -0.0060 80  ASN B OD1 
323  N  ND2 . ASN A 61  ? 0.1590 0.3081 0.1905 0.0009  0.0236  -0.0076 80  ASN B ND2 
324  N  N   . TYR A 62  ? 0.1571 0.3377 0.1925 -0.0246 0.0210  -0.0036 81  TYR B N   
325  C  CA  . TYR A 62  ? 0.1705 0.3469 0.2041 -0.0339 0.0203  0.0002  81  TYR B CA  
326  C  C   . TYR A 62  ? 0.1660 0.3383 0.1972 -0.0357 0.0209  0.0020  81  TYR B C   
327  O  O   . TYR A 62  ? 0.1566 0.3277 0.1855 -0.0432 0.0204  0.0050  81  TYR B O   
328  C  CB  . TYR A 62  ? 0.1721 0.3630 0.2065 -0.0411 0.0205  -0.0003 81  TYR B CB  
329  C  CG  . TYR A 62  ? 0.1681 0.3607 0.2042 -0.0420 0.0194  -0.0010 81  TYR B CG  
330  C  CD1 . TYR A 62  ? 0.1693 0.3489 0.2041 -0.0460 0.0177  0.0020  81  TYR B CD1 
331  C  CD2 . TYR A 62  ? 0.1676 0.3752 0.2067 -0.0386 0.0199  -0.0050 81  TYR B CD2 
332  C  CE1 . TYR A 62  ? 0.1736 0.3547 0.2099 -0.0470 0.0168  0.0010  81  TYR B CE1 
333  C  CE2 . TYR A 62  ? 0.1674 0.3773 0.2081 -0.0395 0.0188  -0.0059 81  TYR B CE2 
334  C  CZ  . TYR A 62  ? 0.1734 0.3698 0.2127 -0.0439 0.0173  -0.0029 81  TYR B CZ  
335  O  OH  . TYR A 62  ? 0.1699 0.3685 0.2106 -0.0449 0.0162  -0.0040 81  TYR B OH  
336  N  N   . ASN A 63  ? 0.3658 0.5355 0.3969 -0.0288 0.0218  0.0001  82  ASN B N   
337  C  CA  . ASN A 63  ? 0.3596 0.5257 0.3885 -0.0297 0.0224  0.0012  82  ASN B CA  
338  C  C   . ASN A 63  ? 0.3640 0.5172 0.3905 -0.0351 0.0208  0.0057  82  ASN B C   
339  O  O   . ASN A 63  ? 0.3662 0.5060 0.3926 -0.0326 0.0197  0.0069  82  ASN B O   
340  C  CB  . ASN A 63  ? 0.3565 0.5175 0.3854 -0.0213 0.0234  -0.0013 82  ASN B CB  
341  C  CG  . ASN A 63  ? 0.3600 0.5192 0.3870 -0.0220 0.0242  -0.0009 82  ASN B CG  
342  O  OD1 . ASN A 63  ? 0.3611 0.5239 0.3865 -0.0285 0.0240  0.0012  82  ASN B OD1 
343  N  ND2 . ASN A 63  ? 0.3547 0.5079 0.3812 -0.0155 0.0251  -0.0030 82  ASN B ND2 
344  N  N   . PRO A 64  ? 0.2028 0.3599 0.2271 -0.0424 0.0207  0.0081  83  PRO B N   
345  C  CA  . PRO A 64  ? 0.2009 0.3463 0.2221 -0.0478 0.0190  0.0126  83  PRO B CA  
346  C  C   . PRO A 64  ? 0.2027 0.3366 0.2230 -0.0436 0.0186  0.0132  83  PRO B C   
347  O  O   . PRO A 64  ? 0.2095 0.3319 0.2279 -0.0459 0.0169  0.0165  83  PRO B O   
348  C  CB  . PRO A 64  ? 0.2167 0.3715 0.2352 -0.0551 0.0197  0.0141  83  PRO B CB  
349  C  CG  . PRO A 64  ? 0.2117 0.3816 0.2321 -0.0518 0.0219  0.0100  83  PRO B CG  
350  C  CD  . PRO A 64  ? 0.2042 0.3776 0.2284 -0.0462 0.0222  0.0067  83  PRO B CD  
351  N  N   . ASP A 65  ? 0.2274 0.3647 0.2489 -0.0376 0.0201  0.0099  84  ASP B N   
352  C  CA  . ASP A 65  ? 0.2282 0.3561 0.2491 -0.0338 0.0201  0.0099  84  ASP B CA  
353  C  C   . ASP A 65  ? 0.2261 0.3411 0.2483 -0.0296 0.0191  0.0101  84  ASP B C   
354  O  O   . ASP A 65  ? 0.2233 0.3291 0.2449 -0.0274 0.0188  0.0104  84  ASP B O   
355  C  CB  . ASP A 65  ? 0.2276 0.3626 0.2490 -0.0287 0.0222  0.0059  84  ASP B CB  
356  C  CG  . ASP A 65  ? 0.2258 0.3714 0.2454 -0.0326 0.0231  0.0058  84  ASP B CG  
357  O  OD1 . ASP A 65  ? 0.2384 0.3827 0.2556 -0.0389 0.0219  0.0093  84  ASP B OD1 
358  O  OD2 . ASP A 65  ? 0.2142 0.3693 0.2345 -0.0292 0.0249  0.0022  84  ASP B OD2 
359  N  N   . ILE A 66  ? 0.1663 0.2812 0.1901 -0.0288 0.0187  0.0097  85  ILE B N   
360  C  CA  . ILE A 66  ? 0.1512 0.2551 0.1762 -0.0246 0.0181  0.0095  85  ILE B CA  
361  C  C   . ILE A 66  ? 0.1464 0.2443 0.1713 -0.0286 0.0161  0.0123  85  ILE B C   
362  O  O   . ILE A 66  ? 0.1493 0.2540 0.1742 -0.0328 0.0158  0.0129  85  ILE B O   
363  C  CB  . ILE A 66  ? 0.1553 0.2631 0.1820 -0.0181 0.0194  0.0059  85  ILE B CB  
364  C  CG1 . ILE A 66  ? 0.1577 0.2719 0.1841 -0.0141 0.0214  0.0029  85  ILE B CG1 
365  C  CG2 . ILE A 66  ? 0.1573 0.2531 0.1846 -0.0137 0.0190  0.0057  85  ILE B CG2 
366  C  CD1 . ILE A 66  ? 0.1579 0.2757 0.1852 -0.0072 0.0227  -0.0007 85  ILE B CD1 
367  N  N   . ILE A 67  ? 0.2214 0.3068 0.2462 -0.0272 0.0149  0.0137  86  ILE B N   
368  C  CA  . ILE A 67  ? 0.2204 0.2985 0.2451 -0.0299 0.0131  0.0158  86  ILE B CA  
369  C  C   . ILE A 67  ? 0.2257 0.3021 0.2525 -0.0254 0.0134  0.0137  86  ILE B C   
370  O  O   . ILE A 67  ? 0.2252 0.2977 0.2528 -0.0197 0.0144  0.0118  86  ILE B O   
371  C  CB  . ILE A 67  ? 0.2228 0.2886 0.2463 -0.0305 0.0114  0.0183  86  ILE B CB  
372  C  CG1 . ILE A 67  ? 0.2291 0.2960 0.2498 -0.0351 0.0107  0.0208  86  ILE B CG1 
373  C  CG2 . ILE A 67  ? 0.2229 0.2804 0.2463 -0.0322 0.0096  0.0200  86  ILE B CG2 
374  C  CD1 . ILE A 67  ? 0.2248 0.2806 0.2442 -0.0351 0.0089  0.0231  86  ILE B CD1 
375  N  N   . PHE A 68  ? 0.2157 0.2949 0.2429 -0.0281 0.0126  0.0140  87  PHE B N   
376  C  CA  . PHE A 68  ? 0.2169 0.2950 0.2458 -0.0242 0.0127  0.0122  87  PHE B CA  
377  C  C   . PHE A 68  ? 0.2355 0.3038 0.2641 -0.0265 0.0108  0.0140  87  PHE B C   
378  O  O   . PHE A 68  ? 0.2433 0.3129 0.2710 -0.0322 0.0097  0.0156  87  PHE B O   
379  C  CB  . PHE A 68  ? 0.2264 0.3179 0.2565 -0.0243 0.0135  0.0100  87  PHE B CB  
380  C  CG  . PHE A 68  ? 0.2250 0.3256 0.2557 -0.0198 0.0154  0.0073  87  PHE B CG  
381  C  CD1 . PHE A 68  ? 0.2305 0.3296 0.2618 -0.0124 0.0164  0.0048  87  PHE B CD1 
382  C  CD2 . PHE A 68  ? 0.2248 0.3350 0.2550 -0.0230 0.0162  0.0072  87  PHE B CD2 
383  C  CE1 . PHE A 68  ? 0.2328 0.3392 0.2641 -0.0079 0.0181  0.0022  87  PHE B CE1 
384  C  CE2 . PHE A 68  ? 0.2240 0.3426 0.2547 -0.0186 0.0179  0.0044  87  PHE B CE2 
385  C  CZ  . PHE A 68  ? 0.2294 0.3457 0.2605 -0.0109 0.0189  0.0019  87  PHE B CZ  
386  N  N   . LYS A 69  ? 0.2427 0.3010 0.2717 -0.0222 0.0106  0.0137  88  LYS B N   
387  C  CA  . LYS A 69  ? 0.2457 0.2942 0.2745 -0.0233 0.0090  0.0150  88  LYS B CA  
388  C  C   . LYS A 69  ? 0.2530 0.3057 0.2822 -0.0264 0.0082  0.0147  88  LYS B C   
389  O  O   . LYS A 69  ? 0.2721 0.3214 0.2999 -0.0317 0.0066  0.0167  88  LYS B O   
390  C  CB  . LYS A 69  ? 0.2387 0.2795 0.2685 -0.0173 0.0095  0.0136  88  LYS B CB  
391  C  CG  . LYS A 69  ? 0.2419 0.2721 0.2716 -0.0178 0.0079  0.0147  88  LYS B CG  
392  C  CD  . LYS A 69  ? 0.2429 0.2668 0.2734 -0.0120 0.0089  0.0131  88  LYS B CD  
393  C  CE  . LYS A 69  ? 0.2532 0.2673 0.2838 -0.0123 0.0074  0.0139  88  LYS B CE  
394  N  NZ  . LYS A 69  ? 0.2627 0.2713 0.2924 -0.0157 0.0057  0.0162  88  LYS B NZ  
395  N  N   . ASP A 70  ? 0.3229 0.3829 0.3535 -0.0229 0.0092  0.0121  89  ASP B N   
396  C  CA  . ASP A 70  ? 0.3309 0.3966 0.3621 -0.0252 0.0085  0.0112  89  ASP B CA  
397  C  C   . ASP A 70  ? 0.3361 0.3919 0.3665 -0.0281 0.0067  0.0125  89  ASP B C   
398  O  O   . ASP A 70  ? 0.3454 0.4022 0.3749 -0.0344 0.0056  0.0137  89  ASP B O   
399  C  CB  . ASP A 70  ? 0.3395 0.4171 0.3706 -0.0309 0.0088  0.0113  89  ASP B CB  
400  C  CG  . ASP A 70  ? 0.3525 0.4380 0.3845 -0.0334 0.0083  0.0097  89  ASP B CG  
401  O  OD1 . ASP A 70  ? 0.3579 0.4465 0.3915 -0.0282 0.0086  0.0073  89  ASP B OD1 
402  O  OD2 . ASP A 70  ? 0.3492 0.4380 0.3803 -0.0406 0.0076  0.0108  89  ASP B OD2 
403  N  N   . GLU A 71  ? 0.2520 0.2982 0.2828 -0.0238 0.0065  0.0123  90  GLU B N   
404  C  CA  . GLU A 71  ? 0.2527 0.2893 0.2827 -0.0256 0.0048  0.0131  90  GLU B CA  
405  C  C   . GLU A 71  ? 0.2594 0.3014 0.2903 -0.0262 0.0045  0.0112  90  GLU B C   
406  O  O   . GLU A 71  ? 0.2812 0.3172 0.3114 -0.0287 0.0031  0.0115  90  GLU B O   
407  C  CB  . GLU A 71  ? 0.2484 0.2744 0.2788 -0.0207 0.0049  0.0130  90  GLU B CB  
408  C  CG  . GLU A 71  ? 0.2483 0.2757 0.2797 -0.0144 0.0062  0.0106  90  GLU B CG  
409  C  CD  . GLU A 71  ? 0.2415 0.2740 0.2732 -0.0101 0.0082  0.0096  90  GLU B CD  
410  O  OE1 . GLU A 71  ? 0.2333 0.2703 0.2648 -0.0122 0.0086  0.0103  90  GLU B OE1 
411  O  OE2 . GLU A 71  ? 0.2402 0.2717 0.2718 -0.0047 0.0094  0.0079  90  GLU B OE2 
412  N  N   . GLU A 72  ? 0.2890 0.3424 0.3211 -0.0236 0.0057  0.0091  91  GLU B N   
413  C  CA  . GLU A 72  ? 0.2897 0.3501 0.3227 -0.0236 0.0053  0.0069  91  GLU B CA  
414  C  C   . GLU A 72  ? 0.2947 0.3638 0.3276 -0.0310 0.0047  0.0070  91  GLU B C   
415  O  O   . GLU A 72  ? 0.3005 0.3751 0.3340 -0.0327 0.0041  0.0053  91  GLU B O   
416  C  CB  . GLU A 72  ? 0.3042 0.3735 0.3383 -0.0170 0.0067  0.0045  91  GLU B CB  
417  C  CG  . GLU A 72  ? 0.2996 0.3607 0.3331 -0.0099 0.0077  0.0042  91  GLU B CG  
418  C  CD  . GLU A 72  ? 0.2819 0.3415 0.3150 -0.0079 0.0090  0.0050  91  GLU B CD  
419  O  OE1 . GLU A 72  ? 0.2774 0.3434 0.3107 -0.0115 0.0092  0.0057  91  GLU B OE1 
420  O  OE2 . GLU A 72  ? 0.2855 0.3376 0.3178 -0.0029 0.0100  0.0049  91  GLU B OE2 
421  N  N   . ASN A 73  ? 0.4306 0.5011 0.4625 -0.0356 0.0049  0.0089  92  ASN B N   
422  C  CA  . ASN A 73  ? 0.4399 0.5189 0.4713 -0.0432 0.0047  0.0091  92  ASN B CA  
423  C  C   . ASN A 73  ? 0.4433 0.5387 0.4770 -0.0420 0.0055  0.0059  92  ASN B C   
424  O  O   . ASN A 73  ? 0.4421 0.5451 0.4760 -0.0477 0.0051  0.0049  92  ASN B O   
425  C  CB  . ASN A 73  ? 0.4420 0.5125 0.4715 -0.0493 0.0030  0.0103  92  ASN B CB  
426  C  CG  . ASN A 73  ? 0.4535 0.5074 0.4806 -0.0493 0.0019  0.0131  92  ASN B CG  
427  O  OD1 . ASN A 73  ? 0.4510 0.5014 0.4764 -0.0512 0.0019  0.0156  92  ASN B OD1 
428  N  ND2 . ASN A 73  ? 0.4565 0.5008 0.4836 -0.0468 0.0008  0.0127  92  ASN B ND2 
429  N  N   . SER A 74  ? 0.3373 0.4379 0.3725 -0.0344 0.0067  0.0041  93  SER B N   
430  C  CA  . SER A 74  ? 0.3401 0.4563 0.3775 -0.0316 0.0073  0.0009  93  SER B CA  
431  C  C   . SER A 74  ? 0.3360 0.4626 0.3741 -0.0298 0.0089  0.0002  93  SER B C   
432  O  O   . SER A 74  ? 0.3412 0.4832 0.3809 -0.0310 0.0094  -0.0020 93  SER B O   
433  C  CB  . SER A 74  ? 0.3381 0.4519 0.3760 -0.0233 0.0072  -0.0009 93  SER B CB  
434  O  OG  . SER A 74  ? 0.3421 0.4472 0.3791 -0.0170 0.0081  -0.0001 93  SER B OG  
435  N  N   . GLY A 75  ? 0.1953 0.3139 0.2322 -0.0270 0.0096  0.0018  94  GLY B N   
436  C  CA  . GLY A 75  ? 0.1898 0.3167 0.2271 -0.0247 0.0111  0.0011  94  GLY B CA  
437  C  C   . GLY A 75  ? 0.1946 0.3220 0.2323 -0.0151 0.0121  -0.0011 94  GLY B C   
438  O  O   . GLY A 75  ? 0.1858 0.3226 0.2240 -0.0117 0.0133  -0.0029 94  GLY B O   
439  N  N   . ALA A 76  ? 0.4768 0.5934 0.5137 -0.0107 0.0116  -0.0009 95  ALA B N   
440  C  CA  . ALA A 76  ? 0.4636 0.5785 0.4999 -0.0017 0.0124  -0.0026 95  ALA B CA  
441  C  C   . ALA A 76  ? 0.4663 0.5766 0.5014 0.0017  0.0139  -0.0022 95  ALA B C   
442  O  O   . ALA A 76  ? 0.4728 0.5859 0.5071 0.0084  0.0151  -0.0041 95  ALA B O   
443  C  CB  . ALA A 76  ? 0.4612 0.5643 0.4965 0.0012  0.0117  -0.0021 95  ALA B CB  
444  N  N   . ASP A 77  ? 0.3160 0.4192 0.3506 -0.0030 0.0139  0.0002  96  ASP B N   
445  C  CA  . ASP A 77  ? 0.3023 0.4001 0.3356 -0.0005 0.0152  0.0005  96  ASP B CA  
446  C  C   . ASP A 77  ? 0.3080 0.4178 0.3417 -0.0004 0.0164  -0.0009 96  ASP B C   
447  O  O   . ASP A 77  ? 0.3251 0.4337 0.3577 0.0045  0.0178  -0.0021 96  ASP B O   
448  C  CB  . ASP A 77  ? 0.3090 0.3960 0.3417 -0.0053 0.0145  0.0035  96  ASP B CB  
449  C  CG  . ASP A 77  ? 0.3122 0.3872 0.3446 -0.0048 0.0135  0.0046  96  ASP B CG  
450  O  OD1 . ASP A 77  ? 0.3185 0.3921 0.3508 0.0001  0.0137  0.0031  96  ASP B OD1 
451  O  OD2 . ASP A 77  ? 0.2990 0.3662 0.3311 -0.0090 0.0124  0.0069  96  ASP B OD2 
452  N  N   . ARG A 78  ? 0.2101 0.3312 0.2451 -0.0060 0.0159  -0.0009 97  ARG B N   
453  C  CA  . ARG A 78  ? 0.2061 0.3400 0.2415 -0.0066 0.0171  -0.0024 97  ARG B CA  
454  C  C   . ARG A 78  ? 0.2120 0.3555 0.2481 0.0009  0.0179  -0.0060 97  ARG B C   
455  O  O   . ARG A 78  ? 0.2173 0.3690 0.2534 0.0034  0.0192  -0.0079 97  ARG B O   
456  C  CB  . ARG A 78  ? 0.2063 0.3501 0.2426 -0.0151 0.0165  -0.0015 97  ARG B CB  
457  C  CG  . ARG A 78  ? 0.2090 0.3431 0.2438 -0.0223 0.0157  0.0022  97  ARG B CG  
458  C  CD  . ARG A 78  ? 0.2028 0.3461 0.2374 -0.0310 0.0154  0.0032  97  ARG B CD  
459  N  NE  . ARG A 78  ? 0.2043 0.3371 0.2365 -0.0373 0.0145  0.0071  97  ARG B NE  
460  C  CZ  . ARG A 78  ? 0.2142 0.3456 0.2447 -0.0392 0.0150  0.0087  97  ARG B CZ  
461  N  NH1 . ARG A 78  ? 0.2159 0.3556 0.2469 -0.0357 0.0166  0.0066  97  ARG B NH1 
462  N  NH2 . ARG A 78  ? 0.2114 0.3329 0.2393 -0.0445 0.0138  0.0122  97  ARG B NH2 
463  N  N   . LEU A 79  ? 0.2590 0.4015 0.2954 0.0048  0.0172  -0.0070 98  LEU B N   
464  C  CA  . LEU A 79  ? 0.2788 0.4298 0.3153 0.0125  0.0176  -0.0103 98  LEU B CA  
465  C  C   . LEU A 79  ? 0.2923 0.4338 0.3261 0.0207  0.0188  -0.0110 98  LEU B C   
466  O  O   . LEU A 79  ? 0.2838 0.4105 0.3158 0.0222  0.0189  -0.0094 98  LEU B O   
467  C  CB  . LEU A 79  ? 0.2777 0.4311 0.3151 0.0138  0.0162  -0.0110 98  LEU B CB  
468  C  CG  . LEU A 79  ? 0.2739 0.4411 0.3140 0.0070  0.0153  -0.0116 98  LEU B CG  
469  C  CD1 . LEU A 79  ? 0.2903 0.4575 0.3310 0.0078  0.0138  -0.0122 98  LEU B CD1 
470  C  CD2 . LEU A 79  ? 0.2839 0.4695 0.3257 0.0086  0.0161  -0.0147 98  LEU B CD2 
471  N  N   . MET A 80  ? 0.2803 0.4304 0.3137 0.0258  0.0199  -0.0137 99  MET B N   
472  C  CA  . MET A 80  ? 0.2852 0.4265 0.3154 0.0334  0.0213  -0.0147 99  MET B CA  
473  C  C   . MET A 80  ? 0.2992 0.4530 0.3292 0.0398  0.0220  -0.0183 99  MET B C   
474  O  O   . MET A 80  ? 0.3021 0.4720 0.3348 0.0371  0.0218  -0.0198 99  MET B O   
475  C  CB  . MET A 80  ? 0.2759 0.4075 0.3050 0.0301  0.0223  -0.0131 99  MET B CB  
476  C  CG  . MET A 80  ? 0.2823 0.4251 0.3129 0.0257  0.0230  -0.0137 99  MET B CG  
477  S  SD  . MET A 80  ? 0.2715 0.4036 0.3009 0.0206  0.0237  -0.0113 99  MET B SD  
478  C  CE  . MET A 80  ? 0.2464 0.3696 0.2770 0.0134  0.0219  -0.0074 99  MET B CE  
479  N  N   . THR A 81  ? 0.2114 0.3577 0.2378 0.0482  0.0229  -0.0197 100 THR B N   
480  C  CA  . THR A 81  ? 0.2136 0.3699 0.2390 0.0555  0.0236  -0.0233 100 THR B CA  
481  C  C   . THR A 81  ? 0.2117 0.3751 0.2382 0.0526  0.0249  -0.0244 100 THR B C   
482  O  O   . THR A 81  ? 0.2071 0.3640 0.2339 0.0463  0.0254  -0.0223 100 THR B O   
483  C  CB  . THR A 81  ? 0.2082 0.3519 0.2284 0.0651  0.0243  -0.0242 100 THR B CB  
484  O  OG1 . THR A 81  ? 0.2173 0.3471 0.2349 0.0642  0.0259  -0.0232 100 THR B OG1 
485  C  CG2 . THR A 81  ? 0.2026 0.3376 0.2212 0.0675  0.0232  -0.0226 100 THR B CG2 
486  N  N   . GLU A 82  ? 0.5246 0.7015 0.5515 0.0574  0.0253  -0.0279 101 GLU B N   
487  C  CA  . GLU A 82  ? 0.5443 0.7301 0.5723 0.0548  0.0265  -0.0294 101 GLU B CA  
488  C  C   . GLU A 82  ? 0.5351 0.7064 0.5596 0.0559  0.0281  -0.0289 101 GLU B C   
489  O  O   . GLU A 82  ? 0.5166 0.6880 0.5420 0.0494  0.0288  -0.0277 101 GLU B O   
490  C  CB  . GLU A 82  ? 0.5615 0.7642 0.5903 0.0614  0.0268  -0.0338 101 GLU B CB  
491  C  CG  . GLU A 82  ? 0.5889 0.8060 0.6200 0.0570  0.0279  -0.0356 101 GLU B CG  
492  C  CD  . GLU A 82  ? 0.6487 0.8815 0.6803 0.0647  0.0283  -0.0404 101 GLU B CD  
493  O  OE1 . GLU A 82  ? 0.6590 0.8847 0.6868 0.0744  0.0287  -0.0425 101 GLU B OE1 
494  O  OE2 . GLU A 82  ? 0.6675 0.9197 0.7029 0.0610  0.0283  -0.0422 101 GLU B OE2 
495  N  N   . ARG A 83  ? 0.5507 0.7096 0.5709 0.0639  0.0287  -0.0298 102 ARG B N   
496  C  CA  . ARG A 83  ? 0.5368 0.6810 0.5532 0.0650  0.0303  -0.0296 102 ARG B CA  
497  C  C   . ARG A 83  ? 0.5286 0.6616 0.5458 0.0570  0.0302  -0.0259 102 ARG B C   
498  O  O   . ARG A 83  ? 0.5239 0.6520 0.5404 0.0538  0.0312  -0.0256 102 ARG B O   
499  C  CB  . ARG A 83  ? 0.5485 0.6796 0.5595 0.0744  0.0309  -0.0308 102 ARG B CB  
500  C  CG  . ARG A 83  ? 0.5494 0.6643 0.5562 0.0751  0.0327  -0.0308 102 ARG B CG  
501  C  CD  . ARG A 83  ? 0.5590 0.6605 0.5595 0.0843  0.0334  -0.0319 102 ARG B CD  
502  N  NE  . ARG A 83  ? 0.5762 0.6626 0.5723 0.0845  0.0354  -0.0323 102 ARG B NE  
503  C  CZ  . ARG A 83  ? 0.6073 0.6942 0.6009 0.0880  0.0368  -0.0355 102 ARG B CZ  
504  N  NH1 . ARG A 83  ? 0.6069 0.7091 0.6020 0.0919  0.0365  -0.0385 102 ARG B NH1 
505  N  NH2 . ARG A 83  ? 0.6022 0.6748 0.5918 0.0875  0.0386  -0.0359 102 ARG B NH2 
506  N  N   . CYS A 84  ? 0.2855 0.4149 0.3042 0.0540  0.0288  -0.0233 103 CYS B N   
507  C  CA  . CYS A 84  ? 0.2724 0.3920 0.2920 0.0467  0.0284  -0.0198 103 CYS B CA  
508  C  C   . CYS A 84  ? 0.2675 0.3957 0.2900 0.0388  0.0283  -0.0189 103 CYS B C   
509  O  O   . CYS A 84  ? 0.2622 0.3832 0.2839 0.0354  0.0289  -0.0178 103 CYS B O   
510  C  CB  . CYS A 84  ? 0.2741 0.3909 0.2951 0.0448  0.0267  -0.0175 103 CYS B CB  
511  S  SG  . CYS A 84  ? 0.2323 0.3333 0.2534 0.0387  0.0263  -0.0138 103 CYS B SG  
512  N  N   . LYS A 85  ? 0.5529 0.6967 0.5784 0.0357  0.0275  -0.0193 104 LYS B N   
513  C  CA  . LYS A 85  ? 0.5436 0.6964 0.5712 0.0280  0.0275  -0.0184 104 LYS B CA  
514  C  C   . LYS A 85  ? 0.5377 0.6890 0.5635 0.0285  0.0290  -0.0196 104 LYS B C   
515  O  O   . LYS A 85  ? 0.5358 0.6806 0.5612 0.0232  0.0290  -0.0174 104 LYS B O   
516  C  CB  . LYS A 85  ? 0.5565 0.7284 0.5869 0.0266  0.0271  -0.0202 104 LYS B CB  
517  C  CG  . LYS A 85  ? 0.5702 0.7461 0.6030 0.0223  0.0255  -0.0185 104 LYS B CG  
518  C  CD  . LYS A 85  ? 0.5790 0.7746 0.6146 0.0186  0.0254  -0.0201 104 LYS B CD  
519  C  CE  . LYS A 85  ? 0.5876 0.7881 0.6255 0.0144  0.0239  -0.0190 104 LYS B CE  
520  N  NZ  . LYS A 85  ? 0.5865 0.8061 0.6270 0.0089  0.0241  -0.0204 104 LYS B NZ  
521  N  N   . GLU A 86  ? 0.3199 0.4779 0.3446 0.0349  0.0302  -0.0234 105 GLU B N   
522  C  CA  . GLU A 86  ? 0.3274 0.4848 0.3501 0.0360  0.0318  -0.0253 105 GLU B CA  
523  C  C   . GLU A 86  ? 0.3286 0.4691 0.3490 0.0345  0.0322  -0.0234 105 GLU B C   
524  O  O   . GLU A 86  ? 0.3235 0.4636 0.3436 0.0301  0.0327  -0.0228 105 GLU B O   
525  C  CB  . GLU A 86  ? 0.3462 0.5067 0.3667 0.0455  0.0330  -0.0296 105 GLU B CB  
526  C  CG  . GLU A 86  ? 0.3628 0.5408 0.3858 0.0485  0.0324  -0.0320 105 GLU B CG  
527  C  CD  . GLU A 86  ? 0.3713 0.5658 0.3958 0.0467  0.0334  -0.0346 105 GLU B CD  
528  O  OE1 . GLU A 86  ? 0.3759 0.5849 0.4037 0.0411  0.0328  -0.0341 105 GLU B OE1 
529  O  OE2 . GLU A 86  ? 0.3744 0.5672 0.3964 0.0509  0.0349  -0.0373 105 GLU B OE2 
530  N  N   . ARG A 87  ? 0.3859 0.5130 0.4046 0.0382  0.0320  -0.0226 106 ARG B N   
531  C  CA  . ARG A 87  ? 0.3748 0.4859 0.3912 0.0373  0.0326  -0.0213 106 ARG B CA  
532  C  C   . ARG A 87  ? 0.3475 0.4561 0.3662 0.0289  0.0314  -0.0176 106 ARG B C   
533  O  O   . ARG A 87  ? 0.3362 0.4412 0.3543 0.0255  0.0318  -0.0171 106 ARG B O   
534  C  CB  . ARG A 87  ? 0.3807 0.4792 0.3947 0.0426  0.0327  -0.0211 106 ARG B CB  
535  C  CG  . ARG A 87  ? 0.3885 0.4727 0.3983 0.0461  0.0345  -0.0224 106 ARG B CG  
536  C  CD  . ARG A 87  ? 0.3904 0.4750 0.3966 0.0544  0.0358  -0.0261 106 ARG B CD  
537  N  NE  . ARG A 87  ? 0.4100 0.5064 0.4167 0.0545  0.0365  -0.0288 106 ARG B NE  
538  C  CZ  . ARG A 87  ? 0.4448 0.5531 0.4518 0.0594  0.0365  -0.0314 106 ARG B CZ  
539  N  NH1 . ARG A 87  ? 0.4497 0.5597 0.4563 0.0648  0.0357  -0.0317 106 ARG B NH1 
540  N  NH2 . ARG A 87  ? 0.4460 0.5652 0.4537 0.0592  0.0372  -0.0339 106 ARG B NH2 
541  N  N   . VAL A 88  ? 0.2609 0.3712 0.2818 0.0259  0.0298  -0.0152 107 VAL B N   
542  C  CA  . VAL A 88  ? 0.2559 0.3628 0.2784 0.0185  0.0283  -0.0116 107 VAL B CA  
543  C  C   . VAL A 88  ? 0.2521 0.3679 0.2754 0.0127  0.0282  -0.0109 107 VAL B C   
544  O  O   . VAL A 88  ? 0.2362 0.3464 0.2591 0.0086  0.0279  -0.0091 107 VAL B O   
545  C  CB  . VAL A 88  ? 0.2431 0.3525 0.2678 0.0162  0.0266  -0.0096 107 VAL B CB  
546  C  CG1 . VAL A 88  ? 0.2414 0.3417 0.2667 0.0106  0.0252  -0.0061 107 VAL B CG1 
547  C  CG2 . VAL A 88  ? 0.2635 0.3690 0.2873 0.0228  0.0268  -0.0110 107 VAL B CG2 
548  N  N   . ASN A 89  ? 0.2608 0.3910 0.2852 0.0122  0.0285  -0.0124 108 ASN B N   
549  C  CA  . ASN A 89  ? 0.2461 0.3862 0.2708 0.0066  0.0286  -0.0118 108 ASN B CA  
550  C  C   . ASN A 89  ? 0.2477 0.3834 0.2703 0.0072  0.0298  -0.0129 108 ASN B C   
551  O  O   . ASN A 89  ? 0.2509 0.3880 0.2731 0.0016  0.0294  -0.0111 108 ASN B O   
552  C  CB  . ASN A 89  ? 0.2523 0.4092 0.2782 0.0075  0.0293  -0.0144 108 ASN B CB  
553  C  CG  . ASN A 89  ? 0.2516 0.4148 0.2798 0.0054  0.0280  -0.0133 108 ASN B CG  
554  O  OD1 . ASN A 89  ? 0.2506 0.4071 0.2794 0.0011  0.0266  -0.0101 108 ASN B OD1 
555  N  ND2 . ASN A 89  ? 0.2583 0.4349 0.2878 0.0087  0.0286  -0.0163 108 ASN B ND2 
556  N  N   . ALA A 90  ? 0.2110 0.3410 0.2319 0.0139  0.0312  -0.0159 109 ALA B N   
557  C  CA  . ALA A 90  ? 0.2061 0.3310 0.2248 0.0147  0.0324  -0.0175 109 ALA B CA  
558  C  C   . ALA A 90  ? 0.2054 0.3175 0.2237 0.0114  0.0316  -0.0148 109 ALA B C   
559  O  O   . ALA A 90  ? 0.2037 0.3156 0.2214 0.0076  0.0315  -0.0141 109 ALA B O   
560  C  CB  . ALA A 90  ? 0.2066 0.3274 0.2230 0.0228  0.0342  -0.0214 109 ALA B CB  
561  N  N   . LEU A 91  ? 0.1701 0.2722 0.1887 0.0130  0.0309  -0.0134 110 LEU B N   
562  C  CA  . LEU A 91  ? 0.1598 0.2504 0.1785 0.0101  0.0301  -0.0110 110 LEU B CA  
563  C  C   . LEU A 91  ? 0.1566 0.2506 0.1768 0.0031  0.0281  -0.0074 110 LEU B C   
564  O  O   . LEU A 91  ? 0.1604 0.2490 0.1803 0.0001  0.0274  -0.0059 110 LEU B O   
565  C  CB  . LEU A 91  ? 0.1677 0.2483 0.1865 0.0133  0.0298  -0.0104 110 LEU B CB  
566  C  CG  . LEU A 91  ? 0.1593 0.2296 0.1789 0.0102  0.0286  -0.0077 110 LEU B CG  
567  C  CD1 . LEU A 91  ? 0.1567 0.2203 0.1750 0.0096  0.0296  -0.0088 110 LEU B CD1 
568  C  CD2 . LEU A 91  ? 0.2217 0.2841 0.2414 0.0133  0.0285  -0.0073 110 LEU B CD2 
569  N  N   . ALA A 92  ? 0.3576 0.4605 0.3791 0.0007  0.0272  -0.0060 111 ALA B N   
570  C  CA  . ALA A 92  ? 0.3605 0.4659 0.3826 -0.0062 0.0254  -0.0024 111 ALA B CA  
571  C  C   . ALA A 92  ? 0.3718 0.4814 0.3925 -0.0098 0.0255  -0.0020 111 ALA B C   
572  O  O   . ALA A 92  ? 0.3791 0.4843 0.3991 -0.0140 0.0240  0.0008  111 ALA B O   
573  C  CB  . ALA A 92  ? 0.3624 0.4778 0.3857 -0.0085 0.0248  -0.0017 111 ALA B CB  
574  N  N   . ILE A 93  ? 0.1961 0.3144 0.2160 -0.0077 0.0272  -0.0051 112 ILE B N   
575  C  CA  . ILE A 93  ? 0.1961 0.3192 0.2144 -0.0106 0.0276  -0.0054 112 ILE B CA  
576  C  C   . ILE A 93  ? 0.1950 0.3079 0.2122 -0.0093 0.0278  -0.0060 112 ILE B C   
577  O  O   . ILE A 93  ? 0.1958 0.3069 0.2121 -0.0133 0.0266  -0.0038 112 ILE B O   
578  C  CB  . ILE A 93  ? 0.2018 0.3366 0.2196 -0.0078 0.0296  -0.0092 112 ILE B CB  
579  C  CG1 . ILE A 93  ? 0.2069 0.3537 0.2261 -0.0094 0.0296  -0.0091 112 ILE B CG1 
580  C  CG2 . ILE A 93  ? 0.1990 0.3386 0.2148 -0.0107 0.0301  -0.0098 112 ILE B CG2 
581  C  CD1 . ILE A 93  ? 0.2272 0.3861 0.2465 -0.0055 0.0315  -0.0133 112 ILE B CD1 
582  N  N   . ALA A 94  ? 0.1740 0.2802 0.1911 -0.0037 0.0292  -0.0089 113 ALA B N   
583  C  CA  . ALA A 94  ? 0.1695 0.2661 0.1856 -0.0024 0.0297  -0.0101 113 ALA B CA  
584  C  C   . ALA A 94  ? 0.1666 0.2553 0.1834 -0.0060 0.0277  -0.0067 113 ALA B C   
585  O  O   . ALA A 94  ? 0.1736 0.2588 0.1898 -0.0074 0.0274  -0.0068 113 ALA B O   
586  C  CB  . ALA A 94  ? 0.1661 0.2551 0.1814 0.0037  0.0314  -0.0132 113 ALA B CB  
587  N  N   . VAL A 95  ? 0.2348 0.3212 0.2531 -0.0072 0.0262  -0.0038 114 VAL B N   
588  C  CA  . VAL A 95  ? 0.2410 0.3199 0.2600 -0.0101 0.0241  -0.0006 114 VAL B CA  
589  C  C   . VAL A 95  ? 0.2454 0.3289 0.2634 -0.0153 0.0224  0.0021  114 VAL B C   
590  O  O   . VAL A 95  ? 0.2557 0.3346 0.2733 -0.0167 0.0213  0.0031  114 VAL B O   
591  C  CB  . VAL A 95  ? 0.2416 0.3172 0.2622 -0.0102 0.0228  0.0016  114 VAL B CB  
592  C  CG1 . VAL A 95  ? 0.2364 0.3051 0.2575 -0.0133 0.0205  0.0050  114 VAL B CG1 
593  C  CG2 . VAL A 95  ? 0.2359 0.3056 0.2571 -0.0049 0.0243  -0.0007 114 VAL B CG2 
594  N  N   . MET A 96  ? 0.2756 0.3684 0.2929 -0.0181 0.0222  0.0032  115 MET B N   
595  C  CA  . MET A 96  ? 0.2797 0.3769 0.2950 -0.0234 0.0207  0.0062  115 MET B CA  
596  C  C   . MET A 96  ? 0.2857 0.3856 0.2994 -0.0236 0.0214  0.0044  115 MET B C   
597  O  O   . MET A 96  ? 0.2954 0.3927 0.3078 -0.0262 0.0197  0.0066  115 MET B O   
598  C  CB  . MET A 96  ? 0.2835 0.3911 0.2982 -0.0267 0.0210  0.0072  115 MET B CB  
599  C  CG  . MET A 96  ? 0.2889 0.3956 0.3053 -0.0265 0.0206  0.0081  115 MET B CG  
600  S  SD  . MET A 96  ? 0.2975 0.4166 0.3129 -0.0320 0.0206  0.0097  115 MET B SD  
601  C  CE  . MET A 96  ? 0.3238 0.4382 0.3357 -0.0389 0.0181  0.0150  115 MET B CE  
602  N  N   . ASN A 97  ? 0.2956 0.4010 0.3092 -0.0206 0.0238  0.0004  116 ASN B N   
603  C  CA  . ASN A 97  ? 0.3052 0.4134 0.3173 -0.0205 0.0247  -0.0019 116 ASN B CA  
604  C  C   . ASN A 97  ? 0.3100 0.4086 0.3224 -0.0194 0.0240  -0.0023 116 ASN B C   
605  O  O   . ASN A 97  ? 0.3160 0.4159 0.3270 -0.0209 0.0237  -0.0029 116 ASN B O   
606  C  CB  . ASN A 97  ? 0.3056 0.4192 0.3174 -0.0164 0.0274  -0.0067 116 ASN B CB  
607  C  CG  . ASN A 97  ? 0.3217 0.4469 0.3334 -0.0174 0.0281  -0.0068 116 ASN B CG  
608  O  OD1 . ASN A 97  ? 0.3232 0.4523 0.3348 -0.0217 0.0267  -0.0033 116 ASN B OD1 
609  N  ND2 . ASN A 97  ? 0.3275 0.4583 0.3390 -0.0134 0.0303  -0.0110 116 ASN B ND2 
610  N  N   . MET A 98  ? 0.2887 0.3784 0.3030 -0.0170 0.0238  -0.0022 117 MET B N   
611  C  CA  . MET A 98  ? 0.2902 0.3710 0.3052 -0.0158 0.0235  -0.0030 117 MET B CA  
612  C  C   . MET A 98  ? 0.3004 0.3784 0.3155 -0.0192 0.0205  0.0009  117 MET B C   
613  O  O   . MET A 98  ? 0.3242 0.4009 0.3390 -0.0199 0.0198  0.0002  117 MET B O   
614  C  CB  . MET A 98  ? 0.2888 0.3615 0.3055 -0.0121 0.0245  -0.0041 117 MET B CB  
615  C  CG  . MET A 98  ? 0.2979 0.3618 0.3155 -0.0110 0.0246  -0.0053 117 MET B CG  
616  S  SD  . MET A 98  ? 0.3030 0.3672 0.3189 -0.0101 0.0268  -0.0101 117 MET B SD  
617  C  CE  . MET A 98  ? 0.3193 0.3722 0.3366 -0.0085 0.0276  -0.0116 117 MET B CE  
618  N  N   . TRP A 99  ? 0.3712 0.4453 0.3874 -0.0198 0.0190  0.0040  118 TRP B N   
619  C  CA  . TRP A 99  ? 0.3779 0.4484 0.3938 -0.0225 0.0160  0.0079  118 TRP B CA  
620  C  C   . TRP A 99  ? 0.3894 0.4648 0.4031 -0.0264 0.0146  0.0116  118 TRP B C   
621  O  O   . TRP A 99  ? 0.3788 0.4545 0.3931 -0.0269 0.0147  0.0127  118 TRP B O   
622  C  CB  . TRP A 99  ? 0.3777 0.4390 0.3958 -0.0206 0.0152  0.0086  118 TRP B CB  
623  C  CG  . TRP A 99  ? 0.3738 0.4302 0.3938 -0.0170 0.0171  0.0050  118 TRP B CG  
624  C  CD1 . TRP A 99  ? 0.3742 0.4279 0.3947 -0.0165 0.0171  0.0031  118 TRP B CD1 
625  C  CD2 . TRP A 99  ? 0.3613 0.4145 0.3823 -0.0137 0.0193  0.0026  118 TRP B CD2 
626  N  NE1 . TRP A 99  ? 0.3701 0.4188 0.3918 -0.0136 0.0194  -0.0001 118 TRP B NE1 
627  C  CE2 . TRP A 99  ? 0.3653 0.4133 0.3871 -0.0116 0.0207  -0.0003 118 TRP B CE2 
628  C  CE3 . TRP A 99  ? 0.3507 0.4054 0.3718 -0.0124 0.0202  0.0027  118 TRP B CE3 
629  C  CZ2 . TRP A 99  ? 0.3643 0.4072 0.3863 -0.0083 0.0230  -0.0029 118 TRP B CZ2 
630  C  CZ3 . TRP A 99  ? 0.3492 0.3995 0.3708 -0.0085 0.0223  0.0002  118 TRP B CZ3 
631  C  CH2 . TRP A 99  ? 0.3545 0.3985 0.3763 -0.0065 0.0237  -0.0024 118 TRP B CH2 
632  N  N   . PRO A 100 ? 0.4729 0.5524 0.4840 -0.0296 0.0133  0.0135  119 PRO B N   
633  C  CA  . PRO A 100 ? 0.4760 0.5599 0.4840 -0.0341 0.0120  0.0173  119 PRO B CA  
634  C  C   . PRO A 100 ? 0.4775 0.5539 0.4852 -0.0356 0.0096  0.0212  119 PRO B C   
635  O  O   . PRO A 100 ? 0.4747 0.5430 0.4833 -0.0340 0.0079  0.0220  119 PRO B O   
636  C  CB  . PRO A 100 ? 0.4857 0.5725 0.4906 -0.0362 0.0107  0.0185  119 PRO B CB  
637  C  CG  . PRO A 100 ? 0.5036 0.5915 0.5103 -0.0329 0.0122  0.0140  119 PRO B CG  
638  C  CD  . PRO A 100 ? 0.4855 0.5659 0.4959 -0.0291 0.0130  0.0119  119 PRO B CD  
639  N  N   . GLY A 101 ? 0.3103 0.3896 0.3166 -0.0389 0.0097  0.0234  120 GLY B N   
640  C  CA  . GLY A 101 ? 0.3008 0.3729 0.3063 -0.0408 0.0076  0.0269  120 GLY B CA  
641  C  C   . GLY A 101 ? 0.3100 0.3775 0.3192 -0.0376 0.0084  0.0251  120 GLY B C   
642  O  O   . GLY A 101 ? 0.3065 0.3688 0.3155 -0.0391 0.0071  0.0273  120 GLY B O   
643  N  N   . VAL A 102 ? 0.3360 0.4050 0.3484 -0.0333 0.0105  0.0210  121 VAL B N   
644  C  CA  . VAL A 102 ? 0.3159 0.3804 0.3313 -0.0298 0.0113  0.0191  121 VAL B CA  
645  C  C   . VAL A 102 ? 0.3034 0.3753 0.3199 -0.0288 0.0136  0.0168  121 VAL B C   
646  O  O   . VAL A 102 ? 0.3045 0.3850 0.3203 -0.0290 0.0152  0.0150  121 VAL B O   
647  C  CB  . VAL A 102 ? 0.3120 0.3712 0.3297 -0.0253 0.0121  0.0162  121 VAL B CB  
648  C  CG1 . VAL A 102 ? 0.2941 0.3479 0.3143 -0.0219 0.0130  0.0147  121 VAL B CG1 
649  C  CG2 . VAL A 102 ? 0.3195 0.3730 0.3365 -0.0259 0.0098  0.0180  121 VAL B CG2 
650  N  N   . ARG A 103 ? 0.5127 0.5818 0.5310 -0.0275 0.0137  0.0166  122 ARG B N   
651  C  CA  . ARG A 103 ? 0.5081 0.5843 0.5276 -0.0260 0.0155  0.0143  122 ARG B CA  
652  C  C   . ARG A 103 ? 0.4942 0.5646 0.5160 -0.0214 0.0161  0.0125  122 ARG B C   
653  O  O   . ARG A 103 ? 0.4844 0.5460 0.5068 -0.0211 0.0147  0.0139  122 ARG B O   
654  C  CB  . ARG A 103 ? 0.4701 0.5525 0.4885 -0.0310 0.0148  0.0166  122 ARG B CB  
655  C  CG  . ARG A 103 ? 0.4730 0.5641 0.4888 -0.0353 0.0151  0.0176  122 ARG B CG  
656  C  CD  . ARG A 103 ? 0.4767 0.5712 0.4907 -0.0415 0.0141  0.0206  122 ARG B CD  
657  N  NE  . ARG A 103 ? 0.4783 0.5627 0.4922 -0.0428 0.0120  0.0232  122 ARG B NE  
658  C  CZ  . ARG A 103 ? 0.4801 0.5657 0.4939 -0.0462 0.0116  0.0243  122 ARG B CZ  
659  N  NH1 . ARG A 103 ? 0.4803 0.5776 0.4942 -0.0487 0.0130  0.0231  122 ARG B NH1 
660  N  NH2 . ARG A 103 ? 0.4821 0.5576 0.4955 -0.0470 0.0097  0.0264  122 ARG B NH2 
661  N  N   . LEU A 104 ? 0.2413 0.3166 0.2640 -0.0176 0.0182  0.0094  123 LEU B N   
662  C  CA  . LEU A 104 ? 0.2353 0.3055 0.2595 -0.0129 0.0189  0.0076  123 LEU B CA  
663  C  C   . LEU A 104 ? 0.2324 0.3004 0.2575 -0.0147 0.0174  0.0096  123 LEU B C   
664  O  O   . LEU A 104 ? 0.2321 0.3060 0.2568 -0.0189 0.0165  0.0112  123 LEU B O   
665  C  CB  . LEU A 104 ? 0.2306 0.3074 0.2548 -0.0085 0.0211  0.0042  123 LEU B CB  
666  C  CG  . LEU A 104 ? 0.2316 0.3038 0.2565 -0.0033 0.0219  0.0025  123 LEU B CG  
667  C  CD1 . LEU A 104 ? 0.2257 0.2865 0.2501 -0.0004 0.0225  0.0017  123 LEU B CD1 
668  C  CD2 . LEU A 104 ? 0.2389 0.3191 0.2634 0.0009  0.0236  -0.0006 123 LEU B CD2 
669  N  N   . ARG A 105 ? 0.1557 0.2152 0.1817 -0.0118 0.0172  0.0092  124 ARG B N   
670  C  CA  . ARG A 105 ? 0.1572 0.2138 0.1840 -0.0130 0.0158  0.0107  124 ARG B CA  
671  C  C   . ARG A 105 ? 0.1630 0.2177 0.1907 -0.0079 0.0169  0.0085  124 ARG B C   
672  O  O   . ARG A 105 ? 0.1728 0.2215 0.2003 -0.0038 0.0181  0.0069  124 ARG B O   
673  C  CB  . ARG A 105 ? 0.1627 0.2097 0.1894 -0.0152 0.0138  0.0132  124 ARG B CB  
674  C  CG  . ARG A 105 ? 0.1576 0.2001 0.1850 -0.0162 0.0123  0.0144  124 ARG B CG  
675  C  CD  . ARG A 105 ? 0.1650 0.1993 0.1917 -0.0190 0.0101  0.0171  124 ARG B CD  
676  N  NE  . ARG A 105 ? 0.1693 0.1971 0.1967 -0.0185 0.0089  0.0175  124 ARG B NE  
677  C  CZ  . ARG A 105 ? 0.1789 0.1991 0.2074 -0.0151 0.0089  0.0166  124 ARG B CZ  
678  N  NH1 . ARG A 105 ? 0.1747 0.1927 0.2037 -0.0122 0.0101  0.0152  124 ARG B NH1 
679  N  NH2 . ARG A 105 ? 0.1938 0.2086 0.2227 -0.0149 0.0079  0.0169  124 ARG B NH2 
680  N  N   . VAL A 106 ? 0.2184 0.2782 0.2467 -0.0084 0.0165  0.0083  125 VAL B N   
681  C  CA  . VAL A 106 ? 0.2170 0.2758 0.2458 -0.0035 0.0173  0.0064  125 VAL B CA  
682  C  C   . VAL A 106 ? 0.1446 0.1974 0.1740 -0.0047 0.0157  0.0077  125 VAL B C   
683  O  O   . VAL A 106 ? 0.1481 0.2037 0.1779 -0.0093 0.0142  0.0093  125 VAL B O   
684  C  CB  . VAL A 106 ? 0.1498 0.2205 0.1788 -0.0020 0.0180  0.0045  125 VAL B CB  
685  C  CG1 . VAL A 106 ? 0.1582 0.2277 0.1873 0.0033  0.0185  0.0028  125 VAL B CG1 
686  C  CG2 . VAL A 106 ? 0.1515 0.2283 0.1797 -0.0001 0.0197  0.0027  125 VAL B CG2 
687  N  N   . THR A 107 ? 0.2817 0.3261 0.3110 -0.0008 0.0162  0.0070  126 THR B N   
688  C  CA  . THR A 107 ? 0.2842 0.3225 0.3140 -0.0014 0.0148  0.0079  126 THR B CA  
689  C  C   . THR A 107 ? 0.2917 0.3324 0.3215 0.0025  0.0153  0.0062  126 THR B C   
690  O  O   . THR A 107 ? 0.3036 0.3412 0.3338 0.0020  0.0142  0.0066  126 THR B O   
691  C  CB  . THR A 107 ? 0.2828 0.3100 0.3127 -0.0002 0.0148  0.0084  126 THR B CB  
692  O  OG1 . THR A 107 ? 0.2783 0.3019 0.3071 0.0049  0.0168  0.0064  126 THR B OG1 
693  C  CG2 . THR A 107 ? 0.2770 0.3023 0.3069 -0.0033 0.0142  0.0098  126 THR B CG2 
694  N  N   . GLU A 108 ? 0.2975 0.3437 0.3265 0.0067  0.0169  0.0042  127 GLU B N   
695  C  CA  . GLU A 108 ? 0.2976 0.3470 0.3260 0.0111  0.0173  0.0026  127 GLU B CA  
696  C  C   . GLU A 108 ? 0.2981 0.3565 0.3257 0.0149  0.0186  0.0005  127 GLU B C   
697  O  O   . GLU A 108 ? 0.2964 0.3518 0.3224 0.0181  0.0202  -0.0005 127 GLU B O   
698  C  CB  . GLU A 108 ? 0.2989 0.3378 0.3257 0.0155  0.0181  0.0021  127 GLU B CB  
699  C  CG  . GLU A 108 ? 0.3060 0.3393 0.3335 0.0138  0.0167  0.0032  127 GLU B CG  
700  C  CD  . GLU A 108 ? 0.3214 0.3623 0.3497 0.0134  0.0154  0.0026  127 GLU B CD  
701  O  OE1 . GLU A 108 ? 0.3274 0.3641 0.3553 0.0147  0.0148  0.0025  127 GLU B OE1 
702  O  OE2 . GLU A 108 ? 0.3259 0.3775 0.3552 0.0118  0.0151  0.0021  127 GLU B OE2 
703  N  N   . GLY A 109 ? 0.2054 0.2750 0.2341 0.0144  0.0179  -0.0004 128 GLY B N   
704  C  CA  . GLY A 109 ? 0.2047 0.2839 0.2328 0.0189  0.0189  -0.0027 128 GLY B CA  
705  C  C   . GLY A 109 ? 0.2195 0.3003 0.2467 0.0244  0.0187  -0.0042 128 GLY B C   
706  O  O   . GLY A 109 ? 0.2186 0.2893 0.2435 0.0287  0.0192  -0.0042 128 GLY B O   
707  N  N   . TRP A 110 ? 0.4222 0.5160 0.4510 0.0243  0.0178  -0.0056 129 TRP B N   
708  C  CA  . TRP A 110 ? 0.4276 0.5245 0.4556 0.0291  0.0172  -0.0070 129 TRP B CA  
709  C  C   . TRP A 110 ? 0.4271 0.5178 0.4558 0.0258  0.0158  -0.0055 129 TRP B C   
710  O  O   . TRP A 110 ? 0.4185 0.5122 0.4495 0.0189  0.0146  -0.0044 129 TRP B O   
711  C  CB  . TRP A 110 ? 0.4313 0.5457 0.4614 0.0294  0.0166  -0.0092 129 TRP B CB  
712  C  CG  . TRP A 110 ? 0.4364 0.5558 0.4663 0.0335  0.0155  -0.0106 129 TRP B CG  
713  C  CD1 . TRP A 110 ? 0.4385 0.5587 0.4658 0.0422  0.0158  -0.0124 129 TRP B CD1 
714  C  CD2 . TRP A 110 ? 0.4391 0.5633 0.4710 0.0292  0.0138  -0.0105 129 TRP B CD2 
715  N  NE1 . TRP A 110 ? 0.4517 0.5776 0.4795 0.0438  0.0143  -0.0133 129 TRP B NE1 
716  C  CE2 . TRP A 110 ? 0.4493 0.5780 0.4801 0.0356  0.0131  -0.0123 129 TRP B CE2 
717  C  CE3 . TRP A 110 ? 0.4353 0.5600 0.4696 0.0205  0.0128  -0.0090 129 TRP B CE3 
718  C  CZ2 . TRP A 110 ? 0.4532 0.5876 0.4855 0.0335  0.0115  -0.0130 129 TRP B CZ2 
719  C  CZ3 . TRP A 110 ? 0.4413 0.5709 0.4768 0.0182  0.0113  -0.0097 129 TRP B CZ3 
720  C  CH2 . TRP A 110 ? 0.4460 0.5808 0.4807 0.0245  0.0106  -0.0118 129 TRP B CH2 
721  N  N   . ASP A 111 ? 0.2753 0.3568 0.3016 0.0306  0.0160  -0.0054 130 ASP B N   
722  C  CA  . ASP A 111 ? 0.2750 0.3492 0.3016 0.0280  0.0149  -0.0041 130 ASP B CA  
723  C  C   . ASP A 111 ? 0.2785 0.3588 0.3049 0.0307  0.0137  -0.0055 130 ASP B C   
724  O  O   . ASP A 111 ? 0.2719 0.3574 0.2966 0.0371  0.0140  -0.0072 130 ASP B O   
725  C  CB  . ASP A 111 ? 0.2793 0.3382 0.3033 0.0303  0.0160  -0.0030 130 ASP B CB  
726  C  CG  . ASP A 111 ? 0.2850 0.3366 0.3090 0.0287  0.0151  -0.0021 130 ASP B CG  
727  O  OD1 . ASP A 111 ? 0.2876 0.3410 0.3141 0.0228  0.0136  -0.0013 130 ASP B OD1 
728  O  OD2 . ASP A 111 ? 0.2900 0.3337 0.3112 0.0332  0.0158  -0.0022 130 ASP B OD2 
729  N  N   . GLU A 112 ? 0.2336 0.3129 0.2615 0.0260  0.0123  -0.0048 131 GLU B N   
730  C  CA  . GLU A 112 ? 0.2246 0.3089 0.2524 0.0277  0.0110  -0.0061 131 GLU B CA  
731  C  C   . GLU A 112 ? 0.2284 0.3022 0.2559 0.0250  0.0102  -0.0050 131 GLU B C   
732  O  O   . GLU A 112 ? 0.2186 0.2953 0.2461 0.0252  0.0090  -0.0059 131 GLU B O   
733  C  CB  . GLU A 112 ? 0.2267 0.3266 0.2575 0.0236  0.0097  -0.0076 131 GLU B CB  
734  C  CG  . GLU A 112 ? 0.2280 0.3281 0.2613 0.0144  0.0090  -0.0063 131 GLU B CG  
735  C  CD  . GLU A 112 ? 0.2379 0.3535 0.2737 0.0097  0.0081  -0.0079 131 GLU B CD  
736  O  OE1 . GLU A 112 ? 0.2373 0.3637 0.2736 0.0135  0.0076  -0.0103 131 GLU B OE1 
737  O  OE2 . GLU A 112 ? 0.2478 0.3650 0.2850 0.0021  0.0078  -0.0068 131 GLU B OE2 
738  N  N   . ASP A 113 ? 0.4301 0.4924 0.4574 0.0226  0.0109  -0.0031 132 ASP B N   
739  C  CA  . ASP A 113 ? 0.4317 0.4834 0.4586 0.0207  0.0103  -0.0022 132 ASP B CA  
740  C  C   . ASP A 113 ? 0.4342 0.4778 0.4578 0.0271  0.0114  -0.0024 132 ASP B C   
741  O  O   . ASP A 113 ? 0.4361 0.4745 0.4590 0.0273  0.0109  -0.0025 132 ASP B O   
742  C  CB  . ASP A 113 ? 0.4238 0.4673 0.4518 0.0159  0.0104  -0.0003 132 ASP B CB  
743  C  CG  . ASP A 113 ? 0.4247 0.4750 0.4550 0.0094  0.0094  0.0004  132 ASP B CG  
744  O  OD1 . ASP A 113 ? 0.4291 0.4860 0.4606 0.0058  0.0080  -0.0003 132 ASP B OD1 
745  O  OD2 . ASP A 113 ? 0.4269 0.4758 0.4576 0.0077  0.0101  0.0015  132 ASP B OD2 
746  N  N   . GLY A 114 ? 0.4411 0.4832 0.4624 0.0321  0.0131  -0.0025 133 GLY B N   
747  C  CA  . GLY A 114 ? 0.4476 0.4825 0.4648 0.0384  0.0144  -0.0027 133 GLY B CA  
748  C  C   . GLY A 114 ? 0.4583 0.4796 0.4740 0.0381  0.0158  -0.0016 133 GLY B C   
749  O  O   . GLY A 114 ? 0.4692 0.4839 0.4817 0.0415  0.0165  -0.0016 133 GLY B O   
750  N  N   . HIS A 115 ? 0.3539 0.3715 0.3717 0.0339  0.0162  -0.0006 134 HIS B N   
751  C  CA  . HIS A 115 ? 0.3439 0.3500 0.3608 0.0335  0.0175  0.0002  134 HIS B CA  
752  C  C   . HIS A 115 ? 0.3441 0.3451 0.3580 0.0369  0.0199  0.0001  134 HIS B C   
753  O  O   . HIS A 115 ? 0.3433 0.3353 0.3561 0.0366  0.0214  0.0005  134 HIS B O   
754  C  CB  . HIS A 115 ? 0.3466 0.3505 0.3671 0.0274  0.0165  0.0011  134 HIS B CB  
755  C  CG  . HIS A 115 ? 0.3344 0.3432 0.3569 0.0244  0.0162  0.0017  134 HIS B CG  
756  N  ND1 . HIS A 115 ? 0.3234 0.3275 0.3460 0.0237  0.0174  0.0022  134 HIS B ND1 
757  C  CD2 . HIS A 115 ? 0.3320 0.3505 0.3565 0.0217  0.0150  0.0017  134 HIS B CD2 
758  C  CE1 . HIS A 115 ? 0.3208 0.3312 0.3452 0.0209  0.0169  0.0026  134 HIS B CE1 
759  N  NE2 . HIS A 115 ? 0.3228 0.3418 0.3482 0.0195  0.0154  0.0024  134 HIS B NE2 
760  N  N   . HIS A 116 ? 0.1906 0.1978 0.2033 0.0399  0.0202  -0.0006 135 HIS B N   
761  C  CA  . HIS A 116 ? 0.1951 0.1976 0.2045 0.0435  0.0224  -0.0010 135 HIS B CA  
762  C  C   . HIS A 116 ? 0.2076 0.2042 0.2114 0.0497  0.0237  -0.0013 135 HIS B C   
763  O  O   . HIS A 116 ? 0.2093 0.2102 0.2119 0.0525  0.0225  -0.0017 135 HIS B O   
764  C  CB  . HIS A 116 ? 0.1839 0.1956 0.1944 0.0441  0.0222  -0.0018 135 HIS B CB  
765  C  CG  . HIS A 116 ? 0.1636 0.1803 0.1786 0.0379  0.0213  -0.0012 135 HIS B CG  
766  N  ND1 . HIS A 116 ? 0.1578 0.1702 0.1733 0.0357  0.0224  -0.0008 135 HIS B ND1 
767  C  CD2 . HIS A 116 ? 0.1571 0.1824 0.1758 0.0335  0.0193  -0.0008 135 HIS B CD2 
768  C  CE1 . HIS A 116 ? 0.1501 0.1681 0.1693 0.0304  0.0210  -0.0001 135 HIS B CE1 
769  N  NE2 . HIS A 116 ? 0.1511 0.1766 0.1721 0.0288  0.0192  0.0000  135 HIS B NE2 
770  N  N   . ALA A 117 ? 0.4691 0.4557 0.4690 0.0517  0.0261  -0.0013 136 ALA B N   
771  C  CA  . ALA A 117 ? 0.4940 0.4727 0.4875 0.0572  0.0276  -0.0013 136 ALA B CA  
772  C  C   . ALA A 117 ? 0.4969 0.4818 0.4873 0.0634  0.0268  -0.0020 136 ALA B C   
773  O  O   . ALA A 117 ? 0.4852 0.4799 0.4782 0.0637  0.0258  -0.0029 136 ALA B O   
774  C  CB  . ALA A 117 ? 0.4975 0.4649 0.4870 0.0577  0.0304  -0.0013 136 ALA B CB  
775  N  N   . GLN A 118 ? 0.7091 0.6887 0.6940 0.0684  0.0273  -0.0017 137 GLN B N   
776  C  CA  . GLN A 118 ? 0.7351 0.7199 0.7163 0.0754  0.0264  -0.0024 137 GLN B CA  
777  C  C   . GLN A 118 ? 0.7232 0.7087 0.7024 0.0788  0.0274  -0.0035 137 GLN B C   
778  O  O   . GLN A 118 ? 0.7209 0.6963 0.6972 0.0784  0.0297  -0.0033 137 GLN B O   
779  C  CB  . GLN A 118 ? 0.7693 0.7451 0.7433 0.0805  0.0272  -0.0016 137 GLN B CB  
780  C  CG  . GLN A 118 ? 0.8177 0.7933 0.7931 0.0778  0.0262  -0.0009 137 GLN B CG  
781  C  CD  . GLN A 118 ? 0.8920 0.8586 0.8595 0.0829  0.0271  0.0000  137 GLN B CD  
782  O  OE1 . GLN A 118 ? 0.9067 0.8650 0.8672 0.0880  0.0287  0.0004  137 GLN B OE1 
783  N  NE2 . GLN A 118 ? 0.8823 0.8501 0.8506 0.0814  0.0260  0.0003  137 GLN B NE2 
784  N  N   . ASP A 119 ? 0.5789 0.5768 0.5598 0.0820  0.0257  -0.0048 138 ASP B N   
785  C  CA  . ASP A 119 ? 0.5717 0.5721 0.5510 0.0859  0.0264  -0.0061 138 ASP B CA  
786  C  C   . ASP A 119 ? 0.5522 0.5531 0.5357 0.0802  0.0274  -0.0065 138 ASP B C   
787  O  O   . ASP A 119 ? 0.5459 0.5422 0.5264 0.0825  0.0291  -0.0073 138 ASP B O   
788  C  CB  . ASP A 119 ? 0.5920 0.5796 0.5623 0.0931  0.0283  -0.0060 138 ASP B CB  
789  C  CG  . ASP A 119 ? 0.6222 0.6128 0.5878 0.1009  0.0268  -0.0062 138 ASP B CG  
790  O  OD1 . ASP A 119 ? 0.6035 0.6092 0.5734 0.1020  0.0245  -0.0074 138 ASP B OD1 
791  O  OD2 . ASP A 119 ? 0.6394 0.6175 0.5970 0.1058  0.0281  -0.0052 138 ASP B OD2 
792  N  N   . SER A 120 ? 0.1951 0.2013 0.1850 0.0729  0.0264  -0.0058 139 SER B N   
793  C  CA  . SER A 120 ? 0.1840 0.1925 0.1781 0.0673  0.0269  -0.0060 139 SER B CA  
794  C  C   . SER A 120 ? 0.3138 0.3360 0.3106 0.0684  0.0259  -0.0076 139 SER B C   
795  O  O   . SER A 120 ? 0.3099 0.3432 0.3084 0.0702  0.0241  -0.0083 139 SER B O   
796  C  CB  . SER A 120 ? 0.1776 0.1871 0.1770 0.0597  0.0258  -0.0047 139 SER B CB  
797  O  OG  . SER A 120 ? 0.2979 0.3104 0.3012 0.0545  0.0259  -0.0046 139 SER B OG  
798  N  N   . LEU A 121 ? 0.2016 0.2236 0.1989 0.0671  0.0271  -0.0083 140 LEU B N   
799  C  CA  . LEU A 121 ? 0.1990 0.2341 0.1987 0.0679  0.0265  -0.0100 140 LEU B CA  
800  C  C   . LEU A 121 ? 0.1918 0.2391 0.1981 0.0610  0.0247  -0.0095 140 LEU B C   
801  O  O   . LEU A 121 ? 0.1903 0.2508 0.1992 0.0609  0.0239  -0.0109 140 LEU B O   
802  C  CB  . LEU A 121 ? 0.1947 0.2257 0.1928 0.0683  0.0284  -0.0111 140 LEU B CB  
803  C  CG  . LEU A 121 ? 0.2056 0.2265 0.1965 0.0759  0.0302  -0.0123 140 LEU B CG  
804  C  CD1 . LEU A 121 ? 0.2083 0.2261 0.1978 0.0757  0.0320  -0.0138 140 LEU B CD1 
805  C  CD2 . LEU A 121 ? 0.2183 0.2468 0.2069 0.0835  0.0291  -0.0137 140 LEU B CD2 
806  N  N   . HIS A 122 ? 0.2917 0.3343 0.3003 0.0553  0.0241  -0.0076 141 HIS B N   
807  C  CA  . HIS A 122 ? 0.2836 0.3355 0.2975 0.0486  0.0223  -0.0068 141 HIS B CA  
808  C  C   . HIS A 122 ? 0.2908 0.3545 0.3062 0.0502  0.0206  -0.0078 141 HIS B C   
809  O  O   . HIS A 122 ? 0.2997 0.3754 0.3188 0.0461  0.0194  -0.0082 141 HIS B O   
810  C  CB  . HIS A 122 ? 0.2799 0.3229 0.2953 0.0433  0.0218  -0.0047 141 HIS B CB  
811  C  CG  . HIS A 122 ? 0.2781 0.3148 0.2943 0.0393  0.0228  -0.0038 141 HIS B CG  
812  N  ND1 . HIS A 122 ? 0.2583 0.3002 0.2780 0.0330  0.0219  -0.0029 141 HIS B ND1 
813  C  CD2 . HIS A 122 ? 0.2796 0.3053 0.2932 0.0405  0.0246  -0.0038 141 HIS B CD2 
814  C  CE1 . HIS A 122 ? 0.2590 0.2939 0.2785 0.0310  0.0229  -0.0024 141 HIS B CE1 
815  N  NE2 . HIS A 122 ? 0.2579 0.2833 0.2739 0.0353  0.0246  -0.0030 141 HIS B NE2 
816  N  N   . TYR A 123 ? 0.2953 0.3558 0.3074 0.0560  0.0204  -0.0082 142 TYR B N   
817  C  CA  . TYR A 123 ? 0.2972 0.3686 0.3105 0.0577  0.0186  -0.0093 142 TYR B CA  
818  C  C   . TYR A 123 ? 0.3037 0.3895 0.3178 0.0617  0.0183  -0.0117 142 TYR B C   
819  O  O   . TYR A 123 ? 0.3166 0.4136 0.3318 0.0635  0.0168  -0.0130 142 TYR B O   
820  C  CB  . TYR A 123 ? 0.3106 0.3744 0.3199 0.0630  0.0185  -0.0089 142 TYR B CB  
821  C  CG  . TYR A 123 ? 0.3157 0.3681 0.3250 0.0588  0.0185  -0.0070 142 TYR B CG  
822  C  CD1 . TYR A 123 ? 0.3098 0.3660 0.3235 0.0518  0.0171  -0.0062 142 TYR B CD1 
823  C  CD2 . TYR A 123 ? 0.3270 0.3648 0.3316 0.0617  0.0201  -0.0060 142 TYR B CD2 
824  C  CE1 . TYR A 123 ? 0.3070 0.3532 0.3207 0.0484  0.0170  -0.0047 142 TYR B CE1 
825  C  CE2 . TYR A 123 ? 0.3264 0.3551 0.3314 0.0580  0.0202  -0.0045 142 TYR B CE2 
826  C  CZ  . TYR A 123 ? 0.3178 0.3509 0.3275 0.0516  0.0186  -0.0040 142 TYR B CZ  
827  O  OH  . TYR A 123 ? 0.3219 0.3462 0.3320 0.0483  0.0186  -0.0028 142 TYR B OH  
828  N  N   . GLU A 124 ? 0.2559 0.3418 0.2692 0.0630  0.0197  -0.0124 143 GLU B N   
829  C  CA  . GLU A 124 ? 0.2643 0.3643 0.2785 0.0666  0.0195  -0.0150 143 GLU B CA  
830  C  C   . GLU A 124 ? 0.2520 0.3570 0.2688 0.0620  0.0205  -0.0154 143 GLU B C   
831  O  O   . GLU A 124 ? 0.2573 0.3680 0.2731 0.0662  0.0213  -0.0175 143 GLU B O   
832  C  CB  . GLU A 124 ? 0.2704 0.3666 0.2792 0.0769  0.0202  -0.0166 143 GLU B CB  
833  C  CG  . GLU A 124 ? 0.2813 0.3580 0.2844 0.0798  0.0219  -0.0150 143 GLU B CG  
834  C  CD  . GLU A 124 ? 0.3119 0.3835 0.3085 0.0900  0.0221  -0.0161 143 GLU B CD  
835  O  OE1 . GLU A 124 ? 0.3240 0.4057 0.3201 0.0958  0.0218  -0.0185 143 GLU B OE1 
836  O  OE2 . GLU A 124 ? 0.3083 0.3660 0.3002 0.0924  0.0228  -0.0145 143 GLU B OE2 
837  N  N   . GLY A 125 ? 0.3318 0.4344 0.3516 0.0535  0.0203  -0.0134 144 GLY B N   
838  C  CA  . GLY A 125 ? 0.3325 0.4400 0.3546 0.0483  0.0209  -0.0133 144 GLY B CA  
839  C  C   . GLY A 125 ? 0.3310 0.4329 0.3503 0.0522  0.0228  -0.0144 144 GLY B C   
840  O  O   . GLY A 125 ? 0.3318 0.4429 0.3522 0.0516  0.0234  -0.0159 144 GLY B O   
841  N  N   . ARG A 126 ? 0.2652 0.3519 0.2803 0.0560  0.0239  -0.0137 145 ARG B N   
842  C  CA  . ARG A 126 ? 0.2662 0.3457 0.2779 0.0596  0.0258  -0.0148 145 ARG B CA  
843  C  C   . ARG A 126 ? 0.2622 0.3280 0.2731 0.0552  0.0269  -0.0130 145 ARG B C   
844  O  O   . ARG A 126 ? 0.2602 0.3189 0.2683 0.0570  0.0286  -0.0138 145 ARG B O   
845  C  CB  . ARG A 126 ? 0.2821 0.3555 0.2884 0.0690  0.0266  -0.0163 145 ARG B CB  
846  C  CG  . ARG A 126 ? 0.2845 0.3717 0.2908 0.0751  0.0259  -0.0191 145 ARG B CG  
847  C  CD  . ARG A 126 ? 0.3075 0.3865 0.3074 0.0844  0.0272  -0.0208 145 ARG B CD  
848  N  NE  . ARG A 126 ? 0.3205 0.3893 0.3159 0.0895  0.0269  -0.0198 145 ARG B NE  
849  C  CZ  . ARG A 126 ? 0.3378 0.3937 0.3263 0.0965  0.0282  -0.0202 145 ARG B CZ  
850  N  NH1 . ARG A 126 ? 0.3483 0.3995 0.3337 0.0992  0.0299  -0.0219 145 ARG B NH1 
851  N  NH2 . ARG A 126 ? 0.3440 0.3910 0.3281 0.1006  0.0279  -0.0189 145 ARG B NH2 
852  N  N   . ALA A 127 ? 0.2751 0.3376 0.2885 0.0495  0.0258  -0.0106 146 ALA B N   
853  C  CA  . ALA A 127 ? 0.2624 0.3130 0.2755 0.0455  0.0266  -0.0090 146 ALA B CA  
854  C  C   . ALA A 127 ? 0.2552 0.3098 0.2727 0.0375  0.0252  -0.0070 146 ALA B C   
855  O  O   . ALA A 127 ? 0.2589 0.3217 0.2791 0.0348  0.0235  -0.0064 146 ALA B O   
856  C  CB  . ALA A 127 ? 0.2687 0.3068 0.2789 0.0480  0.0270  -0.0080 146 ALA B CB  
857  N  N   . LEU A 128 ? 0.2551 0.3036 0.2730 0.0338  0.0258  -0.0061 147 LEU B N   
858  C  CA  . LEU A 128 ? 0.2431 0.2937 0.2642 0.0267  0.0243  -0.0040 147 LEU B CA  
859  C  C   . LEU A 128 ? 0.2461 0.2849 0.2669 0.0243  0.0246  -0.0027 147 LEU B C   
860  O  O   . LEU A 128 ? 0.2496 0.2810 0.2682 0.0267  0.0263  -0.0037 147 LEU B O   
861  C  CB  . LEU A 128 ? 0.2369 0.2970 0.2593 0.0236  0.0244  -0.0044 147 LEU B CB  
862  C  CG  . LEU A 128 ? 0.2390 0.3127 0.2620 0.0254  0.0243  -0.0062 147 LEU B CG  
863  C  CD1 . LEU A 128 ? 0.2338 0.3153 0.2577 0.0217  0.0247  -0.0064 147 LEU B CD1 
864  C  CD2 . LEU A 128 ? 0.2484 0.3293 0.2737 0.0232  0.0226  -0.0054 147 LEU B CD2 
865  N  N   . ASP A 129 ? 0.2215 0.2590 0.2447 0.0196  0.0229  -0.0006 148 ASP B N   
866  C  CA  . ASP A 129 ? 0.2153 0.2437 0.2389 0.0170  0.0228  0.0006  148 ASP B CA  
867  C  C   . ASP A 129 ? 0.2045 0.2368 0.2298 0.0117  0.0217  0.0019  148 ASP B C   
868  O  O   . ASP A 129 ? 0.2048 0.2415 0.2318 0.0077  0.0199  0.0036  148 ASP B O   
869  C  CB  . ASP A 129 ? 0.2138 0.2366 0.2383 0.0161  0.0216  0.0018  148 ASP B CB  
870  C  CG  . ASP A 129 ? 0.2181 0.2345 0.2403 0.0211  0.0229  0.0007  148 ASP B CG  
871  O  OD1 . ASP A 129 ? 0.2222 0.2357 0.2417 0.0248  0.0249  -0.0008 148 ASP B OD1 
872  O  OD2 . ASP A 129 ? 0.2231 0.2370 0.2458 0.0212  0.0219  0.0014  148 ASP B OD2 
873  N  N   . ILE A 130 ? 0.2253 0.2558 0.2498 0.0116  0.0229  0.0012  149 ILE B N   
874  C  CA  . ILE A 130 ? 0.2211 0.2563 0.2466 0.0072  0.0220  0.0023  149 ILE B CA  
875  C  C   . ILE A 130 ? 0.2195 0.2478 0.2457 0.0046  0.0213  0.0034  149 ILE B C   
876  O  O   . ILE A 130 ? 0.2219 0.2425 0.2477 0.0066  0.0223  0.0025  149 ILE B O   
877  C  CB  . ILE A 130 ? 0.2182 0.2592 0.2424 0.0086  0.0236  0.0003  149 ILE B CB  
878  C  CG1 . ILE A 130 ? 0.2151 0.2484 0.2374 0.0119  0.0257  -0.0018 149 ILE B CG1 
879  C  CG2 . ILE A 130 ? 0.2308 0.2803 0.2546 0.0114  0.0241  -0.0011 149 ILE B CG2 
880  C  CD1 . ILE A 130 ? 0.2149 0.2525 0.2357 0.0128  0.0272  -0.0039 149 ILE B CD1 
881  N  N   . THR A 131 ? 0.2193 0.2506 0.2464 0.0001  0.0194  0.0055  150 THR B N   
882  C  CA  . THR A 131 ? 0.2195 0.2463 0.2471 -0.0022 0.0185  0.0066  150 THR B CA  
883  C  C   . THR A 131 ? 0.2201 0.2534 0.2471 -0.0059 0.0175  0.0079  150 THR B C   
884  O  O   . THR A 131 ? 0.2178 0.2591 0.2442 -0.0068 0.0179  0.0078  150 THR B O   
885  C  CB  . THR A 131 ? 0.2126 0.2334 0.2413 -0.0037 0.0164  0.0086  150 THR B CB  
886  O  OG1 . THR A 131 ? 0.2090 0.2334 0.2376 -0.0077 0.0143  0.0112  150 THR B OG1 
887  C  CG2 . THR A 131 ? 0.2166 0.2331 0.2457 -0.0008 0.0170  0.0078  150 THR B CG2 
888  N  N   . THR A 132 ? 0.2764 0.3070 0.3036 -0.0079 0.0163  0.0090  151 THR B N   
889  C  CA  . THR A 132 ? 0.2824 0.3184 0.3085 -0.0116 0.0151  0.0107  151 THR B CA  
890  C  C   . THR A 132 ? 0.2791 0.3134 0.3047 -0.0153 0.0125  0.0142  151 THR B C   
891  O  O   . THR A 132 ? 0.2824 0.3099 0.3089 -0.0148 0.0112  0.0151  151 THR B O   
892  C  CB  . THR A 132 ? 0.2916 0.3260 0.3173 -0.0118 0.0151  0.0101  151 THR B CB  
893  O  OG1 . THR A 132 ? 0.2924 0.3192 0.3194 -0.0111 0.0140  0.0105  151 THR B OG1 
894  C  CG2 . THR A 132 ? 0.2750 0.3112 0.3004 -0.0090 0.0179  0.0065  151 THR B CG2 
895  N  N   . SER A 133 ? 0.1719 0.2124 0.1959 -0.0190 0.0117  0.0160  152 SER B N   
896  C  CA  . SER A 133 ? 0.1733 0.2120 0.1959 -0.0231 0.0094  0.0194  152 SER B CA  
897  C  C   . SER A 133 ? 0.1713 0.2015 0.1935 -0.0235 0.0070  0.0215  152 SER B C   
898  O  O   . SER A 133 ? 0.1772 0.2027 0.1983 -0.0257 0.0050  0.0240  152 SER B O   
899  C  CB  . SER A 133 ? 0.1750 0.2217 0.1952 -0.0275 0.0093  0.0211  152 SER B CB  
900  O  OG  . SER A 133 ? 0.1795 0.2296 0.1988 -0.0275 0.0098  0.0205  152 SER B OG  
901  N  N   . ASP A 134 ? 0.2902 0.3186 0.3130 -0.0214 0.0072  0.0203  153 ASP B N   
902  C  CA  . ASP A 134 ? 0.2995 0.3211 0.3221 -0.0212 0.0049  0.0219  153 ASP B CA  
903  C  C   . ASP A 134 ? 0.3057 0.3209 0.3311 -0.0176 0.0052  0.0200  153 ASP B C   
904  O  O   . ASP A 134 ? 0.3196 0.3296 0.3455 -0.0166 0.0034  0.0206  153 ASP B O   
905  C  CB  . ASP A 134 ? 0.3074 0.3320 0.3291 -0.0215 0.0045  0.0217  153 ASP B CB  
906  C  CG  . ASP A 134 ? 0.3080 0.3355 0.3317 -0.0187 0.0072  0.0179  153 ASP B CG  
907  O  OD1 . ASP A 134 ? 0.2931 0.3191 0.3186 -0.0161 0.0091  0.0155  153 ASP B OD1 
908  O  OD2 . ASP A 134 ? 0.3132 0.3441 0.3361 -0.0191 0.0073  0.0172  153 ASP B OD2 
909  N  N   . ARG A 135 ? 0.2393 0.2550 0.2662 -0.0154 0.0074  0.0177  154 ARG B N   
910  C  CA  . ARG A 135 ? 0.2387 0.2487 0.2679 -0.0121 0.0081  0.0158  154 ARG B CA  
911  C  C   . ARG A 135 ? 0.2384 0.2464 0.2688 -0.0103 0.0084  0.0140  154 ARG B C   
912  O  O   . ARG A 135 ? 0.2315 0.2343 0.2635 -0.0085 0.0081  0.0132  154 ARG B O   
913  C  CB  . ARG A 135 ? 0.2464 0.2503 0.2758 -0.0125 0.0059  0.0176  154 ARG B CB  
914  C  CG  . ARG A 135 ? 0.2411 0.2458 0.2700 -0.0134 0.0061  0.0182  154 ARG B CG  
915  C  CD  . ARG A 135 ? 0.2378 0.2471 0.2644 -0.0177 0.0051  0.0206  154 ARG B CD  
916  N  NE  . ARG A 135 ? 0.2479 0.2567 0.2741 -0.0193 0.0045  0.0214  154 ARG B NE  
917  C  CZ  . ARG A 135 ? 0.2571 0.2698 0.2814 -0.0235 0.0039  0.0233  154 ARG B CZ  
918  N  NH1 . ARG A 135 ? 0.2626 0.2800 0.2849 -0.0264 0.0037  0.0247  154 ARG B NH1 
919  N  NH2 . ARG A 135 ? 0.2591 0.2714 0.2832 -0.0251 0.0035  0.0235  154 ARG B NH2 
920  N  N   . ASP A 136 ? 0.3249 0.3377 0.3546 -0.0110 0.0092  0.0132  155 ASP B N   
921  C  CA  . ASP A 136 ? 0.3250 0.3371 0.3559 -0.0098 0.0098  0.0110  155 ASP B CA  
922  C  C   . ASP A 136 ? 0.3206 0.3307 0.3526 -0.0072 0.0130  0.0076  155 ASP B C   
923  O  O   . ASP A 136 ? 0.3211 0.3341 0.3519 -0.0067 0.0152  0.0059  155 ASP B O   
924  C  CB  . ASP A 136 ? 0.3311 0.3491 0.3606 -0.0115 0.0097  0.0110  155 ASP B CB  
925  C  CG  . ASP A 136 ? 0.3314 0.3495 0.3623 -0.0106 0.0103  0.0084  155 ASP B CG  
926  O  OD1 . ASP A 136 ? 0.3310 0.3448 0.3639 -0.0091 0.0101  0.0074  155 ASP B OD1 
927  O  OD2 . ASP A 136 ? 0.3351 0.3581 0.3649 -0.0116 0.0110  0.0073  155 ASP B OD2 
928  N  N   . ARG A 137 ? 0.4099 0.4147 0.4436 -0.0056 0.0131  0.0066  156 ARG B N   
929  C  CA  . ARG A 137 ? 0.4079 0.4095 0.4420 -0.0034 0.0160  0.0037  156 ARG B CA  
930  C  C   . ARG A 137 ? 0.4095 0.4134 0.4429 -0.0036 0.0183  0.0010  156 ARG B C   
931  O  O   . ARG A 137 ? 0.4154 0.4173 0.4475 -0.0021 0.0211  -0.0012 156 ARG B O   
932  C  CB  . ARG A 137 ? 0.4215 0.4181 0.4577 -0.0023 0.0156  0.0030  156 ARG B CB  
933  C  CG  . ARG A 137 ? 0.4328 0.4246 0.4689 -0.0003 0.0174  0.0022  156 ARG B CG  
934  C  CD  . ARG A 137 ? 0.4190 0.4086 0.4557 -0.0001 0.0151  0.0045  156 ARG B CD  
935  N  NE  . ARG A 137 ? 0.4224 0.4148 0.4576 -0.0010 0.0143  0.0065  156 ARG B NE  
936  C  CZ  . ARG A 137 ? 0.4323 0.4233 0.4674 -0.0016 0.0123  0.0085  156 ARG B CZ  
937  N  NH1 . ARG A 137 ? 0.4167 0.4031 0.4532 -0.0010 0.0109  0.0088  156 ARG B NH1 
938  N  NH2 . ARG A 137 ? 0.4337 0.4282 0.4674 -0.0029 0.0118  0.0101  156 ARG B NH2 
939  N  N   . ASN A 138 ? 0.3722 0.3798 0.4061 -0.0053 0.0169  0.0011  157 ASN B N   
940  C  CA  . ASN A 138 ? 0.3675 0.3776 0.4007 -0.0059 0.0188  -0.0018 157 ASN B CA  
941  C  C   . ASN A 138 ? 0.3705 0.3842 0.4013 -0.0060 0.0205  -0.0025 157 ASN B C   
942  O  O   . ASN A 138 ? 0.3686 0.3834 0.3984 -0.0062 0.0225  -0.0053 157 ASN B O   
943  C  CB  . ASN A 138 ? 0.3770 0.3910 0.4115 -0.0076 0.0166  -0.0015 157 ASN B CB  
944  C  CG  . ASN A 138 ? 0.3922 0.4038 0.4293 -0.0070 0.0162  -0.0030 157 ASN B CG  
945  O  OD1 . ASN A 138 ? 0.4006 0.4074 0.4386 -0.0058 0.0178  -0.0043 157 ASN B OD1 
946  N  ND2 . ASN A 138 ? 0.4091 0.4245 0.4474 -0.0079 0.0140  -0.0030 157 ASN B ND2 
947  N  N   . LYS A 139 ? 0.1936 0.2095 0.2233 -0.0060 0.0196  -0.0002 158 LYS B N   
948  C  CA  . LYS A 139 ? 0.1920 0.2128 0.2196 -0.0059 0.0210  -0.0009 158 LYS B CA  
949  C  C   . LYS A 139 ? 0.1876 0.2058 0.2139 -0.0031 0.0234  -0.0024 158 LYS B C   
950  O  O   . LYS A 139 ? 0.1926 0.2146 0.2172 -0.0022 0.0248  -0.0036 158 LYS B O   
951  C  CB  . LYS A 139 ? 0.1932 0.2197 0.2202 -0.0081 0.0187  0.0023  158 LYS B CB  
952  C  CG  . LYS A 139 ? 0.1931 0.2233 0.2199 -0.0108 0.0165  0.0037  158 LYS B CG  
953  C  CD  . LYS A 139 ? 0.1952 0.2313 0.2203 -0.0132 0.0151  0.0065  158 LYS B CD  
954  C  CE  . LYS A 139 ? 0.2063 0.2451 0.2304 -0.0158 0.0126  0.0086  158 LYS B CE  
955  N  NZ  . LYS A 139 ? 0.2055 0.2390 0.2304 -0.0161 0.0098  0.0112  158 LYS B NZ  
956  N  N   . TYR A 140 ? 0.1800 0.1920 0.2070 -0.0013 0.0239  -0.0024 159 TYR B N   
957  C  CA  . TYR A 140 ? 0.1838 0.1932 0.2092 0.0018  0.0258  -0.0033 159 TYR B CA  
958  C  C   . TYR A 140 ? 0.1878 0.1941 0.2106 0.0039  0.0289  -0.0066 159 TYR B C   
959  O  O   . TYR A 140 ? 0.1870 0.1940 0.2076 0.0066  0.0302  -0.0074 159 TYR B O   
960  C  CB  . TYR A 140 ? 0.1768 0.1805 0.2033 0.0030  0.0253  -0.0022 159 TYR B CB  
961  C  CG  . TYR A 140 ? 0.1867 0.1927 0.2150 0.0012  0.0223  0.0009  159 TYR B CG  
962  C  CD1 . TYR A 140 ? 0.1892 0.2019 0.2174 -0.0010 0.0207  0.0027  159 TYR B CD1 
963  C  CD2 . TYR A 140 ? 0.1954 0.1966 0.2251 0.0016  0.0213  0.0019  159 TYR B CD2 
964  C  CE1 . TYR A 140 ? 0.1804 0.1941 0.2096 -0.0030 0.0181  0.0056  159 TYR B CE1 
965  C  CE2 . TYR A 140 ? 0.1914 0.1937 0.2223 -0.0001 0.0186  0.0045  159 TYR B CE2 
966  C  CZ  . TYR A 140 ? 0.1817 0.1899 0.2121 -0.0025 0.0170  0.0064  159 TYR B CZ  
967  O  OH  . TYR A 140 ? 0.1836 0.1917 0.2144 -0.0046 0.0145  0.0091  159 TYR B OH  
968  N  N   . GLY A 141 ? 0.2058 0.2085 0.2286 0.0029  0.0301  -0.0085 160 GLY B N   
969  C  CA  . GLY A 141 ? 0.2063 0.2050 0.2261 0.0043  0.0331  -0.0118 160 GLY B CA  
970  C  C   . GLY A 141 ? 0.2107 0.2153 0.2288 0.0046  0.0336  -0.0130 160 GLY B C   
971  O  O   . GLY A 141 ? 0.2063 0.2085 0.2212 0.0075  0.0357  -0.0148 160 GLY B O   
972  N  N   . LEU A 142 ? 0.5759 0.5880 0.5957 0.0019  0.0316  -0.0118 161 LEU B N   
973  C  CA  . LEU A 142 ? 0.5809 0.6000 0.5993 0.0017  0.0319  -0.0128 161 LEU B CA  
974  C  C   . LEU A 142 ? 0.5710 0.5948 0.5890 0.0037  0.0314  -0.0113 161 LEU B C   
975  O  O   . LEU A 142 ? 0.5731 0.6005 0.5891 0.0056  0.0327  -0.0131 161 LEU B O   
976  C  CB  . LEU A 142 ? 0.5940 0.6198 0.6140 -0.0020 0.0298  -0.0116 161 LEU B CB  
977  C  CG  . LEU A 142 ? 0.6158 0.6396 0.6364 -0.0041 0.0301  -0.0136 161 LEU B CG  
978  C  CD1 . LEU A 142 ? 0.6073 0.6370 0.6298 -0.0073 0.0271  -0.0113 161 LEU B CD1 
979  C  CD2 . LEU A 142 ? 0.6201 0.6440 0.6380 -0.0037 0.0327  -0.0175 161 LEU B CD2 
980  N  N   . LEU A 143 ? 0.1622 0.1863 0.1821 0.0032  0.0295  -0.0083 162 LEU B N   
981  C  CA  . LEU A 143 ? 0.1573 0.1862 0.1772 0.0047  0.0289  -0.0070 162 LEU B CA  
982  C  C   . LEU A 143 ? 0.1599 0.1851 0.1773 0.0095  0.0312  -0.0093 162 LEU B C   
983  O  O   . LEU A 143 ? 0.1596 0.1904 0.1757 0.0116  0.0319  -0.0104 162 LEU B O   
