data_3N99
# 
_entry.id   3N99 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3N99         
RCSB  RCSB059540   
WWPDB D_1000059540 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          APC4579 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3N99 
_pdbx_database_status.recvd_initial_deposition_date   2010-05-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chruszcz, M.'                                  1  
'Domagalski, M.J.'                              2  
'Wang, S.'                                      3  
'Evdokimova, E.'                                4  
'Kudritska, M.'                                 5  
'Savchenko, A.'                                 6  
'Edwards, A.'                                   7  
'Joachimiak, A.'                                8  
'Minor, W.'                                     9  
'Midwest Center for Structural Genomics (MCSG)' 10 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of TM1086' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chruszcz, M.'     1 
primary 'Domagalski, M.J.' 2 
primary 'Wang, S.'         3 
primary 'Evdokimova, E.'   4 
primary 'Kudritska, M.'    5 
primary 'Savchenko, A.'    6 
primary 'Edwards, A.'      7 
primary 'Joachimiak, A.'   8 
primary 'Minor, W.'        9 
# 
_cell.entry_id           3N99 
_cell.length_a           289.839 
_cell.length_b           299.521 
_cell.length_c           316.013 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              240 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3N99 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'uncharacterized protein TM1086' 31106.725 30   ? ? ? ? 
2 non-polymer syn 'CHLORIDE ION'                   35.453    86   ? ? ? ? 
3 water       nat water                            18.015    5054 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;HHHHHHGHMRTNKDRLVRISVVGEIAPAKMRSPYSVTTEGTVRVIPVLGGITYNVKVGDSAYGWAGDHVEPGVSVMARRK
EEEIPLMTLSCIGNEVIVMSGDAKGSRGFVTGKHGGVNHVLVHFEEEVLGKLMVGDKILIKAWGQGLKLLDHPDVKVMNI
DPDLFEKLGIQEKNGKIHVPVVAKIPAHMMGSGIGASSSASTDYDIMASNPEDLGVADLKLGDIVAIQDHDNSYGVGKYR
KGAVSIGVVVHSACVSAGHGPGVVVIMTGDESKILPEEVERANISDYLVR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;HHHHHHGHMRTNKDRLVRISVVGEIAPAKMRSPYSVTTEGTVRVIPVLGGITYNVKVGDSAYGWAGDHVEPGVSVMARRK
EEEIPLMTLSCIGNEVIVMSGDAKGSRGFVTGKHGGVNHVLVHFEEEVLGKLMVGDKILIKAWGQGLKLLDHPDVKVMNI
DPDLFEKLGIQEKNGKIHVPVVAKIPAHMMGSGIGASSSASTDYDIMASNPEDLGVADLKLGDIVAIQDHDNSYGVGKYR
KGAVSIGVVVHSACVSAGHGPGVVVIMTGDESKILPEEVERANISDYLVR
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,G,H,I,J,K,L,M,N,O,P,S,T,U,V,X,a,b,c,d,e,g,h,i,j,k 
_entity_poly.pdbx_target_identifier         APC4579 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   GLY n 
1 8   HIS n 
1 9   MET n 
1 10  ARG n 
1 11  THR n 
1 12  ASN n 
1 13  LYS n 
1 14  ASP n 
1 15  ARG n 
1 16  LEU n 
1 17  VAL n 
1 18  ARG n 
1 19  ILE n 
1 20  SER n 
1 21  VAL n 
1 22  VAL n 
1 23  GLY n 
1 24  GLU n 
1 25  ILE n 
1 26  ALA n 
1 27  PRO n 
1 28  ALA n 
1 29  LYS n 
1 30  MET n 
1 31  ARG n 
1 32  SER n 
1 33  PRO n 
1 34  TYR n 
1 35  SER n 
1 36  VAL n 
1 37  THR n 
1 38  THR n 
1 39  GLU n 
1 40  GLY n 
1 41  THR n 
1 42  VAL n 
1 43  ARG n 
1 44  VAL n 
1 45  ILE n 
1 46  PRO n 
1 47  VAL n 
1 48  LEU n 
1 49  GLY n 
1 50  GLY n 
1 51  ILE n 
1 52  THR n 
1 53  TYR n 
1 54  ASN n 
1 55  VAL n 
1 56  LYS n 
1 57  VAL n 
1 58  GLY n 
1 59  ASP n 
1 60  SER n 
1 61  ALA n 
1 62  TYR n 
1 63  GLY n 
1 64  TRP n 
1 65  ALA n 
1 66  GLY n 
1 67  ASP n 
1 68  HIS n 
1 69  VAL n 
1 70  GLU n 
1 71  PRO n 
1 72  GLY n 
1 73  VAL n 
1 74  SER n 
1 75  VAL n 
1 76  MET n 
1 77  ALA n 
1 78  ARG n 
1 79  ARG n 
1 80  LYS n 
1 81  GLU n 
1 82  GLU n 
1 83  GLU n 
1 84  ILE n 
1 85  PRO n 
1 86  LEU n 
1 87  MET n 
1 88  THR n 
1 89  LEU n 
1 90  SER n 
1 91  CYS n 
1 92  ILE n 
1 93  GLY n 
1 94  ASN n 
1 95  GLU n 
1 96  VAL n 
1 97  ILE n 
1 98  VAL n 
1 99  MET n 
1 100 SER n 
1 101 GLY n 
1 102 ASP n 
1 103 ALA n 
1 104 LYS n 
1 105 GLY n 
1 106 SER n 
1 107 ARG n 
1 108 GLY n 
1 109 PHE n 
1 110 VAL n 
1 111 THR n 
1 112 GLY n 
1 113 LYS n 
1 114 HIS n 
1 115 GLY n 
1 116 GLY n 
1 117 VAL n 
1 118 ASN n 
1 119 HIS n 
1 120 VAL n 
1 121 LEU n 
1 122 VAL n 
1 123 HIS n 
1 124 PHE n 
1 125 GLU n 
1 126 GLU n 
1 127 GLU n 
1 128 VAL n 
1 129 LEU n 
1 130 GLY n 
1 131 LYS n 
1 132 LEU n 
1 133 MET n 
1 134 VAL n 
1 135 GLY n 
1 136 ASP n 
1 137 LYS n 
1 138 ILE n 
1 139 LEU n 
1 140 ILE n 
1 141 LYS n 
1 142 ALA n 
1 143 TRP n 
1 144 GLY n 
1 145 GLN n 
1 146 GLY n 
1 147 LEU n 
1 148 LYS n 
1 149 LEU n 
1 150 LEU n 
1 151 ASP n 
1 152 HIS n 
1 153 PRO n 
1 154 ASP n 
1 155 VAL n 
1 156 LYS n 
1 157 VAL n 
1 158 MET n 
1 159 ASN n 
1 160 ILE n 
1 161 ASP n 
1 162 PRO n 
1 163 ASP n 
1 164 LEU n 
1 165 PHE n 
1 166 GLU n 
1 167 LYS n 
1 168 LEU n 
1 169 GLY n 
1 170 ILE n 
1 171 GLN n 
1 172 GLU n 
1 173 LYS n 
1 174 ASN n 
1 175 GLY n 
1 176 LYS n 
1 177 ILE n 
1 178 HIS n 
1 179 VAL n 
1 180 PRO n 
1 181 VAL n 
1 182 VAL n 
1 183 ALA n 
1 184 LYS n 
1 185 ILE n 
1 186 PRO n 
1 187 ALA n 
1 188 HIS n 
1 189 MET n 
1 190 MET n 
1 191 GLY n 
1 192 SER n 
1 193 GLY n 
1 194 ILE n 
1 195 GLY n 
1 196 ALA n 
1 197 SER n 
1 198 SER n 
1 199 SER n 
1 200 ALA n 
1 201 SER n 
1 202 THR n 
1 203 ASP n 
1 204 TYR n 
1 205 ASP n 
1 206 ILE n 
1 207 MET n 
1 208 ALA n 
1 209 SER n 
1 210 ASN n 
1 211 PRO n 
1 212 GLU n 
1 213 ASP n 
1 214 LEU n 
1 215 GLY n 
1 216 VAL n 
1 217 ALA n 
1 218 ASP n 
1 219 LEU n 
1 220 LYS n 
1 221 LEU n 
1 222 GLY n 
1 223 ASP n 
1 224 ILE n 
1 225 VAL n 
1 226 ALA n 
1 227 ILE n 
1 228 GLN n 
1 229 ASP n 
1 230 HIS n 
1 231 ASP n 
1 232 ASN n 
1 233 SER n 
1 234 TYR n 
1 235 GLY n 
1 236 VAL n 
1 237 GLY n 
1 238 LYS n 
1 239 TYR n 
1 240 ARG n 
1 241 LYS n 
1 242 GLY n 
1 243 ALA n 
1 244 VAL n 
1 245 SER n 
1 246 ILE n 
1 247 GLY n 
1 248 VAL n 
1 249 VAL n 
1 250 VAL n 
1 251 HIS n 
1 252 SER n 
1 253 ALA n 
1 254 CYS n 
1 255 VAL n 
1 256 SER n 
1 257 ALA n 
1 258 GLY n 
1 259 HIS n 
1 260 GLY n 
1 261 PRO n 
1 262 GLY n 
1 263 VAL n 
1 264 VAL n 
1 265 VAL n 
1 266 ILE n 
1 267 MET n 
1 268 THR n 
1 269 GLY n 
1 270 ASP n 
1 271 GLU n 
1 272 SER n 
1 273 LYS n 
1 274 ILE n 
1 275 LEU n 
1 276 PRO n 
1 277 GLU n 
1 278 GLU n 
1 279 VAL n 
1 280 GLU n 
1 281 ARG n 
1 282 ALA n 
1 283 ASN n 
1 284 ILE n 
1 285 SER n 
1 286 ASP n 
1 287 TYR n 
1 288 LEU n 
1 289 VAL n 
1 290 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 TM_1086 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermotoga maritima' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2336 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21-CODONPLUS(DE3)-RP' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q9X0H2_THEMA 
_struct_ref.pdbx_db_accession          Q9X0H2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MRTNKDRLVRISVVGEIAPAKMRSPYSVTTEGTVRVIPVLGGITYNVKVGDSAYGWAGDHVEPGVSVMARRKEEEIPLMT
LSCIGNEVIVMSGDAKGSRGFVTGKHGGVNHVLVHFEEEVLGKLMVGDKILIKAWGQGLKLLDHPDVKVMNIDPDLFEKL
GIQEKNGKIHVPVVAKIPAHMMGSGIGASSSASTDYDIMASNPEDLGVADLKLGDIVAIQDHDNSYGVGKYRKGAVSIGV
VVHSACVSAGHGPGVVVIMTGDESKILPEEVERANISDYLVR
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3N99 A 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
2  1 3N99 B 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
3  1 3N99 C 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
4  1 3N99 D 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
5  1 3N99 E 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
6  1 3N99 G 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
7  1 3N99 H 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
8  1 3N99 I 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
9  1 3N99 J 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
10 1 3N99 K 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
11 1 3N99 L 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
12 1 3N99 M 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
13 1 3N99 N 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
14 1 3N99 O 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
15 1 3N99 P 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
16 1 3N99 S 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
17 1 3N99 T 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
18 1 3N99 U 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
19 1 3N99 V 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
20 1 3N99 X 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
21 1 3N99 a 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
22 1 3N99 b 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
23 1 3N99 c 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
24 1 3N99 d 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
25 1 3N99 e 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
26 1 3N99 g 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
27 1 3N99 h 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
28 1 3N99 i 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
29 1 3N99 j 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
30 1 3N99 k 9 ? 290 ? Q9X0H2 1 ? 282 ? 1 282 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  3N99 HIS A 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 1   
1  3N99 HIS A 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 2   
1  3N99 HIS A 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 3   
1  3N99 HIS A 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 4   
1  3N99 HIS A 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 5   
1  3N99 HIS A 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 6   
1  3N99 GLY A 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 7   
1  3N99 HIS A 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  8   
2  3N99 HIS B 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 9   
2  3N99 HIS B 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 10  
2  3N99 HIS B 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 11  
2  3N99 HIS B 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 12  
2  3N99 HIS B 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 13  
2  3N99 HIS B 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 14  
2  3N99 GLY B 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 15  
2  3N99 HIS B 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  16  
3  3N99 HIS C 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 17  
3  3N99 HIS C 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 18  
3  3N99 HIS C 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 19  
3  3N99 HIS C 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 20  
3  3N99 HIS C 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 21  
3  3N99 HIS C 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 22  
3  3N99 GLY C 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 23  
3  3N99 HIS C 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  24  
4  3N99 HIS D 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 25  
4  3N99 HIS D 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 26  
4  3N99 HIS D 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 27  
4  3N99 HIS D 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 28  
4  3N99 HIS D 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 29  
4  3N99 HIS D 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 30  
4  3N99 GLY D 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 31  
4  3N99 HIS D 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  32  
5  3N99 HIS E 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 33  
5  3N99 HIS E 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 34  
5  3N99 HIS E 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 35  
5  3N99 HIS E 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 36  
5  3N99 HIS E 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 37  
5  3N99 HIS E 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 38  
5  3N99 GLY E 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 39  
5  3N99 HIS E 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  40  
6  3N99 HIS G 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 41  
6  3N99 HIS G 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 42  
6  3N99 HIS G 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 43  
6  3N99 HIS G 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 44  
6  3N99 HIS G 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 45  
6  3N99 HIS G 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 46  
6  3N99 GLY G 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 47  
6  3N99 HIS G 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  48  
7  3N99 HIS H 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 49  
7  3N99 HIS H 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 50  
7  3N99 HIS H 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 51  
7  3N99 HIS H 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 52  
7  3N99 HIS H 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 53  
7  3N99 HIS H 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 54  
7  3N99 GLY H 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 55  
7  3N99 HIS H 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  56  
8  3N99 HIS I 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 57  
8  3N99 HIS I 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 58  
8  3N99 HIS I 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 59  
8  3N99 HIS I 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 60  
8  3N99 HIS I 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 61  
8  3N99 HIS I 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 62  
8  3N99 GLY I 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 63  
8  3N99 HIS I 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  64  
9  3N99 HIS J 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 65  
9  3N99 HIS J 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 66  
9  3N99 HIS J 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 67  
9  3N99 HIS J 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 68  
9  3N99 HIS J 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 69  
9  3N99 HIS J 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 70  
9  3N99 GLY J 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 71  
9  3N99 HIS J 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  72  
10 3N99 HIS K 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 73  
10 3N99 HIS K 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 74  
10 3N99 HIS K 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 75  
10 3N99 HIS K 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 76  
10 3N99 HIS K 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 77  
10 3N99 HIS K 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 78  
10 3N99 GLY K 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 79  
10 3N99 HIS K 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  80  
11 3N99 HIS L 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 81  
11 3N99 HIS L 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 82  
11 3N99 HIS L 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 83  
11 3N99 HIS L 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 84  
11 3N99 HIS L 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 85  
11 3N99 HIS L 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 86  
11 3N99 GLY L 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 87  
11 3N99 HIS L 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  88  
12 3N99 HIS M 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 89  
12 3N99 HIS M 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 90  
12 3N99 HIS M 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 91  
12 3N99 HIS M 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 92  
12 3N99 HIS M 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 93  
12 3N99 HIS M 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 94  
12 3N99 GLY M 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 95  
12 3N99 HIS M 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  96  
13 3N99 HIS N 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 97  
13 3N99 HIS N 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 98  
13 3N99 HIS N 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 99  
13 3N99 HIS N 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 100 
13 3N99 HIS N 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 101 
13 3N99 HIS N 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 102 
13 3N99 GLY N 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 103 
13 3N99 HIS N 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  104 
14 3N99 HIS O 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 105 
14 3N99 HIS O 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 106 
14 3N99 HIS O 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 107 
14 3N99 HIS O 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 108 
14 3N99 HIS O 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 109 
14 3N99 HIS O 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 110 
14 3N99 GLY O 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 111 
14 3N99 HIS O 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  112 
15 3N99 HIS P 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 113 
15 3N99 HIS P 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 114 
15 3N99 HIS P 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 115 
15 3N99 HIS P 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 116 
15 3N99 HIS P 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 117 
15 3N99 HIS P 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 118 
15 3N99 GLY P 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 119 
15 3N99 HIS P 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  120 
16 3N99 HIS S 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 121 
16 3N99 HIS S 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 122 
16 3N99 HIS S 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 123 
16 3N99 HIS S 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 124 
16 3N99 HIS S 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 125 
16 3N99 HIS S 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 126 
16 3N99 GLY S 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 127 
16 3N99 HIS S 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  128 
17 3N99 HIS T 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 129 
17 3N99 HIS T 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 130 
17 3N99 HIS T 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 131 
17 3N99 HIS T 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 132 
17 3N99 HIS T 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 133 
17 3N99 HIS T 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 134 
17 3N99 GLY T 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 135 
17 3N99 HIS T 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  136 
18 3N99 HIS U 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 137 
18 3N99 HIS U 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 138 
18 3N99 HIS U 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 139 
18 3N99 HIS U 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 140 
18 3N99 HIS U 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 141 
18 3N99 HIS U 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 142 
18 3N99 GLY U 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 143 
18 3N99 HIS U 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  144 
19 3N99 HIS V 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 145 
19 3N99 HIS V 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 146 
19 3N99 HIS V 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 147 
19 3N99 HIS V 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 148 
19 3N99 HIS V 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 149 
19 3N99 HIS V 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 150 
19 3N99 GLY V 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 151 
19 3N99 HIS V 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  152 
20 3N99 HIS X 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 153 
20 3N99 HIS X 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 154 
20 3N99 HIS X 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 155 
20 3N99 HIS X 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 156 
20 3N99 HIS X 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 157 
20 3N99 HIS X 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 158 
20 3N99 GLY X 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 159 
20 3N99 HIS X 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  160 
21 3N99 HIS a 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 161 
21 3N99 HIS a 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 162 
21 3N99 HIS a 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 163 
21 3N99 HIS a 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 164 
21 3N99 HIS a 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 165 
21 3N99 HIS a 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 166 
21 3N99 GLY a 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 167 
21 3N99 HIS a 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  168 
22 3N99 HIS b 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 169 
22 3N99 HIS b 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 170 
22 3N99 HIS b 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 171 
22 3N99 HIS b 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 172 
22 3N99 HIS b 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 173 
22 3N99 HIS b 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 174 
22 3N99 GLY b 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 175 
22 3N99 HIS b 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  176 
23 3N99 HIS c 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 177 
23 3N99 HIS c 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 178 
23 3N99 HIS c 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 179 
23 3N99 HIS c 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 180 
23 3N99 HIS c 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 181 
23 3N99 HIS c 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 182 
23 3N99 GLY c 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 183 
23 3N99 HIS c 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  184 
24 3N99 HIS d 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 185 
24 3N99 HIS d 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 186 
24 3N99 HIS d 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 187 
24 3N99 HIS d 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 188 
24 3N99 HIS d 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 189 
24 3N99 HIS d 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 190 
24 3N99 GLY d 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 191 
24 3N99 HIS d 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  192 
25 3N99 HIS e 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 193 
25 3N99 HIS e 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 194 
25 3N99 HIS e 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 195 
25 3N99 HIS e 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 196 
25 3N99 HIS e 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 197 
25 3N99 HIS e 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 198 
25 3N99 GLY e 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 199 
25 3N99 HIS e 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  200 
26 3N99 HIS g 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 201 
26 3N99 HIS g 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 202 
26 3N99 HIS g 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 203 
26 3N99 HIS g 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 204 
26 3N99 HIS g 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 205 
26 3N99 HIS g 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 206 
26 3N99 GLY g 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 207 
26 3N99 HIS g 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  208 
27 3N99 HIS h 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 209 
27 3N99 HIS h 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 210 
27 3N99 HIS h 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 211 
27 3N99 HIS h 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 212 
27 3N99 HIS h 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 213 
27 3N99 HIS h 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 214 
27 3N99 GLY h 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 215 
27 3N99 HIS h 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  216 
28 3N99 HIS i 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 217 
28 3N99 HIS i 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 218 
28 3N99 HIS i 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 219 
28 3N99 HIS i 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 220 
28 3N99 HIS i 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 221 
28 3N99 HIS i 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 222 
28 3N99 GLY i 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 223 
28 3N99 HIS i 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  224 
29 3N99 HIS j 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 225 
29 3N99 HIS j 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 226 
29 3N99 HIS j 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 227 
29 3N99 HIS j 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 228 
29 3N99 HIS j 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 229 
29 3N99 HIS j 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 230 
29 3N99 GLY j 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 231 
29 3N99 HIS j 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  232 
30 3N99 HIS k 1 ? UNP Q9X0H2 ? ? 'expression tag' -7 233 
30 3N99 HIS k 2 ? UNP Q9X0H2 ? ? 'expression tag' -6 234 
30 3N99 HIS k 3 ? UNP Q9X0H2 ? ? 'expression tag' -5 235 
30 3N99 HIS k 4 ? UNP Q9X0H2 ? ? 'expression tag' -4 236 
30 3N99 HIS k 5 ? UNP Q9X0H2 ? ? 'expression tag' -3 237 
30 3N99 HIS k 6 ? UNP Q9X0H2 ? ? 'expression tag' -2 238 
30 3N99 GLY k 7 ? UNP Q9X0H2 ? ? 'expression tag' -1 239 
30 3N99 HIS k 8 ? UNP Q9X0H2 ? ? 'expression tag' 0  240 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3N99 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.67 
_exptl_crystal.density_percent_sol   66.53 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_details    '60% Tacsimate, 0.1M Na citrate, pH 5.6, VAPOR DIFFUSION, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-07-13 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Double crystal cryo-cooled Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9793 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 23-ID-B' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-B 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9793 
# 
_reflns.entry_id                     3N99 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.38 
_reflns.number_obs                   537068 
_reflns.number_all                   537068 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.113 
_reflns.pdbx_Rsym_value              0.113 
_reflns.pdbx_netI_over_sigmaI        19.7 
_reflns.B_iso_Wilson_estimate        35.0 
_reflns.pdbx_redundancy              7.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.44 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.550 
_reflns_shell.pdbx_Rsym_value        0.550 
_reflns_shell.meanI_over_sigI_obs    3.4 
_reflns_shell.pdbx_redundancy        6.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      26709 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3N99 
_refine.ls_number_reflns_obs                     509826 
_refine.ls_number_reflns_all                     509826 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            2.38 
_refine.ls_percent_reflns_obs                    99.12 
_refine.ls_R_factor_obs                          0.15338 
_refine.ls_R_factor_all                          0.15338 
_refine.ls_R_factor_R_work                       0.15140 
_refine.ls_R_factor_R_free                       0.19130 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  26930 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.965 
_refine.correlation_coeff_Fo_to_Fc_free          0.944 
_refine.B_iso_mean                               25.764 
_refine.aniso_B[1][1]                            -0.16 
_refine.aniso_B[2][2]                            0.37 
_refine.aniso_B[3][3]                            -0.21 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      3DCL 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.171 
_refine.overall_SU_ML                            0.109 
_refine.overall_SU_B                             8.280 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        63060 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         86 
_refine_hist.number_atoms_solvent             5054 
_refine_hist.number_atoms_total               68200 
_refine_hist.d_res_high                       2.38 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.020  0.022  ? 64640  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.000  0.020  ? 43441  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.694  1.967  ? 87470  'X-RAY DIFFRACTION' ? 
r_angle_other_deg            4.293  3.000  ? 106940 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.679  5.000  ? 8554   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       38.460 24.351 ? 2450   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.514 15.000 ? 11415  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       20.194 15.000 ? 343    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.098  0.200  ? 10043  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.021  ? 72135  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.007  0.020  ? 11776  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.928  1.500  ? 41799  'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.000  1.500  ? 17639  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.907  2.000  ? 67437  'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.256  3.000  ? 22841  'X-RAY DIFFRACTION' ? 
r_scangle_it                 5.744  4.500  ? 19977  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?      'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 3391 0.32 0.50 'medium positional' 1 1  'X-RAY DIFFRACTION' ? ? ? 
1 B 3391 0.31 0.50 'medium positional' 1 2  'X-RAY DIFFRACTION' ? ? ? 
1 C 3391 0.31 0.50 'medium positional' 1 3  'X-RAY DIFFRACTION' ? ? ? 
1 D 3391 0.29 0.50 'medium positional' 1 4  'X-RAY DIFFRACTION' ? ? ? 
1 E 3391 0.29 0.50 'medium positional' 1 5  'X-RAY DIFFRACTION' ? ? ? 
1 G 3391 0.46 0.50 'medium positional' 1 6  'X-RAY DIFFRACTION' ? ? ? 
1 H 3391 0.35 0.50 'medium positional' 1 7  'X-RAY DIFFRACTION' ? ? ? 
1 I 3391 0.47 0.50 'medium positional' 1 8  'X-RAY DIFFRACTION' ? ? ? 
1 J 3391 0.34 0.50 'medium positional' 1 9  'X-RAY DIFFRACTION' ? ? ? 
1 K 3391 0.32 0.50 'medium positional' 1 10 'X-RAY DIFFRACTION' ? ? ? 
1 L 3391 0.30 0.50 'medium positional' 1 11 'X-RAY DIFFRACTION' ? ? ? 
1 M 3391 0.27 0.50 'medium positional' 1 12 'X-RAY DIFFRACTION' ? ? ? 
1 N 3391 0.29 0.50 'medium positional' 1 13 'X-RAY DIFFRACTION' ? ? ? 
1 O 3391 0.32 0.50 'medium positional' 1 14 'X-RAY DIFFRACTION' ? ? ? 
1 P 3391 0.30 0.50 'medium positional' 1 15 'X-RAY DIFFRACTION' ? ? ? 
1 S 3391 0.36 0.50 'medium positional' 1 16 'X-RAY DIFFRACTION' ? ? ? 
1 T 3391 0.29 0.50 'medium positional' 1 17 'X-RAY DIFFRACTION' ? ? ? 
1 U 3391 0.29 0.50 'medium positional' 1 18 'X-RAY DIFFRACTION' ? ? ? 
1 V 3391 0.32 0.50 'medium positional' 1 19 'X-RAY DIFFRACTION' ? ? ? 
1 X 3391 0.42 0.50 'medium positional' 1 20 'X-RAY DIFFRACTION' ? ? ? 
1 a 3391 0.26 0.50 'medium positional' 1 21 'X-RAY DIFFRACTION' ? ? ? 
1 b 3391 0.34 0.50 'medium positional' 1 22 'X-RAY DIFFRACTION' ? ? ? 
1 c 3391 0.30 0.50 'medium positional' 1 23 'X-RAY DIFFRACTION' ? ? ? 
1 d 3391 0.30 0.50 'medium positional' 1 24 'X-RAY DIFFRACTION' ? ? ? 
1 e 3391 0.39 0.50 'medium positional' 1 25 'X-RAY DIFFRACTION' ? ? ? 
1 g 3391 0.49 0.50 'medium positional' 1 26 'X-RAY DIFFRACTION' ? ? ? 
1 h 3391 0.37 0.50 'medium positional' 1 27 'X-RAY DIFFRACTION' ? ? ? 
1 i 3391 0.30 0.50 'medium positional' 1 28 'X-RAY DIFFRACTION' ? ? ? 
1 j 3391 0.37 0.50 'medium positional' 1 29 'X-RAY DIFFRACTION' ? ? ? 
1 k 3391 0.46 0.50 'medium positional' 1 30 'X-RAY DIFFRACTION' ? ? ? 
1 A 3391 1.68 2.00 'medium thermal'    1 31 'X-RAY DIFFRACTION' ? ? ? 
1 B 3391 1.99 2.00 'medium thermal'    1 32 'X-RAY DIFFRACTION' ? ? ? 
1 C 3391 3.41 2.00 'medium thermal'    1 33 'X-RAY DIFFRACTION' ? ? ? 
1 D 3391 2.72 2.00 'medium thermal'    1 34 'X-RAY DIFFRACTION' ? ? ? 
1 E 3391 2.77 2.00 'medium thermal'    1 35 'X-RAY DIFFRACTION' ? ? ? 
1 G 3391 2.54 2.00 'medium thermal'    1 36 'X-RAY DIFFRACTION' ? ? ? 
1 H 3391 2.54 2.00 'medium thermal'    1 37 'X-RAY DIFFRACTION' ? ? ? 
1 I 3391 1.58 2.00 'medium thermal'    1 38 'X-RAY DIFFRACTION' ? ? ? 
1 J 3391 4.91 2.00 'medium thermal'    1 39 'X-RAY DIFFRACTION' ? ? ? 
1 K 3391 3.59 2.00 'medium thermal'    1 40 'X-RAY DIFFRACTION' ? ? ? 
1 L 3391 2.60 2.00 'medium thermal'    1 41 'X-RAY DIFFRACTION' ? ? ? 
1 M 3391 2.18 2.00 'medium thermal'    1 42 'X-RAY DIFFRACTION' ? ? ? 
1 N 3391 1.94 2.00 'medium thermal'    1 43 'X-RAY DIFFRACTION' ? ? ? 
1 O 3391 2.31 2.00 'medium thermal'    1 44 'X-RAY DIFFRACTION' ? ? ? 
1 P 3391 2.46 2.00 'medium thermal'    1 45 'X-RAY DIFFRACTION' ? ? ? 
1 S 3391 3.43 2.00 'medium thermal'    1 46 'X-RAY DIFFRACTION' ? ? ? 
1 T 3391 2.22 2.00 'medium thermal'    1 47 'X-RAY DIFFRACTION' ? ? ? 
1 U 3391 3.51 2.00 'medium thermal'    1 48 'X-RAY DIFFRACTION' ? ? ? 
1 V 3391 1.75 2.00 'medium thermal'    1 49 'X-RAY DIFFRACTION' ? ? ? 
1 X 3391 1.70 2.00 'medium thermal'    1 50 'X-RAY DIFFRACTION' ? ? ? 
1 a 3391 3.03 2.00 'medium thermal'    1 51 'X-RAY DIFFRACTION' ? ? ? 
1 b 3391 3.77 2.00 'medium thermal'    1 52 'X-RAY DIFFRACTION' ? ? ? 
1 c 3391 2.46 2.00 'medium thermal'    1 53 'X-RAY DIFFRACTION' ? ? ? 
1 d 3391 2.26 2.00 'medium thermal'    1 54 'X-RAY DIFFRACTION' ? ? ? 
1 e 3391 1.69 2.00 'medium thermal'    1 55 'X-RAY DIFFRACTION' ? ? ? 
1 g 3391 3.53 2.00 'medium thermal'    1 56 'X-RAY DIFFRACTION' ? ? ? 
1 h 3391 3.49 2.00 'medium thermal'    1 57 'X-RAY DIFFRACTION' ? ? ? 
1 i 3391 2.82 2.00 'medium thermal'    1 58 'X-RAY DIFFRACTION' ? ? ? 
1 j 3391 3.50 2.00 'medium thermal'    1 59 'X-RAY DIFFRACTION' ? ? ? 
1 k 3391 1.91 2.00 'medium thermal'    1 60 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.381 
_refine_ls_shell.d_res_low                        2.443 
_refine_ls_shell.number_reflns_R_work             33670 
_refine_ls_shell.R_factor_R_work                  0.219 
_refine_ls_shell.percent_reflns_obs               89.04 
_refine_ls_shell.R_factor_R_free                  0.256 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             1794 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1  A 1 
2  B 1 
3  C 1 
4  D 1 
5  E 1 
6  G 1 
7  H 1 
8  I 1 
9  J 1 
10 K 1 
11 L 1 
12 M 1 
13 N 1 
14 O 1 
15 P 1 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3N99 
_struct.title                     'Crystal structure of TM1086' 
_struct.pdbx_descriptor           'uncharacterized protein TM1086' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3N99 
_struct_keywords.pdbx_keywords   'structural genomics, unknown function' 
_struct_keywords.text            
'unknown function, structural genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 1 ? 
P  N N 1 ? 
Q  N N 1 ? 
R  N N 1 ? 
S  N N 1 ? 
T  N N 1 ? 
U  N N 1 ? 
V  N N 1 ? 
W  N N 1 ? 
X  N N 1 ? 
Y  N N 1 ? 
Z  N N 1 ? 
AA N N 1 ? 
BA N N 1 ? 
CA N N 1 ? 
DA N N 1 ? 
EA N N 2 ? 
FA N N 2 ? 
GA N N 2 ? 
HA N N 2 ? 
IA N N 2 ? 
JA N N 2 ? 
KA N N 2 ? 
LA N N 2 ? 
MA N N 2 ? 
NA N N 2 ? 
OA N N 2 ? 
PA N N 2 ? 
QA N N 2 ? 
RA N N 2 ? 
SA N N 2 ? 
TA N N 2 ? 
UA N N 2 ? 
VA N N 2 ? 
WA N N 2 ? 
XA N N 2 ? 
YA N N 2 ? 
ZA N N 2 ? 
AB N N 2 ? 
BB N N 2 ? 
CB N N 2 ? 
DB N N 2 ? 
EB N N 2 ? 
FB N N 2 ? 
GB N N 2 ? 
HB N N 2 ? 
IB N N 2 ? 
JB N N 2 ? 
KB N N 2 ? 
LB N N 2 ? 
MB N N 2 ? 
NB N N 2 ? 
OB N N 2 ? 
PB N N 2 ? 
QB N N 2 ? 
RB N N 2 ? 
SB N N 2 ? 
TB N N 2 ? 
UB N N 2 ? 
VB N N 2 ? 
WB N N 2 ? 
XB N N 2 ? 
YB N N 2 ? 
ZB N N 2 ? 
AC N N 2 ? 
BC N N 2 ? 
CC N N 2 ? 
DC N N 2 ? 
EC N N 2 ? 
FC N N 2 ? 
GC N N 2 ? 
HC N N 2 ? 
IC N N 2 ? 
JC N N 2 ? 
KC N N 2 ? 
LC N N 2 ? 
MC N N 2 ? 
NC N N 2 ? 
OC N N 2 ? 
PC N N 2 ? 
QC N N 2 ? 
RC N N 2 ? 
SC N N 2 ? 
TC N N 2 ? 
UC N N 2 ? 
VC N N 2 ? 
WC N N 2 ? 
XC N N 2 ? 
YC N N 2 ? 
ZC N N 2 ? 
AD N N 2 ? 
BD N N 2 ? 
CD N N 2 ? 
DD N N 2 ? 
ED N N 2 ? 
FD N N 2 ? 
GD N N 2 ? 
HD N N 2 ? 
ID N N 2 ? 
JD N N 2 ? 
KD N N 2 ? 
LD N N 2 ? 
MD N N 3 ? 
ND N N 3 ? 
OD N N 3 ? 
PD N N 3 ? 
QD N N 3 ? 
RD N N 3 ? 
SD N N 3 ? 
TD N N 3 ? 
UD N N 3 ? 
VD N N 3 ? 
WD N N 3 ? 
XD N N 3 ? 
YD N N 3 ? 
ZD N N 3 ? 
AE N N 3 ? 
BE N N 3 ? 
CE N N 3 ? 
DE N N 3 ? 
EE N N 3 ? 
FE N N 3 ? 
GE N N 3 ? 
HE N N 3 ? 
IE N N 3 ? 
JE N N 3 ? 
KE N N 3 ? 
LE N N 3 ? 
ME N N 3 ? 
NE N N 3 ? 
OE N N 3 ? 
PE N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   decamer 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ASN A  12  ? LEU A  16  ? ASN A 4   LEU A 8   5 ? 5 
HELX_P HELX_P2   2   ARG A  79  ? GLU A  81  ? ARG A 71  GLU A 73  5 ? 3 
HELX_P HELX_P3   3   GLU A  82  ? SER A  90  ? GLU A 74  SER A 82  1 ? 9 
HELX_P HELX_P4   4   GLU A  125 ? GLY A  130 ? GLU A 117 GLY A 122 1 ? 6 
HELX_P HELX_P5   5   ASP A  161 ? GLU A  166 ? ASP A 153 GLU A 158 1 ? 6 
HELX_P HELX_P6   6   PRO A  186 ? MET A  190 ? PRO A 178 MET A 182 5 ? 5 
HELX_P HELX_P7   7   ASN A  210 ? GLY A  215 ? ASN A 202 GLY A 207 5 ? 6 
HELX_P HELX_P8   8   ASN A  283 ? LEU A  288 ? ASN A 275 LEU A 280 5 ? 6 
HELX_P HELX_P9   9   ASN B  12  ? LEU B  16  ? ASN B 4   LEU B 8   5 ? 5 
HELX_P HELX_P10  10  ARG B  79  ? GLU B  81  ? ARG B 71  GLU B 73  5 ? 3 
HELX_P HELX_P11  11  GLU B  82  ? SER B  90  ? GLU B 74  SER B 82  1 ? 9 
HELX_P HELX_P12  12  GLU B  125 ? GLY B  130 ? GLU B 117 GLY B 122 1 ? 6 
HELX_P HELX_P13  13  ASP B  161 ? LYS B  167 ? ASP B 153 LYS B 159 1 ? 7 
HELX_P HELX_P14  14  PRO B  186 ? MET B  190 ? PRO B 178 MET B 182 5 ? 5 
HELX_P HELX_P15  15  ASN B  210 ? GLY B  215 ? ASN B 202 GLY B 207 5 ? 6 
HELX_P HELX_P16  16  ASN B  283 ? TYR B  287 ? ASN B 275 TYR B 279 5 ? 5 
HELX_P HELX_P17  17  ASN C  12  ? LEU C  16  ? ASN C 4   LEU C 8   5 ? 5 
HELX_P HELX_P18  18  ARG C  79  ? GLU C  81  ? ARG C 71  GLU C 73  5 ? 3 
HELX_P HELX_P19  19  GLU C  82  ? SER C  90  ? GLU C 74  SER C 82  1 ? 9 
HELX_P HELX_P20  20  GLU C  125 ? GLY C  130 ? GLU C 117 GLY C 122 1 ? 6 
HELX_P HELX_P21  21  ASP C  161 ? GLU C  166 ? ASP C 153 GLU C 158 1 ? 6 
HELX_P HELX_P22  22  PRO C  186 ? MET C  190 ? PRO C 178 MET C 182 5 ? 5 
HELX_P HELX_P23  23  ASN C  210 ? GLY C  215 ? ASN C 202 GLY C 207 5 ? 6 
HELX_P HELX_P24  24  ASN C  283 ? LEU C  288 ? ASN C 275 LEU C 280 5 ? 6 
HELX_P HELX_P25  25  ASN D  12  ? LEU D  16  ? ASN D 4   LEU D 8   5 ? 5 
HELX_P HELX_P26  26  ARG D  79  ? GLU D  81  ? ARG D 71  GLU D 73  5 ? 3 
HELX_P HELX_P27  27  GLU D  82  ? SER D  90  ? GLU D 74  SER D 82  1 ? 9 
HELX_P HELX_P28  28  GLU D  125 ? GLY D  130 ? GLU D 117 GLY D 122 1 ? 6 
HELX_P HELX_P29  29  ASP D  161 ? GLU D  166 ? ASP D 153 GLU D 158 1 ? 6 
HELX_P HELX_P30  30  PRO D  186 ? MET D  190 ? PRO D 178 MET D 182 5 ? 5 
HELX_P HELX_P31  31  ASN D  210 ? GLY D  215 ? ASN D 202 GLY D 207 5 ? 6 
HELX_P HELX_P32  32  ASN D  283 ? LEU D  288 ? ASN D 275 LEU D 280 5 ? 6 
HELX_P HELX_P33  33  ASN E  12  ? LEU E  16  ? ASN E 4   LEU E 8   5 ? 5 
HELX_P HELX_P34  34  ARG E  79  ? GLU E  81  ? ARG E 71  GLU E 73  5 ? 3 
HELX_P HELX_P35  35  GLU E  82  ? SER E  90  ? GLU E 74  SER E 82  1 ? 9 
HELX_P HELX_P36  36  GLU E  125 ? GLY E  130 ? GLU E 117 GLY E 122 1 ? 6 
HELX_P HELX_P37  37  ASP E  161 ? GLU E  166 ? ASP E 153 GLU E 158 1 ? 6 
HELX_P HELX_P38  38  PRO E  186 ? MET E  190 ? PRO E 178 MET E 182 5 ? 5 
HELX_P HELX_P39  39  ASN E  210 ? GLY E  215 ? ASN E 202 GLY E 207 5 ? 6 
HELX_P HELX_P40  40  ASN E  283 ? LEU E  288 ? ASN E 275 LEU E 280 5 ? 6 
HELX_P HELX_P41  41  ASN F  12  ? LEU F  16  ? ASN G 4   LEU G 8   5 ? 5 
HELX_P HELX_P42  42  ARG F  79  ? GLU F  81  ? ARG G 71  GLU G 73  5 ? 3 
HELX_P HELX_P43  43  GLU F  82  ? SER F  90  ? GLU G 74  SER G 82  1 ? 9 
HELX_P HELX_P44  44  GLU F  125 ? GLY F  130 ? GLU G 117 GLY G 122 1 ? 6 
HELX_P HELX_P45  45  ASP F  161 ? GLU F  166 ? ASP G 153 GLU G 158 1 ? 6 
HELX_P HELX_P46  46  PRO F  186 ? MET F  190 ? PRO G 178 MET G 182 5 ? 5 
HELX_P HELX_P47  47  ASN F  210 ? GLY F  215 ? ASN G 202 GLY G 207 5 ? 6 
HELX_P HELX_P48  48  ASN F  283 ? LEU F  288 ? ASN G 275 LEU G 280 5 ? 6 
HELX_P HELX_P49  49  ASN G  12  ? LEU G  16  ? ASN H 4   LEU H 8   5 ? 5 
HELX_P HELX_P50  50  ARG G  79  ? GLU G  81  ? ARG H 71  GLU H 73  5 ? 3 
HELX_P HELX_P51  51  GLU G  82  ? SER G  90  ? GLU H 74  SER H 82  1 ? 9 
HELX_P HELX_P52  52  GLU G  125 ? GLY G  130 ? GLU H 117 GLY H 122 1 ? 6 
HELX_P HELX_P53  53  ASP G  161 ? LYS G  167 ? ASP H 153 LYS H 159 1 ? 7 
HELX_P HELX_P54  54  PRO G  186 ? MET G  190 ? PRO H 178 MET H 182 5 ? 5 
HELX_P HELX_P55  55  SER G  198 ? THR G  202 ? SER H 190 THR H 194 5 ? 5 
HELX_P HELX_P56  56  ASN G  210 ? GLY G  215 ? ASN H 202 GLY H 207 5 ? 6 
HELX_P HELX_P57  57  ASN G  283 ? LEU G  288 ? ASN H 275 LEU H 280 5 ? 6 
HELX_P HELX_P58  58  ASN H  12  ? LEU H  16  ? ASN I 4   LEU I 8   5 ? 5 
HELX_P HELX_P59  59  ARG H  79  ? GLU H  81  ? ARG I 71  GLU I 73  5 ? 3 
HELX_P HELX_P60  60  GLU H  82  ? SER H  90  ? GLU I 74  SER I 82  1 ? 9 
HELX_P HELX_P61  61  GLU H  125 ? GLY H  130 ? GLU I 117 GLY I 122 1 ? 6 
HELX_P HELX_P62  62  ASP H  161 ? GLU H  166 ? ASP I 153 GLU I 158 1 ? 6 
HELX_P HELX_P63  63  PRO H  186 ? MET H  190 ? PRO I 178 MET I 182 5 ? 5 
HELX_P HELX_P64  64  ASN H  210 ? GLY H  215 ? ASN I 202 GLY I 207 5 ? 6 
HELX_P HELX_P65  65  ASN H  283 ? TYR H  287 ? ASN I 275 TYR I 279 5 ? 5 
HELX_P HELX_P66  66  ASN I  12  ? LEU I  16  ? ASN J 4   LEU J 8   5 ? 5 
HELX_P HELX_P67  67  ARG I  79  ? GLU I  81  ? ARG J 71  GLU J 73  5 ? 3 
HELX_P HELX_P68  68  GLU I  82  ? SER I  90  ? GLU J 74  SER J 82  1 ? 9 
HELX_P HELX_P69  69  GLU I  125 ? GLY I  130 ? GLU J 117 GLY J 122 1 ? 6 
HELX_P HELX_P70  70  ASP I  161 ? GLU I  166 ? ASP J 153 GLU J 158 1 ? 6 
HELX_P HELX_P71  71  PRO I  186 ? MET I  190 ? PRO J 178 MET J 182 5 ? 5 
HELX_P HELX_P72  72  ASN I  210 ? GLY I  215 ? ASN J 202 GLY J 207 5 ? 6 
HELX_P HELX_P73  73  ASN I  283 ? LEU I  288 ? ASN J 275 LEU J 280 5 ? 6 
HELX_P HELX_P74  74  ASN J  12  ? LEU J  16  ? ASN K 4   LEU K 8   5 ? 5 
HELX_P HELX_P75  75  ARG J  79  ? GLU J  81  ? ARG K 71  GLU K 73  5 ? 3 
HELX_P HELX_P76  76  GLU J  82  ? SER J  90  ? GLU K 74  SER K 82  1 ? 9 
HELX_P HELX_P77  77  GLU J  125 ? GLY J  130 ? GLU K 117 GLY K 122 1 ? 6 
HELX_P HELX_P78  78  ASP J  161 ? LEU J  168 ? ASP K 153 LEU K 160 1 ? 8 
HELX_P HELX_P79  79  PRO J  186 ? MET J  190 ? PRO K 178 MET K 182 5 ? 5 
HELX_P HELX_P80  80  ASN J  210 ? GLY J  215 ? ASN K 202 GLY K 207 5 ? 6 
HELX_P HELX_P81  81  ASN J  283 ? LEU J  288 ? ASN K 275 LEU K 280 5 ? 6 
HELX_P HELX_P82  82  ASN K  12  ? LEU K  16  ? ASN L 4   LEU L 8   5 ? 5 
HELX_P HELX_P83  83  ARG K  79  ? GLU K  81  ? ARG L 71  GLU L 73  5 ? 3 
HELX_P HELX_P84  84  GLU K  82  ? SER K  90  ? GLU L 74  SER L 82  1 ? 9 
HELX_P HELX_P85  85  GLU K  125 ? GLY K  130 ? GLU L 117 GLY L 122 1 ? 6 
HELX_P HELX_P86  86  ASP K  161 ? LYS K  167 ? ASP L 153 LYS L 159 1 ? 7 
HELX_P HELX_P87  87  PRO K  186 ? MET K  190 ? PRO L 178 MET L 182 5 ? 5 
HELX_P HELX_P88  88  ASN K  210 ? GLY K  215 ? ASN L 202 GLY L 207 5 ? 6 
HELX_P HELX_P89  89  ASN K  283 ? LEU K  288 ? ASN L 275 LEU L 280 5 ? 6 
HELX_P HELX_P90  90  ASN L  12  ? LEU L  16  ? ASN M 4   LEU M 8   5 ? 5 
HELX_P HELX_P91  91  ARG L  79  ? GLU L  81  ? ARG M 71  GLU M 73  5 ? 3 
HELX_P HELX_P92  92  GLU L  82  ? SER L  90  ? GLU M 74  SER M 82  1 ? 9 
HELX_P HELX_P93  93  GLU L  125 ? GLY L  130 ? GLU M 117 GLY M 122 1 ? 6 
HELX_P HELX_P94  94  ASP L  161 ? GLU L  166 ? ASP M 153 GLU M 158 1 ? 6 
HELX_P HELX_P95  95  PRO L  186 ? MET L  190 ? PRO M 178 MET M 182 5 ? 5 
HELX_P HELX_P96  96  ASN L  210 ? GLY L  215 ? ASN M 202 GLY M 207 5 ? 6 
HELX_P HELX_P97  97  ASN L  283 ? LEU L  288 ? ASN M 275 LEU M 280 5 ? 6 
HELX_P HELX_P98  98  ASN M  12  ? LEU M  16  ? ASN N 4   LEU N 8   5 ? 5 
HELX_P HELX_P99  99  ARG M  79  ? GLU M  81  ? ARG N 71  GLU N 73  5 ? 3 
HELX_P HELX_P100 100 GLU M  82  ? SER M  90  ? GLU N 74  SER N 82  1 ? 9 
HELX_P HELX_P101 101 GLU M  125 ? GLY M  130 ? GLU N 117 GLY N 122 1 ? 6 
HELX_P HELX_P102 102 ASP M  161 ? GLU M  166 ? ASP N 153 GLU N 158 1 ? 6 
HELX_P HELX_P103 103 PRO M  186 ? MET M  190 ? PRO N 178 MET N 182 5 ? 5 
HELX_P HELX_P104 104 ASN M  210 ? GLY M  215 ? ASN N 202 GLY N 207 5 ? 6 
HELX_P HELX_P105 105 ASN M  283 ? LEU M  288 ? ASN N 275 LEU N 280 5 ? 6 
HELX_P HELX_P106 106 ASN N  12  ? LEU N  16  ? ASN O 4   LEU O 8   5 ? 5 
HELX_P HELX_P107 107 ARG N  79  ? GLU N  81  ? ARG O 71  GLU O 73  5 ? 3 
HELX_P HELX_P108 108 GLU N  82  ? SER N  90  ? GLU O 74  SER O 82  1 ? 9 
HELX_P HELX_P109 109 GLU N  125 ? GLY N  130 ? GLU O 117 GLY O 122 1 ? 6 
HELX_P HELX_P110 110 ASP N  161 ? GLU N  166 ? ASP O 153 GLU O 158 1 ? 6 
HELX_P HELX_P111 111 PRO N  186 ? MET N  190 ? PRO O 178 MET O 182 5 ? 5 
HELX_P HELX_P112 112 ASN N  210 ? GLY N  215 ? ASN O 202 GLY O 207 5 ? 6 
HELX_P HELX_P113 113 ASN N  283 ? TYR N  287 ? ASN O 275 TYR O 279 5 ? 5 
HELX_P HELX_P114 114 ASN O  12  ? LEU O  16  ? ASN P 4   LEU P 8   5 ? 5 
HELX_P HELX_P115 115 ARG O  79  ? GLU O  81  ? ARG P 71  GLU P 73  5 ? 3 
HELX_P HELX_P116 116 GLU O  82  ? SER O  90  ? GLU P 74  SER P 82  1 ? 9 
HELX_P HELX_P117 117 GLU O  125 ? GLY O  130 ? GLU P 117 GLY P 122 1 ? 6 
HELX_P HELX_P118 118 ASP O  161 ? GLU O  166 ? ASP P 153 GLU P 158 1 ? 6 
HELX_P HELX_P119 119 PRO O  186 ? MET O  190 ? PRO P 178 MET P 182 5 ? 5 
HELX_P HELX_P120 120 ASN O  210 ? GLY O  215 ? ASN P 202 GLY P 207 5 ? 6 
HELX_P HELX_P121 121 ASN O  283 ? LEU O  288 ? ASN P 275 LEU P 280 5 ? 6 
HELX_P HELX_P122 122 ASN P  12  ? LEU P  16  ? ASN S 4   LEU S 8   5 ? 5 
HELX_P HELX_P123 123 ARG P  79  ? GLU P  81  ? ARG S 71  GLU S 73  5 ? 3 
HELX_P HELX_P124 124 GLU P  82  ? SER P  90  ? GLU S 74  SER S 82  1 ? 9 
HELX_P HELX_P125 125 GLU P  125 ? GLY P  130 ? GLU S 117 GLY S 122 1 ? 6 
HELX_P HELX_P126 126 ASP P  161 ? LYS P  167 ? ASP S 153 LYS S 159 1 ? 7 
HELX_P HELX_P127 127 PRO P  186 ? MET P  190 ? PRO S 178 MET S 182 5 ? 5 
HELX_P HELX_P128 128 ASN P  210 ? GLY P  215 ? ASN S 202 GLY S 207 5 ? 6 
HELX_P HELX_P129 129 ASN P  283 ? LEU P  288 ? ASN S 275 LEU S 280 5 ? 6 
HELX_P HELX_P130 130 ASN Q  12  ? LEU Q  16  ? ASN T 4   LEU T 8   5 ? 5 
HELX_P HELX_P131 131 ARG Q  79  ? GLU Q  81  ? ARG T 71  GLU T 73  5 ? 3 
HELX_P HELX_P132 132 GLU Q  82  ? SER Q  90  ? GLU T 74  SER T 82  1 ? 9 
HELX_P HELX_P133 133 GLU Q  125 ? GLY Q  130 ? GLU T 117 GLY T 122 1 ? 6 
HELX_P HELX_P134 134 ASP Q  161 ? GLU Q  166 ? ASP T 153 GLU T 158 1 ? 6 
HELX_P HELX_P135 135 PRO Q  186 ? MET Q  190 ? PRO T 178 MET T 182 5 ? 5 
HELX_P HELX_P136 136 ASN Q  210 ? GLY Q  215 ? ASN T 202 GLY T 207 5 ? 6 
HELX_P HELX_P137 137 ASN Q  283 ? LEU Q  288 ? ASN T 275 LEU T 280 5 ? 6 
HELX_P HELX_P138 138 ASN R  12  ? LEU R  16  ? ASN U 4   LEU U 8   5 ? 5 
HELX_P HELX_P139 139 ARG R  79  ? GLU R  81  ? ARG U 71  GLU U 73  5 ? 3 
HELX_P HELX_P140 140 GLU R  82  ? SER R  90  ? GLU U 74  SER U 82  1 ? 9 
HELX_P HELX_P141 141 GLU R  125 ? GLY R  130 ? GLU U 117 GLY U 122 1 ? 6 
HELX_P HELX_P142 142 ASP R  161 ? GLU R  166 ? ASP U 153 GLU U 158 1 ? 6 
HELX_P HELX_P143 143 PRO R  186 ? MET R  190 ? PRO U 178 MET U 182 5 ? 5 
HELX_P HELX_P144 144 ASN R  210 ? GLY R  215 ? ASN U 202 GLY U 207 5 ? 6 
HELX_P HELX_P145 145 ASN R  283 ? LEU R  288 ? ASN U 275 LEU U 280 5 ? 6 
HELX_P HELX_P146 146 ASN S  12  ? LEU S  16  ? ASN V 4   LEU V 8   5 ? 5 
HELX_P HELX_P147 147 ARG S  79  ? GLU S  81  ? ARG V 71  GLU V 73  5 ? 3 
HELX_P HELX_P148 148 GLU S  82  ? SER S  90  ? GLU V 74  SER V 82  1 ? 9 
HELX_P HELX_P149 149 GLU S  125 ? GLY S  130 ? GLU V 117 GLY V 122 1 ? 6 
HELX_P HELX_P150 150 ASP S  161 ? GLU S  166 ? ASP V 153 GLU V 158 1 ? 6 
HELX_P HELX_P151 151 PRO S  186 ? MET S  190 ? PRO V 178 MET V 182 5 ? 5 
HELX_P HELX_P152 152 ASN S  210 ? GLY S  215 ? ASN V 202 GLY V 207 5 ? 6 
HELX_P HELX_P153 153 ASN S  283 ? LEU S  288 ? ASN V 275 LEU V 280 5 ? 6 
HELX_P HELX_P154 154 ASN T  12  ? LEU T  16  ? ASN X 4   LEU X 8   5 ? 5 
HELX_P HELX_P155 155 ARG T  79  ? GLU T  81  ? ARG X 71  GLU X 73  5 ? 3 
HELX_P HELX_P156 156 GLU T  82  ? SER T  90  ? GLU X 74  SER X 82  1 ? 9 
HELX_P HELX_P157 157 GLU T  125 ? GLY T  130 ? GLU X 117 GLY X 122 1 ? 6 
HELX_P HELX_P158 158 ASP T  161 ? GLU T  166 ? ASP X 153 GLU X 158 1 ? 6 
HELX_P HELX_P159 159 PRO T  186 ? MET T  190 ? PRO X 178 MET X 182 5 ? 5 
HELX_P HELX_P160 160 ASN T  210 ? GLY T  215 ? ASN X 202 GLY X 207 5 ? 6 
HELX_P HELX_P161 161 ASN T  283 ? LEU T  288 ? ASN X 275 LEU X 280 5 ? 6 
HELX_P HELX_P162 162 ASN U  12  ? LEU U  16  ? ASN a 4   LEU a 8   5 ? 5 
HELX_P HELX_P163 163 ARG U  79  ? GLU U  81  ? ARG a 71  GLU a 73  5 ? 3 
HELX_P HELX_P164 164 GLU U  82  ? SER U  90  ? GLU a 74  SER a 82  1 ? 9 
HELX_P HELX_P165 165 GLU U  125 ? GLY U  130 ? GLU a 117 GLY a 122 1 ? 6 
HELX_P HELX_P166 166 ASP U  161 ? GLU U  166 ? ASP a 153 GLU a 158 1 ? 6 
HELX_P HELX_P167 167 PRO U  186 ? MET U  190 ? PRO a 178 MET a 182 5 ? 5 
HELX_P HELX_P168 168 ASN U  210 ? GLY U  215 ? ASN a 202 GLY a 207 5 ? 6 
HELX_P HELX_P169 169 ASN U  283 ? LEU U  288 ? ASN a 275 LEU a 280 5 ? 6 
HELX_P HELX_P170 170 ASN V  12  ? LEU V  16  ? ASN b 4   LEU b 8   5 ? 5 
HELX_P HELX_P171 171 ARG V  79  ? GLU V  81  ? ARG b 71  GLU b 73  5 ? 3 
HELX_P HELX_P172 172 GLU V  82  ? SER V  90  ? GLU b 74  SER b 82  1 ? 9 
HELX_P HELX_P173 173 GLU V  125 ? GLY V  130 ? GLU b 117 GLY b 122 1 ? 6 
HELX_P HELX_P174 174 ASP V  161 ? GLU V  166 ? ASP b 153 GLU b 158 1 ? 6 
HELX_P HELX_P175 175 PRO V  186 ? MET V  190 ? PRO b 178 MET b 182 5 ? 5 
HELX_P HELX_P176 176 ASN V  210 ? GLY V  215 ? ASN b 202 GLY b 207 5 ? 6 
HELX_P HELX_P177 177 ASN V  283 ? LEU V  288 ? ASN b 275 LEU b 280 5 ? 6 
HELX_P HELX_P178 178 ASN W  12  ? LEU W  16  ? ASN c 4   LEU c 8   5 ? 5 
HELX_P HELX_P179 179 ARG W  79  ? GLU W  81  ? ARG c 71  GLU c 73  5 ? 3 
HELX_P HELX_P180 180 GLU W  82  ? SER W  90  ? GLU c 74  SER c 82  1 ? 9 
HELX_P HELX_P181 181 GLU W  125 ? GLY W  130 ? GLU c 117 GLY c 122 1 ? 6 
HELX_P HELX_P182 182 ASP W  161 ? GLU W  166 ? ASP c 153 GLU c 158 1 ? 6 
HELX_P HELX_P183 183 PRO W  186 ? MET W  190 ? PRO c 178 MET c 182 5 ? 5 
HELX_P HELX_P184 184 ASN W  210 ? GLY W  215 ? ASN c 202 GLY c 207 5 ? 6 
HELX_P HELX_P185 185 ASN W  283 ? LEU W  288 ? ASN c 275 LEU c 280 5 ? 6 
HELX_P HELX_P186 186 ASN X  12  ? LEU X  16  ? ASN d 4   LEU d 8   5 ? 5 
HELX_P HELX_P187 187 ARG X  79  ? GLU X  81  ? ARG d 71  GLU d 73  5 ? 3 
HELX_P HELX_P188 188 GLU X  82  ? SER X  90  ? GLU d 74  SER d 82  1 ? 9 
HELX_P HELX_P189 189 GLU X  125 ? GLY X  130 ? GLU d 117 GLY d 122 1 ? 6 
HELX_P HELX_P190 190 ASP X  161 ? GLU X  166 ? ASP d 153 GLU d 158 1 ? 6 
HELX_P HELX_P191 191 PRO X  186 ? MET X  190 ? PRO d 178 MET d 182 5 ? 5 
HELX_P HELX_P192 192 ASN X  210 ? GLY X  215 ? ASN d 202 GLY d 207 5 ? 6 
HELX_P HELX_P193 193 ASN X  283 ? LEU X  288 ? ASN d 275 LEU d 280 5 ? 6 
HELX_P HELX_P194 194 ASN Y  12  ? LEU Y  16  ? ASN e 4   LEU e 8   5 ? 5 
HELX_P HELX_P195 195 ARG Y  79  ? GLU Y  81  ? ARG e 71  GLU e 73  5 ? 3 
HELX_P HELX_P196 196 GLU Y  82  ? SER Y  90  ? GLU e 74  SER e 82  1 ? 9 
HELX_P HELX_P197 197 GLU Y  125 ? GLY Y  130 ? GLU e 117 GLY e 122 1 ? 6 
HELX_P HELX_P198 198 ASP Y  161 ? GLU Y  166 ? ASP e 153 GLU e 158 1 ? 6 
HELX_P HELX_P199 199 PRO Y  186 ? MET Y  190 ? PRO e 178 MET e 182 5 ? 5 
HELX_P HELX_P200 200 ASN Y  210 ? GLY Y  215 ? ASN e 202 GLY e 207 5 ? 6 
HELX_P HELX_P201 201 ASN Y  283 ? LEU Y  288 ? ASN e 275 LEU e 280 5 ? 6 
HELX_P HELX_P202 202 ASN Z  12  ? LEU Z  16  ? ASN g 4   LEU g 8   5 ? 5 
HELX_P HELX_P203 203 ARG Z  79  ? GLU Z  81  ? ARG g 71  GLU g 73  5 ? 3 
HELX_P HELX_P204 204 GLU Z  82  ? SER Z  90  ? GLU g 74  SER g 82  1 ? 9 
HELX_P HELX_P205 205 GLU Z  125 ? GLY Z  130 ? GLU g 117 GLY g 122 1 ? 6 
HELX_P HELX_P206 206 ASP Z  161 ? GLU Z  166 ? ASP g 153 GLU g 158 1 ? 6 
HELX_P HELX_P207 207 PRO Z  186 ? MET Z  190 ? PRO g 178 MET g 182 5 ? 5 
HELX_P HELX_P208 208 ASN Z  210 ? GLY Z  215 ? ASN g 202 GLY g 207 5 ? 6 
HELX_P HELX_P209 209 ASN Z  283 ? LEU Z  288 ? ASN g 275 LEU g 280 5 ? 6 
HELX_P HELX_P210 210 ASN AA 12  ? LEU AA 16  ? ASN h 4   LEU h 8   5 ? 5 
HELX_P HELX_P211 211 ARG AA 79  ? GLU AA 81  ? ARG h 71  GLU h 73  5 ? 3 
HELX_P HELX_P212 212 GLU AA 82  ? SER AA 90  ? GLU h 74  SER h 82  1 ? 9 
HELX_P HELX_P213 213 GLU AA 125 ? GLY AA 130 ? GLU h 117 GLY h 122 1 ? 6 
HELX_P HELX_P214 214 ASP AA 161 ? GLU AA 166 ? ASP h 153 GLU h 158 1 ? 6 
HELX_P HELX_P215 215 PRO AA 186 ? MET AA 190 ? PRO h 178 MET h 182 5 ? 5 
HELX_P HELX_P216 216 ASN AA 210 ? GLY AA 215 ? ASN h 202 GLY h 207 5 ? 6 
HELX_P HELX_P217 217 ASN AA 283 ? LEU AA 288 ? ASN h 275 LEU h 280 5 ? 6 
HELX_P HELX_P218 218 ASN BA 12  ? LEU BA 16  ? ASN i 4   LEU i 8   5 ? 5 
HELX_P HELX_P219 219 ARG BA 79  ? GLU BA 81  ? ARG i 71  GLU i 73  5 ? 3 
HELX_P HELX_P220 220 GLU BA 82  ? SER BA 90  ? GLU i 74  SER i 82  1 ? 9 
HELX_P HELX_P221 221 GLU BA 125 ? GLY BA 130 ? GLU i 117 GLY i 122 1 ? 6 
HELX_P HELX_P222 222 ASP BA 161 ? LYS BA 167 ? ASP i 153 LYS i 159 1 ? 7 
HELX_P HELX_P223 223 PRO BA 186 ? MET BA 190 ? PRO i 178 MET i 182 5 ? 5 
HELX_P HELX_P224 224 ASN BA 210 ? GLY BA 215 ? ASN i 202 GLY i 207 5 ? 6 
HELX_P HELX_P225 225 ASN BA 283 ? LEU BA 288 ? ASN i 275 LEU i 280 5 ? 6 
HELX_P HELX_P226 226 ASN CA 12  ? LEU CA 16  ? ASN j 4   LEU j 8   5 ? 5 
HELX_P HELX_P227 227 ARG CA 79  ? GLU CA 81  ? ARG j 71  GLU j 73  5 ? 3 
HELX_P HELX_P228 228 GLU CA 82  ? SER CA 90  ? GLU j 74  SER j 82  1 ? 9 
HELX_P HELX_P229 229 GLU CA 125 ? GLY CA 130 ? GLU j 117 GLY j 122 1 ? 6 
HELX_P HELX_P230 230 ASP CA 161 ? LYS CA 167 ? ASP j 153 LYS j 159 1 ? 7 
HELX_P HELX_P231 231 PRO CA 186 ? MET CA 190 ? PRO j 178 MET j 182 5 ? 5 
HELX_P HELX_P232 232 ASN CA 210 ? GLY CA 215 ? ASN j 202 GLY j 207 5 ? 6 
HELX_P HELX_P233 233 ASN CA 283 ? LEU CA 288 ? ASN j 275 LEU j 280 5 ? 6 
HELX_P HELX_P234 234 ASN DA 12  ? LEU DA 16  ? ASN k 4   LEU k 8   5 ? 5 
HELX_P HELX_P235 235 ARG DA 79  ? GLU DA 81  ? ARG k 71  GLU k 73  5 ? 3 
HELX_P HELX_P236 236 GLU DA 82  ? SER DA 90  ? GLU k 74  SER k 82  1 ? 9 
HELX_P HELX_P237 237 GLU DA 125 ? GLY DA 130 ? GLU k 117 GLY k 122 1 ? 6 
HELX_P HELX_P238 238 ASP DA 161 ? GLU DA 166 ? ASP k 153 GLU k 158 1 ? 6 
HELX_P HELX_P239 239 PRO DA 186 ? MET DA 190 ? PRO k 178 MET k 182 5 ? 5 
HELX_P HELX_P240 240 ASN DA 210 ? GLY DA 215 ? ASN k 202 GLY k 207 5 ? 6 
HELX_P HELX_P241 241 ASN DA 283 ? TYR DA 287 ? ASN k 275 TYR k 279 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 8 ? 
B  ? 2 ? 
C  ? 2 ? 
D  ? 5 ? 
E  ? 3 ? 
F  ? 3 ? 
G  ? 8 ? 
H  ? 2 ? 
I  ? 2 ? 
J  ? 5 ? 
K  ? 3 ? 
L  ? 3 ? 
M  ? 8 ? 
N  ? 2 ? 
O  ? 2 ? 
P  ? 5 ? 
Q  ? 3 ? 
R  ? 3 ? 
S  ? 7 ? 
T  ? 2 ? 
U  ? 2 ? 
V  ? 5 ? 
W  ? 3 ? 
X  ? 3 ? 
Y  ? 8 ? 
Z  ? 2 ? 
AA ? 2 ? 
AB ? 5 ? 
AC ? 3 ? 
AD ? 3 ? 
AE ? 4 ? 
AF ? 8 ? 
AG ? 2 ? 
AH ? 5 ? 
AI ? 3 ? 
AJ ? 8 ? 
AK ? 2 ? 
AL ? 2 ? 
AM ? 5 ? 
AN ? 3 ? 
AO ? 3 ? 
AP ? 8 ? 
AQ ? 2 ? 
AR ? 2 ? 
AS ? 5 ? 
AT ? 3 ? 
AU ? 3 ? 
AV ? 7 ? 
AW ? 2 ? 
AX ? 5 ? 
AY ? 3 ? 
AZ ? 3 ? 
BA ? 8 ? 
BB ? 2 ? 
BC ? 2 ? 
BD ? 5 ? 
BE ? 3 ? 
BF ? 3 ? 
BG ? 8 ? 
BH ? 2 ? 
BI ? 5 ? 
BJ ? 3 ? 
BK ? 3 ? 
BL ? 8 ? 
BM ? 2 ? 
BN ? 5 ? 
BO ? 3 ? 
BP ? 3 ? 
BQ ? 8 ? 
BR ? 2 ? 
BS ? 2 ? 
BT ? 5 ? 
BU ? 3 ? 
BV ? 3 ? 
BW ? 7 ? 
BX ? 2 ? 
BY ? 2 ? 
BZ ? 5 ? 
CA ? 3 ? 
CB ? 3 ? 
CC ? 7 ? 
CD ? 2 ? 
CE ? 2 ? 
CF ? 5 ? 
CG ? 3 ? 
CH ? 3 ? 
CI ? 8 ? 
CJ ? 2 ? 
CK ? 2 ? 
CL ? 5 ? 
CM ? 3 ? 
CN ? 3 ? 
CO ? 8 ? 
CP ? 2 ? 
CQ ? 2 ? 
CR ? 5 ? 
CS ? 3 ? 
CT ? 3 ? 
CU ? 8 ? 
CV ? 2 ? 
CW ? 5 ? 
CX ? 3 ? 
CY ? 3 ? 
CZ ? 8 ? 
DA ? 2 ? 
DB ? 2 ? 
DC ? 5 ? 
DD ? 3 ? 
DE ? 3 ? 
DF ? 8 ? 
DG ? 2 ? 
DH ? 5 ? 
DI ? 3 ? 
DJ ? 3 ? 
DK ? 8 ? 
DL ? 2 ? 
DM ? 2 ? 
DN ? 5 ? 
DO ? 3 ? 
DP ? 3 ? 
DQ ? 8 ? 
DR ? 2 ? 
DS ? 2 ? 
DT ? 5 ? 
DU ? 3 ? 
DV ? 3 ? 
DW ? 7 ? 
DX ? 2 ? 
DY ? 2 ? 
DZ ? 5 ? 
EA ? 3 ? 
EB ? 3 ? 
EC ? 7 ? 
ED ? 2 ? 
EE ? 2 ? 
EF ? 5 ? 
EG ? 3 ? 
EH ? 3 ? 
EI ? 8 ? 
EJ ? 2 ? 
EK ? 2 ? 
EL ? 5 ? 
EM ? 3 ? 
EN ? 3 ? 
EO ? 4 ? 
EP ? 8 ? 
EQ ? 2 ? 
ER ? 2 ? 
ES ? 5 ? 
ET ? 3 ? 
EU ? 8 ? 
EV ? 2 ? 
EW ? 2 ? 
EX ? 5 ? 
EY ? 3 ? 
EZ ? 3 ? 
FA ? 8 ? 
FB ? 2 ? 
FC ? 2 ? 
FD ? 5 ? 
FE ? 3 ? 
FF ? 3 ? 
FG ? 8 ? 
FH ? 2 ? 
FI ? 5 ? 
FJ ? 3 ? 
FK ? 3 ? 
FL ? 7 ? 
FM ? 2 ? 
FN ? 2 ? 
FO ? 5 ? 
FP ? 3 ? 
FQ ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
A  4 5 ? anti-parallel 
A  5 6 ? anti-parallel 
A  6 7 ? anti-parallel 
A  7 8 ? anti-parallel 
B  1 2 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
D  4 5 ? parallel      
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? parallel      
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
G  4 5 ? anti-parallel 
G  5 6 ? anti-parallel 
G  6 7 ? anti-parallel 
G  7 8 ? anti-parallel 
H  1 2 ? anti-parallel 
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
J  3 4 ? anti-parallel 
J  4 5 ? parallel      
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? parallel      
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
M  3 4 ? anti-parallel 
M  4 5 ? anti-parallel 
M  5 6 ? anti-parallel 
M  6 7 ? anti-parallel 
M  7 8 ? anti-parallel 
N  1 2 ? anti-parallel 
O  1 2 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? anti-parallel 
P  4 5 ? parallel      
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? parallel      
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
S  3 4 ? anti-parallel 
S  4 5 ? anti-parallel 
S  5 6 ? anti-parallel 
S  6 7 ? anti-parallel 
T  1 2 ? anti-parallel 
U  1 2 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
V  3 4 ? anti-parallel 
V  4 5 ? parallel      
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? parallel      
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Y  3 4 ? anti-parallel 
Y  4 5 ? anti-parallel 
Y  5 6 ? anti-parallel 
Y  6 7 ? anti-parallel 
Y  7 8 ? anti-parallel 
Z  1 2 ? anti-parallel 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? parallel      
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? parallel      
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? parallel      
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AF 4 5 ? anti-parallel 
AF 5 6 ? anti-parallel 
AF 6 7 ? anti-parallel 
AF 7 8 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AH 4 5 ? parallel      
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AJ 4 5 ? anti-parallel 
AJ 5 6 ? anti-parallel 
AJ 6 7 ? anti-parallel 
AJ 7 8 ? anti-parallel 
AK 1 2 ? anti-parallel 
AL 1 2 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? anti-parallel 
AM 4 5 ? parallel      
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? parallel      
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AP 3 4 ? anti-parallel 
AP 4 5 ? anti-parallel 
AP 5 6 ? anti-parallel 
AP 6 7 ? anti-parallel 
AP 7 8 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AR 1 2 ? anti-parallel 
AS 1 2 ? anti-parallel 
AS 2 3 ? anti-parallel 
AS 3 4 ? anti-parallel 
AS 4 5 ? parallel      
AT 1 2 ? anti-parallel 
AT 2 3 ? anti-parallel 
AU 1 2 ? anti-parallel 
AU 2 3 ? parallel      
AV 1 2 ? anti-parallel 
AV 2 3 ? anti-parallel 
AV 3 4 ? anti-parallel 
AV 4 5 ? anti-parallel 
AV 5 6 ? anti-parallel 
AV 6 7 ? anti-parallel 
AW 1 2 ? anti-parallel 
AX 1 2 ? anti-parallel 
AX 2 3 ? anti-parallel 
AX 3 4 ? anti-parallel 
AX 4 5 ? parallel      
AY 1 2 ? anti-parallel 
AY 2 3 ? anti-parallel 
AZ 1 2 ? anti-parallel 
AZ 2 3 ? parallel      
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BA 5 6 ? anti-parallel 
BA 6 7 ? anti-parallel 
BA 7 8 ? anti-parallel 
BB 1 2 ? anti-parallel 
BC 1 2 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BD 3 4 ? anti-parallel 
BD 4 5 ? parallel      
BE 1 2 ? anti-parallel 
BE 2 3 ? anti-parallel 
BF 1 2 ? anti-parallel 
BF 2 3 ? parallel      
BG 1 2 ? anti-parallel 
BG 2 3 ? anti-parallel 
BG 3 4 ? anti-parallel 
BG 4 5 ? anti-parallel 
BG 5 6 ? anti-parallel 
BG 6 7 ? anti-parallel 
BG 7 8 ? anti-parallel 
BH 1 2 ? anti-parallel 
BI 1 2 ? anti-parallel 
BI 2 3 ? anti-parallel 
BI 3 4 ? anti-parallel 
BI 4 5 ? parallel      
BJ 1 2 ? anti-parallel 
BJ 2 3 ? anti-parallel 
BK 1 2 ? anti-parallel 
BK 2 3 ? parallel      
BL 1 2 ? anti-parallel 
BL 2 3 ? anti-parallel 
BL 3 4 ? anti-parallel 
BL 4 5 ? anti-parallel 
BL 5 6 ? anti-parallel 
BL 6 7 ? anti-parallel 
BL 7 8 ? anti-parallel 
BM 1 2 ? anti-parallel 
BN 1 2 ? anti-parallel 
BN 2 3 ? anti-parallel 
BN 3 4 ? anti-parallel 
BN 4 5 ? parallel      
BO 1 2 ? anti-parallel 
BO 2 3 ? anti-parallel 
BP 1 2 ? anti-parallel 
BP 2 3 ? parallel      
BQ 1 2 ? anti-parallel 
BQ 2 3 ? anti-parallel 
BQ 3 4 ? anti-parallel 
BQ 4 5 ? anti-parallel 
BQ 5 6 ? anti-parallel 
BQ 6 7 ? anti-parallel 
BQ 7 8 ? anti-parallel 
BR 1 2 ? anti-parallel 
BS 1 2 ? anti-parallel 
BT 1 2 ? anti-parallel 
BT 2 3 ? anti-parallel 
BT 3 4 ? anti-parallel 
BT 4 5 ? parallel      
BU 1 2 ? anti-parallel 
BU 2 3 ? anti-parallel 
BV 1 2 ? anti-parallel 
BV 2 3 ? parallel      
BW 1 2 ? anti-parallel 
BW 2 3 ? anti-parallel 
BW 3 4 ? anti-parallel 
BW 4 5 ? anti-parallel 
BW 5 6 ? anti-parallel 
BW 6 7 ? anti-parallel 
BX 1 2 ? anti-parallel 
BY 1 2 ? anti-parallel 
BZ 1 2 ? anti-parallel 
BZ 2 3 ? anti-parallel 
BZ 3 4 ? anti-parallel 
BZ 4 5 ? parallel      
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? parallel      
CC 1 2 ? anti-parallel 
CC 2 3 ? anti-parallel 
CC 3 4 ? anti-parallel 
CC 4 5 ? anti-parallel 
CC 5 6 ? anti-parallel 
CC 6 7 ? anti-parallel 
CD 1 2 ? anti-parallel 
CE 1 2 ? anti-parallel 
CF 1 2 ? anti-parallel 
CF 2 3 ? anti-parallel 
CF 3 4 ? anti-parallel 
CF 4 5 ? parallel      
CG 1 2 ? anti-parallel 
CG 2 3 ? anti-parallel 
CH 1 2 ? anti-parallel 
CH 2 3 ? parallel      
CI 1 2 ? anti-parallel 
CI 2 3 ? anti-parallel 
CI 3 4 ? anti-parallel 
CI 4 5 ? anti-parallel 
CI 5 6 ? anti-parallel 
CI 6 7 ? anti-parallel 
CI 7 8 ? anti-parallel 
CJ 1 2 ? anti-parallel 
CK 1 2 ? anti-parallel 
CL 1 2 ? anti-parallel 
CL 2 3 ? anti-parallel 
CL 3 4 ? anti-parallel 
CL 4 5 ? parallel      
CM 1 2 ? anti-parallel 
CM 2 3 ? anti-parallel 
CN 1 2 ? anti-parallel 
CN 2 3 ? parallel      
CO 1 2 ? anti-parallel 
CO 2 3 ? anti-parallel 
CO 3 4 ? anti-parallel 
CO 4 5 ? anti-parallel 
CO 5 6 ? anti-parallel 
CO 6 7 ? anti-parallel 
CO 7 8 ? anti-parallel 
CP 1 2 ? anti-parallel 
CQ 1 2 ? anti-parallel 
CR 1 2 ? anti-parallel 
CR 2 3 ? anti-parallel 
CR 3 4 ? anti-parallel 
CR 4 5 ? parallel      
CS 1 2 ? anti-parallel 
CS 2 3 ? anti-parallel 
CT 1 2 ? anti-parallel 
CT 2 3 ? parallel      
CU 1 2 ? anti-parallel 
CU 2 3 ? anti-parallel 
CU 3 4 ? anti-parallel 
CU 4 5 ? anti-parallel 
CU 5 6 ? anti-parallel 
CU 6 7 ? anti-parallel 
CU 7 8 ? anti-parallel 
CV 1 2 ? anti-parallel 
CW 1 2 ? anti-parallel 
CW 2 3 ? anti-parallel 
CW 3 4 ? anti-parallel 
CW 4 5 ? parallel      
CX 1 2 ? anti-parallel 
CX 2 3 ? anti-parallel 
CY 1 2 ? anti-parallel 
CY 2 3 ? parallel      
CZ 1 2 ? anti-parallel 
CZ 2 3 ? anti-parallel 
CZ 3 4 ? anti-parallel 
CZ 4 5 ? anti-parallel 
CZ 5 6 ? anti-parallel 
CZ 6 7 ? anti-parallel 
CZ 7 8 ? anti-parallel 
DA 1 2 ? anti-parallel 
DB 1 2 ? anti-parallel 
DC 1 2 ? anti-parallel 
DC 2 3 ? anti-parallel 
DC 3 4 ? anti-parallel 
DC 4 5 ? parallel      
DD 1 2 ? anti-parallel 
DD 2 3 ? anti-parallel 
DE 1 2 ? anti-parallel 
DE 2 3 ? parallel      
DF 1 2 ? anti-parallel 
DF 2 3 ? anti-parallel 
DF 3 4 ? anti-parallel 
DF 4 5 ? anti-parallel 
DF 5 6 ? anti-parallel 
DF 6 7 ? anti-parallel 
DF 7 8 ? anti-parallel 
DG 1 2 ? anti-parallel 
DH 1 2 ? anti-parallel 
DH 2 3 ? anti-parallel 
DH 3 4 ? anti-parallel 
DH 4 5 ? parallel      
DI 1 2 ? anti-parallel 
DI 2 3 ? anti-parallel 
DJ 1 2 ? anti-parallel 
DJ 2 3 ? parallel      
DK 1 2 ? anti-parallel 
DK 2 3 ? anti-parallel 
DK 3 4 ? anti-parallel 
DK 4 5 ? anti-parallel 
DK 5 6 ? anti-parallel 
DK 6 7 ? anti-parallel 
DK 7 8 ? anti-parallel 
DL 1 2 ? anti-parallel 
DM 1 2 ? anti-parallel 
DN 1 2 ? anti-parallel 
DN 2 3 ? anti-parallel 
DN 3 4 ? anti-parallel 
DN 4 5 ? parallel      
DO 1 2 ? anti-parallel 
DO 2 3 ? anti-parallel 
DP 1 2 ? anti-parallel 
DP 2 3 ? parallel      
DQ 1 2 ? anti-parallel 
DQ 2 3 ? anti-parallel 
DQ 3 4 ? anti-parallel 
DQ 4 5 ? anti-parallel 
DQ 5 6 ? anti-parallel 
DQ 6 7 ? anti-parallel 
DQ 7 8 ? anti-parallel 
DR 1 2 ? anti-parallel 
DS 1 2 ? anti-parallel 
DT 1 2 ? anti-parallel 
DT 2 3 ? anti-parallel 
DT 3 4 ? anti-parallel 
DT 4 5 ? parallel      
DU 1 2 ? anti-parallel 
DU 2 3 ? anti-parallel 
DV 1 2 ? anti-parallel 
DV 2 3 ? parallel      
DW 1 2 ? anti-parallel 
DW 2 3 ? anti-parallel 
DW 3 4 ? anti-parallel 
DW 4 5 ? anti-parallel 
DW 5 6 ? anti-parallel 
DW 6 7 ? anti-parallel 
DX 1 2 ? anti-parallel 
DY 1 2 ? anti-parallel 
DZ 1 2 ? anti-parallel 
DZ 2 3 ? anti-parallel 
DZ 3 4 ? anti-parallel 
DZ 4 5 ? parallel      
EA 1 2 ? anti-parallel 
EA 2 3 ? anti-parallel 
EB 1 2 ? anti-parallel 
EB 2 3 ? parallel      
EC 1 2 ? anti-parallel 
EC 2 3 ? anti-parallel 
EC 3 4 ? anti-parallel 
EC 4 5 ? anti-parallel 
EC 5 6 ? anti-parallel 
EC 6 7 ? anti-parallel 
ED 1 2 ? anti-parallel 
EE 1 2 ? anti-parallel 
EF 1 2 ? anti-parallel 
EF 2 3 ? anti-parallel 
EF 3 4 ? anti-parallel 
EF 4 5 ? parallel      
EG 1 2 ? anti-parallel 
EG 2 3 ? anti-parallel 
EH 1 2 ? anti-parallel 
EH 2 3 ? parallel      
EI 1 2 ? anti-parallel 
EI 2 3 ? anti-parallel 
EI 3 4 ? anti-parallel 
EI 4 5 ? anti-parallel 
EI 5 6 ? anti-parallel 
EI 6 7 ? anti-parallel 
EI 7 8 ? anti-parallel 
EJ 1 2 ? anti-parallel 
EK 1 2 ? anti-parallel 
EL 1 2 ? anti-parallel 
EL 2 3 ? anti-parallel 
EL 3 4 ? anti-parallel 
EL 4 5 ? parallel      
EM 1 2 ? anti-parallel 
EM 2 3 ? anti-parallel 
EN 1 2 ? anti-parallel 
EN 2 3 ? parallel      
EO 1 2 ? anti-parallel 
EO 2 3 ? anti-parallel 
EO 3 4 ? parallel      
EP 1 2 ? anti-parallel 
EP 2 3 ? anti-parallel 
EP 3 4 ? anti-parallel 
EP 4 5 ? anti-parallel 
EP 5 6 ? anti-parallel 
EP 6 7 ? anti-parallel 
EP 7 8 ? anti-parallel 
EQ 1 2 ? anti-parallel 
ER 1 2 ? anti-parallel 
ES 1 2 ? anti-parallel 
ES 2 3 ? anti-parallel 
ES 3 4 ? anti-parallel 
ES 4 5 ? parallel      
ET 1 2 ? anti-parallel 
ET 2 3 ? anti-parallel 
EU 1 2 ? anti-parallel 
EU 2 3 ? anti-parallel 
EU 3 4 ? anti-parallel 
EU 4 5 ? anti-parallel 
EU 5 6 ? anti-parallel 
EU 6 7 ? anti-parallel 
EU 7 8 ? anti-parallel 
EV 1 2 ? anti-parallel 
EW 1 2 ? anti-parallel 
EX 1 2 ? anti-parallel 
EX 2 3 ? anti-parallel 
EX 3 4 ? anti-parallel 
EX 4 5 ? parallel      
EY 1 2 ? anti-parallel 
EY 2 3 ? anti-parallel 
EZ 1 2 ? anti-parallel 
EZ 2 3 ? parallel      
FA 1 2 ? anti-parallel 
FA 2 3 ? anti-parallel 
FA 3 4 ? anti-parallel 
FA 4 5 ? anti-parallel 
FA 5 6 ? anti-parallel 
FA 6 7 ? anti-parallel 
FA 7 8 ? anti-parallel 
FB 1 2 ? anti-parallel 
FC 1 2 ? anti-parallel 
FD 1 2 ? anti-parallel 
FD 2 3 ? anti-parallel 
FD 3 4 ? anti-parallel 
FD 4 5 ? parallel      
FE 1 2 ? anti-parallel 
FE 2 3 ? anti-parallel 
FF 1 2 ? anti-parallel 
FF 2 3 ? parallel      
FG 1 2 ? anti-parallel 
FG 2 3 ? anti-parallel 
FG 3 4 ? anti-parallel 
FG 4 5 ? anti-parallel 
FG 5 6 ? anti-parallel 
FG 6 7 ? anti-parallel 
FG 7 8 ? anti-parallel 
FH 1 2 ? anti-parallel 
FI 1 2 ? anti-parallel 
FI 2 3 ? anti-parallel 
FI 3 4 ? anti-parallel 
FI 4 5 ? parallel      
FJ 1 2 ? anti-parallel 
FJ 2 3 ? anti-parallel 
FK 1 2 ? anti-parallel 
FK 2 3 ? parallel      
FL 1 2 ? anti-parallel 
FL 2 3 ? anti-parallel 
FL 3 4 ? anti-parallel 
FL 4 5 ? anti-parallel 
FL 5 6 ? anti-parallel 
FL 6 7 ? anti-parallel 
FM 1 2 ? anti-parallel 
FN 1 2 ? anti-parallel 
FO 1 2 ? anti-parallel 
FO 2 3 ? anti-parallel 
FO 3 4 ? anti-parallel 
FO 4 5 ? parallel      
FP 1 2 ? anti-parallel 
FP 2 3 ? anti-parallel 
FQ 1 2 ? anti-parallel 
FQ 2 3 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 ILE A  51  ? THR A  52  ? ILE A 43  THR A 44  
A  2 GLY A  72  ? MET A  76  ? GLY A 64  MET A 68  
A  3 HIS A  119 ? HIS A  123 ? HIS A 111 HIS A 115 
A  4 ARG A  107 ? HIS A  114 ? ARG A 99  HIS A 106 
A  5 GLU A  95  ? VAL A  98  ? GLU A 87  VAL A 90  
A  6 LYS A  137 ? ALA A  142 ? LYS A 129 ALA A 134 
A  7 ILE A  19  ? ILE A  25  ? ILE A 11  ILE A 17  
A  8 GLY A  72  ? MET A  76  ? GLY A 64  MET A 68  
B  1 ALA A  28  ? LYS A  29  ? ALA A 20  LYS A 21  
B  2 LEU A  48  ? GLY A  49  ? LEU A 40  GLY A 41  
C  1 SER A  35  ? VAL A  36  ? SER A 27  VAL A 28  
C  2 VAL A  42  ? ARG A  43  ? VAL A 34  ARG A 35  
D  1 LYS A  156 ? VAL A  157 ? LYS A 148 VAL A 149 
D  2 GLY A  262 ? ASP A  270 ? GLY A 254 ASP A 262 
D  3 LYS A  238 ? VAL A  249 ? LYS A 230 VAL A 241 
D  4 ILE A  224 ? ASP A  231 ? ILE A 216 ASP A 223 
D  5 LYS A  184 ? ILE A  185 ? LYS A 176 ILE A 177 
E  1 LYS A  156 ? VAL A  157 ? LYS A 148 VAL A 149 
E  2 GLY A  262 ? ASP A  270 ? GLY A 254 ASP A 262 
E  3 TYR A  204 ? ASP A  205 ? TYR A 196 ASP A 197 
F  1 GLN A  171 ? LYS A  173 ? GLN A 163 LYS A 165 
F  2 LYS A  176 ? VAL A  181 ? LYS A 168 VAL A 173 
F  3 ILE A  274 ? GLU A  278 ? ILE A 266 GLU A 270 
G  1 ILE B  51  ? THR B  52  ? ILE B 43  THR B 44  
G  2 GLY B  72  ? MET B  76  ? GLY B 64  MET B 68  
G  3 HIS B  119 ? HIS B  123 ? HIS B 111 HIS B 115 
G  4 ARG B  107 ? HIS B  114 ? ARG B 99  HIS B 106 