984  C  CB  . LEU A 143 ? 0.1527 0.1804 0.1747 0.0033  0.0267  -0.0039 162 LEU B CB  
985  C  CG  . LEU A 143 ? 0.2194 0.2525 0.2417 0.0041  0.0259  -0.0026 162 LEU B CG  
986  C  CD1 . LEU A 143 ? 0.1455 0.1888 0.1677 0.0016  0.0252  -0.0019 162 LEU B CD1 
987  C  CD2 . LEU A 143 ? 0.1437 0.1738 0.1678 0.0026  0.0239  0.0001  162 LEU B CD2 
988  N  N   . ALA A 144 ? 0.2048 0.2205 0.2212 0.0112  0.0324  -0.0101 163 ALA B N   
989  C  CA  . ALA A 144 ? 0.2088 0.2190 0.2220 0.0160  0.0346  -0.0119 163 ALA B CA  
990  C  C   . ALA A 144 ? 0.2144 0.2255 0.2245 0.0181  0.0366  -0.0150 163 ALA B C   
991  O  O   . ALA A 144 ? 0.2190 0.2317 0.2268 0.0223  0.0374  -0.0161 163 ALA B O   
992  C  CB  . ALA A 144 ? 0.2141 0.2134 0.2262 0.0165  0.0358  -0.0123 163 ALA B CB  
993  N  N   . ARG A 145 ? 0.2151 0.2254 0.2249 0.0155  0.0373  -0.0166 164 ARG B N   
994  C  CA  . ARG A 145 ? 0.2188 0.2298 0.2256 0.0171  0.0392  -0.0198 164 ARG B CA  
995  C  C   . ARG A 145 ? 0.2151 0.2376 0.2226 0.0179  0.0383  -0.0198 164 ARG B C   
996  O  O   . ARG A 145 ? 0.2261 0.2497 0.2307 0.0217  0.0398  -0.0222 164 ARG B O   
997  C  CB  . ARG A 145 ? 0.2255 0.2350 0.2324 0.0134  0.0399  -0.0215 164 ARG B CB  
998  C  CG  . ARG A 145 ? 0.2423 0.2525 0.2459 0.0146  0.0418  -0.0251 164 ARG B CG  
999  C  CD  . ARG A 145 ? 0.2415 0.2424 0.2402 0.0196  0.0444  -0.0275 164 ARG B CD  
1000 N  NE  . ARG A 145 ? 0.2485 0.2374 0.2453 0.0189  0.0460  -0.0281 164 ARG B NE  
1001 C  CZ  . ARG A 145 ? 0.2609 0.2390 0.2526 0.0224  0.0484  -0.0298 164 ARG B CZ  
1002 N  NH1 . ARG A 145 ? 0.2636 0.2412 0.2516 0.0276  0.0493  -0.0313 164 ARG B NH1 
1003 N  NH2 . ARG A 145 ? 0.2580 0.2257 0.2480 0.0209  0.0500  -0.0301 164 ARG B NH2 
1004 N  N   . LEU A 146 ? 0.1980 0.2289 0.2089 0.0142  0.0360  -0.0171 165 LEU B N   
1005 C  CA  . LEU A 146 ? 0.2006 0.2431 0.2122 0.0140  0.0351  -0.0168 165 LEU B CA  
1006 C  C   . LEU A 146 ? 0.2037 0.2487 0.2147 0.0184  0.0354  -0.0169 165 LEU B C   
1007 O  O   . LEU A 146 ? 0.2012 0.2546 0.2116 0.0204  0.0358  -0.0184 165 LEU B O   
1008 C  CB  . LEU A 146 ? 0.1948 0.2440 0.2095 0.0088  0.0326  -0.0134 165 LEU B CB  
1009 C  CG  . LEU A 146 ? 0.1929 0.2427 0.2080 0.0047  0.0319  -0.0132 165 LEU B CG  
1010 C  CD1 . LEU A 146 ? 0.1935 0.2485 0.2108 0.0001  0.0292  -0.0094 165 LEU B CD1 
1011 C  CD2 . LEU A 146 ? 0.1882 0.2433 0.2012 0.0052  0.0335  -0.0163 165 LEU B CD2 
1012 N  N   . ALA A 147 ? 0.1638 0.2018 0.1749 0.0202  0.0351  -0.0156 166 ALA B N   
1013 C  CA  . ALA A 147 ? 0.2440 0.2838 0.2544 0.0247  0.0351  -0.0157 166 ALA B CA  
1014 C  C   . ALA A 147 ? 0.2523 0.2877 0.2584 0.0307  0.0374  -0.0191 166 ALA B C   
1015 O  O   . ALA A 147 ? 0.1708 0.2112 0.1759 0.0352  0.0375  -0.0202 166 ALA B O   
1016 C  CB  . ALA A 147 ? 0.2378 0.2709 0.2491 0.0248  0.0343  -0.0135 166 ALA B CB  
1017 N  N   . VAL A 148 ? 0.1723 0.1983 0.1757 0.0308  0.0392  -0.0209 167 VAL B N   
1018 C  CA  . VAL A 148 ? 0.1853 0.2050 0.1837 0.0362  0.0415  -0.0242 167 VAL B CA  
1019 C  C   . VAL A 148 ? 0.1909 0.2202 0.1888 0.0374  0.0420  -0.0267 167 VAL B C   
1020 O  O   . VAL A 148 ? 0.1948 0.2271 0.1905 0.0429  0.0425  -0.0286 167 VAL B O   
1021 C  CB  . VAL A 148 ? 0.1885 0.1951 0.1837 0.0351  0.0435  -0.0256 167 VAL B CB  
1022 C  CG1 . VAL A 148 ? 0.2024 0.2025 0.1919 0.0401  0.0459  -0.0292 167 VAL B CG1 
1023 C  CG2 . VAL A 148 ? 0.1861 0.1829 0.1810 0.0348  0.0435  -0.0235 167 VAL B CG2 
1024 N  N   . GLU A 149 ? 0.4140 0.4482 0.4138 0.0324  0.0416  -0.0269 168 GLU B N   
1025 C  CA  . GLU A 149 ? 0.4195 0.4637 0.4191 0.0328  0.0421  -0.0293 168 GLU B CA  
1026 C  C   . GLU A 149 ? 0.4154 0.4731 0.4176 0.0337  0.0406  -0.0282 168 GLU B C   
1027 O  O   . GLU A 149 ? 0.4144 0.4811 0.4160 0.0360  0.0412  -0.0306 168 GLU B O   
1028 C  CB  . GLU A 149 ? 0.4184 0.4660 0.4197 0.0267  0.0416  -0.0291 168 GLU B CB  
1029 C  CG  . GLU A 149 ? 0.4362 0.4721 0.4360 0.0244  0.0426  -0.0297 168 GLU B CG  
1030 C  CD  . GLU A 149 ? 0.4729 0.4981 0.4675 0.0288  0.0453  -0.0334 168 GLU B CD  
1031 O  OE1 . GLU A 149 ? 0.4984 0.5265 0.4904 0.0333  0.0464  -0.0361 168 GLU B OE1 
1032 O  OE2 . GLU A 149 ? 0.4596 0.4734 0.4526 0.0277  0.0465  -0.0338 168 GLU B OE2 
1033 N  N   . ALA A 150 ? 0.2402 0.2997 0.2454 0.0316  0.0388  -0.0248 169 ALA B N   
1034 C  CA  . ALA A 150 ? 0.2339 0.3061 0.2417 0.0316  0.0374  -0.0237 169 ALA B CA  
1035 C  C   . ALA A 150 ? 0.2412 0.3146 0.2470 0.0390  0.0381  -0.0259 169 ALA B C   
1036 O  O   . ALA A 150 ? 0.2496 0.3356 0.2568 0.0405  0.0377  -0.0268 169 ALA B O   
1037 C  CB  . ALA A 150 ? 0.2322 0.3044 0.2433 0.0273  0.0353  -0.0197 169 ALA B CB  
1038 N  N   . GLY A 151 ? 0.2934 0.3539 0.2956 0.0437  0.0393  -0.0268 170 GLY B N   
1039 C  CA  . GLY A 151 ? 0.3061 0.3658 0.3052 0.0516  0.0400  -0.0290 170 GLY B CA  
1040 C  C   . GLY A 151 ? 0.3255 0.3781 0.3237 0.0546  0.0393  -0.0272 170 GLY B C   
1041 O  O   . GLY A 151 ? 0.3504 0.4005 0.3452 0.0617  0.0398  -0.0288 170 GLY B O   
1042 N  N   . PHE A 152 ? 0.3161 0.3654 0.3170 0.0496  0.0381  -0.0239 171 PHE B N   
1043 C  CA  . PHE A 152 ? 0.3095 0.3523 0.3097 0.0520  0.0375  -0.0222 171 PHE B CA  
1044 C  C   . PHE A 152 ? 0.3300 0.3583 0.3241 0.0577  0.0394  -0.0236 171 PHE B C   
1045 O  O   . PHE A 152 ? 0.3324 0.3505 0.3239 0.0563  0.0410  -0.0244 171 PHE B O   
1046 C  CB  . PHE A 152 ? 0.3026 0.3420 0.3061 0.0456  0.0362  -0.0188 171 PHE B CB  
1047 C  CG  . PHE A 152 ? 0.2988 0.3506 0.3072 0.0412  0.0341  -0.0168 171 PHE B CG  
1048 C  CD1 . PHE A 152 ? 0.2989 0.3557 0.3086 0.0430  0.0327  -0.0159 171 PHE B CD1 
1049 C  CD2 . PHE A 152 ? 0.2882 0.3465 0.2995 0.0350  0.0334  -0.0159 171 PHE B CD2 
1050 C  CE1 . PHE A 152 ? 0.2928 0.3605 0.3067 0.0383  0.0309  -0.0142 171 PHE B CE1 
1051 C  CE2 . PHE A 152 ? 0.2832 0.3517 0.2983 0.0305  0.0315  -0.0139 171 PHE B CE2 
1052 C  CZ  . PHE A 152 ? 0.2869 0.3600 0.3033 0.0320  0.0303  -0.0131 171 PHE B CZ  
1053 N  N   . ASP A 153 ? 0.3695 0.3969 0.3611 0.0641  0.0391  -0.0239 172 ASP B N   
1054 C  CA  . ASP A 153 ? 0.3878 0.4014 0.3725 0.0704  0.0408  -0.0252 172 ASP B CA  
1055 C  C   . ASP A 153 ? 0.3828 0.3817 0.3654 0.0679  0.0416  -0.0231 172 ASP B C   
1056 O  O   . ASP A 153 ? 0.3852 0.3703 0.3615 0.0714  0.0435  -0.0239 172 ASP B O   
1057 C  CB  . ASP A 153 ? 0.3956 0.4135 0.3781 0.0783  0.0399  -0.0259 172 ASP B CB  
1058 C  CG  . ASP A 153 ? 0.4067 0.4402 0.3914 0.0811  0.0393  -0.0284 172 ASP B CG  
1059 O  OD1 . ASP A 153 ? 0.4028 0.4357 0.3854 0.0824  0.0407  -0.0310 172 ASP B OD1 
1060 O  OD2 . ASP A 153 ? 0.4074 0.4539 0.3958 0.0818  0.0374  -0.0280 172 ASP B OD2 
1061 N  N   . TRP A 154 ? 0.2420 0.2438 0.2295 0.0618  0.0403  -0.0205 173 TRP B N   
1062 C  CA  . TRP A 154 ? 0.2295 0.2193 0.2160 0.0587  0.0410  -0.0187 173 TRP B CA  
1063 C  C   . TRP A 154 ? 0.2156 0.2105 0.2083 0.0511  0.0395  -0.0167 173 TRP B C   
1064 O  O   . TRP A 154 ? 0.2050 0.2098 0.2022 0.0492  0.0374  -0.0151 173 TRP B O   
1065 C  CB  . TRP A 154 ? 0.2314 0.2157 0.2151 0.0630  0.0406  -0.0173 173 TRP B CB  
1066 C  CG  . TRP A 154 ? 0.2332 0.2027 0.2134 0.0617  0.0422  -0.0163 173 TRP B CG  
1067 C  CD1 . TRP A 154 ? 0.2423 0.1983 0.2162 0.0633  0.0448  -0.0177 173 TRP B CD1 
1068 C  CD2 . TRP A 154 ? 0.2230 0.1898 0.2055 0.0582  0.0414  -0.0140 173 TRP B CD2 
1069 N  NE1 . TRP A 154 ? 0.2380 0.1837 0.2103 0.0607  0.0458  -0.0162 173 TRP B NE1 
1070 C  CE2 . TRP A 154 ? 0.2276 0.1799 0.2053 0.0578  0.0437  -0.0140 173 TRP B CE2 
1071 C  CE3 . TRP A 154 ? 0.2132 0.1882 0.2012 0.0552  0.0391  -0.0120 173 TRP B CE3 
1072 C  CZ2 . TRP A 154 ? 0.2303 0.1771 0.2088 0.0548  0.0438  -0.0122 173 TRP B CZ2 
1073 C  CZ3 . TRP A 154 ? 0.2128 0.1815 0.2014 0.0525  0.0390  -0.0103 173 TRP B CZ3 
1074 C  CH2 . TRP A 154 ? 0.2125 0.1678 0.1966 0.0525  0.0414  -0.0105 173 TRP B CH2 
1075 N  N   . VAL A 155 ? 0.2794 0.2674 0.2721 0.0468  0.0407  -0.0169 174 VAL B N   
1076 C  CA  . VAL A 155 ? 0.2652 0.2565 0.2631 0.0402  0.0393  -0.0150 174 VAL B CA  
1077 C  C   . VAL A 155 ? 0.2632 0.2431 0.2599 0.0384  0.0403  -0.0142 174 VAL B C   
1078 O  O   . VAL A 155 ? 0.2783 0.2478 0.2704 0.0399  0.0427  -0.0156 174 VAL B O   
1079 C  CB  . VAL A 155 ? 0.2624 0.2579 0.2620 0.0363  0.0396  -0.0163 174 VAL B CB  
1080 C  CG1 . VAL A 155 ? 0.2551 0.2537 0.2596 0.0301  0.0379  -0.0142 174 VAL B CG1 
1081 C  CG2 . VAL A 155 ? 0.2595 0.2664 0.2597 0.0381  0.0390  -0.0174 174 VAL B CG2 
1082 N  N   . TYR A 156 ? 0.2612 0.2430 0.2619 0.0350  0.0386  -0.0119 175 TYR B N   
1083 C  CA  . TYR A 156 ? 0.2659 0.2381 0.2657 0.0336  0.0394  -0.0112 175 TYR B CA  
1084 C  C   . TYR A 156 ? 0.2613 0.2369 0.2665 0.0284  0.0375  -0.0095 175 TYR B C   
1085 O  O   . TYR A 156 ? 0.2595 0.2419 0.2681 0.0275  0.0352  -0.0077 175 TYR B O   
1086 C  CB  . TYR A 156 ? 0.2752 0.2426 0.2719 0.0382  0.0397  -0.0105 175 TYR B CB  
1087 C  CG  . TYR A 156 ? 0.2775 0.2364 0.2735 0.0368  0.0404  -0.0095 175 TYR B CG  
1088 C  CD1 . TYR A 156 ? 0.2917 0.2425 0.2863 0.0340  0.0424  -0.0105 175 TYR B CD1 
1089 C  CD2 . TYR A 156 ? 0.2629 0.2222 0.2594 0.0383  0.0391  -0.0078 175 TYR B CD2 
1090 C  CE1 . TYR A 156 ? 0.2853 0.2293 0.2794 0.0326  0.0432  -0.0098 175 TYR B CE1 
1091 C  CE2 . TYR A 156 ? 0.2713 0.2233 0.2670 0.0372  0.0398  -0.0071 175 TYR B CE2 
1092 C  CZ  . TYR A 156 ? 0.2807 0.2251 0.2752 0.0343  0.0419  -0.0081 175 TYR B CZ  
1093 O  OH  . TYR A 156 ? 0.2857 0.2238 0.2796 0.0330  0.0428  -0.0076 175 TYR B OH  
1094 N  N   . TYR A 157 ? 0.3013 0.2720 0.3071 0.0251  0.0385  -0.0102 176 TYR B N   
1095 C  CA  . TYR A 157 ? 0.3039 0.2771 0.3144 0.0208  0.0368  -0.0088 176 TYR B CA  
1096 C  C   . TYR A 157 ? 0.3186 0.2875 0.3295 0.0215  0.0363  -0.0074 176 TYR B C   
1097 O  O   . TYR A 157 ? 0.3382 0.3015 0.3494 0.0198  0.0372  -0.0078 176 TYR B O   
1098 C  CB  . TYR A 157 ? 0.3068 0.2765 0.3176 0.0176  0.0381  -0.0104 176 TYR B CB  
1099 C  CG  . TYR A 157 ? 0.3164 0.2915 0.3321 0.0134  0.0358  -0.0093 176 TYR B CG  
1100 C  CD1 . TYR A 157 ? 0.3119 0.2892 0.3308 0.0125  0.0334  -0.0071 176 TYR B CD1 
1101 C  CD2 . TYR A 157 ? 0.3155 0.2933 0.3323 0.0106  0.0360  -0.0107 176 TYR B CD2 
1102 C  CE1 . TYR A 157 ? 0.3059 0.2871 0.3287 0.0093  0.0312  -0.0060 176 TYR B CE1 
1103 C  CE2 . TYR A 157 ? 0.2973 0.2799 0.3181 0.0074  0.0336  -0.0096 176 TYR B CE2 
1104 C  CZ  . TYR A 157 ? 0.3018 0.2857 0.3254 0.0069  0.0312  -0.0072 176 TYR B CZ  
1105 O  OH  . TYR A 157 ? 0.3099 0.2976 0.3368 0.0042  0.0288  -0.0060 176 TYR B OH  
1106 N  N   . GLU A 158 ? 0.3410 0.3132 0.3518 0.0239  0.0349  -0.0061 177 GLU B N   
1107 C  CA  . GLU A 158 ? 0.3451 0.3133 0.3555 0.0252  0.0346  -0.0051 177 GLU B CA  
1108 C  C   . GLU A 158 ? 0.3440 0.3107 0.3580 0.0217  0.0336  -0.0043 177 GLU B C   
1109 O  O   . GLU A 158 ? 0.3534 0.3132 0.3661 0.0216  0.0351  -0.0049 177 GLU B O   
1110 C  CB  . GLU A 158 ? 0.3362 0.3108 0.3475 0.0273  0.0327  -0.0038 177 GLU B CB  
1111 C  CG  . GLU A 158 ? 0.3393 0.3100 0.3496 0.0290  0.0324  -0.0030 177 GLU B CG  
1112 C  CD  . GLU A 158 ? 0.3680 0.3445 0.3777 0.0321  0.0311  -0.0024 177 GLU B CD  
1113 O  OE1 . GLU A 158 ? 0.3629 0.3484 0.3751 0.0310  0.0295  -0.0021 177 GLU B OE1 
1114 O  OE2 . GLU A 158 ? 0.3848 0.3573 0.3915 0.0355  0.0317  -0.0024 177 GLU B OE2 
1115 N  N   . SER A 159 ? 0.3763 0.3495 0.3945 0.0187  0.0311  -0.0030 178 SER B N   
1116 C  CA  . SER A 159 ? 0.3788 0.3511 0.4004 0.0159  0.0296  -0.0023 178 SER B CA  
1117 C  C   . SER A 159 ? 0.3822 0.3581 0.4064 0.0126  0.0285  -0.0023 178 SER B C   
1118 O  O   . SER A 159 ? 0.3810 0.3620 0.4051 0.0120  0.0282  -0.0022 178 SER B O   
1119 C  CB  . SER A 159 ? 0.3747 0.3500 0.3983 0.0157  0.0270  -0.0004 178 SER B CB  
1120 O  OG  . SER A 159 ? 0.3865 0.3614 0.4133 0.0130  0.0252  0.0004  178 SER B OG  
1121 N  N   . ARG A 160 ? 0.4925 0.4663 0.5190 0.0107  0.0280  -0.0025 179 ARG B N   
1122 C  CA  . ARG A 160 ? 0.4923 0.4697 0.5213 0.0079  0.0266  -0.0024 179 ARG B CA  
1123 C  C   . ARG A 160 ? 0.4780 0.4608 0.5088 0.0065  0.0235  0.0001  179 ARG B C   
1124 O  O   . ARG A 160 ? 0.4841 0.4703 0.5164 0.0043  0.0218  0.0008  179 ARG B O   
1125 C  CB  . ARG A 160 ? 0.5094 0.4840 0.5407 0.0068  0.0265  -0.0032 179 ARG B CB  
1126 C  CG  . ARG A 160 ? 0.5299 0.5004 0.5596 0.0067  0.0297  -0.0059 179 ARG B CG  
1127 C  CD  . ARG A 160 ? 0.5552 0.5225 0.5867 0.0063  0.0302  -0.0069 179 ARG B CD  
1128 N  NE  . ARG A 160 ? 0.5739 0.5382 0.6041 0.0051  0.0332  -0.0097 179 ARG B NE  
1129 C  CZ  . ARG A 160 ? 0.5976 0.5581 0.6278 0.0048  0.0350  -0.0111 179 ARG B CZ  
1130 N  NH1 . ARG A 160 ? 0.6006 0.5598 0.6320 0.0060  0.0339  -0.0102 179 ARG B NH1 
1131 N  NH2 . ARG A 160 ? 0.5968 0.5548 0.6256 0.0030  0.0380  -0.0137 179 ARG B NH2 
1132 N  N   . ASN A 161 ? 0.3390 0.3225 0.3692 0.0076  0.0227  0.0014  180 ASN B N   
1133 C  CA  . ASN A 161 ? 0.3408 0.3288 0.3721 0.0057  0.0199  0.0037  180 ASN B CA  
1134 C  C   . ASN A 161 ? 0.3375 0.3314 0.3673 0.0059  0.0202  0.0040  180 ASN B C   
1135 O  O   . ASN A 161 ? 0.3355 0.3340 0.3659 0.0037  0.0183  0.0058  180 ASN B O   
1136 C  CB  . ASN A 161 ? 0.3477 0.3328 0.3799 0.0060  0.0184  0.0047  180 ASN B CB  
1137 C  CG  . ASN A 161 ? 0.3588 0.3390 0.3927 0.0058  0.0179  0.0043  180 ASN B CG  
1138 O  OD1 . ASN A 161 ? 0.3627 0.3433 0.3980 0.0045  0.0172  0.0042  180 ASN B OD1 
1139 N  ND2 . ASN A 161 ? 0.3635 0.3397 0.3975 0.0074  0.0182  0.0038  180 ASN B ND2 
1140 N  N   . HIS A 162 ? 0.2750 0.2686 0.3026 0.0086  0.0226  0.0022  181 HIS B N   
1141 C  CA  . HIS A 162 ? 0.2628 0.2628 0.2891 0.0096  0.0231  0.0020  181 HIS B CA  
1142 C  C   . HIS A 162 ? 0.2632 0.2611 0.2866 0.0130  0.0259  -0.0003 181 HIS B C   
1143 O  O   . HIS A 162 ? 0.2720 0.2628 0.2939 0.0149  0.0276  -0.0015 181 HIS B O   
1144 C  CB  . HIS A 162 ? 0.2627 0.2654 0.2891 0.0104  0.0219  0.0030  181 HIS B CB  
1145 C  CG  . HIS A 162 ? 0.2765 0.2748 0.3010 0.0144  0.0234  0.0019  181 HIS B CG  
1146 N  ND1 . HIS A 162 ? 0.2798 0.2717 0.3046 0.0150  0.0233  0.0021  181 HIS B ND1 
1147 C  CD2 . HIS A 162 ? 0.2759 0.2751 0.2978 0.0184  0.0250  0.0005  181 HIS B CD2 
1148 C  CE1 . HIS A 162 ? 0.2772 0.2662 0.2994 0.0188  0.0248  0.0011  181 HIS B CE1 
1149 N  NE2 . HIS A 162 ? 0.2768 0.2699 0.2971 0.0211  0.0258  0.0002  181 HIS B NE2 
1150 N  N   . VAL A 163 ? 0.1562 0.1603 0.1786 0.0137  0.0263  -0.0010 182 VAL B N   
1151 C  CA  . VAL A 163 ? 0.1515 0.1537 0.1706 0.0175  0.0288  -0.0033 182 VAL B CA  
1152 C  C   . VAL A 163 ? 0.1509 0.1569 0.1686 0.0212  0.0288  -0.0035 182 VAL B C   
1153 O  O   . VAL A 163 ? 0.1486 0.1623 0.1683 0.0198  0.0271  -0.0023 182 VAL B O   
1154 C  CB  . VAL A 163 ? 0.2311 0.2379 0.2498 0.0163  0.0295  -0.0045 182 VAL B CB  
1155 C  CG1 . VAL A 163 ? 0.1538 0.1582 0.1687 0.0206  0.0320  -0.0071 182 VAL B CG1 
1156 C  CG2 . VAL A 163 ? 0.2307 0.2346 0.2507 0.0128  0.0294  -0.0045 182 VAL B CG2 
1157 N  N   . HIS A 164 ? 0.2823 0.2829 0.2964 0.0258  0.0308  -0.0050 183 HIS B N   
1158 C  CA  . HIS A 164 ? 0.2909 0.2951 0.3033 0.0302  0.0308  -0.0055 183 HIS B CA  
1159 C  C   . HIS A 164 ? 0.2941 0.3018 0.3039 0.0336  0.0321  -0.0076 183 HIS B C   
1160 O  O   . HIS A 164 ? 0.3030 0.3037 0.3095 0.0356  0.0342  -0.0092 183 HIS B O   
1161 C  CB  . HIS A 164 ? 0.2992 0.2946 0.3086 0.0338  0.0317  -0.0054 183 HIS B CB  
1162 C  CG  . HIS A 164 ? 0.3041 0.3030 0.3112 0.0389  0.0315  -0.0059 183 HIS B CG  
1163 N  ND1 . HIS A 164 ? 0.3063 0.3129 0.3160 0.0386  0.0294  -0.0049 183 HIS B ND1 
1164 C  CD2 . HIS A 164 ? 0.3130 0.3088 0.3154 0.0448  0.0330  -0.0075 183 HIS B CD2 
1165 C  CE1 . HIS A 164 ? 0.3132 0.3223 0.3202 0.0441  0.0296  -0.0059 183 HIS B CE1 
1166 N  NE2 . HIS A 164 ? 0.3213 0.3237 0.3237 0.0482  0.0317  -0.0074 183 HIS B NE2 
1167 N  N   . VAL A 165 ? 0.2708 0.2897 0.2822 0.0342  0.0310  -0.0078 184 VAL B N   
1168 C  CA  . VAL A 165 ? 0.2777 0.3016 0.2869 0.0378  0.0321  -0.0100 184 VAL B CA  
1169 C  C   . VAL A 165 ? 0.2879 0.3178 0.2961 0.0430  0.0316  -0.0108 184 VAL B C   
1170 O  O   . VAL A 165 ? 0.2891 0.3257 0.3000 0.0416  0.0298  -0.0095 184 VAL B O   
1171 C  CB  . VAL A 165 ? 0.2738 0.3078 0.2859 0.0336  0.0314  -0.0101 184 VAL B CB  
1172 C  CG1 . VAL A 165 ? 0.2683 0.2967 0.2806 0.0297  0.0321  -0.0100 184 VAL B CG1 
1173 C  CG2 . VAL A 165 ? 0.2633 0.3066 0.2794 0.0293  0.0291  -0.0080 184 VAL B CG2 
1174 N  N   . SER A 166 ? 0.2225 0.2499 0.2265 0.0492  0.0331  -0.0130 185 SER B N   
1175 C  CA  . SER A 166 ? 0.2268 0.2600 0.2293 0.0552  0.0325  -0.0140 185 SER B CA  
1176 C  C   . SER A 166 ? 0.2438 0.2817 0.2438 0.0603  0.0336  -0.0169 185 SER B C   
1177 O  O   . SER A 166 ? 0.2500 0.2833 0.2481 0.0600  0.0352  -0.0183 185 SER B O   
1178 C  CB  . SER A 166 ? 0.2310 0.2534 0.2295 0.0595  0.0329  -0.0133 185 SER B CB  
1179 O  OG  . SER A 166 ? 0.2406 0.2490 0.2341 0.0614  0.0352  -0.0140 185 SER B OG  
1180 N  N   . VAL A 167 ? 0.2518 0.2994 0.2518 0.0652  0.0327  -0.0181 186 VAL B N   
1181 C  CA  . VAL A 167 ? 0.2589 0.3128 0.2569 0.0707  0.0334  -0.0212 186 VAL B CA  
1182 C  C   . VAL A 167 ? 0.2767 0.3295 0.2705 0.0797  0.0332  -0.0225 186 VAL B C   
1183 O  O   . VAL A 167 ? 0.2722 0.3231 0.2657 0.0811  0.0321  -0.0210 186 VAL B O   
1184 C  CB  . VAL A 167 ? 0.2574 0.3296 0.2606 0.0675  0.0323  -0.0221 186 VAL B CB  
1185 C  CG1 . VAL A 167 ? 0.2475 0.3210 0.2541 0.0589  0.0324  -0.0206 186 VAL B CG1 
1186 C  CG2 . VAL A 167 ? 0.2537 0.3370 0.2603 0.0672  0.0303  -0.0213 186 VAL B CG2 
1187 N  N   . LYS A 168 ? 0.4770 0.5310 0.4673 0.0861  0.0342  -0.0254 187 LYS B N   
1188 C  CA  . LYS A 168 ? 0.4870 0.5408 0.4728 0.0957  0.0338  -0.0269 187 LYS B CA  
1189 C  C   . LYS A 168 ? 0.4933 0.5648 0.4837 0.0968  0.0316  -0.0273 187 LYS B C   
1190 O  O   . LYS A 168 ? 0.4968 0.5813 0.4935 0.0902  0.0306  -0.0269 187 LYS B O   
1191 C  CB  . LYS A 168 ? 0.5110 0.5636 0.4925 0.1021  0.0353  -0.0303 187 LYS B CB  
1192 C  CG  . LYS A 168 ? 0.5137 0.5469 0.4888 0.1030  0.0376  -0.0305 187 LYS B CG  
1193 C  CD  . LYS A 168 ? 0.5263 0.5596 0.4976 0.1085  0.0390  -0.0342 187 LYS B CD  
1194 C  CE  . LYS A 168 ? 0.5469 0.5593 0.5101 0.1111  0.0413  -0.0346 187 LYS B CE  
1195 N  NZ  . LYS A 168 ? 0.5227 0.5257 0.4871 0.1023  0.0427  -0.0329 187 LYS B NZ  
1196 N  N   . ALA A 169 ? 0.2881 0.3601 0.2750 0.1051  0.0307  -0.0282 188 ALA B N   
1197 C  CA  . ALA A 169 ? 0.2954 0.3851 0.2864 0.1069  0.0286  -0.0291 188 ALA B CA  
1198 C  C   . ALA A 169 ? 0.3168 0.4235 0.3109 0.1087  0.0285  -0.0326 188 ALA B C   
1199 O  O   . ALA A 169 ? 0.3042 0.4076 0.2963 0.1096  0.0301  -0.0343 188 ALA B O   
1200 C  CB  . ALA A 169 ? 0.3008 0.3863 0.2868 0.1160  0.0276  -0.0293 188 ALA B CB  
1201 N  N   . ASP A 170 ? 0.8719 0.9971 0.8706 0.1089  0.0268  -0.0338 189 ASP B N   
1202 C  CA  . ASP A 170 ? 0.8781 1.0218 0.8802 0.1102  0.0267  -0.0373 189 ASP B CA  
1203 C  C   . ASP A 170 ? 0.9168 1.0674 0.9158 0.1219  0.0258  -0.0405 189 ASP B C   
1204 O  O   . ASP A 170 ? 0.9394 1.0839 0.9348 0.1279  0.0247  -0.0397 189 ASP B O   
1205 C  CB  . ASP A 170 ? 0.6795 0.8411 0.6892 0.1015  0.0255  -0.0368 189 ASP B CB  
1206 C  CG  . ASP A 170 ? 0.6738 0.8351 0.6867 0.0914  0.0266  -0.0353 189 ASP B CG  
1207 O  OD1 . ASP A 170 ? 0.6755 0.8206 0.6853 0.0897  0.0280  -0.0337 189 ASP B OD1 
1208 O  OD2 . ASP A 170 ? 0.6680 0.8452 0.6863 0.0850  0.0262  -0.0357 189 ASP B OD2 
1209 N  N   . GLY B 7   ? 0.5084 0.5705 0.5395 -0.0328 -0.0062 -0.0138 829 GLY C N   
1210 C  CA  . GLY B 7   ? 0.4919 0.5436 0.5225 -0.0284 -0.0052 -0.0110 829 GLY C CA  
1211 C  C   . GLY B 7   ? 0.4732 0.5241 0.5037 -0.0195 -0.0043 -0.0113 829 GLY C C   
1212 O  O   . GLY B 7   ? 0.4761 0.5377 0.5070 -0.0154 -0.0041 -0.0130 829 GLY C O   
1213 N  N   . PRO B 8   ? 0.5020 0.5399 0.5315 -0.0163 -0.0039 -0.0098 830 PRO C N   
1214 C  CA  . PRO B 8   ? 0.4985 0.5336 0.5271 -0.0084 -0.0027 -0.0099 830 PRO C CA  
1215 C  C   . PRO B 8   ? 0.4759 0.5157 0.5049 -0.0038 -0.0011 -0.0086 830 PRO C C   
1216 O  O   . PRO B 8   ? 0.4568 0.5021 0.4869 -0.0066 -0.0009 -0.0076 830 PRO C O   
1217 C  CB  . PRO B 8   ? 0.4892 0.5094 0.5170 -0.0082 -0.0027 -0.0086 830 PRO C CB  
1218 C  CG  . PRO B 8   ? 0.4962 0.5115 0.5240 -0.0154 -0.0042 -0.0084 830 PRO C CG  
1219 C  CD  . PRO B 8   ? 0.4990 0.5241 0.5278 -0.0202 -0.0044 -0.0081 830 PRO C CD  
1220 N  N   . HIS B 9   ? 0.4391 0.4764 0.4665 0.0031  0.0001  -0.0086 831 HIS C N   
1221 C  CA  . HIS B 9   ? 0.4231 0.4624 0.4502 0.0079  0.0017  -0.0074 831 HIS C CA  
1222 C  C   . HIS B 9   ? 0.4217 0.4499 0.4469 0.0126  0.0032  -0.0064 831 HIS C C   
1223 O  O   . HIS B 9   ? 0.4262 0.4514 0.4494 0.0162  0.0034  -0.0073 831 HIS C O   
1224 C  CB  . HIS B 9   ? 0.4125 0.4639 0.4390 0.0123  0.0018  -0.0089 831 HIS C CB  
1225 C  CG  . HIS B 9   ? 0.4020 0.4536 0.4271 0.0182  0.0035  -0.0080 831 HIS C CG  
1226 N  ND1 . HIS B 9   ? 0.3926 0.4504 0.4190 0.0176  0.0041  -0.0074 831 HIS C ND1 
1227 C  CD2 . HIS B 9   ? 0.4008 0.4465 0.4228 0.0248  0.0049  -0.0075 831 HIS C CD2 
1228 C  CE1 . HIS B 9   ? 0.3847 0.4404 0.4091 0.0237  0.0057  -0.0068 831 HIS C CE1 
1229 N  NE2 . HIS B 9   ? 0.3850 0.4330 0.4064 0.0280  0.0062  -0.0068 831 HIS C NE2 
1230 N  N   . ILE B 10  ? 0.3288 0.3513 0.3546 0.0122  0.0043  -0.0045 832 ILE C N   
1231 C  CA  . ILE B 10  ? 0.3190 0.3316 0.3433 0.0160  0.0059  -0.0037 832 ILE C CA  
1232 C  C   . ILE B 10  ? 0.3186 0.3332 0.3402 0.0223  0.0076  -0.0038 832 ILE C C   
1233 O  O   . ILE B 10  ? 0.3078 0.3276 0.3296 0.0237  0.0083  -0.0033 832 ILE C O   
1234 C  CB  . ILE B 10  ? 0.3102 0.3167 0.3359 0.0134  0.0064  -0.0019 832 ILE C CB  
1235 C  CG1 . ILE B 10  ? 0.3075 0.3123 0.3351 0.0071  0.0045  -0.0015 832 ILE C CG1 
1236 C  CG2 . ILE B 10  ? 0.3117 0.3084 0.3362 0.0164  0.0079  -0.0015 832 ILE C CG2 
1237 C  CD1 . ILE B 10  ? 0.2896 0.2907 0.3184 0.0043  0.0045  0.0004  832 ILE C CD1 
1238 N  N   . ALA B 11  ? 0.5412 0.5513 0.5601 0.0263  0.0083  -0.0044 833 ALA C N   
1239 C  CA  . ALA B 11  ? 0.5437 0.5537 0.5589 0.0326  0.0100  -0.0043 833 ALA C CA  
1240 C  C   . ALA B 11  ? 0.5442 0.5475 0.5586 0.0340  0.0121  -0.0029 833 ALA C C   
1241 O  O   . ALA B 11  ? 0.5473 0.5531 0.5599 0.0375  0.0132  -0.0026 833 ALA C O   
1242 C  CB  . ALA B 11  ? 0.5466 0.5523 0.5585 0.0359  0.0103  -0.0050 833 ALA C CB  
1243 N  N   . TYR B 12  ? 0.5794 0.5744 0.5950 0.0315  0.0127  -0.0023 834 TYR C N   
1244 C  CA  . TYR B 12  ? 0.5784 0.5673 0.5935 0.0322  0.0147  -0.0013 834 TYR C CA  
1245 C  C   . TYR B 12  ? 0.5780 0.5604 0.5957 0.0283  0.0146  -0.0009 834 TYR C C   
1246 O  O   . TYR B 12  ? 0.5767 0.5579 0.5960 0.0258  0.0131  -0.0014 834 TYR C O   
1247 C  CB  . TYR B 12  ? 0.5812 0.5644 0.5914 0.0373  0.0170  -0.0012 834 TYR C CB  
1248 C  CG  . TYR B 12  ? 0.5931 0.5697 0.6017 0.0378  0.0176  -0.0017 834 TYR C CG  
1249 C  CD1 . TYR B 12  ? 0.6004 0.5791 0.6065 0.0401  0.0169  -0.0025 834 TYR C CD1 
1250 C  CD2 . TYR B 12  ? 0.5962 0.5651 0.6055 0.0360  0.0189  -0.0016 834 TYR C CD2 
1251 C  CE1 . TYR B 12  ? 0.6099 0.5831 0.6144 0.0405  0.0175  -0.0030 834 TYR C CE1 
1252 C  CE2 . TYR B 12  ? 0.6083 0.5722 0.6163 0.0365  0.0196  -0.0023 834 TYR C CE2 
1253 C  CZ  . TYR B 12  ? 0.6286 0.5943 0.6340 0.0387  0.0189  -0.0029 834 TYR C CZ  
1254 O  OH  . TYR B 12  ? 0.6353 0.5962 0.6391 0.0390  0.0197  -0.0037 834 TYR C OH  
1255 N  N   . THR B 13  ? 0.4196 0.3980 0.4376 0.0282  0.0161  -0.0001 835 THR C N   
1256 C  CA  . THR B 13  ? 0.4075 0.3802 0.4278 0.0253  0.0161  0.0001  835 THR C CA  
1257 C  C   . THR B 13  ? 0.3991 0.3659 0.4175 0.0273  0.0188  0.0001  835 THR C C   
1258 O  O   . THR B 13  ? 0.4009 0.3688 0.4175 0.0292  0.0203  0.0005  835 THR C O   
1259 C  CB  . THR B 13  ? 0.3919 0.3675 0.4156 0.0212  0.0144  0.0010  835 THR C CB  
1260 O  OG1 . THR B 13  ? 0.3811 0.3616 0.4044 0.0218  0.0151  0.0016  835 THR C OG1 
1261 C  CG2 . THR B 13  ? 0.3964 0.3759 0.4216 0.0182  0.0119  0.0009  835 THR C CG2 
1262 N  N   . GLU B 14  ? 0.5243 0.4853 0.5433 0.0267  0.0196  -0.0004 836 GLU C N   
1263 C  CA  . GLU B 14  ? 0.5275 0.4831 0.5447 0.0278  0.0224  -0.0007 836 GLU C CA  
1264 C  C   . GLU B 14  ? 0.5237 0.4758 0.5439 0.0255  0.0224  -0.0013 836 GLU C C   
1265 O  O   . GLU B 14  ? 0.5334 0.4843 0.5549 0.0249  0.0213  -0.0020 836 GLU C O   
1266 C  CB  . GLU B 14  ? 0.5425 0.4943 0.5547 0.0313  0.0245  -0.0011 836 GLU C CB  
1267 C  CG  . GLU B 14  ? 0.5573 0.5031 0.5667 0.0322  0.0277  -0.0013 836 GLU C CG  
1268 C  CD  . GLU B 14  ? 0.5924 0.5337 0.5956 0.0358  0.0299  -0.0013 836 GLU C CD  
1269 O  OE1 . GLU B 14  ? 0.5916 0.5350 0.5933 0.0377  0.0287  -0.0012 836 GLU C OE1 
1270 O  OE2 . GLU B 14  ? 0.6022 0.5378 0.6018 0.0364  0.0327  -0.0013 836 GLU C OE2 
1271 N  N   . ALA B 15  ? 0.2697 0.2205 0.2910 0.0243  0.0235  -0.0013 837 ALA C N   
1272 C  CA  . ALA B 15  ? 0.2609 0.2094 0.2851 0.0224  0.0235  -0.0021 837 ALA C CA  
1273 C  C   . ALA B 15  ? 0.2704 0.2145 0.2927 0.0236  0.0258  -0.0035 837 ALA C C   
1274 O  O   . ALA B 15  ? 0.2856 0.2269 0.3037 0.0254  0.0284  -0.0036 837 ALA C O   
1275 C  CB  . ALA B 15  ? 0.2552 0.2043 0.2808 0.0209  0.0242  -0.0019 837 ALA C CB  
1276 N  N   . VAL B 16  ? 0.4161 0.3593 0.4412 0.0227  0.0250  -0.0046 838 VAL C N   
1277 C  CA  . VAL B 16  ? 0.4260 0.3659 0.4497 0.0234  0.0272  -0.0062 838 VAL C CA  
1278 C  C   . VAL B 16  ? 0.4215 0.3611 0.4480 0.0217  0.0284  -0.0076 838 VAL C C   
1279 O  O   . VAL B 16  ? 0.4325 0.3697 0.4572 0.0216  0.0314  -0.0088 838 VAL C O   
1280 C  CB  . VAL B 16  ? 0.4465 0.3863 0.4711 0.0240  0.0257  -0.0071 838 VAL C CB  
1281 C  CG1 . VAL B 16  ? 0.4759 0.4160 0.4969 0.0259  0.0254  -0.0063 838 VAL C CG1 
1282 C  CG2 . VAL B 16  ? 0.4283 0.3700 0.4572 0.0226  0.0222  -0.0070 838 VAL C CG2 
1283 N  N   . SER B 17  ? 0.3405 0.2828 0.3711 0.0203  0.0260  -0.0073 839 SER C N   
1284 C  CA  . SER B 17  ? 0.3269 0.2701 0.3605 0.0190  0.0266  -0.0087 839 SER C CA  
1285 C  C   . SER B 17  ? 0.3218 0.2678 0.3575 0.0177  0.0248  -0.0074 839 SER C C   
1286 O  O   . SER B 17  ? 0.3244 0.2712 0.3588 0.0177  0.0236  -0.0055 839 SER C O   
1287 C  CB  . SER B 17  ? 0.3242 0.2680 0.3611 0.0193  0.0252  -0.0104 839 SER C CB  
1288 O  OG  . SER B 17  ? 0.3262 0.2707 0.3652 0.0194  0.0214  -0.0093 839 SER C OG  
1289 N  N   . ASP B 18  ? 0.3840 0.3319 0.4229 0.0166  0.0244  -0.0084 840 ASP C N   
1290 C  CA  . ASP B 18  ? 0.3782 0.3288 0.4190 0.0154  0.0225  -0.0072 840 ASP C CA  
1291 C  C   . ASP B 18  ? 0.3768 0.3279 0.4195 0.0155  0.0185  -0.0059 840 ASP C C   
1292 O  O   . ASP B 18  ? 0.3734 0.3263 0.4172 0.0145  0.0165  -0.0045 840 ASP C O   
1293 C  CB  . ASP B 18  ? 0.3771 0.3301 0.4204 0.0143  0.0234  -0.0090 840 ASP C CB  
1294 C  CG  . ASP B 18  ? 0.3739 0.3279 0.4205 0.0150  0.0226  -0.0111 840 ASP C CG  
1295 O  OD1 . ASP B 18  ? 0.3729 0.3249 0.4192 0.0164  0.0221  -0.0115 840 ASP C OD1 
1296 O  OD2 . ASP B 18  ? 0.3788 0.3361 0.4283 0.0144  0.0223  -0.0125 840 ASP C OD2 
1297 N  N   . THR B 19  ? 0.3261 0.2750 0.3687 0.0166  0.0174  -0.0062 841 THR C N   
1298 C  CA  . THR B 19  ? 0.3257 0.2737 0.3695 0.0166  0.0138  -0.0052 841 THR C CA  
1299 C  C   . THR B 19  ? 0.3309 0.2770 0.3726 0.0169  0.0129  -0.0044 841 THR C C   
1300 O  O   . THR B 19  ? 0.3291 0.2738 0.3710 0.0162  0.0100  -0.0033 841 THR C O   
1301 C  CB  . THR B 19  ? 0.3271 0.2743 0.3738 0.0179  0.0124  -0.0071 841 THR C CB  
1302 O  OG1 . THR B 19  ? 0.3369 0.2830 0.3833 0.0193  0.0144  -0.0092 841 THR C OG1 
1303 C  CG2 . THR B 19  ? 0.3282 0.2785 0.3774 0.0177  0.0129  -0.0081 841 THR C CG2 
1304 N  N   . GLN B 20  ? 0.3837 0.3295 0.4230 0.0177  0.0154  -0.0050 842 GLN C N   
1305 C  CA  . GLN B 20  ? 0.3881 0.3328 0.4255 0.0183  0.0147  -0.0048 842 GLN C CA  
1306 C  C   . GLN B 20  ? 0.3849 0.3315 0.4193 0.0184  0.0160  -0.0036 842 GLN C C   
1307 O  O   . GLN B 20  ? 0.3893 0.3363 0.4221 0.0191  0.0186  -0.0036 842 GLN C O   
1308 C  CB  . GLN B 20  ? 0.3887 0.3314 0.4257 0.0199  0.0160  -0.0070 842 GLN C CB  
1309 C  CG  . GLN B 20  ? 0.4015 0.3428 0.4415 0.0204  0.0144  -0.0085 842 GLN C CG  
1310 C  CD  . GLN B 20  ? 0.4184 0.3588 0.4583 0.0220  0.0164  -0.0111 842 GLN C CD  
1311 O  OE1 . GLN B 20  ? 0.4087 0.3495 0.4468 0.0223  0.0196  -0.0117 842 GLN C OE1 
1312 N  NE2 . GLN B 20  ? 0.4374 0.3763 0.4788 0.0230  0.0146  -0.0127 842 GLN C NE2 
1313 N  N   . ILE B 21  ? 0.1883 0.1361 0.2219 0.0178  0.0142  -0.0026 843 ILE C N   
1314 C  CA  . ILE B 21  ? 0.2046 0.1554 0.2356 0.0183  0.0149  -0.0018 843 ILE C CA  
1315 C  C   . ILE B 21  ? 0.2168 0.1680 0.2464 0.0189  0.0139  -0.0023 843 ILE C C   
1316 O  O   . ILE B 21  ? 0.2164 0.1671 0.2473 0.0172  0.0115  -0.0023 843 ILE C O   
1317 C  CB  . ILE B 21  ? 0.1950 0.1496 0.2267 0.0163  0.0136  0.0000  843 ILE C CB  
1318 C  CG1 . ILE B 21  ? 0.3434 0.2980 0.3761 0.0158  0.0147  0.0004  843 ILE C CG1 
1319 C  CG2 . ILE B 21  ? 0.1871 0.1458 0.2164 0.0172  0.0143  0.0005  843 ILE C CG2 
1320 C  CD1 . ILE B 21  ? 0.3164 0.2749 0.3495 0.0138  0.0135  0.0021  843 ILE C CD1 
1321 N  N   . MET B 22  ? 0.6756 0.6276 0.7022 0.0212  0.0157  -0.0027 844 MET C N   
1322 C  CA  . MET B 22  ? 0.6899 0.6433 0.7149 0.0220  0.0149  -0.0033 844 MET C CA  
1323 C  C   . MET B 22  ? 0.6947 0.6538 0.7192 0.0212  0.0135  -0.0023 844 MET C C   
1324 O  O   . MET B 22  ? 0.6987 0.6607 0.7236 0.0206  0.0137  -0.0012 844 MET C O   
1325 C  CB  . MET B 22  ? 0.7030 0.6547 0.7244 0.0253  0.0174  -0.0041 844 MET C CB  
1326 C  CG  . MET B 22  ? 0.7161 0.6631 0.7375 0.0259  0.0191  -0.0054 844 MET C CG  
1327 S  SD  . MET B 22  ? 0.7731 0.7174 0.7889 0.0292  0.0226  -0.0056 844 MET C SD  
1328 C  CE  . MET B 22  ? 0.7353 0.6828 0.7484 0.0311  0.0211  -0.0057 844 MET C CE  
1329 N  N   . LEU B 23  ? 0.3861 0.3476 0.4099 0.0211  0.0121  -0.0031 845 LEU C N   
1330 C  CA  . LEU B 23  ? 0.3841 0.3524 0.4073 0.0206  0.0110  -0.0027 845 LEU C CA  
1331 C  C   . LEU B 23  ? 0.3894 0.3603 0.4109 0.0217  0.0102  -0.0040 845 LEU C C   
1332 O  O   . LEU B 23  ? 0.4001 0.3683 0.4222 0.0203  0.0090  -0.0052 845 LEU C O   
1333 C  CB  . LEU B 23  ? 0.3698 0.3407 0.3955 0.0163  0.0089  -0.0017 845 LEU C CB  
1334 C  CG  . LEU B 23  ? 0.3771 0.3452 0.4044 0.0128  0.0066  -0.0022 845 LEU C CG  
1335 C  CD1 . LEU B 23  ? 0.3762 0.3485 0.4044 0.0085  0.0047  -0.0011 845 LEU C CD1 
1336 C  CD2 . LEU B 23  ? 0.3814 0.3421 0.4100 0.0126  0.0065  -0.0021 845 LEU C CD2 
1337 N  N   . LYS B 24  ? 0.4627 0.4388 0.4819 0.0245  0.0109  -0.0040 846 LYS C N   
1338 C  CA  . LYS B 24  ? 0.4677 0.4479 0.4851 0.0257  0.0099  -0.0054 846 LYS C CA  
1339 C  C   . LYS B 24  ? 0.4640 0.4533 0.4827 0.0237  0.0081  -0.0055 846 LYS C C   
1340 O  O   . LYS B 24  ? 0.4618 0.4553 0.4811 0.0237  0.0085  -0.0045 846 LYS C O   
1341 C  CB  . LYS B 24  ? 0.4674 0.4470 0.4805 0.0310  0.0119  -0.0054 846 LYS C CB  
1342 C  CG  . LYS B 24  ? 0.4837 0.4566 0.4947 0.0326  0.0131  -0.0062 846 LYS C CG  
1343 C  CD  . LYS B 24  ? 0.4904 0.4662 0.5006 0.0325  0.0115  -0.0079 846 LYS C CD  
1344 C  CE  . LYS B 24  ? 0.4822 0.4648 0.4892 0.0361  0.0111  -0.0081 846 LYS C CE  
1345 N  NZ  . LYS B 24  ? 0.5028 0.4893 0.5090 0.0359  0.0095  -0.0100 846 LYS C NZ  
1346 N  N   . TRP B 25  ? 0.3999 0.3928 0.4190 0.0217  0.0063  -0.0070 847 TRP C N   
1347 C  CA  . TRP B 25  ? 0.4027 0.4051 0.4231 0.0191  0.0046  -0.0075 847 TRP C CA  
1348 C  C   . TRP B 25  ? 0.4246 0.4327 0.4439 0.0196  0.0034  -0.0096 847 TRP C C   
1349 O  O   . TRP B 25  ? 0.4379 0.4414 0.4556 0.0208  0.0034  -0.0107 847 TRP C O   
1350 C  CB  . TRP B 25  ? 0.4015 0.4029 0.4248 0.0129  0.0032  -0.0069 847 TRP C CB  
1351 C  CG  . TRP B 25  ? 0.4177 0.4130 0.4415 0.0096  0.0018  -0.0079 847 TRP C CG  
1352 C  CD1 . TRP B 25  ? 0.4248 0.4235 0.4487 0.0063  0.0000  -0.0097 847 TRP C CD1 
1353 C  CD2 . TRP B 25  ? 0.4216 0.4066 0.4458 0.0093  0.0019  -0.0076 847 TRP C CD2 
1354 N  NE1 . TRP B 25  ? 0.4323 0.4225 0.4562 0.0042  -0.0010 -0.0104 847 TRP C NE1 
1355 C  CE2 . TRP B 25  ? 0.4362 0.4182 0.4604 0.0062  0.0002  -0.0092 847 TRP C CE2 
1356 C  CE3 . TRP B 25  ? 0.4149 0.3934 0.4394 0.0114  0.0034  -0.0064 847 TRP C CE3 
1357 C  CZ2 . TRP B 25  ? 0.4403 0.4129 0.4649 0.0057  -0.0003 -0.0095 847 TRP C CZ2 
1358 C  CZ3 . TRP B 25  ? 0.4147 0.3848 0.4398 0.0107  0.0030  -0.0068 847 TRP C CZ3 
1359 C  CH2 . TRP B 25  ? 0.4271 0.3942 0.4522 0.0081  0.0011  -0.0083 847 TRP C CH2 
1360 N  N   . THR B 26  ? 0.4607 0.4795 0.4807 0.0186  0.0023  -0.0103 848 THR C N   
1361 C  CA  . THR B 26  ? 0.4662 0.4924 0.4854 0.0186  0.0008  -0.0126 848 THR C CA  
1362 C  C   . THR B 26  ? 0.4838 0.5163 0.5057 0.0118  -0.0011 -0.0137 848 THR C C   
1363 O  O   . THR B 26  ? 0.4761 0.5086 0.5000 0.0079  -0.0011 -0.0124 848 THR C O   
1364 C  CB  . THR B 26  ? 0.4611 0.4963 0.4782 0.0244  0.0012  -0.0130 848 THR C CB  
1365 O  OG1 . THR B 26  ? 0.4480 0.4920 0.4671 0.0233  0.0011  -0.0126 848 THR C OG1 
1366 C  CG2 . THR B 26  ? 0.4572 0.4850 0.4707 0.0307  0.0033  -0.0116 848 THR C CG2 
1367 N  N   . TYR B 27  ? 0.9749 1.0127 0.9966 0.0102  -0.0026 -0.0161 849 TYR C N   
1368 C  CA  . TYR B 27  ? 0.9866 1.0299 1.0103 0.0031  -0.0042 -0.0175 849 TYR C CA  
1369 C  C   . TYR B 27  ? 0.9805 1.0339 1.0038 0.0028  -0.0057 -0.0205 849 TYR C C   
1370 O  O   . TYR B 27  ? 0.9814 1.0306 1.0034 0.0022  -0.0064 -0.0223 849 TYR C O   
1371 C  CB  . TYR B 27  ? 0.9714 1.0029 0.9955 -0.0022 -0.0048 -0.0170 849 TYR C CB  
1372 C  CG  . TYR B 27  ? 0.9895 1.0244 1.0148 -0.0100 -0.0065 -0.0183 849 TYR C CG  
1373 C  CD1 . TYR B 27  ? 0.9782 1.0197 1.0051 -0.0145 -0.0065 -0.0174 849 TYR C CD1 
1374 C  CD2 . TYR B 27  ? 1.0183 1.0494 1.0427 -0.0133 -0.0078 -0.0206 849 TYR C CD2 
1375 C  CE1 . TYR B 27  ? 1.0031 1.0472 1.0305 -0.0223 -0.0078 -0.0185 849 TYR C CE1 
1376 C  CE2 . TYR B 27  ? 1.0265 1.0597 1.0514 -0.0210 -0.0092 -0.0218 849 TYR C CE2 
1377 C  CZ  . TYR B 27  ? 1.0328 1.0724 1.0590 -0.0257 -0.0091 -0.0207 849 TYR C CZ  
1378 O  OH  . TYR B 27  ? 1.0382 1.0794 1.0644 -0.0340 -0.0103 -0.0219 849 TYR C OH  
1379 N  N   . ILE B 37  ? 0.7115 0.7012 0.7282 -0.0424 -0.0153 -0.0297 859 ILE C N   
1380 C  CA  . ILE B 37  ? 0.7213 0.7035 0.7386 -0.0392 -0.0144 -0.0259 859 ILE C CA  
1381 C  C   . ILE B 37  ? 0.7301 0.6970 0.7458 -0.0366 -0.0149 -0.0260 859 ILE C C   
1382 O  O   . ILE B 37  ? 0.7238 0.6887 0.7389 -0.0335 -0.0151 -0.0286 859 ILE C O   
1383 C  CB  . ILE B 37  ? 0.6923 0.6830 0.7118 -0.0321 -0.0127 -0.0244 859 ILE C CB  
1384 C  CG1 . ILE B 37  ? 0.7130 0.7199 0.7340 -0.0334 -0.0124 -0.0249 859 ILE C CG1 
1385 C  CG2 . ILE B 37  ? 0.6669 0.6506 0.6871 -0.0297 -0.0118 -0.0206 859 ILE C CG2 
1386 C  CD1 . ILE B 37  ? 0.7098 0.7266 0.7307 -0.0320 -0.0129 -0.0285 859 ILE C CD1 
1387 N  N   . GLN B 38  ? 0.7385 0.6952 0.7536 -0.0376 -0.0151 -0.0231 860 GLN C N   
1388 C  CA  . GLN B 38  ? 0.7327 0.6753 0.7465 -0.0348 -0.0157 -0.0231 860 GLN C CA  
1389 C  C   . GLN B 38  ? 0.7050 0.6461 0.7208 -0.0280 -0.0144 -0.0208 860 GLN C C   
1390 O  O   . GLN B 38  ? 0.6985 0.6332 0.7143 -0.0233 -0.0142 -0.0219 860 GLN C O   
1391 C  CB  . GLN B 38  ? 0.7640 0.6945 0.7749 -0.0405 -0.0173 -0.0219 860 GLN C CB  
1392 C  CG  . GLN B 38  ? 0.7995 0.7272 0.8075 -0.0470 -0.0187 -0.0248 860 GLN C CG  
1393 C  CD  . GLN B 38  ? 0.8350 0.7493 0.8391 -0.0527 -0.0202 -0.0232 860 GLN C CD  
1394 O  OE1 . GLN B 38  ? 0.8271 0.7378 0.8309 -0.0533 -0.0202 -0.0195 860 GLN C OE1 
1395 N  NE2 . GLN B 38  ? 0.8586 0.7651 0.8593 -0.0571 -0.0216 -0.0260 860 GLN C NE2 
1396 N  N   . GLY B 39  ? 0.6280 0.5753 0.6454 -0.0277 -0.0133 -0.0179 861 GLY C N   
1397 C  CA  . GLY B 39  ? 0.6013 0.5478 0.6206 -0.0220 -0.0119 -0.0158 861 GLY C CA  
1398 C  C   . GLY B 39  ? 0.5740 0.5278 0.5947 -0.0227 -0.0109 -0.0129 861 GLY C C   
1399 O  O   . GLY B 39  ? 0.5784 0.5398 0.5990 -0.0272 -0.0111 -0.0127 861 GLY C O   
1400 N  N   . PHE B 40  ? 0.3815 0.3334 0.4035 -0.0185 -0.0098 -0.0109 862 PHE C N   
1401 C  CA  . PHE B 40  ? 0.3641 0.3224 0.3874 -0.0185 -0.0087 -0.0083 862 PHE C CA  
1402 C  C   . PHE B 40  ? 0.3624 0.3127 0.3856 -0.0189 -0.0091 -0.0056 862 PHE C C   
1403 O  O   . PHE B 40  ? 0.3587 0.2999 0.3817 -0.0165 -0.0096 -0.0057 862 PHE C O   
1404 C  CB  . PHE B 40  ? 0.3483 0.3136 0.3730 -0.0127 -0.0066 -0.0085 862 PHE C CB  
1405 C  CG  . PHE B 40  ? 0.3463 0.3208 0.3708 -0.0116 -0.0062 -0.0107 862 PHE C CG  
1406 C  CD1 . PHE B 40  ? 0.3559 0.3285 0.3795 -0.0085 -0.0061 -0.0131 862 PHE C CD1 
1407 C  CD2 . PHE B 40  ? 0.3389 0.3244 0.3639 -0.0135 -0.0060 -0.0106 862 PHE C CD2 
1408 C  CE1 . PHE B 40  ? 0.3608 0.3420 0.3838 -0.0072 -0.0059 -0.0151 862 PHE C CE1 
1409 C  CE2 . PHE B 40  ? 0.3457 0.3403 0.3704 -0.0121 -0.0059 -0.0128 862 PHE C CE2 
1410 C  CZ  . PHE B 40  ? 0.3618 0.3541 0.3854 -0.0088 -0.0059 -0.0149 862 PHE C CZ  
1411 N  N   . TYR B 41  ? 0.5566 0.5112 0.5801 -0.0218 -0.0088 -0.0032 863 TYR C N   
1412 C  CA  . TYR B 41  ? 0.5431 0.4921 0.5665 -0.0216 -0.0090 -0.0004 863 TYR C CA  
1413 C  C   . TYR B 41  ? 0.5173 0.4731 0.5428 -0.0176 -0.0070 0.0006  863 TYR C C   
1414 O  O   . TYR B 41  ? 0.4998 0.4655 0.5260 -0.0179 -0.0059 0.0005  863 TYR C O   
1415 C  CB  . TYR B 41  ? 0.5526 0.5004 0.5740 -0.0282 -0.0102 0.0017  863 TYR C CB  
1416 C  CG  . TYR B 41  ? 0.5785 0.5172 0.5969 -0.0327 -0.0123 0.0011  863 TYR C CG  
1417 C  CD1 . TYR B 41  ? 0.5951 0.5369 0.6116 -0.0395 -0.0129 0.0010  863 TYR C CD1 
1418 C  CD2 . TYR B 41  ? 0.5872 0.5142 0.6044 -0.0302 -0.0136 0.0004  863 TYR C CD2 
1419 C  CE1 . TYR B 41  ? 0.6235 0.5559 0.6366 -0.0441 -0.0147 0.0003  863 TYR C CE1 
1420 C  CE2 . TYR B 41  ? 0.6121 0.5297 0.6260 -0.0341 -0.0155 -0.0003 863 TYR C CE2 
1421 C  CZ  . TYR B 41  ? 0.6362 0.5560 0.6478 -0.0412 -0.0160 -0.0002 863 TYR C CZ  
1422 O  OH  . TYR B 41  ? 0.6444 0.5537 0.6520 -0.0455 -0.0178 -0.0010 863 TYR C OH  
1423 N  N   . ILE B 42  ? 0.4147 0.3653 0.4411 -0.0136 -0.0065 0.0013  864 ILE C N   
1424 C  CA  . ILE B 42  ? 0.3970 0.3525 0.4250 -0.0101 -0.0045 0.0021  864 ILE C CA  
1425 C  C   . ILE B 42  ? 0.3741 0.3266 0.4022 -0.0113 -0.0049 0.0047  864 ILE C C   
1426 O  O   . ILE B 42  ? 0.3844 0.3296 0.4127 -0.0096 -0.0056 0.0051  864 ILE C O   
1427 C  CB  . ILE B 42  ? 0.4035 0.3570 0.4325 -0.0044 -0.0030 0.0005  864 ILE C CB  
1428 C  CG1 . ILE B 42  ? 0.3975 0.3555 0.4260 -0.0027 -0.0022 -0.0017 864 ILE C CG1 
1429 C  CG2 . ILE B 42  ? 0.3851 0.3414 0.4153 -0.0015 -0.0010 0.0015  864 ILE C CG2 
1430 C  CD1 . ILE B 42  ? 0.4269 0.3806 0.4544 -0.0045 -0.0039 -0.0036 864 ILE C CD1 
1431 N  N   . TYR B 43  ? 0.5585 0.5174 0.5865 -0.0141 -0.0045 0.0063  865 TYR C N   
1432 C  CA  . TYR B 43  ? 0.5557 0.5128 0.5833 -0.0157 -0.0050 0.0088  865 TYR C CA  
1433 C  C   . TYR B 43  ? 0.5354 0.4961 0.5647 -0.0117 -0.0030 0.0091  865 TYR C C   
1434 O  O   . TYR B 43  ? 0.5260 0.4935 0.5562 -0.0095 -0.0012 0.0080  865 TYR C O   
1435 C  CB  . TYR B 43  ? 0.5632 0.5251 0.5893 -0.0214 -0.0056 0.0104  865 TYR C CB  
1436 C  CG  . TYR B 43  ? 0.5950 0.5529 0.6189 -0.0263 -0.0074 0.0102  865 TYR C CG  
1437 C  CD1 . TYR B 43  ? 0.6066 0.5541 0.6279 -0.0290 -0.0094 0.0118  865 TYR C CD1 
1438 C  CD2 . TYR B 43  ? 0.6108 0.5751 0.6348 -0.0283 -0.0071 0.0083  865 TYR C CD2 
1439 C  CE1 . TYR B 43  ? 0.6348 0.5774 0.6534 -0.0338 -0.0110 0.0116  865 TYR C CE1 
1440 C  CE2 . TYR B 43  ? 0.6329 0.5935 0.6547 -0.0333 -0.0087 0.0078  865 TYR C CE2 
1441 C  CZ  . TYR B 43  ? 0.6441 0.5934 0.6630 -0.0362 -0.0105 0.0095  865 TYR C CZ  
1442 O  OH  . TYR B 43  ? 0.6541 0.5984 0.6701 -0.0415 -0.0120 0.0090  865 TYR C OH  
1443 N  N   . TYR B 44  ? 0.3547 0.3106 0.3843 -0.0109 -0.0035 0.0104  866 TYR C N   
1444 C  CA  . TYR B 44  ? 0.3391 0.2980 0.3701 -0.0078 -0.0017 0.0106  866 TYR C CA  
1445 C  C   . TYR B 44  ? 0.3373 0.2945 0.3678 -0.0095 -0.0027 0.0128  866 TYR C C   
1446 O  O   . TYR B 44  ? 0.3461 0.2964 0.3757 -0.0104 -0.0047 0.0139  866 TYR C O   
1447 C  CB  . TYR B 44  ? 0.3343 0.2899 0.3667 -0.0031 -0.0005 0.0086  866 TYR C CB  
1448 C  CG  . TYR B 44  ? 0.3547 0.3021 0.3873 -0.0023 -0.0023 0.0081  866 TYR C CG  
1449 C  CD1 . TYR B 44  ? 0.3529 0.2967 0.3867 -0.0002 -0.0025 0.0082  866 TYR C CD1 
1450 C  CD2 . TYR B 44  ? 0.3613 0.3050 0.3928 -0.0035 -0.0037 0.0072  866 TYR C CD2 
1451 C  CE1 . TYR B 44  ? 0.3538 0.2907 0.3877 0.0012  -0.0042 0.0074  866 TYR C CE1 
1452 C  CE2 . TYR B 44  ? 0.3753 0.3112 0.4067 -0.0023 -0.0053 0.0064  866 TYR C CE2 
1453 C  CZ  . TYR B 44  ? 0.3739 0.3066 0.4065 0.0003  -0.0056 0.0065  866 TYR C CZ  
1454 O  OH  . TYR B 44  ? 0.3858 0.3113 0.4184 0.0020  -0.0073 0.0055  866 TYR C OH  
1455 N  N   . ARG B 45  ? 0.2859 0.2495 0.3169 -0.0096 -0.0012 0.0135  867 ARG C N   
1456 C  CA  . ARG B 45  ? 0.2738 0.2373 0.3040 -0.0115 -0.0020 0.0156  867 ARG C CA  
1457 C  C   . ARG B 45  ? 0.2608 0.2284 0.2925 -0.0087 0.0001  0.0150  867 ARG C C   
1458 O  O   . ARG B 45  ? 0.2566 0.2291 0.2891 -0.0066 0.0022  0.0135  867 ARG C O   
1459 C  CB  . ARG B 45  ? 0.2733 0.2414 0.3016 -0.0165 -0.0026 0.0174  867 ARG C CB  
1460 C  CG  . ARG B 45  ? 0.2690 0.2395 0.2963 -0.0184 -0.0028 0.0196  867 ARG C CG  
1461 C  CD  . ARG B 45  ? 0.2660 0.2429 0.2916 -0.0234 -0.0028 0.0209  867 ARG C CD  
1462 N  NE  . ARG B 45  ? 0.2494 0.2361 0.2765 -0.0223 -0.0006 0.0191  867 ARG C NE  
1463 C  CZ  . ARG B 45  ? 0.2579 0.2527 0.2843 -0.0259 -0.0001 0.0194  867 ARG C CZ  
1464 N  NH1 . ARG B 45  ? 0.2671 0.2609 0.2909 -0.0315 -0.0015 0.0217  867 ARG C NH1 
1465 N  NH2 . ARG B 45  ? 0.2476 0.2515 0.2756 -0.0239 0.0018  0.0175  867 ARG C NH2 
1466 N  N   . PRO B 46  ? 0.2553 0.2207 0.2870 -0.0086 -0.0007 0.0162  868 PRO C N   
1467 C  CA  . PRO B 46  ? 0.2382 0.2077 0.2710 -0.0068 0.0011  0.0156  868 PRO C CA  
1468 C  C   . PRO B 46  ? 0.2402 0.2176 0.2723 -0.0085 0.0025  0.0159  868 PRO C C   
1469 O  O   . PRO B 46  ? 0.2440 0.2237 0.2745 -0.0122 0.0013  0.0178  868 PRO C O   
1470 C  CB  . PRO B 46  ? 0.2436 0.2102 0.2759 -0.0076 -0.0008 0.0173  868 PRO C CB  
1471 C  CG  . PRO B 46  ? 0.2562 0.2153 0.2878 -0.0078 -0.0033 0.0179  868 PRO C CG  
1472 C  CD  . PRO B 46  ? 0.2667 0.2254 0.2972 -0.0099 -0.0035 0.0179  868 PRO C CD  
1473 N  N   . THR B 47  ? 0.3278 0.3091 0.3607 -0.0057 0.0050  0.0141  869 THR C N   
1474 C  CA  . THR B 47  ? 0.3173 0.3064 0.3496 -0.0064 0.0064  0.0139  869 THR C CA  
1475 C  C   . THR B 47  ? 0.3261 0.3188 0.3576 -0.0092 0.0059  0.0155  869 THR C C   
1476 O  O   . THR B 47  ? 0.3287 0.3284 0.3595 -0.0110 0.0065  0.0159  869 THR C O   
1477 C  CB  . THR B 47  ? 0.3157 0.3067 0.3484 -0.0024 0.0092  0.0117  869 THR C CB  
1478 O  OG1 . THR B 47  ? 0.3169 0.3039 0.3498 0.0002  0.0097  0.0104  869 THR C OG1 
1479 C  CG2 . THR B 47  ? 0.3167 0.3159 0.3486 -0.0023 0.0104  0.0112  869 THR C CG2 
1480 N  N   . ASP B 48  ? 0.3483 0.3370 0.3800 -0.0093 0.0049  0.0164  870 ASP C N   
1481 C  CA  . ASP B 48  ? 0.3371 0.3288 0.3676 -0.0117 0.0043  0.0180  870 ASP C CA  
1482 C  C   . ASP B 48  ? 0.3437 0.3354 0.3720 -0.0163 0.0021  0.0208  870 ASP C C   
1483 O  O   . ASP B 48  ? 0.3451 0.3402 0.3717 -0.0190 0.0016  0.0224  870 ASP C O   
1484 C  CB  . ASP B 48  ? 0.3326 0.3203 0.3638 -0.0103 0.0035  0.0180  870 ASP C CB  
1485 C  CG  . ASP B 48  ? 0.3316 0.3219 0.3641 -0.0076 0.0060  0.0156  870 ASP C CG  
1486 O  OD1 . ASP B 48  ? 0.3286 0.3231 0.3610 -0.0065 0.0082  0.0142  870 ASP C OD1 
1487 O  OD2 . ASP B 48  ? 0.3223 0.3106 0.3558 -0.0065 0.0058  0.0150  870 ASP C OD2 
1488 N  N   . SER B 49  ? 0.2821 0.2698 0.3100 -0.0174 0.0009  0.0212  871 SER C N   
1489 C  CA  . SER B 49  ? 0.2923 0.2785 0.3174 -0.0223 -0.0011 0.0238  871 SER C CA  
1490 C  C   . SER B 49  ? 0.2973 0.2906 0.3221 -0.0250 -0.0001 0.0233  871 SER C C   
1491 O  O   . SER B 49  ? 0.3043 0.2987 0.3306 -0.0233 0.0007  0.0214  871 SER C O   
1492 C  CB  . SER B 49  ? 0.2987 0.2751 0.3230 -0.0222 -0.0034 0.0245  871 SER C CB  
1493 O  OG  . SER B 49  ? 0.3171 0.2908 0.3380 -0.0272 -0.0052 0.0270  871 SER C OG  
1494 N  N   . ASP B 50  ? 0.3228 0.3216 0.3457 -0.0293 -0.0002 0.0250  872 ASP C N   
1495 C  CA  . ASP B 50  ? 0.3194 0.3263 0.3421 -0.0325 0.0007  0.0245  872 ASP C CA  
1496 C  C   . ASP B 50  ? 0.3291 0.3317 0.3489 -0.0381 -0.0012 0.0265  872 ASP C C   
1497 O  O   . ASP B 50  ? 0.3298 0.3390 0.3484 -0.0428 -0.0008 0.0269  872 ASP C O   
1498 C  CB  . ASP B 50  ? 0.3131 0.3301 0.3354 -0.0340 0.0022  0.0245  872 ASP C CB  
1499 C  CG  . ASP B 50  ? 0.3081 0.3296 0.3329 -0.0286 0.0043  0.0220  872 ASP C CG  
1500 O  OD1 . ASP B 50  ? 0.3023 0.3314 0.3269 -0.0290 0.0056  0.0217  872 ASP C OD1 
1501 O  OD2 . ASP B 50  ? 0.3044 0.3213 0.3309 -0.0240 0.0048  0.0203  872 ASP C OD2 
1502 N  N   . ASN B 51  ? 0.2872 0.2786 0.3058 -0.0377 -0.0032 0.0277  873 ASN C N   
1503 C  CA  . ASN B 51  ? 0.3042 0.2889 0.3193 -0.0427 -0.0051 0.0297  873 ASN C CA  
1504 C  C   . ASN B 51  ? 0.3086 0.2885 0.3248 -0.0414 -0.0056 0.0278  873 ASN C C   
1505 O  O   . ASN B 51  ? 0.3031 0.2763 0.3208 -0.0368 -0.0062 0.0268  873 ASN C O   
1506 C  CB  . ASN B 51  ? 0.3185 0.2930 0.3301 -0.0434 -0.0074 0.0327  873 ASN C CB  
1507 C  CG  . ASN B 51  ? 0.3335 0.3005 0.3401 -0.0493 -0.0093 0.0353  873 ASN C CG  
1508 O  OD1 . ASN B 51  ? 0.3491 0.3065 0.3520 -0.0499 -0.0114 0.0379  873 ASN C OD1 
1509 N  ND2 . ASN B 51  ? 0.3290 0.3002 0.3353 -0.0537 -0.0085 0.0344  873 ASN C ND2 
1510 N  N   . ASP B 52  ? 0.4397 0.4239 0.4555 -0.0455 -0.0053 0.0271  874 ASP C N   
1511 C  CA  . ASP B 52  ? 0.4465 0.4275 0.4633 -0.0447 -0.0058 0.0250  874 ASP C CA  
1512 C  C   . ASP B 52  ? 0.4590 0.4261 0.4728 -0.0456 -0.0082 0.0264  874 ASP C C   
1513 O  O   . ASP B 52  ? 0.4652 0.4279 0.4795 -0.0447 -0.0088 0.0246  874 ASP C O   
1514 C  CB  . ASP B 52  ? 0.4486 0.4386 0.4654 -0.0493 -0.0050 0.0237  874 ASP C CB  
1515 C  CG  . ASP B 52  ? 0.4411 0.4446 0.4615 -0.0461 -0.0027 0.0213  874 ASP C CG  
1516 O  OD1 . ASP B 52  ? 0.4377 0.4413 0.4606 -0.0398 -0.0018 0.0199  874 ASP C OD1 
1517 O  OD2 . ASP B 52  ? 0.4383 0.4521 0.4588 -0.0500 -0.0019 0.0206  874 ASP C OD2 
1518 N  N   . SER B 53  ? 0.3812 0.3412 0.3916 -0.0472 -0.0096 0.0294  875 SER C N   
1519 C  CA  . SER B 53  ? 0.3845 0.3305 0.3916 -0.0474 -0.0122 0.0309  875 SER C CA  
1520 C  C   . SER B 53  ? 0.3824 0.3233 0.3922 -0.0402 -0.0127 0.0296  875 SER C C   
1521 O  O   . SER B 53  ? 0.4024 0.3325 0.4105 -0.0386 -0.0147 0.0298  875 SER C O   
1522 C  CB  . SER B 53  ? 0.3937 0.3340 0.3954 -0.0517 -0.0137 0.0348  875 SER C CB  
1523 O  OG  . SER B 53  ? 0.4047 0.3516 0.4041 -0.0586 -0.0127 0.0360  875 SER C OG  
1524 N  N   . ASP B 54  ? 0.3345 0.2830 0.3482 -0.0359 -0.0109 0.0282  876 ASP C N   
1525 C  CA  . ASP B 54  ? 0.3307 0.2758 0.3470 -0.0297 -0.0111 0.0270  876 ASP C CA  
1526 C  C   . ASP B 54  ? 0.3291 0.2753 0.3489 -0.0256 -0.0098 0.0237  876 ASP C C   
1527 O  O   . ASP B 54  ? 0.3212 0.2689 0.3440 -0.0208 -0.0087 0.0221  876 ASP C O   
1528 C  CB  . ASP B 54  ? 0.3207 0.2722 0.3386 -0.0277 -0.0098 0.0275  876 ASP C CB  
1529 C  CG  . ASP B 54  ? 0.3298 0.2793 0.3440 -0.0309 -0.0113 0.0309  876 ASP C CG  
1530 O  OD1 . ASP B 54  ? 0.3407 0.2813 0.3508 -0.0334 -0.0136 0.0330  876 ASP C OD1 
1531 O  OD2 . ASP B 54  ? 0.3237 0.2802 0.3385 -0.0309 -0.0101 0.0314  876 ASP C OD2 
1532 N  N   . TYR B 55  ? 0.3702 0.3156 0.3893 -0.0279 -0.0100 0.0226  877 TYR C N   
1533 C  CA  . TYR B 55  ? 0.3793 0.3258 0.4011 -0.0244 -0.0090 0.0195  877 TYR C CA  
1534 C  C   . TYR B 55  ? 0.4009 0.3370 0.4221 -0.0224 -0.0108 0.0186  877 TYR C C   
1535 O  O   . TYR B 55  ? 0.4106 0.3393 0.4285 -0.0257 -0.0128 0.0198  877 TYR C O   
1536 C  CB  . TYR B 55  ? 0.3821 0.3353 0.4039 -0.0276 -0.0081 0.0183  877 TYR C CB  
1537 C  CG  . TYR B 55  ? 0.3642 0.3293 0.3883 -0.0265 -0.0057 0.0174  877 TYR C CG  
1538 C  CD1 . TYR B 55  ? 0.3483 0.3206 0.3714 -0.0304 -0.0052 0.0188  877 TYR C CD1 
1539 C  CD2 . TYR B 55  ? 0.3513 0.3202 0.3781 -0.0214 -0.0039 0.0150  877 TYR C CD2 
1540 C  CE1 . TYR B 55  ? 0.3424 0.3254 0.3675 -0.0289 -0.0031 0.0177  877 TYR C CE1 
1541 C  CE2 . TYR B 55  ? 0.3375 0.3160 0.3656 -0.0200 -0.0019 0.0142  877 TYR C CE2 
1542 C  CZ  . TYR B 55  ? 0.3324 0.3182 0.3599 -0.0235 -0.0015 0.0154  877 TYR C CZ  
1543 O  OH  . TYR B 55  ? 0.3347 0.3303 0.3635 -0.0215 0.0004  0.0143  877 TYR C OH  
1544 N  N   . LYS B 56  ? 0.5629 0.4983 0.5869 -0.0171 -0.0100 0.0165  878 LYS C N   
1545 C  CA  . LYS B 56  ? 0.5760 0.5031 0.5998 -0.0147 -0.0113 0.0149  878 LYS C CA  
1546 C  C   . LYS B 56  ? 0.5849 0.5140 0.6093 -0.0148 -0.0105 0.0124  878 LYS C C   
1547 O  O   . LYS B 56  ? 0.5751 0.5123 0.6014 -0.0137 -0.0083 0.0112  878 LYS C O   
1548 C  CB  . LYS B 56  ? 0.5759 0.5017 0.6024 -0.0092 -0.0108 0.0137  878 LYS C CB  
1549 C  CG  . LYS B 56  ? 0.6128 0.5334 0.6382 -0.0083 -0.0127 0.0156  878 LYS C CG  
1550 C  CD  . LYS B 56  ? 0.6525 0.5726 0.6809 -0.0030 -0.0123 0.0137  878 LYS C CD  
1551 C  CE  . LYS B 56  ? 0.6842 0.6010 0.7119 -0.0018 -0.0143 0.0155  878 LYS C CE  
1552 N  NZ  . LYS B 56  ? 0.6783 0.5972 0.7095 0.0030  -0.0135 0.0134  878 LYS C NZ  
1553 N  N   . ARG B 57  ? 0.4725 0.3940 0.4950 -0.0158 -0.0122 0.0116  879 ARG C N   
1554 C  CA  . ARG B 57  ? 0.4798 0.4031 0.5025 -0.0165 -0.0117 0.0092  879 ARG C CA  
1555 C  C   . ARG B 57  ? 0.4756 0.3949 0.4997 -0.0117 -0.0116 0.0064  879 ARG C C   
1556 O  O   . ARG B 57  ? 0.4709 0.3824 0.4947 -0.0094 -0.0131 0.0063  879 ARG C O   
1557 C  CB  . ARG B 57  ? 0.5013 0.4199 0.5203 -0.0222 -0.0135 0.0098  879 ARG C CB  
1558 C  CG  . ARG B 57  ? 0.5176 0.4406 0.5368 -0.0240 -0.0129 0.0073  879 ARG C CG  
1559 C  CD  . ARG B 57  ? 0.5468 0.4659 0.5624 -0.0306 -0.0145 0.0079  879 ARG C CD  
1560 N  NE  . ARG B 57  ? 0.5596 0.4663 0.5725 -0.0306 -0.0166 0.0070  879 ARG C NE  
1561 C  CZ  . ARG B 57  ? 0.5974 0.4932 0.6072 -0.0312 -0.0185 0.0091  879 ARG C CZ  
1562 N  NH1 . ARG B 57  ? 0.6257 0.5221 0.6348 -0.0320 -0.0186 0.0123  879 ARG C NH1 
1563 N  NH2 . ARG B 57  ? 0.6038 0.4882 0.6110 -0.0306 -0.0204 0.0080  879 ARG C NH2 
1564 N  N   . ASP B 58  ? 0.4388 0.3639 0.4645 -0.0101 -0.0099 0.0041  880 ASP C N   
1565 C  CA  . ASP B 58  ? 0.4408 0.3629 0.4673 -0.0065 -0.0097 0.0013  880 ASP C CA  
1566 C  C   . ASP B 58  ? 0.4649 0.3875 0.4899 -0.0091 -0.0102 -0.0005 880 ASP C C   
1567 O  O   . ASP B 58  ? 0.4581 0.3866 0.4824 -0.0128 -0.0100 0.0001  880 ASP C O   
1568 C  CB  . ASP B 58  ? 0.4184 0.3464 0.4475 -0.0020 -0.0070 0.0001  880 ASP C CB  
1569 C  CG  . ASP B 58  ? 0.4101 0.3362 0.4408 0.0011  -0.0066 0.0007  880 ASP C CG  
1570 O  OD1 . ASP B 58  ? 0.4107 0.3315 0.4408 0.0002  -0.0085 0.0022  880 ASP C OD1 
1571 O  OD2 . ASP B 58  ? 0.4042 0.3340 0.4367 0.0044  -0.0043 -0.0003 880 ASP C OD2 
1572 N  N   . VAL B 59  ? 0.5178 0.4347 0.5423 -0.0073 -0.0110 -0.0030 881 VAL C N   
1573 C  CA  . VAL B 59  ? 0.5304 0.4471 0.5532 -0.0098 -0.0117 -0.0050 881 VAL C CA  
1574 C  C   . VAL B 59  ? 0.5411 0.4602 0.5651 -0.0058 -0.0104 -0.0081 881 VAL C C   
1575 O  O   . VAL B 59  ? 0.5463 0.4606 0.5711 -0.0019 -0.0103 -0.0095 881 VAL C O   
1576 C  CB  . VAL B 59  ? 0.5419 0.4478 0.5618 -0.0128 -0.0143 -0.0052 881 VAL C CB  
1577 C  CG1 . VAL B 59  ? 0.5623 0.4688 0.5803 -0.0168 -0.0150 -0.0072 881 VAL C CG1 
1578 C  CG2 . VAL B 59  ? 0.5394 0.4414 0.5575 -0.0163 -0.0156 -0.0017 881 VAL C CG2 
1579 N  N   . VAL B 60  ? 0.4153 0.3423 0.4393 -0.0066 -0.0093 -0.0092 882 VAL C N   
1580 C  CA  . VAL B 60  ? 0.4168 0.3465 0.4411 -0.0030 -0.0081 -0.0120 882 VAL C CA  
1581 C  C   . VAL B 60  ? 0.4317 0.3631 0.4543 -0.0060 -0.0092 -0.0142 882 VAL C C   
1582 O  O   . VAL B 60  ? 0.4385 0.3722 0.4601 -0.0109 -0.0102 -0.0135 882 VAL C O   
1583 C  CB  . VAL B 60  ? 0.4115 0.3499 0.4370 0.0002  -0.0056 -0.0113 882 VAL C CB  
1584 C  CG1 . VAL B 60  ? 0.4070 0.3438 0.4340 0.0028  -0.0044 -0.0095 882 VAL C CG1 
1585 C  CG2 . VAL B 60  ? 0.4047 0.3517 0.4299 -0.0027 -0.0055 -0.0103 882 VAL C CG2 
1586 N  N   . GLU B 61  ? 0.7218 0.6526 0.7439 -0.0032 -0.0088 -0.0171 883 GLU C N   
1587 C  CA  . GLU B 61  ? 0.7376 0.6701 0.7580 -0.0058 -0.0098 -0.0197 883 GLU C CA  
1588 C  C   . GLU B 61  ? 0.7271 0.6714 0.7477 -0.0064 -0.0089 -0.0198 883 GLU C C   
1589 O  O   . GLU B 61  ? 0.7093 0.6595 0.7309 -0.0036 -0.0072 -0.0181 883 GLU C O   
1590 C  CB  . GLU B 61  ? 0.7519 0.6801 0.7717 -0.0026 -0.0098 -0.0230 883 GLU C CB  
1591 C  CG  . GLU B 61  ? 0.7519 0.6843 0.7725 0.0029  -0.0074 -0.0235 883 GLU C CG  
1592 C  CD  . GLU B 61  ? 0.7619 0.7029 0.7813 0.0037  -0.0066 -0.0249 883 GLU C CD  
1593 O  OE1 . GLU B 61  ? 0.7589 0.7007 0.7769 0.0013  -0.0079 -0.0274 883 GLU C OE1 
1594 O  OE2 . GLU B 61  ? 0.7521 0.6991 0.7717 0.0068  -0.0047 -0.0236 883 GLU C OE2 
1595 N  N   . GLY B 62  ? 0.6010 0.5485 0.6202 -0.0100 -0.0101 -0.0219 884 GLY C N   
1596 C  CA  . GLY B 62  ? 0.5945 0.5539 0.6139 -0.0113 -0.0097 -0.0221 884 GLY C CA  
1597 C  C   . GLY B 62  ? 0.5933 0.5604 0.6126 -0.0061 -0.0082 -0.0231 884 GLY C C   
1598 O  O   . GLY B 62  ? 0.5878 0.5652 0.6072 -0.0062 -0.0079 -0.0231 884 GLY C O   
1599 N  N   . SER B 63  ? 0.5533 0.5157 0.5720 -0.0015 -0.0072 -0.0240 885 SER C N   
1600 C  CA  . SER B 63  ? 0.5511 0.5195 0.5687 0.0034  -0.0057 -0.0248 885 SER C CA  
1601 C  C   . SER B 63  ? 0.5480 0.5157 0.5660 0.0080  -0.0034 -0.0223 885 SER C C   
1602 O  O   . SER B 63  ? 0.5459 0.5154 0.5623 0.0124  -0.0018 -0.0226 885 SER C O   
1603 C  CB  . SER B 63  ? 0.5713 0.5362 0.5872 0.0052  -0.0059 -0.0279 885 SER C CB  
1604 O  OG  . SER B 63  ? 0.5743 0.5311 0.5905 0.0082  -0.0047 -0.0277 885 SER C OG  
1605 N  N   . LYS B 64  ? 0.6887 0.6534 0.7084 0.0066  -0.0033 -0.0198 886 LYS C N   
1606 C  CA  . LYS B 64  ? 0.6814 0.6453 0.7017 0.0102  -0.0012 -0.0176 886 LYS C CA  
1607 C  C   . LYS B 64  ? 0.6651 0.6367 0.6856 0.0105  -0.0005 -0.0156 886 LYS C C   
1608 O  O   . LYS B 64  ? 0.6532 0.6288 0.6747 0.0067  -0.0018 -0.0150 886 LYS C O   
1609 C  CB  . LYS B 64  ? 0.6722 0.6279 0.6943 0.0094  -0.0013 -0.0164 886 LYS C CB  
1610 C  CG  . LYS B 64  ? 0.6773 0.6261 0.6992 0.0118  -0.0008 -0.0182 886 LYS C CG  
1611 C  CD  . LYS B 64  ? 0.6702 0.6205 0.6909 0.0165  0.0019  -0.0182 886 LYS C CD  
1612 C  CE  . LYS B 64  ? 0.6802 0.6259 0.7004 0.0186  0.0025  -0.0206 886 LYS C CE  
1613 N  NZ  . LYS B 64  ? 0.7087 0.6558 0.7271 0.0180  0.0012  -0.0233 886 LYS C NZ  
1614 N  N   . GLN B 65  ? 0.8505 0.8239 0.8697 0.0151  0.0016  -0.0147 887 GLN C N   
1615 C  CA  . GLN B 65  ? 0.8363 0.8164 0.8553 0.0164  0.0025  -0.0130 887 GLN C CA  
1616 C  C   . GLN B 65  ? 0.8226 0.7983 0.8417 0.0188  0.0045  -0.0110 887 GLN C C   
1617 O  O   . GLN B 65  ? 0.8089 0.7886 0.8274 0.0208  0.0056  -0.0096 887 GLN C O   
1618 C  CB  . GLN B 65  ? 0.8542 0.8409 0.8703 0.0202  0.0030  -0.0139 887 GLN C CB  
1619 C  CG  . GLN B 65  ? 0.8708 0.8645 0.8868 0.0179  0.0009  -0.0160 887 GLN C CG  
1620 C  CD  . GLN B 65  ? 0.9058 0.9067 0.9188 0.0223  0.0012  -0.0168 887 GLN C CD  
1621 O  OE1 . GLN B 65  ? 0.8886 0.8865 0.8987 0.0271  0.0029  -0.0163 887 GLN C OE1 
1622 N  NE2 . GLN B 65  ? 0.9224 0.9332 0.9359 0.0207  -0.0004 -0.0181 887 GLN C NE2 
1623 N  N   . TRP B 66  ? 0.5323 0.5003 0.5524 0.0186  0.0050  -0.0111 888 TRP C N   
1624 C  CA  . TRP B 66  ? 0.5101 0.4742 0.5307 0.0203  0.0070  -0.0096 888 TRP C CA  
1625 C  C   . TRP B 66  ? 0.5092 0.4669 0.5323 0.0180  0.0061  -0.0095 888 TRP C C   
1626 O  O   . TRP B 66  ? 0.5173 0.4715 0.5409 0.0168  0.0047  -0.0111 888 TRP C O   
1627 C  CB  . TRP B 66  ? 0.5067 0.4684 0.5244 0.0245  0.0094  -0.0100 888 TRP C CB  
1628 C  CG  . TRP B 66  ? 0.5032 0.4602 0.5213 0.0257  0.0116  -0.0091 888 TRP C CG  
1629 C  CD1 . TRP B 66  ? 0.4939 0.4515 0.5107 0.0274  0.0136  -0.0075 888 TRP C CD1 
1630 C  CD2 . TRP B 66  ? 0.5022 0.4536 0.5222 0.0251  0.0121  -0.0099 888 TRP C CD2 
1631 N  NE1 . TRP B 66  ? 0.4913 0.4441 0.5090 0.0275  0.0153  -0.0074 888 TRP C NE1 
1632 C  CE2 . TRP B 66  ? 0.4974 0.4469 0.5172 0.0262  0.0144  -0.0088 888 TRP C CE2 
1633 C  CE3 . TRP B 66  ? 0.5046 0.4527 0.5263 0.0240  0.0107  -0.0116 888 TRP C CE3 
1634 C  CZ2 . TRP B 66  ? 0.4920 0.4373 0.5137 0.0259  0.0153  -0.0095 888 TRP C CZ2 
1635 C  CZ3 . TRP B 66  ? 0.4945 0.4383 0.5179 0.0243  0.0116  -0.0122 888 TRP C CZ3 
1636 C  CH2 . TRP B 66  ? 0.4874 0.4305 0.5111 0.0252  0.0139  -0.0112 888 TRP C CH2 
1637 N  N   . HIS B 67  ? 0.6042 0.5606 0.6289 0.0176  0.0068  -0.0078 889 HIS C N   
1638 C  CA  . HIS B 67  ? 0.5984 0.5493 0.6253 0.0160  0.0059  -0.0076 889 HIS C CA  
1639 C  C   . HIS B 67  ? 0.5949 0.5440 0.6227 0.0175  0.0078  -0.0067 889 HIS C C   
1640 O  O   . HIS B 67  ? 0.5846 0.5365 0.6113 0.0189  0.0096  -0.0057 889 HIS C O   
1641 C  CB  . HIS B 67  ? 0.5866 0.5379 0.6147 0.0118  0.0034  -0.0065 889 HIS C CB  
1642 C  CG  . HIS B 67  ? 0.6084 0.5534 0.6381 0.0105  0.0019  -0.0062 889 HIS C CG  
1643 N  ND1 . HIS B 67  ? 0.6155 0.5550 0.6453 0.0105  0.0006  -0.0079 889 HIS C ND1 
1644 C  CD2 . HIS B 67  ? 0.6051 0.5484 0.6362 0.0095  0.0016  -0.0044 889 HIS C CD2 
1645 C  CE1 . HIS B 67  ? 0.6064 0.5409 0.6375 0.0099  -0.0007 -0.0072 889 HIS C CE1 
1646 N  NE2 . HIS B 67  ? 0.5943 0.5312 0.6261 0.0092  -0.0001 -0.0050 889 HIS C NE2 
1647 N  N   . MET B 68  ? 0.5947 0.5392 0.6245 0.0173  0.0072  -0.0072 890 MET C N   
1648 C  CA  . MET B 68  ? 0.5773 0.5205 0.6085 0.0183  0.0088  -0.0067 890 MET C CA  
1649 C  C   . MET B 68  ? 0.5759 0.5169 0.6093 0.0163  0.0067  -0.0056 890 MET C C   
1650 O  O   . MET B 68  ? 0.5879 0.5249 0.6223 0.0160  0.0049  -0.0066 890 MET C O   
1651 C  CB  . MET B 68  ? 0.5823 0.5228 0.6135 0.0207  0.0105  -0.0088 890 MET C CB  
1652 C  CG  . MET B 68  ? 0.5614 0.5005 0.5948 0.0211  0.0116  -0.0090 890 MET C CG  
1653 S  SD  . MET B 68  ? 0.5759 0.5171 0.6080 0.0218  0.0150  -0.0080 890 MET C SD  
1654 C  CE  . MET B 68  ? 0.5799 0.5204 0.6084 0.0242  0.0179  -0.0094 890 MET C CE  
1655 N  N   . ILE B 69  ? 0.3488 0.2922 0.3826 0.0150  0.0068  -0.0037 891 ILE C N   
1656 C  CA  . ILE B 69  ? 0.3437 0.2853 0.3792 0.0132  0.0049  -0.0024 891 ILE C CA  
1657 C  C   . ILE B 69  ? 0.3305 0.2709 0.3678 0.0150  0.0061  -0.0031 891 ILE C C   
1658 O  O   . ILE B 69  ? 0.3300 0.2725 0.3671 0.0162  0.0087  -0.0034 891 ILE C O   
1659 C  CB  . ILE B 69  ? 0.3352 0.2806 0.3702 0.0107  0.0045  -0.0001 891 ILE C CB  
1660 C  CG1 . ILE B 69  ? 0.3399 0.2884 0.3732 0.0090  0.0038  0.0002  891 ILE C CG1 
1661 C  CG2 . ILE B 69  ? 0.3244 0.2671 0.3602 0.0087  0.0021  0.0015  891 ILE C CG2 
1662 C  CD1 . ILE B 69  ? 0.3202 0.2735 0.3532 0.0064  0.0034  0.0022  891 ILE C CD1 
1663 N  N   . GLY B 70  ? 0.2452 0.1821 0.2840 0.0150  0.0041  -0.0034 892 GLY C N   
1664 C  CA  . GLY B 70  ? 0.2391 0.1759 0.2801 0.0167  0.0049  -0.0044 892 GLY C CA  
1665 C  C   . GLY B 70  ? 0.2407 0.1764 0.2828 0.0158  0.0026  -0.0029 892 GLY C C   
1666 O  O   . GLY B 70  ? 0.2392 0.1738 0.2800 0.0136  0.0005  -0.0007 892 GLY C O   
1667 N  N   . HIS B 71  ? 0.5519 0.4884 0.5963 0.0175  0.0029  -0.0040 893 HIS C N   
1668 C  CA  . HIS B 71  ? 0.5544 0.4904 0.5999 0.0172  0.0006  -0.0028 893 HIS C CA  
1669 C  C   . HIS B 71  ? 0.5494 0.4881 0.5937 0.0147  0.0007  -0.0001 893 HIS C C   
1670 O  O   . HIS B 71  ? 0.5452 0.4822 0.5886 0.0133  -0.0018 0.0020  893 HIS C O   
1671 C  CB  . HIS B 71  ? 0.5671 0.4972 0.6116 0.0175  -0.0029 -0.0022 893 HIS C CB  
1672 C  CG  . HIS B 71  ? 0.5732 0.5005 0.6186 0.0202  -0.0032 -0.0051 893 HIS C CG  
1673 N  ND1 . HIS B 71  ? 0.5826 0.5080 0.6266 0.0200  -0.0026 -0.0061 893 HIS C ND1 
1674 C  CD2 . HIS B 71  ? 0.5788 0.5056 0.6265 0.0233  -0.0040 -0.0073 893 HIS C CD2 
1675 C  CE1 . HIS B 71  ? 0.5937 0.5172 0.6390 0.0227  -0.0030 -0.0089 893 HIS C CE1 
1676 N  NE2 . HIS B 71  ? 0.6104 0.5348 0.6580 0.0249  -0.0037 -0.0097 893 HIS C NE2 
1677 N  N   . LEU B 72  ? 0.1770 0.1196 0.2210 0.0142  0.0037  -0.0004 894 LEU C N   
1678 C  CA  . LEU B 72  ? 0.1649 0.1110 0.2081 0.0122  0.0042  0.0016  894 LEU C CA  
1679 C  C   . LEU B 72  ? 0.1545 0.1036 0.1993 0.0127  0.0057  0.0008  894 LEU C C   
1680 O  O   . LEU B 72  ? 0.1510 0.1005 0.1975 0.0144  0.0072  -0.0015 894 LEU C O   
1681 C  CB  . LEU B 72  ? 0.1557 0.1040 0.1970 0.0116  0.0064  0.0018  894 LEU C CB  
1682 C  CG  . LEU B 72  ? 0.1540 0.1006 0.1937 0.0109  0.0053  0.0022  894 LEU C CG  
1683 C  CD1 . LEU B 72  ? 0.1546 0.1045 0.1925 0.0111  0.0074  0.0022  894 LEU C CD1 
1684 C  CD2 . LEU B 72  ? 0.1552 0.1003 0.1940 0.0083  0.0022  0.0044  894 LEU C CD2 
1685 N  N   . GLN B 73  ? 0.4795 0.4314 0.5238 0.0110  0.0054  0.0025  895 GLN C N   
1686 C  CA  . GLN B 73  ? 0.4786 0.4337 0.5244 0.0111  0.0064  0.0017  895 GLN C CA  
1687 C  C   . GLN B 73  ? 0.4766 0.4339 0.5218 0.0112  0.0102  0.0003  895 GLN C C   
1688 O  O   . GLN B 73  ? 0.4811 0.4391 0.5242 0.0105  0.0115  0.0011  895 GLN C O   
1689 C  CB  . GLN B 73  ? 0.4676 0.4246 0.5128 0.0093  0.0044  0.0040  895 GLN C CB  
1690 C  CG  . GLN B 73  ? 0.4846 0.4386 0.5300 0.0098  0.0008  0.0052  895 GLN C CG  
1691 C  CD  . GLN B 73  ? 0.4918 0.4449 0.5398 0.0125  0.0004  0.0028  895 GLN C CD  
1692 O  OE1 . GLN B 73  ? 0.4894 0.4463 0.5396 0.0133  0.0020  0.0008  895 GLN C OE1 
1693 N  NE2 . GLN B 73  ? 0.4964 0.4448 0.5443 0.0140  -0.0017 0.0027  895 GLN C NE2 
1694 N  N   . PRO B 74  ? 0.2044 0.1629 0.2513 0.0119  0.0121  -0.0021 896 PRO C N   
1695 C  CA  . PRO B 74  ? 0.2044 0.1636 0.2501 0.0117  0.0158  -0.0036 896 PRO C CA  
1696 C  C   . PRO B 74  ? 0.2029 0.1643 0.2468 0.0104  0.0167  -0.0023 896 PRO C C   
1697 O  O   . PRO B 74  ? 0.2018 0.1659 0.2465 0.0092  0.0151  -0.0014 896 PRO C O   
1698 C  CB  . PRO B 74  ? 0.1992 0.1604 0.2475 0.0118  0.0169  -0.0061 896 PRO C CB  
1699 C  CG  . PRO B 74  ? 0.1875 0.1484 0.2384 0.0131  0.0140  -0.0064 896 PRO C CG  
1700 C  CD  . PRO B 74  ? 0.1965 0.1559 0.2464 0.0129  0.0106  -0.0035 896 PRO C CD  
1701 N  N   . GLU B 75  ? 0.5097 0.4698 0.5508 0.0108  0.0191  -0.0023 897 GLU C N   
1702 C  CA  . GLU B 75  ? 0.5119 0.4740 0.5510 0.0101  0.0203  -0.0017 897 GLU C CA  
1703 C  C   . GLU B 75  ? 0.5067 0.4716 0.5455 0.0091  0.0178  0.0007  897 GLU C C   
1704 O  O   . GLU B 75  ? 0.5036 0.4715 0.5417 0.0081  0.0180  0.0012  897 GLU C O   
1705 C  CB  . GLU B 75  ? 0.5215 0.4854 0.5617 0.0089  0.0216  -0.0033 897 GLU C CB  
1706 C  CG  . GLU B 75  ? 0.5507 0.5147 0.5881 0.0087  0.0244  -0.0039 897 GLU C CG  
1707 C  CD  . GLU B 75  ? 0.5786 0.5434 0.6167 0.0072  0.0262  -0.0062 897 GLU C CD  
1708 O  OE1 . GLU B 75  ? 0.5908 0.5585 0.6288 0.0060  0.0262  -0.0063 897 GLU C OE1 
1709 O  OE2 . GLU B 75  ? 0.5819 0.5449 0.6210 0.0071  0.0277  -0.0081 897 GLU C OE2 
1710 N  N   . THR B 76  ? 0.3578 0.3217 0.3971 0.0091  0.0154  0.0020  898 THR C N   
1711 C  CA  . THR B 76  ? 0.3536 0.3199 0.3925 0.0074  0.0130  0.0044  898 THR C CA  
1712 C  C   . THR B 76  ? 0.3531 0.3201 0.3901 0.0077  0.0132  0.0051  898 THR C C   
1713 O  O   . THR B 76  ? 0.3620 0.3265 0.3987 0.0090  0.0134  0.0044  898 THR C O   
1714 C  CB  . THR B 76  ? 0.3543 0.3187 0.3946 0.0065  0.0097  0.0055  898 THR C CB  
1715 O  OG1 . THR B 76  ? 0.3696 0.3343 0.4116 0.0066  0.0092  0.0048  898 THR C OG1 
1716 C  CG2 . THR B 76  ? 0.3470 0.3131 0.3860 0.0041  0.0074  0.0081  898 THR C CG2 
1717 N  N   . SER B 77  ? 0.1999 0.1713 0.2358 0.0065  0.0130  0.0062  899 SER C N   
1718 C  CA  . SER B 77  ? 0.1967 0.1706 0.2311 0.0067  0.0131  0.0067  899 SER C CA  
1719 C  C   . SER B 77  ? 0.2012 0.1749 0.2360 0.0044  0.0103  0.0082  899 SER C C   
1720 O  O   . SER B 77  ? 0.2004 0.1728 0.2359 0.0023  0.0082  0.0096  899 SER C O   
1721 C  CB  . SER B 77  ? 0.1897 0.1693 0.2229 0.0064  0.0141  0.0070  899 SER C CB  
1722 O  OG  . SER B 77  ? 0.1841 0.1672 0.2161 0.0073  0.0144  0.0069  899 SER C OG  
1723 N  N   . TYR B 78  ? 0.3912 0.3661 0.4252 0.0048  0.0102  0.0080  900 TYR C N   
1724 C  CA  . TYR B 78  ? 0.3813 0.3556 0.4153 0.0022  0.0078  0.0091  900 TYR C CA  
1725 C  C   . TYR B 78  ? 0.3801 0.3602 0.4130 0.0013  0.0078  0.0091  900 TYR C C   
1726 O  O   . TYR B 78  ? 0.3770 0.3601 0.4092 0.0041  0.0096  0.0079  900 TYR C O   
1727 C  CB  . TYR B 78  ? 0.3836 0.3519 0.4181 0.0034  0.0070  0.0082  900 TYR C CB  
1728 C  CG  . TYR B 78  ? 0.3975 0.3607 0.4332 0.0035  0.0059  0.0083  900 TYR C CG  
1729 C  CD1 . TYR B 78  ? 0.3988 0.3603 0.4355 0.0060  0.0076  0.0069  900 TYR C CD1 
1730 C  CD2 . TYR B 78  ? 0.3992 0.3593 0.4348 0.0011  0.0031  0.0099  900 TYR C CD2 
1731 C  CE1 . TYR B 78  ? 0.4045 0.3628 0.4428 0.0063  0.0065  0.0067  900 TYR C CE1 
1732 C  CE2 . TYR B 78  ? 0.4020 0.3578 0.4386 0.0019  0.0019  0.0099  900 TYR C CE2 
1733 C  CZ  . TYR B 78  ? 0.4019 0.3574 0.4402 0.0046  0.0035  0.0082  900 TYR C CZ  
1734 O  OH  . TYR B 78  ? 0.4008 0.3534 0.4404 0.0056  0.0022  0.0079  900 TYR C OH  
1735 N  N   . ASP B 79  ? 0.1841 0.1659 0.2168 -0.0025 0.0058  0.0105  901 ASP C N   
1736 C  CA  . ASP B 79  ? 0.1832 0.1710 0.2153 -0.0040 0.0056  0.0102  901 ASP C CA  
1737 C  C   . ASP B 79  ? 0.1853 0.1690 0.2172 -0.0043 0.0044  0.0095  901 ASP C C   
1738 O  O   . ASP B 79  ? 0.1895 0.1666 0.2214 -0.0059 0.0027  0.0101  901 ASP C O   
1739 C  CB  . ASP B 79  ? 0.1778 0.1700 0.2092 -0.0089 0.0044  0.0120  901 ASP C CB  
1740 C  CG  . ASP B 79  ? 0.1676 0.1638 0.1991 -0.0089 0.0054  0.0127  901 ASP C CG  
1741 O  OD1 . ASP B 79  ? 0.1686 0.1666 0.2004 -0.0051 0.0074  0.0114  901 ASP C OD1 
1742 O  OD2 . ASP B 79  ? 0.1746 0.1717 0.2053 -0.0128 0.0043  0.0146  901 ASP C OD2 
1743 N  N   . ILE B 80  ? 0.2948 0.2825 0.3264 -0.0024 0.0051  0.0079  902 ILE C N   
1744 C  CA  . ILE B 80  ? 0.3043 0.2887 0.3356 -0.0024 0.0041  0.0068  902 ILE C CA  
1745 C  C   . ILE B 80  ? 0.3119 0.3037 0.3428 -0.0044 0.0035  0.0060  902 ILE C C   
1746 O  O   . ILE B 80  ? 0.3101 0.3088 0.3409 -0.0018 0.0047  0.0050  902 ILE C O   
1747 C  CB  . ILE B 80  ? 0.2985 0.2794 0.3297 0.0026  0.0056  0.0052  902 ILE C CB  
1748 C  CG1 . ILE B 80  ? 0.2956 0.2698 0.3275 0.0040  0.0062  0.0056  902 ILE C CG1 
1749 C  CG2 . ILE B 80  ? 0.3139 0.2923 0.3446 0.0026  0.0046  0.0039  902 ILE C CG2 
1750 C  CD1 . ILE B 80  ? 0.2904 0.2609 0.3217 0.0082  0.0080  0.0040  902 ILE C CD1 
1751 N  N   . LYS B 81  ? 0.3511 0.3413 0.3817 -0.0090 0.0015  0.0065  903 LYS C N   
1752 C  CA  . LYS B 81  ? 0.3662 0.3630 0.3965 -0.0116 0.0008  0.0053  903 LYS C CA  
1753 C  C   . LYS B 81  ? 0.3855 0.3755 0.4151 -0.0138 -0.0009 0.0046  903 LYS C C   
1754 O  O   . LYS B 81  ? 0.3909 0.3715 0.4200 -0.0146 -0.0019 0.0055  903 LYS C O   
1755 C  CB  . LYS B 81  ? 0.3566 0.3606 0.3868 -0.0167 0.0004  0.0065  903 LYS C CB  
1756 C  CG  . LYS B 81  ? 0.3653 0.3627 0.3943 -0.0217 -0.0010 0.0088  903 LYS C CG  
1757 C  CD  . LYS B 81  ? 0.3664 0.3718 0.3949 -0.0269 -0.0010 0.0099  903 LYS C CD  
1758 C  CE  . LYS B 81  ? 0.3817 0.3796 0.4081 -0.0321 -0.0025 0.0126  903 LYS C CE  
1759 N  NZ  . LYS B 81  ? 0.3888 0.3946 0.4143 -0.0375 -0.0023 0.0138  903 LYS C NZ  
1760 N  N   . MET B 82  ? 0.4067 0.4017 0.4361 -0.0145 -0.0013 0.0027  904 MET C N   
1761 C  CA  . MET B 82  ? 0.4297 0.4185 0.4582 -0.0163 -0.0028 0.0015  904 MET C CA  
1762 C  C   . MET B 82  ? 0.4360 0.4315 0.4640 -0.0213 -0.0038 0.0003  904 MET C C   
1763 O  O   . MET B 82  ? 0.4306 0.4368 0.4593 -0.0227 -0.0032 0.0001  904 MET C O   
1764 C  CB  . MET B 82  ? 0.4200 0.4062 0.4485 -0.0108 -0.0020 -0.0003 904 MET C CB  
1765 C  CG  . MET B 82  ? 0.4149 0.4108 0.4434 -0.0079 -0.0011 -0.0021 904 MET C CG  
1766 S  SD  . MET B 82  ? 0.4194 0.4113 0.4469 -0.0020 -0.0003 -0.0040 904 MET C SD  
1767 C  CE  . MET B 82  ? 0.4531 0.4368 0.4801 -0.0057 -0.0023 -0.0053 904 MET C CE  
1768 N  N   . GLN B 83  ? 0.4621 0.4516 0.4889 -0.0239 -0.0053 -0.0009 905 GLN C N   
1769 C  CA  . GLN B 83  ? 0.4882 0.4833 0.5144 -0.0290 -0.0063 -0.0026 905 GLN C CA  
1770 C  C   . GLN B 83  ? 0.4922 0.4798 0.5172 -0.0292 -0.0075 -0.0046 905 GLN C C   
1771 O  O   . GLN B 83  ? 0.4875 0.4641 0.5118 -0.0270 -0.0079 -0.0042 905 GLN C O   
1772 C  CB  . GLN B 83  ? 0.4916 0.4867 0.5165 -0.0364 -0.0071 -0.0008 905 GLN C CB  
1773 C  CG  . GLN B 83  ? 0.4956 0.4766 0.5183 -0.0390 -0.0084 0.0012  905 GLN C CG  
1774 C  CD  . GLN B 83  ? 0.5086 0.4891 0.5291 -0.0466 -0.0091 0.0032  905 GLN C CD  
1775 O  OE1 . GLN B 83  ? 0.5361 0.5050 0.5538 -0.0496 -0.0104 0.0049  905 GLN C OE1 
1776 N  NE2 . GLN B 83  ? 0.4981 0.4912 0.5196 -0.0496 -0.0081 0.0030  905 GLN C NE2 
1777 N  N   . CYS B 84  ? 0.3747 0.3688 0.3995 -0.0317 -0.0081 -0.0071 906 CYS C N   
1778 C  CA  . CYS B 84  ? 0.3916 0.3793 0.4150 -0.0325 -0.0093 -0.0094 906 CYS C CA  
1779 C  C   . CYS B 84  ? 0.4154 0.3976 0.4366 -0.0405 -0.0108 -0.0094 906 CYS C C   
1780 O  O   . CYS B 84  ? 0.4116 0.3984 0.4325 -0.0458 -0.0108 -0.0080 906 CYS C O   
1781 C  CB  . CYS B 84  ? 0.3898 0.3874 0.4139 -0.0301 -0.0090 -0.0125 906 CYS C CB  
1782 S  SG  . CYS B 84  ? 0.4084 0.4213 0.4331 -0.0360 -0.0094 -0.0142 906 CYS C SG  
1783 N  N   . PHE B 85  ? 0.5805 0.5525 0.5997 -0.0414 -0.0121 -0.0109 907 PHE C N   
1784 C  CA  . PHE B 85  ? 0.6135 0.5777 0.6298 -0.0488 -0.0136 -0.0109 907 PHE C CA  
1785 C  C   . PHE B 85  ? 0.6434 0.6028 0.6580 -0.0501 -0.0148 -0.0143 907 PHE C C   
1786 O  O   . PHE B 85  ? 0.6404 0.5972 0.6557 -0.0445 -0.0147 -0.0160 907 PHE C O   
1787 C  CB  . PHE B 85  ? 0.6099 0.5605 0.6241 -0.0490 -0.0143 -0.0077 907 PHE C CB  
1788 C  CG  . PHE B 85  ? 0.5989 0.5382 0.6128 -0.0434 -0.0149 -0.0084 907 PHE C CG  
1789 C  CD1 . PHE B 85  ? 0.6219 0.5497 0.6329 -0.0454 -0.0166 -0.0100 907 PHE C CD1 
1790 C  CD2 . PHE B 85  ? 0.5749 0.5152 0.5913 -0.0362 -0.0138 -0.0076 907 PHE C CD2 
1791 C  CE1 . PHE B 85  ? 0.6197 0.5381 0.6307 -0.0399 -0.0171 -0.0110 907 PHE C CE1 
1792 C  CE2 . PHE B 85  ? 0.5828 0.5139 0.5992 -0.0313 -0.0142 -0.0085 907 PHE C CE2 
1793 C  CZ  . PHE B 85  ? 0.6038 0.5244 0.6177 -0.0329 -0.0158 -0.0102 907 PHE C CZ  
1794 N  N   . ASN B 86  ? 0.8552 0.8135 0.8674 -0.0579 -0.0158 -0.0154 908 ASN C N   
1795 C  CA  . ASN B 86  ? 0.8847 0.8363 0.8945 -0.0604 -0.0171 -0.0186 908 ASN C CA  
1796 C  C   . ASN B 86  ? 0.9235 0.8625 0.9287 -0.0680 -0.0184 -0.0175 908 ASN C C   
1797 O  O   . ASN B 86  ? 0.9275 0.8618 0.9314 -0.0701 -0.0184 -0.0140 908 ASN C O   
1798 C  CB  . ASN B 86  ? 0.8894 0.8548 0.9006 -0.0624 -0.0169 -0.0223 908 ASN C CB  
1799 C  CG  . ASN B 86  ? 0.9094 0.8873 0.9213 -0.0690 -0.0163 -0.0219 908 ASN C CG  
1800 O  OD1 . ASN B 86  ? 0.9150 0.8890 0.9253 -0.0739 -0.0163 -0.0190 908 ASN C OD1 
1801 N  ND2 . ASN B 86  ? 0.8957 0.8890 0.9099 -0.0690 -0.0160 -0.0247 908 ASN C ND2 
1802 N  N   . GLU B 87  ? 1.0838 1.0170 1.0862 -0.0722 -0.0196 -0.0206 909 GLU C N   
1803 C  CA  . GLU B 87  ? 1.1060 1.0261 1.1032 -0.0798 -0.0208 -0.0197 909 GLU C CA  
1804 C  C   . GLU B 87  ? 1.0987 1.0262 1.0950 -0.0881 -0.0201 -0.0178 909 GLU C C   
1805 O  O   . GLU B 87  ? 1.1044 1.0212 1.0963 -0.0935 -0.0207 -0.0152 909 GLU C O   
1806 C  CB  . GLU B 87  ? 1.1212 1.0346 1.1155 -0.0832 -0.0220 -0.0239 909 GLU C CB  
1807 C  CG  . GLU B 87  ? 1.1330 1.0619 1.1301 -0.0842 -0.0215 -0.0282 909 GLU C CG  
1808 C  CD  . GLU B 87  ? 1.1403 1.0720 1.1402 -0.0753 -0.0213 -0.0306 909 GLU C CD  
1809 O  OE1 . GLU B 87  ? 1.1067 1.0381 1.1090 -0.0677 -0.0206 -0.0284 909 GLU C OE1 
1810 O  OE2 . GLU B 87  ? 1.1461 1.0803 1.1455 -0.0763 -0.0218 -0.0348 909 GLU C OE2 
1811 N  N   . GLY B 88  ? 0.9394 0.8854 0.9396 -0.0888 -0.0189 -0.0193 910 GLY C N   
1812 C  CA  . GLY B 88  ? 0.9477 0.9038 0.9479 -0.0962 -0.0180 -0.0180 910 GLY C CA  
1813 C  C   . GLY B 88  ? 0.9541 0.9087 0.9543 -0.0950 -0.0173 -0.0133 910 GLY C C   
1814 O  O   . GLY B 88  ? 0.9518 0.9011 0.9484 -0.1021 -0.0174 -0.0108 910 GLY C O   
1815 N  N   . GLY B 89  ? 0.8980 0.8571 0.9021 -0.0862 -0.0166 -0.0120 911 GLY C N   
1816 C  CA  . GLY B 89  ? 0.8498 0.8082 0.8543 -0.0843 -0.0159 -0.0078 911 GLY C CA  
1817 C  C   . GLY B 89  ? 0.8045 0.7698 0.8136 -0.0746 -0.0148 -0.0074 911 GLY C C   
1818 O  O   . GLY B 89  ? 0.7919 0.7546 0.8024 -0.0683 -0.0151 -0.0093 911 GLY C O   
1819 N  N   . GLU B 90  ? 0.7193 0.6932 0.7304 -0.0738 -0.0136 -0.0051 912 GLU C N   
1820 C  CA  . GLU B 90  ? 0.6804 0.6608 0.6953 -0.0652 -0.0124 -0.0046 912 GLU C CA  
1821 C  C   . GLU B 90  ? 0.6543 0.6529 0.6723 -0.0653 -0.0110 -0.0055 912 GLU C C   
1822 O  O   . GLU B 90  ? 0.6479 0.6531 0.6653 -0.0719 -0.0106 -0.0047 912 GLU C O   
1823 C  CB  . GLU B 90  ? 0.6757 0.6471 0.6899 -0.0622 -0.0123 -0.0009 912 GLU C CB  
1824 C  CG  . GLU B 90  ? 0.6966 0.6500 0.7070 -0.0629 -0.0140 0.0004  912 GLU C CG  
1825 C  CD  . GLU B 90  ? 0.7210 0.6675 0.7268 -0.0716 -0.0149 0.0025  912 GLU C CD  
1826 O  OE1 . GLU B 90  ? 0.7180 0.6741 0.7238 -0.0768 -0.0140 0.0034  912 GLU C OE1 
1827 O  OE2 . GLU B 90  ? 0.7296 0.6609 0.7314 -0.0730 -0.0166 0.0032  912 GLU C OE2 
1828 N  N   . SER B 91  ? 0.6721 0.6789 0.6932 -0.0581 -0.0101 -0.0070 913 SER C N   
1829 C  CA  . SER B 91  ? 0.6603 0.6840 0.6843 -0.0565 -0.0089 -0.0079 913 SER C CA  
1830 C  C   . SER B 91  ? 0.6367 0.6623 0.6615 -0.0550 -0.0077 -0.0049 913 SER C C   
1831 O  O   . SER B 91  ? 0.6362 0.6502 0.6597 -0.0535 -0.0079 -0.0023 913 SER C O   
1832 C  CB  . SER B 91  ? 0.6421 0.6719 0.6682 -0.0486 -0.0085 -0.0102 913 SER C CB  
1833 O  OG  . SER B 91  ? 0.6271 0.6498 0.6536 -0.0413 -0.0077 -0.0085 913 SER C OG  
1834 N  N   . GLU B 92  ? 0.6593 0.6999 0.6862 -0.0552 -0.0067 -0.0055 914 GLU C N   
1835 C  CA  . GLU B 92  ? 0.6572 0.7008 0.6849 -0.0534 -0.0055 -0.0030 914 GLU C CA  
1836 C  C   . GLU B 92  ? 0.6407 0.6782 0.6692 -0.0446 -0.0048 -0.0021 914 GLU C C   
1837 O  O   . GLU B 92  ? 0.6319 0.6671 0.6609 -0.0394 -0.0049 -0.0037 914 GLU C O   
1838 C  CB  . GLU B 92  ? 0.6521 0.7140 0.6821 -0.0540 -0.0044 -0.0046 914 GLU C CB  
1839 C  CG  . GLU B 92  ? 0.6764 0.7455 0.7057 -0.0637 -0.0047 -0.0052 914 GLU C CG  
1840 C  CD  . GLU B 92  ? 0.7234 0.8103 0.7551 -0.0644 -0.0034 -0.0062 914 GLU C CD  
1841 O  OE1 . GLU B 92  ? 0.7486 0.8423 0.7824 -0.0568 -0.0025 -0.0067 914 GLU C OE1 
1842 O  OE2 . GLU B 92  ? 0.7204 0.8143 0.7515 -0.0726 -0.0033 -0.0065 914 GLU C OE2 
1843 N  N   . PHE B 93  ? 0.4555 0.4906 0.4841 -0.0433 -0.0040 0.0005  915 PHE C N   
1844 C  CA  . PHE B 93  ? 0.4237 0.4528 0.4529 -0.0359 -0.0032 0.0014  915 PHE C CA  
1845 C  C   . PHE B 93  ? 0.4106 0.4489 0.4415 -0.0290 -0.0020 -0.0005 915 PHE C C   
1846 O  O   . PHE B 93  ? 0.4031 0.4546 0.4353 -0.0294 -0.0015 -0.0021 915 PHE C O   
1847 C  CB  . PHE B 93  ? 0.4068 0.4328 0.4356 -0.0364 -0.0025 0.0043  915 PHE C CB  
1848 C  CG  . PHE B 93  ? 0.4284 0.4416 0.4548 -0.0407 -0.0038 0.0067  915 PHE C CG  
1849 C  CD1 . PHE B 93  ? 0.4215 0.4353 0.4461 -0.0471 -0.0042 0.0088  915 PHE C CD1 
1850 C  CD2 . PHE B 93  ? 0.4310 0.4317 0.4566 -0.0381 -0.0048 0.0068  915 PHE C CD2 
1851 C  CE1 . PHE B 93  ? 0.4204 0.4216 0.4420 -0.0506 -0.0055 0.0112  915 PHE C CE1 
1852 C  CE2 . PHE B 93  ? 0.4286 0.4174 0.4516 -0.0413 -0.0062 0.0089  915 PHE C CE2 
1853 C  CZ  . PHE B 93  ? 0.4332 0.4218 0.4541 -0.0474 -0.0067 0.0112  915 PHE C CZ  
1854 N  N   . SER B 94  ? 0.2512 0.2824 0.2820 -0.0226 -0.0014 -0.0005 916 SER C N   
1855 C  CA  . SER B 94  ? 0.2292 0.2664 0.2606 -0.0156 -0.0002 -0.0019 916 SER C CA  
1856 C  C   . SER B 94  ? 0.2109 0.2515 0.2428 -0.0127 0.0013  -0.0007 916 SER C C   
1857 O  O   . SER B 94  ? 0.2069 0.2469 0.2390 -0.0165 0.0014  0.0011  916 SER C O   
1858 C  CB  . SER B 94  ? 0.2440 0.2714 0.2745 -0.0106 0.0000  -0.0023 916 SER C CB  
1859 O  OG  . SER B 94  ? 0.2288 0.2460 0.2590 -0.0097 0.0006  -0.0003 916 SER C OG  
1860 N  N   . ASN B 95  ? 0.2122 0.2562 0.2439 -0.0060 0.0026  -0.0016 917 ASN C N   
1861 C  CA  . ASN B 95  ? 0.2071 0.2525 0.2388 -0.0025 0.0042  -0.0007 917 ASN C CA  
1862 C  C   . ASN B 95  ? 0.2033 0.2365 0.2345 -0.0024 0.0047  0.0013  917 ASN C C   
1863 O  O   . ASN B 95  ? 0.2055 0.2293 0.2361 -0.0014 0.0044  0.0014  917 ASN C O   
1864 C  CB  . ASN B 95  ? 0.3775 0.4267 0.4082 0.0050  0.0053  -0.0021 917 ASN C CB  
1865 C  CG  . ASN B 95  ? 0.2068 0.2469 0.2357 0.0090  0.0055  -0.0025 917 ASN C CG  
1866 O  OD1 . ASN B 95  ? 0.2182 0.2541 0.2472 0.0065  0.0044  -0.0029 917 ASN C OD1 
1867 N  ND2 . ASN B 95  ? 0.2065 0.2432 0.2335 0.0152  0.0072  -0.0024 917 ASN C ND2 
1868 N  N   . VAL B 96  ? 0.3581 0.3922 0.3897 -0.0036 0.0054  0.0026  918 VAL C N   
1869 C  CA  . VAL B 96  ? 0.3526 0.3766 0.3840 -0.0038 0.0057  0.0044  918 VAL C CA  
1870 C  C   . VAL B 96  ? 0.3465 0.3672 0.3771 0.0023  0.0076  0.0041  918 VAL C C   
1871 O  O   . VAL B 96  ? 0.3426 0.3691 0.3729 0.0048  0.0089  0.0037  918 VAL C O   
1872 C  CB  . VAL B 96  ? 0.3496 0.3755 0.3814 -0.0087 0.0053  0.0062  918 VAL C CB  
1873 C  CG1 . VAL B 96  ? 0.3489 0.3641 0.3804 -0.0094 0.0050  0.0080  918 VAL C CG1 
1874 C  CG2 . VAL B 96  ? 0.3515 0.3823 0.3833 -0.0151 0.0038  0.0064  918 VAL C CG2 
1875 N  N   . MET B 97  ? 0.3131 0.3242 0.3432 0.0044  0.0079  0.0041  919 MET C N   
1876 C  CA  . MET B 97  ? 0.3055 0.3121 0.3345 0.0094  0.0099  0.0038  919 MET C CA  
1877 C  C   . MET B 97  ? 0.2974 0.2988 0.3270 0.0081  0.0104  0.0051  919 MET C C   
1878 O  O   . MET B 97  ? 0.2959 0.2946 0.3266 0.0040  0.0089  0.0063  919 MET C O   
1879 C  CB  . MET B 97  ? 0.3094 0.3094 0.3372 0.0124  0.0103  0.0029  919 MET C CB  
1880 C  CG  . MET B 97  ? 0.3258 0.3308 0.3526 0.0141  0.0097  0.0016  919 MET C CG  
1881 S  SD  . MET B 97  ? 0.3588 0.3693 0.3831 0.0204  0.0115  0.0006  919 MET C SD  
1882 C  CE  . MET B 97  ? 0.3689 0.3682 0.3904 0.0248  0.0136  0.0005  919 MET C CE  
1883 N  N   . ILE B 98  ? 0.4091 0.4087 0.4377 0.0115  0.0124  0.0047  920 ILE C N   
1884 C  CA  . ILE B 98  ? 0.4099 0.4048 0.4390 0.0106  0.0130  0.0055  920 ILE C CA  
1885 C  C   . ILE B 98  ? 0.4108 0.3986 0.4387 0.0141  0.0149  0.0046  920 ILE C C   
1886 O  O   . ILE B 98  ? 0.4172 0.4051 0.4431 0.0176  0.0169  0.0037  920 ILE C O   
1887 C  CB  . ILE B 98  ? 0.4093 0.4100 0.4384 0.0102  0.0138  0.0058  920 ILE C CB  
1888 C  CG1 . ILE B 98  ? 0.4022 0.4102 0.4324 0.0058  0.0121  0.0068  920 ILE C CG1 
1889 C  CG2 . ILE B 98  ? 0.4006 0.3966 0.4301 0.0096  0.0145  0.0062  920 ILE C CG2 
1890 C  CD1 . ILE B 98  ? 0.3828 0.3968 0.4131 0.0048  0.0127  0.0071  920 ILE C CD1 
1891 N  N   . CYS B 99  ? 0.1458 0.1272 0.1747 0.0132  0.0143  0.0047  921 CYS C N   
1892 C  CA  . CYS B 99  ? 0.1439 0.1190 0.1718 0.0158  0.0163  0.0037  921 CYS C CA  
1893 C  C   . CYS B 99  ? 0.2787 0.2505 0.3084 0.0142  0.0164  0.0039  921 CYS C C   
1894 O  O   . CYS B 99  ? 0.2658 0.2390 0.2973 0.0112  0.0145  0.0050  921 CYS C O   
1895 C  CB  . CYS B 99  ? 0.2875 0.2589 0.3152 0.0167  0.0158  0.0030  921 CYS C CB  
1896 S  SG  . CYS B 99  ? 0.2793 0.2442 0.3045 0.0203  0.0187  0.0016  921 CYS C SG  
1897 N  N   . GLU B 100 ? 0.4744 0.4418 0.5032 0.0160  0.0186  0.0028  922 GLU C N   
1898 C  CA  . GLU B 100 ? 0.4784 0.4437 0.5089 0.0146  0.0190  0.0025  922 GLU C CA  
1899 C  C   . GLU B 100 ? 0.4796 0.4396 0.5102 0.0156  0.0203  0.0011  922 GLU C C   
1900 O  O   . GLU B 100 ? 0.4905 0.4476 0.5185 0.0177  0.0227  0.0001  922 GLU C O   
1901 C  CB  . GLU B 100 ? 0.4807 0.4476 0.5099 0.0149  0.0208  0.0022  922 GLU C CB  
1902 C  CG  . GLU B 100 ? 0.4858 0.4509 0.5164 0.0136  0.0215  0.0015  922 GLU C CG  
1903 C  CD  . GLU B 100 ? 0.4947 0.4617 0.5241 0.0136  0.0231  0.0010  922 GLU C CD  
1904 O  OE1 . GLU B 100 ? 0.4765 0.4477 0.5049 0.0138  0.0228  0.0018  922 GLU C OE1 
1905 O  OE2 . GLU B 100 ? 0.5132 0.4780 0.5427 0.0131  0.0248  -0.0003 922 GLU C OE2 
1906 N  N   . THR B 101 ? 0.2491 0.2078 0.2825 0.0142  0.0187  0.0010  923 THR C N   
1907 C  CA  . THR B 101 ? 0.2616 0.2166 0.2957 0.0150  0.0198  -0.0006 923 THR C CA  
1908 C  C   . THR B 101 ? 0.2655 0.2193 0.2985 0.0153  0.0229  -0.0019 923 THR C C   
1909 O  O   . THR B 101 ? 0.2661 0.2218 0.2986 0.0146  0.0235  -0.0016 923 THR C O   
1910 C  CB  . THR B 101 ? 0.2542 0.2089 0.2916 0.0138  0.0174  -0.0007 923 THR C CB  
1911 O  OG1 . THR B 101 ? 0.2545 0.2116 0.2933 0.0123  0.0166  -0.0001 923 THR C OG1 
1912 C  CG2 . THR B 101 ? 0.2544 0.2089 0.2923 0.0132  0.0144  0.0005  923 THR C CG2 
1913 N  N   . LYS B 102 ? 0.4217 0.3722 0.4542 0.0160  0.0249  -0.0036 924 LYS C N   
1914 C  CA  . LYS B 102 ? 0.4297 0.3784 0.4608 0.0156  0.0281  -0.0051 924 LYS C CA  
1915 C  C   . LYS B 102 ? 0.4342 0.3857 0.4688 0.0136  0.0274  -0.0059 924 LYS C C   
1916 O  O   . LYS B 102 ? 0.4269 0.3806 0.4649 0.0131  0.0248  -0.0057 924 LYS C O   
1917 C  CB  . LYS B 102 ? 0.4421 0.3870 0.4715 0.0164  0.0305  -0.0066 924 LYS C CB  
1918 C  CG  . LYS B 102 ? 0.4411 0.3829 0.4663 0.0186  0.0314  -0.0059 924 LYS C CG  
1919 C  CD  . LYS B 102 ? 0.4617 0.3997 0.4850 0.0190  0.0339  -0.0074 924 LYS C CD  
1920 C  CE  . LYS B 102 ? 0.4877 0.4226 0.5062 0.0215  0.0348  -0.0065 924 LYS C CE  
1921 N  NZ  . LYS B 102 ? 0.5019 0.4331 0.5180 0.0217  0.0372  -0.0078 924 LYS C NZ  
1922 O  OXT . LYS B 102 ? 0.4403 0.3917 0.4740 0.0125  0.0295  -0.0069 924 LYS C OXT 
1923 N  N   . GLN C 20  ? 0.6323 0.4902 0.5977 0.0193  -0.0234 -0.1510 39  GLN A N   
1924 C  CA  . GLN C 20  ? 0.6305 0.5029 0.5964 0.0160  -0.0224 -0.1478 39  GLN A CA  
1925 C  C   . GLN C 20  ? 0.6340 0.5159 0.6037 0.0200  -0.0198 -0.1416 39  GLN A C   
1926 O  O   . GLN C 20  ? 0.6448 0.5314 0.6162 0.0171  -0.0197 -0.1360 39  GLN A O   
1927 C  CB  . GLN C 20  ? 0.6278 0.5092 0.5905 0.0157  -0.0219 -0.1533 39  GLN A CB  
1928 C  CG  . GLN C 20  ? 0.6517 0.5234 0.6103 0.0123  -0.0241 -0.1603 39  GLN A CG  
1929 C  CD  . GLN C 20  ? 0.6960 0.5778 0.6514 0.0084  -0.0245 -0.1642 39  GLN A CD  
1930 O  OE1 . GLN C 20  ? 0.6803 0.5725 0.6362 0.0047  -0.0244 -0.1609 39  GLN A OE1 
1931 N  NE2 . GLN C 20  ? 0.7167 0.5959 0.6689 0.0095  -0.0249 -0.1715 39  GLN A NE2 
1932 N  N   . LEU C 21  ? 0.5015 0.3861 0.4725 0.0263  -0.0177 -0.1429 40  LEU A N   
1933 C  CA  . LEU C 21  ? 0.4833 0.3757 0.4577 0.0299  -0.0152 -0.1375 40  LEU A CA  
1934 C  C   . LEU C 21  ? 0.4945 0.3782 0.4724 0.0315  -0.0156 -0.1335 40  LEU A C   
1935 O  O   . LEU C 21  ? 0.4969 0.3796 0.4772 0.0367  -0.0143 -0.1338 40  LEU A O   
1936 C  CB  . LEU C 21  ? 0.4770 0.3765 0.4512 0.0355  -0.0124 -0.1405 40  LEU A CB  
1937 C  CG  . LEU C 21  ? 0.4849 0.3985 0.4571 0.0355  -0.0102 -0.1395 40  LEU A CG  
1938 C  CD1 . LEU C 21  ? 0.4661 0.3858 0.4388 0.0410  -0.0070 -0.1409 40  LEU A CD1 
1939 C  CD2 . LEU C 21  ? 0.4756 0.3952 0.4492 0.0330  -0.0098 -0.1324 40  LEU A CD2 
1940 N  N   . VAL C 22  ? 0.4465 0.3246 0.4247 0.0268  -0.0176 -0.1299 41  VAL A N   
1941 C  CA  . VAL C 22  ? 0.4549 0.3249 0.4360 0.0278  -0.0182 -0.1257 41  VAL A CA  
1942 C  C   . VAL C 22  ? 0.4405 0.3193 0.4248 0.0279  -0.0164 -0.1188 41  VAL A C   
1943 O  O   . VAL C 22  ? 0.4347 0.3186 0.4187 0.0235  -0.0166 -0.1154 41  VAL A O   
1944 C  CB  . VAL C 22  ? 0.4541 0.3113 0.4332 0.0226  -0.0213 -0.1254 41  VAL A CB  
1945 C  CG1 . VAL C 22  ? 0.4623 0.3251 0.4396 0.0157  -0.0221 -0.1242 41  VAL A CG1 
1946 C  CG2 . VAL C 22  ? 0.4480 0.2979 0.4298 0.0236  -0.0220 -0.1203 41  VAL A CG2 
1947 N  N   . PRO C 23  ? 0.3282 0.2090 0.3156 0.0331  -0.0144 -0.1171 42  PRO A N   
1948 C  CA  . PRO C 23  ? 0.3272 0.2154 0.3176 0.0336  -0.0124 -0.1109 42  PRO A CA  
1949 C  C   . PRO C 23  ? 0.3309 0.2147 0.3222 0.0293  -0.0141 -0.1059 42  PRO A C   
1950 O  O   . PRO C 23  ? 0.3435 0.2166 0.3337 0.0268  -0.0168 -0.1069 42  PRO A O   
1951 C  CB  . PRO C 23  ? 0.3176 0.2043 0.3111 0.0393  -0.0110 -0.1111 42  PRO A CB  
1952 C  CG  . PRO C 23  ? 0.4665 0.3510 0.4584 0.0425  -0.0111 -0.1179 42  PRO A CG  
1953 C  CD  . PRO C 23  ? 0.3267 0.2032 0.3150 0.0387  -0.0140 -0.1213 42  PRO A CD  
1954 N  N   . LEU C 24  ? 0.4998 0.3913 0.4928 0.0284  -0.0126 -0.1005 43  LEU A N   
1955 C  CA  . LEU C 24  ? 0.5073 0.3958 0.5016 0.0247  -0.0140 -0.0956 43  LEU A CA  
1956 C  C   . LEU C 24  ? 0.5164 0.3997 0.5139 0.0276  -0.0137 -0.0925 43  LEU A C   
1957 O  O   . LEU C 24  ? 0.5078 0.3930 0.5072 0.0325  -0.0119 -0.0934 43  LEU A O   
1958 C  CB  . LEU C 24  ? 0.4924 0.3918 0.4867 0.0223  -0.0127 -0.0916 43  LEU A CB  
1959 C  CG  . LEU C 24  ? 0.5093 0.4139 0.5005 0.0183  -0.0137 -0.0938 43  LEU A CG  
1960 C  CD1 . LEU C 24  ? 0.5022 0.4147 0.4939 0.0152  -0.0135 -0.0892 43  LEU A CD1 
1961 C  CD2 . LEU C 24  ? 0.5347 0.4297 0.5238 0.0144  -0.0165 -0.0977 43  LEU A CD2 
1962 N  N   . LEU C 25  ? 0.5134 0.3905 0.5115 0.0244  -0.0155 -0.0891 44  LEU A N   
1963 C  CA  . LEU C 25  ? 0.5128 0.3851 0.5138 0.0268  -0.0156 -0.0858 44  LEU A CA  
1964 C  C   . LEU C 25  ? 0.4954 0.3759 0.4988 0.0261  -0.0138 -0.0802 44  LEU A C   
1965 O  O   . LEU C 25  ? 0.4895 0.3773 0.4920 0.0230  -0.0132 -0.0785 44  LEU A O   
1966 C  CB  . LEU C 25  ? 0.5247 0.3842 0.5241 0.0238  -0.0187 -0.0852 44  LEU A CB  
1967 C  CG  . LEU C 25  ? 0.5255 0.3745 0.5217 0.0240  -0.0208 -0.0906 44  LEU A CG  
1968 C  CD1 . LEU C 25  ? 0.5309 0.3675 0.5241 0.0192  -0.0237 -0.0893 44  LEU A CD1 
1969 C  CD2 . LEU C 25  ? 0.5284 0.3735 0.5260 0.0309  -0.0206 -0.0936 44  LEU A CD2 
1970 N  N   . TYR C 26  ? 0.6245 0.5042 0.6309 0.0292  -0.0130 -0.0776 45  TYR A N   
1971 C  CA  . TYR C 26  ? 0.6230 0.5097 0.6317 0.0287  -0.0112 -0.0725 45  TYR A CA  
1972 C  C   . TYR C 26  ? 0.6321 0.5180 0.6399 0.0234  -0.0126 -0.0688 45  TYR A C   
1973 O  O   . TYR C 26  ? 0.6383 0.5154 0.6452 0.0208  -0.0151 -0.0685 45  TYR A O   
1974 C  CB  . TYR C 26  ? 0.6232 0.5079 0.6352 0.0325  -0.0105 -0.0708 45  TYR A CB  
1975 C  CG  . TYR C 26  ? 0.6252 0.5157 0.6394 0.0318  -0.0088 -0.0656 45  TYR A CG  
1976 C  CD1 . TYR C 26  ? 0.6177 0.5177 0.6316 0.0316  -0.0062 -0.0641 45  TYR A CD1 
1977 C  CD2 . TYR C 26  ? 0.6346 0.5206 0.6508 0.0314  -0.0100 -0.0623 45  TYR A CD2 
1978 C  CE1 . TYR C 26  ? 0.6177 0.5222 0.6332 0.0311  -0.0047 -0.0596 45  TYR A CE1 
1979 C  CE2 . TYR C 26  ? 0.6426 0.5338 0.6606 0.0307  -0.0085 -0.0579 45  TYR A CE2 
1980 C  CZ  . TYR C 26  ? 0.6306 0.5308 0.6483 0.0306  -0.0058 -0.0566 45  TYR A CZ  
1981 O  OH  . TYR C 26  ? 0.6107 0.5153 0.6299 0.0301  -0.0043 -0.0524 45  TYR A OH  
1982 N  N   . LYS C 27  ? 0.4798 0.3750 0.4877 0.0219  -0.0111 -0.0662 46  LYS A N   
1983 C  CA  . LYS C 27  ? 0.4769 0.3738 0.4844 0.0171  -0.0121 -0.0628 46  LYS A CA  
1984 C  C   . LYS C 27  ? 0.4793 0.3742 0.4839 0.0124  -0.0142 -0.0654 46  LYS A C   
1985 O  O   . LYS C 27  ? 0.4854 0.3807 0.4895 0.0076  -0.0154 -0.0632 46  LYS A O   
1986 C  CB  . LYS C 27  ? 0.4832 0.3740 0.4925 0.0161  -0.0132 -0.0591 46  LYS A CB  
1987 C  CG  . LYS C 27  ? 0.4767 0.3721 0.4889 0.0191  -0.0110 -0.0556 46  LYS A CG  
1988 C  CD  . LYS C 27  ? 0.4486 0.3543 0.4608 0.0180  -0.0092 -0.0529 46  LYS A CD  
1989 C  CE  . LYS C 27  ? 0.4628 0.3719 0.4774 0.0204  -0.0071 -0.0493 46  LYS A CE  
1990 N  NZ  . LYS C 27  ? 0.4610 0.3788 0.4751 0.0194  -0.0056 -0.0466 46  LYS A NZ  
1991 N  N   . GLN C 28  ? 0.4470 0.3403 0.4496 0.0134  -0.0146 -0.0702 47  GLN A N   
1992 C  CA  . GLN C 28  ? 0.4533 0.3454 0.4530 0.0088  -0.0164 -0.0733 47  GLN A CA  
1993 C  C   . GLN C 28  ? 0.4434 0.3479 0.4422 0.0080  -0.0153 -0.0738 47  GLN A C   
1994 O  O   . GLN C 28  ? 0.4337 0.3456 0.4331 0.0120  -0.0130 -0.0729 47  GLN A O   
1995 C  CB  . GLN C 28  ? 0.4623 0.3461 0.4600 0.0103  -0.0175 -0.0787 47  GLN A CB  
1996 C  CG  . GLN C 28  ? 0.4837 0.3636 0.4781 0.0049  -0.0197 -0.0821 47  GLN A CG  
1997 C  CD  . GLN C 28  ? 0.4949 0.3700 0.4869 0.0069  -0.0202 -0.0881 47  GLN A CD  
1998 O  OE1 . GLN C 28  ? 0.4880 0.3644 0.4809 0.0124  -0.0188 -0.0899 47  GLN A OE1 
1999 N  NE2 . GLN C 28  ? 0.4998 0.3695 0.4886 0.0021  -0.0222 -0.0915 47  GLN A NE2 
2000 N  N   . PHE C 29  ? 0.5870 0.4936 0.5838 0.0028  -0.0168 -0.0753 48  PHE A N   
2001 C  CA  . PHE C 29  ? 0.5912 0.5100 0.5869 0.0021  -0.0162 -0.0760 48  PHE A CA  
2002 C  C   . PHE C 29  ? 0.6071 0.5258 0.6000 -0.0024 -0.0181 -0.0807 48  PHE A C   
2003 O  O   . PHE C 29  ? 0.6122 0.5237 0.6043 -0.0076 -0.0200 -0.0815 48  PHE A O   
2004 C  CB  . PHE C 29  ? 0.5819 0.5089 0.5793 0.0003  -0.0158 -0.0713 48  PHE A CB  
2005 C  CG  . PHE C 29  ? 0.5934 0.5152 0.5915 -0.0051 -0.0174 -0.0692 48  PHE A CG  
2006 C  CD1 . PHE C 29  ? 0.5841 0.4978 0.5840 -0.0043 -0.0173 -0.0659 48  PHE A CD1 
2007 C  CD2 . PHE C 29  ? 0.5986 0.5241 0.5955 -0.0113 -0.0190 -0.0705 48  PHE A CD2 
2008 C  CE1 . PHE C 29  ? 0.5869 0.4957 0.5870 -0.0094 -0.0187 -0.0638 48  PHE A CE1 
2009 C  CE2 . PHE C 29  ? 0.6004 0.5213 0.5977 -0.0168 -0.0202 -0.0685 48  PHE A CE2 
2010 C  CZ  . PHE C 29  ? 0.6014 0.5135 0.6000 -0.0158 -0.0201 -0.0650 48  PHE A CZ  
2011 N  N   . VAL C 30  ? 0.6550 0.5817 0.6462 -0.0007 -0.0175 -0.0838 49  VAL A N   
2012 C  CA  . VAL C 30  ? 0.6638 0.5919 0.6523 -0.0048 -0.0192 -0.0887 49  VAL A CA  
2013 C  C   . VAL C 30  ? 0.6664 0.6094 0.6541 -0.0053 -0.0190 -0.0888 49  VAL A C   
2014 O  O   . VAL C 30  ? 0.6607 0.6111 0.6479 -0.0003 -0.0173 -0.0878 49  VAL A O   
2015 C  CB  . VAL C 30  ? 0.6754 0.5976 0.6618 -0.0020 -0.0192 -0.0939 49  VAL A CB  
2016 C  CG1 . VAL C 30  ? 0.6738 0.6000 0.6572 -0.0058 -0.0206 -0.0992 49  VAL A CG1 
2017 C  CG2 . VAL C 30  ? 0.6807 0.5877 0.6674 -0.0019 -0.0201 -0.0947 49  VAL A CG2 
2018 N  N   . PRO C 31  ? 0.5953 0.5427 0.5825 -0.0114 -0.0207 -0.0900 50  PRO A N   
2019 C  CA  . PRO C 31  ? 0.6006 0.5385 0.5875 -0.0181 -0.0226 -0.0912 50  PRO A CA  
2020 C  C   . PRO C 31  ? 0.5950 0.5261 0.5842 -0.0191 -0.0224 -0.0861 50  PRO A C   
2021 O  O   . PRO C 31  ? 0.5856 0.5219 0.5771 -0.0154 -0.0209 -0.0817 50  PRO A O   
2022 C  CB  . PRO C 31  ? 0.6046 0.5533 0.5907 -0.0241 -0.0239 -0.0931 50  PRO A CB  
2023 C  CG  . PRO C 31  ? 0.5987 0.5627 0.5859 -0.0199 -0.0227 -0.0909 50  PRO A CG  
2024 C  CD  . PRO C 31  ? 0.5804 0.5429 0.5670 -0.0122 -0.0209 -0.0903 50  PRO A CD  
2025 N  N   . GLY C 32  ? 0.4770 0.3961 0.4651 -0.0240 -0.0238 -0.0868 51  GLY A N   
2026 C  CA  . GLY C 32  ? 0.4745 0.3858 0.4641 -0.0251 -0.0239 -0.0822 51  GLY A CA  
2027 C  C   . GLY C 32  ? 0.4641 0.3835 0.4551 -0.0303 -0.0241 -0.0789 51  GLY A C   
2028 O  O   . GLY C 32  ? 0.4651 0.3773 0.4557 -0.0353 -0.0250 -0.0770 51  GLY A O   
2029 N  N   . VAL C 33  ? 0.4222 0.3570 0.4147 -0.0288 -0.0232 -0.0783 52  VAL A N   
2030 C  CA  . VAL C 33  ? 0.4244 0.3694 0.4187 -0.0326 -0.0232 -0.0754 52  VAL A CA  
2031 C  C   . VAL C 33  ? 0.4116 0.3658 0.4084 -0.0264 -0.0214 -0.0713 52  VAL A C   
2032 O  O   . VAL C 33  ? 0.4076 0.3625 0.4043 -0.0199 -0.0202 -0.0715 52  VAL A O   
2033 C  CB  . VAL C 33  ? 0.4269 0.3834 0.4202 -0.0376 -0.0243 -0.0792 52  VAL A CB  
2034 C  CG1 . VAL C 33  ? 0.4288 0.3756 0.4192 -0.0446 -0.0260 -0.0835 52  VAL A CG1 
2035 C  CG2 . VAL C 33  ? 0.4319 0.3990 0.4247 -0.0322 -0.0238 -0.0816 52  VAL A CG2 
2036 N  N   . PRO C 34  ? 0.6743 0.6352 0.6732 -0.0285 -0.0212 -0.0677 53  PRO A N   
2037 C  CA  . PRO C 34  ? 0.6714 0.6414 0.6724 -0.0229 -0.0196 -0.0640 53  PRO A CA  
2038 C  C   . PRO C 34  ? 0.6710 0.6517 0.6708 -0.0181 -0.0190 -0.0659 53  PRO A C   
2039 O  O   . PRO C 34  ? 0.6801 0.6671 0.6785 -0.0207 -0.0202 -0.0699 53  PRO A O   
2040 C  CB  . PRO C 34  ? 0.6835 0.6618 0.6862 -0.0277 -0.0200 -0.0618 53  PRO A CB  
2041 C  CG  . PRO C 34  ? 0.6913 0.6592 0.6932 -0.0349 -0.0212 -0.0623 53  PRO A CG  
2042 C  CD  . PRO C 34  ? 0.6906 0.6502 0.6897 -0.0363 -0.0223 -0.0670 53  PRO A CD  
2043 N  N   . GLU C 35  ? 0.5214 0.5041 0.5216 -0.0114 -0.0172 -0.0632 54  GLU A N   
2044 C  CA  . GLU C 35  ? 0.5149 0.5052 0.5131 -0.0061 -0.0165 -0.0646 54  GLU A CA  
2045 C  C   . GLU C 35  ? 0.5240 0.5291 0.5216 -0.0073 -0.0175 -0.0659 54  GLU A C   
2046 O  O   . GLU C 35  ? 0.5365 0.5480 0.5317 -0.0047 -0.0178 -0.0685 54  GLU A O   
2047 C  CB  . GLU C 35  ? 0.5015 0.4913 0.4997 0.0006  -0.0142 -0.0607 54  GLU A CB  
2048 C  CG  . GLU C 35  ? 0.4909 0.4871 0.4860 0.0060  -0.0133 -0.0618 54  GLU A CG  
2049 C  CD  . GLU C 35  ? 0.4839 0.4788 0.4784 0.0121  -0.0108 -0.0580 54  GLU A CD  
2050 O  OE1 . GLU C 35  ? 0.4866 0.4778 0.4834 0.0121  -0.0100 -0.0544 54  GLU A OE1 
2051 O  OE2 . GLU C 35  ? 0.4800 0.4773 0.4713 0.0167  -0.0097 -0.0585 54  GLU A OE2 
2052 N  N   . ARG C 36  ? 0.6903 0.7016 0.6901 -0.0110 -0.0182 -0.0643 55  ARG A N   
2053 C  CA  . ARG C 36  ? 0.6947 0.7216 0.6944 -0.0112 -0.0191 -0.0653 55  ARG A CA  
2054 C  C   . ARG C 36  ? 0.7044 0.7366 0.7049 -0.0193 -0.0211 -0.0689 55  ARG A C   
2055 O  O   . ARG C 36  ? 0.6968 0.7426 0.6984 -0.0210 -0.0219 -0.0694 55  ARG A O   
2056 C  CB  . ARG C 36  ? 0.6980 0.7316 0.6994 -0.0078 -0.0181 -0.0608 55  ARG A CB  
2057 C  CG  . ARG C 36  ? 0.7027 0.7339 0.7023 0.0005  -0.0161 -0.0579 55  ARG A CG  
2058 C  CD  . ARG C 36  ? 0.7149 0.7494 0.7161 0.0033  -0.0150 -0.0534 55  ARG A CD  
2059 N  NE  . ARG C 36  ? 0.7167 0.7442 0.7164 0.0096  -0.0127 -0.0503 55  ARG A NE  
2060 C  CZ  . ARG C 36  ? 0.7359 0.7638 0.7364 0.0126  -0.0114 -0.0464 55  ARG A CZ  
2061 N  NH1 . ARG C 36  ? 0.7270 0.7622 0.7300 0.0102  -0.0121 -0.0452 55  ARG A NH1 
2062 N  NH2 . ARG C 36  ? 0.7274 0.7486 0.7262 0.0178  -0.0093 -0.0438 55  ARG A NH2 
2063 N  N   . THR C 37  ? 0.6440 0.6653 0.6437 -0.0243 -0.0218 -0.0715 56  THR A N   
2064 C  CA  . THR C 37  ? 0.6511 0.6759 0.6504 -0.0323 -0.0236 -0.0757 56  THR A CA  
2065 C  C   . THR C 37  ? 0.6414 0.6755 0.6386 -0.0304 -0.0245 -0.0801 56  THR A C   
2066 O  O   . THR C 37  ? 0.6430 0.6753 0.6383 -0.0239 -0.0237 -0.0802 56  THR A O   
2067 C  CB  . THR C 37  ? 0.6540 0.6624 0.6522 -0.0378 -0.0241 -0.0771 56  THR A CB  
2068 O  OG1 . THR C 37  ? 0.6414 0.6386 0.6408 -0.0364 -0.0231 -0.0726 56  THR A OG1 
2069 C  CG2 . THR C 37  ? 0.6736 0.6847 0.6717 -0.0475 -0.0256 -0.0800 56  THR A CG2 
2070 N  N   . LEU C 38  ? 0.7122 0.7568 0.7095 -0.0363 -0.0261 -0.0839 57  LEU A N   
2071 C  CA  . LEU C 38  ? 0.7201 0.7749 0.7154 -0.0348 -0.0271 -0.0884 57  LEU A CA  
2072 C  C   . LEU C 38  ? 0.7148 0.7576 0.7071 -0.0338 -0.0271 -0.0915 57  LEU A C   
2073 O  O   . LEU C 38  ? 0.7088 0.7570 0.6987 -0.0296 -0.0274 -0.0940 57  LEU A O   
2074 C  CB  . LEU C 38  ? 0.7313 0.7987 0.7275 -0.0425 -0.0289 -0.0924 57  LEU A CB  
2075 C  CG  . LEU C 38  ? 0.7314 0.8132 0.7308 -0.0437 -0.0290 -0.0901 57  LEU A CG  
2076 C  CD1 . LEU C 38  ? 0.7664 0.8625 0.7667 -0.0512 -0.0308 -0.0950 57  LEU A CD1 
2077 C  CD2 . LEU C 38  ? 0.7219 0.8136 0.7215 -0.0340 -0.0284 -0.0870 57  LEU A CD2 
2078 N  N   . GLY C 39  ? 0.6599 0.6865 0.6519 -0.0375 -0.0269 -0.0914 58  GLY A N   
2079 C  CA  . GLY C 39  ? 0.6588 0.6730 0.6481 -0.0363 -0.0269 -0.0944 58  GLY A CA  
2080 C  C   . GLY C 39  ? 0.6678 0.6753 0.6567 -0.0278 -0.0251 -0.0915 58  GLY A C   
2081 O  O   . GLY C 39  ? 0.6815 0.6813 0.6682 -0.0254 -0.0249 -0.0942 58  GLY A O   
2082 N  N   . ALA C 40  ? 0.6420 0.6526 0.6327 -0.0233 -0.0238 -0.0863 59  ALA A N   
2083 C  CA  . ALA C 40  ? 0.6216 0.6267 0.6119 -0.0156 -0.0218 -0.0833 59  ALA A CA  
2084 C  C   . ALA C 40  ? 0.6219 0.6391 0.6106 -0.0092 -0.0211 -0.0825 59  ALA A C   
2085 O  O   . ALA C 40  ? 0.6279 0.6481 0.6137 -0.0070 -0.0213 -0.0858 59  ALA A O   
2086 C  CB  . ALA C 40  ? 0.6183 0.6163 0.6112 -0.0149 -0.0207 -0.0781 59  ALA A CB  
2087 N  N   . SER C 41  ? 0.4619 0.4854 0.4519 -0.0060 -0.0202 -0.0780 60  SER A N   
2088 C  CA  . SER C 41  ? 0.4611 0.4947 0.4489 0.0006  -0.0194 -0.0766 60  SER A CA  
2089 C  C   . SER C 41  ? 0.4568 0.5047 0.4458 0.0003  -0.0205 -0.0753 60  SER A C   
2090 O  O   . SER C 41  ? 0.4519 0.5089 0.4387 0.0059  -0.0202 -0.0740 60  SER A O   
2091 C  CB  . SER C 41  ? 0.4362 0.4627 0.4233 0.0070  -0.0169 -0.0723 60  SER A CB  
2092 O  OG  . SER C 41  ? 0.4338 0.4506 0.4192 0.0086  -0.0159 -0.0741 60  SER A OG  
2093 N  N   . GLY C 42  ? 0.5233 0.5732 0.5154 -0.0062 -0.0216 -0.0757 61  GLY A N   
2094 C  CA  . GLY C 42  ? 0.5356 0.5999 0.5295 -0.0071 -0.0226 -0.0749 61  GLY A CA  
2095 C  C   . GLY C 42  ? 0.5297 0.5941 0.5251 -0.0028 -0.0211 -0.0695 61  GLY A C   
2096 O  O   . GLY C 42  ? 0.5248 0.5788 0.5195 0.0012  -0.0192 -0.0663 61  GLY A O   
2097 N  N   . PRO C 43  ? 0.6045 0.6814 0.6019 -0.0037 -0.0219 -0.0687 62  PRO A N   
2098 C  CA  . PRO C 43  ? 0.6002 0.6786 0.5993 -0.0003 -0.0207 -0.0640 62  PRO A CA  
2099 C  C   . PRO C 43  ? 0.5913 0.6692 0.5872 0.0090  -0.0192 -0.0610 62  PRO A C   
2100 O  O   . PRO C 43  ? 0.5945 0.6757 0.5867 0.0130  -0.0196 -0.0627 62  PRO A O   
2101 C  CB  . PRO C 43  ? 0.6156 0.7108 0.6169 -0.0028 -0.0222 -0.0653 62  PRO A CB  
2102 C  CG  . PRO C 43  ? 0.6288 0.7280 0.6306 -0.0103 -0.0240 -0.0705 62  PRO A CG  
2103 C  CD  . PRO C 43  ? 0.6207 0.7120 0.6191 -0.0083 -0.0240 -0.0727 62  PRO A CD  
2104 N  N   . ALA C 44  ? 0.5331 0.6063 0.5298 0.0122  -0.0176 -0.0565 63  ALA A N   
2105 C  CA  . ALA C 44  ? 0.5397 0.6118 0.5329 0.0206  -0.0160 -0.0534 63  ALA A CA  
2106 C  C   . ALA C 44  ? 0.5398 0.6269 0.5318 0.0250  -0.0171 -0.0532 63  ALA A C   
2107 O  O   . ALA C 44  ? 0.5412 0.6362 0.5363 0.0234  -0.0177 -0.0525 63  ALA A O   
2108 C  CB  . ALA C 44  ? 0.5414 0.6030 0.5360 0.0219  -0.0138 -0.0490 63  ALA A CB  
2109 N  N   . GLU C 45  ? 0.6655 0.7565 0.6527 0.0309  -0.0174 -0.0538 64  GLU A N   
2110 C  CA  . GLU C 45  ? 0.6638 0.7690 0.6490 0.0361  -0.0187 -0.0538 64  GLU A CA  
2111 C  C   . GLU C 45  ? 0.6621 0.7637 0.6441 0.0439  -0.0170 -0.0492 64  GLU A C   
2112 O  O   . GLU C 45  ? 0.6761 0.7793 0.6524 0.0509  -0.0169 -0.0482 64  GLU A O   
2113 C  CB  . GLU C 45  ? 0.6811 0.7933 0.6621 0.0385  -0.0203 -0.0571 64  GLU A CB  
2114 C  CG  . GLU C 45  ? 0.6923 0.8062 0.6756 0.0310  -0.0218 -0.0620 64  GLU A CG  
2115 C  CD  . GLU C 45  ? 0.6974 0.8226 0.6773 0.0330  -0.0238 -0.0658 64  GLU A CD  
2116 O  OE1 . GLU C 45  ? 0.6875 0.8177 0.6626 0.0408  -0.0240 -0.0642 64  GLU A OE1 
2117 O  OE2 . GLU C 45  ? 0.7025 0.8311 0.6841 0.0268  -0.0253 -0.0703 64  GLU A OE2 
2118 N  N   . GLY C 46  ? 0.4912 0.5875 0.4763 0.0426  -0.0156 -0.0463 65  GLY A N   
2119 C  CA  . GLY C 46  ? 0.4880 0.5801 0.4703 0.0493  -0.0139 -0.0421 65  GLY A CA  
2120 C  C   . GLY C 46  ? 0.4826 0.5609 0.4599 0.0531  -0.0115 -0.0396 65  GLY A C   
2121 O  O   . GLY C 46  ? 0.4850 0.5581 0.4609 0.0513  -0.0112 -0.0414 65  GLY A O   
2122 N  N   . ARG C 47  ? 0.5058 0.5783 0.4803 0.0583  -0.0096 -0.0357 66  ARG A N   
2123 C  CA  . ARG C 47  ? 0.5009 0.5604 0.4703 0.0618  -0.0069 -0.0332 66  ARG A CA  
2124 C  C   . ARG C 47  ? 0.5116 0.5734 0.4730 0.0697  -0.0070 -0.0320 66  ARG A C   
2125 O  O   . ARG C 47  ? 0.5155 0.5863 0.4753 0.0742  -0.0084 -0.0314 66  ARG A O   
2126 C  CB  . ARG C 47  ? 0.4974 0.5471 0.4683 0.0617  -0.0045 -0.0297 66  ARG A CB  
2127 C  CG  . ARG C 47  ? 0.4953 0.5328 0.4603 0.0659  -0.0016 -0.0268 66  ARG A CG  
2128 C  CD  . ARG C 47  ? 0.4987 0.5265 0.4665 0.0639  0.0007  -0.0242 66  ARG A CD  
2129 N  NE  . ARG C 47  ? 0.4965 0.5135 0.4584 0.0679  0.0037  -0.0213 66  ARG A NE  
2130 C  CZ  . ARG C 47  ? 0.4922 0.5001 0.4554 0.0667  0.0061  -0.0191 66  ARG A CZ  
2131 N  NH1 . ARG C 47  ? 0.4736 0.4817 0.4437 0.0620  0.0057  -0.0194 66  ARG A NH1 
2132 N  NH2 . ARG C 47  ? 0.4969 0.4955 0.4543 0.0699  0.0090  -0.0167 66  ARG A NH2 
2133 N  N   . VAL C 48  ? 0.4268 0.4807 0.3831 0.0714  -0.0054 -0.0316 67  VAL A N   
2134 C  CA  . VAL C 48  ? 0.4382 0.4927 0.3858 0.0786  -0.0053 -0.0301 67  VAL A CA  
2135 C  C   . VAL C 48  ? 0.4325 0.4743 0.3745 0.0828  -0.0021 -0.0257 67  VAL A C   
2136 O  O   . VAL C 48  ? 0.4297 0.4605 0.3712 0.0804  0.0005  -0.0249 67  VAL A O   
2137 C  CB  . VAL C 48  ? 0.4406 0.4953 0.3848 0.0780  -0.0057 -0.0327 67  VAL A CB  
2138 C  CG1 . VAL C 48  ? 0.4579 0.5128 0.3923 0.0856  -0.0055 -0.0308 67  VAL A CG1 
2139 C  CG2 . VAL C 48  ? 0.4364 0.5030 0.3857 0.0734  -0.0088 -0.0374 67  VAL A CG2 
2140 N  N   . ALA C 49  ? 0.4715 0.5151 0.4091 0.0891  -0.0023 -0.0232 68  ALA A N   
2141 C  CA  . ALA C 49  ? 0.4921 0.5234 0.4234 0.0933  0.0007  -0.0190 68  ALA A CA  
2142 C  C   . ALA C 49  ? 0.5005 0.5270 0.4215 0.0985  0.0017  -0.0176 68  ALA A C   
2143 O  O   . ALA C 49  ? 0.5184 0.5528 0.4371 0.0999  -0.0004 -0.0197 68  ALA A O   
2144 C  CB  . ALA C 49  ? 0.5090 0.5431 0.4398 0.0979  0.0002  -0.0169 68  ALA A CB  
2145 N  N   . ARG C 50  ? 0.4494 0.4628 0.3639 0.1010  0.0049  -0.0140 69  ARG A N   
2146 C  CA  . ARG C 50  ? 0.4753 0.4825 0.3791 0.1055  0.0062  -0.0122 69  ARG A CA  
2147 C  C   . ARG C 50  ? 0.5001 0.5147 0.3968 0.1134  0.0036  -0.0114 69  ARG A C   
2148 O  O   . ARG C 50  ? 0.5081 0.5258 0.3990 0.1159  0.0026  -0.0121 69  ARG A O   
2149 C  CB  . ARG C 50  ? 0.4626 0.4540 0.3606 0.1061  0.0104  -0.0084 69  ARG A CB  
2150 C  CG  . ARG C 50  ? 0.4670 0.4506 0.3530 0.1103  0.0122  -0.0061 69  ARG A CG  
2151 C  CD  . ARG C 50  ? 0.4736 0.4418 0.3554 0.1083  0.0167  -0.0033 69  ARG A CD  
2152 N  NE  . ARG C 50  ? 0.4561 0.4223 0.3449 0.1008  0.0185  -0.0056 69  ARG A NE  
2153 C  CZ  . ARG C 50  ? 0.4604 0.4257 0.3471 0.0986  0.0196  -0.0071 69  ARG A CZ  
2154 N  NH1 . ARG C 50  ? 0.4755 0.4416 0.3529 0.1029  0.0192  -0.0064 69  ARG A NH1 
2155 N  NH2 . ARG C 50  ? 0.4571 0.4210 0.3507 0.0923  0.0211  -0.0095 69  ARG A NH2 
2156 N  N   . GLY C 51  ? 0.6734 0.6912 0.5705 0.1175  0.0024  -0.0101 70  GLY A N   
2157 C  CA  . GLY C 51  ? 0.6911 0.7160 0.5815 0.1259  -0.0002 -0.0093 70  GLY A CA  
2158 C  C   . GLY C 51  ? 0.7071 0.7502 0.6026 0.1257  -0.0043 -0.0134 70  GLY A C   
2159 O  O   . GLY C 51  ? 0.7147 0.7647 0.6039 0.1320  -0.0066 -0.0136 70  GLY A O   
2160 N  N   . SER C 52  ? 0.6362 0.6869 0.5428 0.1185  -0.0053 -0.0167 71  SER A N   
2161 C  CA  . SER C 52  ? 0.6296 0.6978 0.5420 0.1169  -0.0090 -0.0210 71  SER A CA  
2162 C  C   . SER C 52  ? 0.6492 0.7229 0.5565 0.1187  -0.0107 -0.0229 71  SER A C   
2163 O  O   . SER C 52  ? 0.6455 0.7093 0.5475 0.1180  -0.0086 -0.0218 71  SER A O   
2164 C  CB  . SER C 52  ? 0.5999 0.6716 0.5238 0.1074  -0.0091 -0.0240 71  SER A CB  
2165 O  OG  . SER C 52  ? 0.5954 0.6596 0.5200 0.1019  -0.0075 -0.0251 71  SER A OG  
2166 N  N   . GLU C 53  ? 0.8893 0.9795 0.7982 0.1209  -0.0144 -0.0259 72  GLU A N   
2167 C  CA  . GLU C 53  ? 0.9082 1.0057 0.8125 0.1228  -0.0164 -0.0281 72  GLU A CA  
2168 C  C   . GLU C 53  ? 0.8841 0.9809 0.7933 0.1143  -0.0158 -0.0316 72  GLU A C   
2169 O  O   . GLU C 53  ? 0.8931 0.9866 0.7966 0.1150  -0.0153 -0.0320 72  GLU A O   
2170 C  CB  . GLU C 53  ? 0.9275 1.0443 0.8333 0.1268  -0.0206 -0.0310 72  GLU A CB  
2171 C  CG  . GLU C 53  ? 0.9577 1.0758 0.8556 0.1375  -0.0216 -0.0278 72  GLU A CG  
2172 C  CD  . GLU C 53  ? 1.0047 1.1131 0.8897 0.1444  -0.0208 -0.0246 72  GLU A CD  
2173 O  OE1 . GLU C 53  ? 1.0005 1.1117 0.8829 0.1428  -0.0215 -0.0266 72  GLU A OE1 
2174 O  OE2 . GLU C 53  ? 1.0234 1.1212 0.9005 0.1512  -0.0194 -0.0201 72  GLU A OE2 
2175 N  N   . ARG C 54  ? 0.6874 0.7868 0.6068 0.1065  -0.0159 -0.0340 73  ARG A N   
2176 C  CA  . ARG C 54  ? 0.6778 0.7758 0.6022 0.0983  -0.0155 -0.0375 73  ARG A CA  
2177 C  C   . ARG C 54  ? 0.6603 0.7419 0.5810 0.0969  -0.0120 -0.0354 73  ARG A C   
2178 O  O   . ARG C 54  ? 0.6421 0.7212 0.5650 0.0915  -0.0115 -0.0381 73  ARG A O   
2179 C  CB  . ARG C 54  ? 0.6619 0.7640 0.5972 0.0906  -0.0161 -0.0398 73  ARG A CB  
2180 C  CG  . ARG C 54  ? 0.6684 0.7885 0.6081 0.0904  -0.0196 -0.0429 73  ARG A CG  
2181 C  CD  . ARG C 54  ? 0.6606 0.7836 0.6101 0.0831  -0.0197 -0.0443 73  ARG A CD  
2182 N  NE  . ARG C 54  ? 0.6323 0.7477 0.5864 0.0746  -0.0187 -0.0463 73  ARG A NE  
2183 C  CZ  . ARG C 54  ? 0.6066 0.7103 0.5645 0.0705  -0.0163 -0.0444 73  ARG A CZ  
2184 N  NH1 . ARG C 54  ? 0.6009 0.6992 0.5585 0.0736  -0.0148 -0.0406 73  ARG A NH1 
2185 N  NH2 . ARG C 54  ? 0.5987 0.6959 0.5603 0.0635  -0.0157 -0.0465 73  ARG A NH2 
2186 N  N   . PHE C 55  ? 0.5824 0.6529 0.4971 0.1016  -0.0094 -0.0307 74  PHE A N   
2187 C  CA  . PHE C 55  ? 0.5799 0.6352 0.4904 0.1005  -0.0057 -0.0285 74  PHE A CA  
2188 C  C   . PHE C 55  ? 0.5856 0.6398 0.4866 0.1044  -0.0055 -0.0284 74  PHE A C   
2189 O  O   . PHE C 55  ? 0.5785 0.6240 0.4772 0.1018  -0.0031 -0.0284 74  PHE A O   
2190 C  CB  . PHE C 55  ? 0.5708 0.6145 0.4781 0.1036  -0.0030 -0.0237 74  PHE A CB  
2191 C  CG  . PHE C 55  ? 0.5606 0.5895 0.4617 0.1034  0.0009  -0.0211 74  PHE A CG  
2192 C  CD1 . PHE C 55  ? 0.5371 0.5584 0.4437 0.0969  0.0033  -0.0220 74  PHE A CD1 
2193 C  CD2 . PHE C 55  ? 0.5842 0.6069 0.4738 0.1098  0.0022  -0.0177 74  PHE A CD2 
2194 C  CE1 . PHE C 55  ? 0.5376 0.5467 0.4390 0.0965  0.0070  -0.0199 74  PHE A CE1 
2195 C  CE2 . PHE C 55  ? 0.5864 0.5959 0.4702 0.1090  0.0060  -0.0154 74  PHE A CE2 
2196 C  CZ  . PHE C 55  ? 0.5631 0.5663 0.4531 0.1022  0.0085  -0.0167 74  PHE A CZ  
2197 N  N   . ARG C 56  ? 0.8381 0.9016 0.7335 0.1107  -0.0082 -0.0283 75  ARG A N   
2198 C  CA  . ARG C 56  ? 0.8528 0.9163 0.7384 0.1151  -0.0084 -0.0280 75  ARG A CA  
2199 C  C   . ARG C 56  ? 0.8419 0.9134 0.7308 0.1102  -0.0099 -0.0331 75  ARG A C   
2200 O  O   . ARG C 56  ? 0.8427 0.9115 0.7248 0.1114  -0.0091 -0.0334 75  ARG A O   
2201 C  CB  . ARG C 56  ? 0.8905 0.9619 0.7689 0.1239  -0.0110 -0.0263 75  ARG A CB  
2202 C  CG  . ARG C 56  ? 0.9193 0.9820 0.7928 0.1297  -0.0096 -0.0213 75  ARG A CG  
2203 C  CD  . ARG C 56  ? 0.9765 1.0457 0.8411 0.1395  -0.0123 -0.0196 75  ARG A CD  
2204 N  NE  . ARG C 56  ? 1.0161 1.0754 0.8748 0.1456  -0.0109 -0.0147 75  ARG A NE  
2205 C  CZ  . ARG C 56  ? 1.0404 1.1022 0.8905 0.1551  -0.0128 -0.0124 75  ARG A CZ  
2206 N  NH1 . ARG C 56  ? 1.0343 1.1091 0.8809 0.1596  -0.0164 -0.0145 75  ARG A NH1 
2207 N  NH2 . ARG C 56  ? 1.0626 1.1137 0.9073 0.1602  -0.0113 -0.0081 75  ARG A NH2 
2208 N  N   . ASP C 57  ? 0.7072 0.7880 0.6062 0.1045  -0.0120 -0.0372 76  ASP A N   
2209 C  CA  . ASP C 57  ? 0.7061 0.7939 0.6089 0.0992  -0.0136 -0.0425 76  ASP A CA  
2210 C  C   . ASP C 57  ? 0.6834 0.7595 0.5889 0.0932  -0.0105 -0.0434 76  ASP A C   
2211 O  O   . ASP C 57  ? 0.6713 0.7503 0.5795 0.0886  -0.0112 -0.0477 76  ASP A O   
2212 C  CB  . ASP C 57  ? 0.7145 0.8157 0.6268 0.0947  -0.0167 -0.0466 76  ASP A CB  
2213 C  CG  . ASP C 57  ? 0.7477 0.8633 0.6579 0.1005  -0.0201 -0.0468 76  ASP A CG  
2214 O  OD1 . ASP C 57  ? 0.7659 0.8827 0.6669 0.1079  -0.0206 -0.0448 76  ASP A OD1 
2215 O  OD2 . ASP C 57  ? 0.7642 0.8904 0.6818 0.0976  -0.0222 -0.0491 76  ASP A OD2 
2216 N  N   . LEU C 58  ? 0.3698 0.4329 0.2745 0.0934  -0.0072 -0.0394 77  LEU A N   
2217 C  CA  . LEU C 58  ? 0.3439 0.3958 0.2507 0.0885  -0.0041 -0.0399 77  LEU A CA  
2218 C  C   . LEU C 58  ? 0.3383 0.3829 0.2354 0.0919  -0.0015 -0.0380 77  LEU A C   
2219 O  O   . LEU C 58  ? 0.3519 0.3908 0.2411 0.0972  0.0000  -0.0335 77  LEU A O   
2220 C  CB  . LEU C 58  ? 0.3343 0.3769 0.2462 0.0862  -0.0018 -0.0371 77  LEU A CB  
2221 C  CG  . LEU C 58  ? 0.3199 0.3681 0.2417 0.0820  -0.0038 -0.0387 77  LEU A CG  
2222 C  CD1 . LEU C 58  ? 0.3028 0.3408 0.2285 0.0800  -0.0013 -0.0358 77  LEU A CD1 
2223 C  CD2 . LEU C 58  ? 0.3019 0.3551 0.2301 0.0756  -0.0056 -0.0441 77  LEU A CD2 
2224 N  N   . VAL C 59  ? 0.4772 0.5214 0.3743 0.0887  -0.0009 -0.0415 78  VAL A N   
2225 C  CA  . VAL C 59  ? 0.4868 0.5247 0.3749 0.0910  0.0017  -0.0402 78  VAL A CA  
2226 C  C   . VAL C 59  ? 0.4678 0.4949 0.3589 0.0864  0.0054  -0.0405 78  VAL A C   
2227 O  O   . VAL C 59  ? 0.4563 0.4840 0.3559 0.0810  0.0049  -0.0441 78  VAL A O   
2228 C  CB  . VAL C 59  ? 0.4922 0.5392 0.3766 0.0916  -0.0004 -0.0442 78  VAL A CB  
2229 C  CG1 . VAL C 59  ? 0.4913 0.5325 0.3647 0.0949  0.0022  -0.0422 78  VAL A CG1 
2230 C  CG2 . VAL C 59  ? 0.5133 0.5733 0.3969 0.0952  -0.0046 -0.0450 78  VAL A CG2 
2231 N  N   . PRO C 60  ? 0.3526 0.3698 0.2365 0.0885  0.0091  -0.0367 79  PRO A N   
2232 C  CA  . PRO C 60  ? 0.3382 0.3462 0.2246 0.0845  0.0129  -0.0370 79  PRO A CA  
2233 C  C   . PRO C 60  ? 0.3452 0.3557 0.2325 0.0815  0.0131  -0.0419 79  PRO A C   
2234 O  O   . PRO C 60  ? 0.3639 0.3790 0.2443 0.0839  0.0124  -0.0430 79  PRO A O   
2235 C  CB  . PRO C 60  ? 0.3388 0.3375 0.2149 0.0880  0.0165  -0.0319 79  PRO A CB  
2236 C  CG  . PRO C 60  ? 0.3626 0.3635 0.2332 0.0937  0.0145  -0.0283 79  PRO A CG  
2237 C  CD  . PRO C 60  ? 0.3668 0.3808 0.2399 0.0948  0.0100  -0.0318 79  PRO A CD  
2238 N  N   . ASN C 61  ? 0.3752 0.3827 0.2707 0.0765  0.0141  -0.0448 80  ASN A N   
2239 C  CA  . ASN C 61  ? 0.3643 0.3729 0.2609 0.0738  0.0147  -0.0495 80  ASN A CA  
2240 C  C   . ASN C 61  ? 0.3663 0.3669 0.2586 0.0735  0.0193  -0.0481 80  ASN A C   
2241 O  O   . ASN C 61  ? 0.3643 0.3583 0.2612 0.0711  0.0216  -0.0471 80  ASN A O   
2242 C  CB  . ASN C 61  ? 0.3563 0.3659 0.2638 0.0689  0.0129  -0.0539 80  ASN A CB  
2243 C  CG  . ASN C 61  ? 0.3549 0.3664 0.2636 0.0665  0.0129  -0.0595 80  ASN A CG  
2244 O  OD1 . ASN C 61  ? 0.3545 0.3667 0.2707 0.0629  0.0111  -0.0635 80  ASN A OD1 
2245 N  ND2 . ASN C 61  ? 0.3630 0.3747 0.2639 0.0685  0.0149  -0.0598 80  ASN A ND2 
2246 N  N   . TYR C 62  ? 0.4690 0.4706 0.3521 0.0758  0.0207  -0.0480 81  TYR A N   
2247 C  CA  . TYR C 62  ? 0.4706 0.4654 0.3484 0.0752  0.0254  -0.0467 81  TYR A CA  
2248 C  C   . TYR C 62  ? 0.4683 0.4654 0.3486 0.0724  0.0263  -0.0523 81  TYR A C   
2249 O  O   . TYR C 62  ? 0.4776 0.4726 0.3515 0.0725  0.0296  -0.0522 81  TYR A O   
2250 C  CB  . TYR C 62  ? 0.4918 0.4848 0.3566 0.0795  0.0269  -0.0425 81  TYR A CB  
2251 C  CG  . TYR C 62  ? 0.4977 0.4844 0.3583 0.0823  0.0277  -0.0364 81  TYR A CG  
2252 C  CD1 . TYR C 62  ? 0.5004 0.4774 0.3588 0.0811  0.0320  -0.0329 81  TYR A CD1 
2253 C  CD2 . TYR C 62  ? 0.4996 0.4905 0.3586 0.0863  0.0242  -0.0343 81  TYR A CD2 
2254 C  CE1 . TYR C 62  ? 0.5202 0.4907 0.3743 0.0836  0.0328  -0.0276 81  TYR A CE1 
2255 C  CE2 . TYR C 62  ? 0.5080 0.4929 0.3629 0.0893  0.0249  -0.0290 81  TYR A CE2 
2256 C  CZ  . TYR C 62  ? 0.5269 0.5010 0.3792 0.0880  0.0292  -0.0256 81  TYR A CZ  
2257 O  OH  . TYR C 62  ? 0.5410 0.5084 0.3889 0.0909  0.0300  -0.0205 81  TYR A OH  
2258 N  N   . ASN C 63  ? 0.3531 0.3543 0.2424 0.0698  0.0235  -0.0571 82  ASN A N   
2259 C  CA  . ASN C 63  ? 0.3451 0.3482 0.2375 0.0673  0.0240  -0.0628 82  ASN A CA  
2260 C  C   . ASN C 63  ? 0.3500 0.3470 0.2425 0.0657  0.0286  -0.0625 82  ASN A C   
2261 O  O   . ASN C 63  ? 0.3410 0.3326 0.2387 0.0642  0.0300  -0.0606 82  ASN A O   
2262 C  CB  . ASN C 63  ? 0.3390 0.3442 0.2417 0.0643  0.0206  -0.0672 82  ASN A CB  
2263 C  CG  . ASN C 63  ? 0.3418 0.3500 0.2464 0.0625  0.0201  -0.0738 82  ASN A CG  
2264 O  OD1 . ASN C 63  ? 0.3412 0.3480 0.2429 0.0625  0.0232  -0.0754 82  ASN A OD1 
2265 N  ND2 . ASN C 63  ? 0.3412 0.3536 0.2504 0.0609  0.0163  -0.0778 82  ASN A ND2 
2266 N  N   . PRO C 64  ? 0.4879 0.4863 0.3743 0.0660  0.0311  -0.0645 83  PRO A N   
2267 C  CA  . PRO C 64  ? 0.4784 0.4725 0.3639 0.0645  0.0358  -0.0645 83  PRO A CA  
2268 C  C   . PRO C 64  ? 0.4620 0.4556 0.3578 0.0616  0.0360  -0.0694 83  PRO A C   
2269 O  O   . PRO C 64  ? 0.4701 0.4603 0.3676 0.0601  0.0395  -0.0691 83  PRO A O   
2270 C  CB  . PRO C 64  ? 0.4795 0.4772 0.3557 0.0657  0.0377  -0.0660 83  PRO A CB  
2271 C  CG  . PRO C 64  ? 0.4795 0.4842 0.3552 0.0670  0.0334  -0.0693 83  PRO A CG  
2272 C  CD  . PRO C 64  ? 0.4801 0.4852 0.3600 0.0678  0.0295  -0.0671 83  PRO A CD  
2273 N  N   . ASP C 65  ? 0.3325 0.3294 0.2348 0.0609  0.0321  -0.0738 84  ASP A N   
2274 C  CA  . ASP C 65  ? 0.3447 0.3404 0.2562 0.0587  0.0317  -0.0785 84  ASP A CA  
2275 C  C   . ASP C 65  ? 0.3411 0.3326 0.2609 0.0574  0.0298  -0.0766 84  ASP A C   
2276 O  O   . ASP C 65  ? 0.3245 0.3147 0.2520 0.0558  0.0281  -0.0803 84  ASP A O   
2277 C  CB  . ASP C 65  ? 0.3472 0.3475 0.2603 0.0584  0.0289  -0.0850 84  ASP A CB  
2278 C  CG  . ASP C 65  ? 0.3554 0.3595 0.2625 0.0591  0.0314  -0.0883 84  ASP A CG  
2279 O  OD1 . ASP C 65  ? 0.3589 0.3614 0.2626 0.0592  0.0357  -0.0866 84  ASP A OD1 
2280 O  OD2 . ASP C 65  ? 0.3671 0.3758 0.2727 0.0594  0.0292  -0.0928 84  ASP A OD2 
2281 N  N   . ILE C 66  ? 0.3559 0.3449 0.2735 0.0581  0.0301  -0.0708 85  ILE A N   
2282 C  CA  . ILE C 66  ? 0.3374 0.3227 0.2620 0.0570  0.0286  -0.0684 85  ILE A CA  
2283 C  C   . ILE C 66  ? 0.3334 0.3137 0.2564 0.0571  0.0321  -0.0633 85  ILE A C   
2284 O  O   . ILE C 66  ? 0.3347 0.3142 0.2496 0.0587  0.0342  -0.0595 85  ILE A O   
2285 C  CB  . ILE C 66  ? 0.3306 0.3187 0.2555 0.0576  0.0246  -0.0668 85  ILE A CB  
2286 C  CG1 . ILE C 66  ? 0.3301 0.3230 0.2570 0.0566  0.0211  -0.0722 85  ILE A CG1 
2287 C  CG2 . ILE C 66  ? 0.3278 0.3121 0.2594 0.0562  0.0234  -0.0641 85  ILE A CG2 
2288 C  CD1 . ILE C 66  ? 0.3341 0.3307 0.2622 0.0565  0.0171  -0.0713 85  ILE A CD1 
2289 N  N   . ILE C 67  ? 0.2681 0.2447 0.1985 0.0553  0.0325  -0.0633 86  ILE A N   
2290 C  CA  . ILE C 67  ? 0.2680 0.2399 0.1979 0.0549  0.0357  -0.0590 86  ILE A CA  
2291 C  C   . ILE C 67  ? 0.2658 0.2354 0.1985 0.0550  0.0335  -0.0550 86  ILE A C   
2292 O  O   . ILE C 67  ? 0.2660 0.2355 0.2061 0.0538  0.0307  -0.0564 86  ILE A O   
2293 C  CB  . ILE C 67  ? 0.4082 0.3783 0.3445 0.0530  0.0379  -0.0614 86  ILE A CB  
2294 C  CG1 . ILE C 67  ? 0.4137 0.3868 0.3474 0.0529  0.0403  -0.0657 86  ILE A CG1 
2295 C  CG2 . ILE C 67  ? 0.4054 0.3710 0.3413 0.0521  0.0410  -0.0571 86  ILE A CG2 
2296 C  CD1 . ILE C 67  ? 0.2692 0.2421 0.2096 0.0516  0.0421  -0.0690 86  ILE A CD1 
2297 N  N   . PHE C 68  ? 0.4079 0.3752 0.3341 0.0566  0.0349  -0.0500 87  PHE A N   
2298 C  CA  . PHE C 68  ? 0.4120 0.3774 0.3401 0.0571  0.0332  -0.0462 87  PHE A CA  
2299 C  C   . PHE C 68  ? 0.4145 0.3740 0.3435 0.0559  0.0364  -0.0429 87  PHE A C   
2300 O  O   . PHE C 68  ? 0.4219 0.3779 0.3438 0.0565  0.0400  -0.0403 87  PHE A O   
2301 C  CB  . PHE C 68  ? 0.4215 0.3887 0.3418 0.0602  0.0319  -0.0431 87  PHE A CB  
2302 C  CG  . PHE C 68  ? 0.4169 0.3910 0.3372 0.0611  0.0282  -0.0462 87  PHE A CG  
2303 C  CD1 . PHE C 68  ? 0.4147 0.3923 0.3405 0.0606  0.0243  -0.0469 87  PHE A CD1 
2304 C  CD2 . PHE C 68  ? 0.4262 0.4035 0.3407 0.0622  0.0288  -0.0486 87  PHE A CD2 
2305 C  CE1 . PHE C 68  ? 0.4189 0.4032 0.3447 0.0609  0.0210  -0.0500 87  PHE A CE1 
2306 C  CE2 . PHE C 68  ? 0.4304 0.4144 0.3448 0.0628  0.0253  -0.0517 87  PHE A CE2 