G  5 GLU B  95  ? VAL B  98  ? GLU B 87  VAL B 90  
G  6 LYS B  137 ? ALA B  142 ? LYS B 129 ALA B 134 
G  7 ILE B  19  ? ILE B  25  ? ILE B 11  ILE B 17  
G  8 GLY B  72  ? MET B  76  ? GLY B 64  MET B 68  
H  1 ALA B  28  ? LYS B  29  ? ALA B 20  LYS B 21  
H  2 LEU B  48  ? GLY B  49  ? LEU B 40  GLY B 41  
I  1 SER B  35  ? VAL B  36  ? SER B 27  VAL B 28  
I  2 VAL B  42  ? ARG B  43  ? VAL B 34  ARG B 35  
J  1 LYS B  156 ? VAL B  157 ? LYS B 148 VAL B 149 
J  2 GLY B  262 ? ASP B  270 ? GLY B 254 ASP B 262 
J  3 LYS B  238 ? VAL B  249 ? LYS B 230 VAL B 241 
J  4 ILE B  224 ? ASP B  231 ? ILE B 216 ASP B 223 
J  5 LYS B  184 ? ILE B  185 ? LYS B 176 ILE B 177 
K  1 LYS B  156 ? VAL B  157 ? LYS B 148 VAL B 149 
K  2 GLY B  262 ? ASP B  270 ? GLY B 254 ASP B 262 
K  3 TYR B  204 ? ASP B  205 ? TYR B 196 ASP B 197 
L  1 GLN B  171 ? LYS B  173 ? GLN B 163 LYS B 165 
L  2 LYS B  176 ? VAL B  181 ? LYS B 168 VAL B 173 
L  3 ILE B  274 ? GLU B  278 ? ILE B 266 GLU B 270 
M  1 ILE C  51  ? THR C  52  ? ILE C 43  THR C 44  
M  2 GLY C  72  ? MET C  76  ? GLY C 64  MET C 68  
M  3 HIS C  119 ? HIS C  123 ? HIS C 111 HIS C 115 
M  4 ARG C  107 ? HIS C  114 ? ARG C 99  HIS C 106 
M  5 GLU C  95  ? VAL C  98  ? GLU C 87  VAL C 90  
M  6 LYS C  137 ? ALA C  142 ? LYS C 129 ALA C 134 
M  7 ILE C  19  ? ILE C  25  ? ILE C 11  ILE C 17  
M  8 GLY C  72  ? MET C  76  ? GLY C 64  MET C 68  
N  1 ALA C  28  ? LYS C  29  ? ALA C 20  LYS C 21  
N  2 LEU C  48  ? GLY C  49  ? LEU C 40  GLY C 41  
O  1 SER C  35  ? VAL C  36  ? SER C 27  VAL C 28  
O  2 VAL C  42  ? ARG C  43  ? VAL C 34  ARG C 35  
P  1 LYS C  156 ? VAL C  157 ? LYS C 148 VAL C 149 
P  2 GLY C  262 ? ASP C  270 ? GLY C 254 ASP C 262 
P  3 LYS C  238 ? VAL C  249 ? LYS C 230 VAL C 241 
P  4 ILE C  224 ? ASP C  231 ? ILE C 216 ASP C 223 
P  5 LYS C  184 ? ILE C  185 ? LYS C 176 ILE C 177 
Q  1 LYS C  156 ? VAL C  157 ? LYS C 148 VAL C 149 
Q  2 GLY C  262 ? ASP C  270 ? GLY C 254 ASP C 262 
Q  3 TYR C  204 ? ASP C  205 ? TYR C 196 ASP C 197 
R  1 GLN C  171 ? LYS C  173 ? GLN C 163 LYS C 165 
R  2 LYS C  176 ? VAL C  181 ? LYS C 168 VAL C 173 
R  3 ILE C  274 ? GLU C  278 ? ILE C 266 GLU C 270 
S  1 ILE D  19  ? ILE D  25  ? ILE D 11  ILE D 17  
S  2 VAL D  73  ? MET D  76  ? VAL D 65  MET D 68  
S  3 HIS D  119 ? HIS D  123 ? HIS D 111 HIS D 115 
S  4 ARG D  107 ? HIS D  114 ? ARG D 99  HIS D 106 
S  5 GLU D  95  ? VAL D  98  ? GLU D 87  VAL D 90  
S  6 LYS D  137 ? ALA D  142 ? LYS D 129 ALA D 134 
S  7 ILE D  19  ? ILE D  25  ? ILE D 11  ILE D 17  
T  1 ALA D  28  ? LYS D  29  ? ALA D 20  LYS D 21  
T  2 LEU D  48  ? GLY D  49  ? LEU D 40  GLY D 41  
U  1 SER D  35  ? VAL D  36  ? SER D 27  VAL D 28  
U  2 VAL D  42  ? ARG D  43  ? VAL D 34  ARG D 35  
V  1 LYS D  156 ? VAL D  157 ? LYS D 148 VAL D 149 
V  2 GLY D  262 ? ASP D  270 ? GLY D 254 ASP D 262 
V  3 LYS D  238 ? VAL D  249 ? LYS D 230 VAL D 241 
V  4 ILE D  224 ? ASP D  231 ? ILE D 216 ASP D 223 
V  5 LYS D  184 ? ILE D  185 ? LYS D 176 ILE D 177 
W  1 LYS D  156 ? VAL D  157 ? LYS D 148 VAL D 149 
W  2 GLY D  262 ? ASP D  270 ? GLY D 254 ASP D 262 
W  3 TYR D  204 ? ASP D  205 ? TYR D 196 ASP D 197 
X  1 GLN D  171 ? LYS D  173 ? GLN D 163 LYS D 165 
X  2 LYS D  176 ? VAL D  181 ? LYS D 168 VAL D 173 
X  3 ILE D  274 ? GLU D  278 ? ILE D 266 GLU D 270 
Y  1 ILE E  51  ? THR E  52  ? ILE E 43  THR E 44  
Y  2 GLY E  72  ? MET E  76  ? GLY E 64  MET E 68  
Y  3 HIS E  119 ? HIS E  123 ? HIS E 111 HIS E 115 
Y  4 ARG E  107 ? HIS E  114 ? ARG E 99  HIS E 106 
Y  5 GLU E  95  ? VAL E  98  ? GLU E 87  VAL E 90  
Y  6 LYS E  137 ? ALA E  142 ? LYS E 129 ALA E 134 
Y  7 ILE E  19  ? ILE E  25  ? ILE E 11  ILE E 17  
Y  8 GLY E  72  ? MET E  76  ? GLY E 64  MET E 68  
Z  1 ALA E  28  ? LYS E  29  ? ALA E 20  LYS E 21  
Z  2 LEU E  48  ? GLY E  49  ? LEU E 40  GLY E 41  
AA 1 SER E  35  ? VAL E  36  ? SER E 27  VAL E 28  
AA 2 VAL E  42  ? ARG E  43  ? VAL E 34  ARG E 35  
AB 1 LYS E  156 ? VAL E  157 ? LYS E 148 VAL E 149 
AB 2 GLY E  262 ? ASP E  270 ? GLY E 254 ASP E 262 
AB 3 LYS E  238 ? VAL E  249 ? LYS E 230 VAL E 241 
AB 4 ILE E  224 ? ASP E  231 ? ILE E 216 ASP E 223 
AB 5 LYS E  184 ? ILE E  185 ? LYS E 176 ILE E 177 
AC 1 LYS E  156 ? VAL E  157 ? LYS E 148 VAL E 149 
AC 2 GLY E  262 ? ASP E  270 ? GLY E 254 ASP E 262 
AC 3 TYR E  204 ? ASP E  205 ? TYR E 196 ASP E 197 
AD 1 GLN E  171 ? LYS E  173 ? GLN E 163 LYS E 165 
AD 2 LYS E  176 ? VAL E  181 ? LYS E 168 VAL E 173 
AD 3 ILE E  274 ? GLU E  278 ? ILE E 266 GLU E 270 
AE 1 HIS F  5   ? HIS F  6   ? HIS G -3  HIS G -2  
AE 2 GLN F  171 ? LYS F  173 ? GLN G 163 LYS G 165 
AE 3 LYS F  176 ? VAL F  181 ? LYS G 168 VAL G 173 
AE 4 ILE F  274 ? GLU F  278 ? ILE G 266 GLU G 270 
AF 1 ILE F  51  ? THR F  52  ? ILE G 43  THR G 44  
AF 2 GLY F  72  ? MET F  76  ? GLY G 64  MET G 68  
AF 3 HIS F  119 ? HIS F  123 ? HIS G 111 HIS G 115 
AF 4 ARG F  107 ? HIS F  114 ? ARG G 99  HIS G 106 
AF 5 GLU F  95  ? VAL F  98  ? GLU G 87  VAL G 90  
AF 6 LYS F  137 ? ALA F  142 ? LYS G 129 ALA G 134 
AF 7 ILE F  19  ? ILE F  25  ? ILE G 11  ILE G 17  
AF 8 GLY F  72  ? MET F  76  ? GLY G 64  MET G 68  
AG 1 SER F  35  ? VAL F  36  ? SER G 27  VAL G 28  
AG 2 VAL F  42  ? ARG F  43  ? VAL G 34  ARG G 35  
AH 1 LYS F  156 ? VAL F  157 ? LYS G 148 VAL G 149 
AH 2 GLY F  262 ? ASP F  270 ? GLY G 254 ASP G 262 
AH 3 LYS F  238 ? VAL F  249 ? LYS G 230 VAL G 241 
AH 4 ILE F  224 ? ASP F  231 ? ILE G 216 ASP G 223 
AH 5 ALA F  183 ? ILE F  185 ? ALA G 175 ILE G 177 
AI 1 LYS F  156 ? VAL F  157 ? LYS G 148 VAL G 149 
AI 2 GLY F  262 ? ASP F  270 ? GLY G 254 ASP G 262 
AI 3 TYR F  204 ? ASP F  205 ? TYR G 196 ASP G 197 
AJ 1 ILE G  51  ? THR G  52  ? ILE H 43  THR H 44  
AJ 2 GLY G  72  ? MET G  76  ? GLY H 64  MET H 68  
AJ 3 HIS G  119 ? HIS G  123 ? HIS H 111 HIS H 115 
AJ 4 ARG G  107 ? HIS G  114 ? ARG H 99  HIS H 106 
AJ 5 GLU G  95  ? VAL G  98  ? GLU H 87  VAL H 90  
AJ 6 LYS G  137 ? ALA G  142 ? LYS H 129 ALA H 134 
AJ 7 ILE G  19  ? ILE G  25  ? ILE H 11  ILE H 17  
AJ 8 GLY G  72  ? MET G  76  ? GLY H 64  MET H 68  
AK 1 ALA G  28  ? LYS G  29  ? ALA H 20  LYS H 21  
AK 2 LEU G  48  ? GLY G  49  ? LEU H 40  GLY H 41  
AL 1 SER G  35  ? VAL G  36  ? SER H 27  VAL H 28  
AL 2 VAL G  42  ? ARG G  43  ? VAL H 34  ARG H 35  
AM 1 LYS G  156 ? VAL G  157 ? LYS H 148 VAL H 149 
AM 2 GLY G  262 ? ASP G  270 ? GLY H 254 ASP H 262 
AM 3 LYS G  238 ? VAL G  249 ? LYS H 230 VAL H 241 
AM 4 ILE G  224 ? ASP G  231 ? ILE H 216 ASP H 223 
AM 5 ALA G  183 ? ILE G  185 ? ALA H 175 ILE H 177 
AN 1 LYS G  156 ? VAL G  157 ? LYS H 148 VAL H 149 
AN 2 GLY G  262 ? ASP G  270 ? GLY H 254 ASP H 262 
AN 3 TYR G  204 ? ASP G  205 ? TYR H 196 ASP H 197 
AO 1 GLN G  171 ? GLU G  172 ? GLN H 163 GLU H 164 
AO 2 ILE G  177 ? VAL G  181 ? ILE H 169 VAL H 173 
AO 3 ILE G  274 ? GLU G  278 ? ILE H 266 GLU H 270 
AP 1 ILE H  51  ? THR H  52  ? ILE I 43  THR I 44  
AP 2 GLY H  72  ? MET H  76  ? GLY I 64  MET I 68  
AP 3 HIS H  119 ? HIS H  123 ? HIS I 111 HIS I 115 
AP 4 ARG H  107 ? HIS H  114 ? ARG I 99  HIS I 106 
AP 5 GLU H  95  ? VAL H  98  ? GLU I 87  VAL I 90  
AP 6 LYS H  137 ? ALA H  142 ? LYS I 129 ALA I 134 
AP 7 ILE H  19  ? ILE H  25  ? ILE I 11  ILE I 17  
AP 8 GLY H  72  ? MET H  76  ? GLY I 64  MET I 68  
AQ 1 ALA H  28  ? LYS H  29  ? ALA I 20  LYS I 21  
AQ 2 LEU H  48  ? GLY H  49  ? LEU I 40  GLY I 41  
AR 1 SER H  35  ? VAL H  36  ? SER I 27  VAL I 28  
AR 2 VAL H  42  ? ARG H  43  ? VAL I 34  ARG I 35  
AS 1 LYS H  156 ? VAL H  157 ? LYS I 148 VAL I 149 
AS 2 GLY H  262 ? ASP H  270 ? GLY I 254 ASP I 262 
AS 3 LYS H  238 ? VAL H  249 ? LYS I 230 VAL I 241 
AS 4 ILE H  224 ? ASP H  231 ? ILE I 216 ASP I 223 
AS 5 LYS H  184 ? ILE H  185 ? LYS I 176 ILE I 177 
AT 1 LYS H  156 ? VAL H  157 ? LYS I 148 VAL I 149 
AT 2 GLY H  262 ? ASP H  270 ? GLY I 254 ASP I 262 
AT 3 TYR H  204 ? ASP H  205 ? TYR I 196 ASP I 197 
AU 1 GLN H  171 ? LYS H  173 ? GLN I 163 LYS I 165 
AU 2 LYS H  176 ? VAL H  181 ? LYS I 168 VAL I 173 
AU 3 ILE H  274 ? GLU H  278 ? ILE I 266 GLU I 270 
AV 1 ILE I  19  ? ILE I  25  ? ILE J 11  ILE J 17  
AV 2 VAL I  73  ? MET I  76  ? VAL J 65  MET J 68  
AV 3 HIS I  119 ? HIS I  123 ? HIS J 111 HIS J 115 
AV 4 ARG I  107 ? HIS I  114 ? ARG J 99  HIS J 106 
AV 5 GLU I  95  ? VAL I  98  ? GLU J 87  VAL J 90  
AV 6 LYS I  137 ? ALA I  142 ? LYS J 129 ALA J 134 
AV 7 ILE I  19  ? ILE I  25  ? ILE J 11  ILE J 17  
AW 1 SER I  35  ? VAL I  36  ? SER J 27  VAL J 28  
AW 2 VAL I  42  ? ARG I  43  ? VAL J 34  ARG J 35  
AX 1 LYS I  156 ? VAL I  157 ? LYS J 148 VAL J 149 
AX 2 GLY I  262 ? ASP I  270 ? GLY J 254 ASP J 262 
AX 3 LYS I  238 ? VAL I  249 ? LYS J 230 VAL J 241 
AX 4 ILE I  224 ? ASP I  231 ? ILE J 216 ASP J 223 
AX 5 LYS I  184 ? ILE I  185 ? LYS J 176 ILE J 177 
AY 1 LYS I  156 ? VAL I  157 ? LYS J 148 VAL J 149 
AY 2 GLY I  262 ? ASP I  270 ? GLY J 254 ASP J 262 
AY 3 TYR I  204 ? ASP I  205 ? TYR J 196 ASP J 197 
AZ 1 GLN I  171 ? GLU I  172 ? GLN J 163 GLU J 164 
AZ 2 ILE I  177 ? VAL I  181 ? ILE J 169 VAL J 173 
AZ 3 ILE I  274 ? GLU I  278 ? ILE J 266 GLU J 270 
BA 1 ILE J  51  ? THR J  52  ? ILE K 43  THR K 44  
BA 2 GLY J  72  ? MET J  76  ? GLY K 64  MET K 68  
BA 3 HIS J  119 ? HIS J  123 ? HIS K 111 HIS K 115 
BA 4 ARG J  107 ? HIS J  114 ? ARG K 99  HIS K 106 
BA 5 GLU J  95  ? VAL J  98  ? GLU K 87  VAL K 90  
BA 6 LYS J  137 ? ALA J  142 ? LYS K 129 ALA K 134 
BA 7 ILE J  19  ? ILE J  25  ? ILE K 11  ILE K 17  
BA 8 GLY J  72  ? MET J  76  ? GLY K 64  MET K 68  
BB 1 ALA J  28  ? LYS J  29  ? ALA K 20  LYS K 21  
BB 2 LEU J  48  ? GLY J  49  ? LEU K 40  GLY K 41  
BC 1 SER J  35  ? VAL J  36  ? SER K 27  VAL K 28  
BC 2 VAL J  42  ? ARG J  43  ? VAL K 34  ARG K 35  
BD 1 LYS J  156 ? VAL J  157 ? LYS K 148 VAL K 149 
BD 2 GLY J  262 ? ASP J  270 ? GLY K 254 ASP K 262 
BD 3 LYS J  238 ? VAL J  249 ? LYS K 230 VAL K 241 
BD 4 ILE J  224 ? ASP J  231 ? ILE K 216 ASP K 223 
BD 5 LYS J  184 ? ILE J  185 ? LYS K 176 ILE K 177 
BE 1 LYS J  156 ? VAL J  157 ? LYS K 148 VAL K 149 
BE 2 GLY J  262 ? ASP J  270 ? GLY K 254 ASP K 262 
BE 3 TYR J  204 ? ASP J  205 ? TYR K 196 ASP K 197 
BF 1 GLN J  171 ? GLU J  172 ? GLN K 163 GLU K 164 
BF 2 ILE J  177 ? VAL J  181 ? ILE K 169 VAL K 173 
BF 3 ILE J  274 ? GLU J  278 ? ILE K 266 GLU K 270 
BG 1 ILE K  51  ? THR K  52  ? ILE L 43  THR L 44  
BG 2 GLY K  72  ? MET K  76  ? GLY L 64  MET L 68  
BG 3 HIS K  119 ? HIS K  123 ? HIS L 111 HIS L 115 
BG 4 ARG K  107 ? HIS K  114 ? ARG L 99  HIS L 106 
BG 5 GLU K  95  ? VAL K  98  ? GLU L 87  VAL L 90  
BG 6 LYS K  137 ? ALA K  142 ? LYS L 129 ALA L 134 
BG 7 ILE K  19  ? ILE K  25  ? ILE L 11  ILE L 17  
BG 8 GLY K  72  ? MET K  76  ? GLY L 64  MET L 68  
BH 1 SER K  35  ? VAL K  36  ? SER L 27  VAL L 28  
BH 2 VAL K  42  ? ARG K  43  ? VAL L 34  ARG L 35  
BI 1 LYS K  156 ? VAL K  157 ? LYS L 148 VAL L 149 
BI 2 GLY K  262 ? ASP K  270 ? GLY L 254 ASP L 262 
BI 3 LYS K  238 ? VAL K  249 ? LYS L 230 VAL L 241 
BI 4 ILE K  224 ? ASP K  231 ? ILE L 216 ASP L 223 
BI 5 LYS K  184 ? ILE K  185 ? LYS L 176 ILE L 177 
BJ 1 LYS K  156 ? VAL K  157 ? LYS L 148 VAL L 149 
BJ 2 GLY K  262 ? ASP K  270 ? GLY L 254 ASP L 262 
BJ 3 TYR K  204 ? ASP K  205 ? TYR L 196 ASP L 197 
BK 1 GLN K  171 ? LYS K  173 ? GLN L 163 LYS L 165 
BK 2 LYS K  176 ? VAL K  181 ? LYS L 168 VAL L 173 
BK 3 ILE K  274 ? GLU K  278 ? ILE L 266 GLU L 270 
BL 1 ILE L  51  ? THR L  52  ? ILE M 43  THR M 44  
BL 2 GLY L  72  ? MET L  76  ? GLY M 64  MET M 68  
BL 3 HIS L  119 ? HIS L  123 ? HIS M 111 HIS M 115 
BL 4 ARG L  107 ? HIS L  114 ? ARG M 99  HIS M 106 
BL 5 GLU L  95  ? VAL L  98  ? GLU M 87  VAL M 90  
BL 6 LYS L  137 ? ALA L  142 ? LYS M 129 ALA M 134 
BL 7 ILE L  19  ? ILE L  25  ? ILE M 11  ILE M 17  
BL 8 GLY L  72  ? MET L  76  ? GLY M 64  MET M 68  
BM 1 TYR L  34  ? VAL L  36  ? TYR M 26  VAL M 28  
BM 2 VAL L  42  ? VAL L  44  ? VAL M 34  VAL M 36  
BN 1 LYS L  156 ? VAL L  157 ? LYS M 148 VAL M 149 
BN 2 GLY L  262 ? ASP L  270 ? GLY M 254 ASP M 262 
BN 3 LYS L  238 ? VAL L  249 ? LYS M 230 VAL M 241 
BN 4 ILE L  224 ? ASP L  231 ? ILE M 216 ASP M 223 
BN 5 LYS L  184 ? ILE L  185 ? LYS M 176 ILE M 177 
BO 1 LYS L  156 ? VAL L  157 ? LYS M 148 VAL M 149 
BO 2 GLY L  262 ? ASP L  270 ? GLY M 254 ASP M 262 
BO 3 TYR L  204 ? ASP L  205 ? TYR M 196 ASP M 197 
BP 1 GLN L  171 ? LYS L  173 ? GLN M 163 LYS M 165 
BP 2 LYS L  176 ? VAL L  181 ? LYS M 168 VAL M 173 
BP 3 ILE L  274 ? GLU L  278 ? ILE M 266 GLU M 270 
BQ 1 ILE M  51  ? THR M  52  ? ILE N 43  THR N 44  
BQ 2 GLY M  72  ? MET M  76  ? GLY N 64  MET N 68  
BQ 3 HIS M  119 ? HIS M  123 ? HIS N 111 HIS N 115 
BQ 4 ARG M  107 ? HIS M  114 ? ARG N 99  HIS N 106 
BQ 5 GLU M  95  ? VAL M  98  ? GLU N 87  VAL N 90  
BQ 6 LYS M  137 ? ALA M  142 ? LYS N 129 ALA N 134 
BQ 7 ILE M  19  ? ILE M  25  ? ILE N 11  ILE N 17  
BQ 8 GLY M  72  ? MET M  76  ? GLY N 64  MET N 68  
BR 1 ALA M  28  ? LYS M  29  ? ALA N 20  LYS N 21  
BR 2 LEU M  48  ? GLY M  49  ? LEU N 40  GLY N 41  
BS 1 SER M  35  ? VAL M  36  ? SER N 27  VAL N 28  
BS 2 VAL M  42  ? ARG M  43  ? VAL N 34  ARG N 35  
BT 1 LYS M  156 ? VAL M  157 ? LYS N 148 VAL N 149 
BT 2 GLY M  262 ? ASP M  270 ? GLY N 254 ASP N 262 
BT 3 LYS M  238 ? VAL M  249 ? LYS N 230 VAL N 241 
BT 4 ILE M  224 ? ASP M  231 ? ILE N 216 ASP N 223 
BT 5 LYS M  184 ? ILE M  185 ? LYS N 176 ILE N 177 
BU 1 LYS M  156 ? VAL M  157 ? LYS N 148 VAL N 149 
BU 2 GLY M  262 ? ASP M  270 ? GLY N 254 ASP N 262 
BU 3 TYR M  204 ? ASP M  205 ? TYR N 196 ASP N 197 
BV 1 GLN M  171 ? LYS M  173 ? GLN N 163 LYS N 165 
BV 2 LYS M  176 ? VAL M  181 ? LYS N 168 VAL N 173 
BV 3 ILE M  274 ? GLU M  278 ? ILE N 266 GLU N 270 
BW 1 ILE N  19  ? ILE N  25  ? ILE O 11  ILE O 17  
BW 2 VAL N  73  ? MET N  76  ? VAL O 65  MET O 68  
BW 3 HIS N  119 ? HIS N  123 ? HIS O 111 HIS O 115 
BW 4 ARG N  107 ? HIS N  114 ? ARG O 99  HIS O 106 
BW 5 GLU N  95  ? VAL N  98  ? GLU O 87  VAL O 90  
BW 6 LYS N  137 ? ALA N  142 ? LYS O 129 ALA O 134 
BW 7 ILE N  19  ? ILE N  25  ? ILE O 11  ILE O 17  
BX 1 ALA N  28  ? LYS N  29  ? ALA O 20  LYS O 21  
BX 2 LEU N  48  ? GLY N  49  ? LEU O 40  GLY O 41  
BY 1 SER N  35  ? VAL N  36  ? SER O 27  VAL O 28  
BY 2 VAL N  42  ? ARG N  43  ? VAL O 34  ARG O 35  
BZ 1 LYS N  156 ? VAL N  157 ? LYS O 148 VAL O 149 
BZ 2 GLY N  262 ? ASP N  270 ? GLY O 254 ASP O 262 
BZ 3 LYS N  238 ? VAL N  249 ? LYS O 230 VAL O 241 
BZ 4 ILE N  224 ? ASP N  231 ? ILE O 216 ASP O 223 
BZ 5 LYS N  184 ? ILE N  185 ? LYS O 176 ILE O 177 
CA 1 LYS N  156 ? VAL N  157 ? LYS O 148 VAL O 149 
CA 2 GLY N  262 ? ASP N  270 ? GLY O 254 ASP O 262 
CA 3 TYR N  204 ? ASP N  205 ? TYR O 196 ASP O 197 
CB 1 GLN N  171 ? LYS N  173 ? GLN O 163 LYS O 165 
CB 2 LYS N  176 ? VAL N  181 ? LYS O 168 VAL O 173 
CB 3 ILE N  274 ? GLU N  278 ? ILE O 266 GLU O 270 
CC 1 ILE O  19  ? ILE O  25  ? ILE P 11  ILE P 17  
CC 2 VAL O  73  ? MET O  76  ? VAL P 65  MET P 68  
CC 3 HIS O  119 ? HIS O  123 ? HIS P 111 HIS P 115 
CC 4 ARG O  107 ? HIS O  114 ? ARG P 99  HIS P 106 
CC 5 GLU O  95  ? VAL O  98  ? GLU P 87  VAL P 90  
CC 6 LYS O  137 ? ALA O  142 ? LYS P 129 ALA P 134 
CC 7 ILE O  19  ? ILE O  25  ? ILE P 11  ILE P 17  
CD 1 ALA O  28  ? LYS O  29  ? ALA P 20  LYS P 21  
CD 2 LEU O  48  ? GLY O  49  ? LEU P 40  GLY P 41  
CE 1 SER O  35  ? VAL O  36  ? SER P 27  VAL P 28  
CE 2 VAL O  42  ? ARG O  43  ? VAL P 34  ARG P 35  
CF 1 LYS O  156 ? VAL O  157 ? LYS P 148 VAL P 149 
CF 2 GLY O  262 ? ASP O  270 ? GLY P 254 ASP P 262 
CF 3 LYS O  238 ? VAL O  249 ? LYS P 230 VAL P 241 
CF 4 ILE O  224 ? ASP O  231 ? ILE P 216 ASP P 223 
CF 5 LYS O  184 ? ILE O  185 ? LYS P 176 ILE P 177 
CG 1 LYS O  156 ? VAL O  157 ? LYS P 148 VAL P 149 
CG 2 GLY O  262 ? ASP O  270 ? GLY P 254 ASP P 262 
CG 3 TYR O  204 ? ASP O  205 ? TYR P 196 ASP P 197 
CH 1 GLN O  171 ? LYS O  173 ? GLN P 163 LYS P 165 
CH 2 LYS O  176 ? VAL O  181 ? LYS P 168 VAL P 173 
CH 3 ILE O  274 ? GLU O  278 ? ILE P 266 GLU P 270 
CI 1 ILE P  51  ? THR P  52  ? ILE S 43  THR S 44  
CI 2 GLY P  72  ? MET P  76  ? GLY S 64  MET S 68  
CI 3 HIS P  119 ? HIS P  123 ? HIS S 111 HIS S 115 
CI 4 ARG P  107 ? HIS P  114 ? ARG S 99  HIS S 106 
CI 5 GLU P  95  ? VAL P  98  ? GLU S 87  VAL S 90  
CI 6 LYS P  137 ? ALA P  142 ? LYS S 129 ALA S 134 
CI 7 ILE P  19  ? ILE P  25  ? ILE S 11  ILE S 17  
CI 8 GLY P  72  ? MET P  76  ? GLY S 64  MET S 68  
CJ 1 ALA P  28  ? LYS P  29  ? ALA S 20  LYS S 21  
CJ 2 LEU P  48  ? GLY P  49  ? LEU S 40  GLY S 41  
CK 1 SER P  35  ? VAL P  36  ? SER S 27  VAL S 28  
CK 2 VAL P  42  ? ARG P  43  ? VAL S 34  ARG S 35  
CL 1 LYS P  156 ? VAL P  157 ? LYS S 148 VAL S 149 
CL 2 GLY P  262 ? ASP P  270 ? GLY S 254 ASP S 262 
CL 3 LYS P  238 ? VAL P  249 ? LYS S 230 VAL S 241 
CL 4 ILE P  224 ? ASP P  231 ? ILE S 216 ASP S 223 
CL 5 ALA P  183 ? ILE P  185 ? ALA S 175 ILE S 177 
CM 1 LYS P  156 ? VAL P  157 ? LYS S 148 VAL S 149 
CM 2 GLY P  262 ? ASP P  270 ? GLY S 254 ASP S 262 
CM 3 TYR P  204 ? ASP P  205 ? TYR S 196 ASP S 197 
CN 1 GLN P  171 ? GLU P  172 ? GLN S 163 GLU S 164 
CN 2 ILE P  177 ? VAL P  181 ? ILE S 169 VAL S 173 
CN 3 ILE P  274 ? GLU P  278 ? ILE S 266 GLU S 270 
CO 1 ILE Q  51  ? THR Q  52  ? ILE T 43  THR T 44  
CO 2 GLY Q  72  ? MET Q  76  ? GLY T 64  MET T 68  
CO 3 HIS Q  119 ? HIS Q  123 ? HIS T 111 HIS T 115 
CO 4 ARG Q  107 ? HIS Q  114 ? ARG T 99  HIS T 106 
CO 5 GLU Q  95  ? VAL Q  98  ? GLU T 87  VAL T 90  
CO 6 LYS Q  137 ? ALA Q  142 ? LYS T 129 ALA T 134 
CO 7 ILE Q  19  ? ILE Q  25  ? ILE T 11  ILE T 17  
CO 8 GLY Q  72  ? MET Q  76  ? GLY T 64  MET T 68  
CP 1 ALA Q  28  ? LYS Q  29  ? ALA T 20  LYS T 21  
CP 2 LEU Q  48  ? GLY Q  49  ? LEU T 40  GLY T 41  
CQ 1 SER Q  35  ? VAL Q  36  ? SER T 27  VAL T 28  
CQ 2 VAL Q  42  ? ARG Q  43  ? VAL T 34  ARG T 35  
CR 1 LYS Q  156 ? VAL Q  157 ? LYS T 148 VAL T 149 
CR 2 GLY Q  262 ? ASP Q  270 ? GLY T 254 ASP T 262 
CR 3 LYS Q  238 ? VAL Q  249 ? LYS T 230 VAL T 241 
CR 4 ILE Q  224 ? ASP Q  231 ? ILE T 216 ASP T 223 
CR 5 LYS Q  184 ? ILE Q  185 ? LYS T 176 ILE T 177 
CS 1 LYS Q  156 ? VAL Q  157 ? LYS T 148 VAL T 149 
CS 2 GLY Q  262 ? ASP Q  270 ? GLY T 254 ASP T 262 
CS 3 TYR Q  204 ? ASP Q  205 ? TYR T 196 ASP T 197 
CT 1 GLN Q  171 ? LYS Q  173 ? GLN T 163 LYS T 165 
CT 2 LYS Q  176 ? VAL Q  181 ? LYS T 168 VAL T 173 
CT 3 ILE Q  274 ? GLU Q  278 ? ILE T 266 GLU T 270 
CU 1 ILE R  51  ? THR R  52  ? ILE U 43  THR U 44  
CU 2 GLY R  72  ? MET R  76  ? GLY U 64  MET U 68  
CU 3 HIS R  119 ? HIS R  123 ? HIS U 111 HIS U 115 
CU 4 ARG R  107 ? HIS R  114 ? ARG U 99  HIS U 106 
CU 5 GLU R  95  ? VAL R  98  ? GLU U 87  VAL U 90  
CU 6 LYS R  137 ? ALA R  142 ? LYS U 129 ALA U 134 
CU 7 ILE R  19  ? ILE R  25  ? ILE U 11  ILE U 17  
CU 8 GLY R  72  ? MET R  76  ? GLY U 64  MET U 68  
CV 1 SER R  35  ? VAL R  36  ? SER U 27  VAL U 28  
CV 2 VAL R  42  ? ARG R  43  ? VAL U 34  ARG U 35  
CW 1 LYS R  156 ? VAL R  157 ? LYS U 148 VAL U 149 
CW 2 GLY R  262 ? ASP R  270 ? GLY U 254 ASP U 262 
CW 3 LYS R  238 ? VAL R  249 ? LYS U 230 VAL U 241 
CW 4 ILE R  224 ? ASP R  231 ? ILE U 216 ASP U 223 
CW 5 ALA R  183 ? ILE R  185 ? ALA U 175 ILE U 177 
CX 1 LYS R  156 ? VAL R  157 ? LYS U 148 VAL U 149 
CX 2 GLY R  262 ? ASP R  270 ? GLY U 254 ASP U 262 
CX 3 TYR R  204 ? ASP R  205 ? TYR U 196 ASP U 197 
CY 1 GLN R  171 ? GLU R  172 ? GLN U 163 GLU U 164 
CY 2 ILE R  177 ? VAL R  181 ? ILE U 169 VAL U 173 
CY 3 ILE R  274 ? GLU R  278 ? ILE U 266 GLU U 270 
CZ 1 ILE S  51  ? THR S  52  ? ILE V 43  THR V 44  
CZ 2 GLY S  72  ? MET S  76  ? GLY V 64  MET V 68  
CZ 3 HIS S  119 ? HIS S  123 ? HIS V 111 HIS V 115 
CZ 4 ARG S  107 ? HIS S  114 ? ARG V 99  HIS V 106 
CZ 5 GLU S  95  ? VAL S  98  ? GLU V 87  VAL V 90  
CZ 6 LYS S  137 ? ALA S  142 ? LYS V 129 ALA V 134 
CZ 7 ILE S  19  ? ILE S  25  ? ILE V 11  ILE V 17  
CZ 8 GLY S  72  ? MET S  76  ? GLY V 64  MET V 68  
DA 1 ALA S  28  ? LYS S  29  ? ALA V 20  LYS V 21  
DA 2 LEU S  48  ? GLY S  49  ? LEU V 40  GLY V 41  
DB 1 SER S  35  ? VAL S  36  ? SER V 27  VAL V 28  
DB 2 VAL S  42  ? ARG S  43  ? VAL V 34  ARG V 35  
DC 1 LYS S  156 ? VAL S  157 ? LYS V 148 VAL V 149 
DC 2 GLY S  262 ? ASP S  270 ? GLY V 254 ASP V 262 
DC 3 LYS S  238 ? VAL S  249 ? LYS V 230 VAL V 241 
DC 4 ILE S  224 ? ASP S  231 ? ILE V 216 ASP V 223 
DC 5 LYS S  184 ? ILE S  185 ? LYS V 176 ILE V 177 
DD 1 LYS S  156 ? VAL S  157 ? LYS V 148 VAL V 149 
DD 2 GLY S  262 ? ASP S  270 ? GLY V 254 ASP V 262 
DD 3 TYR S  204 ? ASP S  205 ? TYR V 196 ASP V 197 
DE 1 GLN S  171 ? LYS S  173 ? GLN V 163 LYS V 165 
DE 2 LYS S  176 ? VAL S  181 ? LYS V 168 VAL V 173 
DE 3 ILE S  274 ? GLU S  278 ? ILE V 266 GLU V 270 
DF 1 ILE T  51  ? THR T  52  ? ILE X 43  THR X 44  
DF 2 GLY T  72  ? MET T  76  ? GLY X 64  MET X 68  
DF 3 HIS T  119 ? HIS T  123 ? HIS X 111 HIS X 115 
DF 4 ARG T  107 ? HIS T  114 ? ARG X 99  HIS X 106 
DF 5 GLU T  95  ? VAL T  98  ? GLU X 87  VAL X 90  
DF 6 LYS T  137 ? ALA T  142 ? LYS X 129 ALA X 134 
DF 7 ILE T  19  ? ILE T  25  ? ILE X 11  ILE X 17  
DF 8 GLY T  72  ? MET T  76  ? GLY X 64  MET X 68  
DG 1 SER T  35  ? VAL T  36  ? SER X 27  VAL X 28  
DG 2 VAL T  42  ? ARG T  43  ? VAL X 34  ARG X 35  
DH 1 LYS T  156 ? VAL T  157 ? LYS X 148 VAL X 149 
DH 2 GLY T  262 ? ASP T  270 ? GLY X 254 ASP X 262 
DH 3 LYS T  238 ? VAL T  249 ? LYS X 230 VAL X 241 
DH 4 ILE T  224 ? ASP T  231 ? ILE X 216 ASP X 223 
DH 5 LYS T  184 ? ILE T  185 ? LYS X 176 ILE X 177 
DI 1 LYS T  156 ? VAL T  157 ? LYS X 148 VAL X 149 
DI 2 GLY T  262 ? ASP T  270 ? GLY X 254 ASP X 262 
DI 3 TYR T  204 ? ASP T  205 ? TYR X 196 ASP X 197 
DJ 1 GLN T  171 ? GLU T  172 ? GLN X 163 GLU X 164 
DJ 2 ILE T  177 ? VAL T  181 ? ILE X 169 VAL X 173 
DJ 3 ILE T  274 ? GLU T  278 ? ILE X 266 GLU X 270 
DK 1 ILE U  51  ? THR U  52  ? ILE a 43  THR a 44  
DK 2 GLY U  72  ? MET U  76  ? GLY a 64  MET a 68  
DK 3 HIS U  119 ? HIS U  123 ? HIS a 111 HIS a 115 
DK 4 ARG U  107 ? HIS U  114 ? ARG a 99  HIS a 106 
DK 5 GLU U  95  ? VAL U  98  ? GLU a 87  VAL a 90  
DK 6 LYS U  137 ? ALA U  142 ? LYS a 129 ALA a 134 
DK 7 ILE U  19  ? ILE U  25  ? ILE a 11  ILE a 17  
DK 8 GLY U  72  ? MET U  76  ? GLY a 64  MET a 68  
DL 1 ALA U  28  ? LYS U  29  ? ALA a 20  LYS a 21  
DL 2 LEU U  48  ? GLY U  49  ? LEU a 40  GLY a 41  
DM 1 SER U  35  ? VAL U  36  ? SER a 27  VAL a 28  
DM 2 VAL U  42  ? ARG U  43  ? VAL a 34  ARG a 35  
DN 1 LYS U  156 ? VAL U  157 ? LYS a 148 VAL a 149 
DN 2 GLY U  262 ? ASP U  270 ? GLY a 254 ASP a 262 
DN 3 LYS U  238 ? VAL U  249 ? LYS a 230 VAL a 241 
DN 4 ILE U  224 ? ASP U  231 ? ILE a 216 ASP a 223 
DN 5 LYS U  184 ? ILE U  185 ? LYS a 176 ILE a 177 
DO 1 LYS U  156 ? VAL U  157 ? LYS a 148 VAL a 149 
DO 2 GLY U  262 ? ASP U  270 ? GLY a 254 ASP a 262 
DO 3 TYR U  204 ? ASP U  205 ? TYR a 196 ASP a 197 
DP 1 GLN U  171 ? LYS U  173 ? GLN a 163 LYS a 165 
DP 2 LYS U  176 ? VAL U  181 ? LYS a 168 VAL a 173 
DP 3 ILE U  274 ? GLU U  278 ? ILE a 266 GLU a 270 
DQ 1 ILE V  51  ? THR V  52  ? ILE b 43  THR b 44  
DQ 2 GLY V  72  ? MET V  76  ? GLY b 64  MET b 68  
DQ 3 HIS V  119 ? HIS V  123 ? HIS b 111 HIS b 115 
DQ 4 ARG V  107 ? HIS V  114 ? ARG b 99  HIS b 106 
DQ 5 GLU V  95  ? VAL V  98  ? GLU b 87  VAL b 90  
DQ 6 LYS V  137 ? ALA V  142 ? LYS b 129 ALA b 134 
DQ 7 ILE V  19  ? ILE V  25  ? ILE b 11  ILE b 17  
DQ 8 GLY V  72  ? MET V  76  ? GLY b 64  MET b 68  
DR 1 ALA V  28  ? LYS V  29  ? ALA b 20  LYS b 21  
DR 2 LEU V  48  ? GLY V  49  ? LEU b 40  GLY b 41  
DS 1 SER V  35  ? VAL V  36  ? SER b 27  VAL b 28  
DS 2 VAL V  42  ? ARG V  43  ? VAL b 34  ARG b 35  
DT 1 LYS V  156 ? VAL V  157 ? LYS b 148 VAL b 149 
DT 2 GLY V  262 ? ASP V  270 ? GLY b 254 ASP b 262 
DT 3 LYS V  238 ? VAL V  249 ? LYS b 230 VAL b 241 
DT 4 ILE V  224 ? ASP V  231 ? ILE b 216 ASP b 223 
DT 5 LYS V  184 ? ILE V  185 ? LYS b 176 ILE b 177 
DU 1 LYS V  156 ? VAL V  157 ? LYS b 148 VAL b 149 
DU 2 GLY V  262 ? ASP V  270 ? GLY b 254 ASP b 262 
DU 3 TYR V  204 ? ASP V  205 ? TYR b 196 ASP b 197 
DV 1 GLN V  171 ? LYS V  173 ? GLN b 163 LYS b 165 
DV 2 LYS V  176 ? VAL V  181 ? LYS b 168 VAL b 173 
DV 3 ILE V  274 ? GLU V  278 ? ILE b 266 GLU b 270 
DW 1 ILE W  19  ? ILE W  25  ? ILE c 11  ILE c 17  
DW 2 VAL W  73  ? MET W  76  ? VAL c 65  MET c 68  
DW 3 HIS W  119 ? HIS W  123 ? HIS c 111 HIS c 115 
DW 4 ARG W  107 ? HIS W  114 ? ARG c 99  HIS c 106 
DW 5 GLU W  95  ? VAL W  98  ? GLU c 87  VAL c 90  
DW 6 LYS W  137 ? ALA W  142 ? LYS c 129 ALA c 134 
DW 7 ILE W  19  ? ILE W  25  ? ILE c 11  ILE c 17  
DX 1 ALA W  28  ? LYS W  29  ? ALA c 20  LYS c 21  
DX 2 LEU W  48  ? GLY W  49  ? LEU c 40  GLY c 41  
DY 1 SER W  35  ? VAL W  36  ? SER c 27  VAL c 28  
DY 2 VAL W  42  ? ARG W  43  ? VAL c 34  ARG c 35  
DZ 1 LYS W  156 ? VAL W  157 ? LYS c 148 VAL c 149 
DZ 2 GLY W  262 ? ASP W  270 ? GLY c 254 ASP c 262 
DZ 3 LYS W  238 ? HIS W  251 ? LYS c 230 HIS c 243 
DZ 4 ILE W  224 ? ASP W  231 ? ILE c 216 ASP c 223 
DZ 5 LYS W  184 ? ILE W  185 ? LYS c 176 ILE c 177 
EA 1 LYS W  156 ? VAL W  157 ? LYS c 148 VAL c 149 
EA 2 GLY W  262 ? ASP W  270 ? GLY c 254 ASP c 262 
EA 3 TYR W  204 ? ASP W  205 ? TYR c 196 ASP c 197 
EB 1 GLN W  171 ? LYS W  173 ? GLN c 163 LYS c 165 
EB 2 LYS W  176 ? VAL W  181 ? LYS c 168 VAL c 173 
EB 3 ILE W  274 ? GLU W  278 ? ILE c 266 GLU c 270 
EC 1 ILE X  19  ? ILE X  25  ? ILE d 11  ILE d 17  
EC 2 VAL X  73  ? MET X  76  ? VAL d 65  MET d 68  
EC 3 HIS X  119 ? HIS X  123 ? HIS d 111 HIS d 115 
EC 4 ARG X  107 ? HIS X  114 ? ARG d 99  HIS d 106 
EC 5 GLU X  95  ? VAL X  98  ? GLU d 87  VAL d 90  
EC 6 LYS X  137 ? ALA X  142 ? LYS d 129 ALA d 134 
EC 7 ILE X  19  ? ILE X  25  ? ILE d 11  ILE d 17  
ED 1 ALA X  28  ? LYS X  29  ? ALA d 20  LYS d 21  
ED 2 LEU X  48  ? GLY X  49  ? LEU d 40  GLY d 41  
EE 1 SER X  35  ? VAL X  36  ? SER d 27  VAL d 28  
EE 2 VAL X  42  ? ARG X  43  ? VAL d 34  ARG d 35  
EF 1 LYS X  156 ? VAL X  157 ? LYS d 148 VAL d 149 
EF 2 GLY X  262 ? ASP X  270 ? GLY d 254 ASP d 262 
EF 3 LYS X  238 ? VAL X  249 ? LYS d 230 VAL d 241 
EF 4 ILE X  224 ? ASP X  231 ? ILE d 216 ASP d 223 
EF 5 LYS X  184 ? ILE X  185 ? LYS d 176 ILE d 177 
EG 1 LYS X  156 ? VAL X  157 ? LYS d 148 VAL d 149 
EG 2 GLY X  262 ? ASP X  270 ? GLY d 254 ASP d 262 
EG 3 TYR X  204 ? ASP X  205 ? TYR d 196 ASP d 197 
EH 1 GLN X  171 ? LYS X  173 ? GLN d 163 LYS d 165 
EH 2 LYS X  176 ? VAL X  181 ? LYS d 168 VAL d 173 
EH 3 ILE X  274 ? GLU X  278 ? ILE d 266 GLU d 270 
EI 1 ILE Y  51  ? THR Y  52  ? ILE e 43  THR e 44  
EI 2 GLY Y  72  ? MET Y  76  ? GLY e 64  MET e 68  
EI 3 HIS Y  119 ? HIS Y  123 ? HIS e 111 HIS e 115 
EI 4 ARG Y  107 ? HIS Y  114 ? ARG e 99  HIS e 106 
EI 5 GLU Y  95  ? VAL Y  98  ? GLU e 87  VAL e 90  
EI 6 LYS Y  137 ? ALA Y  142 ? LYS e 129 ALA e 134 
EI 7 ILE Y  19  ? ILE Y  25  ? ILE e 11  ILE e 17  
EI 8 GLY Y  72  ? MET Y  76  ? GLY e 64  MET e 68  
EJ 1 ALA Y  28  ? LYS Y  29  ? ALA e 20  LYS e 21  
EJ 2 LEU Y  48  ? GLY Y  49  ? LEU e 40  GLY e 41  
EK 1 SER Y  35  ? VAL Y  36  ? SER e 27  VAL e 28  
EK 2 VAL Y  42  ? ARG Y  43  ? VAL e 34  ARG e 35  
EL 1 LYS Y  156 ? VAL Y  157 ? LYS e 148 VAL e 149 
EL 2 GLY Y  262 ? ASP Y  270 ? GLY e 254 ASP e 262 
EL 3 LYS Y  238 ? VAL Y  249 ? LYS e 230 VAL e 241 
EL 4 ILE Y  224 ? ASP Y  231 ? ILE e 216 ASP e 223 
EL 5 LYS Y  184 ? ILE Y  185 ? LYS e 176 ILE e 177 
EM 1 LYS Y  156 ? VAL Y  157 ? LYS e 148 VAL e 149 
EM 2 GLY Y  262 ? ASP Y  270 ? GLY e 254 ASP e 262 
EM 3 TYR Y  204 ? ASP Y  205 ? TYR e 196 ASP e 197 
EN 1 GLN Y  171 ? LYS Y  173 ? GLN e 163 LYS e 165 
EN 2 LYS Y  176 ? VAL Y  181 ? LYS e 168 VAL e 173 
EN 3 ILE Y  274 ? GLU Y  278 ? ILE e 266 GLU e 270 
EO 1 HIS Z  5   ? HIS Z  6   ? HIS g -3  HIS g -2  
EO 2 GLN Z  171 ? LYS Z  173 ? GLN g 163 LYS g 165 
EO 3 LYS Z  176 ? VAL Z  181 ? LYS g 168 VAL g 173 
EO 4 ILE Z  274 ? GLU Z  278 ? ILE g 266 GLU g 270 
EP 1 ILE Z  51  ? THR Z  52  ? ILE g 43  THR g 44  
EP 2 GLY Z  72  ? MET Z  76  ? GLY g 64  MET g 68  
EP 3 HIS Z  119 ? HIS Z  123 ? HIS g 111 HIS g 115 
EP 4 ARG Z  107 ? HIS Z  114 ? ARG g 99  HIS g 106 
EP 5 GLU Z  95  ? VAL Z  98  ? GLU g 87  VAL g 90  
EP 6 LYS Z  137 ? ALA Z  142 ? LYS g 129 ALA g 134 
EP 7 ILE Z  19  ? ILE Z  25  ? ILE g 11  ILE g 17  
EP 8 GLY Z  72  ? MET Z  76  ? GLY g 64  MET g 68  
EQ 1 ALA Z  28  ? LYS Z  29  ? ALA g 20  LYS g 21  
EQ 2 LEU Z  48  ? GLY Z  49  ? LEU g 40  GLY g 41  
ER 1 SER Z  35  ? VAL Z  36  ? SER g 27  VAL g 28  
ER 2 VAL Z  42  ? ARG Z  43  ? VAL g 34  ARG g 35  
ES 1 LYS Z  156 ? VAL Z  157 ? LYS g 148 VAL g 149 
ES 2 GLY Z  262 ? ASP Z  270 ? GLY g 254 ASP g 262 
ES 3 LYS Z  238 ? VAL Z  249 ? LYS g 230 VAL g 241 
ES 4 ILE Z  224 ? ASP Z  231 ? ILE g 216 ASP g 223 
ES 5 ALA Z  183 ? ILE Z  185 ? ALA g 175 ILE g 177 
ET 1 LYS Z  156 ? VAL Z  157 ? LYS g 148 VAL g 149 
ET 2 GLY Z  262 ? ASP Z  270 ? GLY g 254 ASP g 262 
ET 3 TYR Z  204 ? ASP Z  205 ? TYR g 196 ASP g 197 
EU 1 ILE AA 51  ? THR AA 52  ? ILE h 43  THR h 44  
EU 2 GLY AA 72  ? MET AA 76  ? GLY h 64  MET h 68  
EU 3 HIS AA 119 ? HIS AA 123 ? HIS h 111 HIS h 115 
EU 4 ARG AA 107 ? HIS AA 114 ? ARG h 99  HIS h 106 
EU 5 GLU AA 95  ? VAL AA 98  ? GLU h 87  VAL h 90  
EU 6 LYS AA 137 ? ALA AA 142 ? LYS h 129 ALA h 134 
EU 7 ILE AA 19  ? ILE AA 25  ? ILE h 11  ILE h 17  
EU 8 GLY AA 72  ? MET AA 76  ? GLY h 64  MET h 68  
EV 1 ALA AA 28  ? LYS AA 29  ? ALA h 20  LYS h 21  
EV 2 LEU AA 48  ? GLY AA 49  ? LEU h 40  GLY h 41  
EW 1 SER AA 35  ? VAL AA 36  ? SER h 27  VAL h 28  
EW 2 VAL AA 42  ? ARG AA 43  ? VAL h 34  ARG h 35  
EX 1 LYS AA 156 ? VAL AA 157 ? LYS h 148 VAL h 149 
EX 2 GLY AA 262 ? ASP AA 270 ? GLY h 254 ASP h 262 
EX 3 LYS AA 238 ? VAL AA 249 ? LYS h 230 VAL h 241 
EX 4 ILE AA 224 ? ASP AA 231 ? ILE h 216 ASP h 223 
EX 5 LYS AA 184 ? ILE AA 185 ? LYS h 176 ILE h 177 
EY 1 LYS AA 156 ? VAL AA 157 ? LYS h 148 VAL h 149 
EY 2 GLY AA 262 ? ASP AA 270 ? GLY h 254 ASP h 262 
EY 3 TYR AA 204 ? ASP AA 205 ? TYR h 196 ASP h 197 
EZ 1 GLN AA 171 ? LYS AA 173 ? GLN h 163 LYS h 165 
EZ 2 LYS AA 176 ? VAL AA 181 ? LYS h 168 VAL h 173 
EZ 3 ILE AA 274 ? GLU AA 278 ? ILE h 266 GLU h 270 
FA 1 ILE BA 51  ? THR BA 52  ? ILE i 43  THR i 44  
FA 2 GLY BA 72  ? MET BA 76  ? GLY i 64  MET i 68  
FA 3 HIS BA 119 ? HIS BA 123 ? HIS i 111 HIS i 115 
FA 4 ARG BA 107 ? HIS BA 114 ? ARG i 99  HIS i 106 
FA 5 GLU BA 95  ? VAL BA 98  ? GLU i 87  VAL i 90  
FA 6 LYS BA 137 ? ALA BA 142 ? LYS i 129 ALA i 134 
FA 7 ILE BA 19  ? ILE BA 25  ? ILE i 11  ILE i 17  
FA 8 GLY BA 72  ? MET BA 76  ? GLY i 64  MET i 68  
FB 1 ALA BA 28  ? LYS BA 29  ? ALA i 20  LYS i 21  
FB 2 LEU BA 48  ? GLY BA 49  ? LEU i 40  GLY i 41  
FC 1 SER BA 35  ? VAL BA 36  ? SER i 27  VAL i 28  
FC 2 VAL BA 42  ? ARG BA 43  ? VAL i 34  ARG i 35  
FD 1 LYS BA 156 ? VAL BA 157 ? LYS i 148 VAL i 149 
FD 2 GLY BA 262 ? ASP BA 270 ? GLY i 254 ASP i 262 
FD 3 LYS BA 238 ? VAL BA 249 ? LYS i 230 VAL i 241 
FD 4 ILE BA 224 ? ASP BA 231 ? ILE i 216 ASP i 223 
FD 5 LYS BA 184 ? ILE BA 185 ? LYS i 176 ILE i 177 
FE 1 LYS BA 156 ? VAL BA 157 ? LYS i 148 VAL i 149 
FE 2 GLY BA 262 ? ASP BA 270 ? GLY i 254 ASP i 262 
FE 3 TYR BA 204 ? ASP BA 205 ? TYR i 196 ASP i 197 
FF 1 GLN BA 171 ? GLU BA 172 ? GLN i 163 GLU i 164 
FF 2 ILE BA 177 ? VAL BA 181 ? ILE i 169 VAL i 173 
FF 3 ILE BA 274 ? GLU BA 278 ? ILE i 266 GLU i 270 
FG 1 ILE CA 51  ? THR CA 52  ? ILE j 43  THR j 44  
FG 2 GLY CA 72  ? MET CA 76  ? GLY j 64  MET j 68  
FG 3 HIS CA 119 ? HIS CA 123 ? HIS j 111 HIS j 115 
FG 4 ARG CA 107 ? HIS CA 114 ? ARG j 99  HIS j 106 
FG 5 GLU CA 95  ? VAL CA 98  ? GLU j 87  VAL j 90  
FG 6 LYS CA 137 ? ALA CA 142 ? LYS j 129 ALA j 134 
FG 7 ILE CA 19  ? ILE CA 25  ? ILE j 11  ILE j 17  
FG 8 GLY CA 72  ? MET CA 76  ? GLY j 64  MET j 68  
FH 1 SER CA 35  ? VAL CA 36  ? SER j 27  VAL j 28  
FH 2 VAL CA 42  ? ARG CA 43  ? VAL j 34  ARG j 35  
FI 1 LYS CA 156 ? VAL CA 157 ? LYS j 148 VAL j 149 
FI 2 GLY CA 262 ? ASP CA 270 ? GLY j 254 ASP j 262 
FI 3 LYS CA 238 ? VAL CA 249 ? LYS j 230 VAL j 241 
FI 4 ILE CA 224 ? ASP CA 231 ? ILE j 216 ASP j 223 
FI 5 LYS CA 184 ? ILE CA 185 ? LYS j 176 ILE j 177 
FJ 1 LYS CA 156 ? VAL CA 157 ? LYS j 148 VAL j 149 
FJ 2 GLY CA 262 ? ASP CA 270 ? GLY j 254 ASP j 262 
FJ 3 TYR CA 204 ? ASP CA 205 ? TYR j 196 ASP j 197 
FK 1 GLN CA 171 ? LYS CA 173 ? GLN j 163 LYS j 165 
FK 2 LYS CA 176 ? VAL CA 181 ? LYS j 168 VAL j 173 
FK 3 ILE CA 274 ? GLU CA 278 ? ILE j 266 GLU j 270 
FL 1 ILE DA 19  ? ILE DA 25  ? ILE k 11  ILE k 17  
FL 2 VAL DA 73  ? MET DA 76  ? VAL k 65  MET k 68  
FL 3 HIS DA 119 ? HIS DA 123 ? HIS k 111 HIS k 115 
FL 4 ARG DA 107 ? HIS DA 114 ? ARG k 99  HIS k 106 
FL 5 GLU DA 95  ? VAL DA 98  ? GLU k 87  VAL k 90  
FL 6 LYS DA 137 ? ALA DA 142 ? LYS k 129 ALA k 134 
FL 7 ILE DA 19  ? ILE DA 25  ? ILE k 11  ILE k 17  
FM 1 ALA DA 28  ? LYS DA 29  ? ALA k 20  LYS k 21  
FM 2 LEU DA 48  ? GLY DA 49  ? LEU k 40  GLY k 41  
FN 1 SER DA 35  ? VAL DA 36  ? SER k 27  VAL k 28  
FN 2 VAL DA 42  ? ARG DA 43  ? VAL k 34  ARG k 35  
FO 1 LYS DA 156 ? VAL DA 157 ? LYS k 148 VAL k 149 
FO 2 GLY DA 262 ? ASP DA 270 ? GLY k 254 ASP k 262 
FO 3 LYS DA 238 ? VAL DA 249 ? LYS k 230 VAL k 241 
FO 4 ILE DA 224 ? ASP DA 231 ? ILE k 216 ASP k 223 
FO 5 LYS DA 184 ? ILE DA 185 ? LYS k 176 ILE k 177 
FP 1 LYS DA 156 ? VAL DA 157 ? LYS k 148 VAL k 149 
FP 2 GLY DA 262 ? ASP DA 270 ? GLY k 254 ASP k 262 
FP 3 TYR DA 204 ? ASP DA 205 ? TYR k 196 ASP k 197 
FQ 1 GLN DA 171 ? LYS DA 173 ? GLN k 163 LYS k 165 
FQ 2 LYS DA 176 ? VAL DA 181 ? LYS k 168 VAL k 173 
FQ 3 ILE DA 274 ? GLU DA 278 ? ILE k 266 GLU k 270 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N THR A  52  ? N THR A 44  O GLY A  72  ? O GLY A 64  
A  2 3 N VAL A  73  ? N VAL A 65  O VAL A  122 ? O VAL A 114 
A  3 4 O HIS A  123 ? O HIS A 115 N PHE A  109 ? N PHE A 101 
A  4 5 O GLY A  108 ? O GLY A 100 N VAL A  96  ? N VAL A 88  
A  5 6 N ILE A  97  ? N ILE A 89  O LEU A  139 ? O LEU A 131 
A  6 7 O ILE A  140 ? O ILE A 132 N VAL A  21  ? N VAL A 13  
A  7 8 N GLU A  24  ? N GLU A 16  O MET A  76  ? O MET A 68  
B  1 2 N LYS A  29  ? N LYS A 21  O LEU A  48  ? O LEU A 40  
C  1 2 N SER A  35  ? N SER A 27  O ARG A  43  ? O ARG A 35  
D  1 2 N LYS A  156 ? N LYS A 148 O THR A  268 ? O THR A 260 
D  2 3 O ILE A  266 ? O ILE A 258 N ILE A  246 ? N ILE A 238 
D  3 4 O LYS A  238 ? O LYS A 230 N ASP A  231 ? N ASP A 223 
D  4 5 O GLN A  228 ? O GLN A 220 N ILE A  185 ? N ILE A 177 
E  1 2 N LYS A  156 ? N LYS A 148 O THR A  268 ? O THR A 260 
E  2 3 O VAL A  263 ? O VAL A 255 N TYR A  204 ? N TYR A 196 
F  1 2 N GLN A  171 ? N GLN A 163 O HIS A  178 ? O HIS A 170 
F  2 3 N ILE A  177 ? N ILE A 169 O LEU A  275 ? O LEU A 267 
G  1 2 N THR B  52  ? N THR B 44  O GLY B  72  ? O GLY B 64  
G  2 3 N VAL B  75  ? N VAL B 67  O VAL B  120 ? O VAL B 112 
G  3 4 O HIS B  119 ? O HIS B 111 N HIS B  114 ? N HIS B 106 
G  4 5 O GLY B  108 ? O GLY B 100 N VAL B  96  ? N VAL B 88  
G  5 6 N GLU B  95  ? N GLU B 87  O LYS B  141 ? O LYS B 133 
G  6 7 O ILE B  140 ? O ILE B 132 N VAL B  21  ? N VAL B 13  
G  7 8 N GLU B  24  ? N GLU B 16  O MET B  76  ? O MET B 68  
H  1 2 N LYS B  29  ? N LYS B 21  O LEU B  48  ? O LEU B 40  
I  1 2 N SER B  35  ? N SER B 27  O ARG B  43  ? O ARG B 35  
J  1 2 N LYS B  156 ? N LYS B 148 O THR B  268 ? O THR B 260 
J  2 3 O ILE B  266 ? O ILE B 258 N ILE B  246 ? N ILE B 238 
J  3 4 O SER B  245 ? O SER B 237 N ILE B  227 ? N ILE B 219 
J  4 5 O ALA B  226 ? O ALA B 218 N ILE B  185 ? N ILE B 177 
K  1 2 N LYS B  156 ? N LYS B 148 O THR B  268 ? O THR B 260 
K  2 3 O VAL B  263 ? O VAL B 255 N TYR B  204 ? N TYR B 196 
L  1 2 N GLN B  171 ? N GLN B 163 O HIS B  178 ? O HIS B 170 
L  2 3 N ILE B  177 ? N ILE B 169 O LEU B  275 ? O LEU B 267 
M  1 2 N THR C  52  ? N THR C 44  O GLY C  72  ? O GLY C 64  
M  2 3 N VAL C  73  ? N VAL C 65  O VAL C  122 ? O VAL C 114 
M  3 4 O HIS C  119 ? O HIS C 111 N HIS C  114 ? N HIS C 106 
M  4 5 O GLY C  108 ? O GLY C 100 N VAL C  96  ? N VAL C 88  
M  5 6 N ILE C  97  ? N ILE C 89  O LEU C  139 ? O LEU C 131 
M  6 7 O ILE C  138 ? O ILE C 130 N GLY C  23  ? N GLY C 15  
M  7 8 N GLU C  24  ? N GLU C 16  O MET C  76  ? O MET C 68  
N  1 2 N LYS C  29  ? N LYS C 21  O LEU C  48  ? O LEU C 40  
O  1 2 N SER C  35  ? N SER C 27  O ARG C  43  ? O ARG C 35  
P  1 2 N LYS C  156 ? N LYS C 148 O THR C  268 ? O THR C 260 
P  2 3 O GLY C  269 ? O GLY C 261 N VAL C  244 ? N VAL C 236 
P  3 4 O SER C  245 ? O SER C 237 N ILE C  227 ? N ILE C 219 
P  4 5 O GLN C  228 ? O GLN C 220 N ILE C  185 ? N ILE C 177 
Q  1 2 N LYS C  156 ? N LYS C 148 O THR C  268 ? O THR C 260 
Q  2 3 O VAL C  263 ? O VAL C 255 N TYR C  204 ? N TYR C 196 
R  1 2 N GLN C  171 ? N GLN C 163 O HIS C  178 ? O HIS C 170 
R  2 3 N ILE C  177 ? N ILE C 169 O LEU C  275 ? O LEU C 267 
S  1 2 N GLU D  24  ? N GLU D 16  O MET D  76  ? O MET D 68  
S  2 3 N VAL D  73  ? N VAL D 65  O VAL D  122 ? O VAL D 114 
S  3 4 O LEU D  121 ? O LEU D 113 N GLY D  112 ? N GLY D 104 
S  4 5 O GLY D  108 ? O GLY D 100 N VAL D  96  ? N VAL D 88  
S  5 6 N GLU D  95  ? N GLU D 87  O LYS D  141 ? O LYS D 133 
S  6 7 O ILE D  140 ? O ILE D 132 N VAL D  21  ? N VAL D 13  
T  1 2 N LYS D  29  ? N LYS D 21  O LEU D  48  ? O LEU D 40  
U  1 2 N SER D  35  ? N SER D 27  O ARG D  43  ? O ARG D 35  
V  1 2 N LYS D  156 ? N LYS D 148 O THR D  268 ? O THR D 260 
V  2 3 O MET D  267 ? O MET D 259 N ILE D  246 ? N ILE D 238 
V  3 4 O SER D  245 ? O SER D 237 N ILE D  227 ? N ILE D 219 
V  4 5 O ALA D  226 ? O ALA D 218 N ILE D  185 ? N ILE D 177 
W  1 2 N LYS D  156 ? N LYS D 148 O THR D  268 ? O THR D 260 
W  2 3 O VAL D  263 ? O VAL D 255 N TYR D  204 ? N TYR D 196 
X  1 2 N GLN D  171 ? N GLN D 163 O HIS D  178 ? O HIS D 170 
X  2 3 N ILE D  177 ? N ILE D 169 O LEU D  275 ? O LEU D 267 
Y  1 2 N THR E  52  ? N THR E 44  O GLY E  72  ? O GLY E 64  
Y  2 3 N VAL E  75  ? N VAL E 67  O VAL E  120 ? O VAL E 112 
Y  3 4 O HIS E  119 ? O HIS E 111 N HIS E  114 ? N HIS E 106 
Y  4 5 O GLY E  108 ? O GLY E 100 N VAL E  96  ? N VAL E 88  
Y  5 6 N ILE E  97  ? N ILE E 89  O LEU E  139 ? O LEU E 131 
Y  6 7 O ILE E  140 ? O ILE E 132 N VAL E  21  ? N VAL E 13  
Y  7 8 N GLU E  24  ? N GLU E 16  O MET E  76  ? O MET E 68  
Z  1 2 N LYS E  29  ? N LYS E 21  O LEU E  48  ? O LEU E 40  
AA 1 2 N SER E  35  ? N SER E 27  O ARG E  43  ? O ARG E 35  
AB 1 2 N LYS E  156 ? N LYS E 148 O THR E  268 ? O THR E 260 
AB 2 3 O ILE E  266 ? O ILE E 258 N ILE E  246 ? N ILE E 238 
AB 3 4 O SER E  245 ? O SER E 237 N ILE E  227 ? N ILE E 219 
AB 4 5 O ALA E  226 ? O ALA E 218 N ILE E  185 ? N ILE E 177 
AC 1 2 N LYS E  156 ? N LYS E 148 O THR E  268 ? O THR E 260 
AC 2 3 O VAL E  263 ? O VAL E 255 N TYR E  204 ? N TYR E 196 
AD 1 2 N GLN E  171 ? N GLN E 163 O HIS E  178 ? O HIS E 170 
AD 2 3 N ILE E  177 ? N ILE E 169 O LEU E  275 ? O LEU E 267 
AE 1 2 N HIS F  6   ? N HIS G -2  O GLU F  172 ? O GLU G 164 
AE 2 3 N GLN F  171 ? N GLN G 163 O HIS F  178 ? O HIS G 170 
AE 3 4 N ILE F  177 ? N ILE G 169 O LEU F  275 ? O LEU G 267 
AF 1 2 N THR F  52  ? N THR G 44  O GLY F  72  ? O GLY G 64  
AF 2 3 N VAL F  73  ? N VAL G 65  O VAL F  122 ? O VAL G 114 
AF 3 4 O HIS F  123 ? O HIS G 115 N PHE F  109 ? N PHE G 101 
AF 4 5 O GLY F  108 ? O GLY G 100 N VAL F  96  ? N VAL G 88  
AF 5 6 N ILE F  97  ? N ILE G 89  O LEU F  139 ? O LEU G 131 
AF 6 7 O ILE F  140 ? O ILE G 132 N VAL F  21  ? N VAL G 13  
AF 7 8 N GLU F  24  ? N GLU G 16  O MET F  76  ? O MET G 68  
AG 1 2 N SER F  35  ? N SER G 27  O ARG F  43  ? O ARG G 35  
AH 1 2 N LYS F  156 ? N LYS G 148 O THR F  268 ? O THR G 260 
AH 2 3 O MET F  267 ? O MET G 259 N ILE F  246 ? N ILE G 238 
AH 3 4 O SER F  245 ? O SER G 237 N ILE F  227 ? N ILE G 219 
AH 4 5 O GLN F  228 ? O GLN G 220 N ILE F  185 ? N ILE G 177 
AI 1 2 N LYS F  156 ? N LYS G 148 O THR F  268 ? O THR G 260 
AI 2 3 O VAL F  263 ? O VAL G 255 N TYR F  204 ? N TYR G 196 
AJ 1 2 N THR G  52  ? N THR H 44  O GLY G  72  ? O GLY H 64  
AJ 2 3 N VAL G  73  ? N VAL H 65  O VAL G  122 ? O VAL H 114 
AJ 3 4 O HIS G  119 ? O HIS H 111 N HIS G  114 ? N HIS H 106 
AJ 4 5 O GLY G  108 ? O GLY H 100 N VAL G  96  ? N VAL H 88  
AJ 5 6 N ILE G  97  ? N ILE H 89  O LEU G  139 ? O LEU H 131 
AJ 6 7 O ILE G  138 ? O ILE H 130 N GLY G  23  ? N GLY H 15  
AJ 7 8 N GLU G  24  ? N GLU H 16  O MET G  76  ? O MET H 68  
AK 1 2 N LYS G  29  ? N LYS H 21  O LEU G  48  ? O LEU H 40  
AL 1 2 N SER G  35  ? N SER H 27  O ARG G  43  ? O ARG H 35  
AM 1 2 N LYS G  156 ? N LYS H 148 O THR G  268 ? O THR H 260 
AM 2 3 O ILE G  266 ? O ILE H 258 N ILE G  246 ? N ILE H 238 
AM 3 4 O GLY G  247 ? O GLY H 239 N VAL G  225 ? N VAL H 217 
AM 4 5 O GLN G  228 ? O GLN H 220 N ILE G  185 ? N ILE H 177 
AN 1 2 N LYS G  156 ? N LYS H 148 O THR G  268 ? O THR H 260 
AN 2 3 O VAL G  263 ? O VAL H 255 N TYR G  204 ? N TYR H 196 
AO 1 2 N GLN G  171 ? N GLN H 163 O HIS G  178 ? O HIS H 170 
AO 2 3 N VAL G  179 ? N VAL H 171 O GLU G  277 ? O GLU H 269 
AP 1 2 N THR H  52  ? N THR I 44  O GLY H  72  ? O GLY I 64  
AP 2 3 N VAL H  73  ? N VAL I 65  O VAL H  122 ? O VAL I 114 
AP 3 4 O HIS H  119 ? O HIS I 111 N HIS H  114 ? N HIS I 106 
AP 4 5 O GLY H  108 ? O GLY I 100 N VAL H  96  ? N VAL I 88  
AP 5 6 N ILE H  97  ? N ILE I 89  O LEU H  139 ? O LEU I 131 
AP 6 7 O ILE H  140 ? O ILE I 132 N VAL H  21  ? N VAL I 13  
AP 7 8 N GLU H  24  ? N GLU I 16  O MET H  76  ? O MET I 68  
AQ 1 2 N LYS H  29  ? N LYS I 21  O LEU H  48  ? O LEU I 40  
AR 1 2 N SER H  35  ? N SER I 27  O ARG H  43  ? O ARG I 35  
AS 1 2 N LYS H  156 ? N LYS I 148 O THR H  268 ? O THR I 260 
AS 2 3 O ILE H  266 ? O ILE I 258 N ILE H  246 ? N ILE I 238 
AS 3 4 O LYS H  238 ? O LYS I 230 N ASP H  231 ? N ASP I 223 
AS 4 5 O ALA H  226 ? O ALA I 218 N ILE H  185 ? N ILE I 177 
AT 1 2 N LYS H  156 ? N LYS I 148 O THR H  268 ? O THR I 260 
AT 2 3 O VAL H  263 ? O VAL I 255 N TYR H  204 ? N TYR I 196 
AU 1 2 N GLN H  171 ? N GLN I 163 O HIS H  178 ? O HIS I 170 
AU 2 3 N VAL H  179 ? N VAL I 171 O GLU H  277 ? O GLU I 269 
AV 1 2 N GLU I  24  ? N GLU J 16  O MET I  76  ? O MET J 68  
AV 2 3 N VAL I  75  ? N VAL J 67  O VAL I  120 ? O VAL J 112 
AV 3 4 O LEU I  121 ? O LEU J 113 N THR I  111 ? N THR J 103 
AV 4 5 O GLY I  108 ? O GLY J 100 N VAL I  96  ? N VAL J 88  
AV 5 6 N GLU I  95  ? N GLU J 87  O LYS I  141 ? O LYS J 133 
AV 6 7 O ILE I  140 ? O ILE J 132 N VAL I  21  ? N VAL J 13  
AW 1 2 N SER I  35  ? N SER J 27  O ARG I  43  ? O ARG J 35  
AX 1 2 N LYS I  156 ? N LYS J 148 O THR I  268 ? O THR J 260 
AX 2 3 O ILE I  266 ? O ILE J 258 N ILE I  246 ? N ILE J 238 
AX 3 4 O GLY I  247 ? O GLY J 239 N VAL I  225 ? N VAL J 217 
AX 4 5 O ALA I  226 ? O ALA J 218 N ILE I  185 ? N ILE J 177 
AY 1 2 N LYS I  156 ? N LYS J 148 O THR I  268 ? O THR J 260 
AY 2 3 O VAL I  263 ? O VAL J 255 N TYR I  204 ? N TYR J 196 
AZ 1 2 N GLN I  171 ? N GLN J 163 O HIS I  178 ? O HIS J 170 
AZ 2 3 N ILE I  177 ? N ILE J 169 O LEU I  275 ? O LEU J 267 
BA 1 2 N THR J  52  ? N THR K 44  O GLY J  72  ? O GLY K 64  
BA 2 3 N VAL J  75  ? N VAL K 67  O VAL J  120 ? O VAL K 112 
BA 3 4 O HIS J  123 ? O HIS K 115 N PHE J  109 ? N PHE K 101 
BA 4 5 O GLY J  108 ? O GLY K 100 N VAL J  96  ? N VAL K 88  
BA 5 6 N ILE J  97  ? N ILE K 89  O LEU J  139 ? O LEU K 131 
BA 6 7 O ILE J  140 ? O ILE K 132 N VAL J  21  ? N VAL K 13  
BA 7 8 N GLU J  24  ? N GLU K 16  O MET J  76  ? O MET K 68  
BB 1 2 N LYS J  29  ? N LYS K 21  O LEU J  48  ? O LEU K 40  
BC 1 2 N SER J  35  ? N SER K 27  O ARG J  43  ? O ARG K 35  
BD 1 2 N LYS J  156 ? N LYS K 148 O THR J  268 ? O THR K 260 
BD 2 3 O ILE J  266 ? O ILE K 258 N ILE J  246 ? N ILE K 238 
BD 3 4 O LYS J  238 ? O LYS K 230 N ASP J  231 ? N ASP K 223 
BD 4 5 O ALA J  226 ? O ALA K 218 N ILE J  185 ? N ILE K 177 
BE 1 2 N LYS J  156 ? N LYS K 148 O THR J  268 ? O THR K 260 
BE 2 3 O VAL J  263 ? O VAL K 255 N TYR J  204 ? N TYR K 196 
BF 1 2 N GLN J  171 ? N GLN K 163 O HIS J  178 ? O HIS K 170 
BF 2 3 N ILE J  177 ? N ILE K 169 O LEU J  275 ? O LEU K 267 
BG 1 2 N THR K  52  ? N THR L 44  O GLY K  72  ? O GLY L 64  
BG 2 3 N VAL K  73  ? N VAL L 65  O VAL K  122 ? O VAL L 114 
BG 3 4 O HIS K  119 ? O HIS L 111 N HIS K  114 ? N HIS L 106 
BG 4 5 O GLY K  108 ? O GLY L 100 N VAL K  96  ? N VAL L 88  
BG 5 6 N ILE K  97  ? N ILE L 89  O LEU K  139 ? O LEU L 131 
BG 6 7 O ILE K  140 ? O ILE L 132 N VAL K  21  ? N VAL L 13  
BG 7 8 N GLU K  24  ? N GLU L 16  O MET K  76  ? O MET L 68  
BH 1 2 N SER K  35  ? N SER L 27  O ARG K  43  ? O ARG L 35  
BI 1 2 N LYS K  156 ? N LYS L 148 O THR K  268 ? O THR L 260 
BI 2 3 O ILE K  266 ? O ILE L 258 N ILE K  246 ? N ILE L 238 
BI 3 4 O SER K  245 ? O SER L 237 N ILE K  227 ? N ILE L 219 
BI 4 5 O ALA K  226 ? O ALA L 218 N ILE K  185 ? N ILE L 177 
BJ 1 2 N LYS K  156 ? N LYS L 148 O THR K  268 ? O THR L 260 
BJ 2 3 O VAL K  263 ? O VAL L 255 N TYR K  204 ? N TYR L 196 
BK 1 2 N GLN K  171 ? N GLN L 163 O HIS K  178 ? O HIS L 170 
BK 2 3 N ILE K  177 ? N ILE L 169 O LEU K  275 ? O LEU L 267 
BL 1 2 N THR L  52  ? N THR M 44  O GLY L  72  ? O GLY M 64  
BL 2 3 N VAL L  73  ? N VAL M 65  O VAL L  122 ? O VAL M 114 
BL 3 4 O HIS L  123 ? O HIS M 115 N PHE L  109 ? N PHE M 101 
BL 4 5 O GLY L  108 ? O GLY M 100 N VAL L  96  ? N VAL M 88  
BL 5 6 N ILE L  97  ? N ILE M 89  O LEU L  139 ? O LEU M 131 
BL 6 7 O ILE L  140 ? O ILE M 132 N VAL L  21  ? N VAL M 13  
BL 7 8 N GLU L  24  ? N GLU M 16  O MET L  76  ? O MET M 68  
BM 1 2 N SER L  35  ? N SER M 27  O ARG L  43  ? O ARG M 35  
BN 1 2 N LYS L  156 ? N LYS M 148 O THR L  268 ? O THR M 260 
BN 2 3 O MET L  267 ? O MET M 259 N ILE L  246 ? N ILE M 238 
BN 3 4 O LYS L  238 ? O LYS M 230 N ASP L  231 ? N ASP M 223 
BN 4 5 O GLN L  228 ? O GLN M 220 N ILE L  185 ? N ILE M 177 
BO 1 2 N LYS L  156 ? N LYS M 148 O THR L  268 ? O THR M 260 
BO 2 3 O VAL L  263 ? O VAL M 255 N TYR L  204 ? N TYR M 196 
BP 1 2 N GLN L  171 ? N GLN M 163 O HIS L  178 ? O HIS M 170 
BP 2 3 N ILE L  177 ? N ILE M 169 O LEU L  275 ? O LEU M 267 
BQ 1 2 N THR M  52  ? N THR N 44  O GLY M  72  ? O GLY N 64  
BQ 2 3 N VAL M  73  ? N VAL N 65  O VAL M  122 ? O VAL N 114 
BQ 3 4 O HIS M  123 ? O HIS N 115 N PHE M  109 ? N PHE N 101 
BQ 4 5 O GLY M  108 ? O GLY N 100 N VAL M  96  ? N VAL N 88  
BQ 5 6 N ILE M  97  ? N ILE N 89  O LEU M  139 ? O LEU N 131 
BQ 6 7 O ILE M  140 ? O ILE N 132 N VAL M  21  ? N VAL N 13  
BQ 7 8 N GLU M  24  ? N GLU N 16  O MET M  76  ? O MET N 68  
BR 1 2 N LYS M  29  ? N LYS N 21  O LEU M  48  ? O LEU N 40  
BS 1 2 N SER M  35  ? N SER N 27  O ARG M  43  ? O ARG N 35  
BT 1 2 N LYS M  156 ? N LYS N 148 O THR M  268 ? O THR N 260 
BT 2 3 O ILE M  266 ? O ILE N 258 N ILE M  246 ? N ILE N 238 
BT 3 4 O SER M  245 ? O SER N 237 N ILE M  227 ? N ILE N 219 
BT 4 5 O GLN M  228 ? O GLN N 220 N ILE M  185 ? N ILE N 177 
BU 1 2 N LYS M  156 ? N LYS N 148 O THR M  268 ? O THR N 260 
BU 2 3 O VAL M  263 ? O VAL N 255 N TYR M  204 ? N TYR N 196 
BV 1 2 N GLN M  171 ? N GLN N 163 O HIS M  178 ? O HIS N 170 
BV 2 3 N ILE M  177 ? N ILE N 169 O LEU M  275 ? O LEU N 267 
BW 1 2 N GLU N  24  ? N GLU O 16  O MET N  76  ? O MET O 68  
BW 2 3 N VAL N  73  ? N VAL O 65  O VAL N  122 ? O VAL O 114 
BW 3 4 O HIS N  123 ? O HIS O 115 N PHE N  109 ? N PHE O 101 
BW 4 5 O GLY N  108 ? O GLY O 100 N VAL N  96  ? N VAL O 88  
BW 5 6 N ILE N  97  ? N ILE O 89  O LEU N  139 ? O LEU O 131 
BW 6 7 O ILE N  140 ? O ILE O 132 N VAL N  21  ? N VAL O 13  
BX 1 2 N LYS N  29  ? N LYS O 21  O LEU N  48  ? O LEU O 40  
BY 1 2 N SER N  35  ? N SER O 27  O ARG N  43  ? O ARG O 35  
BZ 1 2 N LYS N  156 ? N LYS O 148 O THR N  268 ? O THR O 260 
BZ 2 3 O MET N  267 ? O MET O 259 N ILE N  246 ? N ILE O 238 
BZ 3 4 O GLY N  247 ? O GLY O 239 N VAL N  225 ? N VAL O 217 
BZ 4 5 O GLN N  228 ? O GLN O 220 N ILE N  185 ? N ILE O 177 
CA 1 2 N LYS N  156 ? N LYS O 148 O THR N  268 ? O THR O 260 
CA 2 3 O VAL N  263 ? O VAL O 255 N TYR N  204 ? N TYR O 196 
CB 1 2 N GLN N  171 ? N GLN O 163 O HIS N  178 ? O HIS O 170 
CB 2 3 N ILE N  177 ? N ILE O 169 O LEU N  275 ? O LEU O 267 
CC 1 2 N GLU O  24  ? N GLU P 16  O MET O  76  ? O MET P 68  
CC 2 3 N VAL O  75  ? N VAL P 67  O VAL O  120 ? O VAL P 112 
CC 3 4 O HIS O  123 ? O HIS P 115 N PHE O  109 ? N PHE P 101 
CC 4 5 O GLY O  108 ? O GLY P 100 N VAL O  96  ? N VAL P 88  
CC 5 6 N ILE O  97  ? N ILE P 89  O LEU O  139 ? O LEU P 131 
CC 6 7 O ILE O  140 ? O ILE P 132 N VAL O  21  ? N VAL P 13  
CD 1 2 N LYS O  29  ? N LYS P 21  O LEU O  48  ? O LEU P 40  
CE 1 2 N SER O  35  ? N SER P 27  O ARG O  43  ? O ARG P 35  
CF 1 2 N LYS O  156 ? N LYS P 148 O THR O  268 ? O THR P 260 
CF 2 3 O ILE O  266 ? O ILE P 258 N ILE O  246 ? N ILE P 238 
CF 3 4 O SER O  245 ? O SER P 237 N ILE O  227 ? N ILE P 219 
CF 4 5 O ALA O  226 ? O ALA P 218 N ILE O  185 ? N ILE P 177 
CG 1 2 N LYS O  156 ? N LYS P 148 O THR O  268 ? O THR P 260 
CG 2 3 O VAL O  263 ? O VAL P 255 N TYR O  204 ? N TYR P 196 
CH 1 2 N GLN O  171 ? N GLN P 163 O HIS O  178 ? O HIS P 170 
CH 2 3 N ILE O  177 ? N ILE P 169 O LEU O  275 ? O LEU P 267 
CI 1 2 N THR P  52  ? N THR S 44  O GLY P  72  ? O GLY S 64  
CI 2 3 N VAL P  73  ? N VAL S 65  O VAL P  122 ? O VAL S 114 
CI 3 4 O HIS P  123 ? O HIS S 115 N PHE P  109 ? N PHE S 101 
CI 4 5 O GLY P  108 ? O GLY S 100 N VAL P  96  ? N VAL S 88  
CI 5 6 N ILE P  97  ? N ILE S 89  O LEU P  139 ? O LEU S 131 
CI 6 7 O ILE P  140 ? O ILE S 132 N VAL P  21  ? N VAL S 13  
CI 7 8 N GLU P  24  ? N GLU S 16  O MET P  76  ? O MET S 68  
CJ 1 2 N LYS P  29  ? N LYS S 21  O LEU P  48  ? O LEU S 40  
CK 1 2 N SER P  35  ? N SER S 27  O ARG P  43  ? O ARG S 35  
CL 1 2 N LYS P  156 ? N LYS S 148 O THR P  268 ? O THR S 260 
CL 2 3 O MET P  267 ? O MET S 259 N ILE P  246 ? N ILE S 238 
CL 3 4 O GLY P  247 ? O GLY S 239 N VAL P  225 ? N VAL S 217 
CL 4 5 O ALA P  226 ? O ALA S 218 N ILE P  185 ? N ILE S 177 
CM 1 2 N LYS P  156 ? N LYS S 148 O THR P  268 ? O THR S 260 
CM 2 3 O VAL P  263 ? O VAL S 255 N TYR P  204 ? N TYR S 196 
CN 1 2 N GLN P  171 ? N GLN S 163 O HIS P  178 ? O HIS S 170 
CN 2 3 N ILE P  177 ? N ILE S 169 O LEU P  275 ? O LEU S 267 
CO 1 2 N THR Q  52  ? N THR T 44  O GLY Q  72  ? O GLY T 64  
CO 2 3 N VAL Q  75  ? N VAL T 67  O VAL Q  120 ? O VAL T 112 
CO 3 4 O HIS Q  123 ? O HIS T 115 N PHE Q  109 ? N PHE T 101 
CO 4 5 O GLY Q  108 ? O GLY T 100 N VAL Q  96  ? N VAL T 88  
CO 5 6 N GLU Q  95  ? N GLU T 87  O LYS Q  141 ? O LYS T 133 
CO 6 7 O ILE Q  140 ? O ILE T 132 N VAL Q  21  ? N VAL T 13  
CO 7 8 N GLU Q  24  ? N GLU T 16  O MET Q  76  ? O MET T 68  
CP 1 2 N LYS Q  29  ? N LYS T 21  O LEU Q  48  ? O LEU T 40  
CQ 1 2 N SER Q  35  ? N SER T 27  O ARG Q  43  ? O ARG T 35  
CR 1 2 N LYS Q  156 ? N LYS T 148 O THR Q  268 ? O THR T 260 
CR 2 3 O ILE Q  266 ? O ILE T 258 N ILE Q  246 ? N ILE T 238 
CR 3 4 O SER Q  245 ? O SER T 237 N ILE Q  227 ? N ILE T 219 
CR 4 5 O ALA Q  226 ? O ALA T 218 N ILE Q  185 ? N ILE T 177 
CS 1 2 N LYS Q  156 ? N LYS T 148 O THR Q  268 ? O THR T 260 
CS 2 3 O VAL Q  263 ? O VAL T 255 N TYR Q  204 ? N TYR T 196 
CT 1 2 N GLN Q  171 ? N GLN T 163 O HIS Q  178 ? O HIS T 170 
CT 2 3 N ILE Q  177 ? N ILE T 169 O LEU Q  275 ? O LEU T 267 
CU 1 2 N THR R  52  ? N THR U 44  O GLY R  72  ? O GLY U 64  
CU 2 3 N VAL R  75  ? N VAL U 67  O VAL R  120 ? O VAL U 112 
CU 3 4 O LEU R  121 ? O LEU U 113 N THR R  111 ? N THR U 103 
CU 4 5 O GLY R  108 ? O GLY U 100 N VAL R  96  ? N VAL U 88  
CU 5 6 N ILE R  97  ? N ILE U 89  O LEU R  139 ? O LEU U 131 
CU 6 7 O ILE R  140 ? O ILE U 132 N VAL R  21  ? N VAL U 13  
CU 7 8 N GLU R  24  ? N GLU U 16  O MET R  76  ? O MET U 68  
CV 1 2 N SER R  35  ? N SER U 27  O ARG R  43  ? O ARG U 35  
CW 1 2 N LYS R  156 ? N LYS U 148 O THR R  268 ? O THR U 260 
CW 2 3 O ILE R  266 ? O ILE U 258 N ILE R  246 ? N ILE U 238 
CW 3 4 O GLY R  247 ? O GLY U 239 N VAL R  225 ? N VAL U 217 
CW 4 5 O ALA R  226 ? O ALA U 218 N ILE R  185 ? N ILE U 177 
CX 1 2 N LYS R  156 ? N LYS U 148 O THR R  268 ? O THR U 260 
CX 2 3 O VAL R  263 ? O VAL U 255 N TYR R  204 ? N TYR U 196 
CY 1 2 N GLN R  171 ? N GLN U 163 O HIS R  178 ? O HIS U 170 
CY 2 3 N ILE R  177 ? N ILE U 169 O LEU R  275 ? O LEU U 267 
CZ 1 2 N THR S  52  ? N THR V 44  O GLY S  72  ? O GLY V 64  
CZ 2 3 N VAL S  75  ? N VAL V 67  O VAL S  120 ? O VAL V 112 
CZ 3 4 O HIS S  123 ? O HIS V 115 N PHE S  109 ? N PHE V 101 
CZ 4 5 O GLY S  108 ? O GLY V 100 N VAL S  96  ? N VAL V 88  
CZ 5 6 N GLU S  95  ? N GLU V 87  O LYS S  141 ? O LYS V 133 
CZ 6 7 O ILE S  140 ? O ILE V 132 N VAL S  21  ? N VAL V 13  
CZ 7 8 N GLU S  24  ? N GLU V 16  O MET S  76  ? O MET V 68  
DA 1 2 N LYS S  29  ? N LYS V 21  O LEU S  48  ? O LEU V 40  
DB 1 2 N SER S  35  ? N SER V 27  O ARG S  43  ? O ARG V 35  
DC 1 2 N LYS S  156 ? N LYS V 148 O THR S  268 ? O THR V 260 
DC 2 3 O ILE S  266 ? O ILE V 258 N ILE S  246 ? N ILE V 238 
DC 3 4 O SER S  245 ? O SER V 237 N ILE S  227 ? N ILE V 219 
DC 4 5 O ALA S  226 ? O ALA V 218 N ILE S  185 ? N ILE V 177 
DD 1 2 N LYS S  156 ? N LYS V 148 O THR S  268 ? O THR V 260 
DD 2 3 O VAL S  263 ? O VAL V 255 N TYR S  204 ? N TYR V 196 
DE 1 2 N GLN S  171 ? N GLN V 163 O HIS S  178 ? O HIS V 170 
DE 2 3 N ILE S  177 ? N ILE V 169 O LEU S  275 ? O LEU V 267 
DF 1 2 N THR T  52  ? N THR X 44  O GLY T  72  ? O GLY X 64  
DF 2 3 N VAL T  73  ? N VAL X 65  O VAL T  122 ? O VAL X 114 
DF 3 4 O HIS T  123 ? O HIS X 115 N PHE T  109 ? N PHE X 101 
DF 4 5 O GLY T  108 ? O GLY X 100 N VAL T  96  ? N VAL X 88  
DF 5 6 N GLU T  95  ? N GLU X 87  O LYS T  141 ? O LYS X 133 
DF 6 7 O ILE T  140 ? O ILE X 132 N VAL T  21  ? N VAL X 13  
DF 7 8 N GLU T  24  ? N GLU X 16  O MET T  76  ? O MET X 68  
DG 1 2 N SER T  35  ? N SER X 27  O ARG T  43  ? O ARG X 35  
DH 1 2 N LYS T  156 ? N LYS X 148 O THR T  268 ? O THR X 260 
DH 2 3 O MET T  267 ? O MET X 259 N ILE T  246 ? N ILE X 238 
DH 3 4 O LYS T  238 ? O LYS X 230 N ASP T  231 ? N ASP X 223 
DH 4 5 O ALA T  226 ? O ALA X 218 N ILE T  185 ? N ILE X 177 
DI 1 2 N LYS T  156 ? N LYS X 148 O THR T  268 ? O THR X 260 
DI 2 3 O VAL T  263 ? O VAL X 255 N TYR T  204 ? N TYR X 196 
DJ 1 2 N GLN T  171 ? N GLN X 163 O HIS T  178 ? O HIS X 170 
DJ 2 3 N ILE T  177 ? N ILE X 169 O LEU T  275 ? O LEU X 267 
DK 1 2 N THR U  52  ? N THR a 44  O GLY U  72  ? O GLY a 64  
DK 2 3 N VAL U  73  ? N VAL a 65  O VAL U  122 ? O VAL a 114 
DK 3 4 O LEU U  121 ? O LEU a 113 N THR U  111 ? N THR a 103 
DK 4 5 O GLY U  108 ? O GLY a 100 N VAL U  96  ? N VAL a 88  
DK 5 6 N GLU U  95  ? N GLU a 87  O LYS U  141 ? O LYS a 133 
DK 6 7 O ILE U  140 ? O ILE a 132 N VAL U  21  ? N VAL a 13  
DK 7 8 N GLU U  24  ? N GLU a 16  O MET U  76  ? O MET a 68  
DL 1 2 N LYS U  29  ? N LYS a 21  O LEU U  48  ? O LEU a 40  
DM 1 2 N SER U  35  ? N SER a 27  O ARG U  43  ? O ARG a 35  
DN 1 2 N LYS U  156 ? N LYS a 148 O THR U  268 ? O THR a 260 
DN 2 3 O ILE U  266 ? O ILE a 258 N ILE U  246 ? N ILE a 238 
DN 3 4 O SER U  245 ? O SER a 237 N ILE U  227 ? N ILE a 219 
DN 4 5 O ALA U  226 ? O ALA a 218 N ILE U  185 ? N ILE a 177 
DO 1 2 N LYS U  156 ? N LYS a 148 O THR U  268 ? O THR a 260 
DO 2 3 O VAL U  263 ? O VAL a 255 N TYR U  204 ? N TYR a 196 
DP 1 2 N GLN U  171 ? N GLN a 163 O HIS U  178 ? O HIS a 170 
DP 2 3 N ILE U  177 ? N ILE a 169 O LEU U  275 ? O LEU a 267 
DQ 1 2 N THR V  52  ? N THR b 44  O GLY V  72  ? O GLY b 64  
DQ 2 3 N VAL V  73  ? N VAL b 65  O VAL V  122 ? O VAL b 114 
DQ 3 4 O HIS V  119 ? O HIS b 111 N HIS V  114 ? N HIS b 106 
DQ 4 5 O GLY V  108 ? O GLY b 100 N VAL V  96  ? N VAL b 88  
DQ 5 6 N ILE V  97  ? N ILE b 89  O LEU V  139 ? O LEU b 131 
DQ 6 7 O ILE V  138 ? O ILE b 130 N GLY V  23  ? N GLY b 15  
DQ 7 8 N GLU V  24  ? N GLU b 16  O MET V  76  ? O MET b 68  
DR 1 2 N LYS V  29  ? N LYS b 21  O LEU V  48  ? O LEU b 40  
DS 1 2 N SER V  35  ? N SER b 27  O ARG V  43  ? O ARG b 35  
DT 1 2 N LYS V  156 ? N LYS b 148 O THR V  268 ? O THR b 260 
DT 2 3 O ILE V  266 ? O ILE b 258 N ILE V  246 ? N ILE b 238 
DT 3 4 O SER V  245 ? O SER b 237 N ILE V  227 ? N ILE b 219 
DT 4 5 O ALA V  226 ? O ALA b 218 N ILE V  185 ? N ILE b 177 
DU 1 2 N LYS V  156 ? N LYS b 148 O THR V  268 ? O THR b 260 
DU 2 3 O VAL V  263 ? O VAL b 255 N TYR V  204 ? N TYR b 196 
DV 1 2 N GLN V  171 ? N GLN b 163 O HIS V  178 ? O HIS b 170 
DV 2 3 N ILE V  177 ? N ILE b 169 O LEU V  275 ? O LEU b 267 
DW 1 2 N GLU W  24  ? N GLU c 16  O MET W  76  ? O MET c 68  
DW 2 3 N VAL W  73  ? N VAL c 65  O VAL W  122 ? O VAL c 114 
DW 3 4 O HIS W  123 ? O HIS c 115 N PHE W  109 ? N PHE c 101 
DW 4 5 O GLY W  108 ? O GLY c 100 N VAL W  96  ? N VAL c 88  
DW 5 6 N ILE W  97  ? N ILE c 89  O LEU W  139 ? O LEU c 131 
DW 6 7 O ILE W  140 ? O ILE c 132 N VAL W  21  ? N VAL c 13  
DX 1 2 N LYS W  29  ? N LYS c 21  O LEU W  48  ? O LEU c 40  
DY 1 2 N SER W  35  ? N SER c 27  O ARG W  43  ? O ARG c 35  
DZ 1 2 N LYS W  156 ? N LYS c 148 O THR W  268 ? O THR c 260 
DZ 2 3 O ILE W  266 ? O ILE c 258 N ILE W  246 ? N ILE c 238 
DZ 3 4 O LYS W  238 ? O LYS c 230 N ASP W  231 ? N ASP c 223 
DZ 4 5 O ALA W  226 ? O ALA c 218 N ILE W  185 ? N ILE c 177 
EA 1 2 N LYS W  156 ? N LYS c 148 O THR W  268 ? O THR c 260 
EA 2 3 O VAL W  263 ? O VAL c 255 N TYR W  204 ? N TYR c 196 
EB 1 2 N GLN W  171 ? N GLN c 163 O HIS W  178 ? O HIS c 170 
EB 2 3 N ILE W  177 ? N ILE c 169 O LEU W  275 ? O LEU c 267 
EC 1 2 N GLU X  24  ? N GLU d 16  O MET X  76  ? O MET d 68  
EC 2 3 N VAL X  73  ? N VAL d 65  O VAL X  122 ? O VAL d 114 
EC 3 4 O LEU X  121 ? O LEU d 113 N THR X  111 ? N THR d 103 
EC 4 5 O GLY X  108 ? O GLY d 100 N VAL X  96  ? N VAL d 88  
EC 5 6 N ILE X  97  ? N ILE d 89  O LEU X  139 ? O LEU d 131 
EC 6 7 O ILE X  140 ? O ILE d 132 N VAL X  21  ? N VAL d 13  
ED 1 2 N LYS X  29  ? N LYS d 21  O LEU X  48  ? O LEU d 40  
EE 1 2 N SER X  35  ? N SER d 27  O ARG X  43  ? O ARG d 35  
EF 1 2 N LYS X  156 ? N LYS d 148 O THR X  268 ? O THR d 260 
EF 2 3 O ILE X  266 ? O ILE d 258 N ILE X  246 ? N ILE d 238 
EF 3 4 O SER X  245 ? O SER d 237 N ILE X  227 ? N ILE d 219 
EF 4 5 O ALA X  226 ? O ALA d 218 N ILE X  185 ? N ILE d 177 
EG 1 2 N LYS X  156 ? N LYS d 148 O THR X  268 ? O THR d 260 
EG 2 3 O VAL X  263 ? O VAL d 255 N TYR X  204 ? N TYR d 196 
EH 1 2 N GLN X  171 ? N GLN d 163 O HIS X  178 ? O HIS d 170 
EH 2 3 N ILE X  177 ? N ILE d 169 O LEU X  275 ? O LEU d 267 
EI 1 2 N THR Y  52  ? N THR e 44  O GLY Y  72  ? O GLY e 64  
EI 2 3 N VAL Y  75  ? N VAL e 67  O VAL Y  120 ? O VAL e 112 
EI 3 4 O HIS Y  123 ? O HIS e 115 N PHE Y  109 ? N PHE e 101 
EI 4 5 O GLY Y  108 ? O GLY e 100 N VAL Y  96  ? N VAL e 88  
EI 5 6 N ILE Y  97  ? N ILE e 89  O LEU Y  139 ? O LEU e 131 
EI 6 7 O ILE Y  140 ? O ILE e 132 N VAL Y  21  ? N VAL e 13  
EI 7 8 N GLU Y  24  ? N GLU e 16  O MET Y  76  ? O MET e 68  
EJ 1 2 N LYS Y  29  ? N LYS e 21  O LEU Y  48  ? O LEU e 40  
EK 1 2 N SER Y  35  ? N SER e 27  O ARG Y  43  ? O ARG e 35  
EL 1 2 N LYS Y  156 ? N LYS e 148 O THR Y  268 ? O THR e 260 
EL 2 3 O ILE Y  266 ? O ILE e 258 N ILE Y  246 ? N ILE e 238 
EL 3 4 O SER Y  245 ? O SER e 237 N ILE Y  227 ? N ILE e 219 
EL 4 5 O GLN Y  228 ? O GLN e 220 N ILE Y  185 ? N ILE e 177 
EM 1 2 N LYS Y  156 ? N LYS e 148 O THR Y  268 ? O THR e 260 
EM 2 3 O VAL Y  263 ? O VAL e 255 N TYR Y  204 ? N TYR e 196 
EN 1 2 N GLN Y  171 ? N GLN e 163 O HIS Y  178 ? O HIS e 170 
EN 2 3 N ILE Y  177 ? N ILE e 169 O LEU Y  275 ? O LEU e 267 
EO 1 2 N HIS Z  6   ? N HIS g -2  O GLU Z  172 ? O GLU g 164 
EO 2 3 N GLN Z  171 ? N GLN g 163 O HIS Z  178 ? O HIS g 170 
EO 3 4 N ILE Z  177 ? N ILE g 169 O LEU Z  275 ? O LEU g 267 
EP 1 2 N THR Z  52  ? N THR g 44  O GLY Z  72  ? O GLY g 64  
EP 2 3 N VAL Z  75  ? N VAL g 67  O VAL Z  120 ? O VAL g 112 
EP 3 4 O HIS Z  123 ? O HIS g 115 N PHE Z  109 ? N PHE g 101 
EP 4 5 O GLY Z  108 ? O GLY g 100 N VAL Z  96  ? N VAL g 88  
EP 5 6 N ILE Z  97  ? N ILE g 89  O LEU Z  139 ? O LEU g 131 
EP 6 7 O ILE Z  140 ? O ILE g 132 N VAL Z  21  ? N VAL g 13  
EP 7 8 N GLU Z  24  ? N GLU g 16  O MET Z  76  ? O MET g 68  
EQ 1 2 N LYS Z  29  ? N LYS g 21  O LEU Z  48  ? O LEU g 40  
ER 1 2 N SER Z  35  ? N SER g 27  O ARG Z  43  ? O ARG g 35  
ES 1 2 N LYS Z  156 ? N LYS g 148 O THR Z  268 ? O THR g 260 
ES 2 3 O MET Z  267 ? O MET g 259 N ILE Z  246 ? N ILE g 238 
ES 3 4 O SER Z  245 ? O SER g 237 N ILE Z  227 ? N ILE g 219 
ES 4 5 O ALA Z  226 ? O ALA g 218 N ILE Z  185 ? N ILE g 177 
ET 1 2 N LYS Z  156 ? N LYS g 148 O THR Z  268 ? O THR g 260 
ET 2 3 O VAL Z  263 ? O VAL g 255 N TYR Z  204 ? N TYR g 196 
EU 1 2 N THR AA 52  ? N THR h 44  O GLY AA 72  ? O GLY h 64  
EU 2 3 N VAL AA 75  ? N VAL h 67  O VAL AA 120 ? O VAL h 112 
EU 3 4 O HIS AA 123 ? O HIS h 115 N PHE AA 109 ? N PHE h 101 
EU 4 5 O GLY AA 108 ? O GLY h 100 N VAL AA 96  ? N VAL h 88  
EU 5 6 N GLU AA 95  ? N GLU h 87  O LYS AA 141 ? O LYS h 133 
EU 6 7 O ILE AA 140 ? O ILE h 132 N VAL AA 21  ? N VAL h 13  
EU 7 8 N GLU AA 24  ? N GLU h 16  O MET AA 76  ? O MET h 68  
EV 1 2 N LYS AA 29  ? N LYS h 21  O LEU AA 48  ? O LEU h 40  
EW 1 2 N SER AA 35  ? N SER h 27  O ARG AA 43  ? O ARG h 35  
EX 1 2 N LYS AA 156 ? N LYS h 148 O THR AA 268 ? O THR h 260 
EX 2 3 O ILE AA 266 ? O ILE h 258 N ILE AA 246 ? N ILE h 238 
EX 3 4 O LYS AA 238 ? O LYS h 230 N ASP AA 231 ? N ASP h 223 
EX 4 5 O ALA AA 226 ? O ALA h 218 N ILE AA 185 ? N ILE h 177 
EY 1 2 N LYS AA 156 ? N LYS h 148 O THR AA 268 ? O THR h 260 
EY 2 3 O VAL AA 263 ? O VAL h 255 N TYR AA 204 ? N TYR h 196 
EZ 1 2 N GLN AA 171 ? N GLN h 163 O HIS AA 178 ? O HIS h 170 
EZ 2 3 N ILE AA 177 ? N ILE h 169 O LEU AA 275 ? O LEU h 267 
FA 1 2 N THR BA 52  ? N THR i 44  O GLY BA 72  ? O GLY i 64  
FA 2 3 N VAL BA 75  ? N VAL i 67  O VAL BA 120 ? O VAL i 112 
FA 3 4 O HIS BA 123 ? O HIS i 115 N PHE BA 109 ? N PHE i 101 
FA 4 5 O GLY BA 108 ? O GLY i 100 N VAL BA 96  ? N VAL i 88  
FA 5 6 N ILE BA 97  ? N ILE i 89  O LEU BA 139 ? O LEU i 131 
FA 6 7 O ILE BA 140 ? O ILE i 132 N VAL BA 21  ? N VAL i 13  
FA 7 8 N GLU BA 24  ? N GLU i 16  O MET BA 76  ? O MET i 68  
FB 1 2 N LYS BA 29  ? N LYS i 21  O LEU BA 48  ? O LEU i 40  
FC 1 2 N SER BA 35  ? N SER i 27  O ARG BA 43  ? O ARG i 35  
FD 1 2 N LYS BA 156 ? N LYS i 148 O THR BA 268 ? O THR i 260 
FD 2 3 O ILE BA 266 ? O ILE i 258 N ILE BA 246 ? N ILE i 238 
FD 3 4 O LYS BA 238 ? O LYS i 230 N ASP BA 231 ? N ASP i 223 
FD 4 5 O ALA BA 226 ? O ALA i 218 N ILE BA 185 ? N ILE i 177 
FE 1 2 N LYS BA 156 ? N LYS i 148 O THR BA 268 ? O THR i 260 
FE 2 3 O VAL BA 263 ? O VAL i 255 N TYR BA 204 ? N TYR i 196 
FF 1 2 N GLN BA 171 ? N GLN i 163 O HIS BA 178 ? O HIS i 170 
FF 2 3 N ILE BA 177 ? N ILE i 169 O LEU BA 275 ? O LEU i 267 
FG 1 2 N THR CA 52  ? N THR j 44  O GLY CA 72  ? O GLY j 64  
FG 2 3 N VAL CA 75  ? N VAL j 67  O VAL CA 120 ? O VAL j 112 
FG 3 4 O LEU CA 121 ? O LEU j 113 N THR CA 111 ? N THR j 103 
FG 4 5 O GLY CA 108 ? O GLY j 100 N VAL CA 96  ? N VAL j 88  
FG 5 6 N GLU CA 95  ? N GLU j 87  O LYS CA 141 ? O LYS j 133 
FG 6 7 O ILE CA 140 ? O ILE j 132 N VAL CA 21  ? N VAL j 13  
FG 7 8 N GLU CA 24  ? N GLU j 16  O MET CA 76  ? O MET j 68  
FH 1 2 N SER CA 35  ? N SER j 27  O ARG CA 43  ? O ARG j 35  
FI 1 2 N LYS CA 156 ? N LYS j 148 O THR CA 268 ? O THR j 260 
FI 2 3 O ILE CA 266 ? O ILE j 258 N ILE CA 246 ? N ILE j 238 
FI 3 4 O SER CA 245 ? O SER j 237 N ILE CA 227 ? N ILE j 219 
FI 4 5 O ALA CA 226 ? O ALA j 218 N ILE CA 185 ? N ILE j 177 
FJ 1 2 N LYS CA 156 ? N LYS j 148 O THR CA 268 ? O THR j 260 
FJ 2 3 O VAL CA 263 ? O VAL j 255 N TYR CA 204 ? N TYR j 196 
FK 1 2 N GLN CA 171 ? N GLN j 163 O HIS CA 178 ? O HIS j 170 
FK 2 3 N VAL CA 179 ? N VAL j 171 O GLU CA 277 ? O GLU j 269 
FL 1 2 N GLU DA 24  ? N GLU k 16  O MET DA 76  ? O MET k 68  
FL 2 3 N VAL DA 75  ? N VAL k 67  O VAL DA 120 ? O VAL k 112 
FL 3 4 O HIS DA 123 ? O HIS k 115 N PHE DA 109 ? N PHE k 101 
FL 4 5 O GLY DA 108 ? O GLY k 100 N VAL DA 96  ? N VAL k 88  
FL 5 6 N ILE DA 97  ? N ILE k 89  O LEU DA 139 ? O LEU k 131 
FL 6 7 O ILE DA 140 ? O ILE k 132 N VAL DA 21  ? N VAL k 13  
FM 1 2 N LYS DA 29  ? N LYS k 21  O LEU DA 48  ? O LEU k 40  
FN 1 2 N SER DA 35  ? N SER k 27  O ARG DA 43  ? O ARG k 35  
FO 1 2 N LYS DA 156 ? N LYS k 148 O THR DA 268 ? O THR k 260 
FO 2 3 O ILE DA 266 ? O ILE k 258 N ILE DA 246 ? N ILE k 238 
FO 3 4 O GLY DA 247 ? O GLY k 239 N VAL DA 225 ? N VAL k 217 
FO 4 5 O ALA DA 226 ? O ALA k 218 N ILE DA 185 ? N ILE k 177 
FP 1 2 N LYS DA 156 ? N LYS k 148 O THR DA 268 ? O THR k 260 
FP 2 3 O VAL DA 263 ? O VAL k 255 N TYR DA 204 ? N TYR k 196 
FQ 1 2 N GLN DA 171 ? N GLN k 163 O HIS DA 178 ? O HIS k 170 
FQ 2 3 N ILE DA 177 ? N ILE k 169 O LEU DA 275 ? O LEU k 267 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL A 283' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL A 284' 
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A 285' 
AC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL B 283' 
AC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL B 284' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL B 285' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL C 283' 
AC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL C 284' 
AC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL C 285' 
BC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL D 283' 
BC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL D 284' 
BC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL D 285' 
BC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL E 283' 
BC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL E 284' 
BC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL G 283' 
BC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL G 284' 
BC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL G 285' 
BC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL H 283' 
CC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL H 284' 
CC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL H 285' 
CC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL I 283' 
CC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL I 284' 
CC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL I 285' 
CC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL J 283' 
CC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL J 284' 
CC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL K 283' 
CC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL K 284' 
DC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL L 283' 
DC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL L 284' 
DC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL L 285' 
DC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL M 283' 
DC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL M 284' 
DC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL M 285' 
DC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL N 283' 
DC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL N 284' 
DC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL N 285' 
EC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL O 283' 
EC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL O 284' 
EC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL O 285' 
EC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL P 283' 
EC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL P 284' 
EC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL S 283' 
EC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL S 284' 
EC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL S 285' 
EC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL T 283' 
FC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL T 284' 
FC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL T 285' 
FC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL U 283' 
FC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL U 284' 
FC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL U 285' 
FC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL V 283' 
FC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL V 284' 
FC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL V 285' 
FC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL X 283' 
GC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL X 284' 
GC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL X 285' 
GC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL a 283' 
GC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CL a 284' 
GC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL a 285' 
GC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL b 283' 
GC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL b 284' 
GC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL b 285' 
GC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL c 283' 
HC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL c 284' 
HC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL c 285' 
HC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL d 283' 
HC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL d 284' 
HC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL d 285' 
HC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL e 283' 
HC7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL e 284' 
HC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL e 285' 
HC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL g 283' 
IC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL g 284' 
IC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL h 283' 
IC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL h 284' 
IC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL h 285' 
IC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL i 283' 
IC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL i 284' 
IC7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL i 285' 
IC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL j 283' 
IC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL j 284' 
JC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL j 285' 
JC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL k 283' 
JC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL k 284' 
JC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL k 285' 
JC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL k 286' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 1 HIS A  188 ? HIS A 180  . ? 1_555 ? 
2   AC2 5 LYS A  56  ? LYS A 48   . ? 1_555 ? 
3   AC2 5 VAL A  57  ? VAL A 49   . ? 1_555 ? 
4   AC2 5 HIS A  123 ? HIS A 115  . ? 1_555 ? 
5   AC2 5 HOH MD .   ? HOH A 333  . ? 1_555 ? 
6   AC2 5 HOH MD .   ? HOH A 391  . ? 1_555 ? 
7   AC3 3 HIS A  152 ? HIS A 144  . ? 1_555 ? 
8   AC3 3 PRO A  153 ? PRO A 145  . ? 1_555 ? 
9   AC3 3 ASP A  154 ? ASP A 146  . ? 1_555 ? 
10  AC4 1 HIS B  188 ? HIS B 180  . ? 1_555 ? 
11  AC5 5 LYS B  56  ? LYS B 48   . ? 1_555 ? 
12  AC5 5 VAL B  57  ? VAL B 49   . ? 1_555 ? 
13  AC5 5 HIS B  123 ? HIS B 115  . ? 1_555 ? 
14  AC5 5 HOH ND .   ? HOH B 318  . ? 1_555 ? 
15  AC5 5 HOH ND .   ? HOH B 341  . ? 1_555 ? 
16  AC6 4 HIS B  152 ? HIS B 144  . ? 1_555 ? 
17  AC6 4 PRO B  153 ? PRO B 145  . ? 1_555 ? 
18  AC6 4 ASP B  154 ? ASP B 146  . ? 1_555 ? 
19  AC6 4 LYS B  273 ? LYS B 265  . ? 1_555 ? 
20  AC7 4 LYS C  56  ? LYS C 48   . ? 1_555 ? 
21  AC7 4 VAL C  57  ? VAL C 49   . ? 1_555 ? 
22  AC7 4 HIS C  123 ? HIS C 115  . ? 1_555 ? 
23  AC7 4 HOH OD .   ? HOH C 357  . ? 1_555 ? 
24  AC8 3 HIS C  152 ? HIS C 144  . ? 1_555 ? 
25  AC8 3 ASP C  154 ? ASP C 146  . ? 1_555 ? 
26  AC8 3 LYS C  273 ? LYS C 265  . ? 1_555 ? 
27  AC9 1 HIS C  188 ? HIS C 180  . ? 1_555 ? 
28  BC1 3 HIS D  188 ? HIS D 180  . ? 1_555 ? 
29  BC1 3 HOH PD .   ? HOH D 302  . ? 1_555 ? 
30  BC1 3 HIS F  188 ? HIS G 180  . ? 1_555 ? 
31  BC2 5 LYS D  56  ? LYS D 48   . ? 1_555 ? 
32  BC2 5 VAL D  57  ? VAL D 49   . ? 1_555 ? 
33  BC2 5 HIS D  123 ? HIS D 115  . ? 1_555 ? 
34  BC2 5 HOH PD .   ? HOH D 322  . ? 1_555 ? 
35  BC2 5 HOH PD .   ? HOH D 341  . ? 1_555 ? 
36  BC3 4 HIS D  152 ? HIS D 144  . ? 1_555 ? 
37  BC3 4 PRO D  153 ? PRO D 145  . ? 1_555 ? 
38  BC3 4 ASP D  154 ? ASP D 146  . ? 1_555 ? 
39  BC3 4 LYS D  273 ? LYS D 265  . ? 1_555 ? 
40  BC4 5 LYS E  56  ? LYS E 48   . ? 1_555 ? 
41  BC4 5 VAL E  57  ? VAL E 49   . ? 1_555 ? 
42  BC4 5 HIS E  123 ? HIS E 115  . ? 1_555 ? 
43  BC4 5 HOH QD .   ? HOH E 304  . ? 1_555 ? 
44  BC4 5 HOH QD .   ? HOH E 342  . ? 1_555 ? 
45  BC5 3 HIS E  152 ? HIS E 144  . ? 1_555 ? 
46  BC5 3 ASP E  154 ? ASP E 146  . ? 1_555 ? 
47  BC5 3 LYS E  273 ? LYS E 265  . ? 1_555 ? 
48  BC6 4 HIS D  188 ? HIS D 180  . ? 1_555 ? 
49  BC6 4 ALA F  187 ? ALA G 179  . ? 1_555 ? 
50  BC6 4 HIS F  188 ? HIS G 180  . ? 1_555 ? 
51  BC6 4 HOH RD .   ? HOH G 578  . ? 1_555 ? 
52  BC7 4 LYS F  56  ? LYS G 48   . ? 1_555 ? 
53  BC7 4 VAL F  57  ? VAL G 49   . ? 1_555 ? 
54  BC7 4 HIS F  123 ? HIS G 115  . ? 1_555 ? 
55  BC7 4 HOH RD .   ? HOH G 2477 . ? 1_555 ? 
56  BC8 3 HIS F  152 ? HIS G 144  . ? 1_555 ? 
57  BC8 3 ASP F  154 ? ASP G 146  . ? 1_555 ? 
58  BC8 3 HOH RD .   ? HOH G 5358 . ? 1_555 ? 
59  BC9 2 HIS G  188 ? HIS H 180  . ? 1_555 ? 
60  BC9 2 HOH SD .   ? HOH H 4664 . ? 1_555 ? 
61  CC1 5 LYS G  56  ? LYS H 48   . ? 1_555 ? 
62  CC1 5 VAL G  57  ? VAL H 49   . ? 1_555 ? 
63  CC1 5 HIS G  123 ? HIS H 115  . ? 1_555 ? 
64  CC1 5 HOH SD .   ? HOH H 406  . ? 1_555 ? 
65  CC1 5 HOH SD .   ? HOH H 2732 . ? 1_555 ? 
66  CC2 3 HIS G  152 ? HIS H 144  . ? 1_555 ? 
67  CC2 3 PRO G  153 ? PRO H 145  . ? 1_555 ? 
68  CC2 3 ASP G  154 ? ASP H 146  . ? 1_555 ? 
69  CC3 4 LYS H  56  ? LYS I 48   . ? 1_555 ? 
70  CC3 4 VAL H  57  ? VAL I 49   . ? 1_555 ? 
71  CC3 4 HIS H  123 ? HIS I 115  . ? 1_555 ? 
72  CC3 4 HOH TD .   ? HOH I 410  . ? 1_555 ? 
73  CC4 3 HIS H  152 ? HIS I 144  . ? 1_555 ? 
74  CC4 3 PRO H  153 ? PRO I 145  . ? 1_555 ? 
75  CC4 3 ASP H  154 ? ASP I 146  . ? 1_555 ? 
76  CC5 4 HIS C  188 ? HIS C 180  . ? 1_555 ? 
77  CC5 4 HIS H  188 ? HIS I 180  . ? 1_555 ? 
78  CC5 4 HOH TD .   ? HOH I 2480 . ? 1_555 ? 
79  CC5 4 HOH TD .   ? HOH I 3966 . ? 1_555 ? 
80  CC6 1 HIS I  188 ? HIS J 180  . ? 1_555 ? 
81  CC7 3 VAL I  57  ? VAL J 49   . ? 1_555 ? 
82  CC7 3 HIS I  123 ? HIS J 115  . ? 1_555 ? 
83  CC7 3 HOH UD .   ? HOH J 2649 . ? 1_555 ? 
84  CC8 5 LYS J  56  ? LYS K 48   . ? 1_555 ? 
85  CC8 5 VAL J  57  ? VAL K 49   . ? 1_555 ? 
86  CC8 5 HIS J  123 ? HIS K 115  . ? 1_555 ? 
87  CC8 5 HOH VD .   ? HOH K 395  . ? 1_555 ? 
88  CC8 5 HOH VD .   ? HOH K 4077 . ? 1_555 ? 
89  CC9 4 HIS J  152 ? HIS K 144  . ? 1_555 ? 
90  CC9 4 PRO J  153 ? PRO K 145  . ? 1_555 ? 
91  CC9 4 ASP J  154 ? ASP K 146  . ? 1_555 ? 
92  CC9 4 HOH VD .   ? HOH K 4249 . ? 1_555 ? 
93  DC1 2 HIS K  188 ? HIS L 180  . ? 1_555 ? 
94  DC1 2 HIS S  188 ? HIS V 180  . ? 1_555 ? 
95  DC2 5 LYS K  56  ? LYS L 48   . ? 1_555 ? 
96  DC2 5 VAL K  57  ? VAL L 49   . ? 1_555 ? 
97  DC2 5 HIS K  123 ? HIS L 115  . ? 1_555 ? 
98  DC2 5 HOH WD .   ? HOH L 1028 . ? 1_555 ? 
99  DC2 5 HOH WD .   ? HOH L 1086 . ? 1_555 ? 
100 DC3 3 HIS K  152 ? HIS L 144  . ? 1_555 ? 
101 DC3 3 ASP K  154 ? ASP L 146  . ? 1_555 ? 
102 DC3 3 LYS K  273 ? LYS L 265  . ? 1_555 ? 
103 DC4 2 HIS L  188 ? HIS M 180  . ? 1_555 ? 
104 DC4 2 HIS T  188 ? HIS X 180  . ? 1_555 ? 
105 DC5 5 LYS L  56  ? LYS M 48   . ? 1_555 ? 
106 DC5 5 VAL L  57  ? VAL M 49   . ? 1_555 ? 
107 DC5 5 HIS L  123 ? HIS M 115  . ? 1_555 ? 
108 DC5 5 HOH XD .   ? HOH M 835  . ? 1_555 ? 
109 DC5 5 HOH XD .   ? HOH M 1038 . ? 1_555 ? 
110 DC6 4 HIS L  152 ? HIS M 144  . ? 1_555 ? 
111 DC6 4 PRO L  153 ? PRO M 145  . ? 1_555 ? 
112 DC6 4 ASP L  154 ? ASP M 146  . ? 1_555 ? 
113 DC6 4 LYS L  273 ? LYS M 265  . ? 1_555 ? 
114 DC7 5 LYS M  56  ? LYS N 48   . ? 1_555 ? 
115 DC7 5 VAL M  57  ? VAL N 49   . ? 1_555 ? 
116 DC7 5 HIS M  123 ? HIS N 115  . ? 1_555 ? 
117 DC7 5 HOH YD .   ? HOH N 754  . ? 1_555 ? 
118 DC7 5 HOH YD .   ? HOH N 956  . ? 1_555 ? 
119 DC8 3 HIS M  152 ? HIS N 144  . ? 1_555 ? 
120 DC8 3 PRO M  153 ? PRO N 145  . ? 1_555 ? 
121 DC8 3 ASP M  154 ? ASP N 146  . ? 1_555 ? 
122 DC9 3 ALA M  187 ? ALA N 179  . ? 1_555 ? 
123 DC9 3 HIS M  188 ? HIS N 180  . ? 1_555 ? 
124 DC9 3 HOH YD .   ? HOH N 762  . ? 1_555 ? 
125 EC1 3 HIS N  188 ? HIS O 180  . ? 1_555 ? 
126 EC1 3 HIS P  188 ? HIS S 180  . ? 1_555 ? 
127 EC1 3 HOH BE .   ? HOH S 3536 . ? 1_555 ? 
128 EC2 5 LYS N  56  ? LYS O 48   . ? 1_555 ? 
129 EC2 5 VAL N  57  ? VAL O 49   . ? 1_555 ? 
130 EC2 5 HIS N  123 ? HIS O 115  . ? 1_555 ? 
131 EC2 5 HOH ZD .   ? HOH O 869  . ? 1_555 ? 
132 EC2 5 HOH ZD .   ? HOH O 961  . ? 1_555 ? 
133 EC3 4 HIS N  152 ? HIS O 144  . ? 1_555 ? 
134 EC3 4 PRO N  153 ? PRO O 145  . ? 1_555 ? 
135 EC3 4 ASP N  154 ? ASP O 146  . ? 1_555 ? 
136 EC3 4 LYS N  273 ? LYS O 265  . ? 1_555 ? 
137 EC4 5 LYS O  56  ? LYS P 48   . ? 1_555 ? 
138 EC4 5 VAL O  57  ? VAL P 49   . ? 1_555 ? 
139 EC4 5 HIS O  123 ? HIS P 115  . ? 1_555 ? 
140 EC4 5 HOH AE .   ? HOH P 780  . ? 1_555 ? 
141 EC4 5 HOH AE .   ? HOH P 970  . ? 1_555 ? 
142 EC5 4 HIS O  152 ? HIS P 144  . ? 1_555 ? 
143 EC5 4 PRO O  153 ? PRO P 145  . ? 1_555 ? 
144 EC5 4 ASP O  154 ? ASP P 146  . ? 1_555 ? 
145 EC5 4 LYS O  273 ? LYS P 265  . ? 1_555 ? 
146 EC6 1 HIS P  188 ? HIS S 180  . ? 1_555 ? 
147 EC7 3 LYS P  56  ? LYS S 48   . ? 1_555 ? 
148 EC7 3 VAL P  57  ? VAL S 49   . ? 1_555 ? 
149 EC7 3 HIS P  123 ? HIS S 115  . ? 1_555 ? 
150 EC8 3 HIS P  152 ? HIS S 144  . ? 1_555 ? 
151 EC8 3 PRO P  153 ? PRO S 145  . ? 1_555 ? 
152 EC8 3 ASP P  154 ? ASP S 146  . ? 1_555 ? 
153 EC9 1 HIS Q  188 ? HIS T 180  . ? 1_555 ? 
154 FC1 5 LYS Q  56  ? LYS T 48   . ? 1_555 ? 
155 FC1 5 VAL Q  57  ? VAL T 49   . ? 1_555 ? 
156 FC1 5 HIS Q  123 ? HIS T 115  . ? 1_555 ? 
157 FC1 5 HOH CE .   ? HOH T 1220 . ? 1_555 ? 
158 FC1 5 HOH CE .   ? HOH T 3434 . ? 1_555 ? 
159 FC2 3 HIS Q  152 ? HIS T 144  . ? 1_555 ? 
160 FC2 3 ASP Q  154 ? ASP T 146  . ? 1_555 ? 
161 FC2 3 LYS Q  273 ? LYS T 265  . ? 1_555 ? 
162 FC3 4 LYS R  56  ? LYS U 48   . ? 1_555 ? 
163 FC3 4 VAL R  57  ? VAL U 49   . ? 1_555 ? 
164 FC3 4 HIS R  123 ? HIS U 115  . ? 1_555 ? 
165 FC3 4 HOH DE .   ? HOH U 1137 . ? 1_555 ? 
166 FC4 3 HIS R  152 ? HIS U 144  . ? 1_555 ? 
167 FC4 3 PRO R  153 ? PRO U 145  . ? 1_555 ? 
168 FC4 3 ASP R  154 ? ASP U 146  . ? 1_555 ? 
169 FC5 3 ALA R  187 ? ALA U 179  . ? 1_555 ? 
170 FC5 3 HIS R  188 ? HIS U 180  . ? 1_555 ? 
171 FC5 3 HOH DE .   ? HOH U 1144 . ? 1_555 ? 
172 FC6 1 HIS S  188 ? HIS V 180  . ? 1_555 ? 
173 FC7 5 LYS S  56  ? LYS V 48   . ? 1_555 ? 
174 FC7 5 VAL S  57  ? VAL V 49   . ? 1_555 ? 
175 FC7 5 HIS S  123 ? HIS V 115  . ? 1_555 ? 
176 FC7 5 HOH EE .   ? HOH V 1250 . ? 1_555 ? 
177 FC7 5 HOH EE .   ? HOH V 1325 . ? 1_555 ? 
178 FC8 4 HIS S  152 ? HIS V 144  . ? 1_555 ? 
179 FC8 4 PRO S  153 ? PRO V 145  . ? 1_555 ? 
180 FC8 4 ASP S  154 ? ASP V 146  . ? 1_555 ? 
181 FC8 4 HOH EE .   ? HOH V 3198 . ? 1_555 ? 
182 FC9 3 LYS T  56  ? LYS X 48   . ? 1_555 ? 
183 FC9 3 VAL T  57  ? VAL X 49   . ? 1_555 ? 
184 FC9 3 HIS T  123 ? HIS X 115  . ? 1_555 ? 
185 GC1 4 HIS T  152 ? HIS X 144  . ? 1_555 ? 
186 GC1 4 PRO T  153 ? PRO X 145  . ? 1_555 ? 
187 GC1 4 ASP T  154 ? ASP X 146  . ? 1_555 ? 
188 GC1 4 LYS T  273 ? LYS X 265  . ? 1_555 ? 
189 GC2 1 HIS T  188 ? HIS X 180  . ? 1_555 ? 
190 GC3 3 HIS U  188 ? HIS a 180  . ? 1_555 ? 
191 GC3 3 HOH GE .   ? HOH a 3557 . ? 1_555 ? 
192 GC3 3 HIS CA 188 ? HIS j 180  . ? 1_555 ? 
193 GC4 6 LYS U  56  ? LYS a 48   . ? 1_555 ? 
194 GC4 6 VAL U  57  ? VAL a 49   . ? 1_555 ? 
195 GC4 6 GLY U  72  ? GLY a 64   . ? 1_555 ? 
196 GC4 6 HIS U  123 ? HIS a 115  . ? 1_555 ? 
197 GC4 6 HOH GE .   ? HOH a 1748 . ? 1_555 ? 
198 GC4 6 HOH GE .   ? HOH a 1807 . ? 1_555 ? 
199 GC5 4 HIS U  152 ? HIS a 144  . ? 1_555 ? 
200 GC5 4 PRO U  153 ? PRO a 145  . ? 1_555 ? 
201 GC5 4 ASP U  154 ? ASP a 146  . ? 1_555 ? 
202 GC5 4 LYS U  273 ? LYS a 265  . ? 1_555 ? 
203 GC6 3 ALA V  187 ? ALA b 179  . ? 1_555 ? 
204 GC6 3 HIS V  188 ? HIS b 180  . ? 1_555 ? 
205 GC6 3 HIS DA 188 ? HIS k 180  . ? 1_555 ? 
206 GC7 5 LYS V  56  ? LYS b 48   . ? 1_555 ? 
207 GC7 5 VAL V  57  ? VAL b 49   . ? 1_555 ? 
208 GC7 5 HIS V  123 ? HIS b 115  . ? 1_555 ? 
209 GC7 5 HOH HE .   ? HOH b 1556 . ? 1_555 ? 
210 GC7 5 HOH HE .   ? HOH b 1759 . ? 1_555 ? 
211 GC8 3 HIS V  152 ? HIS b 144  . ? 1_555 ? 
212 GC8 3 ASP V  154 ? ASP b 146  . ? 1_555 ? 
213 GC8 3 LYS V  273 ? LYS b 265  . ? 1_555 ? 
214 GC9 5 LYS W  56  ? LYS c 48   . ? 1_555 ? 
215 GC9 5 VAL W  57  ? VAL c 49   . ? 1_555 ? 
216 GC9 5 HIS W  123 ? HIS c 115  . ? 1_555 ? 
217 GC9 5 HOH IE .   ? HOH c 1469 . ? 1_555 ? 
218 GC9 5 HOH IE .   ? HOH c 1679 . ? 1_555 ? 
219 HC1 4 HIS W  152 ? HIS c 144  . ? 1_555 ? 
220 HC1 4 PRO W  153 ? PRO c 145  . ? 1_555 ? 
221 HC1 4 ASP W  154 ? ASP c 146  . ? 1_555 ? 
222 HC1 4 LYS W  273 ? LYS c 265  . ? 1_555 ? 
223 HC2 3 HIS W  188 ? HIS c 180  . ? 1_555 ? 
224 HC2 3 HOH IE .   ? HOH c 4185 . ? 1_555 ? 
225 HC2 3 HIS BA 188 ? HIS i 180  . ? 1_555 ? 
226 HC3 3 ALA X  187 ? ALA d 179  . ? 1_555 ? 
227 HC3 3 HIS X  188 ? HIS d 180  . ? 1_555 ? 
228 HC3 3 HIS Z  188 ? HIS g 180  . ? 1_555 ? 
229 HC4 5 LYS X  56  ? LYS d 48   . ? 1_555 ? 
230 HC4 5 VAL X  57  ? VAL d 49   . ? 1_555 ? 
231 HC4 5 HIS X  123 ? HIS d 115  . ? 1_555 ? 
232 HC4 5 HOH JE .   ? HOH d 1589 . ? 1_555 ? 
233 HC4 5 HOH JE .   ? HOH d 1683 . ? 1_555 ? 
234 HC5 4 HIS X  152 ? HIS d 144  . ? 1_555 ? 
235 HC5 4 PRO X  153 ? PRO d 145  . ? 1_555 ? 
236 HC5 4 ASP X  154 ? ASP d 146  . ? 1_555 ? 
237 HC5 4 LYS X  273 ? LYS d 265  . ? 1_555 ? 
238 HC6 5 LYS Y  56  ? LYS e 48   . ? 1_555 ? 
239 HC6 5 VAL Y  57  ? VAL e 49   . ? 1_555 ? 
240 HC6 5 HIS Y  123 ? HIS e 115  . ? 1_555 ? 
241 HC6 5 HOH KE .   ? HOH e 1494 . ? 1_555 ? 
242 HC6 5 HOH KE .   ? HOH e 1691 . ? 1_555 ? 
243 HC7 2 HIS Y  188 ? HIS e 180  . ? 1_555 ? 
244 HC7 2 HIS AA 188 ? HIS h 180  . ? 1_555 ? 
245 HC8 4 HIS Y  152 ? HIS e 144  . ? 1_555 ? 
246 HC8 4 PRO Y  153 ? PRO e 145  . ? 1_555 ? 
247 HC8 4 ASP Y  154 ? ASP e 146  . ? 1_555 ? 
248 HC8 4 LYS Y  273 ? LYS e 265  . ? 1_555 ? 
249 HC9 2 HIS Z  188 ? HIS g 180  . ? 1_555 ? 
250 HC9 2 HOH LE .   ? HOH g 2003 . ? 1_555 ? 
251 IC1 4 LYS Z  56  ? LYS g 48   . ? 1_555 ? 
252 IC1 4 VAL Z  57  ? VAL g 49   . ? 1_555 ? 
253 IC1 4 HIS Z  123 ? HIS g 115  . ? 1_555 ? 
254 IC1 4 HOH LE .   ? HOH g 2073 . ? 1_555 ? 
255 IC2 1 HIS AA 188 ? HIS h 180  . ? 1_555 ? 
256 IC3 4 LYS AA 56  ? LYS h 48   . ? 1_555 ? 
257 IC3 4 VAL AA 57  ? VAL h 49   . ? 1_555 ? 
258 IC3 4 HIS AA 123 ? HIS h 115  . ? 1_555 ? 
259 IC3 4 HOH ME .   ? HOH h 2083 . ? 1_555 ? 
260 IC4 3 HIS AA 152 ? HIS h 144  . ? 1_555 ? 
261 IC4 3 PRO AA 153 ? PRO h 145  . ? 1_555 ? 
262 IC4 3 ASP AA 154 ? ASP h 146  . ? 1_555 ? 
263 IC5 5 LYS BA 56  ? LYS i 48   . ? 1_555 ? 
264 IC5 5 VAL BA 57  ? VAL i 49   . ? 1_555 ? 
265 IC5 5 HIS BA 123 ? HIS i 115  . ? 1_555 ? 
266 IC5 5 HOH NE .   ? HOH i 1855 . ? 1_555 ? 
267 IC5 5 HOH NE .   ? HOH i 2029 . ? 1_555 ? 
268 IC6 3 HIS BA 152 ? HIS i 144  . ? 1_555 ? 
269 IC6 3 PRO BA 153 ? PRO i 145  . ? 1_555 ? 
270 IC6 3 ASP BA 154 ? ASP i 146  . ? 1_555 ? 
271 IC7 2 HIS BA 188 ? HIS i 180  . ? 1_555 ? 
272 IC7 2 HOH NE .   ? HOH i 1861 . ? 1_555 ? 
273 IC8 2 HIS U  188 ? HIS a 180  . ? 1_555 ? 
274 IC8 2 HIS CA 188 ? HIS j 180  . ? 1_555 ? 
275 IC9 3 VAL CA 57  ? VAL j 49   . ? 1_555 ? 
276 IC9 3 HIS CA 123 ? HIS j 115  . ? 1_555 ? 
277 IC9 3 HOH OE .   ? HOH j 1961 . ? 1_555 ? 
278 JC1 4 HIS CA 152 ? HIS j 144  . ? 1_555 ? 
279 JC1 4 PRO CA 153 ? PRO j 145  . ? 1_555 ? 
280 JC1 4 ASP CA 154 ? ASP j 146  . ? 1_555 ? 
281 JC1 4 LYS CA 273 ? LYS j 265  . ? 1_555 ? 
282 JC2 4 LYS DA 56  ? LYS k 48   . ? 1_555 ? 
283 JC2 4 VAL DA 57  ? VAL k 49   . ? 1_555 ? 
284 JC2 4 HIS DA 123 ? HIS k 115  . ? 1_555 ? 
285 JC2 4 HOH PE .   ? HOH k 1879 . ? 1_555 ? 
286 JC3 2 HOH OE .   ? HOH j 2034 . ? 1_555 ? 
287 JC3 2 ASN DA 12  ? ASN k 4    . ? 1_555 ? 
288 JC4 2 HIS V  188 ? HIS b 180  . ? 1_555 ? 
289 JC4 2 HIS DA 188 ? HIS k 180  . ? 1_555 ? 
290 JC5 3 HIS DA 152 ? HIS k 144  . ? 1_555 ? 
291 JC5 3 PRO DA 153 ? PRO k 145  . ? 1_555 ? 
292 JC5 3 ASP DA 154 ? ASP k 146  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3N99 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3N99 
_atom_sites.fract_transf_matrix[1][1]   0.003450 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003339 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003164 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . GLY A  1 7   ? -20.503  85.843  -1.096  1.00 50.24 ? -1   GLY A N   1 
ATOM   2     C  CA  . GLY A  1 7   ? -19.330  85.534  -0.210  1.00 50.62 ? -1   GLY A CA  1 
ATOM   3     C  C   . GLY A  1 7   ? -19.366  86.391  1.068   1.00 50.36 ? -1   GLY A C   1 
ATOM   4     O  O   . GLY A  1 7   ? -20.448  86.634  1.646   1.00 50.80 ? -1   GLY A O   1 
ATOM   5     N  N   . HIS A  1 8   ? -18.206  86.895  1.496   1.00 49.20 ? 0    HIS A N   1 
ATOM   6     C  CA  . HIS A  1 8   ? -18.099  87.575  2.792   1.00 48.23 ? 0    HIS A CA  1 
ATOM   7     C  C   . HIS A  1 8   ? -17.533  88.979  2.754   1.00 45.52 ? 0    HIS A C   1 
ATOM   8     O  O   . HIS A  1 8   ? -16.847  89.362  1.836   1.00 44.25 ? 0    HIS A O   1 
ATOM   9     C  CB  . HIS A  1 8   ? -17.313  86.673  3.717   1.00 49.15 ? 0    HIS A CB  1 
ATOM   10    C  CG  . HIS A  1 8   ? -17.974  85.341  3.906   1.00 55.49 ? 0    HIS A CG  1 
ATOM   11    N  ND1 . HIS A  1 8   ? -17.337  84.133  3.641   1.00 61.22 ? 0    HIS A ND1 1 
ATOM   12    C  CD2 . HIS A  1 8   ? -19.249  85.023  4.279   1.00 59.85 ? 0    HIS A CD2 1 
ATOM   13    C  CE1 . HIS A  1 8   ? -18.181  83.131  3.862   1.00 63.05 ? 0    HIS A CE1 1 
ATOM   14    N  NE2 . HIS A  1 8   ? -19.347  83.640  4.249   1.00 63.12 ? 0    HIS A NE2 1 
ATOM   15    N  N   . MET A  1 9   ? -17.852  89.771  3.756   1.00 48.70 ? 1    MET A N   1 
ATOM   16    C  CA  . MET A  1 9   ? -17.328  91.119  3.810   1.00 47.27 ? 1    MET A CA  1 
ATOM   17    C  C   . MET A  1 9   ? -15.787  91.084  3.879   1.00 44.99 ? 1    MET A C   1 
ATOM   18    O  O   . MET A  1 9   ? -15.206  90.145  4.388   1.00 43.77 ? 1    MET A O   1 
ATOM   19    C  CB  . MET A  1 9   ? -17.954  91.900  4.967   1.00 47.39 ? 1    MET A CB  1 
ATOM   20    C  CG  . MET A  1 9   ? -19.453  92.017  4.888   1.00 47.59 ? 1    MET A CG  1 
ATOM   21    S  SD  . MET A  1 9   ? -20.118  93.291  5.957   1.00 47.39 ? 1    MET A SD  1 
ATOM   22    C  CE  . MET A  1 9   ? -20.325  92.320  7.410   1.00 48.64 ? 1    MET A CE  1 
ATOM   23    N  N   . ARG A  1 10  ? -15.134  92.090  3.311   1.00 42.83 ? 2    ARG A N   1 
ATOM   24    C  CA  . ARG A  1 10  ? -13.682  92.170  3.369   1.00 41.45 ? 2    ARG A CA  1 
ATOM   25    C  C   . ARG A  1 10  ? -13.216  92.499  4.806   1.00 38.01 ? 2    ARG A C   1 
ATOM   26    O  O   . ARG A  1 10  ? -13.670  93.471  5.386   1.00 35.39 ? 2    ARG A O   1 
ATOM   27    C  CB  . ARG A  1 10  ? -13.157  93.251  2.418   1.00 42.40 ? 2    ARG A CB  1 
ATOM   28    C  CG  . ARG A  1 10  ? -12.407  92.762  1.192   1.00 45.51 ? 2    ARG A CG  1 
ATOM   29    C  CD  . ARG A  1 10  ? -11.423  93.794  0.610   1.00 45.64 ? 2    ARG A CD  1 
ATOM   30    N  NE  . ARG A  1 10  ? -11.807  95.187  0.854   1.00 45.42 ? 2    ARG A NE  1 
ATOM   31    C  CZ  . ARG A  1 10  ? -10.989  96.132  1.309   1.00 46.34 ? 2    ARG A CZ  1 
ATOM   32    N  NH1 . ARG A  1 10  ? -9.723   95.875  1.567   1.00 47.41 ? 2    ARG A NH1 1 
ATOM   33    N  NH2 . ARG A  1 10  ? -11.427  97.358  1.493   1.00 45.91 ? 2    ARG A NH2 1 
ATOM   34    N  N   . THR A  1 11  ? -12.311  91.693  5.348   1.00 35.26 ? 3    THR A N   1 
ATOM   35    C  CA  . THR A  1 11  ? -11.777  91.942  6.694   1.00 34.04 ? 3    THR A CA  1 
ATOM   36    C  C   . THR A  1 11  ? -10.269  91.863  6.779   1.00 33.85 ? 3    THR A C   1 
ATOM   37    O  O   . THR A  1 11  ? -9.608   91.337  5.885   1.00 34.34 ? 3    THR A O   1 
ATOM   38    C  CB  . THR A  1 11  ? -12.339  90.973  7.732   1.00 33.40 ? 3    THR A CB  1 
ATOM   39    O  OG1 . THR A  1 11  ? -11.836  89.666  7.483   1.00 31.60 ? 3    THR A OG1 1 
ATOM   40    C  CG2 . THR A  1 11  ? -13.886  90.957  7.718   1.00 30.55 ? 3    THR A CG2 1 
ATOM   41    N  N   . ASN A  1 12  ? -9.719   92.360  7.879   1.00 32.35 ? 4    ASN A N   1 
ATOM   42    C  CA  . ASN A  1 12  ? -8.307   92.164  8.188   1.00 31.63 ? 4    ASN A CA  1 
ATOM   43    C  C   . ASN A  1 12  ? -8.000   90.843  8.914   1.00 32.30 ? 4    ASN A C   1 
ATOM   44    O  O   . ASN A  1 12  ? -7.058   90.776  9.713   1.00 31.34 ? 4    ASN A O   1 
ATOM   45    C  CB  . ASN A  1 12  ? -7.832   93.308  9.059   1.00 30.65 ? 4    ASN A CB  1 
ATOM   46    C  CG  . ASN A  1 12  ? -8.484   93.301  10.414  1.00 28.62 ? 4    ASN A CG  1 
ATOM   47    O  OD1 . ASN A  1 12  ? -9.521   92.671  10.610  1.00 27.03 ? 4    ASN A OD1 1 
ATOM   48    N  ND2 . ASN A  1 12  ? -7.867   93.945  11.360  1.00 23.81 ? 4    ASN A ND2 1 
ATOM   49    N  N   . LYS A  1 13  ? -8.784   89.805  8.677   1.00 33.06 ? 5    LYS A N   1 
ATOM   50    C  CA  . LYS A  1 13  ? -8.669   88.620  9.473   1.00 35.47 ? 5    LYS A CA  1 
ATOM   51    C  C   . LYS A  1 13  ? -7.309   87.914  9.410   1.00 36.66 ? 5    LYS A C   1 
ATOM   52    O  O   . LYS A  1 13  ? -6.876   87.311  10.387  1.00 35.63 ? 5    LYS A O   1 
ATOM   53    C  CB  . LYS A  1 13  ? -9.812   87.671  9.221   1.00 36.41 ? 5    LYS A CB  1 
ATOM   54    C  CG  . LYS A  1 13  ? -9.741   86.726  8.093   1.00 41.92 ? 5    LYS A CG  1 
ATOM   55    C  CD  . LYS A  1 13  ? -10.845  85.648  8.318   1.00 46.99 ? 5    LYS A CD  1 
ATOM   56    C  CE  . LYS A  1 13  ? -11.013  84.689  7.154   1.00 50.73 ? 5    LYS A CE  1 
ATOM   57    N  NZ  . LYS A  1 13  ? -11.970  83.603  7.587   1.00 54.66 ? 5    LYS A NZ  1 
ATOM   58    N  N   . ASP A  1 14  ? -6.618   88.034  8.292   1.00 37.65 ? 6    ASP A N   1 
ATOM   59    C  CA  . ASP A  1 14  ? -5.292   87.427  8.159   1.00 39.71 ? 6    ASP A CA  1 
ATOM   60    C  C   . ASP A  1 14  ? -4.252   88.077  9.084   1.00 38.71 ? 6    ASP A C   1 
ATOM   61    O  O   . ASP A  1 14  ? -3.277   87.446  9.472   1.00 39.20 ? 6    ASP A O   1 
ATOM   62    C  CB  . ASP A  1 14  ? -4.859   87.450  6.666   1.00 40.96 ? 6    ASP A CB  1 
ATOM   63    C  CG  . ASP A  1 14  ? -5.660   86.402  5.787   1.00 45.65 ? 6    ASP A CG  1 
ATOM   64    O  OD1 . ASP A  1 14  ? -6.442   85.553  6.330   1.00 48.95 ? 6    ASP A OD1 1 
ATOM   65    O  OD2 . ASP A  1 14  ? -5.520   86.438  4.533   1.00 53.20 ? 6    ASP A OD2 1 
ATOM   66    N  N   . ARG A  1 15  ? -4.502   89.312  9.489   1.00 37.56 ? 7    ARG A N   1 
ATOM   67    C  CA  . ARG A  1 15  ? -3.601   90.047  10.357  1.00 37.22 ? 7    ARG A CA  1 
ATOM   68    C  C   . ARG A  1 15  ? -3.924   89.955  11.842  1.00 34.17 ? 7    ARG A C   1 
ATOM   69    O  O   . ARG A  1 15  ? -3.259   90.611  12.654  1.00 33.26 ? 7    ARG A O   1 
ATOM   70    C  CB  . ARG A  1 15  ? -3.625   91.518  9.948   1.00 38.36 ? 7    ARG A CB  1 
ATOM   71    C  CG  . ARG A  1 15  ? -3.073   91.704  8.536   1.00 45.24 ? 7    ARG A CG  1 
ATOM   72    C  CD  . ARG A  1 15  ? -3.646   92.972  7.897   1.00 54.75 ? 7    ARG A CD  1 
ATOM   73    N  NE  . ARG A  1 15  ? -2.925   94.190  8.280   1.00 63.26 ? 7    ARG A NE  1 
ATOM   74    C  CZ  . ARG A  1 15  ? -1.741   94.567  7.773   1.00 69.44 ? 7    ARG A CZ  1 
ATOM   75    N  NH1 . ARG A  1 15  ? -1.117   93.796  6.857   1.00 70.82 ? 7    ARG A NH1 1 
ATOM   76    N  NH2 . ARG A  1 15  ? -1.170   95.707  8.194   1.00 70.61 ? 7    ARG A NH2 1 
ATOM   77    N  N   . LEU A  1 16  ? -4.951   89.200  12.191  1.00 31.12 ? 8    LEU A N   1 
ATOM   78    C  CA  . LEU A  1 16  ? -5.357   89.098  13.589  1.00 30.23 ? 8    LEU A CA  1 
ATOM   79    C  C   . LEU A  1 16  ? -4.465   88.095  14.289  1.00 28.81 ? 8    LEU A C   1 
ATOM   80    O  O   . LEU A  1 16  ? -4.024   87.158  13.679  1.00 28.45 ? 8    LEU A O   1 
ATOM   81    C  CB  . LEU A  1 16  ? -6.811   88.678  13.743  1.00 29.15 ? 8    LEU A CB  1 
ATOM   82    C  CG  . LEU A  1 16  ? -7.829   89.695  13.218  1.00 28.98 ? 8    LEU A CG  1 
ATOM   83    C  CD1 . LEU A  1 16  ? -9.196   89.111  13.360  1.00 27.08 ? 8    LEU A CD1 1 
ATOM   84    C  CD2 . LEU A  1 16  ? -7.731   91.059  13.886  1.00 27.28 ? 8    LEU A CD2 1 
ATOM   85    N  N   . VAL A  1 17  ? -4.189   88.344  15.560  1.00 27.35 ? 9    VAL A N   1 
ATOM   86    C  CA  . VAL A  1 17  ? -3.349   87.466  16.367  1.00 26.93 ? 9    VAL A CA  1 
ATOM   87    C  C   . VAL A  1 17  ? -4.204   86.441  17.075  1.00 26.37 ? 9    VAL A C   1 
ATOM   88    O  O   . VAL A  1 17  ? -5.222   86.793  17.657  1.00 25.74 ? 9    VAL A O   1 
ATOM   89    C  CB  . VAL A  1 17  ? -2.510   88.274  17.391  1.00 27.13 ? 9    VAL A CB  1 
ATOM   90    C  CG1 . VAL A  1 17  ? -1.582   87.347  18.161  1.00 24.85 ? 9    VAL A CG1 1 
ATOM   91    C  CG2 . VAL A  1 17  ? -1.696   89.327  16.629  1.00 25.44 ? 9    VAL A CG2 1 
ATOM   92    N  N   . ARG A  1 18  ? -3.821   85.175  16.935  1.00 26.20 ? 10   ARG A N   1 
ATOM   93    C  CA  A ARG A  1 18  ? -4.491   84.073  17.632  0.50 25.68 ? 10   ARG A CA  1 
ATOM   94    C  CA  B ARG A  1 18  ? -4.477   84.044  17.588  0.50 25.94 ? 10   ARG A CA  1 
ATOM   95    C  C   . ARG A  1 18  ? -3.590   83.640  18.772  1.00 25.64 ? 10   ARG A C   1 
ATOM   96    O  O   . ARG A  1 18  ? -2.385   83.422  18.591  1.00 25.13 ? 10   ARG A O   1 
ATOM   97    C  CB  A ARG A  1 18  ? -4.798   82.890  16.702  0.50 26.00 ? 10   ARG A CB  1 
ATOM   98    C  CB  B ARG A  1 18  ? -4.627   82.886  16.578  0.50 26.50 ? 10   ARG A CB  1 
ATOM   99    C  CG  A ARG A  1 18  ? -5.470   81.672  17.410  0.50 26.50 ? 10   ARG A CG  1 
ATOM   100   C  CG  B ARG A  1 18  ? -5.987   82.157  16.594  0.50 27.87 ? 10   ARG A CG  1 
ATOM   101   C  CD  A ARG A  1 18  ? -6.124   80.621  16.419  0.50 27.43 ? 10   ARG A CD  1 
ATOM   102   C  CD  B ARG A  1 18  ? -6.193   81.140  15.394  0.50 29.67 ? 10   ARG A CD  1 
ATOM   103   N  NE  A ARG A  1 18  ? -5.175   80.075  15.457  0.50 26.76 ? 10   ARG A NE  1 
ATOM   104   N  NE  B ARG A  1 18  ? -6.065   81.787  14.091  0.50 29.02 ? 10   ARG A NE  1 
ATOM   105   C  CZ  A ARG A  1 18  ? -4.900   78.786  15.362  0.50 28.88 ? 10   ARG A CZ  1 
ATOM   106   C  CZ  B ARG A  1 18  ? -5.107   81.514  13.221  0.50 29.95 ? 10   ARG A CZ  1 
ATOM   107   N  NH1 A ARG A  1 18  ? -5.533   77.974  16.168  0.50 30.68 ? 10   ARG A NH1 1 
ATOM   108   N  NH1 B ARG A  1 18  ? -5.067   82.176  12.057  0.50 31.59 ? 10   ARG A NH1 1 
ATOM   109   N  NH2 A ARG A  1 18  ? -4.008   78.309  14.476  0.50 27.02 ? 10   ARG A NH2 1 
ATOM   110   N  NH2 B ARG A  1 18  ? -4.196   80.580  13.508  0.50 28.19 ? 10   ARG A NH2 1 
ATOM   111   N  N   . ILE A  1 19  ? -4.179   83.519  19.963  1.00 25.01 ? 11   ILE A N   1 
ATOM   112   C  CA  . ILE A  1 19  ? -3.416   83.409  21.190  1.00 25.31 ? 11   ILE A CA  1 
ATOM   113   C  C   . ILE A  1 19  ? -4.097   82.578  22.274  1.00 25.18 ? 11   ILE A C   1 
ATOM   114   O  O   . ILE A  1 19  ? -5.315   82.648  22.445  1.00 25.05 ? 11   ILE A O   1 
ATOM   115   C  CB  . ILE A  1 19  ? -3.052   84.829  21.709  1.00 25.15 ? 11   ILE A CB  1 
ATOM   116   C  CG1 . ILE A  1 19  ? -1.930   84.779  22.740  1.00 26.67 ? 11   ILE A CG1 1 
ATOM   117   C  CG2 . ILE A  1 19  ? -4.212   85.498  22.303  1.00 24.28 ? 11   ILE A CG2 1 
ATOM   118   C  CD1 . ILE A  1 19  ? -1.311   86.161  23.031  1.00 24.62 ? 11   ILE A CD1 1 
ATOM   119   N  N   . SER A  1 20  ? -3.284   81.786  22.986  1.00 24.62 ? 12   SER A N   1 
ATOM   120   C  CA  . SER A  1 20  ? -3.730   80.935  24.108  1.00 24.25 ? 12   SER A CA  1 
ATOM   121   C  C   . SER A  1 20  ? -4.240   81.765  25.263  1.00 24.26 ? 12   SER A C   1 
ATOM   122   O  O   . SER A  1 20  ? -3.496   82.534  25.840  1.00 24.31 ? 12   SER A O   1 
ATOM   123   C  CB  . SER A  1 20  ? -2.579   80.062  24.628  1.00 24.75 ? 12   SER A CB  1 
ATOM   124   O  OG  . SER A  1 20  ? -1.580   80.878  25.218  1.00 21.51 ? 12   SER A OG  1 
ATOM   125   N  N   . VAL A  1 21  ? -5.520   81.604  25.591  1.00 24.27 ? 13   VAL A N   1 
ATOM   126   C  CA  . VAL A  1 21  ? -6.129   82.235  26.751  1.00 23.72 ? 13   VAL A CA  1 
ATOM   127   C  C   . VAL A  1 21  ? -6.507   81.085  27.687  1.00 23.62 ? 13   VAL A C   1 
ATOM   128   O  O   . VAL A  1 21  ? -7.162   80.134  27.286  1.00 25.19 ? 13   VAL A O   1 
ATOM   129   C  CB  . VAL A  1 21  ? -7.306   83.146  26.352  1.00 23.47 ? 13   VAL A CB  1 
ATOM   130   C  CG1 . VAL A  1 21  ? -8.201   83.506  27.564  1.00 22.52 ? 13   VAL A CG1 1 
ATOM   131   C  CG2 . VAL A  1 21  ? -6.773   84.409  25.740  1.00 22.99 ? 13   VAL A CG2 1 
ATOM   132   N  N   . VAL A  1 22  ? -6.018   81.147  28.906  1.00 23.77 ? 14   VAL A N   1 
ATOM   133   C  CA  . VAL A  1 22  ? -6.122   80.066  29.879  1.00 23.97 ? 14   VAL A CA  1 
ATOM   134   C  C   . VAL A  1 22  ? -7.152   80.444  30.936  1.00 23.58 ? 14   VAL A C   1 
ATOM   135   O  O   . VAL A  1 22  ? -7.240   81.644  31.335  1.00 22.58 ? 14   VAL A O   1 
ATOM   136   C  CB  . VAL A  1 22  ? -4.775   79.829  30.672  1.00 25.12 ? 14   VAL A CB  1 
ATOM   137   C  CG1 . VAL A  1 22  ? -4.263   81.110  31.367  1.00 23.23 ? 14   VAL A CG1 1 
ATOM   138   C  CG2 . VAL A  1 22  ? -4.956   78.761  31.734  1.00 27.09 ? 14   VAL A CG2 1 
ATOM   139   N  N   . GLY A  1 23  ? -7.886   79.417  31.390  1.00 22.86 ? 15   GLY A N   1 
ATOM   140   C  CA  . GLY A  1 23  ? -8.689   79.496  32.577  1.00 23.25 ? 15   GLY A CA  1 
ATOM   141   C  C   . GLY A  1 23  ? -8.944   78.138  33.193  1.00 23.78 ? 15   GLY A C   1 
ATOM   142   O  O   . GLY A  1 23  ? -8.310   77.148  32.844  1.00 24.58 ? 15   GLY A O   1 
ATOM   143   N  N   . GLU A  1 24  ? -9.879   78.082  34.120  1.00 23.93 ? 16   GLU A N   1 
ATOM   144   C  CA  . GLU A  1 24  ? -10.315  76.813  34.666  1.00 24.72 ? 16   GLU A CA  1 
ATOM   145   C  C   . GLU A  1 24  ? -11.821  76.791  34.911  1.00 23.48 ? 16   GLU A C   1 
ATOM   146   O  O   . GLU A  1 24  ? -12.444  77.823  35.016  1.00 23.94 ? 16   GLU A O   1 
ATOM   147   C  CB  . GLU A  1 24  ? -9.564   76.536  35.975  1.00 25.81 ? 16   GLU A CB  1 
ATOM   148   C  CG  . GLU A  1 24  ? -9.877   77.501  37.087  1.00 27.94 ? 16   GLU A CG  1 
ATOM   149   C  CD  . GLU A  1 24  ? -8.958   77.322  38.282  1.00 32.13 ? 16   GLU A CD  1 
ATOM   150   O  OE1 . GLU A  1 24  ? -7.710   77.391  38.111  1.00 33.95 ? 16   GLU A OE1 1 
ATOM   151   O  OE2 . GLU A  1 24  ? -9.487   77.116  39.395  1.00 32.44 ? 16   GLU A OE2 1 
ATOM   152   N  N   . ILE A  1 25  ? -12.403  75.612  35.043  1.00 23.20 ? 17   ILE A N   1 
ATOM   153   C  CA  . ILE A  1 25  ? -13.844  75.538  35.240  1.00 22.30 ? 17   ILE A CA  1 
ATOM   154   C  C   . ILE A  1 25  ? -14.162  76.114  36.617  1.00 21.84 ? 17   ILE A C   1 
ATOM   155   O  O   . ILE A  1 25  ? -13.649  75.660  37.630  1.00 21.96 ? 17   ILE A O   1 
ATOM   156   C  CB  . ILE A  1 25  ? -14.363  74.096  35.076  1.00 22.55 ? 17   ILE A CB  1 
ATOM   157   C  CG1 . ILE A  1 25  ? -14.064  73.597  33.659  1.00 22.41 ? 17   ILE A CG1 1 
ATOM   158   C  CG2 . ILE A  1 25  ? -15.858  74.011  35.348  1.00 20.80 ? 17   ILE A CG2 1 
ATOM   159   C  CD1 . ILE A  1 25  ? -14.600  72.157  33.340  1.00 21.46 ? 17   ILE A CD1 1 
ATOM   160   N  N   . ALA A  1 26  ? -14.968  77.158  36.613  1.00 21.95 ? 18   ALA A N   1 
ATOM   161   C  CA  . ALA A  1 26  ? -15.449  77.857  37.822  1.00 22.15 ? 18   ALA A CA  1 
ATOM   162   C  C   . ALA A  1 26  ? -16.395  76.992  38.647  1.00 22.36 ? 18   ALA A C   1 
ATOM   163   O  O   . ALA A  1 26  ? -17.172  76.182  38.112  1.00 22.79 ? 18   ALA A O   1 
ATOM   164   C  CB  . ALA A  1 26  ? -16.187  79.184  37.450  1.00 20.80 ? 18   ALA A CB  1 
ATOM   165   N  N   . PRO A  1 27  ? -16.320  77.130  39.959  1.00 22.81 ? 19   PRO A N   1 
ATOM   166   C  CA  . PRO A  1 27  ? -17.366  76.526  40.786  1.00 23.10 ? 19   PRO A CA  1 
ATOM   167   C  C   . PRO A  1 27  ? -18.676  77.287  40.616  1.00 23.03 ? 19   PRO A C   1 
ATOM   168   O  O   . PRO A  1 27  ? -18.675  78.396  40.095  1.00 22.85 ? 19   PRO A O   1 
ATOM   169   C  CB  . PRO A  1 27  ? -16.843  76.757  42.220  1.00 22.94 ? 19   PRO A CB  1 
ATOM   170   C  CG  . PRO A  1 27  ? -16.083  78.021  42.109  1.00 23.67 ? 19   PRO A CG  1 
ATOM   171   C  CD  . PRO A  1 27  ? -15.396  77.964  40.751  1.00 22.31 ? 19   PRO A CD  1 
ATOM   172   N  N   . ALA A  1 28  ? -19.776  76.687  41.065  1.00 23.86 ? 20   ALA A N   1 
ATOM   173   C  CA  . ALA A  1 28  ? -21.051  77.397  41.296  1.00 23.76 ? 20   ALA A CA  1 
ATOM   174   C  C   . ALA A  1 28  ? -20.735  78.476  42.344  1.00 24.38 ? 20   ALA A C   1 
ATOM   175   O  O   . ALA A  1 28  ? -20.032  78.198  43.292  1.00 24.38 ? 20   ALA A O   1 
ATOM   176   C  CB  . ALA A  1 28  ? -22.124  76.400  41.775  1.00 22.82 ? 20   ALA A CB  1 
ATOM   177   N  N   . LYS A  1 29  ? -21.176  79.710  42.126  1.00 25.21 ? 21   LYS A N   1 
ATOM   178   C  CA  . LYS A  1 29  ? -20.916  80.815  43.032  1.00 26.64 ? 21   LYS A CA  1 
ATOM   179   C  C   . LYS A  1 29  ? -22.208  81.422  43.539  1.00 28.21 ? 21   LYS A C   1 
ATOM   180   O  O   . LYS A  1 29  ? -23.167  81.625  42.765  1.00 28.25 ? 21   LYS A O   1 
ATOM   181   C  CB  . LYS A  1 29  ? -20.123  81.950  42.348  1.00 26.59 ? 21   LYS A CB  1 
ATOM   182   C  CG  . LYS A  1 29  ? -18.730  81.531  41.894  1.00 27.16 ? 21   LYS A CG  1 
ATOM   183   C  CD  . LYS A  1 29  ? -18.005  82.671  41.217  1.00 25.14 ? 21   LYS A CD  1 
ATOM   184   C  CE  . LYS A  1 29  ? -16.580  82.257  40.779  1.00 23.81 ? 21   LYS A CE  1 
ATOM   185   N  NZ  . LYS A  1 29  ? -15.837  83.296  39.924  1.00 23.36 ? 21   LYS A NZ  1 
ATOM   186   N  N   . MET A  1 30  ? -22.216  81.726  44.839  1.00 29.85 ? 22   MET A N   1 
ATOM   187   C  CA  . MET A  1 30  ? -23.276  82.454  45.482  1.00 31.59 ? 22   MET A CA  1 
ATOM   188   C  C   . MET A  1 30  ? -22.642  83.262  46.608  1.00 33.54 ? 22   MET A C   1 
ATOM   189   O  O   . MET A  1 30  ? -21.953  82.716  47.487  1.00 32.29 ? 22   MET A O   1 
ATOM   190   C  CB  . MET A  1 30  ? -24.343  81.522  46.117  1.00 31.84 ? 22   MET A CB  1 
ATOM   191   C  CG  . MET A  1 30  ? -24.898  80.429  45.250  1.00 32.64 ? 22   MET A CG  1 
ATOM   192   S  SD  . MET A  1 30  ? -26.229  79.442  45.986  1.00 33.43 ? 22   MET A SD  1 
ATOM   193   C  CE  . MET A  1 30  ? -27.510  80.687  46.235  1.00 32.03 ? 22   MET A CE  1 
ATOM   194   N  N   . ARG A  1 31  ? -22.934  84.555  46.616  1.00 36.08 ? 23   ARG A N   1 
ATOM   195   C  CA  . ARG A  1 31  ? -22.483  85.425  47.704  1.00 38.67 ? 23   ARG A CA  1 
ATOM   196   C  C   . ARG A  1 31  ? -23.433  85.431  48.913  1.00 37.37 ? 23   ARG A C   1 
ATOM   197   O  O   . ARG A  1 31  ? -23.081  85.895  49.982  1.00 38.12 ? 23   ARG A O   1 
ATOM   198   C  CB  . ARG A  1 31  ? -22.194  86.816  47.131  1.00 40.70 ? 23   ARG A CB  1 
ATOM   199   C  CG  . ARG A  1 31  ? -20.759  86.797  46.430  1.00 50.38 ? 23   ARG A CG  1 
ATOM   200   C  CD  . ARG A  1 31  ? -20.331  87.992  45.498  1.00 63.13 ? 23   ARG A CD  1 
ATOM   201   N  NE  . ARG A  1 31  ? -20.627  89.337  46.025  1.00 73.73 ? 23   ARG A NE  1 
ATOM   202   C  CZ  . ARG A  1 31  ? -21.759  90.019  45.791  1.00 82.43 ? 23   ARG A CZ  1 
ATOM   203   N  NH1 . ARG A  1 31  ? -22.739  89.502  45.034  1.00 85.59 ? 23   ARG A NH1 1 
ATOM   204   N  NH2 . ARG A  1 31  ? -21.930  91.228  46.320  1.00 84.81 ? 23   ARG A NH2 1 
ATOM   205   N  N   . SER A  1 32  ? -24.610  84.847  48.750  1.00 35.37 ? 24   SER A N   1 
ATOM   206   C  CA  . SER A  1 32  ? -25.626  84.728  49.813  1.00 34.28 ? 24   SER A CA  1 
ATOM   207   C  C   . SER A  1 32  ? -26.512  83.526  49.416  1.00 33.51 ? 24   SER A C   1 
ATOM   208   O  O   . SER A  1 32  ? -26.594  83.161  48.227  1.00 32.73 ? 24   SER A O   1 
ATOM   209   C  CB  . SER A  1 32  ? -26.475  86.015  49.880  1.00 34.80 ? 24   SER A CB  1 
ATOM   210   O  OG  . SER A  1 32  ? -27.693  85.864  50.614  1.00 34.10 ? 24   SER A OG  1 
ATOM   211   N  N   . PRO A  1 33  ? -27.195  82.913  50.380  1.00 33.00 ? 25   PRO A N   1 
ATOM   212   C  CA  . PRO A  1 33  ? -28.180  81.892  49.959  1.00 32.55 ? 25   PRO A CA  1 
ATOM   213   C  C   . PRO A  1 33  ? -29.347  82.531  49.180  1.00 32.46 ? 25   PRO A C   1 
ATOM   214   O  O   . PRO A  1 33  ? -29.956  81.878  48.257  1.00 31.80 ? 25   PRO A O   1 
ATOM   215   C  CB  . PRO A  1 33  ? -28.655  81.298  51.260  1.00 32.63 ? 25   PRO A CB  1 
ATOM   216   C  CG  . PRO A  1 33  ? -28.183  82.254  52.325  1.00 33.93 ? 25   PRO A CG  1 
ATOM   217   C  CD  . PRO A  1 33  ? -27.092  83.058  51.831  1.00 33.10 ? 25   PRO A CD  1 
ATOM   218   N  N   . TYR A  1 34  ? -29.591  83.809  49.500  1.00 31.75 ? 26   TYR A N   1 
ATOM   219   C  CA  . TYR A  1 34  ? -30.717  84.553  48.913  1.00 32.64 ? 26   TYR A CA  1 
ATOM   220   C  C   . TYR A  1 34  ? -30.414  85.385  47.663  1.00 32.28 ? 26   TYR A C   1 
ATOM   221   O  O   . TYR A  1 34  ? -29.349  86.014  47.575  1.00 32.35 ? 26   TYR A O   1 
ATOM   222   C  CB  . TYR A  1 34  ? -31.302  85.487  49.979  1.00 32.93 ? 26   TYR A CB  1 
ATOM   223   C  CG  . TYR A  1 34  ? -31.868  84.775  51.195  1.00 32.53 ? 26   TYR A CG  1 
ATOM   224   C  CD1 . TYR A  1 34  ? -32.860  83.811  51.052  1.00 31.74 ? 26   TYR A CD1 1 
ATOM   225   C  CD2 . TYR A  1 34  ? -31.440  85.095  52.490  1.00 33.75 ? 26   TYR A CD2 1 
ATOM   226   C  CE1 . TYR A  1 34  ? -33.425  83.171  52.136  1.00 31.59 ? 26   TYR A CE1 1 
ATOM   227   C  CE2 . TYR A  1 34  ? -32.013  84.452  53.608  1.00 34.39 ? 26   TYR A CE2 1 
ATOM   228   C  CZ  . TYR A  1 34  ? -33.020  83.486  53.400  1.00 33.07 ? 26   TYR A CZ  1 
ATOM   229   O  OH  . TYR A  1 34  ? -33.611  82.817  54.448  1.00 33.16 ? 26   TYR A OH  1 
ATOM   230   N  N   . SER A  1 35  ? -31.375  85.397  46.732  1.00 32.09 ? 27   SER A N   1 
ATOM   231   C  CA  . SER A  1 35  ? -31.450  86.405  45.653  1.00 31.91 ? 27   SER A CA  1 
ATOM   232   C  C   . SER A  1 35  ? -32.632  87.337  45.934  1.00 32.41 ? 27   SER A C   1 
ATOM   233   O  O   . SER A  1 35  ? -33.721  86.865  46.247  1.00 32.04 ? 27   SER A O   1 
ATOM   234   C  CB  . SER A  1 35  ? -31.622  85.759  44.273  1.00 31.62 ? 27   SER A CB  1 
ATOM   235   O  OG  . SER A  1 35  ? -30.636  84.768  44.037  1.00 32.22 ? 27   SER A OG  1 
ATOM   236   N  N   . VAL A  1 36  ? -32.397  88.650  45.808  1.00 32.58 ? 28   VAL A N   1 
ATOM   237   C  CA  . VAL A  1 36  ? -33.379  89.691  46.123  1.00 32.87 ? 28   VAL A CA  1 
ATOM   238   C  C   . VAL A  1 36  ? -34.139  90.096  44.854  1.00 33.49 ? 28   VAL A C   1 
ATOM   239   O  O   . VAL A  1 36  ? -33.546  90.476  43.863  1.00 33.48 ? 28   VAL A O   1 
ATOM   240   C  CB  . VAL A  1 36  ? -32.695  90.938  46.773  1.00 33.30 ? 28   VAL A CB  1 
ATOM   241   C  CG1 . VAL A  1 36  ? -33.706  91.980  47.109  1.00 31.59 ? 28   VAL A CG1 1 
ATOM   242   C  CG2 . VAL A  1 36  ? -31.896  90.518  48.033  1.00 32.44 ? 28   VAL A CG2 1 
ATOM   243   N  N   . THR A  1 37  ? -35.466  89.996  44.889  1.00 34.85 ? 29   THR A N   1 
ATOM   244   C  CA  . THR A  1 37  ? -36.297  90.242  43.707  1.00 34.55 ? 29   THR A CA  1 
ATOM   245   C  C   . THR A  1 37  ? -36.531  91.718  43.576  1.00 36.26 ? 29   THR A C   1 
ATOM   246   O  O   . THR A  1 37  ? -36.244  92.493  44.493  1.00 35.77 ? 29   THR A O   1 
ATOM   247   C  CB  . THR A  1 37  ? -37.661  89.517  43.811  1.00 34.88 ? 29   THR A CB  1 
ATOM   248   O  OG1 . THR A  1 37  ? -38.419  90.043  44.922  1.00 34.12 ? 29   THR A OG1 1 
ATOM   249   C  CG2 . THR A  1 37  ? -37.425  88.000  44.016  1.00 33.01 ? 29   THR A CG2 1 
ATOM   250   N  N   . THR A  1 38  ? -37.105  92.114  42.459  1.00 38.24 ? 30   THR A N   1 
ATOM   251   C  CA  . THR A  1 38  ? -37.460  93.495  42.221  1.00 39.93 ? 30   THR A CA  1 
ATOM   252   C  C   . THR A  1 38  ? -38.546  93.921  43.166  1.00 40.19 ? 30   THR A C   1 
ATOM   253   O  O   . THR A  1 38  ? -38.679  95.071  43.444  1.00 41.13 ? 30   THR A O   1 
ATOM   254   C  CB  . THR A  1 38  ? -37.909  93.760  40.786  1.00 40.32 ? 30   THR A CB  1 
ATOM   255   O  OG1 . THR A  1 38  ? -38.843  92.778  40.394  1.00 45.72 ? 30   THR A OG1 1 
ATOM   256   C  CG2 . THR A  1 38  ? -36.818  93.666  39.874  1.00 39.24 ? 30   THR A CG2 1 
ATOM   257   N  N   . GLU A  1 39  ? -39.301  92.949  43.645  1.00 39.99 ? 31   GLU A N   1 
ATOM   258   C  CA  . GLU A  1 39  ? -40.366  93.132  44.603  1.00 40.54 ? 31   GLU A CA  1 
ATOM   259   C  C   . GLU A  1 39  ? -39.949  93.208  46.089  1.00 39.61 ? 31   GLU A C   1 
ATOM   260   O  O   . GLU A  1 39  ? -40.764  93.413  46.927  1.00 40.23 ? 31   GLU A O   1 
ATOM   261   C  CB  . GLU A  1 39  ? -41.420  92.050  44.405  1.00 41.58 ? 31   GLU A CB  1 
ATOM   262   C  CG  . GLU A  1 39  ? -41.909  91.842  42.962  1.00 47.83 ? 31   GLU A CG  1 
ATOM   263   C  CD  . GLU A  1 39  ? -40.994  90.945  42.079  1.00 56.20 ? 31   GLU A CD  1 
ATOM   264   O  OE1 . GLU A  1 39  ? -40.865  89.741  42.330  1.00 59.02 ? 31   GLU A OE1 1 
ATOM   265   O  OE2 . GLU A  1 39  ? -40.419  91.447  41.110  1.00 60.04 ? 31   GLU A OE2 1 
ATOM   266   N  N   . GLY A  1 40  ? -38.677  93.048  46.392  1.00 37.53 ? 32   GLY A N   1 
ATOM   267   C  CA  . GLY A  1 40  ? -38.182  93.132  47.733  1.00 37.19 ? 32   GLY A CA  1 
ATOM   268   C  C   . GLY A  1 40  ? -38.384  91.892  48.558  1.00 36.19 ? 32   GLY A C   1 
ATOM   269   O  O   . GLY A  1 40  ? -38.459  91.956  49.740  1.00 35.64 ? 32   GLY A O   1 
ATOM   270   N  N   . THR A  1 41  ? -38.476  90.765  47.898  1.00 34.50 ? 33   THR A N   1 
ATOM   271   C  CA  . THR A  1 41  ? -38.535  89.480  48.560  1.00 33.86 ? 33   THR A CA  1 
ATOM   272   C  C   . THR A  1 41  ? -37.271  88.678  48.223  1.00 33.59 ? 33   THR A C   1 
ATOM   273   O  O   . THR A  1 41  ? -36.496  89.036  47.345  1.00 32.88 ? 33   THR A O   1 
ATOM   274   C  CB  . THR A  1 41  ? -39.791  88.689  48.146  1.00 34.44 ? 33   THR A CB  1 
ATOM   275   O  OG1 . THR A  1 41  ? -39.618  88.224  46.804  1.00 34.71 ? 33   THR A OG1 1 
ATOM   276   C  CG2 . THR A  1 41  ? -41.074  89.542  48.225  1.00 32.04 ? 33   THR A CG2 1 
ATOM   277   N  N   . VAL A  1 42  ? -37.059  87.601  48.950  1.00 33.19 ? 34   VAL A N   1 
ATOM   278   C  CA  . VAL A  1 42  ? -35.882  86.777  48.742  1.00 32.69 ? 34   VAL A CA  1 
ATOM   279   C  C   . VAL A  1 42  ? -36.280  85.396  48.261  1.00 32.79 ? 34   VAL A C   1 
ATOM   280   O  O   . VAL A  1 42  ? -37.306  84.880  48.656  1.00 32.29 ? 34   VAL A O   1 
ATOM   281   C  CB  . VAL A  1 42  ? -35.006  86.649  50.030  1.00 32.39 ? 34   VAL A CB  1 
ATOM   282   C  CG1 . VAL A  1 42  ? -34.300  88.002  50.334  1.00 31.49 ? 34   VAL A CG1 1 
ATOM   283   C  CG2 . VAL A  1 42  ? -35.851  86.185  51.213  1.00 31.87 ? 34   VAL A CG2 1 
ATOM   284   N  N   . ARG A  1 43  ? -35.428  84.802  47.428  1.00 33.06 ? 35   ARG A N   1 
ATOM   285   C  CA  . ARG A  1 43  ? -35.608  83.424  46.966  1.00 33.72 ? 35   ARG A CA  1 
ATOM   286   C  C   . ARG A  1 43  ? -34.310  82.668  47.076  1.00 32.43 ? 35   ARG A C   1 
ATOM   287   O  O   . ARG A  1 43  ? -33.236  83.211  46.795  1.00 32.75 ? 35   ARG A O   1 
ATOM   288   C  CB  . ARG A  1 43  ? -35.977  83.431  45.482  1.00 34.36 ? 35   ARG A CB  1 
ATOM   289   C  CG  . ARG A  1 43  ? -37.344  83.998  45.175  1.00 38.62 ? 35   ARG A CG  1 
ATOM   290   C  CD  . ARG A  1 43  ? -37.602  84.037  43.657  1.00 43.55 ? 35   ARG A CD  1 
ATOM   291   N  NE  . ARG A  1 43  ? -37.728  82.692  43.084  1.00 45.79 ? 35   ARG A NE  1 
ATOM   292   C  CZ  . ARG A  1 43  ? -37.782  82.415  41.776  1.00 45.94 ? 35   ARG A CZ  1 
ATOM   293   N  NH1 . ARG A  1 43  ? -37.707  83.410  40.873  1.00 44.74 ? 35   ARG A NH1 1 
ATOM   294   N  NH2 . ARG A  1 43  ? -37.912  81.133  41.376  1.00 43.38 ? 35   ARG A NH2 1 
ATOM   295   N  N   . VAL A  1 44  ? -34.396  81.388  47.384  1.00 31.34 ? 36   VAL A N   1 
ATOM   296   C  CA  . VAL A  1 44  ? -33.211  80.530  47.317  1.00 29.86 ? 36   VAL A CA  1 
ATOM   297   C  C   . VAL A  1 44  ? -33.169  79.732  46.015  1.00 29.74 ? 36   VAL A C   1 
ATOM   298   O  O   . VAL A  1 44  ? -33.835  78.735  45.877  1.00 29.55 ? 36   VAL A O   1 
ATOM   299   C  CB  . VAL A  1 44  ? -33.058  79.605  48.568  1.00 30.19 ? 36   VAL A CB  1 
ATOM   300   C  CG1 . VAL A  1 44  ? -31.783  78.813  48.427  1.00 27.59 ? 36   VAL A CG1 1 
ATOM   301   C  CG2 . VAL A  1 44  ? -33.066  80.464  49.931  1.00 26.95 ? 36   VAL A CG2 1 
ATOM   302   N  N   . ILE A  1 45  ? -32.342  80.178  45.068  1.00 30.01 ? 37   ILE A N   1 
ATOM   303   C  CA  . ILE A  1 45  ? -32.237  79.555  43.744  1.00 29.37 ? 37   ILE A CA  1 
ATOM   304   C  C   . ILE A  1 45  ? -30.778  79.526  43.251  1.00 29.35 ? 37   ILE A C   1 
ATOM   305   O  O   . ILE A  1 45  ? -29.935  80.362  43.653  1.00 28.79 ? 37   ILE A O   1 
ATOM   306   C  CB  . ILE A  1 45  ? -33.086  80.309  42.701  1.00 29.33 ? 37   ILE A CB  1 
ATOM   307   C  CG1 . ILE A  1 45  ? -32.755  81.817  42.734  1.00 29.07 ? 37   ILE A CG1 1 
ATOM   308   C  CG2 . ILE A  1 45  ? -34.578  80.036  42.961  1.00 30.01 ? 37   ILE A CG2 1 
ATOM   309   C  CD1 . ILE A  1 45  ? -33.563  82.710  41.788  1.00 29.25 ? 37   ILE A CD1 1 
ATOM   310   N  N   . PRO A  1 46  ? -30.473  78.584  42.360  1.00 28.48 ? 38   PRO A N   1 
ATOM   311   C  CA  . PRO A  1 46  ? -29.129  78.512  41.768  1.00 28.78 ? 38   PRO A CA  1 
ATOM   312   C  C   . PRO A  1 46  ? -28.777  79.735  40.953  1.00 27.55 ? 38   PRO A C   1 
ATOM   313   O  O   . PRO A  1 46  ? -29.655  80.323  40.335  1.00 27.95 ? 38   PRO A O   1 
ATOM   314   C  CB  . PRO A  1 46  ? -29.201  77.295  40.865  1.00 28.25 ? 38   PRO A CB  1 
ATOM   315   C  CG  . PRO A  1 46  ? -30.310  76.476  41.495  1.00 29.65 ? 38   PRO A CG  1 
ATOM   316   C  CD  . PRO A  1 46  ? -31.302  77.451  41.978  1.00 28.83 ? 38   PRO A CD  1 
ATOM   317   N  N   . VAL A  1 47  ? -27.501  80.088  40.967  1.00 26.99 ? 39   VAL A N   1 
ATOM   318   C  CA  . VAL A  1 47  ? -27.042  81.313  40.311  1.00 27.15 ? 39   VAL A CA  1 
ATOM   319   C  C   . VAL A  1 47  ? -25.979  80.909  39.245  1.00 26.37 ? 39   VAL A C   1 
ATOM   320   O  O   . VAL A  1 47  ? -26.187  79.976  38.435  1.00 25.21 ? 39   VAL A O   1 
ATOM   321   C  CB  . VAL A  1 47  ? -26.605  82.386  41.366  1.00 27.28 ? 39   VAL A CB  1 
ATOM   322   C  CG1 . VAL A  1 47  ? -26.321  83.730  40.718  1.00 27.66 ? 39   VAL A CG1 1 
ATOM   323   C  CG2 . VAL A  1 47  ? -27.679  82.544  42.446  1.00 27.17 ? 39   VAL A CG2 1 
ATOM   324   N  N   . LEU A  1 48  ? -24.826  81.547  39.274  1.00 25.81 ? 40   LEU A N   1 
ATOM   325   C  CA  . LEU A  1 48  ? -23.916  81.434  38.159  1.00 25.65 ? 40   LEU A CA  1 
ATOM   326   C  C   . LEU A  1 48  ? -22.788  80.429  38.439  1.00 25.16 ? 40   LEU A C   1 
ATOM   327   O  O   . LEU A  1 48  ? -22.747  79.804  39.489  1.00 24.05 ? 40   LEU A O   1 
ATOM   328   C  CB  . LEU A  1 48  ? -23.433  82.844  37.786  1.00 26.03 ? 40   LEU A CB  1 
ATOM   329   C  CG  . LEU A  1 48  ? -22.894  83.766  38.877  1.00 26.91 ? 40   LEU A CG  1 
ATOM   330   C  CD1 . LEU A  1 48  ? -21.453  83.329  39.051  1.00 25.12 ? 40   LEU A CD1 1 
ATOM   331   C  CD2 . LEU A  1 48  ? -23.000  85.271  38.457  1.00 24.95 ? 40   LEU A CD2 1 
ATOM   332   N  N   . GLY A  1 49  ? -21.894  80.240  37.465  1.00 24.78 ? 41   GLY A N   1 
ATOM   333   C  CA  . GLY A  1 49  ? -20.712  79.407  37.657  1.00 23.71 ? 41   GLY A CA  1 
ATOM   334   C  C   . GLY A  1 49  ? -21.006  77.984  37.309  1.00 23.54 ? 41   GLY A C   1 
ATOM   335   O  O   . GLY A  1 49  ? -22.086  77.673  36.874  1.00 25.03 ? 41   GLY A O   1 
ATOM   336   N  N   . GLY A  1 50  ? -20.028  77.126  37.505  1.00 23.10 ? 42   GLY A N   1 
ATOM   337   C  CA  . GLY A  1 50  ? -20.181  75.717  37.377  1.00 22.95 ? 42   GLY A CA  1 
ATOM   338   C  C   . GLY A  1 50  ? -20.329  75.112  36.015  1.00 23.21 ? 42   GLY A C   1 
ATOM   339   O  O   . GLY A  1 50  ? -20.242  75.782  34.974  1.00 23.97 ? 42   GLY A O   1 
ATOM   340   N  N   . ILE A  1 51  ? -20.517  73.801  36.051  1.00 23.22 ? 43   ILE A N   1 
ATOM   341   C  CA  . ILE A  1 51  ? -21.052  73.057  34.940  1.00 23.11 ? 43   ILE A CA  1 
ATOM   342   C  C   . ILE A  1 51  ? -22.553  72.994  35.174  1.00 23.43 ? 43   ILE A C   1 
ATOM   343   O  O   . ILE A  1 51  ? -23.013  72.380  36.157  1.00 23.41 ? 43   ILE A O   1 
ATOM   344   C  CB  . ILE A  1 51  ? -20.440  71.658  34.867  1.00 23.86 ? 43   ILE A CB  1 
ATOM   345   C  CG1 . ILE A  1 51  ? -18.886  71.719  34.891  1.00 22.84 ? 43   ILE A CG1 1 
ATOM   346   C  CG2 . ILE A  1 51  ? -20.920  70.949  33.632  1.00 23.38 ? 43   ILE A CG2 1 
ATOM   347   C  CD1 . ILE A  1 51  ? -18.170  70.527  35.622  1.00 21.50 ? 43   ILE A CD1 1 
ATOM   348   N  N   . THR A  1 52  ? -23.313  73.679  34.308  1.00 23.29 ? 44   THR A N   1 
ATOM   349   C  CA  . THR A  1 52  ? -24.756  73.647  34.361  1.00 23.38 ? 44   THR A CA  1 
ATOM   350   C  C   . THR A  1 52  ? -25.252  72.570  33.413  1.00 23.75 ? 44   THR A C   1 
ATOM   351   O  O   . THR A  1 52  ? -25.124  72.711  32.230  1.00 24.66 ? 44   THR A O   1 
ATOM   352   C  CB  . THR A  1 52  ? -25.374  75.022  34.068  1.00 23.53 ? 44   THR A CB  1 
ATOM   353   O  OG1 . THR A  1 52  ? -24.853  76.005  35.005  1.00 23.53 ? 44   THR A OG1 1 
ATOM   354   C  CG2 . THR A  1 52  ? -26.880  74.954  34.222  1.00 22.30 ? 44   THR A CG2 1 
ATOM   355   N  N   . TYR A  1 53  ? -25.794  71.482  33.957  1.00 23.95 ? 45   TYR A N   1 
ATOM   356   C  CA  . TYR A  1 53  ? -26.048  70.247  33.206  1.00 24.68 ? 45   TYR A CA  1 
ATOM   357   C  C   . TYR A  1 53  ? -27.269  70.322  32.315  1.00 25.47 ? 45   TYR A C   1 
ATOM   358   O  O   . TYR A  1 53  ? -27.314  69.631  31.334  1.00 26.98 ? 45   TYR A O   1 
ATOM   359   C  CB  . TYR A  1 53  ? -26.158  69.013  34.138  1.00 24.33 ? 45   TYR A CB  1 
ATOM   360   C  CG  . TYR A  1 53  ? -24.864  68.735  34.888  1.00 25.33 ? 45   TYR A CG  1 
ATOM   361   C  CD1 . TYR A  1 53  ? -23.821  68.061  34.285  1.00 26.18 ? 45   TYR A CD1 1 
ATOM   362   C  CD2 . TYR A  1 53  ? -24.652  69.197  36.184  1.00 26.22 ? 45   TYR A CD2 1 
ATOM   363   C  CE1 . TYR A  1 53  ? -22.616  67.812  34.965  1.00 27.10 ? 45   TYR A CE1 1 
ATOM   364   C  CE2 . TYR A  1 53  ? -23.422  68.926  36.880  1.00 26.03 ? 45   TYR A CE2 1 
ATOM   365   C  CZ  . TYR A  1 53  ? -22.429  68.258  36.249  1.00 25.65 ? 45   TYR A CZ  1 
ATOM   366   O  OH  . TYR A  1 53  ? -21.221  68.037  36.846  1.00 25.02 ? 45   TYR A OH  1 
ATOM   367   N  N   . ASN A  1 54  ? -28.243  71.168  32.603  1.00 25.31 ? 46   ASN A N   1 
ATOM   368   C  CA  . ASN A  1 54  ? -29.510  71.108  31.873  1.00 25.28 ? 46   ASN A CA  1 
ATOM   369   C  C   . ASN A  1 54  ? -29.943  72.443  31.313  1.00 25.66 ? 46   ASN A C   1 
ATOM   370   O  O   . ASN A  1 54  ? -31.093  72.621  31.033  1.00 26.93 ? 46   ASN A O   1 
ATOM   371   C  CB  . ASN A  1 54  ? -30.604  70.547  32.786  1.00 25.35 ? 46   ASN A CB  1 
ATOM   372   C  CG  . ASN A  1 54  ? -30.878  71.452  33.957  1.00 26.71 ? 46   ASN A CG  1 
ATOM   373   O  OD1 . ASN A  1 54  ? -29.977  72.135  34.422  1.00 23.92 ? 46   ASN A OD1 1 
ATOM   374   N  ND2 . ASN A  1 54  ? -32.112  71.470  34.434  1.00 24.29 ? 46   ASN A ND2 1 
ATOM   375   N  N   . VAL A  1 55  ? -29.019  73.394  31.166  1.00 25.58 ? 47   VAL A N   1 
ATOM   376   C  CA  . VAL A  1 55  ? -29.290  74.659  30.518  1.00 24.79 ? 47   VAL A CA  1 
ATOM   377   C  C   . VAL A  1 55  ? -28.131  74.879  29.578  1.00 25.88 ? 47   VAL A C   1 
ATOM   378   O  O   . VAL A  1 55  ? -26.954  74.799  29.999  1.00 26.25 ? 47   VAL A O   1 
ATOM   379   C  CB  . VAL A  1 55  ? -29.364  75.837  31.497  1.00 25.01 ? 47   VAL A CB  1 
ATOM   380   C  CG1 . VAL A  1 55  ? -29.733  77.108  30.746  1.00 21.18 ? 47   VAL A CG1 1 
ATOM   381   C  CG2 . VAL A  1 55  ? -30.370  75.568  32.591  1.00 22.74 ? 47   VAL A CG2 1 
ATOM   382   N  N   . LYS A  1 56  ? -28.461  75.108  28.299  1.00 26.40 ? 48   LYS A N   1 
ATOM   383   C  CA  . LYS A  1 56  ? -27.467  75.174  27.233  1.00 26.86 ? 48   LYS A CA  1 
ATOM   384   C  C   . LYS A  1 56  ? -27.875  76.185  26.194  1.00 25.26 ? 48   LYS A C   1 
ATOM   385   O  O   . LYS A  1 56  ? -29.030  76.600  26.133  1.00 24.60 ? 48   LYS A O   1 
ATOM   386   C  CB  . LYS A  1 56  ? -27.287  73.800  26.590  1.00 28.58 ? 48   LYS A CB  1 
ATOM   387   C  CG  . LYS A  1 56  ? -28.419  73.412  25.665  1.00 34.90 ? 48   LYS A CG  1 
ATOM   388   C  CD  . LYS A  1 56  ? -28.333  71.917  25.141  1.00 42.35 ? 48   LYS A CD  1 
ATOM   389   C  CE  . LYS A  1 56  ? -29.658  71.464  24.420  1.00 44.88 ? 48   LYS A CE  1 
ATOM   390   N  NZ  . LYS A  1 56  ? -30.902  71.650  25.305  1.00 45.61 ? 48   LYS A NZ  1 
ATOM   391   N  N   . VAL A  1 57  ? -26.908  76.600  25.396  1.00 23.87 ? 49   VAL A N   1 
ATOM   392   C  CA  . VAL A  1 57  ? -27.146  77.542  24.336  1.00 23.43 ? 49   VAL A CA  1 
ATOM   393   C  C   . VAL A  1 57  ? -28.290  76.983  23.467  1.00 23.52 ? 49   VAL A C   1 
ATOM   394   O  O   . VAL A  1 57  ? -28.405  75.801  23.268  1.00 23.43 ? 49   VAL A O   1 
ATOM   395   C  CB  . VAL A  1 57  ? -25.834  77.851  23.532  1.00 23.72 ? 49   VAL A CB  1 
ATOM   396   C  CG1 . VAL A  1 57  ? -25.361  76.623  22.699  1.00 21.10 ? 49   VAL A CG1 1 
ATOM   397   C  CG2 . VAL A  1 57  ? -26.011  79.106  22.670  1.00 20.80 ? 49   VAL A CG2 1 
ATOM   398   N  N   . GLY A  1 58  ? -29.192  77.842  23.065  1.00 23.91 ? 50   GLY A N   1 
ATOM   399   C  CA  . GLY A  1 58  ? -30.382  77.426  22.355  1.00 24.49 ? 50   GLY A CA  1 
ATOM   400   C  C   . GLY A  1 58  ? -31.628  77.322  23.204  1.00 24.80 ? 50   GLY A C   1 
ATOM   401   O  O   . GLY A  1 58  ? -32.747  77.400  22.678  1.00 25.61 ? 50   GLY A O   1 
ATOM   402   N  N   . ASP A  1 59  ? -31.463  77.120  24.504  1.00 24.52 ? 51   ASP A N   1 
ATOM   403   C  CA  . ASP A  1 59  ? -32.618  77.070  25.380  1.00 24.92 ? 51   ASP A CA  1 
ATOM   404   C  C   . ASP A  1 59  ? -33.100  78.469  25.679  1.00 24.39 ? 51   ASP A C   1 
ATOM   405   O  O   . ASP A  1 59  ? -32.399  79.461  25.488  1.00 23.85 ? 51   ASP A O   1 
ATOM   406   C  CB  . ASP A  1 59  ? -32.275  76.419  26.721  1.00 25.88 ? 51   ASP A CB  1 
ATOM   407   C  CG  . ASP A  1 59  ? -31.922  74.964  26.616  1.00 27.47 ? 51   ASP A CG  1 
ATOM   408   O  OD1 . ASP A  1 59  ? -32.224  74.304  25.608  1.00 32.73 ? 51   ASP A OD1 1 
ATOM   409   O  OD2 . ASP A  1 59  ? -31.288  74.455  27.561  1.00 30.94 ? 51   ASP A OD2 1 
ATOM   410   N  N   . SER A  1 60  ? -34.301  78.547  26.199  1.00 24.66 ? 52   SER A N   1 
ATOM   411   C  CA  . SER A  1 60  ? -34.839  79.815  26.611  1.00 24.84 ? 52   SER A CA  1 
ATOM   412   C  C   . SER A  1 60  ? -34.007  80.472  27.724  1.00 24.45 ? 52   SER A C   1 
ATOM   413   O  O   . SER A  1 60  ? -33.566  79.809  28.642  1.00 24.46 ? 52   SER A O   1 
ATOM   414   C  CB  . SER A  1 60  ? -36.245  79.621  27.125  1.00 24.29 ? 52   SER A CB  1 
ATOM   415   O  OG  . SER A  1 60  ? -36.805  80.901  27.403  1.00 26.64 ? 52   SER A OG  1 
ATOM   416   N  N   . ALA A  1 61  ? -33.863  81.790  27.659  1.00 24.90 ? 53   ALA A N   1 
ATOM   417   C  CA  . ALA A  1 61  ? -33.285  82.573  28.731  1.00 24.74 ? 53   ALA A CA  1 
ATOM   418   C  C   . ALA A  1 61  ? -34.252  82.798  29.899  1.00 25.67 ? 53   ALA A C   1 
ATOM   419   O  O   . ALA A  1 61  ? -33.820  83.247  31.008  1.00 26.35 ? 53   ALA A O   1 
ATOM   420   C  CB  . ALA A  1 61  ? -32.804  83.898  28.202  1.00 23.69 ? 53   ALA A CB  1 
ATOM   421   N  N   . TYR A  1 62  ? -35.534  82.490  29.678  1.00 26.19 ? 54   TYR A N   1 
ATOM   422   C  CA  . TYR A  1 62  ? -36.578  82.676  30.694  1.00 26.78 ? 54   TYR A CA  1 
ATOM   423   C  C   . TYR A  1 62  ? -37.148  81.360  31.124  1.00 27.68 ? 54   TYR A C   1 
ATOM   424   O  O   . TYR A  1 62  ? -36.892  80.334  30.508  1.00 28.01 ? 54   TYR A O   1 
ATOM   425   C  CB  . TYR A  1 62  ? -37.721  83.526  30.162  1.00 26.90 ? 54   TYR A CB  1 
ATOM   426   C  CG  . TYR A  1 62  ? -37.328  84.939  29.933  1.00 27.76 ? 54   TYR A CG  1 
ATOM   427   C  CD1 . TYR A  1 62  ? -36.830  85.360  28.711  1.00 28.35 ? 54   TYR A CD1 1 
ATOM   428   C  CD2 . TYR A  1 62  ? -37.439  85.880  30.950  1.00 28.32 ? 54   TYR A CD2 1 
ATOM   429   C  CE1 . TYR A  1 62  ? -36.432  86.713  28.516  1.00 29.20 ? 54   TYR A CE1 1 
ATOM   430   C  CE2 . TYR A  1 62  ? -37.058  87.228  30.747  1.00 28.51 ? 54   TYR A CE2 1 
ATOM   431   C  CZ  . TYR A  1 62  ? -36.555  87.622  29.546  1.00 28.19 ? 54   TYR A CZ  1 
ATOM   432   O  OH  . TYR A  1 62  ? -36.210  88.933  29.390  1.00 31.61 ? 54   TYR A OH  1 
ATOM   433   N  N   . GLY A  1 63  ? -37.924  81.404  32.205  1.00 28.65 ? 55   GLY A N   1 
ATOM   434   C  CA  . GLY A  1 63  ? -38.547  80.223  32.725  1.00 29.20 ? 55   GLY A CA  1 
ATOM   435   C  C   . GLY A  1 63  ? -37.706  79.309  33.605  1.00 29.95 ? 55   GLY A C   1 
ATOM   436   O  O   . GLY A  1 63  ? -38.202  78.279  33.999  1.00 31.57 ? 55   GLY A O   1 
ATOM   437   N  N   . TRP A  1 64  ? -36.465  79.663  33.950  1.00 29.17 ? 56   TRP A N   1 
ATOM   438   C  CA  . TRP A  1 64  ? -35.694  78.844  34.878  1.00 28.78 ? 56   TRP A CA  1 
ATOM   439   C  C   . TRP A  1 64  ? -35.860  79.306  36.331  1.00 28.39 ? 56   TRP A C   1 
ATOM   440   O  O   . TRP A  1 64  ? -35.959  80.483  36.596  1.00 27.79 ? 56   TRP A O   1 
ATOM   441   C  CB  . TRP A  1 64  ? -34.211  78.794  34.486  1.00 28.74 ? 56   TRP A CB  1 
ATOM   442   C  CG  . TRP A  1 64  ? -34.003  78.247  33.120  1.00 27.18 ? 56   TRP A CG  1 
ATOM   443   C  CD1 . TRP A  1 64  ? -33.762  78.962  32.010  1.00 25.98 ? 56   TRP A CD1 1 
ATOM   444   C  CD2 . TRP A  1 64  ? -34.022  76.869  32.724  1.00 26.06 ? 56   TRP A CD2 1 
ATOM   445   N  NE1 . TRP A  1 64  ? -33.617  78.118  30.924  1.00 26.61 ? 56   TRP A NE1 1 
ATOM   446   C  CE2 . TRP A  1 64  ? -33.794  76.830  31.339  1.00 25.75 ? 56   TRP A CE2 1 
ATOM   447   C  CE3 . TRP A  1 64  ? -34.248  75.666  33.398  1.00 28.55 ? 56   TRP A CE3 1 
ATOM   448   C  CZ2 . TRP A  1 64  ? -33.756  75.632  30.611  1.00 27.95 ? 56   TRP A CZ2 1 
ATOM   449   C  CZ3 . TRP A  1 64  ? -34.212  74.468  32.687  1.00 30.54 ? 56   TRP A CZ3 1 
ATOM   450   C  CH2 . TRP A  1 64  ? -33.954  74.457  31.296  1.00 28.19 ? 56   TRP A CH2 1 
ATOM   451   N  N   . ALA A  1 65  ? -35.922  78.355  37.264  1.00 28.19 ? 57   ALA A N   1 
ATOM   452   C  CA  . ALA A  1 65  ? -35.883  78.695  38.690  1.00 28.97 ? 57   ALA A CA  1 
ATOM   453   C  C   . ALA A  1 65  ? -34.418  78.955  39.085  1.00 28.82 ? 57   ALA A C   1 
ATOM   454   O  O   . ALA A  1 65  ? -33.760  78.120  39.716  1.00 28.83 ? 57   ALA A O   1 
ATOM   455   C  CB  . ALA A  1 65  ? -36.488  77.576  39.525  1.00 28.69 ? 57   ALA A CB  1 
ATOM   456   N  N   . GLY A  1 66  ? -33.920  80.110  38.674  1.00 29.15 ? 58   GLY A N   1 
ATOM   457   C  CA  . GLY A  1 66  ? -32.516  80.451  38.845  1.00 29.79 ? 58   GLY A CA  1 
ATOM   458   C  C   . GLY A  1 66  ? -32.264  81.875  38.440  1.00 30.25 ? 58   GLY A C   1 
ATOM   459   O  O   . GLY A  1 66  ? -33.118  82.485  37.833  1.00 31.21 ? 58   GLY A O   1 
ATOM   460   N  N   . ASP A  1 67  ? -31.096  82.397  38.789  1.00 30.46 ? 59   ASP A N   1 
ATOM   461   C  CA  . ASP A  1 67  ? -30.773  83.768  38.523  1.00 31.49 ? 59   ASP A CA  1 
ATOM   462   C  C   . ASP A  1 67  ? -29.435  83.764  37.835  1.00 30.61 ? 59   ASP A C   1 
ATOM   463   O  O   . ASP A  1 67  ? -28.587  82.987  38.199  1.00 30.58 ? 59   ASP A O   1 
ATOM   464   C  CB  . ASP A  1 67  ? -30.715  84.541  39.850  1.00 33.03 ? 59   ASP A CB  1 
ATOM   465   C  CG  . ASP A  1 67  ? -30.405  86.034  39.660  1.00 37.86 ? 59   ASP A CG  1 
ATOM   466   O  OD1 . ASP A  1 67  ? -31.307  86.732  39.210  1.00 42.22 ? 59   ASP A OD1 1 
ATOM   467   O  OD2 . ASP A  1 67  ? -29.262  86.514  39.935  1.00 45.77 ? 59   ASP A OD2 1 
ATOM   468   N  N   . HIS A  1 68  ? -29.266  84.606  36.828  1.00 30.22 ? 60   HIS A N   1 
ATOM   469   C  CA  . HIS A  1 68  ? -28.011  84.739  36.107  1.00 30.81 ? 60   HIS A CA  1 
ATOM   470   C  C   . HIS A  1 68  ? -27.468  83.368  35.678  1.00 28.73 ? 60   HIS A C   1 
ATOM   471   O  O   . HIS A  1 68  ? -26.272  83.118  35.730  1.00 28.50 ? 60   HIS A O   1 
ATOM   472   C  CB  . HIS A  1 68  ? -26.941  85.454  36.967  1.00 31.95 ? 60   HIS A CB  1 
ATOM   473   C  CG  . HIS A  1 68  ? -27.093  86.937  37.063  1.00 37.65 ? 60   HIS A CG  1 
ATOM   474   N  ND1 . HIS A  1 68  ? -27.864  87.553  38.042  1.00 42.02 ? 60   HIS A ND1 1 
ATOM   475   C  CD2 . HIS A  1 68  ? -26.507  87.937  36.351  1.00 41.87 ? 60   HIS A CD2 1 
ATOM   476   C  CE1 . HIS A  1 68  ? -27.770  88.868  37.895  1.00 45.25 ? 60   HIS A CE1 1 
ATOM   477   N  NE2 . HIS A  1 68  ? -26.968  89.126  36.869  1.00 45.87 ? 60   HIS A NE2 1 
ATOM   478   N  N   . VAL A  1 69  ? -28.323  82.456  35.270  1.00 26.81 ? 61   VAL A N   1 
ATOM   479   C  CA  . VAL A  1 69  ? -27.806  81.143  35.016  1.00 25.18 ? 61   VAL A CA  1 
ATOM   480   C  C   . VAL A  1 69  ? -26.940  81.161  33.752  1.00 24.46 ? 61   VAL A C   1 
ATOM   481   O  O   . VAL A  1 69  ? -27.314  81.704  32.717  1.00 23.12 ? 61   VAL A O   1 
ATOM   482   C  CB  . VAL A  1 69  ? -28.923  80.098  34.948  1.00 25.83 ? 61   VAL A CB  1 
ATOM   483   C  CG1 . VAL A  1 69  ? -28.310  78.684  34.731  1.00 24.26 ? 61   VAL A CG1 1 
ATOM   484   C  CG2 . VAL A  1 69  ? -29.725  80.167  36.231  1.00 24.81 ? 61   VAL A CG2 1 
ATOM   485   N  N   . GLU A  1 70  ? -25.768  80.563  33.861  1.00 23.12 ? 62   GLU A N   1 
ATOM   486   C  CA  . GLU A  1 70  ? -24.845  80.506  32.782  1.00 22.84 ? 62   GLU A CA  1 
ATOM   487   C  C   . GLU A  1 70  ? -24.945  79.137  32.141  1.00 22.91 ? 62   GLU A C   1 
ATOM   488   O  O   . GLU A  1 70  ? -24.741  78.119  32.828  1.00 22.57 ? 62   GLU A O   1 
ATOM   489   C  CB  . GLU A  1 70  ? -23.436  80.747  33.293  1.00 23.10 ? 62   GLU A CB  1 
ATOM   490   C  CG  . GLU A  1 70  ? -23.249  82.185  33.765  1.00 22.21 ? 62   GLU A CG  1 
ATOM   491   C  CD  . GLU A  1 70  ? -21.915  82.472  34.461  1.00 21.23 ? 62   GLU A CD  1 
ATOM   492   O  OE1 . GLU A  1 70  ? -21.277  81.541  35.016  1.00 18.21 ? 62   GLU A OE1 1 
ATOM   493   O  OE2 . GLU A  1 70  ? -21.553  83.674  34.501  1.00 20.63 ? 62   GLU A OE2 1 
ATOM   494   N  N   . PRO A  1 71  ? -25.278  79.092  30.830  1.00 21.78 ? 63   PRO A N   1 
ATOM   495   C  CA  . PRO A  1 71  ? -25.364  77.805  30.184  1.00 22.31 ? 63   PRO A CA  1 
ATOM   496   C  C   . PRO A  1 71  ? -24.006  77.097  30.047  1.00 21.50 ? 63   PRO A C   1 
ATOM   497   O  O   . PRO A  1 71  ? -22.978  77.727  29.968  1.00 20.37 ? 63   PRO A O   1 
ATOM   498   C  CB  . PRO A  1 71  ? -25.951  78.140  28.818  1.00 22.49 ? 63   PRO A CB  1 
ATOM   499   C  CG  . PRO A  1 71  ? -25.555  79.475  28.565  1.00 22.91 ? 63   PRO A CG  1 
ATOM   500   C  CD  . PRO A  1 71  ? -25.623  80.162  29.899  1.00 22.20 ? 63   PRO A CD  1 
ATOM   501   N  N   . GLY A  1 72  ? -24.041  75.781  30.018  1.00 21.49 ? 64   GLY A N   1 
ATOM   502   C  CA  . GLY A  1 72  ? -22.842  74.992  29.783  1.00 22.10 ? 64   GLY A CA  1 
ATOM   503   C  C   . GLY A  1 72  ? -21.797  75.191  30.886  1.00 22.89 ? 64   GLY A C   1 
ATOM   504   O  O   . GLY A  1 72  ? -22.136  75.218  32.099  1.00 22.09 ? 64   GLY A O   1 
ATOM   505   N  N   . VAL A  1 73  ? -20.542  75.387  30.455  1.00 22.37 ? 65   VAL A N   1 
ATOM   506   C  CA  . VAL A  1 73  ? -19.395  75.398  31.359  1.00 22.02 ? 65   VAL A CA  1 
ATOM   507   C  C   . VAL A  1 73  ? -18.937  76.839  31.542  1.00 22.11 ? 65   VAL A C   1 
ATOM   508   O  O   . VAL A  1 73  ? -18.699  77.525  30.586  1.00 22.72 ? 65   VAL A O   1 
ATOM   509   C  CB  . VAL A  1 73  ? -18.288  74.465  30.801  1.00 22.14 ? 65   VAL A CB  1 
ATOM   510   C  CG1 . VAL A  1 73  ? -17.039  74.467  31.680  1.00 23.04 ? 65   VAL A CG1 1 
ATOM   511   C  CG2 . VAL A  1 73  ? -18.850  73.061  30.654  1.00 22.49 ? 65   VAL A CG2 1 
ATOM   512   N  N   . SER A  1 74  ? -18.890  77.309  32.778  1.00 21.99 ? 66   SER A N   1 
ATOM   513   C  CA  . SER A  1 74  ? -18.339  78.598  33.106  1.00 21.47 ? 66   SER A CA  1 
ATOM   514   C  C   . SER A  1 74  ? -16.845  78.457  33.402  1.00 21.45 ? 66   SER A C   1 
ATOM   515   O  O   . SER A  1 74  ? -16.404  77.538  34.115  1.00 20.98 ? 66   SER A O   1 
ATOM   516   C  CB  . SER A  1 74  ? -19.041  79.160  34.346  1.00 21.76 ? 66   SER A CB  1 
ATOM   517   O  OG  . SER A  1 74  ? -20.422  79.366  34.114  1.00 19.50 ? 66   SER A OG  1 
ATOM   518   N  N   . VAL A  1 75  ? -16.068  79.365  32.839  1.00 21.61 ? 67   VAL A N   1 
ATOM   519   C  CA  . VAL A  1 75  ? -14.611  79.315  32.912  1.00 21.55 ? 67   VAL A CA  1 
ATOM   520   C  C   . VAL A  1 75  ? -14.131  80.602  33.540  1.00 21.90 ? 67   VAL A C   1 
ATOM   521   O  O   . VAL A  1 75  ? -14.498  81.668  33.086  1.00 20.86 ? 67   VAL A O   1 
ATOM   522   C  CB  . VAL A  1 75  ? -13.984  79.138  31.496  1.00 22.27 ? 67   VAL A CB  1 
ATOM   523   C  CG1 . VAL A  1 75  ? -12.409  79.192  31.559  1.00 20.59 ? 67   VAL A CG1 1 
ATOM   524   C  CG2 . VAL A  1 75  ? -14.463  77.855  30.900  1.00 19.36 ? 67   VAL A CG2 1 
ATOM   525   N  N   . MET A  1 76  ? -13.312  80.498  34.593  1.00 22.89 ? 68   MET A N   1 
ATOM   526   C  CA  . MET A  1 76  ? -12.796  81.668  35.282  1.00 23.37 ? 68   MET A CA  1 
ATOM   527   C  C   . MET A  1 76  ? -11.276  81.686  35.161  1.00 23.17 ? 68   MET A C   1 
ATOM   528   O  O   . MET A  1 76  ? -10.654  80.710  34.760  1.00 23.01 ? 68   MET A O   1 
ATOM   529   C  CB  . MET A  1 76  ? -13.250  81.708  36.753  1.00 23.81 ? 68   MET A CB  1 
ATOM   530   C  CG  . MET A  1 76  ? -12.553  80.707  37.641  1.00 26.89 ? 68   MET A CG  1 
ATOM   531   S  SD  . MET A  1 76  ? -13.068  80.532  39.358  1.00 29.72 ? 68   MET A SD  1 
ATOM   532   C  CE  . MET A  1 76  ? -13.058  82.231  39.909  1.00 37.60 ? 68   MET A CE  1 
ATOM   533   N  N   . ALA A  1 77  ? -10.698  82.835  35.474  1.00 22.65 ? 69   ALA A N   1 
ATOM   534   C  CA  . ALA A  1 77  ? -9.230   83.002  35.503  1.00 23.04 ? 69   ALA A CA  1 
ATOM   535   C  C   . ALA A  1 77  ? -8.623   82.167  36.598  1.00 23.38 ? 69   ALA A C   1 
ATOM   536   O  O   . ALA A  1 77  ? -9.274   81.928  37.588  1.00 23.01 ? 69   ALA A O   1 
ATOM   537   C  CB  . ALA A  1 77  ? -8.881   84.437  35.711  1.00 21.44 ? 69   ALA A CB  1 
ATOM   538   N  N   . ARG A  1 78  ? -7.379   81.720  36.413  1.00 25.04 ? 70   ARG A N   1 
ATOM   539   C  CA  . ARG A  1 78  ? -6.563   81.122  37.498  1.00 26.64 ? 70   ARG A CA  1 
ATOM   540   C  C   . ARG A  1 78  ? -6.281   82.122  38.611  1.00 27.59 ? 70   ARG A C   1 
ATOM   541   O  O   . ARG A  1 78  ? -6.070   81.724  39.723  1.00 27.74 ? 70   ARG A O   1 
ATOM   542   C  CB  . ARG A  1 78  ? -5.184   80.629  36.995  1.00 26.95 ? 70   ARG A CB  1 
ATOM   543   C  CG  . ARG A  1 78  ? -5.270   79.552  35.924  1.00 29.19 ? 70   ARG A CG  1 
ATOM   544   C  CD  . ARG A  1 78  ? -3.914   79.023  35.472  1.00 29.80 ? 70   ARG A CD  1 
ATOM   545   N  NE  . ARG A  1 78  ? -3.049   80.089  35.016  1.00 28.70 ? 70   ARG A NE  1 
ATOM   546   C  CZ  . ARG A  1 78  ? -1.781   79.923  34.660  1.00 29.46 ? 70   ARG A CZ  1 
ATOM   547   N  NH1 . ARG A  1 78  ? -1.216   78.737  34.681  1.00 31.47 ? 70   ARG A NH1 1 
ATOM   548   N  NH2 . ARG A  1 78  ? -1.068   80.957  34.288  1.00 31.15 ? 70   ARG A NH2 1 
ATOM   549   N  N   . ARG A  1 79  ? -6.228   83.407  38.300  1.00 28.11 ? 71   ARG A N   1 
ATOM   550   C  CA  . ARG A  1 79  ? -5.947   84.411  39.308  1.00 29.58 ? 71   ARG A CA  1 
ATOM   551   C  C   . ARG A  1 79  ? -6.395   85.723  38.731  1.00 29.89 ? 71   ARG A C   1 
ATOM   552   O  O   . ARG A  1 79  ? -6.662   85.837  37.543  1.00 27.27 ? 71   ARG A O   1 
ATOM   553   C  CB  . ARG A  1 79  ? -4.445   84.489  39.631  1.00 30.42 ? 71   ARG A CB  1 
ATOM   554   C  CG  . ARG A  1 79  ? -3.575   84.634  38.394  1.00 34.21 ? 71   ARG A CG  1 
ATOM   555   C  CD  . ARG A  1 79  ? -2.108   84.887  38.704  1.00 36.60 ? 71   ARG A CD  1 
ATOM   556   N  NE  . ARG A  1 79  ? -1.584   83.765  39.444  1.00 40.66 ? 71   ARG A NE  1 
ATOM   557   C  CZ  . ARG A  1 79  ? -1.440   82.531  38.956  1.00 44.72 ? 71   ARG A CZ  1 
ATOM   558   N  NH1 . ARG A  1 79  ? -1.748   82.234  37.716  1.00 46.30 ? 71   ARG A NH1 1 
ATOM   559   N  NH2 . ARG A  1 79  ? -0.977   81.564  39.708  1.00 46.57 ? 71   ARG A NH2 1 
ATOM   560   N  N   . LYS A  1 80  ? -6.484   86.714  39.591  1.00 31.21 ? 72   LYS A N   1 
ATOM   561   C  CA  . LYS A  1 80  ? -7.055   87.981  39.204  1.00 33.23 ? 72   LYS A CA  1 
ATOM   562   C  C   . LYS A  1 80  ? -6.322   88.684  38.057  1.00 32.30 ? 72   LYS A C   1 
ATOM   563   O  O   . LYS A  1 80  ? -6.917   89.338  37.243  1.00 32.29 ? 72   LYS A O   1 
ATOM   564   C  CB  . LYS A  1 80  ? -7.116   88.881  40.433  1.00 34.46 ? 72   LYS A CB  1 
ATOM   565   C  CG  . LYS A  1 80  ? -7.808   90.177  40.144  1.00 40.06 ? 72   LYS A CG  1 
ATOM   566   C  CD  . LYS A  1 80  ? -7.528   91.133  41.242  1.00 49.14 ? 72   LYS A CD  1 
ATOM   567   C  CE  . LYS A  1 80  ? -7.918   92.578  40.858  1.00 54.07 ? 72   LYS A CE  1 
ATOM   568   N  NZ  . LYS A  1 80  ? -9.330   92.901  41.204  1.00 55.54 ? 72   LYS A NZ  1 
ATOM   569   N  N   . GLU A  1 81  ? -5.023   88.562  38.039  1.00 32.70 ? 73   GLU A N   1 
ATOM   570   C  CA  . GLU A  1 81  ? -4.190   89.197  37.005  1.00 34.50 ? 73   GLU A CA  1 
ATOM   571   C  C   . GLU A  1 81  ? -4.574   88.635  35.631  1.00 31.61 ? 73   GLU A C   1 
ATOM   572   O  O   . GLU A  1 81  ? -4.387   89.276  34.632  1.00 31.92 ? 73   GLU A O   1 
ATOM   573   C  CB  . GLU A  1 81  ? -2.690   88.918  37.284  1.00 36.18 ? 73   GLU A CB  1 
ATOM   574   C  CG  . GLU A  1 81  ? -2.184   89.320  38.751  1.00 42.95 ? 73   GLU A CG  1 
ATOM   575   C  CD  . GLU A  1 81  ? -2.839   88.535  39.978  1.00 48.24 ? 73   GLU A CD  1 
ATOM   576   O  OE1 . GLU A  1 81  ? -3.148   87.343  39.918  1.00 47.70 ? 73   GLU A OE1 1 
ATOM   577   O  OE2 . GLU A  1 81  ? -3.057   89.142  41.031  1.00 55.42 ? 73   GLU A OE2 1 
ATOM   578   N  N   . GLU A  1 82  ? -5.138   87.450  35.596  1.00 29.11 ? 74   GLU A N   1 
ATOM   579   C  CA  . GLU A  1 82  ? -5.442   86.810  34.356  1.00 27.89 ? 74   GLU A CA  1 
ATOM   580   C  C   . GLU A  1 82  ? -6.880   87.105  33.842  1.00 27.01 ? 74   GLU A C   1 
ATOM   581   O  O   . GLU A  1 82  ? -7.293   86.600  32.806  1.00 26.83 ? 74   GLU A O   1 
ATOM   582   C  CB  . GLU A  1 82  ? -5.223   85.322  34.553  1.00 28.42 ? 74   GLU A CB  1 
ATOM   583   C  CG  . GLU A  1 82  ? -3.993   84.860  33.957  1.00 30.45 ? 74   GLU A CG  1 
ATOM   584   C  CD  . GLU A  1 82  ? -3.287   83.747  34.686  1.00 29.42 ? 74   GLU A CD  1 
ATOM   585   O  OE1 . GLU A  1 82  ? -3.813   82.652  34.775  1.00 30.28 ? 74   GLU A OE1 1 
ATOM   586   O  OE2 . GLU A  1 82  ? -2.146   83.943  35.054  1.00 30.24 ? 74   GLU A OE2 1 
ATOM   587   N  N   . GLU A  1 83  ? -7.624   87.912  34.573  1.00 25.94 ? 75   GLU A N   1 
ATOM   588   C  CA  . GLU A  1 83  ? -9.014   88.163  34.271  1.00 26.18 ? 75   GLU A CA  1 
ATOM   589   C  C   . GLU A  1 83  ? -9.198   89.036  33.033  1.00 25.15 ? 75   GLU A C   1 
ATOM   590   O  O   . GLU A  1 83  ? -10.014  88.702  32.188  1.00 24.20 ? 75   GLU A O   1 
ATOM   591   C  CB  . GLU A  1 83  ? -9.748   88.784  35.473  1.00 26.06 ? 75   GLU A CB  1 
ATOM   592   C  CG  . GLU A  1 83  ? -10.087  87.741  36.519  1.00 29.59 ? 75   GLU A CG  1 
ATOM   593   C  CD  . GLU A  1 83  ? -10.887  88.250  37.721  1.00 32.65 ? 75   GLU A CD  1 
ATOM   594   O  OE1 . GLU A  1 83  ? -11.557  89.313  37.647  1.00 31.56 ? 75   GLU A OE1 1 
ATOM   595   O  OE2 . GLU A  1 83  ? -10.820  87.535  38.744  1.00 36.35 ? 75   GLU A OE2 1 
ATOM   596   N  N   . ILE A  1 84  ? -8.469   90.135  32.948  1.00 24.02 ? 76   ILE A N   1 
ATOM   597   C  CA  . ILE A  1 84  ? -8.644   91.026  31.845  1.00 23.69 ? 76   ILE A CA  1 
ATOM   598   C  C   . ILE A  1 84  ? -8.416   90.331  30.513  1.00 23.69 ? 76   ILE A C   1 
ATOM   599   O  O   . ILE A  1 84  ? -9.259   90.435  29.641  1.00 24.24 ? 76   ILE A O   1 
ATOM   600   C  CB  . ILE A  1 84  ? -7.824   92.286  32.005  1.00 23.77 ? 76   ILE A CB  1 
ATOM   601   C  CG1 . ILE A  1 84  ? -8.503   93.204  33.028  1.00 25.78 ? 76   ILE A CG1 1 
ATOM   602   C  CG2 . ILE A  1 84  ? -7.748   93.048  30.734  1.00 22.50 ? 76   ILE A CG2 1 
ATOM   603   C  CD1 . ILE A  1 84  ? -7.644   94.457  33.447  1.00 23.90 ? 76   ILE A CD1 1 
ATOM   604   N  N   . PRO A  1 85  ? -7.321   89.592  30.352  1.00 24.02 ? 77   PRO A N   1 
ATOM   605   C  CA  . PRO A  1 85  ? -7.149   88.944  29.041  1.00 24.21 ? 77   PRO A CA  1 
ATOM   606   C  C   . PRO A  1 85  ? -8.139   87.820  28.747  1.00 23.86 ? 77   PRO A C   1 
ATOM   607   O  O   . PRO A  1 85  ? -8.541   87.625  27.589  1.00 23.70 ? 77   PRO A O   1 
ATOM   608   C  CB  . PRO A  1 85  ? -5.703   88.395  29.085  1.00 24.87 ? 77   PRO A CB  1 
ATOM   609   C  CG  . PRO A  1 85  ? -5.342   88.333  30.579  1.00 25.14 ? 77   PRO A CG  1 
ATOM   610   C  CD  . PRO A  1 85  ? -6.135   89.442  31.215  1.00 24.44 ? 77   PRO A CD  1 
ATOM   611   N  N   . LEU A  1 86  ? -8.502   87.058  29.771  1.00 23.65 ? 78   LEU A N   1 
ATOM   612   C  CA  . LEU A  1 86  ? -9.583   86.077  29.641  1.00 22.99 ? 78   LEU A CA  1 
ATOM   613   C  C   . LEU A  1 86  ? -10.854  86.707  29.066  1.00 22.45 ? 78   LEU A C   1 
ATOM   614   O  O   . LEU A  1 86  ? -11.425  86.186  28.133  1.00 22.22 ? 78   LEU A O   1 
ATOM   615   C  CB  . LEU A  1 86  ? -9.935   85.470  30.998  1.00 23.10 ? 78   LEU A CB  1 
ATOM   616   C  CG  . LEU A  1 86  ? -11.096  84.434  31.018  1.00 22.98 ? 78   LEU A CG  1 
ATOM   617   C  CD1 . LEU A  1 86  ? -10.698  83.235  30.221  1.00 18.35 ? 78   LEU A CD1 1 
ATOM   618   C  CD2 . LEU A  1 86  ? -11.481  83.991  32.462  1.00 21.57 ? 78   LEU A CD2 1 
ATOM   619   N  N   . MET A  1 87  ? -11.275  87.824  29.650  1.00 22.06 ? 79   MET A N   1 
ATOM   620   C  CA  . MET A  1 87  ? -12.508  88.466  29.308  1.00 21.69 ? 79   MET A CA  1 
ATOM   621   C  C   . MET A  1 87  ? -12.445  89.280  28.037  1.00 22.17 ? 79   MET A C   1 
ATOM   622   O  O   . MET A  1 87  ? -13.486  89.456  27.374  1.00 22.39 ? 79   MET A O   1 