2307 C  CZ  . PHE C 68  ? 0.4231 0.4107 0.3432 0.0620  0.0214  -0.0525 87  PHE A CZ  
2308 N  N   . LYS C 69  ? 0.3056 0.2637 0.2430 0.0541  0.0352  -0.0432 88  LYS A N   
2309 C  CA  . LYS C 69  ? 0.3070 0.2603 0.2463 0.0527  0.0379  -0.0406 88  LYS A CA  
2310 C  C   . LYS C 69  ? 0.3123 0.2615 0.2438 0.0544  0.0398  -0.0355 88  LYS A C   
2311 O  O   . LYS C 69  ? 0.3091 0.2541 0.2360 0.0538  0.0438  -0.0337 88  LYS A O   
2312 C  CB  . LYS C 69  ? 0.2868 0.2396 0.2354 0.0512  0.0354  -0.0410 88  LYS A CB  
2313 C  CG  . LYS C 69  ? 0.2876 0.2362 0.2390 0.0496  0.0378  -0.0388 88  LYS A CG  
2314 C  CD  . LYS C 69  ? 0.2795 0.2281 0.2399 0.0481  0.0351  -0.0396 88  LYS A CD  
2315 C  CE  . LYS C 69  ? 0.2769 0.2218 0.2398 0.0466  0.0374  -0.0374 88  LYS A CE  
2316 N  NZ  . LYS C 69  ? 0.2887 0.2327 0.2506 0.0454  0.0414  -0.0388 88  LYS A NZ  
2317 N  N   . ASP C 70  ? 0.5175 0.4681 0.4476 0.0566  0.0369  -0.0333 89  ASP A N   
2318 C  CA  . ASP C 70  ? 0.5321 0.4789 0.4543 0.0592  0.0381  -0.0286 89  ASP A CA  
2319 C  C   . ASP C 70  ? 0.5405 0.4803 0.4619 0.0577  0.0417  -0.0258 89  ASP A C   
2320 O  O   . ASP C 70  ? 0.5543 0.4891 0.4676 0.0581  0.0452  -0.0235 89  ASP A O   
2321 C  CB  . ASP C 70  ? 0.5390 0.4859 0.4507 0.0618  0.0393  -0.0278 89  ASP A CB  
2322 C  CG  . ASP C 70  ? 0.5550 0.4985 0.4582 0.0655  0.0395  -0.0231 89  ASP A CG  
2323 O  OD1 . ASP C 70  ? 0.5472 0.4925 0.4531 0.0672  0.0366  -0.0217 89  ASP A OD1 
2324 O  OD2 . ASP C 70  ? 0.5728 0.5115 0.4661 0.0669  0.0424  -0.0208 89  ASP A OD2 
2325 N  N   . GLU C 71  ? 0.4795 0.4188 0.4090 0.0558  0.0408  -0.0259 90  GLU A N   
2326 C  CA  . GLU C 71  ? 0.4765 0.4098 0.4060 0.0541  0.0439  -0.0235 90  GLU A CA  
2327 C  C   . GLU C 71  ? 0.4887 0.4176 0.4123 0.0567  0.0440  -0.0190 90  GLU A C   
2328 O  O   . GLU C 71  ? 0.5036 0.4261 0.4236 0.0559  0.0471  -0.0165 90  GLU A O   
2329 C  CB  . GLU C 71  ? 0.4723 0.4068 0.4124 0.0512  0.0428  -0.0254 90  GLU A CB  
2330 C  CG  . GLU C 71  ? 0.4670 0.4037 0.4123 0.0520  0.0391  -0.0243 90  GLU A CG  
2331 C  CD  . GLU C 71  ? 0.4571 0.3999 0.4063 0.0524  0.0350  -0.0272 90  GLU A CD  
2332 O  OE1 . GLU C 71  ? 0.4496 0.3948 0.3987 0.0520  0.0351  -0.0303 90  GLU A OE1 
2333 O  OE2 . GLU C 71  ? 0.4575 0.4029 0.4100 0.0529  0.0319  -0.0264 90  GLU A OE2 
2334 N  N   . GLU C 72  ? 0.5134 0.4461 0.4359 0.0598  0.0405  -0.0183 91  GLU A N   
2335 C  CA  . GLU C 72  ? 0.5224 0.4520 0.4391 0.0633  0.0401  -0.0144 91  GLU A CA  
2336 C  C   . GLU C 72  ? 0.5343 0.4590 0.4388 0.0662  0.0425  -0.0119 91  GLU A C   
2337 O  O   . GLU C 72  ? 0.5395 0.4597 0.4371 0.0695  0.0428  -0.0084 91  GLU A O   
2338 C  CB  . GLU C 72  ? 0.5226 0.4593 0.4425 0.0657  0.0355  -0.0148 91  GLU A CB  
2339 C  CG  . GLU C 72  ? 0.5096 0.4526 0.4405 0.0627  0.0326  -0.0182 91  GLU A CG  
2340 C  CD  . GLU C 72  ? 0.5020 0.4506 0.4341 0.0620  0.0309  -0.0219 91  GLU A CD  
2341 O  OE1 . GLU C 72  ? 0.5088 0.4555 0.4364 0.0619  0.0332  -0.0228 91  GLU A OE1 
2342 O  OE2 . GLU C 72  ? 0.4961 0.4511 0.4335 0.0615  0.0273  -0.0240 91  GLU A OE2 
2343 N  N   . ASN C 73  ? 0.5631 0.4884 0.4646 0.0650  0.0442  -0.0137 92  ASN A N   
2344 C  CA  . ASN C 73  ? 0.5740 0.4947 0.4633 0.0674  0.0466  -0.0115 92  ASN A CA  
2345 C  C   . ASN C 73  ? 0.5808 0.5028 0.4633 0.0730  0.0438  -0.0090 92  ASN A C   
2346 O  O   . ASN C 73  ? 0.5957 0.5104 0.4682 0.0760  0.0455  -0.0051 92  ASN A O   
2347 C  CB  . ASN C 73  ? 0.5820 0.4924 0.4651 0.0655  0.0514  -0.0086 92  ASN A CB  
2348 C  CG  . ASN C 73  ? 0.5915 0.5019 0.4799 0.0601  0.0546  -0.0114 92  ASN A CG  
2349 O  OD1 . ASN C 73  ? 0.5928 0.5083 0.4832 0.0587  0.0547  -0.0147 92  ASN A OD1 
2350 N  ND2 . ASN C 73  ? 0.5894 0.4944 0.4800 0.0572  0.0572  -0.0103 92  ASN A ND2 
2351 N  N   . SER C 74  ? 0.5404 0.4716 0.4283 0.0745  0.0394  -0.0113 93  SER A N   
2352 C  CA  . SER C 74  ? 0.5397 0.4746 0.4227 0.0799  0.0363  -0.0096 93  SER A CA  
2353 C  C   . SER C 74  ? 0.5417 0.4858 0.4249 0.0809  0.0334  -0.0128 93  SER A C   
2354 O  O   . SER C 74  ? 0.5471 0.4958 0.4257 0.0855  0.0307  -0.0119 93  SER A O   
2355 C  CB  . SER C 74  ? 0.5274 0.4655 0.4172 0.0808  0.0334  -0.0091 93  SER A CB  
2356 O  OG  . SER C 74  ? 0.5192 0.4648 0.4204 0.0772  0.0310  -0.0128 93  SER A OG  
2357 N  N   . GLY C 75  ? 0.4836 0.4307 0.3722 0.0769  0.0339  -0.0166 94  GLY A N   
2358 C  CA  . GLY C 75  ? 0.4735 0.4291 0.3630 0.0772  0.0313  -0.0202 94  GLY A CA  
2359 C  C   . GLY C 75  ? 0.4646 0.4291 0.3618 0.0773  0.0267  -0.0225 94  GLY A C   
2360 O  O   . GLY C 75  ? 0.4657 0.4379 0.3623 0.0785  0.0239  -0.0250 94  GLY A O   
2361 N  N   . ALA C 76  ? 0.3495 0.3132 0.2539 0.0758  0.0259  -0.0218 95  ALA A N   
2362 C  CA  . ALA C 76  ? 0.3386 0.3104 0.2505 0.0752  0.0218  -0.0236 95  ALA A CA  
2363 C  C   . ALA C 76  ? 0.3250 0.3023 0.2439 0.0713  0.0199  -0.0286 95  ALA A C   
2364 O  O   . ALA C 76  ? 0.3261 0.3117 0.2472 0.0715  0.0165  -0.0310 95  ALA A O   
2365 C  CB  . ALA C 76  ? 0.3417 0.3107 0.2596 0.0738  0.0219  -0.0218 95  ALA A CB  
2366 N  N   . ASP C 77  ? 0.4739 0.4467 0.3960 0.0679  0.0222  -0.0304 96  ASP A N   
2367 C  CA  . ASP C 77  ? 0.4620 0.4383 0.3905 0.0644  0.0207  -0.0352 96  ASP A CA  
2368 C  C   . ASP C 77  ? 0.4637 0.4467 0.3883 0.0657  0.0188  -0.0381 96  ASP A C   
2369 O  O   . ASP C 77  ? 0.4586 0.4471 0.3882 0.0636  0.0158  -0.0418 96  ASP A O   
2370 C  CB  . ASP C 77  ? 0.4649 0.4354 0.3953 0.0618  0.0239  -0.0366 96  ASP A CB  
2371 C  CG  . ASP C 77  ? 0.4513 0.4166 0.3876 0.0596  0.0252  -0.0349 96  ASP A CG  
2372 O  OD1 . ASP C 77  ? 0.4504 0.4175 0.3926 0.0585  0.0228  -0.0347 96  ASP A OD1 
2373 O  OD2 . ASP C 77  ? 0.4428 0.4027 0.3778 0.0587  0.0288  -0.0341 96  ASP A OD2 
2374 N  N   . ARG C 78  ? 0.3953 0.3775 0.3105 0.0691  0.0204  -0.0364 97  ARG A N   
2375 C  CA  . ARG C 78  ? 0.3982 0.3868 0.3086 0.0708  0.0188  -0.0389 97  ARG A CA  
2376 C  C   . ARG C 78  ? 0.4034 0.4009 0.3149 0.0725  0.0146  -0.0395 97  ARG A C   
2377 O  O   . ARG C 78  ? 0.4152 0.4198 0.3283 0.0714  0.0120  -0.0435 97  ARG A O   
2378 C  CB  . ARG C 78  ? 0.4042 0.3894 0.3034 0.0743  0.0216  -0.0361 97  ARG A CB  
2379 C  CG  . ARG C 78  ? 0.3971 0.3744 0.2948 0.0723  0.0261  -0.0355 97  ARG A CG  
2380 C  CD  . ARG C 78  ? 0.4238 0.3979 0.3096 0.0752  0.0289  -0.0331 97  ARG A CD  
2381 N  NE  . ARG C 78  ? 0.4255 0.3937 0.3100 0.0725  0.0333  -0.0334 97  ARG A NE  
2382 C  CZ  . ARG C 78  ? 0.4302 0.4010 0.3168 0.0700  0.0342  -0.0378 97  ARG A CZ  
2383 N  NH1 . ARG C 78  ? 0.4160 0.3942 0.3058 0.0699  0.0309  -0.0421 97  ARG A NH1 
2384 N  NH2 . ARG C 78  ? 0.4450 0.4111 0.3305 0.0677  0.0384  -0.0380 97  ARG A NH2 
2385 N  N   . LEU C 79  ? 0.3345 0.3319 0.2452 0.0750  0.0139  -0.0358 98  LEU A N   
2386 C  CA  . LEU C 79  ? 0.3372 0.3441 0.2491 0.0769  0.0100  -0.0363 98  LEU A CA  
2387 C  C   . LEU C 79  ? 0.3369 0.3495 0.2584 0.0720  0.0072  -0.0406 98  LEU A C   
2388 O  O   . LEU C 79  ? 0.3266 0.3348 0.2552 0.0681  0.0078  -0.0410 98  LEU A O   
2389 C  CB  . LEU C 79  ? 0.3305 0.3356 0.2413 0.0800  0.0100  -0.0318 98  LEU A CB  
2390 C  CG  . LEU C 79  ? 0.3456 0.3434 0.2460 0.0850  0.0128  -0.0272 98  LEU A CG  
2391 C  CD1 . LEU C 79  ? 0.3480 0.3426 0.2486 0.0874  0.0130  -0.0233 98  LEU A CD1 
2392 C  CD2 . LEU C 79  ? 0.3724 0.3755 0.2638 0.0899  0.0114  -0.0270 98  LEU A CD2 
2393 N  N   . MET C 80  ? 0.4543 0.4768 0.3757 0.0721  0.0040  -0.0438 99  MET A N   
2394 C  CA  . MET C 80  ? 0.4588 0.4868 0.3882 0.0671  0.0012  -0.0481 99  MET A CA  
2395 C  C   . MET C 80  ? 0.4782 0.5185 0.4059 0.0681  -0.0022 -0.0510 99  MET A C   
2396 O  O   . MET C 80  ? 0.4759 0.5202 0.3961 0.0729  -0.0025 -0.0500 99  MET A O   
2397 C  CB  . MET C 80  ? 0.4526 0.4751 0.3852 0.0629  0.0025  -0.0517 99  MET A CB  
2398 C  CG  . MET C 80  ? 0.4616 0.4851 0.3878 0.0646  0.0033  -0.0539 99  MET A CG  
2399 S  SD  . MET C 80  ? 0.4598 0.4762 0.3894 0.0606  0.0053  -0.0579 99  MET A SD  
2400 C  CE  . MET C 80  ? 0.4322 0.4377 0.3626 0.0610  0.0093  -0.0534 99  MET A CE  
2401 N  N   . THR C 81  ? 0.6198 0.6660 0.5543 0.0635  -0.0049 -0.0546 100 THR A N   
2402 C  CA  . THR C 81  ? 0.6259 0.6846 0.5597 0.0634  -0.0083 -0.0581 100 THR A CA  
2403 C  C   . THR C 81  ? 0.6328 0.6928 0.5635 0.0625  -0.0085 -0.0623 100 THR A C   
2404 O  O   . THR C 81  ? 0.6318 0.6830 0.5614 0.0617  -0.0060 -0.0627 100 THR A O   
2405 C  CB  . THR C 81  ? 0.6281 0.6927 0.5701 0.0578  -0.0109 -0.0608 100 THR A CB  
2406 O  OG1 . THR C 81  ? 0.6188 0.6773 0.5655 0.0519  -0.0107 -0.0643 100 THR A OG1 
2407 C  CG2 . THR C 81  ? 0.6114 0.6742 0.5572 0.0581  -0.0105 -0.0568 100 THR A CG2 
2408 N  N   . GLU C 82  ? 0.6384 0.7099 0.5674 0.0628  -0.0114 -0.0656 101 GLU A N   
2409 C  CA  . GLU C 82  ? 0.6363 0.7102 0.5619 0.0620  -0.0119 -0.0700 101 GLU A CA  
2410 C  C   . GLU C 82  ? 0.6239 0.6932 0.5557 0.0553  -0.0120 -0.0747 101 GLU A C   
2411 O  O   . GLU C 82  ? 0.6275 0.6907 0.5574 0.0547  -0.0104 -0.0767 101 GLU A O   
2412 C  CB  . GLU C 82  ? 0.6394 0.7278 0.5618 0.0641  -0.0152 -0.0725 101 GLU A CB  
2413 C  CG  . GLU C 82  ? 0.6434 0.7360 0.5581 0.0718  -0.0152 -0.0681 101 GLU A CG  
2414 C  CD  . GLU C 82  ? 0.6615 0.7451 0.5680 0.0760  -0.0120 -0.0652 101 GLU A CD  
2415 O  OE1 . GLU C 82  ? 0.6655 0.7454 0.5709 0.0737  -0.0108 -0.0683 101 GLU A OE1 
2416 O  OE2 . GLU C 82  ? 0.6578 0.7378 0.5587 0.0816  -0.0106 -0.0600 101 GLU A OE2 
2417 N  N   . ARG C 83  ? 0.4755 0.5475 0.4142 0.0503  -0.0140 -0.0765 102 ARG A N   
2418 C  CA  . ARG C 83  ? 0.4777 0.5444 0.4218 0.0438  -0.0145 -0.0808 102 ARG A CA  
2419 C  C   . ARG C 83  ? 0.4697 0.5224 0.4153 0.0435  -0.0114 -0.0791 102 ARG A C   
2420 O  O   . ARG C 83  ? 0.4672 0.5142 0.4138 0.0408  -0.0109 -0.0827 102 ARG A O   
2421 C  CB  . ARG C 83  ? 0.4637 0.5344 0.4144 0.0384  -0.0167 -0.0819 102 ARG A CB  
2422 C  CG  . ARG C 83  ? 0.4598 0.5250 0.4149 0.0314  -0.0176 -0.0867 102 ARG A CG  
2423 C  CD  . ARG C 83  ? 0.4702 0.5403 0.4307 0.0256  -0.0199 -0.0880 102 ARG A CD  
2424 N  NE  . ARG C 83  ? 0.4746 0.5374 0.4385 0.0189  -0.0206 -0.0922 102 ARG A NE  
2425 C  CZ  . ARG C 83  ? 0.4818 0.5495 0.4454 0.0144  -0.0227 -0.0978 102 ARG A CZ  
2426 N  NH1 . ARG C 83  ? 0.4934 0.5744 0.4539 0.0160  -0.0244 -0.1001 102 ARG A NH1 
2427 N  NH2 . ARG C 83  ? 0.4772 0.5361 0.4432 0.0085  -0.0232 -0.1013 102 ARG A NH2 
2428 N  N   . CYS C 84  ? 0.4931 0.5408 0.4388 0.0463  -0.0094 -0.0737 103 CYS A N   
2429 C  CA  . CYS C 84  ? 0.4795 0.5152 0.4266 0.0464  -0.0064 -0.0718 103 CYS A CA  
2430 C  C   . CYS C 84  ? 0.4798 0.5125 0.4216 0.0488  -0.0043 -0.0733 103 CYS A C   
2431 O  O   . CYS C 84  ? 0.4743 0.5005 0.4182 0.0465  -0.0034 -0.0763 103 CYS A O   
2432 C  CB  . CYS C 84  ? 0.4825 0.5148 0.4292 0.0496  -0.0045 -0.0657 103 CYS A CB  
2433 S  SG  . CYS C 84  ? 0.4420 0.4609 0.3929 0.0482  -0.0014 -0.0634 103 CYS A SG  
2434 N  N   . LYS C 85  ? 0.6945 0.7318 0.6291 0.0536  -0.0036 -0.0715 104 LYS A N   
2435 C  CA  . LYS C 85  ? 0.6837 0.7190 0.6122 0.0561  -0.0015 -0.0726 104 LYS A CA  
2436 C  C   . LYS C 85  ? 0.6847 0.7212 0.6143 0.0529  -0.0026 -0.0790 104 LYS A C   
2437 O  O   . LYS C 85  ? 0.6830 0.7133 0.6126 0.0524  -0.0004 -0.0808 104 LYS A O   
2438 C  CB  . LYS C 85  ? 0.6993 0.7410 0.6192 0.0614  -0.0015 -0.0701 104 LYS A CB  
2439 C  CG  . LYS C 85  ? 0.7197 0.7571 0.6360 0.0655  0.0006  -0.0636 104 LYS A CG  
2440 C  CD  . LYS C 85  ? 0.7281 0.7699 0.6345 0.0711  0.0008  -0.0613 104 LYS A CD  
2441 C  CE  . LYS C 85  ? 0.7202 0.7555 0.6220 0.0751  0.0033  -0.0549 104 LYS A CE  
2442 N  NZ  . LYS C 85  ? 0.7503 0.7891 0.6417 0.0810  0.0032  -0.0522 104 LYS A NZ  
2443 N  N   . GLU C 86  ? 0.6472 0.6921 0.5779 0.0508  -0.0059 -0.0826 105 GLU A N   
2444 C  CA  . GLU C 86  ? 0.6564 0.7027 0.5879 0.0475  -0.0073 -0.0891 105 GLU A CA  
2445 C  C   . GLU C 86  ? 0.6444 0.6803 0.5817 0.0438  -0.0063 -0.0912 105 GLU A C   
2446 O  O   . GLU C 86  ? 0.6372 0.6700 0.5738 0.0430  -0.0056 -0.0955 105 GLU A O   
2447 C  CB  . GLU C 86  ? 0.6811 0.7372 0.6146 0.0444  -0.0111 -0.0925 105 GLU A CB  
2448 C  CG  . GLU C 86  ? 0.6939 0.7620 0.6213 0.0481  -0.0127 -0.0921 105 GLU A CG  
2449 C  CD  . GLU C 86  ? 0.7320 0.8108 0.6617 0.0443  -0.0164 -0.0966 105 GLU A CD  
2450 O  OE1 . GLU C 86  ? 0.7266 0.8025 0.6624 0.0385  -0.0176 -0.0997 105 GLU A OE1 
2451 O  OE2 . GLU C 86  ? 0.7457 0.8359 0.6709 0.0472  -0.0182 -0.0971 105 GLU A OE2 
2452 N  N   . ARG C 87  ? 0.4714 0.5022 0.4143 0.0419  -0.0063 -0.0884 106 ARG A N   
2453 C  CA  . ARG C 87  ? 0.4486 0.4694 0.3971 0.0386  -0.0058 -0.0899 106 ARG A CA  
2454 C  C   . ARG C 87  ? 0.4322 0.4452 0.3800 0.0414  -0.0022 -0.0879 106 ARG A C   
2455 O  O   . ARG C 87  ? 0.4284 0.4356 0.3775 0.0406  -0.0013 -0.0914 106 ARG A O   
2456 C  CB  . ARG C 87  ? 0.4503 0.4689 0.4046 0.0354  -0.0072 -0.0875 106 ARG A CB  
2457 C  CG  . ARG C 87  ? 0.4555 0.4824 0.4110 0.0319  -0.0105 -0.0896 106 ARG A CG  
2458 C  CD  . ARG C 87  ? 0.4684 0.4953 0.4241 0.0280  -0.0124 -0.0962 106 ARG A CD  
2459 N  NE  . ARG C 87  ? 0.4841 0.5191 0.4412 0.0237  -0.0154 -0.0986 106 ARG A NE  
2460 C  CZ  . ARG C 87  ? 0.5010 0.5477 0.4545 0.0246  -0.0170 -0.1006 106 ARG A CZ  
2461 N  NH1 . ARG C 87  ? 0.4981 0.5490 0.4461 0.0297  -0.0158 -0.1002 106 ARG A NH1 
2462 N  NH2 . ARG C 87  ? 0.5102 0.5648 0.4657 0.0202  -0.0197 -0.1030 106 ARG A NH2 
2463 N  N   . VAL C 88  ? 0.3484 0.3612 0.2939 0.0448  -0.0001 -0.0824 107 VAL A N   
2464 C  CA  . VAL C 88  ? 0.3449 0.3510 0.2895 0.0470  0.0035  -0.0802 107 VAL A CA  
2465 C  C   . VAL C 88  ? 0.3424 0.3497 0.2820 0.0489  0.0053  -0.0833 107 VAL A C   
2466 O  O   . VAL C 88  ? 0.3347 0.3367 0.2758 0.0487  0.0073  -0.0853 107 VAL A O   
2467 C  CB  . VAL C 88  ? 0.3499 0.3560 0.2916 0.0502  0.0055  -0.0738 107 VAL A CB  
2468 C  CG1 . VAL C 88  ? 0.3255 0.3236 0.2688 0.0507  0.0089  -0.0715 107 VAL A CG1 
2469 C  CG2 . VAL C 88  ? 0.3572 0.3660 0.3020 0.0491  0.0032  -0.0711 107 VAL A CG2 
2470 N  N   . ASN C 89  ? 0.4396 0.4544 0.3729 0.0508  0.0045  -0.0838 108 ASN A N   
2471 C  CA  . ASN C 89  ? 0.4432 0.4601 0.3708 0.0526  0.0060  -0.0868 108 ASN A CA  
2472 C  C   . ASN C 89  ? 0.4413 0.4564 0.3722 0.0499  0.0051  -0.0935 108 ASN A C   
2473 O  O   . ASN C 89  ? 0.4397 0.4526 0.3690 0.0508  0.0074  -0.0959 108 ASN A O   
2474 C  CB  . ASN C 89  ? 0.4534 0.4795 0.3740 0.0549  0.0045  -0.0865 108 ASN A CB  
2475 C  CG  . ASN C 89  ? 0.4649 0.4920 0.3807 0.0586  0.0056  -0.0800 108 ASN A CG  
2476 O  OD1 . ASN C 89  ? 0.4581 0.4788 0.3751 0.0593  0.0081  -0.0758 108 ASN A OD1 
2477 N  ND2 . ASN C 89  ? 0.4751 0.5103 0.3854 0.0611  0.0038  -0.0793 108 ASN A ND2 
2478 N  N   . ALA C 90  ? 0.3220 0.3379 0.2574 0.0464  0.0017  -0.0965 109 ALA A N   
2479 C  CA  . ALA C 90  ? 0.3215 0.3342 0.2599 0.0436  0.0005  -0.1029 109 ALA A CA  
2480 C  C   . ALA C 90  ? 0.3197 0.3227 0.2633 0.0431  0.0022  -0.1031 109 ALA A C   
2481 O  O   . ALA C 90  ? 0.3174 0.3173 0.2612 0.0435  0.0032  -0.1074 109 ALA A O   
2482 C  CB  . ALA C 90  ? 0.3243 0.3395 0.2658 0.0396  -0.0034 -0.1056 109 ALA A CB  
2483 N  N   . LEU C 91  ? 0.3423 0.3411 0.2901 0.0426  0.0024  -0.0985 110 LEU A N   
2484 C  CA  . LEU C 91  ? 0.3334 0.3236 0.2861 0.0424  0.0039  -0.0981 110 LEU A CA  
2485 C  C   . LEU C 91  ? 0.3297 0.3191 0.2798 0.0456  0.0078  -0.0975 110 LEU A C   
2486 O  O   . LEU C 91  ? 0.3328 0.3176 0.2856 0.0459  0.0089  -0.1005 110 LEU A O   
2487 C  CB  . LEU C 91  ? 0.3342 0.3213 0.2911 0.0413  0.0035  -0.0929 110 LEU A CB  
2488 C  CG  . LEU C 91  ? 0.3196 0.2982 0.2819 0.0410  0.0045  -0.0920 110 LEU A CG  
2489 C  CD1 . LEU C 91  ? 0.3299 0.3028 0.2956 0.0389  0.0025  -0.0973 110 LEU A CD1 
2490 C  CD2 . LEU C 91  ? 0.3051 0.2819 0.2708 0.0399  0.0040  -0.0867 110 LEU A CD2 
2491 N  N   . ALA C 92  ? 0.3498 0.3437 0.2945 0.0480  0.0098  -0.0936 111 ALA A N   
2492 C  CA  . ALA C 92  ? 0.3490 0.3427 0.2902 0.0505  0.0138  -0.0927 111 ALA A CA  
2493 C  C   . ALA C 92  ? 0.3593 0.3544 0.2988 0.0509  0.0144  -0.0989 111 ALA A C   
2494 O  O   . ALA C 92  ? 0.3587 0.3517 0.2991 0.0519  0.0172  -0.1004 111 ALA A O   
2495 C  CB  . ALA C 92  ? 0.3544 0.3525 0.2884 0.0528  0.0154  -0.0880 111 ALA A CB  
2496 N  N   . ILE C 93  ? 0.4078 0.4073 0.3450 0.0501  0.0118  -0.1028 112 ILE A N   
2497 C  CA  . ILE C 93  ? 0.4173 0.4183 0.3528 0.0503  0.0120  -0.1092 112 ILE A CA  
2498 C  C   . ILE C 93  ? 0.4196 0.4138 0.3616 0.0490  0.0111  -0.1136 112 ILE A C   
2499 O  O   . ILE C 93  ? 0.4252 0.4183 0.3676 0.0503  0.0129  -0.1175 112 ILE A O   
2500 C  CB  . ILE C 93  ? 0.4231 0.4306 0.3546 0.0495  0.0092  -0.1124 112 ILE A CB  
2501 C  CG1 . ILE C 93  ? 0.4330 0.4476 0.3566 0.0519  0.0105  -0.1088 112 ILE A CG1 
2502 C  CG2 . ILE C 93  ? 0.4366 0.4442 0.3677 0.0491  0.0087  -0.1199 112 ILE A CG2 
2503 C  CD1 . ILE C 93  ? 0.4408 0.4631 0.3600 0.0515  0.0077  -0.1120 112 ILE A CD1 
2504 N  N   . ALA C 94  ? 0.3180 0.3079 0.2651 0.0465  0.0081  -0.1131 113 ALA A N   
2505 C  CA  . ALA C 94  ? 0.3111 0.2932 0.2638 0.0453  0.0068  -0.1169 113 ALA A CA  
2506 C  C   . ALA C 94  ? 0.3099 0.2875 0.2662 0.0473  0.0095  -0.1153 113 ALA A C   
2507 O  O   . ALA C 94  ? 0.3119 0.2852 0.2710 0.0482  0.0096  -0.1196 113 ALA A O   
2508 C  CB  . ALA C 94  ? 0.3063 0.2845 0.2627 0.0419  0.0033  -0.1156 113 ALA A CB  
2509 N  N   . VAL C 95  ? 0.3971 0.3759 0.3531 0.0482  0.0116  -0.1092 114 VAL A N   
2510 C  CA  . VAL C 95  ? 0.3912 0.3667 0.3509 0.0496  0.0143  -0.1073 114 VAL A CA  
2511 C  C   . VAL C 95  ? 0.3943 0.3726 0.3518 0.0519  0.0176  -0.1107 114 VAL A C   
2512 O  O   . VAL C 95  ? 0.3894 0.3647 0.3510 0.0530  0.0183  -0.1138 114 VAL A O   
2513 C  CB  . VAL C 95  ? 0.3770 0.3531 0.3361 0.0496  0.0160  -0.1002 114 VAL A CB  
2514 C  CG1 . VAL C 95  ? 0.3732 0.3478 0.3345 0.0510  0.0195  -0.0987 114 VAL A CG1 
2515 C  CG2 . VAL C 95  ? 0.3597 0.3322 0.3227 0.0474  0.0130  -0.0971 114 VAL A CG2 
2516 N  N   . MET C 96  ? 0.4281 0.4127 0.3791 0.0528  0.0196  -0.1101 115 MET A N   
2517 C  CA  . MET C 96  ? 0.4337 0.4220 0.3818 0.0546  0.0230  -0.1131 115 MET A CA  
2518 C  C   . MET C 96  ? 0.4363 0.4240 0.3862 0.0552  0.0216  -0.1207 115 MET A C   
2519 O  O   . MET C 96  ? 0.4352 0.4238 0.3864 0.0568  0.0240  -0.1243 115 MET A O   
2520 C  CB  . MET C 96  ? 0.4284 0.4229 0.3680 0.0551  0.0249  -0.1111 115 MET A CB  
2521 C  CG  . MET C 96  ? 0.4365 0.4310 0.3731 0.0549  0.0256  -0.1037 115 MET A CG  
2522 S  SD  . MET C 96  ? 0.4607 0.4610 0.3864 0.0563  0.0289  -0.1010 115 MET A SD  
2523 C  CE  . MET C 96  ? 0.4655 0.4656 0.3913 0.0567  0.0342  -0.1018 115 MET A CE  
2524 N  N   . ASN C 97  ? 0.5910 0.5773 0.5408 0.0538  0.0179  -0.1234 116 ASN A N   
2525 C  CA  . ASN C 97  ? 0.6031 0.5876 0.5540 0.0541  0.0161  -0.1308 116 ASN A CA  
2526 C  C   . ASN C 97  ? 0.5979 0.5748 0.5557 0.0548  0.0151  -0.1331 116 ASN A C   
2527 O  O   . ASN C 97  ? 0.6032 0.5790 0.5623 0.0568  0.0155  -0.1388 116 ASN A O   
2528 C  CB  . ASN C 97  ? 0.6214 0.6062 0.5702 0.0518  0.0124  -0.1329 116 ASN A CB  
2529 C  CG  . ASN C 97  ? 0.6537 0.6351 0.6034 0.0517  0.0103  -0.1406 116 ASN A CG  
2530 O  OD1 . ASN C 97  ? 0.6693 0.6538 0.6167 0.0537  0.0120  -0.1455 116 ASN A OD1 
2531 N  ND2 . ASN C 97  ? 0.6645 0.6391 0.6171 0.0493  0.0067  -0.1418 116 ASN A ND2 
2532 N  N   . MET C 98  ? 0.4272 0.3988 0.3891 0.0535  0.0136  -0.1286 117 MET A N   
2533 C  CA  . MET C 98  ? 0.4206 0.3844 0.3886 0.0542  0.0123  -0.1299 117 MET A CA  
2534 C  C   . MET C 98  ? 0.4156 0.3810 0.3865 0.0571  0.0156  -0.1300 117 MET A C   
2535 O  O   . MET C 98  ? 0.4335 0.3955 0.4078 0.0594  0.0152  -0.1345 117 MET A O   
2536 C  CB  . MET C 98  ? 0.4147 0.3732 0.3858 0.0518  0.0099  -0.1247 117 MET A CB  
2537 C  CG  . MET C 98  ? 0.4110 0.3609 0.3878 0.0525  0.0083  -0.1255 117 MET A CG  
2538 S  SD  . MET C 98  ? 0.4353 0.3770 0.4123 0.0525  0.0047  -0.1329 117 MET A SD  
2539 C  CE  . MET C 98  ? 0.4151 0.3560 0.3891 0.0474  0.0015  -0.1314 117 MET A CE  
2540 N  N   . TRP C 99  ? 0.3602 0.3306 0.3295 0.0571  0.0188  -0.1251 118 TRP A N   
2541 C  CA  . TRP C 99  ? 0.3616 0.3345 0.3335 0.0591  0.0223  -0.1248 118 TRP A CA  
2542 C  C   . TRP C 99  ? 0.3628 0.3437 0.3292 0.0593  0.0265  -0.1239 118 TRP A C   
2543 O  O   . TRP C 99  ? 0.3555 0.3382 0.3187 0.0579  0.0281  -0.1182 118 TRP A O   
2544 C  CB  . TRP C 99  ? 0.3625 0.3318 0.3388 0.0583  0.0224  -0.1192 118 TRP A CB  
2545 C  CG  . TRP C 99  ? 0.3545 0.3156 0.3354 0.0577  0.0183  -0.1193 118 TRP A CG  
2546 C  CD1 . TRP C 99  ? 0.3500 0.3060 0.3353 0.0598  0.0165  -0.1235 118 TRP A CD1 
2547 C  CD2 . TRP C 99  ? 0.3472 0.3041 0.3284 0.0550  0.0156  -0.1149 118 TRP A CD2 
2548 N  NE1 . TRP C 99  ? 0.3525 0.3005 0.3403 0.0583  0.0129  -0.1217 118 TRP A NE1 
2549 C  CE2 . TRP C 99  ? 0.3526 0.3015 0.3381 0.0551  0.0123  -0.1165 118 TRP A CE2 
2550 C  CE3 . TRP C 99  ? 0.3438 0.3030 0.3218 0.0527  0.0155  -0.1098 118 TRP A CE3 
2551 C  CZ2 . TRP C 99  ? 0.3501 0.2935 0.3368 0.0524  0.0093  -0.1132 118 TRP A CZ2 
2552 C  CZ3 . TRP C 99  ? 0.3305 0.2851 0.3102 0.0504  0.0124  -0.1068 118 TRP A CZ3 
2553 C  CH2 . TRP C 99  ? 0.3370 0.2839 0.3210 0.0499  0.0095  -0.1085 118 TRP A CH2 
2554 N  N   . PRO C 100 ? 0.5837 0.5690 0.5487 0.0611  0.0284  -0.1296 119 PRO A N   
2555 C  CA  . PRO C 100 ? 0.5939 0.5868 0.5529 0.0611  0.0325  -0.1293 119 PRO A CA  
2556 C  C   . PRO C 100 ? 0.5836 0.5785 0.5429 0.0603  0.0364  -0.1241 119 PRO A C   
2557 O  O   . PRO C 100 ? 0.5780 0.5723 0.5430 0.0612  0.0375  -0.1249 119 PRO A O   
2558 C  CB  . PRO C 100 ? 0.6071 0.6036 0.5670 0.0634  0.0336  -0.1369 119 PRO A CB  
2559 C  CG  . PRO C 100 ? 0.6003 0.5905 0.5643 0.0645  0.0291  -0.1415 119 PRO A CG  
2560 C  CD  . PRO C 100 ? 0.5882 0.5712 0.5569 0.0634  0.0266  -0.1367 119 PRO A CD  
2561 N  N   . GLY C 101 ? 0.4187 0.4157 0.3716 0.0588  0.0384  -0.1190 120 GLY A N   
2562 C  CA  . GLY C 101 ? 0.4055 0.4034 0.3574 0.0576  0.0422  -0.1139 120 GLY A CA  
2563 C  C   . GLY C 101 ? 0.3949 0.3872 0.3490 0.0564  0.0405  -0.1077 120 GLY A C   
2564 O  O   . GLY C 101 ? 0.4069 0.3988 0.3591 0.0552  0.0433  -0.1027 120 GLY A O   
2565 N  N   . VAL C 102 ? 0.3432 0.3310 0.3009 0.0565  0.0360  -0.1080 121 VAL A N   
2566 C  CA  . VAL C 102 ? 0.3279 0.3109 0.2880 0.0553  0.0340  -0.1025 121 VAL A CA  
2567 C  C   . VAL C 102 ? 0.3368 0.3201 0.2910 0.0545  0.0325  -0.0988 121 VAL A C   
2568 O  O   . VAL C 102 ? 0.3448 0.3314 0.2942 0.0549  0.0318  -0.1013 121 VAL A O   
2569 C  CB  . VAL C 102 ? 0.3136 0.2914 0.2811 0.0554  0.0300  -0.1046 121 VAL A CB  
2570 C  CG1 . VAL C 102 ? 0.3088 0.2822 0.2787 0.0540  0.0283  -0.0989 121 VAL A CG1 
2571 C  CG2 . VAL C 102 ? 0.3162 0.2939 0.2896 0.0570  0.0312  -0.1085 121 VAL A CG2 
2572 N  N   . ARG C 103 ? 0.7989 0.7793 0.7536 0.0535  0.0318  -0.0931 122 ARG A N   
2573 C  CA  . ARG C 103 ? 0.7965 0.7777 0.7461 0.0533  0.0302  -0.0894 122 ARG A CA  
2574 C  C   . ARG C 103 ? 0.7963 0.7736 0.7501 0.0522  0.0276  -0.0855 122 ARG A C   
2575 O  O   . ARG C 103 ? 0.7818 0.7555 0.7411 0.0516  0.0279  -0.0842 122 ARG A O   
2576 C  CB  . ARG C 103 ? 0.7087 0.6921 0.6503 0.0538  0.0339  -0.0853 122 ARG A CB  
2577 C  CG  . ARG C 103 ? 0.7158 0.7040 0.6499 0.0548  0.0346  -0.0876 122 ARG A CG  
2578 C  CD  . ARG C 103 ? 0.7192 0.7082 0.6443 0.0556  0.0371  -0.0823 122 ARG A CD  
2579 N  NE  . ARG C 103 ? 0.7238 0.7141 0.6442 0.0554  0.0419  -0.0827 122 ARG A NE  
2580 C  CZ  . ARG C 103 ? 0.7242 0.7118 0.6414 0.0548  0.0456  -0.0781 122 ARG A CZ  
2581 N  NH1 . ARG C 103 ? 0.7202 0.7033 0.6384 0.0545  0.0450  -0.0730 122 ARG A NH1 
2582 N  NH2 . ARG C 103 ? 0.7291 0.7183 0.6418 0.0540  0.0501  -0.0789 122 ARG A NH2 
2583 N  N   . LEU C 104 ? 0.3869 0.3656 0.3379 0.0519  0.0249  -0.0837 123 LEU A N   
2584 C  CA  . LEU C 104 ? 0.3610 0.3370 0.3155 0.0508  0.0224  -0.0801 123 LEU A CA  
2585 C  C   . LEU C 104 ? 0.3587 0.3333 0.3113 0.0512  0.0248  -0.0740 123 LEU A C   
2586 O  O   . LEU C 104 ? 0.3668 0.3433 0.3126 0.0525  0.0272  -0.0715 123 LEU A O   
2587 C  CB  . LEU C 104 ? 0.3626 0.3420 0.3148 0.0503  0.0189  -0.0806 123 LEU A CB  
2588 C  CG  . LEU C 104 ? 0.3628 0.3408 0.3185 0.0487  0.0161  -0.0774 123 LEU A CG  
2589 C  CD1 . LEU C 104 ? 0.3621 0.3354 0.3252 0.0466  0.0138  -0.0800 123 LEU A CD1 
2590 C  CD2 . LEU C 104 ? 0.3760 0.3597 0.3281 0.0486  0.0134  -0.0774 123 LEU A CD2 
2591 N  N   . ARG C 105 ? 0.3963 0.3671 0.3544 0.0501  0.0241  -0.0716 124 ARG A N   
2592 C  CA  . ARG C 105 ? 0.3911 0.3598 0.3480 0.0504  0.0262  -0.0661 124 ARG A CA  
2593 C  C   . ARG C 105 ? 0.3856 0.3534 0.3450 0.0496  0.0234  -0.0628 124 ARG A C   
2594 O  O   . ARG C 105 ? 0.3821 0.3477 0.3477 0.0480  0.0210  -0.0639 124 ARG A O   
2595 C  CB  . ARG C 105 ? 0.3894 0.3550 0.3503 0.0498  0.0290  -0.0661 124 ARG A CB  
2596 C  CG  . ARG C 105 ? 0.3862 0.3490 0.3467 0.0494  0.0310  -0.0608 124 ARG A CG  
2597 C  CD  . ARG C 105 ? 0.3846 0.3455 0.3489 0.0486  0.0339  -0.0614 124 ARG A CD  
2598 N  NE  . ARG C 105 ? 0.3849 0.3429 0.3493 0.0479  0.0357  -0.0567 124 ARG A NE  
2599 C  CZ  . ARG C 105 ? 0.3841 0.3397 0.3545 0.0470  0.0342  -0.0553 124 ARG A CZ  
2600 N  NH1 . ARG C 105 ? 0.3772 0.3324 0.3539 0.0466  0.0309  -0.0580 124 ARG A NH1 
2601 N  NH2 . ARG C 105 ? 0.2319 0.1850 0.2016 0.0463  0.0361  -0.0512 124 ARG A NH2 
2602 N  N   . VAL C 106 ? 0.4085 0.3778 0.3626 0.0509  0.0237  -0.0588 125 VAL A N   
2603 C  CA  . VAL C 106 ? 0.4120 0.3815 0.3679 0.0505  0.0214  -0.0555 125 VAL A CA  
2604 C  C   . VAL C 106 ? 0.4119 0.3774 0.3680 0.0508  0.0237  -0.0509 125 VAL A C   
2605 O  O   . VAL C 106 ? 0.4188 0.3829 0.3693 0.0523  0.0269  -0.0484 125 VAL A O   
2606 C  CB  . VAL C 106 ? 0.4218 0.3964 0.3717 0.0524  0.0198  -0.0544 125 VAL A CB  
2607 C  CG1 . VAL C 106 ? 0.4231 0.3986 0.3746 0.0524  0.0178  -0.0508 125 VAL A CG1 
2608 C  CG2 . VAL C 106 ? 0.4254 0.4044 0.3756 0.0516  0.0171  -0.0592 125 VAL A CG2 
2609 N  N   . THR C 107 ? 0.2740 0.2374 0.2363 0.0491  0.0222  -0.0498 126 THR A N   
2610 C  CA  . THR C 107 ? 0.2747 0.2345 0.2378 0.0492  0.0242  -0.0457 126 THR A CA  
2611 C  C   . THR C 107 ? 0.2878 0.2491 0.2499 0.0499  0.0224  -0.0422 126 THR A C   
2612 O  O   . THR C 107 ? 0.2996 0.2582 0.2608 0.0505  0.0240  -0.0385 126 THR A O   
2613 C  CB  . THR C 107 ? 0.2657 0.2220 0.2362 0.0471  0.0242  -0.0466 126 THR A CB  
2614 O  OG1 . THR C 107 ? 0.2605 0.2175 0.2363 0.0454  0.0204  -0.0479 126 THR A OG1 
2615 C  CG2 . THR C 107 ? 0.2721 0.2278 0.2440 0.0468  0.0259  -0.0504 126 THR A CG2 
2616 N  N   . GLU C 108 ? 0.4845 0.4505 0.4468 0.0498  0.0191  -0.0435 127 GLU A N   
2617 C  CA  . GLU C 108 ? 0.4847 0.4538 0.4466 0.0505  0.0171  -0.0408 127 GLU A CA  
2618 C  C   . GLU C 108 ? 0.4965 0.4726 0.4560 0.0512  0.0143  -0.0426 127 GLU A C   
2619 O  O   . GLU C 108 ? 0.4922 0.4708 0.4558 0.0487  0.0116  -0.0458 127 GLU A O   
2620 C  CB  . GLU C 108 ? 0.4900 0.4576 0.4591 0.0478  0.0155  -0.0401 127 GLU A CB  
2621 C  CG  . GLU C 108 ? 0.5017 0.4640 0.4722 0.0478  0.0180  -0.0369 127 GLU A CG  
2622 C  CD  . GLU C 108 ? 0.5086 0.4711 0.4741 0.0506  0.0194  -0.0328 127 GLU A CD  
2623 O  OE1 . GLU C 108 ? 0.5127 0.4798 0.4774 0.0516  0.0172  -0.0317 127 GLU A OE1 
2624 O  OE2 . GLU C 108 ? 0.5067 0.4646 0.4686 0.0518  0.0227  -0.0309 127 GLU A OE2 
2625 N  N   . GLY C 109 ? 0.4351 0.4141 0.3877 0.0547  0.0148  -0.0406 128 GLY A N   
2626 C  CA  . GLY C 109 ? 0.4372 0.4241 0.3872 0.0559  0.0120  -0.0420 128 GLY A CA  
2627 C  C   . GLY C 109 ? 0.4465 0.4375 0.3971 0.0571  0.0102  -0.0393 128 GLY A C   
2628 O  O   . GLY C 109 ? 0.4442 0.4351 0.4010 0.0544  0.0089  -0.0391 128 GLY A O   
2629 N  N   . TRP C 110 ? 0.3327 0.3275 0.2768 0.0614  0.0101  -0.0372 129 TRP A N   
2630 C  CA  . TRP C 110 ? 0.3335 0.3323 0.2776 0.0635  0.0087  -0.0345 129 TRP A CA  
2631 C  C   . TRP C 110 ? 0.3323 0.3233 0.2772 0.0639  0.0112  -0.0308 129 TRP A C   
2632 O  O   . TRP C 110 ? 0.3262 0.3095 0.2679 0.0644  0.0144  -0.0294 129 TRP A O   
2633 C  CB  . TRP C 110 ? 0.3356 0.3396 0.2716 0.0689  0.0080  -0.0332 129 TRP A CB  
2634 C  CG  . TRP C 110 ? 0.3427 0.3500 0.2777 0.0723  0.0070  -0.0301 129 TRP A CG  
2635 C  CD1 . TRP C 110 ? 0.3489 0.3653 0.2885 0.0716  0.0039  -0.0312 129 TRP A CD1 
2636 C  CD2 . TRP C 110 ? 0.3543 0.3557 0.2832 0.0769  0.0091  -0.0257 129 TRP A CD2 
2637 N  NE1 . TRP C 110 ? 0.3585 0.3758 0.2955 0.0758  0.0039  -0.0279 129 TRP A NE1 
2638 C  CE2 . TRP C 110 ? 0.3605 0.3681 0.2908 0.0792  0.0070  -0.0244 129 TRP A CE2 
2639 C  CE3 . TRP C 110 ? 0.3565 0.3479 0.2787 0.0789  0.0127  -0.0229 129 TRP A CE3 
2640 C  CZ2 . TRP C 110 ? 0.3754 0.3789 0.3004 0.0841  0.0083  -0.0205 129 TRP A CZ2 
2641 C  CZ3 . TRP C 110 ? 0.3647 0.3514 0.2813 0.0833  0.0140  -0.0188 129 TRP A CZ3 
2642 C  CH2 . TRP C 110 ? 0.3783 0.3708 0.2962 0.0861  0.0117  -0.0176 129 TRP A CH2 
2643 N  N   . ASP C 111 ? 0.6434 0.6367 0.5924 0.0634  0.0099  -0.0293 130 ASP A N   
2644 C  CA  . ASP C 111 ? 0.6489 0.6352 0.5996 0.0630  0.0121  -0.0263 130 ASP A CA  
2645 C  C   . ASP C 111 ? 0.6563 0.6447 0.6046 0.0667  0.0117  -0.0231 130 ASP A C   
2646 O  O   . ASP C 111 ? 0.6608 0.6581 0.6100 0.0680  0.0090  -0.0238 130 ASP A O   
2647 C  CB  . ASP C 111 ? 0.6406 0.6254 0.6000 0.0578  0.0114  -0.0278 130 ASP A CB  
2648 C  CG  . ASP C 111 ? 0.6485 0.6258 0.6097 0.0571  0.0139  -0.0251 130 ASP A CG  
2649 O  OD1 . ASP C 111 ? 0.6504 0.6217 0.6066 0.0593  0.0169  -0.0230 130 ASP A OD1 
2650 O  OD2 . ASP C 111 ? 0.6517 0.6292 0.6193 0.0541  0.0129  -0.0250 130 ASP A OD2 
2651 N  N   . GLU C 112 ? 0.5647 0.5453 0.5100 0.0684  0.0146  -0.0199 131 GLU A N   
2652 C  CA  . GLU C 112 ? 0.5747 0.5555 0.5177 0.0720  0.0146  -0.0168 131 GLU A CA  
2653 C  C   . GLU C 112 ? 0.5657 0.5386 0.5113 0.0701  0.0170  -0.0148 131 GLU A C   
2654 O  O   . GLU C 112 ? 0.5550 0.5265 0.4992 0.0725  0.0174  -0.0123 131 GLU A O   
2655 C  CB  . GLU C 112 ? 0.5788 0.5576 0.5115 0.0781  0.0155  -0.0145 131 GLU A CB  
2656 C  CG  . GLU C 112 ? 0.5955 0.5643 0.5218 0.0784  0.0191  -0.0132 131 GLU A CG  
2657 C  CD  . GLU C 112 ? 0.6228 0.5882 0.5379 0.0844  0.0201  -0.0105 131 GLU A CD  
2658 O  OE1 . GLU C 112 ? 0.6287 0.5993 0.5412 0.0890  0.0179  -0.0094 131 GLU A OE1 
2659 O  OE2 . GLU C 112 ? 0.6201 0.5777 0.5287 0.0847  0.0231  -0.0093 131 GLU A OE2 
2660 N  N   . ASP C 113 ? 0.5139 0.4819 0.4635 0.0658  0.0185  -0.0160 132 ASP A N   
2661 C  CA  . ASP C 113 ? 0.5124 0.4736 0.4651 0.0635  0.0208  -0.0146 132 ASP A CA  
2662 C  C   . ASP C 113 ? 0.4915 0.4569 0.4522 0.0606  0.0186  -0.0150 132 ASP A C   
2663 O  O   . ASP C 113 ? 0.4858 0.4479 0.4482 0.0601  0.0197  -0.0132 132 ASP A O   
2664 C  CB  . ASP C 113 ? 0.5045 0.4602 0.4588 0.0603  0.0231  -0.0160 132 ASP A CB  
2665 C  CG  . ASP C 113 ? 0.5145 0.4664 0.4608 0.0625  0.0254  -0.0158 132 ASP A CG  
2666 O  OD1 . ASP C 113 ? 0.5063 0.4511 0.4500 0.0617  0.0288  -0.0147 132 ASP A OD1 
2667 O  OD2 . ASP C 113 ? 0.5244 0.4808 0.4668 0.0648  0.0239  -0.0167 132 ASP A OD2 
2668 N  N   . GLY C 114 ? 0.5243 0.4968 0.4896 0.0584  0.0156  -0.0176 133 GLY A N   
2669 C  CA  . GLY C 114 ? 0.5213 0.4987 0.4932 0.0555  0.0134  -0.0180 133 GLY A CA  
2670 C  C   . GLY C 114 ? 0.5224 0.4952 0.5005 0.0509  0.0138  -0.0185 133 GLY A C   
2671 O  O   . GLY C 114 ? 0.5275 0.5010 0.5096 0.0492  0.0133  -0.0174 133 GLY A O   
2672 N  N   . HIS C 115 ? 0.4530 0.4215 0.4321 0.0490  0.0147  -0.0203 134 HIS A N   
2673 C  CA  . HIS C 115 ? 0.4475 0.4120 0.4324 0.0452  0.0147  -0.0211 134 HIS A CA  
2674 C  C   . HIS C 115 ? 0.4430 0.4105 0.4323 0.0417  0.0118  -0.0239 134 HIS A C   
2675 O  O   . HIS C 115 ? 0.4328 0.3972 0.4269 0.0386  0.0112  -0.0247 134 HIS A O   
2676 C  CB  . HIS C 115 ? 0.4420 0.3997 0.4258 0.0453  0.0177  -0.0213 134 HIS A CB  
2677 C  CG  . HIS C 115 ? 0.4290 0.3867 0.4095 0.0463  0.0182  -0.0236 134 HIS A CG  
2678 N  ND1 . HIS C 115 ? 0.4265 0.3852 0.4101 0.0441  0.0165  -0.0269 134 HIS A ND1 
2679 C  CD2 . HIS C 115 ? 0.4366 0.3929 0.4105 0.0492  0.0203  -0.0231 134 HIS A CD2 
2680 C  CE1 . HIS C 115 ? 0.4375 0.3961 0.4169 0.0457  0.0175  -0.0285 134 HIS A CE1 
2681 N  NE2 . HIS C 115 ? 0.4490 0.4064 0.4225 0.0487  0.0199  -0.0261 134 HIS A NE2 
2682 N  N   . HIS C 116 ? 0.3343 0.3078 0.3217 0.0424  0.0100  -0.0255 135 HIS A N   
2683 C  CA  . HIS C 116 ? 0.3398 0.3163 0.3306 0.0388  0.0072  -0.0284 135 HIS A CA  
2684 C  C   . HIS C 116 ? 0.3563 0.3380 0.3504 0.0363  0.0050  -0.0276 135 HIS A C   
2685 O  O   . HIS C 116 ? 0.3536 0.3391 0.3465 0.0384  0.0054  -0.0254 135 HIS A O   
2686 C  CB  . HIS C 116 ? 0.3405 0.3215 0.3277 0.0401  0.0062  -0.0309 135 HIS A CB  
2687 C  CG  . HIS C 116 ? 0.3307 0.3070 0.3147 0.0418  0.0081  -0.0323 135 HIS A CG  
2688 N  ND1 . HIS C 116 ? 0.3278 0.3005 0.3143 0.0395  0.0077  -0.0353 135 HIS A ND1 
2689 C  CD2 . HIS C 116 ? 0.3297 0.3044 0.3082 0.0456  0.0105  -0.0311 135 HIS A CD2 
2690 C  CE1 . HIS C 116 ? 0.3256 0.2956 0.3086 0.0417  0.0098  -0.0361 135 HIS A CE1 
2691 N  NE2 . HIS C 116 ? 0.3181 0.2892 0.2961 0.0452  0.0117  -0.0334 135 HIS A NE2 
2692 N  N   . ALA C 117 ? 0.7471 0.7288 0.7450 0.0318  0.0029  -0.0295 136 ALA A N   
2693 C  CA  . ALA C 117 ? 0.7663 0.7528 0.7674 0.0285  0.0010  -0.0289 136 ALA A CA  
2694 C  C   . ALA C 117 ? 0.7688 0.7657 0.7679 0.0302  -0.0001 -0.0290 136 ALA A C   
2695 O  O   . ALA C 117 ? 0.7660 0.7661 0.7611 0.0335  0.0002  -0.0300 136 ALA A O   
2696 C  CB  . ALA C 117 ? 0.7722 0.7564 0.7764 0.0232  -0.0011 -0.0313 136 ALA A CB  
2697 N  N   . GLN C 118 ? 0.7893 0.7920 0.7909 0.0279  -0.0012 -0.0281 137 GLN A N   
2698 C  CA  . GLN C 118 ? 0.8077 0.8217 0.8081 0.0295  -0.0024 -0.0285 137 GLN A CA  
2699 C  C   . GLN C 118 ? 0.8028 0.8232 0.8030 0.0270  -0.0046 -0.0321 137 GLN A C   
2700 O  O   . GLN C 118 ? 0.7965 0.8146 0.7993 0.0216  -0.0059 -0.0340 137 GLN A O   
2701 C  CB  . GLN C 118 ? 0.8338 0.8530 0.8374 0.0273  -0.0030 -0.0269 137 GLN A CB  
2702 C  CG  . GLN C 118 ? 0.8662 0.8804 0.8698 0.0300  -0.0009 -0.0236 137 GLN A CG  
2703 C  CD  . GLN C 118 ? 0.9000 0.9195 0.9069 0.0275  -0.0014 -0.0223 137 GLN A CD  
2704 O  OE1 . GLN C 118 ? 0.9066 0.9297 0.9166 0.0220  -0.0031 -0.0235 137 GLN A OE1 
2705 N  NE2 . GLN C 118 ? 0.8921 0.9120 0.8980 0.0313  0.0000  -0.0199 137 GLN A NE2 
2706 N  N   . ASP C 119 ? 0.7728 0.8008 0.7695 0.0310  -0.0051 -0.0330 138 ASP A N   
2707 C  CA  . ASP C 119 ? 0.7817 0.8171 0.7779 0.0290  -0.0072 -0.0367 138 ASP A CA  
2708 C  C   . ASP C 119 ? 0.7686 0.7970 0.7624 0.0292  -0.0068 -0.0388 138 ASP A C   
2709 O  O   . ASP C 119 ? 0.7640 0.7973 0.7570 0.0277  -0.0084 -0.0421 138 ASP A O   
2710 C  CB  . ASP C 119 ? 0.7954 0.8350 0.7961 0.0218  -0.0091 -0.0385 138 ASP A CB  
2711 C  CG  . ASP C 119 ? 0.8118 0.8636 0.8141 0.0216  -0.0101 -0.0380 138 ASP A CG  
2712 O  OD1 . ASP C 119 ? 0.8164 0.8715 0.8170 0.0272  -0.0091 -0.0357 138 ASP A OD1 
2713 O  OD2 . ASP C 119 ? 0.7893 0.8474 0.7945 0.0157  -0.0118 -0.0401 138 ASP A OD2 
2714 N  N   . SER C 120 ? 0.3828 0.4005 0.3758 0.0309  -0.0046 -0.0370 139 SER A N   
2715 C  CA  . SER C 120 ? 0.3694 0.3805 0.3605 0.0314  -0.0039 -0.0390 139 SER A CA  
2716 C  C   . SER C 120 ? 0.3573 0.3749 0.3436 0.0347  -0.0045 -0.0409 139 SER A C   
2717 O  O   . SER C 120 ? 0.3495 0.3732 0.3326 0.0392  -0.0043 -0.0393 139 SER A O   
2718 C  CB  . SER C 120 ? 0.3532 0.3544 0.3432 0.0342  -0.0011 -0.0365 139 SER A CB  
2719 O  OG  . SER C 120 ? 0.3325 0.3280 0.3211 0.0343  -0.0003 -0.0387 139 SER A OG  
2720 N  N   . LEU C 121 ? 0.3075 0.3236 0.2932 0.0328  -0.0052 -0.0444 140 LEU A N   
2721 C  CA  . LEU C 121 ? 0.3103 0.3325 0.2915 0.0356  -0.0059 -0.0466 140 LEU A CA  
2722 C  C   . LEU C 121 ? 0.3016 0.3198 0.2774 0.0415  -0.0034 -0.0444 140 LEU A C   
2723 O  O   . LEU C 121 ? 0.3034 0.3273 0.2742 0.0455  -0.0036 -0.0446 140 LEU A O   
2724 C  CB  . LEU C 121 ? 0.3084 0.3291 0.2902 0.0318  -0.0072 -0.0512 140 LEU A CB  
2725 C  CG  . LEU C 121 ? 0.3101 0.3355 0.2958 0.0256  -0.0099 -0.0541 140 LEU A CG  
2726 C  CD1 . LEU C 121 ? 0.3114 0.3358 0.2962 0.0227  -0.0111 -0.0589 140 LEU A CD1 
2727 C  CD2 . LEU C 121 ? 0.3188 0.3573 0.3044 0.0261  -0.0115 -0.0538 140 LEU A CD2 
2728 N  N   . HIS C 122 ? 0.3775 0.3859 0.3540 0.0419  -0.0009 -0.0423 141 HIS A N   
2729 C  CA  . HIS C 122 ? 0.3759 0.3794 0.3472 0.0466  0.0019  -0.0402 141 HIS A CA  
2730 C  C   . HIS C 122 ? 0.3863 0.3945 0.3530 0.0515  0.0022  -0.0370 141 HIS A C   
2731 O  O   . HIS C 122 ? 0.3902 0.3965 0.3507 0.0558  0.0040  -0.0356 141 HIS A O   
2732 C  CB  . HIS C 122 ? 0.3654 0.3590 0.3392 0.0457  0.0044  -0.0383 141 HIS A CB  
2733 C  CG  . HIS C 122 ? 0.3632 0.3511 0.3393 0.0429  0.0047  -0.0413 141 HIS A CG  
2734 N  ND1 . HIS C 122 ? 0.3607 0.3449 0.3333 0.0449  0.0068  -0.0422 141 HIS A ND1 
2735 C  CD2 . HIS C 122 ? 0.3644 0.3495 0.3457 0.0386  0.0032  -0.0435 141 HIS A CD2 
2736 C  CE1 . HIS C 122 ? 0.3572 0.3372 0.3331 0.0422  0.0065  -0.0452 141 HIS A CE1 
2737 N  NE2 . HIS C 122 ? 0.3538 0.3337 0.3349 0.0385  0.0043  -0.0460 141 HIS A NE2 
2738 N  N   . TYR C 123 ? 0.4018 0.4159 0.3713 0.0510  0.0006  -0.0360 142 TYR A N   
2739 C  CA  . TYR C 123 ? 0.4036 0.4225 0.3692 0.0561  0.0007  -0.0332 142 TYR A CA  
2740 C  C   . TYR C 123 ? 0.4105 0.4393 0.3718 0.0593  -0.0013 -0.0349 142 TYR A C   
2741 O  O   . TYR C 123 ? 0.4169 0.4481 0.3726 0.0650  -0.0011 -0.0327 142 TYR A O   
2742 C  CB  . TYR C 123 ? 0.4056 0.4279 0.3759 0.0546  -0.0002 -0.0317 142 TYR A CB  
2743 C  CG  . TYR C 123 ? 0.4011 0.4140 0.3746 0.0527  0.0019  -0.0294 142 TYR A CG  
2744 C  CD1 . TYR C 123 ? 0.4045 0.4088 0.3740 0.0560  0.0049  -0.0265 142 TYR A CD1 
2745 C  CD2 . TYR C 123 ? 0.4047 0.4171 0.3847 0.0473  0.0010  -0.0301 142 TYR A CD2 
2746 C  CE1 . TYR C 123 ? 0.4011 0.3976 0.3736 0.0541  0.0068  -0.0247 142 TYR A CE1 
2747 C  CE2 . TYR C 123 ? 0.4164 0.4207 0.3991 0.0458  0.0027  -0.0280 142 TYR A CE2 
2748 C  CZ  . TYR C 123 ? 0.4078 0.4047 0.3871 0.0492  0.0056  -0.0255 142 TYR A CZ  
2749 O  OH  . TYR C 123 ? 0.4011 0.3908 0.3832 0.0475  0.0073  -0.0237 142 TYR A OH  
2750 N  N   . GLU C 124 ? 0.4505 0.4848 0.4140 0.0557  -0.0035 -0.0389 143 GLU A N   
2751 C  CA  . GLU C 124 ? 0.4537 0.4979 0.4133 0.0583  -0.0055 -0.0411 143 GLU A CA  
2752 C  C   . GLU C 124 ? 0.4574 0.4983 0.4135 0.0580  -0.0049 -0.0437 143 GLU A C   
2753 O  O   . GLU C 124 ? 0.4643 0.5130 0.4197 0.0571  -0.0071 -0.0472 143 GLU A O   
2754 C  CB  . GLU C 124 ? 0.4584 0.5144 0.4228 0.0545  -0.0087 -0.0442 143 GLU A CB  
2755 C  CG  . GLU C 124 ? 0.4579 0.5106 0.4295 0.0470  -0.0092 -0.0459 143 GLU A CG  
2756 C  CD  . GLU C 124 ? 0.4751 0.5395 0.4512 0.0431  -0.0119 -0.0481 143 GLU A CD  
2757 O  OE1 . GLU C 124 ? 0.4821 0.5577 0.4564 0.0441  -0.0139 -0.0507 143 GLU A OE1 
2758 O  OE2 . GLU C 124 ? 0.4712 0.5339 0.4523 0.0389  -0.0119 -0.0473 143 GLU A OE2 
2759 N  N   . GLY C 125 ? 0.4721 0.5020 0.4262 0.0587  -0.0020 -0.0420 144 GLY A N   
2760 C  CA  . GLY C 125 ? 0.4681 0.4944 0.4183 0.0590  -0.0009 -0.0441 144 GLY A CA  
2761 C  C   . GLY C 125 ? 0.4693 0.4993 0.4229 0.0544  -0.0030 -0.0492 144 GLY A C   
2762 O  O   . GLY C 125 ? 0.4752 0.5078 0.4248 0.0555  -0.0033 -0.0517 144 GLY A O   
2763 N  N   . ARG C 126 ? 0.4358 0.4655 0.3963 0.0491  -0.0044 -0.0508 145 ARG A N   
2764 C  CA  . ARG C 126 ? 0.4329 0.4645 0.3965 0.0441  -0.0063 -0.0558 145 ARG A CA  
2765 C  C   . ARG C 126 ? 0.4301 0.4509 0.3976 0.0404  -0.0051 -0.0568 145 ARG A C   
2766 O  O   . ARG C 126 ? 0.4345 0.4542 0.4045 0.0362  -0.0065 -0.0608 145 ARG A O   
2767 C  CB  . ARG C 126 ? 0.4448 0.4854 0.4125 0.0403  -0.0093 -0.0574 145 ARG A CB  
2768 C  CG  . ARG C 126 ? 0.4411 0.4947 0.4055 0.0426  -0.0114 -0.0591 145 ARG A CG  
2769 C  CD  . ARG C 126 ? 0.4532 0.5154 0.4222 0.0369  -0.0143 -0.0626 145 ARG A CD  
2770 N  NE  . ARG C 126 ? 0.4488 0.5127 0.4225 0.0347  -0.0147 -0.0603 145 ARG A NE  
2771 C  CZ  . ARG C 126 ? 0.4547 0.5203 0.4335 0.0280  -0.0162 -0.0624 145 ARG A CZ  
2772 N  NH1 . ARG C 126 ? 0.4656 0.5304 0.4453 0.0228  -0.0175 -0.0669 145 ARG A NH1 
2773 N  NH2 . ARG C 126 ? 0.4578 0.5254 0.4403 0.0263  -0.0162 -0.0600 145 ARG A NH2 
2774 N  N   . ALA C 127 ? 0.3256 0.3383 0.2935 0.0422  -0.0025 -0.0534 146 ALA A N   
2775 C  CA  . ALA C 127 ? 0.3109 0.3139 0.2827 0.0394  -0.0014 -0.0542 146 ALA A CA  
2776 C  C   . ALA C 127 ? 0.3114 0.3077 0.2801 0.0425  0.0019  -0.0529 146 ALA A C   
2777 O  O   . ALA C 127 ? 0.3066 0.3034 0.2708 0.0465  0.0038  -0.0498 146 ALA A O   
2778 C  CB  . ALA C 127 ? 0.3099 0.3099 0.2869 0.0368  -0.0017 -0.0517 146 ALA A CB  
2779 N  N   . LEU C 128 ? 0.3625 0.3524 0.3335 0.0407  0.0025  -0.0555 147 LEU A N   
2780 C  CA  . LEU C 128 ? 0.3474 0.3316 0.3163 0.0430  0.0057  -0.0550 147 LEU A CA  
2781 C  C   . LEU C 128 ? 0.3356 0.3121 0.3099 0.0408  0.0064  -0.0556 147 LEU A C   
2782 O  O   . LEU C 128 ? 0.3408 0.3152 0.3190 0.0377  0.0042  -0.0584 147 LEU A O   
2783 C  CB  . LEU C 128 ? 0.3465 0.3328 0.3111 0.0443  0.0061  -0.0586 147 LEU A CB  
2784 C  CG  . LEU C 128 ? 0.3541 0.3481 0.3124 0.0469  0.0054  -0.0584 147 LEU A CG  
2785 C  CD1 . LEU C 128 ? 0.3505 0.3460 0.3054 0.0474  0.0056  -0.0627 147 LEU A CD1 
2786 C  CD2 . LEU C 128 ? 0.3596 0.3533 0.3128 0.0510  0.0078  -0.0536 147 LEU A CD2 
2787 N  N   . ASP C 129 ? 0.3061 0.2782 0.2801 0.0426  0.0093  -0.0532 148 ASP A N   
2788 C  CA  . ASP C 129 ? 0.2956 0.2613 0.2741 0.0414  0.0103  -0.0542 148 ASP A CA  
2789 C  C   . ASP C 129 ? 0.2905 0.2550 0.2665 0.0431  0.0126  -0.0568 148 ASP A C   
2790 O  O   . ASP C 129 ? 0.2894 0.2545 0.2610 0.0453  0.0155  -0.0550 148 ASP A O   
2791 C  CB  . ASP C 129 ? 0.3008 0.2633 0.2814 0.0417  0.0120  -0.0500 148 ASP A CB  
2792 C  CG  . ASP C 129 ? 0.3101 0.2737 0.2939 0.0397  0.0097  -0.0478 148 ASP A CG  
2793 O  OD1 . ASP C 129 ? 0.3117 0.2781 0.2964 0.0376  0.0068  -0.0496 148 ASP A OD1 
2794 O  OD2 . ASP C 129 ? 0.3179 0.2797 0.3030 0.0400  0.0108  -0.0443 148 ASP A OD2 
2795 N  N   . ILE C 130 ? 0.2734 0.2360 0.2518 0.0419  0.0114  -0.0612 149 ILE A N   
2796 C  CA  . ILE C 130 ? 0.2615 0.2242 0.2375 0.0435  0.0133  -0.0646 149 ILE A CA  
2797 C  C   . ILE C 130 ? 0.2532 0.2110 0.2337 0.0434  0.0143  -0.0668 149 ILE A C   
2798 O  O   . ILE C 130 ? 0.2581 0.2118 0.2435 0.0419  0.0123  -0.0673 149 ILE A O   
2799 C  CB  . ILE C 130 ? 0.2664 0.2323 0.2400 0.0430  0.0113  -0.0690 149 ILE A CB  
2800 C  CG1 . ILE C 130 ? 0.2724 0.2346 0.2507 0.0403  0.0080  -0.0721 149 ILE A CG1 
2801 C  CG2 . ILE C 130 ? 0.2759 0.2479 0.2449 0.0435  0.0102  -0.0671 149 ILE A CG2 
2802 C  CD1 . ILE C 130 ? 0.2779 0.2421 0.2542 0.0395  0.0061  -0.0773 149 ILE A CD1 
2803 N  N   . THR C 131 ? 0.3675 0.3261 0.3459 0.0452  0.0173  -0.0683 150 THR A N   
2804 C  CA  . THR C 131 ? 0.3658 0.3215 0.3481 0.0457  0.0182  -0.0715 150 THR A CA  
2805 C  C   . THR C 131 ? 0.3759 0.3348 0.3547 0.0472  0.0199  -0.0756 150 THR A C   
2806 O  O   . THR C 131 ? 0.3802 0.3427 0.3537 0.0475  0.0198  -0.0760 150 THR A O   
2807 C  CB  . THR C 131 ? 0.3584 0.3128 0.3429 0.0462  0.0211  -0.0686 150 THR A CB  
2808 O  OG1 . THR C 131 ? 0.3622 0.3196 0.3418 0.0473  0.0250  -0.0679 150 THR A OG1 
2809 C  CG2 . THR C 131 ? 0.3656 0.3184 0.3515 0.0450  0.0204  -0.0636 150 THR A CG2 
2810 N  N   . THR C 132 ? 0.3077 0.2657 0.2892 0.0482  0.0213  -0.0789 151 THR A N   
2811 C  CA  . THR C 132 ? 0.3055 0.2671 0.2837 0.0497  0.0235  -0.0828 151 THR A CA  
2812 C  C   . THR C 132 ? 0.3086 0.2726 0.2845 0.0502  0.0280  -0.0805 151 THR A C   
2813 O  O   . THR C 132 ? 0.3046 0.2669 0.2837 0.0497  0.0293  -0.0778 151 THR A O   
2814 C  CB  . THR C 132 ? 0.3096 0.2695 0.2921 0.0507  0.0223  -0.0886 151 THR A CB  
2815 O  OG1 . THR C 132 ? 0.3124 0.2697 0.3004 0.0513  0.0229  -0.0882 151 THR A OG1 
2816 C  CG2 . THR C 132 ? 0.2594 0.2156 0.2431 0.0498  0.0179  -0.0910 151 THR A CG2 
2817 N  N   . SER C 133 ? 0.3413 0.3093 0.3114 0.0509  0.0305  -0.0817 152 SER A N   
2818 C  CA  . SER C 133 ? 0.3440 0.3140 0.3105 0.0508  0.0351  -0.0794 152 SER A CA  
2819 C  C   . SER C 133 ? 0.3462 0.3158 0.3183 0.0505  0.0372  -0.0803 152 SER A C   
2820 O  O   . SER C 133 ? 0.3446 0.3137 0.3157 0.0495  0.0402  -0.0768 152 SER A O   
2821 C  CB  . SER C 133 ? 0.3527 0.3270 0.3126 0.0516  0.0374  -0.0819 152 SER A CB  
2822 O  OG  . SER C 133 ? 0.3693 0.3457 0.3322 0.0525  0.0367  -0.0882 152 SER A OG  
2823 N  N   . ASP C 134 ? 0.2871 0.2568 0.2649 0.0516  0.0357  -0.0853 153 ASP A N   
2824 C  CA  . ASP C 134 ? 0.2750 0.2458 0.2583 0.0519  0.0375  -0.0870 153 ASP A CA  
2825 C  C   . ASP C 134 ? 0.2739 0.2404 0.2634 0.0515  0.0352  -0.0846 153 ASP A C   
2826 O  O   . ASP C 134 ? 0.2702 0.2376 0.2649 0.0520  0.0361  -0.0860 153 ASP A O   
2827 C  CB  . ASP C 134 ? 0.2799 0.2534 0.2660 0.0540  0.0370  -0.0938 153 ASP A CB  
2828 C  CG  . ASP C 134 ? 0.2785 0.2475 0.2683 0.0552  0.0322  -0.0966 153 ASP A CG  
2829 O  OD1 . ASP C 134 ? 0.2829 0.2473 0.2727 0.0541  0.0293  -0.0933 153 ASP A OD1 
2830 O  OD2 . ASP C 134 ? 0.2797 0.2495 0.2722 0.0573  0.0314  -0.1022 153 ASP A OD2 
2831 N  N   . ARG C 135 ? 0.2985 0.2609 0.2874 0.0506  0.0322  -0.0812 154 ARG A N   
2832 C  CA  . ARG C 135 ? 0.2922 0.2505 0.2862 0.0500  0.0299  -0.0785 154 ARG A CA  
2833 C  C   . ARG C 135 ? 0.2945 0.2506 0.2950 0.0515  0.0274  -0.0824 154 ARG A C   
2834 O  O   . ARG C 135 ? 0.2992 0.2535 0.3043 0.0515  0.0269  -0.0810 154 ARG A O   
2835 C  CB  . ARG C 135 ? 0.2844 0.2433 0.2789 0.0488  0.0331  -0.0745 154 ARG A CB  
2836 C  CG  . ARG C 135 ? 0.2871 0.2453 0.2761 0.0474  0.0344  -0.0692 154 ARG A CG  
2837 C  CD  . ARG C 135 ? 0.3069 0.2682 0.2887 0.0474  0.0380  -0.0692 154 ARG A CD  
2838 N  NE  . ARG C 135 ? 0.3201 0.2800 0.2971 0.0463  0.0406  -0.0640 154 ARG A NE  
2839 C  CZ  . ARG C 135 ? 0.3219 0.2826 0.2910 0.0462  0.0432  -0.0623 154 ARG A CZ  
2840 N  NH1 . ARG C 135 ? 0.3224 0.2862 0.2877 0.0472  0.0436  -0.0654 154 ARG A NH1 
2841 N  NH2 . ARG C 135 ? 0.3292 0.2872 0.2938 0.0454  0.0453  -0.0575 154 ARG A NH2 
2842 N  N   . ASP C 136 ? 0.2620 0.2178 0.2622 0.0529  0.0256  -0.0872 155 ASP A N   
2843 C  CA  . ASP C 136 ? 0.2657 0.2181 0.2710 0.0549  0.0229  -0.0911 155 ASP A CA  
2844 C  C   . ASP C 136 ? 0.2793 0.2248 0.2855 0.0539  0.0185  -0.0899 155 ASP A C   
2845 O  O   . ASP C 136 ? 0.2853 0.2291 0.2886 0.0532  0.0165  -0.0916 155 ASP A O   
2846 C  CB  . ASP C 136 ? 0.2770 0.2320 0.2816 0.0573  0.0234  -0.0975 155 ASP A CB  
2847 C  CG  . ASP C 136 ? 0.2902 0.2411 0.2997 0.0600  0.0205  -0.1017 155 ASP A CG  
2848 O  OD1 . ASP C 136 ? 0.2887 0.2354 0.3022 0.0602  0.0187  -0.0995 155 ASP A OD1 
2849 O  OD2 . ASP C 136 ? 0.2957 0.2471 0.3046 0.0622  0.0200  -0.1072 155 ASP A OD2 
2850 N  N   . ARG C 137 ? 0.3447 0.2864 0.3549 0.0535  0.0169  -0.0871 156 ARG A N   
2851 C  CA  . ARG C 137 ? 0.3428 0.2779 0.3536 0.0518  0.0131  -0.0851 156 ARG A CA  
2852 C  C   . ARG C 137 ? 0.3533 0.2829 0.3642 0.0530  0.0098  -0.0899 156 ARG A C   
2853 O  O   . ARG C 137 ? 0.3581 0.2829 0.3676 0.0509  0.0069  -0.0894 156 ARG A O   
2854 C  CB  . ARG C 137 ? 0.3448 0.2772 0.3597 0.0514  0.0123  -0.0815 156 ARG A CB  
2855 C  CG  . ARG C 137 ? 0.3419 0.2796 0.3573 0.0510  0.0160  -0.0782 156 ARG A CG  
2856 C  CD  . ARG C 137 ? 0.3567 0.2920 0.3739 0.0491  0.0151  -0.0731 156 ARG A CD  
2857 N  NE  . ARG C 137 ? 0.3613 0.3011 0.3785 0.0485  0.0187  -0.0701 156 ARG A NE  
2858 C  CZ  . ARG C 137 ? 0.3541 0.2971 0.3669 0.0472  0.0213  -0.0678 156 ARG A CZ  
2859 N  NH1 . ARG C 137 ? 0.3620 0.3051 0.3703 0.0467  0.0206  -0.0680 156 ARG A NH1 
2860 N  NH2 . ARG C 137 ? 0.3493 0.2950 0.3617 0.0465  0.0245  -0.0652 156 ARG A NH2 
2861 N  N   . ASN C 138 ? 0.4586 0.3892 0.4713 0.0563  0.0105  -0.0947 157 ASN A N   
2862 C  CA  . ASN C 138 ? 0.4642 0.3893 0.4766 0.0580  0.0077  -0.0999 157 ASN A CA  
2863 C  C   . ASN C 138 ? 0.4703 0.3961 0.4779 0.0563  0.0072  -0.1022 157 ASN A C   
2864 O  O   . ASN C 138 ? 0.4784 0.3995 0.4849 0.0573  0.0050  -0.1067 157 ASN A O   
2865 C  CB  . ASN C 138 ? 0.4611 0.3888 0.4762 0.0624  0.0089  -0.1050 157 ASN A CB  
2866 C  CG  . ASN C 138 ? 0.4664 0.3913 0.4864 0.0648  0.0078  -0.1041 157 ASN A CG  
2867 O  OD1 . ASN C 138 ? 0.4700 0.3896 0.4911 0.0631  0.0057  -0.1000 157 ASN A OD1 
2868 N  ND2 . ASN C 138 ? 0.4654 0.3946 0.4884 0.0687  0.0091  -0.1082 157 ASN A ND2 
2869 N  N   . LYS C 139 ? 0.3536 0.2851 0.3580 0.0540  0.0093  -0.0991 158 LYS A N   
2870 C  CA  . LYS C 139 ? 0.3634 0.2967 0.3631 0.0525  0.0088  -0.1010 158 LYS A CA  
2871 C  C   . LYS C 139 ? 0.3644 0.2963 0.3623 0.0487  0.0069  -0.0968 158 LYS A C   
2872 O  O   . LYS C 139 ? 0.3741 0.3064 0.3688 0.0469  0.0054  -0.0985 158 LYS A O   
2873 C  CB  . LYS C 139 ? 0.3577 0.2996 0.3540 0.0533  0.0126  -0.1015 158 LYS A CB  
2874 C  CG  . LYS C 139 ? 0.3623 0.3073 0.3598 0.0566  0.0147  -0.1065 158 LYS A CG  
2875 C  CD  . LYS C 139 ? 0.3550 0.3081 0.3479 0.0568  0.0183  -0.1072 158 LYS A CD  
2876 C  CE  . LYS C 139 ? 0.3492 0.3065 0.3432 0.0597  0.0208  -0.1122 158 LYS A CE  
2877 N  NZ  . LYS C 139 ? 0.3343 0.2936 0.3328 0.0607  0.0230  -0.1105 158 LYS A NZ  
2878 N  N   . TYR C 140 ? 0.4014 0.3323 0.4016 0.0475  0.0069  -0.0916 159 TYR A N   
2879 C  CA  . TYR C 140 ? 0.3984 0.3293 0.3971 0.0441  0.0054  -0.0875 159 TYR A CA  
2880 C  C   . TYR C 140 ? 0.4143 0.3390 0.4127 0.0416  0.0016  -0.0894 159 TYR A C   
2881 O  O   . TYR C 140 ? 0.4087 0.3354 0.4047 0.0386  0.0003  -0.0884 159 TYR A O   
2882 C  CB  . TYR C 140 ? 0.4004 0.3309 0.4018 0.0434  0.0061  -0.0819 159 TYR A CB  
2883 C  CG  . TYR C 140 ? 0.3960 0.3321 0.3971 0.0451  0.0100  -0.0796 159 TYR A CG  
2884 C  CD1 . TYR C 140 ? 0.3807 0.3224 0.3781 0.0464  0.0127  -0.0814 159 TYR A CD1 
2885 C  CD2 . TYR C 140 ? 0.3860 0.3217 0.3900 0.0450  0.0111  -0.0756 159 TYR A CD2 
2886 C  CE1 . TYR C 140 ? 0.3714 0.3173 0.3678 0.0474  0.0164  -0.0792 159 TYR A CE1 
2887 C  CE2 . TYR C 140 ? 0.3800 0.3201 0.3833 0.0460  0.0148  -0.0737 159 TYR A CE2 
2888 C  CZ  . TYR C 140 ? 0.3696 0.3146 0.3690 0.0470  0.0175  -0.0754 159 TYR A CZ  
2889 O  OH  . TYR C 140 ? 0.3662 0.3147 0.3641 0.0475  0.0213  -0.0734 159 TYR A OH  
2890 N  N   . GLY C 141 ? 0.5502 0.4674 0.5508 0.0427  -0.0002 -0.0924 160 GLY A N   
2891 C  CA  . GLY C 141 ? 0.5579 0.4675 0.5576 0.0402  -0.0038 -0.0945 160 GLY A CA  
2892 C  C   . GLY C 141 ? 0.5602 0.4720 0.5559 0.0390  -0.0043 -0.0989 160 GLY A C   
2893 O  O   . GLY C 141 ? 0.5661 0.4773 0.5598 0.0351  -0.0063 -0.0988 160 GLY A O   
2894 N  N   . LEU C 142 ? 0.3812 0.2965 0.3759 0.0423  -0.0025 -0.1030 161 LEU A N   
2895 C  CA  . LEU C 142 ? 0.3867 0.3051 0.3775 0.0416  -0.0028 -0.1076 161 LEU A CA  
2896 C  C   . LEU C 142 ? 0.3828 0.3104 0.3707 0.0398  -0.0015 -0.1046 161 LEU A C   
2897 O  O   . LEU C 142 ? 0.3966 0.3263 0.3815 0.0371  -0.0030 -0.1064 161 LEU A O   
2898 C  CB  . LEU C 142 ? 0.3890 0.3096 0.3795 0.0459  -0.0008 -0.1125 161 LEU A CB  
2899 C  CG  . LEU C 142 ? 0.3974 0.3156 0.3851 0.0461  -0.0023 -0.1192 161 LEU A CG  
2900 C  CD1 . LEU C 142 ? 0.3943 0.3187 0.3809 0.0500  0.0006  -0.1231 161 LEU A CD1 
2901 C  CD2 . LEU C 142 ? 0.4121 0.3329 0.3959 0.0419  -0.0038 -0.1196 161 LEU A CD2 
2902 N  N   . LEU C 143 ? 0.4234 0.3566 0.4120 0.0413  0.0012  -0.1003 162 LEU A N   
2903 C  CA  . LEU C 143 ? 0.4210 0.3623 0.4064 0.0404  0.0026  -0.0970 162 LEU A CA  
2904 C  C   . LEU C 143 ? 0.4264 0.3678 0.4112 0.0365  -0.0001 -0.0949 162 LEU A C   
2905 O  O   . LEU C 143 ? 0.4228 0.3704 0.4042 0.0353  -0.0004 -0.0952 162 LEU A O   
2906 C  CB  . LEU C 143 ? 0.4053 0.3495 0.3917 0.0421  0.0056  -0.0920 162 LEU A CB  
2907 C  CG  . LEU C 143 ? 0.3909 0.3426 0.3733 0.0422  0.0074  -0.0884 162 LEU A CG  
2908 C  CD1 . LEU C 143 ? 0.4006 0.3577 0.3782 0.0438  0.0089  -0.0918 162 LEU A CD1 
2909 C  CD2 . LEU C 143 ? 0.3834 0.3360 0.3670 0.0434  0.0102  -0.0835 162 LEU A CD2 
2910 N  N   . ALA C 144 ? 0.5222 0.4573 0.5104 0.0344  -0.0019 -0.0928 163 ALA A N   
2911 C  CA  . ALA C 144 ? 0.5222 0.4573 0.5103 0.0302  -0.0044 -0.0909 163 ALA A CA  
2912 C  C   . ALA C 144 ? 0.5442 0.4788 0.5298 0.0274  -0.0067 -0.0958 163 ALA A C   
2913 O  O   . ALA C 144 ? 0.5548 0.4952 0.5384 0.0247  -0.0078 -0.0954 163 ALA A O   
2914 C  CB  . ALA C 144 ? 0.5267 0.4540 0.5185 0.0284  -0.0058 -0.0882 163 ALA A CB  
2915 N  N   . ARG C 145 ? 0.4806 0.4083 0.4662 0.0282  -0.0075 -0.1006 164 ARG A N   
2916 C  CA  . ARG C 145 ? 0.4891 0.4152 0.4719 0.0257  -0.0096 -0.1060 164 ARG A CA  
2917 C  C   . ARG C 145 ? 0.4931 0.4296 0.4722 0.0265  -0.0085 -0.1079 164 ARG A C   
2918 O  O   . ARG C 145 ? 0.5023 0.4428 0.4792 0.0231  -0.0102 -0.1096 164 ARG A O   
2919 C  CB  . ARG C 145 ? 0.4955 0.4122 0.4785 0.0277  -0.0103 -0.1111 164 ARG A CB  
2920 C  CG  . ARG C 145 ? 0.5011 0.4161 0.4807 0.0258  -0.0119 -0.1174 164 ARG A CG  
2921 C  CD  . ARG C 145 ? 0.5083 0.4220 0.4866 0.0196  -0.0146 -0.1174 164 ARG A CD  
2922 N  NE  . ARG C 145 ? 0.5279 0.4309 0.5082 0.0168  -0.0164 -0.1153 164 ARG A NE  
2923 C  CZ  . ARG C 145 ? 0.5323 0.4336 0.5121 0.0110  -0.0184 -0.1138 164 ARG A CZ  
2924 N  NH1 . ARG C 145 ? 0.5260 0.4366 0.5041 0.0074  -0.0189 -0.1146 164 ARG A NH1 
2925 N  NH2 . ARG C 145 ? 0.5152 0.4060 0.4962 0.0087  -0.0199 -0.1117 164 ARG A NH2 
2926 N  N   . LEU C 146 ? 0.4327 0.3739 0.4109 0.0309  -0.0056 -0.1076 165 LEU A N   
2927 C  CA  . LEU C 146 ? 0.4364 0.3871 0.4103 0.0322  -0.0044 -0.1091 165 LEU A CA  
2928 C  C   . LEU C 146 ? 0.4294 0.3883 0.4017 0.0304  -0.0048 -0.1050 165 LEU A C   
2929 O  O   . LEU C 146 ? 0.4383 0.4046 0.4069 0.0300  -0.0053 -0.1068 165 LEU A O   
2930 C  CB  . LEU C 146 ? 0.4210 0.3747 0.3940 0.0368  -0.0009 -0.1086 165 LEU A CB  
2931 C  CG  . LEU C 146 ? 0.4233 0.3722 0.3971 0.0391  -0.0003 -0.1140 165 LEU A CG  
2932 C  CD1 . LEU C 146 ? 0.4114 0.3655 0.3837 0.0430  0.0034  -0.1139 165 LEU A CD1 
2933 C  CD2 . LEU C 146 ? 0.4202 0.3682 0.3914 0.0375  -0.0025 -0.1203 165 LEU A CD2 
2934 N  N   . ALA C 147 ? 0.3581 0.3159 0.3332 0.0296  -0.0047 -0.0997 166 ALA A N   
2935 C  CA  . ALA C 147 ? 0.3571 0.3225 0.3312 0.0284  -0.0052 -0.0957 166 ALA A CA  
2936 C  C   . ALA C 147 ? 0.3773 0.3443 0.3513 0.0235  -0.0084 -0.0981 166 ALA A C   
2937 O  O   . ALA C 147 ? 0.3814 0.3574 0.3530 0.0227  -0.0092 -0.0978 166 ALA A O   
2938 C  CB  . ALA C 147 ? 0.3530 0.3164 0.3302 0.0288  -0.0043 -0.0898 166 ALA A CB  
2939 N  N   . VAL C 148 ? 0.5464 0.5046 0.5227 0.0203  -0.0103 -0.1006 167 VAL A N   
2940 C  CA  . VAL C 148 ? 0.5495 0.5080 0.5255 0.0148  -0.0131 -0.1033 167 VAL A CA  
2941 C  C   . VAL C 148 ? 0.5675 0.5310 0.5396 0.0145  -0.0139 -0.1090 167 VAL A C   
2942 O  O   . VAL C 148 ? 0.5752 0.5465 0.5457 0.0115  -0.0154 -0.1103 167 VAL A O   
2943 C  CB  . VAL C 148 ? 0.5601 0.5059 0.5382 0.0116  -0.0148 -0.1049 167 VAL A CB  
2944 C  CG1 . VAL C 148 ? 0.5738 0.5197 0.5511 0.0051  -0.0175 -0.1076 167 VAL A CG1 
2945 C  CG2 . VAL C 148 ? 0.5674 0.5079 0.5491 0.0122  -0.0141 -0.0995 167 VAL A CG2 
2946 N  N   . GLU C 149 ? 0.4743 0.4341 0.4449 0.0177  -0.0127 -0.1125 168 GLU A N   
2947 C  CA  . GLU C 149 ? 0.4751 0.4392 0.4420 0.0178  -0.0132 -0.1183 168 GLU A CA  
2948 C  C   . GLU C 149 ? 0.4657 0.4424 0.4292 0.0207  -0.0118 -0.1166 168 GLU A C   
2949 O  O   . GLU C 149 ? 0.4598 0.4432 0.4198 0.0200  -0.0127 -0.1205 168 GLU A O   
2950 C  CB  . GLU C 149 ? 0.4787 0.4353 0.4452 0.0207  -0.0121 -0.1225 168 GLU A CB  
2951 C  CG  . GLU C 149 ? 0.4818 0.4250 0.4513 0.0194  -0.0132 -0.1234 168 GLU A CG  
2952 C  CD  . GLU C 149 ? 0.4926 0.4302 0.4617 0.0133  -0.0163 -0.1262 168 GLU A CD  
2953 O  OE1 . GLU C 149 ? 0.5046 0.4489 0.4711 0.0103  -0.0175 -0.1293 168 GLU A OE1 
2954 O  OE2 . GLU C 149 ? 0.4909 0.4175 0.4621 0.0115  -0.0174 -0.1254 168 GLU A OE2 
2955 N  N   . ALA C 150 ? 0.3812 0.3605 0.3453 0.0241  -0.0097 -0.1109 169 ALA A N   
2956 C  CA  . ALA C 150 ? 0.3802 0.3701 0.3404 0.0272  -0.0084 -0.1085 169 ALA A CA  
2957 C  C   . ALA C 150 ? 0.3862 0.3848 0.3457 0.0244  -0.0107 -0.1075 169 ALA A C   
2958 O  O   . ALA C 150 ? 0.3929 0.4012 0.3484 0.0265  -0.0107 -0.1071 169 ALA A O   
2959 C  CB  . ALA C 150 ? 0.3761 0.3649 0.3368 0.0310  -0.0056 -0.1026 169 ALA A CB  
2960 N  N   . GLY C 151 ? 0.5000 0.4954 0.4632 0.0198  -0.0128 -0.1072 170 GLY A N   
2961 C  CA  . GLY C 151 ? 0.5082 0.5124 0.4716 0.0165  -0.0150 -0.1068 170 GLY A CA  
2962 C  C   . GLY C 151 ? 0.5055 0.5116 0.4715 0.0168  -0.0147 -0.1006 170 GLY A C   
2963 O  O   . GLY C 151 ? 0.5145 0.5299 0.4806 0.0154  -0.0161 -0.0995 170 GLY A O   
2964 N  N   . PHE C 152 ? 0.4181 0.4161 0.3866 0.0188  -0.0128 -0.0969 171 PHE A N   
2965 C  CA  . PHE C 152 ? 0.4172 0.4160 0.3884 0.0191  -0.0123 -0.0912 171 PHE A CA  
2966 C  C   . PHE C 152 ? 0.4278 0.4251 0.4026 0.0131  -0.0146 -0.0915 171 PHE A C   
2967 O  O   . PHE C 152 ? 0.4277 0.4166 0.4041 0.0093  -0.0157 -0.0945 171 PHE A O   
2968 C  CB  . PHE C 152 ? 0.4119 0.4023 0.3847 0.0223  -0.0098 -0.0876 171 PHE A CB  
2969 C  CG  . PHE C 152 ? 0.4044 0.3986 0.3737 0.0279  -0.0071 -0.0847 171 PHE A CG  
2970 C  CD1 . PHE C 152 ? 0.4070 0.4073 0.3751 0.0302  -0.0065 -0.0801 171 PHE A CD1 
2971 C  CD2 . PHE C 152 ? 0.4002 0.3914 0.3670 0.0308  -0.0051 -0.0868 171 PHE A CD2 
2972 C  CE1 . PHE C 152 ? 0.4060 0.4082 0.3698 0.0351  -0.0040 -0.0773 171 PHE A CE1 
2973 C  CE2 . PHE C 152 ? 0.3995 0.3935 0.3624 0.0354  -0.0025 -0.0841 171 PHE A CE2 
2974 C  CZ  . PHE C 152 ? 0.4015 0.4005 0.3627 0.0374  -0.0019 -0.0792 171 PHE A CZ  
2975 N  N   . ASP C 153 ? 0.5460 0.5514 0.5218 0.0123  -0.0153 -0.0883 172 ASP A N   
2976 C  CA  . ASP C 153 ? 0.5575 0.5643 0.5362 0.0062  -0.0175 -0.0888 172 ASP A CA  
2977 C  C   . ASP C 153 ? 0.5552 0.5516 0.5377 0.0038  -0.0171 -0.0858 172 ASP A C   
2978 O  O   . ASP C 153 ? 0.5798 0.5737 0.5642 -0.0020 -0.0187 -0.0867 172 ASP A O   
2979 C  CB  . ASP C 153 ? 0.5540 0.5746 0.5326 0.0066  -0.0183 -0.0868 172 ASP A CB  
2980 C  CG  . ASP C 153 ? 0.5583 0.5900 0.5330 0.0083  -0.0192 -0.0901 172 ASP A CG  
2981 O  OD1 . ASP C 153 ? 0.5682 0.5998 0.5418 0.0047  -0.0207 -0.0954 172 ASP A OD1 
2982 O  OD2 . ASP C 153 ? 0.5550 0.5951 0.5274 0.0134  -0.0186 -0.0875 172 ASP A OD2 
2983 N  N   . TRP C 154 ? 0.3816 0.3718 0.3648 0.0082  -0.0149 -0.0823 173 TRP A N   
2984 C  CA  . TRP C 154 ? 0.3738 0.3540 0.3603 0.0067  -0.0146 -0.0796 173 TRP A CA  
2985 C  C   . TRP C 154 ? 0.3650 0.3381 0.3517 0.0117  -0.0122 -0.0778 173 TRP A C   
2986 O  O   . TRP C 154 ? 0.3580 0.3351 0.3438 0.0162  -0.0102 -0.0746 173 TRP A O   
2987 C  CB  . TRP C 154 ? 0.3800 0.3651 0.3689 0.0051  -0.0148 -0.0752 173 TRP A CB  
2988 C  CG  . TRP C 154 ? 0.3864 0.3622 0.3785 0.0013  -0.0153 -0.0733 173 TRP A CG  
2989 C  CD1 . TRP C 154 ? 0.3929 0.3635 0.3855 -0.0049 -0.0173 -0.0757 173 TRP A CD1 
2990 C  CD2 . TRP C 154 ? 0.3702 0.3405 0.3646 0.0033  -0.0139 -0.0688 173 TRP A CD2 
2991 N  NE1 . TRP C 154 ? 0.3788 0.3407 0.3737 -0.0066 -0.0172 -0.0726 173 TRP A NE1 
2992 C  CE2 . TRP C 154 ? 0.3711 0.3332 0.3674 -0.0015 -0.0152 -0.0685 173 TRP A CE2 
2993 C  CE3 . TRP C 154 ? 0.3596 0.3309 0.3544 0.0086  -0.0116 -0.0651 173 TRP A CE3 
2994 C  CZ2 . TRP C 154 ? 0.3701 0.3257 0.3688 -0.0010 -0.0145 -0.0646 173 TRP A CZ2 
2995 C  CZ3 . TRP C 154 ? 0.3529 0.3179 0.3503 0.0089  -0.0108 -0.0615 173 TRP A CZ3 
2996 C  CH2 . TRP C 154 ? 0.3595 0.3172 0.3590 0.0043  -0.0123 -0.0612 173 TRP A CH2 
2997 N  N   . VAL C 155 ? 0.4091 0.3716 0.3968 0.0110  -0.0124 -0.0800 174 VAL A N   
2998 C  CA  . VAL C 155 ? 0.4002 0.3563 0.3885 0.0154  -0.0103 -0.0790 174 VAL A CA  
2999 C  C   . VAL C 155 ? 0.3993 0.3462 0.3911 0.0141  -0.0106 -0.0765 174 VAL A C   
3000 O  O   . VAL C 155 ? 0.4072 0.3467 0.3998 0.0104  -0.0125 -0.0784 174 VAL A O   
3001 C  CB  . VAL C 155 ? 0.4070 0.3590 0.3934 0.0169  -0.0102 -0.0842 174 VAL A CB  
3002 C  CG1 . VAL C 155 ? 0.3950 0.3424 0.3823 0.0215  -0.0078 -0.0834 174 VAL A CG1 
3003 C  CG2 . VAL C 155 ? 0.4048 0.3660 0.3874 0.0177  -0.0102 -0.0870 174 VAL A CG2 
3004 N  N   . TYR C 156 ? 0.3521 0.2990 0.3456 0.0171  -0.0086 -0.0723 175 TYR A N   
3005 C  CA  . TYR C 156 ? 0.3506 0.2901 0.3473 0.0162  -0.0088 -0.0694 175 TYR A CA  
3006 C  C   . TYR C 156 ? 0.3456 0.2811 0.3438 0.0206  -0.0066 -0.0683 175 TYR A C   
3007 O  O   . TYR C 156 ? 0.3339 0.2744 0.3315 0.0238  -0.0042 -0.0660 175 TYR A O   
3008 C  CB  . TYR C 156 ? 0.3376 0.2820 0.3357 0.0141  -0.0090 -0.0649 175 TYR A CB  
3009 C  CG  . TYR C 156 ? 0.3394 0.2775 0.3406 0.0134  -0.0090 -0.0614 175 TYR A CG  
3010 C  CD1 . TYR C 156 ? 0.3463 0.2741 0.3486 0.0116  -0.0105 -0.0627 175 TYR A CD1 
3011 C  CD2 . TYR C 156 ? 0.3412 0.2833 0.3438 0.0147  -0.0076 -0.0569 175 TYR A CD2 
3012 C  CE1 . TYR C 156 ? 0.3406 0.2630 0.3454 0.0112  -0.0107 -0.0594 175 TYR A CE1 
3013 C  CE2 . TYR C 156 ? 0.3367 0.2737 0.3420 0.0140  -0.0077 -0.0538 175 TYR A CE2 
3014 C  CZ  . TYR C 156 ? 0.3376 0.2650 0.3440 0.0123  -0.0092 -0.0550 175 TYR A CZ  
3015 O  OH  . TYR C 156 ? 0.3622 0.2846 0.3709 0.0118  -0.0094 -0.0519 175 TYR A OH  
3016 N  N   . TYR C 157 ? 0.3516 0.2781 0.3514 0.0208  -0.0074 -0.0701 176 TYR A N   
3017 C  CA  . TYR C 157 ? 0.3435 0.2666 0.3453 0.0247  -0.0056 -0.0694 176 TYR A CA  
3018 C  C   . TYR C 157 ? 0.3397 0.2628 0.3441 0.0244  -0.0050 -0.0642 176 TYR A C   
3019 O  O   . TYR C 157 ? 0.3480 0.2643 0.3547 0.0238  -0.0061 -0.0632 176 TYR A O   
3020 C  CB  . TYR C 157 ? 0.3533 0.2669 0.3560 0.0253  -0.0072 -0.0728 176 TYR A CB  
3021 C  CG  . TYR C 157 ? 0.3499 0.2621 0.3540 0.0300  -0.0053 -0.0744 176 TYR A CG  
3022 C  CD1 . TYR C 157 ? 0.3485 0.2636 0.3549 0.0323  -0.0030 -0.0711 176 TYR A CD1 
3023 C  CD2 . TYR C 157 ? 0.3503 0.2587 0.3536 0.0320  -0.0058 -0.0796 176 TYR A CD2 
3024 C  CE1 . TYR C 157 ? 0.3413 0.2563 0.3493 0.0362  -0.0012 -0.0729 176 TYR A CE1 
3025 C  CE2 . TYR C 157 ? 0.3460 0.2545 0.3510 0.0364  -0.0040 -0.0814 176 TYR A CE2 
3026 C  CZ  . TYR C 157 ? 0.3339 0.2459 0.3413 0.0383  -0.0017 -0.0780 176 TYR A CZ  
3027 O  OH  . TYR C 157 ? 0.3232 0.2364 0.3325 0.0422  0.0002  -0.0801 176 TYR A OH  
3028 N  N   . GLU C 158 ? 0.6171 0.5472 0.6210 0.0257  -0.0030 -0.0612 177 GLU A N   
3029 C  CA  . GLU C 158 ? 0.6174 0.5490 0.6231 0.0243  -0.0028 -0.0563 177 GLU A CA  
3030 C  C   . GLU C 158 ? 0.6146 0.5421 0.6231 0.0267  -0.0014 -0.0548 177 GLU A C   
3031 O  O   . GLU C 158 ? 0.6180 0.5405 0.6289 0.0253  -0.0027 -0.0531 177 GLU A O   
3032 C  CB  . GLU C 158 ? 0.6165 0.5567 0.6201 0.0254  -0.0011 -0.0537 177 GLU A CB  
3033 C  CG  . GLU C 158 ? 0.6264 0.5684 0.6317 0.0244  -0.0008 -0.0492 177 GLU A CG  
3034 C  CD  . GLU C 158 ? 0.6477 0.5979 0.6503 0.0254  0.0001  -0.0472 177 GLU A CD  
3035 O  OE1 . GLU C 158 ? 0.6406 0.5948 0.6399 0.0272  0.0008  -0.0490 177 GLU A OE1 
3036 O  OE2 . GLU C 158 ? 0.6584 0.6111 0.6621 0.0245  0.0001  -0.0439 177 GLU A OE2 
3037 N  N   . SER C 159 ? 0.3543 0.2841 0.3622 0.0302  0.0013  -0.0554 178 SER A N   
3038 C  CA  . SER C 159 ? 0.3441 0.2716 0.3548 0.0324  0.0029  -0.0544 178 SER A CA  
3039 C  C   . SER C 159 ? 0.3439 0.2687 0.3551 0.0349  0.0033  -0.0587 178 SER A C   
3040 O  O   . SER C 159 ? 0.3507 0.2762 0.3597 0.0352  0.0030  -0.0622 178 SER A O   
3041 C  CB  . SER C 159 ? 0.3437 0.2762 0.3533 0.0339  0.0062  -0.0514 178 SER A CB  
3042 O  OG  . SER C 159 ? 0.3569 0.2880 0.3690 0.0357  0.0080  -0.0511 178 SER A OG  
3043 N  N   . ARG C 160 ? 0.6321 0.5544 0.6465 0.0367  0.0041  -0.0586 179 ARG A N   
3044 C  CA  . ARG C 160 ? 0.6383 0.5594 0.6536 0.0396  0.0048  -0.0628 179 ARG A CA  
3045 C  C   . ARG C 160 ? 0.6316 0.5591 0.6450 0.0414  0.0084  -0.0636 179 ARG A C   
3046 O  O   . ARG C 160 ? 0.6293 0.5579 0.6430 0.0437  0.0096  -0.0673 179 ARG A O   
3047 C  CB  . ARG C 160 ? 0.6539 0.5716 0.6734 0.0413  0.0043  -0.0625 179 ARG A CB  
3048 C  CG  . ARG C 160 ? 0.6843 0.5944 0.7049 0.0399  0.0006  -0.0618 179 ARG A CG  
3049 C  CD  . ARG C 160 ? 0.7250 0.6317 0.7492 0.0425  -0.0001 -0.0624 179 ARG A CD  
3050 N  NE  . ARG C 160 ? 0.7620 0.6601 0.7863 0.0415  -0.0038 -0.0619 179 ARG A NE  
3051 C  CZ  . ARG C 160 ? 0.7914 0.6850 0.8182 0.0439  -0.0053 -0.0622 179 ARG A CZ  
3052 N  NH1 . ARG C 160 ? 0.7987 0.6967 0.8286 0.0473  -0.0035 -0.0632 179 ARG A NH1 
3053 N  NH2 . ARG C 160 ? 0.8059 0.6905 0.8316 0.0428  -0.0087 -0.0614 179 ARG A NH2 
3054 N  N   . ASN C 161 ? 0.4657 0.3973 0.4768 0.0404  0.0102  -0.0601 180 ASN A N   
3055 C  CA  . ASN C 161 ? 0.4602 0.3968 0.4684 0.0417  0.0139  -0.0599 180 ASN A CA  
3056 C  C   . ASN C 161 ? 0.4695 0.4094 0.4725 0.0414  0.0141  -0.0603 180 ASN A C   
3057 O  O   . ASN C 161 ? 0.4677 0.4112 0.4673 0.0426  0.0169  -0.0606 180 ASN A O   
3058 C  CB  . ASN C 161 ? 0.4595 0.3975 0.4681 0.0413  0.0162  -0.0556 180 ASN A CB  
3059 C  CG  . ASN C 161 ? 0.4691 0.4054 0.4826 0.0419  0.0165  -0.0556 180 ASN A CG  
3060 O  OD1 . ASN C 161 ? 0.4674 0.4020 0.4836 0.0432  0.0155  -0.0591 180 ASN A OD1 
3061 N  ND2 . ASN C 161 ? 0.4790 0.4157 0.4934 0.0410  0.0179  -0.0519 180 ASN A ND2 
3062 N  N   . HIS C 162 ? 0.4159 0.3550 0.4183 0.0396  0.0111  -0.0603 181 HIS A N   
3063 C  CA  . HIS C 162 ? 0.4110 0.3542 0.4088 0.0394  0.0108  -0.0609 181 HIS A CA  
3064 C  C   . HIS C 162 ? 0.4188 0.3606 0.4168 0.0370  0.0072  -0.0626 181 HIS A C   
3065 O  O   . HIS C 162 ? 0.4110 0.3484 0.4122 0.0351  0.0050  -0.0621 181 HIS A O   
3066 C  CB  . HIS C 162 ? 0.3984 0.3454 0.3930 0.0396  0.0125  -0.0565 181 HIS A CB  
3067 C  CG  . HIS C 162 ? 0.4051 0.3525 0.4010 0.0376  0.0103  -0.0535 181 HIS A CG  
3068 N  ND1 . HIS C 162 ? 0.4110 0.3564 0.4098 0.0369  0.0106  -0.0501 181 HIS A ND1 
3069 C  CD2 . HIS C 162 ? 0.4136 0.3638 0.4082 0.0359  0.0079  -0.0536 181 HIS A CD2 
3070 C  CE1 . HIS C 162 ? 0.4142 0.3611 0.4134 0.0349  0.0085  -0.0481 181 HIS A CE1 
3071 N  NE2 . HIS C 162 ? 0.4180 0.3681 0.4148 0.0342  0.0068  -0.0503 181 HIS A NE2 
3072 N  N   . VAL C 163 ? 0.3664 0.3121 0.3607 0.0368  0.0067  -0.0646 182 VAL A N   
3073 C  CA  . VAL C 163 ? 0.3660 0.3117 0.3599 0.0341  0.0034  -0.0665 182 VAL A CA  
3074 C  C   . VAL C 163 ? 0.3613 0.3138 0.3522 0.0333  0.0031  -0.0641 182 VAL A C   
3075 O  O   . VAL C 163 ? 0.3545 0.3119 0.3416 0.0357  0.0050  -0.0633 182 VAL A O   
3076 C  CB  . VAL C 163 ? 0.3631 0.3079 0.3554 0.0343  0.0026  -0.0720 182 VAL A CB  
3077 C  CG1 . VAL C 163 ? 0.3620 0.3065 0.3536 0.0308  -0.0007 -0.0741 182 VAL A CG1 
3078 C  CG2 . VAL C 163 ? 0.3598 0.2982 0.3550 0.0358  0.0028  -0.0747 182 VAL A CG2 
3079 N  N   . HIS C 164 ? 0.2903 0.2433 0.2828 0.0301  0.0006  -0.0630 183 HIS A N   
3080 C  CA  . HIS C 164 ? 0.2914 0.2518 0.2817 0.0295  -0.0001 -0.0610 183 HIS A CA  
3081 C  C   . HIS C 164 ? 0.2985 0.2631 0.2866 0.0276  -0.0022 -0.0649 183 HIS A C   
3082 O  O   . HIS C 164 ? 0.3038 0.2645 0.2935 0.0243  -0.0044 -0.0679 183 HIS A O   
3083 C  CB  . HIS C 164 ? 0.2936 0.2537 0.2870 0.0269  -0.0013 -0.0576 183 HIS A CB  
3084 C  CG  . HIS C 164 ? 0.2940 0.2626 0.2858 0.0262  -0.0022 -0.0560 183 HIS A CG  
3085 N  ND1 . HIS C 164 ? 0.2911 0.2649 0.2802 0.0296  -0.0005 -0.0529 183 HIS A ND1 
3086 C  CD2 . HIS C 164 ? 0.2995 0.2724 0.2919 0.0226  -0.0048 -0.0572 183 HIS A CD2 
3087 C  CE1 . HIS C 164 ? 0.3003 0.2817 0.2886 0.0286  -0.0021 -0.0524 183 HIS A CE1 
3088 N  NE2 . HIS C 164 ? 0.3027 0.2843 0.2932 0.0242  -0.0046 -0.0550 183 HIS A NE2 
3089 N  N   . VAL C 165 ? 0.4493 0.4214 0.4333 0.0297  -0.0017 -0.0649 184 VAL A N   
3090 C  CA  . VAL C 165 ? 0.4599 0.4373 0.4415 0.0282  -0.0036 -0.0688 184 VAL A CA  
3091 C  C   . VAL C 165 ? 0.4559 0.4432 0.4348 0.0291  -0.0043 -0.0670 184 VAL A C   
3092 O  O   . VAL C 165 ? 0.4530 0.4437 0.4287 0.0331  -0.0024 -0.0642 184 VAL A O   
3093 C  CB  . VAL C 165 ? 0.4554 0.4323 0.4336 0.0308  -0.0023 -0.0723 184 VAL A CB  
3094 C  CG1 . VAL C 165 ? 0.4668 0.4444 0.4445 0.0279  -0.0046 -0.0777 184 VAL A CG1 
3095 C  CG2 . VAL C 165 ? 0.4431 0.4121 0.4232 0.0325  -0.0002 -0.0723 184 VAL A CG2 
3096 N  N   . SER C 166 ? 0.3234 0.3157 0.3036 0.0253  -0.0069 -0.0686 185 SER A N   
3097 C  CA  . SER C 166 ? 0.3309 0.3338 0.3092 0.0261  -0.0079 -0.0672 185 SER A CA  
3098 C  C   . SER C 166 ? 0.3411 0.3519 0.3175 0.0241  -0.0102 -0.0717 185 SER A C   
3099 O  O   . SER C 166 ? 0.3395 0.3467 0.3161 0.0212  -0.0112 -0.0760 185 SER A O   
3100 C  CB  . SER C 166 ? 0.3211 0.3255 0.3033 0.0236  -0.0088 -0.0641 185 SER A CB  
3101 O  OG  . SER C 166 ? 0.3244 0.3263 0.3099 0.0176  -0.0109 -0.0666 185 SER A OG  
3102 N  N   . VAL C 167 ? 0.4910 0.5127 0.4653 0.0257  -0.0112 -0.0707 186 VAL A N   
3103 C  CA  . VAL C 167 ? 0.5013 0.5327 0.4736 0.0241  -0.0134 -0.0749 186 VAL A CA  
3104 C  C   . VAL C 167 ? 0.5078 0.5502 0.4820 0.0222  -0.0154 -0.0741 186 VAL A C   
3105 O  O   . VAL C 167 ? 0.5006 0.5448 0.4761 0.0242  -0.0148 -0.0699 186 VAL A O   
3106 C  CB  . VAL C 167 ? 0.4977 0.5342 0.4641 0.0296  -0.0126 -0.0753 186 VAL A CB  
3107 C  CG1 . VAL C 167 ? 0.4982 0.5253 0.4627 0.0311  -0.0105 -0.0768 186 VAL A CG1 
3108 C  CG2 . VAL C 167 ? 0.4948 0.5354 0.4584 0.0352  -0.0114 -0.0703 186 VAL A CG2 
3109 N  N   . LYS C 168 ? 0.5666 0.6168 0.5410 0.0182  -0.0179 -0.0786 187 LYS A N   
3110 C  CA  . LYS C 168 ? 0.5660 0.6288 0.5421 0.0161  -0.0199 -0.0788 187 LYS A CA  
3111 C  C   . LYS C 168 ? 0.5607 0.6342 0.5330 0.0230  -0.0199 -0.0765 187 LYS A C   
3112 O  O   . LYS C 168 ? 0.5634 0.6351 0.5310 0.0284  -0.0186 -0.0757 187 LYS A O   
3113 C  CB  . LYS C 168 ? 0.5668 0.6357 0.5435 0.0100  -0.0224 -0.0847 187 LYS A CB  
3114 C  CG  . LYS C 168 ? 0.5741 0.6317 0.5536 0.0030  -0.0227 -0.0874 187 LYS A CG  
3115 C  CD  . LYS C 168 ? 0.5803 0.6435 0.5593 -0.0030 -0.0249 -0.0936 187 LYS A CD  
3116 C  CE  . LYS C 168 ? 0.5805 0.6300 0.5606 -0.0090 -0.0251 -0.0966 187 LYS A CE  
3117 N  NZ  . LYS C 168 ? 0.5873 0.6300 0.5712 -0.0140 -0.0251 -0.0941 187 LYS A NZ  
3118 N  N   . ALA C 169 ? 0.5609 0.6455 0.5351 0.0228  -0.0212 -0.0755 188 ALA A N   
3119 C  CA  . ALA C 169 ? 0.5610 0.6560 0.5316 0.0297  -0.0216 -0.0733 188 ALA A CA  
3120 C  C   . ALA C 169 ? 0.5767 0.6796 0.5424 0.0323  -0.0229 -0.0768 188 ALA A C   
3121 O  O   . ALA C 169 ? 0.5830 0.6879 0.5493 0.0274  -0.0243 -0.0817 188 ALA A O   
3122 C  CB  . ALA C 169 ? 0.5808 0.6879 0.5550 0.0284  -0.0232 -0.0728 188 ALA A CB  
3123 N  N   . ASP C 170 ? 0.8456 0.9526 0.8059 0.0400  -0.0225 -0.0742 189 ASP A N   
3124 C  CA  . ASP C 170 ? 0.8603 0.9750 0.8150 0.0435  -0.0237 -0.0768 189 ASP A CA  
3125 C  C   . ASP C 170 ? 0.8616 0.9943 0.8164 0.0447  -0.0267 -0.0788 189 ASP A C   
3126 O  O   . ASP C 170 ? 0.8624 1.0042 0.8194 0.0396  -0.0290 -0.0839 189 ASP A O   
3127 C  CB  . ASP C 170 ? 0.6227 0.7310 0.5703 0.0513  -0.0215 -0.0729 189 ASP A CB  
3128 C  CG  . ASP C 170 ? 0.6259 0.7233 0.5709 0.0503  -0.0196 -0.0744 189 ASP A CG  
3129 O  OD1 . ASP C 170 ? 0.6301 0.7319 0.5738 0.0480  -0.0210 -0.0792 189 ASP A OD1 
3130 O  OD2 . ASP C 170 ? 0.6244 0.7094 0.5686 0.0517  -0.0167 -0.0710 189 ASP A OD2 
3131 N  N   . GLY D 7   ? 0.7818 0.6386 0.6540 0.0838  0.0518  0.0145  829 GLY D N   
3132 C  CA  . GLY D 7   ? 0.7619 0.6270 0.6463 0.0775  0.0514  0.0115  829 GLY D CA  
3133 C  C   . GLY D 7   ? 0.7344 0.6104 0.6297 0.0779  0.0476  0.0098  829 GLY D C   
3134 O  O   . GLY D 7   ? 0.7324 0.6135 0.6269 0.0831  0.0445  0.0103  829 GLY D O   
3135 N  N   . PRO D 8   ? 0.7079 0.5879 0.6132 0.0723  0.0479  0.0077  830 PRO D N   
3136 C  CA  . PRO D 8   ? 0.6693 0.5590 0.5850 0.0716  0.0446  0.0062  830 PRO D CA  
3137 C  C   . PRO D 8   ? 0.6372 0.5383 0.5586 0.0722  0.0409  0.0044  830 PRO D C   
3138 O  O   . PRO D 8   ? 0.6374 0.5392 0.5548 0.0735  0.0407  0.0042  830 PRO D O   
3139 C  CB  . PRO D 8   ? 0.6447 0.5337 0.5678 0.0653  0.0464  0.0047  830 PRO D CB  
3140 C  CG  . PRO D 8   ? 0.6905 0.5686 0.6063 0.0631  0.0510  0.0056  830 PRO D CG  
3141 C  CD  . PRO D 8   ? 0.7065 0.5817 0.6133 0.0664  0.0514  0.0068  830 PRO D CD  
3142 N  N   . HIS D 9   ? 0.7606 0.6705 0.6910 0.0710  0.0380  0.0030  831 HIS D N   
3143 C  CA  . HIS D 9   ? 0.7497 0.6702 0.6862 0.0705  0.0345  0.0010  831 HIS D CA  
3144 C  C   . HIS D 9   ? 0.7310 0.6567 0.6781 0.0654  0.0332  -0.0009 831 HIS D C   
3145 O  O   . HIS D 9   ? 0.7296 0.6574 0.6809 0.0647  0.0324  -0.0006 831 HIS D O   
3146 C  CB  . HIS D 9   ? 0.7466 0.6740 0.6814 0.0755  0.0314  0.0015  831 HIS D CB  
3147 C  CG  . HIS D 9   ? 0.7358 0.6746 0.6770 0.0744  0.0279  -0.0008 831 HIS D CG  
3148 N  ND1 . HIS D 9   ? 0.7400 0.6821 0.6783 0.0759  0.0267  -0.0017 831 HIS D ND1 
3149 C  CD2 . HIS D 9   ? 0.7243 0.6713 0.6742 0.0714  0.0253  -0.0024 831 HIS D CD2 
3150 C  CE1 . HIS D 9   ? 0.7346 0.6866 0.6797 0.0738  0.0236  -0.0040 831 HIS D CE1 
3151 N  NE2 . HIS D 9   ? 0.7395 0.6944 0.6916 0.0710  0.0228  -0.0043 831 HIS D NE2 
3152 N  N   . ILE D 10  ? 0.4852 0.4130 0.4365 0.0619  0.0330  -0.0029 832 ILE D N   
3153 C  CA  . ILE D 10  ? 0.4666 0.3986 0.4273 0.0574  0.0315  -0.0047 832 ILE D CA  
3154 C  C   . ILE D 10  ? 0.4596 0.4009 0.4251 0.0577  0.0276  -0.0057 832 ILE D C   
3155 O  O   . ILE D 10  ? 0.4522 0.3982 0.4164 0.0591  0.0257  -0.0067 832 ILE D O   
3156 C  CB  . ILE D 10  ? 0.4573 0.3883 0.4205 0.0542  0.0324  -0.0068 832 ILE D CB  
3157 C  CG1 . ILE D 10  ? 0.4662 0.3890 0.4242 0.0536  0.0365  -0.0061 832 ILE D CG1 
3158 C  CG2 . ILE D 10  ? 0.4439 0.3780 0.4162 0.0501  0.0308  -0.0085 832 ILE D CG2 
3159 C  CD1 . ILE D 10  ? 0.4568 0.3793 0.4174 0.0506  0.0377  -0.0084 832 ILE D CD1 
3160 N  N   . ALA D 11  ? 0.4709 0.4150 0.4418 0.0559  0.0264  -0.0054 833 ALA D N   
3161 C  CA  . ALA D 11  ? 0.4537 0.4068 0.4292 0.0554  0.0230  -0.0062 833 ALA D CA  
3162 C  C   . ALA D 11  ? 0.4437 0.4000 0.4253 0.0513  0.0210  -0.0085 833 ALA D C   
3163 O  O   . ALA D 11  ? 0.4460 0.4086 0.4287 0.0511  0.0185  -0.0098 833 ALA D O   
3164 C  CB  . ALA D 11  ? 0.4546 0.4094 0.4332 0.0548  0.0226  -0.0051 833 ALA D CB  
3165 N  N   . TYR D 12  ? 0.4498 0.4016 0.4350 0.0480  0.0221  -0.0090 834 TYR D N   
3166 C  CA  . TYR D 12  ? 0.4369 0.3902 0.4273 0.0444  0.0204  -0.0111 834 TYR D CA  
3167 C  C   . TYR D 12  ? 0.4222 0.3697 0.4149 0.0423  0.0223  -0.0117 834 TYR D C   
3168 O  O   . TYR D 12  ? 0.4178 0.3612 0.4094 0.0425  0.0246  -0.0104 834 TYR D O   
3169 C  CB  . TYR D 12  ? 0.4326 0.3911 0.4283 0.0418  0.0175  -0.0113 834 TYR D CB  
3170 C  CG  . TYR D 12  ? 0.4289 0.3858 0.4277 0.0401  0.0181  -0.0098 834 TYR D CG  
3171 C  CD1 . TYR D 12  ? 0.4378 0.3971 0.4352 0.0419  0.0184  -0.0081 834 TYR D CD1 
3172 C  CD2 . TYR D 12  ? 0.4229 0.3762 0.4260 0.0371  0.0183  -0.0103 834 TYR D CD2 
3173 C  CE1 . TYR D 12  ? 0.4327 0.3908 0.4328 0.0403  0.0190  -0.0069 834 TYR D CE1 
3174 C  CE2 . TYR D 12  ? 0.4306 0.3829 0.4363 0.0357  0.0187  -0.0090 834 TYR D CE2 
3175 C  CZ  . TYR D 12  ? 0.4325 0.3871 0.4367 0.0371  0.0191  -0.0073 834 TYR D CZ  
3176 O  OH  . TYR D 12  ? 0.4197 0.3735 0.4263 0.0356  0.0196  -0.0062 834 TYR D OH  
3177 N  N   . THR D 13  ? 0.3095 0.2570 0.3053 0.0403  0.0212  -0.0139 835 THR D N   
3178 C  CA  . THR D 13  ? 0.3070 0.2504 0.3059 0.0384  0.0224  -0.0150 835 THR D CA  
3179 C  C   . THR D 13  ? 0.2997 0.2444 0.3043 0.0356  0.0195  -0.0165 835 THR D C   
3180 O  O   . THR D 13  ? 0.3073 0.2540 0.3122 0.0352  0.0176  -0.0182 835 THR D O   
3181 C  CB  . THR D 13  ? 0.2954 0.2362 0.2910 0.0394  0.0247  -0.0165 835 THR D CB  
3182 O  OG1 . THR D 13  ? 0.2844 0.2278 0.2791 0.0399  0.0229  -0.0184 835 THR D OG1 
3183 C  CG2 . THR D 13  ? 0.3123 0.2502 0.3013 0.0418  0.0278  -0.0147 835 THR D CG2 
3184 N  N   . GLU D 14  ? 0.3536 0.2968 0.3622 0.0337  0.0192  -0.0159 836 GLU D N   
3185 C  CA  . GLU D 14  ? 0.3641 0.3071 0.3775 0.0313  0.0165  -0.0171 836 GLU D CA  
3186 C  C   . GLU D 14  ? 0.3689 0.3086 0.3856 0.0306  0.0173  -0.0178 836 GLU D C   
3187 O  O   . GLU D 14  ? 0.3685 0.3073 0.3854 0.0307  0.0194  -0.0167 836 GLU D O   
3188 C  CB  . GLU D 14  ? 0.3728 0.3186 0.3881 0.0294  0.0143  -0.0154 836 GLU D CB  
3189 C  CG  . GLU D 14  ? 0.3782 0.3287 0.3914 0.0296  0.0127  -0.0155 836 GLU D CG  
3190 C  CD  . GLU D 14  ? 0.4019 0.3542 0.4180 0.0263  0.0096  -0.0157 836 GLU D CD  
3191 O  OE1 . GLU D 14  ? 0.4058 0.3544 0.4249 0.0242  0.0085  -0.0160 836 GLU D OE1 
3192 O  OE2 . GLU D 14  ? 0.4104 0.3679 0.4255 0.0257  0.0083  -0.0156 836 GLU D OE2 
3193 N  N   . ALA D 15  ? 0.7153 0.6535 0.7346 0.0299  0.0156  -0.0200 837 ALA D N   
3194 C  CA  . ALA D 15  ? 0.7253 0.6611 0.7479 0.0297  0.0160  -0.0212 837 ALA D CA  
3195 C  C   . ALA D 15  ? 0.7371 0.6723 0.7631 0.0281  0.0143  -0.0195 837 ALA D C   
3196 O  O   . ALA D 15  ? 0.7374 0.6727 0.7640 0.0264  0.0117  -0.0184 837 ALA D O   
3197 C  CB  . ALA D 15  ? 0.7184 0.6526 0.7423 0.0302  0.0145  -0.0243 837 ALA D CB  
3198 N  N   . VAL D 16  ? 0.5623 0.4970 0.5903 0.0283  0.0158  -0.0194 838 VAL D N   
3199 C  CA  . VAL D 16  ? 0.5624 0.4968 0.5934 0.0269  0.0143  -0.0178 838 VAL D CA  
3200 C  C   . VAL D 16  ? 0.5726 0.5051 0.6071 0.0274  0.0127  -0.0197 838 VAL D C   
3201 O  O   . VAL D 16  ? 0.5767 0.5080 0.6133 0.0264  0.0106  -0.0186 838 VAL D O   
3202 C  CB  . VAL D 16  ? 0.5498 0.4857 0.5805 0.0267  0.0169  -0.0162 838 VAL D CB  
3203 C  CG1 . VAL D 16  ? 0.5451 0.4821 0.5715 0.0273  0.0190  -0.0150 838 VAL D CG1 
3204 C  CG2 . VAL D 16  ? 0.5406 0.4765 0.5729 0.0274  0.0191  -0.0181 838 VAL D CG2 
3205 N  N   . SER D 17  ? 0.4018 0.3340 0.4365 0.0290  0.0138  -0.0225 839 SER D N   
3206 C  CA  . SER D 17  ? 0.3936 0.3244 0.4316 0.0302  0.0122  -0.0247 839 SER D CA  
3207 C  C   . SER D 17  ? 0.4042 0.3348 0.4416 0.0320  0.0128  -0.0281 839 SER D C   
3208 O  O   . SER D 17  ? 0.4026 0.3335 0.4369 0.0320  0.0138  -0.0285 839 SER D O   
3209 C  CB  . SER D 17  ? 0.3866 0.3198 0.4274 0.0306  0.0137  -0.0250 839 SER D CB  
3210 O  OG  . SER D 17  ? 0.3862 0.3220 0.4262 0.0311  0.0174  -0.0266 839 SER D OG  
3211 N  N   . ASP D 18  ? 0.4789 0.4094 0.5193 0.0338  0.0121  -0.0307 840 ASP D N   
3212 C  CA  . ASP D 18  ? 0.4699 0.4008 0.5102 0.0358  0.0128  -0.0344 840 ASP D CA  
3213 C  C   . ASP D 18  ? 0.4612 0.3965 0.5011 0.0361  0.0169  -0.0358 840 ASP D C   
3214 O  O   . ASP D 18  ? 0.4563 0.3930 0.4957 0.0375  0.0182  -0.0389 840 ASP D O   
3215 C  CB  . ASP D 18  ? 0.4743 0.4032 0.5178 0.0381  0.0101  -0.0368 840 ASP D CB  
3216 C  CG  . ASP D 18  ? 0.4794 0.4114 0.5267 0.0389  0.0105  -0.0370 840 ASP D CG  
3217 O  OD1 . ASP D 18  ? 0.4789 0.4136 0.5263 0.0371  0.0125  -0.0349 840 ASP D OD1 
3218 O  OD2 . ASP D 18  ? 0.4666 0.3985 0.5167 0.0415  0.0088  -0.0396 840 ASP D OD2 
3219 N  N   . THR D 19  ? 0.3921 0.3294 0.4319 0.0346  0.0192  -0.0337 841 THR D N   
3220 C  CA  . THR D 19  ? 0.3910 0.3317 0.4299 0.0342  0.0234  -0.0348 841 THR D CA  
3221 C  C   . THR D 19  ? 0.3927 0.3329 0.4278 0.0323  0.0259  -0.0317 841 THR D C   
3222 O  O   . THR D 19  ? 0.3904 0.3322 0.4240 0.0313  0.0295  -0.0320 841 THR D O   
3223 C  CB  . THR D 19  ? 0.3941 0.3385 0.4376 0.0344  0.0240  -0.0365 841 THR D CB  
3224 O  OG1 . THR D 19  ? 0.4017 0.3456 0.4467 0.0332  0.0228  -0.0339 841 THR D OG1 
3225 C  CG2 . THR D 19  ? 0.3939 0.3391 0.4411 0.0371  0.0215  -0.0399 841 THR D CG2 
3226 N  N   . GLN D 20  ? 0.5880 0.5258 0.6212 0.0317  0.0240  -0.0289 842 GLN D N   
3227 C  CA  . GLN D 20  ? 0.5894 0.5266 0.6191 0.0305  0.0260  -0.0259 842 GLN D CA  
3228 C  C   . GLN D 20  ? 0.5944 0.5302 0.6202 0.0309  0.0249  -0.0242 842 GLN D C   
3229 O  O   . GLN D 20  ? 0.5962 0.5314 0.6230 0.0310  0.0217  -0.0242 842 GLN D O   
3230 C  CB  . GLN D 20  ? 0.5921 0.5296 0.6243 0.0293  0.0251  -0.0239 842 GLN D CB  
3231 C  CG  . GLN D 20  ? 0.5907 0.5305 0.6264 0.0287  0.0265  -0.0254 842 GLN D CG  
3232 C  CD  . GLN D 20  ? 0.5845 0.5249 0.6234 0.0279  0.0243  -0.0239 842 GLN D CD  
3233 O  OE1 . GLN D 20  ? 0.5780 0.5169 0.6181 0.0282  0.0209  -0.0227 842 GLN D OE1 
3234 N  NE2 . GLN D 20  ? 0.6126 0.5549 0.6526 0.0267  0.0264  -0.0239 842 GLN D NE2 
3235 N  N   . ILE D 21  ? 0.5058 0.4411 0.5269 0.0310  0.0276  -0.0228 843 ILE D N   
3236 C  CA  . ILE D 21  ? 0.5094 0.4443 0.5264 0.0318  0.0268  -0.0211 843 ILE D CA  
3237 C  C   . ILE D 21  ? 0.5137 0.4479 0.5274 0.0318  0.0284  -0.0183 843 ILE D C   
3238 O  O   . ILE D 21  ? 0.5274 0.4600 0.5389 0.0315  0.0316  -0.0179 843 ILE D O   
3239 C  CB  . ILE D 21  ? 0.5099 0.4447 0.5229 0.0332  0.0280  -0.0226 843 ILE D CB  
3240 C  CG1 . ILE D 21  ? 0.5078 0.4434 0.5238 0.0335  0.0258  -0.0256 843 ILE D CG1 
3241 C  CG2 . ILE D 21  ? 0.5081 0.4433 0.5164 0.0344  0.0275  -0.0208 843 ILE D CG2 
3242 C  CD1 . ILE D 21  ? 0.4960 0.4320 0.5083 0.0348  0.0270  -0.0275 843 ILE D CD1 
3243 N  N   . MET D 22  ? 0.4926 0.4278 0.5058 0.0319  0.0263  -0.0164 844 MET D N   
3244 C  CA  . MET D 22  ? 0.4941 0.4290 0.5045 0.0324  0.0274  -0.0139 844 MET D CA  
3245 C  C   . MET D 22  ? 0.5070 0.4422 0.5117 0.0347  0.0279  -0.0130 844 MET D C   
3246 O  O   . MET D 22  ? 0.5000 0.4376 0.5046 0.0352  0.0256  -0.0135 844 MET D O   
3247 C  CB  . MET D 22  ? 0.4941 0.4311 0.5080 0.0311  0.0248  -0.0125 844 MET D CB  
3248 C  CG  . MET D 22  ? 0.4973 0.4352 0.5084 0.0320  0.0253  -0.0102 844 MET D CG  
3249 S  SD  . MET D 22  ? 0.5031 0.4378 0.5125 0.0318  0.0287  -0.0092 844 MET D SD  
3250 C  CE  . MET D 22  ? 0.5046 0.4407 0.5208 0.0289  0.0272  -0.0097 844 MET D CE  
3251 N  N   . LEU D 23  ? 0.4346 0.3670 0.4343 0.0360  0.0307  -0.0116 845 LEU D N   
3252 C  CA  . LEU D 23  ? 0.4325 0.3646 0.4260 0.0388  0.0311  -0.0104 845 LEU D CA  
3253 C  C   . LEU D 23  ? 0.4348 0.3658 0.4253 0.0403  0.0319  -0.0081 845 LEU D C   
3254 O  O   . LEU D 23  ? 0.4467 0.3737 0.4359 0.0397  0.0344  -0.0074 845 LEU D O   
3255 C  CB  . LEU D 23  ? 0.4256 0.3542 0.4138 0.0399  0.0339  -0.0110 845 LEU D CB  
3256 C  CG  . LEU D 23  ? 0.4380 0.3611 0.4225 0.0393  0.0379  -0.0103 845 LEU D CG  
3257 C  CD1 . LEU D 23  ? 0.4540 0.3733 0.4308 0.0410  0.0405  -0.0100 845 LEU D CD1 
3258 C  CD2 . LEU D 23  ? 0.4507 0.3739 0.4406 0.0361  0.0389  -0.0122 845 LEU D CD2 
3259 N  N   . LYS D 24  ? 0.4901 0.4249 0.4794 0.0423  0.0297  -0.0072 846 LYS D N   
3260 C  CA  . LYS D 24  ? 0.5009 0.4355 0.4872 0.0445  0.0302  -0.0053 846 LYS D CA  
3261 C  C   . LYS D 24  ? 0.5315 0.4647 0.5103 0.0487  0.0310  -0.0043 846 LYS D C   
3262 O  O   . LYS D 24  ? 0.5233 0.4605 0.5013 0.0501  0.0291  -0.0050 846 LYS D O   
3263 C  CB  . LYS D 24  ? 0.4948 0.4360 0.4858 0.0437  0.0271  -0.0050 846 LYS D CB  
3264 C  CG  . LYS D 24  ? 0.5129 0.4546 0.5020 0.0457  0.0276  -0.0034 846 LYS D CG  
3265 C  CD  . LYS D 24  ? 0.5313 0.4747 0.5146 0.0503  0.0273  -0.0026 846 LYS D CD  
3266 C  CE  . LYS D 24  ? 0.5475 0.4903 0.5281 0.0529  0.0280  -0.0013 846 LYS D CE  
3267 N  NZ  . LYS D 24  ? 0.5581 0.4923 0.5359 0.0524  0.0313  -0.0006 846 LYS D NZ  
3268 N  N   . TRP D 25  ? 0.5449 0.4720 0.5177 0.0508  0.0336  -0.0028 847 TRP D N   
3269 C  CA  . TRP D 25  ? 0.5490 0.4732 0.5135 0.0552  0.0346  -0.0016 847 TRP D CA  
3270 C  C   . TRP D 25  ? 0.5651 0.4878 0.5254 0.0589  0.0348  0.0002  847 TRP D C   
3271 O  O   . TRP D 25  ? 0.5742 0.4974 0.5378 0.0576  0.0348  0.0004  847 TRP D O   
3272 C  CB  . TRP D 25  ? 0.5635 0.4795 0.5222 0.0547  0.0381  -0.0014 847 TRP D CB  
3273 C  CG  . TRP D 25  ? 0.5695 0.4781 0.5261 0.0532  0.0413  -0.0005 847 TRP D CG  
3274 C  CD1 . TRP D 25  ? 0.5850 0.4869 0.5343 0.0560  0.0432  0.0014  847 TRP D CD1 
3275 C  CD2 . TRP D 25  ? 0.5659 0.4729 0.5273 0.0486  0.0430  -0.0017 847 TRP D CD2 
3276 N  NE1 . TRP D 25  ? 0.6015 0.4975 0.5508 0.0529  0.0461  0.0013  847 TRP D NE1 
3277 C  CE2 . TRP D 25  ? 0.5857 0.4854 0.5426 0.0483  0.0460  -0.0006 847 TRP D CE2 
3278 C  CE3 . TRP D 25  ? 0.5525 0.4637 0.5213 0.0448  0.0422  -0.0038 847 TRP D CE3 
3279 C  CZ2 . TRP D 25  ? 0.5941 0.4914 0.5541 0.0441  0.0482  -0.0016 847 TRP D CZ2 
3280 C  CZ3 . TRP D 25  ? 0.5475 0.4565 0.5194 0.0412  0.0443  -0.0047 847 TRP D CZ3 
3281 C  CH2 . TRP D 25  ? 0.5764 0.4789 0.5441 0.0407  0.0473  -0.0037 847 TRP D CH2 
3282 N  N   . THR D 26  ? 0.5729 0.4940 0.5257 0.0637  0.0348  0.0013  848 THR D N   
3283 C  CA  . THR D 26  ? 0.5813 0.5007 0.5292 0.0683  0.0349  0.0029  848 THR D CA  
3284 C  C   . THR D 26  ? 0.6101 0.5193 0.5471 0.0721  0.0376  0.0047  848 THR D C   
3285 O  O   . THR D 26  ? 0.6137 0.5195 0.5466 0.0719  0.0387  0.0048  848 THR D O   
3286 C  CB  . THR D 26  ? 0.5531 0.4829 0.5028 0.0718  0.0312  0.0025  848 THR D CB  
3287 O  OG1 . THR D 26  ? 0.5459 0.4786 0.4929 0.0736  0.0300  0.0020  848 THR D OG1 
3288 C  CG2 . THR D 26  ? 0.5504 0.4893 0.5100 0.0677  0.0288  0.0010  848 THR D CG2 
3289 N  N   . TYR D 27  ? 0.8670 0.7707 0.7987 0.0755  0.0387  0.0061  849 TYR D N   
3290 C  CA  . TYR D 27  ? 0.8925 0.7847 0.8127 0.0792  0.0413  0.0081  849 TYR D CA  
3291 C  C   . TYR D 27  ? 0.9064 0.7977 0.8209 0.0860  0.0402  0.0094  849 TYR D C   
3292 O  O   . TYR D 27  ? 0.9004 0.7840 0.8111 0.0871  0.0421  0.0103  849 TYR D O   
3293 C  CB  . TYR D 27  ? 0.9132 0.7945 0.8311 0.0749  0.0454  0.0085  849 TYR D CB  
3294 C  CG  . TYR D 27  ? 0.9551 0.8231 0.8607 0.0772  0.0487  0.0105  849 TYR D CG  
3295 C  CD1 . TYR D 27  ? 0.9517 0.8172 0.8526 0.0769  0.0497  0.0110  849 TYR D CD1 
3296 C  CD2 . TYR D 27  ? 0.9867 0.8444 0.8849 0.0796  0.0507  0.0120  849 TYR D CD2 
3297 C  CE1 . TYR D 27  ? 0.9871 0.8400 0.8760 0.0786  0.0528  0.0131  849 TYR D CE1 
3298 C  CE2 . TYR D 27  ? 1.0102 0.8544 0.8962 0.0814  0.0538  0.0141  849 TYR D CE2 
3299 C  CZ  . TYR D 27  ? 1.0303 0.8722 0.9117 0.0808  0.0548  0.0148  849 TYR D CZ  
3300 O  OH  . TYR D 27  ? 1.0703 0.8984 0.9388 0.0823  0.0580  0.0171  849 TYR D OH  
3301 N  N   . ILE D 37  ? 1.1159 0.9010 0.9769 0.0592  0.0753  0.0148  859 ILE D N   
3302 C  CA  . ILE D 37  ? 1.1324 0.9309 1.0044 0.0553  0.0739  0.0129  859 ILE D CA  
3303 C  C   . ILE D 37  ? 1.1169 0.9186 0.9969 0.0473  0.0761  0.0102  859 ILE D C   
3304 O  O   . ILE D 37  ? 1.0986 0.9035 0.9846 0.0463  0.0752  0.0088  859 ILE D O   
3305 C  CB  . ILE D 37  ? 1.1357 0.9488 1.0173 0.0595  0.0687  0.0122  859 ILE D CB  
3306 C  CG1 . ILE D 37  ? 1.1470 0.9592 1.0215 0.0673  0.0663  0.0144  859 ILE D CG1 
3307 C  CG2 . ILE D 37  ? 1.0784 0.9040 0.9711 0.0552  0.0673  0.0100  859 ILE D CG2 
3308 C  CD1 . ILE D 37  ? 1.1332 0.9379 1.0002 0.0736  0.0657  0.0160  859 ILE D CD1 
3309 N  N   . GLN D 38  ? 1.0339 0.8355 0.9141 0.0419  0.0788  0.0092  860 GLN D N   
3310 C  CA  . GLN D 38  ? 1.0279 0.8333 0.9155 0.0344  0.0810  0.0064  860 GLN D CA  
3311 C  C   . GLN D 38  ? 1.0070 0.8283 0.9088 0.0329  0.0777  0.0040  860 GLN D C   
3312 O  O   . GLN D 38  ? 0.9950 0.8218 0.9050 0.0288  0.0777  0.0017  860 GLN D O   
3313 C  CB  . GLN D 38  ? 1.0549 0.8530 0.9359 0.0289  0.0859  0.0062  860 GLN D CB  
3314 C  CG  . GLN D 38  ? 1.0943 0.8756 0.9624 0.0275  0.0901  0.0078  860 GLN D CG  
3315 C  CD  . GLN D 38  ? 1.1132 0.8883 0.9756 0.0207  0.0952  0.0073  860 GLN D CD  
3316 O  OE1 . GLN D 38  ? 1.1051 0.8844 0.9676 0.0198  0.0957  0.0072  860 GLN D OE1 
3317 N  NE2 . GLN D 38  ? 1.1209 0.8861 0.9781 0.0156  0.0993  0.0067  860 GLN D NE2 
3318 N  N   . GLY D 39  ? 0.9793 0.8077 0.8836 0.0362  0.0748  0.0044  861 GLY D N   
3319 C  CA  . GLY D 39  ? 0.9334 0.7756 0.8501 0.0351  0.0716  0.0022  861 GLY D CA  
3320 C  C   . GLY D 39  ? 0.9117 0.7593 0.8288 0.0380  0.0693  0.0025  861 GLY D C   
3321 O  O   . GLY D 39  ? 0.9220 0.7648 0.8309 0.0425  0.0690  0.0047  861 GLY D O   
3322 N  N   . PHE D 40  ? 0.6402 0.4978 0.5666 0.0356  0.0677  0.0002  862 PHE D N   
3323 C  CA  . PHE D 40  ? 0.6242 0.4877 0.5519 0.0379  0.0655  -0.0001 862 PHE D CA  
3324 C  C   . PHE D 40  ? 0.6113 0.4793 0.5434 0.0337  0.0670  -0.0026 862 PHE D C   
3325 O  O   . PHE D 40  ? 0.5992 0.4702 0.5374 0.0293  0.0682  -0.0048 862 PHE D O   
3326 C  CB  . PHE D 40  ? 0.5963 0.4693 0.5321 0.0409  0.0605  -0.0005 862 PHE D CB  
3327 C  CG  . PHE D 40  ? 0.6017 0.4727 0.5349 0.0450  0.0587  0.0015  862 PHE D CG  
3328 C  CD1 . PHE D 40  ? 0.5991 0.4715 0.5372 0.0437  0.0580  0.0011  862 PHE D CD1 
3329 C  CD2 . PHE D 40  ? 0.6140 0.4822 0.5397 0.0503  0.0576  0.0036  862 PHE D CD2 
3330 C  CE1 . PHE D 40  ? 0.6021 0.4734 0.5380 0.0476  0.0565  0.0026  862 PHE D CE1 
3331 C  CE2 . PHE D 40  ? 0.6227 0.4900 0.5463 0.0545  0.0560  0.0051  862 PHE D CE2 
3332 C  CZ  . PHE D 40  ? 0.6089 0.4778 0.5377 0.0531  0.0555  0.0045  862 PHE D CZ  
3333 N  N   . TYR D 41  ? 0.6994 0.5684 0.6280 0.0352  0.0669  -0.0026 863 TYR D N   
3334 C  CA  . TYR D 41  ? 0.6848 0.5593 0.6178 0.0320  0.0678  -0.0053 863 TYR D CA  
3335 C  C   . TYR D 41  ? 0.6546 0.5384 0.5946 0.0345  0.0635  -0.0067 863 TYR D C   
3336 O  O   . TYR D 41  ? 0.6424 0.5264 0.5782 0.0383  0.0617  -0.0055 863 TYR D O   
3337 C  CB  . TYR D 41  ? 0.6977 0.5660 0.6209 0.0311  0.0717  -0.0046 863 TYR D CB  
3338 C  CG  . TYR D 41  ? 0.7168 0.5761 0.6334 0.0271  0.0766  -0.0039 863 TYR D CG  
3339 C  CD1 . TYR D 41  ? 0.7520 0.6000 0.6557 0.0285  0.0793  -0.0008 863 TYR D CD1 
3340 C  CD2 . TYR D 41  ? 0.7166 0.5784 0.6392 0.0219  0.0786  -0.0063 863 TYR D CD2 
3341 C  CE1 . TYR D 41  ? 0.7775 0.6160 0.6743 0.0243  0.0841  -0.0002 863 TYR D CE1 
3342 C  CE2 . TYR D 41  ? 0.7361 0.5897 0.6525 0.0176  0.0833  -0.0059 863 TYR D CE2 
3343 C  CZ  . TYR D 41  ? 0.7653 0.6068 0.6686 0.0186  0.0861  -0.0028 863 TYR D CZ  
3344 O  OH  . TYR D 41  ? 0.7707 0.6031 0.6671 0.0139  0.0910  -0.0025 863 TYR D OH  
3345 N  N   . ILE D 42  ? 0.5866 0.4779 0.5368 0.0324  0.0616  -0.0093 864 ILE D N   
3346 C  CA  . ILE D 42  ? 0.5615 0.4607 0.5184 0.0341  0.0576  -0.0109 864 ILE D CA  
3347 C  C   . ILE D 42  ? 0.5509 0.4540 0.5100 0.0322  0.0587  -0.0138 864 ILE D C   
3348 O  O   . ILE D 42  ? 0.5415 0.4470 0.5053 0.0289  0.0604  -0.0161 864 ILE D O   
3349 C  CB  . ILE D 42  ? 0.5439 0.4485 0.5103 0.0335  0.0543  -0.0117 864 ILE D CB  
3350 C  CG1 . ILE D 42  ? 0.5548 0.4581 0.5197 0.0364  0.0521  -0.0092 864 ILE D CG1 
3351 C  CG2 . ILE D 42  ? 0.5231 0.4349 0.4965 0.0339  0.0510  -0.0141 864 ILE D CG2 
3352 C  CD1 . ILE D 42  ? 0.5893 0.4853 0.5483 0.0361  0.0549  -0.0071 864 ILE D CD1 
3353 N  N   . TYR D 43  ? 0.5403 0.4447 0.4960 0.0346  0.0578  -0.0139 865 TYR D N   
3354 C  CA  . TYR D 43  ? 0.5276 0.4357 0.4847 0.0333  0.0588  -0.0168 865 TYR D CA  
3355 C  C   . TYR D 43  ? 0.5077 0.4229 0.4725 0.0346  0.0545  -0.0192 865 TYR D C   
3356 O  O   . TYR D 43  ? 0.5078 0.4244 0.4728 0.0374  0.0511  -0.0181 865 TYR D O   
3357 C  CB  . TYR D 43  ? 0.5315 0.4358 0.4787 0.0347  0.0610  -0.0156 865 TYR D CB  
3358 C  CG  . TYR D 43  ? 0.5722 0.4677 0.5102 0.0333  0.0653  -0.0130 865 TYR D CG  
3359 C  CD1 . TYR D 43  ? 0.5793 0.4732 0.5155 0.0291  0.0698  -0.0144 865 TYR D CD1 
3360 C  CD2 . TYR D 43  ? 0.5879 0.4769 0.5188 0.0362  0.0650  -0.0094 865 TYR D CD2 
3361 C  CE1 . TYR D 43  ? 0.5977 0.4826 0.5248 0.0273  0.0739  -0.0120 865 TYR D CE1 
3362 C  CE2 . TYR D 43  ? 0.6028 0.4823 0.5245 0.0351  0.0690  -0.0070 865 TYR D CE2 
3363 C  CZ  . TYR D 43  ? 0.6181 0.4952 0.5378 0.0304  0.0735  -0.0083 865 TYR D CZ  
3364 O  OH  . TYR D 43  ? 0.6365 0.5033 0.5464 0.0287  0.0776  -0.0059 865 TYR D OH  
3365 N  N   . TYR D 44  ? 0.5986 0.5185 0.5698 0.0327  0.0547  -0.0226 866 TYR D N   
3366 C  CA  . TYR D 44  ? 0.5876 0.5130 0.5655 0.0339  0.0508  -0.0251 866 TYR D CA  
3367 C  C   . TYR D 44  ? 0.5799 0.5092 0.5596 0.0331  0.0521  -0.0289 866 TYR D C   
3368 O  O   . TYR D 44  ? 0.5853 0.5155 0.5659 0.0307  0.0552  -0.0305 866 TYR D O   
3369 C  CB  . TYR D 44  ? 0.5758 0.5034 0.5620 0.0332  0.0480  -0.0255 866 TYR D CB  
3370 C  CG  . TYR D 44  ? 0.6009 0.5285 0.5902 0.0304  0.0505  -0.0260 866 TYR D CG  
3371 C  CD1 . TYR D 44  ? 0.6017 0.5338 0.5976 0.0291  0.0504  -0.0294 866 TYR D CD1 
3372 C  CD2 . TYR D 44  ? 0.6085 0.5316 0.5940 0.0292  0.0527  -0.0234 866 TYR D CD2 
3373 C  CE1 . TYR D 44  ? 0.5972 0.5304 0.5961 0.0266  0.0525  -0.0302 866 TYR D CE1 
3374 C  CE2 . TYR D 44  ? 0.6035 0.5269 0.5918 0.0263  0.0550  -0.0242 866 TYR D CE2 
3375 C  CZ  . TYR D 44  ? 0.6001 0.5290 0.5952 0.0249  0.0549  -0.0276 866 TYR D CZ  
3376 O  OH  . TYR D 44  ? 0.6177 0.5480 0.6158 0.0220  0.0570  -0.0287 866 TYR D OH  
3377 N  N   . ARG D 45  ? 0.3749 0.3067 0.3549 0.0351  0.0496  -0.0305 867 ARG D N   
3378 C  CA  . ARG D 45  ? 0.3666 0.3020 0.3473 0.0350  0.0506  -0.0342 867 ARG D CA  
3379 C  C   . ARG D 45  ? 0.3501 0.2889 0.3360 0.0368  0.0463  -0.0367 867 ARG D C   
3380 O  O   . ARG D 45  ? 0.3457 0.2837 0.3309 0.0382  0.0432  -0.0353 867 ARG D O   
3381 C  CB  . ARG D 45  ? 0.3754 0.3088 0.3468 0.0356  0.0533  -0.0332 867 ARG D CB  
3382 C  CG  . ARG D 45  ? 0.3691 0.3065 0.3402 0.0357  0.0543  -0.0369 867 ARG D CG  
3383 C  CD  . ARG D 45  ? 0.3667 0.3020 0.3280 0.0368  0.0562  -0.0355 867 ARG D CD  
3384 N  NE  . ARG D 45  ? 0.3585 0.2935 0.3176 0.0397  0.0525  -0.0341 867 ARG D NE  
3385 C  CZ  . ARG D 45  ? 0.3687 0.3020 0.3193 0.0415  0.0531  -0.0323 867 ARG D CZ  
3386 N  NH1 . ARG D 45  ? 0.3822 0.3130 0.3252 0.0406  0.0573  -0.0314 867 ARG D NH1 
3387 N  NH2 . ARG D 45  ? 0.3532 0.2876 0.3028 0.0441  0.0495  -0.0315 867 ARG D NH2 
3388 N  N   . PRO D 46  ? 0.4844 0.4269 0.4753 0.0365  0.0462  -0.0408 868 PRO D N   
3389 C  CA  . PRO D 46  ? 0.4675 0.4121 0.4625 0.0382  0.0424  -0.0436 868 PRO D CA  
3390 C  C   . PRO D 46  ? 0.4663 0.4108 0.4557 0.0397  0.0415  -0.0436 868 PRO D C   
3391 O  O   . PRO D 46  ? 0.4702 0.4154 0.4541 0.0398  0.0444  -0.0441 868 PRO D O   
3392 C  CB  . PRO D 46  ? 0.4635 0.4121 0.4626 0.0381  0.0437  -0.0481 868 PRO D CB  
3393 C  CG  . PRO D 46  ? 0.4647 0.4139 0.4652 0.0360  0.0469  -0.0474 868 PRO D CG  
3394 C  CD  . PRO D 46  ? 0.4875 0.4327 0.4808 0.0347  0.0495  -0.0431 868 PRO D CD  
3395 N  N   . THR D 47  ? 0.3017 0.2456 0.2923 0.0407  0.0375  -0.0431 869 THR D N   
3396 C  CA  . THR D 47  ? 0.2916 0.2362 0.2772 0.0421  0.0363  -0.0430 869 THR D CA  
3397 C  C   . THR D 47  ? 0.2896 0.2369 0.2737 0.0428  0.0371  -0.0471 869 THR D C   
3398 O  O   . THR D 47  ? 0.2914 0.2397 0.2701 0.0439  0.0371  -0.0473 869 THR D O   
3399 C  CB  . THR D 47  ? 0.2930 0.2375 0.2813 0.0424  0.0318  -0.0426 869 THR D CB  
3400 O  OG1 . THR D 47  ? 0.2908 0.2334 0.2808 0.0416  0.0311  -0.0391 869 THR D OG1 
3401 C  CG2 . THR D 47  ? 0.3003 0.2465 0.2832 0.0436  0.0305  -0.0423 869 THR D CG2 
3402 N  N   . ASP D 48  ? 0.4077 0.3565 0.3967 0.0425  0.0378  -0.0506 870 ASP D N   
3403 C  CA  . ASP D 48  ? 0.3921 0.3440 0.3803 0.0434  0.0387  -0.0549 870 ASP D CA  
3404 C  C   . ASP D 48  ? 0.3991 0.3524 0.3808 0.0428  0.0433  -0.0545 870 ASP D C   
3405 O  O   . ASP D 48  ? 0.3987 0.3548 0.3783 0.0434  0.0446  -0.0577 870 ASP D O   
3406 C  CB  . ASP D 48  ? 0.3845 0.3381 0.3800 0.0437  0.0381  -0.0589 870 ASP D CB  
3407 C  CG  . ASP D 48  ? 0.3825 0.3345 0.3823 0.0448  0.0334  -0.0611 870 ASP D CG  
3408 O  OD1 . ASP D 48  ? 0.3892 0.3392 0.3872 0.0447  0.0307  -0.0593 870 ASP D OD1 
3409 O  OD2 . ASP D 48  ? 0.3776 0.3304 0.3826 0.0458  0.0324  -0.0647 870 ASP D OD2 
3410 N  N   . SER D 49  ? 0.3186 0.2693 0.2967 0.0416  0.0459  -0.0504 871 SER D N   
3411 C  CA  . SER D 49  ? 0.3237 0.2742 0.2945 0.0406  0.0505  -0.0494 871 SER D CA  
3412 C  C   . SER D 49  ? 0.3434 0.2907 0.3055 0.0416  0.0507  -0.0454 871 SER D C   
3413 O  O   . SER D 49  ? 0.3457 0.2900 0.3073 0.0423  0.0488  -0.0420 871 SER D O   
3414 C  CB  . SER D 49  ? 0.3383 0.2877 0.3104 0.0381  0.0540  -0.0481 871 SER D CB  
3415 O  OG  . SER D 49  ? 0.3643 0.3120 0.3283 0.0366  0.0585  -0.0464 871 SER D OG  
3416 N  N   . ASP D 50  ? 0.4189 0.3671 0.3739 0.0420  0.0529  -0.0460 872 ASP D N   
3417 C  CA  . ASP D 50  ? 0.4246 0.3697 0.3702 0.0435  0.0535  -0.0423 872 ASP D CA  
3418 C  C   . ASP D 50  ? 0.4431 0.3844 0.3811 0.0417  0.0586  -0.0397 872 ASP D C   
3419 O  O   . ASP D 50  ? 0.4465 0.3851 0.3749 0.0428  0.0601  -0.0372 872 ASP D O   
3420 C  CB  . ASP D 50  ? 0.4257 0.3743 0.3677 0.0454  0.0518  -0.0445 872 ASP D CB  
3421 C  CG  . ASP D 50  ? 0.4082 0.3598 0.3566 0.0468  0.0468  -0.0470 872 ASP D CG  
3422 O  OD1 . ASP D 50  ? 0.4000 0.3548 0.3463 0.0481  0.0451  -0.0493 872 ASP D OD1 
3423 O  OD2 . ASP D 50  ? 0.3963 0.3469 0.3516 0.0462  0.0446  -0.0465 872 ASP D OD2 
3424 N  N   . ASN D 51  ? 0.5660 0.5070 0.5080 0.0389  0.0613  -0.0404 873 ASN D N   
3425 C  CA  . ASN D 51  ? 0.5817 0.5188 0.5172 0.0362  0.0664  -0.0383 873 ASN D CA  
3426 C  C   . ASN D 51  ? 0.5904 0.5215 0.5256 0.0352  0.0669  -0.0343 873 ASN D C   
3427 O  O   . ASN D 51  ? 0.5877 0.5202 0.5312 0.0341  0.0658  -0.0353 873 ASN D O   
3428 C  CB  . ASN D 51  ? 0.5833 0.5253 0.5229 0.0331  0.0697  -0.0424 873 ASN D CB  
3429 C  CG  . ASN D 51  ? 0.6109 0.5494 0.5428 0.0296  0.0754  -0.0407 873 ASN D CG  
3430 O  OD1 . ASN D 51  ? 0.6204 0.5615 0.5562 0.0263  0.0784  -0.0427 873 ASN D OD1 
3431 N  ND2 . ASN D 51  ? 0.6204 0.5530 0.5411 0.0303  0.0770  -0.0369 873 ASN D ND2 
3432 N  N   . ASP D 52  ? 0.6565 0.5808 0.5819 0.0359  0.0685  -0.0299 874 ASP D N   
3433 C  CA  . ASP D 52  ? 0.6543 0.5720 0.5781 0.0355  0.0690  -0.0261 874 ASP D CA  
3434 C  C   . ASP D 52  ? 0.6609 0.5774 0.5875 0.0310  0.0728  -0.0268 874 ASP D C   
3435 O  O   . ASP D 52  ? 0.6631 0.5754 0.5908 0.0301  0.0729  -0.0246 874 ASP D O   
3436 C  CB  . ASP D 52  ? 0.6680 0.5778 0.5794 0.0375  0.0703  -0.0214 874 ASP D CB  
3437 C  CG  . ASP D 52  ? 0.6882 0.5994 0.5978 0.0423  0.0658  -0.0202 874 ASP D CG  
3438 O  OD1 . ASP D 52  ? 0.6748 0.5928 0.5926 0.0435  0.0620  -0.0230 874 ASP D OD1 
3439 O  OD2 . ASP D 52  ? 0.6992 0.6047 0.5991 0.0449  0.0662  -0.0164 874 ASP D OD2 
3440 N  N   . SER D 53  ? 0.6076 0.5284 0.5353 0.0281  0.0759  -0.0301 875 SER D N   
3441 C  CA  . SER D 53  ? 0.6125 0.5337 0.5428 0.0234  0.0798  -0.0314 875 SER D CA  
3442 C  C   . SER D 53  ? 0.6111 0.5388 0.5542 0.0230  0.0773  -0.0346 875 SER D C   
3443 O  O   . SER D 53  ? 0.6150 0.5444 0.5619 0.0195  0.0798  -0.0361 875 SER D O   
3444 C  CB  . SER D 53  ? 0.6218 0.5462 0.5484 0.0203  0.0843  -0.0340 875 SER D CB  
3445 O  OG  . SER D 53  ? 0.6456 0.5636 0.5596 0.0208  0.0866  -0.0308 875 SER D OG  
3446 N  N   . ASP D 54  ? 0.6826 0.6137 0.6320 0.0265  0.0722  -0.0358 876 ASP D N   
3447 C  CA  . ASP D 54  ? 0.6699 0.6065 0.6306 0.0266  0.0694  -0.0387 876 ASP D CA  
3448 C  C   . ASP D 54  ? 0.6799 0.6129 0.6438 0.0275  0.0666  -0.0358 876 ASP D C   
3449 O  O   . ASP D 54  ? 0.6796 0.6161 0.6522 0.0281  0.0636  -0.0374 876 ASP D O   
3450 C  CB  . ASP D 54  ? 0.6579 0.6003 0.6238 0.0295  0.0658  -0.0422 876 ASP D CB  
3451 C  CG  . ASP D 54  ? 0.6678 0.6158 0.6336 0.0285  0.0684  -0.0464 876 ASP D CG  
3452 O  OD1 . ASP D 54  ? 0.6851 0.6352 0.6512 0.0252  0.0724  -0.0478 876 ASP D OD1 
3453 O  OD2 . ASP D 54  ? 0.6603 0.6111 0.6257 0.0308  0.0666  -0.0486 876 ASP D OD2 
3454 N  N   . TYR D 55  ? 0.5264 0.4522 0.4828 0.0276  0.0677  -0.0314 877 TYR D N   
3455 C  CA  . TYR D 55  ? 0.5230 0.4453 0.4815 0.0282  0.0656  -0.0286 877 TYR D CA  
3456 C  C   . TYR D 55  ? 0.5385 0.4604 0.5004 0.0246  0.0682  -0.0290 877 TYR D C   
3457 O  O   . TYR D 55  ? 0.5581 0.4779 0.5154 0.0214  0.0728  -0.0291 877 TYR D O   
3458 C  CB  . TYR D 55  ? 0.5282 0.4431 0.4773 0.0302  0.0659  -0.0241 877 TYR D CB  
3459 C  CG  . TYR D 55  ? 0.5268 0.4430 0.4747 0.0344  0.0619  -0.0233 877 TYR D CG  
3460 C  CD1 . TYR D 55  ? 0.5273 0.4424 0.4673 0.0362  0.0626  -0.0227 877 TYR D CD1 
3461 C  CD2 . TYR D 55  ? 0.5167 0.4354 0.4710 0.0362  0.0574  -0.0231 877 TYR D CD2 
3462 C  CE1 . TYR D 55  ? 0.5200 0.4371 0.4590 0.0398  0.0588  -0.0222 877 TYR D CE1 
3463 C  CE2 . TYR D 55  ? 0.5020 0.4225 0.4552 0.0395  0.0538  -0.0226 877 TYR D CE2 
3464 C  CZ  . TYR D 55  ? 0.5019 0.4219 0.4477 0.0413  0.0545  -0.0223 877 TYR D CZ  
3465 O  OH  . TYR D 55  ? 0.4947 0.4175 0.4397 0.0444  0.0509  -0.0221 877 TYR D OH  
3466 N  N   . LYS D 56  ? 0.4198 0.3439 0.3896 0.0248  0.0653  -0.0293 878 LYS D N   
3467 C  CA  . LYS D 56  ? 0.4301 0.3537 0.4028 0.0216  0.0673  -0.0294 878 LYS D CA  
3468 C  C   . LYS D 56  ? 0.4467 0.3639 0.4163 0.0223  0.0665  -0.0255 878 LYS D C   
3469 O  O   . LYS D 56  ? 0.4349 0.3513 0.4049 0.0256  0.0629  -0.0236 878 LYS D O   
3470 C  CB  . LYS D 56  ? 0.4173 0.3484 0.4009 0.0213  0.0650  -0.0328 878 LYS D CB  
3471 C  CG  . LYS D 56  ? 0.4305 0.3683 0.4173 0.0200  0.0668  -0.0372 878 LYS D CG  
3472 C  CD  . LYS D 56  ? 0.4577 0.4025 0.4547 0.0200  0.0647  -0.0405 878 LYS D CD  
3473 C  CE  . LYS D 56  ? 0.4619 0.4140 0.4621 0.0193  0.0664  -0.0452 878 LYS D CE  
3474 N  NZ  . LYS D 56  ? 0.4623 0.4214 0.4724 0.0204  0.0636  -0.0486 878 LYS D NZ  
3475 N  N   . ARG D 57  ? 0.7170 0.6300 0.6835 0.0192  0.0700  -0.0244 879 ARG D N   
3476 C  CA  . ARG D 57  ? 0.7251 0.6307 0.6868 0.0199  0.0701  -0.0207 879 ARG D CA  
3477 C  C   . ARG D 57  ? 0.7146 0.6216 0.6826 0.0183  0.0692  -0.0210 879 ARG D C   
3478 O  O   . ARG D 57  ? 0.7057 0.6167 0.6787 0.0149  0.0708  -0.0236 879 ARG D O   
3479 C  CB  . ARG D 57  ? 0.7426 0.6396 0.6932 0.0179  0.0750  -0.0187 879 ARG D CB  
3480 C  CG  . ARG D 57  ? 0.7590 0.6470 0.7021 0.0202  0.0748  -0.0146 879 ARG D CG  
3481 C  CD  . ARG D 57  ? 0.8012 0.6794 0.7322 0.0185  0.0795  -0.0124 879 ARG D CD  
3482 N  NE  . ARG D 57  ? 0.8189 0.6931 0.7487 0.0134  0.0834  -0.0129 879 ARG D NE  
3483 C  CZ  . ARG D 57  ? 0.8174 0.6949 0.7492 0.0083  0.0869  -0.0158 879 ARG D CZ  
3484 N  NH1 . ARG D 57  ? 0.8158 0.7007 0.7509 0.0078  0.0870  -0.0184 879 ARG D NH1 
3485 N  NH2 . ARG D 57  ? 0.8197 0.6936 0.7502 0.0035  0.0904  -0.0163 879 ARG D NH2 
3486 N  N   . ASP D 58  ? 0.4718 0.3760 0.4396 0.0208  0.0664  -0.0184 880 ASP D N   
3487 C  CA  . ASP D 58  ? 0.4707 0.3751 0.4429 0.0195  0.0657  -0.0181 880 ASP D CA  
3488 C  C   . ASP D 58  ? 0.4998 0.3954 0.4641 0.0201  0.0673  -0.0148 880 ASP D C   
3489 O  O   . ASP D 58  ? 0.5054 0.3971 0.4640 0.0237  0.0661  -0.0123 880 ASP D O   
3490 C  CB  . ASP D 58  ? 0.4370 0.3471 0.4173 0.0219  0.0606  -0.0183 880 ASP D CB  
3491 C  CG  . ASP D 58  ? 0.4133 0.3313 0.4024 0.0208  0.0590  -0.0218 880 ASP D CG  
3492 O  OD1 . ASP D 58  ? 0.4263 0.3465 0.4160 0.0183  0.0619  -0.0243 880 ASP D OD1 
3493 O  OD2 . ASP D 58  ? 0.3964 0.3184 0.3917 0.0225  0.0549  -0.0220 880 ASP D OD2 
3494 N  N   . VAL D 59  ? 0.6073 0.4999 0.5711 0.0167  0.0699  -0.0150 881 VAL D N   
3495 C  CA  . VAL D 59  ? 0.6402 0.5235 0.5962 0.0172  0.0717  -0.0122 881 VAL D CA  
3496 C  C   . VAL D 59  ? 0.6417 0.5267 0.6026 0.0185  0.0687  -0.0115 881 VAL D C   
3497 O  O   . VAL D 59  ? 0.6420 0.5326 0.6106 0.0160  0.0680  -0.0135 881 VAL D O   
3498 C  CB  . VAL D 59  ? 0.6551 0.5322 0.6055 0.0123  0.0770  -0.0128 881 VAL D CB  
3499 C  CG1 . VAL D 59  ? 0.6670 0.5331 0.6086 0.0132  0.0786  -0.0099 881 VAL D CG1 
3500 C  CG2 . VAL D 59  ? 0.6506 0.5264 0.5959 0.0106  0.0801  -0.0135 881 VAL D CG2 
3501 N  N   . VAL D 60  ? 0.7011 0.5819 0.6575 0.0225  0.0671  -0.0087 882 VAL D N   
3502 C  CA  . VAL D 60  ? 0.7049 0.5874 0.6652 0.0239  0.0644  -0.0080 882 VAL D CA  
3503 C  C   . VAL D 60  ? 0.7242 0.5973 0.6761 0.0254  0.0662  -0.0057 882 VAL D C   
3504 O  O   . VAL D 60  ? 0.7325 0.5977 0.6749 0.0271  0.0683  -0.0039 882 VAL D O   
3505 C  CB  . VAL D 60  ? 0.6899 0.5789 0.6549 0.0277  0.0596  -0.0073 882 VAL D CB  
3506 C  CG1 . VAL D 60  ? 0.6640 0.5608 0.6362 0.0267  0.0577  -0.0096 882 VAL D CG1 
3507 C  CG2 . VAL D 60  ? 0.7005 0.5853 0.6577 0.0323  0.0590  -0.0050 882 VAL D CG2 
3508 N  N   . GLU D 61  ? 0.9561 0.8297 0.9110 0.0249  0.0654  -0.0057 883 GLU D N   
3509 C  CA  . GLU D 61  ? 0.9645 0.8293 0.9119 0.0264  0.0670  -0.0039 883 GLU D CA  
3510 C  C   . GLU D 61  ? 0.9620 0.8252 0.9048 0.0326  0.0646  -0.0015 883 GLU D C   
3511 O  O   . GLU D 61  ? 0.9448 0.8159 0.8928 0.0351  0.0609  -0.0014 883 GLU D O   
3512 C  CB  . GLU D 61  ? 0.9703 0.8372 0.9227 0.0241  0.0668  -0.0050 883 GLU D CB  
3513 C  CG  . GLU D 61  ? 0.9672 0.8438 0.9284 0.0258  0.0623  -0.0053 883 GLU D CG  
3514 C  CD  . GLU D 61  ? 0.9696 0.8445 0.9280 0.0300  0.0605  -0.0035 883 GLU D CD  
3515 O  OE1 . GLU D 61  ? 0.9756 0.8413 0.9261 0.0311  0.0630  -0.0025 883 GLU D OE1 
3516 O  OE2 . GLU D 61  ? 0.9458 0.8282 0.9096 0.0323  0.0568  -0.0031 883 GLU D OE2 
3517 N  N   . GLY D 62  ? 0.6774 0.5304 0.6105 0.0350  0.0666  0.0004  884 GLY D N   
3518 C  CA  . GLY D 62  ? 0.6798 0.5305 0.6070 0.0413  0.0647  0.0027  884 GLY D CA  
3519 C  C   . GLY D 62  ? 0.6713 0.5298 0.6039 0.0450  0.0606  0.0029  884 GLY D C   
3520 O  O   . GLY D 62  ? 0.6820 0.5436 0.6131 0.0498  0.0580  0.0040  884 GLY D O   
3521 N  N   . SER D 63  ? 0.6948 0.5569 0.6336 0.0428  0.0600  0.0017  885 SER D N   
3522 C  CA  . SER D 63  ? 0.6887 0.5578 0.6319 0.0459  0.0565  0.0020  885 SER D CA  
3523 C  C   . SER D 63  ? 0.6828 0.5641 0.6361 0.0447  0.0528  0.0010  885 SER D C   
3524 O  O   . SER D 63  ? 0.6703 0.5586 0.6280 0.0464  0.0499  0.0011  885 SER D O   
3525 C  CB  . SER D 63  ? 0.7076 0.5745 0.6517 0.0444  0.0575  0.0013  885 SER D CB  
3526 O  OG  . SER D 63  ? 0.6915 0.5632 0.6434 0.0389  0.0577  -0.0006 885 SER D OG  
3527 N  N   . LYS D 64  ? 0.7997 0.6834 0.7564 0.0416  0.0531  -0.0001 886 LYS D N   
3528 C  CA  . LYS D 64  ? 0.7625 0.6562 0.7281 0.0403  0.0498  -0.0011 886 LYS D CA  
3529 C  C   . LYS D 64  ? 0.7527 0.6502 0.7171 0.0440  0.0473  -0.0003 886 LYS D C   
3530 O  O   . LYS D 64  ? 0.7646 0.6570 0.7218 0.0465  0.0487  0.0006  886 LYS D O   
3531 C  CB  . LYS D 64  ? 0.7516 0.6464 0.7215 0.0358  0.0511  -0.0029 886 LYS D CB  
3532 C  CG  . LYS D 64  ? 0.7314 0.6351 0.7110 0.0338  0.0480  -0.0043 886 LYS D CG  
3533 C  CD  . LYS D 64  ? 0.7182 0.6228 0.7020 0.0295  0.0495  -0.0063 886 LYS D CD  
3534 C  CE  . LYS D 64  ? 0.6726 0.5851 0.6654 0.0282  0.0462  -0.0075 886 LYS D CE  
3535 N  NZ  . LYS D 64  ? 0.6546 0.5706 0.6509 0.0283  0.0438  -0.0067 886 LYS D NZ  
3536 N  N   . GLN D 65  ? 0.8009 0.7070 0.7719 0.0442  0.0437  -0.0007 887 GLN D N   
3537 C  CA  . GLN D 65  ? 0.7861 0.6970 0.7565 0.0473  0.0411  -0.0003 887 GLN D CA  
3538 C  C   . GLN D 65  ? 0.7595 0.6768 0.7366 0.0449  0.0387  -0.0018 887 GLN D C   
3539 O  O   . GLN D 65  ? 0.7410 0.6627 0.7182 0.0467  0.0365  -0.0019 887 GLN D O   
3540 C  CB  . GLN D 65  ? 0.7993 0.7150 0.7700 0.0504  0.0388  0.0005  887 GLN D CB  
3541 C  CG  . GLN D 65  ? 0.8221 0.7319 0.7842 0.0552  0.0403  0.0020  887 GLN D CG  
3542 C  CD  . GLN D 65  ? 0.8496 0.7660 0.8120 0.0591  0.0377  0.0025  887 GLN D CD  
3543 O  OE1 . GLN D 65  ? 0.8396 0.7623 0.8078 0.0576  0.0360  0.0020  887 GLN D OE1 
3544 N  NE2 . GLN D 65  ? 0.8377 0.7532 0.7937 0.0642  0.0372  0.0033  887 GLN D NE2 
3545 N  N   . TRP D 66  ? 0.6220 0.5398 0.6045 0.0409  0.0392  -0.0030 888 TRP D N   
3546 C  CA  . TRP D 66  ? 0.5881 0.5102 0.5762 0.0389  0.0373  -0.0046 888 TRP D CA  
3547 C  C   . TRP D 66  ? 0.5888 0.5087 0.5794 0.0356  0.0393  -0.0061 888 TRP D C   
3548 O  O   . TRP D 66  ? 0.5961 0.5138 0.5874 0.0338  0.0410  -0.0061 888 TRP D O   
3549 C  CB  . TRP D 66  ? 0.5701 0.4989 0.5646 0.0378  0.0336  -0.0047 888 TRP D CB  
3550 C  CG  . TRP D 66  ? 0.5626 0.4923 0.5611 0.0356  0.0336  -0.0044 888 TRP D CG  
3551 C  CD1 . TRP D 66  ? 0.5681 0.4996 0.5664 0.0363  0.0329  -0.0033 888 TRP D CD1 
3552 C  CD2 . TRP D 66  ? 0.5665 0.4958 0.5695 0.0324  0.0340  -0.0056 888 TRP D CD2 
3553 N  NE1 . TRP D 66  ? 0.5615 0.4935 0.5638 0.0336  0.0330  -0.0035 888 TRP D NE1 
3554 C  CE2 . TRP D 66  ? 0.5464 0.4772 0.5517 0.0313  0.0336  -0.0049 888 TRP D CE2 
3555 C  CE3 . TRP D 66  ? 0.5640 0.4925 0.5695 0.0307  0.0347  -0.0073 888 TRP D CE3 
3556 C  CZ2 . TRP D 66  ? 0.5255 0.4569 0.5352 0.0285  0.0337  -0.0057 888 TRP D CZ2 
3557 C  CZ3 . TRP D 66  ? 0.5539 0.4834 0.5640 0.0281  0.0348  -0.0082 888 TRP D CZ3 
3558 C  CH2 . TRP D 66  ? 0.5376 0.4684 0.5497 0.0270  0.0342  -0.0074 888 TRP D CH2 
3559 N  N   . HIS D 67  ? 0.4920 0.4129 0.4841 0.0349  0.0391  -0.0076 889 HIS D N   
3560 C  CA  . HIS D 67  ? 0.4853 0.4052 0.4798 0.0322  0.0411  -0.0095 889 HIS D CA  
3561 C  C   . HIS D 67  ? 0.4843 0.4089 0.4854 0.0311  0.0385  -0.0114 889 HIS D C   
3562 O  O   . HIS D 67  ? 0.4767 0.4038 0.4787 0.0323  0.0359  -0.0116 889 HIS D O   
3563 C  CB  . HIS D 67  ? 0.5046 0.4199 0.4928 0.0325  0.0446  -0.0098 889 HIS D CB  
3564 C  CG  . HIS D 67  ? 0.5068 0.4222 0.4974 0.0296  0.0468  -0.0121 889 HIS D CG  
3565 N  ND1 . HIS D 67  ? 0.5078 0.4221 0.4999 0.0268  0.0491  -0.0127 889 HIS D ND1 
3566 C  CD2 . HIS D 67  ? 0.5042 0.4217 0.4963 0.0290  0.0472  -0.0142 889 HIS D CD2 
3567 C  CE1 . HIS D 67  ? 0.5037 0.4198 0.4981 0.0247  0.0507  -0.0151 889 HIS D CE1 
3568 N  NE2 . HIS D 67  ? 0.4970 0.4151 0.4915 0.0261  0.0496  -0.0161 889 HIS D NE2 
3569 N  N   . MET D 68  ? 0.6952 0.6209 0.7008 0.0287  0.0392  -0.0131 890 MET D N   
3570 C  CA  . MET D 68  ? 0.6817 0.6110 0.6932 0.0280  0.0368  -0.0151 890 MET D CA  
3571 C  C   . MET D 68  ? 0.6780 0.6073 0.6894 0.0274  0.0392  -0.0176 890 MET D C   
3572 O  O   . MET D 68  ? 0.6818 0.6105 0.6931 0.0256  0.0421  -0.0185 890 MET D O   
3573 C  CB  . MET D 68  ? 0.6849 0.6165 0.7021 0.0264  0.0353  -0.0152 890 MET D CB  
3574 C  CG  . MET D 68  ? 0.6755 0.6101 0.6985 0.0262  0.0326  -0.0171 890 MET D CG  
3575 S  SD  . MET D 68  ? 0.6830 0.6188 0.7082 0.0269  0.0278  -0.0159 890 MET D SD  
3576 C  CE  . MET D 68  ? 0.6487 0.5853 0.6753 0.0256  0.0269  -0.0135 890 MET D CE  
3577 N  N   . ILE D 69  ? 0.3606 0.2909 0.3717 0.0287  0.0381  -0.0188 891 ILE D N   
3578 C  CA  . ILE D 69  ? 0.3609 0.2921 0.3722 0.0282  0.0401  -0.0216 891 ILE D CA  
3579 C  C   . ILE D 69  ? 0.3486 0.2836 0.3670 0.0278  0.0380  -0.0241 891 ILE D C   
3580 O  O   . ILE D 69  ? 0.3438 0.2798 0.3652 0.0289  0.0344  -0.0244 891 ILE D O   
3581 C  CB  . ILE D 69  ? 0.3559 0.2865 0.3632 0.0300  0.0401  -0.0221 891 ILE D CB  
3582 C  CG1 . ILE D 69  ? 0.3616 0.2885 0.3615 0.0312  0.0415  -0.0193 891 ILE D CG1 
3583 C  CG2 . ILE D 69  ? 0.3502 0.2821 0.3571 0.0293  0.0427  -0.0249 891 ILE D CG2 
3584 C  CD1 . ILE D 69  ? 0.3425 0.2691 0.3378 0.0331  0.0414  -0.0196 891 ILE D CD1 
3585 N  N   . GLY D 70  ? 0.4402 0.3772 0.4610 0.0263  0.0402  -0.0260 892 GLY D N   
3586 C  CA  . GLY D 70  ? 0.4363 0.3773 0.4638 0.0264  0.0382  -0.0285 892 GLY D CA  
3587 C  C   . GLY D 70  ? 0.4461 0.3902 0.4748 0.0267  0.0398  -0.0321 892 GLY D C   
3588 O  O   . GLY D 70  ? 0.4391 0.3822 0.4632 0.0263  0.0429  -0.0326 892 GLY D O   
3589 N  N   . HIS D 71  ? 0.6213 0.5692 0.6558 0.0277  0.0377  -0.0347 893 HIS D N   
3590 C  CA  . HIS D 71  ? 0.6235 0.5756 0.6602 0.0284  0.0389  -0.0387 893 HIS D CA  
3591 C  C   . HIS D 71  ? 0.6222 0.5727 0.6555 0.0300  0.0388  -0.0396 893 HIS D C   
3592 O  O   . HIS D 71  ? 0.6319 0.5836 0.6621 0.0292  0.0422  -0.0410 893 HIS D O   
3593 C  CB  . HIS D 71  ? 0.6330 0.5881 0.6687 0.0257  0.0436  -0.0401 893 HIS D CB  
3594 C  CG  . HIS D 71  ? 0.6356 0.5917 0.6733 0.0235  0.0443  -0.0390 893 HIS D CG  
3595 N  ND1 . HIS D 71  ? 0.6199 0.5726 0.6529 0.0208  0.0475  -0.0367 893 HIS D ND1 
3596 C  CD2 . HIS D 71  ? 0.6361 0.5961 0.6797 0.0238  0.0422  -0.0399 893 HIS D CD2 
3597 C  CE1 . HIS D 71  ? 0.6304 0.5850 0.6665 0.0192  0.0473  -0.0365 893 HIS D CE1 
3598 N  NE2 . HIS D 71  ? 0.6444 0.6037 0.6869 0.0210  0.0441  -0.0384 893 HIS D NE2 
3599 N  N   . LEU D 72  ? 0.3035 0.2514 0.3372 0.0319  0.0350  -0.0387 894 LEU D N   
3600 C  CA  . LEU D 72  ? 0.2951 0.2417 0.3260 0.0334  0.0343  -0.0398 894 LEU D CA  
3601 C  C   . LEU D 72  ? 0.2919 0.2396 0.3270 0.0358  0.0311  -0.0430 894 LEU D C   
3602 O  O   . LEU D 72  ? 0.2919 0.2397 0.3315 0.0366  0.0283  -0.0431 894 LEU D O   
3603 C  CB  . LEU D 72  ? 0.2916 0.2340 0.3184 0.0334  0.0327  -0.0365 894 LEU D CB  
3604 C  CG  . LEU D 72  ? 0.2998 0.2402 0.3210 0.0321  0.0357  -0.0334 894 LEU D CG  
3605 C  CD1 . LEU D 72  ? 0.2951 0.2329 0.3131 0.0328  0.0335  -0.0308 894 LEU D CD1 
3606 C  CD2 . LEU D 72  ? 0.2963 0.2374 0.3132 0.0316  0.0398  -0.0348 894 LEU D CD2 
3607 N  N   . GLN D 73  ? 0.4683 0.4166 0.5018 0.0371  0.0315  -0.0456 895 GLN D N   
3608 C  CA  . GLN D 73  ? 0.4674 0.4158 0.5041 0.0397  0.0284  -0.0488 895 GLN D CA  
3609 C  C   . GLN D 73  ? 0.4639 0.4071 0.5001 0.0401  0.0242  -0.0469 895 GLN D C   
3610 O  O   . GLN D 73  ? 0.4597 0.4005 0.4919 0.0390  0.0241  -0.0444 895 GLN D O   
3611 C  CB  . GLN D 73  ? 0.4751 0.4259 0.5099 0.0408  0.0302  -0.0524 895 GLN D CB  
3612 C  CG  . GLN D 73  ? 0.4803 0.4371 0.5187 0.0417  0.0322  -0.0565 895 GLN D CG  
3613 C  CD  . GLN D 73  ? 0.4710 0.4310 0.5128 0.0403  0.0336  -0.0557 895 GLN D CD  
3614 O  OE1 . GLN D 73  ? 0.4671 0.4293 0.5068 0.0377  0.0376  -0.0548 895 GLN D OE1 
3615 N  NE2 . GLN D 73  ? 0.4471 0.4070 0.4938 0.0420  0.0304  -0.0561 895 GLN D NE2 
3616 N  N   . PRO D 74  ? 0.3728 0.3143 0.4128 0.0418  0.0207  -0.0482 896 PRO D N   
3617 C  CA  . PRO D 74  ? 0.3761 0.3121 0.4157 0.0417  0.0167  -0.0465 896 PRO D CA  
3618 C  C   . PRO D 74  ? 0.3798 0.3135 0.4161 0.0421  0.0157  -0.0480 896 PRO D C   
3619 O  O   . PRO D 74  ? 0.3673 0.3028 0.4034 0.0438  0.0167  -0.0517 896 PRO D O   
3620 C  CB  . PRO D 74  ? 0.3694 0.3039 0.4132 0.0440  0.0137  -0.0484 896 PRO D CB  
3621 C  CG  . PRO D 74  ? 0.3796 0.3201 0.4268 0.0449  0.0161  -0.0501 896 PRO D CG  
3622 C  CD  . PRO D 74  ? 0.3774 0.3221 0.4222 0.0440  0.0204  -0.0515 896 PRO D CD  
3623 N  N   . GLU D 75  ? 0.7673 0.6977 0.8011 0.0404  0.0138  -0.0455 897 GLU D N   
3624 C  CA  . GLU D 75  ? 0.7748 0.7030 0.8059 0.0404  0.0123  -0.0470 897 GLU D CA  
3625 C  C   . GLU D 75  ? 0.7637 0.6956 0.7913 0.0408  0.0154  -0.0485 897 GLU D C   
3626 O  O   . GLU D 75  ? 0.7639 0.6954 0.7897 0.0416  0.0148  -0.0513 897 GLU D O   
3627 C  CB  . GLU D 75  ? 0.8029 0.7274 0.8360 0.0425  0.0095  -0.0506 897 GLU D CB  
3628 C  CG  . GLU D 75  ? 0.8283 0.7488 0.8587 0.0420  0.0071  -0.0522 897 GLU D CG  
3629 C  CD  . GLU D 75  ? 0.8680 0.7838 0.9001 0.0444  0.0044  -0.0558 897 GLU D CD  