ATOM   623   C  CB  . MET A  1 87  ? -12.942  89.360  30.449  1.00 21.35 ? 79   MET A CB  1 
ATOM   624   C  CG  . MET A  1 87  ? -13.348  88.574  31.687  1.00 23.61 ? 79   MET A CG  1 
ATOM   625   S  SD  . MET A  1 87  ? -14.714  87.389  31.486  1.00 24.54 ? 79   MET A SD  1 
ATOM   626   C  CE  . MET A  1 87  ? -16.037  88.528  31.015  1.00 22.14 ? 79   MET A CE  1 
ATOM   627   N  N   . THR A  1 88  ? -11.257  89.810  27.705  1.00 22.26 ? 80   THR A N   1 
ATOM   628   C  CA  . THR A  1 88  ? -11.102  90.686  26.561  1.00 21.86 ? 80   THR A CA  1 
ATOM   629   C  C   . THR A  1 88  ? -10.874  89.907  25.290  1.00 22.45 ? 80   THR A C   1 
ATOM   630   O  O   . THR A  1 88  ? -11.510  90.179  24.296  1.00 23.36 ? 80   THR A O   1 
ATOM   631   C  CB  . THR A  1 88  ? -9.976   91.657  26.764  1.00 22.56 ? 80   THR A CB  1 
ATOM   632   O  OG1 . THR A  1 88  ? -10.263  92.399  27.938  1.00 22.26 ? 80   THR A OG1 1 
ATOM   633   C  CG2 . THR A  1 88  ? -9.823   92.614  25.571  1.00 20.18 ? 80   THR A CG2 1 
ATOM   634   N  N   . LEU A  1 89  ? -10.017  88.900  25.323  1.00 22.34 ? 81   LEU A N   1 
ATOM   635   C  CA  . LEU A  1 89  ? -9.637   88.237  24.111  1.00 22.25 ? 81   LEU A CA  1 
ATOM   636   C  C   . LEU A  1 89  ? -10.586  87.114  23.699  1.00 21.98 ? 81   LEU A C   1 
ATOM   637   O  O   . LEU A  1 89  ? -10.651  86.766  22.536  1.00 22.29 ? 81   LEU A O   1 
ATOM   638   C  CB  . LEU A  1 89  ? -8.219   87.694  24.238  1.00 22.68 ? 81   LEU A CB  1 
ATOM   639   C  CG  . LEU A  1 89  ? -7.132   88.744  24.548  1.00 24.31 ? 81   LEU A CG  1 
ATOM   640   C  CD1 . LEU A  1 89  ? -5.791   88.012  24.728  1.00 25.20 ? 81   LEU A CD1 1 
ATOM   641   C  CD2 . LEU A  1 89  ? -7.031   89.807  23.474  1.00 23.09 ? 81   LEU A CD2 1 
ATOM   642   N  N   . SER A  1 90  ? -11.277  86.506  24.643  1.00 21.17 ? 82   SER A N   1 
ATOM   643   C  CA  . SER A  1 90  ? -12.160  85.428  24.315  1.00 21.27 ? 82   SER A CA  1 
ATOM   644   C  C   . SER A  1 90  ? -13.334  85.949  23.463  1.00 20.77 ? 82   SER A C   1 
ATOM   645   O  O   . SER A  1 90  ? -14.011  86.857  23.859  1.00 20.18 ? 82   SER A O   1 
ATOM   646   C  CB  . SER A  1 90  ? -12.681  84.760  25.595  1.00 20.85 ? 82   SER A CB  1 
ATOM   647   O  OG  . SER A  1 90  ? -11.620  84.188  26.322  1.00 21.68 ? 82   SER A OG  1 
ATOM   648   N  N   . CYS A  1 91  ? -13.535  85.358  22.292  1.00 21.00 ? 83   CYS A N   1 
ATOM   649   C  CA  . CYS A  1 91  ? -14.596  85.755  21.374  1.00 21.08 ? 83   CYS A CA  1 
ATOM   650   C  C   . CYS A  1 91  ? -15.582  84.602  21.198  1.00 20.50 ? 83   CYS A C   1 
ATOM   651   O  O   . CYS A  1 91  ? -15.197  83.432  21.181  1.00 20.01 ? 83   CYS A O   1 
ATOM   652   C  CB  . CYS A  1 91  ? -13.972  86.154  20.042  1.00 20.94 ? 83   CYS A CB  1 
ATOM   653   S  SG  . CYS A  1 91  ? -13.042  87.715  20.106  1.00 21.39 ? 83   CYS A SG  1 
ATOM   654   N  N   . ILE A  1 92  ? -16.860  84.952  21.075  1.00 20.28 ? 84   ILE A N   1 
ATOM   655   C  CA  . ILE A  1 92  ? -17.949  84.018  20.811  1.00 19.12 ? 84   ILE A CA  1 
ATOM   656   C  C   . ILE A  1 92  ? -17.623  83.257  19.551  1.00 20.06 ? 84   ILE A C   1 
ATOM   657   O  O   . ILE A  1 92  ? -17.299  83.861  18.530  1.00 19.27 ? 84   ILE A O   1 
ATOM   658   C  CB  . ILE A  1 92  ? -19.297  84.765  20.649  1.00 19.21 ? 84   ILE A CB  1 
ATOM   659   C  CG1 . ILE A  1 92  ? -19.641  85.515  21.966  1.00 18.99 ? 84   ILE A CG1 1 
ATOM   660   C  CG2 . ILE A  1 92  ? -20.386  83.763  20.294  1.00 15.44 ? 84   ILE A CG2 1 
ATOM   661   C  CD1 . ILE A  1 92  ? -20.811  86.518  21.943  1.00 19.14 ? 84   ILE A CD1 1 
ATOM   662   N  N   . GLY A  1 93  ? -17.678  81.927  19.641  1.00 20.85 ? 85   GLY A N   1 
ATOM   663   C  CA  . GLY A  1 93  ? -17.279  81.054  18.552  1.00 21.85 ? 85   GLY A CA  1 
ATOM   664   C  C   . GLY A  1 93  ? -15.875  80.467  18.626  1.00 22.75 ? 85   GLY A C   1 
ATOM   665   O  O   . GLY A  1 93  ? -15.581  79.499  17.933  1.00 23.14 ? 85   GLY A O   1 
ATOM   666   N  N   . ASN A  1 94  ? -14.996  81.035  19.450  1.00 23.87 ? 86   ASN A N   1 
ATOM   667   C  CA  . ASN A  1 94  ? -13.610  80.559  19.533  1.00 24.41 ? 86   ASN A CA  1 
ATOM   668   C  C   . ASN A  1 94  ? -13.565  79.120  20.005  1.00 25.12 ? 86   ASN A C   1 
ATOM   669   O  O   . ASN A  1 94  ? -14.383  78.713  20.780  1.00 25.71 ? 86   ASN A O   1 
ATOM   670   C  CB  . ASN A  1 94  ? -12.765  81.405  20.470  1.00 24.06 ? 86   ASN A CB  1 
ATOM   671   C  CG  . ASN A  1 94  ? -12.351  82.743  19.888  1.00 24.63 ? 86   ASN A CG  1 
ATOM   672   O  OD1 . ASN A  1 94  ? -11.953  83.634  20.651  1.00 23.96 ? 86   ASN A OD1 1 
ATOM   673   N  ND2 . ASN A  1 94  ? -12.425  82.901  18.554  1.00 19.73 ? 86   ASN A ND2 1 
ATOM   674   N  N   . GLU A  1 95  ? -12.591  78.363  19.517  1.00 26.33 ? 87   GLU A N   1 
ATOM   675   C  CA  . GLU A  1 95  ? -12.377  76.971  19.898  1.00 28.20 ? 87   GLU A CA  1 
ATOM   676   C  C   . GLU A  1 95  ? -11.874  76.846  21.360  1.00 26.95 ? 87   GLU A C   1 
ATOM   677   O  O   . GLU A  1 95  ? -11.087  77.661  21.840  1.00 25.27 ? 87   GLU A O   1 
ATOM   678   C  CB  . GLU A  1 95  ? -11.357  76.331  18.945  1.00 29.69 ? 87   GLU A CB  1 
ATOM   679   C  CG  . GLU A  1 95  ? -11.340  74.843  19.018  1.00 36.26 ? 87   GLU A CG  1 
ATOM   680   C  CD  . GLU A  1 95  ? -10.219  74.179  18.212  1.00 44.66 ? 87   GLU A CD  1 
ATOM   681   O  OE1 . GLU A  1 95  ? -9.213   74.862  17.836  1.00 47.71 ? 87   GLU A OE1 1 
ATOM   682   O  OE2 . GLU A  1 95  ? -10.357  72.947  18.004  1.00 49.93 ? 87   GLU A OE2 1 
ATOM   683   N  N   . VAL A  1 96  ? -12.376  75.843  22.057  1.00 26.31 ? 88   VAL A N   1 
ATOM   684   C  CA  . VAL A  1 96  ? -12.033  75.664  23.449  1.00 26.54 ? 88   VAL A CA  1 
ATOM   685   C  C   . VAL A  1 96  ? -11.635  74.211  23.612  1.00 27.81 ? 88   VAL A C   1 
ATOM   686   O  O   . VAL A  1 96  ? -12.344  73.360  23.134  1.00 27.69 ? 88   VAL A O   1 
ATOM   687   C  CB  . VAL A  1 96  ? -13.198  76.008  24.409  1.00 25.78 ? 88   VAL A CB  1 
ATOM   688   C  CG1 . VAL A  1 96  ? -12.730  75.876  25.811  1.00 22.02 ? 88   VAL A CG1 1 
ATOM   689   C  CG2 . VAL A  1 96  ? -13.713  77.439  24.129  1.00 23.53 ? 88   VAL A CG2 1 
ATOM   690   N  N   . ILE A  1 97  ? -10.500  73.949  24.279  1.00 28.62 ? 89   ILE A N   1 
ATOM   691   C  CA  . ILE A  1 97  ? -9.982   72.577  24.478  1.00 28.93 ? 89   ILE A CA  1 
ATOM   692   C  C   . ILE A  1 97  ? -9.803   72.324  25.966  1.00 28.83 ? 89   ILE A C   1 
ATOM   693   O  O   . ILE A  1 97  ? -9.235   73.153  26.666  1.00 27.97 ? 89   ILE A O   1 
ATOM   694   C  CB  . ILE A  1 97  ? -8.606   72.337  23.728  1.00 29.78 ? 89   ILE A CB  1 
ATOM   695   C  CG1 . ILE A  1 97  ? -8.746   72.720  22.264  1.00 31.82 ? 89   ILE A CG1 1 
ATOM   696   C  CG2 . ILE A  1 97  ? -8.169   70.831  23.729  1.00 28.00 ? 89   ILE A CG2 1 
ATOM   697   C  CD1 . ILE A  1 97  ? -7.542   73.336  21.734  1.00 36.16 ? 89   ILE A CD1 1 
ATOM   698   N  N   . VAL A  1 98  ? -10.329  71.202  26.444  1.00 28.67 ? 90   VAL A N   1 
ATOM   699   C  CA  . VAL A  1 98  ? -10.147  70.803  27.819  1.00 28.88 ? 90   VAL A CA  1 
ATOM   700   C  C   . VAL A  1 98  ? -8.736   70.238  27.961  1.00 30.40 ? 90   VAL A C   1 
ATOM   701   O  O   . VAL A  1 98  ? -8.331   69.371  27.188  1.00 30.00 ? 90   VAL A O   1 
ATOM   702   C  CB  . VAL A  1 98  ? -11.175  69.729  28.217  1.00 29.07 ? 90   VAL A CB  1 
ATOM   703   C  CG1 . VAL A  1 98  ? -10.958  69.273  29.676  1.00 27.76 ? 90   VAL A CG1 1 
ATOM   704   C  CG2 . VAL A  1 98  ? -12.638  70.241  27.963  1.00 27.55 ? 90   VAL A CG2 1 
ATOM   705   N  N   . MET A  1 99  ? -7.981   70.715  28.949  1.00 31.09 ? 91   MET A N   1 
ATOM   706   C  CA  . MET A  1 99  ? -6.547   70.376  29.024  1.00 32.08 ? 91   MET A CA  1 
ATOM   707   C  C   . MET A  1 99  ? -6.103   69.576  30.280  1.00 32.25 ? 91   MET A C   1 
ATOM   708   O  O   . MET A  1 99  ? -4.943   69.274  30.434  1.00 32.96 ? 91   MET A O   1 
ATOM   709   C  CB  . MET A  1 99  ? -5.726   71.664  28.820  1.00 32.26 ? 91   MET A CB  1 
ATOM   710   C  CG  . MET A  1 99  ? -5.704   72.098  27.330  1.00 35.23 ? 91   MET A CG  1 
ATOM   711   S  SD  . MET A  1 99  ? -4.485   71.105  26.408  1.00 43.63 ? 91   MET A SD  1 
ATOM   712   C  CE  . MET A  1 99  ? -4.518   71.878  24.822  1.00 42.44 ? 91   MET A CE  1 
ATOM   713   N  N   . SER A  1 100 ? -7.029   69.234  31.164  1.00 32.06 ? 92   SER A N   1 
ATOM   714   C  CA  . SER A  1 100 ? -6.792   68.262  32.225  1.00 32.13 ? 92   SER A CA  1 
ATOM   715   C  C   . SER A  1 100 ? -8.107   67.554  32.540  1.00 33.09 ? 92   SER A C   1 
ATOM   716   O  O   . SER A  1 100 ? -9.141   67.919  31.996  1.00 32.48 ? 92   SER A O   1 
ATOM   717   C  CB  . SER A  1 100 ? -6.228   68.938  33.471  1.00 31.27 ? 92   SER A CB  1 
ATOM   718   O  OG  . SER A  1 100 ? -7.212   69.735  34.077  1.00 29.03 ? 92   SER A OG  1 
ATOM   719   N  N   . GLY A  1 101 ? -8.048   66.532  33.397  1.00 34.24 ? 93   GLY A N   1 
ATOM   720   C  CA  . GLY A  1 101 ? -9.220   65.819  33.864  1.00 34.60 ? 93   GLY A CA  1 
ATOM   721   C  C   . GLY A  1 101 ? -9.680   64.727  32.945  1.00 36.15 ? 93   GLY A C   1 
ATOM   722   O  O   . GLY A  1 101 ? -9.017   64.399  31.979  1.00 36.55 ? 93   GLY A O   1 
ATOM   723   N  N   . ASP A  1 102 ? -10.840  64.145  33.211  1.00 37.35 ? 94   ASP A N   1 
ATOM   724   C  CA  . ASP A  1 102 ? -11.270  63.036  32.385  1.00 39.01 ? 94   ASP A CA  1 
ATOM   725   C  C   . ASP A  1 102 ? -11.713  63.386  30.981  1.00 38.27 ? 94   ASP A C   1 
ATOM   726   O  O   . ASP A  1 102 ? -11.843  62.486  30.165  1.00 39.12 ? 94   ASP A O   1 
ATOM   727   C  CB  . ASP A  1 102 ? -12.415  62.306  33.047  1.00 40.93 ? 94   ASP A CB  1 
ATOM   728   C  CG  . ASP A  1 102 ? -12.030  61.704  34.349  1.00 44.72 ? 94   ASP A CG  1 
ATOM   729   O  OD1 . ASP A  1 102 ? -10.841  61.327  34.469  1.00 51.38 ? 94   ASP A OD1 1 
ATOM   730   O  OD2 . ASP A  1 102 ? -12.904  61.633  35.258  1.00 50.46 ? 94   ASP A OD2 1 
ATOM   731   N  N   . ALA A  1 103 ? -11.976  64.657  30.690  1.00 36.93 ? 95   ALA A N   1 
ATOM   732   C  CA  . ALA A  1 103 ? -12.444  65.034  29.364  1.00 36.39 ? 95   ALA A CA  1 
ATOM   733   C  C   . ALA A  1 103 ? -11.332  65.657  28.551  1.00 36.21 ? 95   ALA A C   1 
ATOM   734   O  O   . ALA A  1 103 ? -11.569  66.230  27.473  1.00 35.21 ? 95   ALA A O   1 
ATOM   735   C  CB  . ALA A  1 103 ? -13.651  65.984  29.457  1.00 35.97 ? 95   ALA A CB  1 
ATOM   736   N  N   . LYS A  1 104 ? -10.115  65.517  29.045  1.00 36.16 ? 96   LYS A N   1 
ATOM   737   C  CA  . LYS A  1 104 ? -8.966   66.082  28.360  1.00 37.19 ? 96   LYS A CA  1 
ATOM   738   C  C   . LYS A  1 104 ? -8.999   65.774  26.882  1.00 36.31 ? 96   LYS A C   1 
ATOM   739   O  O   . LYS A  1 104 ? -9.227   64.653  26.530  1.00 37.03 ? 96   LYS A O   1 
ATOM   740   C  CB  . LYS A  1 104 ? -7.694   65.532  28.958  1.00 37.89 ? 96   LYS A CB  1 
ATOM   741   C  CG  . LYS A  1 104 ? -6.470   66.102  28.372  1.00 41.27 ? 96   LYS A CG  1 
ATOM   742   C  CD  . LYS A  1 104 ? -5.261   65.669  29.225  1.00 46.96 ? 96   LYS A CD  1 
ATOM   743   C  CE  . LYS A  1 104 ? -3.967   66.123  28.604  1.00 50.10 ? 96   LYS A CE  1 
ATOM   744   N  NZ  . LYS A  1 104 ? -3.917   65.538  27.202  1.00 54.63 ? 96   LYS A NZ  1 
ATOM   745   N  N   . GLY A  1 105 ? -8.774   66.774  26.045  1.00 35.47 ? 97   GLY A N   1 
ATOM   746   C  CA  . GLY A  1 105 ? -8.861   66.643  24.600  1.00 35.24 ? 97   GLY A CA  1 
ATOM   747   C  C   . GLY A  1 105 ? -10.206  67.027  23.992  1.00 34.63 ? 97   GLY A C   1 
ATOM   748   O  O   . GLY A  1 105 ? -10.296  67.272  22.822  1.00 34.32 ? 97   GLY A O   1 
ATOM   749   N  N   . SER A  1 106 ? -11.259  67.090  24.781  1.00 34.09 ? 98   SER A N   1 
ATOM   750   C  CA  . SER A  1 106 ? -12.537  67.484  24.249  1.00 34.37 ? 98   SER A CA  1 
ATOM   751   C  C   . SER A  1 106 ? -12.513  68.963  23.882  1.00 34.14 ? 98   SER A C   1 
ATOM   752   O  O   . SER A  1 106 ? -11.843  69.776  24.541  1.00 32.26 ? 98   SER A O   1 
ATOM   753   C  CB  . SER A  1 106 ? -13.645  67.249  25.267  1.00 34.53 ? 98   SER A CB  1 
ATOM   754   O  OG  . SER A  1 106 ? -13.723  65.906  25.606  1.00 36.10 ? 98   SER A OG  1 
ATOM   755   N  N   . ARG A  1 107 ? -13.270  69.268  22.833  1.00 34.42 ? 99   ARG A N   1 
ATOM   756   C  CA  . ARG A  1 107 ? -13.315  70.572  22.230  1.00 35.30 ? 99   ARG A CA  1 
ATOM   757   C  C   . ARG A  1 107 ? -14.726  71.093  22.275  1.00 33.83 ? 99   ARG A C   1 
ATOM   758   O  O   . ARG A  1 107 ? -15.676  70.318  22.133  1.00 33.99 ? 99   ARG A O   1 
ATOM   759   C  CB  . ARG A  1 107 ? -12.917  70.459  20.782  1.00 36.64 ? 99   ARG A CB  1 
ATOM   760   C  CG  . ARG A  1 107 ? -11.530  69.899  20.604  1.00 44.86 ? 99   ARG A CG  1 
ATOM   761   C  CD  . ARG A  1 107 ? -11.177  69.669  19.126  1.00 55.12 ? 99   ARG A CD  1 
ATOM   762   N  NE  . ARG A  1 107 ? -9.926   70.337  18.755  1.00 62.79 ? 99   ARG A NE  1 
ATOM   763   C  CZ  . ARG A  1 107 ? -8.720   70.036  19.228  1.00 68.47 ? 99   ARG A CZ  1 
ATOM   764   N  NH1 . ARG A  1 107 ? -8.555   69.059  20.118  1.00 70.70 ? 99   ARG A NH1 1 
ATOM   765   N  NH2 . ARG A  1 107 ? -7.670   70.742  18.826  1.00 70.23 ? 99   ARG A NH2 1 
ATOM   766   N  N   . GLY A  1 108 ? -14.852  72.398  22.430  1.00 31.26 ? 100  GLY A N   1 
ATOM   767   C  CA  . GLY A  1 108 ? -16.127  73.073  22.481  1.00 29.98 ? 100  GLY A CA  1 
ATOM   768   C  C   . GLY A  1 108 ? -15.947  74.480  21.955  1.00 29.05 ? 100  GLY A C   1 
ATOM   769   O  O   . GLY A  1 108 ? -14.923  74.791  21.353  1.00 28.94 ? 100  GLY A O   1 
ATOM   770   N  N   . PHE A  1 109 ? -16.934  75.332  22.194  1.00 28.29 ? 101  PHE A N   1 
ATOM   771   C  CA  . PHE A  1 109 ? -16.986  76.671  21.648  1.00 28.33 ? 101  PHE A CA  1 
ATOM   772   C  C   . PHE A  1 109 ? -17.458  77.657  22.683  1.00 24.99 ? 101  PHE A C   1 
ATOM   773   O  O   . PHE A  1 109 ? -18.339  77.345  23.469  1.00 22.94 ? 101  PHE A O   1 
ATOM   774   C  CB  . PHE A  1 109 ? -17.983  76.706  20.482  1.00 30.94 ? 101  PHE A CB  1 
ATOM   775   C  CG  . PHE A  1 109 ? -17.560  75.870  19.304  1.00 41.13 ? 101  PHE A CG  1 
ATOM   776   C  CD1 . PHE A  1 109 ? -16.449  76.248  18.504  1.00 49.47 ? 101  PHE A CD1 1 
ATOM   777   C  CD2 . PHE A  1 109 ? -18.261  74.692  18.972  1.00 50.72 ? 101  PHE A CD2 1 
ATOM   778   C  CE1 . PHE A  1 109 ? -16.033  75.449  17.372  1.00 53.52 ? 101  PHE A CE1 1 
ATOM   779   C  CE2 . PHE A  1 109 ? -17.851  73.879  17.831  1.00 54.14 ? 101  PHE A CE2 1 
ATOM   780   C  CZ  . PHE A  1 109 ? -16.750  74.279  17.036  1.00 54.38 ? 101  PHE A CZ  1 
ATOM   781   N  N   . VAL A  1 110 ? -16.875  78.850  22.651  1.00 22.56 ? 102  VAL A N   1 
ATOM   782   C  CA  . VAL A  1 110 ? -17.265  79.915  23.507  1.00 20.94 ? 102  VAL A CA  1 
ATOM   783   C  C   . VAL A  1 110 ? -18.638  80.345  23.025  1.00 20.71 ? 102  VAL A C   1 
ATOM   784   O  O   . VAL A  1 110 ? -18.801  80.680  21.872  1.00 20.37 ? 102  VAL A O   1 
ATOM   785   C  CB  . VAL A  1 110 ? -16.287  81.126  23.421  1.00 21.09 ? 102  VAL A CB  1 
ATOM   786   C  CG1 . VAL A  1 110 ? -16.799  82.346  24.204  1.00 15.46 ? 102  VAL A CG1 1 
ATOM   787   C  CG2 . VAL A  1 110 ? -14.842  80.721  23.865  1.00 20.31 ? 102  VAL A CG2 1 
ATOM   788   N  N   . THR A  1 111 ? -19.608  80.356  23.921  1.00 20.04 ? 103  THR A N   1 
ATOM   789   C  CA  . THR A  1 111 ? -20.925  80.880  23.635  1.00 19.66 ? 103  THR A CA  1 
ATOM   790   C  C   . THR A  1 111 ? -21.131  82.284  24.118  1.00 19.88 ? 103  THR A C   1 
ATOM   791   O  O   . THR A  1 111 ? -22.074  82.935  23.716  1.00 19.46 ? 103  THR A O   1 
ATOM   792   C  CB  . THR A  1 111 ? -21.991  80.055  24.321  1.00 19.83 ? 103  THR A CB  1 
ATOM   793   O  OG1 . THR A  1 111 ? -21.843  80.209  25.727  1.00 18.54 ? 103  THR A OG1 1 
ATOM   794   C  CG2 . THR A  1 111 ? -21.887  78.582  23.924  1.00 17.11 ? 103  THR A CG2 1 
ATOM   795   N  N   . GLY A  1 112 ? -20.265  82.765  25.006  1.00 20.97 ? 104  GLY A N   1 
ATOM   796   C  CA  . GLY A  1 112 ? -20.475  84.094  25.603  1.00 20.53 ? 104  GLY A CA  1 
ATOM   797   C  C   . GLY A  1 112 ? -19.521  84.404  26.731  1.00 21.19 ? 104  GLY A C   1 
ATOM   798   O  O   . GLY A  1 112 ? -18.534  83.679  26.989  1.00 20.14 ? 104  GLY A O   1 
ATOM   799   N  N   . LYS A  1 113 ? -19.798  85.505  27.410  1.00 21.48 ? 105  LYS A N   1 
ATOM   800   C  CA  . LYS A  1 113 ? -18.962  85.899  28.513  1.00 21.58 ? 105  LYS A CA  1 
ATOM   801   C  C   . LYS A  1 113 ? -19.729  86.873  29.357  1.00 22.57 ? 105  LYS A C   1 
ATOM   802   O  O   . LYS A  1 113 ? -20.605  87.587  28.854  1.00 22.07 ? 105  LYS A O   1 
ATOM   803   C  CB  . LYS A  1 113 ? -17.608  86.475  28.039  1.00 21.01 ? 105  LYS A CB  1 
ATOM   804   C  CG  . LYS A  1 113 ? -17.613  87.782  27.242  1.00 20.85 ? 105  LYS A CG  1 
ATOM   805   C  CD  . LYS A  1 113 ? -16.288  87.895  26.426  1.00 20.34 ? 105  LYS A CD  1 
ATOM   806   C  CE  . LYS A  1 113 ? -16.091  89.158  25.646  1.00 19.37 ? 105  LYS A CE  1 
ATOM   807   N  NZ  . LYS A  1 113 ? -14.720  89.245  24.977  1.00 15.73 ? 105  LYS A NZ  1 
ATOM   808   N  N   . HIS A  1 114 ? -19.399  86.890  30.642  1.00 23.28 ? 106  HIS A N   1 
ATOM   809   C  CA  . HIS A  1 114 ? -20.216  87.582  31.642  1.00 24.62 ? 106  HIS A CA  1 
ATOM   810   C  C   . HIS A  1 114 ? -19.319  88.305  32.606  1.00 25.07 ? 106  HIS A C   1 
ATOM   811   O  O   . HIS A  1 114 ? -18.517  87.677  33.318  1.00 25.32 ? 106  HIS A O   1 
ATOM   812   C  CB  . HIS A  1 114 ? -21.084  86.570  32.400  1.00 24.38 ? 106  HIS A CB  1 
ATOM   813   C  CG  . HIS A  1 114 ? -21.937  87.189  33.448  1.00 26.98 ? 106  HIS A CG  1 
ATOM   814   N  ND1 . HIS A  1 114 ? -22.480  86.462  34.483  1.00 31.72 ? 106  HIS A ND1 1 
ATOM   815   C  CD2 . HIS A  1 114 ? -22.343  88.470  33.628  1.00 28.70 ? 106  HIS A CD2 1 
ATOM   816   C  CE1 . HIS A  1 114 ? -23.163  87.286  35.269  1.00 34.10 ? 106  HIS A CE1 1 
ATOM   817   N  NE2 . HIS A  1 114 ? -23.099  88.509  34.771  1.00 29.01 ? 106  HIS A NE2 1 
ATOM   818   N  N   . GLY A  1 115 ? -19.451  89.604  32.585  1.00 26.42 ? 107  GLY A N   1 
ATOM   819   C  CA  . GLY A  1 115 ? -18.642  90.464  33.389  1.00 28.20 ? 107  GLY A CA  1 
ATOM   820   C  C   . GLY A  1 115 ? -19.042  90.568  34.826  1.00 29.06 ? 107  GLY A C   1 
ATOM   821   O  O   . GLY A  1 115 ? -20.136  90.317  35.181  1.00 29.66 ? 107  GLY A O   1 
ATOM   822   N  N   . GLY A  1 116 ? -18.106  90.969  35.655  1.00 30.87 ? 108  GLY A N   1 
ATOM   823   C  CA  . GLY A  1 116 ? -18.311  91.035  37.083  1.00 30.42 ? 108  GLY A CA  1 
ATOM   824   C  C   . GLY A  1 116 ? -17.592  89.896  37.724  1.00 30.67 ? 108  GLY A C   1 
ATOM   825   O  O   . GLY A  1 116 ? -16.468  90.028  38.078  1.00 32.58 ? 108  GLY A O   1 
ATOM   826   N  N   . VAL A  1 117 ? -18.250  88.766  37.812  1.00 29.53 ? 109  VAL A N   1 
ATOM   827   C  CA  . VAL A  1 117 ? -17.621  87.523  38.112  1.00 28.51 ? 109  VAL A CA  1 
ATOM   828   C  C   . VAL A  1 117 ? -16.575  87.166  37.089  1.00 27.52 ? 109  VAL A C   1 
ATOM   829   O  O   . VAL A  1 117 ? -15.691  86.447  37.381  1.00 27.86 ? 109  VAL A O   1 
ATOM   830   C  CB  . VAL A  1 117 ? -18.627  86.352  38.263  1.00 29.29 ? 109  VAL A CB  1 
ATOM   831   C  CG1 . VAL A  1 117 ? -19.557  86.614  39.311  1.00 30.82 ? 109  VAL A CG1 1 
ATOM   832   C  CG2 . VAL A  1 117 ? -19.347  86.033  36.981  1.00 28.48 ? 109  VAL A CG2 1 
ATOM   833   N  N   . ASN A  1 118 ? -16.693  87.673  35.887  1.00 26.06 ? 110  ASN A N   1 
ATOM   834   C  CA  . ASN A  1 118 ? -15.721  87.458  34.842  1.00 24.43 ? 110  ASN A CA  1 
ATOM   835   C  C   . ASN A  1 118 ? -15.541  86.033  34.371  1.00 23.66 ? 110  ASN A C   1 
ATOM   836   O  O   . ASN A  1 118 ? -14.517  85.462  34.479  1.00 23.98 ? 110  ASN A O   1 
ATOM   837   C  CB  . ASN A  1 118 ? -14.397  88.117  35.207  1.00 25.23 ? 110  ASN A CB  1 
ATOM   838   C  CG  . ASN A  1 118 ? -14.454  89.615  35.138  1.00 26.52 ? 110  ASN A CG  1 
ATOM   839   O  OD1 . ASN A  1 118 ? -15.201  90.171  34.400  1.00 24.81 ? 110  ASN A OD1 1 
ATOM   840   N  ND2 . ASN A  1 118 ? -13.646  90.255  35.901  1.00 23.32 ? 110  ASN A ND2 1 
ATOM   841   N  N   . HIS A  1 119 ? -16.593  85.482  33.833  1.00 23.20 ? 111  HIS A N   1 
ATOM   842   C  CA  . HIS A  1 119 ? -16.612  84.131  33.315  1.00 22.08 ? 111  HIS A CA  1 
ATOM   843   C  C   . HIS A  1 119 ? -16.733  84.129  31.786  1.00 21.77 ? 111  HIS A C   1 
ATOM   844   O  O   . HIS A  1 119 ? -17.407  84.965  31.187  1.00 21.42 ? 111  HIS A O   1 
ATOM   845   C  CB  . HIS A  1 119 ? -17.838  83.381  33.878  1.00 23.24 ? 111  HIS A CB  1 
ATOM   846   C  CG  . HIS A  1 119 ? -17.734  83.031  35.331  1.00 24.76 ? 111  HIS A CG  1 
ATOM   847   N  ND1 . HIS A  1 119 ? -18.748  82.391  36.007  1.00 22.69 ? 111  HIS A ND1 1 
ATOM   848   C  CD2 . HIS A  1 119 ? -16.731  83.224  36.236  1.00 26.22 ? 111  HIS A CD2 1 
ATOM   849   C  CE1 . HIS A  1 119 ? -18.384  82.214  37.271  1.00 24.71 ? 111  HIS A CE1 1 
ATOM   850   N  NE2 . HIS A  1 119 ? -17.168  82.711  37.438  1.00 24.92 ? 111  HIS A NE2 1 
ATOM   851   N  N   . VAL A  1 120 ? -16.123  83.145  31.156  1.00 21.59 ? 112  VAL A N   1 
ATOM   852   C  CA  . VAL A  1 120 ? -16.318  82.881  29.759  1.00 21.10 ? 112  VAL A CA  1 
ATOM   853   C  C   . VAL A  1 120 ? -17.127  81.594  29.694  1.00 21.78 ? 112  VAL A C   1 
ATOM   854   O  O   . VAL A  1 120 ? -16.852  80.643  30.408  1.00 21.49 ? 112  VAL A O   1 
ATOM   855   C  CB  . VAL A  1 120 ? -14.960  82.762  28.979  1.00 21.43 ? 112  VAL A CB  1 
ATOM   856   C  CG1 . VAL A  1 120 ? -15.161  82.104  27.572  1.00 18.39 ? 112  VAL A CG1 1 
ATOM   857   C  CG2 . VAL A  1 120 ? -14.308  84.117  28.900  1.00 18.68 ? 112  VAL A CG2 1 
ATOM   858   N  N   . LEU A  1 121 ? -18.140  81.573  28.825  1.00 22.29 ? 113  LEU A N   1 
ATOM   859   C  CA  . LEU A  1 121 ? -19.092  80.486  28.811  1.00 21.97 ? 113  LEU A CA  1 
ATOM   860   C  C   . LEU A  1 121 ? -18.866  79.649  27.592  1.00 22.38 ? 113  LEU A C   1 
ATOM   861   O  O   . LEU A  1 121 ? -18.596  80.185  26.524  1.00 22.84 ? 113  LEU A O   1 
ATOM   862   C  CB  . LEU A  1 121 ? -20.496  81.068  28.841  1.00 22.28 ? 113  LEU A CB  1 
ATOM   863   C  CG  . LEU A  1 121 ? -20.671  82.132  29.940  1.00 22.07 ? 113  LEU A CG  1 
ATOM   864   C  CD1 . LEU A  1 121 ? -22.105  82.654  29.925  1.00 19.85 ? 113  LEU A CD1 1 
ATOM   865   C  CD2 . LEU A  1 121 ? -20.278  81.560  31.330  1.00 19.87 ? 113  LEU A CD2 1 
ATOM   866   N  N   . VAL A  1 122 ? -18.987  78.337  27.745  1.00 22.46 ? 114  VAL A N   1 
ATOM   867   C  CA  . VAL A  1 122 ? -18.507  77.415  26.756  1.00 23.06 ? 114  VAL A CA  1 
ATOM   868   C  C   . VAL A  1 122 ? -19.484  76.244  26.591  1.00 24.67 ? 114  VAL A C   1 
ATOM   869   O  O   . VAL A  1 122 ? -19.959  75.696  27.568  1.00 25.50 ? 114  VAL A O   1 
ATOM   870   C  CB  . VAL A  1 122 ? -17.076  76.839  27.134  1.00 23.73 ? 114  VAL A CB  1 
ATOM   871   C  CG1 . VAL A  1 122 ? -16.603  75.790  26.074  1.00 21.13 ? 114  VAL A CG1 1 
ATOM   872   C  CG2 . VAL A  1 122 ? -16.065  77.974  27.384  1.00 19.35 ? 114  VAL A CG2 1 
ATOM   873   N  N   . HIS A  1 123 ? -19.746  75.866  25.353  1.00 25.59 ? 115  HIS A N   1 
ATOM   874   C  CA  . HIS A  1 123 ? -20.567  74.695  25.030  1.00 27.57 ? 115  HIS A CA  1 
ATOM   875   C  C   . HIS A  1 123 ? -19.692  73.489  24.669  1.00 28.39 ? 115  HIS A C   1 
ATOM   876   O  O   . HIS A  1 123 ? -18.862  73.587  23.767  1.00 28.49 ? 115  HIS A O   1 
ATOM   877   C  CB  . HIS A  1 123 ? -21.484  75.025  23.825  1.00 27.66 ? 115  HIS A CB  1 
ATOM   878   C  CG  . HIS A  1 123 ? -22.234  73.851  23.299  1.00 28.79 ? 115  HIS A CG  1 
ATOM   879   N  ND1 . HIS A  1 123 ? -23.440  73.449  23.823  1.00 30.55 ? 115  HIS A ND1 1 
ATOM   880   C  CD2 . HIS A  1 123 ? -21.937  72.971  22.311  1.00 30.94 ? 115  HIS A CD2 1 
ATOM   881   C  CE1 . HIS A  1 123 ? -23.844  72.360  23.188  1.00 31.14 ? 115  HIS A CE1 1 
ATOM   882   N  NE2 . HIS A  1 123 ? -22.952  72.053  22.265  1.00 28.74 ? 115  HIS A NE2 1 
ATOM   883   N  N   . PHE A  1 124 ? -19.870  72.377  25.364  1.00 29.69 ? 116  PHE A N   1 
ATOM   884   C  CA  . PHE A  1 124 ? -19.315  71.118  24.915  1.00 31.78 ? 116  PHE A CA  1 
ATOM   885   C  C   . PHE A  1 124 ? -20.485  70.231  24.591  1.00 34.61 ? 116  PHE A C   1 
ATOM   886   O  O   . PHE A  1 124 ? -21.577  70.478  25.054  1.00 35.00 ? 116  PHE A O   1 
ATOM   887   C  CB  . PHE A  1 124 ? -18.455  70.442  25.979  1.00 30.78 ? 116  PHE A CB  1 
ATOM   888   C  CG  . PHE A  1 124 ? -17.273  71.255  26.419  1.00 29.34 ? 116  PHE A CG  1 
ATOM   889   C  CD1 . PHE A  1 124 ? -16.079  71.212  25.724  1.00 29.35 ? 116  PHE A CD1 1 
ATOM   890   C  CD2 . PHE A  1 124 ? -17.340  72.043  27.534  1.00 26.32 ? 116  PHE A CD2 1 
ATOM   891   C  CE1 . PHE A  1 124 ? -14.978  72.004  26.118  1.00 29.58 ? 116  PHE A CE1 1 
ATOM   892   C  CE2 . PHE A  1 124 ? -16.235  72.789  27.945  1.00 26.74 ? 116  PHE A CE2 1 
ATOM   893   C  CZ  . PHE A  1 124 ? -15.065  72.771  27.234  1.00 26.41 ? 116  PHE A CZ  1 
ATOM   894   N  N   . GLU A  1 125 ? -20.251  69.168  23.842  1.00 38.38 ? 117  GLU A N   1 
ATOM   895   C  CA  . GLU A  1 125 ? -21.306  68.213  23.536  1.00 41.89 ? 117  GLU A CA  1 
ATOM   896   C  C   . GLU A  1 125 ? -21.687  67.474  24.794  1.00 42.44 ? 117  GLU A C   1 
ATOM   897   O  O   . GLU A  1 125 ? -20.942  67.447  25.767  1.00 41.78 ? 117  GLU A O   1 
ATOM   898   C  CB  . GLU A  1 125 ? -20.941  67.289  22.345  1.00 43.94 ? 117  GLU A CB  1 
ATOM   899   C  CG  . GLU A  1 125 ? -19.688  66.445  22.520  1.00 51.61 ? 117  GLU A CG  1 
ATOM   900   C  CD  . GLU A  1 125 ? -18.832  66.281  21.199  1.00 60.93 ? 117  GLU A CD  1 
ATOM   901   O  OE1 . GLU A  1 125 ? -19.436  66.025  20.098  1.00 65.73 ? 117  GLU A OE1 1 
ATOM   902   O  OE2 . GLU A  1 125 ? -17.552  66.387  21.295  1.00 63.15 ? 117  GLU A OE2 1 
ATOM   903   N  N   . GLU A  1 126 ? -22.895  66.942  24.808  1.00 44.10 ? 118  GLU A N   1 
ATOM   904   C  CA  . GLU A  1 126 ? -23.484  66.464  26.047  1.00 45.85 ? 118  GLU A CA  1 
ATOM   905   C  C   . GLU A  1 126 ? -22.723  65.335  26.754  1.00 45.02 ? 118  GLU A C   1 
ATOM   906   O  O   . GLU A  1 126 ? -22.617  65.321  27.962  1.00 44.48 ? 118  GLU A O   1 
ATOM   907   C  CB  . GLU A  1 126 ? -24.909  66.033  25.777  1.00 47.48 ? 118  GLU A CB  1 
ATOM   908   C  CG  . GLU A  1 126 ? -25.652  65.611  27.028  1.00 54.20 ? 118  GLU A CG  1 
ATOM   909   C  CD  . GLU A  1 126 ? -27.180  65.593  26.832  1.00 63.22 ? 118  GLU A CD  1 
ATOM   910   O  OE1 . GLU A  1 126 ? -27.655  65.368  25.675  1.00 66.68 ? 118  GLU A OE1 1 
ATOM   911   O  OE2 . GLU A  1 126 ? -27.895  65.808  27.853  1.00 67.42 ? 118  GLU A OE2 1 
ATOM   912   N  N   . GLU A  1 127 ? -22.209  64.372  26.014  1.00 44.99 ? 119  GLU A N   1 
ATOM   913   C  CA  . GLU A  1 127 ? -21.436  63.317  26.647  1.00 46.24 ? 119  GLU A CA  1 
ATOM   914   C  C   . GLU A  1 127 ? -20.178  63.854  27.368  1.00 43.80 ? 119  GLU A C   1 
ATOM   915   O  O   . GLU A  1 127 ? -19.670  63.209  28.231  1.00 44.37 ? 119  GLU A O   1 
ATOM   916   C  CB  . GLU A  1 127 ? -21.066  62.196  25.642  1.00 48.35 ? 119  GLU A CB  1 
ATOM   917   C  CG  . GLU A  1 127 ? -20.281  62.682  24.399  1.00 55.22 ? 119  GLU A CG  1 
ATOM   918   C  CD  . GLU A  1 127 ? -20.160  61.659  23.189  1.00 64.87 ? 119  GLU A CD  1 
ATOM   919   O  OE1 . GLU A  1 127 ? -19.122  60.904  23.119  1.00 68.17 ? 119  GLU A OE1 1 
ATOM   920   O  OE2 . GLU A  1 127 ? -21.069  61.675  22.281  1.00 67.41 ? 119  GLU A OE2 1 
ATOM   921   N  N   . VAL A  1 128 ? -19.669  65.026  27.012  1.00 41.55 ? 120  VAL A N   1 
ATOM   922   C  CA  . VAL A  1 128 ? -18.499  65.584  27.692  1.00 39.80 ? 120  VAL A CA  1 
ATOM   923   C  C   . VAL A  1 128 ? -18.802  66.046  29.138  1.00 38.94 ? 120  VAL A C   1 
ATOM   924   O  O   . VAL A  1 128 ? -17.982  65.873  30.052  1.00 37.72 ? 120  VAL A O   1 
ATOM   925   C  CB  . VAL A  1 128 ? -17.902  66.755  26.890  1.00 39.55 ? 120  VAL A CB  1 
ATOM   926   C  CG1 . VAL A  1 128 ? -16.840  67.465  27.706  1.00 36.60 ? 120  VAL A CG1 1 
ATOM   927   C  CG2 . VAL A  1 128 ? -17.379  66.275  25.512  1.00 36.36 ? 120  VAL A CG2 1 
ATOM   928   N  N   . LEU A  1 129 ? -19.995  66.592  29.344  1.00 37.52 ? 121  LEU A N   1 
ATOM   929   C  CA  . LEU A  1 129 ? -20.292  67.319  30.571  1.00 36.78 ? 121  LEU A CA  1 
ATOM   930   C  C   . LEU A  1 129 ? -20.143  66.447  31.787  1.00 36.91 ? 121  LEU A C   1 
ATOM   931   O  O   . LEU A  1 129 ? -19.685  66.904  32.842  1.00 36.06 ? 121  LEU A O   1 
ATOM   932   C  CB  . LEU A  1 129 ? -21.716  67.909  30.534  1.00 36.58 ? 121  LEU A CB  1 
ATOM   933   C  CG  . LEU A  1 129 ? -22.002  68.990  29.495  1.00 36.20 ? 121  LEU A CG  1 
ATOM   934   C  CD1 . LEU A  1 129 ? -23.373  69.577  29.733  1.00 35.94 ? 121  LEU A CD1 1 
ATOM   935   C  CD2 . LEU A  1 129 ? -20.956  70.033  29.580  1.00 32.30 ? 121  LEU A CD2 1 
ATOM   936   N  N   . GLY A  1 130 ? -20.580  65.195  31.632  1.00 37.82 ? 122  GLY A N   1 
ATOM   937   C  CA  . GLY A  1 130 ? -20.543  64.196  32.705  1.00 38.12 ? 122  GLY A CA  1 
ATOM   938   C  C   . GLY A  1 130 ? -19.131  63.839  33.188  1.00 38.32 ? 122  GLY A C   1 
ATOM   939   O  O   . GLY A  1 130 ? -18.968  63.389  34.304  1.00 38.42 ? 122  GLY A O   1 
ATOM   940   N  N   . LYS A  1 131 ? -18.116  64.070  32.355  1.00 37.86 ? 123  LYS A N   1 
ATOM   941   C  CA  . LYS A  1 131 ? -16.734  63.821  32.748  1.00 38.17 ? 123  LYS A CA  1 
ATOM   942   C  C   . LYS A  1 131 ? -15.993  65.044  33.318  1.00 36.06 ? 123  LYS A C   1 
ATOM   943   O  O   . LYS A  1 131 ? -14.881  64.891  33.841  1.00 36.01 ? 123  LYS A O   1 
ATOM   944   C  CB  . LYS A  1 131 ? -15.953  63.301  31.552  1.00 39.76 ? 123  LYS A CB  1 
ATOM   945   C  CG  . LYS A  1 131 ? -16.564  62.062  30.895  1.00 44.47 ? 123  LYS A CG  1 
ATOM   946   C  CD  . LYS A  1 131 ? -15.529  61.329  29.981  1.00 52.29 ? 123  LYS A CD  1 
ATOM   947   C  CE  . LYS A  1 131 ? -15.760  61.561  28.478  1.00 56.42 ? 123  LYS A CE  1 
ATOM   948   N  NZ  . LYS A  1 131 ? -17.115  61.084  27.975  1.00 58.23 ? 123  LYS A NZ  1 
ATOM   949   N  N   . LEU A  1 132 ? -16.583  66.234  33.203  1.00 33.14 ? 124  LEU A N   1 
ATOM   950   C  CA  . LEU A  1 132 ? -15.919  67.451  33.636  1.00 31.63 ? 124  LEU A CA  1 
ATOM   951   C  C   . LEU A  1 132 ? -15.938  67.643  35.150  1.00 30.54 ? 124  LEU A C   1 
ATOM   952   O  O   . LEU A  1 132 ? -16.836  67.208  35.836  1.00 29.37 ? 124  LEU A O   1 
ATOM   953   C  CB  . LEU A  1 132 ? -16.547  68.684  32.978  1.00 31.07 ? 124  LEU A CB  1 
ATOM   954   C  CG  . LEU A  1 132 ? -16.384  68.825  31.459  1.00 31.19 ? 124  LEU A CG  1 
ATOM   955   C  CD1 . LEU A  1 132 ? -17.156  70.025  31.005  1.00 29.94 ? 124  LEU A CD1 1 
ATOM   956   C  CD2 . LEU A  1 132 ? -14.916  68.909  30.971  1.00 26.94 ? 124  LEU A CD2 1 
ATOM   957   N  N   . MET A  1 133 ? -14.934  68.342  35.656  1.00 29.76 ? 125  MET A N   1 
ATOM   958   C  CA  . MET A  1 133 ? -14.866  68.648  37.078  1.00 29.25 ? 125  MET A CA  1 
ATOM   959   C  C   . MET A  1 133 ? -14.473  70.115  37.270  1.00 27.96 ? 125  MET A C   1 
ATOM   960   O  O   . MET A  1 133 ? -13.664  70.652  36.519  1.00 28.35 ? 125  MET A O   1 
ATOM   961   C  CB  . MET A  1 133 ? -13.832  67.720  37.742  1.00 29.60 ? 125  MET A CB  1 
ATOM   962   C  CG  . MET A  1 133 ? -13.652  67.954  39.226  1.00 31.39 ? 125  MET A CG  1 
ATOM   963   S  SD  . MET A  1 133 ? -15.273  67.868  40.066  1.00 34.37 ? 125  MET A SD  1 
ATOM   964   C  CE  . MET A  1 133 ? -14.726  68.261  41.756  1.00 31.48 ? 125  MET A CE  1 
ATOM   965   N  N   . VAL A  1 134 ? -15.036  70.759  38.282  1.00 26.76 ? 126  VAL A N   1 
ATOM   966   C  CA  . VAL A  1 134 ? -14.625  72.092  38.641  1.00 25.52 ? 126  VAL A CA  1 
ATOM   967   C  C   . VAL A  1 134 ? -13.131  72.128  38.881  1.00 26.72 ? 126  VAL A C   1 
ATOM   968   O  O   . VAL A  1 134 ? -12.591  71.250  39.544  1.00 27.96 ? 126  VAL A O   1 
ATOM   969   C  CB  . VAL A  1 134 ? -15.357  72.607  39.873  1.00 24.76 ? 126  VAL A CB  1 
ATOM   970   C  CG1 . VAL A  1 134 ? -14.825  73.977  40.267  1.00 23.62 ? 126  VAL A CG1 1 
ATOM   971   C  CG2 . VAL A  1 134 ? -16.817  72.686  39.588  1.00 22.42 ? 126  VAL A CG2 1 
ATOM   972   N  N   . GLY A  1 135 ? -12.447  73.132  38.325  1.00 26.91 ? 127  GLY A N   1 
ATOM   973   C  CA  . GLY A  1 135 ? -10.981  73.190  38.420  1.00 26.39 ? 127  GLY A CA  1 
ATOM   974   C  C   . GLY A  1 135 ? -10.239  72.573  37.239  1.00 26.68 ? 127  GLY A C   1 
ATOM   975   O  O   . GLY A  1 135 ? -9.071   72.806  37.094  1.00 25.22 ? 127  GLY A O   1 
ATOM   976   N  N   . ASP A  1 136 ? -10.905  71.808  36.363  1.00 26.95 ? 128  ASP A N   1 
ATOM   977   C  CA  . ASP A  1 136 ? -10.241  71.320  35.173  1.00 27.53 ? 128  ASP A CA  1 
ATOM   978   C  C   . ASP A  1 136 ? -9.690   72.500  34.331  1.00 28.12 ? 128  ASP A C   1 
ATOM   979   O  O   . ASP A  1 136 ? -10.325  73.547  34.207  1.00 27.65 ? 128  ASP A O   1 
ATOM   980   C  CB  . ASP A  1 136 ? -11.179  70.409  34.347  1.00 27.89 ? 128  ASP A CB  1 
ATOM   981   C  CG  . ASP A  1 136 ? -11.421  69.009  35.006  1.00 30.74 ? 128  ASP A CG  1 
ATOM   982   O  OD1 . ASP A  1 136 ? -10.766  68.709  36.066  1.00 31.54 ? 128  ASP A OD1 1 
ATOM   983   O  OD2 . ASP A  1 136 ? -12.277  68.217  34.461  1.00 31.99 ? 128  ASP A OD2 1 
ATOM   984   N  N   . LYS A  1 137 ? -8.511   72.327  33.739  1.00 28.91 ? 129  LYS A N   1 
ATOM   985   C  CA  . LYS A  1 137 ? -7.877   73.390  32.975  1.00 29.00 ? 129  LYS A CA  1 
ATOM   986   C  C   . LYS A  1 137 ? -8.497   73.549  31.606  1.00 27.63 ? 129  LYS A C   1 
ATOM   987   O  O   . LYS A  1 137 ? -8.804   72.552  30.937  1.00 27.10 ? 129  LYS A O   1 
ATOM   988   C  CB  . LYS A  1 137 ? -6.386   73.128  32.803  1.00 29.88 ? 129  LYS A CB  1 
ATOM   989   C  CG  . LYS A  1 137 ? -5.616   72.917  34.086  1.00 34.78 ? 129  LYS A CG  1 
ATOM   990   C  CD  . LYS A  1 137 ? -4.164   72.642  33.710  1.00 41.69 ? 129  LYS A CD  1 
ATOM   991   C  CE  . LYS A  1 137 ? -3.277   72.360  34.907  1.00 45.63 ? 129  LYS A CE  1 
ATOM   992   N  NZ  . LYS A  1 137 ? -1.955   71.858  34.335  1.00 48.67 ? 129  LYS A NZ  1 
ATOM   993   N  N   . ILE A  1 138 ? -8.603   74.813  31.166  1.00 26.70 ? 130  ILE A N   1 
ATOM   994   C  CA  . ILE A  1 138 ? -9.289   75.161  29.904  1.00 25.44 ? 130  ILE A CA  1 
ATOM   995   C  C   . ILE A  1 138 ? -8.431   76.085  29.040  1.00 25.74 ? 130  ILE A C   1 
ATOM   996   O  O   . ILE A  1 138 ? -7.866   77.088  29.544  1.00 25.56 ? 130  ILE A O   1 
ATOM   997   C  CB  . ILE A  1 138 ? -10.657  75.859  30.177  1.00 24.69 ? 130  ILE A CB  1 
ATOM   998   C  CG1 . ILE A  1 138 ? -11.594  74.936  30.957  1.00 23.46 ? 130  ILE A CG1 1 
ATOM   999   C  CG2 . ILE A  1 138 ? -11.341  76.254  28.874  1.00 22.73 ? 130  ILE A CG2 1 
ATOM   1000  C  CD1 . ILE A  1 138 ? -12.074  73.681  30.189  1.00 21.12 ? 130  ILE A CD1 1 
ATOM   1001  N  N   . LEU A  1 139 ? -8.310   75.700  27.759  1.00 24.96 ? 131  LEU A N   1 
ATOM   1002  C  CA  . LEU A  1 139 ? -7.601   76.459  26.753  1.00 25.66 ? 131  LEU A CA  1 
ATOM   1003  C  C   . LEU A  1 139 ? -8.585   77.060  25.728  1.00 24.85 ? 131  LEU A C   1 
ATOM   1004  O  O   . LEU A  1 139 ? -9.329   76.326  25.050  1.00 23.83 ? 131  LEU A O   1 
ATOM   1005  C  CB  . LEU A  1 139 ? -6.551   75.614  26.040  1.00 26.16 ? 131  LEU A CB  1 
ATOM   1006  C  CG  . LEU A  1 139 ? -5.766   76.276  24.880  1.00 27.90 ? 131  LEU A CG  1 
ATOM   1007  C  CD1 . LEU A  1 139 ? -4.969   77.476  25.278  1.00 25.88 ? 131  LEU A CD1 1 
ATOM   1008  C  CD2 . LEU A  1 139 ? -4.823   75.203  24.243  1.00 29.60 ? 131  LEU A CD2 1 
ATOM   1009  N  N   . ILE A  1 140 ? -8.605   78.396  25.688  1.00 24.22 ? 132  ILE A N   1 
ATOM   1010  C  CA  . ILE A  1 140 ? -9.361   79.113  24.720  1.00 24.36 ? 132  ILE A CA  1 
ATOM   1011  C  C   . ILE A  1 140 ? -8.400   79.601  23.644  1.00 25.13 ? 132  ILE A C   1 
ATOM   1012  O  O   . ILE A  1 140 ? -7.440   80.314  23.941  1.00 25.18 ? 132  ILE A O   1 
ATOM   1013  C  CB  . ILE A  1 140 ? -10.112  80.294  25.331  1.00 24.28 ? 132  ILE A CB  1 
ATOM   1014  C  CG1 . ILE A  1 140 ? -11.214  79.817  26.303  1.00 23.38 ? 132  ILE A CG1 1 
ATOM   1015  C  CG2 . ILE A  1 140 ? -10.725  81.080  24.206  1.00 21.81 ? 132  ILE A CG2 1 
ATOM   1016  C  CD1 . ILE A  1 140 ? -11.553  80.763  27.476  1.00 20.49 ? 132  ILE A CD1 1 
ATOM   1017  N  N   . LYS A  1 141 ? -8.640   79.222  22.393  1.00 25.79 ? 133  LYS A N   1 
ATOM   1018  C  CA  . LYS A  1 141 ? -7.815   79.756  21.293  1.00 26.72 ? 133  LYS A CA  1 
ATOM   1019  C  C   . LYS A  1 141 ? -8.440   81.050  20.847  1.00 25.37 ? 133  LYS A C   1 
ATOM   1020  O  O   . LYS A  1 141 ? -9.278   81.087  19.990  1.00 26.12 ? 133  LYS A O   1 
ATOM   1021  C  CB  . LYS A  1 141 ? -7.628   78.724  20.181  1.00 28.26 ? 133  LYS A CB  1 
ATOM   1022  C  CG  . LYS A  1 141 ? -7.192   77.360  20.726  1.00 32.25 ? 133  LYS A CG  1 
ATOM   1023  C  CD  . LYS A  1 141 ? -6.011   76.714  20.034  1.00 40.72 ? 133  LYS A CD  1 
ATOM   1024  C  CE  . LYS A  1 141 ? -6.312   76.101  18.656  1.00 46.28 ? 133  LYS A CE  1 
ATOM   1025  N  NZ  . LYS A  1 141 ? -5.062   75.567  17.949  1.00 49.54 ? 133  LYS A NZ  1 
ATOM   1026  N  N   . ALA A  1 142 ? -8.045   82.111  21.517  1.00 24.83 ? 134  ALA A N   1 
ATOM   1027  C  CA  . ALA A  1 142 ? -8.684   83.390  21.408  1.00 24.65 ? 134  ALA A CA  1 
ATOM   1028  C  C   . ALA A  1 142 ? -8.355   84.012  20.065  1.00 25.07 ? 134  ALA A C   1 
ATOM   1029  O  O   . ALA A  1 142 ? -7.185   84.213  19.750  1.00 24.96 ? 134  ALA A O   1 
ATOM   1030  C  CB  . ALA A  1 142 ? -8.212   84.319  22.544  1.00 22.58 ? 134  ALA A CB  1 
ATOM   1031  N  N   . TRP A  1 143 ? -9.375   84.410  19.326  1.00 25.32 ? 135  TRP A N   1 
ATOM   1032  C  CA  . TRP A  1 143 ? -9.186   85.023  18.004  1.00 25.27 ? 135  TRP A CA  1 
ATOM   1033  C  C   . TRP A  1 143 ? -10.408  85.873  17.665  1.00 23.99 ? 135  TRP A C   1 
ATOM   1034  O  O   . TRP A  1 143 ? -11.546  85.390  17.729  1.00 23.27 ? 135  TRP A O   1 
ATOM   1035  C  CB  . TRP A  1 143 ? -9.072   83.872  17.048  1.00 26.01 ? 135  TRP A CB  1 
ATOM   1036  C  CG  . TRP A  1 143 ? -8.816   84.191  15.632  1.00 30.57 ? 135  TRP A CG  1 
ATOM   1037  C  CD1 . TRP A  1 143 ? -7.896   85.046  15.136  1.00 35.98 ? 135  TRP A CD1 1 
ATOM   1038  C  CD2 . TRP A  1 143 ? -9.413   83.566  14.509  1.00 32.85 ? 135  TRP A CD2 1 
ATOM   1039  N  NE1 . TRP A  1 143 ? -7.910   85.038  13.750  1.00 34.97 ? 135  TRP A NE1 1 
ATOM   1040  C  CE2 . TRP A  1 143 ? -8.845   84.141  13.345  1.00 35.06 ? 135  TRP A CE2 1 
ATOM   1041  C  CE3 . TRP A  1 143 ? -10.397  82.602  14.368  1.00 33.23 ? 135  TRP A CE3 1 
ATOM   1042  C  CZ2 . TRP A  1 143 ? -9.225   83.785  12.074  1.00 36.77 ? 135  TRP A CZ2 1 
ATOM   1043  C  CZ3 . TRP A  1 143 ? -10.798  82.264  13.110  1.00 34.34 ? 135  TRP A CZ3 1 
ATOM   1044  C  CH2 . TRP A  1 143 ? -10.207  82.844  11.972  1.00 36.46 ? 135  TRP A CH2 1 
ATOM   1045  N  N   . GLY A  1 144 ? -10.186  87.143  17.360  1.00 23.12 ? 136  GLY A N   1 
ATOM   1046  C  CA  . GLY A  1 144 ? -11.201  87.991  16.815  1.00 22.15 ? 136  GLY A CA  1 
ATOM   1047  C  C   . GLY A  1 144 ? -11.128  89.427  17.248  1.00 22.97 ? 136  GLY A C   1 
ATOM   1048  O  O   . GLY A  1 144 ? -11.641  90.302  16.542  1.00 22.36 ? 136  GLY A O   1 
ATOM   1049  N  N   . GLN A  1 145 ? -10.537  89.728  18.409  1.00 23.40 ? 137  GLN A N   1 
ATOM   1050  C  CA  . GLN A  1 145 ? -10.403  91.146  18.736  1.00 24.40 ? 137  GLN A CA  1 
ATOM   1051  C  C   . GLN A  1 145 ? -9.350   91.750  17.805  1.00 24.84 ? 137  GLN A C   1 
ATOM   1052  O  O   . GLN A  1 145 ? -8.275   91.114  17.540  1.00 25.43 ? 137  GLN A O   1 
ATOM   1053  C  CB  . GLN A  1 145 ? -10.042  91.406  20.204  1.00 24.58 ? 137  GLN A CB  1 
ATOM   1054  C  CG  . GLN A  1 145 ? -10.961  90.797  21.201  1.00 25.42 ? 137  GLN A CG  1 
ATOM   1055  C  CD  . GLN A  1 145 ? -12.361  91.424  21.210  1.00 25.40 ? 137  GLN A CD  1 
ATOM   1056  O  OE1 . GLN A  1 145 ? -12.878  91.819  20.161  1.00 24.77 ? 137  GLN A OE1 1 
ATOM   1057  N  NE2 . GLN A  1 145 ? -12.984  91.484  22.397  1.00 21.51 ? 137  GLN A NE2 1 
ATOM   1058  N  N   . GLY A  1 146 ? -9.676   92.953  17.329  1.00 24.51 ? 138  GLY A N   1 
ATOM   1059  C  CA  . GLY A  1 146 ? -8.950   93.652  16.286  1.00 25.14 ? 138  GLY A CA  1 
ATOM   1060  C  C   . GLY A  1 146 ? -9.554   93.552  14.899  1.00 25.51 ? 138  GLY A C   1 
ATOM   1061  O  O   . GLY A  1 146 ? -9.104   94.242  13.947  1.00 25.90 ? 138  GLY A O   1 
ATOM   1062  N  N   . LEU A  1 147 ? -10.571  92.694  14.770  1.00 26.04 ? 139  LEU A N   1 
ATOM   1063  C  CA  . LEU A  1 147 ? -11.274  92.510  13.501  1.00 26.02 ? 139  LEU A CA  1 
ATOM   1064  C  C   . LEU A  1 147 ? -11.826  93.811  13.004  1.00 26.49 ? 139  LEU A C   1 
ATOM   1065  O  O   . LEU A  1 147 ? -12.435  94.562  13.747  1.00 24.27 ? 139  LEU A O   1 
ATOM   1066  C  CB  . LEU A  1 147 ? -12.395  91.491  13.621  1.00 25.60 ? 139  LEU A CB  1 
ATOM   1067  C  CG  . LEU A  1 147 ? -13.176  91.182  12.333  1.00 26.08 ? 139  LEU A CG  1 
ATOM   1068  C  CD1 . LEU A  1 147 ? -12.287  90.495  11.226  1.00 22.09 ? 139  LEU A CD1 1 
ATOM   1069  C  CD2 . LEU A  1 147 ? -14.380  90.294  12.678  1.00 23.26 ? 139  LEU A CD2 1 
ATOM   1070  N  N   . LYS A  1 148 ? -11.599  94.066  11.718  1.00 28.85 ? 140  LYS A N   1 
ATOM   1071  C  CA  . LYS A  1 148 ? -12.145  95.238  11.045  1.00 30.87 ? 140  LYS A CA  1 
ATOM   1072  C  C   . LYS A  1 148 ? -12.857  94.889  9.773   1.00 30.30 ? 140  LYS A C   1 
ATOM   1073  O  O   . LYS A  1 148 ? -12.426  93.990  9.029   1.00 29.90 ? 140  LYS A O   1 
ATOM   1074  C  CB  . LYS A  1 148 ? -11.043  96.221  10.712  1.00 32.75 ? 140  LYS A CB  1 
ATOM   1075  C  CG  . LYS A  1 148 ? -10.533  96.965  11.894  1.00 37.04 ? 140  LYS A CG  1 
ATOM   1076  C  CD  . LYS A  1 148 ? -9.289   97.722  11.507  1.00 45.83 ? 140  LYS A CD  1 
ATOM   1077  C  CE  . LYS A  1 148 ? -8.988   98.839  12.542  1.00 51.62 ? 140  LYS A CE  1 
ATOM   1078  N  NZ  . LYS A  1 148 ? -7.893   99.708  11.942  1.00 56.86 ? 140  LYS A NZ  1 
ATOM   1079  N  N   . LEU A  1 149 ? -13.957  95.597  9.528   1.00 30.38 ? 141  LEU A N   1 
ATOM   1080  C  CA  . LEU A  1 149 ? -14.634  95.529  8.238   1.00 30.83 ? 141  LEU A CA  1 
ATOM   1081  C  C   . LEU A  1 149 ? -13.978  96.576  7.347   1.00 31.28 ? 141  LEU A C   1 
ATOM   1082  O  O   . LEU A  1 149 ? -14.145  97.765  7.548   1.00 30.91 ? 141  LEU A O   1 
ATOM   1083  C  CB  . LEU A  1 149 ? -16.127  95.767  8.372   1.00 30.30 ? 141  LEU A CB  1 
ATOM   1084  C  CG  . LEU A  1 149 ? -16.868  94.819  9.317   1.00 28.95 ? 141  LEU A CG  1 
ATOM   1085  C  CD1 . LEU A  1 149 ? -18.344  95.197  9.372   1.00 26.34 ? 141  LEU A CD1 1 
ATOM   1086  C  CD2 . LEU A  1 149 ? -16.695  93.433  8.890   1.00 28.34 ? 141  LEU A CD2 1 
ATOM   1087  N  N   . LEU A  1 150 ? -13.183  96.128  6.383   1.00 32.34 ? 142  LEU A N   1 
ATOM   1088  C  CA  . LEU A  1 150 ? -12.304  97.060  5.660   1.00 33.71 ? 142  LEU A CA  1 
ATOM   1089  C  C   . LEU A  1 150 ? -13.066  98.029  4.745   1.00 34.21 ? 142  LEU A C   1 
ATOM   1090  O  O   . LEU A  1 150 ? -12.651  99.146  4.577   1.00 33.17 ? 142  LEU A O   1 
ATOM   1091  C  CB  . LEU A  1 150 ? -11.201  96.311  4.925   1.00 33.85 ? 142  LEU A CB  1 
ATOM   1092  C  CG  . LEU A  1 150 ? -10.172  95.619  5.841   1.00 34.04 ? 142  LEU A CG  1 
ATOM   1093  C  CD1 . LEU A  1 150 ? -9.224   94.700  5.007   1.00 31.91 ? 142  LEU A CD1 1 
ATOM   1094  C  CD2 . LEU A  1 150 ? -9.423   96.619  6.717   1.00 30.41 ? 142  LEU A CD2 1 
ATOM   1095  N  N   . ASP A  1 151 ? -14.217  97.614  4.229   1.00 35.88 ? 143  ASP A N   1 
ATOM   1096  C  CA  . ASP A  1 151 ? -15.093  98.529  3.452   1.00 37.69 ? 143  ASP A CA  1 
ATOM   1097  C  C   . ASP A  1 151 ? -16.081  99.317  4.307   1.00 38.09 ? 143  ASP A C   1 
ATOM   1098  O  O   . ASP A  1 151 ? -16.834  100.071 3.757   1.00 38.98 ? 143  ASP A O   1 
ATOM   1099  C  CB  . ASP A  1 151 ? -15.862  97.774  2.345   1.00 37.25 ? 143  ASP A CB  1 
ATOM   1100  C  CG  . ASP A  1 151 ? -14.923  97.134  1.329   1.00 38.09 ? 143  ASP A CG  1 
ATOM   1101  O  OD1 . ASP A  1 151 ? -13.975  97.798  0.867   1.00 39.08 ? 143  ASP A OD1 1 
ATOM   1102  O  OD2 . ASP A  1 151 ? -15.062  95.944  1.041   1.00 38.35 ? 143  ASP A OD2 1 
ATOM   1103  N  N   . HIS A  1 152 ? -16.100  99.130  5.629   1.00 38.05 ? 144  HIS A N   1 
ATOM   1104  C  CA  . HIS A  1 152 ? -17.074  99.832  6.468   1.00 37.98 ? 144  HIS A CA  1 
ATOM   1105  C  C   . HIS A  1 152 ? -16.426  100.349 7.711   1.00 38.11 ? 144  HIS A C   1 
ATOM   1106  O  O   . HIS A  1 152 ? -16.757  99.931  8.796   1.00 37.27 ? 144  HIS A O   1 
ATOM   1107  C  CB  . HIS A  1 152 ? -18.243  98.934  6.836   1.00 37.45 ? 144  HIS A CB  1 
ATOM   1108  C  CG  . HIS A  1 152 ? -18.864  98.266  5.665   1.00 36.25 ? 144  HIS A CG  1 
ATOM   1109  N  ND1 . HIS A  1 152 ? -19.786  98.891  4.867   1.00 35.48 ? 144  HIS A ND1 1 
ATOM   1110  C  CD2 . HIS A  1 152 ? -18.668  97.037  5.131   1.00 38.26 ? 144  HIS A CD2 1 
ATOM   1111  C  CE1 . HIS A  1 152 ? -20.150  98.065  3.900   1.00 38.01 ? 144  HIS A CE1 1 
ATOM   1112  N  NE2 . HIS A  1 152 ? -19.486  96.933  4.033   1.00 36.99 ? 144  HIS A NE2 1 
ATOM   1113  N  N   . PRO A  1 153 ? -15.510  101.299 7.554   1.00 39.34 ? 145  PRO A N   1 
ATOM   1114  C  CA  . PRO A  1 153 ? -14.671  101.662 8.673   1.00 39.75 ? 145  PRO A CA  1 
ATOM   1115  C  C   . PRO A  1 153 ? -15.430  102.224 9.871   1.00 39.56 ? 145  PRO A C   1 
ATOM   1116  O  O   . PRO A  1 153 ? -14.910  102.136 10.986  1.00 39.70 ? 145  PRO A O   1 
ATOM   1117  C  CB  . PRO A  1 153 ? -13.704  102.698 8.064   1.00 40.27 ? 145  PRO A CB  1 
ATOM   1118  C  CG  . PRO A  1 153 ? -14.478  103.271 6.878   1.00 40.61 ? 145  PRO A CG  1 
ATOM   1119  C  CD  . PRO A  1 153 ? -15.141  102.038 6.329   1.00 40.01 ? 145  PRO A CD  1 
ATOM   1120  N  N   . ASP A  1 154 ? -16.632  102.764 9.667   1.00 39.13 ? 146  ASP A N   1 
ATOM   1121  C  CA  . ASP A  1 154 ? -17.420  103.266 10.799  1.00 39.13 ? 146  ASP A CA  1 
ATOM   1122  C  C   . ASP A  1 154 ? -18.313  102.262 11.486  1.00 37.33 ? 146  ASP A C   1 
ATOM   1123  O  O   . ASP A  1 154 ? -19.016  102.633 12.412  1.00 36.26 ? 146  ASP A O   1 
ATOM   1124  C  CB  . ASP A  1 154 ? -18.271  104.451 10.374  1.00 40.39 ? 146  ASP A CB  1 
ATOM   1125  C  CG  . ASP A  1 154 ? -17.431  105.690 10.077  1.00 45.25 ? 146  ASP A CG  1 
ATOM   1126  O  OD1 . ASP A  1 154 ? -16.372  105.918 10.735  1.00 49.56 ? 146  ASP A OD1 1 
ATOM   1127  O  OD2 . ASP A  1 154 ? -17.822  106.416 9.139   1.00 52.06 ? 146  ASP A OD2 1 
ATOM   1128  N  N   . VAL A  1 155 ? -18.291  101.007 11.036  1.00 35.59 ? 147  VAL A N   1 
ATOM   1129  C  CA  . VAL A  1 155 ? -19.009  99.917  11.679  1.00 34.58 ? 147  VAL A CA  1 
ATOM   1130  C  C   . VAL A  1 155 ? -17.976  99.102  12.440  1.00 34.09 ? 147  VAL A C   1 
ATOM   1131  O  O   . VAL A  1 155 ? -17.105  98.545  11.831  1.00 35.36 ? 147  VAL A O   1 
ATOM   1132  C  CB  . VAL A  1 155 ? -19.711  99.031  10.660  1.00 34.19 ? 147  VAL A CB  1 
ATOM   1133  C  CG1 . VAL A  1 155 ? -20.365  97.860  11.349  1.00 33.22 ? 147  VAL A CG1 1 
ATOM   1134  C  CG2 . VAL A  1 155 ? -20.736  99.862  9.857   1.00 33.01 ? 147  VAL A CG2 1 
ATOM   1135  N  N   . LYS A  1 156 ? -18.047  99.062  13.764  1.00 32.74 ? 148  LYS A N   1 
ATOM   1136  C  CA  . LYS A  1 156 ? -17.066  98.332  14.540  1.00 32.67 ? 148  LYS A CA  1 
ATOM   1137  C  C   . LYS A  1 156 ? -17.604  96.981  14.850  1.00 30.76 ? 148  LYS A C   1 
ATOM   1138  O  O   . LYS A  1 156 ? -18.785  96.860  15.146  1.00 29.78 ? 148  LYS A O   1 
ATOM   1139  C  CB  . LYS A  1 156 ? -16.764  99.029  15.852  1.00 33.75 ? 148  LYS A CB  1 
ATOM   1140  C  CG  . LYS A  1 156 ? -16.566  100.528 15.691  1.00 40.12 ? 148  LYS A CG  1 
ATOM   1141  C  CD  . LYS A  1 156 ? -15.321  100.910 14.843  1.00 47.51 ? 148  LYS A CD  1 
ATOM   1142  C  CE  . LYS A  1 156 ? -15.290  102.438 14.543  1.00 50.49 ? 148  LYS A CE  1 
ATOM   1143  N  NZ  . LYS A  1 156 ? -13.915  102.902 14.394  1.00 53.05 ? 148  LYS A NZ  1 
ATOM   1144  N  N   . VAL A  1 157 ? -16.749  95.965  14.755  1.00 29.33 ? 149  VAL A N   1 
ATOM   1145  C  CA  . VAL A  1 157 ? -17.095  94.607  15.177  1.00 28.26 ? 149  VAL A CA  1 
ATOM   1146  C  C   . VAL A  1 157 ? -16.136  94.189  16.277  1.00 27.31 ? 149  VAL A C   1 
ATOM   1147  O  O   . VAL A  1 157 ? -15.034  94.736  16.399  1.00 25.54 ? 149  VAL A O   1 
ATOM   1148  C  CB  . VAL A  1 157 ? -17.053  93.586  14.027  1.00 28.54 ? 149  VAL A CB  1 
ATOM   1149  C  CG1 . VAL A  1 157 ? -18.025  93.975  12.978  1.00 28.64 ? 149  VAL A CG1 1 
ATOM   1150  C  CG2 . VAL A  1 157 ? -15.689  93.556  13.406  1.00 29.24 ? 149  VAL A CG2 1 
ATOM   1151  N  N   . MET A  1 158 ? -16.573  93.218  17.082  1.00 26.32 ? 150  MET A N   1 
ATOM   1152  C  CA  . MET A  1 158 ? -15.821  92.789  18.247  1.00 25.27 ? 150  MET A CA  1 
ATOM   1153  C  C   . MET A  1 158 ? -16.435  91.508  18.830  1.00 23.38 ? 150  MET A C   1 
ATOM   1154  O  O   . MET A  1 158 ? -17.571  91.178  18.530  1.00 20.20 ? 150  MET A O   1 
ATOM   1155  C  CB  . MET A  1 158 ? -15.910  93.875  19.314  1.00 25.35 ? 150  MET A CB  1 
ATOM   1156  C  CG  . MET A  1 158 ? -17.392  94.198  19.702  1.00 28.19 ? 150  MET A CG  1 
ATOM   1157  S  SD  . MET A  1 158 ? -17.604  95.543  20.886  1.00 31.59 ? 150  MET A SD  1 
ATOM   1158  C  CE  . MET A  1 158 ? -17.539  96.927  19.732  1.00 31.77 ? 150  MET A CE  1 
ATOM   1159  N  N   . ASN A  1 159 ? -15.691  90.873  19.741  1.00 21.42 ? 151  ASN A N   1 
ATOM   1160  C  CA  . ASN A  1 159 ? -16.190  89.768  20.533  1.00 21.57 ? 151  ASN A CA  1 
ATOM   1161  C  C   . ASN A  1 159 ? -16.636  88.541  19.725  1.00 21.55 ? 151  ASN A C   1 
ATOM   1162  O  O   . ASN A  1 159 ? -17.329  87.660  20.248  1.00 21.66 ? 151  ASN A O   1 
ATOM   1163  C  CB  . ASN A  1 159 ? -17.334  90.234  21.447  1.00 21.17 ? 151  ASN A CB  1 
ATOM   1164  C  CG  . ASN A  1 159 ? -16.887  91.236  22.468  1.00 21.05 ? 151  ASN A CG  1 
ATOM   1165  O  OD1 . ASN A  1 159 ? -15.807  91.108  23.036  1.00 21.62 ? 151  ASN A OD1 1 
ATOM   1166  N  ND2 . ASN A  1 159 ? -17.730  92.221  22.746  1.00 18.54 ? 151  ASN A ND2 1 
ATOM   1167  N  N   . ILE A  1 160 ? -16.230  88.458  18.470  1.00 21.21 ? 152  ILE A N   1 
ATOM   1168  C  CA  . ILE A  1 160 ? -16.712  87.382  17.638  1.00 22.14 ? 152  ILE A CA  1 
ATOM   1169  C  C   . ILE A  1 160 ? -15.631  86.715  16.814  1.00 22.36 ? 152  ILE A C   1 
ATOM   1170  O  O   . ILE A  1 160 ? -14.816  87.383  16.201  1.00 22.46 ? 152  ILE A O   1 
ATOM   1171  C  CB  . ILE A  1 160 ? -17.940  87.839  16.731  1.00 23.01 ? 152  ILE A CB  1 
ATOM   1172  C  CG1 . ILE A  1 160 ? -18.542  86.609  16.059  1.00 23.42 ? 152  ILE A CG1 1 
ATOM   1173  C  CG2 . ILE A  1 160 ? -17.600  88.950  15.719  1.00 20.15 ? 152  ILE A CG2 1 
ATOM   1174  C  CD1 . ILE A  1 160 ? -20.021  86.684  15.973  1.00 26.39 ? 152  ILE A CD1 1 
ATOM   1175  N  N   . ASP A  1 161 ? -15.607  85.397  16.859  1.00 23.17 ? 153  ASP A N   1 
ATOM   1176  C  CA  . ASP A  1 161 ? -14.724  84.594  16.005  1.00 25.01 ? 153  ASP A CA  1 
ATOM   1177  C  C   . ASP A  1 161 ? -15.007  84.952  14.527  1.00 25.78 ? 153  ASP A C   1 
ATOM   1178  O  O   . ASP A  1 161 ? -16.175  84.920  14.112  1.00 25.22 ? 153  ASP A O   1 
ATOM   1179  C  CB  . ASP A  1 161 ? -15.018  83.121  16.272  1.00 25.13 ? 153  ASP A CB  1 
ATOM   1180  C  CG  . ASP A  1 161 ? -14.064  82.171  15.558  1.00 27.24 ? 153  ASP A CG  1 
ATOM   1181  O  OD1 . ASP A  1 161 ? -14.290  81.934  14.346  1.00 30.04 ? 153  ASP A OD1 1 
ATOM   1182  O  OD2 . ASP A  1 161 ? -13.142  81.606  16.222  1.00 25.89 ? 153  ASP A OD2 1 
ATOM   1183  N  N   . PRO A  1 162 ? -13.972  85.330  13.752  1.00 26.45 ? 154  PRO A N   1 
ATOM   1184  C  CA  . PRO A  1 162 ? -14.208  85.695  12.347  1.00 27.35 ? 154  PRO A CA  1 
ATOM   1185  C  C   . PRO A  1 162 ? -14.864  84.589  11.534  1.00 28.47 ? 154  PRO A C   1 
ATOM   1186  O  O   . PRO A  1 162 ? -15.677  84.888  10.706  1.00 28.93 ? 154  PRO A O   1 
ATOM   1187  C  CB  . PRO A  1 162 ? -12.842  86.017  11.806  1.00 27.62 ? 154  PRO A CB  1 
ATOM   1188  C  CG  . PRO A  1 162 ? -11.967  86.338  13.038  1.00 28.43 ? 154  PRO A CG  1 
ATOM   1189  C  CD  . PRO A  1 162 ? -12.584  85.564  14.184  1.00 27.69 ? 154  PRO A CD  1 
ATOM   1190  N  N   . ASP A  1 163 ? -14.590  83.322  11.818  1.00 29.58 ? 155  ASP A N   1 
ATOM   1191  C  CA  . ASP A  1 163 ? -15.257  82.226  11.098  1.00 30.41 ? 155  ASP A CA  1 
ATOM   1192  C  C   . ASP A  1 163 ? -16.725  82.132  11.450  1.00 30.10 ? 155  ASP A C   1 
ATOM   1193  O  O   . ASP A  1 163 ? -17.559  81.956  10.554  1.00 30.28 ? 155  ASP A O   1 
ATOM   1194  C  CB  . ASP A  1 163 ? -14.543  80.889  11.318  1.00 31.25 ? 155  ASP A CB  1 
ATOM   1195  C  CG  . ASP A  1 163 ? -13.133  80.834  10.619  1.00 34.62 ? 155  ASP A CG  1 
ATOM   1196  O  OD1 . ASP A  1 163 ? -12.774  81.729  9.818   1.00 37.87 ? 155  ASP A OD1 1 
ATOM   1197  O  OD2 . ASP A  1 163 ? -12.370  79.891  10.873  1.00 38.40 ? 155  ASP A OD2 1 
ATOM   1198  N  N   . LEU A  1 164 ? -17.066  82.295  12.738  1.00 29.01 ? 156  LEU A N   1 
ATOM   1199  C  CA  . LEU A  1 164 ? -18.477  82.332  13.126  1.00 28.36 ? 156  LEU A CA  1 
ATOM   1200  C  C   . LEU A  1 164 ? -19.192  83.567  12.511  1.00 28.49 ? 156  LEU A C   1 
ATOM   1201  O  O   . LEU A  1 164 ? -20.334  83.472  12.083  1.00 27.92 ? 156  LEU A O   1 
ATOM   1202  C  CB  . LEU A  1 164 ? -18.661  82.329  14.629  1.00 27.59 ? 156  LEU A CB  1 
ATOM   1203  C  CG  . LEU A  1 164 ? -20.120  82.411  15.145  1.00 28.41 ? 156  LEU A CG  1 
ATOM   1204  C  CD1 . LEU A  1 164 ? -20.923  81.196  14.653  1.00 25.24 ? 156  LEU A CD1 1 
ATOM   1205  C  CD2 . LEU A  1 164 ? -20.269  82.531  16.684  1.00 25.81 ? 156  LEU A CD2 1 
ATOM   1206  N  N   . PHE A  1 165 ? -18.517  84.709  12.490  1.00 28.15 ? 157  PHE A N   1 
ATOM   1207  C  CA  . PHE A  1 165 ? -19.084  85.931  11.981  1.00 29.05 ? 157  PHE A CA  1 
ATOM   1208  C  C   . PHE A  1 165 ? -19.635  85.728  10.561  1.00 30.88 ? 157  PHE A C   1 
ATOM   1209  O  O   . PHE A  1 165 ? -20.748  86.133  10.232  1.00 30.36 ? 157  PHE A O   1 
ATOM   1210  C  CB  . PHE A  1 165 ? -18.009  86.997  11.992  1.00 29.01 ? 157  PHE A CB  1 
ATOM   1211  C  CG  . PHE A  1 165 ? -18.459  88.309  11.497  1.00 28.75 ? 157  PHE A CG  1 
ATOM   1212  C  CD1 . PHE A  1 165 ? -19.289  89.095  12.273  1.00 30.23 ? 157  PHE A CD1 1 
ATOM   1213  C  CD2 . PHE A  1 165 ? -18.063  88.767  10.257  1.00 30.02 ? 157  PHE A CD2 1 
ATOM   1214  C  CE1 . PHE A  1 165 ? -19.750  90.347  11.826  1.00 30.62 ? 157  PHE A CE1 1 
ATOM   1215  C  CE2 . PHE A  1 165 ? -18.501  89.988  9.780   1.00 32.94 ? 157  PHE A CE2 1 
ATOM   1216  C  CZ  . PHE A  1 165 ? -19.359  90.807  10.579  1.00 31.00 ? 157  PHE A CZ  1 
ATOM   1217  N  N   . GLU A  1 166 ? -18.849  85.029  9.757   1.00 32.80 ? 158  GLU A N   1 
ATOM   1218  C  CA  . GLU A  1 166 ? -19.179  84.687  8.386   1.00 35.00 ? 158  GLU A CA  1 
ATOM   1219  C  C   . GLU A  1 166 ? -20.346  83.737  8.218   1.00 35.29 ? 158  GLU A C   1 
ATOM   1220  O  O   . GLU A  1 166 ? -20.792  83.544  7.121   1.00 35.51 ? 158  GLU A O   1 
ATOM   1221  C  CB  . GLU A  1 166 ? -17.947  84.107  7.681   1.00 35.69 ? 158  GLU A CB  1 
ATOM   1222  C  CG  . GLU A  1 166 ? -16.889  85.209  7.394   1.00 39.54 ? 158  GLU A CG  1 
ATOM   1223  C  CD  . GLU A  1 166 ? -15.572  84.672  6.841   1.00 45.08 ? 158  GLU A CD  1 
ATOM   1224  O  OE1 . GLU A  1 166 ? -15.560  83.475  6.487   1.00 47.95 ? 158  GLU A OE1 1 
ATOM   1225  O  OE2 . GLU A  1 166 ? -14.561  85.431  6.778   1.00 47.12 ? 158  GLU A OE2 1 
ATOM   1226  N  N   . LYS A  1 167 ? -20.872  83.177  9.293   1.00 35.82 ? 159  LYS A N   1 
ATOM   1227  C  CA  . LYS A  1 167 ? -21.979  82.265  9.188   1.00 36.35 ? 159  LYS A CA  1 
ATOM   1228  C  C   . LYS A  1 167 ? -23.258  82.813  9.761   1.00 36.04 ? 159  LYS A C   1 
ATOM   1229  O  O   . LYS A  1 167 ? -24.258  82.120  9.797   1.00 37.54 ? 159  LYS A O   1 
ATOM   1230  C  CB  . LYS A  1 167 ? -21.633  80.990  9.934   1.00 37.14 ? 159  LYS A CB  1 
ATOM   1231  C  CG  . LYS A  1 167 ? -20.510  80.231  9.355   1.00 39.18 ? 159  LYS A CG  1 
ATOM   1232  C  CD  . LYS A  1 167 ? -20.268  79.027  10.230  1.00 44.47 ? 159  LYS A CD  1 
ATOM   1233  C  CE  . LYS A  1 167 ? -19.009  78.256  9.799   1.00 48.26 ? 159  LYS A CE  1 
ATOM   1234  N  NZ  . LYS A  1 167 ? -19.023  76.896  10.427  1.00 51.72 ? 159  LYS A NZ  1 
ATOM   1235  N  N   . LEU A  1 168 ? -23.263  84.040  10.230  1.00 35.79 ? 160  LEU A N   1 
ATOM   1236  C  CA  . LEU A  1 168 ? -24.464  84.553  10.856  1.00 35.62 ? 160  LEU A CA  1 
ATOM   1237  C  C   . LEU A  1 168 ? -25.545  85.017  9.898   1.00 36.71 ? 160  LEU A C   1 
ATOM   1238  O  O   . LEU A  1 168 ? -26.611  85.490  10.341  1.00 37.81 ? 160  LEU A O   1 
ATOM   1239  C  CB  . LEU A  1 168 ? -24.143  85.719  11.761  1.00 34.92 ? 160  LEU A CB  1 
ATOM   1240  C  CG  . LEU A  1 168 ? -23.158  85.418  12.877  1.00 34.38 ? 160  LEU A CG  1 
ATOM   1241  C  CD1 . LEU A  1 168 ? -22.969  86.693  13.651  1.00 31.40 ? 160  LEU A CD1 1 
ATOM   1242  C  CD2 . LEU A  1 168 ? -23.622  84.293  13.744  1.00 30.28 ? 160  LEU A CD2 1 
ATOM   1243  N  N   . GLY A  1 169 ? -25.313  84.934  8.599   1.00 36.69 ? 161  GLY A N   1 
ATOM   1244  C  CA  . GLY A  1 169 ? -26.342  85.409  7.675   1.00 36.54 ? 161  GLY A CA  1 
ATOM   1245  C  C   . GLY A  1 169 ? -26.349  86.912  7.501   1.00 36.47 ? 161  GLY A C   1 
ATOM   1246  O  O   . GLY A  1 169 ? -27.332  87.456  7.079   1.00 36.36 ? 161  GLY A O   1 
ATOM   1247  N  N   . ILE A  1 170 ? -25.264  87.589  7.850   1.00 36.92 ? 162  ILE A N   1 
ATOM   1248  C  CA  . ILE A  1 170 ? -25.152  89.001  7.573   1.00 38.10 ? 162  ILE A CA  1 
ATOM   1249  C  C   . ILE A  1 170 ? -24.882  89.167  6.065   1.00 40.38 ? 162  ILE A C   1 
ATOM   1250  O  O   . ILE A  1 170 ? -24.202  88.350  5.449   1.00 40.54 ? 162  ILE A O   1 
ATOM   1251  C  CB  . ILE A  1 170 ? -24.052  89.641  8.417   1.00 37.67 ? 162  ILE A CB  1 
ATOM   1252  C  CG1 . ILE A  1 170 ? -24.471  89.618  9.897   1.00 37.28 ? 162  ILE A CG1 1 
ATOM   1253  C  CG2 . ILE A  1 170 ? -23.796  91.056  7.983   1.00 36.53 ? 162  ILE A CG2 1 
ATOM   1254  C  CD1 . ILE A  1 170 ? -23.361  89.703  10.850  1.00 34.04 ? 162  ILE A CD1 1 
ATOM   1255  N  N   . GLN A  1 171 ? -25.470  90.203  5.475   1.00 42.32 ? 163  GLN A N   1 
ATOM   1256  C  CA  . GLN A  1 171 ? -25.377  90.480  4.042   1.00 43.79 ? 163  GLN A CA  1 
ATOM   1257  C  C   . GLN A  1 171 ? -25.141  91.952  3.805   1.00 43.14 ? 163  GLN A C   1 
ATOM   1258  O  O   . GLN A  1 171 ? -25.932  92.806  4.198   1.00 42.77 ? 163  GLN A O   1 
ATOM   1259  C  CB  . GLN A  1 171 ? -26.645  90.046  3.294   1.00 45.00 ? 163  GLN A CB  1 
ATOM   1260  C  CG  . GLN A  1 171 ? -26.638  88.535  2.930   1.00 51.43 ? 163  GLN A CG  1 
ATOM   1261  C  CD  . GLN A  1 171 ? -28.042  87.958  2.570   1.00 58.54 ? 163  GLN A CD  1 
ATOM   1262  O  OE1 . GLN A  1 171 ? -29.055  88.693  2.509   1.00 62.16 ? 163  GLN A OE1 1 
ATOM   1263  N  NE2 . GLN A  1 171 ? -28.097  86.629  2.346   1.00 61.65 ? 163  GLN A NE2 1 
ATOM   1264  N  N   . GLU A  1 172 ? -24.037  92.219  3.147   1.00 43.37 ? 164  GLU A N   1 
ATOM   1265  C  CA  . GLU A  1 172 ? -23.743  93.505  2.610   1.00 44.16 ? 164  GLU A CA  1 
ATOM   1266  C  C   . GLU A  1 172 ? -24.504  93.613  1.271   1.00 44.02 ? 164  GLU A C   1 
ATOM   1267  O  O   . GLU A  1 172 ? -24.403  92.745  0.414   1.00 43.62 ? 164  GLU A O   1 
ATOM   1268  C  CB  . GLU A  1 172 ? -22.235  93.611  2.480   1.00 44.31 ? 164  GLU A CB  1 
ATOM   1269  C  CG  . GLU A  1 172 ? -21.680  94.855  1.857   1.00 47.92 ? 164  GLU A CG  1 
ATOM   1270  C  CD  . GLU A  1 172 ? -20.202  94.659  1.603   1.00 51.75 ? 164  GLU A CD  1 
ATOM   1271  O  OE1 . GLU A  1 172 ? -19.834  94.183  0.504   1.00 54.00 ? 164  GLU A OE1 1 
ATOM   1272  O  OE2 . GLU A  1 172 ? -19.413  94.897  2.548   1.00 53.82 ? 164  GLU A OE2 1 
ATOM   1273  N  N   . LYS A  1 173 ? -25.303  94.659  1.126   1.00 44.27 ? 165  LYS A N   1 
ATOM   1274  C  CA  . LYS A  1 173 ? -26.013  94.903  -0.105  1.00 45.93 ? 165  LYS A CA  1 
ATOM   1275  C  C   . LYS A  1 173 ? -26.158  96.395  -0.330  1.00 44.70 ? 165  LYS A C   1 
ATOM   1276  O  O   . LYS A  1 173 ? -26.780  97.083  0.454   1.00 44.27 ? 165  LYS A O   1 
ATOM   1277  C  CB  . LYS A  1 173 ? -27.367  94.210  -0.069  1.00 47.25 ? 165  LYS A CB  1 
ATOM   1278  C  CG  . LYS A  1 173 ? -28.075  94.134  -1.407  1.00 53.11 ? 165  LYS A CG  1 
ATOM   1279  C  CD  . LYS A  1 173 ? -29.098  92.945  -1.495  1.00 58.64 ? 165  LYS A CD  1 
ATOM   1280  C  CE  . LYS A  1 173 ? -30.467  93.309  -0.907  1.00 62.49 ? 165  LYS A CE  1 
ATOM   1281  N  NZ  . LYS A  1 173 ? -31.229  94.404  -1.632  1.00 63.48 ? 165  LYS A NZ  1 
ATOM   1282  N  N   . ASN A  1 174 ? -25.560  96.889  -1.404  1.00 43.81 ? 166  ASN A N   1 
ATOM   1283  C  CA  . ASN A  1 174 ? -25.530  98.321  -1.688  1.00 43.81 ? 166  ASN A CA  1 
ATOM   1284  C  C   . ASN A  1 174 ? -24.927  99.189  -0.601  1.00 42.62 ? 166  ASN A C   1 
ATOM   1285  O  O   . ASN A  1 174 ? -25.437  100.227 -0.301  1.00 41.86 ? 166  ASN A O   1 
ATOM   1286  C  CB  . ASN A  1 174 ? -26.922  98.818  -2.068  1.00 43.74 ? 166  ASN A CB  1 
ATOM   1287  C  CG  . ASN A  1 174 ? -27.402  98.200  -3.363  1.00 44.25 ? 166  ASN A CG  1 
ATOM   1288  O  OD1 . ASN A  1 174 ? -26.656  98.089  -4.334  1.00 41.56 ? 166  ASN A OD1 1 
ATOM   1289  N  ND2 . ASN A  1 174 ? -28.644  97.772  -3.372  1.00 42.94 ? 166  ASN A ND2 1 
ATOM   1290  N  N   . GLY A  1 175 ? -23.828  98.751  -0.025  1.00 41.91 ? 167  GLY A N   1 
ATOM   1291  C  CA  . GLY A  1 175 ? -23.193  99.489  1.032   1.00 42.03 ? 167  GLY A CA  1 
ATOM   1292  C  C   . GLY A  1 175 ? -23.814  99.373  2.416   1.00 41.74 ? 167  GLY A C   1 
ATOM   1293  O  O   . GLY A  1 175 ? -23.339  100.007 3.344   1.00 41.90 ? 167  GLY A O   1 
ATOM   1294  N  N   . LYS A  1 176 ? -24.852  98.563  2.576   1.00 40.79 ? 168  LYS A N   1 
ATOM   1295  C  CA  . LYS A  1 176 ? -25.535  98.454  3.859   1.00 40.31 ? 168  LYS A CA  1 
ATOM   1296  C  C   . LYS A  1 176 ? -25.460  97.058  4.404   1.00 37.35 ? 168  LYS A C   1 
ATOM   1297  O  O   . LYS A  1 176 ? -25.438  96.113  3.666   1.00 36.91 ? 168  LYS A O   1 
ATOM   1298  C  CB  . LYS A  1 176 ? -26.983  98.912  3.735   1.00 41.31 ? 168  LYS A CB  1 
ATOM   1299  C  CG  . LYS A  1 176 ? -27.058  100.409 3.574   1.00 46.31 ? 168  LYS A CG  1 
ATOM   1300  C  CD  . LYS A  1 176 ? -28.433  100.890 3.136   1.00 53.66 ? 168  LYS A CD  1 
ATOM   1301  C  CE  . LYS A  1 176 ? -28.627  102.432 3.321   1.00 56.73 ? 168  LYS A CE  1 
ATOM   1302  N  NZ  . LYS A  1 176 ? -27.379  103.267 3.400   1.00 57.44 ? 168  LYS A NZ  1 
ATOM   1303  N  N   . ILE A  1 177 ? -25.428  96.938  5.715   1.00 34.62 ? 169  ILE A N   1 
ATOM   1304  C  CA  . ILE A  1 177 ? -25.242  95.667  6.340   1.00 32.48 ? 169  ILE A CA  1 
ATOM   1305  C  C   . ILE A  1 177 ? -26.555  95.204  6.935   1.00 31.16 ? 169  ILE A C   1 
ATOM   1306  O  O   . ILE A  1 177 ? -27.084  95.811  7.857   1.00 29.97 ? 169  ILE A O   1 
ATOM   1307  C  CB  . ILE A  1 177 ? -24.155  95.757  7.410   1.00 32.58 ? 169  ILE A CB  1 
ATOM   1308  C  CG1 . ILE A  1 177 ? -22.898  96.423  6.833   1.00 32.48 ? 169  ILE A CG1 1 
ATOM   1309  C  CG2 . ILE A  1 177 ? -23.865  94.370  8.006   1.00 29.24 ? 169  ILE A CG2 1 
ATOM   1310  C  CD1 . ILE A  1 177 ? -21.691  96.437  7.819   1.00 33.11 ? 169  ILE A CD1 1 
ATOM   1311  N  N   . HIS A  1 178 ? -27.096  94.127  6.388   1.00 30.08 ? 170  HIS A N   1 
ATOM   1312  C  CA  . HIS A  1 178 ? -28.354  93.621  6.849   1.00 29.69 ? 170  HIS A CA  1 
ATOM   1313  C  C   . HIS A  1 178 ? -28.024  92.521  7.831   1.00 28.83 ? 170  HIS A C   1 
ATOM   1314  O  O   . HIS A  1 178 ? -27.278  91.597  7.498   1.00 27.50 ? 170  HIS A O   1 
ATOM   1315  C  CB  . HIS A  1 178 ? -29.178  93.042  5.716   1.00 30.49 ? 170  HIS A CB  1 
ATOM   1316  C  CG  . HIS A  1 178 ? -29.598  94.041  4.679   1.00 33.19 ? 170  HIS A CG  1 
ATOM   1317  N  ND1 . HIS A  1 178 ? -30.821  94.680  4.708   1.00 35.11 ? 170  HIS A ND1 1 
ATOM   1318  C  CD2 . HIS A  1 178 ? -28.974  94.484  3.564   1.00 35.03 ? 170  HIS A CD2 1 
ATOM   1319  C  CE1 . HIS A  1 178 ? -30.930  95.487  3.674   1.00 34.81 ? 170  HIS A CE1 1 
ATOM   1320  N  NE2 . HIS A  1 178 ? -29.820  95.389  2.959   1.00 38.40 ? 170  HIS A NE2 1 
ATOM   1321  N  N   . VAL A  1 179 ? -28.581  92.632  9.043   1.00 27.84 ? 171  VAL A N   1 
ATOM   1322  C  CA  . VAL A  1 179 ? -28.326  91.683  10.132  1.00 26.73 ? 171  VAL A CA  1 
ATOM   1323  C  C   . VAL A  1 179 ? -29.599  91.033  10.671  1.00 26.25 ? 171  VAL A C   1 
ATOM   1324  O  O   . VAL A  1 179 ? -30.475  91.705  11.166  1.00 26.36 ? 171  VAL A O   1 
ATOM   1325  C  CB  . VAL A  1 179 ? -27.617  92.339  11.323  1.00 26.28 ? 171  VAL A CB  1 
ATOM   1326  C  CG1 . VAL A  1 179 ? -27.241  91.270  12.388  1.00 24.16 ? 171  VAL A CG1 1 
ATOM   1327  C  CG2 . VAL A  1 179 ? -26.371  93.084  10.859  1.00 24.33 ? 171  VAL A CG2 1 
ATOM   1328  N  N   . PRO A  1 180 ? -29.688  89.719  10.581  1.00 25.87 ? 172  PRO A N   1 
ATOM   1329  C  CA  . PRO A  1 180 ? -30.806  88.991  11.123  1.00 26.23 ? 172  PRO A CA  1 
ATOM   1330  C  C   . PRO A  1 180 ? -30.792  89.015  12.651  1.00 25.99 ? 172  PRO A C   1 
ATOM   1331  O  O   . PRO A  1 180 ? -29.764  88.703  13.246  1.00 26.21 ? 172  PRO A O   1 
ATOM   1332  C  CB  . PRO A  1 180 ? -30.602  87.553  10.617  1.00 26.77 ? 172  PRO A CB  1 
ATOM   1333  C  CG  . PRO A  1 180 ? -29.634  87.596  9.564   1.00 27.28 ? 172  PRO A CG  1 
ATOM   1334  C  CD  . PRO A  1 180 ? -28.823  88.878  9.744   1.00 26.58 ? 172  PRO A CD  1 
ATOM   1335  N  N   . VAL A  1 181 ? -31.914  89.410  13.255  1.00 24.96 ? 173  VAL A N   1 
ATOM   1336  C  CA  . VAL A  1 181 ? -32.062  89.517  14.700  1.00 24.38 ? 173  VAL A CA  1 
ATOM   1337  C  C   . VAL A  1 181 ? -33.418  88.928  15.116  1.00 24.95 ? 173  VAL A C   1 
ATOM   1338  O  O   . VAL A  1 181 ? -34.295  88.864  14.301  1.00 24.75 ? 173  VAL A O   1 
ATOM   1339  C  CB  . VAL A  1 181 ? -31.943  90.985  15.176  1.00 24.66 ? 173  VAL A CB  1 
ATOM   1340  C  CG1 . VAL A  1 181 ? -30.524  91.562  14.886  1.00 21.42 ? 173  VAL A CG1 1 
ATOM   1341  C  CG2 . VAL A  1 181 ? -33.079  91.887  14.553  1.00 22.83 ? 173  VAL A CG2 1 
ATOM   1342  N  N   . VAL A  1 182 ? -33.578  88.454  16.359  1.00 24.90 ? 174  VAL A N   1 
ATOM   1343  C  CA  . VAL A  1 182 ? -34.882  88.009  16.802  1.00 25.80 ? 174  VAL A CA  1 
ATOM   1344  C  C   . VAL A  1 182 ? -35.670  89.108  17.456  1.00 26.28 ? 174  VAL A C   1 
ATOM   1345  O  O   . VAL A  1 182 ? -36.869  88.963  17.634  1.00 28.41 ? 174  VAL A O   1 
ATOM   1346  C  CB  . VAL A  1 182 ? -34.837  86.831  17.773  1.00 25.62 ? 174  VAL A CB  1 
ATOM   1347  C  CG1 . VAL A  1 182 ? -34.045  85.689  17.193  1.00 25.38 ? 174  VAL A CG1 1 
ATOM   1348  C  CG2 . VAL A  1 182 ? -34.263  87.285  19.077  1.00 26.70 ? 174  VAL A CG2 1 
ATOM   1349  N  N   . ALA A  1 183 ? -35.024  90.179  17.877  1.00 25.78 ? 175  ALA A N   1 
ATOM   1350  C  CA  . ALA A  1 183 ? -35.741  91.293  18.497  1.00 25.77 ? 175  ALA A CA  1 
ATOM   1351  C  C   . ALA A  1 183 ? -34.902  92.553  18.373  1.00 26.69 ? 175  ALA A C   1 
ATOM   1352  O  O   . ALA A  1 183 ? -33.674  92.469  18.229  1.00 26.34 ? 175  ALA A O   1 
ATOM   1353  C  CB  . ALA A  1 183 ? -36.036  91.009  19.930  1.00 24.94 ? 175  ALA A CB  1 
ATOM   1354  N  N   . LYS A  1 184 ? -35.591  93.697  18.391  1.00 27.96 ? 176  LYS A N   1 
ATOM   1355  C  CA  . LYS A  1 184 ? -35.013  95.020  18.461  1.00 29.15 ? 176  LYS A CA  1 
ATOM   1356  C  C   . LYS A  1 184 ? -35.338  95.584  19.854  1.00 29.55 ? 176  LYS A C   1 
ATOM   1357  O  O   . LYS A  1 184 ? -36.482  95.735  20.193  1.00 30.37 ? 176  LYS A O   1 
ATOM   1358  C  CB  . LYS A  1 184 ? -35.640  95.889  17.407  1.00 29.06 ? 176  LYS A CB  1 
ATOM   1359  C  CG  . LYS A  1 184 ? -35.469  95.334  15.998  1.00 32.34 ? 176  LYS A CG  1 
ATOM   1360  C  CD  . LYS A  1 184 ? -35.956  96.260  14.820  1.00 33.93 ? 176  LYS A CD  1 
ATOM   1361  C  CE  . LYS A  1 184 ? -36.030  95.427  13.524  1.00 38.35 ? 176  LYS A CE  1 
ATOM   1362  N  NZ  . LYS A  1 184 ? -36.469  96.081  12.215  1.00 38.90 ? 176  LYS A NZ  1 
ATOM   1363  N  N   . ILE A  1 185 ? -34.326  95.897  20.659  1.00 29.21 ? 177  ILE A N   1 
ATOM   1364  C  CA  . ILE A  1 185 ? -34.520  96.221  22.055  1.00 27.89 ? 177  ILE A CA  1 
ATOM   1365  C  C   . ILE A  1 185 ? -34.264  97.702  22.221  1.00 28.23 ? 177  ILE A C   1 
ATOM   1366  O  O   . ILE A  1 185 ? -33.198  98.184  21.847  1.00 27.46 ? 177  ILE A O   1 
ATOM   1367  C  CB  . ILE A  1 185 ? -33.579  95.423  22.931  1.00 27.63 ? 177  ILE A CB  1 
ATOM   1368  C  CG1 . ILE A  1 185 ? -33.900  93.953  22.767  1.00 28.41 ? 177  ILE A CG1 1 
ATOM   1369  C  CG2 . ILE A  1 185 ? -33.703  95.846  24.387  1.00 25.30 ? 177  ILE A CG2 1 
ATOM   1370  C  CD1 . ILE A  1 185 ? -32.868  93.075  23.279  1.00 30.52 ? 177  ILE A CD1 1 
ATOM   1371  N  N   . PRO A  1 186 ? -35.240  98.429  22.792  1.00 28.19 ? 178  PRO A N   1 
ATOM   1372  C  CA  . PRO A  1 186 ? -35.035  99.870  22.926  1.00 28.63 ? 178  PRO A CA  1 
ATOM   1373  C  C   . PRO A  1 186 ? -34.011  100.185 23.987  1.00 27.96 ? 178  PRO A C   1 
ATOM   1374  O  O   . PRO A  1 186 ? -33.872  99.436  24.917  1.00 28.15 ? 178  PRO A O   1 
ATOM   1375  C  CB  . PRO A  1 186 ? -36.428  100.436 23.295  1.00 29.60 ? 178  PRO A CB  1 
ATOM   1376  C  CG  . PRO A  1 186 ? -37.351  99.229  23.490  1.00 30.29 ? 178  PRO A CG  1 
ATOM   1377  C  CD  . PRO A  1 186 ? -36.613  97.978  23.078  1.00 28.43 ? 178  PRO A CD  1 
ATOM   1378  N  N   . ALA A  1 187 ? -33.301  101.296 23.818  1.00 27.87 ? 179  ALA A N   1 
ATOM   1379  C  CA  . ALA A  1 187 ? -32.318  101.782 24.786  1.00 27.57 ? 179  ALA A CA  1 
ATOM   1380  C  C   . ALA A  1 187 ? -32.785  101.612 26.235  1.00 28.30 ? 179  ALA A C   1 
ATOM   1381  O  O   . ALA A  1 187 ? -32.056  101.022 27.045  1.00 29.32 ? 179  ALA A O   1 
ATOM   1382  C  CB  . ALA A  1 187 ? -32.030  103.196 24.514  1.00 27.49 ? 179  ALA A CB  1 
ATOM   1383  N  N   . HIS A  1 188 ? -33.997  102.053 26.556  1.00 28.21 ? 180  HIS A N   1 
ATOM   1384  C  CA  . HIS A  1 188 ? -34.454  102.032 27.948  1.00 29.24 ? 180  HIS A CA  1 
ATOM   1385  C  C   . HIS A  1 188 ? -34.614  100.624 28.577  1.00 29.72 ? 180  HIS A C   1 
ATOM   1386  O  O   . HIS A  1 188 ? -34.818  100.514 29.818  1.00 29.08 ? 180  HIS A O   1 
ATOM   1387  C  CB  . HIS A  1 188 ? -35.757  102.830 28.164  1.00 29.31 ? 180  HIS A CB  1 
ATOM   1388  C  CG  . HIS A  1 188 ? -36.964  102.237 27.516  1.00 30.38 ? 180  HIS A CG  1 
ATOM   1389  N  ND1 . HIS A  1 188 ? -37.430  102.668 26.292  1.00 33.92 ? 180  HIS A ND1 1 
ATOM   1390  C  CD2 . HIS A  1 188 ? -37.821  101.261 27.922  1.00 32.32 ? 180  HIS A CD2 1 
ATOM   1391  C  CE1 . HIS A  1 188 ? -38.521  101.979 25.968  1.00 32.40 ? 180  HIS A CE1 1 
ATOM   1392  N  NE2 . HIS A  1 188 ? -38.778  101.118 26.935  1.00 31.66 ? 180  HIS A NE2 1 
ATOM   1393  N  N   . MET A  1 189 ? -34.563  99.565  27.766  1.00 29.42 ? 181  MET A N   1 
ATOM   1394  C  CA  . MET A  1 189 ? -34.625  98.223  28.331  1.00 29.97 ? 181  MET A CA  1 
ATOM   1395  C  C   . MET A  1 189 ? -33.241  97.694  28.715  1.00 30.09 ? 181  MET A C   1 
ATOM   1396  O  O   . MET A  1 189 ? -33.147  96.578  29.253  1.00 29.93 ? 181  MET A O   1 
ATOM   1397  C  CB  . MET A  1 189 ? -35.343  97.235  27.421  1.00 30.66 ? 181  MET A CB  1 
ATOM   1398  C  CG  . MET A  1 189 ? -36.876  97.460  27.260  1.00 34.43 ? 181  MET A CG  1 
ATOM   1399  S  SD  . MET A  1 189 ? -37.786  97.464  28.813  1.00 41.82 ? 181  MET A SD  1 
ATOM   1400  C  CE  . MET A  1 189 ? -37.442  95.860  29.529  1.00 38.27 ? 181  MET A CE  1 
ATOM   1401  N  N   . MET A  1 190 ? -32.172  98.480  28.496  1.00 29.73 ? 182  MET A N   1 
ATOM   1402  C  CA  . MET A  1 190 ? -30.829  97.996  28.856  1.00 28.98 ? 182  MET A CA  1 
ATOM   1403  C  C   . MET A  1 190 ? -30.478  98.475  30.245  1.00 29.49 ? 182  MET A C   1 
ATOM   1404  O  O   . MET A  1 190 ? -30.761  99.623  30.598  1.00 31.34 ? 182  MET A O   1 
ATOM   1405  C  CB  . MET A  1 190 ? -29.789  98.471  27.847  1.00 28.93 ? 182  MET A CB  1 
ATOM   1406  C  CG  . MET A  1 190 ? -30.078  97.971  26.469  1.00 27.49 ? 182  MET A CG  1 
ATOM   1407  S  SD  . MET A  1 190 ? -30.254  96.175  26.390  1.00 27.02 ? 182  MET A SD  1 
ATOM   1408  C  CE  . MET A  1 190 ? -28.600  95.597  26.863  1.00 22.87 ? 182  MET A CE  1 
ATOM   1409  N  N   . GLY A  1 191 ? -29.876  97.603  31.037  1.00 28.92 ? 183  GLY A N   1 
ATOM   1410  C  CA  . GLY A  1 191 ? -29.573  97.924  32.434  1.00 29.86 ? 183  GLY A CA  1 
ATOM   1411  C  C   . GLY A  1 191 ? -28.132  97.614  32.882  1.00 29.91 ? 183  GLY A C   1 
ATOM   1412  O  O   . GLY A  1 191 ? -27.174  98.197  32.370  1.00 30.56 ? 183  GLY A O   1 
ATOM   1413  N  N   . SER A  1 192 ? -27.984  96.695  33.833  1.00 29.80 ? 184  SER A N   1 
ATOM   1414  C  CA  . SER A  1 192 ? -26.702  96.460  34.514  1.00 30.00 ? 184  SER A CA  1 
ATOM   1415  C  C   . SER A  1 192 ? -25.589  96.256  33.517  1.00 29.05 ? 184  SER A C   1 
ATOM   1416  O  O   . SER A  1 192 ? -25.726  95.464  32.613  1.00 27.98 ? 184  SER A O   1 
ATOM   1417  C  CB  . SER A  1 192 ? -26.760  95.220  35.408  1.00 30.51 ? 184  SER A CB  1 
ATOM   1418  O  OG  . SER A  1 192 ? -25.630  95.149  36.286  1.00 30.47 ? 184  SER A OG  1 
ATOM   1419  N  N   . GLY A  1 193 ? -24.496  96.984  33.696  1.00 28.67 ? 185  GLY A N   1 
ATOM   1420  C  CA  . GLY A  1 193 ? -23.368  96.907  32.775  1.00 28.17 ? 185  GLY A CA  1 
ATOM   1421  C  C   . GLY A  1 193 ? -23.141  98.191  31.992  1.00 28.31 ? 185  GLY A C   1 
ATOM   1422  O  O   . GLY A  1 193 ? -22.019  98.432  31.529  1.00 28.27 ? 185  GLY A O   1 
ATOM   1423  N  N   . ILE A  1 194 ? -24.190  99.008  31.831  1.00 27.71 ? 186  ILE A N   1 
ATOM   1424  C  CA  . ILE A  1 194 ? -24.015  100.263 31.180  1.00 27.57 ? 186  ILE A CA  1 
ATOM   1425  C  C   . ILE A  1 194 ? -22.906  100.944 31.972  1.00 28.66 ? 186  ILE A C   1 
ATOM   1426  O  O   . ILE A  1 194 ? -22.874  100.877 33.209  1.00 28.91 ? 186  ILE A O   1 
ATOM   1427  C  CB  . ILE A  1 194 ? -25.281  101.149 31.192  1.00 28.40 ? 186  ILE A CB  1 
ATOM   1428  C  CG1 . ILE A  1 194 ? -26.391  100.551 30.350  1.00 27.87 ? 186  ILE A CG1 1 
ATOM   1429  C  CG2 . ILE A  1 194 ? -24.960  102.507 30.577  1.00 26.35 ? 186  ILE A CG2 1 
ATOM   1430  C  CD1 . ILE A  1 194 ? -27.709  101.315 30.430  1.00 29.36 ? 186  ILE A CD1 1 
ATOM   1431  N  N   . GLY A  1 195 ? -21.970  101.570 31.269  1.00 29.05 ? 187  GLY A N   1 
ATOM   1432  C  CA  . GLY A  1 195 ? -20.871  102.257 31.942  1.00 29.12 ? 187  GLY A CA  1 
ATOM   1433  C  C   . GLY A  1 195 ? -19.584  101.453 32.047  1.00 28.85 ? 187  GLY A C   1 
ATOM   1434  O  O   . GLY A  1 195 ? -18.528  102.020 32.389  1.00 29.49 ? 187  GLY A O   1 
ATOM   1435  N  N   . ALA A  1 196 ? -19.647  100.145 31.754  1.00 28.15 ? 188  ALA A N   1 
ATOM   1436  C  CA  . ALA A  1 196 ? -18.464  99.322  31.776  1.00 27.85 ? 188  ALA A CA  1 
ATOM   1437  C  C   . ALA A  1 196 ? -17.432  99.975  30.828  1.00 28.82 ? 188  ALA A C   1 
ATOM   1438  O  O   . ALA A  1 196 ? -17.760  100.675 29.848  1.00 27.17 ? 188  ALA A O   1 
ATOM   1439  C  CB  . ALA A  1 196 ? -18.757  97.882  31.417  1.00 27.20 ? 188  ALA A CB  1 
ATOM   1440  N  N   . SER A  1 197 ? -16.182  99.813  31.224  1.00 29.50 ? 189  SER A N   1 
ATOM   1441  C  CA  . SER A  1 197 ? -15.065  100.481 30.604  1.00 30.49 ? 189  SER A CA  1 
ATOM   1442  C  C   . SER A  1 197 ? -14.846  100.079 29.139  1.00 28.82 ? 189  SER A C   1 
ATOM   1443  O  O   . SER A  1 197 ? -14.457  100.905 28.301  1.00 28.84 ? 189  SER A O   1 
ATOM   1444  C  CB  . SER A  1 197 ? -13.810  100.170 31.442  1.00 31.06 ? 189  SER A CB  1 
ATOM   1445  O  OG  . SER A  1 197 ? -12.734  100.932 30.961  1.00 38.07 ? 189  SER A OG  1 
ATOM   1446  N  N   . SER A  1 198 ? -15.077  98.814  28.839  1.00 26.99 ? 190  SER A N   1 
ATOM   1447  C  CA  . SER A  1 198 ? -14.950  98.333  27.476  1.00 26.54 ? 190  SER A CA  1 
ATOM   1448  C  C   . SER A  1 198 ? -15.981  97.253  27.111  1.00 25.64 ? 190  SER A C   1 
ATOM   1449  O  O   . SER A  1 198 ? -16.071  96.199  27.776  1.00 25.17 ? 190  SER A O   1 
ATOM   1450  C  CB  . SER A  1 198 ? -13.575  97.729  27.240  1.00 26.43 ? 190  SER A CB  1 
ATOM   1451  O  OG  . SER A  1 198 ? -13.481  97.232  25.902  1.00 28.06 ? 190  SER A OG  1 
ATOM   1452  N  N   . SER A  1 199 ? -16.695  97.494  26.011  1.00 24.56 ? 191  SER A N   1 
ATOM   1453  C  CA  . SER A  1 199 ? -17.553  96.498  25.420  1.00 23.98 ? 191  SER A CA  1 
ATOM   1454  C  C   . SER A  1 199 ? -16.814  95.235  24.974  1.00 24.22 ? 191  SER A C   1 
ATOM   1455  O  O   . SER A  1 199 ? -17.448  94.223  24.672  1.00 23.95 ? 191  SER A O   1 
ATOM   1456  C  CB  . SER A  1 199 ? -18.294  97.100  24.241  1.00 24.50 ? 191  SER A CB  1 
ATOM   1457  O  OG  . SER A  1 199 ? -17.440  97.743  23.295  1.00 24.50 ? 191  SER A OG  1 
ATOM   1458  N  N   . ALA A  1 200 ? -15.481  95.267  24.922  1.00 24.63 ? 192  ALA A N   1 
ATOM   1459  C  CA  . ALA A  1 200 ? -14.722  94.039  24.587  1.00 24.57 ? 192  ALA A CA  1 
ATOM   1460  C  C   . ALA A  1 200 ? -14.627  93.065  25.768  1.00 24.06 ? 192  ALA A C   1 
ATOM   1461  O  O   . ALA A  1 200 ? -14.289  91.891  25.592  1.00 23.76 ? 192  ALA A O   1 
ATOM   1462  C  CB  . ALA A  1 200 ? -13.305  94.376  24.059  1.00 24.08 ? 192  ALA A CB  1 
ATOM   1463  N  N   . SER A  1 201 ? -14.924  93.518  26.965  1.00 24.08 ? 193  SER A N   1 
ATOM   1464  C  CA  . SER A  1 201 ? -14.663  92.639  28.129  1.00 24.94 ? 193  SER A CA  1 
ATOM   1465  C  C   . SER A  1 201 ? -15.863  92.319  29.014  1.00 24.77 ? 193  SER A C   1 
ATOM   1466  O  O   . SER A  1 201 ? -15.732  91.759  30.091  1.00 26.12 ? 193  SER A O   1 
ATOM   1467  C  CB  . SER A  1 201 ? -13.512  93.207  28.966  1.00 25.21 ? 193  SER A CB  1 
ATOM   1468  O  OG  . SER A  1 201 ? -13.841  94.453  29.496  1.00 25.28 ? 193  SER A OG  1 
ATOM   1469  N  N   . THR A  1 202 ? -17.041  92.679  28.567  1.00 25.03 ? 194  THR A N   1 
ATOM   1470  C  CA  . THR A  1 202 ? -18.208  92.418  29.357  1.00 24.48 ? 194  THR A CA  1 
ATOM   1471  C  C   . THR A  1 202 ? -19.500  92.389  28.539  1.00 25.08 ? 194  THR A C   1 
ATOM   1472  O  O   . THR A  1 202 ? -19.583  92.890  27.418  1.00 25.66 ? 194  THR A O   1 
ATOM   1473  C  CB  . THR A  1 202 ? -18.343  93.446  30.494  1.00 24.02 ? 194  THR A CB  1 
ATOM   1474  O  OG1 . THR A  1 202 ? -19.320  92.963  31.396  1.00 22.92 ? 194  THR A OG1 1 
ATOM   1475  C  CG2 . THR A  1 202 ? -18.789  94.795  30.003  1.00 22.69 ? 194  THR A CG2 1 
ATOM   1476  N  N   . ASP A  1 203 ? -20.523  91.806  29.147  1.00 25.31 ? 195  ASP A N   1 
ATOM   1477  C  CA  . ASP A  1 203 ? -21.873  91.880  28.657  1.00 25.20 ? 195  ASP A CA  1 
ATOM   1478  C  C   . ASP A  1 203 ? -22.613  92.972  29.399  1.00 24.99 ? 195  ASP A C   1 
ATOM   1479  O  O   . ASP A  1 203 ? -22.108  93.493  30.350  1.00 25.57 ? 195  ASP A O   1 
ATOM   1480  C  CB  . ASP A  1 203 ? -22.539  90.545  28.919  1.00 25.52 ? 195  ASP A CB  1 
ATOM   1481  C  CG  . ASP A  1 203 ? -22.614  90.231  30.393  1.00 27.62 ? 195  ASP A CG  1 
ATOM   1482  O  OD1 . ASP A  1 203 ? -21.679  90.608  31.160  1.00 29.22 ? 195  ASP A OD1 1 
ATOM   1483  O  OD2 . ASP A  1 203 ? -23.630  89.643  30.797  1.00 30.83 ? 195  ASP A OD2 1 
ATOM   1484  N  N   . TYR A  1 204 ? -23.810  93.311  28.937  1.00 25.12 ? 196  TYR A N   1 
ATOM   1485  C  CA  . TYR A  1 204 ? -24.771  94.051  29.729  1.00 24.89 ? 196  TYR A CA  1 
ATOM   1486  C  C   . TYR A  1 204 ? -26.192  93.545  29.530  1.00 24.91 ? 196  TYR A C   1 
ATOM   1487  O  O   . TYR A  1 204 ? -26.469  92.806  28.578  1.00 24.91 ? 196  TYR A O   1 
ATOM   1488  C  CB  . TYR A  1 204 ? -24.644  95.561  29.535  1.00 24.94 ? 196  TYR A CB  1 
ATOM   1489  C  CG  . TYR A  1 204 ? -25.065  96.240  28.243  1.00 24.40 ? 196  TYR A CG  1 
ATOM   1490  C  CD1 . TYR A  1 204 ? -24.636  95.812  27.009  1.00 22.89 ? 196  TYR A CD1 1 
ATOM   1491  C  CD2 . TYR A  1 204 ? -25.774  97.431  28.292  1.00 25.64 ? 196  TYR A CD2 1 
ATOM   1492  C  CE1 . TYR A  1 204 ? -24.961  96.497  25.855  1.00 23.72 ? 196  TYR A CE1 1 
ATOM   1493  C  CE2 . TYR A  1 204 ? -26.110  98.132  27.153  1.00 26.52 ? 196  TYR A CE2 1 
ATOM   1494  C  CZ  . TYR A  1 204 ? -25.696  97.677  25.920  1.00 27.78 ? 196  TYR A CZ  1 
ATOM   1495  O  OH  . TYR A  1 204 ? -26.026  98.421  24.786  1.00 26.25 ? 196  TYR A OH  1 
ATOM   1496  N  N   . ASP A  1 205 ? -27.065  93.921  30.460  1.00 25.59 ? 197  ASP A N   1 
ATOM   1497  C  CA  . ASP A  1 205 ? -28.372  93.264  30.683  1.00 26.59 ? 197  ASP A CA  1 
ATOM   1498  C  C   . ASP A  1 205 ? -29.553  93.930  29.984  1.00 26.71 ? 197  ASP A C   1 
ATOM   1499  O  O   . ASP A  1 205 ? -29.759  95.147  30.072  1.00 26.79 ? 197  ASP A O   1 
ATOM   1500  C  CB  . ASP A  1 205 ? -28.683  93.142  32.207  1.00 27.60 ? 197  ASP A CB  1 
ATOM   1501  C  CG  . ASP A  1 205 ? -27.739  92.188  32.944  1.00 27.86 ? 197  ASP A CG  1 
ATOM   1502  O  OD1 . ASP A  1 205 ? -26.794  91.762  32.293  1.00 31.38 ? 197  ASP A OD1 1 
ATOM   1503  O  OD2 . ASP A  1 205 ? -27.917  91.848  34.151  1.00 32.77 ? 197  ASP A OD2 1 
ATOM   1504  N  N   . ILE A  1 206 ? -30.332  93.113  29.279  1.00 27.46 ? 198  ILE A N   1 
ATOM   1505  C  CA  . ILE A  1 206 ? -31.680  93.490  28.873  1.00 27.79 ? 198  ILE A CA  1 
ATOM   1506  C  C   . ILE A  1 206 ? -32.474  93.290  30.140  1.00 29.36 ? 198  ILE A C   1 
ATOM   1507  O  O   . ILE A  1 206 ? -32.636  92.138  30.583  1.00 29.67 ? 198  ILE A O   1 
ATOM   1508  C  CB  . ILE A  1 206 ? -32.292  92.501  27.887  1.00 27.05 ? 198  ILE A CB  1 
ATOM   1509  C  CG1 . ILE A  1 206 ? -31.479  92.419  26.607  1.00 28.57 ? 198  ILE A CG1 1 
ATOM   1510  C  CG2 . ILE A  1 206 ? -33.764  92.838  27.602  1.00 25.32 ? 198  ILE A CG2 1 
ATOM   1511  C  CD1 . ILE A  1 206 ? -31.813  91.173  25.775  1.00 26.99 ? 198  ILE A CD1 1 
ATOM   1512  N  N   . MET A  1 207 ? -32.992  94.363  30.722  1.00 30.80 ? 199  MET A N   1 
ATOM   1513  C  CA  A MET A  1 207 ? -33.684  94.239  32.021  0.50 31.85 ? 199  MET A CA  1 
ATOM   1514  C  CA  B MET A  1 207 ? -33.682  94.277  32.016  0.50 32.05 ? 199  MET A CA  1 
ATOM   1515  C  C   . MET A  1 207 ? -35.195  94.082  31.869  1.00 32.80 ? 199  MET A C   1 
ATOM   1516  O  O   . MET A  1 207 ? -35.964  94.695  32.582  1.00 35.17 ? 199  MET A O   1 
ATOM   1517  C  CB  A MET A  1 207 ? -33.338  95.402  32.968  0.50 31.98 ? 199  MET A CB  1 
ATOM   1518  C  CB  B MET A  1 207 ? -33.350  95.501  32.906  0.50 32.39 ? 199  MET A CB  1 
ATOM   1519  C  CG  A MET A  1 207 ? -33.713  96.770  32.490  0.50 30.79 ? 199  MET A CG  1 
ATOM   1520  C  CG  B MET A  1 207 ? -33.402  96.866  32.248  0.50 31.86 ? 199  MET A CG  1 
ATOM   1521  S  SD  A MET A  1 207 ? -33.930  97.882  33.874  0.50 28.53 ? 199  MET A SD  1 
ATOM   1522  S  SD  B MET A  1 207 ? -33.539  98.123  33.522  0.50 32.64 ? 199  MET A SD  1 
ATOM   1523  C  CE  A MET A  1 207 ? -33.677  99.437  32.953  0.50 21.76 ? 199  MET A CE  1 
ATOM   1524  C  CE  B MET A  1 207 ? -35.118  97.602  34.205  0.50 23.41 ? 199  MET A CE  1 
ATOM   1525  N  N   . ALA A  1 208 ? -35.592  93.223  30.944  1.00 33.29 ? 200  ALA A N   1 
ATOM   1526  C  CA  . ALA A  1 208 ? -36.964  92.802  30.731  1.00 34.01 ? 200  ALA A CA  1 
ATOM   1527  C  C   . ALA A  1 208 ? -37.267  91.601  31.651  1.00 35.18 ? 200  ALA A C   1 
ATOM   1528  O  O   . ALA A  1 208 ? -36.601  90.545  31.551  1.00 35.36 ? 200  ALA A O   1 
ATOM   1529  C  CB  . ALA A  1 208 ? -37.100  92.359  29.266  1.00 33.60 ? 200  ALA A CB  1 
ATOM   1530  N  N   . SER A  1 209 ? -38.248  91.688  32.539  1.00 35.94 ? 201  SER A N   1 
ATOM   1531  C  CA  . SER A  1 209 ? -38.516  90.505  33.389  1.00 37.00 ? 201  SER A CA  1 
ATOM   1532  C  C   . SER A  1 209 ? -39.254  89.406  32.645  1.00 37.08 ? 201  SER A C   1 
ATOM   1533  O  O   . SER A  1 209 ? -39.222  88.277  33.068  1.00 36.74 ? 201  SER A O   1 
ATOM   1534  C  CB  . SER A  1 209 ? -39.273  90.864  34.663  1.00 37.48 ? 201  SER A CB  1 
ATOM   1535  O  OG  . SER A  1 209 ? -40.264  91.800  34.369  1.00 41.93 ? 201  SER A OG  1 
ATOM   1536  N  N   . ASN A  1 210 ? -39.896  89.754  31.530  1.00 37.94 ? 202  ASN A N   1 
ATOM   1537  C  CA  . ASN A  1 210 ? -40.606  88.795  30.670  1.00 38.64 ? 202  ASN A CA  1 
ATOM   1538  C  C   . ASN A  1 210 ? -40.337  89.088  29.226  1.00 37.72 ? 202  ASN A C   1 
ATOM   1539  O  O   . ASN A  1 210 ? -40.098  90.211  28.863  1.00 37.66 ? 202  ASN A O   1 
ATOM   1540  C  CB  . ASN A  1 210 ? -42.114  88.910  30.885  1.00 40.20 ? 202  ASN A CB  1 
ATOM   1541  C  CG  . ASN A  1 210 ? -42.523  88.420  32.263  1.00 44.13 ? 202  ASN A CG  1 
ATOM   1542  O  OD1 . ASN A  1 210 ? -42.261  87.274  32.618  1.00 49.81 ? 202  ASN A OD1 1 
ATOM   1543  N  ND2 . ASN A  1 210 ? -43.107  89.294  33.061  1.00 46.83 ? 202  ASN A ND2 1 
ATOM   1544  N  N   . PRO A  1 211 ? -40.296  88.067  28.402  1.00 37.76 ? 203  PRO A N   1 
ATOM   1545  C  CA  . PRO A  1 211 ? -39.982  88.258  27.008  1.00 38.45 ? 203  PRO A CA  1 
ATOM   1546  C  C   . PRO A  1 211 ? -40.992  89.147  26.304  1.00 39.52 ? 203  PRO A C   1 
ATOM   1547  O  O   . PRO A  1 211 ? -40.670  89.847  25.394  1.00 39.63 ? 203  PRO A O   1 
ATOM   1548  C  CB  . PRO A  1 211 ? -40.012  86.831  26.470  1.00 38.83 ? 203  PRO A CB  1 
ATOM   1549  C  CG  . PRO A  1 211 ? -40.586  86.050  27.471  1.00 37.59 ? 203  PRO A CG  1 
ATOM   1550  C  CD  . PRO A  1 211 ? -40.291  86.649  28.722  1.00 37.99 ? 203  PRO A CD  1 
ATOM   1551  N  N   . GLU A  1 212 ? -42.209  89.118  26.788  1.00 41.03 ? 204  GLU A N   1 
ATOM   1552  C  CA  . GLU A  1 212 ? -43.285  89.893  26.240  1.00 43.28 ? 204  GLU A CA  1 
ATOM   1553  C  C   . GLU A  1 212 ? -43.048  91.368  26.401  1.00 42.74 ? 204  GLU A C   1 
ATOM   1554  O  O   . GLU A  1 212 ? -43.508  92.122  25.614  1.00 42.70 ? 204  GLU A O   1 
ATOM   1555  C  CB  . GLU A  1 212 ? -44.607  89.477  26.877  1.00 44.52 ? 204  GLU A CB  1 
ATOM   1556  C  CG  . GLU A  1 212 ? -45.071  88.047  26.559  1.00 48.98 ? 204  GLU A CG  1 
ATOM   1557  C  CD  . GLU A  1 212 ? -44.523  86.954  27.518  1.00 54.77 ? 204  GLU A CD  1 
ATOM   1558  O  OE1 . GLU A  1 212 ? -43.851  87.271  28.509  1.00 53.83 ? 204  GLU A OE1 1 
ATOM   1559  O  OE2 . GLU A  1 212 ? -44.762  85.765  27.266  1.00 57.05 ? 204  GLU A OE2 1 
ATOM   1560  N  N   . ASP A  1 213 ? -42.313  91.774  27.423  1.00 43.07 ? 205  ASP A N   1 
ATOM   1561  C  CA  . ASP A  1 213 ? -41.917  93.154  27.567  1.00 43.02 ? 205  ASP A CA  1 
ATOM   1562  C  C   . ASP A  1 213 ? -41.056  93.644  26.418  1.00 42.12 ? 205  ASP A C   1 
ATOM   1563  O  O   . ASP A  1 213 ? -40.914  94.801  26.255  1.00 42.56 ? 205  ASP A O   1 
ATOM   1564  C  CB  . ASP A  1 213 ? -41.187  93.402  28.869  1.00 43.74 ? 205  ASP A CB  1 
ATOM   1565  C  CG  . ASP A  1 213 ? -41.976  93.032  30.053  1.00 46.75 ? 205  ASP A CG  1 
ATOM   1566  O  OD1 . ASP A  1 213 ? -43.179  93.219  30.061  1.00 50.28 ? 205  ASP A OD1 1 
ATOM   1567  O  OD2 . ASP A  1 213 ? -41.394  92.557  31.001  1.00 48.37 ? 205  ASP A OD2 1 
ATOM   1568  N  N   . LEU A  1 214 ? -40.499  92.755  25.623  1.00 40.90 ? 206  LEU A N   1 
ATOM   1569  C  CA  . LEU A  1 214 ? -39.794  93.126  24.422  1.00 39.56 ? 206  LEU A CA  1 
ATOM   1570  C  C   . LEU A  1 214 ? -40.580  92.843  23.179  1.00 39.47 ? 206  LEU A C   1 
ATOM   1571  O  O   . LEU A  1 214 ? -40.072  92.916  22.103  1.00 38.15 ? 206  LEU A O   1 
ATOM   1572  C  CB  . LEU A  1 214 ? -38.474  92.404  24.342  1.00 39.02 ? 206  LEU A CB  1 
ATOM   1573  C  CG  . LEU A  1 214 ? -37.685  92.367  25.620  1.00 37.79 ? 206  LEU A CG  1 
ATOM   1574  C  CD1 . LEU A  1 214 ? -36.845  91.204  25.726  1.00 32.52 ? 206  LEU A CD1 1 
ATOM   1575  C  CD2 . LEU A  1 214 ? -36.900  93.582  25.742  1.00 33.90 ? 206  LEU A CD2 1 
ATOM   1576  N  N   . GLY A  1 215 ? -41.834  92.497  23.347  1.00 40.20 ? 207  GLY A N   1 
ATOM   1577  C  CA  . GLY A  1 215 ? -42.702  92.189  22.204  1.00 39.52 ? 207  GLY A CA  1 
ATOM   1578  C  C   . GLY A  1 215 ? -42.432  90.863  21.513  1.00 38.63 ? 207  GLY A C   1 
ATOM   1579  O  O   . GLY A  1 215 ? -42.789  90.698  20.358  1.00 38.33 ? 207  GLY A O   1 
ATOM   1580  N  N   . VAL A  1 216 ? -41.819  89.913  22.210  1.00 37.30 ? 208  VAL A N   1 
ATOM   1581  C  CA  . VAL A  1 216 ? -41.582  88.592  21.621  1.00 36.41 ? 208  VAL A CA  1 
ATOM   1582  C  C   . VAL A  1 216 ? -42.039  87.574  22.605  1.00 35.43 ? 208  VAL A C   1 
ATOM   1583  O  O   . VAL A  1 216 ? -42.184  87.855  23.765  1.00 35.67 ? 208  VAL A O   1 
ATOM   1584  C  CB  . VAL A  1 216 ? -40.083  88.357  21.206  1.00 36.19 ? 208  VAL A CB  1 
ATOM   1585  C  CG1 . VAL A  1 216 ? -39.754  89.238  20.007  1.00 35.65 ? 208  VAL A CG1 1 
ATOM   1586  C  CG2 . VAL A  1 216 ? -39.109  88.605  22.384  1.00 33.40 ? 208  VAL A CG2 1 
ATOM   1587  N  N   . ALA A  1 217 ? -42.292  86.384  22.117  1.00 34.85 ? 209  ALA A N   1 
ATOM   1588  C  CA  . ALA A  1 217 ? -42.822  85.292  22.926  1.00 34.51 ? 209  ALA A CA  1 
ATOM   1589  C  C   . ALA A  1 217 ? -41.746  84.586  23.722  1.00 34.06 ? 209  ALA A C   1 
ATOM   1590  O  O   . ALA A  1 217 ? -42.053  83.923  24.690  1.00 33.54 ? 209  ALA A O   1 
ATOM   1591  C  CB  . ALA A  1 217 ? -43.485  84.259  22.039  1.00 34.59 ? 209  ALA A CB  1 
ATOM   1592  N  N   . ASP A  1 218 ? -40.502  84.673  23.270  1.00 33.32 ? 210  ASP A N   1 
ATOM   1593  C  CA  . ASP A  1 218 ? -39.395  83.994  23.923  1.00 33.12 ? 210  ASP A CA  1 
ATOM   1594  C  C   . ASP A  1 218 ? -38.111  84.715  23.527  1.00 32.13 ? 210  ASP A C   1 
ATOM   1595  O  O   . ASP A  1 218 ? -38.104  85.515  22.618  1.00 32.79 ? 210  ASP A O   1 
ATOM   1596  C  CB  . ASP A  1 218 ? -39.340  82.521  23.526  1.00 33.24 ? 210  ASP A CB  1 
ATOM   1597  C  CG  . ASP A  1 218 ? -38.392  81.704  24.406  1.00 34.75 ? 210  ASP A CG  1 
ATOM   1598  O  OD1 . ASP A  1 218 ? -38.092  82.155  25.527  1.00 34.64 ? 210  ASP A OD1 1 
ATOM   1599  O  OD2 . ASP A  1 218 ? -37.939  80.613  23.984  1.00 37.69 ? 210  ASP A OD2 1 
ATOM   1600  N  N   . LEU A  1 219 ? -37.062  84.487  24.294  1.00 30.55 ? 211  LEU A N   1 
ATOM   1601  C  CA  . LEU A  1 219 ? -35.755  84.988  24.012  1.00 29.10 ? 211  LEU A CA  1 
ATOM   1602  C  C   . LEU A  1 219 ? -34.844  83.915  24.520  1.00 28.59 ? 211  LEU A C   1 
ATOM   1603  O  O   . LEU A  1 219 ? -34.966  83.469  25.677  1.00 28.61 ? 211  LEU A O   1 
ATOM   1604  C  CB  . LEU A  1 219 ? -35.509  86.288  24.738  1.00 28.91 ? 211  LEU A CB  1 
ATOM   1605  C  CG  . LEU A  1 219 ? -34.220  87.021  24.367  1.00 28.89 ? 211  LEU A CG  1 
ATOM   1606  C  CD1 . LEU A  1 219 ? -34.229  87.500  22.900  1.00 28.96 ? 211  LEU A CD1 1 
ATOM   1607  C  CD2 . LEU A  1 219 ? -34.006  88.194  25.310  1.00 26.05 ? 211  LEU A CD2 1 
ATOM   1608  N  N   . LYS A  1 220 ? -33.972  83.456  23.628  1.00 27.59 ? 212  LYS A N   1 
ATOM   1609  C  CA  . LYS A  1 220 ? -33.154  82.293  23.861  1.00 26.94 ? 212  LYS A CA  1 
ATOM   1610  C  C   . LYS A  1 220 ? -31.695  82.674  24.112  1.00 25.63 ? 212  LYS A C   1 
ATOM   1611  O  O   . LYS A  1 220 ? -31.198  83.670  23.594  1.00 23.31 ? 212  LYS A O   1 
ATOM   1612  C  CB  . LYS A  1 220 ? -33.254  81.325  22.673  1.00 27.57 ? 212  LYS A CB  1 
ATOM   1613  C  CG  . LYS A  1 220 ? -34.672  80.823  22.443  1.00 29.58 ? 212  LYS A CG  1 
ATOM   1614  C  CD  . LYS A  1 220 ? -34.797  79.859  21.284  1.00 33.66 ? 212  LYS A CD  1 
ATOM   1615  C  CE  . LYS A  1 220 ? -36.252  79.394  21.082  1.00 35.58 ? 212  LYS A CE  1 
ATOM   1616  N  NZ  . LYS A  1 220 ? -37.047  80.611  20.727  1.00 37.96 ? 212  LYS A NZ  1 
ATOM   1617  N  N   . LEU A  1 221 ? -31.041  81.847  24.932  1.00 24.36 ? 213  LEU A N   1 
ATOM   1618  C  CA  . LEU A  1 221 ? -29.606  81.927  25.129  1.00 23.42 ? 213  LEU A CA  1 
ATOM   1619  C  C   . LEU A  1 221 ? -29.048  81.620  23.756  1.00 23.56 ? 213  LEU A C   1 
ATOM   1620  O  O   . LEU A  1 221 ? -29.454  80.638  23.136  1.00 22.33 ? 213  LEU A O   1 
ATOM   1621  C  CB  . LEU A  1 221 ? -29.136  80.881  26.132  1.00 22.74 ? 213  LEU A CB  1 
ATOM   1622  C  CG  . LEU A  1 221 ? -29.767  80.930  27.532  1.00 22.38 ? 213  LEU A CG  1 
ATOM   1623  C  CD1 . LEU A  1 221 ? -29.309  79.704  28.364  1.00 18.50 ? 213  LEU A CD1 1 
ATOM   1624  C  CD2 . LEU A  1 221 ? -29.410  82.236  28.188  1.00 19.52 ? 213  LEU A CD2 1 
ATOM   1625  N  N   . GLY A  1 222 ? -28.162  82.491  23.269  1.00 23.87 ? 214  GLY A N   1 
ATOM   1626  C  CA  . GLY A  1 222 ? -27.628  82.372  21.902  1.00 23.36 ? 214  GLY A CA  1 
ATOM   1627  C  C   . GLY A  1 222 ? -28.270  83.223  20.826  1.00 23.35 ? 214  GLY A C   1 
ATOM   1628  O  O   . GLY A  1 222 ? -27.747  83.294  19.685  1.00 23.76 ? 214  GLY A O   1 
ATOM   1629  N  N   . ASP A  1 223 ? -29.370  83.889  21.159  1.00 22.95 ? 215  ASP A N   1 
ATOM   1630  C  CA  . ASP A  1 223 ? -30.090  84.694  20.157  1.00 23.14 ? 215  ASP A CA  1 
ATOM   1631  C  C   . ASP A  1 223 ? -29.319  85.936  19.746  1.00 22.97 ? 215  ASP A C   1 
ATOM   1632  O  O   . ASP A  1 223 ? -28.617  86.511  20.556  1.00 24.32 ? 215  ASP A O   1 
ATOM   1633  C  CB  . ASP A  1 223 ? -31.453  85.144  20.706  1.00 23.55 ? 215  ASP A CB  1 
ATOM   1634  C  CG  . ASP A  1 223 ? -32.590  84.086  20.490  1.00 26.62 ? 215  ASP A CG  1 
ATOM   1635  O  OD1 . ASP A  1 223 ? -32.335  83.054  19.779  1.00 27.72 ? 215  ASP A OD1 1 
ATOM   1636  O  OD2 . ASP A  1 223 ? -33.739  84.339  21.015  1.00 27.98 ? 215  ASP A OD2 1 
ATOM   1637  N  N   . ILE A  1 224 ? -29.492  86.396  18.514  1.00 22.57 ? 216  ILE A N   1 
ATOM   1638  C  CA  . ILE A  1 224 ? -28.915  87.666  18.079  1.00 21.85 ? 216  ILE A CA  1 
ATOM   1639  C  C   . ILE A  1 224 ? -29.996  88.718  18.151  1.00 21.73 ? 216  ILE A C   1 
ATOM   1640  O  O   . ILE A  1 224 ? -31.103  88.464  17.709  1.00 21.70 ? 216  ILE A O   1 
ATOM   1641  C  CB  . ILE A  1 224 ? -28.384  87.518  16.667  1.00 22.46 ? 216  ILE A CB  1 
ATOM   1642  C  CG1 . ILE A  1 224 ? -27.434  86.328  16.671  1.00 23.36 ? 216  ILE A CG1 1 
ATOM   1643  C  CG2 . ILE A  1 224 ? -27.741  88.833  16.165  1.00 20.17 ? 216  ILE A CG2 1 
ATOM   1644  C  CD1 . ILE A  1 224 ? -26.836  86.044  15.397  1.00 30.28 ? 216  ILE A CD1 1 
ATOM   1645  N  N   . VAL A  1 225 ? -29.683  89.861  18.754  1.00 21.11 ? 217  VAL A N   1 
ATOM   1646  C  CA  . VAL A  1 225 ? -30.612  90.931  18.980  1.00 20.74 ? 217  VAL A CA  1 
ATOM   1647  C  C   . VAL A  1 225 ? -29.997  92.251  18.524  1.00 21.45 ? 217  VAL A C   1 
ATOM   1648  O  O   . VAL A  1 225 ? -28.787  92.374  18.408  1.00 22.00 ? 217  VAL A O   1 
ATOM   1649  C  CB  . VAL A  1 225 ? -30.982  91.039  20.468  1.00 21.40 ? 217  VAL A CB  1 
ATOM   1650  C  CG1 . VAL A  1 225 ? -31.613  89.750  20.958  1.00 21.44 ? 217  VAL A CG1 1 
ATOM   1651  C  CG2 . VAL A  1 225 ? -29.750  91.383  21.360  1.00 20.72 ? 217  VAL A CG2 1 
ATOM   1652  N  N   . ALA A  1 226 ? -30.835  93.234  18.250  1.00 22.04 ? 218  ALA A N   1 
ATOM   1653  C  CA  . ALA A  1 226 ? -30.394  94.614  18.024  1.00 22.60 ? 218  ALA A CA  1 
ATOM   1654  C  C   . ALA A  1 226 ? -30.723  95.416  19.242  1.00 22.96 ? 218  ALA A C   1 
ATOM   1655  O  O   . ALA A  1 226 ? -31.740  95.168  19.847  1.00 23.45 ? 218  ALA A O   1 
ATOM   1656  C  CB  . ALA A  1 226 ? -31.094  95.216  16.822  1.00 22.10 ? 218  ALA A CB  1 
ATOM   1657  N  N   . ILE A  1 227 ? -29.854  96.357  19.610  1.00 23.89 ? 219  ILE A N   1 
ATOM   1658  C  CA  . ILE A  1 227 ? -30.121  97.302  20.657  1.00 24.39 ? 219  ILE A CA  1 
ATOM   1659  C  C   . ILE A  1 227 ? -30.191  98.659  20.018  1.00 24.93 ? 219  ILE A C   1 
ATOM   1660  O  O   . ILE A  1 227 ? -29.235  99.116  19.424  1.00 25.44 ? 219  ILE A O   1 
ATOM   1661  C  CB  . ILE A  1 227 ? -29.032  97.292  21.731  1.00 25.14 ? 219  ILE A CB  1 
ATOM   1662  C  CG1 . ILE A  1 227 ? -28.890  95.886  22.300  1.00 26.10 ? 219  ILE A CG1 1 
ATOM   1663  C  CG2 . ILE A  1 227 ? -29.362  98.268  22.881  1.00 24.01 ? 219  ILE A CG2 1 
ATOM   1664  C  CD1 . ILE A  1 227 ? -27.650  95.725  23.101  1.00 28.57 ? 219  ILE A CD1 1 
ATOM   1665  N  N   . GLN A  1 228 ? -31.340  99.299  20.123  1.00 25.95 ? 220  GLN A N   1 
ATOM   1666  C  CA  . GLN A  1 228 ? -31.581  100.564 19.446  1.00 27.29 ? 220  GLN A CA  1 
ATOM   1667  C  C   . GLN A  1 228 ? -31.011  101.716 20.226  1.00 26.98 ? 220  GLN A C   1 
ATOM   1668  O  O   . GLN A  1 228 ? -31.142  101.776 21.426  1.00 25.49 ? 220  GLN A O   1 
ATOM   1669  C  CB  . GLN A  1 228 ? -33.067  100.776 19.235  1.00 27.94 ? 220  GLN A CB  1 
ATOM   1670  C  CG  . GLN A  1 228 ? -33.662  99.682  18.401  1.00 32.91 ? 220  GLN A CG  1 
ATOM   1671  C  CD  . GLN A  1 228 ? -35.201  99.809  18.187  1.00 39.56 ? 220  GLN A CD  1 
ATOM   1672  O  OE1 . GLN A  1 228 ? -35.981  99.996  19.142  1.00 42.63 ? 220  GLN A OE1 1 
ATOM   1673  N  NE2 . GLN A  1 228 ? -35.631  99.656  16.922  1.00 39.22 ? 220  GLN A NE2 1 
ATOM   1674  N  N   . ASP A  1 229 ? -30.353  102.626 19.520  1.00 26.92 ? 221  ASP A N   1 
ATOM   1675  C  CA  . ASP A  1 229 ? -29.912  103.883 20.092  1.00 27.56 ? 221  ASP A CA  1 
ATOM   1676  C  C   . ASP A  1 229 ? -28.867  103.727 21.197  1.00 27.60 ? 221  ASP A C   1 
ATOM   1677  O  O   . ASP A  1 229 ? -28.770  104.588 22.086  1.00 28.59 ? 221  ASP A O   1 
ATOM   1678  C  CB  . ASP A  1 229 ? -31.110  104.697 20.635  1.00 28.77 ? 221  ASP A CB  1 
ATOM   1679  C  CG  . ASP A  1 229 ? -32.207  104.914 19.603  1.00 29.49 ? 221  ASP A CG  1 
ATOM   1680  O  OD1 . ASP A  1 229 ? -31.914  105.400 18.486  1.00 29.70 ? 221  ASP A OD1 1 
ATOM   1681  O  OD2 . ASP A  1 229 ? -33.371  104.618 19.954  1.00 31.89 ? 221  ASP A OD2 1 
ATOM   1682  N  N   . HIS A  1 230 ? -28.084  102.662 21.134  1.00 26.32 ? 222  HIS A N   1 
ATOM   1683  C  CA  . HIS A  1 230 ? -26.893  102.522 21.959  1.00 26.52 ? 222  HIS A CA  1 
ATOM   1684  C  C   . HIS A  1 230 ? -25.654  102.347 21.115  1.00 25.88 ? 222  HIS A C   1 
ATOM   1685  O  O   . HIS A  1 230 ? -25.606  101.501 20.250  1.00 24.92 ? 222  HIS A O   1 
ATOM   1686  C  CB  . HIS A  1 230 ? -27.023  101.302 22.860  1.00 26.54 ? 222  HIS A CB  1 
ATOM   1687  C  CG  . HIS A  1 230 ? -27.634  101.603 24.181  1.00 27.75 ? 222  HIS A CG  1 
ATOM   1688  N  ND1 . HIS A  1 230 ? -27.418  100.810 25.292  1.00 26.27 ? 222  HIS A ND1 1 
ATOM   1689  C  CD2 . HIS A  1 230 ? -28.431  102.631 24.582  1.00 28.05 ? 222  HIS A CD2 1 
ATOM   1690  C  CE1 . HIS A  1 230 ? -28.064  101.347 26.320  1.00 30.08 ? 222  HIS A CE1 1 
ATOM   1691  N  NE2 . HIS A  1 230 ? -28.695  102.442 25.914  1.00 28.09 ? 222  HIS A NE2 1 
ATOM   1692  N  N   . ASP A  1 231 ? -24.663  103.172 21.366  1.00 26.92 ? 223  ASP A N   1 
ATOM   1693  C  CA  . ASP A  1 231 ? -23.368  103.014 20.789  1.00 27.64 ? 223  ASP A CA  1 
ATOM   1694  C  C   . ASP A  1 231 ? -22.471  102.238 21.777  1.00 26.97 ? 223  ASP A C   1 
ATOM   1695  O  O   . ASP A  1 231 ? -22.411  102.575 22.974  1.00 27.34 ? 223  ASP A O   1 
ATOM   1696  C  CB  . ASP A  1 231 ? -22.753  104.390 20.491  1.00 28.88 ? 223  ASP A CB  1 
ATOM   1697  C  CG  . ASP A  1 231 ? -21.232  104.299 20.336  1.00 31.82 ? 223  ASP A CG  1 
ATOM   1698  O  OD1 . ASP A  1 231 ? -20.737  103.747 19.381  1.00 32.67 ? 223  ASP A OD1 1 
ATOM   1699  O  OD2 . ASP A  1 231 ? -20.496  104.666 21.253  1.00 43.91 ? 223  ASP A OD2 1 
ATOM   1700  N  N   . ASN A  1 232 ? -21.769  101.226 21.292  1.00 26.08 ? 224  ASN A N   1 
ATOM   1701  C  CA  . ASN A  1 232 ? -20.837  100.451 22.124  1.00 26.12 ? 224  ASN A CA  1 
ATOM   1702  C  C   . ASN A  1 232 ? -19.442  100.372 21.548  1.00 26.61 ? 224  ASN A C   1 
ATOM   1703  O  O   . ASN A  1 232 ? -18.710  99.372  21.673  1.00 26.82 ? 224  ASN A O   1 
ATOM   1704  C  CB  . ASN A  1 232 ? -21.374  99.068  22.302  1.00 25.93 ? 224  ASN A CB  1 
ATOM   1705  C  CG  . ASN A  1 232 ? -22.528  99.029  23.262  1.00 26.80 ? 224  ASN A CG  1 
ATOM   1706  O  OD1 . ASN A  1 232 ? -22.316  99.068  24.449  1.00 27.28 ? 224  ASN A OD1 1 
ATOM   1707  N  ND2 . ASN A  1 232 ? -23.754  98.937  22.753  1.00 25.43 ? 224  ASN A ND2 1 
ATOM   1708  N  N   . SER A  1 233 ? -19.048  101.457 20.913  1.00 27.81 ? 225  SER A N   1 
ATOM   1709  C  CA  . SER A  1 233 ? -17.751  101.504 20.250  1.00 27.52 ? 225  SER A CA  1 
ATOM   1710  C  C   . SER A  1 233 ? -16.601  101.358 21.244  1.00 27.11 ? 225  SER A C   1 
ATOM   1711  O  O   . SER A  1 233 ? -15.607  100.719 20.930  1.00 26.96 ? 225  SER A O   1 
ATOM   1712  C  CB  . SER A  1 233 ? -17.623  102.838 19.513  1.00 28.22 ? 225  SER A CB  1 
ATOM   1713  O  OG  . SER A  1 233 ? -18.477  102.825 18.400  1.00 27.04 ? 225  SER A OG  1 
ATOM   1714  N  N   . TYR A  1 234 ? -16.728  101.996 22.406  1.00 26.95 ? 226  TYR A N   1 
ATOM   1715  C  CA  . TYR A  1 234 ? -15.675  101.949 23.438  1.00 27.47 ? 226  TYR A CA  1 
ATOM   1716  C  C   . TYR A  1 234 ? -16.258  101.412 24.723  1.00 27.20 ? 226  TYR A C   1 
ATOM   1717  O  O   . TYR A  1 234 ? -16.305  100.189 24.908  1.00 26.61 ? 226  TYR A O   1 
ATOM   1718  C  CB  . TYR A  1 234 ? -14.972  103.327 23.566  1.00 28.03 ? 226  TYR A CB  1 
ATOM   1719  C  CG  . TYR A  1 234 ? -14.387  103.655 22.225  1.00 29.94 ? 226  TYR A CG  1 
ATOM   1720  C  CD1 . TYR A  1 234 ? -13.270  102.965 21.784  1.00 31.56 ? 226  TYR A CD1 1 
ATOM   1721  C  CD2 . TYR A  1 234 ? -15.065  104.485 21.304  1.00 32.23 ? 226  TYR A CD2 1 
ATOM   1722  C  CE1 . TYR A  1 234 ? -12.755  103.152 20.514  1.00 33.01 ? 226  TYR A CE1 1 
ATOM   1723  C  CE2 . TYR A  1 234 ? -14.540  104.684 19.976  1.00 32.32 ? 226  TYR A CE2 1 
ATOM   1724  C  CZ  . TYR A  1 234 ? -13.372  104.003 19.622  1.00 33.54 ? 226  TYR A CZ  1 
ATOM   1725  O  OH  . TYR A  1 234 ? -12.763  104.126 18.411  1.00 35.75 ? 226  TYR A OH  1 
ATOM   1726  N  N   . GLY A  1 235 ? -16.727  102.305 25.590  1.00 27.01 ? 227  GLY A N   1 
ATOM   1727  C  CA  . GLY A  1 235 ? -17.398  101.900 26.773  1.00 27.14 ? 227  GLY A CA  1 
ATOM   1728  C  C   . GLY A  1 235 ? -18.795  101.394 26.449  1.00 26.99 ? 227  GLY A C   1 
ATOM   1729  O  O   . GLY A  1 235 ? -19.293  101.584 25.332  1.00 27.34 ? 227  GLY A O   1 
ATOM   1730  N  N   . VAL A  1 236 ? -19.420  100.728 27.418  1.00 26.20 ? 228  VAL A N   1 
ATOM   1731  C  CA  . VAL A  1 236 ? -20.715  100.098 27.188  1.00 25.49 ? 228  VAL A CA  1 
ATOM   1732  C  C   . VAL A  1 236 ? -21.907  101.038 27.363  1.00 26.07 ? 228  VAL A C   1 
ATOM   1733  O  O   . VAL A  1 236 ? -22.035  101.768 28.347  1.00 26.30 ? 228  VAL A O   1 
ATOM   1734  C  CB  . VAL A  1 236 ? -20.896  98.840  28.079  1.00 25.72 ? 228  VAL A CB  1 
ATOM   1735  C  CG1 . VAL A  1 236 ? -22.370  98.309  27.988  1.00 22.33 ? 228  VAL A CG1 1 
ATOM   1736  C  CG2 . VAL A  1 236 ? -19.860  97.773  27.666  1.00 22.35 ? 228  VAL A CG2 1 
ATOM   1737  N  N   . GLY A  1 237 ? -22.772  101.020 26.383  1.00 26.35 ? 229  GLY A N   1 
ATOM   1738  C  CA  . GLY A  1 237 ? -24.136  101.546 26.563  1.00 27.46 ? 229  GLY A CA  1 
ATOM   1739  C  C   . GLY A  1 237 ? -24.347  103.047 26.482  1.00 28.62 ? 229  GLY A C   1 
ATOM   1740  O  O   . GLY A  1 237 ? -25.128  103.587 27.255  1.00 29.09 ? 229  GLY A O   1 
ATOM   1741  N  N   . LYS A  1 238 ? -23.658  103.719 25.562  1.00 29.07 ? 230  LYS A N   1 
ATOM   1742  C  CA  . LYS A  1 238 ? -23.857  105.145 25.326  1.00 30.32 ? 230  LYS A CA  1 
ATOM   1743  C  C   . LYS A  1 238 ? -25.179  105.362 24.559  1.00 29.86 ? 230  LYS A C   1 
ATOM   1744  O  O   . LYS A  1 238 ? -25.323  104.873 23.425  1.00 28.79 ? 230  LYS A O   1 
ATOM   1745  C  CB  . LYS A  1 238 ? -22.693  105.703 24.496  1.00 31.01 ? 230  LYS A CB  1 
ATOM   1746  C  CG  . LYS A  1 238 ? -22.930  107.062 23.765  1.00 35.29 ? 230  LYS A CG  1 
ATOM   1747  C  CD  . LYS A  1 238 ? -22.868  108.221 24.740  1.00 43.70 ? 230  LYS A CD  1 
ATOM   1748  C  CE  . LYS A  1 238 ? -22.865  109.636 24.083  1.00 49.01 ? 230  LYS A CE  1 
ATOM   1749  N  NZ  . LYS A  1 238 ? -23.109  110.693 25.202  1.00 52.26 ? 230  LYS A NZ  1 
ATOM   1750  N  N   . TYR A  1 239 ? -26.123  106.098 25.143  1.00 29.93 ? 231  TYR A N   1 
ATOM   1751  C  CA  . TYR A  1 239 ? -27.342  106.445 24.410  1.00 29.83 ? 231  TYR A CA  1 
ATOM   1752  C  C   . TYR A  1 239 ? -26.967  107.434 23.347  1.00 30.42 ? 231  TYR A C   1 
ATOM   1753  O  O   . TYR A  1 239 ? -26.281  108.393 23.649  1.00 29.79 ? 231  TYR A O   1 
ATOM   1754  C  CB  . TYR A  1 239 ? -28.416  107.096 25.271  1.00 29.97 ? 231  TYR A CB  1 
ATOM   1755  C  CG  . TYR A  1 239 ? -29.622  107.580 24.435  1.00 29.85 ? 231  TYR A CG  1 
ATOM   1756  C  CD1 . TYR A  1 239 ? -30.594  106.689 24.030  1.00 29.70 ? 231  TYR A CD1 1 
ATOM   1757  C  CD2 . TYR A  1 239 ? -29.764  108.913 24.052  1.00 31.66 ? 231  TYR A CD2 1 
ATOM   1758  C  CE1 . TYR A  1 239 ? -31.664  107.085 23.267  1.00 31.65 ? 231  TYR A CE1 1 
ATOM   1759  C  CE2 . TYR A  1 239 ? -30.865  109.336 23.283  1.00 33.09 ? 231  TYR A CE2 1 
ATOM   1760  C  CZ  . TYR A  1 239 ? -31.809  108.411 22.900  1.00 32.93 ? 231  TYR A CZ  1 
ATOM   1761  O  OH  . TYR A  1 239 ? -32.913  108.768 22.159  1.00 34.66 ? 231  TYR A OH  1 
ATOM   1762  N  N   . ARG A  1 240 ? -27.368  107.163 22.114  1.00 31.48 ? 232  ARG A N   1 
ATOM   1763  C  CA  . ARG A  1 240 ? -27.221  108.099 21.008  1.00 33.73 ? 232  ARG A CA  1 
ATOM   1764  C  C   . ARG A  1 240 ? -28.253  107.772 19.979  1.00 33.90 ? 232  ARG A C   1 
ATOM   1765  O  O   . ARG A  1 240 ? -28.264  106.677 19.433  1.00 33.19 ? 232  ARG A O   1 
ATOM   1766  C  CB  . ARG A  1 240 ? -25.854  108.035 20.352  1.00 34.38 ? 232  ARG A CB  1 
ATOM   1767  C  CG  . ARG A  1 240 ? -25.724  109.062 19.180  1.00 39.36 ? 232  ARG A CG  1 
ATOM   1768  C  CD  . ARG A  1 240 ? -24.314  109.169 18.606  1.00 45.18 ? 232  ARG A CD  1 
ATOM   1769  N  NE  . ARG A  1 240 ? -23.791  107.931 18.003  1.00 51.11 ? 232  ARG A NE  1 
ATOM   1770  C  CZ  . ARG A  1 240 ? -24.212  107.383 16.834  1.00 54.12 ? 232  ARG A CZ  1 
ATOM   1771  N  NH1 . ARG A  1 240 ? -25.225  107.925 16.095  1.00 50.99 ? 232  ARG A NH1 1 
ATOM   1772  N  NH2 . ARG A  1 240 ? -23.602  106.253 16.400  1.00 54.50 ? 232  ARG A NH2 1 
ATOM   1773  N  N   . LYS A  1 241 ? -29.119  108.736 19.708  1.00 35.59 ? 233  LYS A N   1 
ATOM   1774  C  CA  . LYS A  1 241 ? -30.299  108.511 18.824  1.00 36.50 ? 233  LYS A CA  1 
ATOM   1775  C  C   . LYS A  1 241 ? -29.749  108.238 17.442  1.00 34.64 ? 233  LYS A C   1 
ATOM   1776  O  O   . LYS A  1 241 ? -28.903  108.973 16.985  1.00 34.90 ? 233  LYS A O   1 
ATOM   1777  C  CB  . LYS A  1 241 ? -31.199  109.737 18.829  1.00 37.58 ? 233  LYS A CB  1 
ATOM   1778  C  CG  . LYS A  1 241 ? -32.399  109.651 17.886  1.00 43.35 ? 233  LYS A CG  1 
ATOM   1779  C  CD  . LYS A  1 241 ? -33.660  109.099 18.546  1.00 49.08 ? 233  LYS A CD  1 
ATOM   1780  C  CE  . LYS A  1 241 ? -34.902  109.448 17.698  1.00 52.99 ? 233  LYS A CE  1 
ATOM   1781  N  NZ  . LYS A  1 241 ? -35.839  108.287 17.601  1.00 54.69 ? 233  LYS A NZ  1 
ATOM   1782  N  N   . GLY A  1 242 ? -30.134  107.118 16.852  1.00 32.98 ? 234  GLY A N   1 
ATOM   1783  C  CA  . GLY A  1 242 ? -29.583  106.696 15.577  1.00 32.18 ? 234  GLY A CA  1 
ATOM   1784  C  C   . GLY A  1 242 ? -28.471  105.643 15.621  1.00 31.17 ? 234  GLY A C   1 
ATOM   1785  O  O   . GLY A  1 242 ? -28.212  105.003 14.620  1.00 31.82 ? 234  GLY A O   1 
ATOM   1786  N  N   . ALA A  1 243 ? -27.809  105.463 16.756  1.00 30.00 ? 235  ALA A N   1 
ATOM   1787  C  CA  . ALA A  1 243 ? -26.816  104.392 16.903  1.00 28.62 ? 235  ALA A CA  1 
ATOM   1788  C  C   . ALA A  1 243 ? -27.589  103.064 16.910  1.00 27.11 ? 235  ALA A C   1 
ATOM   1789  O  O   . ALA A  1 243 ? -28.768  103.053 17.236  1.00 25.82 ? 235  ALA A O   1 
ATOM   1790  C  CB  . ALA A  1 243 ? -26.001  104.561 18.170  1.00 27.43 ? 235  ALA A CB  1 
ATOM   1791  N  N   . VAL A  1 244 ? -26.939  101.989 16.471  1.00 25.46 ? 236  VAL A N   1 
ATOM   1792  C  CA  . VAL A  1 244 ? -27.443  100.660 16.638  1.00 25.23 ? 236  VAL A CA  1 
ATOM   1793  C  C   . VAL A  1 244 ? -26.308  99.701  17.008  1.00 24.41 ? 236  VAL A C   1 
ATOM   1794  O  O   . VAL A  1 244 ? -25.191  99.847  16.537  1.00 24.78 ? 236  VAL A O   1 
ATOM   1795  C  CB  . VAL A  1 244 ? -28.242  100.137 15.390  1.00 25.45 ? 236  VAL A CB  1 
ATOM   1796  C  CG1 . VAL A  1 244 ? -27.406  100.016 14.221  1.00 28.37 ? 236  VAL A CG1 1 
ATOM   1797  C  CG2 . VAL A  1 244 ? -28.790  98.756  15.667  1.00 26.37 ? 236  VAL A CG2 1 
ATOM   1798  N  N   . SER A  1 245 ? -26.590  98.765  17.900  1.00 23.16 ? 237  SER A N   1 
ATOM   1799  C  CA  . SER A  1 245 ? -25.665  97.730  18.250  1.00 22.46 ? 237  SER A CA  1 
ATOM   1800  C  C   . SER A  1 245 ? -26.348  96.366  18.011  1.00 22.83 ? 237  SER A C   1 
ATOM   1801  O  O   . SER A  1 245 ? -27.575  96.260  17.993  1.00 23.03 ? 237  SER A O   1 
ATOM   1802  C  CB  . SER A  1 245 ? -25.243  97.917  19.712  1.00 22.76 ? 237  SER A CB  1 
ATOM   1803  O  OG  . SER A  1 245 ? -24.523  99.141  19.944  1.00 21.68 ? 237  SER A OG  1 
ATOM   1804  N  N   . ILE A  1 246 ? -25.547  95.337  17.770  1.00 22.53 ? 238  ILE A N   1 
ATOM   1805  C  CA  . ILE A  1 246 ? -26.015  93.969  17.611  1.00 21.55 ? 238  ILE A CA  1 
ATOM   1806  C  C   . ILE A  1 246 ? -25.253  93.197  18.666  1.00 21.36 ? 238  ILE A C   1 
ATOM   1807  O  O   . ILE A  1 246 ? -24.081  93.439  18.864  1.00 20.67 ? 238  ILE A O   1 
ATOM   1808  C  CB  . ILE A  1 246 ? -25.591  93.407  16.252  1.00 21.22 ? 238  ILE A CB  1 
ATOM   1809  C  CG1 . ILE A  1 246 ? -26.124  94.285  15.100  1.00 24.50 ? 238  ILE A CG1 1 
ATOM   1810  C  CG2 . ILE A  1 246 ? -25.933  91.936  16.099  1.00 17.80 ? 238  ILE A CG2 1 
ATOM   1811  C  CD1 . ILE A  1 246 ? -27.686  94.299  14.873  1.00 22.65 ? 238  ILE A CD1 1 
ATOM   1812  N  N   . GLY A  1 247 ? -25.921  92.249  19.313  1.00 21.64 ? 239  GLY A N   1 
ATOM   1813  C  CA  . GLY A  1 247 ? -25.312  91.400  20.297  1.00 20.86 ? 239  GLY A CA  1 
ATOM   1814  C  C   . GLY A  1 247 ? -25.902  90.015  20.402  1.00 20.39 ? 239  GLY A C   1 
ATOM   1815  O  O   . GLY A  1 247 ? -26.849  89.693  19.722  1.00 20.83 ? 239  GLY A O   1 
ATOM   1816  N  N   . VAL A  1 248 ? -25.311  89.206  21.276  1.00 20.03 ? 240  VAL A N   1 
ATOM   1817  C  CA  . VAL A  1 248 ? -25.700  87.840  21.502  1.00 19.68 ? 240  VAL A CA  1 
ATOM   1818  C  C   . VAL A  1 248 ? -26.125  87.694  22.978  1.00 20.92 ? 240  VAL A C   1 
ATOM   1819  O  O   . VAL A  1 248 ? -25.453  88.187  23.892  1.00 21.52 ? 240  VAL A O   1 
ATOM   1820  C  CB  . VAL A  1 248 ? -24.540  86.878  21.207  1.00 19.16 ? 240  VAL A CB  1 
ATOM   1821  C  CG1 . VAL A  1 248 ? -24.988  85.410  21.400  1.00 18.62 ? 240  VAL A CG1 1 
ATOM   1822  C  CG2 . VAL A  1 248 ? -23.970  87.107  19.807  1.00 17.03 ? 240  VAL A CG2 1 
ATOM   1823  N  N   . VAL A  1 249 ? -27.227  86.989  23.213  1.00 21.16 ? 241  VAL A N   1 
ATOM   1824  C  CA  . VAL A  1 249 ? -27.708  86.743  24.542  1.00 20.41 ? 241  VAL A CA  1 
ATOM   1825  C  C   . VAL A  1 249 ? -26.886  85.612  25.133  1.00 20.99 ? 241  VAL A C   1 
ATOM   1826  O  O   . VAL A  1 249 ? -26.700  84.565  24.471  1.00 22.01 ? 241  VAL A O   1 
ATOM   1827  C  CB  . VAL A  1 249 ? -29.172  86.350  24.534  1.00 21.74 ? 241  VAL A CB  1 
ATOM   1828  C  CG1 . VAL A  1 249 ? -29.607  86.007  25.975  1.00 20.20 ? 241  VAL A CG1 1 
ATOM   1829  C  CG2 . VAL A  1 249 ? -30.059  87.493  23.937  1.00 19.01 ? 241  VAL A CG2 1 
ATOM   1830  N  N   . VAL A  1 250 ? -26.359  85.815  26.342  1.00 20.42 ? 242  VAL A N   1 
ATOM   1831  C  CA  . VAL A  1 250 ? -25.345  84.900  26.905  1.00 20.53 ? 242  VAL A CA  1 
ATOM   1832  C  C   . VAL A  1 250 ? -25.684  84.261  28.242  1.00 21.39 ? 242  VAL A C   1 
ATOM   1833  O  O   . VAL A  1 250 ? -25.105  83.216  28.576  1.00 21.60 ? 242  VAL A O   1 
ATOM   1834  C  CB  . VAL A  1 250 ? -23.975  85.579  27.049  1.00 20.65 ? 242  VAL A CB  1 
ATOM   1835  C  CG1 . VAL A  1 250 ? -23.417  86.008  25.617  1.00 19.49 ? 242  VAL A CG1 1 
ATOM   1836  C  CG2 . VAL A  1 250 ? -24.045  86.782  28.053  1.00 17.97 ? 242  VAL A CG2 1 
ATOM   1837  N  N   . HIS A  1 251 ? -26.620  84.844  29.001  1.00 21.60 ? 243  HIS A N   1 
ATOM   1838  C  CA  . HIS A  1 251 ? -27.081  84.196  30.234  1.00 21.84 ? 243  HIS A CA  1 
ATOM   1839  C  C   . HIS A  1 251 ? -28.541  84.399  30.517  1.00 22.19 ? 243  HIS A C   1 
ATOM   1840  O  O   . HIS A  1 251 ? -29.153  85.237  29.925  1.00 22.74 ? 243  HIS A O   1 
ATOM   1841  C  CB  . HIS A  1 251 ? -26.223  84.601  31.449  1.00 21.86 ? 243  HIS A CB  1 
ATOM   1842  C  CG  . HIS A  1 251 ? -26.362  86.029  31.896  1.00 21.70 ? 243  HIS A CG  1 
ATOM   1843  N  ND1 . HIS A  1 251 ? -27.464  86.502  32.556  1.00 23.98 ? 243  HIS A ND1 1 
ATOM   1844  C  CD2 . HIS A  1 251 ? -25.487  87.055  31.869  1.00 23.70 ? 243  HIS A CD2 1 
ATOM   1845  C  CE1 . HIS A  1 251 ? -27.300  87.776  32.851  1.00 22.93 ? 243  HIS A CE1 1 
ATOM   1846  N  NE2 . HIS A  1 251 ? -26.102  88.135  32.457  1.00 24.64 ? 243  HIS A NE2 1 
ATOM   1847  N  N   . SER A  1 252 ? -29.067  83.649  31.478  1.00 23.64 ? 244  SER A N   1 
ATOM   1848  C  CA  . SER A  1 252 ? -30.507  83.602  31.754  1.00 25.10 ? 244  SER A CA  1 
ATOM   1849  C  C   . SER A  1 252 ? -31.032  84.875  32.375  1.00 25.77 ? 244  SER A C   1 
ATOM   1850  O  O   . SER A  1 252 ? -30.257  85.738  32.788  1.00 25.36 ? 244  SER A O   1 
ATOM   1851  C  CB  . SER A  1 252 ? -30.856  82.439  32.684  1.00 25.25 ? 244  SER A CB  1 
ATOM   1852  O  OG  . SER A  1 252 ? -30.794  82.845  34.031  1.00 26.42 ? 244  SER A OG  1 
ATOM   1853  N  N   . ALA A  1 253 ? -32.357  84.953  32.456  1.00 26.88 ? 245  ALA A N   1 
ATOM   1854  C  CA  . ALA A  1 253 ? -33.034  86.057  33.152  1.00 28.63 ? 245  ALA A CA  1 
ATOM   1855  C  C   . ALA A  1 253 ? -32.663  86.097  34.621  1.00 29.95 ? 245  ALA A C   1 
ATOM   1856  O  O   . ALA A  1 253 ? -32.118  85.148  35.190  1.00 30.11 ? 245  ALA A O   1 
ATOM   1857  C  CB  . ALA A  1 253 ? -34.567  85.988  32.990  1.00 27.67 ? 245  ALA A CB  1 
ATOM   1858  N  N   . CYS A  1 254 ? -33.002  87.223  35.224  1.00 32.39 ? 246  CYS A N   1 
ATOM   1859  C  CA  . CYS A  1 254 ? -32.556  87.615  36.556  1.00 34.00 ? 246  CYS A CA  1 
ATOM   1860  C  C   . CYS A  1 254 ? -33.730  88.165  37.365  1.00 33.69 ? 246  CYS A C   1 
ATOM   1861  O  O   . CYS A  1 254 ? -34.654  88.761  36.825  1.00 34.54 ? 246  CYS A O   1 
ATOM   1862  C  CB  . CYS A  1 254 ? -31.455  88.693  36.440  1.00 34.59 ? 246  CYS A CB  1 
ATOM   1863  S  SG  . CYS A  1 254 ? -29.908  88.117  35.543  1.00 41.25 ? 246  CYS A SG  1 
ATOM   1864  N  N   . VAL A  1 255 ? -33.678  87.991  38.676  1.00 33.66 ? 247  VAL A N   1 
ATOM   1865  C  CA  . VAL A  1 255 ? -34.797  88.374  39.531  1.00 33.72 ? 247  VAL A CA  1 
ATOM   1866  C  C   . VAL A  1 255 ? -34.671  89.795  40.095  1.00 34.00 ? 247  VAL A C   1 
ATOM   1867  O  O   . VAL A  1 255 ? -35.674  90.420  40.400  1.00 34.38 ? 247  VAL A O   1 
ATOM   1868  C  CB  . VAL A  1 255 ? -35.001  87.349  40.621  1.00 34.44 ? 247  VAL A CB  1 
ATOM   1869  C  CG1 . VAL A  1 255 ? -35.427  85.974  39.946  1.00 33.05 ? 247  VAL A CG1 1 
ATOM   1870  C  CG2 . VAL A  1 255 ? -33.743  87.253  41.553  1.00 31.63 ? 247  VAL A CG2 1 
ATOM   1871  N  N   . SER A  1 256 ? -33.457  90.335  40.137  1.00 33.43 ? 248  SER A N   1 
ATOM   1872  C  CA  . SER A  1 256 ? -33.212  91.656  40.747  1.00 33.08 ? 248  SER A CA  1 
ATOM   1873  C  C   . SER A  1 256 ? -33.418  92.838  39.824  1.00 33.10 ? 248  SER A C   1 
ATOM   1874  O  O   . SER A  1 256 ? -33.219  92.742  38.624  1.00 33.14 ? 248  SER A O   1 
ATOM   1875  C  CB  . SER A  1 256 ? -31.763  91.732  41.261  1.00 32.69 ? 248  SER A CB  1 
ATOM   1876  O  OG  . SER A  1 256 ? -31.461  90.617  42.072  1.00 33.46 ? 248  SER A OG  1 
ATOM   1877  N  N   . ALA A  1 257 ? -33.715  93.992  40.417  1.00 33.66 ? 249  ALA A N   1 
ATOM   1878  C  CA  . ALA A  1 257 ? -33.897  95.240  39.681  1.00 33.38 ? 249  ALA A CA  1 
ATOM   1879  C  C   . ALA A  1 257 ? -32.662  95.551  38.814  1.00 32.87 ? 249  ALA A C   1 
ATOM   1880  O  O   . ALA A  1 257 ? -31.511  95.439  39.287  1.00 33.04 ? 249  ALA A O   1 
ATOM   1881  C  CB  . ALA A  1 257 ? -34.154  96.411  40.659  1.00 33.45 ? 249  ALA A CB  1 
ATOM   1882  N  N   . GLY A  1 258 ? -32.902  95.969  37.562  1.00 31.70 ? 250  GLY A N   1 
ATOM   1883  C  CA  . GLY A  1 258 ? -31.812  96.409  36.681  1.00 30.78 ? 250  GLY A CA  1 
ATOM   1884  C  C   . GLY A  1 258 ? -31.077  95.301  35.933  1.00 29.77 ? 250  GLY A C   1 
ATOM   1885  O  O   . GLY A  1 258 ? -30.237  95.599  35.104  1.00 28.74 ? 250  GLY A O   1 
ATOM   1886  N  N   . HIS A  1 259 ? -31.431  94.040  36.194  1.00 29.50 ? 251  HIS A N   1 
ATOM   1887  C  CA  . HIS A  1 259 ? -30.711  92.886  35.648  1.00 29.35 ? 251  HIS A CA  1 
ATOM   1888  C  C   . HIS A  1 259 ? -31.641  92.089  34.731  1.00 29.62 ? 251  HIS A C   1 
ATOM   1889  O  O   . HIS A  1 259 ? -32.873  92.243  34.746  1.00 28.76 ? 251  HIS A O   1 
ATOM   1890  C  CB  . HIS A  1 259 ? -30.207  91.952  36.757  1.00 29.39 ? 251  HIS A CB  1 
ATOM   1891  C  CG  . HIS A  1 259 ? -29.093  92.523  37.577  1.00 30.37 ? 251  HIS A CG  1 
ATOM   1892  N  ND1 . HIS A  1 259 ? -27.764  92.268  37.302  1.00 33.73 ? 251  HIS A ND1 1 
ATOM   1893  C  CD2 . HIS A  1 259 ? -29.110  93.341  38.655  1.00 30.12 ? 251  HIS A CD2 1 
ATOM   1894  C  CE1 . HIS A  1 259 ? -27.016  92.898  38.193  1.00 33.71 ? 251  HIS A CE1 1 
ATOM   1895  N  NE2 . HIS A  1 259 ? -27.805  93.560  39.018  1.00 31.44 ? 251  HIS A NE2 1 
ATOM   1896  N  N   . GLY A  1 260 ? -31.034  91.219  33.929  1.00 28.62 ? 252  GLY A N   1 
ATOM   1897  C  CA  . GLY A  1 260 ? -31.807  90.468  32.941  1.00 28.02 ? 252  GLY A CA  1 
ATOM   1898  C  C   . GLY A  1 260 ? -30.840  89.711  32.079  1.00 27.05 ? 252  GLY A C   1 
ATOM   1899  O  O   . GLY A  1 260 ? -29.641  89.690  32.375  1.00 27.48 ? 252  GLY A O   1 
ATOM   1900  N  N   . PRO A  1 261 ? -31.342  89.105  31.008  1.00 26.26 ? 253  PRO A N   1 
ATOM   1901  C  CA  . PRO A  1 261 ? -30.449  88.326  30.182  1.00 25.63 ? 253  PRO A CA  1 
ATOM   1902  C  C   . PRO A  1 261 ? -29.335  89.218  29.626  1.00 25.28 ? 253  PRO A C   1 
ATOM   1903  O  O   . PRO A  1 261 ? -29.565  90.363  29.208  1.00 25.72 ? 253  PRO A O   1 
ATOM   1904  C  CB  . PRO A  1 261 ? -31.353  87.798  29.084  1.00 25.22 ? 253  PRO A CB  1 
ATOM   1905  C  CG  . PRO A  1 261 ? -32.668  87.786  29.665  1.00 25.99 ? 253  PRO A CG  1 
ATOM   1906  C  CD  . PRO A  1 261 ? -32.731  89.014  30.538  1.00 26.90 ? 253  PRO A CD  1 
ATOM   1907  N  N   . GLY A  1 262 ? -28.133  88.680  29.691  1.00 24.45 ? 254  GLY A N   1 
ATOM   1908  C  CA  . GLY A  1 262 ? -26.973  89.398  29.260  1.00 24.13 ? 254  GLY A CA  1 
ATOM   1909  C  C   . GLY A  1 262 ? -26.767  89.321  27.758  1.00 23.48 ? 254  GLY A C   1 
ATOM   1910  O  O   . GLY A  1 262 ? -27.099  88.333  27.115  1.00 23.63 ? 254  GLY A O   1 
ATOM   1911  N  N   . VAL A  1 263 ? -26.182  90.383  27.238  1.00 22.73 ? 255  VAL A N   1 
ATOM   1912  C  CA  . VAL A  1 263 ? -25.891  90.533  25.843  1.00 22.31 ? 255  VAL A CA  1 
ATOM   1913  C  C   . VAL A  1 263 ? -24.426  90.946  25.688  1.00 21.25 ? 255  VAL A C   1 
ATOM   1914  O  O   . VAL A  1 263 ? -23.997  91.916  26.293  1.00 21.27 ? 255  VAL A O   1 
ATOM   1915  C  CB  . VAL A  1 263 ? -26.784  91.641  25.250  1.00 22.34 ? 255  VAL A CB  1 
ATOM   1916  C  CG1 . VAL A  1 263 ? -26.383  91.923  23.821  1.00 23.97 ? 255  VAL A CG1 1 
ATOM   1917  C  CG2 . VAL A  1 263 ? -28.205  91.227  25.344  1.00 21.84 ? 255  VAL A CG2 1 
ATOM   1918  N  N   . VAL A  1 264 ? -23.665  90.181  24.908  1.00 21.02 ? 256  VAL A N   1 
ATOM   1919  C  CA  . VAL A  1 264 ? -22.355  90.585  24.431  1.00 20.48 ? 256  VAL A CA  1 
ATOM   1920  C  C   . VAL A  1 264 ? -22.501  91.280  23.093  1.00 20.84 ? 256  VAL A C   1 
ATOM   1921  O  O   . VAL A  1 264 ? -23.051  90.726  22.165  1.00 21.13 ? 256  VAL A O   1 
ATOM   1922  C  CB  . VAL A  1 264 ? -21.413  89.389  24.333  1.00 20.73 ? 256  VAL A CB  1 
ATOM   1923  C  CG1 . VAL A  1 264 ? -20.071  89.796  23.710  1.00 18.56 ? 256  VAL A CG1 1 
ATOM   1924  C  CG2 . VAL A  1 264 ? -21.216  88.766  25.757  1.00 18.91 ? 256  VAL A CG2 1 
ATOM   1925  N  N   . VAL A  1 265 ? -21.999  92.496  22.988  1.00 21.07 ? 257  VAL A N   1 
ATOM   1926  C  CA  . VAL A  1 265 ? -22.052  93.214  21.727  1.00 21.10 ? 257  VAL A CA  1 
ATOM   1927  C  C   . VAL A  1 265 ? -21.029  92.656  20.741  1.00 21.74 ? 257  VAL A C   1 
ATOM   1928  O  O   . VAL A  1 265 ? -19.856  92.379  21.112  1.00 21.69 ? 257  VAL A O   1 
ATOM   1929  C  CB  . VAL A  1 265 ? -21.766  94.704  21.895  1.00 21.40 ? 257  VAL A CB  1 
ATOM   1930  C  CG1 . VAL A  1 265 ? -21.896  95.422  20.556  1.00 20.65 ? 257  VAL A CG1 1 
ATOM   1931  C  CG2 . VAL A  1 265 ? -22.710  95.338  22.917  1.00 21.40 ? 257  VAL A CG2 1 
ATOM   1932  N  N   . ILE A  1 266 ? -21.488  92.486  19.494  1.00 21.35 ? 258  ILE A N   1 
ATOM   1933  C  CA  . ILE A  1 266 ? -20.647  92.051  18.407  1.00 21.28 ? 258  ILE A CA  1 
ATOM   1934  C  C   . ILE A  1 266 ? -20.468  93.062  17.262  1.00 22.05 ? 258  ILE A C   1 
ATOM   1935  O  O   . ILE A  1 266 ? -19.520  92.924  16.463  1.00 20.95 ? 258  ILE A O   1 
ATOM   1936  C  CB  . ILE A  1 266 ? -21.061  90.663  17.874  1.00 21.03 ? 258  ILE A CB  1 
ATOM   1937  C  CG1 . ILE A  1 266 ? -22.441  90.660  17.224  1.00 21.12 ? 258  ILE A CG1 1 
ATOM   1938  C  CG2 . ILE A  1 266 ? -20.964  89.648  18.995  1.00 20.97 ? 258  ILE A CG2 1 
ATOM   1939  C  CD1 . ILE A  1 266 ? -22.725  89.409  16.291  1.00 17.75 ? 258  ILE A CD1 1 
ATOM   1940  N  N   . MET A  1 267 ? -21.348  94.067  17.192  1.00 23.20 ? 259  MET A N   1 
ATOM   1941  C  CA  . MET A  1 267 ? -21.309  95.056  16.153  1.00 24.09 ? 259  MET A CA  1 
ATOM   1942  C  C   . MET A  1 267 ? -21.985  96.324  16.617  1.00 23.62 ? 259  MET A C   1 
ATOM   1943  O  O   . MET A  1 267 ? -22.988  96.283  17.304  1.00 23.76 ? 259  MET A O   1 
ATOM   1944  C  CB  . MET A  1 267 ? -21.975  94.498  14.872  1.00 25.59 ? 259  MET A CB  1 
ATOM   1945  C  CG  . MET A  1 267 ? -21.863  95.415  13.622  1.00 29.38 ? 259  MET A CG  1 
ATOM   1946  S  SD  . MET A  1 267 ? -22.774  94.862  12.138  1.00 34.48 ? 259  MET A SD  1 
ATOM   1947  C  CE  . MET A  1 267 ? -21.982  93.303  11.842  1.00 30.06 ? 259  MET A CE  1 
ATOM   1948  N  N   . THR A  1 268 ? -21.430  97.458  16.237  1.00 23.61 ? 260  THR A N   1 
ATOM   1949  C  CA  . THR A  1 268 ? -22.000  98.708  16.625  1.00 24.26 ? 260  THR A CA  1 
ATOM   1950  C  C   . THR A  1 268 ? -21.673  99.747  15.585  1.00 24.79 ? 260  THR A C   1 
ATOM   1951  O  O   . THR A  1 268 ? -20.593  99.724  14.976  1.00 24.34 ? 260  THR A O   1 
ATOM   1952  C  CB  . THR A  1 268 ? -21.496  99.142  18.048  1.00 25.03 ? 260  THR A CB  1 
ATOM   1953  O  OG1 . THR A  1 268 ? -22.274  100.233 18.505  1.00 24.66 ? 260  THR A OG1 1 
ATOM   1954  C  CG2 . THR A  1 268 ? -20.038  99.555  18.073  1.00 22.97 ? 260  THR A CG2 1 
ATOM   1955  N  N   . GLY A  1 269 ? -22.609  100.649 15.384  1.00 25.70 ? 261  GLY A N   1 
ATOM   1956  C  CA  . GLY A  1 269 ? -22.456  101.724 14.408  1.00 27.55 ? 261  GLY A CA  1 
ATOM   1957  C  C   . GLY A  1 269 ? -23.727  102.535 14.210  1.00 29.32 ? 261  GLY A C   1 
ATOM   1958  O  O   . GLY A  1 269 ? -24.557  102.623 15.096  1.00 29.87 ? 261  GLY A O   1 
ATOM   1959  N  N   . ASP A  1 270 ? -23.877  103.147 13.050  1.00 31.47 ? 262  ASP A N   1 
ATOM   1960  C  CA  . ASP A  1 270 ? -25.003  104.013 12.793  1.00 33.18 ? 262  ASP A CA  1 
ATOM   1961  C  C   . ASP A  1 270 ? -26.129  103.254 12.095  1.00 33.65 ? 262  ASP A C   1 
ATOM   1962  O  O   . ASP A  1 270 ? -25.883  102.252 11.374  1.00 33.30 ? 262  ASP A O   1 
ATOM   1963  C  CB  . ASP A  1 270 ? -24.575  105.208 11.939  1.00 34.14 ? 262  ASP A CB  1 
ATOM   1964  C  CG  . ASP A  1 270 ? -25.691  106.255 11.827  1.00 38.58 ? 262  ASP A CG  1 
ATOM   1965  O  OD1 . ASP A  1 270 ? -26.019  106.864 12.884  1.00 43.77 ? 262  ASP A OD1 1 
ATOM   1966  O  OD2 . ASP A  1 270 ? -26.280  106.403 10.730  1.00 40.81 ? 262  ASP A OD2 1 
ATOM   1967  N  N   . GLU A  1 271 ? -27.353  103.731 12.290  1.00 34.91 ? 263  GLU A N   1 
ATOM   1968  C  CA  . GLU A  1 271 ? -28.573  103.126 11.675  1.00 36.04 ? 263  GLU A CA  1 
ATOM   1969  C  C   . GLU A  1 271 ? -28.597  103.212 10.155  1.00 36.17 ? 263  GLU A C   1 
ATOM   1970  O  O   . GLU A  1 271 ? -29.243  102.420 9.500   1.00 36.52 ? 263  GLU A O   1 
ATOM   1971  C  CB  . GLU A  1 271 ? -29.853  103.774 12.222  1.00 36.18 ? 263  GLU A CB  1 
ATOM   1972  C  CG  . GLU A  1 271 ? -30.131  105.197 11.655  1.00 39.84 ? 263  GLU A CG  1 
ATOM   1973  C  CD  . GLU A  1 271 ? -31.246  105.915 12.408  1.00 44.23 ? 263  GLU A CD  1 
ATOM   1974  O  OE1 . GLU A  1 271 ? -32.109  105.221 13.006  1.00 44.97 ? 263  GLU A OE1 1 
ATOM   1975  O  OE2 . GLU A  1 271 ? -31.226  107.166 12.427  1.00 47.09 ? 263  GLU A OE2 1 
ATOM   1976  N  N   . SER A  1 272 ? -27.904  104.181 9.588   1.00 36.60 ? 264  SER A N   1 
ATOM   1977  C  CA  . SER A  1 272 ? -27.849  104.251 8.158   1.00 37.28 ? 264  SER A CA  1 
ATOM   1978  C  C   . SER A  1 272 ? -26.973  103.140 7.592   1.00 37.27 ? 264  SER A C   1 
ATOM   1979  O  O   . SER A  1 272 ? -27.065  102.893 6.431   1.00 39.43 ? 264  SER A O   1 
ATOM   1980  C  CB  . SER A  1 272 ? -27.328  105.594 7.699   1.00 37.08 ? 264  SER A CB  1 
ATOM   1981  O  OG  . SER A  1 272 ? -26.000  105.740 8.117   1.00 40.05 ? 264  SER A OG  1 
ATOM   1982  N  N   . LYS A  1 273 ? -26.130  102.470 8.370   1.00 36.25 ? 265  LYS A N   1 
ATOM   1983  C  CA  . LYS A  1 273 ? -25.291  101.388 7.828   1.00 35.83 ? 265  LYS A CA  1 
ATOM   1984  C  C   . LYS A  1 273 ? -25.721  100.005 8.281   1.00 33.86 ? 265  LYS A C   1 
ATOM   1985  O  O   . LYS A  1 273 ? -25.571  99.031  7.552   1.00 32.65 ? 265  LYS A O   1 
ATOM   1986  C  CB  . LYS A  1 273 ? -23.819  101.561 8.220   1.00 36.63 ? 265  LYS A CB  1 
ATOM   1987  C  CG  . LYS A  1 273 ? -23.126  102.780 7.648   1.00 41.98 ? 265  LYS A CG  1 
ATOM   1988  C  CD  . LYS A  1 273 ? -22.585  102.496 6.209   1.00 50.26 ? 265  LYS A CD  1 
ATOM   1989  C  CE  . LYS A  1 273 ? -22.465  103.822 5.376   1.00 54.68 ? 265  LYS A CE  1 
ATOM   1990  N  NZ  . LYS A  1 273 ? -22.302  105.045 6.270   1.00 57.15 ? 265  LYS A NZ  1 
ATOM   1991  N  N   . ILE A  1 274 ? -26.213  99.913  9.508   1.00 31.99 ? 266  ILE A N   1 
ATOM   1992  C  CA  . ILE A  1 274 ? -26.569  98.642  10.065  1.00 30.59 ? 266  ILE A CA  1 
ATOM   1993  C  C   . ILE A  1 274 ? -28.074  98.525  10.051  1.00 30.51 ? 266  ILE A C   1 
ATOM   1994  O  O   . ILE A  1 274 ? -28.764  99.316  10.679  1.00 31.18 ? 266  ILE A O   1 
ATOM   1995  C  CB  . ILE A  1 274 ? -25.992  98.444  11.485  1.00 30.14 ? 266  ILE A CB  1 
ATOM   1996  C  CG1 . ILE A  1 274 ? -24.454  98.651  11.501  1.00 28.88 ? 266  ILE A CG1 1 
ATOM   1997  C  CG2 . ILE A  1 274 ? -26.331  97.068  11.969  1.00 25.84 ? 266  ILE A CG2 1 
ATOM   1998  C  CD1 . ILE A  1 274 ? -23.803  98.688  12.956  1.00 25.77 ? 266  ILE A CD1 1 
ATOM   1999  N  N   . LEU A  1 275 ? -28.577  97.559  9.295   1.00 30.81 ? 267  LEU A N   1 
ATOM   2000  C  CA  . LEU A  1 275 ? -30.024  97.352  9.146   1.00 31.36 ? 267  LEU A CA  1 
ATOM   2001  C  C   . LEU A  1 275 ? -30.449  96.027  9.772   1.00 30.59 ? 267  LEU A C   1 
ATOM   2002  O  O   . LEU A  1 275 ? -30.308  94.963  9.145   1.00 30.05 ? 267  LEU A O   1 
ATOM   2003  C  CB  . LEU A  1 275 ? -30.453  97.372  7.681   1.00 31.83 ? 267  LEU A CB  1 
ATOM   2004  C  CG  . LEU A  1 275 ? -30.206  98.631  6.805   1.00 35.35 ? 267  LEU A CG  1 
ATOM   2005  C  CD1 . LEU A  1 275 ? -31.019  98.454  5.484   1.00 35.00 ? 267  LEU A CD1 1 
ATOM   2006  C  CD2 . LEU A  1 275 ? -30.529  99.952  7.476   1.00 34.31 ? 267  LEU A CD2 1 
ATOM   2007  N  N   . PRO A  1 276 ? -30.973  96.083  11.004  1.00 29.82 ? 268  PRO A N   1 
ATOM   2008  C  CA  . PRO A  1 276 ? -31.424  94.862  11.613  1.00 30.00 ? 268  PRO A CA  1 
ATOM   2009  C  C   . PRO A  1 276 ? -32.749  94.401  10.985  1.00 30.76 ? 268  PRO A C   1 
ATOM   2010  O  O   . PRO A  1 276 ? -33.643  95.180  10.821  1.00 30.15 ? 268  PRO A O   1 
ATOM   2011  C  CB  . PRO A  1 276 ? -31.615  95.250  13.090  1.00 29.51 ? 268  PRO A CB  1 
ATOM   2012  C  CG  . PRO A  1 276 ? -30.980  96.565  13.255  1.00 30.57 ? 268  PRO A CG  1 
ATOM   2013  C  CD  . PRO A  1 276 ? -31.044  97.218  11.928  1.00 30.32 ? 268  PRO A CD  1 
ATOM   2014  N  N   . GLU A  1 277 ? -32.839  93.129  10.677  1.00 31.12 ? 269  GLU A N   1 
ATOM   2015  C  CA  . GLU A  1 277 ? -33.982  92.536  10.082  1.00 32.86 ? 269  GLU A CA  1 
ATOM   2016  C  C   . GLU A  1 277 ? -34.547  91.541  11.091  1.00 32.43 ? 269  GLU A C   1 
ATOM   2017  O  O   . GLU A  1 277 ? -33.950  90.520  11.352  1.00 30.76 ? 269  GLU A O   1 
ATOM   2018  C  CB  . GLU A  1 277 ? -33.555  91.706  8.844   1.00 34.23 ? 269  GLU A CB  1 
ATOM   2019  C  CG  . GLU A  1 277 ? -32.661  92.384  7.797   1.00 40.54 ? 269  GLU A CG  1 
ATOM   2020  C  CD  . GLU A  1 277 ? -33.394  93.416  6.941   1.00 46.58 ? 269  GLU A CD  1 
ATOM   2021  O  OE1 . GLU A  1 277 ? -34.590  93.681  7.211   1.00 51.70 ? 269  GLU A OE1 1 
ATOM   2022  O  OE2 . GLU A  1 277 ? -32.770  93.961  6.008   1.00 49.28 ? 269  GLU A OE2 1 
ATOM   2023  N  N   . GLU A  1 278 ? -35.723  91.796  11.606  1.00 33.12 ? 270  GLU A N   1 
ATOM   2024  C  CA  . GLU A  1 278 ? -36.288  90.915  12.597  1.00 33.85 ? 270  GLU A CA  1 
ATOM   2025  C  C   . GLU A  1 278 ? -36.827  89.649  11.914  1.00 33.43 ? 270  GLU A C   1 
ATOM   2026  O  O   . GLU A  1 278 ? -37.668  89.753  11.037  1.00 33.00 ? 270  GLU A O   1 
ATOM   2027  C  CB  . GLU A  1 278 ? -37.375  91.653  13.336  1.00 35.04 ? 270  GLU A CB  1 
ATOM   2028  C  CG  . GLU A  1 278 ? -38.099  90.804  14.381  1.00 40.48 ? 270  GLU A CG  1 
ATOM   2029  C  CD  . GLU A  1 278 ? -38.807  91.643  15.482  1.00 45.61 ? 270  GLU A CD  1 
ATOM   2030  O  OE1 . GLU A  1 278 ? -38.659  92.903  15.513  1.00 46.08 ? 270  GLU A OE1 1 
ATOM   2031  O  OE2 . GLU A  1 278 ? -39.504  90.988  16.314  1.00 50.76 ? 270  GLU A OE2 1 
ATOM   2032  N  N   . VAL A  1 279 ? -36.296  88.483  12.288  1.00 32.61 ? 271  VAL A N   1 
ATOM   2033  C  CA  . VAL A  1 279 ? -36.638  87.223  11.667  1.00 32.57 ? 271  VAL A CA  1 
ATOM   2034  C  C   . VAL A  1 279 ? -37.101  86.233  12.737  1.00 34.22 ? 271  VAL A C   1 
ATOM   2035  O  O   . VAL A  1 279 ? -37.114  86.542  13.909  1.00 34.66 ? 271  VAL A O   1 
ATOM   2036  C  CB  . VAL A  1 279 ? -35.510  86.653  10.862  1.00 32.31 ? 271  VAL A CB  1 
ATOM   2037  C  CG1 . VAL A  1 279 ? -35.216  87.533  9.625   1.00 29.93 ? 271  VAL A CG1 1 
ATOM   2038  C  CG2 . VAL A  1 279 ? -34.276  86.454  11.749  1.00 30.57 ? 271  VAL A CG2 1 
ATOM   2039  N  N   . GLU A  1 280 ? -37.522  85.048  12.308  1.00 36.08 ? 272  GLU A N   1 
ATOM   2040  C  CA  . GLU A  1 280 ? -38.097  84.063  13.224  1.00 38.50 ? 272  GLU A CA  1 
ATOM   2041  C  C   . GLU A  1 280 ? -37.043  83.395  14.102  1.00 37.27 ? 272  GLU A C   1 
ATOM   2042  O  O   . GLU A  1 280 ? -37.274  83.132  15.282  1.00 37.80 ? 272  GLU A O   1 
ATOM   2043  C  CB  . GLU A  1 280 ? -38.879  83.002  12.447  1.00 40.70 ? 272  GLU A CB  1 
ATOM   2044  C  CG  . GLU A  1 280 ? -38.245  82.609  11.123  1.00 47.77 ? 272  GLU A CG  1 
ATOM   2045  C  CD  . GLU A  1 280 ? -38.914  83.275  9.939   1.00 56.48 ? 272  GLU A CD  1 
ATOM   2046  O  OE1 . GLU A  1 280 ? -39.935  82.744  9.455   1.00 58.58 ? 272  GLU A OE1 1 
ATOM   2047  O  OE2 . GLU A  1 280 ? -38.418  84.330  9.491   1.00 56.36 ? 272  GLU A OE2 1 
ATOM   2048  N  N   . ARG A  1 281 ? -35.886  83.123  13.511  1.00 35.51 ? 273  ARG A N   1 
ATOM   2049  C  CA  . ARG A  1 281 ? -34.798  82.445  14.197  1.00 34.22 ? 273  ARG A CA  1 
ATOM   2050  C  C   . ARG A  1 281 ? -33.412  83.007  13.840  1.00 31.69 ? 273  ARG A C   1 
ATOM   2051  O  O   . ARG A  1 281 ? -33.079  83.110  12.691  1.00 30.32 ? 273  ARG A O   1 
ATOM   2052  C  CB  . ARG A  1 281 ? -34.785  80.958  13.825  1.00 35.37 ? 273  ARG A CB  1 
ATOM   2053  C  CG  . ARG A  1 281 ? -33.591  80.207  14.392  1.00 38.95 ? 273  ARG A CG  1 
ATOM   2054  C  CD  . ARG A  1 281 ? -33.888  78.763  14.780  1.00 43.08 ? 273  ARG A CD  1 
ATOM   2055  N  NE  . ARG A  1 281 ? -32.798  78.182  15.587  1.00 44.02 ? 273  ARG A NE  1 
ATOM   2056  C  CZ  . ARG A  1 281 ? -32.821  77.949  16.910  1.00 43.80 ? 273  ARG A CZ  1 
ATOM   2057  N  NH1 . ARG A  1 281 ? -33.893  78.238  17.656  1.00 42.64 ? 273  ARG A NH1 1 
ATOM   2058  N  NH2 . ARG A  1 281 ? -31.750  77.403  17.498  1.00 41.37 ? 273  ARG A NH2 1 
ATOM   2059  N  N   . ALA A  1 282 ? -32.595  83.275  14.850  1.00 29.21 ? 274  ALA A N   1 
ATOM   2060  C  CA  . ALA A  1 282 ? -31.260  83.802  14.667  1.00 28.02 ? 274  ALA A CA  1 
ATOM   2061  C  C   . ALA A  1 282 ? -30.531  83.481  15.963  1.00 26.96 ? 274  ALA A C   1 
ATOM   2062  O  O   . ALA A  1 282 ? -30.601  84.220  16.932  1.00 25.59 ? 274  ALA A O   1 
ATOM   2063  C  CB  . ALA A  1 282 ? -31.309  85.318  14.397  1.00 26.93 ? 274  ALA A CB  1 
ATOM   2064  N  N   . ASN A  1 283 ? -29.893  82.323  15.981  1.00 26.72 ? 275  ASN A N   1 
ATOM   2065  C  CA  . ASN A  1 283 ? -29.289  81.781  17.176  1.00 26.62 ? 275  ASN A CA  1 
ATOM   2066  C  C   . ASN A  1 283 ? -27.950  81.119  16.876  1.00 27.06 ? 275  ASN A C   1 
ATOM   2067  O  O   . ASN A  1 283 ? -27.846  80.315  15.952  1.00 25.86 ? 275  ASN A O   1 
ATOM   2068  C  CB  . ASN A  1 283 ? -30.237  80.795  17.828  1.00 26.46 ? 275  ASN A CB  1 
ATOM   2069  C  CG  . ASN A  1 283 ? -29.852  80.473  19.269  1.00 26.04 ? 275  ASN A CG  1 
ATOM   2070  O  OD1 . ASN A  1 283 ? -28.966  79.657  19.501  1.00 27.55 ? 275  ASN A OD1 1 
ATOM   2071  N  ND2 . ASN A  1 283 ? -30.533  81.099  20.236  1.00 22.45 ? 275  ASN A ND2 1 
ATOM   2072  N  N   . ILE A  1 284 ? -26.914  81.476  17.646  1.00 27.71 ? 276  ILE A N   1 
ATOM   2073  C  CA  . ILE A  1 284 ? -25.574  80.952  17.356  1.00 27.48 ? 276  ILE A CA  1 
ATOM   2074  C  C   . ILE A  1 284 ? -25.513  79.439  17.588  1.00 28.57 ? 276  ILE A C   1 
ATOM   2075  O  O   . ILE A  1 284 ? -24.632  78.788  17.041  1.00 27.91 ? 276  ILE A O   1 
ATOM   2076  C  CB  . ILE A  1 284 ? -24.435  81.650  18.123  1.00 26.99 ? 276  ILE A CB  1 
ATOM   2077  C  CG1 . ILE A  1 284 ? -24.509  81.295  19.605  1.00 26.68 ? 276  ILE A CG1 1 
ATOM   2078  C  CG2 . ILE A  1 284 ? -24.439  83.119  17.877  1.00 24.08 ? 276  ILE A CG2 1 
ATOM   2079  C  CD1 . ILE A  1 284 ? -23.265  81.700  20.394  1.00 26.79 ? 276  ILE A CD1 1 
ATOM   2080  N  N   . SER A  1 285 ? -26.441  78.852  18.347  1.00 30.00 ? 277  SER A N   1 
ATOM   2081  C  CA  . SER A  1 285 ? -26.380  77.400  18.481  1.00 32.47 ? 277  SER A CA  1 
ATOM   2082  C  C   . SER A  1 285 ? -26.549  76.659  17.154  1.00 35.01 ? 277  SER A C   1 
ATOM   2083  O  O   . SER A  1 285 ? -26.105  75.528  17.012  1.00 36.20 ? 277  SER A O   1 
ATOM   2084  C  CB  . SER A  1 285 ? -27.371  76.863  19.487  1.00 32.22 ? 277  SER A CB  1 
ATOM   2085  O  OG  . SER A  1 285 ? -28.668  76.878  18.977  1.00 33.44 ? 277  SER A OG  1 
ATOM   2086  N  N   . ASP A  1 286 ? -27.162  77.282  16.165  1.00 37.62 ? 278  ASP A N   1 
ATOM   2087  C  CA  . ASP A  1 286 ? -27.320  76.615  14.874  1.00 40.24 ? 278  ASP A CA  1 
ATOM   2088  C  C   . ASP A  1 286 ? -25.993  76.421  14.158  1.00 43.00 ? 278  ASP A C   1 
ATOM   2089  O  O   . ASP A  1 286 ? -25.935  75.610  13.254  1.00 43.75 ? 278  ASP A O   1 
ATOM   2090  C  CB  . ASP A  1 286 ? -28.300  77.353  13.950  1.00 39.68 ? 278  ASP A CB  1 
ATOM   2091  C  CG  . ASP A  1 286 ? -29.716  77.355  14.494  1.00 39.24 ? 278  ASP A CG  1 
ATOM   2092  O  OD1 . ASP A  1 286 ? -30.081  76.432  15.260  1.00 38.48 ? 278  ASP A OD1 1 
ATOM   2093  O  OD2 . ASP A  1 286 ? -30.464  78.316  14.207  1.00 39.04 ? 278  ASP A OD2 1 
ATOM   2094  N  N   . TYR A  1 287 ? -24.930  77.126  14.552  1.00 45.20 ? 279  TYR A N   1 
ATOM   2095  C  CA  . TYR A  1 287 ? -23.669  77.001  13.846  1.00 47.19 ? 279  TYR A CA  1 
ATOM   2096  C  C   . TYR A  1 287 ? -22.540  76.457  14.693  1.00 49.37 ? 279  TYR A C   1 
ATOM   2097  O  O   . TYR A  1 287 ? -21.409  76.545  14.313  1.00 50.03 ? 279  TYR A O   1 
ATOM   2098  C  CB  . TYR A  1 287 ? -23.267  78.335  13.264  1.00 46.82 ? 279  TYR A CB  1 
ATOM   2099  C  CG  . TYR A  1 287 ? -24.418  79.183  12.815  1.00 47.45 ? 279  TYR A CG  1 
ATOM   2100  C  CD1 . TYR A  1 287 ? -25.089  78.937  11.607  1.00 49.17 ? 279  TYR A CD1 1 
ATOM   2101  C  CD2 . TYR A  1 287 ? -24.819  80.270  13.578  1.00 46.68 ? 279  TYR A CD2 1 
ATOM   2102  C  CE1 . TYR A  1 287 ? -26.166  79.762  11.203  1.00 49.61 ? 279  TYR A CE1 1 
ATOM   2103  C  CE2 . TYR A  1 287 ? -25.864  81.094  13.192  1.00 47.33 ? 279  TYR A CE2 1 
ATOM   2104  C  CZ  . TYR A  1 287 ? -26.546  80.840  12.022  1.00 48.95 ? 279  TYR A CZ  1 
ATOM   2105  O  OH  . TYR A  1 287 ? -27.589  81.681  11.715  1.00 49.43 ? 279  TYR A OH  1 
ATOM   2106  N  N   . LEU A  1 288 ? -22.831  75.890  15.839  1.00 52.42 ? 280  LEU A N   1 
ATOM   2107  C  CA  . LEU A  1 288 ? -21.796  75.190  16.591  1.00 54.80 ? 280  LEU A CA  1 
ATOM   2108  C  C   . LEU A  1 288 ? -22.105  73.693  16.584  1.00 56.04 ? 280  LEU A C   1 
ATOM   2109  O  O   . LEU A  1 288 ? -21.181  72.879  16.476  1.00 58.13 ? 280  LEU A O   1 
ATOM   2110  C  CB  . LEU A  1 288 ? -21.703  75.721  18.038  1.00 55.17 ? 280  LEU A CB  1 
ATOM   2111  C  CG  . LEU A  1 288 ? -21.433  77.265  18.176  1.00 56.63 ? 280  LEU A CG  1 
ATOM   2112  C  CD1 . LEU A  1 288 ? -21.420  77.627  19.690  1.00 56.73 ? 280  LEU A CD1 1 
ATOM   2113  C  CD2 . LEU A  1 288 ? -20.159  77.810  17.397  1.00 57.67 ? 280  LEU A CD2 1 
ATOM   2114  N  N   . GLY B  1 7   ? 37.340   79.104  9.273   1.00 51.04 ? -1   GLY B N   1 
ATOM   2115  C  CA  . GLY B  1 7   ? 36.993   78.705  10.675  1.00 50.91 ? -1   GLY B CA  1 
ATOM   2116  C  C   . GLY B  1 7   ? 36.253   79.781  11.477  1.00 50.57 ? -1   GLY B C   1 
ATOM   2117  O  O   . GLY B  1 7   ? 35.482   80.607  10.938  1.00 51.31 ? -1   GLY B O   1 
ATOM   2118  N  N   . HIS B  1 8   ? 36.474   79.792  12.785  1.00 49.18 ? 0    HIS B N   1 
ATOM   2119  C  CA  . HIS B  1 8   ? 35.743   80.731  13.628  1.00 48.47 ? 0    HIS B CA  1 
ATOM   2120  C  C   . HIS B  1 8   ? 36.623   81.524  14.547  1.00 45.81 ? 0    HIS B C   1 
ATOM   2121  O  O   . HIS B  1 8   ? 37.773   81.168  14.789  1.00 44.70 ? 0    HIS B O   1 
ATOM   2122  C  CB  . HIS B  1 8   ? 34.603   79.995  14.352  1.00 49.46 ? 0    HIS B CB  1 
ATOM   2123  C  CG  . HIS B  1 8   ? 33.525   79.542  13.400  1.00 55.33 ? 0    HIS B CG  1 
ATOM   2124  N  ND1 . HIS B  1 8   ? 33.194   78.204  13.211  1.00 59.58 ? 0    HIS B ND1 1 
ATOM   2125  C  CD2 . HIS B  1 8   ? 32.775   80.251  12.504  1.00 57.48 ? 0    HIS B CD2 1 
ATOM   2126  C  CE1 . HIS B  1 8   ? 32.258   78.116  12.272  1.00 60.51 ? 0    HIS B CE1 1 
ATOM   2127  N  NE2 . HIS B  1 8   ? 31.991   79.341  11.826  1.00 60.50 ? 0    HIS B NE2 1 
ATOM   2128  N  N   . MET B  1 9   ? 36.089   82.635  15.031  1.00 48.90 ? 1    MET B N   1 
ATOM   2129  C  CA  . MET B  1 9   ? 36.831   83.455  15.947  1.00 47.01 ? 1    MET B CA  1 
ATOM   2130  C  C   . MET B  1 9   ? 37.157   82.627  17.173  1.00 44.19 ? 1    MET B C   1 
ATOM   2131  O  O   . MET B  1 9   ? 36.369   81.802  17.584  1.00 42.10 ? 1    MET B O   1 
ATOM   2132  C  CB  . MET B  1 9   ? 36.056   84.714  16.299  1.00 47.01 ? 1    MET B CB  1 
ATOM   2133  C  CG  . MET B  1 9   ? 35.973   85.662  15.145  1.00 48.32 ? 1    MET B CG  1 
ATOM   2134  S  SD  . MET B  1 9   ? 35.288   87.269  15.531  1.00 45.75 ? 1    MET B SD  1 
ATOM   2135  C  CE  . MET B  1 9   ? 33.634   86.727  15.798  1.00 47.04 ? 1    MET B CE  1 
ATOM   2136  N  N   . ARG B  1 10  ? 38.352   82.844  17.707  1.00 41.66 ? 2    ARG B N   1 
ATOM   2137  C  CA  . ARG B  1 10  ? 38.789   82.249  18.938  1.00 39.91 ? 2    ARG B CA  1 
ATOM   2138  C  C   . ARG B  1 10  ? 37.974   82.748  20.146  1.00 36.78 ? 2    ARG B C   1 
ATOM   2139  O  O   . ARG B  1 10  ? 37.903   83.940  20.405  1.00 34.35 ? 2    ARG B O   1 
ATOM   2140  C  CB  . ARG B  1 10  ? 40.220   82.631  19.216  1.00 40.65 ? 2    ARG B CB  1 
ATOM   2141  C  CG  . ARG B  1 10  ? 41.272   81.685  18.756  1.00 44.37 ? 2    ARG B CG  1 
ATOM   2142  C  CD  . ARG B  1 10  ? 42.472   81.643  19.740  1.00 45.46 ? 2    ARG B CD  1 
ATOM   2143  N  NE  . ARG B  1 10  ? 42.944   82.981  20.118  1.00 46.91 ? 2    ARG B NE  1 
ATOM   2144  C  CZ  . ARG B  1 10  ? 43.411   83.318  21.325  1.00 46.83 ? 2    ARG B CZ  1 
ATOM   2145  N  NH1 . ARG B  1 10  ? 43.491   82.424  22.290  1.00 47.58 ? 2    ARG B NH1 1 
ATOM   2146  N  NH2 . ARG B  1 10  ? 43.792   84.563  21.576  1.00 45.15 ? 2    ARG B NH2 1 
ATOM   2147  N  N   . THR B  1 11  ? 37.419   81.799  20.888  1.00 33.87 ? 3    THR B N   1 
ATOM   2148  C  CA  . THR B  1 11  ? 36.624   82.086  22.061  1.00 32.66 ? 3    THR B CA  1 
ATOM   2149  C  C   . THR B  1 11  ? 36.980   81.260  23.271  1.00 31.83 ? 3    THR B C   1 
ATOM   2150  O  O   . THR B  1 11  ? 37.692   80.266  23.190  1.00 30.51 ? 3    THR B O   1 
ATOM   2151  C  CB  . THR B  1 11  ? 35.124   81.922  21.800  1.00 31.59 ? 3    THR B CB  1 
ATOM   2152  O  OG1 . THR B  1 11  ? 34.780   80.551  21.836  1.00 29.52 ? 3    THR B OG1 1 
ATOM   2153  C  CG2 . THR B  1 11  ? 34.755   82.479  20.470  1.00 31.06 ? 3    THR B CG2 1 
ATOM   2154  N  N   . ASN B  1 12  ? 36.478   81.713  24.413  1.00 31.05 ? 4    ASN B N   1 
ATOM   2155  C  CA  . ASN B  1 12  ? 36.552   80.941  25.649  1.00 30.94 ? 4    ASN B CA  1 
ATOM   2156  C  C   . ASN B  1 12  ? 35.374   79.978  25.823  1.00 31.78 ? 4    ASN B C   1 
ATOM   2157  O  O   . ASN B  1 12  ? 34.983   79.697  26.945  1.00 31.82 ? 4    ASN B O   1 
ATOM   2158  C  CB  . ASN B  1 12  ? 36.582   81.879  26.848  1.00 30.19 ? 4    ASN B CB  1 
ATOM   2159  C  CG  . ASN B  1 12  ? 35.261   82.597  27.066  1.00 27.63 ? 4    ASN B CG  1 
ATOM   2160  O  OD1 . ASN B  1 12  ? 34.442   82.695  26.159  1.00 24.09 ? 4    ASN B OD1 1 
ATOM   2161  N  ND2 . ASN B  1 12  ? 35.074   83.131  28.258  1.00 23.42 ? 4    ASN B ND2 1 
ATOM   2162  N  N   . LYS B  1 13  ? 34.799   79.478  24.748  1.00 32.66 ? 5    LYS B N   1 
ATOM   2163  C  CA  . LYS B  1 13  ? 33.573   78.758  24.881  1.00 35.08 ? 5    LYS B CA  1 
ATOM   2164  C  C   . LYS B  1 13  ? 33.644   77.484  25.689  1.00 35.75 ? 5    LYS B C   1 
ATOM   2165  O  O   . LYS B  1 13  ? 32.611   77.111  26.248  1.00 35.33 ? 5    LYS B O   1 
ATOM   2166  C  CB  . LYS B  1 13  ? 32.874   78.527  23.548  1.00 36.51 ? 5    LYS B CB  1 