3630 O  OE1 . GLU D 75  ? 0.8885 0.8040 0.9191 0.0457  0.0044  -0.0596 897 GLU D OE1 
3631 O  OE2 . GLU D 75  ? 0.8601 0.7724 0.8947 0.0453  0.0024  -0.0550 897 GLU D OE2 
3632 N  N   . THR D 76  ? 0.3456 0.2807 0.3718 0.0400  0.0187  -0.0464 898 THR D N   
3633 C  CA  . THR D 76  ? 0.3341 0.2722 0.3563 0.0403  0.0220  -0.0473 898 THR D CA  
3634 C  C   . THR D 76  ? 0.3263 0.2644 0.3438 0.0390  0.0228  -0.0437 898 THR D C   
3635 O  O   . THR D 76  ? 0.3242 0.2612 0.3421 0.0378  0.0222  -0.0404 898 THR D O   
3636 C  CB  . THR D 76  ? 0.3374 0.2789 0.3606 0.0405  0.0258  -0.0482 898 THR D CB  
3637 O  OG1 . THR D 76  ? 0.3427 0.2854 0.3705 0.0421  0.0249  -0.0519 898 THR D OG1 
3638 C  CG2 . THR D 76  ? 0.3338 0.2776 0.3519 0.0405  0.0293  -0.0490 898 THR D CG2 
3639 N  N   . SER D 77  ? 0.4294 0.3688 0.4422 0.0396  0.0241  -0.0445 899 SER D N   
3640 C  CA  . SER D 77  ? 0.4214 0.3613 0.4293 0.0392  0.0249  -0.0414 899 SER D CA  
3641 C  C   . SER D 77  ? 0.4159 0.3563 0.4200 0.0392  0.0291  -0.0396 899 SER D C   
3642 O  O   . SER D 77  ? 0.4179 0.3595 0.4225 0.0392  0.0317  -0.0416 899 SER D O   
3643 C  CB  . SER D 77  ? 0.4249 0.3659 0.4291 0.0400  0.0237  -0.0431 899 SER D CB  
3644 O  OG  . SER D 77  ? 0.4312 0.3732 0.4308 0.0400  0.0238  -0.0402 899 SER D OG  
3645 N  N   . TYR D 78  ? 0.4031 0.3427 0.4035 0.0390  0.0298  -0.0360 900 TYR D N   
3646 C  CA  . TYR D 78  ? 0.4110 0.3496 0.4071 0.0388  0.0338  -0.0340 900 TYR D CA  
3647 C  C   . TYR D 78  ? 0.4107 0.3484 0.4000 0.0400  0.0343  -0.0311 900 TYR D C   
3648 O  O   . TYR D 78  ? 0.4123 0.3505 0.4016 0.0406  0.0317  -0.0294 900 TYR D O   
3649 C  CB  . TYR D 78  ? 0.4153 0.3526 0.4148 0.0374  0.0347  -0.0323 900 TYR D CB  
3650 C  CG  . TYR D 78  ? 0.4096 0.3484 0.4145 0.0365  0.0355  -0.0351 900 TYR D CG  
3651 C  CD1 . TYR D 78  ? 0.4063 0.3456 0.4175 0.0365  0.0323  -0.0364 900 TYR D CD1 
3652 C  CD2 . TYR D 78  ? 0.4101 0.3499 0.4135 0.0358  0.0393  -0.0365 900 TYR D CD2 
3653 C  CE1 . TYR D 78  ? 0.4076 0.3487 0.4236 0.0364  0.0327  -0.0391 900 TYR D CE1 
3654 C  CE2 . TYR D 78  ? 0.4052 0.3476 0.4138 0.0352  0.0400  -0.0394 900 TYR D CE2 
3655 C  CZ  . TYR D 78  ? 0.4070 0.3503 0.4220 0.0358  0.0365  -0.0408 900 TYR D CZ  
3656 O  OH  . TYR D 78  ? 0.4183 0.3647 0.4385 0.0359  0.0369  -0.0438 900 TYR D OH  
3657 N  N   . ASP D 79  ? 0.3434 0.2798 0.3264 0.0405  0.0378  -0.0305 901 ASP D N   
3658 C  CA  . ASP D 79  ? 0.3512 0.2858 0.3267 0.0422  0.0387  -0.0274 901 ASP D CA  
3659 C  C   . ASP D 79  ? 0.3608 0.2915 0.3347 0.0415  0.0409  -0.0243 901 ASP D C   
3660 O  O   . ASP D 79  ? 0.3603 0.2890 0.3339 0.0397  0.0442  -0.0246 901 ASP D O   
3661 C  CB  . ASP D 79  ? 0.3570 0.2912 0.3256 0.0431  0.0414  -0.0281 901 ASP D CB  
3662 C  CG  . ASP D 79  ? 0.3448 0.2828 0.3154 0.0433  0.0399  -0.0320 901 ASP D CG  
3663 O  OD1 . ASP D 79  ? 0.3462 0.2867 0.3209 0.0437  0.0361  -0.0334 901 ASP D OD1 
3664 O  OD2 . ASP D 79  ? 0.3420 0.2804 0.3099 0.0430  0.0426  -0.0339 901 ASP D OD2 
3665 N  N   . ILE D 80  ? 0.4634 0.3935 0.4363 0.0427  0.0392  -0.0216 902 ILE D N   
3666 C  CA  . ILE D 80  ? 0.4741 0.4005 0.4458 0.0422  0.0409  -0.0188 902 ILE D CA  
3667 C  C   . ILE D 80  ? 0.4869 0.4099 0.4502 0.0449  0.0419  -0.0156 902 ILE D C   
3668 O  O   . ILE D 80  ? 0.4860 0.4114 0.4484 0.0473  0.0392  -0.0145 902 ILE D O   
3669 C  CB  . ILE D 80  ? 0.4554 0.3838 0.4341 0.0413  0.0380  -0.0184 902 ILE D CB  
3670 C  CG1 . ILE D 80  ? 0.4398 0.3712 0.4262 0.0394  0.0362  -0.0215 902 ILE D CG1 
3671 C  CG2 . ILE D 80  ? 0.4620 0.3867 0.4403 0.0403  0.0401  -0.0163 902 ILE D CG2 
3672 C  CD1 . ILE D 80  ? 0.4273 0.3603 0.4200 0.0384  0.0332  -0.0209 902 ILE D CD1 
3673 N  N   . LYS D 81  ? 0.4484 0.3658 0.4052 0.0447  0.0458  -0.0143 903 LYS D N   
3674 C  CA  . LYS D 81  ? 0.4734 0.3858 0.4213 0.0475  0.0470  -0.0110 903 LYS D CA  
3675 C  C   . LYS D 81  ? 0.4949 0.4004 0.4400 0.0459  0.0504  -0.0092 903 LYS D C   
3676 O  O   . LYS D 81  ? 0.4952 0.3998 0.4432 0.0423  0.0529  -0.0106 903 LYS D O   
3677 C  CB  . LYS D 81  ? 0.4791 0.3898 0.4186 0.0494  0.0484  -0.0107 903 LYS D CB  
3678 C  CG  . LYS D 81  ? 0.4769 0.3844 0.4135 0.0465  0.0526  -0.0119 903 LYS D CG  
3679 C  CD  . LYS D 81  ? 0.4840 0.3899 0.4116 0.0486  0.0539  -0.0113 903 LYS D CD  
3680 C  CE  . LYS D 81  ? 0.4803 0.3831 0.4042 0.0454  0.0584  -0.0123 903 LYS D CE  
3681 N  NZ  . LYS D 81  ? 0.4817 0.3833 0.3966 0.0472  0.0596  -0.0118 903 LYS D NZ  
3682 N  N   . MET D 82  ? 0.5674 0.4685 0.5068 0.0485  0.0506  -0.0062 904 MET D N   
3683 C  CA  . MET D 82  ? 0.5837 0.4775 0.5198 0.0471  0.0536  -0.0045 904 MET D CA  
3684 C  C   . MET D 82  ? 0.6075 0.4929 0.5319 0.0504  0.0556  -0.0014 904 MET D C   
3685 O  O   . MET D 82  ? 0.5999 0.4854 0.5184 0.0540  0.0546  -0.0004 904 MET D O   
3686 C  CB  . MET D 82  ? 0.5797 0.4761 0.5228 0.0467  0.0515  -0.0044 904 MET D CB  
3687 C  CG  . MET D 82  ? 0.5776 0.4762 0.5194 0.0511  0.0483  -0.0026 904 MET D CG  
3688 S  SD  . MET D 82  ? 0.5610 0.4632 0.5107 0.0501  0.0461  -0.0026 904 MET D SD  
3689 C  CE  . MET D 82  ? 0.5904 0.4834 0.5363 0.0476  0.0505  -0.0016 904 MET D CE  
3690 N  N   . GLN D 83  ? 0.6568 0.5346 0.5775 0.0493  0.0583  0.0002  905 GLN D N   
3691 C  CA  . GLN D 83  ? 0.6808 0.5486 0.5896 0.0524  0.0603  0.0033  905 GLN D CA  
3692 C  C   . GLN D 83  ? 0.6978 0.5582 0.6052 0.0504  0.0628  0.0043  905 GLN D C   
3693 O  O   . GLN D 83  ? 0.6918 0.5521 0.6036 0.0452  0.0651  0.0026  905 GLN D O   
3694 C  CB  . GLN D 83  ? 0.6893 0.5513 0.5891 0.0516  0.0636  0.0040  905 GLN D CB  
3695 C  CG  . GLN D 83  ? 0.6830 0.5427 0.5841 0.0453  0.0678  0.0023  905 GLN D CG  
3696 C  CD  . GLN D 83  ? 0.6892 0.5439 0.5811 0.0443  0.0711  0.0029  905 GLN D CD  
3697 O  OE1 . GLN D 83  ? 0.6946 0.5483 0.5869 0.0392  0.0747  0.0013  905 GLN D OE1 
3698 N  NE2 . GLN D 83  ? 0.6924 0.5445 0.5759 0.0491  0.0700  0.0050  905 GLN D NE2 
3699 N  N   . CYS D 84  ? 0.8017 0.6563 0.7029 0.0546  0.0623  0.0067  906 CYS D N   
3700 C  CA  . CYS D 84  ? 0.8090 0.6554 0.7074 0.0531  0.0647  0.0076  906 CYS D CA  
3701 C  C   . CYS D 84  ? 0.8367 0.6703 0.7235 0.0513  0.0695  0.0093  906 CYS D C   
3702 O  O   . CYS D 84  ? 0.8498 0.6790 0.7278 0.0538  0.0703  0.0109  906 CYS D O   
3703 C  CB  . CYS D 84  ? 0.8184 0.6638 0.7149 0.0586  0.0622  0.0093  906 CYS D CB  
3704 S  SG  . CYS D 84  ? 0.8715 0.7068 0.7529 0.0658  0.0625  0.0128  906 CYS D SG  
3705 N  N   . PHE D 85  ? 0.9474 0.7748 0.8337 0.0466  0.0729  0.0087  907 PHE D N   
3706 C  CA  . PHE D 85  ? 0.9726 0.7876 0.8481 0.0436  0.0779  0.0100  907 PHE D CA  
3707 C  C   . PHE D 85  ? 1.0046 0.8085 0.8746 0.0427  0.0803  0.0111  907 PHE D C   
3708 O  O   . PHE D 85  ? 0.9934 0.8011 0.8703 0.0426  0.0786  0.0100  907 PHE D O   
3709 C  CB  . PHE D 85  ? 0.9345 0.7536 0.8147 0.0366  0.0808  0.0074  907 PHE D CB  
3710 C  CG  . PHE D 85  ? 0.9296 0.7532 0.8193 0.0313  0.0815  0.0047  907 PHE D CG  
3711 C  CD1 . PHE D 85  ? 0.9620 0.7768 0.8471 0.0265  0.0859  0.0045  907 PHE D CD1 
3712 C  CD2 . PHE D 85  ? 0.9008 0.7371 0.8035 0.0312  0.0779  0.0023  907 PHE D CD2 
3713 C  CE1 . PHE D 85  ? 0.9457 0.7655 0.8396 0.0217  0.0865  0.0018  907 PHE D CE1 
3714 C  CE2 . PHE D 85  ? 0.8996 0.7402 0.8107 0.0267  0.0785  -0.0001 907 PHE D CE2 
3715 C  CZ  . PHE D 85  ? 0.9106 0.7434 0.8175 0.0220  0.0827  -0.0004 907 PHE D CZ  
3716 N  N   . ASN D 86  ? 0.9259 0.7159 0.7831 0.0417  0.0843  0.0132  908 ASN D N   
3717 C  CA  . ASN D 86  ? 0.9477 0.7254 0.7984 0.0395  0.0875  0.0139  908 ASN D CA  
3718 C  C   . ASN D 86  ? 0.9741 0.7408 0.8153 0.0335  0.0931  0.0144  908 ASN D C   
3719 O  O   . ASN D 86  ? 0.9589 0.7291 0.7997 0.0310  0.0945  0.0139  908 ASN D O   
3720 C  CB  . ASN D 86  ? 0.9506 0.7191 0.7925 0.0470  0.0858  0.0168  908 ASN D CB  
3721 C  CG  . ASN D 86  ? 0.9503 0.7115 0.7800 0.0524  0.0857  0.0200  908 ASN D CG  
3722 O  OD1 . ASN D 86  ? 0.9510 0.7108 0.7765 0.0497  0.0879  0.0204  908 ASN D OD1 
3723 N  ND2 . ASN D 86  ? 0.9473 0.7043 0.7712 0.0604  0.0830  0.0222  908 ASN D ND2 
3724 N  N   . GLU D 87  ? 1.2394 0.9928 1.0727 0.0310  0.0966  0.0151  909 GLU D N   
3725 C  CA  . GLU D 87  ? 1.2575 0.9993 1.0808 0.0246  0.1023  0.0156  909 GLU D CA  
3726 C  C   . GLU D 87  ? 1.2610 0.9943 1.0714 0.0279  0.1033  0.0190  909 GLU D C   
3727 O  O   . GLU D 87  ? 1.2585 0.9869 1.0626 0.0224  0.1075  0.0191  909 GLU D O   
3728 C  CB  . GLU D 87  ? 1.2842 1.0115 1.0999 0.0220  0.1055  0.0161  909 GLU D CB  
3729 C  CG  . GLU D 87  ? 1.2966 1.0136 1.1042 0.0302  0.1032  0.0190  909 GLU D CG  
3730 C  CD  . GLU D 87  ? 1.2875 1.0140 1.1064 0.0333  0.0992  0.0171  909 GLU D CD  
3731 O  OE1 . GLU D 87  ? 1.2562 0.9996 1.0893 0.0325  0.0963  0.0147  909 GLU D OE1 
3732 O  OE2 . GLU D 87  ? 1.3165 1.0334 1.1297 0.0366  0.0991  0.0181  909 GLU D OE2 
3733 N  N   . GLY D 88  ? 1.0152 0.7474 0.8215 0.0367  0.0995  0.0216  910 GLY D N   
3734 C  CA  . GLY D 88  ? 1.0150 0.7399 0.8090 0.0411  0.0997  0.0249  910 GLY D CA  
3735 C  C   . GLY D 88  ? 1.0170 0.7543 0.8166 0.0397  0.0989  0.0237  910 GLY D C   
3736 O  O   . GLY D 88  ? 1.0156 0.7467 0.8059 0.0374  0.1020  0.0251  910 GLY D O   
3737 N  N   . GLY D 89  ? 1.0914 0.8457 0.9057 0.0411  0.0948  0.0210  911 GLY D N   
3738 C  CA  . GLY D 89  ? 1.0506 0.8172 0.8711 0.0401  0.0935  0.0193  911 GLY D CA  
3739 C  C   . GLY D 89  ? 1.0249 0.8077 0.8593 0.0438  0.0880  0.0172  911 GLY D C   
3740 O  O   . GLY D 89  ? 1.0152 0.8004 0.8550 0.0467  0.0852  0.0169  911 GLY D O   
3741 N  N   . GLU D 90  ? 1.0464 0.8399 0.8862 0.0435  0.0865  0.0155  912 GLU D N   
3742 C  CA  . GLU D 90  ? 0.9991 0.8074 0.8515 0.0464  0.0814  0.0134  912 GLU D CA  
3743 C  C   . GLU D 90  ? 0.9905 0.8007 0.8384 0.0542  0.0776  0.0154  912 GLU D C   
3744 O  O   . GLU D 90  ? 0.9905 0.7954 0.8281 0.0562  0.0788  0.0174  912 GLU D O   
3745 C  CB  . GLU D 90  ? 0.9751 0.7947 0.8370 0.0417  0.0817  0.0098  912 GLU D CB  
3746 C  CG  . GLU D 90  ? 0.9839 0.8034 0.8503 0.0340  0.0856  0.0074  912 GLU D CG  
3747 C  CD  . GLU D 90  ? 1.0080 0.8194 0.8643 0.0295  0.0910  0.0081  912 GLU D CD  
3748 O  OE1 . GLU D 90  ? 1.0357 0.8379 0.8795 0.0326  0.0920  0.0113  912 GLU D OE1 
3749 O  OE2 . GLU D 90  ? 0.9939 0.8083 0.8547 0.0229  0.0941  0.0054  912 GLU D OE2 
3750 N  N   . SER D 91  ? 0.9410 0.7593 0.7966 0.0583  0.0731  0.0148  913 SER D N   
3751 C  CA  . SER D 91  ? 0.9293 0.7517 0.7822 0.0655  0.0691  0.0161  913 SER D CA  
3752 C  C   . SER D 91  ? 0.9236 0.7566 0.7812 0.0649  0.0673  0.0141  913 SER D C   
3753 O  O   . SER D 91  ? 0.9197 0.7555 0.7814 0.0594  0.0695  0.0120  913 SER D O   
3754 C  CB  . SER D 91  ? 0.9176 0.7470 0.7782 0.0692  0.0649  0.0156  913 SER D CB  
3755 O  OG  . SER D 91  ? 0.8786 0.7207 0.7533 0.0658  0.0626  0.0123  913 SER D OG  
3756 N  N   . GLU D 92  ? 1.0188 0.8580 0.8759 0.0707  0.0634  0.0146  914 GLU D N   
3757 C  CA  . GLU D 92  ? 1.0002 0.8498 0.8618 0.0706  0.0613  0.0124  914 GLU D CA  
3758 C  C   . GLU D 92  ? 0.9649 0.8270 0.8417 0.0680  0.0583  0.0090  914 GLU D C   
3759 O  O   . GLU D 92  ? 0.9607 0.8256 0.8432 0.0690  0.0561  0.0088  914 GLU D O   
3760 C  CB  . GLU D 92  ? 1.0151 0.8669 0.8700 0.0776  0.0582  0.0141  914 GLU D CB  
3761 C  CG  . GLU D 92  ? 1.0306 0.8860 0.8876 0.0831  0.0544  0.0149  914 GLU D CG  
3762 C  CD  . GLU D 92  ? 1.0719 0.9298 0.9216 0.0904  0.0514  0.0164  914 GLU D CD  
3763 O  OE1 . GLU D 92  ? 1.0908 0.9470 0.9333 0.0911  0.0523  0.0170  914 GLU D OE1 
3764 O  OE2 . GLU D 92  ? 1.0669 0.9291 0.9180 0.0954  0.0482  0.0169  914 GLU D OE2 
3765 N  N   . PHE D 93  ? 0.5522 0.4213 0.4348 0.0646  0.0581  0.0062  915 PHE D N   
3766 C  CA  . PHE D 93  ? 0.5142 0.3937 0.4102 0.0618  0.0555  0.0029  915 PHE D CA  
3767 C  C   . PHE D 93  ? 0.4981 0.3855 0.3991 0.0658  0.0507  0.0027  915 PHE D C   
3768 O  O   . PHE D 93  ? 0.5033 0.3921 0.3987 0.0707  0.0487  0.0039  915 PHE D O   
3769 C  CB  . PHE D 93  ? 0.4856 0.3710 0.3854 0.0590  0.0558  -0.0001 915 PHE D CB  
3770 C  CG  . PHE D 93  ? 0.4792 0.3603 0.3782 0.0538  0.0603  -0.0011 915 PHE D CG  
3771 C  CD1 . PHE D 93  ? 0.4954 0.3721 0.3855 0.0532  0.0634  -0.0005 915 PHE D CD1 
3772 C  CD2 . PHE D 93  ? 0.4785 0.3606 0.3856 0.0495  0.0614  -0.0028 915 PHE D CD2 
3773 C  CE1 . PHE D 93  ? 0.5050 0.3789 0.3947 0.0481  0.0677  -0.0018 915 PHE D CE1 
3774 C  CE2 . PHE D 93  ? 0.4879 0.3674 0.3947 0.0447  0.0655  -0.0041 915 PHE D CE2 
3775 C  CZ  . PHE D 93  ? 0.5015 0.3771 0.3997 0.0438  0.0687  -0.0037 915 PHE D CZ  
3776 N  N   . SER D 94  ? 0.4953 0.3883 0.4068 0.0634  0.0488  0.0010  916 SER D N   
3777 C  CA  . SER D 94  ? 0.4804 0.3820 0.3978 0.0659  0.0444  0.0003  916 SER D CA  
3778 C  C   . SER D 94  ? 0.4658 0.3762 0.3886 0.0649  0.0418  -0.0025 916 SER D C   
3779 O  O   . SER D 94  ? 0.4573 0.3672 0.3801 0.0623  0.0435  -0.0041 916 SER D O   
3780 C  CB  . SER D 94  ? 0.4799 0.3834 0.4057 0.0634  0.0435  -0.0002 916 SER D CB  
3781 O  OG  . SER D 94  ? 0.4642 0.3709 0.3985 0.0585  0.0438  -0.0028 916 SER D OG  
3782 N  N   . ASN D 95  ? 0.5603 0.4790 0.4876 0.0667  0.0378  -0.0034 917 ASN D N   
3783 C  CA  . ASN D 95  ? 0.5338 0.4607 0.4666 0.0653  0.0351  -0.0063 917 ASN D CA  
3784 C  C   . ASN D 95  ? 0.5218 0.4490 0.4622 0.0602  0.0360  -0.0088 917 ASN D C   
3785 O  O   . ASN D 95  ? 0.5260 0.4511 0.4713 0.0576  0.0368  -0.0087 917 ASN D O   
3786 C  CB  . ASN D 95  ? 0.5273 0.4628 0.4651 0.0668  0.0310  -0.0070 917 ASN D CB  
3787 C  CG  . ASN D 95  ? 0.5291 0.4649 0.4729 0.0651  0.0304  -0.0063 917 ASN D CG  
3788 O  OD1 . ASN D 95  ? 0.5333 0.4626 0.4770 0.0634  0.0331  -0.0052 917 ASN D OD1 
3789 N  ND2 . ASN D 95  ? 0.5319 0.4757 0.4811 0.0652  0.0270  -0.0072 917 ASN D ND2 
3790 N  N   . VAL D 96  ? 0.5013 0.4313 0.4426 0.0590  0.0356  -0.0114 918 VAL D N   
3791 C  CA  . VAL D 96  ? 0.4915 0.4222 0.4397 0.0549  0.0363  -0.0141 918 VAL D CA  
3792 C  C   . VAL D 96  ? 0.4737 0.4108 0.4306 0.0532  0.0325  -0.0164 918 VAL D C   
3793 O  O   . VAL D 96  ? 0.4762 0.4185 0.4333 0.0542  0.0298  -0.0178 918 VAL D O   
3794 C  CB  . VAL D 96  ? 0.4772 0.4072 0.4219 0.0543  0.0382  -0.0160 918 VAL D CB  
3795 C  CG1 . VAL D 96  ? 0.4716 0.4020 0.4233 0.0505  0.0391  -0.0189 918 VAL D CG1 
3796 C  CG2 . VAL D 96  ? 0.4917 0.4149 0.4265 0.0557  0.0421  -0.0134 918 VAL D CG2 
3797 N  N   . MET D 97  ? 0.4280 0.3644 0.3918 0.0504  0.0323  -0.0169 919 MET D N   
3798 C  CA  . MET D 97  ? 0.4196 0.3605 0.3912 0.0483  0.0289  -0.0187 919 MET D CA  
3799 C  C   . MET D 97  ? 0.4157 0.3565 0.3919 0.0459  0.0291  -0.0219 919 MET D C   
3800 O  O   . MET D 97  ? 0.4118 0.3493 0.3869 0.0452  0.0321  -0.0224 919 MET D O   
3801 C  CB  . MET D 97  ? 0.4212 0.3617 0.3973 0.0471  0.0283  -0.0170 919 MET D CB  
3802 C  CG  . MET D 97  ? 0.4280 0.3686 0.3999 0.0498  0.0282  -0.0141 919 MET D CG  
3803 S  SD  . MET D 97  ? 0.4222 0.3709 0.3950 0.0513  0.0241  -0.0144 919 MET D SD  
3804 C  CE  . MET D 97  ? 0.4328 0.3840 0.4145 0.0475  0.0218  -0.0148 919 MET D CE  
3805 N  N   . ILE D 98  ? 0.3963 0.3406 0.3772 0.0447  0.0259  -0.0242 920 ILE D N   
3806 C  CA  . ILE D 98  ? 0.3855 0.3293 0.3710 0.0428  0.0255  -0.0274 920 ILE D CA  
3807 C  C   . ILE D 98  ? 0.3707 0.3145 0.3632 0.0406  0.0230  -0.0276 920 ILE D C   
3808 O  O   . ILE D 98  ? 0.3712 0.3175 0.3653 0.0398  0.0201  -0.0274 920 ILE D O   
3809 C  CB  . ILE D 98  ? 0.3822 0.3287 0.3664 0.0433  0.0240  -0.0304 920 ILE D CB  
3810 C  CG1 . ILE D 98  ? 0.3811 0.3278 0.3578 0.0456  0.0263  -0.0300 920 ILE D CG1 
3811 C  CG2 . ILE D 98  ? 0.3740 0.3194 0.3628 0.0419  0.0237  -0.0339 920 ILE D CG2 
3812 C  CD1 . ILE D 98  ? 0.3738 0.3235 0.3487 0.0462  0.0250  -0.0331 920 ILE D CD1 
3813 N  N   . CYS D 99  ? 0.3196 0.2608 0.3158 0.0393  0.0242  -0.0279 921 CYS D N   
3814 C  CA  . CYS D 99  ? 0.3172 0.2578 0.3194 0.0374  0.0220  -0.0278 921 CYS D CA  
3815 C  C   . CYS D 99  ? 0.3214 0.2605 0.3279 0.0367  0.0217  -0.0307 921 CYS D C   
3816 O  O   . CYS D 99  ? 0.3236 0.2622 0.3295 0.0374  0.0243  -0.0321 921 CYS D O   
3817 C  CB  . CYS D 99  ? 0.3208 0.2604 0.3237 0.0370  0.0231  -0.0247 921 CYS D CB  
3818 S  SG  . CYS D 99  ? 0.3126 0.2528 0.3206 0.0348  0.0198  -0.0234 921 CYS D SG  
3819 N  N   . GLU D 100 ? 0.4199 0.3581 0.4305 0.0354  0.0185  -0.0315 922 GLU D N   
3820 C  CA  . GLU D 100 ? 0.4250 0.3613 0.4394 0.0354  0.0176  -0.0344 922 GLU D CA  
3821 C  C   . GLU D 100 ? 0.4357 0.3702 0.4547 0.0344  0.0165  -0.0332 922 GLU D C   
3822 O  O   . GLU D 100 ? 0.4356 0.3694 0.4557 0.0329  0.0144  -0.0312 922 GLU D O   
3823 C  CB  . GLU D 100 ? 0.4279 0.3635 0.4425 0.0350  0.0146  -0.0369 922 GLU D CB  
3824 C  CG  . GLU D 100 ? 0.4434 0.3764 0.4610 0.0357  0.0135  -0.0404 922 GLU D CG  
3825 C  CD  . GLU D 100 ? 0.4422 0.3741 0.4586 0.0355  0.0111  -0.0434 922 GLU D CD  
3826 O  OE1 . GLU D 100 ? 0.4342 0.3688 0.4468 0.0358  0.0119  -0.0440 922 GLU D OE1 
3827 O  OE2 . GLU D 100 ? 0.4412 0.3691 0.4600 0.0351  0.0086  -0.0451 922 GLU D OE2 
3828 N  N   . THR D 101 ? 0.3594 0.2936 0.3808 0.0351  0.0181  -0.0345 923 THR D N   
3829 C  CA  . THR D 101 ? 0.3529 0.2859 0.3786 0.0345  0.0170  -0.0336 923 THR D CA  
3830 C  C   . THR D 101 ? 0.3703 0.3001 0.3984 0.0343  0.0131  -0.0348 923 THR D C   
3831 O  O   . THR D 101 ? 0.3847 0.3132 0.4119 0.0348  0.0118  -0.0372 923 THR D O   
3832 C  CB  . THR D 101 ? 0.3587 0.2933 0.3868 0.0355  0.0194  -0.0355 923 THR D CB  
3833 O  OG1 . THR D 101 ? 0.3591 0.2942 0.3873 0.0371  0.0196  -0.0393 923 THR D OG1 
3834 C  CG2 . THR D 101 ? 0.3632 0.2996 0.3885 0.0349  0.0234  -0.0339 923 THR D CG2 
3835 N  N   . LYS D 102 ? 0.6246 0.5527 0.6555 0.0333  0.0114  -0.0330 924 LYS D N   
3836 C  CA  . LYS D 102 ? 0.6382 0.5619 0.6705 0.0328  0.0077  -0.0334 924 LYS D CA  
3837 C  C   . LYS D 102 ? 0.6511 0.5726 0.6855 0.0353  0.0067  -0.0371 924 LYS D C   
3838 O  O   . LYS D 102 ? 0.6515 0.5758 0.6878 0.0372  0.0088  -0.0387 924 LYS D O   
3839 C  CB  . LYS D 102 ? 0.6477 0.5701 0.6817 0.0313  0.0061  -0.0303 924 LYS D CB  
3840 C  CG  . LYS D 102 ? 0.6515 0.5764 0.6837 0.0290  0.0068  -0.0270 924 LYS D CG  
3841 C  CD  . LYS D 102 ? 0.6515 0.5748 0.6850 0.0271  0.0048  -0.0242 924 LYS D CD  
3842 C  CE  . LYS D 102 ? 0.6537 0.5801 0.6854 0.0249  0.0053  -0.0213 924 LYS D CE  
3843 N  NZ  . LYS D 102 ? 0.6845 0.6100 0.7173 0.0227  0.0035  -0.0186 924 LYS D NZ  
3844 O  OXT . LYS D 102 ? 0.6567 0.5738 0.6909 0.0355  0.0040  -0.0386 924 LYS D OXT 
3845 N  N   . LEU E 21  ? 0.9282 0.7644 0.9396 0.1104  -0.0757 0.0000  40  LEU E N   
3846 C  CA  . LEU E 21  ? 0.9285 0.7652 0.9361 0.1066  -0.0766 0.0054  40  LEU E CA  
3847 C  C   . LEU E 21  ? 0.9201 0.7694 0.9314 0.1130  -0.0790 0.0041  40  LEU E C   
3848 O  O   . LEU E 21  ? 0.9096 0.7744 0.9297 0.1164  -0.0774 -0.0013 40  LEU E O   
3849 C  CB  . LEU E 21  ? 0.9146 0.7591 0.9255 0.0965  -0.0715 0.0068  40  LEU E CB  
3850 C  CG  . LEU E 21  ? 0.9308 0.7663 0.9393 0.0895  -0.0686 0.0077  40  LEU E CG  
3851 C  CD1 . LEU E 21  ? 0.9105 0.7573 0.9241 0.0812  -0.0635 0.0080  40  LEU E CD1 
3852 C  CD2 . LEU E 21  ? 0.9317 0.7476 0.9291 0.0870  -0.0714 0.0132  40  LEU E CD2 
3853 N  N   . VAL E 22  ? 0.8067 0.6497 0.8109 0.1144  -0.0826 0.0090  41  VAL E N   
3854 C  CA  . VAL E 22  ? 0.8017 0.6564 0.8086 0.1205  -0.0853 0.0082  41  VAL E CA  
3855 C  C   . VAL E 22  ? 0.7802 0.6430 0.7871 0.1140  -0.0838 0.0119  41  VAL E C   
3856 O  O   . VAL E 22  ? 0.7781 0.6297 0.7765 0.1104  -0.0853 0.0179  41  VAL E O   
3857 C  CB  . VAL E 22  ? 0.8275 0.6693 0.8260 0.1295  -0.0918 0.0105  41  VAL E CB  
3858 C  CG1 . VAL E 22  ? 0.8068 0.6621 0.8082 0.1359  -0.0947 0.0095  41  VAL E CG1 
3859 C  CG2 . VAL E 22  ? 0.8575 0.6911 0.8558 0.1365  -0.0935 0.0065  41  VAL E CG2 
3860 N  N   . PRO E 23  ? 0.5389 0.4212 0.5553 0.1125  -0.0807 0.0081  42  PRO E N   
3861 C  CA  . PRO E 23  ? 0.5180 0.4100 0.5356 0.1066  -0.0788 0.0106  42  PRO E CA  
3862 C  C   . PRO E 23  ? 0.5236 0.4113 0.5339 0.1098  -0.0835 0.0153  42  PRO E C   
3863 O  O   . PRO E 23  ? 0.5339 0.4175 0.5411 0.1185  -0.0883 0.0150  42  PRO E O   
3864 C  CB  . PRO E 23  ? 0.5003 0.4134 0.5292 0.1079  -0.0761 0.0044  42  PRO E CB  
3865 C  CG  . PRO E 23  ? 0.5101 0.4245 0.5423 0.1167  -0.0783 -0.0007 42  PRO E CG  
3866 C  CD  . PRO E 23  ? 0.5291 0.4255 0.5555 0.1162  -0.0786 0.0010  42  PRO E CD  
3867 N  N   . LEU E 24  ? 0.5297 0.4184 0.5369 0.1030  -0.0822 0.0196  43  LEU E N   
3868 C  CA  . LEU E 24  ? 0.5462 0.4319 0.5463 0.1051  -0.0863 0.0243  43  LEU E CA  
3869 C  C   . LEU E 24  ? 0.5377 0.4424 0.5444 0.1088  -0.0870 0.0210  43  LEU E C   
3870 O  O   . LEU E 24  ? 0.5123 0.4326 0.5282 0.1054  -0.0829 0.0167  43  LEU E O   
3871 C  CB  . LEU E 24  ? 0.5339 0.4131 0.5276 0.0961  -0.0845 0.0303  43  LEU E CB  
3872 C  CG  . LEU E 24  ? 0.5514 0.4117 0.5372 0.0912  -0.0840 0.0343  43  LEU E CG  
3873 C  CD1 . LEU E 24  ? 0.5453 0.3999 0.5235 0.0839  -0.0836 0.0407  43  LEU E CD1 
3874 C  CD2 . LEU E 24  ? 0.5891 0.4331 0.5679 0.0986  -0.0887 0.0353  43  LEU E CD2 
3875 N  N   . LEU E 25  ? 0.6256 0.5288 0.6273 0.1158  -0.0923 0.0230  44  LEU E N   
3876 C  CA  . LEU E 25  ? 0.6145 0.5358 0.6218 0.1196  -0.0936 0.0201  44  LEU E CA  
3877 C  C   . LEU E 25  ? 0.5930 0.5204 0.5987 0.1124  -0.0919 0.0234  44  LEU E C   
3878 O  O   . LEU E 25  ? 0.5966 0.5119 0.5942 0.1070  -0.0917 0.0293  44  LEU E O   
3879 C  CB  . LEU E 25  ? 0.6370 0.5548 0.6394 0.1305  -0.1002 0.0208  44  LEU E CB  
3880 C  CG  . LEU E 25  ? 0.6866 0.6042 0.6928 0.1395  -0.1023 0.0157  44  LEU E CG  
3881 C  CD1 . LEU E 25  ? 0.7554 0.6686 0.7554 0.1506  -0.1092 0.0171  44  LEU E CD1 
3882 C  CD2 . LEU E 25  ? 0.6632 0.6021 0.6827 0.1395  -0.0987 0.0079  44  LEU E CD2 
3883 N  N   . TYR E 26  ? 0.5366 0.4832 0.5500 0.1123  -0.0905 0.0194  45  TYR E N   
3884 C  CA  . TYR E 26  ? 0.5265 0.4804 0.5389 0.1061  -0.0890 0.0219  45  TYR E CA  
3885 C  C   . TYR E 26  ? 0.5502 0.4929 0.5510 0.1080  -0.0938 0.0288  45  TYR E C   
3886 O  O   . TYR E 26  ? 0.5773 0.5133 0.5728 0.1164  -0.0992 0.0302  45  TYR E O   
3887 C  CB  . TYR E 26  ? 0.5216 0.4976 0.5434 0.1073  -0.0879 0.0161  45  TYR E CB  
3888 C  CG  . TYR E 26  ? 0.5132 0.4978 0.5339 0.1021  -0.0870 0.0181  45  TYR E CG  
3889 C  CD1 . TYR E 26  ? 0.4965 0.4791 0.5163 0.0926  -0.0825 0.0204  45  TYR E CD1 
3890 C  CD2 . TYR E 26  ? 0.5228 0.5183 0.5434 0.1069  -0.0907 0.0173  45  TYR E CD2 
3891 C  CE1 . TYR E 26  ? 0.4995 0.4901 0.5182 0.0880  -0.0816 0.0219  45  TYR E CE1 
3892 C  CE2 . TYR E 26  ? 0.5194 0.5231 0.5389 0.1022  -0.0899 0.0189  45  TYR E CE2 
3893 C  CZ  . TYR E 26  ? 0.5110 0.5120 0.5295 0.0927  -0.0853 0.0211  45  TYR E CZ  
3894 O  OH  . TYR E 26  ? 0.5041 0.5132 0.5213 0.0882  -0.0844 0.0223  45  TYR E OH  
3895 N  N   . LYS E 27  ? 0.5584 0.4971 0.5546 0.0998  -0.0915 0.0332  46  LYS E N   
3896 C  CA  . LYS E 27  ? 0.5675 0.4954 0.5521 0.0997  -0.0951 0.0402  46  LYS E CA  
3897 C  C   . LYS E 27  ? 0.5979 0.5032 0.5724 0.1011  -0.0976 0.0451  46  LYS E C   
3898 O  O   . LYS E 27  ? 0.6259 0.5224 0.5904 0.1035  -0.1018 0.0504  46  LYS E O   
3899 C  CB  . LYS E 27  ? 0.5701 0.5067 0.5532 0.1071  -0.1001 0.0400  46  LYS E CB  
3900 C  CG  . LYS E 27  ? 0.5693 0.5255 0.5587 0.1035  -0.0978 0.0373  46  LYS E CG  
3901 C  CD  . LYS E 27  ? 0.5719 0.5248 0.5564 0.0939  -0.0948 0.0419  46  LYS E CD  
3902 C  CE  . LYS E 27  ? 0.5553 0.5269 0.5460 0.0898  -0.0922 0.0389  46  LYS E CE  
3903 N  NZ  . LYS E 27  ? 0.5522 0.5210 0.5387 0.0805  -0.0888 0.0428  46  LYS E NZ  
3904 N  N   . GLN E 28  ? 0.4544 0.3491 0.4300 0.1020  -0.0966 0.0434  47  GLN E N   
3905 C  CA  . GLN E 28  ? 0.4700 0.3436 0.4371 0.1035  -0.0986 0.0469  47  GLN E CA  
3906 C  C   . GLN E 28  ? 0.4731 0.3364 0.4361 0.0932  -0.0947 0.0506  47  GLN E C   
3907 O  O   . GLN E 28  ? 0.4577 0.3308 0.4278 0.0862  -0.0897 0.0482  47  GLN E O   
3908 C  CB  . GLN E 28  ? 0.4662 0.3387 0.4389 0.1099  -0.0991 0.0416  47  GLN E CB  
3909 C  CG  . GLN E 28  ? 0.5023 0.3526 0.4663 0.1117  -0.1012 0.0445  47  GLN E CG  
3910 C  CD  . GLN E 28  ? 0.5037 0.3538 0.4734 0.1185  -0.1017 0.0388  47  GLN E CD  
3911 O  OE1 . GLN E 28  ? 0.4999 0.3664 0.4793 0.1233  -0.1014 0.0330  47  GLN E OE1 
3912 N  NE2 . GLN E 28  ? 0.5005 0.3323 0.4641 0.1188  -0.1025 0.0404  47  GLN E NE2 
3913 N  N   . PHE E 29  ? 0.6890 0.5338 0.6399 0.0917  -0.0972 0.0568  48  PHE E N   
3914 C  CA  . PHE E 29  ? 0.7043 0.5393 0.6506 0.0817  -0.0938 0.0605  48  PHE E CA  
3915 C  C   . PHE E 29  ? 0.7384 0.5517 0.6763 0.0825  -0.0956 0.0630  48  PHE E C   
3916 O  O   . PHE E 29  ? 0.7586 0.5599 0.6891 0.0899  -0.1006 0.0650  48  PHE E O   
3917 C  CB  . PHE E 29  ? 0.7010 0.5363 0.6404 0.0755  -0.0936 0.0661  48  PHE E CB  
3918 C  CG  . PHE E 29  ? 0.7358 0.5649 0.6657 0.0815  -0.0991 0.0704  48  PHE E CG  
3919 C  CD1 . PHE E 29  ? 0.7323 0.5766 0.6657 0.0856  -0.1008 0.0690  48  PHE E CD1 
3920 C  CD2 . PHE E 29  ? 0.7743 0.5820 0.6913 0.0831  -0.1028 0.0758  48  PHE E CD2 
3921 C  CE1 . PHE E 29  ? 0.7413 0.5804 0.6657 0.0915  -0.1061 0.0731  48  PHE E CE1 
3922 C  CE2 . PHE E 29  ? 0.7964 0.5976 0.7038 0.0890  -0.1081 0.0801  48  PHE E CE2 
3923 C  CZ  . PHE E 29  ? 0.7789 0.5962 0.6901 0.0934  -0.1098 0.0787  48  PHE E CZ  
3924 N  N   . VAL E 30  ? 0.7335 0.5416 0.6723 0.0750  -0.0917 0.0628  49  VAL E N   
3925 C  CA  . VAL E 30  ? 0.7532 0.5414 0.6847 0.0745  -0.0929 0.0646  49  VAL E CA  
3926 C  C   . VAL E 30  ? 0.7670 0.5465 0.6923 0.0635  -0.0898 0.0690  49  VAL E C   
3927 O  O   . VAL E 30  ? 0.7536 0.5440 0.6857 0.0564  -0.0851 0.0672  49  VAL E O   
3928 C  CB  . VAL E 30  ? 0.7321 0.5224 0.6720 0.0778  -0.0913 0.0584  49  VAL E CB  
3929 C  CG1 . VAL E 30  ? 0.7516 0.5216 0.6840 0.0759  -0.0919 0.0601  49  VAL E CG1 
3930 C  CG2 . VAL E 30  ? 0.7328 0.5303 0.6779 0.0891  -0.0945 0.0541  49  VAL E CG2 
3931 N  N   . PRO E 31  ? 0.8387 0.5986 0.7509 0.0620  -0.0926 0.0746  50  PRO E N   
3932 C  CA  . PRO E 31  ? 0.8674 0.6129 0.7705 0.0708  -0.0984 0.0771  50  PRO E CA  
3933 C  C   . PRO E 31  ? 0.8614 0.6149 0.7626 0.0760  -0.1017 0.0792  50  PRO E C   
3934 O  O   . PRO E 31  ? 0.8443 0.6103 0.7478 0.0707  -0.0994 0.0805  50  PRO E O   
3935 C  CB  . PRO E 31  ? 0.9004 0.6235 0.7895 0.0647  -0.0993 0.0832  50  PRO E CB  
3936 C  CG  . PRO E 31  ? 0.8843 0.6141 0.7745 0.0527  -0.0945 0.0852  50  PRO E CG  
3937 C  CD  . PRO E 31  ? 0.8439 0.5943 0.7491 0.0512  -0.0901 0.0790  50  PRO E CD  
3938 N  N   . GLY E 32  ? 0.7314 0.4781 0.6283 0.0865  -0.1069 0.0794  51  GLY E N   
3939 C  CA  . GLY E 32  ? 0.7253 0.4796 0.6203 0.0927  -0.1106 0.0810  51  GLY E CA  
3940 C  C   . GLY E 32  ? 0.7575 0.5009 0.6390 0.0883  -0.1124 0.0889  51  GLY E C   
3941 O  O   . GLY E 32  ? 0.7828 0.5148 0.6540 0.0950  -0.1176 0.0927  51  GLY E O   
3942 N  N   . VAL E 33  ? 0.6720 0.4192 0.5532 0.0770  -0.1081 0.0913  52  VAL E N   
3943 C  CA  . VAL E 33  ? 0.6815 0.4205 0.5506 0.0712  -0.1089 0.0985  52  VAL E CA  
3944 C  C   . VAL E 33  ? 0.6568 0.4141 0.5324 0.0627  -0.1043 0.0981  52  VAL E C   
3945 O  O   . VAL E 33  ? 0.6349 0.4067 0.5228 0.0596  -0.1000 0.0929  52  VAL E O   
3946 C  CB  . VAL E 33  ? 0.7009 0.4168 0.5580 0.0645  -0.1085 0.1034  52  VAL E CB  
3947 C  CG1 . VAL E 33  ? 0.7079 0.4027 0.5556 0.0731  -0.1137 0.1049  52  VAL E CG1 
3948 C  CG2 . VAL E 33  ? 0.6909 0.4102 0.5560 0.0564  -0.1030 0.0997  52  VAL E CG2 
3949 N  N   . PRO E 34  ? 0.9345 0.6911 0.8016 0.0591  -0.1052 0.1037  53  PRO E N   
3950 C  CA  . PRO E 34  ? 0.9264 0.6997 0.7985 0.0509  -0.1010 0.1036  53  PRO E CA  
3951 C  C   . PRO E 34  ? 0.9172 0.6925 0.7943 0.0408  -0.0952 0.1019  53  PRO E C   
3952 O  O   . PRO E 34  ? 0.9277 0.6869 0.7984 0.0366  -0.0947 0.1042  53  PRO E O   
3953 C  CB  . PRO E 34  ? 0.9395 0.7038 0.7974 0.0477  -0.1032 0.1111  53  PRO E CB  
3954 C  CG  . PRO E 34  ? 0.9694 0.7204 0.8185 0.0581  -0.1095 0.1137  53  PRO E CG  
3955 C  CD  . PRO E 34  ? 0.9633 0.7038 0.8152 0.0631  -0.1104 0.1102  53  PRO E CD  
3956 N  N   . GLU E 35  ? 0.8321 0.6270 0.7205 0.0371  -0.0910 0.0978  54  GLU E N   
3957 C  CA  . GLU E 35  ? 0.8072 0.6067 0.7014 0.0282  -0.0855 0.0957  54  GLU E CA  
3958 C  C   . GLU E 35  ? 0.8333 0.6224 0.7170 0.0184  -0.0840 0.1015  54  GLU E C   
3959 O  O   . GLU E 35  ? 0.8310 0.6198 0.7170 0.0109  -0.0801 0.1006  54  GLU E O   
3960 C  CB  . GLU E 35  ? 0.7786 0.6007 0.6849 0.0264  -0.0817 0.0910  54  GLU E CB  
3961 C  CG  . GLU E 35  ? 0.7563 0.5849 0.6701 0.0190  -0.0762 0.0879  54  GLU E CG  
3962 C  CD  . GLU E 35  ? 0.7181 0.5674 0.6419 0.0170  -0.0726 0.0840  54  GLU E CD  
3963 O  OE1 . GLU E 35  ? 0.7125 0.5694 0.6339 0.0164  -0.0733 0.0859  54  GLU E OE1 
3964 O  OE2 . GLU E 35  ? 0.6876 0.5452 0.6212 0.0160  -0.0691 0.0791  54  GLU E OE2 
3965 N  N   . ARG E 36  ? 1.1825 0.9632 1.0543 0.0184  -0.0872 0.1075  55  ARG E N   
3966 C  CA  . ARG E 36  ? 1.2035 0.9756 1.0647 0.0086  -0.0857 0.1133  55  ARG E CA  
3967 C  C   . ARG E 36  ? 1.2209 0.9681 1.0686 0.0078  -0.0884 0.1182  55  ARG E C   
3968 O  O   . ARG E 36  ? 1.2509 0.9881 1.0870 0.0008  -0.0883 0.1241  55  ARG E O   
3969 C  CB  . ARG E 36  ? 1.2112 0.9909 1.0672 0.0074  -0.0866 0.1170  55  ARG E CB  
3970 C  CG  . ARG E 36  ? 1.1967 1.0002 1.0648 0.0073  -0.0837 0.1124  55  ARG E CG  
3971 C  CD  . ARG E 36  ? 1.1737 0.9868 1.0502 -0.0009 -0.0778 0.1090  55  ARG E CD  
3972 N  NE  . ARG E 36  ? 1.1583 0.9928 1.0454 -0.0012 -0.0750 0.1046  55  ARG E NE  
3973 C  CZ  . ARG E 36  ? 1.1595 1.0038 1.0445 -0.0060 -0.0734 0.1065  55  ARG E CZ  
3974 N  NH1 . ARG E 36  ? 1.1708 1.0057 1.0433 -0.0111 -0.0744 0.1129  55  ARG E NH1 
3975 N  NH2 . ARG E 36  ? 1.1366 0.9996 1.0314 -0.0058 -0.0708 0.1021  55  ARG E NH2 
3976 N  N   . THR E 37  ? 0.8505 0.5876 0.6995 0.0147  -0.0908 0.1158  56  THR E N   
3977 C  CA  . THR E 37  ? 0.8882 0.6006 0.7246 0.0145  -0.0935 0.1199  56  THR E CA  
3978 C  C   . THR E 37  ? 0.8922 0.5987 0.7310 0.0073  -0.0899 0.1178  56  THR E C   
3979 O  O   . THR E 37  ? 0.8676 0.5885 0.7192 0.0057  -0.0862 0.1122  56  THR E O   
3980 C  CB  . THR E 37  ? 0.8932 0.5957 0.7276 0.0271  -0.0989 0.1189  56  THR E CB  
3981 O  OG1 . THR E 37  ? 0.8623 0.5756 0.7107 0.0325  -0.0977 0.1115  56  THR E OG1 
3982 C  CG2 . THR E 37  ? 0.8937 0.6018 0.7248 0.0344  -0.1029 0.1212  56  THR E CG2 
3983 N  N   . LEU E 38  ? 1.1104 0.7954 0.9366 0.0027  -0.0909 0.1222  57  LEU E N   
3984 C  CA  . LEU E 38  ? 1.1172 0.7954 0.9443 -0.0048 -0.0877 0.1205  57  LEU E CA  
3985 C  C   . LEU E 38  ? 1.1011 0.7784 0.9370 0.0024  -0.0883 0.1144  57  LEU E C   
3986 O  O   . LEU E 38  ? 1.0987 0.7780 0.9405 -0.0026 -0.0850 0.1109  57  LEU E O   
3987 C  CB  . LEU E 38  ? 1.1416 0.7957 0.9521 -0.0113 -0.0889 0.1267  57  LEU E CB  
3988 C  CG  . LEU E 38  ? 1.1629 0.8166 0.9637 -0.0208 -0.0874 0.1328  57  LEU E CG  
3989 C  CD1 . LEU E 38  ? 1.1771 0.8079 0.9633 -0.0293 -0.0874 0.1377  57  LEU E CD1 
3990 C  CD2 . LEU E 38  ? 1.1043 0.7814 0.9161 -0.0285 -0.0821 0.1300  57  LEU E CD2 
3991 N  N   . GLY E 39  ? 0.9573 0.6320 0.7939 0.0141  -0.0926 0.1131  58  GLY E N   
3992 C  CA  . GLY E 39  ? 0.9348 0.6100 0.7799 0.0218  -0.0934 0.1071  58  GLY E CA  
3993 C  C   . GLY E 39  ? 0.9081 0.6084 0.7700 0.0241  -0.0904 0.1009  58  GLY E C   
3994 O  O   . GLY E 39  ? 0.8945 0.5992 0.7655 0.0292  -0.0900 0.0952  58  GLY E O   
3995 N  N   . ALA E 40  ? 0.8221 0.5382 0.6874 0.0202  -0.0883 0.1019  59  ALA E N   
3996 C  CA  . ALA E 40  ? 0.7805 0.5199 0.6606 0.0214  -0.0852 0.0963  59  ALA E CA  
3997 C  C   . ALA E 40  ? 0.7650 0.5144 0.6503 0.0108  -0.0797 0.0953  59  ALA E C   
3998 O  O   . ALA E 40  ? 0.7606 0.5045 0.6470 0.0064  -0.0775 0.0936  59  ALA E O   
3999 C  CB  . ALA E 40  ? 0.7760 0.5279 0.6577 0.0261  -0.0870 0.0972  59  ALA E CB  
4000 N  N   . SER E 41  ? 0.5906 0.3549 0.4788 0.0070  -0.0775 0.0961  60  SER E N   
4001 C  CA  . SER E 41  ? 0.5650 0.3405 0.4583 -0.0023 -0.0723 0.0948  60  SER E CA  
4002 C  C   . SER E 41  ? 0.5827 0.3545 0.4662 -0.0111 -0.0714 0.1006  60  SER E C   
4003 O  O   . SER E 41  ? 0.5792 0.3615 0.4662 -0.0189 -0.0673 0.1001  60  SER E O   
4004 C  CB  . SER E 41  ? 0.5243 0.3219 0.4305 -0.0002 -0.0697 0.0900  60  SER E CB  
4005 O  OG  . SER E 41  ? 0.5119 0.3137 0.4277 0.0063  -0.0696 0.0843  60  SER E OG  
4006 N  N   . GLY E 42  ? 0.7111 0.4679 0.5820 -0.0098 -0.0753 0.1062  61  GLY E N   
4007 C  CA  . GLY E 42  ? 0.7344 0.4864 0.5947 -0.0180 -0.0747 0.1121  61  GLY E CA  
4008 C  C   . GLY E 42  ? 0.7348 0.5024 0.5969 -0.0181 -0.0741 0.1131  61  GLY E C   
4009 O  O   . GLY E 42  ? 0.7286 0.5087 0.5990 -0.0109 -0.0750 0.1097  61  GLY E O   
4010 N  N   . PRO E 43  ? 0.7877 0.5552 0.6420 -0.0267 -0.0725 0.1177  62  PRO E N   
4011 C  CA  . PRO E 43  ? 0.7919 0.5728 0.6461 -0.0277 -0.0721 0.1193  62  PRO E CA  
4012 C  C   . PRO E 43  ? 0.7697 0.5714 0.6349 -0.0329 -0.0669 0.1151  62  PRO E C   
4013 O  O   . PRO E 43  ? 0.7582 0.5623 0.6288 -0.0378 -0.0635 0.1122  62  PRO E O   
4014 C  CB  . PRO E 43  ? 0.8154 0.5830 0.6542 -0.0349 -0.0728 0.1266  62  PRO E CB  
4015 C  CG  . PRO E 43  ? 0.8173 0.5757 0.6540 -0.0430 -0.0701 0.1266  62  PRO E CG  
4016 C  CD  . PRO E 43  ? 0.7994 0.5539 0.6442 -0.0366 -0.0709 0.1216  62  PRO E CD  
4017 N  N   . ALA E 44  ? 0.7680 0.5844 0.6363 -0.0316 -0.0665 0.1146  63  ALA E N   
4018 C  CA  . ALA E 44  ? 0.7533 0.5890 0.6309 -0.0363 -0.0618 0.1109  63  ALA E CA  
4019 C  C   . ALA E 44  ? 0.7581 0.5936 0.6289 -0.0473 -0.0588 0.1144  63  ALA E C   
4020 O  O   . ALA E 44  ? 0.7651 0.5972 0.6260 -0.0504 -0.0600 0.1195  63  ALA E O   
4021 C  CB  . ALA E 44  ? 0.7455 0.5961 0.6278 -0.0315 -0.0624 0.1091  63  ALA E CB  
4022 N  N   . GLU E 45  ? 0.9261 0.7657 0.8023 -0.0531 -0.0549 0.1117  64  GLU E N   
4023 C  CA  . GLU E 45  ? 0.9321 0.7725 0.8028 -0.0638 -0.0518 0.1144  64  GLU E CA  
4024 C  C   . GLU E 45  ? 0.9126 0.7727 0.7881 -0.0675 -0.0484 0.1127  64  GLU E C   
4025 O  O   . GLU E 45  ? 0.9162 0.7811 0.7894 -0.0762 -0.0452 0.1137  64  GLU E O   
4026 C  CB  . GLU E 45  ? 0.9549 0.7914 0.8288 -0.0686 -0.0493 0.1121  64  GLU E CB  
4027 C  CG  . GLU E 45  ? 0.9930 0.8087 0.8606 -0.0664 -0.0525 0.1140  64  GLU E CG  
4028 C  CD  . GLU E 45  ? 1.0003 0.8116 0.8692 -0.0727 -0.0500 0.1123  64  GLU E CD  
4029 O  OE1 . GLU E 45  ? 0.9983 0.8243 0.8753 -0.0770 -0.0460 0.1086  64  GLU E OE1 
4030 O  OE2 . GLU E 45  ? 1.0088 0.8020 0.8704 -0.0733 -0.0521 0.1145  64  GLU E OE2 
4031 N  N   . GLY E 46  ? 0.8302 0.7017 0.7123 -0.0609 -0.0491 0.1099  65  GLY E N   
4032 C  CA  . GLY E 46  ? 0.8092 0.6988 0.6958 -0.0634 -0.0461 0.1079  65  GLY E CA  
4033 C  C   . GLY E 46  ? 0.7879 0.6919 0.6879 -0.0576 -0.0444 0.1013  65  GLY E C   
4034 O  O   . GLY E 46  ? 0.7753 0.6756 0.6809 -0.0511 -0.0459 0.0984  65  GLY E O   
4035 N  N   . ARG E 47  ? 0.8420 0.7622 0.7467 -0.0602 -0.0413 0.0988  66  ARG E N   
4036 C  CA  . ARG E 47  ? 0.8051 0.7389 0.7218 -0.0555 -0.0393 0.0926  66  ARG E CA  
4037 C  C   . ARG E 47  ? 0.7816 0.7268 0.7046 -0.0605 -0.0345 0.0890  66  ARG E C   
4038 O  O   . ARG E 47  ? 0.7741 0.7282 0.6949 -0.0659 -0.0322 0.0898  66  ARG E O   
4039 C  CB  . ARG E 47  ? 0.7981 0.7413 0.7152 -0.0518 -0.0404 0.0920  66  ARG E CB  
4040 C  CG  . ARG E 47  ? 0.7685 0.7256 0.6971 -0.0477 -0.0381 0.0855  66  ARG E CG  
4041 C  CD  . ARG E 47  ? 0.7644 0.7283 0.6933 -0.0431 -0.0401 0.0848  66  ARG E CD  
4042 N  NE  . ARG E 47  ? 0.7509 0.7285 0.6898 -0.0406 -0.0374 0.0787  66  ARG E NE  
4043 C  CZ  . ARG E 47  ? 0.7466 0.7322 0.6879 -0.0366 -0.0384 0.0765  66  ARG E CZ  
4044 N  NH1 . ARG E 47  ? 0.7552 0.7373 0.6898 -0.0342 -0.0423 0.0799  66  ARG E NH1 
4045 N  NH2 . ARG E 47  ? 0.7036 0.7004 0.6535 -0.0350 -0.0357 0.0708  66  ARG E NH2 
4046 N  N   . VAL E 48  ? 0.4318 0.3772 0.3627 -0.0583 -0.0331 0.0850  67  VAL E N   
4047 C  CA  . VAL E 48  ? 0.4142 0.3697 0.3512 -0.0622 -0.0288 0.0814  67  VAL E CA  
4048 C  C   . VAL E 48  ? 0.3928 0.3638 0.3375 -0.0596 -0.0263 0.0768  67  VAL E C   
4049 O  O   . VAL E 48  ? 0.3824 0.3556 0.3332 -0.0533 -0.0269 0.0734  67  VAL E O   
4050 C  CB  . VAL E 48  ? 0.4109 0.3607 0.3532 -0.0605 -0.0283 0.0788  67  VAL E CB  
4051 C  CG1 . VAL E 48  ? 0.4146 0.3746 0.3622 -0.0646 -0.0242 0.0756  67  VAL E CG1 
4052 C  CG2 . VAL E 48  ? 0.4303 0.3636 0.3650 -0.0626 -0.0310 0.0830  67  VAL E CG2 
4053 N  N   . ALA E 49  ? 0.5617 0.5436 0.5060 -0.0647 -0.0233 0.0763  68  ALA E N   
4054 C  CA  . ALA E 49  ? 0.5545 0.5508 0.5055 -0.0627 -0.0207 0.0718  68  ALA E CA  
4055 C  C   . ALA E 49  ? 0.5627 0.5660 0.5207 -0.0637 -0.0171 0.0676  68  ALA E C   
4056 O  O   . ALA E 49  ? 0.5714 0.5705 0.5282 -0.0675 -0.0164 0.0686  68  ALA E O   
4057 C  CB  . ALA E 49  ? 0.5650 0.5697 0.5110 -0.0668 -0.0198 0.0736  68  ALA E CB  
4058 N  N   . ARG E 50  ? 0.8176 0.8310 0.7824 -0.0603 -0.0149 0.0628  69  ARG E N   
4059 C  CA  . ARG E 50  ? 0.8065 0.8260 0.7781 -0.0598 -0.0118 0.0585  69  ARG E CA  
4060 C  C   . ARG E 50  ? 0.8140 0.8409 0.7840 -0.0660 -0.0092 0.0589  69  ARG E C   
4061 O  O   . ARG E 50  ? 0.8212 0.8499 0.7949 -0.0667 -0.0074 0.0568  69  ARG E O   
4062 C  CB  . ARG E 50  ? 0.7898 0.8178 0.7679 -0.0549 -0.0099 0.0535  69  ARG E CB  
4063 C  CG  . ARG E 50  ? 0.7867 0.8208 0.7711 -0.0538 -0.0067 0.0492  69  ARG E CG  
4064 C  CD  . ARG E 50  ? 0.7621 0.8014 0.7523 -0.0485 -0.0052 0.0445  69  ARG E CD  
4065 N  NE  . ARG E 50  ? 0.7509 0.7822 0.7433 -0.0438 -0.0073 0.0439  69  ARG E NE  
4066 C  CZ  . ARG E 50  ? 0.7620 0.7871 0.7579 -0.0411 -0.0074 0.0426  69  ARG E CZ  
4067 N  NH1 . ARG E 50  ? 0.7670 0.7928 0.7647 -0.0425 -0.0057 0.0417  69  ARG E NH1 
4068 N  NH2 . ARG E 50  ? 0.7280 0.7470 0.7259 -0.0369 -0.0092 0.0419  69  ARG E NH2 
4069 N  N   . GLY E 51  ? 0.5244 0.5562 0.4888 -0.0706 -0.0089 0.0614  70  GLY E N   
4070 C  CA  . GLY E 51  ? 0.5409 0.5812 0.5037 -0.0769 -0.0064 0.0617  70  GLY E CA  
4071 C  C   . GLY E 51  ? 0.5515 0.5835 0.5078 -0.0833 -0.0074 0.0661  70  GLY E C   
4072 O  O   . GLY E 51  ? 0.5369 0.5750 0.4928 -0.0886 -0.0053 0.0658  70  GLY E O   
4073 N  N   . SER E 52  ? 0.6952 0.7134 0.6463 -0.0826 -0.0108 0.0701  71  SER E N   
4074 C  CA  . SER E 52  ? 0.7146 0.7226 0.6578 -0.0888 -0.0121 0.0750  71  SER E CA  
4075 C  C   . SER E 52  ? 0.7038 0.7098 0.6494 -0.0918 -0.0109 0.0737  71  SER E C   
4076 O  O   . SER E 52  ? 0.6973 0.7094 0.6509 -0.0884 -0.0092 0.0691  71  SER E O   
4077 C  CB  . SER E 52  ? 0.7224 0.7147 0.6602 -0.0858 -0.0163 0.0789  71  SER E CB  
4078 O  OG  . SER E 52  ? 0.7087 0.6934 0.6517 -0.0800 -0.0176 0.0767  71  SER E OG  
4079 N  N   . GLU E 53  ? 0.9201 0.9171 0.8584 -0.0982 -0.0118 0.0778  72  GLU E N   
4080 C  CA  . GLU E 53  ? 0.9433 0.9370 0.8827 -0.1019 -0.0109 0.0769  72  GLU E CA  
4081 C  C   . GLU E 53  ? 0.9465 0.9237 0.8851 -0.0981 -0.0139 0.0781  72  GLU E C   
4082 O  O   . GLU E 53  ? 0.9501 0.9232 0.8905 -0.0995 -0.0136 0.0768  72  GLU E O   
4083 C  CB  . GLU E 53  ? 0.9686 0.9627 0.9005 -0.1120 -0.0097 0.0802  72  GLU E CB  
4084 C  CG  . GLU E 53  ? 0.9702 0.9831 0.9050 -0.1164 -0.0060 0.0777  72  GLU E CG  
4085 C  CD  . GLU E 53  ? 0.9721 0.9954 0.9160 -0.1149 -0.0036 0.0723  72  GLU E CD  
4086 O  OE1 . GLU E 53  ? 0.9612 0.9768 0.9064 -0.1150 -0.0043 0.0717  72  GLU E OE1 
4087 O  OE2 . GLU E 53  ? 0.9518 0.9909 0.9011 -0.1135 -0.0011 0.0686  72  GLU E OE2 
4088 N  N   . ARG E 54  ? 0.8315 0.7995 0.7670 -0.0932 -0.0170 0.0804  73  ARG E N   
4089 C  CA  . ARG E 54  ? 0.8334 0.7865 0.7686 -0.0882 -0.0200 0.0810  73  ARG E CA  
4090 C  C   . ARG E 54  ? 0.8047 0.7628 0.7497 -0.0799 -0.0197 0.0760  73  ARG E C   
4091 O  O   . ARG E 54  ? 0.7925 0.7409 0.7392 -0.0747 -0.0219 0.0755  73  ARG E O   
4092 C  CB  . ARG E 54  ? 0.8356 0.7763 0.7622 -0.0868 -0.0236 0.0860  73  ARG E CB  
4093 C  CG  . ARG E 54  ? 0.8624 0.7940 0.7776 -0.0950 -0.0243 0.0914  73  ARG E CG  
4094 C  CD  . ARG E 54  ? 0.8926 0.8136 0.7987 -0.0932 -0.0278 0.0965  73  ARG E CD  
4095 N  NE  . ARG E 54  ? 0.9012 0.8093 0.8075 -0.0855 -0.0314 0.0967  73  ARG E NE  
4096 C  CZ  . ARG E 54  ? 0.8773 0.7865 0.7857 -0.0778 -0.0337 0.0962  73  ARG E CZ  
4097 N  NH1 . ARG E 54  ? 0.8489 0.7708 0.7591 -0.0770 -0.0327 0.0955  73  ARG E NH1 
4098 N  NH2 . ARG E 54  ? 0.8635 0.7615 0.7722 -0.0710 -0.0370 0.0961  73  ARG E NH2 
4099 N  N   . PHE E 55  ? 0.7339 0.7071 0.6854 -0.0787 -0.0169 0.0724  74  PHE E N   
4100 C  CA  . PHE E 55  ? 0.7135 0.6923 0.6740 -0.0716 -0.0161 0.0675  74  PHE E CA  
4101 C  C   . PHE E 55  ? 0.7252 0.7063 0.6912 -0.0718 -0.0142 0.0641  74  PHE E C   
4102 O  O   . PHE E 55  ? 0.7042 0.6827 0.6757 -0.0663 -0.0144 0.0612  74  PHE E O   
4103 C  CB  . PHE E 55  ? 0.6975 0.6902 0.6613 -0.0702 -0.0140 0.0651  74  PHE E CB  
4104 C  CG  . PHE E 55  ? 0.6786 0.6768 0.6510 -0.0634 -0.0128 0.0602  74  PHE E CG  
4105 C  CD1 . PHE E 55  ? 0.6672 0.6610 0.6413 -0.0574 -0.0148 0.0595  74  PHE E CD1 
4106 C  CD2 . PHE E 55  ? 0.6803 0.6879 0.6586 -0.0631 -0.0097 0.0561  74  PHE E CD2 
4107 C  CE1 . PHE E 55  ? 0.6495 0.6479 0.6309 -0.0518 -0.0134 0.0550  74  PHE E CE1 
4108 C  CE2 . PHE E 55  ? 0.6732 0.6845 0.6584 -0.0571 -0.0085 0.0518  74  PHE E CE2 
4109 C  CZ  . PHE E 55  ? 0.6476 0.6542 0.6342 -0.0518 -0.0103 0.0513  74  PHE E CZ  
4110 N  N   . ARG E 56  ? 1.1666 1.1530 1.1310 -0.0784 -0.0122 0.0644  75  ARG E N   
4111 C  CA  . ARG E 56  ? 1.1524 1.1424 1.1217 -0.0792 -0.0104 0.0612  75  ARG E CA  
4112 C  C   . ARG E 56  ? 1.1531 1.1291 1.1204 -0.0794 -0.0125 0.0624  75  ARG E C   
4113 O  O   . ARG E 56  ? 1.1524 1.1294 1.1239 -0.0789 -0.0116 0.0596  75  ARG E O   
4114 C  CB  . ARG E 56  ? 1.1774 1.1784 1.1455 -0.0864 -0.0078 0.0610  75  ARG E CB  
4115 C  CG  . ARG E 56  ? 1.1816 1.1978 1.1525 -0.0858 -0.0054 0.0590  75  ARG E CG  
4116 C  CD  . ARG E 56  ? 1.1929 1.2212 1.1634 -0.0926 -0.0027 0.0582  75  ARG E CD  
4117 N  NE  . ARG E 56  ? 1.1863 1.2296 1.1600 -0.0912 -0.0003 0.0556  75  ARG E NE  
4118 C  CZ  . ARG E 56  ? 1.1628 1.2163 1.1436 -0.0866 0.0017  0.0508  75  ARG E CZ  
4119 N  NH1 . ARG E 56  ? 1.1520 1.2026 1.1375 -0.0830 0.0016  0.0483  75  ARG E NH1 
4120 N  NH2 . ARG E 56  ? 1.1141 1.1802 1.0969 -0.0854 0.0037  0.0486  75  ARG E NH2 
4121 N  N   . ASP E 57  ? 0.7023 0.6651 0.6629 -0.0798 -0.0154 0.0664  76  ASP E N   
4122 C  CA  . ASP E 57  ? 0.7107 0.6586 0.6687 -0.0792 -0.0178 0.0676  76  ASP E CA  
4123 C  C   . ASP E 57  ? 0.6877 0.6311 0.6508 -0.0704 -0.0193 0.0652  76  ASP E C   
4124 O  O   . ASP E 57  ? 0.6678 0.6013 0.6313 -0.0683 -0.0208 0.0646  76  ASP E O   
4125 C  CB  . ASP E 57  ? 0.7415 0.6763 0.6892 -0.0834 -0.0203 0.0730  76  ASP E CB  
4126 C  CG  . ASP E 57  ? 0.7669 0.7036 0.7089 -0.0932 -0.0187 0.0753  76  ASP E CG  
4127 O  OD1 . ASP E 57  ? 0.7683 0.7152 0.7147 -0.0966 -0.0160 0.0724  76  ASP E OD1 
4128 O  OD2 . ASP E 57  ? 0.7865 0.7148 0.7193 -0.0976 -0.0202 0.0801  76  ASP E OD2 
4129 N  N   . LEU E 58  ? 0.6901 0.6411 0.6572 -0.0655 -0.0189 0.0637  77  LEU E N   
4130 C  CA  . LEU E 58  ? 0.6593 0.6082 0.6318 -0.0576 -0.0199 0.0609  77  LEU E CA  
4131 C  C   . LEU E 58  ? 0.6451 0.6013 0.6255 -0.0551 -0.0173 0.0562  77  LEU E C   
4132 O  O   . LEU E 58  ? 0.6468 0.6148 0.6304 -0.0567 -0.0145 0.0541  77  LEU E O   
4133 C  CB  . LEU E 58  ? 0.6463 0.6006 0.6198 -0.0538 -0.0203 0.0609  77  LEU E CB  
4134 C  CG  . LEU E 58  ? 0.6648 0.6106 0.6308 -0.0539 -0.0236 0.0654  77  LEU E CG  
4135 C  CD1 . LEU E 58  ? 0.6373 0.5897 0.6054 -0.0495 -0.0240 0.0645  77  LEU E CD1 
4136 C  CD2 . LEU E 58  ? 0.6619 0.5928 0.6251 -0.0510 -0.0268 0.0668  77  LEU E CD2 
4137 N  N   . VAL E 59  ? 0.5636 0.5127 0.5468 -0.0510 -0.0184 0.0544  78  VAL E N   
4138 C  CA  . VAL E 59  ? 0.5388 0.4933 0.5287 -0.0485 -0.0162 0.0501  78  VAL E CA  
4139 C  C   . VAL E 59  ? 0.5211 0.4764 0.5164 -0.0412 -0.0162 0.0472  78  VAL E C   
4140 O  O   . VAL E 59  ? 0.5205 0.4680 0.5145 -0.0377 -0.0187 0.0482  78  VAL E O   
4141 C  CB  . VAL E 59  ? 0.5515 0.4983 0.5404 -0.0504 -0.0168 0.0499  78  VAL E CB  
4142 C  CG1 . VAL E 59  ? 0.5317 0.4863 0.5266 -0.0492 -0.0143 0.0459  78  VAL E CG1 
4143 C  CG2 . VAL E 59  ? 0.5905 0.5336 0.5727 -0.0580 -0.0174 0.0533  78  VAL E CG2 
4144 N  N   . PRO E 60  ? 0.3794 0.3441 0.3803 -0.0389 -0.0135 0.0436  79  PRO E N   
4145 C  CA  . PRO E 60  ? 0.3468 0.3131 0.3528 -0.0328 -0.0129 0.0405  79  PRO E CA  
4146 C  C   . PRO E 60  ? 0.3332 0.2924 0.3417 -0.0294 -0.0136 0.0387  79  PRO E C   
4147 O  O   . PRO E 60  ? 0.3397 0.2987 0.3491 -0.0307 -0.0126 0.0376  79  PRO E O   
4148 C  CB  . PRO E 60  ? 0.3285 0.3059 0.3384 -0.0325 -0.0095 0.0376  79  PRO E CB  
4149 C  CG  . PRO E 60  ? 0.3418 0.3252 0.3486 -0.0381 -0.0087 0.0395  79  PRO E CG  
4150 C  CD  . PRO E 60  ? 0.3755 0.3508 0.3777 -0.0423 -0.0107 0.0425  79  PRO E CD  
4151 N  N   . ASN E 61  ? 0.3172 0.2713 0.3267 -0.0250 -0.0153 0.0382  80  ASN E N   
4152 C  CA  . ASN E 61  ? 0.3125 0.2609 0.3248 -0.0212 -0.0158 0.0360  80  ASN E CA  
4153 C  C   . ASN E 61  ? 0.2915 0.2461 0.3095 -0.0173 -0.0132 0.0321  80  ASN E C   
4154 O  O   . ASN E 61  ? 0.2786 0.2370 0.2984 -0.0149 -0.0128 0.0310  80  ASN E O   
4155 C  CB  . ASN E 61  ? 0.3259 0.2653 0.3361 -0.0183 -0.0191 0.0374  80  ASN E CB  
4156 C  CG  . ASN E 61  ? 0.3383 0.2708 0.3503 -0.0151 -0.0200 0.0354  80  ASN E CG  
4157 O  OD1 . ASN E 61  ? 0.3599 0.2839 0.3695 -0.0130 -0.0228 0.0365  80  ASN E OD1 
4158 N  ND2 . ASN E 61  ? 0.3203 0.2565 0.3362 -0.0144 -0.0175 0.0324  80  ASN E ND2 
4159 N  N   . TYR E 62  ? 0.4097 0.3651 0.4300 -0.0170 -0.0114 0.0299  81  TYR E N   
4160 C  CA  . TYR E 62  ? 0.3924 0.3529 0.4172 -0.0137 -0.0087 0.0264  81  TYR E CA  
4161 C  C   . TYR E 62  ? 0.3876 0.3429 0.4149 -0.0099 -0.0090 0.0242  81  TYR E C   
4162 O  O   . TYR E 62  ? 0.3864 0.3445 0.4167 -0.0076 -0.0067 0.0214  81  TYR E O   
4163 C  CB  . TYR E 62  ? 0.3648 0.3317 0.3903 -0.0155 -0.0061 0.0254  81  TYR E CB  
4164 C  CG  . TYR E 62  ? 0.3594 0.3338 0.3837 -0.0181 -0.0050 0.0264  81  TYR E CG  
4165 C  CD1 . TYR E 62  ? 0.3484 0.3281 0.3745 -0.0161 -0.0033 0.0248  81  TYR E CD1 
4166 C  CD2 . TYR E 62  ? 0.3654 0.3418 0.3866 -0.0228 -0.0055 0.0287  81  TYR E CD2 
4167 C  CE1 . TYR E 62  ? 0.3439 0.3306 0.3688 -0.0183 -0.0022 0.0254  81  TYR E CE1 
4168 C  CE2 . TYR E 62  ? 0.3620 0.3460 0.3821 -0.0251 -0.0043 0.0294  81  TYR E CE2 
4169 C  CZ  . TYR E 62  ? 0.3539 0.3430 0.3759 -0.0226 -0.0027 0.0277  81  TYR E CZ  
4170 O  OH  . TYR E 62  ? 0.3406 0.3375 0.3615 -0.0248 -0.0016 0.0281  81  TYR E OH  
4171 N  N   . ASN E 63  ? 0.2930 0.2405 0.3186 -0.0093 -0.0118 0.0254  82  ASN E N   
4172 C  CA  . ASN E 63  ? 0.2982 0.2407 0.3258 -0.0056 -0.0124 0.0232  82  ASN E CA  
4173 C  C   . ASN E 63  ? 0.2886 0.2353 0.3204 -0.0018 -0.0106 0.0201  82  ASN E C   
4174 O  O   . ASN E 63  ? 0.2900 0.2384 0.3225 -0.0003 -0.0114 0.0202  82  ASN E O   
4175 C  CB  . ASN E 63  ? 0.3223 0.2560 0.3472 -0.0047 -0.0160 0.0249  82  ASN E CB  
4176 C  CG  . ASN E 63  ? 0.3200 0.2481 0.3466 -0.0013 -0.0167 0.0227  82  ASN E CG  
4177 O  OD1 . ASN E 63  ? 0.3125 0.2441 0.3429 0.0010  -0.0145 0.0196  82  ASN E OD1 
4178 N  ND2 . ASN E 63  ? 0.3274 0.2465 0.3507 -0.0011 -0.0197 0.0241  82  ASN E ND2 
4179 N  N   . PRO E 64  ? 0.2793 0.2279 0.3137 -0.0004 -0.0081 0.0174  83  PRO E N   
4180 C  CA  . PRO E 64  ? 0.2708 0.2230 0.3087 0.0025  -0.0058 0.0144  83  PRO E CA  
4181 C  C   . PRO E 64  ? 0.2784 0.2275 0.3181 0.0059  -0.0074 0.0130  83  PRO E C   
4182 O  O   . PRO E 64  ? 0.2830 0.2357 0.3255 0.0078  -0.0060 0.0107  83  PRO E O   
4183 C  CB  . PRO E 64  ? 0.2768 0.2295 0.3156 0.0030  -0.0033 0.0126  83  PRO E CB  
4184 C  CG  . PRO E 64  ? 0.2705 0.2229 0.3067 -0.0002 -0.0038 0.0145  83  PRO E CG  
4185 C  CD  . PRO E 64  ? 0.2834 0.2309 0.3170 -0.0019 -0.0072 0.0172  83  PRO E CD  
4186 N  N   . ASP E 65  ? 0.3538 0.2963 0.3919 0.0065  -0.0103 0.0141  84  ASP E N   
4187 C  CA  . ASP E 65  ? 0.3689 0.3085 0.4087 0.0102  -0.0122 0.0126  84  ASP E CA  
4188 C  C   . ASP E 65  ? 0.3706 0.3112 0.4097 0.0112  -0.0146 0.0140  84  ASP E C   
4189 O  O   . ASP E 65  ? 0.3773 0.3159 0.4173 0.0146  -0.0168 0.0131  84  ASP E O   
4190 C  CB  . ASP E 65  ? 0.3728 0.3043 0.4107 0.0110  -0.0144 0.0129  84  ASP E CB  
4191 C  CG  . ASP E 65  ? 0.3810 0.3120 0.4199 0.0108  -0.0122 0.0109  84  ASP E CG  
4192 O  OD1 . ASP E 65  ? 0.3643 0.3003 0.4061 0.0119  -0.0093 0.0084  84  ASP E OD1 
4193 O  OD2 . ASP E 65  ? 0.3965 0.3220 0.4329 0.0093  -0.0134 0.0118  84  ASP E OD2 
4194 N  N   . ILE E 66  ? 0.3377 0.2819 0.3750 0.0083  -0.0143 0.0161  85  ILE E N   
4195 C  CA  . ILE E 66  ? 0.3377 0.2838 0.3741 0.0089  -0.0164 0.0176  85  ILE E CA  
4196 C  C   . ILE E 66  ? 0.3304 0.2851 0.3686 0.0076  -0.0138 0.0166  85  ILE E C   
4197 O  O   . ILE E 66  ? 0.3194 0.2770 0.3571 0.0047  -0.0114 0.0169  85  ILE E O   
4198 C  CB  . ILE E 66  ? 0.3467 0.2876 0.3777 0.0063  -0.0191 0.0219  85  ILE E CB  
4199 C  CG1 . ILE E 66  ? 0.3631 0.2942 0.3914 0.0071  -0.0216 0.0230  85  ILE E CG1 
4200 C  CG2 . ILE E 66  ? 0.3426 0.2854 0.3720 0.0072  -0.0214 0.0236  85  ILE E CG2 
4201 C  CD1 . ILE E 66  ? 0.3763 0.3010 0.3985 0.0035  -0.0238 0.0273  85  ILE E CD1 
4202 N  N   . ILE E 67  ? 0.2649 0.2239 0.3052 0.0098  -0.0145 0.0151  86  ILE E N   
4203 C  CA  . ILE E 67  ? 0.2531 0.2200 0.2949 0.0085  -0.0123 0.0139  86  ILE E CA  
4204 C  C   . ILE E 67  ? 0.2584 0.2268 0.2969 0.0068  -0.0144 0.0169  86  ILE E C   
4205 O  O   . ILE E 67  ? 0.2663 0.2335 0.3037 0.0088  -0.0176 0.0181  86  ILE E O   
4206 C  CB  . ILE E 67  ? 0.2471 0.2190 0.2932 0.0112  -0.0115 0.0101  86  ILE E CB  
4207 C  CG1 . ILE E 67  ? 0.2421 0.2128 0.2912 0.0125  -0.0091 0.0070  86  ILE E CG1 
4208 C  CG2 . ILE E 67  ? 0.2407 0.2202 0.2879 0.0094  -0.0093 0.0087  86  ILE E CG2 
4209 C  CD1 . ILE E 67  ? 0.2307 0.2070 0.2841 0.0144  -0.0077 0.0030  86  ILE E CD1 
4210 N  N   . PHE E 68  ? 0.2638 0.2351 0.3005 0.0034  -0.0126 0.0182  87  PHE E N   
4211 C  CA  . PHE E 68  ? 0.2623 0.2362 0.2958 0.0014  -0.0141 0.0209  87  PHE E CA  
4212 C  C   . PHE E 68  ? 0.2654 0.2476 0.3010 0.0012  -0.0123 0.0185  87  PHE E C   
4213 O  O   . PHE E 68  ? 0.2614 0.2474 0.2985 -0.0003 -0.0089 0.0165  87  PHE E O   
4214 C  CB  . PHE E 68  ? 0.2691 0.2418 0.2989 -0.0026 -0.0134 0.0237  87  PHE E CB  
4215 C  CG  . PHE E 68  ? 0.2857 0.2501 0.3125 -0.0033 -0.0155 0.0264  87  PHE E CG  
4216 C  CD1 . PHE E 68  ? 0.3048 0.2647 0.3266 -0.0048 -0.0186 0.0303  87  PHE E CD1 
4217 C  CD2 . PHE E 68  ? 0.2813 0.2419 0.3097 -0.0027 -0.0144 0.0250  87  PHE E CD2 
4218 C  CE1 . PHE E 68  ? 0.3092 0.2606 0.3278 -0.0059 -0.0204 0.0326  87  PHE E CE1 
4219 C  CE2 . PHE E 68  ? 0.2904 0.2433 0.3160 -0.0036 -0.0163 0.0271  87  PHE E CE2 
4220 C  CZ  . PHE E 68  ? 0.3028 0.2508 0.3233 -0.0054 -0.0193 0.0308  87  PHE E CZ  
4221 N  N   . LYS E 69  ? 0.2562 0.2410 0.2919 0.0028  -0.0146 0.0185  88  LYS E N   
4222 C  CA  . LYS E 69  ? 0.2496 0.2426 0.2873 0.0026  -0.0132 0.0160  88  LYS E CA  
4223 C  C   . LYS E 69  ? 0.2445 0.2413 0.2804 -0.0010 -0.0107 0.0165  88  LYS E C   
4224 O  O   . LYS E 69  ? 0.2431 0.2437 0.2812 -0.0018 -0.0073 0.0135  88  LYS E O   
4225 C  CB  . LYS E 69  ? 0.2593 0.2547 0.2958 0.0044  -0.0168 0.0170  88  LYS E CB  
4226 C  CG  . LYS E 69  ? 0.2469 0.2513 0.2861 0.0044  -0.0157 0.0138  88  LYS E CG  
4227 C  CD  . LYS E 69  ? 0.2539 0.2611 0.2921 0.0068  -0.0196 0.0147  88  LYS E CD  
4228 C  CE  . LYS E 69  ? 0.2572 0.2741 0.2974 0.0061  -0.0186 0.0116  88  LYS E CE  
4229 N  NZ  . LYS E 69  ? 0.2538 0.2749 0.2996 0.0066  -0.0155 0.0064  88  LYS E NZ  
4230 N  N   . ASP E 70  ? 0.2830 0.2783 0.3144 -0.0032 -0.0124 0.0204  89  ASP E N   
4231 C  CA  . ASP E 70  ? 0.2801 0.2795 0.3095 -0.0066 -0.0102 0.0210  89  ASP E CA  
4232 C  C   . ASP E 70  ? 0.2707 0.2778 0.3020 -0.0069 -0.0081 0.0178  89  ASP E C   
4233 O  O   . ASP E 70  ? 0.2606 0.2705 0.2928 -0.0081 -0.0048 0.0158  89  ASP E O   
4234 C  CB  . ASP E 70  ? 0.2722 0.2693 0.3022 -0.0078 -0.0075 0.0206  89  ASP E CB  
4235 C  CG  . ASP E 70  ? 0.2719 0.2732 0.2994 -0.0110 -0.0058 0.0216  89  ASP E CG  
4236 O  OD1 . ASP E 70  ? 0.2720 0.2765 0.2966 -0.0129 -0.0071 0.0237  89  ASP E OD1 
4237 O  OD2 . ASP E 70  ? 0.2760 0.2779 0.3045 -0.0115 -0.0031 0.0203  89  ASP E OD2 
4238 N  N   . GLU E 71  ? 0.3040 0.3144 0.3357 -0.0055 -0.0101 0.0172  90  GLU E N   
4239 C  CA  . GLU E 71  ? 0.2978 0.3157 0.3311 -0.0061 -0.0083 0.0140  90  GLU E CA  
4240 C  C   . GLU E 71  ? 0.2928 0.3148 0.3226 -0.0092 -0.0076 0.0156  90  GLU E C   
4241 O  O   . GLU E 71  ? 0.2924 0.3204 0.3229 -0.0102 -0.0056 0.0129  90  GLU E O   
4242 C  CB  . GLU E 71  ? 0.1632 0.1846 0.1978 -0.0040 -0.0110 0.0130  90  GLU E CB  
4243 C  CG  . GLU E 71  ? 0.1749 0.1972 0.2052 -0.0041 -0.0148 0.0168  90  GLU E CG  
4244 C  CD  . GLU E 71  ? 0.3204 0.3346 0.3479 -0.0026 -0.0182 0.0209  90  GLU E CD  
4245 O  OE1 . GLU E 71  ? 0.3138 0.3222 0.3432 -0.0013 -0.0177 0.0205  90  GLU E OE1 
4246 O  OE2 . GLU E 71  ? 0.1831 0.1962 0.2061 -0.0026 -0.0214 0.0245  90  GLU E OE2 
4247 N  N   . GLU E 72  ? 0.2162 0.2350 0.2421 -0.0108 -0.0091 0.0198  91  GLU E N   
4248 C  CA  . GLU E 72  ? 0.2244 0.2473 0.2468 -0.0140 -0.0082 0.0214  91  GLU E CA  
4249 C  C   . GLU E 72  ? 0.2151 0.2394 0.2390 -0.0151 -0.0043 0.0191  91  GLU E C   
4250 O  O   . GLU E 72  ? 0.2141 0.2435 0.2363 -0.0171 -0.0026 0.0188  91  GLU E O   
4251 C  CB  . GLU E 72  ? 0.2375 0.2563 0.2551 -0.0160 -0.0108 0.0265  91  GLU E CB  
4252 C  CG  . GLU E 72  ? 0.2580 0.2743 0.2726 -0.0148 -0.0149 0.0294  91  GLU E CG  
4253 C  CD  . GLU E 72  ? 0.2617 0.2710 0.2782 -0.0113 -0.0171 0.0295  91  GLU E CD  
4254 O  OE1 . GLU E 72  ? 0.2482 0.2539 0.2676 -0.0105 -0.0155 0.0280  91  GLU E OE1 
4255 O  OE2 . GLU E 72  ? 0.2748 0.2826 0.2896 -0.0091 -0.0206 0.0310  91  GLU E OE2 
4256 N  N   . ASN E 73  ? 0.3445 0.3644 0.3713 -0.0134 -0.0029 0.0175  92  ASN E N   
4257 C  CA  . ASN E 73  ? 0.3304 0.3505 0.3581 -0.0137 0.0005  0.0157  92  ASN E CA  
4258 C  C   . ASN E 73  ? 0.3400 0.3615 0.3646 -0.0164 0.0005  0.0185  92  ASN E C   
4259 O  O   . ASN E 73  ? 0.3378 0.3638 0.3620 -0.0173 0.0030  0.0171  92  ASN E O   
4260 C  CB  . ASN E 73  ? 0.3269 0.3518 0.3560 -0.0134 0.0035  0.0117  92  ASN E CB  
4261 C  CG  . ASN E 73  ? 0.3356 0.3589 0.3680 -0.0114 0.0043  0.0083  92  ASN E CG  
4262 O  OD1 . ASN E 73  ? 0.3445 0.3629 0.3789 -0.0097 0.0038  0.0083  92  ASN E OD1 
4263 N  ND2 . ASN E 73  ? 0.3355 0.3633 0.3684 -0.0118 0.0056  0.0053  92  ASN E ND2 
4264 N  N   . SER E 74  ? 0.2802 0.2979 0.3023 -0.0176 -0.0022 0.0224  93  SER E N   
4265 C  CA  . SER E 74  ? 0.2802 0.2993 0.2991 -0.0209 -0.0024 0.0253  93  SER E CA  
4266 C  C   . SER E 74  ? 0.2857 0.2977 0.3037 -0.0215 -0.0040 0.0279  93  SER E C   
4267 O  O   . SER E 74  ? 0.2931 0.3055 0.3085 -0.0246 -0.0041 0.0301  93  SER E O   
4268 C  CB  . SER E 74  ? 0.3051 0.3277 0.3199 -0.0235 -0.0042 0.0279  93  SER E CB  
4269 O  OG  . SER E 74  ? 0.3146 0.3322 0.3278 -0.0225 -0.0076 0.0303  93  SER E OG  
4270 N  N   . GLY E 75  ? 0.2962 0.3019 0.3161 -0.0187 -0.0054 0.0273  94  GLY E N   
4271 C  CA  . GLY E 75  ? 0.3128 0.3112 0.3320 -0.0188 -0.0070 0.0293  94  GLY E CA  
4272 C  C   . GLY E 75  ? 0.1774 0.1713 0.1917 -0.0213 -0.0102 0.0337  94  GLY E C   
4273 O  O   . GLY E 75  ? 0.1811 0.1691 0.1934 -0.0229 -0.0112 0.0357  94  GLY E O   
4274 N  N   . ALA E 76  ? 0.3205 0.3167 0.3323 -0.0217 -0.0117 0.0352  95  ALA E N   
4275 C  CA  . ALA E 76  ? 0.3404 0.3319 0.3465 -0.0240 -0.0148 0.0397  95  ALA E CA  
4276 C  C   . ALA E 76  ? 0.3468 0.3283 0.3521 -0.0213 -0.0179 0.0410  95  ALA E C   
4277 O  O   . ALA E 76  ? 0.3657 0.3400 0.3658 -0.0231 -0.0204 0.0449  95  ALA E O   
4278 C  CB  . ALA E 76  ? 0.3407 0.3373 0.3443 -0.0244 -0.0158 0.0407  95  ALA E CB  
4279 N  N   . ASP E 77  ? 0.3295 0.3103 0.3396 -0.0169 -0.0177 0.0378  96  ASP E N   
4280 C  CA  . ASP E 77  ? 0.3371 0.3095 0.3471 -0.0135 -0.0206 0.0384  96  ASP E CA  
4281 C  C   . ASP E 77  ? 0.3527 0.3176 0.3618 -0.0148 -0.0206 0.0393  96  ASP E C   
4282 O  O   . ASP E 77  ? 0.3703 0.3262 0.3765 -0.0138 -0.0234 0.0414  96  ASP E O   
4283 C  CB  . ASP E 77  ? 0.3237 0.2988 0.3395 -0.0089 -0.0199 0.0342  96  ASP E CB  
4284 C  CG  . ASP E 77  ? 0.3172 0.2999 0.3341 -0.0078 -0.0200 0.0328  96  ASP E CG  
4285 O  OD1 . ASP E 77  ? 0.3293 0.3143 0.3421 -0.0100 -0.0211 0.0354  96  ASP E OD1 
4286 O  OD2 . ASP E 77  ? 0.3029 0.2895 0.3247 -0.0049 -0.0190 0.0290  96  ASP E OD2 
4287 N  N   . ARG E 78  ? 0.3799 0.3484 0.3912 -0.0169 -0.0175 0.0376  97  ARG E N   
4288 C  CA  . ARG E 78  ? 0.3713 0.3342 0.3822 -0.0183 -0.0172 0.0380  97  ARG E CA  
4289 C  C   . ARG E 78  ? 0.4015 0.3592 0.4062 -0.0230 -0.0189 0.0422  97  ARG E C   
4290 O  O   . ARG E 78  ? 0.4219 0.3713 0.4245 -0.0237 -0.0203 0.0435  97  ARG E O   
4291 C  CB  . ARG E 78  ? 0.3627 0.3318 0.3774 -0.0191 -0.0135 0.0351  97  ARG E CB  
4292 C  CG  . ARG E 78  ? 0.3530 0.3265 0.3731 -0.0151 -0.0115 0.0310  97  ARG E CG  
4293 C  CD  . ARG E 78  ? 0.3393 0.3178 0.3620 -0.0155 -0.0080 0.0285  97  ARG E CD  
4294 N  NE  . ARG E 78  ? 0.3389 0.3200 0.3657 -0.0120 -0.0060 0.0248  97  ARG E NE  
4295 C  CZ  . ARG E 78  ? 0.3405 0.3177 0.3700 -0.0091 -0.0057 0.0228  97  ARG E CZ  
4296 N  NH1 . ARG E 78  ? 0.3345 0.3051 0.3631 -0.0089 -0.0075 0.0239  97  ARG E NH1 
4297 N  NH2 . ARG E 78  ? 0.3360 0.3157 0.3688 -0.0066 -0.0036 0.0196  97  ARG E NH2 
4298 N  N   . LEU E 79  ? 0.3330 0.2957 0.3344 -0.0264 -0.0186 0.0444  98  LEU E N   
4299 C  CA  . LEU E 79  ? 0.3528 0.3113 0.3477 -0.0316 -0.0198 0.0485  98  LEU E CA  
4300 C  C   . LEU E 79  ? 0.3750 0.3218 0.3647 -0.0306 -0.0237 0.0518  98  LEU E C   
4301 O  O   . LEU E 79  ? 0.3682 0.3137 0.3574 -0.0268 -0.0258 0.0522  98  LEU E O   
4302 C  CB  . LEU E 79  ? 0.3542 0.3211 0.3467 -0.0351 -0.0188 0.0500  98  LEU E CB  
4303 C  CG  . LEU E 79  ? 0.3550 0.3332 0.3514 -0.0367 -0.0150 0.0471  98  LEU E CG  
4304 C  CD1 . LEU E 79  ? 0.3785 0.3645 0.3719 -0.0401 -0.0142 0.0486  98  LEU E CD1 
4305 C  CD2 . LEU E 79  ? 0.3608 0.3384 0.3575 -0.0399 -0.0136 0.0467  98  LEU E CD2 
4306 N  N   . MET E 80  ? 0.3943 0.3325 0.3799 -0.0338 -0.0247 0.0540  99  MET E N   
4307 C  CA  . MET E 80  ? 0.4134 0.3384 0.3929 -0.0330 -0.0284 0.0573  99  MET E CA  
4308 C  C   . MET E 80  ? 0.4371 0.3543 0.4109 -0.0390 -0.0287 0.0601  99  MET E C   
4309 O  O   . MET E 80  ? 0.4451 0.3683 0.4203 -0.0436 -0.0260 0.0592  99  MET E O   
4310 C  CB  . MET E 80  ? 0.4034 0.3229 0.3868 -0.0264 -0.0300 0.0547  99  MET E CB  
4311 C  CG  . MET E 80  ? 0.4000 0.3197 0.3884 -0.0260 -0.0280 0.0513  99  MET E CG  
4312 S  SD  . MET E 80  ? 0.3875 0.3032 0.3810 -0.0182 -0.0293 0.0477  99  MET E SD  
4313 C  CE  . MET E 80  ? 0.3566 0.2857 0.3570 -0.0147 -0.0271 0.0443  99  MET E CE  
4314 N  N   . THR E 81  ? 0.3853 0.2891 0.3525 -0.0389 -0.0319 0.0633  100 THR E N   
4315 C  CA  . THR E 81  ? 0.4037 0.2982 0.3644 -0.0450 -0.0323 0.0661  100 THR E CA  
4316 C  C   . THR E 81  ? 0.4171 0.3060 0.3808 -0.0439 -0.0320 0.0633  100 THR E C   
4317 O  O   . THR E 81  ? 0.4018 0.2903 0.3708 -0.0375 -0.0326 0.0602  100 THR E O   
4318 C  CB  . THR E 81  ? 0.4192 0.3000 0.3699 -0.0458 -0.0359 0.0711  100 THR E CB  
4319 O  OG1 . THR E 81  ? 0.4305 0.3009 0.3812 -0.0390 -0.0390 0.0705  100 THR E OG1 
4320 C  CG2 . THR E 81  ? 0.4153 0.3017 0.3631 -0.0459 -0.0365 0.0738  100 THR E CG2 
4321 N  N   . GLU E 82  ? 0.6646 0.5498 0.6250 -0.0503 -0.0311 0.0642  101 GLU E N   
4322 C  CA  . GLU E 82  ? 0.6684 0.5488 0.6312 -0.0501 -0.0308 0.0615  101 GLU E CA  
4323 C  C   . GLU E 82  ? 0.6715 0.5377 0.6319 -0.0446 -0.0341 0.0617  101 GLU E C   
4324 O  O   . GLU E 82  ? 0.6633 0.5284 0.6286 -0.0404 -0.0340 0.0582  101 GLU E O   
4325 C  CB  . GLU E 82  ? 0.6905 0.5681 0.6486 -0.0586 -0.0297 0.0629  101 GLU E CB  
4326 C  CG  . GLU E 82  ? 0.7038 0.5808 0.6657 -0.0592 -0.0286 0.0594  101 GLU E CG  
4327 C  CD  . GLU E 82  ? 0.6802 0.5725 0.6514 -0.0565 -0.0256 0.0550  101 GLU E CD  
4328 O  OE1 . GLU E 82  ? 0.6385 0.5430 0.6120 -0.0583 -0.0235 0.0550  101 GLU E OE1 
4329 O  OE2 . GLU E 82  ? 0.6724 0.5641 0.6484 -0.0526 -0.0253 0.0516  101 GLU E OE2 
4330 N  N   . ARG E 83  ? 0.7553 0.6107 0.7079 -0.0444 -0.0371 0.0658  102 ARG E N   
4331 C  CA  . ARG E 83  ? 0.7769 0.6186 0.7265 -0.0385 -0.0407 0.0662  102 ARG E CA  
4332 C  C   . ARG E 83  ? 0.7594 0.6079 0.7166 -0.0298 -0.0411 0.0628  102 ARG E C   
4333 O  O   . ARG E 83  ? 0.7518 0.5962 0.7124 -0.0247 -0.0420 0.0598  102 ARG E O   
4334 C  CB  . ARG E 83  ? 0.7916 0.6212 0.7307 -0.0396 -0.0439 0.0716  102 ARG E CB  
4335 C  CG  . ARG E 83  ? 0.8136 0.6271 0.7481 -0.0337 -0.0478 0.0724  102 ARG E CG  
4336 C  CD  . ARG E 83  ? 0.8532 0.6523 0.7754 -0.0364 -0.0507 0.0782  102 ARG E CD  
4337 N  NE  . ARG E 83  ? 0.8953 0.6772 0.8120 -0.0310 -0.0546 0.0790  102 ARG E NE  
4338 C  CZ  . ARG E 83  ? 0.9293 0.6986 0.8427 -0.0328 -0.0551 0.0783  102 ARG E CZ  
4339 N  NH1 . ARG E 83  ? 0.9260 0.6985 0.8411 -0.0403 -0.0520 0.0768  102 ARG E NH1 
4340 N  NH2 . ARG E 83  ? 0.9406 0.6942 0.8488 -0.0271 -0.0587 0.0789  102 ARG E NH2 
4341 N  N   . CYS E 84  ? 0.5365 0.3959 0.4964 -0.0284 -0.0404 0.0631  103 CYS E N   
4342 C  CA  . CYS E 84  ? 0.5091 0.3761 0.4761 -0.0210 -0.0406 0.0598  103 CYS E CA  
4343 C  C   . CYS E 84  ? 0.4961 0.3691 0.4715 -0.0187 -0.0382 0.0547  103 CYS E C   
4344 O  O   . CYS E 84  ? 0.4929 0.3632 0.4717 -0.0127 -0.0394 0.0521  103 CYS E O   
4345 C  CB  . CYS E 84  ? 0.5039 0.3835 0.4730 -0.0216 -0.0393 0.0603  103 CYS E CB  
4346 S  SG  . CYS E 84  ? 0.4716 0.3591 0.4471 -0.0132 -0.0403 0.0573  103 CYS E SG  
4347 N  N   . LYS E 85  ? 0.8636 0.7450 0.8422 -0.0234 -0.0347 0.0533  104 LYS E N   
4348 C  CA  . LYS E 85  ? 0.8428 0.7305 0.8289 -0.0216 -0.0322 0.0488  104 LYS E CA  
4349 C  C   . LYS E 85  ? 0.8465 0.7244 0.8327 -0.0184 -0.0337 0.0469  104 LYS E C   
4350 O  O   . LYS E 85  ? 0.8310 0.7113 0.8227 -0.0128 -0.0336 0.0435  104 LYS E O   
4351 C  CB  . LYS E 85  ? 0.8316 0.7264 0.8187 -0.0278 -0.0290 0.0483  104 LYS E CB  
4352 C  CG  . LYS E 85  ? 0.8373 0.7434 0.8252 -0.0306 -0.0271 0.0492  104 LYS E CG  
4353 C  CD  . LYS E 85  ? 0.8411 0.7571 0.8329 -0.0339 -0.0236 0.0469  104 LYS E CD  
4354 C  CE  . LYS E 85  ? 0.8235 0.7513 0.8167 -0.0357 -0.0215 0.0472  104 LYS E CE  
4355 N  NZ  . LYS E 85  ? 0.8217 0.7600 0.8199 -0.0366 -0.0181 0.0441  104 LYS E NZ  
4356 N  N   . GLU E 86  ? 0.8501 0.7170 0.8302 -0.0223 -0.0351 0.0490  105 GLU E N   
4357 C  CA  . GLU E 86  ? 0.8682 0.7249 0.8477 -0.0199 -0.0365 0.0473  105 GLU E CA  
4358 C  C   . GLU E 86  ? 0.8561 0.7099 0.8381 -0.0116 -0.0387 0.0454  105 GLU E C   
4359 O  O   . GLU E 86  ? 0.8412 0.6962 0.8282 -0.0076 -0.0381 0.0416  105 GLU E O   
4360 C  CB  . GLU E 86  ? 0.9106 0.7528 0.8810 -0.0245 -0.0387 0.0507  105 GLU E CB  
4361 C  CG  . GLU E 86  ? 0.9294 0.7745 0.8968 -0.0333 -0.0366 0.0525  105 GLU E CG  
4362 C  CD  . GLU E 86  ? 0.9774 0.8073 0.9353 -0.0384 -0.0386 0.0559  105 GLU E CD  
4363 O  OE1 . GLU E 86  ? 0.9956 0.8122 0.9484 -0.0346 -0.0419 0.0575  105 GLU E OE1 
4364 O  OE2 . GLU E 86  ? 0.9814 0.8127 0.9366 -0.0462 -0.0370 0.0569  105 GLU E OE2 
4365 N  N   . ARG E 87  ? 0.7209 0.5714 0.6992 -0.0090 -0.0413 0.0482  106 ARG E N   
4366 C  CA  . ARG E 87  ? 0.7150 0.5630 0.6951 -0.0010 -0.0439 0.0466  106 ARG E CA  
4367 C  C   . ARG E 87  ? 0.6857 0.5480 0.6746 0.0030  -0.0418 0.0429  106 ARG E C   
4368 O  O   . ARG E 87  ? 0.6744 0.5376 0.6676 0.0090  -0.0425 0.0396  106 ARG E O   
4369 C  CB  . ARG E 87  ? 0.7464 0.5867 0.7192 0.0005  -0.0475 0.0509  106 ARG E CB  
4370 C  CG  . ARG E 87  ? 0.7816 0.6050 0.7447 -0.0025 -0.0500 0.0545  106 ARG E CG  
4371 C  CD  . ARG E 87  ? 0.8193 0.6365 0.7740 -0.0036 -0.0527 0.0597  106 ARG E CD  
4372 N  NE  . ARG E 87  ? 0.8786 0.6772 0.8235 -0.0042 -0.0558 0.0629  106 ARG E NE  
4373 C  CZ  . ARG E 87  ? 0.8988 0.6887 0.8375 -0.0117 -0.0550 0.0652  106 ARG E CZ  
4374 N  NH1 . ARG E 87  ? 0.8806 0.6800 0.8223 -0.0190 -0.0513 0.0646  106 ARG E NH1 
4375 N  NH2 . ARG E 87  ? 0.9002 0.6720 0.8294 -0.0120 -0.0579 0.0680  106 ARG E NH2 
4376 N  N   . VAL E 88  ? 0.5311 0.4045 0.5224 -0.0005 -0.0391 0.0433  107 VAL E N   
4377 C  CA  . VAL E 88  ? 0.5123 0.3986 0.5114 0.0023  -0.0367 0.0398  107 VAL E CA  
4378 C  C   . VAL E 88  ? 0.4949 0.3838 0.4997 0.0037  -0.0344 0.0355  107 VAL E C   
4379 O  O   . VAL E 88  ? 0.4786 0.3707 0.4883 0.0088  -0.0343 0.0321  107 VAL E O   
4380 C  CB  . VAL E 88  ? 0.5002 0.3971 0.5004 -0.0022 -0.0340 0.0407  107 VAL E CB  
4381 C  CG1 . VAL E 88  ? 0.4740 0.3827 0.4814 0.0009  -0.0317 0.0371  107 VAL E CG1 
4382 C  CG2 . VAL E 88  ? 0.5188 0.4132 0.5127 -0.0045 -0.0361 0.0452  107 VAL E CG2 
4383 N  N   . ASN E 89  ? 0.5015 0.3893 0.5055 -0.0010 -0.0325 0.0356  108 ASN E N   
4384 C  CA  . ASN E 89  ? 0.4802 0.3699 0.4886 -0.0001 -0.0304 0.0319  108 ASN E CA  
4385 C  C   . ASN E 89  ? 0.4909 0.3720 0.4992 0.0047  -0.0326 0.0300  108 ASN E C   
4386 O  O   . ASN E 89  ? 0.4783 0.3630 0.4918 0.0083  -0.0313 0.0262  108 ASN E O   
4387 C  CB  . ASN E 89  ? 0.4888 0.3778 0.4952 -0.0061 -0.0287 0.0327  108 ASN E CB  
4388 C  CG  . ASN E 89  ? 0.4911 0.3884 0.4970 -0.0109 -0.0267 0.0346  108 ASN E CG  
4389 O  OD1 . ASN E 89  ? 0.4781 0.3819 0.4855 -0.0098 -0.0263 0.0351  108 ASN E OD1 
4390 N  ND2 . ASN E 89  ? 0.4966 0.3942 0.5005 -0.0164 -0.0255 0.0354  108 ASN E ND2 
4391 N  N   . ALA E 90  ? 0.4270 0.2963 0.4290 0.0046  -0.0360 0.0327  109 ALA E N   
4392 C  CA  . ALA E 90  ? 0.4347 0.2946 0.4357 0.0096  -0.0385 0.0311  109 ALA E CA  
4393 C  C   . ALA E 90  ? 0.4268 0.2921 0.4326 0.0166  -0.0393 0.0285  109 ALA E C   
4394 O  O   . ALA E 90  ? 0.4244 0.2910 0.4345 0.0206  -0.0388 0.0246  109 ALA E O   
4395 C  CB  . ALA E 90  ? 0.4548 0.3004 0.4471 0.0085  -0.0422 0.0350  109 ALA E CB  
4396 N  N   . LEU E 91  ? 0.3677 0.2367 0.3728 0.0178  -0.0406 0.0304  110 LEU E N   
4397 C  CA  . LEU E 91  ? 0.3712 0.2470 0.3810 0.0240  -0.0413 0.0279  110 LEU E CA  
4398 C  C   . LEU E 91  ? 0.3498 0.2378 0.3675 0.0243  -0.0374 0.0236  110 LEU E C   
4399 O  O   . LEU E 91  ? 0.3403 0.2317 0.3626 0.0291  -0.0372 0.0199  110 LEU E O   
4400 C  CB  . LEU E 91  ? 0.3780 0.2572 0.3855 0.0243  -0.0430 0.0308  110 LEU E CB  
4401 C  CG  . LEU E 91  ? 0.3656 0.2528 0.3777 0.0303  -0.0441 0.0283  110 LEU E CG  
4402 C  CD1 . LEU E 91  ? 0.3794 0.2599 0.3914 0.0371  -0.0471 0.0262  110 LEU E CD1 
4403 C  CD2 . LEU E 91  ? 0.3571 0.2471 0.3660 0.0300  -0.0459 0.0315  110 LEU E CD2 
4404 N  N   . ALA E 92  ? 0.5303 0.4248 0.5492 0.0192  -0.0342 0.0243  111 ALA E N   
4405 C  CA  . ALA E 92  ? 0.5149 0.4196 0.5401 0.0189  -0.0303 0.0207  111 ALA E CA  
4406 C  C   . ALA E 92  ? 0.5206 0.4231 0.5487 0.0214  -0.0293 0.0172  111 ALA E C   
4407 O  O   . ALA E 92  ? 0.5149 0.4244 0.5482 0.0238  -0.0272 0.0136  111 ALA E O   
4408 C  CB  . ALA E 92  ? 0.4948 0.4040 0.5195 0.0132  -0.0273 0.0222  111 ALA E CB  
4409 N  N   . ILE E 93  ? 0.4395 0.3322 0.4638 0.0204  -0.0308 0.0181  112 ILE E N   
4410 C  CA  . ILE E 93  ? 0.4386 0.3285 0.4649 0.0226  -0.0302 0.0148  112 ILE E CA  
4411 C  C   . ILE E 93  ? 0.4473 0.3348 0.4750 0.0291  -0.0326 0.0124  112 ILE E C   
4412 O  O   . ILE E 93  ? 0.4489 0.3414 0.4814 0.0323  -0.0311 0.0085  112 ILE E O   
4413 C  CB  . ILE E 93  ? 0.4383 0.3180 0.4596 0.0194  -0.0312 0.0163  112 ILE E CB  
4414 C  CG1 . ILE E 93  ? 0.4325 0.3156 0.4525 0.0129  -0.0289 0.0184  112 ILE E CG1 
4415 C  CG2 . ILE E 93  ? 0.4214 0.2985 0.4448 0.0219  -0.0306 0.0126  112 ILE E CG2 
4416 C  CD1 . ILE E 93  ? 0.4146 0.2889 0.4297 0.0087  -0.0298 0.0199  112 ILE E CD1 
4417 N  N   . ALA E 94  ? 0.4070 0.2871 0.4304 0.0312  -0.0365 0.0149  113 ALA E N   
4418 C  CA  . ALA E 94  ? 0.4199 0.2973 0.4440 0.0380  -0.0393 0.0129  113 ALA E CA  
4419 C  C   . ALA E 94  ? 0.4090 0.2990 0.4397 0.0416  -0.0380 0.0097  113 ALA E C   
4420 O  O   . ALA E 94  ? 0.4127 0.3051 0.4470 0.0466  -0.0383 0.0059  113 ALA E O   
4421 C  CB  . ALA E 94  ? 0.4308 0.2983 0.4482 0.0396  -0.0437 0.0167  113 ALA E CB  
4422 N  N   . VAL E 95  ? 0.3464 0.2446 0.3785 0.0387  -0.0364 0.0111  114 VAL E N   
4423 C  CA  . VAL E 95  ? 0.3402 0.2505 0.3782 0.0411  -0.0349 0.0082  114 VAL E CA  
4424 C  C   . VAL E 95  ? 0.3319 0.2488 0.3755 0.0411  -0.0311 0.0037  114 VAL E C   
4425 O  O   . VAL E 95  ? 0.3305 0.2522 0.3782 0.0454  -0.0311 -0.0001 114 VAL E O   
4426 C  CB  . VAL E 95  ? 0.3252 0.2425 0.3631 0.0372  -0.0335 0.0104  114 VAL E CB  
4427 C  CG1 . VAL E 95  ? 0.3075 0.2374 0.3517 0.0388  -0.0314 0.0068  114 VAL E CG1 
4428 C  CG2 . VAL E 95  ? 0.3370 0.2489 0.3693 0.0374  -0.0373 0.0147  114 VAL E CG2 
4429 N  N   . MET E 96  ? 0.4843 0.4018 0.5278 0.0363  -0.0278 0.0043  115 MET E N   
4430 C  CA  . MET E 96  ? 0.4749 0.3978 0.5226 0.0359  -0.0241 0.0006  115 MET E CA  
4431 C  C   . MET E 96  ? 0.4825 0.4015 0.5313 0.0401  -0.0251 -0.0025 115 MET E C   
4432 O  O   . MET E 96  ? 0.4831 0.4084 0.5364 0.0421  -0.0230 -0.0064 115 MET E O   
4433 C  CB  . MET E 96  ? 0.4726 0.3943 0.5186 0.0308  -0.0213 0.0021  115 MET E CB  
4434 C  CG  . MET E 96  ? 0.4628 0.3881 0.5074 0.0267  -0.0203 0.0051  115 MET E CG  
4435 S  SD  . MET E 96  ? 0.4395 0.3659 0.4831 0.0217  -0.0166 0.0058  115 MET E SD  
4436 C  CE  . MET E 96  ? 0.4273 0.3615 0.4760 0.0232  -0.0125 0.0014  115 MET E CE  
4437 N  N   . ASN E 97  ? 0.6052 0.5137 0.6497 0.0412  -0.0283 -0.0008 116 ASN E N   
4438 C  CA  . ASN E 97  ? 0.6236 0.5270 0.6684 0.0454  -0.0297 -0.0037 116 ASN E CA  
4439 C  C   . ASN E 97  ? 0.6221 0.5298 0.6701 0.0516  -0.0316 -0.0065 116 ASN E C   
4440 O  O   . ASN E 97  ? 0.6213 0.5329 0.6730 0.0549  -0.0306 -0.0107 116 ASN E O   
4441 C  CB  . ASN E 97  ? 0.6515 0.5415 0.6900 0.0448  -0.0328 -0.0010 116 ASN E CB  
4442 C  CG  . ASN E 97  ? 0.6889 0.5731 0.7273 0.0474  -0.0332 -0.0041 116 ASN E CG  
4443 O  OD1 . ASN E 97  ? 0.7056 0.5806 0.7397 0.0450  -0.0340 -0.0028 116 ASN E OD1 
4444 N  ND2 . ASN E 97  ? 0.6825 0.5727 0.7256 0.0522  -0.0326 -0.0085 116 ASN E ND2 
4445 N  N   . MET E 98  ? 0.4724 0.3799 0.5187 0.0532  -0.0345 -0.0041 117 MET E N   
4446 C  CA  . MET E 98  ? 0.4606 0.3732 0.5097 0.0594  -0.0368 -0.0066 117 MET E CA  
4447 C  C   . MET E 98  ? 0.4516 0.3787 0.5078 0.0594  -0.0334 -0.0106 117 MET E C   
4448 O  O   . MET E 98  ? 0.4480 0.3805 0.5084 0.0638  -0.0333 -0.0149 117 MET E O   
4449 C  CB  . MET E 98  ? 0.4713 0.3811 0.5166 0.0605  -0.0405 -0.0028 117 MET E CB  
4450 C  CG  . MET E 98  ? 0.4886 0.4045 0.5367 0.0673  -0.0433 -0.0053 117 MET E CG  
4451 S  SD  . MET E 98  ? 0.5349 0.4435 0.5824 0.0751  -0.0466 -0.0085 117 MET E SD  
4452 C  CE  . MET E 98  ? 0.5256 0.4144 0.5632 0.0735  -0.0499 -0.0031 117 MET E CE  
4453 N  N   . TRP E 99  ? 0.5931 0.5262 0.6502 0.0544  -0.0305 -0.0092 118 TRP E N   
4454 C  CA  . TRP E 99  ? 0.5856 0.5312 0.6485 0.0532  -0.0268 -0.0126 118 TRP E CA  
4455 C  C   . TRP E 99  ? 0.5823 0.5288 0.6454 0.0477  -0.0222 -0.0124 118 TRP E C   
4456 O  O   . TRP E 99  ? 0.5821 0.5266 0.6424 0.0434  -0.0214 -0.0089 118 TRP E O   
4457 C  CB  . TRP E 99  ? 0.5876 0.5408 0.6517 0.0529  -0.0275 -0.0118 118 TRP E CB  
4458 C  CG  . TRP E 99  ? 0.5952 0.5483 0.6588 0.0586  -0.0322 -0.0117 118 TRP E CG  
4459 C  CD1 . TRP E 99  ? 0.5908 0.5507 0.6586 0.0641  -0.0335 -0.0159 118 TRP E CD1 
4460 C  CD2 . TRP E 99  ? 0.5959 0.5420 0.6541 0.0596  -0.0363 -0.0073 118 TRP E CD2 
4461 N  NE1 . TRP E 99  ? 0.6042 0.5617 0.6697 0.0690  -0.0383 -0.0144 118 TRP E NE1 
4462 C  CE2 . TRP E 99  ? 0.6093 0.5577 0.6685 0.0662  -0.0401 -0.0089 118 TRP E CE2 
4463 C  CE3 . TRP E 99  ? 0.5931 0.5313 0.6455 0.0555  -0.0371 -0.0021 118 TRP E CE3 
4464 C  CZ2 . TRP E 99  ? 0.6268 0.5690 0.6808 0.0691  -0.0448 -0.0052 118 TRP E CZ2 
4465 C  CZ3 . TRP E 99  ? 0.6026 0.5348 0.6500 0.0577  -0.0415 0.0015  118 TRP E CZ3 
4466 C  CH2 . TRP E 99  ? 0.6233 0.5570 0.6713 0.0645  -0.0453 0.0001  118 TRP E CH2 
4467 N  N   . PRO E 100 ? 0.6395 0.5890 0.7055 0.0479  -0.0192 -0.0160 119 PRO E N   
4468 C  CA  . PRO E 100 ? 0.6302 0.5807 0.6962 0.0433  -0.0149 -0.0160 119 PRO E CA  
4469 C  C   . PRO E 100 ? 0.6186 0.5774 0.6866 0.0400  -0.0118 -0.0162 119 PRO E C   
4470 O  O   . PRO E 100 ? 0.6129 0.5796 0.6843 0.0415  -0.0117 -0.0186 119 PRO E O   
4471 C  CB  . PRO E 100 ? 0.6463 0.5992 0.7151 0.0454  -0.0129 -0.0203 119 PRO E CB  
4472 C  CG  . PRO E 100 ? 0.6619 0.6118 0.7311 0.0509  -0.0167 -0.0219 119 PRO E CG  
4473 C  CD  . PRO E 100 ? 0.6630 0.6148 0.7322 0.0528  -0.0200 -0.0202 119 PRO E CD  
4474 N  N   . GLY E 101 ? 0.5986 0.5557 0.6642 0.0356  -0.0094 -0.0139 120 GLY E N   
4475 C  CA  . GLY E 101 ? 0.5939 0.5575 0.6607 0.0324  -0.0064 -0.0140 120 GLY E CA  
4476 C  C   . GLY E 101 ? 0.5858 0.5517 0.6521 0.0322  -0.0088 -0.0120 120 GLY E C   
4477 O  O   . GLY E 101 ? 0.5790 0.5517 0.6470 0.0304  -0.0070 -0.0130 120 GLY E O   
4478 N  N   . VAL E 102 ? 0.3656 0.3255 0.4290 0.0338  -0.0129 -0.0091 121 VAL E N   
4479 C  CA  . VAL E 102 ? 0.3614 0.3227 0.4234 0.0338  -0.0156 -0.0066 121 VAL E CA  
4480 C  C   . VAL E 102 ? 0.3609 0.3135 0.4175 0.0323  -0.0181 -0.0019 121 VAL E C   
4481 O  O   . VAL E 102 ? 0.3759 0.3209 0.4301 0.0344  -0.0209 -0.0008 121 VAL E O   
4482 C  CB  . VAL E 102 ? 0.3681 0.3327 0.4323 0.0388  -0.0189 -0.0085 121 VAL E CB  
4483 C  CG1 . VAL E 102 ? 0.3629 0.3279 0.4248 0.0390  -0.0221 -0.0054 121 VAL E CG1 
4484 C  CG2 . VAL E 102 ? 0.3616 0.3365 0.4314 0.0397  -0.0163 -0.0133 121 VAL E CG2 
4485 N  N   . ARG E 103 ? 0.6807 0.6346 0.7353 0.0283  -0.0169 0.0006  122 ARG E N   
4486 C  CA  . ARG E 103 ? 0.6813 0.6283 0.7308 0.0259  -0.0188 0.0050  122 ARG E CA  
4487 C  C   . ARG E 103 ? 0.6818 0.6298 0.7290 0.0261  -0.0217 0.0077  122 ARG E C   
4488 O  O   . ARG E 103 ? 0.6754 0.6307 0.7253 0.0274  -0.0216 0.0061  122 ARG E O   
4489 C  CB  . ARG E 103 ? 0.5343 0.4821 0.5827 0.0214  -0.0155 0.0061  122 ARG E CB  
4490 C  CG  . ARG E 103 ? 0.5267 0.4814 0.5788 0.0206  -0.0113 0.0029  122 ARG E CG  
4491 C  CD  . ARG E 103 ? 0.5236 0.4765 0.5743 0.0178  -0.0084 0.0034  122 ARG E CD  
4492 N  NE  . ARG E 103 ? 0.5189 0.4769 0.5696 0.0151  -0.0056 0.0035  122 ARG E NE  
4493 C  CZ  . ARG E 103 ? 0.5152 0.4792 0.5685 0.0152  -0.0033 0.0010  122 ARG E CZ  
4494 N  NH1 . ARG E 103 ? 0.5152 0.4818 0.5717 0.0177  -0.0036 -0.0018 122 ARG E NH1 
4495 N  NH2 . ARG E 103 ? 0.5120 0.4794 0.5646 0.0127  -0.0008 0.0012  122 ARG E NH2 
4496 N  N   . LEU E 104 ? 0.3610 0.3017 0.4031 0.0245  -0.0241 0.0118  123 LEU E N   
4497 C  CA  . LEU E 104 ? 0.3541 0.2946 0.3929 0.0244  -0.0270 0.0149  123 LEU E CA  
4498 C  C   . LEU E 104 ? 0.3458 0.2940 0.3850 0.0207  -0.0246 0.0155  123 LEU E C   
4499 O  O   . LEU E 104 ? 0.3402 0.2899 0.3796 0.0171  -0.0215 0.0155  123 LEU E O   
4500 C  CB  . LEU E 104 ? 0.3621 0.2919 0.3944 0.0229  -0.0298 0.0192  123 LEU E CB  
4501 C  CG  . LEU E 104 ? 0.3677 0.2963 0.3952 0.0214  -0.0323 0.0233  123 LEU E CG  
4502 C  CD1 . LEU E 104 ? 0.3803 0.3089 0.4074 0.0268  -0.0360 0.0231  123 LEU E CD1 
4503 C  CD2 . LEU E 104 ? 0.3850 0.3034 0.4059 0.0179  -0.0338 0.0275  123 LEU E CD2 
4504 N  N   . ARG E 105 ? 0.2045 0.1577 0.2438 0.0220  -0.0262 0.0158  124 ARG E N   
4505 C  CA  . ARG E 105 ? 0.1867 0.1475 0.2263 0.0188  -0.0242 0.0161  124 ARG E CA  
4506 C  C   . ARG E 105 ? 0.1948 0.1539 0.2293 0.0176  -0.0272 0.0202  124 ARG E C   
4507 O  O   . ARG E 105 ? 0.2039 0.1609 0.2366 0.0209  -0.0308 0.0214  124 ARG E O   
4508 C  CB  . ARG E 105 ? 0.1810 0.1515 0.2260 0.0206  -0.0227 0.0119  124 ARG E CB  
4509 C  CG  . ARG E 105 ? 0.2940 0.2721 0.3390 0.0176  -0.0209 0.0118  124 ARG E CG  
4510 C  CD  . ARG E 105 ? 0.2743 0.2617 0.3245 0.0187  -0.0191 0.0072  124 ARG E CD  
4511 N  NE  . ARG E 105 ? 0.2636 0.2580 0.3135 0.0162  -0.0181 0.0071  124 ARG E NE  
4512 C  CZ  . ARG E 105 ? 0.2719 0.2712 0.3213 0.0176  -0.0208 0.0073  124 ARG E CZ  
4513 N  NH1 . ARG E 105 ? 0.2870 0.2850 0.3363 0.0219  -0.0247 0.0078  124 ARG E NH1 
4514 N  NH2 . ARG E 105 ? 0.2600 0.2656 0.3089 0.0150  -0.0196 0.0070  124 ARG E NH2 
4515 N  N   . VAL E 106 ? 0.2350 0.1950 0.2669 0.0130  -0.0255 0.0225  125 VAL E N   
4516 C  CA  . VAL E 106 ? 0.2464 0.2053 0.2729 0.0110  -0.0277 0.0266  125 VAL E CA  
4517 C  C   . VAL E 106 ? 0.2414 0.2103 0.2694 0.0097  -0.0263 0.0254  125 VAL E C   
4518 O  O   . VAL E 106 ? 0.2250 0.1995 0.2556 0.0072  -0.0227 0.0234  125 VAL E O   
4519 C  CB  . VAL E 106 ? 0.2521 0.2057 0.2741 0.0063  -0.0270 0.0300  125 VAL E CB  
4520 C  CG1 . VAL E 106 ? 0.2614 0.2152 0.2778 0.0035  -0.0287 0.0340  125 VAL E CG1 
4521 C  CG2 . VAL E 106 ? 0.2545 0.1976 0.2742 0.0071  -0.0287 0.0313  125 VAL E CG2 
4522 N  N   . THR E 107 ? 0.3389 0.3097 0.3649 0.0116  -0.0294 0.0268  126 THR E N   
4523 C  CA  . THR E 107 ? 0.3222 0.3027 0.3493 0.0105  -0.0284 0.0255  126 THR E CA  
4524 C  C   . THR E 107 ? 0.3332 0.3133 0.3543 0.0072  -0.0296 0.0298  126 THR E C   
4525 O  O   . THR E 107 ? 0.3319 0.3198 0.3532 0.0057  -0.0287 0.0291  126 THR E O   
4526 C  CB  . THR E 107 ? 0.3216 0.3074 0.3514 0.0151  -0.0308 0.0232  126 THR E CB  
4527 O  OG1 . THR E 107 ? 0.3608 0.3415 0.3854 0.0176  -0.0355 0.0269  126 THR E OG1 
4528 C  CG2 . THR E 107 ? 0.3127 0.2983 0.3479 0.0185  -0.0301 0.0192  126 THR E CG2 
4529 N  N   . GLU E 108 ? 0.3973 0.3682 0.4128 0.0059  -0.0317 0.0341  127 GLU E N   
4530 C  CA  . GLU E 108 ? 0.4089 0.3785 0.4179 0.0022  -0.0326 0.0385  127 GLU E CA  
4531 C  C   . GLU E 108 ? 0.4183 0.3770 0.4218 -0.0004 -0.0337 0.0426  127 GLU E C   
4532 O  O   . GLU E 108 ? 0.4347 0.3843 0.4348 0.0022  -0.0370 0.0447  127 GLU E O   
4533 C  CB  . GLU E 108 ? 0.4261 0.3976 0.4318 0.0045  -0.0362 0.0404  127 GLU E CB  
4534 C  CG  . GLU E 108 ? 0.4228 0.4060 0.4304 0.0033  -0.0347 0.0384  127 GLU E CG  
4535 C  CD  . GLU E 108 ? 0.4235 0.4097 0.4280 -0.0024 -0.0323 0.0403  127 GLU E CD  
4536 O  OE1 . GLU E 108 ? 0.4199 0.4134 0.4230 -0.0036 -0.0322 0.0404  127 GLU E OE1 
4537 O  OE2 . GLU E 108 ? 0.4361 0.4179 0.4396 -0.0056 -0.0304 0.0415  127 GLU E OE2 
4538 N  N   . GLY E 109 ? 0.3629 0.3228 0.3653 -0.0055 -0.0309 0.0435  128 GLY E N   
4539 C  CA  . GLY E 109 ? 0.3733 0.3243 0.3703 -0.0091 -0.0316 0.0472  128 GLY E CA  
4540 C  C   . GLY E 109 ? 0.3902 0.3417 0.3805 -0.0134 -0.0324 0.0514  128 GLY E C   
4541 O  O   . GLY E 109 ? 0.4218 0.3717 0.4080 -0.0117 -0.0354 0.0538  128 GLY E O   
4542 N  N   . TRP E 110 ? 0.3028 0.2570 0.2919 -0.0189 -0.0298 0.0523  129 TRP E N   
4543 C  CA  . TRP E 110 ? 0.3283 0.2853 0.3116 -0.0235 -0.0298 0.0558  129 TRP E CA  
4544 C  C   . TRP E 110 ? 0.3298 0.2982 0.3158 -0.0224 -0.0286 0.0536  129 TRP E C   
4545 O  O   . TRP E 110 ? 0.3153 0.2920 0.3075 -0.0219 -0.0255 0.0495  129 TRP E O   
4546 C  CB  . TRP E 110 ? 0.3272 0.2857 0.3091 -0.0296 -0.0271 0.0567  129 TRP E CB  
4547 C  CG  . TRP E 110 ? 0.3377 0.3011 0.3143 -0.0346 -0.0265 0.0596  129 TRP E CG  
4548 C  CD1 . TRP E 110 ? 0.3644 0.3211 0.3325 -0.0381 -0.0288 0.0646  129 TRP E CD1 
4549 C  CD2 . TRP E 110 ? 0.3341 0.3100 0.3133 -0.0366 -0.0235 0.0576  129 TRP E CD2 
4550 N  NE1 . TRP E 110 ? 0.3655 0.3304 0.3309 -0.0424 -0.0272 0.0659  129 TRP E NE1 
4551 C  CE2 . TRP E 110 ? 0.3533 0.3303 0.3255 -0.0414 -0.0241 0.0615  129 TRP E CE2 
4552 C  CE3 . TRP E 110 ? 0.3256 0.3113 0.3117 -0.0349 -0.0204 0.0528  129 TRP E CE3 
4553 C  CZ2 . TRP E 110 ? 0.3734 0.3619 0.3460 -0.0443 -0.0216 0.0605  129 TRP E CZ2 
4554 C  CZ3 . TRP E 110 ? 0.3311 0.3272 0.3172 -0.0375 -0.0181 0.0519  129 TRP E CZ3 
4555 C  CH2 . TRP E 110 ? 0.3523 0.3502 0.3320 -0.0421 -0.0186 0.0556  129 TRP E CH2 
4556 N  N   . ASP E 111 ? 0.3779 0.3466 0.3591 -0.0221 -0.0312 0.0564  130 ASP E N   
4557 C  CA  . ASP E 111 ? 0.3690 0.3484 0.3524 -0.0210 -0.0305 0.0543  130 ASP E CA  
4558 C  C   . ASP E 111 ? 0.3754 0.3605 0.3540 -0.0262 -0.0293 0.0567  130 ASP E C   
4559 O  O   . ASP E 111 ? 0.3945 0.3736 0.3659 -0.0298 -0.0306 0.0613  130 ASP E O   
4560 C  CB  . ASP E 111 ? 0.3841 0.3618 0.3663 -0.0159 -0.0343 0.0547  130 ASP E CB  
4561 C  CG  . ASP E 111 ? 0.3807 0.3696 0.3643 -0.0152 -0.0339 0.0528  130 ASP E CG  
4562 O  OD1 . ASP E 111 ? 0.3622 0.3600 0.3517 -0.0156 -0.0305 0.0485  130 ASP E OD1 
4563 O  OD2 . ASP E 111 ? 0.3993 0.3878 0.3777 -0.0141 -0.0370 0.0556  130 ASP E OD2 
4564 N  N   . GLU E 112 ? 0.6111 0.6074 0.5934 -0.0267 -0.0266 0.0534  131 GLU E N   
4565 C  CA  . GLU E 112 ? 0.6069 0.6103 0.5852 -0.0310 -0.0255 0.0549  131 GLU E CA  
4566 C  C   . GLU E 112 ? 0.6024 0.6148 0.5826 -0.0286 -0.0256 0.0524  131 GLU E C   
4567 O  O   . GLU E 112 ? 0.6139 0.6338 0.5915 -0.0315 -0.0245 0.0527  131 GLU E O   
4568 C  CB  . GLU E 112 ? 0.6098 0.6189 0.5905 -0.0349 -0.0214 0.0531  131 GLU E CB  
4569 C  CG  . GLU E 112 ? 0.6091 0.6245 0.5977 -0.0323 -0.0182 0.0474  131 GLU E CG  
4570 C  CD  . GLU E 112 ? 0.6252 0.6473 0.6155 -0.0357 -0.0144 0.0456  131 GLU E CD  
4571 O  OE1 . GLU E 112 ? 0.6474 0.6722 0.6330 -0.0402 -0.0139 0.0483  131 GLU E OE1 
4572 O  OE2 . GLU E 112 ? 0.6087 0.6334 0.6047 -0.0336 -0.0119 0.0415  131 GLU E OE2 
4573 N  N   . ASP E 113 ? 0.4766 0.4889 0.4613 -0.0236 -0.0269 0.0495  132 ASP E N   
4574 C  CA  . ASP E 113 ? 0.4766 0.4974 0.4634 -0.0213 -0.0273 0.0467  132 ASP E CA  
4575 C  C   . ASP E 113 ? 0.4938 0.5135 0.4740 -0.0205 -0.0313 0.0506  132 ASP E C   
4576 O  O   . ASP E 113 ? 0.4927 0.5206 0.4720 -0.0206 -0.0315 0.0496  132 ASP E O   
4577 C  CB  . ASP E 113 ? 0.4738 0.4952 0.4677 -0.0165 -0.0272 0.0421  132 ASP E CB  
4578 C  CG  . ASP E 113 ? 0.4565 0.4793 0.4565 -0.0171 -0.0232 0.0381  132 ASP E CG  
4579 O  OD1 . ASP E 113 ? 0.4505 0.4802 0.4519 -0.0195 -0.0199 0.0358  132 ASP E OD1 
4580 O  OD2 . ASP E 113 ? 0.4358 0.4524 0.4388 -0.0148 -0.0233 0.0373  132 ASP E OD2 
4581 N  N   . GLY E 114 ? 0.6339 0.6429 0.6091 -0.0195 -0.0346 0.0551  133 GLY E N   
4582 C  CA  . GLY E 114 ? 0.6442 0.6498 0.6114 -0.0188 -0.0386 0.0597  133 GLY E CA  
4583 C  C   . GLY E 114 ? 0.6457 0.6532 0.6144 -0.0128 -0.0422 0.0583  133 GLY E C   
4584 O  O   . GLY E 114 ? 0.6684 0.6776 0.6315 -0.0119 -0.0450 0.0609  133 GLY E O   
4585 N  N   . HIS E 115 ? 0.4833 0.4907 0.4591 -0.0085 -0.0420 0.0543  134 HIS E N   
4586 C  CA  . HIS E 115 ? 0.4932 0.5036 0.4713 -0.0026 -0.0453 0.0524  134 HIS E CA  
4587 C  C   . HIS E 115 ? 0.5097 0.5083 0.4837 0.0018  -0.0497 0.0558  134 HIS E C   
4588 O  O   . HIS E 115 ? 0.5144 0.5146 0.4895 0.0074  -0.0530 0.0547  134 HIS E O   
4589 C  CB  . HIS E 115 ? 0.4663 0.4846 0.4543 -0.0005 -0.0427 0.0456  134 HIS E CB  
4590 C  CG  . HIS E 115 ? 0.4503 0.4625 0.4431 0.0002  -0.0408 0.0438  134 HIS E CG  
4591 N  ND1 . HIS E 115 ? 0.4476 0.4526 0.4414 0.0049  -0.0435 0.0440  134 HIS E ND1 
4592 C  CD2 . HIS E 115 ? 0.4348 0.4471 0.4315 -0.0029 -0.0365 0.0416  134 HIS E CD2 
4593 C  CE1 . HIS E 115 ? 0.4341 0.4352 0.4323 0.0043  -0.0409 0.0420  134 HIS E CE1 
4594 N  NE2 . HIS E 115 ? 0.4243 0.4296 0.4242 -0.0004 -0.0367 0.0407  134 HIS E NE2 
4595 N  N   . HIS E 116 ? 0.4952 0.4822 0.4646 -0.0007 -0.0497 0.0597  135 HIS E N   
4596 C  CA  . HIS E 116 ? 0.5264 0.5005 0.4908 0.0032  -0.0538 0.0632  135 HIS E CA  
4597 C  C   . HIS E 116 ? 0.5726 0.5413 0.5263 0.0032  -0.0577 0.0692  135 HIS E C   
4598 O  O   . HIS E 116 ? 0.5809 0.5553 0.5307 -0.0009 -0.0567 0.0710  135 HIS E O   
4599 C  CB  . HIS E 116 ? 0.5229 0.4862 0.4866 0.0003  -0.0521 0.0647  135 HIS E CB  
4600 C  CG  . HIS E 116 ? 0.4892 0.4557 0.4624 0.0014  -0.0490 0.0593  135 HIS E CG  
4601 N  ND1 . HIS E 116 ? 0.4840 0.4481 0.4618 0.0073  -0.0507 0.0565  135 HIS E ND1 
4602 C  CD2 . HIS E 116 ? 0.4691 0.4410 0.4478 -0.0025 -0.0444 0.0563  135 HIS E CD2 
4603 C  CE1 . HIS E 116 ? 0.4722 0.4398 0.4577 0.0066  -0.0471 0.0522  135 HIS E CE1 
4604 N  NE2 . HIS E 116 ? 0.4648 0.4368 0.4507 0.0008  -0.0434 0.0520  135 HIS E NE2 
4605 N  N   . ALA E 117 ? 0.6666 0.6242 0.6153 0.0080  -0.0620 0.0721  136 ALA E N   
4606 C  CA  . ALA E 117 ? 0.6933 0.6436 0.6309 0.0089  -0.0662 0.0781  136 ALA E CA  
4607 C  C   . ALA E 117 ? 0.7005 0.6439 0.6295 0.0012  -0.0646 0.0834  136 ALA E C   
4608 O  O   . ALA E 117 ? 0.6800 0.6246 0.6121 -0.0046 -0.0604 0.0823  136 ALA E O   
4609 C  CB  . ALA E 117 ? 0.7019 0.6396 0.6356 0.0158  -0.0710 0.0801  136 ALA E CB  
4610 N  N   . GLN E 118 ? 0.7547 0.6909 0.6725 0.0011  -0.0680 0.0893  137 GLN E N   
4611 C  CA  . GLN E 118 ? 0.7873 0.7168 0.6958 -0.0066 -0.0667 0.0947  137 GLN E CA  
4612 C  C   . GLN E 118 ? 0.7882 0.7018 0.6929 -0.0091 -0.0665 0.0973  137 GLN E C   
4613 O  O   . GLN E 118 ? 0.7910 0.6924 0.6928 -0.0039 -0.0700 0.0987  137 GLN E O   
4614 C  CB  . GLN E 118 ? 0.8276 0.7532 0.7245 -0.0058 -0.0706 0.1004  137 GLN E CB  
4615 C  CG  . GLN E 118 ? 0.8401 0.7819 0.7394 -0.0049 -0.0705 0.0982  137 GLN E CG  
4616 C  CD  . GLN E 118 ? 0.9091 0.8470 0.7977 -0.0015 -0.0754 0.1032  137 GLN E CD  
4617 O  OE1 . GLN E 118 ? 0.9308 0.8551 0.8125 0.0033  -0.0798 0.1069  137 GLN E OE1 
4618 N  NE2 . GLN E 118 ? 0.9065 0.8562 0.7934 -0.0037 -0.0748 0.1033  137 GLN E NE2 
4619 N  N   . ASP E 119 ? 0.9874 0.9018 0.8923 -0.0171 -0.0623 0.0977  138 ASP E N   
4620 C  CA  . ASP E 119 ? 1.0031 0.9036 0.9041 -0.0209 -0.0616 0.1001  138 ASP E CA  
4621 C  C   . ASP E 119 ? 0.9893 0.8869 0.8990 -0.0166 -0.0612 0.0955  138 ASP E C   
4622 O  O   . ASP E 119 ? 1.0006 0.8865 0.9078 -0.0189 -0.0609 0.0968  138 ASP E O   
4623 C  CB  . ASP E 119 ? 1.0559 0.9389 0.9431 -0.0208 -0.0657 0.1070  138 ASP E CB  
4624 C  CG  . ASP E 119 ? 1.0892 0.9739 0.9666 -0.0256 -0.0661 0.1120  138 ASP E CG  
4625 O  OD1 . ASP E 119 ? 1.0801 0.9788 0.9612 -0.0305 -0.0625 0.1102  138 ASP E OD1 
4626 O  OD2 . ASP E 119 ? 1.0978 0.9696 0.9635 -0.0242 -0.0699 0.1177  138 ASP E OD2 
4627 N  N   . SER E 120 ? 0.6550 0.5634 0.5745 -0.0107 -0.0611 0.0902  139 SER E N   
4628 C  CA  . SER E 120 ? 0.6216 0.5289 0.5497 -0.0064 -0.0606 0.0855  139 SER E CA  
4629 C  C   . SER E 120 ? 0.6011 0.5043 0.5314 -0.0121 -0.0570 0.0847  139 SER E C   
4630 O  O   . SER E 120 ? 0.5920 0.5018 0.5229 -0.0188 -0.0533 0.0847  139 SER E O   
4631 C  CB  . SER E 120 ? 0.5945 0.5176 0.5338 -0.0025 -0.0590 0.0793  139 SER E CB  
4632 O  OG  . SER E 120 ? 0.5605 0.4829 0.5079 0.0011  -0.0580 0.0747  139 SER E OG  
4633 N  N   . LEU E 121 ? 0.4220 0.3150 0.3534 -0.0091 -0.0581 0.0837  140 LEU E N   
4634 C  CA  . LEU E 121 ? 0.4148 0.3034 0.3481 -0.0141 -0.0551 0.0829  140 LEU E CA  
4635 C  C   . LEU E 121 ? 0.3843 0.2872 0.3284 -0.0158 -0.0505 0.0775  140 LEU E C   
4636 O  O   . LEU E 121 ? 0.3799 0.2828 0.3256 -0.0210 -0.0474 0.0767  140 LEU E O   
4637 C  CB  . LEU E 121 ? 0.4168 0.2918 0.3493 -0.0098 -0.0575 0.0825  140 LEU E CB  
4638 C  CG  . LEU E 121 ? 0.4469 0.3049 0.3677 -0.0080 -0.0620 0.0879  140 LEU E CG  
4639 C  CD1 . LEU E 121 ? 0.4697 0.3141 0.3900 -0.0050 -0.0636 0.0870  140 LEU E CD1 
4640 C  CD2 . LEU E 121 ? 0.4832 0.3354 0.3939 -0.0163 -0.0613 0.0935  140 LEU E CD2 
4641 N  N   . HIS E 122 ? 0.4616 0.3764 0.4127 -0.0115 -0.0501 0.0736  141 HIS E N   
4642 C  CA  . HIS E 122 ? 0.4331 0.3608 0.3936 -0.0128 -0.0458 0.0686  141 HIS E CA  
4643 C  C   . HIS E 122 ? 0.4384 0.3733 0.3973 -0.0201 -0.0425 0.0697  141 HIS E C   
4644 O  O   . HIS E 122 ? 0.4256 0.3681 0.3906 -0.0224 -0.0387 0.0664  141 HIS E O   
4645 C  CB  . HIS E 122 ? 0.4210 0.3596 0.3881 -0.0074 -0.0461 0.0645  141 HIS E CB  
4646 C  CG  . HIS E 122 ? 0.4105 0.3467 0.3831 -0.0009 -0.0475 0.0611  141 HIS E CG  
4647 N  ND1 . HIS E 122 ? 0.3778 0.3175 0.3584 -0.0003 -0.0445 0.0565  141 HIS E ND1 
4648 C  CD2 . HIS E 122 ? 0.4093 0.3405 0.3805 0.0055  -0.0516 0.0614  141 HIS E CD2 
4649 C  CE1 . HIS E 122 ? 0.3751 0.3122 0.3591 0.0057  -0.0465 0.0541  141 HIS E CE1 
4650 N  NE2 . HIS E 122 ? 0.3823 0.3145 0.3609 0.0095  -0.0508 0.0569  141 HIS E NE2 
4651 N  N   . TYR E 123 ? 0.4645 0.3970 0.4149 -0.0234 -0.0439 0.0745  142 TYR E N   
4652 C  CA  . TYR E 123 ? 0.4667 0.4063 0.4149 -0.0304 -0.0409 0.0757  142 TYR E CA  
4653 C  C   . TYR E 123 ? 0.4789 0.4112 0.4232 -0.0367 -0.0394 0.0781  142 TYR E C   
4654 O  O   . TYR E 123 ? 0.4850 0.4215 0.4258 -0.0431 -0.0374 0.0800  142 TYR E O   
4655 C  CB  . TYR E 123 ? 0.4835 0.4247 0.4241 -0.0317 -0.0429 0.0797  142 TYR E CB  
4656 C  CG  . TYR E 123 ? 0.4793 0.4295 0.4234 -0.0263 -0.0443 0.0773  142 TYR E CG  
4657 C  CD1 . TYR E 123 ? 0.4582 0.4221 0.4109 -0.0256 -0.0411 0.0721  142 TYR E CD1 
4658 C  CD2 . TYR E 123 ? 0.4960 0.4408 0.4345 -0.0219 -0.0487 0.0802  142 TYR E CD2 
4659 C  CE1 . TYR E 123 ? 0.4470 0.4193 0.4028 -0.0213 -0.0423 0.0695  142 TYR E CE1 
4660 C  CE2 . TYR E 123 ? 0.4881 0.4423 0.4300 -0.0171 -0.0500 0.0776  142 TYR E CE2 
4661 C  CZ  . TYR E 123 ? 0.4595 0.4275 0.4102 -0.0171 -0.0467 0.0723  142 TYR E CZ  
4662 O  OH  . TYR E 123 ? 0.4458 0.4231 0.3997 -0.0130 -0.0479 0.0695  142 TYR E OH  
4663 N  N   . GLU E 124 ? 0.6850 0.6070 0.6300 -0.0350 -0.0404 0.0777  143 GLU E N   
4664 C  CA  . GLU E 124 ? 0.6974 0.6117 0.6387 -0.0408 -0.0393 0.0797  143 GLU E CA  
4665 C  C   . GLU E 124 ? 0.6810 0.5941 0.6295 -0.0390 -0.0378 0.0755  143 GLU E C   
4666 O  O   . GLU E 124 ? 0.6890 0.5947 0.6351 -0.0429 -0.0372 0.0765  143 GLU E O   
4667 C  CB  . GLU E 124 ? 0.7396 0.6374 0.6700 -0.0419 -0.0430 0.0852  143 GLU E CB  
4668 C  CG  . GLU E 124 ? 0.7607 0.6574 0.6831 -0.0417 -0.0455 0.0895  143 GLU E CG  
4669 C  CD  . GLU E 124 ? 0.8039 0.6831 0.7144 -0.0434 -0.0488 0.0954  143 GLU E CD  
4670 O  OE1 . GLU E 124 ? 0.8155 0.6869 0.7216 -0.0497 -0.0476 0.0972  143 GLU E OE1 
4671 O  OE2 . GLU E 124 ? 0.8224 0.6952 0.7274 -0.0385 -0.0526 0.0981  143 GLU E OE2 
4672 N  N   . GLY E 125 ? 0.4341 0.3545 0.3912 -0.0333 -0.0371 0.0709  144 GLY E N   
4673 C  CA  . GLY E 125 ? 0.4091 0.3287 0.3730 -0.0309 -0.0357 0.0669  144 GLY E CA  
4674 C  C   . GLY E 125 ? 0.4162 0.3212 0.3769 -0.0280 -0.0388 0.0681  144 GLY E C   
4675 O  O   . GLY E 125 ? 0.4011 0.3028 0.3651 -0.0279 -0.0377 0.0659  144 GLY E O   
4676 N  N   . ARG E 126 ? 0.6017 0.4979 0.5557 -0.0254 -0.0426 0.0716  145 ARG E N   
4677 C  CA  . ARG E 126 ? 0.6202 0.5015 0.5703 -0.0219 -0.0459 0.0729  145 ARG E CA  
4678 C  C   . ARG E 126 ? 0.6072 0.4888 0.5613 -0.0131 -0.0485 0.0704  145 ARG E C   
4679 O  O   . ARG E 126 ? 0.6249 0.4946 0.5749 -0.0089 -0.0520 0.0718  145 ARG E O   
4680 C  CB  . ARG E 126 ? 0.6471 0.5153 0.5853 -0.0253 -0.0487 0.0789  145 ARG E CB  
4681 C  CG  . ARG E 126 ? 0.6507 0.5132 0.5839 -0.0338 -0.0468 0.0812  145 ARG E CG  
4682 C  CD  . ARG E 126 ? 0.7024 0.5473 0.6234 -0.0358 -0.0500 0.0868  145 ARG E CD  
4683 N  NE  . ARG E 126 ? 0.7249 0.5699 0.6384 -0.0370 -0.0517 0.0913  145 ARG E NE  
4684 C  CZ  . ARG E 126 ? 0.7418 0.5731 0.6456 -0.0346 -0.0557 0.0957  145 ARG E CZ  
4685 N  NH1 . ARG E 126 ? 0.7446 0.5609 0.6451 -0.0305 -0.0586 0.0961  145 ARG E NH1 
4686 N  NH2 . ARG E 126 ? 0.7643 0.5969 0.6614 -0.0359 -0.0570 0.0998  145 ARG E NH2 
4687 N  N   . ALA E 127 ? 0.5045 0.3998 0.4664 -0.0102 -0.0469 0.0667  146 ALA E N   
4688 C  CA  . ALA E 127 ? 0.4853 0.3832 0.4515 -0.0024 -0.0491 0.0639  146 ALA E CA  
4689 C  C   . ALA E 127 ? 0.4520 0.3633 0.4289 -0.0006 -0.0458 0.0582  146 ALA E C   
4690 O  O   . ALA E 127 ? 0.4388 0.3601 0.4187 -0.0044 -0.0425 0.0570  146 ALA E O   
4691 C  CB  . ALA E 127 ? 0.4936 0.3929 0.4550 0.0000  -0.0522 0.0667  146 ALA E CB  
4692 N  N   . LEU E 128 ? 0.3253 0.2363 0.3073 0.0054  -0.0467 0.0546  147 LEU E N   
4693 C  CA  . LEU E 128 ? 0.2978 0.2201 0.2893 0.0072  -0.0437 0.0492  147 LEU E CA  
4694 C  C   . LEU E 128 ? 0.2898 0.2167 0.2853 0.0141  -0.0458 0.0463  147 LEU E C   
4695 O  O   . LEU E 128 ? 0.3065 0.2257 0.2999 0.0190  -0.0493 0.0468  147 LEU E O   
4696 C  CB  . LEU E 128 ? 0.2839 0.2029 0.2793 0.0067  -0.0414 0.0465  147 LEU E CB  
4697 C  CG  . LEU E 128 ? 0.2804 0.1952 0.2731 0.0004  -0.0392 0.0483  147 LEU E CG  
4698 C  CD1 . LEU E 128 ? 0.2672 0.1799 0.2645 0.0013  -0.0374 0.0450  147 LEU E CD1 
4699 C  CD2 . LEU E 128 ? 0.2763 0.2013 0.2702 -0.0047 -0.0359 0.0484  147 LEU E CD2 
4700 N  N   . ASP E 129 ? 0.2579 0.1974 0.2589 0.0144  -0.0438 0.0431  148 ASP E N   
4701 C  CA  . ASP E 129 ? 0.2431 0.1894 0.2494 0.0202  -0.0450 0.0393  148 ASP E CA  
4702 C  C   . ASP E 129 ? 0.2271 0.1767 0.2410 0.0212  -0.0419 0.0344  148 ASP E C   
4703 O  O   . ASP E 129 ? 0.3959 0.3521 0.4138 0.0178  -0.0379 0.0321  148 ASP E O   
4704 C  CB  . ASP E 129 ? 0.2479 0.2061 0.2559 0.0196  -0.0444 0.0382  148 ASP E CB  
4705 C  CG  . ASP E 129 ? 0.2708 0.2264 0.2713 0.0198  -0.0481 0.0428  148 ASP E CG  
4706 O  OD1 . ASP E 129 ? 0.2878 0.2316 0.2815 0.0205  -0.0510 0.0470  148 ASP E OD1 
4707 O  OD2 . ASP E 129 ? 0.2634 0.2285 0.2645 0.0194  -0.0480 0.0422  148 ASP E OD2 
4708 N  N   . ILE E 130 ? 0.3393 0.2842 0.3548 0.0262  -0.0439 0.0327  149 ILE E N   
4709 C  CA  . ILE E 130 ? 0.3249 0.2710 0.3464 0.0271  -0.0411 0.0285  149 ILE E CA  
4710 C  C   . ILE E 130 ? 0.3134 0.2672 0.3413 0.0323  -0.0415 0.0237  149 ILE E C   
4711 O  O   . ILE E 130 ? 0.3198 0.2749 0.3468 0.0370  -0.0451 0.0238  149 ILE E O   
4712 C  CB  . ILE E 130 ? 0.3376 0.2712 0.3560 0.0276  -0.0423 0.0300  149 ILE E CB  
4713 C  CG1 . ILE E 130 ? 0.2391 0.1653 0.2542 0.0336  -0.0471 0.0311  149 ILE E CG1 
4714 C  CG2 . ILE E 130 ? 0.3411 0.2677 0.3536 0.0217  -0.0416 0.0343  149 ILE E CG2 
4715 C  CD1 . ILE E 130 ? 0.2610 0.1743 0.2730 0.0347  -0.0484 0.0320  149 ILE E CD1 
4716 N  N   . THR E 131 ? 0.2557 0.2148 0.2897 0.0315  -0.0377 0.0195  150 THR E N   
4717 C  CA  . THR E 131 ? 0.2616 0.2274 0.3019 0.0358  -0.0374 0.0145  150 THR E CA  
4718 C  C   . THR E 131 ? 0.2556 0.2193 0.2993 0.0350  -0.0342 0.0118  150 THR E C   
4719 O  O   . THR E 131 ? 0.2473 0.2034 0.2881 0.0320  -0.0331 0.0140  150 THR E O   
4720 C  CB  . THR E 131 ? 0.2468 0.2259 0.2917 0.0349  -0.0354 0.0113  150 THR E CB  
4721 O  OG1 . THR E 131 ? 0.2190 0.2012 0.2655 0.0295  -0.0307 0.0103  150 THR E OG1 
4722 C  CG2 . THR E 131 ? 0.2691 0.2513 0.3106 0.0353  -0.0384 0.0139  150 THR E CG2 
4723 N  N   . THR E 132 ? 0.4232 0.3940 0.4729 0.0374  -0.0326 0.0070  151 THR E N   
4724 C  CA  . THR E 132 ? 0.4195 0.3895 0.4725 0.0364  -0.0292 0.0041  151 THR E CA  
4725 C  C   . THR E 132 ? 0.4096 0.3873 0.4659 0.0321  -0.0244 0.0018  151 THR E C   
4726 O  O   . THR E 132 ? 0.3989 0.3840 0.4560 0.0306  -0.0238 0.0014  151 THR E O   
4727 C  CB  . THR E 132 ? 0.4245 0.3966 0.4817 0.0415  -0.0301 0.0001  151 THR E CB  
4728 O  OG1 . THR E 132 ? 0.4346 0.4177 0.4958 0.0438  -0.0306 -0.0030 151 THR E OG1 
4729 C  CG2 . THR E 132 ? 0.4380 0.4002 0.4914 0.0460  -0.0345 0.0022  151 THR E CG2 
4730 N  N   . SER E 133 ? 0.3135 0.2893 0.3712 0.0302  -0.0210 0.0004  152 SER E N   
4731 C  CA  . SER E 133 ? 0.3001 0.2812 0.3598 0.0263  -0.0163 -0.0015 152 SER E CA  
4732 C  C   . SER E 133 ? 0.2842 0.2752 0.3491 0.0271  -0.0145 -0.0062 152 SER E C   
4733 O  O   . SER E 133 ? 0.2651 0.2614 0.3312 0.0239  -0.0113 -0.0077 152 SER E O   
4734 C  CB  . SER E 133 ? 0.2955 0.2715 0.3549 0.0246  -0.0134 -0.0018 152 SER E CB  
4735 O  OG  . SER E 133 ? 0.3074 0.2811 0.3688 0.0278  -0.0140 -0.0040 152 SER E OG  
4736 N  N   . ASP E 134 ? 0.3310 0.3245 0.3987 0.0314  -0.0166 -0.0086 153 ASP E N   
4737 C  CA  . ASP E 134 ? 0.3226 0.3263 0.3955 0.0321  -0.0150 -0.0135 153 ASP E CA  
4738 C  C   . ASP E 134 ? 0.3405 0.3514 0.4144 0.0344  -0.0183 -0.0138 153 ASP E C   
4739 O  O   . ASP E 134 ? 0.3419 0.3622 0.4202 0.0359  -0.0180 -0.0180 153 ASP E O   
4740 C  CB  . ASP E 134 ? 0.3321 0.3362 0.4083 0.0354  -0.0147 -0.0168 153 ASP E CB  
4741 C  CG  . ASP E 134 ? 0.3585 0.3572 0.4333 0.0408  -0.0195 -0.0153 153 ASP E CG  
4742 O  OD1 . ASP E 134 ? 0.3600 0.3543 0.4309 0.0419  -0.0231 -0.0115 153 ASP E OD1 
4743 O  OD2 . ASP E 134 ? 0.3686 0.3671 0.4457 0.0440  -0.0197 -0.0180 153 ASP E OD2 
4744 N  N   . ARG E 135 ? 0.2665 0.2733 0.3359 0.0344  -0.0213 -0.0095 154 ARG E N   
4745 C  CA  . ARG E 135 ? 0.2626 0.2753 0.3317 0.0366  -0.0248 -0.0091 154 ARG E CA  
4746 C  C   . ARG E 135 ? 0.2780 0.2967 0.3509 0.0422  -0.0275 -0.0124 154 ARG E C   
4747 O  O   . ARG E 135 ? 0.2749 0.3041 0.3509 0.0432  -0.0282 -0.0151 154 ARG E O   
4748 C  CB  . ARG E 135 ? 0.2441 0.2656 0.3146 0.0324  -0.0221 -0.0107 154 ARG E CB  
4749 C  CG  . ARG E 135 ? 0.2252 0.2422 0.2912 0.0279  -0.0208 -0.0069 154 ARG E CG  
4750 C  CD  . ARG E 135 ? 0.2187 0.2302 0.2844 0.0245  -0.0166 -0.0069 154 ARG E CD  
4751 N  NE  . ARG E 135 ? 0.2004 0.2111 0.2631 0.0200  -0.0144 -0.0049 154 ARG E NE  
4752 C  CZ  . ARG E 135 ? 0.1991 0.2057 0.2609 0.0170  -0.0108 -0.0046 154 ARG E CZ  
4753 N  NH1 . ARG E 135 ? 0.1971 0.1998 0.2602 0.0177  -0.0091 -0.0059 154 ARG E NH1 
4754 N  NH2 . ARG E 135 ? 0.2017 0.2084 0.2608 0.0135  -0.0091 -0.0030 154 ARG E NH2 
4755 N  N   . ASP E 136 ? 0.4215 0.4339 0.4944 0.0461  -0.0291 -0.0125 155 ASP E N   
4756 C  CA  . ASP E 136 ? 0.4381 0.4556 0.5143 0.0523  -0.0320 -0.0157 155 ASP E CA  
4757 C  C   . ASP E 136 ? 0.4535 0.4663 0.5252 0.0572  -0.0379 -0.0122 155 ASP E C   
4758 O  O   . ASP E 136 ? 0.4610 0.4615 0.5275 0.0584  -0.0401 -0.0081 155 ASP E O   
4759 C  CB  . ASP E 136 ? 0.4392 0.4524 0.5173 0.0545  -0.0310 -0.0179 155 ASP E CB  
4760 C  CG  . ASP E 136 ? 0.4483 0.4677 0.5303 0.0612  -0.0338 -0.0218 155 ASP E CG  
4761 O  OD1 . ASP E 136 ? 0.4499 0.4777 0.5333 0.0641  -0.0365 -0.0229 155 ASP E OD1 
4762 O  OD2 . ASP E 136 ? 0.4492 0.4656 0.5327 0.0638  -0.0334 -0.0238 155 ASP E OD2 
4763 N  N   . ARG E 137 ? 0.4222 0.4448 0.4957 0.0599  -0.0403 -0.0137 156 ARG E N   
4764 C  CA  . ARG E 137 ? 0.4380 0.4569 0.5068 0.0648  -0.0459 -0.0102 156 ARG E CA  
4765 C  C   . ARG E 137 ? 0.4519 0.4633 0.5193 0.0718  -0.0498 -0.0101 156 ARG E C   
4766 O  O   . ARG E 137 ? 0.4642 0.4644 0.5249 0.0746  -0.0537 -0.0055 156 ARG E O   
4767 C  CB  . ARG E 137 ? 0.4430 0.4758 0.5147 0.0666  -0.0477 -0.0128 156 ARG E CB  
4768 C  CG  . ARG E 137 ? 0.4268 0.4675 0.5001 0.0599  -0.0440 -0.0135 156 ARG E CG  
4769 C  CD  . ARG E 137 ? 0.4324 0.4640 0.4986 0.0560  -0.0444 -0.0075 156 ARG E CD  
4770 N  NE  . ARG E 137 ? 0.4168 0.4537 0.4843 0.0491  -0.0400 -0.0084 156 ARG E NE  
4771 C  CZ  . ARG E 137 ? 0.4132 0.4608 0.4821 0.0476  -0.0399 -0.0100 156 ARG E CZ  
4772 N  NH1 . ARG E 137 ? 0.4393 0.4941 0.5087 0.0525  -0.0441 -0.0109 156 ARG E NH1 
4773 N  NH2 . ARG E 137 ? 0.4000 0.4510 0.4696 0.0414  -0.0358 -0.0109 156 ARG E NH2 
4774 N  N   . ASN E 138 ? 0.4959 0.5131 0.5692 0.0746  -0.0484 -0.0153 157 ASN E N   
4775 C  CA  . ASN E 138 ? 0.5049 0.5162 0.5774 0.0817  -0.0518 -0.0161 157 ASN E CA  
4776 C  C   . ASN E 138 ? 0.5193 0.5134 0.5860 0.0808  -0.0521 -0.0121 157 ASN E C   
4777 O  O   . ASN E 138 ? 0.5357 0.5205 0.5988 0.0865  -0.0560 -0.0108 157 ASN E O   
4778 C  CB  . ASN E 138 ? 0.4908 0.5132 0.5713 0.0840  -0.0496 -0.0229 157 ASN E CB  
4779 C  CG  . ASN E 138 ? 0.4929 0.5333 0.5796 0.0842  -0.0489 -0.0275 157 ASN E CG  
4780 O  OD1 . ASN E 138 ? 0.4852 0.5301 0.5704 0.0867  -0.0524 -0.0262 157 ASN E OD1 
4781 N  ND2 . ASN E 138 ? 0.4843 0.5351 0.5777 0.0813  -0.0445 -0.0328 157 ASN E ND2 
4782 N  N   . LYS E 139 ? 0.4964 0.4863 0.5620 0.0736  -0.0480 -0.0102 158 LYS E N   
4783 C  CA  . LYS E 139 ? 0.5030 0.4781 0.5637 0.0717  -0.0476 -0.0069 158 LYS E CA  
4784 C  C   . LYS E 139 ? 0.5142 0.4776 0.5665 0.0706  -0.0508 -0.0005 158 LYS E C   
4785 O  O   . LYS E 139 ? 0.5283 0.4784 0.5755 0.0698  -0.0515 0.0025  158 LYS E O   
4786 C  CB  . LYS E 139 ? 0.4930 0.4689 0.5559 0.0648  -0.0420 -0.0078 158 LYS E CB  
4787 C  CG  . LYS E 139 ? 0.4846 0.4674 0.5539 0.0655  -0.0387 -0.0133 158 LYS E CG  
4788 C  CD  . LYS E 139 ? 0.4753 0.4539 0.5444 0.0596  -0.0341 -0.0129 158 LYS E CD  
4789 C  CE  . LYS E 139 ? 0.4751 0.4613 0.5502 0.0594  -0.0302 -0.0182 158 LYS E CE  
4790 N  NZ  . LYS E 139 ? 0.4643 0.4638 0.5442 0.0568  -0.0273 -0.0214 158 LYS E NZ  
4791 N  N   . TYR E 140 ? 0.3124 0.2806 0.3629 0.0701  -0.0525 0.0015  159 TYR E N   
4792 C  CA  . TYR E 140 ? 0.3249 0.2828 0.3672 0.0683  -0.0551 0.0078  159 TYR E CA  
4793 C  C   . TYR E 140 ? 0.3488 0.2940 0.3848 0.0743  -0.0602 0.0104  159 TYR E C   
4794 O  O   . TYR E 140 ? 0.3509 0.2826 0.3795 0.0721  -0.0615 0.0153  159 TYR E O   
4795 C  CB  . TYR E 140 ? 0.3155 0.2821 0.3571 0.0669  -0.0559 0.0091  159 TYR E CB  
4796 C  CG  . TYR E 140 ? 0.2981 0.2758 0.3447 0.0607  -0.0509 0.0069  159 TYR E CG  
4797 C  CD1 . TYR E 140 ? 0.2879 0.2645 0.3372 0.0559  -0.0462 0.0055  159 TYR E CD1 
4798 C  CD2 . TYR E 140 ? 0.2929 0.2816 0.3410 0.0598  -0.0510 0.0062  159 TYR E CD2 
4799 C  CE1 . TYR E 140 ? 0.2678 0.2532 0.3208 0.0505  -0.0417 0.0035  159 TYR E CE1 
4800 C  CE2 . TYR E 140 ? 0.2826 0.2803 0.3346 0.0541  -0.0465 0.0040  159 TYR E CE2 
4801 C  CZ  . TYR E 140 ? 0.2656 0.2612 0.3199 0.0496  -0.0419 0.0027  159 TYR E CZ  
4802 O  OH  . TYR E 140 ? 0.2479 0.2513 0.3054 0.0444  -0.0374 0.0006  159 TYR E OH  
4803 N  N   . GLY E 141 ? 0.4935 0.4430 0.5323 0.0820  -0.0632 0.0071  160 GLY E N   
4804 C  CA  . GLY E 141 ? 0.5109 0.4483 0.5440 0.0888  -0.0682 0.0089  160 GLY E CA  
4805 C  C   . GLY E 141 ? 0.5235 0.4461 0.5529 0.0869  -0.0673 0.0104  160 GLY E C   
4806 O  O   . GLY E 141 ? 0.5376 0.4452 0.5585 0.0865  -0.0699 0.0153  160 GLY E O   
4807 N  N   . LEU E 142 ? 0.7485 0.6754 0.7841 0.0853  -0.0635 0.0061  161 LEU E N   
4808 C  CA  . LEU E 142 ? 0.7590 0.6737 0.7920 0.0830  -0.0622 0.0068  161 LEU E CA  
4809 C  C   . LEU E 142 ? 0.7507 0.6581 0.7788 0.0747  -0.0600 0.0116  161 LEU E C   
4810 O  O   . LEU E 142 ? 0.7614 0.6543 0.7829 0.0732  -0.0612 0.0148  161 LEU E O   
4811 C  CB  . LEU E 142 ? 0.7600 0.6827 0.8009 0.0827  -0.0582 0.0010  161 LEU E CB  
4812 C  CG  . LEU E 142 ? 0.7934 0.7222 0.8392 0.0908  -0.0600 -0.0043 161 LEU E CG  
4813 C  CD1 . LEU E 142 ? 0.7791 0.7170 0.8325 0.0890  -0.0553 -0.0097 161 LEU E CD1 
4814 C  CD2 . LEU E 142 ? 0.8029 0.7170 0.8427 0.0970  -0.0644 -0.0031 161 LEU E CD2 
4815 N  N   . LEU E 143 ? 0.4154 0.3329 0.4466 0.0692  -0.0567 0.0117  162 LEU E N   
4816 C  CA  . LEU E 143 ? 0.4055 0.3187 0.4330 0.0614  -0.0543 0.0157  162 LEU E CA  
4817 C  C   . LEU E 143 ? 0.4195 0.3196 0.4374 0.0608  -0.0580 0.0217  162 LEU E C   
4818 O  O   . LEU E 143 ? 0.4280 0.3178 0.4409 0.0561  -0.0572 0.0247  162 LEU E O   
4819 C  CB  . LEU E 143 ? 0.3888 0.3152 0.4204 0.0570  -0.0510 0.0150  162 LEU E CB  
4820 C  CG  . LEU E 143 ? 0.3739 0.2978 0.4022 0.0493  -0.0484 0.0186  162 LEU E CG  
4821 C  CD1 . LEU E 143 ? 0.3612 0.2794 0.3900 0.0458  -0.0454 0.0180  162 LEU E CD1 
4822 C  CD2 . LEU E 143 ? 0.3555 0.2926 0.3881 0.0459  -0.0453 0.0172  162 LEU E CD2 
4823 N  N   . ALA E 144 ? 0.4920 0.3927 0.5070 0.0653  -0.0619 0.0233  163 ALA E N   
4824 C  CA  . ALA E 144 ? 0.5107 0.3984 0.5156 0.0653  -0.0657 0.0291  163 ALA E CA  
4825 C  C   . ALA E 144 ? 0.5299 0.4010 0.5294 0.0669  -0.0676 0.0303  163 ALA E C   
4826 O  O   . ALA E 144 ? 0.5405 0.3999 0.5329 0.0618  -0.0675 0.0345  163 ALA E O   
4827 C  CB  . ALA E 144 ? 0.5082 0.3992 0.5112 0.0717  -0.0701 0.0299  163 ALA E CB  
4828 N  N   . ARG E 145 ? 0.5708 0.4413 0.5734 0.0738  -0.0691 0.0263  164 ARG E N   
4829 C  CA  . ARG E 145 ? 0.5903 0.4453 0.5882 0.0760  -0.0709 0.0266  164 ARG E CA  
4830 C  C   . ARG E 145 ? 0.5832 0.4336 0.5811 0.0684  -0.0670 0.0269  164 ARG E C   
4831 O  O   . ARG E 145 ? 0.6022 0.4377 0.5925 0.0655  -0.0681 0.0303  164 ARG E O   
4832 C  CB  . ARG E 145 ? 0.6032 0.4618 0.6065 0.0844  -0.0723 0.0211  164 ARG E CB  
4833 C  CG  . ARG E 145 ? 0.6317 0.4749 0.6307 0.0870  -0.0739 0.0205  164 ARG E CG  
4834 C  CD  . ARG E 145 ? 0.6526 0.4770 0.6396 0.0877  -0.0782 0.0262  164 ARG E CD  
4835 N  NE  . ARG E 145 ? 0.6756 0.5000 0.6594 0.0951  -0.0829 0.0276  164 ARG E NE  
4836 C  CZ  . ARG E 145 ? 0.6935 0.5023 0.6664 0.0972  -0.0872 0.0327  164 ARG E CZ  
4837 N  NH1 . ARG E 145 ? 0.6987 0.4906 0.6632 0.0918  -0.0871 0.0367  164 ARG E NH1 
4838 N  NH2 . ARG E 145 ? 0.6816 0.4917 0.6519 0.1045  -0.0915 0.0338  164 ARG E NH2 
4839 N  N   . LEU E 146 ? 0.4688 0.3318 0.4749 0.0651  -0.0625 0.0233  165 LEU E N   
4840 C  CA  . LEU E 146 ? 0.4546 0.3153 0.4614 0.0583  -0.0587 0.0232  165 LEU E CA  
4841 C  C   . LEU E 146 ? 0.4708 0.3264 0.4714 0.0508  -0.0580 0.0285  165 LEU E C   
4842 O  O   . LEU E 146 ? 0.4765 0.3249 0.4742 0.0455  -0.0564 0.0299  165 LEU E O   
4843 C  CB  . LEU E 146 ? 0.4354 0.3111 0.4516 0.0565  -0.0540 0.0187  165 LEU E CB  
4844 C  CG  . LEU E 146 ? 0.4475 0.3286 0.4702 0.0622  -0.0535 0.0129  165 LEU E CG  
4845 C  CD1 . LEU E 146 ? 0.4137 0.3090 0.4444 0.0594  -0.0487 0.0092  165 LEU E CD1 
4846 C  CD2 . LEU E 146 ? 0.4514 0.3204 0.4712 0.0635  -0.0544 0.0120  165 LEU E CD2 
4847 N  N   . ALA E 147 ? 0.4546 0.3147 0.4533 0.0503  -0.0592 0.0314  166 ALA E N   
4848 C  CA  . ALA E 147 ? 0.4541 0.3102 0.4466 0.0434  -0.0587 0.0365  166 ALA E CA  
4849 C  C   . ALA E 147 ? 0.4810 0.3192 0.4631 0.0433  -0.0623 0.0410  166 ALA E C   
4850 O  O   . ALA E 147 ? 0.4889 0.3202 0.4652 0.0365  -0.0614 0.0447  166 ALA E O   
4851 C  CB  . ALA E 147 ? 0.4483 0.3147 0.4416 0.0433  -0.0590 0.0380  166 ALA E CB  
4852 N  N   . VAL E 148 ? 0.5224 0.3529 0.5016 0.0508  -0.0664 0.0406  167 VAL E N   
4853 C  CA  . VAL E 148 ? 0.5480 0.3597 0.5167 0.0517  -0.0702 0.0445  167 VAL E CA  
4854 C  C   . VAL E 148 ? 0.5633 0.3647 0.5306 0.0486  -0.0688 0.0434  167 VAL E C   
4855 O  O   . VAL E 148 ? 0.5698 0.3580 0.5288 0.0434  -0.0693 0.0472  167 VAL E O   
4856 C  CB  . VAL E 148 ? 0.5495 0.3560 0.5159 0.0617  -0.0751 0.0439  167 VAL E CB  
4857 C  CG1 . VAL E 148 ? 0.5766 0.3616 0.5315 0.0628  -0.0788 0.0477  167 VAL E CG1 
4858 C  CG2 . VAL E 148 ? 0.5559 0.3721 0.5228 0.0647  -0.0769 0.0454  167 VAL E CG2 
4859 N  N   . GLU E 149 ? 0.8943 0.7020 0.8694 0.0515  -0.0669 0.0379  168 GLU E N   
4860 C  CA  . GLU E 149 ? 0.8981 0.6980 0.8730 0.0489  -0.0654 0.0360  168 GLU E CA  
4861 C  C   . GLU E 149 ? 0.8972 0.7007 0.8726 0.0392  -0.0614 0.0373  168 GLU E C   
4862 O  O   . GLU E 149 ? 0.9107 0.7048 0.8824 0.0348  -0.0607 0.0379  168 GLU E O   
4863 C  CB  . GLU E 149 ? 0.8912 0.6990 0.8747 0.0543  -0.0642 0.0297  168 GLU E CB  
4864 C  CG  . GLU E 149 ? 0.9199 0.7269 0.9042 0.0643  -0.0679 0.0274  168 GLU E CG  
4865 C  CD  . GLU E 149 ? 0.9722 0.7598 0.9473 0.0681  -0.0722 0.0292  168 GLU E CD  
4866 O  OE1 . GLU E 149 ? 0.9755 0.7517 0.9464 0.0641  -0.0715 0.0297  168 GLU E OE1 
4867 O  OE2 . GLU E 149 ? 0.9899 0.7736 0.9617 0.0753  -0.0763 0.0301  168 GLU E OE2 
4868 N  N   . ALA E 150 ? 0.6749 0.4924 0.6550 0.0361  -0.0588 0.0377  169 ALA E N   
4869 C  CA  . ALA E 150 ? 0.6590 0.4818 0.6401 0.0276  -0.0549 0.0388  169 ALA E CA  
4870 C  C   . ALA E 150 ? 0.6856 0.4965 0.6571 0.0213  -0.0560 0.0440  169 ALA E C   
4871 O  O   . ALA E 150 ? 0.7016 0.5103 0.6718 0.0147  -0.0538 0.0444  169 ALA E O   
4872 C  CB  . ALA E 150 ? 0.6245 0.4635 0.6116 0.0263  -0.0524 0.0382  169 ALA E CB  
4873 N  N   . GLY E 151 ? 0.6837 0.4870 0.6481 0.0231  -0.0595 0.0480  170 GLY E N   
4874 C  CA  . GLY E 151 ? 0.7197 0.5106 0.6740 0.0170  -0.0606 0.0533  170 GLY E CA  
4875 C  C   . GLY E 151 ? 0.7360 0.5291 0.6856 0.0155  -0.0618 0.0579  170 GLY E C   
4876 O  O   . GLY E 151 ? 0.7716 0.5529 0.7113 0.0117  -0.0636 0.0628  170 GLY E O   
4877 N  N   . PHE E 152 ? 0.5486 0.3568 0.5049 0.0183  -0.0609 0.0563  171 PHE E N   
4878 C  CA  . PHE E 152 ? 0.5518 0.3640 0.5044 0.0170  -0.0619 0.0602  171 PHE E CA  
4879 C  C   . PHE E 152 ? 0.5737 0.3704 0.5154 0.0200  -0.0666 0.0648  171 PHE E C   
4880 O  O   . PHE E 152 ? 0.5727 0.3615 0.5131 0.0274  -0.0699 0.0636  171 PHE E O   
4881 C  CB  . PHE E 152 ? 0.5285 0.3573 0.4895 0.0216  -0.0611 0.0571  171 PHE E CB  
4882 C  CG  . PHE E 152 ? 0.4801 0.3239 0.4498 0.0175  -0.0563 0.0539  171 PHE E CG  
4883 C  CD1 . PHE E 152 ? 0.4745 0.3256 0.4434 0.0110  -0.0539 0.0561  171 PHE E CD1 
4884 C  CD2 . PHE E 152 ? 0.4475 0.2977 0.4257 0.0202  -0.0541 0.0486  171 PHE E CD2 
4885 C  CE1 . PHE E 152 ? 0.4526 0.3166 0.4289 0.0078  -0.0496 0.0531  171 PHE E CE1 
4886 C  CE2 . PHE E 152 ? 0.4266 0.2894 0.4119 0.0167  -0.0498 0.0459  171 PHE E CE2 
4887 C  CZ  . PHE E 152 ? 0.4243 0.2937 0.4086 0.0107  -0.0476 0.0481  171 PHE E CZ  
4888 N  N   . ASP E 153 ? 0.7592 0.5516 0.6929 0.0143  -0.0669 0.0701  172 ASP E N   
4889 C  CA  . ASP E 153 ? 0.7875 0.5634 0.7090 0.0157  -0.0712 0.0753  172 ASP E CA  
4890 C  C   . ASP E 153 ? 0.7889 0.5687 0.7098 0.0236  -0.0747 0.0761  172 ASP E C   
4891 O  O   . ASP E 153 ? 0.8180 0.5844 0.7293 0.0272  -0.0789 0.0800  172 ASP E O   
4892 C  CB  . ASP E 153 ? 0.8010 0.5717 0.7140 0.0060  -0.0699 0.0806  172 ASP E CB  
4893 C  CG  . ASP E 153 ? 0.7986 0.5684 0.7131 -0.0023 -0.0661 0.0793  172 ASP E CG  
4894 O  OD1 . ASP E 153 ? 0.8034 0.5659 0.7194 -0.0006 -0.0663 0.0765  172 ASP E OD1 
4895 O  OD2 . ASP E 153 ? 0.7805 0.5576 0.6948 -0.0103 -0.0631 0.0810  172 ASP E OD2 
4896 N  N   . TRP E 154 ? 0.6057 0.4038 0.5366 0.0262  -0.0730 0.0725  173 TRP E N   
4897 C  CA  . TRP E 154 ? 0.6012 0.4058 0.5330 0.0336  -0.0761 0.0724  173 TRP E CA  
4898 C  C   . TRP E 154 ? 0.5642 0.3885 0.5090 0.0366  -0.0737 0.0665  173 TRP E C   
4899 O  O   . TRP E 154 ? 0.5384 0.3748 0.4888 0.0310  -0.0696 0.0651  173 TRP E O   
4900 C  CB  . TRP E 154 ? 0.6147 0.4191 0.5385 0.0300  -0.0772 0.0779  173 TRP E CB  
4901 C  CG  . TRP E 154 ? 0.6247 0.4301 0.5456 0.0381  -0.0817 0.0792  173 TRP E CG  
4902 C  CD1 . TRP E 154 ? 0.6474 0.4382 0.5600 0.0449  -0.0868 0.0817  173 TRP E CD1 
4903 C  CD2 . TRP E 154 ? 0.6102 0.4322 0.5362 0.0404  -0.0817 0.0778  173 TRP E CD2 
4904 N  NE1 . TRP E 154 ? 0.6539 0.4519 0.5663 0.0515  -0.0900 0.0820  173 TRP E NE1 
4905 C  CE2 . TRP E 154 ? 0.6244 0.4417 0.5451 0.0486  -0.0870 0.0796  173 TRP E CE2 
4906 C  CE3 . TRP E 154 ? 0.5934 0.4335 0.5277 0.0363  -0.0778 0.0752  173 TRP E CE3 
4907 C  CZ2 . TRP E 154 ? 0.6107 0.4418 0.5344 0.0527  -0.0884 0.0787  173 TRP E CZ2 
4908 C  CZ3 . TRP E 154 ? 0.5831 0.4358 0.5201 0.0401  -0.0791 0.0742  173 TRP E CZ3 
4909 C  CH2 . TRP E 154 ? 0.5873 0.4360 0.5193 0.0480  -0.0844 0.0759  173 TRP E CH2 
4910 N  N   . VAL E 155 ? 0.6108 0.4379 0.5598 0.0455  -0.0762 0.0630  174 VAL E N   
4911 C  CA  . VAL E 155 ? 0.5902 0.4353 0.5510 0.0486  -0.0741 0.0573  174 VAL E CA  
4912 C  C   . VAL E 155 ? 0.5981 0.4502 0.5594 0.0561  -0.0777 0.0568  174 VAL E C   
4913 O  O   . VAL E 155 ? 0.6188 0.4610 0.5742 0.0627  -0.0824 0.0585  174 VAL E O   
4914 C  CB  . VAL E 155 ? 0.5841 0.4294 0.5519 0.0521  -0.0728 0.0519  174 VAL E CB  
4915 C  CG1 . VAL E 155 ? 0.5472 0.4109 0.5266 0.0548  -0.0705 0.0461  174 VAL E CG1 
4916 C  CG2 . VAL E 155 ? 0.5728 0.4118 0.5403 0.0450  -0.0694 0.0522  174 VAL E CG2 
4917 N  N   . TYR E 156 ? 0.4434 0.3124 0.4114 0.0551  -0.0757 0.0545  175 TYR E N   
4918 C  CA  . TYR E 156 ? 0.4260 0.3036 0.3947 0.0612  -0.0789 0.0539  175 TYR E CA  
4919 C  C   . TYR E 156 ? 0.3971 0.2940 0.3777 0.0626  -0.0762 0.0477  175 TYR E C   
4920 O  O   . TYR E 156 ? 0.3784 0.2852 0.3637 0.0565  -0.0719 0.0463  175 TYR E O   
4921 C  CB  . TYR E 156 ? 0.4346 0.3113 0.3953 0.0575  -0.0802 0.0594  175 TYR E CB  
4922 C  CG  . TYR E 156 ? 0.4342 0.3216 0.3957 0.0629  -0.0832 0.0589  175 TYR E CG  
4923 C  CD1 . TYR E 156 ? 0.4536 0.3413 0.4160 0.0726  -0.0875 0.0568  175 TYR E CD1 
4924 C  CD2 . TYR E 156 ? 0.4143 0.3119 0.3755 0.0585  -0.0818 0.0603  175 TYR E CD2 
4925 C  CE1 . TYR E 156 ? 0.4449 0.3434 0.4081 0.0776  -0.0904 0.0561  175 TYR E CE1 
4926 C  CE2 . TYR E 156 ? 0.4168 0.3246 0.3784 0.0633  -0.0846 0.0596  175 TYR E CE2 
4927 C  CZ  . TYR E 156 ? 0.4288 0.3373 0.3916 0.0728  -0.0890 0.0575  175 TYR E CZ  
4928 O  OH  . TYR E 156 ? 0.4230 0.3426 0.3864 0.0776  -0.0919 0.0566  175 TYR E OH  
4929 N  N   . TYR E 157 ? 0.4520 0.3540 0.4371 0.0707  -0.0787 0.0437  176 TYR E N   
4930 C  CA  . TYR E 157 ? 0.4272 0.3474 0.4230 0.0724  -0.0765 0.0376  176 TYR E CA  
4931 C  C   . TYR E 157 ? 0.4260 0.3573 0.4212 0.0717  -0.0774 0.0387  176 TYR E C   
4932 O  O   . TYR E 157 ? 0.4303 0.3692 0.4270 0.0781  -0.0807 0.0369  176 TYR E O   
4933 C  CB  . TYR E 157 ? 0.4200 0.3426 0.4201 0.0815  -0.0793 0.0333  176 TYR E CB  
4934 C  CG  . TYR E 157 ? 0.4103 0.3490 0.4221 0.0819  -0.0758 0.0262  176 TYR E CG  
4935 C  CD1 . TYR E 157 ? 0.4043 0.3593 0.4219 0.0792  -0.0736 0.0237  176 TYR E CD1 
4936 C  CD2 . TYR E 157 ? 0.4123 0.3499 0.4292 0.0850  -0.0748 0.0220  176 TYR E CD2 
4937 C  CE1 . TYR E 157 ? 0.3845 0.3534 0.4121 0.0791  -0.0702 0.0173  176 TYR E CE1 
4938 C  CE2 . TYR E 157 ? 0.3947 0.3467 0.4218 0.0850  -0.0715 0.0157  176 TYR E CE2 
4939 C  CZ  . TYR E 157 ? 0.3856 0.3529 0.4178 0.0819  -0.0692 0.0134  176 TYR E CZ  
4940 O  OH  . TYR E 157 ? 0.3825 0.3635 0.4242 0.0814  -0.0657 0.0072  176 TYR E OH  
4941 N  N   . GLU E 158 ? 0.5031 0.4357 0.4961 0.0639  -0.0745 0.0415  177 GLU E N   
4942 C  CA  . GLU E 158 ? 0.5092 0.4501 0.4998 0.0624  -0.0754 0.0434  177 GLU E CA  
4943 C  C   . GLU E 158 ? 0.5067 0.4658 0.5060 0.0653  -0.0749 0.0377  177 GLU E C   
4944 O  O   . GLU E 158 ? 0.5272 0.4912 0.5252 0.0711  -0.0789 0.0376  177 GLU E O   
4945 C  CB  . GLU E 158 ? 0.5119 0.4528 0.5003 0.0531  -0.0715 0.0461  177 GLU E CB  
4946 C  CG  . GLU E 158 ? 0.5201 0.4661 0.5034 0.0511  -0.0728 0.0493  177 GLU E CG  
4947 C  CD  . GLU E 158 ? 0.5264 0.4670 0.5039 0.0429  -0.0702 0.0537  177 GLU E CD  
4948 O  OE1 . GLU E 158 ? 0.5092 0.4446 0.4882 0.0384  -0.0669 0.0535  177 GLU E OE1 
4949 O  OE2 . GLU E 158 ? 0.5422 0.4843 0.5137 0.0409  -0.0716 0.0573  177 GLU E OE2 
4950 N  N   . SER E 159 ? 0.5621 0.5309 0.5699 0.0612  -0.0699 0.0330  178 SER E N   
4951 C  CA  . SER E 159 ? 0.5400 0.5261 0.5563 0.0627  -0.0687 0.0272  178 SER E CA  
4952 C  C   . SER E 159 ? 0.5353 0.5255 0.5598 0.0660  -0.0671 0.0215  178 SER E C   