ATOM   2167  C  CG  . LYS B  1 13  ? 33.180   77.296  22.771  1.00 41.24 ? 5    LYS B CG  1 
ATOM   2168  C  CD  . LYS B  1 13  ? 32.352   77.298  21.495  1.00 46.97 ? 5    LYS B CD  1 
ATOM   2169  C  CE  . LYS B  1 13  ? 32.854   76.287  20.480  1.00 50.95 ? 5    LYS B CE  1 
ATOM   2170  N  NZ  . LYS B  1 13  ? 31.987   75.078  20.506  1.00 53.60 ? 5    LYS B NZ  1 
ATOM   2171  N  N   . ASP B  1 14  ? 34.816   76.854  25.804  1.00 36.40 ? 6    ASP B N   1 
ATOM   2172  C  CA  . ASP B  1 14  ? 34.953   75.651  26.650  1.00 38.24 ? 6    ASP B CA  1 
ATOM   2173  C  C   . ASP B  1 14  ? 34.927   75.962  28.158  1.00 37.15 ? 6    ASP B C   1 
ATOM   2174  O  O   . ASP B  1 14  ? 34.757   75.064  28.960  1.00 37.43 ? 6    ASP B O   1 
ATOM   2175  C  CB  . ASP B  1 14  ? 36.245   74.852  26.339  1.00 39.87 ? 6    ASP B CB  1 
ATOM   2176  C  CG  . ASP B  1 14  ? 36.235   74.176  24.937  1.00 44.96 ? 6    ASP B CG  1 
ATOM   2177  O  OD1 . ASP B  1 14  ? 35.147   74.002  24.275  1.00 47.65 ? 6    ASP B OD1 1 
ATOM   2178  O  OD2 . ASP B  1 14  ? 37.375   73.856  24.489  1.00 51.12 ? 6    ASP B OD2 1 
ATOM   2179  N  N   . ARG B  1 15  ? 35.105   77.218  28.530  1.00 35.75 ? 7    ARG B N   1 
ATOM   2180  C  CA  . ARG B  1 15  ? 35.016   77.641  29.921  1.00 35.16 ? 7    ARG B CA  1 
ATOM   2181  C  C   . ARG B  1 15  ? 33.631   78.133  30.352  1.00 31.75 ? 7    ARG B C   1 
ATOM   2182  O  O   . ARG B  1 15  ? 33.404   78.468  31.509  1.00 30.41 ? 7    ARG B O   1 
ATOM   2183  C  CB  . ARG B  1 15  ? 36.001   78.775  30.165  1.00 36.43 ? 7    ARG B CB  1 
ATOM   2184  C  CG  . ARG B  1 15  ? 37.444   78.406  29.912  1.00 43.32 ? 7    ARG B CG  1 
ATOM   2185  C  CD  . ARG B  1 15  ? 38.399   79.596  30.211  1.00 51.98 ? 7    ARG B CD  1 
ATOM   2186  N  NE  . ARG B  1 15  ? 39.775   79.154  30.012  1.00 60.74 ? 7    ARG B NE  1 
ATOM   2187  C  CZ  . ARG B  1 15  ? 40.392   78.206  30.734  1.00 67.11 ? 7    ARG B CZ  1 
ATOM   2188  N  NH1 . ARG B  1 15  ? 41.630   77.864  30.441  1.00 69.31 ? 7    ARG B NH1 1 
ATOM   2189  N  NH2 . ARG B  1 15  ? 39.800   77.584  31.749  1.00 69.71 ? 7    ARG B NH2 1 
ATOM   2190  N  N   . LEU B  1 16  ? 32.711   78.214  29.424  1.00 29.06 ? 8    LEU B N   1 
ATOM   2191  C  CA  . LEU B  1 16  ? 31.379   78.696  29.773  1.00 27.53 ? 8    LEU B CA  1 
ATOM   2192  C  C   . LEU B  1 16  ? 30.632   77.650  30.587  1.00 25.63 ? 8    LEU B C   1 
ATOM   2193  O  O   . LEU B  1 16  ? 30.808   76.469  30.413  1.00 24.56 ? 8    LEU B O   1 
ATOM   2194  C  CB  . LEU B  1 16  ? 30.612   79.106  28.522  1.00 26.27 ? 8    LEU B CB  1 
ATOM   2195  C  CG  . LEU B  1 16  ? 31.319   80.197  27.692  1.00 27.13 ? 8    LEU B CG  1 
ATOM   2196  C  CD1 . LEU B  1 16  ? 30.451   80.598  26.538  1.00 24.38 ? 8    LEU B CD1 1 
ATOM   2197  C  CD2 . LEU B  1 16  ? 31.756   81.457  28.503  1.00 24.89 ? 8    LEU B CD2 1 
ATOM   2198  N  N   . VAL B  1 17  ? 29.819   78.107  31.506  1.00 24.29 ? 9    VAL B N   1 
ATOM   2199  C  CA  . VAL B  1 17  ? 29.049   77.215  32.324  1.00 24.07 ? 9    VAL B CA  1 
ATOM   2200  C  C   . VAL B  1 17  ? 27.682   77.084  31.687  1.00 24.06 ? 9    VAL B C   1 
ATOM   2201  O  O   . VAL B  1 17  ? 27.094   78.069  31.331  1.00 23.84 ? 9    VAL B O   1 
ATOM   2202  C  CB  . VAL B  1 17  ? 28.963   77.734  33.782  1.00 23.99 ? 9    VAL B CB  1 
ATOM   2203  C  CG1 . VAL B  1 17  ? 28.033   76.892  34.594  1.00 21.26 ? 9    VAL B CG1 1 
ATOM   2204  C  CG2 . VAL B  1 17  ? 30.365   77.780  34.430  1.00 23.41 ? 9    VAL B CG2 1 
ATOM   2205  N  N   . ARG B  1 18  ? 27.219   75.845  31.556  1.00 24.56 ? 10   ARG B N   1 
ATOM   2206  C  CA  A ARG B  1 18  ? 25.932   75.510  30.976  0.50 24.42 ? 10   ARG B CA  1 
ATOM   2207  C  CA  B ARG B  1 18  ? 25.936   75.492  30.976  0.50 24.37 ? 10   ARG B CA  1 
ATOM   2208  C  C   . ARG B  1 18  ? 25.049   75.020  32.110  1.00 24.03 ? 10   ARG B C   1 
ATOM   2209  O  O   . ARG B  1 18  ? 25.444   74.167  32.878  1.00 23.66 ? 10   ARG B O   1 
ATOM   2210  C  CB  A ARG B  1 18  ? 26.093   74.450  29.862  0.50 24.91 ? 10   ARG B CB  1 
ATOM   2211  C  CB  B ARG B  1 18  ? 26.114   74.387  29.913  0.50 24.82 ? 10   ARG B CB  1 
ATOM   2212  C  CG  A ARG B  1 18  ? 24.786   74.128  29.089  0.50 28.55 ? 10   ARG B CG  1 
ATOM   2213  C  CG  B ARG B  1 18  ? 24.792   73.860  29.319  0.50 28.25 ? 10   ARG B CG  1 
ATOM   2214  C  CD  A ARG B  1 18  ? 24.999   73.337  27.739  0.50 31.23 ? 10   ARG B CD  1 
ATOM   2215  C  CD  B ARG B  1 18  ? 24.955   72.898  28.083  0.50 30.97 ? 10   ARG B CD  1 
ATOM   2216  N  NE  A ARG B  1 18  ? 25.794   72.121  27.942  0.50 32.11 ? 10   ARG B NE  1 
ATOM   2217  N  NE  B ARG B  1 18  ? 26.005   73.317  27.134  0.50 32.64 ? 10   ARG B NE  1 
ATOM   2218  C  CZ  A ARG B  1 18  ? 25.286   70.896  27.994  0.50 31.32 ? 10   ARG B CZ  1 
ATOM   2219  C  CZ  B ARG B  1 18  ? 27.231   72.817  27.109  0.50 32.10 ? 10   ARG B CZ  1 
ATOM   2220  N  NH1 A ARG B  1 18  ? 26.086   69.851  28.221  0.50 30.61 ? 10   ARG B NH1 1 
ATOM   2221  N  NH1 B ARG B  1 18  ? 27.604   71.873  27.964  0.50 31.77 ? 10   ARG B NH1 1 
ATOM   2222  N  NH2 A ARG B  1 18  ? 23.986   70.735  27.830  0.50 29.68 ? 10   ARG B NH2 1 
ATOM   2223  N  NH2 B ARG B  1 18  ? 28.081   73.251  26.208  0.50 34.98 ? 10   ARG B NH2 1 
ATOM   2224  N  N   . ILE B  1 19  ? 23.840   75.583  32.219  1.00 23.62 ? 11   ILE B N   1 
ATOM   2225  C  CA  . ILE B  1 19  ? 23.044   75.482  33.441  1.00 22.65 ? 11   ILE B CA  1 
ATOM   2226  C  C   . ILE B  1 19  ? 21.543   75.480  33.177  1.00 22.34 ? 11   ILE B C   1 
ATOM   2227  O  O   . ILE B  1 19  ? 21.073   76.151  32.277  1.00 20.66 ? 11   ILE B O   1 
ATOM   2228  C  CB  . ILE B  1 19  ? 23.416   76.630  34.410  1.00 22.34 ? 11   ILE B CB  1 
ATOM   2229  C  CG1 . ILE B  1 19  ? 22.960   76.327  35.836  1.00 24.02 ? 11   ILE B CG1 1 
ATOM   2230  C  CG2 . ILE B  1 19  ? 22.811   77.953  33.995  1.00 22.34 ? 11   ILE B CG2 1 
ATOM   2231  C  CD1 . ILE B  1 19  ? 23.731   77.156  36.897  1.00 22.70 ? 11   ILE B CD1 1 
ATOM   2232  N  N   . SER B  1 20  ? 20.804   74.714  33.970  1.00 21.82 ? 12   SER B N   1 
ATOM   2233  C  CA  . SER B  1 20  ? 19.352   74.633  33.856  1.00 21.97 ? 12   SER B CA  1 
ATOM   2234  C  C   . SER B  1 20  ? 18.647   75.903  34.317  1.00 22.21 ? 12   SER B C   1 
ATOM   2235  O  O   . SER B  1 20  ? 18.753   76.257  35.451  1.00 22.15 ? 12   SER B O   1 
ATOM   2236  C  CB  . SER B  1 20  ? 18.846   73.506  34.736  1.00 22.35 ? 12   SER B CB  1 
ATOM   2237  O  OG  . SER B  1 20  ? 19.101   73.811  36.095  1.00 19.66 ? 12   SER B OG  1 
ATOM   2238  N  N   . VAL B  1 21  ? 17.929   76.567  33.431  1.00 22.38 ? 13   VAL B N   1 
ATOM   2239  C  CA  . VAL B  1 21  ? 17.130   77.742  33.768  1.00 22.67 ? 13   VAL B CA  1 
ATOM   2240  C  C   . VAL B  1 21  ? 15.691   77.360  33.540  1.00 22.84 ? 13   VAL B C   1 
ATOM   2241  O  O   . VAL B  1 21  ? 15.369   76.882  32.494  1.00 23.14 ? 13   VAL B O   1 
ATOM   2242  C  CB  . VAL B  1 21  ? 17.483   78.964  32.874  1.00 22.90 ? 13   VAL B CB  1 
ATOM   2243  C  CG1 . VAL B  1 21  ? 16.412   80.049  33.007  1.00 20.00 ? 13   VAL B CG1 1 
ATOM   2244  C  CG2 . VAL B  1 21  ? 18.840   79.466  33.258  1.00 21.42 ? 13   VAL B CG2 1 
ATOM   2245  N  N   . VAL B  1 22  ? 14.841   77.534  34.545  1.00 23.56 ? 14   VAL B N   1 
ATOM   2246  C  CA  . VAL B  1 22  ? 13.496   76.982  34.523  1.00 23.04 ? 14   VAL B CA  1 
ATOM   2247  C  C   . VAL B  1 22  ? 12.506   78.114  34.389  1.00 22.57 ? 14   VAL B C   1 
ATOM   2248  O  O   . VAL B  1 22  ? 12.746   79.230  34.867  1.00 21.25 ? 14   VAL B O   1 
ATOM   2249  C  CB  . VAL B  1 22  ? 13.171   76.166  35.816  1.00 24.40 ? 14   VAL B CB  1 
ATOM   2250  C  CG1 . VAL B  1 22  ? 13.479   76.948  37.074  1.00 23.55 ? 14   VAL B CG1 1 
ATOM   2251  C  CG2 . VAL B  1 22  ? 11.700   75.815  35.887  1.00 26.82 ? 14   VAL B CG2 1 
ATOM   2252  N  N   . GLY B  1 23  ? 11.409   77.826  33.696  1.00 22.73 ? 15   GLY B N   1 
ATOM   2253  C  CA  . GLY B  1 23  ? 10.261   78.668  33.745  1.00 22.92 ? 15   GLY B CA  1 
ATOM   2254  C  C   . GLY B  1 23  ? 9.004    77.911  33.384  1.00 23.42 ? 15   GLY B C   1 
ATOM   2255  O  O   . GLY B  1 23  ? 8.995    76.670  33.328  1.00 22.09 ? 15   GLY B O   1 
ATOM   2256  N  N   . GLU B  1 24  ? 7.945    78.678  33.088  1.00 23.46 ? 16   GLU B N   1 
ATOM   2257  C  CA  . GLU B  1 24  ? 6.694    78.083  32.645  1.00 23.90 ? 16   GLU B CA  1 
ATOM   2258  C  C   . GLU B  1 24  ? 6.033    78.871  31.545  1.00 22.96 ? 16   GLU B C   1 
ATOM   2259  O  O   . GLU B  1 24  ? 6.254    80.070  31.428  1.00 22.25 ? 16   GLU B O   1 
ATOM   2260  C  CB  . GLU B  1 24  ? 5.732    77.912  33.831  1.00 24.34 ? 16   GLU B CB  1 
ATOM   2261  C  CG  . GLU B  1 24  ? 5.221    79.197  34.394  1.00 27.69 ? 16   GLU B CG  1 
ATOM   2262  C  CD  . GLU B  1 24  ? 4.483    78.995  35.718  1.00 31.26 ? 16   GLU B CD  1 
ATOM   2263  O  OE1 . GLU B  1 24  ? 5.052    78.331  36.605  1.00 33.73 ? 16   GLU B OE1 1 
ATOM   2264  O  OE2 . GLU B  1 24  ? 3.339    79.500  35.862  1.00 33.28 ? 16   GLU B OE2 1 
ATOM   2265  N  N   . ILE B  1 25  ? 5.204    78.202  30.731  1.00 22.40 ? 17   ILE B N   1 
ATOM   2266  C  CA  . ILE B  1 25  ? 4.535    78.936  29.629  1.00 21.24 ? 17   ILE B CA  1 
ATOM   2267  C  C   . ILE B  1 25  ? 3.674    79.990  30.266  1.00 20.88 ? 17   ILE B C   1 
ATOM   2268  O  O   . ILE B  1 25  ? 2.862    79.674  31.134  1.00 19.98 ? 17   ILE B O   1 
ATOM   2269  C  CB  . ILE B  1 25  ? 3.712    78.036  28.762  1.00 21.04 ? 17   ILE B CB  1 
ATOM   2270  C  CG1 . ILE B  1 25  ? 4.631    76.992  28.092  1.00 21.81 ? 17   ILE B CG1 1 
ATOM   2271  C  CG2 . ILE B  1 25  ? 2.917    78.847  27.752  1.00 19.23 ? 17   ILE B CG2 1 
ATOM   2272  C  CD1 . ILE B  1 25  ? 3.943    76.075  27.050  1.00 20.30 ? 17   ILE B CD1 1 
ATOM   2273  N  N   . ALA B  1 26  ? 3.873    81.237  29.856  1.00 20.66 ? 18   ALA B N   1 
ATOM   2274  C  CA  . ALA B  1 26  ? 3.118    82.371  30.395  1.00 20.95 ? 18   ALA B CA  1 
ATOM   2275  C  C   . ALA B  1 26  ? 1.730    82.486  29.786  1.00 21.80 ? 18   ALA B C   1 
ATOM   2276  O  O   . ALA B  1 26  ? 1.514    82.135  28.626  1.00 22.75 ? 18   ALA B O   1 
ATOM   2277  C  CB  . ALA B  1 26  ? 3.857    83.685  30.132  1.00 20.90 ? 18   ALA B CB  1 
ATOM   2278  N  N   . PRO B  1 27  ? 0.777    83.004  30.547  1.00 22.13 ? 19   PRO B N   1 
ATOM   2279  C  CA  . PRO B  1 27  ? -0.509   83.287  29.951  1.00 22.85 ? 19   PRO B CA  1 
ATOM   2280  C  C   . PRO B  1 27  ? -0.390   84.494  29.063  1.00 23.10 ? 19   PRO B C   1 
ATOM   2281  O  O   . PRO B  1 27  ? 0.563    85.258  29.216  1.00 23.38 ? 19   PRO B O   1 
ATOM   2282  C  CB  . PRO B  1 27  ? -1.353   83.694  31.153  1.00 23.13 ? 19   PRO B CB  1 
ATOM   2283  C  CG  . PRO B  1 27  ? -0.378   84.321  32.062  1.00 23.59 ? 19   PRO B CG  1 
ATOM   2284  C  CD  . PRO B  1 27  ? 0.830    83.440  31.945  1.00 22.41 ? 19   PRO B CD  1 
ATOM   2285  N  N   . ALA B  1 28  ? -1.338   84.677  28.159  1.00 23.19 ? 20   ALA B N   1 
ATOM   2286  C  CA  . ALA B  1 28  ? -1.554   85.964  27.530  1.00 23.60 ? 20   ALA B CA  1 
ATOM   2287  C  C   . ALA B  1 28  ? -1.765   87.020  28.632  1.00 24.15 ? 20   ALA B C   1 
ATOM   2288  O  O   . ALA B  1 28  ? -2.458   86.745  29.567  1.00 24.96 ? 20   ALA B O   1 
ATOM   2289  C  CB  . ALA B  1 28  ? -2.798   85.901  26.572  1.00 23.28 ? 20   ALA B CB  1 
ATOM   2290  N  N   . LYS B  1 29  ? -1.164   88.202  28.517  1.00 24.64 ? 21   LYS B N   1 
ATOM   2291  C  CA  . LYS B  1 29  ? -1.254   89.217  29.512  1.00 26.34 ? 21   LYS B CA  1 
ATOM   2292  C  C   . LYS B  1 29  ? -1.743   90.543  28.949  1.00 28.21 ? 21   LYS B C   1 
ATOM   2293  O  O   . LYS B  1 29  ? -1.359   90.942  27.842  1.00 29.38 ? 21   LYS B O   1 
ATOM   2294  C  CB  . LYS B  1 29  ? 0.125    89.441  30.162  1.00 26.81 ? 21   LYS B CB  1 
ATOM   2295  C  CG  . LYS B  1 29  ? 0.710    88.217  30.922  1.00 26.17 ? 21   LYS B CG  1 
ATOM   2296  C  CD  . LYS B  1 29  ? 2.011    88.583  31.657  1.00 26.81 ? 21   LYS B CD  1 
ATOM   2297  C  CE  . LYS B  1 29  ? 2.669    87.346  32.389  1.00 25.19 ? 21   LYS B CE  1 
ATOM   2298  N  NZ  . LYS B  1 29  ? 4.084    87.590  32.851  1.00 24.64 ? 21   LYS B NZ  1 
ATOM   2299  N  N   . MET B  1 30  ? -2.588   91.214  29.720  1.00 29.53 ? 22   MET B N   1 
ATOM   2300  C  CA  . MET B  1 30  ? -3.100   92.551  29.413  1.00 31.35 ? 22   MET B CA  1 
ATOM   2301  C  C   . MET B  1 30  ? -3.393   93.222  30.736  1.00 32.42 ? 22   MET B C   1 
ATOM   2302  O  O   . MET B  1 30  ? -4.119   92.673  31.575  1.00 30.67 ? 22   MET B O   1 
ATOM   2303  C  CB  . MET B  1 30  ? -4.427   92.516  28.618  1.00 31.44 ? 22   MET B CB  1 
ATOM   2304  C  CG  . MET B  1 30  ? -4.356   91.784  27.326  1.00 32.75 ? 22   MET B CG  1 
ATOM   2305  S  SD  . MET B  1 30  ? -5.901   91.775  26.432  1.00 33.38 ? 22   MET B SD  1 
ATOM   2306  C  CE  . MET B  1 30  ? -6.027   93.494  25.852  1.00 31.83 ? 22   MET B CE  1 
ATOM   2307  N  N   . ARG B  1 31  ? -2.846   94.404  30.922  1.00 34.72 ? 23   ARG B N   1 
ATOM   2308  C  CA  . ARG B  1 31  ? -3.144   95.161  32.136  1.00 37.81 ? 23   ARG B CA  1 
ATOM   2309  C  C   . ARG B  1 31  ? -4.375   96.026  31.951  1.00 36.60 ? 23   ARG B C   1 
ATOM   2310  O  O   . ARG B  1 31  ? -4.903   96.528  32.900  1.00 36.79 ? 23   ARG B O   1 
ATOM   2311  C  CB  . ARG B  1 31  ? -1.925   95.963  32.587  1.00 40.10 ? 23   ARG B CB  1 
ATOM   2312  C  CG  . ARG B  1 31  ? -0.712   95.000  32.936  1.00 50.00 ? 23   ARG B CG  1 
ATOM   2313  C  CD  . ARG B  1 31  ? 0.396    95.583  33.866  1.00 62.54 ? 23   ARG B CD  1 
ATOM   2314  N  NE  . ARG B  1 31  ? 0.715    96.997  33.625  1.00 73.27 ? 23   ARG B NE  1 
ATOM   2315  C  CZ  . ARG B  1 31  ? 1.383    97.500  32.575  1.00 81.89 ? 23   ARG B CZ  1 
ATOM   2316  N  NH1 . ARG B  1 31  ? 1.838    96.724  31.583  1.00 84.18 ? 23   ARG B NH1 1 
ATOM   2317  N  NH2 . ARG B  1 31  ? 1.589    98.818  32.511  1.00 84.66 ? 23   ARG B NH2 1 
ATOM   2318  N  N   . SER B  1 32  ? -4.815   96.204  30.711  1.00 35.34 ? 24   SER B N   1 
ATOM   2319  C  CA  . SER B  1 32  ? -6.037   96.910  30.418  1.00 34.70 ? 24   SER B CA  1 
ATOM   2320  C  C   . SER B  1 32  ? -6.581   96.259  29.163  1.00 33.92 ? 24   SER B C   1 
ATOM   2321  O  O   . SER B  1 32  ? -5.817   95.659  28.403  1.00 33.67 ? 24   SER B O   1 
ATOM   2322  C  CB  . SER B  1 32  ? -5.805   98.423  30.184  1.00 34.63 ? 24   SER B CB  1 
ATOM   2323  O  OG  . SER B  1 32  ? -6.887   99.025  29.436  1.00 34.32 ? 24   SER B OG  1 
ATOM   2324  N  N   . PRO B  1 33  ? -7.894   96.371  28.947  1.00 33.04 ? 25   PRO B N   1 
ATOM   2325  C  CA  . PRO B  1 33  ? -8.432   95.985  27.630  1.00 32.88 ? 25   PRO B CA  1 
ATOM   2326  C  C   . PRO B  1 33  ? -7.890   96.886  26.517  1.00 31.85 ? 25   PRO B C   1 
ATOM   2327  O  O   . PRO B  1 33  ? -7.778   96.445  25.379  1.00 31.14 ? 25   PRO B O   1 
ATOM   2328  C  CB  . PRO B  1 33  ? -9.945   96.134  27.789  1.00 32.77 ? 25   PRO B CB  1 
ATOM   2329  C  CG  . PRO B  1 33  ? -10.147  96.981  29.010  1.00 33.81 ? 25   PRO B CG  1 
ATOM   2330  C  CD  . PRO B  1 33  ? -8.923   96.871  29.870  1.00 33.51 ? 25   PRO B CD  1 
ATOM   2331  N  N   . TYR B  1 34  ? -7.532   98.123  26.870  1.00 31.87 ? 26   TYR B N   1 
ATOM   2332  C  CA  . TYR B  1 34  ? -7.139   99.119  25.871  1.00 32.15 ? 26   TYR B CA  1 
ATOM   2333  C  C   . TYR B  1 34  ? -5.617   99.241  25.708  1.00 31.63 ? 26   TYR B C   1 
ATOM   2334  O  O   . TYR B  1 34  ? -4.904   99.190  26.687  1.00 30.85 ? 26   TYR B O   1 
ATOM   2335  C  CB  . TYR B  1 34  ? -7.721   100.495 26.214  1.00 32.28 ? 26   TYR B CB  1 
ATOM   2336  C  CG  . TYR B  1 34  ? -9.222   100.588 26.100  1.00 31.73 ? 26   TYR B CG  1 
ATOM   2337  C  CD1 . TYR B  1 34  ? -9.866   100.364 24.895  1.00 31.47 ? 26   TYR B CD1 1 
ATOM   2338  C  CD2 . TYR B  1 34  ? -9.987   100.928 27.200  1.00 32.47 ? 26   TYR B CD2 1 
ATOM   2339  C  CE1 . TYR B  1 34  ? -11.253  100.458 24.787  1.00 32.36 ? 26   TYR B CE1 1 
ATOM   2340  C  CE2 . TYR B  1 34  ? -11.358  101.022 27.113  1.00 33.38 ? 26   TYR B CE2 1 
ATOM   2341  C  CZ  . TYR B  1 34  ? -11.992  100.804 25.893  1.00 32.80 ? 26   TYR B CZ  1 
ATOM   2342  O  OH  . TYR B  1 34  ? -13.355  100.915 25.825  1.00 31.95 ? 26   TYR B OH  1 
ATOM   2343  N  N   . SER B  1 35  ? -5.179   99.386  24.456  1.00 31.42 ? 27   SER B N   1 
ATOM   2344  C  CA  . SER B  1 35  ? -3.842   99.836  24.107  1.00 31.35 ? 27   SER B CA  1 
ATOM   2345  C  C   . SER B  1 35  ? -3.932   101.272 23.632  1.00 32.11 ? 27   SER B C   1 
ATOM   2346  O  O   . SER B  1 35  ? -4.792   101.597 22.812  1.00 31.57 ? 27   SER B O   1 
ATOM   2347  C  CB  . SER B  1 35  ? -3.245   98.943  23.013  1.00 31.75 ? 27   SER B CB  1 
ATOM   2348  O  OG  . SER B  1 35  ? -2.819   97.671  23.523  1.00 30.76 ? 27   SER B OG  1 
ATOM   2349  N  N   . VAL B  1 36  ? -3.067   102.146 24.167  1.00 32.45 ? 28   VAL B N   1 
ATOM   2350  C  CA  . VAL B  1 36  ? -3.097   103.602 23.848  1.00 32.62 ? 28   VAL B CA  1 
ATOM   2351  C  C   . VAL B  1 36  ? -2.121   103.958 22.728  1.00 33.09 ? 28   VAL B C   1 
ATOM   2352  O  O   . VAL B  1 36  ? -0.924   103.645 22.796  1.00 32.51 ? 28   VAL B O   1 
ATOM   2353  C  CB  . VAL B  1 36  ? -2.732   104.469 25.055  1.00 32.86 ? 28   VAL B CB  1 
ATOM   2354  C  CG1 . VAL B  1 36  ? -2.825   105.947 24.678  1.00 30.29 ? 28   VAL B CG1 1 
ATOM   2355  C  CG2 . VAL B  1 36  ? -3.644   104.127 26.240  1.00 31.88 ? 28   VAL B CG2 1 
ATOM   2356  N  N   . THR B  1 37  ? -2.626   104.619 21.698  1.00 34.10 ? 29   THR B N   1 
ATOM   2357  C  CA  . THR B  1 37  ? -1.799   104.860 20.512  1.00 34.36 ? 29   THR B CA  1 
ATOM   2358  C  C   . THR B  1 37  ? -1.009   106.145 20.709  1.00 34.94 ? 29   THR B C   1 
ATOM   2359  O  O   . THR B  1 37  ? -1.265   106.905 21.634  1.00 34.63 ? 29   THR B O   1 
ATOM   2360  C  CB  . THR B  1 37  ? -2.650   105.000 19.237  1.00 33.87 ? 29   THR B CB  1 
ATOM   2361  O  OG1 . THR B  1 37  ? -3.412   106.198 19.339  1.00 35.60 ? 29   THR B OG1 1 
ATOM   2362  C  CG2 . THR B  1 37  ? -3.586   103.867 19.079  1.00 32.33 ? 29   THR B CG2 1 
ATOM   2363  N  N   . THR B  1 38  ? -0.085   106.404 19.788  1.00 36.63 ? 30   THR B N   1 
ATOM   2364  C  CA  . THR B  1 38  ? 0.658    107.689 19.752  1.00 37.97 ? 30   THR B CA  1 
ATOM   2365  C  C   . THR B  1 38  ? -0.271   108.862 19.320  1.00 37.89 ? 30   THR B C   1 
ATOM   2366  O  O   . THR B  1 38  ? 0.020    110.016 19.594  1.00 38.77 ? 30   THR B O   1 
ATOM   2367  C  CB  . THR B  1 38  ? 1.936    107.582 18.851  1.00 37.77 ? 30   THR B CB  1 
ATOM   2368  O  OG1 . THR B  1 38  ? 1.530    107.386 17.506  1.00 43.83 ? 30   THR B OG1 1 
ATOM   2369  C  CG2 . THR B  1 38  ? 2.776    106.371 19.215  1.00 34.58 ? 30   THR B CG2 1 
ATOM   2370  N  N   . GLU B  1 39  ? -1.407   108.570 18.693  1.00 37.82 ? 31   GLU B N   1 
ATOM   2371  C  CA  . GLU B  1 39  ? -2.374   109.614 18.390  1.00 39.18 ? 31   GLU B CA  1 
ATOM   2372  C  C   . GLU B  1 39  ? -3.329   109.894 19.573  1.00 38.19 ? 31   GLU B C   1 
ATOM   2373  O  O   . GLU B  1 39  ? -4.209   110.728 19.468  1.00 39.14 ? 31   GLU B O   1 
ATOM   2374  C  CB  . GLU B  1 39  ? -3.147   109.289 17.113  1.00 40.34 ? 31   GLU B CB  1 
ATOM   2375  C  CG  . GLU B  1 39  ? -2.226   108.931 15.886  1.00 46.54 ? 31   GLU B CG  1 
ATOM   2376  C  CD  . GLU B  1 39  ? -1.886   107.389 15.843  1.00 55.30 ? 31   GLU B CD  1 
ATOM   2377  O  OE1 . GLU B  1 39  ? -2.794   106.626 15.422  1.00 59.76 ? 31   GLU B OE1 1 
ATOM   2378  O  OE2 . GLU B  1 39  ? -0.774   106.921 16.267  1.00 57.56 ? 31   GLU B OE2 1 
ATOM   2379  N  N   . GLY B  1 40  ? -3.135   109.229 20.707  1.00 36.43 ? 32   GLY B N   1 
ATOM   2380  C  CA  . GLY B  1 40  ? -4.003   109.413 21.858  1.00 35.98 ? 32   GLY B CA  1 
ATOM   2381  C  C   . GLY B  1 40  ? -5.394   108.786 21.708  1.00 35.57 ? 32   GLY B C   1 
ATOM   2382  O  O   . GLY B  1 40  ? -6.373   109.287 22.280  1.00 36.45 ? 32   GLY B O   1 
ATOM   2383  N  N   . THR B  1 41  ? -5.503   107.716 20.932  1.00 33.47 ? 33   THR B N   1 
ATOM   2384  C  CA  . THR B  1 41  ? -6.744   106.959 20.863  1.00 33.21 ? 33   THR B CA  1 
ATOM   2385  C  C   . THR B  1 41  ? -6.500   105.544 21.478  1.00 33.07 ? 33   THR B C   1 
ATOM   2386  O  O   . THR B  1 41  ? -5.356   105.181 21.789  1.00 32.09 ? 33   THR B O   1 
ATOM   2387  C  CB  . THR B  1 41  ? -7.177   106.775 19.399  1.00 33.32 ? 33   THR B CB  1 
ATOM   2388  O  OG1 . THR B  1 41  ? -6.162   106.020 18.714  1.00 33.47 ? 33   THR B OG1 1 
ATOM   2389  C  CG2 . THR B  1 41  ? -7.379   108.129 18.679  1.00 32.56 ? 33   THR B CG2 1 
ATOM   2390  N  N   . VAL B  1 42  ? -7.571   104.765 21.617  1.00 32.82 ? 34   VAL B N   1 
ATOM   2391  C  CA  . VAL B  1 42  ? -7.526   103.420 22.189  1.00 32.27 ? 34   VAL B CA  1 
ATOM   2392  C  C   . VAL B  1 42  ? -7.979   102.323 21.230  1.00 32.81 ? 34   VAL B C   1 
ATOM   2393  O  O   . VAL B  1 42  ? -8.870   102.515 20.401  1.00 33.17 ? 34   VAL B O   1 
ATOM   2394  C  CB  . VAL B  1 42  ? -8.336   103.285 23.531  1.00 33.05 ? 34   VAL B CB  1 
ATOM   2395  C  CG1 . VAL B  1 42  ? -7.664   104.213 24.696  1.00 30.24 ? 34   VAL B CG1 1 
ATOM   2396  C  CG2 . VAL B  1 42  ? -9.830   103.526 23.316  1.00 30.55 ? 34   VAL B CG2 1 
ATOM   2397  N  N   . ARG B  1 43  ? -7.333   101.171 21.363  1.00 32.62 ? 35   ARG B N   1 
ATOM   2398  C  CA  . ARG B  1 43  ? -7.592   100.018 20.546  1.00 33.53 ? 35   ARG B CA  1 
ATOM   2399  C  C   . ARG B  1 43  ? -7.664   98.829  21.479  1.00 32.51 ? 35   ARG B C   1 
ATOM   2400  O  O   . ARG B  1 43  ? -6.898   98.746  22.458  1.00 32.16 ? 35   ARG B O   1 
ATOM   2401  C  CB  . ARG B  1 43  ? -6.435   99.800  19.562  1.00 34.31 ? 35   ARG B CB  1 
ATOM   2402  C  CG  . ARG B  1 43  ? -6.422   100.806 18.413  1.00 38.28 ? 35   ARG B CG  1 
ATOM   2403  C  CD  . ARG B  1 43  ? -5.238   100.573 17.484  1.00 42.54 ? 35   ARG B CD  1 
ATOM   2404  N  NE  . ARG B  1 43  ? -5.429   99.336  16.729  1.00 45.77 ? 35   ARG B NE  1 
ATOM   2405  C  CZ  . ARG B  1 43  ? -4.545   98.803  15.882  1.00 46.23 ? 35   ARG B CZ  1 
ATOM   2406  N  NH1 . ARG B  1 43  ? -3.372   99.410  15.670  1.00 45.81 ? 35   ARG B NH1 1 
ATOM   2407  N  NH2 . ARG B  1 43  ? -4.847   97.659  15.244  1.00 43.56 ? 35   ARG B NH2 1 
ATOM   2408  N  N   . VAL B  1 44  ? -8.583   97.927  21.186  1.00 31.20 ? 36   VAL B N   1 
ATOM   2409  C  CA  . VAL B  1 44  ? -8.622   96.653  21.869  1.00 30.75 ? 36   VAL B CA  1 
ATOM   2410  C  C   . VAL B  1 44  ? -7.969   95.611  20.982  1.00 30.63 ? 36   VAL B C   1 
ATOM   2411  O  O   . VAL B  1 44  ? -8.563   95.141  20.033  1.00 31.16 ? 36   VAL B O   1 
ATOM   2412  C  CB  . VAL B  1 44  ? -10.043  96.188  22.259  1.00 30.57 ? 36   VAL B CB  1 
ATOM   2413  C  CG1 . VAL B  1 44  ? -9.919   94.853  22.956  1.00 27.97 ? 36   VAL B CG1 1 
ATOM   2414  C  CG2 . VAL B  1 44  ? -10.724  97.210  23.189  1.00 29.04 ? 36   VAL B CG2 1 
ATOM   2415  N  N   . ILE B  1 45  ? -6.742   95.241  21.315  1.00 30.86 ? 37   ILE B N   1 
ATOM   2416  C  CA  . ILE B  1 45  ? -5.981   94.269  20.540  1.00 30.03 ? 37   ILE B CA  1 
ATOM   2417  C  C   . ILE B  1 45  ? -5.165   93.373  21.459  1.00 29.53 ? 37   ILE B C   1 
ATOM   2418  O  O   . ILE B  1 45  ? -4.835   93.753  22.586  1.00 28.70 ? 37   ILE B O   1 
ATOM   2419  C  CB  . ILE B  1 45  ? -5.049   94.958  19.518  1.00 30.49 ? 37   ILE B CB  1 
ATOM   2420  C  CG1 . ILE B  1 45  ? -4.135   95.996  20.209  1.00 28.97 ? 37   ILE B CG1 1 
ATOM   2421  C  CG2 . ILE B  1 45  ? -5.901   95.583  18.386  1.00 31.16 ? 37   ILE B CG2 1 
ATOM   2422  C  CD1 . ILE B  1 45  ? -3.291   96.896  19.233  1.00 28.95 ? 37   ILE B CD1 1 
ATOM   2423  N  N   . PRO B  1 46  ? -4.831   92.165  20.968  1.00 29.27 ? 38   PRO B N   1 
ATOM   2424  C  CA  . PRO B  1 46  ? -3.972   91.255  21.719  1.00 28.99 ? 38   PRO B CA  1 
ATOM   2425  C  C   . PRO B  1 46  ? -2.576   91.841  21.981  1.00 28.84 ? 38   PRO B C   1 
ATOM   2426  O  O   . PRO B  1 46  ? -2.122   92.689  21.235  1.00 29.16 ? 38   PRO B O   1 
ATOM   2427  C  CB  . PRO B  1 46  ? -3.874   90.017  20.820  1.00 28.39 ? 38   PRO B CB  1 
ATOM   2428  C  CG  . PRO B  1 46  ? -5.111   90.105  19.931  1.00 30.21 ? 38   PRO B CG  1 
ATOM   2429  C  CD  . PRO B  1 46  ? -5.271   91.579  19.689  1.00 29.76 ? 38   PRO B CD  1 
ATOM   2430  N  N   . VAL B  1 47  ? -1.930   91.398  23.049  1.00 28.27 ? 39   VAL B N   1 
ATOM   2431  C  CA  . VAL B  1 47  ? -0.679   91.971  23.423  1.00 27.98 ? 39   VAL B CA  1 
ATOM   2432  C  C   . VAL B  1 47  ? 0.291    90.785  23.632  1.00 27.84 ? 39   VAL B C   1 
ATOM   2433  O  O   . VAL B  1 47  ? 0.411    89.920  22.754  1.00 27.73 ? 39   VAL B O   1 
ATOM   2434  C  CB  . VAL B  1 47  ? -0.857   92.967  24.604  1.00 28.36 ? 39   VAL B CB  1 
ATOM   2435  C  CG1 . VAL B  1 47  ? 0.427    93.802  24.815  1.00 27.35 ? 39   VAL B CG1 1 
ATOM   2436  C  CG2 . VAL B  1 47  ? -2.034   93.942  24.332  1.00 27.69 ? 39   VAL B CG2 1 
ATOM   2437  N  N   . LEU B  1 48  ? 0.929    90.680  24.781  1.00 26.64 ? 40   LEU B N   1 
ATOM   2438  C  CA  . LEU B  1 48  ? 2.052    89.788  24.870  1.00 26.54 ? 40   LEU B CA  1 
ATOM   2439  C  C   . LEU B  1 48  ? 1.684    88.486  25.617  1.00 25.87 ? 40   LEU B C   1 
ATOM   2440  O  O   . LEU B  1 48  ? 0.529    88.292  25.945  1.00 26.05 ? 40   LEU B O   1 
ATOM   2441  C  CB  . LEU B  1 48  ? 3.283    90.530  25.433  1.00 26.96 ? 40   LEU B CB  1 
ATOM   2442  C  CG  . LEU B  1 48  ? 3.060    91.430  26.648  1.00 28.19 ? 40   LEU B CG  1 
ATOM   2443  C  CD1 . LEU B  1 48  ? 2.844    90.481  27.790  1.00 30.21 ? 40   LEU B CD1 1 
ATOM   2444  C  CD2 . LEU B  1 48  ? 4.253    92.290  26.881  1.00 26.25 ? 40   LEU B CD2 1 
ATOM   2445  N  N   . GLY B  1 49  ? 2.639    87.565  25.773  1.00 24.04 ? 41   GLY B N   1 
ATOM   2446  C  CA  . GLY B  1 49  ? 2.435    86.358  26.533  1.00 23.37 ? 41   GLY B CA  1 
ATOM   2447  C  C   . GLY B  1 49  ? 1.879    85.232  25.684  1.00 23.40 ? 41   GLY B C   1 
ATOM   2448  O  O   . GLY B  1 49  ? 1.687    85.383  24.495  1.00 24.44 ? 41   GLY B O   1 
ATOM   2449  N  N   . GLY B  1 50  ? 1.624    84.101  26.303  1.00 22.51 ? 42   GLY B N   1 
ATOM   2450  C  CA  . GLY B  1 50  ? 0.965    83.009  25.652  1.00 22.83 ? 42   GLY B CA  1 
ATOM   2451  C  C   . GLY B  1 50  ? 1.760    82.164  24.689  1.00 22.70 ? 42   GLY B C   1 
ATOM   2452  O  O   . GLY B  1 50  ? 2.955    82.393  24.414  1.00 22.88 ? 42   GLY B O   1 
ATOM   2453  N  N   . ILE B  1 51  ? 1.062    81.146  24.201  1.00 22.37 ? 43   ILE B N   1 
ATOM   2454  C  CA  . ILE B  1 51  ? 1.359    80.539  22.927  1.00 22.07 ? 43   ILE B CA  1 
ATOM   2455  C  C   . ILE B  1 51  ? 0.639    81.379  21.851  1.00 22.33 ? 43   ILE B C   1 
ATOM   2456  O  O   . ILE B  1 51  ? -0.599   81.485  21.839  1.00 22.41 ? 43   ILE B O   1 
ATOM   2457  C  CB  . ILE B  1 51  ? 0.849    79.106  22.915  1.00 22.96 ? 43   ILE B CB  1 
ATOM   2458  C  CG1 . ILE B  1 51  ? 1.385    78.342  24.136  1.00 22.23 ? 43   ILE B CG1 1 
ATOM   2459  C  CG2 . ILE B  1 51  ? 1.211    78.392  21.580  1.00 21.43 ? 43   ILE B CG2 1 
ATOM   2460  C  CD1 . ILE B  1 51  ? 0.377    77.344  24.736  1.00 22.05 ? 43   ILE B CD1 1 
ATOM   2461  N  N   . THR B  1 52  ? 1.405    82.031  20.984  1.00 22.51 ? 44   THR B N   1 
ATOM   2462  C  CA  . THR B  1 52  ? 0.854    82.795  19.880  1.00 21.99 ? 44   THR B CA  1 
ATOM   2463  C  C   . THR B  1 52  ? 0.921    81.875  18.671  1.00 23.02 ? 44   THR B C   1 
ATOM   2464  O  O   . THR B  1 52  ? 1.982    81.507  18.211  1.00 22.65 ? 44   THR B O   1 
ATOM   2465  C  CB  . THR B  1 52  ? 1.627    84.051  19.651  1.00 21.52 ? 44   THR B CB  1 
ATOM   2466  O  OG1 . THR B  1 52  ? 1.567    84.877  20.840  1.00 20.58 ? 44   THR B OG1 1 
ATOM   2467  C  CG2 . THR B  1 52  ? 1.056    84.827  18.445  1.00 19.65 ? 44   THR B CG2 1 
ATOM   2468  N  N   . TYR B  1 53  ? -0.233   81.479  18.168  1.00 23.74 ? 45   TYR B N   1 
ATOM   2469  C  CA  . TYR B  1 53  ? -0.304   80.367  17.227  1.00 24.03 ? 45   TYR B CA  1 
ATOM   2470  C  C   . TYR B  1 53  ? 0.091    80.732  15.809  1.00 24.56 ? 45   TYR B C   1 
ATOM   2471  O  O   . TYR B  1 53  ? 0.504    79.875  15.052  1.00 24.49 ? 45   TYR B O   1 
ATOM   2472  C  CB  . TYR B  1 53  ? -1.695   79.709  17.243  1.00 24.25 ? 45   TYR B CB  1 
ATOM   2473  C  CG  . TYR B  1 53  ? -2.042   79.039  18.552  1.00 22.99 ? 45   TYR B CG  1 
ATOM   2474  C  CD1 . TYR B  1 53  ? -1.611   77.769  18.832  1.00 24.62 ? 45   TYR B CD1 1 
ATOM   2475  C  CD2 . TYR B  1 53  ? -2.812   79.699  19.512  1.00 23.46 ? 45   TYR B CD2 1 
ATOM   2476  C  CE1 . TYR B  1 53  ? -1.923   77.146  20.076  1.00 26.02 ? 45   TYR B CE1 1 
ATOM   2477  C  CE2 . TYR B  1 53  ? -3.133   79.109  20.720  1.00 24.77 ? 45   TYR B CE2 1 
ATOM   2478  C  CZ  . TYR B  1 53  ? -2.696   77.831  21.008  1.00 26.02 ? 45   TYR B CZ  1 
ATOM   2479  O  OH  . TYR B  1 53  ? -3.006   77.246  22.236  1.00 27.39 ? 45   TYR B OH  1 
ATOM   2480  N  N   . ASN B  1 54  ? -0.005   82.003  15.440  1.00 24.90 ? 46   ASN B N   1 
ATOM   2481  C  CA  . ASN B  1 54  ? 0.151    82.360  14.024  1.00 25.00 ? 46   ASN B CA  1 
ATOM   2482  C  C   . ASN B  1 54  ? 1.194    83.441  13.778  1.00 24.67 ? 46   ASN B C   1 
ATOM   2483  O  O   . ASN B  1 54  ? 1.181    84.041  12.748  1.00 24.95 ? 46   ASN B O   1 
ATOM   2484  C  CB  . ASN B  1 54  ? -1.210   82.767  13.446  1.00 24.21 ? 46   ASN B CB  1 
ATOM   2485  C  CG  . ASN B  1 54  ? -1.736   84.021  14.064  1.00 25.27 ? 46   ASN B CG  1 
ATOM   2486  O  OD1 . ASN B  1 54  ? -1.605   84.238  15.268  1.00 23.91 ? 46   ASN B OD1 1 
ATOM   2487  N  ND2 . ASN B  1 54  ? -2.314   84.875  13.255  1.00 22.41 ? 46   ASN B ND2 1 
ATOM   2488  N  N   . VAL B  1 55  ? 2.059    83.704  14.757  1.00 24.33 ? 47   VAL B N   1 
ATOM   2489  C  CA  . VAL B  1 55  ? 3.156    84.654  14.603  1.00 23.64 ? 47   VAL B CA  1 
ATOM   2490  C  C   . VAL B  1 55  ? 4.407    83.952  15.053  1.00 24.14 ? 47   VAL B C   1 
ATOM   2491  O  O   . VAL B  1 55  ? 4.459    83.417  16.157  1.00 23.41 ? 47   VAL B O   1 
ATOM   2492  C  CB  . VAL B  1 55  ? 2.936    85.924  15.424  1.00 24.40 ? 47   VAL B CB  1 
ATOM   2493  C  CG1 . VAL B  1 55  ? 4.076    86.930  15.179  1.00 21.07 ? 47   VAL B CG1 1 
ATOM   2494  C  CG2 . VAL B  1 55  ? 1.532    86.572  15.075  1.00 21.71 ? 47   VAL B CG2 1 
ATOM   2495  N  N   . LYS B  1 56  ? 5.406    83.909  14.188  1.00 25.03 ? 48   LYS B N   1 
ATOM   2496  C  CA  . LYS B  1 56  ? 6.614    83.175  14.480  1.00 26.92 ? 48   LYS B CA  1 
ATOM   2497  C  C   . LYS B  1 56  ? 7.875    83.862  13.984  1.00 26.08 ? 48   LYS B C   1 
ATOM   2498  O  O   . LYS B  1 56  ? 7.807    84.804  13.175  1.00 26.54 ? 48   LYS B O   1 
ATOM   2499  C  CB  . LYS B  1 56  ? 6.496    81.749  13.938  1.00 28.66 ? 48   LYS B CB  1 
ATOM   2500  C  CG  . LYS B  1 56  ? 6.256    81.653  12.444  1.00 35.35 ? 48   LYS B CG  1 
ATOM   2501  C  CD  . LYS B  1 56  ? 6.364    80.169  11.882  1.00 42.54 ? 48   LYS B CD  1 
ATOM   2502  C  CE  . LYS B  1 56  ? 6.610    80.088  10.331  1.00 43.99 ? 48   LYS B CE  1 
ATOM   2503  N  NZ  . LYS B  1 56  ? 5.640    81.004  9.533   1.00 46.58 ? 48   LYS B NZ  1 
ATOM   2504  N  N   . VAL B  1 57  ? 9.025    83.423  14.493  1.00 24.56 ? 49   VAL B N   1 
ATOM   2505  C  CA  . VAL B  1 57  ? 10.279   83.994  14.075  1.00 23.44 ? 49   VAL B CA  1 
ATOM   2506  C  C   . VAL B  1 57  ? 10.354   83.843  12.550  1.00 24.07 ? 49   VAL B C   1 
ATOM   2507  O  O   . VAL B  1 57  ? 9.986    82.855  11.996  1.00 23.01 ? 49   VAL B O   1 
ATOM   2508  C  CB  . VAL B  1 57  ? 11.465   83.317  14.818  1.00 23.57 ? 49   VAL B CB  1 
ATOM   2509  C  CG1 . VAL B  1 57  ? 11.557   81.878  14.459  1.00 21.44 ? 49   VAL B CG1 1 
ATOM   2510  C  CG2 . VAL B  1 57  ? 12.801   84.044  14.539  1.00 21.45 ? 49   VAL B CG2 1 
ATOM   2511  N  N   . GLY B  1 58  ? 10.821   84.874  11.876  1.00 25.32 ? 50   GLY B N   1 
ATOM   2512  C  CA  . GLY B  1 58  ? 10.826   84.907  10.448  1.00 25.38 ? 50   GLY B CA  1 
ATOM   2513  C  C   . GLY B  1 58  ? 9.688    85.689  9.822   1.00 25.86 ? 50   GLY B C   1 
ATOM   2514  O  O   . GLY B  1 58  ? 9.796    86.121  8.668   1.00 26.10 ? 50   GLY B O   1 
ATOM   2515  N  N   . ASP B  1 59  ? 8.574    85.818  10.535  1.00 25.80 ? 51   ASP B N   1 
ATOM   2516  C  CA  . ASP B  1 59  ? 7.477    86.676  10.090  1.00 25.50 ? 51   ASP B CA  1 
ATOM   2517  C  C   . ASP B  1 59  ? 7.859    88.125  10.266  1.00 25.02 ? 51   ASP B C   1 
ATOM   2518  O  O   . ASP B  1 59  ? 8.770    88.435  11.025  1.00 24.38 ? 51   ASP B O   1 
ATOM   2519  C  CB  . ASP B  1 59  ? 6.190    86.398  10.878  1.00 25.53 ? 51   ASP B CB  1 
ATOM   2520  C  CG  . ASP B  1 59  ? 5.643    84.997  10.659  1.00 28.24 ? 51   ASP B CG  1 
ATOM   2521  O  OD1 . ASP B  1 59  ? 6.089    84.295  9.723   1.00 32.74 ? 51   ASP B OD1 1 
ATOM   2522  O  OD2 . ASP B  1 59  ? 4.749    84.558  11.422  1.00 31.02 ? 51   ASP B OD2 1 
ATOM   2523  N  N   . SER B  1 60  ? 7.138    89.006  9.575   1.00 24.97 ? 52   SER B N   1 
ATOM   2524  C  CA  . SER B  1 60  ? 7.287    90.429  9.739   1.00 24.95 ? 52   SER B CA  1 
ATOM   2525  C  C   . SER B  1 60  ? 6.953    90.855  11.170  1.00 24.78 ? 52   SER B C   1 
ATOM   2526  O  O   . SER B  1 60  ? 6.063    90.280  11.794  1.00 22.74 ? 52   SER B O   1 
ATOM   2527  C  CB  . SER B  1 60  ? 6.347    91.202  8.789   1.00 25.68 ? 52   SER B CB  1 
ATOM   2528  O  OG  . SER B  1 60  ? 6.495    92.623  8.968   1.00 25.53 ? 52   SER B OG  1 
ATOM   2529  N  N   . ALA B  1 61  ? 7.685    91.869  11.645  1.00 24.15 ? 53   ALA B N   1 
ATOM   2530  C  CA  . ALA B  1 61  ? 7.437    92.551  12.902  1.00 24.16 ? 53   ALA B CA  1 
ATOM   2531  C  C   . ALA B  1 61  ? 6.289    93.549  12.766  1.00 25.30 ? 53   ALA B C   1 
ATOM   2532  O  O   . ALA B  1 61  ? 5.725    93.995  13.790  1.00 25.18 ? 53   ALA B O   1 
ATOM   2533  C  CB  . ALA B  1 61  ? 8.721    93.288  13.383  1.00 23.56 ? 53   ALA B CB  1 
ATOM   2534  N  N   . TYR B  1 62  ? 5.924    93.870  11.517  1.00 25.96 ? 54   TYR B N   1 
ATOM   2535  C  CA  . TYR B  1 62  ? 4.898    94.842  11.232  1.00 26.97 ? 54   TYR B CA  1 
ATOM   2536  C  C   . TYR B  1 62  ? 3.664    94.213  10.606  1.00 27.75 ? 54   TYR B C   1 
ATOM   2537  O  O   . TYR B  1 62  ? 3.703    93.102  10.128  1.00 28.16 ? 54   TYR B O   1 
ATOM   2538  C  CB  . TYR B  1 62  ? 5.447    95.890  10.314  1.00 26.90 ? 54   TYR B CB  1 
ATOM   2539  C  CG  . TYR B  1 62  ? 6.434    96.762  10.982  1.00 28.68 ? 54   TYR B CG  1 
ATOM   2540  C  CD1 . TYR B  1 62  ? 7.800    96.474  10.922  1.00 29.36 ? 54   TYR B CD1 1 
ATOM   2541  C  CD2 . TYR B  1 62  ? 6.025    97.891  11.696  1.00 27.45 ? 54   TYR B CD2 1 
ATOM   2542  C  CE1 . TYR B  1 62  ? 8.749    97.319  11.551  1.00 29.23 ? 54   TYR B CE1 1 
ATOM   2543  C  CE2 . TYR B  1 62  ? 6.936    98.714  12.324  1.00 26.40 ? 54   TYR B CE2 1 
ATOM   2544  C  CZ  . TYR B  1 62  ? 8.306    98.419  12.246  1.00 30.11 ? 54   TYR B CZ  1 
ATOM   2545  O  OH  . TYR B  1 62  ? 9.214    99.235  12.852  1.00 30.70 ? 54   TYR B OH  1 
ATOM   2546  N  N   . GLY B  1 63  ? 2.548    94.939  10.683  1.00 29.18 ? 55   GLY B N   1 
ATOM   2547  C  CA  . GLY B  1 63  ? 1.310    94.520  10.056  1.00 29.83 ? 55   GLY B CA  1 
ATOM   2548  C  C   . GLY B  1 63  ? 0.358    93.668  10.872  1.00 30.74 ? 55   GLY B C   1 
ATOM   2549  O  O   . GLY B  1 63  ? -0.682   93.230  10.336  1.00 32.14 ? 55   GLY B O   1 
ATOM   2550  N  N   . TRP B  1 64  ? 0.670    93.417  12.143  1.00 29.83 ? 56   TRP B N   1 
ATOM   2551  C  CA  . TRP B  1 64  ? -0.193   92.582  12.979  1.00 29.07 ? 56   TRP B CA  1 
ATOM   2552  C  C   . TRP B  1 64  ? -1.168   93.434  13.749  1.00 28.75 ? 56   TRP B C   1 
ATOM   2553  O  O   . TRP B  1 64  ? -0.820   94.483  14.177  1.00 28.13 ? 56   TRP B O   1 
ATOM   2554  C  CB  . TRP B  1 64  ? 0.609    91.723  13.942  1.00 28.84 ? 56   TRP B CB  1 
ATOM   2555  C  CG  . TRP B  1 64  ? 1.470    90.749  13.239  1.00 28.42 ? 56   TRP B CG  1 
ATOM   2556  C  CD1 . TRP B  1 64  ? 2.818    90.844  13.038  1.00 26.52 ? 56   TRP B CD1 1 
ATOM   2557  C  CD2 . TRP B  1 64  ? 1.058    89.541  12.619  1.00 27.56 ? 56   TRP B CD2 1 
ATOM   2558  N  NE1 . TRP B  1 64  ? 3.252    89.763  12.333  1.00 25.96 ? 56   TRP B NE1 1 
ATOM   2559  C  CE2 . TRP B  1 64  ? 2.201    88.945  12.069  1.00 26.19 ? 56   TRP B CE2 1 
ATOM   2560  C  CE3 . TRP B  1 64  ? -0.168   88.908  12.458  1.00 27.58 ? 56   TRP B CE3 1 
ATOM   2561  C  CZ2 . TRP B  1 64  ? 2.156    87.736  11.377  1.00 29.90 ? 56   TRP B CZ2 1 
ATOM   2562  C  CZ3 . TRP B  1 64  ? -0.202   87.700  11.765  1.00 29.63 ? 56   TRP B CZ3 1 
ATOM   2563  C  CH2 . TRP B  1 64  ? 0.945    87.128  11.235  1.00 27.01 ? 56   TRP B CH2 1 
ATOM   2564  N  N   . ALA B  1 65  ? -2.419   92.998  13.892  1.00 29.44 ? 57   ALA B N   1 
ATOM   2565  C  CA  . ALA B  1 65  ? -3.380   93.735  14.746  1.00 29.66 ? 57   ALA B CA  1 
ATOM   2566  C  C   . ALA B  1 65  ? -3.104   93.324  16.197  1.00 29.37 ? 57   ALA B C   1 
ATOM   2567  O  O   . ALA B  1 65  ? -3.852   92.552  16.790  1.00 29.60 ? 57   ALA B O   1 
ATOM   2568  C  CB  . ALA B  1 65  ? -4.829   93.447  14.348  1.00 29.51 ? 57   ALA B CB  1 
ATOM   2569  N  N   . GLY B  1 66  ? -2.003   93.835  16.736  1.00 28.95 ? 58   GLY B N   1 
ATOM   2570  C  CA  . GLY B  1 66  ? -1.512   93.430  18.016  1.00 28.99 ? 58   GLY B CA  1 
ATOM   2571  C  C   . GLY B  1 66  ? -0.478   94.404  18.490  1.00 29.55 ? 58   GLY B C   1 
ATOM   2572  O  O   . GLY B  1 66  ? 0.035    95.192  17.736  1.00 30.47 ? 58   GLY B O   1 
ATOM   2573  N  N   . ASP B  1 67  ? -0.154   94.358  19.751  1.00 30.30 ? 59   ASP B N   1 
ATOM   2574  C  CA  . ASP B  1 67  ? 0.845    95.249  20.280  1.00 31.72 ? 59   ASP B CA  1 
ATOM   2575  C  C   . ASP B  1 67  ? 1.861    94.395  21.047  1.00 30.60 ? 59   ASP B C   1 
ATOM   2576  O  O   . ASP B  1 67  ? 1.482    93.547  21.807  1.00 29.79 ? 59   ASP B O   1 
ATOM   2577  C  CB  . ASP B  1 67  ? 0.161    96.299  21.167  1.00 32.78 ? 59   ASP B CB  1 
ATOM   2578  C  CG  . ASP B  1 67  ? 1.148    97.239  21.807  1.00 37.82 ? 59   ASP B CG  1 
ATOM   2579  O  OD1 . ASP B  1 67  ? 1.663    98.108  21.097  1.00 43.84 ? 59   ASP B OD1 1 
ATOM   2580  O  OD2 . ASP B  1 67  ? 1.442    97.078  23.022  1.00 45.12 ? 59   ASP B OD2 1 
ATOM   2581  N  N   . HIS B  1 68  ? 3.148    94.607  20.801  1.00 30.69 ? 60   HIS B N   1 
ATOM   2582  C  CA  . HIS B  1 68  ? 4.207    93.910  21.525  1.00 30.89 ? 60   HIS B CA  1 
ATOM   2583  C  C   . HIS B  1 68  ? 3.999    92.412  21.369  1.00 28.92 ? 60   HIS B C   1 
ATOM   2584  O  O   . HIS B  1 68  ? 4.176    91.651  22.300  1.00 28.43 ? 60   HIS B O   1 
ATOM   2585  C  CB  . HIS B  1 68  ? 4.156    94.243  23.034  1.00 32.19 ? 60   HIS B CB  1 
ATOM   2586  C  CG  . HIS B  1 68  ? 4.817    95.522  23.425  1.00 37.38 ? 60   HIS B CG  1 
ATOM   2587  N  ND1 . HIS B  1 68  ? 4.131    96.718  23.527  1.00 42.03 ? 60   HIS B ND1 1 
ATOM   2588  C  CD2 . HIS B  1 68  ? 6.095    95.776  23.812  1.00 41.96 ? 60   HIS B CD2 1 
ATOM   2589  C  CE1 . HIS B  1 68  ? 4.977    97.658  23.927  1.00 45.31 ? 60   HIS B CE1 1 
ATOM   2590  N  NE2 . HIS B  1 68  ? 6.178    97.117  24.082  1.00 44.22 ? 60   HIS B NE2 1 
ATOM   2591  N  N   . VAL B  1 69  ? 3.573    91.960  20.208  1.00 27.68 ? 61   VAL B N   1 
ATOM   2592  C  CA  . VAL B  1 69  ? 3.255    90.551  20.102  1.00 25.50 ? 61   VAL B CA  1 
ATOM   2593  C  C   . VAL B  1 69  ? 4.560    89.754  20.140  1.00 24.56 ? 61   VAL B C   1 
ATOM   2594  O  O   . VAL B  1 69  ? 5.522    90.117  19.493  1.00 23.22 ? 61   VAL B O   1 
ATOM   2595  C  CB  . VAL B  1 69  ? 2.470    90.227  18.852  1.00 25.78 ? 61   VAL B CB  1 
ATOM   2596  C  CG1 . VAL B  1 69  ? 2.171    88.714  18.824  1.00 22.39 ? 61   VAL B CG1 1 
ATOM   2597  C  CG2 . VAL B  1 69  ? 1.198    91.094  18.816  1.00 24.97 ? 61   VAL B CG2 1 
ATOM   2598  N  N   . GLU B  1 70  ? 4.550    88.656  20.888  1.00 23.15 ? 62   GLU B N   1 
ATOM   2599  C  CA  . GLU B  1 70  ? 5.697    87.821  21.066  1.00 22.32 ? 62   GLU B CA  1 
ATOM   2600  C  C   . GLU B  1 70  ? 5.521    86.574  20.237  1.00 22.32 ? 62   GLU B C   1 
ATOM   2601  O  O   . GLU B  1 70  ? 4.568    85.820  20.462  1.00 22.12 ? 62   GLU B O   1 
ATOM   2602  C  CB  . GLU B  1 70  ? 5.832    87.453  22.554  1.00 22.14 ? 62   GLU B CB  1 
ATOM   2603  C  CG  . GLU B  1 70  ? 6.054    88.691  23.457  1.00 23.22 ? 62   GLU B CG  1 
ATOM   2604  C  CD  . GLU B  1 70  ? 6.207    88.380  24.943  1.00 23.99 ? 62   GLU B CD  1 
ATOM   2605  O  OE1 . GLU B  1 70  ? 5.576    87.410  25.459  1.00 22.52 ? 62   GLU B OE1 1 
ATOM   2606  O  OE2 . GLU B  1 70  ? 6.939    89.158  25.588  1.00 23.26 ? 62   GLU B OE2 1 
ATOM   2607  N  N   . PRO B  1 71  ? 6.429    86.331  19.286  1.00 21.36 ? 63   PRO B N   1 
ATOM   2608  C  CA  . PRO B  1 71  ? 6.336    85.103  18.486  1.00 21.99 ? 63   PRO B CA  1 
ATOM   2609  C  C   . PRO B  1 71  ? 6.398    83.811  19.312  1.00 22.01 ? 63   PRO B C   1 
ATOM   2610  O  O   . PRO B  1 71  ? 7.091    83.767  20.293  1.00 21.88 ? 63   PRO B O   1 
ATOM   2611  C  CB  . PRO B  1 71  ? 7.579    85.157  17.601  1.00 22.17 ? 63   PRO B CB  1 
ATOM   2612  C  CG  . PRO B  1 71  ? 8.517    86.090  18.298  1.00 21.90 ? 63   PRO B CG  1 
ATOM   2613  C  CD  . PRO B  1 71  ? 7.595    87.137  18.910  1.00 21.53 ? 63   PRO B CD  1 
ATOM   2614  N  N   . GLY B  1 72  ? 5.687    82.778  18.903  1.00 21.85 ? 64   GLY B N   1 
ATOM   2615  C  CA  . GLY B  1 72  ? 5.866    81.474  19.488  1.00 22.28 ? 64   GLY B CA  1 
ATOM   2616  C  C   . GLY B  1 72  ? 5.407    81.388  20.945  1.00 22.24 ? 64   GLY B C   1 
ATOM   2617  O  O   . GLY B  1 72  ? 4.343    81.914  21.322  1.00 22.25 ? 64   GLY B O   1 
ATOM   2618  N  N   . VAL B  1 73  ? 6.243    80.777  21.773  1.00 21.49 ? 65   VAL B N   1 
ATOM   2619  C  CA  . VAL B  1 73  ? 5.867    80.465  23.131  1.00 21.51 ? 65   VAL B CA  1 
ATOM   2620  C  C   . VAL B  1 73  ? 6.582    81.418  24.084  1.00 21.26 ? 65   VAL B C   1 
ATOM   2621  O  O   . VAL B  1 73  ? 7.805    81.502  24.065  1.00 22.63 ? 65   VAL B O   1 
ATOM   2622  C  CB  . VAL B  1 73  ? 6.175    78.981  23.449  1.00 21.40 ? 65   VAL B CB  1 
ATOM   2623  C  CG1 . VAL B  1 73  ? 5.965    78.658  24.988  1.00 21.14 ? 65   VAL B CG1 1 
ATOM   2624  C  CG2 . VAL B  1 73  ? 5.369    78.042  22.520  1.00 19.67 ? 65   VAL B CG2 1 
ATOM   2625  N  N   . SER B  1 74  ? 5.833    82.130  24.914  1.00 20.27 ? 66   SER B N   1 
ATOM   2626  C  CA  . SER B  1 74  ? 6.424    83.001  25.907  1.00 20.43 ? 66   SER B CA  1 
ATOM   2627  C  C   . SER B  1 74  ? 6.591    82.237  27.208  1.00 20.94 ? 66   SER B C   1 
ATOM   2628  O  O   . SER B  1 74  ? 5.654    81.553  27.667  1.00 21.96 ? 66   SER B O   1 
ATOM   2629  C  CB  . SER B  1 74  ? 5.553    84.220  26.159  1.00 20.68 ? 66   SER B CB  1 
ATOM   2630  O  OG  . SER B  1 74  ? 5.215    84.911  24.981  1.00 20.20 ? 66   SER B OG  1 
ATOM   2631  N  N   . VAL B  1 75  ? 7.783    82.337  27.798  1.00 21.34 ? 67   VAL B N   1 
ATOM   2632  C  CA  . VAL B  1 75  ? 8.152    81.602  29.005  1.00 20.74 ? 67   VAL B CA  1 
ATOM   2633  C  C   . VAL B  1 75  ? 8.393    82.599  30.116  1.00 21.37 ? 67   VAL B C   1 
ATOM   2634  O  O   . VAL B  1 75  ? 9.129    83.553  29.926  1.00 22.47 ? 67   VAL B O   1 
ATOM   2635  C  CB  . VAL B  1 75  ? 9.385    80.714  28.781  1.00 21.01 ? 67   VAL B CB  1 
ATOM   2636  C  CG1 . VAL B  1 75  ? 9.760    79.942  30.088  1.00 18.84 ? 67   VAL B CG1 1 
ATOM   2637  C  CG2 . VAL B  1 75  ? 9.130    79.789  27.623  1.00 16.65 ? 67   VAL B CG2 1 
ATOM   2638  N  N   . MET B  1 76  ? 7.718    82.431  31.249  1.00 21.46 ? 68   MET B N   1 
ATOM   2639  C  CA  . MET B  1 76  ? 7.923    83.316  32.403  1.00 22.01 ? 68   MET B CA  1 
ATOM   2640  C  C   . MET B  1 76  ? 8.467    82.543  33.594  1.00 21.79 ? 68   MET B C   1 
ATOM   2641  O  O   . MET B  1 76  ? 8.488    81.305  33.605  1.00 20.68 ? 68   MET B O   1 
ATOM   2642  C  CB  . MET B  1 76  ? 6.612    84.023  32.808  1.00 22.50 ? 68   MET B CB  1 
ATOM   2643  C  CG  . MET B  1 76  ? 5.523    83.139  33.382  1.00 23.87 ? 68   MET B CG  1 
ATOM   2644  S  SD  . MET B  1 76  ? 4.064    84.123  33.817  1.00 27.11 ? 68   MET B SD  1 
ATOM   2645  C  CE  . MET B  1 76  ? 3.367    83.065  35.063  1.00 32.21 ? 68   MET B CE  1 
ATOM   2646  N  N   . ALA B  1 77  ? 8.894    83.294  34.598  1.00 21.69 ? 69   ALA B N   1 
ATOM   2647  C  CA  . ALA B  1 77  ? 9.460    82.709  35.831  1.00 22.47 ? 69   ALA B CA  1 
ATOM   2648  C  C   . ALA B  1 77  ? 8.366    82.029  36.663  1.00 23.43 ? 69   ALA B C   1 
ATOM   2649  O  O   . ALA B  1 77  ? 7.217    82.436  36.588  1.00 23.05 ? 69   ALA B O   1 
ATOM   2650  C  CB  . ALA B  1 77  ? 10.126   83.765  36.649  1.00 21.15 ? 69   ALA B CB  1 
ATOM   2651  N  N   . ARG B  1 78  ? 8.726    81.017  37.472  1.00 24.62 ? 70   ARG B N   1 
ATOM   2652  C  CA  . ARG B  1 78  ? 7.768    80.424  38.414  1.00 25.90 ? 70   ARG B CA  1 
ATOM   2653  C  C   . ARG B  1 78  ? 7.405    81.386  39.505  1.00 26.27 ? 70   ARG B C   1 
ATOM   2654  O  O   . ARG B  1 78  ? 6.356    81.280  40.053  1.00 26.69 ? 70   ARG B O   1 
ATOM   2655  C  CB  . ARG B  1 78  ? 8.300    79.172  39.091  1.00 26.14 ? 70   ARG B CB  1 
ATOM   2656  C  CG  . ARG B  1 78  ? 8.707    78.088  38.119  1.00 27.43 ? 70   ARG B CG  1 
ATOM   2657  C  CD  . ARG B  1 78  ? 9.177    76.854  38.831  1.00 26.69 ? 70   ARG B CD  1 
ATOM   2658  N  NE  . ARG B  1 78  ? 10.280   77.134  39.732  1.00 26.69 ? 70   ARG B NE  1 
ATOM   2659  C  CZ  . ARG B  1 78  ? 10.887   76.203  40.462  1.00 28.05 ? 70   ARG B CZ  1 
ATOM   2660  N  NH1 . ARG B  1 78  ? 10.521   74.943  40.351  1.00 29.72 ? 70   ARG B NH1 1 
ATOM   2661  N  NH2 . ARG B  1 78  ? 11.870   76.520  41.290  1.00 27.73 ? 70   ARG B NH2 1 
ATOM   2662  N  N   . ARG B  1 79  ? 8.289    82.309  39.818  1.00 27.17 ? 71   ARG B N   1 
ATOM   2663  C  CA  . ARG B  1 79  ? 8.085    83.257  40.902  1.00 28.39 ? 71   ARG B CA  1 
ATOM   2664  C  C   . ARG B  1 79  ? 9.081    84.391  40.709  1.00 28.02 ? 71   ARG B C   1 
ATOM   2665  O  O   . ARG B  1 79  ? 10.040   84.229  39.953  1.00 26.46 ? 71   ARG B O   1 
ATOM   2666  C  CB  . ARG B  1 79  ? 8.340    82.571  42.244  1.00 28.65 ? 71   ARG B CB  1 
ATOM   2667  C  CG  . ARG B  1 79  ? 9.750    82.032  42.391  1.00 31.48 ? 71   ARG B CG  1 
ATOM   2668  C  CD  . ARG B  1 79  ? 10.044   81.483  43.808  1.00 34.21 ? 71   ARG B CD  1 
ATOM   2669  N  NE  . ARG B  1 79  ? 9.011    80.546  44.170  1.00 38.74 ? 71   ARG B NE  1 
ATOM   2670  C  CZ  . ARG B  1 79  ? 8.892    79.300  43.694  1.00 43.25 ? 71   ARG B CZ  1 
ATOM   2671  N  NH1 . ARG B  1 79  ? 7.865    78.546  44.088  1.00 44.01 ? 71   ARG B NH1 1 
ATOM   2672  N  NH2 . ARG B  1 79  ? 9.768    78.785  42.825  1.00 43.32 ? 71   ARG B NH2 1 
ATOM   2673  N  N   . LYS B  1 80  ? 8.890    85.506  41.399  1.00 28.83 ? 72   LYS B N   1 
ATOM   2674  C  CA  . LYS B  1 80  ? 9.635    86.706  41.091  1.00 30.54 ? 72   LYS B CA  1 
ATOM   2675  C  C   . LYS B  1 80  ? 11.159   86.530  41.188  1.00 29.67 ? 72   LYS B C   1 
ATOM   2676  O  O   . LYS B  1 80  ? 11.885   86.978  40.324  1.00 28.49 ? 72   LYS B O   1 
ATOM   2677  C  CB  . LYS B  1 80  ? 9.178    87.863  41.959  1.00 32.15 ? 72   LYS B CB  1 
ATOM   2678  C  CG  . LYS B  1 80  ? 9.992    89.181  41.729  1.00 38.71 ? 72   LYS B CG  1 
ATOM   2679  C  CD  . LYS B  1 80  ? 9.361    90.390  42.448  1.00 47.13 ? 72   LYS B CD  1 
ATOM   2680  C  CE  . LYS B  1 80  ? 10.102   91.716  42.140  1.00 52.07 ? 72   LYS B CE  1 
ATOM   2681  N  NZ  . LYS B  1 80  ? 9.295    92.942  42.525  1.00 55.36 ? 72   LYS B NZ  1 
ATOM   2682  N  N   . GLU B  1 81  ? 11.614   85.891  42.243  1.00 29.87 ? 73   GLU B N   1 
ATOM   2683  C  CA  . GLU B  1 81  ? 13.052   85.671  42.508  1.00 31.67 ? 73   GLU B CA  1 
ATOM   2684  C  C   . GLU B  1 81  ? 13.774   84.886  41.409  1.00 29.86 ? 73   GLU B C   1 
ATOM   2685  O  O   . GLU B  1 81  ? 15.004   84.977  41.318  1.00 30.01 ? 73   GLU B O   1 
ATOM   2686  C  CB  . GLU B  1 81  ? 13.308   84.888  43.834  1.00 33.31 ? 73   GLU B CB  1 
ATOM   2687  C  CG  . GLU B  1 81  ? 12.586   85.460  45.119  1.00 39.70 ? 73   GLU B CG  1 
ATOM   2688  C  CD  . GLU B  1 81  ? 11.116   84.869  45.315  1.00 47.48 ? 73   GLU B CD  1 
ATOM   2689  O  OE1 . GLU B  1 81  ? 10.157   85.193  44.538  1.00 43.77 ? 73   GLU B OE1 1 
ATOM   2690  O  OE2 . GLU B  1 81  ? 10.943   84.039  46.263  1.00 55.47 ? 73   GLU B OE2 1 
ATOM   2691  N  N   . GLU B  1 82  ? 13.037   84.125  40.606  1.00 26.57 ? 74   GLU B N   1 
ATOM   2692  C  CA  . GLU B  1 82  ? 13.635   83.385  39.517  1.00 25.18 ? 74   GLU B CA  1 
ATOM   2693  C  C   . GLU B  1 82  ? 13.630   84.182  38.201  1.00 24.32 ? 74   GLU B C   1 
ATOM   2694  O  O   . GLU B  1 82  ? 14.019   83.637  37.164  1.00 22.59 ? 74   GLU B O   1 
ATOM   2695  C  CB  . GLU B  1 82  ? 12.936   82.013  39.339  1.00 25.22 ? 74   GLU B CB  1 
ATOM   2696  C  CG  . GLU B  1 82  ? 13.074   81.158  40.587  1.00 25.04 ? 74   GLU B CG  1 
ATOM   2697  C  CD  . GLU B  1 82  ? 12.321   79.859  40.588  1.00 25.26 ? 74   GLU B CD  1 
ATOM   2698  O  OE1 . GLU B  1 82  ? 11.871   79.372  39.529  1.00 27.77 ? 74   GLU B OE1 1 
ATOM   2699  O  OE2 . GLU B  1 82  ? 12.188   79.288  41.682  1.00 25.16 ? 74   GLU B OE2 1 
ATOM   2700  N  N   . GLU B  1 83  ? 13.236   85.460  38.242  1.00 23.34 ? 75   GLU B N   1 
ATOM   2701  C  CA  . GLU B  1 83  ? 13.193   86.284  37.017  1.00 23.77 ? 75   GLU B CA  1 
ATOM   2702  C  C   . GLU B  1 83  ? 14.580   86.688  36.493  1.00 22.47 ? 75   GLU B C   1 
ATOM   2703  O  O   . GLU B  1 83  ? 14.860   86.564  35.307  1.00 21.25 ? 75   GLU B O   1 
ATOM   2704  C  CB  . GLU B  1 83  ? 12.300   87.519  37.169  1.00 23.73 ? 75   GLU B CB  1 
ATOM   2705  C  CG  . GLU B  1 83  ? 10.843   87.196  37.106  1.00 27.81 ? 75   GLU B CG  1 
ATOM   2706  C  CD  . GLU B  1 83  ? 9.910    88.418  37.300  1.00 31.84 ? 75   GLU B CD  1 
ATOM   2707  O  OE1 . GLU B  1 83  ? 10.277   89.557  36.973  1.00 30.34 ? 75   GLU B OE1 1 
ATOM   2708  O  OE2 . GLU B  1 83  ? 8.790    88.214  37.794  1.00 36.14 ? 75   GLU B OE2 1 
ATOM   2709  N  N   . ILE B  1 84  ? 15.426   87.177  37.377  1.00 22.46 ? 76   ILE B N   1 
ATOM   2710  C  CA  . ILE B  1 84  ? 16.723   87.654  36.985  1.00 21.85 ? 76   ILE B CA  1 
ATOM   2711  C  C   . ILE B  1 84  ? 17.500   86.565  36.259  1.00 21.89 ? 76   ILE B C   1 
ATOM   2712  O  O   . ILE B  1 84  ? 17.930   86.784  35.126  1.00 21.80 ? 76   ILE B O   1 
ATOM   2713  C  CB  . ILE B  1 84  ? 17.481   88.345  38.118  1.00 22.18 ? 76   ILE B CB  1 
ATOM   2714  C  CG1 . ILE B  1 84  ? 16.760   89.695  38.495  1.00 23.41 ? 76   ILE B CG1 1 
ATOM   2715  C  CG2 . ILE B  1 84  ? 18.899   88.703  37.655  1.00 19.10 ? 76   ILE B CG2 1 
ATOM   2716  C  CD1 . ILE B  1 84  ? 17.262   90.412  39.813  1.00 19.11 ? 76   ILE B CD1 1 
ATOM   2717  N  N   . PRO B  1 85  ? 17.585   85.362  36.833  1.00 22.29 ? 77   PRO B N   1 
ATOM   2718  C  CA  . PRO B  1 85  ? 18.340   84.301  36.115  1.00 21.67 ? 77   PRO B CA  1 
ATOM   2719  C  C   . PRO B  1 85  ? 17.717   83.866  34.819  1.00 21.53 ? 77   PRO B C   1 
ATOM   2720  O  O   . PRO B  1 85  ? 18.439   83.577  33.845  1.00 21.03 ? 77   PRO B O   1 
ATOM   2721  C  CB  . PRO B  1 85  ? 18.357   83.120  37.103  1.00 22.74 ? 77   PRO B CB  1 
ATOM   2722  C  CG  . PRO B  1 85  ? 17.198   83.436  38.138  1.00 22.74 ? 77   PRO B CG  1 
ATOM   2723  C  CD  . PRO B  1 85  ? 17.081   84.930  38.162  1.00 22.07 ? 77   PRO B CD  1 
ATOM   2724  N  N   . LEU B  1 86  ? 16.384   83.797  34.777  1.00 21.58 ? 78   LEU B N   1 
ATOM   2725  C  CA  . LEU B  1 86  ? 15.677   83.478  33.511  1.00 20.98 ? 78   LEU B CA  1 
ATOM   2726  C  C   . LEU B  1 86  ? 16.056   84.452  32.397  1.00 20.99 ? 78   LEU B C   1 
ATOM   2727  O  O   . LEU B  1 86  ? 16.338   84.049  31.269  1.00 20.85 ? 78   LEU B O   1 
ATOM   2728  C  CB  . LEU B  1 86  ? 14.194   83.535  33.715  1.00 20.63 ? 78   LEU B CB  1 
ATOM   2729  C  CG  . LEU B  1 86  ? 13.319   83.396  32.491  1.00 20.34 ? 78   LEU B CG  1 
ATOM   2730  C  CD1 . LEU B  1 86  ? 13.518   82.017  31.899  1.00 15.19 ? 78   LEU B CD1 1 
ATOM   2731  C  CD2 . LEU B  1 86  ? 11.858   83.626  32.883  1.00 18.49 ? 78   LEU B CD2 1 
ATOM   2732  N  N   . MET B  1 87  ? 16.059   85.733  32.735  1.00 20.95 ? 79   MET B N   1 
ATOM   2733  C  CA  . MET B  1 87  ? 16.239   86.782  31.756  1.00 21.42 ? 79   MET B CA  1 
ATOM   2734  C  C   . MET B  1 87  ? 17.718   87.006  31.455  1.00 21.32 ? 79   MET B C   1 
ATOM   2735  O  O   . MET B  1 87  ? 18.041   87.399  30.365  1.00 21.35 ? 79   MET B O   1 
ATOM   2736  C  CB  . MET B  1 87  ? 15.627   88.097  32.269  1.00 21.27 ? 79   MET B CB  1 
ATOM   2737  C  CG  . MET B  1 87  ? 14.096   88.098  32.293  1.00 23.71 ? 79   MET B CG  1 
ATOM   2738  S  SD  . MET B  1 87  ? 13.309   87.742  30.721  1.00 23.32 ? 79   MET B SD  1 
ATOM   2739  C  CE  . MET B  1 87  ? 13.733   89.233  29.835  1.00 22.95 ? 79   MET B CE  1 
ATOM   2740  N  N   . THR B  1 88  ? 18.606   86.766  32.426  1.00 21.03 ? 80   THR B N   1 
ATOM   2741  C  CA  . THR B  1 88  ? 20.019   87.011  32.221  1.00 20.61 ? 80   THR B CA  1 
ATOM   2742  C  C   . THR B  1 88  ? 20.726   85.837  31.524  1.00 20.91 ? 80   THR B C   1 
ATOM   2743  O  O   . THR B  1 88  ? 21.530   86.035  30.606  1.00 21.01 ? 80   THR B O   1 
ATOM   2744  C  CB  . THR B  1 88  ? 20.677   87.347  33.537  1.00 21.34 ? 80   THR B CB  1 
ATOM   2745  O  OG1 . THR B  1 88  ? 19.994   88.474  34.086  1.00 21.51 ? 80   THR B OG1 1 
ATOM   2746  C  CG2 . THR B  1 88  ? 22.162   87.654  33.370  1.00 17.59 ? 80   THR B CG2 1 
ATOM   2747  N  N   . LEU B  1 89  ? 20.435   84.609  31.934  1.00 20.71 ? 81   LEU B N   1 
ATOM   2748  C  CA  . LEU B  1 89  ? 21.213   83.483  31.432  1.00 20.36 ? 81   LEU B CA  1 
ATOM   2749  C  C   . LEU B  1 89  ? 20.713   82.899  30.140  1.00 20.54 ? 81   LEU B C   1 
ATOM   2750  O  O   . LEU B  1 89  ? 21.483   82.252  29.467  1.00 20.34 ? 81   LEU B O   1 
ATOM   2751  C  CB  . LEU B  1 89  ? 21.298   82.380  32.475  1.00 21.25 ? 81   LEU B CB  1 
ATOM   2752  C  CG  . LEU B  1 89  ? 21.850   82.782  33.857  1.00 22.18 ? 81   LEU B CG  1 
ATOM   2753  C  CD1 . LEU B  1 89  ? 21.816   81.549  34.757  1.00 20.57 ? 81   LEU B CD1 1 
ATOM   2754  C  CD2 . LEU B  1 89  ? 23.244   83.346  33.716  1.00 21.30 ? 81   LEU B CD2 1 
ATOM   2755  N  N   . SER B  1 90  ? 19.423   83.073  29.816  1.00 20.10 ? 82   SER B N   1 
ATOM   2756  C  CA  . SER B  1 90  ? 18.837   82.551  28.593  1.00 19.10 ? 82   SER B CA  1 
ATOM   2757  C  C   . SER B  1 90  ? 19.379   83.306  27.378  1.00 18.74 ? 82   SER B C   1 
ATOM   2758  O  O   . SER B  1 90  ? 19.240   84.535  27.299  1.00 18.37 ? 82   SER B O   1 
ATOM   2759  C  CB  . SER B  1 90  ? 17.311   82.714  28.647  1.00 19.39 ? 82   SER B CB  1 
ATOM   2760  O  OG  . SER B  1 90  ? 16.742   81.898  29.667  1.00 20.03 ? 82   SER B OG  1 
ATOM   2761  N  N   . CYS B  1 91  ? 19.979   82.578  26.439  1.00 18.36 ? 83   CYS B N   1 
ATOM   2762  C  CA  . CYS B  1 91  ? 20.567   83.169  25.241  1.00 18.97 ? 83   CYS B CA  1 
ATOM   2763  C  C   . CYS B  1 91  ? 19.856   82.697  23.965  1.00 19.00 ? 83   CYS B C   1 
ATOM   2764  O  O   . CYS B  1 91  ? 19.375   81.574  23.867  1.00 19.40 ? 83   CYS B O   1 
ATOM   2765  C  CB  . CYS B  1 91  ? 22.071   82.834  25.157  1.00 18.97 ? 83   CYS B CB  1 
ATOM   2766  S  SG  . CYS B  1 91  ? 23.150   83.563  26.440  1.00 19.01 ? 83   CYS B SG  1 
ATOM   2767  N  N   . ILE B  1 92  ? 19.817   83.562  22.977  1.00 19.52 ? 84   ILE B N   1 
ATOM   2768  C  CA  . ILE B  1 92  ? 19.219   83.270  21.682  1.00 19.48 ? 84   ILE B CA  1 
ATOM   2769  C  C   . ILE B  1 92  ? 19.921   82.106  21.051  1.00 20.14 ? 84   ILE B C   1 
ATOM   2770  O  O   . ILE B  1 92  ? 21.146   82.085  20.958  1.00 19.76 ? 84   ILE B O   1 
ATOM   2771  C  CB  . ILE B  1 92  ? 19.271   84.493  20.761  1.00 19.88 ? 84   ILE B CB  1 
ATOM   2772  C  CG1 . ILE B  1 92  ? 18.419   85.621  21.404  1.00 19.49 ? 84   ILE B CG1 1 
ATOM   2773  C  CG2 . ILE B  1 92  ? 18.750   84.085  19.360  1.00 17.65 ? 84   ILE B CG2 1 
ATOM   2774  C  CD1 . ILE B  1 92  ? 18.538   86.947  20.753  1.00 19.75 ? 84   ILE B CD1 1 
ATOM   2775  N  N   . GLY B  1 93  ? 19.144   81.090  20.703  1.00 20.66 ? 85   GLY B N   1 
ATOM   2776  C  CA  . GLY B  1 93  ? 19.694   79.825  20.192  1.00 21.72 ? 85   GLY B CA  1 
ATOM   2777  C  C   . GLY B  1 93  ? 19.754   78.660  21.175  1.00 22.30 ? 85   GLY B C   1 
ATOM   2778  O  O   . GLY B  1 93  ? 19.875   77.509  20.782  1.00 22.57 ? 85   GLY B O   1 
ATOM   2779  N  N   . ASN B  1 94  ? 19.656   78.949  22.458  1.00 23.03 ? 86   ASN B N   1 
ATOM   2780  C  CA  . ASN B  1 94  ? 19.728   77.891  23.459  1.00 23.48 ? 86   ASN B CA  1 
ATOM   2781  C  C   . ASN B  1 94  ? 18.627   76.836  23.299  1.00 24.01 ? 86   ASN B C   1 
ATOM   2782  O  O   . ASN B  1 94  ? 17.493   77.129  23.022  1.00 24.40 ? 86   ASN B O   1 
ATOM   2783  C  CB  . ASN B  1 94  ? 19.673   78.453  24.871  1.00 22.57 ? 86   ASN B CB  1 
ATOM   2784  C  CG  . ASN B  1 94  ? 20.960   79.114  25.326  1.00 22.00 ? 86   ASN B CG  1 
ATOM   2785  O  OD1 . ASN B  1 94  ? 20.957   79.840  26.337  1.00 18.93 ? 86   ASN B OD1 1 
ATOM   2786  N  ND2 . ASN B  1 94  ? 22.059   78.863  24.625  1.00 17.08 ? 86   ASN B ND2 1 
ATOM   2787  N  N   . GLU B  1 95  ? 18.983   75.594  23.549  1.00 25.38 ? 87   GLU B N   1 
ATOM   2788  C  CA  . GLU B  1 95  ? 18.040   74.499  23.523  1.00 26.86 ? 87   GLU B CA  1 
ATOM   2789  C  C   . GLU B  1 95  ? 16.978   74.640  24.633  1.00 25.74 ? 87   GLU B C   1 
ATOM   2790  O  O   . GLU B  1 95  ? 17.286   75.015  25.758  1.00 24.18 ? 87   GLU B O   1 
ATOM   2791  C  CB  . GLU B  1 95  ? 18.827   73.221  23.681  1.00 28.14 ? 87   GLU B CB  1 
ATOM   2792  C  CG  . GLU B  1 95  ? 18.015   71.948  23.476  1.00 35.58 ? 87   GLU B CG  1 
ATOM   2793  C  CD  . GLU B  1 95  ? 18.852   70.647  23.634  1.00 42.50 ? 87   GLU B CD  1 
ATOM   2794  O  OE1 . GLU B  1 95  ? 19.866   70.624  24.392  1.00 46.91 ? 87   GLU B OE1 1 
ATOM   2795  O  OE2 . GLU B  1 95  ? 18.471   69.660  22.976  1.00 48.95 ? 87   GLU B OE2 1 
ATOM   2796  N  N   . VAL B  1 96  ? 15.715   74.380  24.265  1.00 25.87 ? 88   VAL B N   1 
ATOM   2797  C  CA  . VAL B  1 96  ? 14.584   74.428  25.185  1.00 24.76 ? 88   VAL B CA  1 
ATOM   2798  C  C   . VAL B  1 96  ? 13.834   73.122  25.134  1.00 25.44 ? 88   VAL B C   1 
ATOM   2799  O  O   . VAL B  1 96  ? 13.586   72.627  24.071  1.00 25.46 ? 88   VAL B O   1 
ATOM   2800  C  CB  . VAL B  1 96  ? 13.628   75.562  24.837  1.00 24.76 ? 88   VAL B CB  1 
ATOM   2801  C  CG1 . VAL B  1 96  ? 12.527   75.643  25.899  1.00 21.75 ? 88   VAL B CG1 1 
ATOM   2802  C  CG2 . VAL B  1 96  ? 14.386   76.875  24.730  1.00 21.30 ? 88   VAL B CG2 1 
ATOM   2803  N  N   . ILE B  1 97  ? 13.508   72.547  26.282  1.00 25.85 ? 89   ILE B N   1 
ATOM   2804  C  CA  . ILE B  1 97  ? 12.794   71.277  26.340  1.00 26.81 ? 89   ILE B CA  1 
ATOM   2805  C  C   . ILE B  1 97  ? 11.538   71.412  27.194  1.00 26.37 ? 89   ILE B C   1 
ATOM   2806  O  O   . ILE B  1 97  ? 11.581   71.927  28.306  1.00 24.41 ? 89   ILE B O   1 
ATOM   2807  C  CB  . ILE B  1 97  ? 13.687   70.173  26.962  1.00 28.14 ? 89   ILE B CB  1 
ATOM   2808  C  CG1 . ILE B  1 97  ? 15.004   70.105  26.198  1.00 30.49 ? 89   ILE B CG1 1 
ATOM   2809  C  CG2 . ILE B  1 97  ? 13.004   68.767  26.908  1.00 27.40 ? 89   ILE B CG2 1 
ATOM   2810  C  CD1 . ILE B  1 97  ? 16.193   70.261  27.071  1.00 33.74 ? 89   ILE B CD1 1 
ATOM   2811  N  N   . VAL B  1 98  ? 10.416   70.958  26.650  1.00 27.64 ? 90   VAL B N   1 
ATOM   2812  C  CA  . VAL B  1 98  ? 9.137    70.936  27.387  1.00 27.45 ? 90   VAL B CA  1 
ATOM   2813  C  C   . VAL B  1 98  ? 9.212    69.785  28.393  1.00 28.80 ? 90   VAL B C   1 
ATOM   2814  O  O   . VAL B  1 98  ? 9.577    68.646  28.042  1.00 29.12 ? 90   VAL B O   1 
ATOM   2815  C  CB  . VAL B  1 98  ? 7.940    70.735  26.459  1.00 27.57 ? 90   VAL B CB  1 
ATOM   2816  C  CG1 . VAL B  1 98  ? 6.629    70.689  27.282  1.00 25.59 ? 90   VAL B CG1 1 
ATOM   2817  C  CG2 . VAL B  1 98  ? 7.903    71.834  25.384  1.00 24.78 ? 90   VAL B CG2 1 
ATOM   2818  N  N   . MET B  1 99  ? 8.902    70.095  29.642  1.00 29.34 ? 91   MET B N   1 
ATOM   2819  C  CA  . MET B  1 99  ? 9.110    69.178  30.729  1.00 30.76 ? 91   MET B CA  1 
ATOM   2820  C  C   . MET B  1 99  ? 7.842    68.714  31.432  1.00 31.18 ? 91   MET B C   1 
ATOM   2821  O  O   . MET B  1 99  ? 7.941    67.895  32.333  1.00 32.17 ? 91   MET B O   1 
ATOM   2822  C  CB  . MET B  1 99  ? 10.095   69.795  31.727  1.00 31.10 ? 91   MET B CB  1 
ATOM   2823  C  CG  . MET B  1 99  ? 11.542   69.832  31.193  1.00 33.43 ? 91   MET B CG  1 
ATOM   2824  S  SD  . MET B  1 99  ? 12.284   68.233  30.777  1.00 41.24 ? 91   MET B SD  1 
ATOM   2825  C  CE  . MET B  1 99  ? 12.723   67.536  32.323  1.00 35.90 ? 91   MET B CE  1 
ATOM   2826  N  N   . SER B  1 100 ? 6.669    69.198  31.014  1.00 31.13 ? 92   SER B N   1 
ATOM   2827  C  CA  . SER B  1 100 ? 5.394    68.649  31.459  1.00 31.07 ? 92   SER B CA  1 
ATOM   2828  C  C   . SER B  1 100 ? 4.331    68.863  30.428  1.00 31.98 ? 92   SER B C   1 
ATOM   2829  O  O   . SER B  1 100 ? 4.558    69.566  29.452  1.00 32.14 ? 92   SER B O   1 
ATOM   2830  C  CB  . SER B  1 100 ? 4.954    69.282  32.750  1.00 30.42 ? 92   SER B CB  1 
ATOM   2831  O  OG  . SER B  1 100 ? 4.484    70.569  32.516  1.00 28.05 ? 92   SER B OG  1 
ATOM   2832  N  N   . GLY B  1 101 ? 3.172    68.234  30.636  1.00 33.13 ? 93   GLY B N   1 
ATOM   2833  C  CA  . GLY B  1 101 ? 2.036    68.285  29.697  1.00 33.62 ? 93   GLY B CA  1 
ATOM   2834  C  C   . GLY B  1 101 ? 2.136    67.391  28.469  1.00 34.73 ? 93   GLY B C   1 
ATOM   2835  O  O   . GLY B  1 101 ? 3.015    66.541  28.362  1.00 33.99 ? 93   GLY B O   1 
ATOM   2836  N  N   . ASP B  1 102 ? 1.271    67.629  27.492  1.00 36.17 ? 94   ASP B N   1 
ATOM   2837  C  CA  . ASP B  1 102 ? 1.207    66.730  26.353  1.00 38.21 ? 94   ASP B CA  1 
ATOM   2838  C  C   . ASP B  1 102 ? 2.371    66.762  25.400  1.00 38.13 ? 94   ASP B C   1 
ATOM   2839  O  O   . ASP B  1 102 ? 2.533    65.827  24.640  1.00 39.56 ? 94   ASP B O   1 
ATOM   2840  C  CB  . ASP B  1 102 ? -0.064   66.967  25.562  1.00 39.75 ? 94   ASP B CB  1 
ATOM   2841  C  CG  . ASP B  1 102 ? -1.304   66.717  26.381  1.00 43.28 ? 94   ASP B CG  1 
ATOM   2842  O  OD1 . ASP B  1 102 ? -1.289   65.778  27.201  1.00 47.15 ? 94   ASP B OD1 1 
ATOM   2843  O  OD2 . ASP B  1 102 ? -2.281   67.487  26.229  1.00 50.48 ? 94   ASP B OD2 1 
ATOM   2844  N  N   . ALA B  1 103 ? 3.153    67.840  25.404  1.00 37.27 ? 95   ALA B N   1 
ATOM   2845  C  CA  . ALA B  1 103 ? 4.296    67.995  24.489  1.00 36.52 ? 95   ALA B CA  1 
ATOM   2846  C  C   . ALA B  1 103 ? 5.625    67.705  25.204  1.00 35.92 ? 95   ALA B C   1 
ATOM   2847  O  O   . ALA B  1 103 ? 6.708    68.059  24.753  1.00 35.31 ? 95   ALA B O   1 
ATOM   2848  C  CB  . ALA B  1 103 ? 4.285    69.409  23.871  1.00 35.74 ? 95   ALA B CB  1 
ATOM   2849  N  N   . LYS B  1 104 ? 5.520    67.039  26.333  1.00 36.10 ? 96   LYS B N   1 
ATOM   2850  C  CA  . LYS B  1 104 ? 6.682    66.698  27.133  1.00 36.47 ? 96   LYS B CA  1 
ATOM   2851  C  C   . LYS B  1 104 ? 7.732    66.027  26.277  1.00 35.57 ? 96   LYS B C   1 
ATOM   2852  O  O   . LYS B  1 104 ? 7.413    65.111  25.554  1.00 34.13 ? 96   LYS B O   1 
ATOM   2853  C  CB  . LYS B  1 104 ? 6.259    65.718  28.210  1.00 37.19 ? 96   LYS B CB  1 
ATOM   2854  C  CG  . LYS B  1 104 ? 7.294    65.515  29.262  1.00 40.48 ? 96   LYS B CG  1 
ATOM   2855  C  CD  . LYS B  1 104 ? 6.703    64.714  30.420  1.00 44.72 ? 96   LYS B CD  1 
ATOM   2856  C  CE  . LYS B  1 104 ? 7.786    64.376  31.421  1.00 49.01 ? 96   LYS B CE  1 
ATOM   2857  N  NZ  . LYS B  1 104 ? 8.935    63.707  30.727  1.00 51.28 ? 96   LYS B NZ  1 
ATOM   2858  N  N   . GLY B  1 105 ? 8.974    66.471  26.387  1.00 34.99 ? 97   GLY B N   1 
ATOM   2859  C  CA  . GLY B  1 105 ? 10.076   65.932  25.572  1.00 34.17 ? 97   GLY B CA  1 
ATOM   2860  C  C   . GLY B  1 105 ? 10.335   66.697  24.275  1.00 33.62 ? 97   GLY B C   1 
ATOM   2861  O  O   . GLY B  1 105 ? 11.391   66.555  23.690  1.00 32.91 ? 97   GLY B O   1 
ATOM   2862  N  N   . SER B  1 106 ? 9.384    67.513  23.841  1.00 32.72 ? 98   SER B N   1 
ATOM   2863  C  CA  . SER B  1 106 ? 9.578    68.337  22.672  1.00 33.15 ? 98   SER B CA  1 
ATOM   2864  C  C   . SER B  1 106 ? 10.671   69.396  22.888  1.00 33.01 ? 98   SER B C   1 
ATOM   2865  O  O   . SER B  1 106 ? 10.775   69.981  23.957  1.00 31.73 ? 98   SER B O   1 
ATOM   2866  C  CB  . SER B  1 106 ? 8.272    69.033  22.315  1.00 33.35 ? 98   SER B CB  1 
ATOM   2867  O  OG  . SER B  1 106 ? 7.341    68.093  21.822  1.00 34.08 ? 98   SER B OG  1 
ATOM   2868  N  N   . ARG B  1 107 ? 11.454   69.640  21.847  1.00 33.56 ? 99   ARG B N   1 
ATOM   2869  C  CA  . ARG B  1 107 ? 12.606   70.506  21.911  1.00 34.49 ? 99   ARG B CA  1 
ATOM   2870  C  C   . ARG B  1 107 ? 12.411   71.716  21.043  1.00 32.58 ? 99   ARG B C   1 
ATOM   2871  O  O   . ARG B  1 107 ? 11.947   71.598  19.949  1.00 32.83 ? 99   ARG B O   1 
ATOM   2872  C  CB  . ARG B  1 107 ? 13.834   69.768  21.386  1.00 36.50 ? 99   ARG B CB  1 
ATOM   2873  C  CG  . ARG B  1 107 ? 14.166   68.565  22.229  1.00 44.32 ? 99   ARG B CG  1 
ATOM   2874  C  CD  . ARG B  1 107 ? 15.448   67.797  21.818  1.00 54.36 ? 99   ARG B CD  1 
ATOM   2875  N  NE  . ARG B  1 107 ? 15.726   66.761  22.837  1.00 61.97 ? 99   ARG B NE  1 
ATOM   2876  C  CZ  . ARG B  1 107 ? 16.430   66.946  23.963  1.00 66.47 ? 99   ARG B CZ  1 
ATOM   2877  N  NH1 . ARG B  1 107 ? 16.991   68.112  24.241  1.00 68.70 ? 99   ARG B NH1 1 
ATOM   2878  N  NH2 . ARG B  1 107 ? 16.591   65.949  24.816  1.00 68.15 ? 99   ARG B NH2 1 
ATOM   2879  N  N   . GLY B  1 108 ? 12.792   72.873  21.527  1.00 30.60 ? 100  GLY B N   1 
ATOM   2880  C  CA  . GLY B  1 108 ? 12.776   74.083  20.739  1.00 29.44 ? 100  GLY B CA  1 
ATOM   2881  C  C   . GLY B  1 108 ? 14.021   74.916  20.985  1.00 28.18 ? 100  GLY B C   1 
ATOM   2882  O  O   . GLY B  1 108 ? 14.992   74.406  21.554  1.00 26.94 ? 100  GLY B O   1 
ATOM   2883  N  N   . PHE B  1 109 ? 13.955   76.194  20.588  1.00 27.47 ? 101  PHE B N   1 
ATOM   2884  C  CA  . PHE B  1 109 ? 15.081   77.133  20.633  1.00 28.10 ? 101  PHE B CA  1 
ATOM   2885  C  C   . PHE B  1 109 ? 14.623   78.486  21.105  1.00 25.11 ? 101  PHE B C   1 
ATOM   2886  O  O   . PHE B  1 109 ? 13.601   78.949  20.677  1.00 24.17 ? 101  PHE B O   1 
ATOM   2887  C  CB  . PHE B  1 109 ? 15.685   77.349  19.217  1.00 30.10 ? 101  PHE B CB  1 
ATOM   2888  C  CG  . PHE B  1 109 ? 16.297   76.112  18.647  1.00 41.07 ? 101  PHE B CG  1 
ATOM   2889  C  CD1 . PHE B  1 109 ? 15.607   75.330  17.707  1.00 50.60 ? 101  PHE B CD1 1 
ATOM   2890  C  CD2 . PHE B  1 109 ? 17.562   75.663  19.093  1.00 50.13 ? 101  PHE B CD2 1 
ATOM   2891  C  CE1 . PHE B  1 109 ? 16.202   74.103  17.181  1.00 54.12 ? 101  PHE B CE1 1 
ATOM   2892  C  CE2 . PHE B  1 109 ? 18.171   74.458  18.561  1.00 53.79 ? 101  PHE B CE2 1 
ATOM   2893  C  CZ  . PHE B  1 109 ? 17.487   73.691  17.618  1.00 54.87 ? 101  PHE B CZ  1 
ATOM   2894  N  N   . VAL B  1 110 ? 15.445   79.161  21.902  1.00 22.82 ? 102  VAL B N   1 
ATOM   2895  C  CA  . VAL B  1 110 ? 15.187   80.526  22.301  1.00 20.64 ? 102  VAL B CA  1 
ATOM   2896  C  C   . VAL B  1 110 ? 15.357   81.457  21.111  1.00 20.75 ? 102  VAL B C   1 
ATOM   2897  O  O   . VAL B  1 110 ? 16.380   81.443  20.442  1.00 20.36 ? 102  VAL B O   1 
ATOM   2898  C  CB  . VAL B  1 110 ? 16.137   80.935  23.440  1.00 20.07 ? 102  VAL B CB  1 
ATOM   2899  C  CG1 . VAL B  1 110 ? 15.990   82.398  23.798  1.00 16.59 ? 102  VAL B CG1 1 
ATOM   2900  C  CG2 . VAL B  1 110 ? 15.911   80.029  24.653  1.00 17.05 ? 102  VAL B CG2 1 
ATOM   2901  N  N   . THR B  1 111 ? 14.358   82.292  20.863  1.00 20.52 ? 103  THR B N   1 
ATOM   2902  C  CA  . THR B  1 111 ? 14.438   83.269  19.794  1.00 20.27 ? 103  THR B CA  1 
ATOM   2903  C  C   . THR B  1 111 ? 14.773   84.662  20.272  1.00 20.03 ? 103  THR B C   1 
ATOM   2904  O  O   . THR B  1 111 ? 15.171   85.525  19.517  1.00 19.13 ? 103  THR B O   1 
ATOM   2905  C  CB  . THR B  1 111 ? 13.091   83.339  19.017  1.00 20.94 ? 103  THR B CB  1 
ATOM   2906  O  OG1 . THR B  1 111 ? 12.042   83.756  19.893  1.00 18.11 ? 103  THR B OG1 1 
ATOM   2907  C  CG2 . THR B  1 111 ? 12.771   81.988  18.419  1.00 18.85 ? 103  THR B CG2 1 
ATOM   2908  N  N   . GLY B  1 112 ? 14.536   84.898  21.535  1.00 20.38 ? 104  GLY B N   1 
ATOM   2909  C  CA  . GLY B  1 112 ? 14.591   86.248  22.052  1.00 19.99 ? 104  GLY B CA  1 
ATOM   2910  C  C   . GLY B  1 112 ? 14.097   86.316  23.470  1.00 19.77 ? 104  GLY B C   1 
ATOM   2911  O  O   . GLY B  1 112 ? 13.794   85.295  24.096  1.00 19.26 ? 104  GLY B O   1 
ATOM   2912  N  N   . LYS B  1 113 ? 14.052   87.528  23.986  1.00 20.10 ? 105  LYS B N   1 
ATOM   2913  C  CA  . LYS B  1 113 ? 13.585   87.754  25.327  1.00 20.13 ? 105  LYS B CA  1 
ATOM   2914  C  C   . LYS B  1 113 ? 13.156   89.170  25.460  1.00 20.91 ? 105  LYS B C   1 
ATOM   2915  O  O   . LYS B  1 113 ? 13.609   90.032  24.736  1.00 20.51 ? 105  LYS B O   1 
ATOM   2916  C  CB  . LYS B  1 113 ? 14.643   87.407  26.366  1.00 20.13 ? 105  LYS B CB  1 
ATOM   2917  C  CG  . LYS B  1 113 ? 15.965   88.194  26.339  1.00 19.97 ? 105  LYS B CG  1 
ATOM   2918  C  CD  . LYS B  1 113 ? 17.000   87.391  27.145  1.00 19.05 ? 105  LYS B CD  1 
ATOM   2919  C  CE  . LYS B  1 113 ? 18.408   87.924  27.117  1.00 19.66 ? 105  LYS B CE  1 
ATOM   2920  N  NZ  . LYS B  1 113 ? 19.341   87.206  28.085  1.00 14.81 ? 105  LYS B NZ  1 
ATOM   2921  N  N   . HIS B  1 114 ? 12.256   89.394  26.390  1.00 22.33 ? 106  HIS B N   1 
ATOM   2922  C  CA  . HIS B  1 114 ? 11.598   90.660  26.507  1.00 24.13 ? 106  HIS B CA  1 
ATOM   2923  C  C   . HIS B  1 114 ? 11.474   91.119  27.944  1.00 24.39 ? 106  HIS B C   1 
ATOM   2924  O  O   . HIS B  1 114 ? 10.883   90.420  28.778  1.00 24.29 ? 106  HIS B O   1 
ATOM   2925  C  CB  . HIS B  1 114 ? 10.207   90.527  25.894  1.00 25.20 ? 106  HIS B CB  1 
ATOM   2926  C  CG  . HIS B  1 114 ? 9.444    91.800  25.896  1.00 27.21 ? 106  HIS B CG  1 
ATOM   2927  N  ND1 . HIS B  1 114 ? 8.079    91.836  25.805  1.00 32.33 ? 106  HIS B ND1 1 
ATOM   2928  C  CD2 . HIS B  1 114 ? 9.858    93.079  26.003  1.00 27.47 ? 106  HIS B CD2 1 
ATOM   2929  C  CE1 . HIS B  1 114 ? 7.686    93.097  25.855  1.00 34.12 ? 106  HIS B CE1 1 
ATOM   2930  N  NE2 . HIS B  1 114 ? 8.749    93.866  25.983  1.00 30.30 ? 106  HIS B NE2 1 
ATOM   2931  N  N   . GLY B  1 115 ? 12.025   92.285  28.230  1.00 25.47 ? 107  GLY B N   1 
ATOM   2932  C  CA  . GLY B  1 115 ? 12.095   92.821  29.614  1.00 27.06 ? 107  GLY B CA  1 
ATOM   2933  C  C   . GLY B  1 115 ? 10.846   93.555  30.059  1.00 28.32 ? 107  GLY B C   1 
ATOM   2934  O  O   . GLY B  1 115 ? 10.030   93.916  29.242  1.00 30.38 ? 107  GLY B O   1 
ATOM   2935  N  N   . GLY B  1 116 ? 10.703   93.781  31.363  1.00 29.42 ? 108  GLY B N   1 
ATOM   2936  C  CA  . GLY B  1 116 ? 9.475    94.357  31.927  1.00 29.44 ? 108  GLY B CA  1 
ATOM   2937  C  C   . GLY B  1 116 ? 8.670    93.167  32.386  1.00 29.55 ? 108  GLY B C   1 
ATOM   2938  O  O   . GLY B  1 116 ? 8.802    92.735  33.513  1.00 30.78 ? 108  GLY B O   1 
ATOM   2939  N  N   . VAL B  1 117 ? 7.902    92.567  31.489  1.00 28.60 ? 109  VAL B N   1 
ATOM   2940  C  CA  . VAL B  1 117 ? 7.182    91.359  31.840  1.00 27.68 ? 109  VAL B CA  1 
ATOM   2941  C  C   . VAL B  1 117 ? 8.106    90.160  32.035  1.00 26.48 ? 109  VAL B C   1 
ATOM   2942  O  O   . VAL B  1 117 ? 7.752    89.206  32.729  1.00 26.25 ? 109  VAL B O   1 
ATOM   2943  C  CB  . VAL B  1 117 ? 6.135    91.018  30.795  1.00 28.52 ? 109  VAL B CB  1 
ATOM   2944  C  CG1 . VAL B  1 117 ? 5.235    92.226  30.607  1.00 31.12 ? 109  VAL B CG1 1 
ATOM   2945  C  CG2 . VAL B  1 117 ? 6.798    90.605  29.459  1.00 27.62 ? 109  VAL B CG2 1 
ATOM   2946  N  N   . ASN B  1 118 ? 9.287    90.224  31.425  1.00 25.09 ? 110  ASN B N   1 
ATOM   2947  C  CA  . ASN B  1 118 ? 10.323   89.254  31.629  1.00 23.41 ? 110  ASN B CA  1 
ATOM   2948  C  C   . ASN B  1 118 ? 9.954    87.908  31.113  1.00 22.69 ? 110  ASN B C   1 
ATOM   2949  O  O   . ASN B  1 118 ? 9.816    86.930  31.848  1.00 22.57 ? 110  ASN B O   1 
ATOM   2950  C  CB  . ASN B  1 118 ? 10.751   89.212  33.076  1.00 23.42 ? 110  ASN B CB  1 
ATOM   2951  C  CG  . ASN B  1 118 ? 11.535   90.451  33.451  1.00 25.42 ? 110  ASN B CG  1 
ATOM   2952  O  OD1 . ASN B  1 118 ? 12.169   91.083  32.591  1.00 25.09 ? 110  ASN B OD1 1 
ATOM   2953  N  ND2 . ASN B  1 118 ? 11.517   90.798  34.724  1.00 22.31 ? 110  ASN B ND2 1 
ATOM   2954  N  N   . HIS B  1 119 ? 9.804    87.874  29.812  1.00 21.70 ? 111  HIS B N   1 
ATOM   2955  C  CA  . HIS B  1 119 ? 9.562    86.649  29.113  1.00 21.45 ? 111  HIS B CA  1 
ATOM   2956  C  C   . HIS B  1 119 ? 10.769   86.245  28.280  1.00 20.68 ? 111  HIS B C   1 
ATOM   2957  O  O   . HIS B  1 119 ? 11.406   87.084  27.656  1.00 20.16 ? 111  HIS B O   1 
ATOM   2958  C  CB  . HIS B  1 119 ? 8.370    86.837  28.196  1.00 21.55 ? 111  HIS B CB  1 
ATOM   2959  C  CG  . HIS B  1 119 ? 7.071    86.983  28.922  1.00 23.42 ? 111  HIS B CG  1 
ATOM   2960  N  ND1 . HIS B  1 119 ? 5.903    87.330  28.281  1.00 22.20 ? 111  HIS B ND1 1 
ATOM   2961  C  CD2 . HIS B  1 119 ? 6.749    86.812  30.235  1.00 24.92 ? 111  HIS B CD2 1 
ATOM   2962  C  CE1 . HIS B  1 119 ? 4.917    87.371  29.171  1.00 25.71 ? 111  HIS B CE1 1 
ATOM   2963  N  NE2 . HIS B  1 119 ? 5.409    87.085  30.366  1.00 24.82 ? 111  HIS B NE2 1 
ATOM   2964  N  N   . VAL B  1 120 ? 11.060   84.954  28.273  1.00 20.24 ? 112  VAL B N   1 
ATOM   2965  C  CA  . VAL B  1 120 ? 11.914   84.361  27.263  1.00 19.77 ? 112  VAL B CA  1 
ATOM   2966  C  C   . VAL B  1 120 ? 11.026   83.751  26.175  1.00 20.44 ? 112  VAL B C   1 
ATOM   2967  O  O   . VAL B  1 120 ? 10.033   83.126  26.469  1.00 20.50 ? 112  VAL B O   1 
ATOM   2968  C  CB  . VAL B  1 120 ? 12.880   83.306  27.874  1.00 19.44 ? 112  VAL B CB  1 
ATOM   2969  C  CG1 . VAL B  1 120 ? 13.632   82.578  26.776  1.00 18.00 ? 112  VAL B CG1 1 
ATOM   2970  C  CG2 . VAL B  1 120 ? 13.837   83.970  28.865  1.00 16.36 ? 112  VAL B CG2 1 
ATOM   2971  N  N   . LEU B  1 121 ? 11.415   83.932  24.918  1.00 20.63 ? 113  LEU B N   1 
ATOM   2972  C  CA  . LEU B  1 121 ? 10.587   83.628  23.771  1.00 20.38 ? 113  LEU B CA  1 
ATOM   2973  C  C   . LEU B  1 121 ? 11.182   82.442  23.075  1.00 20.97 ? 113  LEU B C   1 
ATOM   2974  O  O   . LEU B  1 121 ? 12.372   82.452  22.831  1.00 21.63 ? 113  LEU B O   1 
ATOM   2975  C  CB  . LEU B  1 121 ? 10.546   84.845  22.860  1.00 20.20 ? 113  LEU B CB  1 
ATOM   2976  C  CG  . LEU B  1 121 ? 10.094   86.151  23.564  1.00 19.54 ? 113  LEU B CG  1 
ATOM   2977  C  CD1 . LEU B  1 121 ? 9.861    87.300  22.574  1.00 16.98 ? 113  LEU B CD1 1 
ATOM   2978  C  CD2 . LEU B  1 121 ? 8.831    85.875  24.413  1.00 17.91 ? 113  LEU B CD2 1 
ATOM   2979  N  N   . VAL B  1 122 ? 10.361   81.435  22.757  1.00 21.28 ? 114  VAL B N   1 
ATOM   2980  C  CA  . VAL B  1 122 ? 10.826   80.147  22.274  1.00 22.03 ? 114  VAL B CA  1 
ATOM   2981  C  C   . VAL B  1 122 ? 10.069   79.660  21.007  1.00 24.11 ? 114  VAL B C   1 
ATOM   2982  O  O   . VAL B  1 122 ? 8.812    79.758  20.899  1.00 23.38 ? 114  VAL B O   1 
ATOM   2983  C  CB  . VAL B  1 122 ? 10.681   79.043  23.364  1.00 22.80 ? 114  VAL B CB  1 
ATOM   2984  C  CG1 . VAL B  1 122 ? 11.222   77.690  22.838  1.00 20.33 ? 114  VAL B CG1 1 
ATOM   2985  C  CG2 . VAL B  1 122 ? 11.355   79.474  24.679  1.00 18.92 ? 114  VAL B CG2 1 
ATOM   2986  N  N   . HIS B  1 123 ? 10.847   79.141  20.055  1.00 24.99 ? 115  HIS B N   1 
ATOM   2987  C  CA  . HIS B  1 123 ? 10.312   78.529  18.841  1.00 26.84 ? 115  HIS B CA  1 
ATOM   2988  C  C   . HIS B  1 123 ? 10.241   77.039  18.972  1.00 27.18 ? 115  HIS B C   1 
ATOM   2989  O  O   . HIS B  1 123 ? 11.244   76.424  19.188  1.00 27.38 ? 115  HIS B O   1 
ATOM   2990  C  CB  . HIS B  1 123 ? 11.210   78.806  17.624  1.00 27.42 ? 115  HIS B CB  1 
ATOM   2991  C  CG  . HIS B  1 123 ? 10.751   78.104  16.378  1.00 30.48 ? 115  HIS B CG  1 
ATOM   2992  N  ND1 . HIS B  1 123 ? 9.755    78.609  15.571  1.00 31.44 ? 115  HIS B ND1 1 
ATOM   2993  C  CD2 . HIS B  1 123 ? 11.108   76.913  15.835  1.00 30.94 ? 115  HIS B CD2 1 
ATOM   2994  C  CE1 . HIS B  1 123 ? 9.517    77.756  14.590  1.00 31.49 ? 115  HIS B CE1 1 
ATOM   2995  N  NE2 . HIS B  1 123 ? 10.335   76.731  14.716  1.00 29.95 ? 115  HIS B NE2 1 
ATOM   2996  N  N   . PHE B  1 124 ? 9.063    76.476  18.775  1.00 29.00 ? 116  PHE B N   1 
ATOM   2997  C  CA  . PHE B  1 124 ? 8.868    75.047  18.612  1.00 30.72 ? 116  PHE B CA  1 
ATOM   2998  C  C   . PHE B  1 124 ? 8.283    74.793  17.225  1.00 33.38 ? 116  PHE B C   1 
ATOM   2999  O  O   . PHE B  1 124 ? 7.693    75.660  16.614  1.00 33.84 ? 116  PHE B O   1 
ATOM   3000  C  CB  . PHE B  1 124 ? 7.897    74.483  19.632  1.00 30.03 ? 116  PHE B CB  1 
ATOM   3001  C  CG  . PHE B  1 124 ? 8.362    74.576  21.033  1.00 29.29 ? 116  PHE B CG  1 
ATOM   3002  C  CD1 . PHE B  1 124 ? 9.213    73.636  21.553  1.00 30.20 ? 116  PHE B CD1 1 
ATOM   3003  C  CD2 . PHE B  1 124 ? 7.925    75.584  21.861  1.00 27.09 ? 116  PHE B CD2 1 
ATOM   3004  C  CE1 . PHE B  1 124 ? 9.632    73.736  22.863  1.00 28.81 ? 116  PHE B CE1 1 
ATOM   3005  C  CE2 . PHE B  1 124 ? 8.327    75.664  23.153  1.00 26.99 ? 116  PHE B CE2 1 
ATOM   3006  C  CZ  . PHE B  1 124 ? 9.167    74.753  23.658  1.00 26.32 ? 116  PHE B CZ  1 
ATOM   3007  N  N   . GLU B  1 125 ? 8.447    73.574  16.735  1.00 36.96 ? 117  GLU B N   1 
ATOM   3008  C  CA  . GLU B  1 125 ? 7.881    73.168  15.457  1.00 39.50 ? 117  GLU B CA  1 
ATOM   3009  C  C   . GLU B  1 125 ? 6.339    73.261  15.554  1.00 41.13 ? 117  GLU B C   1 
ATOM   3010  O  O   . GLU B  1 125 ? 5.753    73.171  16.616  1.00 41.55 ? 117  GLU B O   1 
ATOM   3011  C  CB  . GLU B  1 125 ? 8.395    71.772  15.077  1.00 38.91 ? 117  GLU B CB  1 
ATOM   3012  N  N   . GLU B  1 126 ? 5.695    73.518  14.450  1.00 43.34 ? 118  GLU B N   1 
ATOM   3013  C  CA  . GLU B  1 126 ? 4.271    73.809  14.428  1.00 45.66 ? 118  GLU B CA  1 
ATOM   3014  C  C   . GLU B  1 126 ? 3.403    72.722  15.068  1.00 44.94 ? 118  GLU B C   1 
ATOM   3015  O  O   . GLU B  1 126 ? 2.432    72.999  15.727  1.00 44.17 ? 118  GLU B O   1 
ATOM   3016  C  CB  . GLU B  1 126 ? 3.876    73.976  12.966  1.00 47.61 ? 118  GLU B CB  1 
ATOM   3017  C  CG  . GLU B  1 126 ? 2.770    74.987  12.724  1.00 54.58 ? 118  GLU B CG  1 
ATOM   3018  C  CD  . GLU B  1 126 ? 2.246    74.881  11.277  1.00 63.02 ? 118  GLU B CD  1 
ATOM   3019  O  OE1 . GLU B  1 126 ? 3.068    75.085  10.337  1.00 67.43 ? 118  GLU B OE1 1 
ATOM   3020  O  OE2 . GLU B  1 126 ? 1.032    74.554  11.094  1.00 67.54 ? 118  GLU B OE2 1 
ATOM   3021  N  N   . GLU B  1 127 ? 3.778    71.480  14.856  1.00 44.97 ? 119  GLU B N   1 
ATOM   3022  C  CA  . GLU B  1 127 ? 3.018    70.340  15.357  1.00 45.80 ? 119  GLU B CA  1 
ATOM   3023  C  C   . GLU B  1 127 ? 2.950    70.324  16.888  1.00 43.72 ? 119  GLU B C   1 
ATOM   3024  O  O   . GLU B  1 127 ? 1.992    69.840  17.460  1.00 42.90 ? 119  GLU B O   1 
ATOM   3025  C  CB  . GLU B  1 127 ? 3.582    68.998  14.813  1.00 47.62 ? 119  GLU B CB  1 
ATOM   3026  C  CG  . GLU B  1 127 ? 5.059    69.020  14.230  1.00 54.34 ? 119  GLU B CG  1 
ATOM   3027  C  CD  . GLU B  1 127 ? 5.239    69.697  12.812  1.00 60.61 ? 119  GLU B CD  1 
ATOM   3028  O  OE1 . GLU B  1 127 ? 4.429    69.436  11.876  1.00 66.16 ? 119  GLU B OE1 1 
ATOM   3029  O  OE2 . GLU B  1 127 ? 6.209    70.470  12.639  1.00 59.46 ? 119  GLU B OE2 1 
ATOM   3030  N  N   . VAL B  1 128 ? 3.991    70.854  17.534  1.00 41.05 ? 120  VAL B N   1 
ATOM   3031  C  CA  . VAL B  1 128 ? 4.049    70.950  18.974  1.00 38.83 ? 120  VAL B CA  1 
ATOM   3032  C  C   . VAL B  1 128 ? 3.048    71.948  19.524  1.00 37.54 ? 120  VAL B C   1 
ATOM   3033  O  O   . VAL B  1 128 ? 2.474    71.700  20.551  1.00 36.39 ? 120  VAL B O   1 
ATOM   3034  C  CB  . VAL B  1 128 ? 5.497    71.369  19.457  1.00 39.16 ? 120  VAL B CB  1 
ATOM   3035  C  CG1 . VAL B  1 128 ? 5.514    71.754  20.911  1.00 34.96 ? 120  VAL B CG1 1 
ATOM   3036  C  CG2 . VAL B  1 128 ? 6.520    70.263  19.168  1.00 37.81 ? 120  VAL B CG2 1 
ATOM   3037  N  N   . LEU B  1 129 ? 2.849    73.065  18.844  1.00 35.85 ? 121  LEU B N   1 
ATOM   3038  C  CA  . LEU B  1 129 ? 2.146    74.195  19.428  1.00 35.89 ? 121  LEU B CA  1 
ATOM   3039  C  C   . LEU B  1 129 ? 0.762    73.834  19.937  1.00 36.22 ? 121  LEU B C   1 
ATOM   3040  O  O   . LEU B  1 129 ? 0.316    74.273  20.994  1.00 34.44 ? 121  LEU B O   1 
ATOM   3041  C  CB  . LEU B  1 129 ? 2.008    75.332  18.410  1.00 36.08 ? 121  LEU B CB  1 
ATOM   3042  C  CG  . LEU B  1 129 ? 3.285    76.110  18.120  1.00 36.54 ? 121  LEU B CG  1 
ATOM   3043  C  CD1 . LEU B  1 129 ? 2.976    77.326  17.288  1.00 36.24 ? 121  LEU B CD1 1 
ATOM   3044  C  CD2 . LEU B  1 129 ? 3.926    76.484  19.454  1.00 33.95 ? 121  LEU B CD2 1 
ATOM   3045  N  N   . GLY B  1 130 ? 0.090    73.007  19.162  1.00 37.15 ? 122  GLY B N   1 
ATOM   3046  C  CA  . GLY B  1 130 ? -1.250   72.572  19.483  1.00 37.63 ? 122  GLY B CA  1 
ATOM   3047  C  C   . GLY B  1 130 ? -1.375   71.756  20.738  1.00 37.70 ? 122  GLY B C   1 
ATOM   3048  O  O   . GLY B  1 130 ? -2.441   71.680  21.277  1.00 38.60 ? 122  GLY B O   1 
ATOM   3049  N  N   . LYS B  1 131 ? -0.288   71.152  21.190  1.00 37.52 ? 123  LYS B N   1 
ATOM   3050  C  CA  . LYS B  1 131 ? -0.280   70.380  22.425  1.00 37.39 ? 123  LYS B CA  1 
ATOM   3051  C  C   . LYS B  1 131 ? 0.096    71.128  23.678  1.00 35.33 ? 123  LYS B C   1 
ATOM   3052  O  O   . LYS B  1 131 ? -0.016   70.577  24.760  1.00 35.00 ? 123  LYS B O   1 
ATOM   3053  C  CB  . LYS B  1 131 ? 0.725    69.280  22.302  1.00 38.39 ? 123  LYS B CB  1 
ATOM   3054  C  CG  . LYS B  1 131 ? 0.490    68.404  21.125  1.00 43.61 ? 123  LYS B CG  1 
ATOM   3055  C  CD  . LYS B  1 131 ? 1.195    67.103  21.406  1.00 51.02 ? 123  LYS B CD  1 
ATOM   3056  C  CE  . LYS B  1 131 ? 1.696    66.485  20.156  1.00 55.00 ? 123  LYS B CE  1 
ATOM   3057  N  NZ  . LYS B  1 131 ? 2.472    65.315  20.552  1.00 58.01 ? 123  LYS B NZ  1 
ATOM   3058  N  N   . LEU B  1 132 ? 0.596    72.352  23.549  1.00 33.02 ? 124  LEU B N   1 
ATOM   3059  C  CA  . LEU B  1 132 ? 1.073    73.063  24.708  1.00 30.23 ? 124  LEU B CA  1 
ATOM   3060  C  C   . LEU B  1 132 ? -0.080   73.683  25.467  1.00 28.70 ? 124  LEU B C   1 
ATOM   3061  O  O   . LEU B  1 132 ? -1.104   73.961  24.902  1.00 28.02 ? 124  LEU B O   1 
ATOM   3062  C  CB  . LEU B  1 132 ? 2.039    74.137  24.274  1.00 29.38 ? 124  LEU B CB  1 
ATOM   3063  C  CG  . LEU B  1 132 ? 3.346    73.683  23.628  1.00 28.99 ? 124  LEU B CG  1 
ATOM   3064  C  CD1 . LEU B  1 132 ? 4.065    74.883  23.043  1.00 24.86 ? 124  LEU B CD1 1 
ATOM   3065  C  CD2 . LEU B  1 132 ? 4.241    72.917  24.637  1.00 26.50 ? 124  LEU B CD2 1 
ATOM   3066  N  N   . MET B  1 133 ? 0.139    73.930  26.744  1.00 27.75 ? 125  MET B N   1 
ATOM   3067  C  CA  . MET B  1 133 ? -0.802   74.591  27.621  1.00 27.44 ? 125  MET B CA  1 
ATOM   3068  C  C   . MET B  1 133 ? -0.061   75.581  28.477  1.00 26.72 ? 125  MET B C   1 
ATOM   3069  O  O   . MET B  1 133 ? 1.110    75.376  28.841  1.00 26.91 ? 125  MET B O   1 
ATOM   3070  C  CB  . MET B  1 133 ? -1.478   73.554  28.549  1.00 28.58 ? 125  MET B CB  1 
ATOM   3071  C  CG  . MET B  1 133 ? -2.492   74.144  29.535  1.00 28.51 ? 125  MET B CG  1 
ATOM   3072  S  SD  . MET B  1 133 ? -3.769   75.125  28.681  1.00 29.99 ? 125  MET B SD  1 
ATOM   3073  C  CE  . MET B  1 133 ? -4.899   75.477  30.062  1.00 28.86 ? 125  MET B CE  1 
ATOM   3074  N  N   . VAL B  1 134 ? -0.731   76.684  28.773  1.00 26.17 ? 126  VAL B N   1 
ATOM   3075  C  CA  . VAL B  1 134 ? -0.186   77.683  29.644  1.00 24.85 ? 126  VAL B CA  1 
ATOM   3076  C  C   . VAL B  1 134 ? 0.093    76.949  30.953  1.00 25.72 ? 126  VAL B C   1 
ATOM   3077  O  O   . VAL B  1 134 ? -0.723   76.146  31.397  1.00 25.51 ? 126  VAL B O   1 
ATOM   3078  C  CB  . VAL B  1 134 ? -1.138   78.842  29.872  1.00 24.07 ? 126  VAL B CB  1 
ATOM   3079  C  CG1 . VAL B  1 134 ? -0.568   79.763  30.949  1.00 24.14 ? 126  VAL B CG1 1 
ATOM   3080  C  CG2 . VAL B  1 134 ? -1.339   79.607  28.602  1.00 21.41 ? 126  VAL B CG2 1 
ATOM   3081  N  N   . GLY B  1 135 ? 1.262    77.211  31.535  1.00 25.31 ? 127  GLY B N   1 
ATOM   3082  C  CA  . GLY B  1 135 ? 1.658    76.576  32.744  1.00 25.25 ? 127  GLY B CA  1 
ATOM   3083  C  C   . GLY B  1 135 ? 2.556    75.367  32.590  1.00 25.17 ? 127  GLY B C   1 
ATOM   3084  O  O   . GLY B  1 135 ? 3.129    74.937  33.557  1.00 24.57 ? 127  GLY B O   1 
ATOM   3085  N  N   . ASP B  1 136 ? 2.660    74.796  31.405  1.00 25.16 ? 128  ASP B N   1 
ATOM   3086  C  CA  . ASP B  1 136 ? 3.588    73.725  31.178  1.00 25.89 ? 128  ASP B CA  1 
ATOM   3087  C  C   . ASP B  1 136 ? 5.031    74.170  31.524  1.00 26.56 ? 128  ASP B C   1 
ATOM   3088  O  O   . ASP B  1 136 ? 5.449    75.319  31.279  1.00 26.54 ? 128  ASP B O   1 
ATOM   3089  C  CB  . ASP B  1 136 ? 3.465    73.199  29.738  1.00 26.86 ? 128  ASP B CB  1 
ATOM   3090  C  CG  . ASP B  1 136 ? 2.119    72.464  29.466  1.00 29.63 ? 128  ASP B CG  1 
ATOM   3091  O  OD1 . ASP B  1 136 ? 1.341    72.199  30.430  1.00 33.26 ? 128  ASP B OD1 1 
ATOM   3092  O  OD2 . ASP B  1 136 ? 1.835    72.149  28.287  1.00 31.69 ? 128  ASP B OD2 1 
ATOM   3093  N  N   . LYS B  1 137 ? 5.746    73.259  32.177  1.00 26.88 ? 129  LYS B N   1 
ATOM   3094  C  CA  . LYS B  1 137 ? 7.079    73.497  32.673  1.00 27.30 ? 129  LYS B CA  1 
ATOM   3095  C  C   . LYS B  1 137 ? 8.076    73.513  31.543  1.00 25.74 ? 129  LYS B C   1 
ATOM   3096  O  O   . LYS B  1 137 ? 8.023    72.647  30.678  1.00 25.37 ? 129  LYS B O   1 
ATOM   3097  C  CB  . LYS B  1 137 ? 7.467    72.402  33.652  1.00 27.88 ? 129  LYS B CB  1 
ATOM   3098  C  CG  . LYS B  1 137 ? 6.660    72.396  34.945  1.00 32.58 ? 129  LYS B CG  1 
ATOM   3099  C  CD  . LYS B  1 137 ? 7.252    71.350  35.869  1.00 39.13 ? 129  LYS B CD  1 
ATOM   3100  C  CE  . LYS B  1 137 ? 6.392    70.935  37.055  1.00 42.70 ? 129  LYS B CE  1 
ATOM   3101  N  NZ  . LYS B  1 137 ? 6.988    69.608  37.538  1.00 45.40 ? 129  LYS B NZ  1 
ATOM   3102  N  N   . ILE B  1 138 ? 8.978    74.488  31.576  1.00 23.94 ? 130  ILE B N   1 
ATOM   3103  C  CA  . ILE B  1 138 ? 9.930    74.690  30.518  1.00 23.39 ? 130  ILE B CA  1 
ATOM   3104  C  C   . ILE B  1 138 ? 11.332   74.697  31.072  1.00 23.89 ? 130  ILE B C   1 
ATOM   3105  O  O   . ILE B  1 138 ? 11.588   75.383  32.055  1.00 23.52 ? 130  ILE B O   1 
ATOM   3106  C  CB  . ILE B  1 138 ? 9.685    76.033  29.817  1.00 23.35 ? 130  ILE B CB  1 
ATOM   3107  C  CG1 . ILE B  1 138 ? 8.289    76.058  29.165  1.00 21.92 ? 130  ILE B CG1 1 
ATOM   3108  C  CG2 . ILE B  1 138 ? 10.776   76.274  28.753  1.00 20.60 ? 130  ILE B CG2 1 
ATOM   3109  C  CD1 . ILE B  1 138 ? 8.142    75.073  28.008  1.00 18.74 ? 130  ILE B CD1 1 
ATOM   3110  N  N   . LEU B  1 139 ? 12.242   73.956  30.431  1.00 24.28 ? 131  LEU B N   1 
ATOM   3111  C  CA  . LEU B  1 139 ? 13.678   73.941  30.813  1.00 23.98 ? 131  LEU B CA  1 
ATOM   3112  C  C   . LEU B  1 139 ? 14.549   74.555  29.708  1.00 23.83 ? 131  LEU B C   1 
ATOM   3113  O  O   . LEU B  1 139 ? 14.528   74.088  28.576  1.00 23.92 ? 131  LEU B O   1 
ATOM   3114  C  CB  . LEU B  1 139 ? 14.129   72.517  31.053  1.00 24.27 ? 131  LEU B CB  1 
ATOM   3115  C  CG  . LEU B  1 139 ? 15.643   72.214  31.119  1.00 25.88 ? 131  LEU B CG  1 
ATOM   3116  C  CD1 . LEU B  1 139 ? 16.259   72.738  32.396  1.00 22.62 ? 131  LEU B CD1 1 
ATOM   3117  C  CD2 . LEU B  1 139 ? 15.834   70.662  30.967  1.00 25.26 ? 131  LEU B CD2 1 
ATOM   3118  N  N   . ILE B  1 140 ? 15.296   75.609  30.029  1.00 23.09 ? 132  ILE B N   1 
ATOM   3119  C  CA  . ILE B  1 140 ? 16.203   76.219  29.084  1.00 22.45 ? 132  ILE B CA  1 
ATOM   3120  C  C   . ILE B  1 140 ? 17.617   75.792  29.453  1.00 23.22 ? 132  ILE B C   1 
ATOM   3121  O  O   . ILE B  1 140 ? 18.056   76.007  30.570  1.00 21.69 ? 132  ILE B O   1 
ATOM   3122  C  CB  . ILE B  1 140 ? 16.105   77.724  29.140  1.00 22.14 ? 132  ILE B CB  1 
ATOM   3123  C  CG1 . ILE B  1 140 ? 14.702   78.163  28.714  1.00 21.85 ? 132  ILE B CG1 1 
ATOM   3124  C  CG2 . ILE B  1 140 ? 17.196   78.327  28.301  1.00 17.88 ? 132  ILE B CG2 1 
ATOM   3125  C  CD1 . ILE B  1 140 ? 14.215   79.549  29.267  1.00 20.90 ? 132  ILE B CD1 1 
ATOM   3126  N  N   . LYS B  1 141 ? 18.297   75.118  28.534  1.00 24.17 ? 133  LYS B N   1 
ATOM   3127  C  CA  . LYS B  1 141 ? 19.679   74.760  28.751  1.00 25.20 ? 133  LYS B CA  1 
ATOM   3128  C  C   . LYS B  1 141 ? 20.543   75.986  28.436  1.00 24.11 ? 133  LYS B C   1 
ATOM   3129  O  O   . LYS B  1 141 ? 21.036   76.177  27.333  1.00 24.45 ? 133  LYS B O   1 
ATOM   3130  C  CB  . LYS B  1 141 ? 20.024   73.520  27.947  1.00 26.74 ? 133  LYS B CB  1 
ATOM   3131  C  CG  . LYS B  1 141 ? 19.588   72.188  28.653  1.00 31.56 ? 133  LYS B CG  1 
ATOM   3132  C  CD  . LYS B  1 141 ? 19.469   71.022  27.703  1.00 38.96 ? 133  LYS B CD  1 
ATOM   3133  C  CE  . LYS B  1 141 ? 19.824   69.617  28.300  1.00 44.10 ? 133  LYS B CE  1 
ATOM   3134  N  NZ  . LYS B  1 141 ? 21.329   69.360  28.190  1.00 46.03 ? 133  LYS B NZ  1 
ATOM   3135  N  N   . ALA B  1 142 ? 20.661   76.850  29.430  1.00 23.32 ? 134  ALA B N   1 
ATOM   3136  C  CA  . ALA B  1 142 ? 21.214   78.212  29.266  1.00 23.06 ? 134  ALA B CA  1 
ATOM   3137  C  C   . ALA B  1 142 ? 22.706   78.138  29.092  1.00 22.71 ? 134  ALA B C   1 
ATOM   3138  O  O   . ALA B  1 142 ? 23.372   77.438  29.840  1.00 21.96 ? 134  ALA B O   1 
ATOM   3139  C  CB  . ALA B  1 142 ? 20.882   79.093  30.479  1.00 20.74 ? 134  ALA B CB  1 
ATOM   3140  N  N   . TRP B  1 143 ? 23.234   78.912  28.160  1.00 22.88 ? 135  TRP B N   1 
ATOM   3141  C  CA  . TRP B  1 143 ? 24.635   78.772  27.762  1.00 24.11 ? 135  TRP B CA  1 
ATOM   3142  C  C   . TRP B  1 143 ? 25.023   79.929  26.899  1.00 22.75 ? 135  TRP B C   1 
ATOM   3143  O  O   . TRP B  1 143 ? 24.408   80.114  25.891  1.00 21.37 ? 135  TRP B O   1 
ATOM   3144  C  CB  . TRP B  1 143 ? 24.795   77.470  26.926  1.00 25.12 ? 135  TRP B CB  1 
ATOM   3145  C  CG  . TRP B  1 143 ? 26.151   77.139  26.576  1.00 29.16 ? 135  TRP B CG  1 
ATOM   3146  C  CD1 . TRP B  1 143 ? 27.251   77.205  27.398  1.00 34.51 ? 135  TRP B CD1 1 
ATOM   3147  C  CD2 . TRP B  1 143 ? 26.621   76.649  25.328  1.00 31.36 ? 135  TRP B CD2 1 
ATOM   3148  N  NE1 . TRP B  1 143 ? 28.387   76.799  26.712  1.00 32.99 ? 135  TRP B NE1 1 
ATOM   3149  C  CE2 . TRP B  1 143 ? 28.030   76.461  25.446  1.00 33.17 ? 135  TRP B CE2 1 
ATOM   3150  C  CE3 . TRP B  1 143 ? 26.003   76.339  24.132  1.00 31.76 ? 135  TRP B CE3 1 
ATOM   3151  C  CZ2 . TRP B  1 143 ? 28.817   75.993  24.402  1.00 34.96 ? 135  TRP B CZ2 1 
ATOM   3152  C  CZ3 . TRP B  1 143 ? 26.794   75.908  23.078  1.00 33.82 ? 135  TRP B CZ3 1 
ATOM   3153  C  CH2 . TRP B  1 143 ? 28.184   75.727  23.221  1.00 33.90 ? 135  TRP B CH2 1 
ATOM   3154  N  N   . GLY B  1 144 ? 26.038   80.701  27.284  1.00 22.79 ? 136  GLY B N   1 
ATOM   3155  C  CA  . GLY B  1 144 ? 26.509   81.770  26.427  1.00 22.69 ? 136  GLY B CA  1 
ATOM   3156  C  C   . GLY B  1 144 ? 26.927   83.062  27.093  1.00 23.02 ? 136  GLY B C   1 
ATOM   3157  O  O   . GLY B  1 144 ? 27.793   83.791  26.570  1.00 21.90 ? 136  GLY B O   1 
ATOM   3158  N  N   . GLN B  1 145 ? 26.318   83.402  28.225  1.00 23.01 ? 137  GLN B N   1 
ATOM   3159  C  CA  . GLN B  1 145 ? 26.795   84.591  28.934  1.00 22.91 ? 137  GLN B CA  1 
ATOM   3160  C  C   . GLN B  1 145 ? 28.164   84.258  29.509  1.00 22.92 ? 137  GLN B C   1 
ATOM   3161  O  O   . GLN B  1 145 ? 28.392   83.166  30.066  1.00 22.40 ? 137  GLN B O   1 
ATOM   3162  C  CB  . GLN B  1 145 ? 25.851   85.013  30.052  1.00 23.62 ? 137  GLN B CB  1 
ATOM   3163  C  CG  . GLN B  1 145 ? 24.406   85.371  29.677  1.00 23.99 ? 137  GLN B CG  1 
ATOM   3164  C  CD  . GLN B  1 145 ? 24.274   86.542  28.729  1.00 23.36 ? 137  GLN B CD  1 
ATOM   3165  O  OE1 . GLN B  1 145 ? 25.158   86.782  27.907  1.00 21.52 ? 137  GLN B OE1 1 
ATOM   3166  N  NE2 . GLN B  1 145 ? 23.123   87.230  28.782  1.00 19.60 ? 137  GLN B NE2 1 
ATOM   3167  N  N   . GLY B  1 146 ? 29.077   85.212  29.362  1.00 23.26 ? 138  GLY B N   1 
ATOM   3168  C  CA  . GLY B  1 146 ? 30.491   84.990  29.637  1.00 23.28 ? 138  GLY B CA  1 
ATOM   3169  C  C   . GLY B  1 146 ? 31.381   84.781  28.409  1.00 24.12 ? 138  GLY B C   1 
ATOM   3170  O  O   . GLY B  1 146 ? 32.618   84.842  28.532  1.00 24.59 ? 138  GLY B O   1 
ATOM   3171  N  N   . LEU B  1 147 ? 30.775   84.561  27.233  1.00 23.81 ? 139  LEU B N   1 
ATOM   3172  C  CA  . LEU B  1 147 ? 31.522   84.386  26.017  1.00 24.21 ? 139  LEU B CA  1 
ATOM   3173  C  C   . LEU B  1 147 ? 32.405   85.591  25.760  1.00 25.42 ? 139  LEU B C   1 
ATOM   3174  O  O   . LEU B  1 147 ? 32.006   86.743  25.940  1.00 24.17 ? 139  LEU B O   1 
ATOM   3175  C  CB  . LEU B  1 147 ? 30.609   84.157  24.815  1.00 24.03 ? 139  LEU B CB  1 
ATOM   3176  C  CG  . LEU B  1 147 ? 31.183   83.791  23.442  1.00 23.55 ? 139  LEU B CG  1 
ATOM   3177  C  CD1 . LEU B  1 147 ? 31.832   82.424  23.484  1.00 20.03 ? 139  LEU B CD1 1 
ATOM   3178  C  CD2 . LEU B  1 147 ? 30.071   83.860  22.374  1.00 20.22 ? 139  LEU B CD2 1 
ATOM   3179  N  N   . LYS B  1 148 ? 33.621   85.290  25.325  1.00 27.51 ? 140  LYS B N   1 
ATOM   3180  C  CA  . LYS B  1 148 ? 34.606   86.293  24.971  1.00 29.61 ? 140  LYS B CA  1 
ATOM   3181  C  C   . LYS B  1 148 ? 35.301   85.933  23.655  1.00 28.97 ? 140  LYS B C   1 
ATOM   3182  O  O   . LYS B  1 148 ? 35.610   84.754  23.360  1.00 26.75 ? 140  LYS B O   1 
ATOM   3183  C  CB  . LYS B  1 148 ? 35.660   86.387  26.070  1.00 31.06 ? 140  LYS B CB  1 
ATOM   3184  C  CG  . LYS B  1 148 ? 35.304   87.199  27.288  1.00 35.25 ? 140  LYS B CG  1 
ATOM   3185  C  CD  . LYS B  1 148 ? 36.403   86.953  28.314  1.00 44.46 ? 140  LYS B CD  1 
ATOM   3186  C  CE  . LYS B  1 148 ? 36.274   87.867  29.535  1.00 50.74 ? 140  LYS B CE  1 
ATOM   3187  N  NZ  . LYS B  1 148 ? 36.921   87.211  30.755  1.00 54.74 ? 140  LYS B NZ  1 
ATOM   3188  N  N   . LEU B  1 149 ? 35.532   86.971  22.875  1.00 29.00 ? 141  LEU B N   1 
ATOM   3189  C  CA  . LEU B  1 149 ? 36.366   86.898  21.691  1.00 29.74 ? 141  LEU B CA  1 
ATOM   3190  C  C   . LEU B  1 149 ? 37.808   87.165  22.140  1.00 30.10 ? 141  LEU B C   1 
ATOM   3191  O  O   . LEU B  1 149 ? 38.202   88.275  22.470  1.00 28.82 ? 141  LEU B O   1 
ATOM   3192  C  CB  . LEU B  1 149 ? 35.878   87.915  20.663  1.00 30.00 ? 141  LEU B CB  1 
ATOM   3193  C  CG  . LEU B  1 149 ? 34.419   87.791  20.200  1.00 29.58 ? 141  LEU B CG  1 
ATOM   3194  C  CD1 . LEU B  1 149 ? 34.049   88.827  19.134  1.00 25.41 ? 141  LEU B CD1 1 
ATOM   3195  C  CD2 . LEU B  1 149 ? 34.150   86.394  19.689  1.00 29.28 ? 141  LEU B CD2 1 
ATOM   3196  N  N   . LEU B  1 150 ? 38.571   86.096  22.214  1.00 31.38 ? 142  LEU B N   1 
ATOM   3197  C  CA  . LEU B  1 150 ? 39.881   86.159  22.831  1.00 33.20 ? 142  LEU B CA  1 
ATOM   3198  C  C   . LEU B  1 150 ? 40.843   87.077  22.063  1.00 34.31 ? 142  LEU B C   1 
ATOM   3199  O  O   . LEU B  1 150 ? 41.684   87.683  22.684  1.00 34.86 ? 142  LEU B O   1 
ATOM   3200  C  CB  . LEU B  1 150 ? 40.461   84.753  22.993  1.00 32.89 ? 142  LEU B CB  1 
ATOM   3201  C  CG  . LEU B  1 150 ? 39.676   83.976  24.054  1.00 34.37 ? 142  LEU B CG  1 
ATOM   3202  C  CD1 . LEU B  1 150 ? 40.231   82.559  24.226  1.00 32.11 ? 142  LEU B CD1 1 
ATOM   3203  C  CD2 . LEU B  1 150 ? 39.600   84.756  25.400  1.00 31.19 ? 142  LEU B CD2 1 
ATOM   3204  N  N   . ASP B  1 151 ? 40.705   87.187  20.742  1.00 35.09 ? 143  ASP B N   1 
ATOM   3205  C  CA  . ASP B  1 151 ? 41.493   88.150  19.978  1.00 36.56 ? 143  ASP B CA  1 
ATOM   3206  C  C   . ASP B  1 151 ? 40.848   89.543  19.874  1.00 37.09 ? 143  ASP B C   1 
ATOM   3207  O  O   . ASP B  1 151 ? 41.434   90.417  19.283  1.00 37.93 ? 143  ASP B O   1 
ATOM   3208  C  CB  . ASP B  1 151 ? 41.767   87.628  18.563  1.00 36.62 ? 143  ASP B CB  1 
ATOM   3209  C  CG  . ASP B  1 151 ? 42.538   86.328  18.561  1.00 37.43 ? 143  ASP B CG  1 
ATOM   3210  O  OD1 . ASP B  1 151 ? 43.583   86.270  19.237  1.00 38.78 ? 143  ASP B OD1 1 
ATOM   3211  O  OD2 . ASP B  1 151 ? 42.099   85.364  17.904  1.00 36.42 ? 143  ASP B OD2 1 
ATOM   3212  N  N   . HIS B  1 152 ? 39.649   89.763  20.407  1.00 37.31 ? 144  HIS B N   1 
ATOM   3213  C  CA  . HIS B  1 152 ? 39.003   91.069  20.270  1.00 36.95 ? 144  HIS B CA  1 
ATOM   3214  C  C   . HIS B  1 152 ? 38.452   91.505  21.586  1.00 36.98 ? 144  HIS B C   1 
ATOM   3215  O  O   . HIS B  1 152 ? 37.266   91.533  21.815  1.00 36.36 ? 144  HIS B O   1 
ATOM   3216  C  CB  . HIS B  1 152 ? 37.935   91.032  19.199  1.00 36.79 ? 144  HIS B CB  1 
ATOM   3217  C  CG  . HIS B  1 152 ? 38.406   90.445  17.913  1.00 36.14 ? 144  HIS B CG  1 
ATOM   3218  N  ND1 . HIS B  1 152 ? 39.121   91.164  16.987  1.00 35.72 ? 144  HIS B ND1 1 
ATOM   3219  C  CD2 . HIS B  1 152 ? 38.257   89.207  17.392  1.00 36.62 ? 144  HIS B CD2 1 
ATOM   3220  C  CE1 . HIS B  1 152 ? 39.388   90.391  15.950  1.00 36.35 ? 144  HIS B CE1 1 
ATOM   3221  N  NE2 . HIS B  1 152 ? 38.865   89.205  16.166  1.00 34.03 ? 144  HIS B NE2 1 
ATOM   3222  N  N   . PRO B  1 153 ? 39.343   91.873  22.482  1.00 38.40 ? 145  PRO B N   1 
ATOM   3223  C  CA  . PRO B  1 153 ? 38.887   92.094  23.844  1.00 38.62 ? 145  PRO B CA  1 
ATOM   3224  C  C   . PRO B  1 153 ? 38.003   93.293  23.999  1.00 38.51 ? 145  PRO B C   1 
ATOM   3225  O  O   . PRO B  1 153 ? 37.289   93.376  24.969  1.00 38.21 ? 145  PRO B O   1 
ATOM   3226  C  CB  . PRO B  1 153 ? 40.193   92.274  24.632  1.00 39.31 ? 145  PRO B CB  1 
ATOM   3227  C  CG  . PRO B  1 153 ? 41.244   92.604  23.584  1.00 39.46 ? 145  PRO B CG  1 
ATOM   3228  C  CD  . PRO B  1 153 ? 40.814   91.883  22.362  1.00 39.12 ? 145  PRO B CD  1 
ATOM   3229  N  N   . ASP B  1 154 ? 38.045   94.230  23.063  1.00 38.78 ? 146  ASP B N   1 
ATOM   3230  C  CA  . ASP B  1 154 ? 37.169   95.397  23.161  1.00 38.53 ? 146  ASP B CA  1 
ATOM   3231  C  C   . ASP B  1 154 ? 35.847   95.232  22.416  1.00 36.34 ? 146  ASP B C   1 
ATOM   3232  O  O   . ASP B  1 154 ? 35.053   96.160  22.357  1.00 35.49 ? 146  ASP B O   1 
ATOM   3233  C  CB  . ASP B  1 154 ? 37.915   96.636  22.690  1.00 39.49 ? 146  ASP B CB  1 
ATOM   3234  C  CG  . ASP B  1 154 ? 39.089   96.975  23.598  1.00 44.07 ? 146  ASP B CG  1 
ATOM   3235  O  OD1 . ASP B  1 154 ? 38.989   96.767  24.847  1.00 47.47 ? 146  ASP B OD1 1 
ATOM   3236  O  OD2 . ASP B  1 154 ? 40.132   97.443  23.059  1.00 50.36 ? 146  ASP B OD2 1 
ATOM   3237  N  N   . VAL B  1 155 ? 35.630   94.054  21.838  1.00 34.23 ? 147  VAL B N   1 
ATOM   3238  C  CA  . VAL B  1 155 ? 34.356   93.716  21.258  1.00 32.77 ? 147  VAL B CA  1 
ATOM   3239  C  C   . VAL B  1 155 ? 33.606   92.791  22.221  1.00 32.57 ? 147  VAL B C   1 
ATOM   3240  O  O   . VAL B  1 155 ? 34.020   91.679  22.457  1.00 33.07 ? 147  VAL B O   1 
ATOM   3241  C  CB  . VAL B  1 155 ? 34.544   93.051  19.937  1.00 32.23 ? 147  VAL B CB  1 
ATOM   3242  C  CG1 . VAL B  1 155 ? 33.207   92.732  19.343  1.00 32.18 ? 147  VAL B CG1 1 
ATOM   3243  C  CG2 . VAL B  1 155 ? 35.320   93.947  19.014  1.00 29.57 ? 147  VAL B CG2 1 
ATOM   3244  N  N   . LYS B  1 156 ? 32.499   93.249  22.793  1.00 32.03 ? 148  LYS B N   1 
ATOM   3245  C  CA  . LYS B  1 156 ? 31.731   92.433  23.745  1.00 31.02 ? 148  LYS B CA  1 
ATOM   3246  C  C   . LYS B  1 156 ? 30.631   91.672  23.043  1.00 28.52 ? 148  LYS B C   1 
ATOM   3247  O  O   . LYS B  1 156 ? 29.952   92.196  22.159  1.00 27.59 ? 148  LYS B O   1 
ATOM   3248  C  CB  . LYS B  1 156 ? 31.108   93.297  24.810  1.00 32.28 ? 148  LYS B CB  1 
ATOM   3249  C  CG  . LYS B  1 156 ? 32.034   94.366  25.345  1.00 38.42 ? 148  LYS B CG  1 
ATOM   3250  C  CD  . LYS B  1 156 ? 33.348   93.835  25.961  1.00 46.15 ? 148  LYS B CD  1 
ATOM   3251  C  CE  . LYS B  1 156 ? 34.072   94.990  26.715  1.00 49.40 ? 148  LYS B CE  1 
ATOM   3252  N  NZ  . LYS B  1 156 ? 35.230   94.504  27.473  1.00 50.67 ? 148  LYS B NZ  1 
ATOM   3253  N  N   . VAL B  1 157 ? 30.480   90.422  23.438  1.00 26.26 ? 149  VAL B N   1 
ATOM   3254  C  CA  A VAL B  1 157 ? 29.420   89.570  22.912  0.50 25.08 ? 149  VAL B CA  1 
ATOM   3255  C  CA  B VAL B  1 157 ? 29.465   89.541  22.905  0.50 25.23 ? 149  VAL B CA  1 
ATOM   3256  C  C   . VAL B  1 157 ? 28.601   89.087  24.082  1.00 24.79 ? 149  VAL B C   1 
ATOM   3257  O  O   . VAL B  1 157 ? 29.083   89.018  25.226  1.00 23.74 ? 149  VAL B O   1 
ATOM   3258  C  CB  A VAL B  1 157 ? 29.922   88.374  22.107  0.50 25.06 ? 149  VAL B CB  1 
ATOM   3259  C  CB  B VAL B  1 157 ? 30.135   88.378  22.186  0.50 25.33 ? 149  VAL B CB  1 
ATOM   3260  C  CG1 A VAL B  1 157 ? 30.550   88.856  20.825  0.50 25.25 ? 149  VAL B CG1 1 
ATOM   3261  C  CG1 B VAL B  1 157 ? 29.137   87.358  21.723  0.50 24.18 ? 149  VAL B CG1 1 
ATOM   3262  C  CG2 A VAL B  1 157 ? 30.892   87.523  22.931  0.50 23.27 ? 149  VAL B CG2 1 
ATOM   3263  C  CG2 B VAL B  1 157 ? 30.929   88.920  21.011  0.50 25.52 ? 149  VAL B CG2 1 
ATOM   3264  N  N   . MET B  1 158 ? 27.341   88.797  23.799  1.00 24.09 ? 150  MET B N   1 
ATOM   3265  C  CA  . MET B  1 158 ? 26.381   88.506  24.832  1.00 23.72 ? 150  MET B CA  1 
ATOM   3266  C  C   . MET B  1 158 ? 25.091   87.953  24.236  1.00 22.34 ? 150  MET B C   1 
ATOM   3267  O  O   . MET B  1 158 ? 24.848   88.068  23.038  1.00 20.62 ? 150  MET B O   1 
ATOM   3268  C  CB  . MET B  1 158 ? 26.057   89.788  25.613  1.00 24.42 ? 150  MET B CB  1 
ATOM   3269  C  CG  . MET B  1 158 ? 25.300   90.840  24.813  1.00 27.30 ? 150  MET B CG  1 
ATOM   3270  S  SD  . MET B  1 158 ? 25.096   92.438  25.717  1.00 30.01 ? 150  MET B SD  1 
ATOM   3271  C  CE  . MET B  1 158 ? 26.784   93.039  25.642  1.00 31.88 ? 150  MET B CE  1 
ATOM   3272  N  N   . ASN B  1 159 ? 24.271   87.391  25.121  1.00 20.46 ? 151  ASN B N   1 
ATOM   3273  C  CA  . ASN B  1 159 ? 22.919   86.974  24.826  1.00 19.89 ? 151  ASN B CA  1 
ATOM   3274  C  C   . ASN B  1 159 ? 22.830   85.942  23.705  1.00 20.46 ? 151  ASN B C   1 
ATOM   3275  O  O   . ASN B  1 159 ? 21.753   85.739  23.146  1.00 20.08 ? 151  ASN B O   1 
ATOM   3276  C  CB  . ASN B  1 159 ? 22.019   88.166  24.510  1.00 18.88 ? 151  ASN B CB  1 
ATOM   3277  C  CG  . ASN B  1 159 ? 21.799   89.055  25.684  1.00 18.62 ? 151  ASN B CG  1 
ATOM   3278  O  OD1 . ASN B  1 159 ? 21.602   88.576  26.798  1.00 18.23 ? 151  ASN B OD1 1 
ATOM   3279  N  ND2 . ASN B  1 159 ? 21.779   90.369  25.445  1.00 14.63 ? 151  ASN B ND2 1 
ATOM   3280  N  N   . ILE B  1 160 ? 23.926   85.257  23.393  1.00 20.73 ? 152  ILE B N   1 
ATOM   3281  C  CA  . ILE B  1 160 ? 23.916   84.365  22.247  1.00 21.13 ? 152  ILE B CA  1 
ATOM   3282  C  C   . ILE B  1 160 ? 24.623   83.042  22.443  1.00 21.28 ? 152  ILE B C   1 
ATOM   3283  O  O   . ILE B  1 160 ? 25.748   82.973  22.904  1.00 21.53 ? 152  ILE B O   1 
ATOM   3284  C  CB  . ILE B  1 160 ? 24.451   85.099  20.948  1.00 22.23 ? 152  ILE B CB  1 
ATOM   3285  C  CG1 . ILE B  1 160 ? 24.212   84.190  19.722  1.00 23.40 ? 152  ILE B CG1 1 
ATOM   3286  C  CG2 . ILE B  1 160 ? 25.899   85.590  21.154  1.00 20.55 ? 152  ILE B CG2 1 
ATOM   3287  C  CD1 . ILE B  1 160 ? 23.807   84.875  18.528  1.00 25.57 ? 152  ILE B CD1 1 
ATOM   3288  N  N   . ASP B  1 161 ? 23.923   81.984  22.089  1.00 21.70 ? 153  ASP B N   1 
ATOM   3289  C  CA  . ASP B  1 161 ? 24.423   80.644  22.125  1.00 22.11 ? 153  ASP B CA  1 
ATOM   3290  C  C   . ASP B  1 161 ? 25.669   80.609  21.261  1.00 23.02 ? 153  ASP B C   1 
ATOM   3291  O  O   . ASP B  1 161 ? 25.630   81.028  20.115  1.00 22.74 ? 153  ASP B O   1 
ATOM   3292  C  CB  . ASP B  1 161 ? 23.343   79.733  21.552  1.00 22.23 ? 153  ASP B CB  1 
ATOM   3293  C  CG  . ASP B  1 161 ? 23.698   78.256  21.647  1.00 23.93 ? 153  ASP B CG  1 
ATOM   3294  O  OD1 . ASP B  1 161 ? 24.537   77.815  20.821  1.00 22.99 ? 153  ASP B OD1 1 
ATOM   3295  O  OD2 . ASP B  1 161 ? 23.104   77.542  22.509  1.00 20.52 ? 153  ASP B OD2 1 
ATOM   3296  N  N   . PRO B  1 162 ? 26.783   80.139  21.801  1.00 24.46 ? 154  PRO B N   1 
ATOM   3297  C  CA  . PRO B  1 162 ? 28.007   80.091  21.021  1.00 25.68 ? 154  PRO B CA  1 
ATOM   3298  C  C   . PRO B  1 162 ? 27.931   79.269  19.745  1.00 26.77 ? 154  PRO B C   1 
ATOM   3299  O  O   . PRO B  1 162 ? 28.563   79.629  18.744  1.00 27.48 ? 154  PRO B O   1 
ATOM   3300  C  CB  . PRO B  1 162 ? 29.018   79.472  21.990  1.00 26.28 ? 154  PRO B CB  1 
ATOM   3301  C  CG  . PRO B  1 162 ? 28.503   79.804  23.361  1.00 25.82 ? 154  PRO B CG  1 
ATOM   3302  C  CD  . PRO B  1 162 ? 26.996   79.695  23.189  1.00 25.12 ? 154  PRO B CD  1 
ATOM   3303  N  N   . ASP B  1 163 ? 27.170   78.191  19.743  1.00 27.51 ? 155  ASP B N   1 
ATOM   3304  C  CA  . ASP B  1 163 ? 26.991   77.458  18.509  1.00 29.04 ? 155  ASP B CA  1 
ATOM   3305  C  C   . ASP B  1 163 ? 26.224   78.252  17.470  1.00 29.16 ? 155  ASP B C   1 
ATOM   3306  O  O   . ASP B  1 163 ? 26.594   78.188  16.296  1.00 29.72 ? 155  ASP B O   1 
ATOM   3307  C  CB  . ASP B  1 163 ? 26.295   76.123  18.715  1.00 29.63 ? 155  ASP B CB  1 
ATOM   3308  C  CG  . ASP B  1 163 ? 27.163   75.104  19.425  1.00 32.31 ? 155  ASP B CG  1 
ATOM   3309  O  OD1 . ASP B  1 163 ? 28.390   75.251  19.547  1.00 34.91 ? 155  ASP B OD1 1 
ATOM   3310  O  OD2 . ASP B  1 163 ? 26.581   74.119  19.888  1.00 39.97 ? 155  ASP B OD2 1 
ATOM   3311  N  N   . LEU B  1 164 ? 25.177   78.986  17.874  1.00 28.21 ? 156  LEU B N   1 
ATOM   3312  C  CA  . LEU B  1 164 ? 24.444   79.820  16.925  1.00 28.09 ? 156  LEU B CA  1 
ATOM   3313  C  C   . LEU B  1 164 ? 25.348   80.935  16.409  1.00 28.33 ? 156  LEU B C   1 
ATOM   3314  O  O   . LEU B  1 164 ? 25.322   81.258  15.225  1.00 27.99 ? 156  LEU B O   1 
ATOM   3315  C  CB  . LEU B  1 164 ? 23.182   80.419  17.528  1.00 27.23 ? 156  LEU B CB  1 
ATOM   3316  C  CG  . LEU B  1 164 ? 22.363   81.375  16.642  1.00 27.46 ? 156  LEU B CG  1 
ATOM   3317  C  CD1 . LEU B  1 164 ? 22.078   80.709  15.300  1.00 26.49 ? 156  LEU B CD1 1 
ATOM   3318  C  CD2 . LEU B  1 164 ? 21.024   81.849  17.299  1.00 24.38 ? 156  LEU B CD2 1 
ATOM   3319  N  N   . PHE B  1 165 ? 26.099   81.548  17.317  1.00 28.37 ? 157  PHE B N   1 
ATOM   3320  C  CA  . PHE B  1 165 ? 27.018   82.627  16.978  1.00 28.81 ? 157  PHE B CA  1 
ATOM   3321  C  C   . PHE B  1 165 ? 27.929   82.212  15.796  1.00 30.12 ? 157  PHE B C   1 
ATOM   3322  O  O   . PHE B  1 165 ? 28.126   82.969  14.866  1.00 28.44 ? 157  PHE B O   1 
ATOM   3323  C  CB  . PHE B  1 165 ? 27.866   82.973  18.203  1.00 28.27 ? 157  PHE B CB  1 
ATOM   3324  C  CG  . PHE B  1 165 ? 28.812   84.104  17.986  1.00 28.55 ? 157  PHE B CG  1 
ATOM   3325  C  CD1 . PHE B  1 165 ? 28.351   85.411  17.933  1.00 28.44 ? 157  PHE B CD1 1 
ATOM   3326  C  CD2 . PHE B  1 165 ? 30.165   83.877  17.836  1.00 30.61 ? 157  PHE B CD2 1 
ATOM   3327  C  CE1 . PHE B  1 165 ? 29.204   86.481  17.737  1.00 28.86 ? 157  PHE B CE1 1 
ATOM   3328  C  CE2 . PHE B  1 165 ? 31.021   84.942  17.622  1.00 31.83 ? 157  PHE B CE2 1 
ATOM   3329  C  CZ  . PHE B  1 165 ? 30.524   86.260  17.591  1.00 30.43 ? 157  PHE B CZ  1 
ATOM   3330  N  N   . GLU B  1 166 ? 28.437   80.984  15.827  1.00 31.90 ? 158  GLU B N   1 
ATOM   3331  C  CA  . GLU B  1 166 ? 29.305   80.510  14.759  1.00 34.36 ? 158  GLU B CA  1 
ATOM   3332  C  C   . GLU B  1 166 ? 28.651   80.373  13.408  1.00 34.61 ? 158  GLU B C   1 
ATOM   3333  O  O   . GLU B  1 166 ? 29.323   80.387  12.427  1.00 35.06 ? 158  GLU B O   1 
ATOM   3334  C  CB  . GLU B  1 166 ? 29.989   79.217  15.137  1.00 35.12 ? 158  GLU B CB  1 
ATOM   3335  C  CG  . GLU B  1 166 ? 31.101   79.441  16.182  1.00 39.43 ? 158  GLU B CG  1 
ATOM   3336  C  CD  . GLU B  1 166 ? 31.556   78.138  16.836  1.00 46.00 ? 158  GLU B CD  1 
ATOM   3337  O  OE1 . GLU B  1 166 ? 31.091   77.073  16.345  1.00 49.70 ? 158  GLU B OE1 1 
ATOM   3338  O  OE2 . GLU B  1 166 ? 32.337   78.173  17.834  1.00 49.01 ? 158  GLU B OE2 1 
ATOM   3339  N  N   . LYS B  1 167 ? 27.339   80.300  13.346  1.00 35.66 ? 159  LYS B N   1 
ATOM   3340  C  CA  . LYS B  1 167 ? 26.651   80.119  12.101  1.00 36.22 ? 159  LYS B CA  1 
ATOM   3341  C  C   . LYS B  1 167 ? 26.117   81.407  11.534  1.00 36.06 ? 159  LYS B C   1 
ATOM   3342  O  O   . LYS B  1 167 ? 25.412   81.384  10.519  1.00 37.95 ? 159  LYS B O   1 
ATOM   3343  C  CB  . LYS B  1 167 ? 25.447   79.210  12.331  1.00 36.98 ? 159  LYS B CB  1 
ATOM   3344  C  CG  . LYS B  1 167 ? 25.725   77.803  12.834  1.00 39.13 ? 159  LYS B CG  1 
ATOM   3345  C  CD  . LYS B  1 167 ? 24.319   77.117  12.981  1.00 44.73 ? 159  LYS B CD  1 
ATOM   3346  C  CE  . LYS B  1 167 ? 24.288   75.759  13.710  1.00 48.06 ? 159  LYS B CE  1 
ATOM   3347  N  NZ  . LYS B  1 167 ? 22.855   75.456  14.126  1.00 51.05 ? 159  LYS B NZ  1 
ATOM   3348  N  N   . LEU B  1 168 ? 26.359   82.533  12.172  1.00 35.00 ? 160  LEU B N   1 
ATOM   3349  C  CA  . LEU B  1 168 ? 25.715   83.757  11.695  1.00 35.11 ? 160  LEU B CA  1 
ATOM   3350  C  C   . LEU B  1 168 ? 26.351   84.419  10.477  1.00 35.87 ? 160  LEU B C   1 
ATOM   3351  O  O   . LEU B  1 168 ? 25.879   85.478  10.036  1.00 36.95 ? 160  LEU B O   1 
ATOM   3352  C  CB  . LEU B  1 168 ? 25.684   84.819  12.798  1.00 34.67 ? 160  LEU B CB  1 
ATOM   3353  C  CG  . LEU B  1 168 ? 24.749   84.556  13.967  1.00 34.38 ? 160  LEU B CG  1 
ATOM   3354  C  CD1 . LEU B  1 168 ? 24.863   85.752  14.855  1.00 31.01 ? 160  LEU B CD1 1 
ATOM   3355  C  CD2 . LEU B  1 168 ? 23.344   84.316  13.502  1.00 30.69 ? 160  LEU B CD2 1 
ATOM   3356  N  N   . GLY B  1 169 ? 27.441   83.895  9.957   1.00 35.58 ? 161  GLY B N   1 
ATOM   3357  C  CA  . GLY B  1 169 ? 28.088   84.583  8.847   1.00 35.74 ? 161  GLY B CA  1 
ATOM   3358  C  C   . GLY B  1 169 ? 29.050   85.691  9.250   1.00 35.90 ? 161  GLY B C   1 
ATOM   3359  O  O   . GLY B  1 169 ? 29.497   86.426  8.416   1.00 35.32 ? 161  GLY B O   1 
ATOM   3360  N  N   . ILE B  1 170 ? 29.385   85.798  10.525  1.00 36.62 ? 162  ILE B N   1 
ATOM   3361  C  CA  . ILE B  1 170 ? 30.309   86.819  10.985  1.00 38.00 ? 162  ILE B CA  1 
ATOM   3362  C  C   . ILE B  1 170 ? 31.718   86.437  10.508  1.00 40.63 ? 162  ILE B C   1 
ATOM   3363  O  O   . ILE B  1 170 ? 32.075   85.265  10.572  1.00 41.61 ? 162  ILE B O   1 
ATOM   3364  C  CB  . ILE B  1 170 ? 30.268   86.956  12.495  1.00 36.83 ? 162  ILE B CB  1 
ATOM   3365  C  CG1 . ILE B  1 170 ? 28.919   87.554  12.907  1.00 36.42 ? 162  ILE B CG1 1 
ATOM   3366  C  CG2 . ILE B  1 170 ? 31.363   87.829  12.943  1.00 36.63 ? 162  ILE B CG2 1 
ATOM   3367  C  CD1 . ILE B  1 170 ? 28.556   87.412  14.341  1.00 32.49 ? 162  ILE B CD1 1 
ATOM   3368  N  N   . GLN B  1 171 ? 32.487   87.389  9.970   1.00 42.21 ? 163  GLN B N   1 
ATOM   3369  C  CA  . GLN B  1 171 ? 33.838   87.080  9.445   1.00 43.82 ? 163  GLN B CA  1 
ATOM   3370  C  C   . GLN B  1 171 ? 34.857   87.997  10.014  1.00 42.71 ? 163  GLN B C   1 
ATOM   3371  O  O   . GLN B  1 171 ? 34.707   89.204  9.985   1.00 41.35 ? 163  GLN B O   1 
ATOM   3372  C  CB  . GLN B  1 171 ? 33.931   87.206  7.931   1.00 45.04 ? 163  GLN B CB  1 
ATOM   3373  C  CG  . GLN B  1 171 ? 33.258   86.081  7.140   1.00 51.64 ? 163  GLN B CG  1 
ATOM   3374  C  CD  . GLN B  1 171 ? 33.214   86.395  5.624   1.00 58.68 ? 163  GLN B CD  1 
ATOM   3375  O  OE1 . GLN B  1 171 ? 33.993   87.245  5.137   1.00 63.01 ? 163  GLN B OE1 1 
ATOM   3376  N  NE2 . GLN B  1 171 ? 32.312   85.718  4.881   1.00 60.11 ? 163  GLN B NE2 1 
ATOM   3377  N  N   . GLU B  1 172 ? 35.901   87.381  10.517  1.00 43.23 ? 164  GLU B N   1 
ATOM   3378  C  CA  . GLU B  1 172 ? 37.091   88.064  10.917  1.00 44.39 ? 164  GLU B CA  1 
ATOM   3379  C  C   . GLU B  1 172 ? 38.039   88.150  9.719   1.00 44.71 ? 164  GLU B C   1 
ATOM   3380  O  O   . GLU B  1 172 ? 38.484   87.125  9.189   1.00 44.67 ? 164  GLU B O   1 
ATOM   3381  C  CB  . GLU B  1 172 ? 37.716   87.270  12.040  1.00 44.91 ? 164  GLU B CB  1 
ATOM   3382  C  CG  . GLU B  1 172 ? 38.855   87.969  12.727  1.00 48.31 ? 164  GLU B CG  1 
ATOM   3383  C  CD  . GLU B  1 172 ? 39.514   87.082  13.765  1.00 51.14 ? 164  GLU B CD  1 
ATOM   3384  O  OE1 . GLU B  1 172 ? 40.212   86.130  13.364  1.00 55.60 ? 164  GLU B OE1 1 
ATOM   3385  O  OE2 . GLU B  1 172 ? 39.326   87.324  14.971  1.00 51.90 ? 164  GLU B OE2 1 
ATOM   3386  N  N   . LYS B  1 173 ? 38.337   89.362  9.291   1.00 44.97 ? 165  LYS B N   1 
ATOM   3387  C  CA  . LYS B  1 173 ? 39.265   89.572  8.212   1.00 46.45 ? 165  LYS B CA  1 
ATOM   3388  C  C   . LYS B  1 173 ? 40.151   90.796  8.505   1.00 45.38 ? 165  LYS B C   1 
ATOM   3389  O  O   . LYS B  1 173 ? 39.671   91.921  8.675   1.00 44.74 ? 165  LYS B O   1 
ATOM   3390  C  CB  . LYS B  1 173 ? 38.510   89.698  6.877   1.00 47.60 ? 165  LYS B CB  1 
ATOM   3391  C  CG  . LYS B  1 173 ? 39.367   89.457  5.639   1.00 53.66 ? 165  LYS B CG  1 
ATOM   3392  C  CD  . LYS B  1 173 ? 38.577   89.447  4.265   1.00 59.39 ? 165  LYS B CD  1 
ATOM   3393  C  CE  . LYS B  1 173 ? 38.289   90.900  3.788   1.00 63.11 ? 165  LYS B CE  1 
ATOM   3394  N  NZ  . LYS B  1 173 ? 38.197   91.094  2.309   1.00 64.27 ? 165  LYS B NZ  1 
ATOM   3395  N  N   . ASN B  1 174 ? 41.457   90.545  8.575   1.00 44.49 ? 166  ASN B N   1 
ATOM   3396  C  CA  . ASN B  1 174 ? 42.457   91.567  8.856   1.00 43.85 ? 166  ASN B CA  1 
ATOM   3397  C  C   . ASN B  1 174 ? 42.172   92.301  10.159  1.00 42.58 ? 166  ASN B C   1 
ATOM   3398  O  O   . ASN B  1 174 ? 42.280   93.504  10.244  1.00 40.87 ? 166  ASN B O   1 
ATOM   3399  C  CB  . ASN B  1 174 ? 42.604   92.547  7.667   1.00 44.29 ? 166  ASN B CB  1 
ATOM   3400  C  CG  . ASN B  1 174 ? 43.179   91.881  6.408   1.00 42.97 ? 166  ASN B CG  1 
ATOM   3401  O  OD1 . ASN B  1 174 ? 44.197   91.201  6.458   1.00 39.12 ? 166  ASN B OD1 1 
ATOM   3402  N  ND2 . ASN B  1 174 ? 42.508   92.066  5.290   1.00 38.91 ? 166  ASN B ND2 1 
ATOM   3403  N  N   . GLY B  1 175 ? 41.802   91.538  11.173  1.00 42.11 ? 167  GLY B N   1 
ATOM   3404  C  CA  . GLY B  1 175 ? 41.452   92.097  12.476  1.00 42.03 ? 167  GLY B CA  1 
ATOM   3405  C  C   . GLY B  1 175 ? 40.132   92.864  12.610  1.00 41.35 ? 167  GLY B C   1 
ATOM   3406  O  O   . GLY B  1 175 ? 39.918   93.503  13.626  1.00 41.02 ? 167  GLY B O   1 
ATOM   3407  N  N   . LYS B  1 176 ? 39.271   92.844  11.597  1.00 39.90 ? 168  LYS B N   1 
ATOM   3408  C  CA  . LYS B  1 176 ? 37.959   93.464  11.736  1.00 39.71 ? 168  LYS B CA  1 
ATOM   3409  C  C   . LYS B  1 176 ? 36.856   92.444  11.622  1.00 36.75 ? 168  LYS B C   1 
ATOM   3410  O  O   . LYS B  1 176 ? 37.004   91.415  10.981  1.00 35.90 ? 168  LYS B O   1 
ATOM   3411  C  CB  . LYS B  1 176 ? 37.797   94.588  10.752  1.00 40.79 ? 168  LYS B CB  1 
ATOM   3412  C  CG  . LYS B  1 176 ? 38.968   95.488  10.851  1.00 46.07 ? 168  LYS B CG  1 
ATOM   3413  C  CD  . LYS B  1 176 ? 38.858   96.671  9.955   1.00 53.01 ? 168  LYS B CD  1 
ATOM   3414  C  CE  . LYS B  1 176 ? 40.017   97.646  10.228  1.00 56.20 ? 168  LYS B CE  1 
ATOM   3415  N  NZ  . LYS B  1 176 ? 40.253   97.869  11.713  1.00 57.92 ? 168  LYS B NZ  1 
ATOM   3416  N  N   . ILE B  1 177 ? 35.762   92.722  12.302  1.00 34.23 ? 169  ILE B N   1 
ATOM   3417  C  CA  . ILE B  1 177 ? 34.661   91.793  12.392  1.00 32.13 ? 169  ILE B CA  1 
ATOM   3418  C  C   . ILE B  1 177 ? 33.550   92.337  11.528  1.00 31.23 ? 169  ILE B C   1 
ATOM   3419  O  O   . ILE B  1 177 ? 33.015   93.408  11.795  1.00 30.66 ? 169  ILE B O   1 
ATOM   3420  C  CB  . ILE B  1 177 ? 34.195   91.641  13.847  1.00 32.10 ? 169  ILE B CB  1 
ATOM   3421  C  CG1 . ILE B  1 177 ? 35.384   91.283  14.776  1.00 32.22 ? 169  ILE B CG1 1 
ATOM   3422  C  CG2 . ILE B  1 177 ? 33.131   90.604  13.951  1.00 28.28 ? 169  ILE B CG2 1 
ATOM   3423  C  CD1 . ILE B  1 177 ? 35.026   91.185  16.286  1.00 32.28 ? 169  ILE B CD1 1 
ATOM   3424  N  N   . HIS B  1 178 ? 33.230   91.597  10.480  1.00 30.21 ? 170  HIS B N   1 
ATOM   3425  C  CA  . HIS B  1 178 ? 32.189   91.952  9.507   1.00 29.81 ? 170  HIS B CA  1 
ATOM   3426  C  C   . HIS B  1 178 ? 30.925   91.209  9.869   1.00 28.33 ? 170  HIS B C   1 
ATOM   3427  O  O   . HIS B  1 178 ? 30.927   89.995  9.975   1.00 28.26 ? 170  HIS B O   1 
ATOM   3428  C  CB  . HIS B  1 178 ? 32.592   91.519  8.092   1.00 29.92 ? 170  HIS B CB  1 
ATOM   3429  C  CG  . HIS B  1 178 ? 33.802   92.219  7.558   1.00 33.11 ? 170  HIS B CG  1 
ATOM   3430  N  ND1 . HIS B  1 178 ? 33.722   93.251  6.650   1.00 33.71 ? 170  HIS B ND1 1 
ATOM   3431  C  CD2 . HIS B  1 178 ? 35.122   92.011  7.779   1.00 33.76 ? 170  HIS B CD2 1 
ATOM   3432  C  CE1 . HIS B  1 178 ? 34.938   93.681  6.370   1.00 34.29 ? 170  HIS B CE1 1 
ATOM   3433  N  NE2 . HIS B  1 178 ? 35.804   92.936  7.029   1.00 36.24 ? 170  HIS B NE2 1 
ATOM   3434  N  N   . VAL B  1 179 ? 29.829   91.930  10.016  1.00 27.07 ? 171  VAL B N   1 
ATOM   3435  C  CA  . VAL B  1 179 ? 28.612   91.337  10.508  1.00 25.57 ? 171  VAL B CA  1 
ATOM   3436  C  C   . VAL B  1 179 ? 27.462   91.636  9.545   1.00 25.06 ? 171  VAL B C   1 
ATOM   3437  O  O   . VAL B  1 179 ? 27.115   92.764  9.321   1.00 25.17 ? 171  VAL B O   1 
ATOM   3438  C  CB  . VAL B  1 179 ? 28.258   91.893  11.897  1.00 25.00 ? 171  VAL B CB  1 
ATOM   3439  C  CG1 . VAL B  1 179 ? 26.960   91.241  12.379  1.00 25.22 ? 171  VAL B CG1 1 
ATOM   3440  C  CG2 . VAL B  1 179 ? 29.371   91.666  12.897  1.00 23.22 ? 171  VAL B CG2 1 
ATOM   3441  N  N   . PRO B  1 180 ? 26.877   90.623  8.961   1.00 25.03 ? 172  PRO B N   1 
ATOM   3442  C  CA  . PRO B  1 180 ? 25.725   90.850  8.134   1.00 25.55 ? 172  PRO B CA  1 
ATOM   3443  C  C   . PRO B  1 180 ? 24.514   91.320  8.924   1.00 24.60 ? 172  PRO B C   1 
ATOM   3444  O  O   . PRO B  1 180 ? 24.145   90.700  9.900   1.00 22.62 ? 172  PRO B O   1 
ATOM   3445  C  CB  . PRO B  1 180 ? 25.412   89.471  7.576   1.00 26.09 ? 172  PRO B CB  1 
ATOM   3446  C  CG  . PRO B  1 180 ? 26.572   88.628  7.865   1.00 27.12 ? 172  PRO B CG  1 
ATOM   3447  C  CD  . PRO B  1 180 ? 27.221   89.204  9.045   1.00 25.98 ? 172  PRO B CD  1 
ATOM   3448  N  N   . VAL B  1 181 ? 23.857   92.347  8.412   1.00 24.19 ? 173  VAL B N   1 
ATOM   3449  C  CA  . VAL B  1 181 ? 22.695   92.945  9.039   1.00 23.63 ? 173  VAL B CA  1 
ATOM   3450  C  C   . VAL B  1 181 ? 21.677   93.307  7.968   1.00 24.40 ? 173  VAL B C   1 
ATOM   3451  O  O   . VAL B  1 181 ? 22.064   93.482  6.830   1.00 23.78 ? 173  VAL B O   1 
ATOM   3452  C  CB  . VAL B  1 181 ? 23.092   94.225  9.825   1.00 23.45 ? 173  VAL B CB  1 
ATOM   3453  C  CG1 . VAL B  1 181 ? 24.099   93.860  10.946  1.00 22.98 ? 173  VAL B CG1 1 
ATOM   3454  C  CG2 . VAL B  1 181 ? 23.650   95.326  8.899   1.00 19.54 ? 173  VAL B CG2 1 
ATOM   3455  N  N   . VAL B  1 182 ? 20.381   93.403  8.317   1.00 24.59 ? 174  VAL B N   1 
ATOM   3456  C  CA  . VAL B  1 182 ? 19.367   93.812  7.339   1.00 25.13 ? 174  VAL B CA  1 
ATOM   3457  C  C   . VAL B  1 182 ? 19.162   95.307  7.370   1.00 25.48 ? 174  VAL B C   1 
ATOM   3458  O  O   . VAL B  1 182 ? 18.580   95.848  6.473   1.00 25.80 ? 174  VAL B O   1 
ATOM   3459  C  CB  . VAL B  1 182 ? 18.000   93.150  7.540   1.00 25.14 ? 174  VAL B CB  1 
ATOM   3460  C  CG1 . VAL B  1 182 ? 18.096   91.672  7.498   1.00 26.32 ? 174  VAL B CG1 1 
ATOM   3461  C  CG2 . VAL B  1 182 ? 17.416   93.560  8.858   1.00 25.45 ? 174  VAL B CG2 1 
ATOM   3462  N  N   . ALA B  1 183 ? 19.649   95.980  8.401   1.00 26.02 ? 175  ALA B N   1 
ATOM   3463  C  CA  . ALA B  1 183 ? 19.386   97.428  8.559   1.00 26.26 ? 175  ALA B CA  1 
ATOM   3464  C  C   . ALA B  1 183 ? 20.333   98.018  9.562   1.00 26.58 ? 175  ALA B C   1 
ATOM   3465  O  O   . ALA B  1 183 ? 20.804   97.336  10.454  1.00 25.67 ? 175  ALA B O   1 
ATOM   3466  C  CB  . ALA B  1 183 ? 17.953   97.697  9.009   1.00 25.18 ? 175  ALA B CB  1 
ATOM   3467  N  N   . LYS B  1 184 ? 20.592   99.303  9.385   1.00 27.99 ? 176  LYS B N   1 
ATOM   3468  C  CA  . LYS B  1 184 ? 21.419   100.086 10.261  1.00 28.81 ? 176  LYS B CA  1 
ATOM   3469  C  C   . LYS B  1 184 ? 20.484   101.140 10.825  1.00 29.02 ? 176  LYS B C   1 
ATOM   3470  O  O   . LYS B  1 184 ? 19.923   101.892 10.073  1.00 30.45 ? 176  LYS B O   1 
ATOM   3471  C  CB  . LYS B  1 184 ? 22.541   100.735 9.483   1.00 28.73 ? 176  LYS B CB  1 
ATOM   3472  C  CG  . LYS B  1 184 ? 23.479   99.746  8.795   1.00 31.73 ? 176  LYS B CG  1 
ATOM   3473  C  CD  . LYS B  1 184 ? 24.696   100.448 8.184   1.00 34.54 ? 176  LYS B CD  1 
ATOM   3474  C  CE  . LYS B  1 184 ? 25.488   99.463  7.316   1.00 39.92 ? 176  LYS B CE  1 
ATOM   3475  N  NZ  . LYS B  1 184 ? 26.933   99.791  6.980   1.00 41.14 ? 176  LYS B NZ  1 
ATOM   3476  N  N   . ILE B  1 185 ? 20.321   101.175 12.137  1.00 28.36 ? 177  ILE B N   1 
ATOM   3477  C  CA  . ILE B  1 185 ? 19.327   101.990 12.782  1.00 28.15 ? 177  ILE B CA  1 
ATOM   3478  C  C   . ILE B  1 185 ? 20.016   103.130 13.536  1.00 28.14 ? 177  ILE B C   1 
ATOM   3479  O  O   . ILE B  1 185 ? 20.863   102.888 14.384  1.00 27.92 ? 177  ILE B O   1 
ATOM   3480  C  CB  . ILE B  1 185 ? 18.524   101.141 13.781  1.00 28.15 ? 177  ILE B CB  1 
ATOM   3481  C  CG1 . ILE B  1 185 ? 17.797   100.020 13.024  1.00 29.40 ? 177  ILE B CG1 1 
ATOM   3482  C  CG2 . ILE B  1 185 ? 17.551   102.014 14.553  1.00 26.24 ? 177  ILE B CG2 1 
ATOM   3483  C  CD1 . ILE B  1 185 ? 17.427   98.893  13.855  1.00 30.21 ? 177  ILE B CD1 1 
ATOM   3484  N  N   . PRO B  1 186 ? 19.637   104.370 13.259  1.00 27.63 ? 178  PRO B N   1 
ATOM   3485  C  CA  . PRO B  1 186 ? 20.251   105.475 13.997  1.00 27.91 ? 178  PRO B CA  1 
ATOM   3486  C  C   . PRO B  1 186 ? 19.864   105.498 15.475  1.00 27.20 ? 178  PRO B C   1 
ATOM   3487  O  O   . PRO B  1 186 ? 18.758   105.071 15.836  1.00 26.48 ? 178  PRO B O   1 
ATOM   3488  C  CB  . PRO B  1 186 ? 19.697   106.721 13.308  1.00 28.56 ? 178  PRO B CB  1 
ATOM   3489  C  CG  . PRO B  1 186 ? 19.054   106.255 12.058  1.00 29.25 ? 178  PRO B CG  1 
ATOM   3490  C  CD  . PRO B  1 186 ? 18.673   104.836 12.258  1.00 28.25 ? 178  PRO B CD  1 
ATOM   3491  N  N   . ALA B  1 187 ? 20.761   106.027 16.297  1.00 26.56 ? 179  ALA B N   1 
ATOM   3492  C  CA  . ALA B  1 187 ? 20.536   106.168 17.738  1.00 26.46 ? 179  ALA B CA  1 
ATOM   3493  C  C   . ALA B  1 187 ? 19.120   106.706 18.052  1.00 26.96 ? 179  ALA B C   1 
ATOM   3494  O  O   . ALA B  1 187 ? 18.402   106.145 18.878  1.00 26.32 ? 179  ALA B O   1 
ATOM   3495  C  CB  . ALA B  1 187 ? 21.542   107.072 18.321  1.00 25.78 ? 179  ALA B CB  1 
ATOM   3496  N  N   . HIS B  1 188 ? 18.716   107.758 17.360  1.00 27.21 ? 180  HIS B N   1 
ATOM   3497  C  CA  . HIS B  1 188 ? 17.460   108.403 17.689  1.00 28.71 ? 180  HIS B CA  1 
ATOM   3498  C  C   . HIS B  1 188 ? 16.208   107.566 17.414  1.00 28.83 ? 180  HIS B C   1 
ATOM   3499  O  O   . HIS B  1 188 ? 15.130   107.944 17.889  1.00 29.47 ? 180  HIS B O   1 
ATOM   3500  C  CB  . HIS B  1 188 ? 17.320   109.772 17.014  1.00 29.03 ? 180  HIS B CB  1 
ATOM   3501  C  CG  . HIS B  1 188 ? 17.187   109.700 15.532  1.00 29.93 ? 180  HIS B CG  1 
ATOM   3502  N  ND1 . HIS B  1 188 ? 18.242   109.946 14.682  1.00 31.61 ? 180  HIS B ND1 1 
ATOM   3503  C  CD2 . HIS B  1 188 ? 16.128   109.405 14.746  1.00 32.60 ? 180  HIS B CD2 1 
ATOM   3504  C  CE1 . HIS B  1 188 ? 17.831   109.808 13.433  1.00 31.07 ? 180  HIS B CE1 1 
ATOM   3505  N  NE2 . HIS B  1 188 ? 16.556   109.478 13.445  1.00 30.86 ? 180  HIS B NE2 1 
ATOM   3506  N  N   . MET B  1 189 ? 16.326   106.460 16.680  1.00 28.59 ? 181  MET B N   1 
ATOM   3507  C  CA  . MET B  1 189 ? 15.179   105.569 16.490  1.00 29.04 ? 181  MET B CA  1 
ATOM   3508  C  C   . MET B  1 189 ? 15.029   104.563 17.640  1.00 28.90 ? 181  MET B C   1 
ATOM   3509  O  O   . MET B  1 189 ? 14.129   103.734 17.630  1.00 28.50 ? 181  MET B O   1 
ATOM   3510  C  CB  . MET B  1 189 ? 15.261   104.859 15.137  1.00 29.89 ? 181  MET B CB  1 
ATOM   3511  C  CG  . MET B  1 189 ? 15.116   105.806 13.909  1.00 33.01 ? 181  MET B CG  1 
ATOM   3512  S  SD  . MET B  1 189 ? 13.506   106.635 13.807  1.00 38.97 ? 181  MET B SD  1 
ATOM   3513  C  CE  . MET B  1 189 ? 12.273   105.340 14.020  1.00 37.16 ? 181  MET B CE  1 
ATOM   3514  N  N   . MET B  1 190 ? 15.898   104.642 18.646  1.00 28.59 ? 182  MET B N   1 
ATOM   3515  C  CA  . MET B  1 190 ? 15.812   103.707 19.754  1.00 28.36 ? 182  MET B CA  1 
ATOM   3516  C  C   . MET B  1 190 ? 15.070   104.333 20.927  1.00 28.67 ? 182  MET B C   1 
ATOM   3517  O  O   . MET B  1 190 ? 15.318   105.492 21.260  1.00 29.02 ? 182  MET B O   1 
ATOM   3518  C  CB  . MET B  1 190 ? 17.213   103.300 20.185  1.00 28.35 ? 182  MET B CB  1 
ATOM   3519  C  CG  . MET B  1 190 ? 17.993   102.552 19.117  1.00 27.12 ? 182  MET B CG  1 
ATOM   3520  S  SD  . MET B  1 190 ? 17.168   101.098 18.437  1.00 24.09 ? 182  MET B SD  1 
ATOM   3521  C  CE  . MET B  1 190 ? 16.941   99.992  19.840  1.00 22.74 ? 182  MET B CE  1 
ATOM   3522  N  N   . GLY B  1 191 ? 14.164   103.574 21.544  1.00 28.18 ? 183  GLY B N   1 
ATOM   3523  C  CA  . GLY B  1 191 ? 13.374   104.090 22.668  1.00 29.16 ? 183  GLY B CA  1 
ATOM   3524  C  C   . GLY B  1 191 ? 13.288   103.216 23.930  1.00 29.55 ? 183  GLY B C   1 
ATOM   3525  O  O   . GLY B  1 191 ? 14.295   102.938 24.619  1.00 30.03 ? 183  GLY B O   1 
ATOM   3526  N  N   . SER B  1 192 ? 12.069   102.769 24.230  1.00 28.92 ? 184  SER B N   1 
ATOM   3527  C  CA  . SER B  1 192 ? 11.784   102.082 25.473  1.00 28.26 ? 184  SER B CA  1 
ATOM   3528  C  C   . SER B  1 192 ? 12.847   101.040 25.788  1.00 27.41 ? 184  SER B C   1 
ATOM   3529  O  O   . SER B  1 192 ? 13.134   100.186 24.951  1.00 27.50 ? 184  SER B O   1 
ATOM   3530  C  CB  . SER B  1 192 ? 10.423   101.390 25.391  1.00 28.77 ? 184  SER B CB  1 
ATOM   3531  O  OG  . SER B  1 192 ? 9.983    101.014 26.668  1.00 28.03 ? 184  SER B OG  1 
ATOM   3532  N  N   . GLY B  1 193 ? 13.393   101.109 26.996  1.00 26.46 ? 185  GLY B N   1 
ATOM   3533  C  CA  . GLY B  1 193 ? 14.431   100.227 27.437  1.00 26.01 ? 185  GLY B CA  1 
ATOM   3534  C  C   . GLY B  1 193 ? 15.773   100.928 27.582  1.00 26.55 ? 185  GLY B C   1 
ATOM   3535  O  O   . GLY B  1 193 ? 16.638   100.421 28.296  1.00 26.17 ? 185  GLY B O   1 
ATOM   3536  N  N   . ILE B  1 194 ? 15.993   102.053 26.888  1.00 26.68 ? 186  ILE B N   1 
ATOM   3537  C  CA  . ILE B  1 194 ? 17.230   102.761 27.099  1.00 26.53 ? 186  ILE B CA  1 
ATOM   3538  C  C   . ILE B  1 194 ? 17.292   103.008 28.607  1.00 27.54 ? 186  ILE B C   1 
ATOM   3539  O  O   . ILE B  1 194 ? 16.305   103.386 29.213  1.00 27.75 ? 186  ILE B O   1 
ATOM   3540  C  CB  . ILE B  1 194 ? 17.289   104.088 26.361  1.00 27.12 ? 186  ILE B CB  1 
ATOM   3541  C  CG1 . ILE B  1 194 ? 17.384   103.891 24.840  1.00 27.24 ? 186  ILE B CG1 1 
ATOM   3542  C  CG2 . ILE B  1 194 ? 18.534   104.904 26.792  1.00 24.39 ? 186  ILE B CG2 1 
ATOM   3543  C  CD1 . ILE B  1 194 ? 17.183   105.241 24.033  1.00 27.09 ? 186  ILE B CD1 1 
ATOM   3544  N  N   . GLY B  1 195 ? 18.451   102.775 29.215  1.00 27.87 ? 187  GLY B N   1 
ATOM   3545  C  CA  . GLY B  1 195 ? 18.618   102.950 30.653  1.00 27.56 ? 187  GLY B CA  1 
ATOM   3546  C  C   . GLY B  1 195 ? 18.440   101.688 31.481  1.00 27.11 ? 187  GLY B C   1 
ATOM   3547  O  O   . GLY B  1 195 ? 18.707   101.682 32.683  1.00 27.79 ? 187  GLY B O   1 
ATOM   3548  N  N   . ALA B  1 196 ? 17.954   100.613 30.878  1.00 27.08 ? 188  ALA B N   1 
ATOM   3549  C  CA  . ALA B  1 196 ? 17.892   99.331  31.575  1.00 26.76 ? 188  ALA B CA  1 
ATOM   3550  C  C   . ALA B  1 196 ? 19.305   99.048  32.172  1.00 27.30 ? 188  ALA B C   1 
ATOM   3551  O  O   . ALA B  1 196 ? 20.369   99.410  31.622  1.00 26.24 ? 188  ALA B O   1 
ATOM   3552  C  CB  . ALA B  1 196 ? 17.436   98.212  30.662  1.00 25.29 ? 188  ALA B CB  1 
ATOM   3553  N  N   . SER B  1 197 ? 19.265   98.424  33.328  1.00 27.30 ? 189  SER B N   1 
ATOM   3554  C  CA  . SER B  1 197 ? 20.436   98.176  34.132  1.00 28.53 ? 189  SER B CA  1 
ATOM   3555  C  C   . SER B  1 197 ? 21.511   97.306  33.445  1.00 26.61 ? 189  SER B C   1 
ATOM   3556  O  O   . SER B  1 197 ? 22.714   97.536  33.633  1.00 26.26 ? 189  SER B O   1 
ATOM   3557  C  CB  . SER B  1 197 ? 19.951   97.508  35.432  1.00 28.66 ? 189  SER B CB  1 
ATOM   3558  O  OG  . SER B  1 197 ? 21.072   97.278  36.224  1.00 35.34 ? 189  SER B OG  1 
ATOM   3559  N  N   . SER B  1 198 ? 21.051   96.338  32.654  1.00 24.54 ? 190  SER B N   1 
ATOM   3560  C  CA  . SER B  1 198 ? 21.914   95.419  31.942  1.00 23.74 ? 190  SER B CA  1 
ATOM   3561  C  C   . SER B  1 198 ? 21.343   94.945  30.575  1.00 22.98 ? 190  SER B C   1 
ATOM   3562  O  O   . SER B  1 198 ? 20.249   94.377  30.499  1.00 21.63 ? 190  SER B O   1 
ATOM   3563  C  CB  . SER B  1 198 ? 22.195   94.201  32.802  1.00 23.55 ? 190  SER B CB  1 
ATOM   3564  O  OG  . SER B  1 198 ? 23.089   93.298  32.157  1.00 25.45 ? 190  SER B OG  1 
ATOM   3565  N  N   . SER B  1 199 ? 22.143   95.138  29.529  1.00 21.62 ? 191  SER B N   1 
ATOM   3566  C  CA  . SER B  1 199 ? 21.840   94.626  28.220  1.00 21.56 ? 191  SER B CA  1 
ATOM   3567  C  C   . SER B  1 199 ? 21.792   93.106  28.174  1.00 21.90 ? 191  SER B C   1 
ATOM   3568  O  O   . SER B  1 199 ? 21.311   92.539  27.166  1.00 20.72 ? 191  SER B O   1 
ATOM   3569  C  CB  . SER B  1 199 ? 22.862   95.092  27.213  1.00 21.15 ? 191  SER B CB  1 
ATOM   3570  O  OG  . SER B  1 199 ? 24.177   94.778  27.659  1.00 20.91 ? 191  SER B OG  1 
ATOM   3571  N  N   . ALA B  1 200 ? 22.298   92.457  29.236  1.00 22.21 ? 192  ALA B N   1 
ATOM   3572  C  CA  . ALA B  1 200 ? 22.196   91.009  29.361  1.00 22.40 ? 192  ALA B CA  1 
ATOM   3573  C  C   . ALA B  1 200 ? 20.795   90.521  29.696  1.00 22.19 ? 192  ALA B C   1 
ATOM   3574  O  O   . ALA B  1 200 ? 20.497   89.326  29.518  1.00 23.00 ? 192  ALA B O   1 
ATOM   3575  C  CB  . ALA B  1 200 ? 23.211   90.457  30.405  1.00 22.67 ? 192  ALA B CB  1 
ATOM   3576  N  N   . SER B  1 201 ? 19.934   91.383  30.196  1.00 21.91 ? 193  SER B N   1 
ATOM   3577  C  CA  . SER B  1 201 ? 18.680   90.859  30.754  1.00 22.91 ? 193  SER B CA  1 
ATOM   3578  C  C   . SER B  1 201 ? 17.422   91.516  30.195  1.00 23.22 ? 193  SER B C   1 
ATOM   3579  O  O   . SER B  1 201 ? 16.334   91.335  30.714  1.00 23.52 ? 193  SER B O   1 
ATOM   3580  C  CB  . SER B  1 201 ? 18.710   90.984  32.284  1.00 22.89 ? 193  SER B CB  1 
ATOM   3581  O  OG  . SER B  1 201 ? 18.748   92.333  32.623  1.00 23.69 ? 193  SER B OG  1 
ATOM   3582  N  N   . THR B  1 202 ? 17.573   92.285  29.136  1.00 23.82 ? 194  THR B N   1 
ATOM   3583  C  CA  . THR B  1 202 ? 16.421   92.871  28.495  1.00 23.86 ? 194  THR B CA  1 
ATOM   3584  C  C   . THR B  1 202 ? 16.680   93.226  27.009  1.00 24.48 ? 194  THR B C   1 
ATOM   3585  O  O   . THR B  1 202 ? 17.831   93.269  26.560  1.00 25.17 ? 194  THR B O   1 
ATOM   3586  C  CB  . THR B  1 202 ? 15.979   94.132  29.245  1.00 23.62 ? 194  THR B CB  1 
ATOM   3587  O  OG1 . THR B  1 202 ? 14.722   94.520  28.709  1.00 22.46 ? 194  THR B OG1 1 
ATOM   3588  C  CG2 . THR B  1 202 ? 16.969   95.258  29.035  1.00 21.62 ? 194  THR B CG2 1 
ATOM   3589  N  N   . ASP B  1 203 ? 15.591   93.492  26.292  1.00 24.13 ? 195  ASP B N   1 
ATOM   3590  C  CA  . ASP B  1 203 ? 15.608   94.083  24.968  1.00 24.39 ? 195  ASP B CA  1 
ATOM   3591  C  C   . ASP B  1 203 ? 15.333   95.590  25.039  1.00 24.03 ? 195  ASP B C   1 
ATOM   3592  O  O   . ASP B  1 203 ? 14.928   96.092  26.081  1.00 23.81 ? 195  ASP B O   1 
ATOM   3593  C  CB  . ASP B  1 203 ? 14.501   93.430  24.147  1.00 25.18 ? 195  ASP B CB  1 
ATOM   3594  C  CG  . ASP B  1 203 ? 13.108   93.655  24.745  1.00 26.98 ? 195  ASP B CG  1 
ATOM   3595  O  OD1 . ASP B  1 203 ? 12.993   93.697  26.001  1.00 26.77 ? 195  ASP B OD1 1 
ATOM   3596  O  OD2 . ASP B  1 203 ? 12.144   93.811  23.947  1.00 30.86 ? 195  ASP B OD2 1 
ATOM   3597  N  N   . TYR B  1 204 ? 15.540   96.305  23.943  1.00 23.52 ? 196  TYR B N   1 
ATOM   3598  C  CA  . TYR B  1 204 ? 15.022   97.675  23.857  1.00 23.89 ? 196  TYR B CA  1 
ATOM   3599  C  C   . TYR B  1 204 ? 14.484   97.957  22.457  1.00 23.99 ? 196  TYR B C   1 
ATOM   3600  O  O   . TYR B  1 204 ? 14.767   97.205  21.551  1.00 23.48 ? 196  TYR B O   1 
ATOM   3601  C  CB  . TYR B  1 204 ? 15.983   98.749  24.375  1.00 23.65 ? 196  TYR B CB  1 
ATOM   3602  C  CG  . TYR B  1 204 ? 17.232   99.126  23.579  1.00 23.56 ? 196  TYR B CG  1 
ATOM   3603  C  CD1 . TYR B  1 204 ? 18.157   98.174  23.179  1.00 21.04 ? 196  TYR B CD1 1 
ATOM   3604  C  CD2 . TYR B  1 204 ? 17.552   100.494 23.359  1.00 24.96 ? 196  TYR B CD2 1 
ATOM   3605  C  CE1 . TYR B  1 204 ? 19.357   98.553  22.547  1.00 22.19 ? 196  TYR B CE1 1 
ATOM   3606  C  CE2 . TYR B  1 204 ? 18.729   100.889 22.713  1.00 24.34 ? 196  TYR B CE2 1 
ATOM   3607  C  CZ  . TYR B  1 204 ? 19.639   99.903  22.306  1.00 25.69 ? 196  TYR B CZ  1 
ATOM   3608  O  OH  . TYR B  1 204 ? 20.830   100.267 21.693  1.00 25.40 ? 196  TYR B OH  1 
ATOM   3609  N  N   . ASP B  1 205 ? 13.659   98.993  22.323  1.00 24.38 ? 197  ASP B N   1 
ATOM   3610  C  CA  . ASP B  1 205 ? 12.722   99.084  21.211  1.00 26.02 ? 197  ASP B CA  1 
ATOM   3611  C  C   . ASP B  1 205 ? 13.279   99.947  20.138  1.00 26.29 ? 197  ASP B C   1 
ATOM   3612  O  O   . ASP B  1 205 ? 13.796   101.008 20.435  1.00 26.61 ? 197  ASP B O   1 
ATOM   3613  C  CB  . ASP B  1 205 ? 11.344   99.680  21.629  1.00 26.58 ? 197  ASP B CB  1 
ATOM   3614  C  CG  . ASP B  1 205 ? 10.506   98.729  22.474  1.00 27.81 ? 197  ASP B CG  1 
ATOM   3615  O  OD1 . ASP B  1 205 ? 10.991   97.646  22.871  1.00 30.25 ? 197  ASP B OD1 1 
ATOM   3616  O  OD2 . ASP B  1 205 ? 9.328    99.049  22.731  1.00 31.68 ? 197  ASP B OD2 1 
ATOM   3617  N  N   . ILE B  1 206 ? 13.123   99.512  18.884  1.00 26.59 ? 198  ILE B N   1 
ATOM   3618  C  CA  . ILE B  1 206 ? 13.241   100.428 17.747  1.00 27.14 ? 198  ILE B CA  1 
ATOM   3619  C  C   . ILE B  1 206 ? 11.892   101.126 17.653  1.00 28.87 ? 198  ILE B C   1 
ATOM   3620  O  O   . ILE B  1 206 ? 10.883   100.461 17.337  1.00 29.64 ? 198  ILE B O   1 
ATOM   3621  C  CB  . ILE B  1 206 ? 13.440   99.665  16.455  1.00 26.48 ? 198  ILE B CB  1 
ATOM   3622  C  CG1 . ILE B  1 206 ? 14.703   98.800  16.498  1.00 25.92 ? 198  ILE B CG1 1 
ATOM   3623  C  CG2 . ILE B  1 206 ? 13.472   100.612 15.281  1.00 26.39 ? 198  ILE B CG2 1 
ATOM   3624  C  CD1 . ILE B  1 206 ? 14.714   97.736  15.397  1.00 21.76 ? 198  ILE B CD1 1 
ATOM   3625  N  N   . MET B  1 207 ? 11.829   102.434 17.870  1.00 30.02 ? 199  MET B N   1 
ATOM   3626  C  CA  A MET B  1 207 ? 10.550   103.137 17.915  0.50 31.66 ? 199  MET B CA  1 
ATOM   3627  C  CA  B MET B  1 207 ? 10.504   103.080 17.897  0.50 31.11 ? 199  MET B CA  1 
ATOM   3628  C  C   . MET B  1 207 ? 10.086   103.701 16.557  1.00 32.51 ? 199  MET B C   1 
ATOM   3629  O  O   . MET B  1 207 ? 9.751    104.901 16.469  1.00 34.63 ? 199  MET B O   1 
ATOM   3630  C  CB  A MET B  1 207 ? 10.578   104.234 18.993  0.50 32.04 ? 199  MET B CB  1 
ATOM   3631  C  CB  B MET B  1 207 ? 10.352   104.063 19.057  0.50 30.93 ? 199  MET B CB  1 
ATOM   3632  C  CG  A MET B  1 207 ? 11.804   105.126 18.998  0.50 32.66 ? 199  MET B CG  1 
ATOM   3633  C  CG  B MET B  1 207 ? 11.386   105.108 19.123  0.50 29.59 ? 199  MET B CG  1 
ATOM   3634  S  SD  A MET B  1 207 ? 11.374   106.686 19.790  0.50 34.20 ? 199  MET B SD  1 
ATOM   3635  S  SD  B MET B  1 207 ? 10.722   106.570 19.903  0.50 24.29 ? 199  MET B SD  1 
ATOM   3636  C  CE  A MET B  1 207 ? 9.988    107.089 18.737  0.50 26.01 ? 199  MET B CE  1 
ATOM   3637  C  CE  B MET B  1 207 ? 12.313   107.461 20.064  0.50 20.81 ? 199  MET B CE  1 
ATOM   3638  N  N   . ALA B  1 208 ? 10.072   102.843 15.532  1.00 32.29 ? 200  ALA B N   1 
ATOM   3639  C  CA  . ALA B  1 208 ? 9.637    103.170 14.193  1.00 32.93 ? 200  ALA B CA  1 
ATOM   3640  C  C   . ALA B  1 208 ? 8.231    102.579 13.979  1.00 34.01 ? 200  ALA B C   1 
ATOM   3641  O  O   . ALA B  1 208 ? 8.008    101.364 14.111  1.00 33.69 ? 200  ALA B O   1 
ATOM   3642  C  CB  . ALA B  1 208 ? 10.589   102.561 13.198  1.00 32.09 ? 200  ALA B CB  1 
ATOM   3643  N  N   . SER B  1 209 ? 7.292    103.434 13.622  1.00 35.43 ? 201  SER B N   1 
ATOM   3644  C  CA  . SER B  1 209 ? 5.901    103.012 13.401  1.00 36.87 ? 201  SER B CA  1 
ATOM   3645  C  C   . SER B  1 209 ? 5.801    102.189 12.155  1.00 36.59 ? 201  SER B C   1 
ATOM   3646  O  O   . SER B  1 209 ? 4.929    101.361 12.096  1.00 36.68 ? 201  SER B O   1 
ATOM   3647  C  CB  . SER B  1 209 ? 4.899    104.199 13.239  1.00 37.17 ? 201  SER B CB  1 
ATOM   3648  O  OG  . SER B  1 209 ? 5.397    105.421 13.772  1.00 40.93 ? 201  SER B OG  1 
ATOM   3649  N  N   . ASN B  1 210 ? 6.658    102.458 11.163  1.00 37.18 ? 202  ASN B N   1 
ATOM   3650  C  CA  . ASN B  1 210 ? 6.634    101.773 9.871   1.00 38.29 ? 202  ASN B CA  1 
ATOM   3651  C  C   . ASN B  1 210 ? 8.036    101.432 9.479   1.00 37.48 ? 202  ASN B C   1 
ATOM   3652  O  O   . ASN B  1 210 ? 8.920    102.188 9.782   1.00 36.83 ? 202  ASN B O   1 
ATOM   3653  C  CB  . ASN B  1 210 ? 6.015    102.688 8.806   1.00 39.67 ? 202  ASN B CB  1 
ATOM   3654  C  CG  . ASN B  1 210 ? 4.541    102.945 9.088   1.00 43.65 ? 202  ASN B CG  1 
ATOM   3655  O  OD1 . ASN B  1 210 ? 4.158    104.035 9.500   1.00 49.23 ? 202  ASN B OD1 1 
ATOM   3656  N  ND2 . ASN B  1 210 ? 3.727    101.896 8.979   1.00 45.64 ? 202  ASN B ND2 1 
ATOM   3657  N  N   . PRO B  1 211 ? 8.239    100.293 8.800   1.00 37.40 ? 203  PRO B N   1 
ATOM   3658  C  CA  . PRO B  1 211 ? 9.581    99.899  8.415   1.00 38.23 ? 203  PRO B CA  1 
ATOM   3659  C  C   . PRO B  1 211 ? 10.270   100.947 7.538   1.00 39.33 ? 203  PRO B C   1 
ATOM   3660  O  O   . PRO B  1 211 ? 11.493   101.080 7.562   1.00 39.83 ? 203  PRO B O   1 
ATOM   3661  C  CB  . PRO B  1 211 ? 9.372    98.553  7.666   1.00 38.45 ? 203  PRO B CB  1 
ATOM   3662  C  CG  . PRO B  1 211 ? 7.900    98.417  7.450   1.00 37.40 ? 203  PRO B CG  1 
ATOM   3663  C  CD  . PRO B  1 211 ? 7.223    99.286  8.426   1.00 37.39 ? 203  PRO B CD  1 
ATOM   3664  N  N   . GLU B  1 212 ? 9.472    101.694 6.797   1.00 41.07 ? 204  GLU B N   1 
ATOM   3665  C  CA  . GLU B  1 212 ? 9.960    102.690 5.854   1.00 43.23 ? 204  GLU B CA  1 
ATOM   3666  C  C   . GLU B  1 212 ? 10.682   103.785 6.615   1.00 42.70 ? 204  GLU B C   1 
ATOM   3667  O  O   . GLU B  1 212 ? 11.678   104.322 6.144   1.00 42.29 ? 204  GLU B O   1 
ATOM   3668  C  CB  . GLU B  1 212 ? 8.791    103.240 5.014   1.00 44.52 ? 204  GLU B CB  1 
ATOM   3669  C  CG  . GLU B  1 212 ? 8.207    102.211 3.963   1.00 49.37 ? 204  GLU B CG  1 
ATOM   3670  C  CD  . GLU B  1 212 ? 7.106    101.212 4.521   1.00 54.71 ? 204  GLU B CD  1 
ATOM   3671  O  OE1 . GLU B  1 212 ? 6.604    101.299 5.693   1.00 54.04 ? 204  GLU B OE1 1 
ATOM   3672  O  OE2 . GLU B  1 212 ? 6.755    100.307 3.737   1.00 59.05 ? 204  GLU B OE2 1 
ATOM   3673  N  N   . ASP B  1 213 ? 10.215   104.055 7.834   1.00 42.82 ? 205  ASP B N   1 
ATOM   3674  C  CA  . ASP B  1 213 ? 10.916   104.974 8.734   1.00 43.13 ? 205  ASP B CA  1 
ATOM   3675  C  C   . ASP B  1 213 ? 12.364   104.558 8.989   1.00 42.12 ? 205  ASP B C   1 
ATOM   3676  O  O   . ASP B  1 213 ? 13.158   105.364 9.444   1.00 42.80 ? 205  ASP B O   1 
ATOM   3677  C  CB  . ASP B  1 213 ? 10.171   105.112 10.062  1.00 43.21 ? 205  ASP B CB  1 
ATOM   3678  C  CG  . ASP B  1 213 ? 8.822    105.718 9.889   1.00 45.82 ? 205  ASP B CG  1 
ATOM   3679  O  OD1 . ASP B  1 213 ? 8.721    106.681 9.075   1.00 48.27 ? 205  ASP B OD1 1 
ATOM   3680  O  OD2 . ASP B  1 213 ? 7.874    105.227 10.547  1.00 49.39 ? 205  ASP B OD2 1 
ATOM   3681  N  N   . LEU B  1 214 ? 12.697   103.295 8.733   1.00 40.94 ? 206  LEU B N   1 
ATOM   3682  C  CA  . LEU B  1 214 ? 14.080   102.827 8.850   1.00 40.02 ? 206  LEU B CA  1 
ATOM   3683  C  C   . LEU B  1 214 ? 14.780   102.743 7.499   1.00 39.76 ? 206  LEU B C   1 
ATOM   3684  O  O   . LEU B  1 214 ? 15.897   102.276 7.438   1.00 39.53 ? 206  LEU B O   1 
ATOM   3685  C  CB  . LEU B  1 214 ? 14.154   101.465 9.569   1.00 39.04 ? 206  LEU B CB  1 
ATOM   3686  C  CG  . LEU B  1 214 ? 13.459   101.416 10.928  1.00 37.13 ? 206  LEU B CG  1 
ATOM   3687  C  CD1 . LEU B  1 214 ? 13.312   99.981  11.399  1.00 34.65 ? 206  LEU B CD1 1 
ATOM   3688  C  CD2 . LEU B  1 214 ? 14.188   102.299 11.931  1.00 33.69 ? 206  LEU B CD2 1 
ATOM   3689  N  N   . GLY B  1 215 ? 14.137   103.192 6.423   1.00 40.02 ? 207  GLY B N   1 
ATOM   3690  C  CA  . GLY B  1 215 ? 14.691   103.015 5.066   1.00 39.52 ? 207  GLY B CA  1 
ATOM   3691  C  C   . GLY B  1 215 ? 14.680   101.581 4.519   1.00 39.39 ? 207  GLY B C   1 
ATOM   3692  O  O   . GLY B  1 215 ? 15.428   101.279 3.564   1.00 39.44 ? 207  GLY B O   1 
ATOM   3693  N  N   . VAL B  1 216 ? 13.834   100.703 5.093   1.00 37.81 ? 208  VAL B N   1 
ATOM   3694  C  CA  . VAL B  1 216 ? 13.645   99.361  4.558   1.00 36.35 ? 208  VAL B CA  1 
ATOM   3695  C  C   . VAL B  1 216 ? 12.176   99.054  4.340   1.00 35.92 ? 208  VAL B C   1 
ATOM   3696  O  O   . VAL B  1 216 ? 11.301   99.727  4.852   1.00 35.40 ? 208  VAL B O   1 
ATOM   3697  C  CB  . VAL B  1 216 ? 14.305   98.314  5.471   1.00 36.77 ? 208  VAL B CB  1 
ATOM   3698  C  CG1 . VAL B  1 216 ? 15.821   98.551  5.483   1.00 36.32 ? 208  VAL B CG1 1 
ATOM   3699  C  CG2 . VAL B  1 216 ? 13.669   98.323  6.920   1.00 33.97 ? 208  VAL B CG2 1 
ATOM   3700  N  N   . ALA B  1 217 ? 11.894   98.019  3.567   1.00 35.39 ? 209  ALA B N   1 
ATOM   3701  C  CA  . ALA B  1 217 ? 10.510   97.694  3.204   1.00 34.68 ? 209  ALA B CA  1 
ATOM   3702  C  C   . ALA B  1 217 ? 9.866    96.811  4.257   1.00 33.94 ? 209  ALA B C   1 
ATOM   3703  O  O   . ALA B  1 217 ? 8.673    96.772  4.385   1.00 33.44 ? 209  ALA B O   1 
ATOM   3704  C  CB  . ALA B  1 217 ? 10.476   96.975  1.854   1.00 34.42 ? 209  ALA B CB  1 
ATOM   3705  N  N   . ASP B  1 218 ? 10.677   96.046  4.966   1.00 33.56 ? 210  ASP B N   1 
ATOM   3706  C  CA  . ASP B  1 218 ? 10.180   95.167  6.010   1.00 33.48 ? 210  ASP B CA  1 
ATOM   3707  C  C   . ASP B  1 218 ? 11.265   95.005  7.052   1.00 32.40 ? 210  ASP B C   1 
ATOM   3708  O  O   . ASP B  1 218 ? 12.435   95.314  6.799   1.00 33.24 ? 210  ASP B O   1 
ATOM   3709  C  CB  . ASP B  1 218 ? 9.747    93.804  5.474   1.00 33.37 ? 210  ASP B CB  1 
ATOM   3710  C  CG  . ASP B  1 218 ? 8.789    93.057  6.435   1.00 34.93 ? 210  ASP B CG  1 
ATOM   3711  O  OD1 . ASP B  1 218 ? 8.239    93.658  7.391   1.00 32.60 ? 210  ASP B OD1 1 