4953 O  O   . SER E 159 ? 0.5360 0.5170 0.5607 0.0651  -0.0656 0.0216  178 SER E O   
4954 C  CB  . SER E 159 ? 0.5181 0.5131 0.5373 0.0551  -0.0639 0.0261  178 SER E CB  
4955 O  OG  . SER E 159 ? 0.5067 0.5173 0.5343 0.0555  -0.0619 0.0200  178 SER E OG  
4956 N  N   . ARG E 160 ? 0.5044 0.5089 0.5357 0.0695  -0.0675 0.0163  179 ARG E N   
4957 C  CA  . ARG E 160 ? 0.4945 0.5055 0.5342 0.0718  -0.0655 0.0103  179 ARG E CA  
4958 C  C   . ARG E 160 ? 0.4718 0.4857 0.5165 0.0645  -0.0592 0.0078  179 ARG E C   
4959 O  O   . ARG E 160 ? 0.4787 0.4973 0.5300 0.0650  -0.0566 0.0030  179 ARG E O   
4960 C  CB  . ARG E 160 ? 0.5033 0.5302 0.5489 0.0766  -0.0674 0.0053  179 ARG E CB  
4961 C  CG  . ARG E 160 ? 0.5507 0.5750 0.5941 0.0861  -0.0732 0.0055  179 ARG E CG  
4962 C  CD  . ARG E 160 ? 0.5511 0.5926 0.5999 0.0910  -0.0755 0.0007  179 ARG E CD  
4963 N  NE  . ARG E 160 ? 0.5610 0.5997 0.6079 0.1009  -0.0811 0.0007  179 ARG E NE  
4964 C  CZ  . ARG E 160 ? 0.5931 0.6440 0.6421 0.1073  -0.0850 -0.0020 179 ARG E CZ  
4965 N  NH1 . ARG E 160 ? 0.6000 0.6670 0.6532 0.1044  -0.0839 -0.0049 179 ARG E NH1 
4966 N  NH2 . ARG E 160 ? 0.6257 0.6727 0.6724 0.1168  -0.0902 -0.0019 179 ARG E NH2 
4967 N  N   . ASN E 161 ? 0.4345 0.4457 0.4757 0.0580  -0.0568 0.0109  180 ASN E N   
4968 C  CA  . ASN E 161 ? 0.4239 0.4378 0.4690 0.0513  -0.0510 0.0088  180 ASN E CA  
4969 C  C   . ASN E 161 ? 0.4269 0.4277 0.4676 0.0473  -0.0492 0.0128  180 ASN E C   
4970 O  O   . ASN E 161 ? 0.4202 0.4217 0.4635 0.0424  -0.0446 0.0114  180 ASN E O   
4971 C  CB  . ASN E 161 ? 0.4179 0.4423 0.4640 0.0468  -0.0489 0.0079  180 ASN E CB  
4972 C  CG  . ASN E 161 ? 0.4090 0.4469 0.4589 0.0504  -0.0511 0.0042  180 ASN E CG  
4973 O  OD1 . ASN E 161 ? 0.4059 0.4501 0.4614 0.0543  -0.0515 -0.0003 180 ASN E OD1 
4974 N  ND2 . ASN E 161 ? 0.4051 0.4482 0.4520 0.0490  -0.0525 0.0058  180 ASN E ND2 
4975 N  N   . HIS E 162 ? 0.3373 0.3261 0.3709 0.0494  -0.0529 0.0178  181 HIS E N   
4976 C  CA  . HIS E 162 ? 0.3346 0.3108 0.3636 0.0456  -0.0515 0.0215  181 HIS E CA  
4977 C  C   . HIS E 162 ? 0.3506 0.3129 0.3719 0.0490  -0.0561 0.0262  181 HIS E C   
4978 O  O   . HIS E 162 ? 0.3620 0.3239 0.3805 0.0544  -0.0605 0.0273  181 HIS E O   
4979 C  CB  . HIS E 162 ? 0.3222 0.2996 0.3485 0.0386  -0.0487 0.0241  181 HIS E CB  
4980 C  CG  . HIS E 162 ? 0.3445 0.3182 0.3630 0.0381  -0.0520 0.0293  181 HIS E CG  
4981 N  ND1 . HIS E 162 ? 0.3390 0.3224 0.3574 0.0381  -0.0529 0.0290  181 HIS E ND1 
4982 C  CD2 . HIS E 162 ? 0.3571 0.3185 0.3674 0.0372  -0.0544 0.0348  181 HIS E CD2 
4983 C  CE1 . HIS E 162 ? 0.3610 0.3382 0.3712 0.0375  -0.0559 0.0344  181 HIS E CE1 
4984 N  NE2 . HIS E 162 ? 0.3661 0.3297 0.3712 0.0368  -0.0568 0.0380  181 HIS E NE2 
4985 N  N   . VAL E 163 ? 0.3444 0.2951 0.3621 0.0459  -0.0550 0.0289  182 VAL E N   
4986 C  CA  . VAL E 163 ? 0.3591 0.2949 0.3686 0.0479  -0.0589 0.0335  182 VAL E CA  
4987 C  C   . VAL E 163 ? 0.3617 0.2904 0.3643 0.0411  -0.0579 0.0387  182 VAL E C   
4988 O  O   . VAL E 163 ? 0.3538 0.2874 0.3589 0.0353  -0.0537 0.0380  182 VAL E O   
4989 C  CB  . VAL E 163 ? 0.3633 0.2903 0.3741 0.0505  -0.0589 0.0318  182 VAL E CB  
4990 C  CG1 . VAL E 163 ? 0.3955 0.3062 0.3972 0.0528  -0.0631 0.0363  182 VAL E CG1 
4991 C  CG2 . VAL E 163 ? 0.3602 0.2958 0.3786 0.0566  -0.0592 0.0260  182 VAL E CG2 
4992 N  N   . HIS E 164 ? 0.3351 0.2523 0.3287 0.0420  -0.0616 0.0438  183 HIS E N   
4993 C  CA  . HIS E 164 ? 0.3485 0.2590 0.3347 0.0354  -0.0609 0.0490  183 HIS E CA  
4994 C  C   . HIS E 164 ? 0.3756 0.2696 0.3555 0.0340  -0.0620 0.0521  183 HIS E C   
4995 O  O   . HIS E 164 ? 0.4045 0.2882 0.3801 0.0393  -0.0659 0.0533  183 HIS E O   
4996 C  CB  . HIS E 164 ? 0.3674 0.2785 0.3470 0.0360  -0.0640 0.0530  183 HIS E CB  
4997 C  CG  . HIS E 164 ? 0.3868 0.2912 0.3582 0.0292  -0.0634 0.0585  183 HIS E CG  
4998 N  ND1 . HIS E 164 ? 0.3658 0.2791 0.3390 0.0226  -0.0596 0.0585  183 HIS E ND1 
4999 C  CD2 . HIS E 164 ? 0.4144 0.3042 0.3755 0.0277  -0.0661 0.0640  183 HIS E CD2 
5000 C  CE1 . HIS E 164 ? 0.3874 0.2928 0.3521 0.0173  -0.0599 0.0637  183 HIS E CE1 
5001 N  NE2 . HIS E 164 ? 0.4192 0.3101 0.3764 0.0200  -0.0637 0.0672  183 HIS E NE2 
5002 N  N   . VAL E 165 ? 0.4059 0.2975 0.3850 0.0270  -0.0586 0.0531  184 VAL E N   
5003 C  CA  . VAL E 165 ? 0.4345 0.3114 0.4081 0.0246  -0.0591 0.0556  184 VAL E CA  
5004 C  C   . VAL E 165 ? 0.4470 0.3195 0.4138 0.0165  -0.0578 0.0602  184 VAL E C   
5005 O  O   . VAL E 165 ? 0.4272 0.3097 0.3973 0.0113  -0.0542 0.0595  184 VAL E O   
5006 C  CB  . VAL E 165 ? 0.4232 0.3011 0.4037 0.0244  -0.0562 0.0512  184 VAL E CB  
5007 C  CG1 . VAL E 165 ? 0.4181 0.2970 0.4035 0.0324  -0.0581 0.0470  184 VAL E CG1 
5008 C  CG2 . VAL E 165 ? 0.3869 0.2783 0.3745 0.0199  -0.0513 0.0483  184 VAL E CG2 
5009 N  N   . SER E 166 ? 0.5571 0.4145 0.5142 0.0153  -0.0605 0.0648  185 SER E N   
5010 C  CA  . SER E 166 ? 0.5775 0.4300 0.5271 0.0072  -0.0594 0.0695  185 SER E CA  
5011 C  C   . SER E 166 ? 0.5972 0.4344 0.5408 0.0036  -0.0598 0.0716  185 SER E C   
5012 O  O   . SER E 166 ? 0.6106 0.4379 0.5535 0.0082  -0.0619 0.0703  185 SER E O   
5013 C  CB  . SER E 166 ? 0.6029 0.4527 0.5442 0.0077  -0.0625 0.0744  185 SER E CB  
5014 O  OG  . SER E 166 ? 0.6320 0.4675 0.5660 0.0132  -0.0672 0.0769  185 SER E OG  
5015 N  N   . VAL E 167 ? 0.5437 0.3794 0.4828 -0.0049 -0.0576 0.0745  186 VAL E N   
5016 C  CA  . VAL E 167 ? 0.5744 0.3966 0.5077 -0.0098 -0.0574 0.0763  186 VAL E CA  
5017 C  C   . VAL E 167 ? 0.6007 0.4141 0.5226 -0.0166 -0.0581 0.0824  186 VAL E C   
5018 O  O   . VAL E 167 ? 0.5893 0.4102 0.5094 -0.0189 -0.0577 0.0847  186 VAL E O   
5019 C  CB  . VAL E 167 ? 0.5505 0.3806 0.4910 -0.0147 -0.0530 0.0726  186 VAL E CB  
5020 C  CG1 . VAL E 167 ? 0.5231 0.3599 0.4737 -0.0084 -0.0522 0.0668  186 VAL E CG1 
5021 C  CG2 . VAL E 167 ? 0.5343 0.3785 0.4775 -0.0207 -0.0495 0.0729  186 VAL E CG2 
5022 N  N   . LYS E 168 ? 0.7165 0.5139 0.6306 -0.0201 -0.0592 0.0848  187 LYS E N   
5023 C  CA  . LYS E 168 ? 0.7413 0.5288 0.6438 -0.0275 -0.0597 0.0906  187 LYS E CA  
5024 C  C   . LYS E 168 ? 0.7383 0.5375 0.6433 -0.0369 -0.0552 0.0904  187 LYS E C   
5025 O  O   . LYS E 168 ? 0.7335 0.5452 0.6484 -0.0376 -0.0520 0.0859  187 LYS E O   
5026 C  CB  . LYS E 168 ? 0.7614 0.5281 0.6550 -0.0291 -0.0618 0.0927  187 LYS E CB  
5027 C  CG  . LYS E 168 ? 0.7783 0.5301 0.6657 -0.0203 -0.0668 0.0944  187 LYS E CG  
5028 C  CD  . LYS E 168 ? 0.7970 0.5271 0.6748 -0.0225 -0.0686 0.0964  187 LYS E CD  
5029 C  CE  . LYS E 168 ? 0.8131 0.5271 0.6834 -0.0135 -0.0739 0.0985  187 LYS E CE  
5030 N  NZ  . LYS E 168 ? 0.8026 0.5224 0.6825 -0.0030 -0.0753 0.0931  187 LYS E NZ  
5031 N  N   . ALA E 169 ? 0.8881 0.6834 0.7840 -0.0440 -0.0550 0.0954  188 ALA E N   
5032 C  CA  . ALA E 169 ? 0.8975 0.7041 0.7950 -0.0532 -0.0508 0.0954  188 ALA E CA  
5033 C  C   . ALA E 169 ? 0.9067 0.7074 0.8035 -0.0598 -0.0488 0.0942  188 ALA E C   
5034 O  O   . ALA E 169 ? 0.9168 0.7001 0.8061 -0.0605 -0.0509 0.0961  188 ALA E O   
5035 C  CB  . ALA E 169 ? 0.9078 0.7129 0.7956 -0.0588 -0.0511 0.1010  188 ALA E CB  
5036 N  N   . ASP E 170 ? 0.9913 0.8067 0.8957 -0.0644 -0.0448 0.0909  189 ASP E N   
5037 C  CA  . ASP E 170 ? 1.0036 0.8164 0.9086 -0.0706 -0.0427 0.0892  189 ASP E CA  
5038 C  C   . ASP E 170 ? 1.0362 0.8373 0.9293 -0.0801 -0.0428 0.0940  189 ASP E C   
5039 O  O   . ASP E 170 ? 1.0556 0.8419 0.9432 -0.0826 -0.0439 0.0946  189 ASP E O   
5040 C  CB  . ASP E 170 ? 0.9774 0.8097 0.8926 -0.0733 -0.0385 0.0848  189 ASP E CB  
5041 C  CG  . ASP E 170 ? 0.9320 0.7743 0.8585 -0.0647 -0.0381 0.0798  189 ASP E CG  
5042 O  OD1 . ASP E 170 ? 0.9234 0.7568 0.8509 -0.0579 -0.0406 0.0785  189 ASP E OD1 
5043 O  OD2 . ASP E 170 ? 0.8955 0.7542 0.8294 -0.0647 -0.0353 0.0771  189 ASP E OD2 
5044 N  N   . GLY F 7   ? 0.7207 0.8232 0.7232 -0.0325 0.0070  0.0035  829 GLY F N   
5045 C  CA  . GLY F 7   ? 0.7264 0.8252 0.7304 -0.0313 0.0041  0.0047  829 GLY F CA  
5046 C  C   . GLY F 7   ? 0.7403 0.8415 0.7402 -0.0328 0.0003  0.0093  829 GLY F C   
5047 O  O   . GLY F 7   ? 0.7496 0.8514 0.7457 -0.0348 -0.0006 0.0135  829 GLY F O   
5048 N  N   . PRO F 8   ? 0.6798 0.7823 0.6802 -0.0317 -0.0021 0.0084  830 PRO F N   
5049 C  CA  . PRO F 8   ? 0.6748 0.7793 0.6712 -0.0322 -0.0061 0.0126  830 PRO F CA  
5050 C  C   . PRO F 8   ? 0.6587 0.7551 0.6536 -0.0315 -0.0089 0.0182  830 PRO F C   
5051 O  O   . PRO F 8   ? 0.6670 0.7576 0.6635 -0.0315 -0.0075 0.0191  830 PRO F O   
5052 C  CB  . PRO F 8   ? 0.6668 0.7743 0.6659 -0.0303 -0.0075 0.0091  830 PRO F CB  
5053 C  CG  . PRO F 8   ? 0.6723 0.7815 0.6755 -0.0302 -0.0036 0.0027  830 PRO F CG  
5054 C  CD  . PRO F 8   ? 0.6693 0.7722 0.6741 -0.0300 -0.0008 0.0030  830 PRO F CD  
5055 N  N   . HIS F 9   ? 0.5760 0.6718 0.5676 -0.0308 -0.0129 0.0217  831 HIS F N   
5056 C  CA  . HIS F 9   ? 0.5640 0.6511 0.5536 -0.0297 -0.0160 0.0269  831 HIS F CA  
5057 C  C   . HIS F 9   ? 0.5667 0.6533 0.5549 -0.0268 -0.0204 0.0284  831 HIS F C   
5058 O  O   . HIS F 9   ? 0.5764 0.6685 0.5604 -0.0274 -0.0224 0.0296  831 HIS F O   
5059 C  CB  . HIS F 9   ? 0.5601 0.6451 0.5435 -0.0331 -0.0163 0.0322  831 HIS F CB  
5060 C  CG  . HIS F 9   ? 0.5635 0.6390 0.5434 -0.0324 -0.0198 0.0378  831 HIS F CG  
5061 N  ND1 . HIS F 9   ? 0.5594 0.6264 0.5414 -0.0320 -0.0193 0.0390  831 HIS F ND1 
5062 C  CD2 . HIS F 9   ? 0.5715 0.6439 0.5454 -0.0320 -0.0238 0.0425  831 HIS F CD2 
5063 C  CE1 . HIS F 9   ? 0.5636 0.6225 0.5410 -0.0314 -0.0228 0.0441  831 HIS F CE1 
5064 N  NE2 . HIS F 9   ? 0.5836 0.6452 0.5559 -0.0313 -0.0256 0.0464  831 HIS F NE2 
5065 N  N   . ILE F 10  ? 0.5272 0.6077 0.5191 -0.0235 -0.0219 0.0282  832 ILE F N   
5066 C  CA  . ILE F 10  ? 0.5149 0.5949 0.5060 -0.0200 -0.0263 0.0293  832 ILE F CA  
5067 C  C   . ILE F 10  ? 0.5181 0.5919 0.5016 -0.0200 -0.0301 0.0362  832 ILE F C   
5068 O  O   . ILE F 10  ? 0.5151 0.5797 0.4968 -0.0204 -0.0305 0.0398  832 ILE F O   
5069 C  CB  . ILE F 10  ? 0.4882 0.5637 0.4854 -0.0163 -0.0266 0.0268  832 ILE F CB  
5070 C  CG1 . ILE F 10  ? 0.4767 0.5567 0.4807 -0.0168 -0.0224 0.0204  832 ILE F CG1 
5071 C  CG2 . ILE F 10  ? 0.4817 0.5586 0.4788 -0.0121 -0.0310 0.0272  832 ILE F CG2 
5072 C  CD1 . ILE F 10  ? 0.4660 0.5419 0.4760 -0.0139 -0.0220 0.0178  832 ILE F CD1 
5073 N  N   . ALA F 11  ? 0.4271 0.5057 0.4056 -0.0197 -0.0330 0.0380  833 ALA F N   
5074 C  CA  . ALA F 11  ? 0.4379 0.5103 0.4080 -0.0197 -0.0368 0.0448  833 ALA F CA  
5075 C  C   . ALA F 11  ? 0.4161 0.4806 0.3862 -0.0146 -0.0409 0.0468  833 ALA F C   
5076 O  O   . ALA F 11  ? 0.4079 0.4620 0.3725 -0.0144 -0.0432 0.0522  833 ALA F O   
5077 C  CB  . ALA F 11  ? 0.4511 0.5314 0.4155 -0.0208 -0.0385 0.0460  833 ALA F CB  
5078 N  N   . TYR F 12  ? 0.3694 0.4389 0.3456 -0.0105 -0.0418 0.0422  834 TYR F N   
5079 C  CA  . TYR F 12  ? 0.3605 0.4242 0.3377 -0.0050 -0.0457 0.0431  834 TYR F CA  
5080 C  C   . TYR F 12  ? 0.3511 0.4223 0.3371 -0.0017 -0.0451 0.0366  834 TYR F C   
5081 O  O   . TYR F 12  ? 0.3536 0.4355 0.3431 -0.0031 -0.0431 0.0319  834 TYR F O   
5082 C  CB  . TYR F 12  ? 0.3705 0.4324 0.3396 -0.0023 -0.0509 0.0480  834 TYR F CB  
5083 C  CG  . TYR F 12  ? 0.3825 0.4569 0.3523 -0.0005 -0.0527 0.0451  834 TYR F CG  
5084 C  CD1 . TYR F 12  ? 0.4029 0.4840 0.3675 -0.0040 -0.0523 0.0463  834 TYR F CD1 
5085 C  CD2 . TYR F 12  ? 0.3744 0.4545 0.3500 0.0045  -0.0547 0.0408  834 TYR F CD2 
5086 C  CE1 . TYR F 12  ? 0.3986 0.4914 0.3636 -0.0024 -0.0540 0.0434  834 TYR F CE1 
5087 C  CE2 . TYR F 12  ? 0.3715 0.4638 0.3478 0.0060  -0.0564 0.0378  834 TYR F CE2 
5088 C  CZ  . TYR F 12  ? 0.3973 0.4957 0.3682 0.0025  -0.0561 0.0391  834 TYR F CZ  
5089 O  OH  . TYR F 12  ? 0.4112 0.5221 0.3828 0.0039  -0.0578 0.0360  834 TYR F OH  
5090 N  N   . THR F 13  ? 0.3225 0.3880 0.3119 0.0025  -0.0468 0.0361  835 THR F N   
5091 C  CA  . THR F 13  ? 0.2949 0.3673 0.2920 0.0061  -0.0469 0.0304  835 THR F CA  
5092 C  C   . THR F 13  ? 0.2990 0.3684 0.2942 0.0124  -0.0524 0.0325  835 THR F C   
5093 O  O   . THR F 13  ? 0.2939 0.3518 0.2857 0.0145  -0.0544 0.0366  835 THR F O   
5094 C  CB  . THR F 13  ? 0.2864 0.3558 0.2908 0.0054  -0.0430 0.0266  835 THR F CB  
5095 O  OG1 . THR F 13  ? 0.2960 0.3528 0.2978 0.0059  -0.0435 0.0308  835 THR F OG1 
5096 C  CG2 . THR F 13  ? 0.2798 0.3537 0.2867 0.0001  -0.0377 0.0234  835 THR F CG2 
5097 N  N   . GLU F 14  ? 0.7319 0.8118 0.7291 0.0155  -0.0548 0.0295  836 GLU F N   
5098 C  CA  . GLU F 14  ? 0.7304 0.8091 0.7252 0.0221  -0.0604 0.0313  836 GLU F CA  
5099 C  C   . GLU F 14  ? 0.7007 0.7909 0.7038 0.0258  -0.0610 0.0247  836 GLU F C   
5100 O  O   . GLU F 14  ? 0.7007 0.8030 0.7079 0.0234  -0.0589 0.0198  836 GLU F O   
5101 C  CB  . GLU F 14  ? 0.7384 0.8185 0.7243 0.0227  -0.0643 0.0359  836 GLU F CB  
5102 C  CG  . GLU F 14  ? 0.7703 0.8488 0.7526 0.0301  -0.0705 0.0383  836 GLU F CG  
5103 C  CD  . GLU F 14  ? 0.8160 0.8941 0.7880 0.0306  -0.0743 0.0437  836 GLU F CD  
5104 O  OE1 . GLU F 14  ? 0.8207 0.8993 0.7885 0.0247  -0.0718 0.0458  836 GLU F OE1 
5105 O  OE2 . GLU F 14  ? 0.8453 0.9229 0.8135 0.0369  -0.0797 0.0458  836 GLU F OE2 
5106 N  N   . ALA F 15  ? 0.2609 0.3473 0.2663 0.0315  -0.0638 0.0244  837 ALA F N   
5107 C  CA  . ALA F 15  ? 0.2440 0.3418 0.2572 0.0355  -0.0647 0.0182  837 ALA F CA  
5108 C  C   . ALA F 15  ? 0.2593 0.3673 0.2698 0.0394  -0.0694 0.0182  837 ALA F C   
5109 O  O   . ALA F 15  ? 0.2793 0.3812 0.2825 0.0439  -0.0744 0.0234  837 ALA F O   
5110 C  CB  . ALA F 15  ? 0.2429 0.3339 0.2591 0.0407  -0.0663 0.0180  837 ALA F CB  
5111 N  N   . VAL F 16  ? 0.3147 0.4378 0.3306 0.0375  -0.0679 0.0122  838 VAL F N   
5112 C  CA  . VAL F 16  ? 0.3199 0.4547 0.3338 0.0408  -0.0722 0.0114  838 VAL F CA  
5113 C  C   . VAL F 16  ? 0.3117 0.4552 0.3316 0.0475  -0.0754 0.0070  838 VAL F C   
5114 O  O   . VAL F 16  ? 0.3206 0.4697 0.3374 0.0532  -0.0808 0.0081  838 VAL F O   
5115 C  CB  . VAL F 16  ? 0.3250 0.4722 0.3408 0.0350  -0.0691 0.0072  838 VAL F CB  
5116 C  CG1 . VAL F 16  ? 0.3130 0.4524 0.3255 0.0280  -0.0645 0.0098  838 VAL F CG1 
5117 C  CG2 . VAL F 16  ? 0.3074 0.4672 0.3335 0.0335  -0.0661 -0.0013 838 VAL F CG2 
5118 N  N   . SER F 17  ? 0.2382 0.3832 0.2666 0.0470  -0.0722 0.0021  839 SER F N   
5119 C  CA  . SER F 17  ? 0.2312 0.3849 0.2660 0.0530  -0.0747 -0.0025 839 SER F CA  
5120 C  C   . SER F 17  ? 0.3632 0.5094 0.4034 0.0534  -0.0719 -0.0041 839 SER F C   
5121 O  O   . SER F 17  ? 0.2272 0.3588 0.2640 0.0512  -0.0700 0.0001  839 SER F O   
5122 C  CB  . SER F 17  ? 0.2254 0.3984 0.2673 0.0507  -0.0733 -0.0102 839 SER F CB  
5123 O  OG  . SER F 17  ? 0.3482 0.5228 0.3961 0.0435  -0.0667 -0.0148 839 SER F OG  
5124 N  N   . ASP F 18  ? 0.2871 0.4439 0.3356 0.0560  -0.0717 -0.0104 840 ASP F N   
5125 C  CA  . ASP F 18  ? 0.2829 0.4344 0.3369 0.0565  -0.0690 -0.0127 840 ASP F CA  
5126 C  C   . ASP F 18  ? 0.2696 0.4249 0.3298 0.0486  -0.0622 -0.0178 840 ASP F C   
5127 O  O   . ASP F 18  ? 0.2613 0.4131 0.3263 0.0479  -0.0591 -0.0201 840 ASP F O   
5128 C  CB  . ASP F 18  ? 0.2822 0.4429 0.3416 0.0640  -0.0726 -0.0167 840 ASP F CB  
5129 C  CG  . ASP F 18  ? 0.2822 0.4634 0.3488 0.0628  -0.0720 -0.0243 840 ASP F CG  
5130 O  OD1 . ASP F 18  ? 0.2743 0.4629 0.3392 0.0587  -0.0714 -0.0250 840 ASP F OD1 
5131 O  OD2 . ASP F 18  ? 0.2816 0.4721 0.3556 0.0657  -0.0719 -0.0297 840 ASP F OD2 
5132 N  N   . THR F 19  ? 0.3169 0.4790 0.3765 0.0429  -0.0598 -0.0194 841 THR F N   
5133 C  CA  . THR F 19  ? 0.2995 0.4654 0.3642 0.0354  -0.0534 -0.0244 841 THR F CA  
5134 C  C   . THR F 19  ? 0.2946 0.4566 0.3544 0.0292  -0.0506 -0.0221 841 THR F C   
5135 O  O   . THR F 19  ? 0.2962 0.4601 0.3588 0.0230  -0.0454 -0.0259 841 THR F O   
5136 C  CB  . THR F 19  ? 0.3034 0.4874 0.3754 0.0345  -0.0527 -0.0323 841 THR F CB  
5137 O  OG1 . THR F 19  ? 0.3100 0.5043 0.3792 0.0357  -0.0563 -0.0323 841 THR F OG1 
5138 C  CG2 . THR F 19  ? 0.3099 0.4994 0.3877 0.0402  -0.0548 -0.0355 841 THR F CG2 
5139 N  N   . GLN F 20  ? 0.2626 0.4191 0.3146 0.0309  -0.0541 -0.0161 842 GLN F N   
5140 C  CA  . GLN F 20  ? 0.2694 0.4242 0.3165 0.0254  -0.0519 -0.0140 842 GLN F CA  
5141 C  C   . GLN F 20  ? 0.2856 0.4259 0.3246 0.0258  -0.0532 -0.0061 842 GLN F C   
5142 O  O   . GLN F 20  ? 0.2920 0.4266 0.3265 0.0311  -0.0580 -0.0014 842 GLN F O   
5143 C  CB  . GLN F 20  ? 0.2774 0.4456 0.3231 0.0256  -0.0546 -0.0159 842 GLN F CB  
5144 C  CG  . GLN F 20  ? 0.2745 0.4587 0.3279 0.0249  -0.0537 -0.0239 842 GLN F CG  
5145 C  CD  . GLN F 20  ? 0.2811 0.4786 0.3327 0.0273  -0.0580 -0.0250 842 GLN F CD  
5146 O  OE1 . GLN F 20  ? 0.2866 0.4830 0.3336 0.0335  -0.0636 -0.0207 842 GLN F OE1 
5147 N  NE2 . GLN F 20  ? 0.2838 0.4936 0.3386 0.0226  -0.0556 -0.0309 842 GLN F NE2 
5148 N  N   . ILE F 21  ? 0.2376 0.3719 0.2746 0.0201  -0.0489 -0.0049 843 ILE F N   
5149 C  CA  . ILE F 21  ? 0.2371 0.3592 0.2665 0.0191  -0.0495 0.0021  843 ILE F CA  
5150 C  C   . ILE F 21  ? 0.2446 0.3703 0.2701 0.0139  -0.0475 0.0026  843 ILE F C   
5151 O  O   . ILE F 21  ? 0.2585 0.3910 0.2877 0.0097  -0.0436 -0.0025 843 ILE F O   
5152 C  CB  . ILE F 21  ? 0.2301 0.3401 0.2608 0.0173  -0.0460 0.0034  843 ILE F CB  
5153 C  CG1 . ILE F 21  ? 0.2238 0.3302 0.2585 0.0224  -0.0478 0.0026  843 ILE F CG1 
5154 C  CG2 . ILE F 21  ? 0.2438 0.3424 0.2670 0.0156  -0.0464 0.0102  843 ILE F CG2 
5155 C  CD1 . ILE F 21  ? 0.2185 0.3133 0.2543 0.0210  -0.0447 0.0039  843 ILE F CD1 
5156 N  N   . MET F 22  ? 0.2167 0.3376 0.2340 0.0142  -0.0503 0.0086  844 MET F N   
5157 C  CA  . MET F 22  ? 0.2305 0.3550 0.2434 0.0096  -0.0486 0.0095  844 MET F CA  
5158 C  C   . MET F 22  ? 0.2482 0.3614 0.2564 0.0061  -0.0463 0.0144  844 MET F C   
5159 O  O   . MET F 22  ? 0.2540 0.3563 0.2589 0.0081  -0.0481 0.0193  844 MET F O   
5160 C  CB  . MET F 22  ? 0.2390 0.3693 0.2458 0.0121  -0.0536 0.0123  844 MET F CB  
5161 C  CG  . MET F 22  ? 0.2596 0.3926 0.2605 0.0076  -0.0524 0.0143  844 MET F CG  
5162 S  SD  . MET F 22  ? 0.2828 0.4302 0.2888 0.0029  -0.0483 0.0063  844 MET F SD  
5163 C  CE  . MET F 22  ? 0.2718 0.4329 0.2796 0.0076  -0.0533 0.0031  844 MET F CE  
5164 N  N   . LEU F 23  ? 0.3428 0.4590 0.3507 0.0009  -0.0422 0.0127  845 LEU F N   
5165 C  CA  . LEU F 23  ? 0.3603 0.4679 0.3639 -0.0027 -0.0398 0.0167  845 LEU F CA  
5166 C  C   . LEU F 23  ? 0.3848 0.4982 0.3836 -0.0067 -0.0386 0.0173  845 LEU F C   
5167 O  O   . LEU F 23  ? 0.3819 0.5052 0.3832 -0.0085 -0.0368 0.0123  845 LEU F O   
5168 C  CB  . LEU F 23  ? 0.3576 0.4605 0.3666 -0.0048 -0.0349 0.0137  845 LEU F CB  
5169 C  CG  . LEU F 23  ? 0.3512 0.4617 0.3664 -0.0072 -0.0308 0.0066  845 LEU F CG  
5170 C  CD1 . LEU F 23  ? 0.3509 0.4550 0.3683 -0.0100 -0.0259 0.0055  845 LEU F CD1 
5171 C  CD2 . LEU F 23  ? 0.3318 0.4475 0.3532 -0.0042 -0.0319 0.0020  845 LEU F CD2 
5172 N  N   . LYS F 24  ? 0.6523 0.7596 0.6440 -0.0083 -0.0395 0.0232  846 LYS F N   
5173 C  CA  . LYS F 24  ? 0.6822 0.7948 0.6687 -0.0122 -0.0383 0.0243  846 LYS F CA  
5174 C  C   . LYS F 24  ? 0.7002 0.8067 0.6850 -0.0163 -0.0346 0.0264  846 LYS F C   
5175 O  O   . LYS F 24  ? 0.6919 0.7883 0.6745 -0.0161 -0.0352 0.0308  846 LYS F O   
5176 C  CB  . LYS F 24  ? 0.6891 0.8019 0.6673 -0.0107 -0.0431 0.0298  846 LYS F CB  
5177 C  CG  . LYS F 24  ? 0.7138 0.8342 0.6866 -0.0144 -0.0424 0.0304  846 LYS F CG  
5178 C  CD  . LYS F 24  ? 0.7306 0.8450 0.6978 -0.0187 -0.0403 0.0349  846 LYS F CD  
5179 C  CE  . LYS F 24  ? 0.7571 0.8784 0.7172 -0.0218 -0.0407 0.0369  846 LYS F CE  
5180 N  NZ  . LYS F 24  ? 0.7550 0.8887 0.7189 -0.0234 -0.0381 0.0303  846 LYS F NZ  
5181 N  N   . TRP F 25  ? 0.5780 0.6908 0.5637 -0.0200 -0.0307 0.0230  847 TRP F N   
5182 C  CA  . TRP F 25  ? 0.5797 0.6886 0.5647 -0.0235 -0.0269 0.0240  847 TRP F CA  
5183 C  C   . TRP F 25  ? 0.5990 0.7143 0.5785 -0.0273 -0.0257 0.0249  847 TRP F C   
5184 O  O   . TRP F 25  ? 0.6144 0.7375 0.5912 -0.0274 -0.0273 0.0241  847 TRP F O   
5185 C  CB  . TRP F 25  ? 0.5798 0.6888 0.5720 -0.0239 -0.0225 0.0182  847 TRP F CB  
5186 C  CG  . TRP F 25  ? 0.5787 0.6973 0.5739 -0.0248 -0.0204 0.0119  847 TRP F CG  
5187 C  CD1 . TRP F 25  ? 0.5864 0.7112 0.5800 -0.0279 -0.0176 0.0095  847 TRP F CD1 
5188 C  CD2 . TRP F 25  ? 0.5742 0.6973 0.5745 -0.0228 -0.0209 0.0069  847 TRP F CD2 
5189 N  NE1 . TRP F 25  ? 0.5896 0.7216 0.5865 -0.0280 -0.0163 0.0033  847 TRP F NE1 
5190 C  CE2 . TRP F 25  ? 0.5842 0.7156 0.5854 -0.0252 -0.0183 0.0017  847 TRP F CE2 
5191 C  CE3 . TRP F 25  ? 0.5508 0.6721 0.5549 -0.0194 -0.0233 0.0062  847 TRP F CE3 
5192 C  CZ2 . TRP F 25  ? 0.5794 0.7170 0.5851 -0.0247 -0.0178 -0.0043 847 TRP F CZ2 
5193 C  CZ3 . TRP F 25  ? 0.5359 0.6644 0.5448 -0.0188 -0.0229 0.0003  847 TRP F CZ3 
5194 C  CH2 . TRP F 25  ? 0.5534 0.6898 0.5630 -0.0217 -0.0201 -0.0048 847 TRP F CH2 
5195 N  N   . THR F 26  ? 0.7134 0.8259 0.6914 -0.0305 -0.0227 0.0264  848 THR F N   
5196 C  CA  . THR F 26  ? 0.7312 0.8502 0.7045 -0.0343 -0.0210 0.0270  848 THR F CA  
5197 C  C   . THR F 26  ? 0.7299 0.8509 0.7070 -0.0363 -0.0160 0.0228  848 THR F C   
5198 O  O   . THR F 26  ? 0.7202 0.8347 0.6998 -0.0363 -0.0142 0.0235  848 THR F O   
5199 C  CB  . THR F 26  ? 0.7344 0.8485 0.6999 -0.0366 -0.0229 0.0343  848 THR F CB  
5200 O  OG1 . THR F 26  ? 0.7047 0.8107 0.6717 -0.0376 -0.0212 0.0363  848 THR F OG1 
5201 C  CG2 . THR F 26  ? 0.7410 0.8509 0.7019 -0.0340 -0.0281 0.0389  848 THR F CG2 
5202 N  N   . TYR F 27  ? 0.9780 1.1079 0.9554 -0.0377 -0.0137 0.0183  849 TYR F N   
5203 C  CA  . TYR F 27  ? 0.9954 1.1274 0.9760 -0.0389 -0.0090 0.0139  849 TYR F CA  
5204 C  C   . TYR F 27  ? 0.9997 1.1385 0.9755 -0.0424 -0.0073 0.0148  849 TYR F C   
5205 O  O   . TYR F 27  ? 0.9964 1.1432 0.9720 -0.0433 -0.0054 0.0105  849 TYR F O   
5206 C  CB  . TYR F 27  ? 0.9922 1.1282 0.9779 -0.0376 -0.0071 0.0068  849 TYR F CB  
5207 C  CG  . TYR F 27  ? 1.0096 1.1448 0.9986 -0.0379 -0.0024 0.0022  849 TYR F CG  
5208 C  CD1 . TYR F 27  ? 0.9937 1.1208 0.9863 -0.0365 -0.0009 0.0026  849 TYR F CD1 
5209 C  CD2 . TYR F 27  ? 1.0261 1.1684 1.0145 -0.0392 0.0003  -0.0025 849 TYR F CD2 
5210 C  CE1 . TYR F 27  ? 0.9944 1.1206 0.9896 -0.0363 0.0032  -0.0014 849 TYR F CE1 
5211 C  CE2 . TYR F 27  ? 1.0319 1.1728 1.0229 -0.0389 0.0045  -0.0067 849 TYR F CE2 
5212 C  CZ  . TYR F 27  ? 1.0238 1.1565 1.0181 -0.0373 0.0058  -0.0060 849 TYR F CZ  
5213 O  OH  . TYR F 27  ? 1.0258 1.1568 1.0220 -0.0364 0.0097  -0.0100 849 TYR F OH  
5214 N  N   . ILE F 37  ? 0.8520 1.0075 0.8472 -0.0409 0.0142  -0.0367 859 ILE F N   
5215 C  CA  . ILE F 37  ? 0.8493 0.9967 0.8488 -0.0394 0.0137  -0.0357 859 ILE F CA  
5216 C  C   . ILE F 37  ? 0.8377 0.9863 0.8398 -0.0404 0.0137  -0.0407 859 ILE F C   
5217 O  O   . ILE F 37  ? 0.8300 0.9867 0.8312 -0.0417 0.0113  -0.0416 859 ILE F O   
5218 C  CB  . ILE F 37  ? 0.8230 0.9693 0.8226 -0.0385 0.0097  -0.0287 859 ILE F CB  
5219 C  CG1 . ILE F 37  ? 0.8278 0.9744 0.8242 -0.0385 0.0095  -0.0236 859 ILE F CG1 
5220 C  CG2 . ILE F 37  ? 0.7866 0.9242 0.7906 -0.0367 0.0096  -0.0278 859 ILE F CG2 
5221 C  CD1 . ILE F 37  ? 0.8226 0.9786 0.8140 -0.0405 0.0079  -0.0220 859 ILE F CD1 
5222 N  N   . GLN F 38  ? 0.9653 1.1061 0.9704 -0.0399 0.0163  -0.0441 860 GLN F N   
5223 C  CA  . GLN F 38  ? 0.9620 1.1033 0.9698 -0.0414 0.0168  -0.0491 860 GLN F CA  
5224 C  C   . GLN F 38  ? 0.9323 1.0755 0.9434 -0.0407 0.0131  -0.0463 860 GLN F C   
5225 O  O   . GLN F 38  ? 0.9120 1.0603 0.9250 -0.0421 0.0122  -0.0499 860 GLN F O   
5226 C  CB  . GLN F 38  ? 0.9548 1.0862 0.9641 -0.0413 0.0211  -0.0533 860 GLN F CB  
5227 C  CG  . GLN F 38  ? 0.9679 1.0973 0.9739 -0.0419 0.0249  -0.0578 860 GLN F CG  
5228 C  CD  . GLN F 38  ? 0.9844 1.1029 0.9911 -0.0418 0.0289  -0.0617 860 GLN F CD  
5229 O  OE1 . GLN F 38  ? 0.9634 1.0746 0.9726 -0.0405 0.0290  -0.0595 860 GLN F OE1 
5230 N  NE2 . GLN F 38  ? 0.9684 1.0852 0.9724 -0.0432 0.0321  -0.0676 860 GLN F NE2 
5231 N  N   . GLY F 39  ? 0.8148 0.9538 0.8265 -0.0384 0.0110  -0.0403 861 GLY F N   
5232 C  CA  . GLY F 39  ? 0.7922 0.9321 0.8066 -0.0370 0.0073  -0.0373 861 GLY F CA  
5233 C  C   . GLY F 39  ? 0.7691 0.9013 0.7845 -0.0345 0.0061  -0.0315 861 GLY F C   
5234 O  O   . GLY F 39  ? 0.7748 0.9021 0.7883 -0.0340 0.0077  -0.0291 861 GLY F O   
5235 N  N   . PHE F 40  ? 0.6279 0.7597 0.6462 -0.0329 0.0032  -0.0296 862 PHE F N   
5236 C  CA  . PHE F 40  ? 0.6049 0.7291 0.6242 -0.0305 0.0019  -0.0245 862 PHE F CA  
5237 C  C   . PHE F 40  ? 0.5928 0.7125 0.6170 -0.0294 0.0025  -0.0266 862 PHE F C   
5238 O  O   . PHE F 40  ? 0.5880 0.7125 0.6150 -0.0301 0.0024  -0.0308 862 PHE F O   
5239 C  CB  . PHE F 40  ? 0.5936 0.7204 0.6103 -0.0290 -0.0030 -0.0187 862 PHE F CB  
5240 C  CG  . PHE F 40  ? 0.6186 0.7501 0.6299 -0.0304 -0.0038 -0.0161 862 PHE F CG  
5241 C  CD1 . PHE F 40  ? 0.6250 0.7659 0.6341 -0.0315 -0.0056 -0.0176 862 PHE F CD1 
5242 C  CD2 . PHE F 40  ? 0.6237 0.7509 0.6322 -0.0308 -0.0028 -0.0122 862 PHE F CD2 
5243 C  CE1 . PHE F 40  ? 0.6425 0.7880 0.6463 -0.0329 -0.0062 -0.0152 862 PHE F CE1 
5244 C  CE2 . PHE F 40  ? 0.6398 0.7719 0.6432 -0.0324 -0.0034 -0.0099 862 PHE F CE2 
5245 C  CZ  . PHE F 40  ? 0.6522 0.7933 0.6531 -0.0335 -0.0050 -0.0113 862 PHE F CZ  
5246 N  N   . TYR F 41  ? 0.6244 0.7354 0.6496 -0.0278 0.0033  -0.0238 863 TYR F N   
5247 C  CA  . TYR F 41  ? 0.5916 0.6977 0.6211 -0.0265 0.0037  -0.0249 863 TYR F CA  
5248 C  C   . TYR F 41  ? 0.5593 0.6634 0.5893 -0.0237 -0.0004 -0.0196 863 TYR F C   
5249 O  O   . TYR F 41  ? 0.5598 0.6596 0.5871 -0.0228 -0.0014 -0.0147 863 TYR F O   
5250 C  CB  . TYR F 41  ? 0.5899 0.6871 0.6200 -0.0266 0.0078  -0.0260 863 TYR F CB  
5251 C  CG  . TYR F 41  ? 0.5987 0.6955 0.6286 -0.0290 0.0121  -0.0318 863 TYR F CG  
5252 C  CD1 . TYR F 41  ? 0.6161 0.7079 0.6434 -0.0292 0.0154  -0.0322 863 TYR F CD1 
5253 C  CD2 . TYR F 41  ? 0.6119 0.7134 0.6440 -0.0309 0.0129  -0.0369 863 TYR F CD2 
5254 C  CE1 . TYR F 41  ? 0.6427 0.7328 0.6690 -0.0311 0.0192  -0.0375 863 TYR F CE1 
5255 C  CE2 . TYR F 41  ? 0.6326 0.7326 0.6638 -0.0334 0.0169  -0.0423 863 TYR F CE2 
5256 C  CZ  . TYR F 41  ? 0.6507 0.7444 0.6788 -0.0333 0.0201  -0.0425 863 TYR F CZ  
5257 O  OH  . TYR F 41  ? 0.6750 0.7659 0.7015 -0.0355 0.0240  -0.0478 863 TYR F OH  
5258 N  N   . ILE F 42  ? 0.3039 0.4113 0.3372 -0.0222 -0.0027 -0.0208 864 ILE F N   
5259 C  CA  . ILE F 42  ? 0.2858 0.3905 0.3195 -0.0190 -0.0066 -0.0162 864 ILE F CA  
5260 C  C   . ILE F 42  ? 0.2668 0.3665 0.3051 -0.0174 -0.0056 -0.0177 864 ILE F C   
5261 O  O   . ILE F 42  ? 0.2664 0.3706 0.3086 -0.0176 -0.0051 -0.0222 864 ILE F O   
5262 C  CB  . ILE F 42  ? 0.2864 0.3994 0.3194 -0.0174 -0.0112 -0.0155 864 ILE F CB  
5263 C  CG1 . ILE F 42  ? 0.2974 0.4134 0.3246 -0.0183 -0.0131 -0.0119 864 ILE F CG1 
5264 C  CG2 . ILE F 42  ? 0.2674 0.3773 0.3018 -0.0134 -0.0150 -0.0123 864 ILE F CG2 
5265 C  CD1 . ILE F 42  ? 0.3241 0.4464 0.3499 -0.0217 -0.0104 -0.0158 864 ILE F CD1 
5266 N  N   . TYR F 43  ? 0.3617 0.4525 0.3995 -0.0161 -0.0053 -0.0142 865 TYR F N   
5267 C  CA  . TYR F 43  ? 0.3430 0.4285 0.3847 -0.0146 -0.0041 -0.0153 865 TYR F CA  
5268 C  C   . TYR F 43  ? 0.3300 0.4138 0.3726 -0.0110 -0.0083 -0.0120 865 TYR F C   
5269 O  O   . TYR F 43  ? 0.3289 0.4097 0.3680 -0.0096 -0.0113 -0.0069 865 TYR F O   
5270 C  CB  . TYR F 43  ? 0.3392 0.4159 0.3800 -0.0154 -0.0007 -0.0143 865 TYR F CB  
5271 C  CG  . TYR F 43  ? 0.3593 0.4363 0.3988 -0.0183 0.0036  -0.0177 865 TYR F CG  
5272 C  CD1 . TYR F 43  ? 0.3574 0.4329 0.3994 -0.0197 0.0073  -0.0225 865 TYR F CD1 
5273 C  CD2 . TYR F 43  ? 0.3846 0.4631 0.4201 -0.0196 0.0039  -0.0161 865 TYR F CD2 
5274 C  CE1 . TYR F 43  ? 0.3777 0.4522 0.4178 -0.0220 0.0111  -0.0256 865 TYR F CE1 
5275 C  CE2 . TYR F 43  ? 0.3999 0.4785 0.4341 -0.0217 0.0077  -0.0194 865 TYR F CE2 
5276 C  CZ  . TYR F 43  ? 0.4026 0.4787 0.4389 -0.0228 0.0112  -0.0241 865 TYR F CZ  
5277 O  OH  . TYR F 43  ? 0.4127 0.4876 0.4470 -0.0246 0.0149  -0.0275 865 TYR F OH  
5278 N  N   . TYR F 44  ? 0.1678 0.2536 0.2150 -0.0094 -0.0086 -0.0150 866 TYR F N   
5279 C  CA  . TYR F 44  ? 0.1587 0.2428 0.2072 -0.0054 -0.0124 -0.0125 866 TYR F CA  
5280 C  C   . TYR F 44  ? 0.2892 0.3698 0.3422 -0.0043 -0.0105 -0.0150 866 TYR F C   
5281 O  O   . TYR F 44  ? 0.2856 0.3690 0.3418 -0.0065 -0.0070 -0.0199 866 TYR F O   
5282 C  CB  . TYR F 44  ? 0.1674 0.2607 0.2164 -0.0033 -0.0165 -0.0133 866 TYR F CB  
5283 C  CG  . TYR F 44  ? 0.1683 0.2719 0.2207 -0.0055 -0.0148 -0.0194 866 TYR F CG  
5284 C  CD1 . TYR F 44  ? 0.2943 0.4035 0.3522 -0.0042 -0.0148 -0.0237 866 TYR F CD1 
5285 C  CD2 . TYR F 44  ? 0.1779 0.2863 0.2282 -0.0090 -0.0130 -0.0213 866 TYR F CD2 
5286 C  CE1 . TYR F 44  ? 0.1597 0.2786 0.2207 -0.0068 -0.0131 -0.0296 866 TYR F CE1 
5287 C  CE2 . TYR F 44  ? 0.1877 0.3052 0.2409 -0.0114 -0.0113 -0.0271 866 TYR F CE2 
5288 C  CZ  . TYR F 44  ? 0.1754 0.2982 0.2340 -0.0105 -0.0114 -0.0313 866 TYR F CZ  
5289 O  OH  . TYR F 44  ? 0.1970 0.3293 0.2585 -0.0135 -0.0096 -0.0374 866 TYR F OH  
5290 N  N   . ARG F 45  ? 0.1608 0.2348 0.2136 -0.0012 -0.0127 -0.0117 867 ARG F N   
5291 C  CA  . ARG F 45  ? 0.3164 0.3861 0.3729 -0.0001 -0.0108 -0.0134 867 ARG F CA  
5292 C  C   . ARG F 45  ? 0.3133 0.3800 0.3703 0.0046  -0.0150 -0.0108 867 ARG F C   
5293 O  O   . ARG F 45  ? 0.3228 0.3862 0.3758 0.0064  -0.0186 -0.0061 867 ARG F O   
5294 C  CB  . ARG F 45  ? 0.3077 0.3686 0.3625 -0.0021 -0.0072 -0.0120 867 ARG F CB  
5295 C  CG  . ARG F 45  ? 0.2986 0.3533 0.3558 -0.0006 -0.0059 -0.0125 867 ARG F CG  
5296 C  CD  . ARG F 45  ? 0.3028 0.3487 0.3574 -0.0019 -0.0035 -0.0100 867 ARG F CD  
5297 N  NE  . ARG F 45  ? 0.3049 0.3462 0.3555 -0.0009 -0.0064 -0.0047 867 ARG F NE  
5298 C  CZ  . ARG F 45  ? 0.3007 0.3352 0.3487 -0.0018 -0.0052 -0.0019 867 ARG F CZ  
5299 N  NH1 . ARG F 45  ? 0.2989 0.3302 0.3479 -0.0030 -0.0013 -0.0039 867 ARG F NH1 
5300 N  NH2 . ARG F 45  ? 0.2997 0.3307 0.3441 -0.0015 -0.0079 0.0027  867 ARG F NH2 
5301 N  N   . PRO F 46  ? 0.2708 0.3384 0.3323 0.0065  -0.0145 -0.0138 868 PRO F N   
5302 C  CA  . PRO F 46  ? 0.2793 0.3430 0.3412 0.0113  -0.0181 -0.0116 868 PRO F CA  
5303 C  C   . PRO F 46  ? 0.2835 0.3356 0.3411 0.0116  -0.0187 -0.0063 868 PRO F C   
5304 O  O   . PRO F 46  ? 0.2796 0.3265 0.3369 0.0090  -0.0151 -0.0063 868 PRO F O   
5305 C  CB  . PRO F 46  ? 0.2613 0.3269 0.3287 0.0118  -0.0156 -0.0161 868 PRO F CB  
5306 C  CG  . PRO F 46  ? 0.2515 0.3257 0.3217 0.0080  -0.0123 -0.0212 868 PRO F CG  
5307 C  CD  . PRO F 46  ? 0.2671 0.3398 0.3333 0.0043  -0.0106 -0.0195 868 PRO F CD  
5308 N  N   . THR F 47  ? 0.2468 0.2950 0.3009 0.0147  -0.0232 -0.0021 869 THR F N   
5309 C  CA  . THR F 47  ? 0.2516 0.2887 0.3014 0.0147  -0.0239 0.0028  869 THR F CA  
5310 C  C   . THR F 47  ? 0.2458 0.2772 0.2986 0.0159  -0.0222 0.0014  869 THR F C   
5311 O  O   . THR F 47  ? 0.2489 0.2717 0.2992 0.0150  -0.0216 0.0042  869 THR F O   
5312 C  CB  . THR F 47  ? 0.2621 0.2949 0.3072 0.0180  -0.0292 0.0074  869 THR F CB  
5313 O  OG1 . THR F 47  ? 0.2694 0.3083 0.3116 0.0171  -0.0310 0.0086  869 THR F OG1 
5314 C  CG2 . THR F 47  ? 0.2561 0.2775 0.2962 0.0167  -0.0296 0.0124  869 THR F CG2 
5315 N  N   . ASP F 48  ? 0.3545 0.3914 0.4126 0.0178  -0.0214 -0.0032 870 ASP F N   
5316 C  CA  . ASP F 48  ? 0.3418 0.3746 0.4029 0.0190  -0.0196 -0.0050 870 ASP F CA  
5317 C  C   . ASP F 48  ? 0.3333 0.3640 0.3951 0.0148  -0.0144 -0.0066 870 ASP F C   
5318 O  O   . ASP F 48  ? 0.3301 0.3550 0.3927 0.0151  -0.0128 -0.0067 870 ASP F O   
5319 C  CB  . ASP F 48  ? 0.3449 0.3856 0.4114 0.0220  -0.0203 -0.0097 870 ASP F CB  
5320 C  CG  . ASP F 48  ? 0.3711 0.4114 0.4369 0.0276  -0.0256 -0.0082 870 ASP F CG  
5321 O  OD1 . ASP F 48  ? 0.3802 0.4160 0.4410 0.0287  -0.0290 -0.0037 870 ASP F OD1 
5322 O  OD2 . ASP F 48  ? 0.3825 0.4271 0.4527 0.0311  -0.0263 -0.0116 870 ASP F OD2 
5323 N  N   . SER F 49  ? 0.2921 0.3274 0.3535 0.0112  -0.0119 -0.0079 871 SER F N   
5324 C  CA  . SER F 49  ? 0.2901 0.3232 0.3516 0.0076  -0.0070 -0.0094 871 SER F CA  
5325 C  C   . SER F 49  ? 0.2958 0.3225 0.3527 0.0057  -0.0065 -0.0054 871 SER F C   
5326 O  O   . SER F 49  ? 0.3011 0.3292 0.3549 0.0048  -0.0083 -0.0028 871 SER F O   
5327 C  CB  . SER F 49  ? 0.2904 0.3313 0.3537 0.0046  -0.0042 -0.0136 871 SER F CB  
5328 O  OG  . SER F 49  ? 0.3019 0.3393 0.3646 0.0015  0.0005  -0.0151 871 SER F OG  
5329 N  N   . ASP F 50  ? 0.3834 0.4037 0.4398 0.0050  -0.0041 -0.0048 872 ASP F N   
5330 C  CA  . ASP F 50  ? 0.3813 0.3967 0.4339 0.0032  -0.0032 -0.0016 872 ASP F CA  
5331 C  C   . ASP F 50  ? 0.3890 0.4052 0.4413 0.0004  0.0013  -0.0039 872 ASP F C   
5332 O  O   . ASP F 50  ? 0.3986 0.4106 0.4486 -0.0006 0.0029  -0.0024 872 ASP F O   
5333 C  CB  . ASP F 50  ? 0.3858 0.3933 0.4374 0.0045  -0.0040 0.0008  872 ASP F CB  
5334 C  CG  . ASP F 50  ? 0.3926 0.3974 0.4434 0.0073  -0.0085 0.0035  872 ASP F CG  
5335 O  OD1 . ASP F 50  ? 0.3941 0.3923 0.4442 0.0086  -0.0094 0.0050  872 ASP F OD1 
5336 O  OD2 . ASP F 50  ? 0.3904 0.3993 0.4407 0.0082  -0.0113 0.0040  872 ASP F OD2 
5337 N  N   . ASN F 51  ? 0.4154 0.4371 0.4699 -0.0007 0.0032  -0.0078 873 ASN F N   
5338 C  CA  . ASN F 51  ? 0.4085 0.4304 0.4621 -0.0033 0.0074  -0.0103 873 ASN F CA  
5339 C  C   . ASN F 51  ? 0.4131 0.4408 0.4652 -0.0053 0.0073  -0.0109 873 ASN F C   
5340 O  O   . ASN F 51  ? 0.4190 0.4531 0.4728 -0.0053 0.0056  -0.0124 873 ASN F O   
5341 C  CB  . ASN F 51  ? 0.4110 0.4338 0.4676 -0.0039 0.0104  -0.0147 873 ASN F CB  
5342 C  CG  . ASN F 51  ? 0.4393 0.4594 0.4940 -0.0063 0.0150  -0.0170 873 ASN F CG  
5343 O  OD1 . ASN F 51  ? 0.4506 0.4743 0.5059 -0.0085 0.0172  -0.0206 873 ASN F OD1 
5344 N  ND2 . ASN F 51  ? 0.4534 0.4671 0.5054 -0.0059 0.0165  -0.0150 873 ASN F ND2 
5345 N  N   . ASP F 52  ? 0.3057 0.3316 0.3547 -0.0069 0.0092  -0.0100 874 ASP F N   
5346 C  CA  . ASP F 52  ? 0.3079 0.3390 0.3550 -0.0087 0.0092  -0.0105 874 ASP F CA  
5347 C  C   . ASP F 52  ? 0.3140 0.3488 0.3623 -0.0108 0.0122  -0.0154 874 ASP F C   
5348 O  O   . ASP F 52  ? 0.3299 0.3698 0.3771 -0.0124 0.0123  -0.0167 874 ASP F O   
5349 C  CB  . ASP F 52  ? 0.3011 0.3298 0.3446 -0.0095 0.0103  -0.0082 874 ASP F CB  
5350 C  CG  . ASP F 52  ? 0.3043 0.3314 0.3461 -0.0087 0.0070  -0.0033 874 ASP F CG  
5351 O  OD1 . ASP F 52  ? 0.3111 0.3391 0.3536 -0.0075 0.0036  -0.0015 874 ASP F OD1 
5352 O  OD2 . ASP F 52  ? 0.3053 0.3301 0.3448 -0.0091 0.0079  -0.0013 874 ASP F OD2 
5353 N  N   . SER F 53  ? 0.3326 0.3646 0.3829 -0.0109 0.0148  -0.0183 875 SER F N   
5354 C  CA  . SER F 53  ? 0.3366 0.3712 0.3878 -0.0135 0.0179  -0.0232 875 SER F CA  
5355 C  C   . SER F 53  ? 0.3425 0.3852 0.3974 -0.0137 0.0159  -0.0256 875 SER F C   
5356 O  O   . SER F 53  ? 0.3461 0.3930 0.4020 -0.0163 0.0179  -0.0299 875 SER F O   
5357 C  CB  . SER F 53  ? 0.3485 0.3764 0.3996 -0.0140 0.0218  -0.0252 875 SER F CB  
5358 O  OG  . SER F 53  ? 0.3694 0.3902 0.4169 -0.0132 0.0236  -0.0232 875 SER F OG  
5359 N  N   . ASP F 54  ? 0.3249 0.3698 0.3817 -0.0110 0.0118  -0.0230 876 ASP F N   
5360 C  CA  . ASP F 54  ? 0.3142 0.3671 0.3746 -0.0102 0.0094  -0.0251 876 ASP F CA  
5361 C  C   . ASP F 54  ? 0.3241 0.3840 0.3834 -0.0101 0.0061  -0.0240 876 ASP F C   
5362 O  O   . ASP F 54  ? 0.3279 0.3934 0.3892 -0.0079 0.0024  -0.0238 876 ASP F O   
5363 C  CB  . ASP F 54  ? 0.3042 0.3552 0.3670 -0.0067 0.0068  -0.0234 876 ASP F CB  
5364 C  CG  . ASP F 54  ? 0.3142 0.3599 0.3785 -0.0069 0.0100  -0.0251 876 ASP F CG  
5365 O  OD1 . ASP F 54  ? 0.3175 0.3624 0.3816 -0.0100 0.0142  -0.0285 876 ASP F OD1 
5366 O  OD2 . ASP F 54  ? 0.3044 0.3464 0.3697 -0.0041 0.0084  -0.0232 876 ASP F OD2 
5367 N  N   . TYR F 55  ? 0.3607 0.4205 0.4166 -0.0122 0.0073  -0.0235 877 TYR F N   
5368 C  CA  . TYR F 55  ? 0.3693 0.4358 0.4235 -0.0124 0.0045  -0.0225 877 TYR F CA  
5369 C  C   . TYR F 55  ? 0.3790 0.4534 0.4345 -0.0153 0.0061  -0.0276 877 TYR F C   
5370 O  O   . TYR F 55  ? 0.3905 0.4629 0.4452 -0.0182 0.0102  -0.0308 877 TYR F O   
5371 C  CB  . TYR F 55  ? 0.3727 0.4356 0.4223 -0.0131 0.0046  -0.0189 877 TYR F CB  
5372 C  CG  . TYR F 55  ? 0.3771 0.4357 0.4247 -0.0107 0.0013  -0.0132 877 TYR F CG  
5373 C  CD1 . TYR F 55  ? 0.3652 0.4155 0.4123 -0.0097 0.0024  -0.0110 877 TYR F CD1 
5374 C  CD2 . TYR F 55  ? 0.3851 0.4474 0.4307 -0.0095 -0.0029 -0.0102 877 TYR F CD2 
5375 C  CE1 . TYR F 55  ? 0.3708 0.4168 0.4157 -0.0081 -0.0005 -0.0061 877 TYR F CE1 
5376 C  CE2 . TYR F 55  ? 0.3787 0.4359 0.4217 -0.0078 -0.0057 -0.0049 877 TYR F CE2 
5377 C  CZ  . TYR F 55  ? 0.3815 0.4307 0.4243 -0.0073 -0.0045 -0.0030 877 TYR F CZ  
5378 O  OH  . TYR F 55  ? 0.3821 0.4260 0.4221 -0.0062 -0.0072 0.0019  877 TYR F OH  
5379 N  N   . LYS F 56  ? 0.3092 0.3925 0.3665 -0.0144 0.0028  -0.0285 878 LYS F N   
5380 C  CA  . LYS F 56  ? 0.3154 0.4075 0.3734 -0.0172 0.0038  -0.0332 878 LYS F CA  
5381 C  C   . LYS F 56  ? 0.3451 0.4386 0.3988 -0.0186 0.0034  -0.0316 878 LYS F C   
5382 O  O   . LYS F 56  ? 0.3447 0.4339 0.3951 -0.0171 0.0017  -0.0266 878 LYS F O   
5383 C  CB  . LYS F 56  ? 0.3137 0.4160 0.3754 -0.0154 0.0001  -0.0349 878 LYS F CB  
5384 C  CG  . LYS F 56  ? 0.2903 0.3953 0.3571 -0.0155 0.0016  -0.0391 878 LYS F CG  
5385 C  CD  . LYS F 56  ? 0.3039 0.4218 0.3742 -0.0148 -0.0012 -0.0425 878 LYS F CD  
5386 C  CE  . LYS F 56  ? 0.3304 0.4526 0.4060 -0.0159 0.0008  -0.0475 878 LYS F CE  
5387 N  NZ  . LYS F 56  ? 0.3141 0.4504 0.3937 -0.0148 -0.0022 -0.0511 878 LYS F NZ  
5388 N  N   . ARG F 57  ? 0.4810 0.5808 0.5345 -0.0218 0.0051  -0.0359 879 ARG F N   
5389 C  CA  . ARG F 57  ? 0.4998 0.6017 0.5491 -0.0233 0.0050  -0.0350 879 ARG F CA  
5390 C  C   . ARG F 57  ? 0.5142 0.6276 0.5641 -0.0248 0.0033  -0.0383 879 ARG F C   
5391 O  O   . ARG F 57  ? 0.5299 0.6484 0.5828 -0.0271 0.0050  -0.0437 879 ARG F O   
5392 C  CB  . ARG F 57  ? 0.5166 0.6117 0.5633 -0.0259 0.0098  -0.0368 879 ARG F CB  
5393 C  CG  . ARG F 57  ? 0.5356 0.6324 0.5780 -0.0270 0.0099  -0.0356 879 ARG F CG  
5394 C  CD  . ARG F 57  ? 0.5566 0.6454 0.5961 -0.0282 0.0142  -0.0366 879 ARG F CD  
5395 N  NE  . ARG F 57  ? 0.5906 0.6796 0.6301 -0.0315 0.0180  -0.0426 879 ARG F NE  
5396 C  CZ  . ARG F 57  ? 0.5857 0.6670 0.6255 -0.0325 0.0219  -0.0451 879 ARG F CZ  
5397 N  NH1 . ARG F 57  ? 0.5583 0.6319 0.5988 -0.0304 0.0224  -0.0423 879 ARG F NH1 
5398 N  NH2 . ARG F 57  ? 0.5907 0.6716 0.6296 -0.0359 0.0253  -0.0506 879 ARG F NH2 
5399 N  N   . ASP F 58  ? 0.3470 0.4647 0.3938 -0.0237 0.0000  -0.0352 880 ASP F N   
5400 C  CA  . ASP F 58  ? 0.3664 0.4953 0.4129 -0.0251 -0.0017 -0.0381 880 ASP F CA  
5401 C  C   . ASP F 58  ? 0.4034 0.5325 0.4451 -0.0272 -0.0004 -0.0376 880 ASP F C   
5402 O  O   . ASP F 58  ? 0.4046 0.5285 0.4427 -0.0261 -0.0010 -0.0327 880 ASP F O   
5403 C  CB  . ASP F 58  ? 0.3517 0.4870 0.3985 -0.0214 -0.0073 -0.0349 880 ASP F CB  
5404 C  CG  . ASP F 58  ? 0.3305 0.4689 0.3826 -0.0192 -0.0087 -0.0371 880 ASP F CG  
5405 O  OD1 . ASP F 58  ? 0.3158 0.4507 0.3713 -0.0209 -0.0052 -0.0404 880 ASP F OD1 
5406 O  OD2 . ASP F 58  ? 0.3259 0.4704 0.3787 -0.0158 -0.0134 -0.0354 880 ASP F OD2 
5407 N  N   . VAL F 59  ? 0.6593 0.7949 0.7008 -0.0305 0.0015  -0.0429 881 VAL F N   
5408 C  CA  . VAL F 59  ? 0.6830 0.8196 0.7200 -0.0327 0.0030  -0.0434 881 VAL F CA  
5409 C  C   . VAL F 59  ? 0.6995 0.8477 0.7348 -0.0330 -0.0004 -0.0439 881 VAL F C   
5410 O  O   . VAL F 59  ? 0.6956 0.8522 0.7332 -0.0350 -0.0003 -0.0491 881 VAL F O   
5411 C  CB  . VAL F 59  ? 0.6894 0.8228 0.7264 -0.0364 0.0083  -0.0492 881 VAL F CB  
5412 C  CG1 . VAL F 59  ? 0.6996 0.8308 0.7317 -0.0375 0.0102  -0.0487 881 VAL F CG1 
5413 C  CG2 . VAL F 59  ? 0.6609 0.7842 0.7002 -0.0362 0.0114  -0.0497 881 VAL F CG2 
5414 N  N   . VAL F 60  ? 1.0562 1.2051 1.0874 -0.0313 -0.0033 -0.0386 882 VAL F N   
5415 C  CA  . VAL F 60  ? 1.0833 1.2426 1.1118 -0.0314 -0.0066 -0.0383 882 VAL F CA  
5416 C  C   . VAL F 60  ? 1.1005 1.2633 1.1260 -0.0349 -0.0037 -0.0420 882 VAL F C   
5417 O  O   . VAL F 60  ? 1.0926 1.2547 1.1199 -0.0377 0.0002  -0.0478 882 VAL F O   
5418 C  CB  . VAL F 60  ? 1.0743 1.2323 1.0988 -0.0284 -0.0108 -0.0308 882 VAL F CB  
5419 C  CG1 . VAL F 60  ? 1.0483 1.2166 1.0690 -0.0287 -0.0139 -0.0304 882 VAL F CG1 
5420 C  CG2 . VAL F 60  ? 1.0700 1.2245 1.0970 -0.0246 -0.0140 -0.0274 882 VAL F CG2 
5421 N  N   . GLU F 61  ? 1.0995 1.2657 1.1200 -0.0348 -0.0055 -0.0387 883 GLU F N   
5422 C  CA  . GLU F 61  ? 1.0988 1.2690 1.1160 -0.0378 -0.0031 -0.0419 883 GLU F CA  
5423 C  C   . GLU F 61  ? 1.1108 1.2744 1.1241 -0.0378 -0.0011 -0.0383 883 GLU F C   
5424 O  O   . GLU F 61  ? 1.1119 1.2660 1.1265 -0.0369 0.0010  -0.0367 883 GLU F O   
5425 C  CB  . GLU F 61  ? 1.1207 1.3027 1.1351 -0.0381 -0.0066 -0.0421 883 GLU F CB  
5426 C  CG  . GLU F 61  ? 1.1403 1.3294 1.1538 -0.0417 -0.0041 -0.0489 883 GLU F CG  
5427 C  CD  . GLU F 61  ? 1.1897 1.3913 1.2039 -0.0421 -0.0073 -0.0518 883 GLU F CD  
5428 O  OE1 . GLU F 61  ? 1.2031 1.4076 1.2222 -0.0427 -0.0071 -0.0563 883 GLU F OE1 
5429 O  OE2 . GLU F 61  ? 1.1719 1.3810 1.1818 -0.0419 -0.0101 -0.0498 883 GLU F OE2 
5430 N  N   . GLY F 62  ? 0.9589 1.1282 0.9674 -0.0388 -0.0019 -0.0370 884 GLY F N   
5431 C  CA  . GLY F 62  ? 0.9639 1.1291 0.9686 -0.0391 -0.0001 -0.0339 884 GLY F CA  
5432 C  C   . GLY F 62  ? 0.9683 1.1384 0.9678 -0.0388 -0.0035 -0.0283 884 GLY F C   
5433 O  O   . GLY F 62  ? 0.9659 1.1328 0.9624 -0.0389 -0.0029 -0.0242 884 GLY F O   
5434 N  N   . SER F 63  ? 0.8920 1.0702 0.8903 -0.0385 -0.0073 -0.0280 885 SER F N   
5435 C  CA  . SER F 63  ? 0.8977 1.0804 0.8903 -0.0382 -0.0108 -0.0224 885 SER F CA  
5436 C  C   . SER F 63  ? 0.8801 1.0603 0.8725 -0.0352 -0.0156 -0.0170 885 SER F C   
5437 O  O   . SER F 63  ? 0.8740 1.0551 0.8611 -0.0345 -0.0188 -0.0113 885 SER F O   
5438 C  CB  . SER F 63  ? 0.9123 1.1065 0.9019 -0.0401 -0.0116 -0.0259 885 SER F CB  
5439 O  OG  . SER F 63  ? 0.9019 1.1021 0.8903 -0.0383 -0.0165 -0.0238 885 SER F OG  
5440 N  N   . LYS F 64  ? 0.8609 1.0378 0.8590 -0.0332 -0.0159 -0.0190 886 LYS F N   
5441 C  CA  . LYS F 64  ? 0.8358 1.0102 0.8345 -0.0297 -0.0204 -0.0146 886 LYS F CA  
5442 C  C   . LYS F 64  ? 0.8175 0.9810 0.8142 -0.0285 -0.0208 -0.0080 886 LYS F C   
5443 O  O   . LYS F 64  ? 0.8216 0.9780 0.8205 -0.0294 -0.0173 -0.0086 886 LYS F O   
5444 C  CB  . LYS F 64  ? 0.8071 0.9821 0.8127 -0.0282 -0.0202 -0.0193 886 LYS F CB  
5445 C  CG  . LYS F 64  ? 0.7570 0.9358 0.7633 -0.0245 -0.0255 -0.0173 886 LYS F CG  
5446 C  CD  . LYS F 64  ? 0.7599 0.9373 0.7733 -0.0228 -0.0250 -0.0209 886 LYS F CD  
5447 C  CE  . LYS F 64  ? 0.7479 0.9375 0.7648 -0.0232 -0.0260 -0.0272 886 LYS F CE  
5448 N  NZ  . LYS F 64  ? 0.7286 0.9261 0.7423 -0.0200 -0.0317 -0.0244 886 LYS F NZ  
5449 N  N   . GLN F 65  ? 0.7019 0.8639 0.6939 -0.0264 -0.0252 -0.0018 887 GLN F N   
5450 C  CA  . GLN F 65  ? 0.6838 0.8354 0.6732 -0.0256 -0.0260 0.0046  887 GLN F CA  
5451 C  C   . GLN F 65  ? 0.6625 0.8083 0.6541 -0.0214 -0.0295 0.0071  887 GLN F C   
5452 O  O   . GLN F 65  ? 0.6647 0.8016 0.6534 -0.0202 -0.0312 0.0128  887 GLN F O   
5453 C  CB  . GLN F 65  ? 0.6999 0.8520 0.6809 -0.0271 -0.0279 0.0105  887 GLN F CB  
5454 C  CG  . GLN F 65  ? 0.7160 0.8718 0.6945 -0.0312 -0.0241 0.0091  887 GLN F CG  
5455 C  CD  . GLN F 65  ? 0.7209 0.8725 0.6925 -0.0332 -0.0246 0.0157  887 GLN F CD  
5456 O  OE1 . GLN F 65  ? 0.7139 0.8612 0.6806 -0.0318 -0.0284 0.0216  887 GLN F OE1 
5457 N  NE2 . GLN F 65  ? 0.7435 0.8959 0.7145 -0.0364 -0.0206 0.0147  887 GLN F NE2 
5458 N  N   . TRP F 66  ? 0.4670 0.6182 0.4639 -0.0193 -0.0305 0.0025  888 TRP F N   
5459 C  CA  . TRP F 66  ? 0.4462 0.5936 0.4458 -0.0149 -0.0337 0.0038  888 TRP F CA  
5460 C  C   . TRP F 66  ? 0.4207 0.5724 0.4284 -0.0144 -0.0319 -0.0031 888 TRP F C   
5461 O  O   . TRP F 66  ? 0.4187 0.5776 0.4289 -0.0173 -0.0290 -0.0089 888 TRP F O   
5462 C  CB  . TRP F 66  ? 0.4402 0.5916 0.4350 -0.0116 -0.0395 0.0075  888 TRP F CB  
5463 C  CG  . TRP F 66  ? 0.4375 0.6021 0.4323 -0.0122 -0.0405 0.0031  888 TRP F CG  
5464 C  CD1 . TRP F 66  ? 0.4419 0.6129 0.4310 -0.0145 -0.0409 0.0040  888 TRP F CD1 
5465 C  CD2 . TRP F 66  ? 0.4333 0.6072 0.4344 -0.0107 -0.0411 -0.0031 888 TRP F CD2 
5466 N  NE1 . TRP F 66  ? 0.4372 0.6207 0.4285 -0.0144 -0.0419 -0.0013 888 TRP F NE1 
5467 C  CE2 . TRP F 66  ? 0.4331 0.6188 0.4318 -0.0122 -0.0420 -0.0058 888 TRP F CE2 
5468 C  CE3 . TRP F 66  ? 0.4257 0.5997 0.4340 -0.0084 -0.0409 -0.0068 888 TRP F CE3 
5469 C  CZ2 . TRP F 66  ? 0.4243 0.6218 0.4279 -0.0117 -0.0428 -0.0121 888 TRP F CZ2 
5470 C  CZ3 . TRP F 66  ? 0.4193 0.6053 0.4325 -0.0080 -0.0415 -0.0131 888 TRP F CZ3 
5471 C  CH2 . TRP F 66  ? 0.4192 0.6168 0.4300 -0.0097 -0.0425 -0.0157 888 TRP F CH2 
5472 N  N   . HIS F 67  ? 0.2961 0.4433 0.3076 -0.0110 -0.0334 -0.0027 889 HIS F N   
5473 C  CA  . HIS F 67  ? 0.2742 0.4251 0.2934 -0.0107 -0.0315 -0.0090 889 HIS F CA  
5474 C  C   . HIS F 67  ? 0.2620 0.4120 0.2841 -0.0056 -0.0352 -0.0082 889 HIS F C   
5475 O  O   . HIS F 67  ? 0.2575 0.3983 0.2775 -0.0028 -0.0373 -0.0030 889 HIS F O   
5476 C  CB  . HIS F 67  ? 0.2702 0.4139 0.2927 -0.0135 -0.0261 -0.0113 889 HIS F CB  
5477 C  CG  . HIS F 67  ? 0.2547 0.4010 0.2843 -0.0139 -0.0236 -0.0175 889 HIS F CG  
5478 N  ND1 . HIS F 67  ? 0.2624 0.4178 0.2948 -0.0167 -0.0215 -0.0240 889 HIS F ND1 
5479 C  CD2 . HIS F 67  ? 0.2485 0.3896 0.2828 -0.0121 -0.0229 -0.0184 889 HIS F CD2 
5480 C  CE1 . HIS F 67  ? 0.2532 0.4087 0.2914 -0.0169 -0.0194 -0.0285 889 HIS F CE1 
5481 N  NE2 . HIS F 67  ? 0.2455 0.3927 0.2851 -0.0140 -0.0202 -0.0251 889 HIS F NE2 
5482 N  N   . MET F 68  ? 0.5554 0.7155 0.5826 -0.0046 -0.0360 -0.0136 890 MET F N   
5483 C  CA  . MET F 68  ? 0.5430 0.7046 0.5738 0.0004  -0.0394 -0.0139 890 MET F CA  
5484 C  C   . MET F 68  ? 0.5288 0.6892 0.5671 -0.0006 -0.0357 -0.0190 890 MET F C   
5485 O  O   . MET F 68  ? 0.5325 0.7019 0.5756 -0.0031 -0.0334 -0.0255 890 MET F O   
5486 C  CB  . MET F 68  ? 0.5655 0.7408 0.5967 0.0027  -0.0434 -0.0166 890 MET F CB  
5487 C  CG  . MET F 68  ? 0.5472 0.7286 0.5843 0.0072  -0.0460 -0.0197 890 MET F CG  
5488 S  SD  . MET F 68  ? 0.5439 0.7184 0.5772 0.0153  -0.0524 -0.0130 890 MET F SD  
5489 C  CE  . MET F 68  ? 0.5618 0.7413 0.5864 0.0168  -0.0572 -0.0086 890 MET F CE  
5490 N  N   . ILE F 69  ? 0.2295 0.3788 0.2685 0.0010  -0.0350 -0.0160 891 ILE F N   
5491 C  CA  . ILE F 69  ? 0.2147 0.3623 0.2603 0.0005  -0.0318 -0.0202 891 ILE F CA  
5492 C  C   . ILE F 69  ? 0.1914 0.3463 0.2416 0.0051  -0.0352 -0.0226 891 ILE F C   
5493 O  O   . ILE F 69  ? 0.1929 0.3458 0.2407 0.0103  -0.0400 -0.0185 891 ILE F O   
5494 C  CB  . ILE F 69  ? 0.2032 0.3367 0.2479 0.0008  -0.0300 -0.0163 891 ILE F CB  
5495 C  CG1 . ILE F 69  ? 0.2194 0.3465 0.2596 -0.0032 -0.0269 -0.0137 891 ILE F CG1 
5496 C  CG2 . ILE F 69  ? 0.1849 0.3169 0.2359 0.0001  -0.0265 -0.0207 891 ILE F CG2 
5497 C  CD1 . ILE F 69  ? 0.2188 0.3332 0.2581 -0.0032 -0.0250 -0.0103 891 ILE F CD1 
5498 N  N   . GLY F 70  ? 0.2307 0.3939 0.2871 0.0031  -0.0327 -0.0294 892 GLY F N   
5499 C  CA  . GLY F 70  ? 0.2294 0.4018 0.2909 0.0071  -0.0356 -0.0327 892 GLY F CA  
5500 C  C   . GLY F 70  ? 0.2169 0.3888 0.2850 0.0060  -0.0320 -0.0372 892 GLY F C   
5501 O  O   . GLY F 70  ? 0.2185 0.3816 0.2869 0.0024  -0.0274 -0.0373 892 GLY F O   
5502 N  N   . HIS F 71  ? 0.2101 0.3917 0.2834 0.0094  -0.0343 -0.0408 893 HIS F N   
5503 C  CA  . HIS F 71  ? 0.2043 0.3876 0.2841 0.0084  -0.0311 -0.0456 893 HIS F CA  
5504 C  C   . HIS F 71  ? 0.1965 0.3661 0.2758 0.0108  -0.0304 -0.0416 893 HIS F C   
5505 O  O   . HIS F 71  ? 0.2926 0.4581 0.3750 0.0079  -0.0260 -0.0442 893 HIS F O   
5506 C  CB  . HIS F 71  ? 0.1986 0.3848 0.2809 0.0008  -0.0251 -0.0512 893 HIS F CB  
5507 C  CG  . HIS F 71  ? 0.2048 0.4049 0.2880 -0.0021 -0.0255 -0.0560 893 HIS F CG  
5508 N  ND1 . HIS F 71  ? 0.2175 0.4170 0.2962 -0.0060 -0.0243 -0.0554 893 HIS F ND1 
5509 C  CD2 . HIS F 71  ? 0.2120 0.4279 0.3002 -0.0016 -0.0271 -0.0616 893 HIS F CD2 
5510 C  CE1 . HIS F 71  ? 0.2362 0.4499 0.3169 -0.0079 -0.0250 -0.0604 893 HIS F CE1 
5511 N  NE2 . HIS F 71  ? 0.2340 0.4581 0.3205 -0.0054 -0.0268 -0.0643 893 HIS F NE2 
5512 N  N   . LEU F 72  ? 0.1931 0.3553 0.2680 0.0160  -0.0348 -0.0354 894 LEU F N   
5513 C  CA  . LEU F 72  ? 0.1867 0.3358 0.2605 0.0187  -0.0348 -0.0314 894 LEU F CA  
5514 C  C   . LEU F 72  ? 0.1821 0.3348 0.2592 0.0255  -0.0389 -0.0321 894 LEU F C   
5515 O  O   . LEU F 72  ? 0.1870 0.3518 0.2661 0.0287  -0.0424 -0.0347 894 LEU F O   
5516 C  CB  . LEU F 72  ? 0.1893 0.3264 0.2554 0.0195  -0.0367 -0.0240 894 LEU F CB  
5517 C  CG  . LEU F 72  ? 0.1868 0.3227 0.2490 0.0139  -0.0340 -0.0230 894 LEU F CG  
5518 C  CD1 . LEU F 72  ? 0.1957 0.3202 0.2505 0.0146  -0.0358 -0.0157 894 LEU F CD1 
5519 C  CD2 . LEU F 72  ? 0.1835 0.3172 0.2485 0.0081  -0.0277 -0.0268 894 LEU F CD2 
5520 N  N   . GLN F 73  ? 0.2477 0.3902 0.3251 0.0279  -0.0385 -0.0300 895 GLN F N   
5521 C  CA  . GLN F 73  ? 0.2564 0.4013 0.3368 0.0346  -0.0421 -0.0308 895 GLN F CA  
5522 C  C   . GLN F 73  ? 0.2687 0.4057 0.3429 0.0409  -0.0480 -0.0245 895 GLN F C   
5523 O  O   . GLN F 73  ? 0.2729 0.3980 0.3407 0.0396  -0.0481 -0.0187 895 GLN F O   
5524 C  CB  . GLN F 73  ? 0.2574 0.3958 0.3415 0.0341  -0.0387 -0.0324 895 GLN F CB  
5525 C  CG  . GLN F 73  ? 0.2425 0.3888 0.3326 0.0284  -0.0331 -0.0390 895 GLN F CG  
5526 C  CD  . GLN F 73  ? 0.2390 0.4028 0.3352 0.0298  -0.0344 -0.0452 895 GLN F CD  
5527 O  OE1 . GLN F 73  ? 0.2419 0.4112 0.3396 0.0365  -0.0391 -0.0455 895 GLN F OE1 
5528 N  NE2 . GLN F 73  ? 0.2252 0.3978 0.3246 0.0236  -0.0302 -0.0505 895 GLN F NE2 
5529 N  N   . PRO F 74  ? 0.2270 0.3707 0.3029 0.0479  -0.0528 -0.0256 896 PRO F N   
5530 C  CA  . PRO F 74  ? 0.2412 0.3769 0.3108 0.0548  -0.0588 -0.0198 896 PRO F CA  
5531 C  C   . PRO F 74  ? 0.2477 0.3663 0.3140 0.0563  -0.0586 -0.0153 896 PRO F C   
5532 O  O   . PRO F 74  ? 0.2408 0.3573 0.3118 0.0552  -0.0553 -0.0181 896 PRO F O   
5533 C  CB  . PRO F 74  ? 0.2393 0.3873 0.3133 0.0620  -0.0630 -0.0238 896 PRO F CB  
5534 C  CG  . PRO F 74  ? 0.2249 0.3902 0.3062 0.0577  -0.0598 -0.0311 896 PRO F CG  
5535 C  CD  . PRO F 74  ? 0.2173 0.3775 0.3008 0.0496  -0.0530 -0.0327 896 PRO F CD  
5536 N  N   . GLU F 75  ? 0.5010 0.6077 0.5591 0.0585  -0.0620 -0.0085 897 GLU F N   
5537 C  CA  . GLU F 75  ? 0.5146 0.6046 0.5687 0.0597  -0.0622 -0.0039 897 GLU F CA  
5538 C  C   . GLU F 75  ? 0.5075 0.5915 0.5639 0.0531  -0.0561 -0.0047 897 GLU F C   
5539 O  O   . GLU F 75  ? 0.5161 0.5912 0.5733 0.0543  -0.0552 -0.0042 897 GLU F O   
5540 C  CB  . GLU F 75  ? 0.5519 0.6403 0.6082 0.0674  -0.0655 -0.0053 897 GLU F CB  
5541 C  CG  . GLU F 75  ? 0.6121 0.7020 0.6642 0.0754  -0.0722 -0.0032 897 GLU F CG  
5542 C  CD  . GLU F 75  ? 0.6841 0.7705 0.7378 0.0834  -0.0754 -0.0043 897 GLU F CD  
5543 O  OE1 . GLU F 75  ? 0.6733 0.7525 0.7295 0.0824  -0.0726 -0.0053 897 GLU F OE1 
5544 O  OE2 . GLU F 75  ? 0.7354 0.8264 0.7877 0.0909  -0.0808 -0.0044 897 GLU F OE2 
5545 N  N   . THR F 76  ? 0.2548 0.3435 0.3120 0.0464  -0.0522 -0.0060 898 THR F N   
5546 C  CA  . THR F 76  ? 0.2461 0.3296 0.3051 0.0405  -0.0465 -0.0069 898 THR F CA  
5547 C  C   . THR F 76  ? 0.2510 0.3258 0.3035 0.0359  -0.0452 -0.0017 898 THR F C   
5548 O  O   . THR F 76  ? 0.2460 0.3250 0.2951 0.0342  -0.0463 -0.0003 898 THR F O   
5549 C  CB  . THR F 76  ? 0.2352 0.3308 0.3010 0.0362  -0.0419 -0.0135 898 THR F CB  
5550 O  OG1 . THR F 76  ? 0.2301 0.3347 0.3023 0.0401  -0.0429 -0.0185 898 THR F OG1 
5551 C  CG2 . THR F 76  ? 0.2342 0.3232 0.3011 0.0307  -0.0362 -0.0141 898 THR F CG2 
5552 N  N   . SER F 77  ? 0.4062 0.4695 0.4570 0.0339  -0.0430 0.0008  899 SER F N   
5553 C  CA  . SER F 77  ? 0.4029 0.4582 0.4480 0.0295  -0.0416 0.0054  899 SER F CA  
5554 C  C   . SER F 77  ? 0.4009 0.4605 0.4487 0.0233  -0.0360 0.0025  899 SER F C   
5555 O  O   . SER F 77  ? 0.3911 0.4522 0.4440 0.0220  -0.0324 -0.0016 899 SER F O   
5556 C  CB  . SER F 77  ? 0.4057 0.4470 0.4474 0.0302  -0.0420 0.0095  899 SER F CB  
5557 O  OG  . SER F 77  ? 0.4194 0.4538 0.4551 0.0262  -0.0413 0.0142  899 SER F OG  
5558 N  N   . TYR F 78  ? 0.2675 0.3285 0.3112 0.0197  -0.0354 0.0045  900 TYR F N   
5559 C  CA  . TYR F 78  ? 0.2530 0.3179 0.2986 0.0143  -0.0305 0.0017  900 TYR F CA  
5560 C  C   . TYR F 78  ? 0.2632 0.3209 0.3036 0.0106  -0.0288 0.0058  900 TYR F C   
5561 O  O   . TYR F 78  ? 0.2734 0.3259 0.3081 0.0112  -0.0318 0.0109  900 TYR F O   
5562 C  CB  . TYR F 78  ? 0.2481 0.3253 0.2951 0.0132  -0.0306 -0.0018 900 TYR F CB  
5563 C  CG  . TYR F 78  ? 0.2568 0.3433 0.3099 0.0156  -0.0311 -0.0072 900 TYR F CG  
5564 C  CD1 . TYR F 78  ? 0.2645 0.3546 0.3179 0.0211  -0.0360 -0.0067 900 TYR F CD1 
5565 C  CD2 . TYR F 78  ? 0.2413 0.3331 0.2997 0.0125  -0.0266 -0.0129 900 TYR F CD2 
5566 C  CE1 . TYR F 78  ? 0.2493 0.3494 0.3088 0.0234  -0.0365 -0.0120 900 TYR F CE1 
5567 C  CE2 . TYR F 78  ? 0.2387 0.3398 0.3029 0.0141  -0.0268 -0.0180 900 TYR F CE2 
5568 C  CZ  . TYR F 78  ? 0.2405 0.3464 0.3055 0.0196  -0.0318 -0.0178 900 TYR F CZ  
5569 O  OH  . TYR F 78  ? 0.2317 0.3484 0.3028 0.0212  -0.0319 -0.0233 900 TYR F OH  
5570 N  N   . ASP F 79  ? 0.3732 0.4307 0.4154 0.0067  -0.0240 0.0035  901 ASP F N   
5571 C  CA  . ASP F 79  ? 0.3754 0.4285 0.4135 0.0030  -0.0220 0.0064  901 ASP F CA  
5572 C  C   . ASP F 79  ? 0.3786 0.4399 0.4156 0.0000  -0.0205 0.0046  901 ASP F C   
5573 O  O   . ASP F 79  ? 0.3831 0.4515 0.4239 -0.0009 -0.0185 -0.0004 901 ASP F O   
5574 C  CB  . ASP F 79  ? 0.3659 0.4136 0.4062 0.0013  -0.0178 0.0050  901 ASP F CB  
5575 C  CG  . ASP F 79  ? 0.3649 0.4049 0.4065 0.0041  -0.0189 0.0063  901 ASP F CG  
5576 O  OD1 . ASP F 79  ? 0.3695 0.4069 0.4094 0.0073  -0.0231 0.0090  901 ASP F OD1 
5577 O  OD2 . ASP F 79  ? 0.3610 0.3972 0.4049 0.0033  -0.0158 0.0047  901 ASP F OD2 
5578 N  N   . ILE F 80  ? 0.3488 0.4092 0.3804 -0.0019 -0.0214 0.0084  902 ILE F N   
5579 C  CA  . ILE F 80  ? 0.3647 0.4331 0.3948 -0.0046 -0.0204 0.0068  902 ILE F CA  
5580 C  C   . ILE F 80  ? 0.1921 0.2583 0.2183 -0.0082 -0.0180 0.0090  902 ILE F C   
5581 O  O   . ILE F 80  ? 0.1978 0.2593 0.2193 -0.0087 -0.0198 0.0140  902 ILE F O   
5582 C  CB  . ILE F 80  ? 0.1946 0.2684 0.2216 -0.0028 -0.0249 0.0087  902 ILE F CB  
5583 C  CG1 . ILE F 80  ? 0.1848 0.2607 0.2154 0.0017  -0.0280 0.0071  902 ILE F CG1 
5584 C  CG2 . ILE F 80  ? 0.2048 0.2883 0.2312 -0.0054 -0.0236 0.0058  902 ILE F CG2 
5585 C  CD1 . ILE F 80  ? 0.3760 0.4566 0.4032 0.0044  -0.0329 0.0091  902 ILE F CD1 
5586 N  N   . LYS F 81  ? 0.4070 0.4766 0.4351 -0.0108 -0.0139 0.0051  903 LYS F N   
5587 C  CA  . LYS F 81  ? 0.4310 0.5004 0.4559 -0.0139 -0.0114 0.0062  903 LYS F CA  
5588 C  C   . LYS F 81  ? 0.4451 0.5222 0.4707 -0.0160 -0.0088 0.0015  903 LYS F C   
5589 O  O   . LYS F 81  ? 0.4331 0.5131 0.4626 -0.0157 -0.0073 -0.0032 903 LYS F O   
5590 C  CB  . LYS F 81  ? 0.4283 0.4905 0.4542 -0.0143 -0.0085 0.0066  903 LYS F CB  
5591 C  CG  . LYS F 81  ? 0.4059 0.4671 0.4365 -0.0140 -0.0050 0.0017  903 LYS F CG  
5592 C  CD  . LYS F 81  ? 0.3979 0.4517 0.4291 -0.0139 -0.0027 0.0026  903 LYS F CD  
5593 C  CE  . LYS F 81  ? 0.3932 0.4451 0.4282 -0.0134 0.0007  -0.0019 903 LYS F CE  
5594 N  NZ  . LYS F 81  ? 0.3786 0.4231 0.4140 -0.0127 0.0025  -0.0008 903 LYS F NZ  
5595 N  N   . MET F 82  ? 0.4479 0.5282 0.4696 -0.0184 -0.0080 0.0026  904 MET F N   
5596 C  CA  . MET F 82  ? 0.4567 0.5444 0.4786 -0.0204 -0.0058 -0.0018 904 MET F CA  
5597 C  C   . MET F 82  ? 0.4764 0.5638 0.4961 -0.0226 -0.0022 -0.0024 904 MET F C   
5598 O  O   . MET F 82  ? 0.4710 0.5542 0.4887 -0.0229 -0.0020 0.0011  904 MET F O   
5599 C  CB  . MET F 82  ? 0.4644 0.5597 0.4833 -0.0206 -0.0090 -0.0008 904 MET F CB  
5600 C  CG  . MET F 82  ? 0.4717 0.5668 0.4848 -0.0217 -0.0111 0.0047  904 MET F CG  
5601 S  SD  . MET F 82  ? 0.4881 0.5929 0.4971 -0.0224 -0.0142 0.0053  904 MET F SD  
5602 C  CE  . MET F 82  ? 0.4990 0.6117 0.5106 -0.0245 -0.0102 -0.0022 904 MET F CE  
5603 N  N   . GLN F 83  ? 0.3383 0.4306 0.3584 -0.0241 0.0004  -0.0072 905 GLN F N   
5604 C  CA  . GLN F 83  ? 0.3536 0.4466 0.3717 -0.0257 0.0037  -0.0087 905 GLN F CA  
5605 C  C   . GLN F 83  ? 0.3734 0.4738 0.3906 -0.0274 0.0051  -0.0133 905 GLN F C   
5606 O  O   . GLN F 83  ? 0.3648 0.4668 0.3847 -0.0276 0.0058  -0.0176 905 GLN F O   
5607 C  CB  . GLN F 83  ? 0.3483 0.4342 0.3687 -0.0248 0.0073  -0.0107 905 GLN F CB  
5608 C  CG  . GLN F 83  ? 0.3361 0.4202 0.3602 -0.0245 0.0092  -0.0157 905 GLN F CG  
5609 C  CD  . GLN F 83  ? 0.3311 0.4074 0.3565 -0.0236 0.0127  -0.0173 905 GLN F CD  
5610 O  OE1 . GLN F 83  ? 0.3273 0.4010 0.3548 -0.0238 0.0149  -0.0213 905 GLN F OE1 
5611 N  NE2 . GLN F 83  ? 0.3385 0.4112 0.3624 -0.0227 0.0132  -0.0143 905 GLN F NE2 
5612 N  N   . CYS F 84  ? 0.6746 0.7799 0.6881 -0.0290 0.0056  -0.0126 906 CYS F N   
5613 C  CA  . CYS F 84  ? 0.6915 0.8036 0.7037 -0.0307 0.0071  -0.0172 906 CYS F CA  
5614 C  C   . CYS F 84  ? 0.7132 0.8216 0.7265 -0.0307 0.0117  -0.0221 906 CYS F C   
5