ATOM   3712  O  OD2 . ASP B  1 218 ? 8.580    91.848  6.226   1.00 39.02 ? 210  ASP B OD2 1 
ATOM   3713  N  N   . LEU B  1 219 ? 10.838   94.628  8.251   1.00 30.56 ? 211  LEU B N   1 
ATOM   3714  C  CA  . LEU B  1 219 ? 11.724   94.181  9.300   1.00 28.50 ? 211  LEU B CA  1 
ATOM   3715  C  C   . LEU B  1 219 ? 11.055   92.966  9.901   1.00 27.42 ? 211  LEU B C   1 
ATOM   3716  O  O   . LEU B  1 219 ? 9.874    92.986  10.194  1.00 26.38 ? 211  LEU B O   1 
ATOM   3717  C  CB  . LEU B  1 219 ? 11.914   95.283  10.304  1.00 27.79 ? 211  LEU B CB  1 
ATOM   3718  C  CG  . LEU B  1 219 ? 13.003   95.089  11.330  1.00 27.76 ? 211  LEU B CG  1 
ATOM   3719  C  CD1 . LEU B  1 219 ? 14.386   95.260  10.681  1.00 27.07 ? 211  LEU B CD1 1 
ATOM   3720  C  CD2 . LEU B  1 219 ? 12.800   96.100  12.450  1.00 24.18 ? 211  LEU B CD2 1 
ATOM   3721  N  N   . LYS B  1 220 ? 11.810   91.887  10.004  1.00 26.72 ? 212  LYS B N   1 
ATOM   3722  C  CA  . LYS B  1 220 ? 11.277   90.607  10.427  1.00 26.53 ? 212  LYS B CA  1 
ATOM   3723  C  C   . LYS B  1 220 ? 11.722   90.260  11.841  1.00 25.57 ? 212  LYS B C   1 
ATOM   3724  O  O   . LYS B  1 220 ? 12.793   90.685  12.306  1.00 24.61 ? 212  LYS B O   1 
ATOM   3725  C  CB  . LYS B  1 220 ? 11.705   89.496  9.469   1.00 27.56 ? 212  LYS B CB  1 
ATOM   3726  C  CG  . LYS B  1 220 ? 11.157   89.647  8.051   1.00 29.61 ? 212  LYS B CG  1 
ATOM   3727  C  CD  . LYS B  1 220 ? 11.801   88.689  7.077   1.00 33.47 ? 212  LYS B CD  1 
ATOM   3728  C  CE  . LYS B  1 220 ? 11.149   88.798  5.681   1.00 35.75 ? 212  LYS B CE  1 
ATOM   3729  N  NZ  . LYS B  1 220 ? 11.273   90.228  5.186   1.00 38.31 ? 212  LYS B NZ  1 
ATOM   3730  N  N   . LEU B  1 221 ? 10.853   89.527  12.528  1.00 23.66 ? 213  LEU B N   1 
ATOM   3731  C  CA  . LEU B  1 221 ? 11.202   88.893  13.771  1.00 22.49 ? 213  LEU B CA  1 
ATOM   3732  C  C   . LEU B  1 221 ? 12.349   87.947  13.460  1.00 22.15 ? 213  LEU B C   1 
ATOM   3733  O  O   . LEU B  1 221 ? 12.308   87.203  12.488  1.00 23.16 ? 213  LEU B O   1 
ATOM   3734  C  CB  . LEU B  1 221 ? 9.994    88.167  14.383  1.00 21.81 ? 213  LEU B CB  1 
ATOM   3735  C  CG  . LEU B  1 221 ? 8.758    89.034  14.670  1.00 20.96 ? 213  LEU B CG  1 
ATOM   3736  C  CD1 . LEU B  1 221 ? 7.557    88.123  14.944  1.00 17.77 ? 213  LEU B CD1 1 
ATOM   3737  C  CD2 . LEU B  1 221 ? 8.956    90.092  15.773  1.00 17.52 ? 213  LEU B CD2 1 
ATOM   3738  N  N   . GLY B  1 222 ? 13.422   88.055  14.233  1.00 22.47 ? 214  GLY B N   1 
ATOM   3739  C  CA  . GLY B  1 222 ? 14.635   87.273  14.016  1.00 22.27 ? 214  GLY B CA  1 
ATOM   3740  C  C   . GLY B  1 222 ? 15.701   87.946  13.169  1.00 22.44 ? 214  GLY B C   1 
ATOM   3741  O  O   . GLY B  1 222 ? 16.782   87.406  13.002  1.00 21.92 ? 214  GLY B O   1 
ATOM   3742  N  N   . ASP B  1 223 ? 15.431   89.151  12.683  1.00 22.75 ? 215  ASP B N   1 
ATOM   3743  C  CA  . ASP B  1 223 ? 16.419   89.866  11.877  1.00 22.54 ? 215  ASP B CA  1 
ATOM   3744  C  C   . ASP B  1 223 ? 17.580   90.381  12.732  1.00 22.09 ? 215  ASP B C   1 
ATOM   3745  O  O   . ASP B  1 223 ? 17.406   90.791  13.878  1.00 21.95 ? 215  ASP B O   1 
ATOM   3746  C  CB  . ASP B  1 223 ? 15.775   91.044  11.144  1.00 23.09 ? 215  ASP B CB  1 
ATOM   3747  C  CG  . ASP B  1 223 ? 15.095   90.648  9.756   1.00 26.93 ? 215  ASP B CG  1 
ATOM   3748  O  OD1 . ASP B  1 223 ? 15.179   89.451  9.272   1.00 25.73 ? 215  ASP B OD1 1 
ATOM   3749  O  OD2 . ASP B  1 223 ? 14.476   91.607  9.160   1.00 29.81 ? 215  ASP B OD2 1 
ATOM   3750  N  N   . ILE B  1 224 ? 18.770   90.363  12.149  1.00 21.61 ? 216  ILE B N   1 
ATOM   3751  C  CA  . ILE B  1 224 ? 19.951   90.901  12.746  1.00 20.88 ? 216  ILE B CA  1 
ATOM   3752  C  C   . ILE B  1 224 ? 20.094   92.275  12.229  1.00 21.08 ? 216  ILE B C   1 
ATOM   3753  O  O   . ILE B  1 224 ? 20.092   92.496  11.025  1.00 23.19 ? 216  ILE B O   1 
ATOM   3754  C  CB  . ILE B  1 224 ? 21.148   90.043  12.350  1.00 21.84 ? 216  ILE B CB  1 
ATOM   3755  C  CG1 . ILE B  1 224 ? 20.901   88.606  12.843  1.00 23.09 ? 216  ILE B CG1 1 
ATOM   3756  C  CG2 . ILE B  1 224 ? 22.475   90.611  12.888  1.00 19.18 ? 216  ILE B CG2 1 
ATOM   3757  C  CD1 . ILE B  1 224 ? 21.581   87.571  12.065  1.00 27.52 ? 216  ILE B CD1 1 
ATOM   3758  N  N   . VAL B  1 225 ? 20.218   93.206  13.131  1.00 20.64 ? 217  VAL B N   1 
ATOM   3759  C  CA  . VAL B  1 225 ? 20.340   94.623  12.824  1.00 20.56 ? 217  VAL B CA  1 
ATOM   3760  C  C   . VAL B  1 225 ? 21.553   95.248  13.535  1.00 20.78 ? 217  VAL B C   1 
ATOM   3761  O  O   . VAL B  1 225 ? 22.095   94.688  14.500  1.00 20.08 ? 217  VAL B O   1 
ATOM   3762  C  CB  . VAL B  1 225 ? 19.074   95.398  13.284  1.00 20.67 ? 217  VAL B CB  1 
ATOM   3763  C  CG1 . VAL B  1 225 ? 17.821   94.849  12.571  1.00 20.44 ? 217  VAL B CG1 1 
ATOM   3764  C  CG2 . VAL B  1 225 ? 18.907   95.311  14.790  1.00 18.62 ? 217  VAL B CG2 1 
ATOM   3765  N  N   . ALA B  1 226 ? 21.955   96.414  13.046  1.00 21.16 ? 218  ALA B N   1 
ATOM   3766  C  CA  . ALA B  1 226 ? 22.980   97.245  13.679  1.00 22.20 ? 218  ALA B CA  1 
ATOM   3767  C  C   . ALA B  1 226 ? 22.330   98.467  14.251  1.00 22.52 ? 218  ALA B C   1 
ATOM   3768  O  O   . ALA B  1 226 ? 21.496   99.056  13.600  1.00 22.84 ? 218  ALA B O   1 
ATOM   3769  C  CB  . ALA B  1 226 ? 24.045   97.684  12.674  1.00 21.39 ? 218  ALA B CB  1 
ATOM   3770  N  N   . ILE B  1 227 ? 22.744   98.865  15.455  1.00 23.75 ? 219  ILE B N   1 
ATOM   3771  C  CA  . ILE B  1 227 ? 22.297   100.110 16.058  1.00 23.87 ? 219  ILE B CA  1 
ATOM   3772  C  C   . ILE B  1 227 ? 23.484   101.006 16.106  1.00 24.05 ? 219  ILE B C   1 
ATOM   3773  O  O   . ILE B  1 227 ? 24.474   100.720 16.770  1.00 24.58 ? 219  ILE B O   1 
ATOM   3774  C  CB  . ILE B  1 227 ? 21.739   99.869  17.467  1.00 24.45 ? 219  ILE B CB  1 
ATOM   3775  C  CG1 . ILE B  1 227 ? 20.648   98.815  17.398  1.00 24.07 ? 219  ILE B CG1 1 
ATOM   3776  C  CG2 . ILE B  1 227 ? 21.258   101.190 18.105  1.00 21.76 ? 219  ILE B CG2 1 
ATOM   3777  C  CD1 . ILE B  1 227 ? 20.241   98.359  18.755  1.00 29.56 ? 219  ILE B CD1 1 
ATOM   3778  N  N   . GLN B  1 228 ? 23.391   102.091 15.382  1.00 24.77 ? 220  GLN B N   1 
ATOM   3779  C  CA  . GLN B  1 228 ? 24.492   103.002 15.219  1.00 26.22 ? 220  GLN B CA  1 
ATOM   3780  C  C   . GLN B  1 228 ? 24.613   103.930 16.401  1.00 25.74 ? 220  GLN B C   1 
ATOM   3781  O  O   . GLN B  1 228 ? 23.643   104.492 16.850  1.00 25.40 ? 220  GLN B O   1 
ATOM   3782  C  CB  . GLN B  1 228 ? 24.260   103.825 13.952  1.00 27.94 ? 220  GLN B CB  1 
ATOM   3783  C  CG  . GLN B  1 228 ? 24.349   103.024 12.691  1.00 32.21 ? 220  GLN B CG  1 
ATOM   3784  C  CD  . GLN B  1 228 ? 24.107   103.878 11.457  1.00 40.38 ? 220  GLN B CD  1 
ATOM   3785  O  OE1 . GLN B  1 228 ? 23.174   104.716 11.399  1.00 43.56 ? 220  GLN B OE1 1 
ATOM   3786  N  NE2 . GLN B  1 228 ? 24.927   103.646 10.436  1.00 42.92 ? 220  GLN B NE2 1 
ATOM   3787  N  N   . ASP B  1 229 ? 25.822   104.107 16.879  1.00 25.60 ? 221  ASP B N   1 
ATOM   3788  C  CA  . ASP B  1 229 ? 26.141   105.084 17.906  1.00 26.01 ? 221  ASP B CA  1 
ATOM   3789  C  C   . ASP B  1 229 ? 25.537   104.776 19.294  1.00 26.35 ? 221  ASP B C   1 
ATOM   3790  O  O   . ASP B  1 229 ? 25.323   105.702 20.136  1.00 26.00 ? 221  ASP B O   1 
ATOM   3791  C  CB  . ASP B  1 229 ? 25.761   106.502 17.463  1.00 27.04 ? 221  ASP B CB  1 
ATOM   3792  C  CG  . ASP B  1 229 ? 26.413   106.925 16.126  1.00 27.46 ? 221  ASP B CG  1 
ATOM   3793  O  OD1 . ASP B  1 229 ? 27.633   106.745 15.937  1.00 27.98 ? 221  ASP B OD1 1 
ATOM   3794  O  OD2 . ASP B  1 229 ? 25.676   107.450 15.267  1.00 28.73 ? 221  ASP B OD2 1 
ATOM   3795  N  N   . HIS B  1 230 ? 25.299   103.489 19.546  1.00 25.18 ? 222  HIS B N   1 
ATOM   3796  C  CA  . HIS B  1 230 ? 24.894   103.015 20.866  1.00 24.99 ? 222  HIS B CA  1 
ATOM   3797  C  C   . HIS B  1 230 ? 25.890   101.980 21.368  1.00 24.81 ? 222  HIS B C   1 
ATOM   3798  O  O   . HIS B  1 230 ? 26.152   100.984 20.689  1.00 24.41 ? 222  HIS B O   1 
ATOM   3799  C  CB  . HIS B  1 230 ? 23.495   102.394 20.832  1.00 25.15 ? 222  HIS B CB  1 
ATOM   3800  C  CG  . HIS B  1 230 ? 22.380   103.363 21.074  1.00 25.53 ? 222  HIS B CG  1 
ATOM   3801  N  ND1 . HIS B  1 230 ? 21.140   102.957 21.518  1.00 21.36 ? 222  HIS B ND1 1 
ATOM   3802  C  CD2 . HIS B  1 230 ? 22.321   104.721 20.971  1.00 27.34 ? 222  HIS B CD2 1 
ATOM   3803  C  CE1 . HIS B  1 230 ? 20.361   104.019 21.662  1.00 25.54 ? 222  HIS B CE1 1 
ATOM   3804  N  NE2 . HIS B  1 230 ? 21.046   105.103 21.320  1.00 26.20 ? 222  HIS B NE2 1 
ATOM   3805  N  N   . ASP B  1 231 ? 26.470   102.251 22.538  1.00 25.43 ? 223  ASP B N   1 
ATOM   3806  C  CA  . ASP B  1 231 ? 27.188   101.263 23.302  1.00 25.89 ? 223  ASP B CA  1 
ATOM   3807  C  C   . ASP B  1 231 ? 26.207   100.532 24.255  1.00 25.05 ? 223  ASP B C   1 
ATOM   3808  O  O   . ASP B  1 231 ? 25.448   101.168 24.951  1.00 23.97 ? 223  ASP B O   1 
ATOM   3809  C  CB  . ASP B  1 231 ? 28.345   101.865 24.120  1.00 26.47 ? 223  ASP B CB  1 
ATOM   3810  C  CG  . ASP B  1 231 ? 28.881   100.868 25.136  1.00 28.79 ? 223  ASP B CG  1 
ATOM   3811  O  OD1 . ASP B  1 231 ? 29.518   99.873  24.780  1.00 32.28 ? 223  ASP B OD1 1 
ATOM   3812  O  OD2 . ASP B  1 231 ? 28.559   100.976 26.311  1.00 39.24 ? 223  ASP B OD2 1 
ATOM   3813  N  N   . ASN B  1 232 ? 26.282   99.201  24.278  1.00 24.33 ? 224  ASN B N   1 
ATOM   3814  C  CA  . ASN B  1 232 ? 25.471   98.366  25.164  1.00 24.59 ? 224  ASN B CA  1 
ATOM   3815  C  C   . ASN B  1 232 ? 26.303   97.409  26.020  1.00 24.75 ? 224  ASN B C   1 
ATOM   3816  O  O   . ASN B  1 232 ? 25.869   96.314  26.406  1.00 26.02 ? 224  ASN B O   1 
ATOM   3817  C  CB  . ASN B  1 232 ? 24.427   97.600  24.327  1.00 23.86 ? 224  ASN B CB  1 
ATOM   3818  C  CG  . ASN B  1 232 ? 23.290   98.488  23.884  1.00 24.26 ? 224  ASN B CG  1 
ATOM   3819  O  OD1 . ASN B  1 232 ? 22.428   98.840  24.693  1.00 23.01 ? 224  ASN B OD1 1 
ATOM   3820  N  ND2 . ASN B  1 232 ? 23.283   98.874  22.597  1.00 22.09 ? 224  ASN B ND2 1 
ATOM   3821  N  N   . SER B  1 233 ? 27.509   97.826  26.332  1.00 25.30 ? 225  SER B N   1 
ATOM   3822  C  CA  . SER B  1 233 ? 28.443   97.009  27.089  1.00 25.37 ? 225  SER B CA  1 
ATOM   3823  C  C   . SER B  1 233 ? 27.944   96.612  28.477  1.00 25.02 ? 225  SER B C   1 
ATOM   3824  O  O   . SER B  1 233 ? 28.200   95.517  28.922  1.00 25.01 ? 225  SER B O   1 
ATOM   3825  C  CB  . SER B  1 233 ? 29.768   97.770  27.240  1.00 26.04 ? 225  SER B CB  1 
ATOM   3826  O  OG  . SER B  1 233 ? 30.353   97.927  25.983  1.00 25.08 ? 225  SER B OG  1 
ATOM   3827  N  N   . TYR B  1 234 ? 27.261   97.519  29.158  1.00 25.44 ? 226  TYR B N   1 
ATOM   3828  C  CA  . TYR B  1 234 ? 26.788   97.283  30.519  1.00 25.82 ? 226  TYR B CA  1 
ATOM   3829  C  C   . TYR B  1 234 ? 25.316   97.611  30.520  1.00 25.71 ? 226  TYR B C   1 
ATOM   3830  O  O   . TYR B  1 234 ? 24.491   96.724  30.201  1.00 25.18 ? 226  TYR B O   1 
ATOM   3831  C  CB  . TYR B  1 234 ? 27.632   98.072  31.566  1.00 26.62 ? 226  TYR B CB  1 
ATOM   3832  C  CG  . TYR B  1 234 ? 29.073   97.667  31.447  1.00 26.37 ? 226  TYR B CG  1 
ATOM   3833  C  CD1 . TYR B  1 234 ? 29.479   96.395  31.889  1.00 27.78 ? 226  TYR B CD1 1 
ATOM   3834  C  CD2 . TYR B  1 234 ? 29.997   98.457  30.761  1.00 27.90 ? 226  TYR B CD2 1 
ATOM   3835  C  CE1 . TYR B  1 234 ? 30.762   95.932  31.729  1.00 26.32 ? 226  TYR B CE1 1 
ATOM   3836  C  CE2 . TYR B  1 234 ? 31.319   97.996  30.560  1.00 29.30 ? 226  TYR B CE2 1 
ATOM   3837  C  CZ  . TYR B  1 234 ? 31.673   96.699  31.073  1.00 30.70 ? 226  TYR B CZ  1 
ATOM   3838  O  OH  . TYR B  1 234 ? 32.926   96.172  30.950  1.00 31.18 ? 226  TYR B OH  1 
ATOM   3839  N  N   . GLY B  1 235 ? 24.981   98.876  30.805  1.00 25.44 ? 227  GLY B N   1 
ATOM   3840  C  CA  . GLY B  1 235 ? 23.606   99.340  30.699  1.00 24.81 ? 227  GLY B CA  1 
ATOM   3841  C  C   . GLY B  1 235 ? 23.174   99.486  29.243  1.00 24.50 ? 227  GLY B C   1 
ATOM   3842  O  O   . GLY B  1 235 ? 23.988   99.465  28.327  1.00 24.06 ? 227  GLY B O   1 
ATOM   3843  N  N   . VAL B  1 236 ? 21.873   99.655  29.028  1.00 24.55 ? 228  VAL B N   1 
ATOM   3844  C  CA  . VAL B  1 236 ? 21.306   99.716  27.692  1.00 23.38 ? 228  VAL B CA  1 
ATOM   3845  C  C   . VAL B  1 236 ? 21.282   101.144 27.142  1.00 24.06 ? 228  VAL B C   1 
ATOM   3846  O  O   . VAL B  1 236 ? 20.844   102.073 27.792  1.00 23.55 ? 228  VAL B O   1 
ATOM   3847  C  CB  . VAL B  1 236 ? 19.929   99.092  27.667  1.00 22.60 ? 228  VAL B CB  1 
ATOM   3848  C  CG1 . VAL B  1 236 ? 19.279   99.270  26.292  1.00 21.66 ? 228  VAL B CG1 1 
ATOM   3849  C  CG2 . VAL B  1 236 ? 20.025   97.604  28.003  1.00 21.92 ? 228  VAL B CG2 1 
ATOM   3850  N  N   . GLY B  1 237 ? 21.755   101.303 25.924  1.00 24.66 ? 229  GLY B N   1 
ATOM   3851  C  CA  . GLY B  1 237 ? 21.419   102.496 25.119  1.00 25.55 ? 229  GLY B CA  1 
ATOM   3852  C  C   . GLY B  1 237 ? 22.218   103.759 25.390  1.00 26.38 ? 229  GLY B C   1 
ATOM   3853  O  O   . GLY B  1 237 ? 21.652   104.847 25.308  1.00 25.51 ? 229  GLY B O   1 
ATOM   3854  N  N   . LYS B  1 238 ? 23.516   103.615 25.720  1.00 26.66 ? 230  LYS B N   1 
ATOM   3855  C  CA  . LYS B  1 238 ? 24.401   104.768 25.860  1.00 28.41 ? 230  LYS B CA  1 
ATOM   3856  C  C   . LYS B  1 238 ? 24.706   105.340 24.496  1.00 27.92 ? 230  LYS B C   1 
ATOM   3857  O  O   . LYS B  1 238 ? 25.335   104.652 23.662  1.00 26.70 ? 230  LYS B O   1 
ATOM   3858  C  CB  . LYS B  1 238 ? 25.719   104.367 26.550  1.00 29.81 ? 230  LYS B CB  1 
ATOM   3859  C  CG  . LYS B  1 238 ? 26.882   105.406 26.549  1.00 33.64 ? 230  LYS B CG  1 
ATOM   3860  C  CD  . LYS B  1 238 ? 26.615   106.617 27.502  1.00 42.38 ? 230  LYS B CD  1 
ATOM   3861  C  CE  . LYS B  1 238 ? 27.740   107.745 27.502  1.00 45.73 ? 230  LYS B CE  1 
ATOM   3862  N  NZ  . LYS B  1 238 ? 27.224   109.081 28.033  1.00 47.14 ? 230  LYS B NZ  1 
ATOM   3863  N  N   . TYR B  1 239 ? 24.268   106.574 24.249  1.00 27.82 ? 231  TYR B N   1 
ATOM   3864  C  CA  . TYR B  1 239 ? 24.691   107.247 23.039  1.00 27.84 ? 231  TYR B CA  1 
ATOM   3865  C  C   . TYR B  1 239 ? 26.212   107.549 23.102  1.00 28.17 ? 231  TYR B C   1 
ATOM   3866  O  O   . TYR B  1 239 ? 26.675   108.148 24.067  1.00 27.49 ? 231  TYR B O   1 
ATOM   3867  C  CB  . TYR B  1 239 ? 23.946   108.541 22.798  1.00 28.18 ? 231  TYR B CB  1 
ATOM   3868  C  CG  . TYR B  1 239 ? 24.481   109.257 21.559  1.00 28.94 ? 231  TYR B CG  1 
ATOM   3869  C  CD1 . TYR B  1 239 ? 24.041   108.904 20.269  1.00 28.64 ? 231  TYR B CD1 1 
ATOM   3870  C  CD2 . TYR B  1 239 ? 25.446   110.251 21.667  1.00 29.49 ? 231  TYR B CD2 1 
ATOM   3871  C  CE1 . TYR B  1 239 ? 24.575   109.513 19.118  1.00 29.25 ? 231  TYR B CE1 1 
ATOM   3872  C  CE2 . TYR B  1 239 ? 25.961   110.933 20.507  1.00 31.44 ? 231  TYR B CE2 1 
ATOM   3873  C  CZ  . TYR B  1 239 ? 25.524   110.547 19.237  1.00 32.30 ? 231  TYR B CZ  1 
ATOM   3874  O  OH  . TYR B  1 239 ? 26.028   111.184 18.104  1.00 33.22 ? 231  TYR B OH  1 
ATOM   3875  N  N   . ARG B  1 240 ? 26.943   107.085 22.087  1.00 27.65 ? 232  ARG B N   1 
ATOM   3876  C  CA  A ARG B  1 240 ? 28.357   107.416 21.891  0.50 28.10 ? 232  ARG B CA  1 
ATOM   3877  C  CA  B ARG B  1 240 ? 28.323   107.481 21.879  0.50 28.26 ? 232  ARG B CA  1 
ATOM   3878  C  C   . ARG B  1 240 ? 28.682   107.382 20.406  1.00 29.00 ? 232  ARG B C   1 
ATOM   3879  O  O   . ARG B  1 240 ? 28.541   106.326 19.761  1.00 26.42 ? 232  ARG B O   1 
ATOM   3880  C  CB  A ARG B  1 240 ? 29.253   106.425 22.621  0.50 27.96 ? 232  ARG B CB  1 
ATOM   3881  C  CB  B ARG B  1 240 ? 29.277   106.651 22.702  0.50 28.24 ? 232  ARG B CB  1 
ATOM   3882  C  CG  A ARG B  1 240 ? 30.748   106.446 22.188  0.50 28.50 ? 232  ARG B CG  1 
ATOM   3883  C  CG  B ARG B  1 240 ? 30.682   107.252 22.780  0.50 29.40 ? 232  ARG B CG  1 
ATOM   3884  C  CD  A ARG B  1 240 ? 31.612   105.407 22.950  0.50 27.18 ? 232  ARG B CD  1 
ATOM   3885  C  CD  B ARG B  1 240 ? 31.692   106.265 23.376  0.50 30.83 ? 232  ARG B CD  1 
ATOM   3886  N  NE  A ARG B  1 240 ? 32.073   104.269 22.152  0.50 25.09 ? 232  ARG B NE  1 
ATOM   3887  N  NE  B ARG B  1 240 ? 31.291   105.742 24.693  0.50 31.27 ? 232  ARG B NE  1 
ATOM   3888  C  CZ  A ARG B  1 240 ? 32.816   104.359 21.050  0.50 24.12 ? 232  ARG B CZ  1 
ATOM   3889  C  CZ  B ARG B  1 240 ? 31.209   104.455 25.007  0.50 28.98 ? 232  ARG B CZ  1 
ATOM   3890  N  NH1 A ARG B  1 240 ? 33.177   105.540 20.555  0.50 23.57 ? 232  ARG B NH1 1 
ATOM   3891  N  NH1 B ARG B  1 240 ? 30.842   104.110 26.231  0.50 27.74 ? 232  ARG B NH1 1 
ATOM   3892  N  NH2 A ARG B  1 240 ? 33.168   103.245 20.418  0.50 23.96 ? 232  ARG B NH2 1 
ATOM   3893  N  NH2 B ARG B  1 240 ? 31.491   103.521 24.099  0.50 27.93 ? 232  ARG B NH2 1 
ATOM   3894  N  N   . LYS B  1 241 ? 29.129   108.519 19.861  1.00 31.25 ? 233  LYS B N   1 
ATOM   3895  C  CA  . LYS B  1 241 ? 29.437   108.587 18.449  1.00 33.18 ? 233  LYS B CA  1 
ATOM   3896  C  C   . LYS B  1 241 ? 30.563   107.642 18.150  1.00 31.68 ? 233  LYS B C   1 
ATOM   3897  O  O   . LYS B  1 241 ? 31.554   107.618 18.847  1.00 31.88 ? 233  LYS B O   1 
ATOM   3898  C  CB  . LYS B  1 241 ? 29.812   110.015 18.046  1.00 35.26 ? 233  LYS B CB  1 
ATOM   3899  C  CG  . LYS B  1 241 ? 29.898   110.215 16.515  1.00 41.11 ? 233  LYS B CG  1 
ATOM   3900  C  CD  . LYS B  1 241 ? 29.179   111.479 16.037  1.00 48.47 ? 233  LYS B CD  1 
ATOM   3901  C  CE  . LYS B  1 241 ? 29.348   111.681 14.511  1.00 52.33 ? 233  LYS B CE  1 
ATOM   3902  N  NZ  . LYS B  1 241 ? 28.430   110.791 13.714  1.00 53.27 ? 233  LYS B NZ  1 
ATOM   3903  N  N   . GLY B  1 242 ? 30.382   106.808 17.151  1.00 31.07 ? 234  GLY B N   1 
ATOM   3904  C  CA  . GLY B  1 242 ? 31.365   105.768 16.849  1.00 30.78 ? 234  GLY B CA  1 
ATOM   3905  C  C   . GLY B  1 242 ? 31.113   104.396 17.441  1.00 30.15 ? 234  GLY B C   1 
ATOM   3906  O  O   . GLY B  1 242 ? 31.704   103.422 17.002  1.00 31.28 ? 234  GLY B O   1 
ATOM   3907  N  N   . ALA B  1 243 ? 30.227   104.280 18.425  1.00 28.77 ? 235  ALA B N   1 
ATOM   3908  C  CA  . ALA B  1 243 ? 29.911   102.967 18.990  1.00 27.48 ? 235  ALA B CA  1 
ATOM   3909  C  C   . ALA B  1 243 ? 28.999   102.267 17.998  1.00 26.02 ? 235  ALA B C   1 
ATOM   3910  O  O   . ALA B  1 243 ? 28.358   102.916 17.225  1.00 25.68 ? 235  ALA B O   1 
ATOM   3911  C  CB  . ALA B  1 243 ? 29.238   103.100 20.376  1.00 26.39 ? 235  ALA B CB  1 
ATOM   3912  N  N   . VAL B  1 244 ? 28.982   100.947 17.996  1.00 24.93 ? 236  VAL B N   1 
ATOM   3913  C  CA  . VAL B  1 244 ? 28.042   100.195 17.178  1.00 23.76 ? 236  VAL B CA  1 
ATOM   3914  C  C   . VAL B  1 244 ? 27.573   98.980  17.966  1.00 22.45 ? 236  VAL B C   1 
ATOM   3915  O  O   . VAL B  1 244 ? 28.342   98.347  18.665  1.00 21.84 ? 236  VAL B O   1 
ATOM   3916  C  CB  . VAL B  1 244 ? 28.685   99.748  15.811  1.00 24.17 ? 236  VAL B CB  1 
ATOM   3917  C  CG1 . VAL B  1 244 ? 29.892   98.920  16.046  1.00 24.52 ? 236  VAL B CG1 1 
ATOM   3918  C  CG2 . VAL B  1 244 ? 27.720   98.926  15.008  1.00 24.55 ? 236  VAL B CG2 1 
ATOM   3919  N  N   . SER B  1 245 ? 26.298   98.678  17.876  1.00 21.92 ? 237  SER B N   1 
ATOM   3920  C  CA  . SER B  1 245 ? 25.765   97.484  18.483  1.00 21.85 ? 237  SER B CA  1 
ATOM   3921  C  C   . SER B  1 245 ? 25.064   96.611  17.416  1.00 21.70 ? 237  SER B C   1 
ATOM   3922  O  O   . SER B  1 245 ? 24.596   97.120  16.400  1.00 21.41 ? 237  SER B O   1 
ATOM   3923  C  CB  . SER B  1 245 ? 24.839   97.859  19.644  1.00 22.02 ? 237  SER B CB  1 
ATOM   3924  O  OG  . SER B  1 245 ? 25.531   98.453  20.768  1.00 22.29 ? 237  SER B OG  1 
ATOM   3925  N  N   . ILE B  1 246 ? 25.099   95.294  17.624  1.00 20.88 ? 238  ILE B N   1 
ATOM   3926  C  CA  . ILE B  1 246 ? 24.416   94.333  16.797  1.00 20.17 ? 238  ILE B CA  1 
ATOM   3927  C  C   . ILE B  1 246 ? 23.361   93.679  17.695  1.00 19.85 ? 238  ILE B C   1 
ATOM   3928  O  O   . ILE B  1 246 ? 23.636   93.295  18.815  1.00 18.76 ? 238  ILE B O   1 
ATOM   3929  C  CB  . ILE B  1 246 ? 25.347   93.253  16.229  1.00 20.25 ? 238  ILE B CB  1 
ATOM   3930  C  CG1 . ILE B  1 246 ? 26.607   93.851  15.530  1.00 21.50 ? 238  ILE B CG1 1 
ATOM   3931  C  CG2 . ILE B  1 246 ? 24.575   92.309  15.303  1.00 17.31 ? 238  ILE B CG2 1 
ATOM   3932  C  CD1 . ILE B  1 246 ? 26.369   94.599  14.149  1.00 20.64 ? 238  ILE B CD1 1 
ATOM   3933  N  N   . GLY B  1 247 ? 22.144   93.575  17.172  1.00 20.20 ? 239  GLY B N   1 
ATOM   3934  C  CA  . GLY B  1 247 ? 21.038   92.943  17.864  1.00 20.16 ? 239  GLY B CA  1 
ATOM   3935  C  C   . GLY B  1 247 ? 20.131   92.079  17.000  1.00 19.56 ? 239  GLY B C   1 
ATOM   3936  O  O   . GLY B  1 247 ? 20.306   92.014  15.775  1.00 19.37 ? 239  GLY B O   1 
ATOM   3937  N  N   . VAL B  1 248 ? 19.185   91.406  17.664  1.00 18.41 ? 240  VAL B N   1 
ATOM   3938  C  CA  . VAL B  1 248 ? 18.220   90.549  17.044  1.00 18.43 ? 240  VAL B CA  1 
ATOM   3939  C  C   . VAL B  1 248 ? 16.837   91.046  17.385  1.00 19.41 ? 240  VAL B C   1 
ATOM   3940  O  O   . VAL B  1 248 ? 16.527   91.249  18.549  1.00 21.00 ? 240  VAL B O   1 
ATOM   3941  C  CB  . VAL B  1 248 ? 18.376   89.107  17.522  1.00 18.05 ? 240  VAL B CB  1 
ATOM   3942  C  CG1 . VAL B  1 248 ? 17.332   88.166  16.841  1.00 17.15 ? 240  VAL B CG1 1 
ATOM   3943  C  CG2 . VAL B  1 248 ? 19.777   88.611  17.271  1.00 14.14 ? 240  VAL B CG2 1 
ATOM   3944  N  N   . VAL B  1 249 ? 15.998   91.260  16.376  1.00 19.74 ? 241  VAL B N   1 
ATOM   3945  C  CA  . VAL B  1 249 ? 14.647   91.705  16.601  1.00 19.05 ? 241  VAL B CA  1 
ATOM   3946  C  C   . VAL B  1 249 ? 13.831   90.578  17.230  1.00 20.12 ? 241  VAL B C   1 
ATOM   3947  O  O   . VAL B  1 249 ? 13.825   89.446  16.693  1.00 21.32 ? 241  VAL B O   1 
ATOM   3948  C  CB  . VAL B  1 249 ? 13.970   92.083  15.310  1.00 19.78 ? 241  VAL B CB  1 
ATOM   3949  C  CG1 . VAL B  1 249 ? 12.479   92.428  15.573  1.00 15.37 ? 241  VAL B CG1 1 
ATOM   3950  C  CG2 . VAL B  1 249 ? 14.717   93.252  14.668  1.00 18.76 ? 241  VAL B CG2 1 
ATOM   3951  N  N   . VAL B  1 250 ? 13.118   90.845  18.331  1.00 19.46 ? 242  VAL B N   1 
ATOM   3952  C  CA  . VAL B  1 250 ? 12.535   89.727  19.097  1.00 19.26 ? 242  VAL B CA  1 
ATOM   3953  C  C   . VAL B  1 250 ? 11.014   89.773  19.347  1.00 20.50 ? 242  VAL B C   1 
ATOM   3954  O  O   . VAL B  1 250 ? 10.395   88.726  19.663  1.00 19.56 ? 242  VAL B O   1 
ATOM   3955  C  CB  . VAL B  1 250 ? 13.242   89.580  20.417  1.00 19.44 ? 242  VAL B CB  1 
ATOM   3956  C  CG1 . VAL B  1 250 ? 14.752   89.258  20.191  1.00 18.63 ? 242  VAL B CG1 1 
ATOM   3957  C  CG2 . VAL B  1 250 ? 13.048   90.902  21.254  1.00 18.76 ? 242  VAL B CG2 1 
ATOM   3958  N  N   . HIS B  1 251 ? 10.406   90.952  19.203  1.00 20.59 ? 243  HIS B N   1 
ATOM   3959  C  CA  . HIS B  1 251 ? 8.948    91.048  19.227  1.00 21.29 ? 243  HIS B CA  1 
ATOM   3960  C  C   . HIS B  1 251 ? 8.397    92.061  18.226  1.00 22.00 ? 243  HIS B C   1 
ATOM   3961  O  O   . HIS B  1 251 ? 9.136    92.842  17.632  1.00 21.36 ? 243  HIS B O   1 
ATOM   3962  C  CB  . HIS B  1 251 ? 8.445    91.338  20.652  1.00 20.54 ? 243  HIS B CB  1 
ATOM   3963  C  CG  . HIS B  1 251 ? 8.722    92.723  21.147  1.00 21.18 ? 243  HIS B CG  1 
ATOM   3964  N  ND1 . HIS B  1 251 ? 8.133    93.848  20.606  1.00 25.40 ? 243  HIS B ND1 1 
ATOM   3965  C  CD2 . HIS B  1 251 ? 9.496    93.166  22.163  1.00 22.53 ? 243  HIS B CD2 1 
ATOM   3966  C  CE1 . HIS B  1 251 ? 8.546    94.927  21.259  1.00 23.95 ? 243  HIS B CE1 1 
ATOM   3967  N  NE2 . HIS B  1 251 ? 9.367    94.538  22.217  1.00 23.95 ? 243  HIS B NE2 1 
ATOM   3968  N  N   . SER B  1 252 ? 7.064    92.096  18.122  1.00 23.56 ? 244  SER B N   1 
ATOM   3969  C  CA  . SER B  1 252 ? 6.381    92.836  17.073  1.00 24.62 ? 244  SER B CA  1 
ATOM   3970  C  C   . SER B  1 252 ? 6.315    94.303  17.377  1.00 24.96 ? 244  SER B C   1 
ATOM   3971  O  O   . SER B  1 252 ? 6.706    94.761  18.409  1.00 25.17 ? 244  SER B O   1 
ATOM   3972  C  CB  . SER B  1 252 ? 4.980    92.289  16.850  1.00 25.09 ? 244  SER B CB  1 
ATOM   3973  O  OG  . SER B  1 252 ? 4.031    93.078  17.550  1.00 27.90 ? 244  SER B OG  1 
ATOM   3974  N  N   . ALA B  1 253 ? 5.823    95.051  16.419  1.00 27.14 ? 245  ALA B N   1 
ATOM   3975  C  CA  . ALA B  1 253 ? 5.667    96.494  16.530  1.00 28.16 ? 245  ALA B CA  1 
ATOM   3976  C  C   . ALA B  1 253 ? 4.589    96.784  17.563  1.00 29.42 ? 245  ALA B C   1 
ATOM   3977  O  O   . ALA B  1 253 ? 3.828    95.900  17.964  1.00 30.08 ? 245  ALA B O   1 
ATOM   3978  C  CB  . ALA B  1 253 ? 5.276    97.107  15.190  1.00 27.00 ? 245  ALA B CB  1 
ATOM   3979  N  N   . CYS B  1 254 ? 4.536    98.046  17.953  1.00 30.94 ? 246  CYS B N   1 
ATOM   3980  C  CA  . CYS B  1 254 ? 3.736    98.512  19.037  1.00 32.53 ? 246  CYS B CA  1 
ATOM   3981  C  C   . CYS B  1 254 ? 3.035    99.777  18.601  1.00 32.45 ? 246  CYS B C   1 
ATOM   3982  O  O   . CYS B  1 254 ? 3.452    100.429 17.671  1.00 33.12 ? 246  CYS B O   1 
ATOM   3983  C  CB  . CYS B  1 254 ? 4.631    98.750  20.269  1.00 33.01 ? 246  CYS B CB  1 
ATOM   3984  S  SG  . CYS B  1 254 ? 5.611    97.226  20.718  1.00 39.09 ? 246  CYS B SG  1 
ATOM   3985  N  N   . VAL B  1 255 ? 1.951    100.092 19.289  1.00 32.65 ? 247  VAL B N   1 
ATOM   3986  C  CA  . VAL B  1 255 ? 1.065    101.178 18.930  1.00 32.61 ? 247  VAL B CA  1 
ATOM   3987  C  C   . VAL B  1 255 ? 1.372    102.445 19.749  1.00 32.88 ? 247  VAL B C   1 
ATOM   3988  O  O   . VAL B  1 255 ? 1.037    103.509 19.310  1.00 33.89 ? 247  VAL B O   1 
ATOM   3989  C  CB  . VAL B  1 255 ? -0.447   100.743 19.066  1.00 33.60 ? 247  VAL B CB  1 
ATOM   3990  C  CG1 . VAL B  1 255 ? -0.725   99.494  18.202  1.00 32.94 ? 247  VAL B CG1 1 
ATOM   3991  C  CG2 . VAL B  1 255 ? -0.875   100.482 20.497  1.00 31.13 ? 247  VAL B CG2 1 
ATOM   3992  N  N   . SER B  1 256 ? 2.058    102.333 20.885  1.00 31.86 ? 248  SER B N   1 
ATOM   3993  C  CA  . SER B  1 256 ? 2.291    103.474 21.777  1.00 31.69 ? 248  SER B CA  1 
ATOM   3994  C  C   . SER B  1 256 ? 3.586    104.236 21.537  1.00 30.88 ? 248  SER B C   1 
ATOM   3995  O  O   . SER B  1 256 ? 4.546    103.685 21.071  1.00 29.96 ? 248  SER B O   1 
ATOM   3996  C  CB  . SER B  1 256 ? 2.308    102.977 23.225  1.00 31.60 ? 248  SER B CB  1 
ATOM   3997  O  OG  . SER B  1 256 ? 1.170    102.173 23.435  1.00 32.05 ? 248  SER B OG  1 
ATOM   3998  N  N   . ALA B  1 257 ? 3.608    105.492 21.961  1.00 31.16 ? 249  ALA B N   1 
ATOM   3999  C  CA  . ALA B  1 257 ? 4.759    106.367 21.811  1.00 30.47 ? 249  ALA B CA  1 
ATOM   4000  C  C   . ALA B  1 257 ? 5.967    105.716 22.475  1.00 29.75 ? 249  ALA B C   1 
ATOM   4001  O  O   . ALA B  1 257 ? 5.864    105.187 23.568  1.00 29.47 ? 249  ALA B O   1 
ATOM   4002  C  CB  . ALA B  1 257 ? 4.471    107.733 22.459  1.00 30.80 ? 249  ALA B CB  1 
ATOM   4003  N  N   . GLY B  1 258 ? 7.103    105.735 21.784  1.00 29.45 ? 250  GLY B N   1 
ATOM   4004  C  CA  . GLY B  1 258 ? 8.369    105.278 22.326  1.00 28.74 ? 250  GLY B CA  1 
ATOM   4005  C  C   . GLY B  1 258 ? 8.570    103.789 22.170  1.00 27.98 ? 250  GLY B C   1 
ATOM   4006  O  O   . GLY B  1 258 ? 9.606    103.288 22.523  1.00 27.49 ? 250  GLY B O   1 
ATOM   4007  N  N   . HIS B  1 259 ? 7.594    103.076 21.626  1.00 27.96 ? 251  HIS B N   1 
ATOM   4008  C  CA  . HIS B  1 259 ? 7.681    101.626 21.563  1.00 27.79 ? 251  HIS B CA  1 
ATOM   4009  C  C   . HIS B  1 259 ? 7.788    101.132 20.143  1.00 27.28 ? 251  HIS B C   1 
ATOM   4010  O  O   . HIS B  1 259 ? 7.490    101.845 19.198  1.00 27.39 ? 251  HIS B O   1 
ATOM   4011  C  CB  . HIS B  1 259 ? 6.493    100.949 22.254  1.00 28.53 ? 251  HIS B CB  1 
ATOM   4012  C  CG  . HIS B  1 259 ? 6.514    101.072 23.738  1.00 28.79 ? 251  HIS B CG  1 
ATOM   4013  N  ND1 . HIS B  1 259 ? 7.057    100.102 24.549  1.00 32.34 ? 251  HIS B ND1 1 
ATOM   4014  C  CD2 . HIS B  1 259 ? 6.085    102.062 24.557  1.00 31.20 ? 251  HIS B CD2 1 
ATOM   4015  C  CE1 . HIS B  1 259 ? 6.973    100.497 25.812  1.00 34.31 ? 251  HIS B CE1 1 
ATOM   4016  N  NE2 . HIS B  1 259 ? 6.379    101.679 25.848  1.00 31.97 ? 251  HIS B NE2 1 
ATOM   4017  N  N   . GLY B  1 260 ? 8.220    99.883  20.005  1.00 26.54 ? 252  GLY B N   1 
ATOM   4018  C  CA  . GLY B  1 260 ? 8.347    99.289  18.677  1.00 26.35 ? 252  GLY B CA  1 
ATOM   4019  C  C   . GLY B  1 260 ? 9.041    97.965  18.764  1.00 25.50 ? 252  GLY B C   1 
ATOM   4020  O  O   . GLY B  1 260 ? 9.265    97.468  19.859  1.00 25.69 ? 252  GLY B O   1 
ATOM   4021  N  N   . PRO B  1 261 ? 9.398    97.382  17.632  1.00 24.55 ? 253  PRO B N   1 
ATOM   4022  C  CA  . PRO B  1 261 ? 9.964    96.034  17.726  1.00 24.49 ? 253  PRO B CA  1 
ATOM   4023  C  C   . PRO B  1 261 ? 11.215   96.002  18.625  1.00 23.59 ? 253  PRO B C   1 
ATOM   4024  O  O   . PRO B  1 261 ? 12.042   96.908  18.568  1.00 23.92 ? 253  PRO B O   1 
ATOM   4025  C  CB  . PRO B  1 261 ? 10.306   95.675  16.278  1.00 24.36 ? 253  PRO B CB  1 
ATOM   4026  C  CG  . PRO B  1 261 ? 9.580    96.646  15.445  1.00 24.99 ? 253  PRO B CG  1 
ATOM   4027  C  CD  . PRO B  1 261 ? 9.303    97.864  16.257  1.00 25.17 ? 253  PRO B CD  1 
ATOM   4028  N  N   . GLY B  1 262 ? 11.296   94.990  19.470  1.00 22.21 ? 254  GLY B N   1 
ATOM   4029  C  CA  . GLY B  1 262 ? 12.338   94.921  20.447  1.00 22.18 ? 254  GLY B CA  1 
ATOM   4030  C  C   . GLY B  1 262 ? 13.568   94.276  19.855  1.00 21.62 ? 254  GLY B C   1 
ATOM   4031  O  O   . GLY B  1 262 ? 13.468   93.431  18.942  1.00 20.96 ? 254  GLY B O   1 
ATOM   4032  N  N   . VAL B  1 263 ? 14.705   94.694  20.383  1.00 20.64 ? 255  VAL B N   1 
ATOM   4033  C  CA  . VAL B  1 263 ? 16.017   94.220  19.940  1.00 20.93 ? 255  VAL B CA  1 
ATOM   4034  C  C   . VAL B  1 263 ? 16.814   93.732  21.140  1.00 20.30 ? 255  VAL B C   1 
ATOM   4035  O  O   . VAL B  1 263 ? 16.951   94.474  22.119  1.00 20.25 ? 255  VAL B O   1 
ATOM   4036  C  CB  . VAL B  1 263 ? 16.833   95.364  19.228  1.00 20.97 ? 255  VAL B CB  1 
ATOM   4037  C  CG1 . VAL B  1 263 ? 18.236   94.905  18.895  1.00 20.12 ? 255  VAL B CG1 1 
ATOM   4038  C  CG2 . VAL B  1 263 ? 16.110   95.795  17.994  1.00 21.16 ? 255  VAL B CG2 1 
ATOM   4039  N  N   . VAL B  1 264 ? 17.319   92.498  21.068  1.00 19.81 ? 256  VAL B N   1 
ATOM   4040  C  CA  . VAL B  1 264 ? 18.225   91.979  22.074  1.00 19.27 ? 256  VAL B CA  1 
ATOM   4041  C  C   . VAL B  1 264 ? 19.641   92.156  21.537  1.00 20.31 ? 256  VAL B C   1 
ATOM   4042  O  O   . VAL B  1 264 ? 19.921   91.716  20.422  1.00 20.05 ? 256  VAL B O   1 
ATOM   4043  C  CB  . VAL B  1 264 ? 17.956   90.534  22.382  1.00 19.27 ? 256  VAL B CB  1 
ATOM   4044  C  CG1 . VAL B  1 264 ? 19.108   89.917  23.250  1.00 16.93 ? 256  VAL B CG1 1 
ATOM   4045  C  CG2 . VAL B  1 264 ? 16.643   90.412  23.090  1.00 15.98 ? 256  VAL B CG2 1 
ATOM   4046  N  N   . VAL B  1 265 ? 20.517   92.837  22.289  1.00 20.00 ? 257  VAL B N   1 
ATOM   4047  C  CA  . VAL B  1 265 ? 21.855   93.111  21.788  1.00 19.84 ? 257  VAL B CA  1 
ATOM   4048  C  C   . VAL B  1 265 ? 22.676   91.829  21.903  1.00 20.66 ? 257  VAL B C   1 
ATOM   4049  O  O   . VAL B  1 265 ? 22.614   91.142  22.940  1.00 20.80 ? 257  VAL B O   1 
ATOM   4050  C  CB  . VAL B  1 265 ? 22.567   94.201  22.579  1.00 19.93 ? 257  VAL B CB  1 
ATOM   4051  C  CG1 . VAL B  1 265 ? 24.050   94.338  22.137  1.00 18.57 ? 257  VAL B CG1 1 
ATOM   4052  C  CG2 . VAL B  1 265 ? 21.841   95.544  22.424  1.00 18.44 ? 257  VAL B CG2 1 
ATOM   4053  N  N   . ILE B  1 266 ? 23.434   91.512  20.849  1.00 19.91 ? 258  ILE B N   1 
ATOM   4054  C  CA  . ILE B  1 266 ? 24.345   90.400  20.887  1.00 20.44 ? 258  ILE B CA  1 
ATOM   4055  C  C   . ILE B  1 266 ? 25.831   90.731  20.727  1.00 20.29 ? 258  ILE B C   1 
ATOM   4056  O  O   . ILE B  1 266 ? 26.655   89.872  20.989  1.00 18.57 ? 258  ILE B O   1 
ATOM   4057  C  CB  . ILE B  1 266 ? 24.002   89.301  19.863  1.00 20.80 ? 258  ILE B CB  1 
ATOM   4058  C  CG1 . ILE B  1 266 ? 24.162   89.838  18.433  1.00 22.16 ? 258  ILE B CG1 1 
ATOM   4059  C  CG2 . ILE B  1 266 ? 22.659   88.713  20.170  1.00 19.11 ? 258  ILE B CG2 1 
ATOM   4060  C  CD1 . ILE B  1 266 ? 24.138   88.771  17.341  1.00 20.10 ? 258  ILE B CD1 1 
ATOM   4061  N  N   . MET B  1 267 ? 26.152   91.951  20.314  1.00 21.84 ? 259  MET B N   1 
ATOM   4062  C  CA  . MET B  1 267 ? 27.536   92.401  20.157  1.00 22.89 ? 259  MET B CA  1 
ATOM   4063  C  C   . MET B  1 267 ? 27.597   93.920  20.246  1.00 22.18 ? 259  MET B C   1 
ATOM   4064  O  O   . MET B  1 267 ? 26.739   94.590  19.760  1.00 21.55 ? 259  MET B O   1 
ATOM   4065  C  CB  . MET B  1 267 ? 28.125   91.875  18.848  1.00 23.66 ? 259  MET B CB  1 
ATOM   4066  C  CG  . MET B  1 267 ? 29.531   92.326  18.508  1.00 28.18 ? 259  MET B CG  1 
ATOM   4067  S  SD  . MET B  1 267 ? 30.273   91.647  16.934  1.00 34.45 ? 259  MET B SD  1 
ATOM   4068  C  CE  . MET B  1 267 ? 29.903   89.925  17.089  1.00 29.44 ? 259  MET B CE  1 
ATOM   4069  N  N   . THR B  1 268 ? 28.617   94.457  20.900  1.00 22.18 ? 260  THR B N   1 
ATOM   4070  C  CA  . THR B  1 268 ? 28.770   95.886  21.015  1.00 23.45 ? 260  THR B CA  1 
ATOM   4071  C  C   . THR B  1 268 ? 30.253   96.244  21.110  1.00 24.01 ? 260  THR B C   1 
ATOM   4072  O  O   . THR B  1 268 ? 31.063   95.481  21.629  1.00 24.24 ? 260  THR B O   1 
ATOM   4073  C  CB  . THR B  1 268 ? 27.924   96.454  22.196  1.00 23.47 ? 260  THR B CB  1 
ATOM   4074  O  OG1 . THR B  1 268 ? 27.875   97.879  22.141  1.00 24.06 ? 260  THR B OG1 1 
ATOM   4075  C  CG2 . THR B  1 268 ? 28.469   96.046  23.514  1.00 23.15 ? 260  THR B CG2 1 
ATOM   4076  N  N   . GLY B  1 269 ? 30.598   97.385  20.562  1.00 24.81 ? 261  GLY B N   1 
ATOM   4077  C  CA  . GLY B  1 269 ? 31.970   97.832  20.502  1.00 26.23 ? 261  GLY B CA  1 
ATOM   4078  C  C   . GLY B  1 269 ? 32.107   99.075  19.630  1.00 27.39 ? 261  GLY B C   1 
ATOM   4079  O  O   . GLY B  1 269 ? 31.166   99.849  19.500  1.00 27.02 ? 261  GLY B O   1 
ATOM   4080  N  N   . ASP B  1 270 ? 33.279   99.247  19.036  1.00 29.47 ? 262  ASP B N   1 
ATOM   4081  C  CA  . ASP B  1 270 ? 33.631   100.445 18.264  1.00 31.95 ? 262  ASP B CA  1 
ATOM   4082  C  C   . ASP B  1 270 ? 33.504   100.213 16.765  1.00 31.99 ? 262  ASP B C   1 
ATOM   4083  O  O   . ASP B  1 270 ? 33.724   99.130  16.249  1.00 31.48 ? 262  ASP B O   1 
ATOM   4084  C  CB  . ASP B  1 270 ? 35.063   100.910 18.612  1.00 32.99 ? 262  ASP B CB  1 
ATOM   4085  C  CG  . ASP B  1 270 ? 35.406   102.287 18.008  1.00 37.57 ? 262  ASP B CG  1 
ATOM   4086  O  OD1 . ASP B  1 270 ? 34.956   103.303 18.574  1.00 42.28 ? 262  ASP B OD1 1 
ATOM   4087  O  OD2 . ASP B  1 270 ? 36.131   102.360 16.975  1.00 40.48 ? 262  ASP B OD2 1 
ATOM   4088  N  N   . GLU B  1 271 ? 33.140   101.246 16.052  1.00 33.66 ? 263  GLU B N   1 
ATOM   4089  C  CA  . GLU B  1 271 ? 33.025   101.149 14.598  1.00 35.11 ? 263  GLU B CA  1 
ATOM   4090  C  C   . GLU B  1 271 ? 34.330   100.770 13.899  1.00 35.22 ? 263  GLU B C   1 
ATOM   4091  O  O   . GLU B  1 271 ? 34.293   100.274 12.800  1.00 35.53 ? 263  GLU B O   1 
ATOM   4092  C  CB  . GLU B  1 271 ? 32.543   102.476 14.016  1.00 35.80 ? 263  GLU B CB  1 
ATOM   4093  C  CG  . GLU B  1 271 ? 33.570   103.636 14.135  1.00 39.24 ? 263  GLU B CG  1 
ATOM   4094  C  CD  . GLU B  1 271 ? 32.963   104.983 13.699  1.00 43.70 ? 263  GLU B CD  1 
ATOM   4095  O  OE1 . GLU B  1 271 ? 31.896   104.966 13.020  1.00 46.37 ? 263  GLU B OE1 1 
ATOM   4096  O  OE2 . GLU B  1 271 ? 33.527   106.030 14.074  1.00 45.43 ? 263  GLU B OE2 1 
ATOM   4097  N  N   . SER B  1 272 ? 35.472   101.031 14.509  1.00 35.18 ? 264  SER B N   1 
ATOM   4098  C  CA  . SER B  1 272 ? 36.729   100.605 13.917  1.00 36.17 ? 264  SER B CA  1 
ATOM   4099  C  C   . SER B  1 272 ? 36.923   99.088  13.925  1.00 36.18 ? 264  SER B C   1 
ATOM   4100  O  O   . SER B  1 272 ? 37.731   98.580  13.150  1.00 37.14 ? 264  SER B O   1 
ATOM   4101  C  CB  . SER B  1 272 ? 37.926   101.276 14.617  1.00 36.46 ? 264  SER B CB  1 
ATOM   4102  O  OG  . SER B  1 272 ? 38.030   100.896 15.995  1.00 37.41 ? 264  SER B OG  1 
ATOM   4103  N  N   . LYS B  1 273 ? 36.209   98.369  14.792  1.00 35.36 ? 265  LYS B N   1 
ATOM   4104  C  CA  . LYS B  1 273 ? 36.355   96.917  14.909  1.00 34.86 ? 265  LYS B CA  1 
ATOM   4105  C  C   . LYS B  1 273 ? 35.166   96.144  14.377  1.00 32.49 ? 265  LYS B C   1 
ATOM   4106  O  O   . LYS B  1 273 ? 35.358   95.041  13.870  1.00 31.19 ? 265  LYS B O   1 
ATOM   4107  C  CB  . LYS B  1 273 ? 36.576   96.476  16.359  1.00 35.47 ? 265  LYS B CB  1 
ATOM   4108  C  CG  . LYS B  1 273 ? 37.697   97.203  17.142  1.00 42.29 ? 265  LYS B CG  1 
ATOM   4109  C  CD  . LYS B  1 273 ? 39.150   96.917  16.632  1.00 50.03 ? 265  LYS B CD  1 
ATOM   4110  C  CE  . LYS B  1 273 ? 39.472   95.403  16.249  1.00 53.76 ? 265  LYS B CE  1 
ATOM   4111  N  NZ  . LYS B  1 273 ? 39.389   94.288  17.330  1.00 54.52 ? 265  LYS B NZ  1 
ATOM   4112  N  N   . ILE B  1 274 ? 33.947   96.682  14.550  1.00 30.47 ? 266  ILE B N   1 
ATOM   4113  C  CA  . ILE B  1 274 ? 32.732   96.003  14.102  1.00 28.77 ? 266  ILE B CA  1 
ATOM   4114  C  C   . ILE B  1 274 ? 32.270   96.718  12.843  1.00 29.18 ? 266  ILE B C   1 
ATOM   4115  O  O   . ILE B  1 274 ? 32.014   97.927  12.880  1.00 28.45 ? 266  ILE B O   1 
ATOM   4116  C  CB  . ILE B  1 274 ? 31.617   96.020  15.178  1.00 28.67 ? 266  ILE B CB  1 
ATOM   4117  C  CG1 . ILE B  1 274 ? 32.123   95.375  16.496  1.00 27.90 ? 266  ILE B CG1 1 
ATOM   4118  C  CG2 . ILE B  1 274 ? 30.351   95.358  14.658  1.00 22.17 ? 266  ILE B CG2 1 
ATOM   4119  C  CD1 . ILE B  1 274 ? 31.324   95.816  17.818  1.00 27.20 ? 266  ILE B CD1 1 
ATOM   4120  N  N   . LEU B  1 275 ? 32.211   95.977  11.732  1.00 28.84 ? 267  LEU B N   1 
ATOM   4121  C  CA  . LEU B  1 275 ? 31.811   96.523  10.456  1.00 30.20 ? 267  LEU B CA  1 
ATOM   4122  C  C   . LEU B  1 275 ? 30.490   95.883  10.017  1.00 29.62 ? 267  LEU B C   1 
ATOM   4123  O  O   . LEU B  1 275 ? 30.482   94.794  9.433   1.00 28.62 ? 267  LEU B O   1 
ATOM   4124  C  CB  . LEU B  1 275 ? 32.906   96.343  9.382   1.00 31.56 ? 267  LEU B CB  1 
ATOM   4125  C  CG  . LEU B  1 275 ? 34.364   96.836  9.669   1.00 34.88 ? 267  LEU B CG  1 
ATOM   4126  C  CD1 . LEU B  1 275 ? 35.278   96.578  8.427   1.00 35.35 ? 267  LEU B CD1 1 
ATOM   4127  C  CD2 . LEU B  1 275 ? 34.460   98.292  10.042  1.00 36.58 ? 267  LEU B CD2 1 
ATOM   4128  N  N   . PRO B  1 276 ? 29.365   96.553  10.318  1.00 29.51 ? 268  PRO B N   1 
ATOM   4129  C  CA  . PRO B  1 276 ? 28.098   96.005  9.867   1.00 29.95 ? 268  PRO B CA  1 
ATOM   4130  C  C   . PRO B  1 276 ? 27.985   96.124  8.374   1.00 30.58 ? 268  PRO B C   1 
ATOM   4131  O  O   . PRO B  1 276 ? 28.264   97.159  7.808   1.00 29.95 ? 268  PRO B O   1 
ATOM   4132  C  CB  . PRO B  1 276 ? 27.030   96.882  10.553  1.00 29.23 ? 268  PRO B CB  1 
ATOM   4133  C  CG  . PRO B  1 276 ? 27.778   97.720  11.524  1.00 30.82 ? 268  PRO B CG  1 
ATOM   4134  C  CD  . PRO B  1 276 ? 29.188   97.814  11.053  1.00 29.54 ? 268  PRO B CD  1 
ATOM   4135  N  N   . GLU B  1 277 ? 27.546   95.050  7.761   1.00 31.72 ? 269  GLU B N   1 
ATOM   4136  C  CA  . GLU B  1 277 ? 27.349   95.031  6.348   1.00 33.40 ? 269  GLU B CA  1 
ATOM   4137  C  C   . GLU B  1 277 ? 25.924   94.725  6.007   1.00 33.07 ? 269  GLU B C   1 
ATOM   4138  O  O   . GLU B  1 277 ? 25.422   93.658  6.322   1.00 32.21 ? 269  GLU B O   1 
ATOM   4139  C  CB  . GLU B  1 277 ? 28.292   94.013  5.733   1.00 34.65 ? 269  GLU B CB  1 
ATOM   4140  C  CG  . GLU B  1 277 ? 29.465   94.789  5.057   1.00 40.31 ? 269  GLU B CG  1 
ATOM   4141  C  CD  . GLU B  1 277 ? 30.804   94.201  5.286   1.00 44.45 ? 269  GLU B CD  1 
ATOM   4142  O  OE1 . GLU B  1 277 ? 30.961   92.973  5.182   1.00 49.22 ? 269  GLU B OE1 1 
ATOM   4143  O  OE2 . GLU B  1 277 ? 31.722   94.997  5.538   1.00 50.72 ? 269  GLU B OE2 1 
ATOM   4144  N  N   . GLU B  1 278 ? 25.268   95.672  5.375   1.00 32.63 ? 270  GLU B N   1 
ATOM   4145  C  CA  . GLU B  1 278 ? 23.881   95.521  5.063   1.00 33.84 ? 270  GLU B CA  1 
ATOM   4146  C  C   . GLU B  1 278 ? 23.650   94.596  3.878   1.00 33.30 ? 270  GLU B C   1 
ATOM   4147  O  O   . GLU B  1 278 ? 24.141   94.825  2.809   1.00 33.29 ? 270  GLU B O   1 
ATOM   4148  C  CB  . GLU B  1 278 ? 23.305   96.876  4.777   1.00 34.61 ? 270  GLU B CB  1 
ATOM   4149  C  CG  . GLU B  1 278 ? 21.817   96.873  4.727   1.00 39.83 ? 270  GLU B CG  1 
ATOM   4150  C  CD  . GLU B  1 278 ? 21.202   98.291  4.821   1.00 46.03 ? 270  GLU B CD  1 
ATOM   4151  O  OE1 . GLU B  1 278 ? 21.854   99.254  5.342   1.00 46.15 ? 270  GLU B OE1 1 
ATOM   4152  O  OE2 . GLU B  1 278 ? 20.036   98.410  4.374   1.00 49.87 ? 270  GLU B OE2 1 
ATOM   4153  N  N   . VAL B  1 279 ? 22.868   93.559  4.088   1.00 33.00 ? 271  VAL B N   1 
ATOM   4154  C  CA  . VAL B  1 279 ? 22.628   92.538  3.092   1.00 32.73 ? 271  VAL B CA  1 
ATOM   4155  C  C   . VAL B  1 279 ? 21.127   92.299  2.960   1.00 34.51 ? 271  VAL B C   1 
ATOM   4156  O  O   . VAL B  1 279 ? 20.306   92.867  3.668   1.00 33.99 ? 271  VAL B O   1 
ATOM   4157  C  CB  . VAL B  1 279 ? 23.369   91.221  3.417   1.00 32.27 ? 271  VAL B CB  1 
ATOM   4158  C  CG1 . VAL B  1 279 ? 24.876   91.439  3.383   1.00 29.12 ? 271  VAL B CG1 1 
ATOM   4159  C  CG2 . VAL B  1 279 ? 22.902   90.638  4.755   1.00 28.55 ? 271  VAL B CG2 1 
ATOM   4160  N  N   . GLU B  1 280 ? 20.766   91.464  2.019   1.00 36.47 ? 272  GLU B N   1 
ATOM   4161  C  CA  . GLU B  1 280 ? 19.367   91.213  1.777   1.00 38.80 ? 272  GLU B CA  1 
ATOM   4162  C  C   . GLU B  1 280 ? 18.713   90.326  2.849   1.00 37.60 ? 272  GLU B C   1 
ATOM   4163  O  O   . GLU B  1 280 ? 17.572   90.552  3.213   1.00 37.87 ? 272  GLU B O   1 
ATOM   4164  C  CB  . GLU B  1 280 ? 19.140   90.706  0.335   1.00 41.37 ? 272  GLU B CB  1 
ATOM   4165  C  CG  . GLU B  1 280 ? 20.055   89.547  -0.169  1.00 48.27 ? 272  GLU B CG  1 
ATOM   4166  C  CD  . GLU B  1 280 ? 21.418   89.976  -0.887  1.00 57.26 ? 272  GLU B CD  1 
ATOM   4167  O  OE1 . GLU B  1 280 ? 22.468   90.099  -0.168  1.00 58.43 ? 272  GLU B OE1 1 
ATOM   4168  O  OE2 . GLU B  1 280 ? 21.457   90.098  -2.168  1.00 59.67 ? 272  GLU B OE2 1 
ATOM   4169  N  N   . ARG B  1 281 ? 19.427   89.365  3.416   1.00 35.85 ? 273  ARG B N   1 
ATOM   4170  C  CA  . ARG B  1 281 ? 18.822   88.587  4.462   1.00 34.04 ? 273  ARG B CA  1 
ATOM   4171  C  C   . ARG B  1 281 ? 19.753   88.254  5.630   1.00 32.17 ? 273  ARG B C   1 
ATOM   4172  O  O   . ARG B  1 281 ? 20.881   87.848  5.425   1.00 31.57 ? 273  ARG B O   1 
ATOM   4173  C  CB  . ARG B  1 281 ? 18.267   87.289  3.886   1.00 34.78 ? 273  ARG B CB  1 
ATOM   4174  C  CG  . ARG B  1 281 ? 17.489   86.545  4.920   1.00 38.23 ? 273  ARG B CG  1 
ATOM   4175  C  CD  . ARG B  1 281 ? 16.706   85.461  4.356   1.00 41.44 ? 273  ARG B CD  1 
ATOM   4176  N  NE  . ARG B  1 281 ? 16.054   84.662  5.392   1.00 42.64 ? 273  ARG B NE  1 
ATOM   4177  C  CZ  . ARG B  1 281 ? 14.860   84.916  5.925   1.00 42.05 ? 273  ARG B CZ  1 
ATOM   4178  N  NH1 . ARG B  1 281 ? 14.147   85.977  5.576   1.00 42.17 ? 273  ARG B NH1 1 
ATOM   4179  N  NH2 . ARG B  1 281 ? 14.381   84.098  6.824   1.00 40.70 ? 273  ARG B NH2 1 
ATOM   4180  N  N   . ALA B  1 282 ? 19.252   88.421  6.857   1.00 29.11 ? 274  ALA B N   1 
ATOM   4181  C  CA  . ALA B  1 282 ? 19.979   88.035  8.030   1.00 27.33 ? 274  ALA B CA  1 
ATOM   4182  C  C   . ALA B  1 282 ? 18.985   87.819  9.144   1.00 25.88 ? 274  ALA B C   1 
ATOM   4183  O  O   . ALA B  1 282 ? 18.574   88.749  9.805   1.00 24.31 ? 274  ALA B O   1 
ATOM   4184  C  CB  . ALA B  1 282 ? 21.016   89.088  8.364   1.00 26.12 ? 274  ALA B CB  1 
ATOM   4185  N  N   . ASN B  1 283 ? 18.590   86.563  9.305   1.00 25.64 ? 275  ASN B N   1 
ATOM   4186  C  CA  . ASN B  1 283 ? 17.541   86.156  10.205  1.00 25.53 ? 275  ASN B CA  1 
ATOM   4187  C  C   . ASN B  1 283 ? 17.909   84.857  10.878  1.00 26.59 ? 275  ASN B C   1 
ATOM   4188  O  O   . ASN B  1 283 ? 18.273   83.895  10.216  1.00 26.12 ? 275  ASN B O   1 
ATOM   4189  C  CB  . ASN B  1 283 ? 16.263   85.937  9.428   1.00 25.61 ? 275  ASN B CB  1 
ATOM   4190  C  CG  . ASN B  1 283 ? 15.019   85.972  10.315  1.00 26.13 ? 275  ASN B CG  1 
ATOM   4191  O  OD1 . ASN B  1 283 ? 14.688   85.000  10.960  1.00 26.01 ? 275  ASN B OD1 1 
ATOM   4192  N  ND2 . ASN B  1 283 ? 14.319   87.098  10.320  1.00 23.39 ? 275  ASN B ND2 1 
ATOM   4193  N  N   . ILE B  1 284 ? 17.792   84.807  12.199  1.00 26.96 ? 276  ILE B N   1 
ATOM   4194  C  CA  . ILE B  1 284 ? 18.141   83.602  12.929  1.00 27.32 ? 276  ILE B CA  1 
ATOM   4195  C  C   . ILE B  1 284 ? 17.222   82.450  12.575  1.00 28.71 ? 276  ILE B C   1 
ATOM   4196  O  O   . ILE B  1 284 ? 17.580   81.326  12.824  1.00 29.16 ? 276  ILE B O   1 
ATOM   4197  C  CB  . ILE B  1 284 ? 18.151   83.812  14.477  1.00 27.13 ? 276  ILE B CB  1 
ATOM   4198  C  CG1 . ILE B  1 284 ? 16.711   84.015  14.977  1.00 25.75 ? 276  ILE B CG1 1 
ATOM   4199  C  CG2 . ILE B  1 284 ? 19.097   84.964  14.821  1.00 24.25 ? 276  ILE B CG2 1 
ATOM   4200  C  CD1 . ILE B  1 284 ? 16.546   84.218  16.444  1.00 23.88 ? 276  ILE B CD1 1 
ATOM   4201  N  N   . SER B  1 285 ? 16.051   82.696  11.991  1.00 30.42 ? 277  SER B N   1 
ATOM   4202  C  CA  . SER B  1 285 ? 15.183   81.565  11.656  1.00 32.34 ? 277  SER B CA  1 
ATOM   4203  C  C   . SER B  1 285 ? 15.814   80.632  10.641  1.00 34.65 ? 277  SER B C   1 
ATOM   4204  O  O   . SER B  1 285 ? 15.494   79.456  10.605  1.00 34.75 ? 277  SER B O   1 
ATOM   4205  C  CB  . SER B  1 285 ? 13.812   81.986  11.161  1.00 31.93 ? 277  SER B CB  1 
ATOM   4206  O  OG  . SER B  1 285 ? 13.918   82.752  10.011  1.00 32.70 ? 277  SER B OG  1 
ATOM   4207  N  N   . ASP B  1 286 ? 16.717   81.149  9.817   1.00 37.48 ? 278  ASP B N   1 
ATOM   4208  C  CA  . ASP B  1 286 ? 17.434   80.299  8.858   1.00 39.80 ? 278  ASP B CA  1 
ATOM   4209  C  C   . ASP B  1 286 ? 18.377   79.306  9.539   1.00 42.36 ? 278  ASP B C   1 
ATOM   4210  O  O   . ASP B  1 286 ? 18.792   78.388  8.894   1.00 42.35 ? 278  ASP B O   1 
ATOM   4211  C  CB  . ASP B  1 286 ? 18.274   81.122  7.874   1.00 39.65 ? 278  ASP B CB  1 
ATOM   4212  C  CG  . ASP B  1 286 ? 17.441   82.017  7.007   1.00 38.35 ? 278  ASP B CG  1 
ATOM   4213  O  OD1 . ASP B  1 286 ? 16.280   81.692  6.778   1.00 39.33 ? 278  ASP B OD1 1 
ATOM   4214  O  OD2 . ASP B  1 286 ? 17.938   83.060  6.559   1.00 37.57 ? 278  ASP B OD2 1 
ATOM   4215  N  N   . TYR B  1 287 ? 18.741   79.485  10.811  1.00 44.72 ? 279  TYR B N   1 
ATOM   4216  C  CA  . TYR B  1 287 ? 19.631   78.515  11.424  1.00 46.68 ? 279  TYR B CA  1 
ATOM   4217  C  C   . TYR B  1 287 ? 18.981   77.790  12.541  1.00 48.91 ? 279  TYR B C   1 
ATOM   4218  O  O   . TYR B  1 287 ? 19.598   76.969  13.138  1.00 50.11 ? 279  TYR B O   1 
ATOM   4219  C  CB  . TYR B  1 287 ? 20.902   79.179  11.916  1.00 46.62 ? 279  TYR B CB  1 
ATOM   4220  C  CG  . TYR B  1 287 ? 21.322   80.318  11.062  1.00 46.05 ? 279  TYR B CG  1 
ATOM   4221  C  CD1 . TYR B  1 287 ? 21.953   80.115  9.839   1.00 47.83 ? 279  TYR B CD1 1 
ATOM   4222  C  CD2 . TYR B  1 287 ? 21.073   81.604  11.457  1.00 45.76 ? 279  TYR B CD2 1 
ATOM   4223  C  CE1 . TYR B  1 287 ? 22.345   81.208  9.056   1.00 49.13 ? 279  TYR B CE1 1 
ATOM   4224  C  CE2 . TYR B  1 287 ? 21.445   82.689  10.698  1.00 46.27 ? 279  TYR B CE2 1 
ATOM   4225  C  CZ  . TYR B  1 287 ? 22.074   82.498  9.512   1.00 47.84 ? 279  TYR B CZ  1 
ATOM   4226  O  OH  . TYR B  1 287 ? 22.396   83.614  8.805   1.00 47.88 ? 279  TYR B OH  1 
ATOM   4227  N  N   . LEU B  1 288 ? 17.729   78.073  12.837  1.00 51.88 ? 280  LEU B N   1 
ATOM   4228  C  CA  . LEU B  1 288 ? 17.023   77.301  13.855  1.00 53.61 ? 280  LEU B CA  1 
ATOM   4229  C  C   . LEU B  1 288 ? 15.985   76.392  13.185  1.00 54.61 ? 280  LEU B C   1 
ATOM   4230  O  O   . LEU B  1 288 ? 15.979   75.202  13.457  1.00 56.18 ? 280  LEU B O   1 
ATOM   4231  C  CB  . LEU B  1 288 ? 16.324   78.217  14.884  1.00 53.91 ? 280  LEU B CB  1 
ATOM   4232  C  CG  . LEU B  1 288 ? 17.101   79.165  15.826  1.00 53.87 ? 280  LEU B CG  1 
ATOM   4233  C  CD1 . LEU B  1 288 ? 16.087   79.566  16.963  1.00 54.35 ? 280  LEU B CD1 1 
ATOM   4234  C  CD2 . LEU B  1 288 ? 18.439   78.570  16.368  1.00 50.61 ? 280  LEU B CD2 1 
ATOM   4235  N  N   . GLY C  1 7   ? 43.328   47.919  58.708  1.00 52.52 ? -1   GLY C N   1 
ATOM   4236  C  CA  . GLY C  1 7   ? 41.897   48.217  59.067  1.00 52.73 ? -1   GLY C CA  1 
ATOM   4237  C  C   . GLY C  1 7   ? 41.561   49.710  59.269  1.00 52.32 ? -1   GLY C C   1 
ATOM   4238  O  O   . GLY C  1 7   ? 42.244   50.610  58.732  1.00 53.36 ? -1   GLY C O   1 
ATOM   4239  N  N   . HIS C  1 8   ? 40.515   49.987  60.057  1.00 50.89 ? 0    HIS C N   1 
ATOM   4240  C  CA  . HIS C  1 8   ? 39.966   51.353  60.164  1.00 49.49 ? 0    HIS C CA  1 
ATOM   4241  C  C   . HIS C  1 8   ? 39.874   51.849  61.586  1.00 46.18 ? 0    HIS C C   1 
ATOM   4242  O  O   . HIS C  1 8   ? 39.882   51.074  62.506  1.00 44.58 ? 0    HIS C O   1 
ATOM   4243  C  CB  . HIS C  1 8   ? 38.608   51.403  59.452  1.00 50.37 ? 0    HIS C CB  1 
ATOM   4244  C  CG  . HIS C  1 8   ? 38.720   51.164  57.968  1.00 55.53 ? 0    HIS C CG  1 
ATOM   4245  N  ND1 . HIS C  1 8   ? 37.993   50.187  57.304  1.00 59.12 ? 0    HIS C ND1 1 
ATOM   4246  C  CD2 . HIS C  1 8   ? 39.515   51.751  57.027  1.00 58.05 ? 0    HIS C CD2 1 
ATOM   4247  C  CE1 . HIS C  1 8   ? 38.319   50.193  56.018  1.00 60.36 ? 0    HIS C CE1 1 
ATOM   4248  N  NE2 . HIS C  1 8   ? 39.242   51.128  55.825  1.00 61.14 ? 0    HIS C NE2 1 
ATOM   4249  N  N   . MET C  1 9   ? 39.802   53.155  61.760  1.00 47.25 ? 1    MET C N   1 
ATOM   4250  C  CA  . MET C  1 9   ? 39.754   53.716  63.089  1.00 45.32 ? 1    MET C CA  1 
ATOM   4251  C  C   . MET C  1 9   ? 38.494   53.306  63.806  1.00 42.35 ? 1    MET C C   1 
ATOM   4252  O  O   . MET C  1 9   ? 37.491   53.100  63.188  1.00 40.83 ? 1    MET C O   1 
ATOM   4253  C  CB  . MET C  1 9   ? 39.886   55.230  63.019  1.00 45.59 ? 1    MET C CB  1 
ATOM   4254  C  CG  . MET C  1 9   ? 41.317   55.682  62.794  1.00 47.16 ? 1    MET C CG  1 
ATOM   4255  S  SD  . MET C  1 9   ? 41.617   57.451  62.941  1.00 45.16 ? 1    MET C SD  1 
ATOM   4256  C  CE  . MET C  1 9   ? 40.651   57.966  61.545  1.00 48.09 ? 1    MET C CE  1 
ATOM   4257  N  N   . ARG C  1 10  ? 38.563   53.139  65.115  1.00 40.21 ? 2    ARG C N   1 
ATOM   4258  C  CA  . ARG C  1 10  ? 37.384   52.762  65.902  1.00 38.88 ? 2    ARG C CA  1 
ATOM   4259  C  C   . ARG C  1 10  ? 36.411   53.949  66.012  1.00 35.69 ? 2    ARG C C   1 
ATOM   4260  O  O   . ARG C  1 10  ? 36.811   55.025  66.433  1.00 33.13 ? 2    ARG C O   1 
ATOM   4261  C  CB  . ARG C  1 10  ? 37.747   52.344  67.318  1.00 39.16 ? 2    ARG C CB  1 
ATOM   4262  C  CG  . ARG C  1 10  ? 37.662   50.873  67.627  1.00 43.16 ? 2    ARG C CG  1 
ATOM   4263  C  CD  . ARG C  1 10  ? 37.373   50.610  69.136  1.00 44.14 ? 2    ARG C CD  1 
ATOM   4264  N  NE  . ARG C  1 10  ? 38.002   51.592  70.014  1.00 43.79 ? 2    ARG C NE  1 
ATOM   4265  C  CZ  . ARG C  1 10  ? 37.456   52.095  71.114  1.00 44.77 ? 2    ARG C CZ  1 
ATOM   4266  N  NH1 . ARG C  1 10  ? 36.254   51.726  71.511  1.00 45.02 ? 2    ARG C NH1 1 
ATOM   4267  N  NH2 . ARG C  1 10  ? 38.116   52.994  71.826  1.00 43.19 ? 2    ARG C NH2 1 
ATOM   4268  N  N   . THR C  1 11  ? 35.145   53.705  65.676  1.00 33.06 ? 3    THR C N   1 
ATOM   4269  C  CA  . THR C  1 11  ? 34.115   54.718  65.712  1.00 31.79 ? 3    THR C CA  1 
ATOM   4270  C  C   . THR C  1 11  ? 32.829   54.227  66.315  1.00 31.41 ? 3    THR C C   1 
ATOM   4271  O  O   . THR C  1 11  ? 32.603   53.049  66.464  1.00 31.23 ? 3    THR C O   1 
ATOM   4272  C  CB  . THR C  1 11  ? 33.769   55.246  64.308  1.00 31.63 ? 3    THR C CB  1 
ATOM   4273  O  OG1 . THR C  1 11  ? 32.982   54.276  63.623  1.00 29.14 ? 3    THR C OG1 1 
ATOM   4274  C  CG2 . THR C  1 11  ? 35.034   55.580  63.504  1.00 28.69 ? 3    THR C CG2 1 
ATOM   4275  N  N   . ASN C  1 12  ? 31.977   55.186  66.644  1.00 31.07 ? 4    ASN C N   1 
ATOM   4276  C  CA  . ASN C  1 12  ? 30.626   54.939  67.143  1.00 30.50 ? 4    ASN C CA  1 
ATOM   4277  C  C   . ASN C  1 12  ? 29.589   54.768  66.028  1.00 30.89 ? 4    ASN C C   1 
ATOM   4278  O  O   . ASN C  1 12  ? 28.427   55.011  66.243  1.00 30.22 ? 4    ASN C O   1 
ATOM   4279  C  CB  . ASN C  1 12  ? 30.202   56.086  68.058  1.00 29.39 ? 4    ASN C CB  1 
ATOM   4280  C  CG  . ASN C  1 12  ? 29.996   57.386  67.308  1.00 27.55 ? 4    ASN C CG  1 
ATOM   4281  O  OD1 . ASN C  1 12  ? 30.502   57.527  66.197  1.00 26.16 ? 4    ASN C OD1 1 
ATOM   4282  N  ND2 . ASN C  1 12  ? 29.242   58.325  67.886  1.00 19.79 ? 4    ASN C ND2 1 
ATOM   4283  N  N   . LYS C  1 13  ? 30.007   54.325  64.856  1.00 31.88 ? 5    LYS C N   1 
ATOM   4284  C  CA  . LYS C  1 13  ? 29.132   54.381  63.693  1.00 34.43 ? 5    LYS C CA  1 
ATOM   4285  C  C   . LYS C  1 13  ? 27.818   53.584  63.799  1.00 34.61 ? 5    LYS C C   1 
ATOM   4286  O  O   . LYS C  1 13  ? 26.849   53.938  63.170  1.00 33.54 ? 5    LYS C O   1 
ATOM   4287  C  CB  . LYS C  1 13  ? 29.881   54.070  62.382  1.00 34.62 ? 5    LYS C CB  1 
ATOM   4288  C  CG  . LYS C  1 13  ? 29.698   52.726  61.861  1.00 39.91 ? 5    LYS C CG  1 
ATOM   4289  C  CD  . LYS C  1 13  ? 30.373   52.520  60.526  1.00 45.26 ? 5    LYS C CD  1 
ATOM   4290  C  CE  . LYS C  1 13  ? 31.429   51.461  60.644  1.00 49.17 ? 5    LYS C CE  1 
ATOM   4291  N  NZ  . LYS C  1 13  ? 31.792   50.945  59.328  1.00 52.26 ? 5    LYS C NZ  1 
ATOM   4292  N  N   . ASP C  1 14  ? 27.782   52.544  64.602  1.00 35.62 ? 6    ASP C N   1 
ATOM   4293  C  CA  . ASP C  1 14  ? 26.553   51.769  64.753  1.00 37.38 ? 6    ASP C CA  1 
ATOM   4294  C  C   . ASP C  1 14  ? 25.551   52.489  65.597  1.00 36.35 ? 6    ASP C C   1 
ATOM   4295  O  O   . ASP C  1 14  ? 24.393   52.184  65.535  1.00 38.04 ? 6    ASP C O   1 
ATOM   4296  C  CB  . ASP C  1 14  ? 26.823   50.408  65.400  1.00 38.79 ? 6    ASP C CB  1 
ATOM   4297  C  CG  . ASP C  1 14  ? 27.657   49.481  64.507  1.00 43.46 ? 6    ASP C CG  1 
ATOM   4298  O  OD1 . ASP C  1 14  ? 27.735   49.658  63.237  1.00 46.63 ? 6    ASP C OD1 1 
ATOM   4299  O  OD2 . ASP C  1 14  ? 28.241   48.545  65.115  1.00 51.60 ? 6    ASP C OD2 1 
ATOM   4300  N  N   . ARG C  1 15  ? 25.980   53.460  66.368  1.00 35.08 ? 7    ARG C N   1 
ATOM   4301  C  CA  . ARG C  1 15  ? 25.065   54.260  67.136  1.00 34.93 ? 7    ARG C CA  1 
ATOM   4302  C  C   . ARG C  1 15  ? 24.566   55.511  66.441  1.00 31.90 ? 7    ARG C C   1 
ATOM   4303  O  O   . ARG C  1 15  ? 23.849   56.282  67.056  1.00 30.63 ? 7    ARG C O   1 
ATOM   4304  C  CB  . ARG C  1 15  ? 25.733   54.688  68.429  1.00 36.57 ? 7    ARG C CB  1 
ATOM   4305  C  CG  . ARG C  1 15  ? 26.138   53.532  69.314  1.00 42.62 ? 7    ARG C CG  1 
ATOM   4306  C  CD  . ARG C  1 15  ? 26.732   54.097  70.665  1.00 52.82 ? 7    ARG C CD  1 
ATOM   4307  N  NE  . ARG C  1 15  ? 27.150   53.003  71.555  1.00 61.32 ? 7    ARG C NE  1 
ATOM   4308  C  CZ  . ARG C  1 15  ? 26.341   52.122  72.168  1.00 67.33 ? 7    ARG C CZ  1 
ATOM   4309  N  NH1 . ARG C  1 15  ? 25.008   52.171  72.066  1.00 68.65 ? 7    ARG C NH1 1 
ATOM   4310  N  NH2 . ARG C  1 15  ? 26.883   51.169  72.909  1.00 69.41 ? 7    ARG C NH2 1 
ATOM   4311  N  N   . LEU C  1 16  ? 24.935   55.721  65.188  1.00 29.12 ? 8    LEU C N   1 
ATOM   4312  C  CA  . LEU C  1 16  ? 24.470   56.897  64.487  1.00 28.10 ? 8    LEU C CA  1 
ATOM   4313  C  C   . LEU C  1 16  ? 23.064   56.668  63.928  1.00 26.91 ? 8    LEU C C   1 
ATOM   4314  O  O   . LEU C  1 16  ? 22.701   55.575  63.532  1.00 26.10 ? 8    LEU C O   1 
ATOM   4315  C  CB  . LEU C  1 16  ? 25.422   57.292  63.369  1.00 27.24 ? 8    LEU C CB  1 
ATOM   4316  C  CG  . LEU C  1 16  ? 26.862   57.550  63.839  1.00 28.04 ? 8    LEU C CG  1 
ATOM   4317  C  CD1 . LEU C  1 16  ? 27.759   57.723  62.626  1.00 26.28 ? 8    LEU C CD1 1 
ATOM   4318  C  CD2 . LEU C  1 16  ? 26.963   58.717  64.792  1.00 25.13 ? 8    LEU C CD2 1 
ATOM   4319  N  N   . VAL C  1 17  ? 22.288   57.731  63.905  1.00 25.52 ? 9    VAL C N   1 
ATOM   4320  C  CA  . VAL C  1 17  ? 20.944   57.683  63.394  1.00 24.98 ? 9    VAL C CA  1 
ATOM   4321  C  C   . VAL C  1 17  ? 20.993   58.036  61.928  1.00 25.48 ? 9    VAL C C   1 
ATOM   4322  O  O   . VAL C  1 17  ? 21.676   58.989  61.541  1.00 25.72 ? 9    VAL C O   1 
ATOM   4323  C  CB  . VAL C  1 17  ? 20.061   58.666  64.174  1.00 25.69 ? 9    VAL C CB  1 
ATOM   4324  C  CG1 . VAL C  1 17  ? 18.601   58.779  63.605  1.00 22.80 ? 9    VAL C CG1 1 
ATOM   4325  C  CG2 . VAL C  1 17  ? 20.099   58.285  65.685  1.00 22.59 ? 9    VAL C CG2 1 
ATOM   4326  N  N   . ARG C  1 18  ? 20.298   57.231  61.129  1.00 24.90 ? 10   ARG C N   1 
ATOM   4327  C  CA  A ARG C  1 18  ? 20.224   57.384  59.711  0.50 25.07 ? 10   ARG C CA  1 
ATOM   4328  C  CA  B ARG C  1 18  ? 20.221   57.426  59.700  0.50 25.04 ? 10   ARG C CA  1 
ATOM   4329  C  C   . ARG C  1 18  ? 18.795   57.870  59.405  1.00 25.06 ? 10   ARG C C   1 
ATOM   4330  O  O   . ARG C  1 18  ? 17.806   57.195  59.772  1.00 26.18 ? 10   ARG C O   1 
ATOM   4331  C  CB  A ARG C  1 18  ? 20.544   56.012  59.112  0.50 25.60 ? 10   ARG C CB  1 
ATOM   4332  C  CB  B ARG C  1 18  ? 20.598   56.145  58.938  0.50 25.52 ? 10   ARG C CB  1 
ATOM   4333  C  CG  A ARG C  1 18  ? 21.029   55.986  57.674  0.50 28.46 ? 10   ARG C CG  1 
ATOM   4334  C  CG  B ARG C  1 18  ? 20.786   56.326  57.389  0.50 28.26 ? 10   ARG C CG  1 
ATOM   4335  C  CD  A ARG C  1 18  ? 21.772   54.656  57.271  0.50 29.90 ? 10   ARG C CD  1 
ATOM   4336  C  CD  B ARG C  1 18  ? 20.918   54.973  56.551  0.50 29.68 ? 10   ARG C CD  1 
ATOM   4337  N  NE  A ARG C  1 18  ? 21.082   53.415  57.657  0.50 30.52 ? 10   ARG C NE  1 
ATOM   4338  N  NE  B ARG C  1 18  ? 22.280   54.431  56.505  0.50 31.25 ? 10   ARG C NE  1 
ATOM   4339  C  CZ  A ARG C  1 18  ? 20.181   52.785  56.908  0.50 30.70 ? 10   ARG C CZ  1 
ATOM   4340  C  CZ  B ARG C  1 18  ? 22.798   53.586  57.404  0.50 32.49 ? 10   ARG C CZ  1 
ATOM   4341  N  NH1 A ARG C  1 18  ? 19.848   53.301  55.710  0.50 30.14 ? 10   ARG C NH1 1 
ATOM   4342  N  NH1 B ARG C  1 18  ? 22.078   53.173  58.446  0.50 32.32 ? 10   ARG C NH1 1 
ATOM   4343  N  NH2 A ARG C  1 18  ? 19.608   51.655  57.368  0.50 26.18 ? 10   ARG C NH2 1 
ATOM   4344  N  NH2 B ARG C  1 18  ? 24.044   53.147  57.264  0.50 32.21 ? 10   ARG C NH2 1 
ATOM   4345  N  N   . ILE C  1 19  ? 18.661   59.024  58.759  1.00 23.58 ? 11   ILE C N   1 
ATOM   4346  C  CA  . ILE C  1 19  ? 17.383   59.688  58.644  1.00 23.10 ? 11   ILE C CA  1 
ATOM   4347  C  C   . ILE C  1 19  ? 17.136   60.352  57.285  1.00 22.73 ? 11   ILE C C   1 
ATOM   4348  O  O   . ILE C  1 19  ? 18.070   60.764  56.635  1.00 22.92 ? 11   ILE C O   1 
ATOM   4349  C  CB  . ILE C  1 19  ? 17.258   60.700  59.778  1.00 23.06 ? 11   ILE C CB  1 
ATOM   4350  C  CG1 . ILE C  1 19  ? 15.806   61.162  59.994  1.00 24.21 ? 11   ILE C CG1 1 
ATOM   4351  C  CG2 . ILE C  1 19  ? 18.110   61.881  59.525  1.00 22.08 ? 11   ILE C CG2 1 
ATOM   4352  C  CD1 . ILE C  1 19  ? 15.637   61.869  61.368  1.00 22.69 ? 11   ILE C CD1 1 
ATOM   4353  N  N   . SER C  1 20  ? 15.870   60.379  56.854  1.00 22.00 ? 12   SER C N   1 
ATOM   4354  C  CA  . SER C  1 20  ? 15.443   60.942  55.594  1.00 21.83 ? 12   SER C CA  1 
ATOM   4355  C  C   . SER C  1 20  ? 15.504   62.449  55.629  1.00 22.30 ? 12   SER C C   1 
ATOM   4356  O  O   . SER C  1 20  ? 14.834   63.057  56.463  1.00 20.71 ? 12   SER C O   1 
ATOM   4357  C  CB  . SER C  1 20  ? 13.983   60.574  55.294  1.00 23.03 ? 12   SER C CB  1 
ATOM   4358  O  OG  . SER C  1 20  ? 13.092   61.165  56.224  1.00 19.13 ? 12   SER C OG  1 
ATOM   4359  N  N   . VAL C  1 21  ? 16.303   63.040  54.726  1.00 22.32 ? 13   VAL C N   1 
ATOM   4360  C  CA  . VAL C  1 21  ? 16.418   64.500  54.590  1.00 22.15 ? 13   VAL C CA  1 
ATOM   4361  C  C   . VAL C  1 21  ? 15.906   64.876  53.207  1.00 22.27 ? 13   VAL C C   1 
ATOM   4362  O  O   . VAL C  1 21  ? 16.362   64.351  52.211  1.00 22.90 ? 13   VAL C O   1 
ATOM   4363  C  CB  . VAL C  1 21  ? 17.869   64.979  54.806  1.00 22.16 ? 13   VAL C CB  1 
ATOM   4364  C  CG1 . VAL C  1 21  ? 18.090   66.319  54.166  1.00 20.63 ? 13   VAL C CG1 1 
ATOM   4365  C  CG2 . VAL C  1 21  ? 18.164   65.017  56.296  1.00 21.21 ? 13   VAL C CG2 1 
ATOM   4366  N  N   . VAL C  1 22  ? 14.911   65.736  53.150  1.00 22.54 ? 14   VAL C N   1 
ATOM   4367  C  CA  . VAL C  1 22  ? 14.199   65.990  51.896  1.00 23.39 ? 14   VAL C CA  1 
ATOM   4368  C  C   . VAL C  1 22  ? 14.613   67.360  51.339  1.00 23.21 ? 14   VAL C C   1 
ATOM   4369  O  O   . VAL C  1 22  ? 14.902   68.290  52.099  1.00 22.77 ? 14   VAL C O   1 
ATOM   4370  C  CB  . VAL C  1 22  ? 12.650   65.990  52.106  1.00 23.91 ? 14   VAL C CB  1 
ATOM   4371  C  CG1 . VAL C  1 22  ? 12.198   67.098  52.989  1.00 23.00 ? 14   VAL C CG1 1 
ATOM   4372  C  CG2 . VAL C  1 22  ? 11.914   66.171  50.801  1.00 29.78 ? 14   VAL C CG2 1 
ATOM   4373  N  N   . GLY C  1 23  ? 14.664   67.453  50.015  1.00 23.35 ? 15   GLY C N   1 
ATOM   4374  C  CA  . GLY C  1 23  ? 14.792   68.710  49.314  1.00 22.87 ? 15   GLY C CA  1 
ATOM   4375  C  C   . GLY C  1 23  ? 14.224   68.613  47.915  1.00 22.70 ? 15   GLY C C   1 
ATOM   4376  O  O   . GLY C  1 23  ? 13.581   67.621  47.538  1.00 22.06 ? 15   GLY C O   1 
ATOM   4377  N  N   . GLU C  1 24  ? 14.486   69.657  47.138  1.00 22.53 ? 16   GLU C N   1 
ATOM   4378  C  CA  . GLU C  1 24  ? 14.161   69.661  45.708  1.00 23.22 ? 16   GLU C CA  1 
ATOM   4379  C  C   . GLU C  1 24  ? 15.281   70.291  44.895  1.00 21.68 ? 16   GLU C C   1 
ATOM   4380  O  O   . GLU C  1 24  ? 16.031   71.104  45.409  1.00 21.76 ? 16   GLU C O   1 
ATOM   4381  C  CB  . GLU C  1 24  ? 12.823   70.384  45.452  1.00 23.14 ? 16   GLU C CB  1 
ATOM   4382  C  CG  . GLU C  1 24  ? 12.848   71.825  45.872  1.00 27.03 ? 16   GLU C CG  1 
ATOM   4383  C  CD  . GLU C  1 24  ? 11.495   72.514  45.811  1.00 30.04 ? 16   GLU C CD  1 
ATOM   4384  O  OE1 . GLU C  1 24  ? 10.622   72.187  46.636  1.00 33.80 ? 16   GLU C OE1 1 
ATOM   4385  O  OE2 . GLU C  1 24  ? 11.324   73.409  44.953  1.00 31.55 ? 16   GLU C OE2 1 
ATOM   4386  N  N   . ILE C  1 25  ? 15.373   69.936  43.614  1.00 20.80 ? 17   ILE C N   1 
ATOM   4387  C  CA  . ILE C  1 25  ? 16.350   70.548  42.754  1.00 19.86 ? 17   ILE C CA  1 
ATOM   4388  C  C   . ILE C  1 25  ? 16.100   72.051  42.681  1.00 20.24 ? 17   ILE C C   1 
ATOM   4389  O  O   . ILE C  1 25  ? 14.981   72.496  42.368  1.00 20.97 ? 17   ILE C O   1 
ATOM   4390  C  CB  . ILE C  1 25  ? 16.379   69.931  41.376  1.00 20.18 ? 17   ILE C CB  1 
ATOM   4391  C  CG1 . ILE C  1 25  ? 16.815   68.468  41.474  1.00 19.72 ? 17   ILE C CG1 1 
ATOM   4392  C  CG2 . ILE C  1 25  ? 17.418   70.694  40.482  1.00 17.91 ? 17   ILE C CG2 1 
ATOM   4393  C  CD1 . ILE C  1 25  ? 16.858   67.767  40.155  1.00 18.33 ? 17   ILE C CD1 1 
ATOM   4394  N  N   . ALA C  1 26  ? 17.145   72.809  42.998  1.00 19.53 ? 18   ALA C N   1 
ATOM   4395  C  CA  . ALA C  1 26  ? 17.111   74.253  43.038  1.00 20.23 ? 18   ALA C CA  1 
ATOM   4396  C  C   . ALA C  1 26  ? 17.264   74.867  41.632  1.00 20.31 ? 18   ALA C C   1 
ATOM   4397  O  O   . ALA C  1 26  ? 17.935   74.301  40.783  1.00 22.00 ? 18   ALA C O   1 
ATOM   4398  C  CB  . ALA C  1 26  ? 18.220   74.806  43.966  1.00 18.73 ? 18   ALA C CB  1 
ATOM   4399  N  N   . PRO C  1 27  ? 16.655   76.014  41.395  1.00 20.17 ? 19   PRO C N   1 
ATOM   4400  C  CA  . PRO C  1 27  ? 16.857   76.722  40.149  1.00 21.17 ? 19   PRO C CA  1 
ATOM   4401  C  C   . PRO C  1 27  ? 18.212   77.354  40.173  1.00 21.87 ? 19   PRO C C   1 
ATOM   4402  O  O   . PRO C  1 27  ? 18.774   77.475  41.252  1.00 22.05 ? 19   PRO C O   1 
ATOM   4403  C  CB  . PRO C  1 27  ? 15.824   77.826  40.204  1.00 21.18 ? 19   PRO C CB  1 
ATOM   4404  C  CG  . PRO C  1 27  ? 15.650   78.089  41.681  1.00 21.75 ? 19   PRO C CG  1 
ATOM   4405  C  CD  . PRO C  1 27  ? 15.766   76.747  42.312  1.00 20.70 ? 19   PRO C CD  1 
ATOM   4406  N  N   . ALA C  1 28  ? 18.725   77.742  39.003  1.00 22.08 ? 20   ALA C N   1 
ATOM   4407  C  CA  . ALA C  1 28  ? 19.828   78.684  38.937  1.00 22.14 ? 20   ALA C CA  1 
ATOM   4408  C  C   . ALA C  1 28  ? 19.370   79.934  39.647  1.00 22.20 ? 20   ALA C C   1 
ATOM   4409  O  O   . ALA C  1 28  ? 18.234   80.329  39.465  1.00 21.78 ? 20   ALA C O   1 
ATOM   4410  C  CB  . ALA C  1 28  ? 20.241   79.006  37.455  1.00 20.97 ? 20   ALA C CB  1 
ATOM   4411  N  N   . LYS C  1 29  ? 20.253   80.534  40.444  1.00 22.95 ? 21   LYS C N   1 
ATOM   4412  C  CA  . LYS C  1 29  ? 19.937   81.724  41.202  1.00 24.97 ? 21   LYS C CA  1 
ATOM   4413  C  C   . LYS C  1 29  ? 20.918   82.859  40.919  1.00 26.28 ? 21   LYS C C   1 
ATOM   4414  O  O   . LYS C  1 29  ? 22.104   82.633  40.649  1.00 26.53 ? 21   LYS C O   1 
ATOM   4415  C  CB  . LYS C  1 29  ? 19.969   81.412  42.700  1.00 24.78 ? 21   LYS C CB  1 
ATOM   4416  C  CG  . LYS C  1 29  ? 18.883   80.418  43.177  1.00 25.47 ? 21   LYS C CG  1 
ATOM   4417  C  CD  . LYS C  1 29  ? 18.976   80.098  44.667  1.00 25.06 ? 21   LYS C CD  1 
ATOM   4418  C  CE  . LYS C  1 29  ? 17.899   79.123  45.154  1.00 24.20 ? 21   LYS C CE  1 
ATOM   4419  N  NZ  . LYS C  1 29  ? 18.050   78.789  46.607  1.00 22.99 ? 21   LYS C NZ  1 
ATOM   4420  N  N   . MET C  1 30  ? 20.403   84.072  40.984  1.00 27.31 ? 22   MET C N   1 
ATOM   4421  C  CA  . MET C  1 30  ? 21.163   85.299  40.779  1.00 29.39 ? 22   MET C CA  1 
ATOM   4422  C  C   . MET C  1 30  ? 20.328   86.415  41.363  1.00 30.74 ? 22   MET C C   1 
ATOM   4423  O  O   . MET C  1 30  ? 19.146   86.614  40.987  1.00 29.50 ? 22   MET C O   1 
ATOM   4424  C  CB  . MET C  1 30  ? 21.339   85.659  39.297  1.00 30.19 ? 22   MET C CB  1 
ATOM   4425  C  CG  . MET C  1 30  ? 22.094   84.676  38.406  1.00 32.20 ? 22   MET C CG  1 
ATOM   4426  S  SD  . MET C  1 30  ? 22.232   85.182  36.694  1.00 31.09 ? 22   MET C SD  1 
ATOM   4427  C  CE  . MET C  1 30  ? 23.633   86.300  36.678  1.00 30.06 ? 22   MET C CE  1 
ATOM   4428  N  N   . ARG C  1 31  ? 20.934   87.146  42.261  1.00 32.57 ? 23   ARG C N   1 
ATOM   4429  C  CA  . ARG C  1 31  ? 20.284   88.297  42.858  1.00 35.61 ? 23   ARG C CA  1 
ATOM   4430  C  C   . ARG C  1 31  ? 20.424   89.609  42.034  1.00 33.91 ? 23   ARG C C   1 
ATOM   4431  O  O   . ARG C  1 31  ? 19.734   90.589  42.291  1.00 32.25 ? 23   ARG C O   1 
ATOM   4432  C  CB  . ARG C  1 31  ? 20.751   88.405  44.320  1.00 37.79 ? 23   ARG C CB  1 
ATOM   4433  C  CG  . ARG C  1 31  ? 19.773   87.543  45.256  1.00 48.22 ? 23   ARG C CG  1 
ATOM   4434  C  CD  . ARG C  1 31  ? 20.338   87.127  46.642  1.00 61.02 ? 23   ARG C CD  1 
ATOM   4435  N  NE  . ARG C  1 31  ? 21.051   88.228  47.300  1.00 72.09 ? 23   ARG C NE  1 
ATOM   4436  C  CZ  . ARG C  1 31  ? 22.379   88.409  47.299  1.00 80.52 ? 23   ARG C CZ  1 
ATOM   4437  N  NH1 . ARG C  1 31  ? 22.894   89.466  47.918  1.00 83.60 ? 23   ARG C NH1 1 
ATOM   4438  N  NH2 . ARG C  1 31  ? 23.204   87.553  46.691  1.00 82.71 ? 23   ARG C NH2 1 
ATOM   4439  N  N   . SER C  1 32  ? 21.292   89.556  41.012  1.00 32.29 ? 24   SER C N   1 
ATOM   4440  C  CA  . SER C  1 32  ? 21.601   90.666  40.121  1.00 31.34 ? 24   SER C CA  1 
ATOM   4441  C  C   . SER C  1 32  ? 22.126   90.047  38.840  1.00 30.43 ? 24   SER C C   1 
ATOM   4442  O  O   . SER C  1 32  ? 22.647   88.962  38.895  1.00 30.00 ? 24   SER C O   1 
ATOM   4443  C  CB  . SER C  1 32  ? 22.677   91.595  40.722  1.00 30.71 ? 24   SER C CB  1 
ATOM   4444  O  OG  . SER C  1 32  ? 23.155   92.500  39.748  1.00 28.39 ? 24   SER C OG  1 
ATOM   4445  N  N   . PRO C  1 33  ? 21.989   90.732  37.686  1.00 30.38 ? 25   PRO C N   1 
ATOM   4446  C  CA  . PRO C  1 33  ? 22.634   90.186  36.479  1.00 29.86 ? 25   PRO C CA  1 
ATOM   4447  C  C   . PRO C  1 33  ? 24.129   90.258  36.627  1.00 29.32 ? 25   PRO C C   1 
ATOM   4448  O  O   . PRO C  1 33  ? 24.858   89.430  36.055  1.00 27.35 ? 25   PRO C O   1 
ATOM   4449  C  CB  . PRO C  1 33  ? 22.168   91.095  35.359  1.00 30.19 ? 25   PRO C CB  1 
ATOM   4450  C  CG  . PRO C  1 33  ? 21.512   92.306  36.045  1.00 30.62 ? 25   PRO C CG  1 
ATOM   4451  C  CD  . PRO C  1 33  ? 21.099   91.873  37.396  1.00 30.39 ? 25   PRO C CD  1 
ATOM   4452  N  N   . TYR C  1 34  ? 24.570   91.234  37.420  1.00 29.10 ? 26   TYR C N   1 
ATOM   4453  C  CA  . TYR C  1 34  ? 26.022   91.489  37.596  1.00 29.84 ? 26   TYR C CA  1 
ATOM   4454  C  C   . TYR C  1 34  ? 26.644   90.773  38.795  1.00 29.62 ? 26   TYR C C   1 
ATOM   4455  O  O   . TYR C  1 34  ? 26.013   90.681  39.846  1.00 29.30 ? 26   TYR C O   1 
ATOM   4456  C  CB  . TYR C  1 34  ? 26.283   92.984  37.761  1.00 29.75 ? 26   TYR C CB  1 
ATOM   4457  C  CG  . TYR C  1 34  ? 25.916   93.795  36.537  1.00 29.64 ? 26   TYR C CG  1 
ATOM   4458  C  CD1 . TYR C  1 34  ? 26.562   93.572  35.298  1.00 28.39 ? 26   TYR C CD1 1 
ATOM   4459  C  CD2 . TYR C  1 34  ? 24.954   94.817  36.619  1.00 29.01 ? 26   TYR C CD2 1 
ATOM   4460  C  CE1 . TYR C  1 34  ? 26.263   94.360  34.183  1.00 29.77 ? 26   TYR C CE1 1 
ATOM   4461  C  CE2 . TYR C  1 34  ? 24.624   95.587  35.492  1.00 30.04 ? 26   TYR C CE2 1 
ATOM   4462  C  CZ  . TYR C  1 34  ? 25.268   95.342  34.279  1.00 29.95 ? 26   TYR C CZ  1 
ATOM   4463  O  OH  . TYR C  1 34  ? 24.942   96.108  33.203  1.00 28.82 ? 26   TYR C OH  1 
ATOM   4464  N  N   . SER C  1 35  ? 27.866   90.288  38.589  1.00 29.28 ? 27   SER C N   1 
ATOM   4465  C  CA  . SER C  1 35  ? 28.783   89.909  39.653  1.00 29.61 ? 27   SER C CA  1 
ATOM   4466  C  C   . SER C  1 35  ? 29.865   90.986  39.749  1.00 29.99 ? 27   SER C C   1 
ATOM   4467  O  O   . SER C  1 35  ? 30.437   91.385  38.725  1.00 28.77 ? 27   SER C O   1 
ATOM   4468  C  CB  . SER C  1 35  ? 29.454   88.544  39.390  1.00 29.20 ? 27   SER C CB  1 
ATOM   4469  O  OG  . SER C  1 35  ? 28.483   87.512  39.322  1.00 29.72 ? 27   SER C OG  1 
ATOM   4470  N  N   . VAL C  1 36  ? 30.147   91.418  40.983  1.00 30.00 ? 28   VAL C N   1 
ATOM   4471  C  CA  . VAL C  1 36  ? 31.087   92.472  41.244  1.00 29.47 ? 28   VAL C CA  1 
ATOM   4472  C  C   . VAL C  1 36  ? 32.414   91.890  41.628  1.00 30.15 ? 28   VAL C C   1 
ATOM   4473  O  O   . VAL C  1 36  ? 32.511   91.135  42.566  1.00 29.72 ? 28   VAL C O   1 
ATOM   4474  C  CB  . VAL C  1 36  ? 30.635   93.346  42.380  1.00 30.01 ? 28   VAL C CB  1 
ATOM   4475  C  CG1 . VAL C  1 36  ? 31.691   94.439  42.638  1.00 26.59 ? 28   VAL C CG1 1 
ATOM   4476  C  CG2 . VAL C  1 36  ? 29.291   93.945  42.048  1.00 28.91 ? 28   VAL C CG2 1 
ATOM   4477  N  N   . THR C  1 37  ? 33.437   92.275  40.878  1.00 30.84 ? 29   THR C N   1 
ATOM   4478  C  CA  . THR C  1 37  ? 34.773   91.768  41.070  1.00 31.24 ? 29   THR C CA  1 
ATOM   4479  C  C   . THR C  1 37  ? 35.542   92.519  42.148  1.00 32.10 ? 29   THR C C   1 
ATOM   4480  O  O   . THR C  1 37  ? 35.123   93.561  42.635  1.00 32.19 ? 29   THR C O   1 
ATOM   4481  C  CB  . THR C  1 37  ? 35.558   91.780  39.753  1.00 31.43 ? 29   THR C CB  1 
ATOM   4482  O  OG1 . THR C  1 37  ? 36.005   93.117  39.476  1.00 31.34 ? 29   THR C OG1 1 
ATOM   4483  C  CG2 . THR C  1 37  ? 34.672   91.296  38.600  1.00 30.54 ? 29   THR C CG2 1 
ATOM   4484  N  N   . THR C  1 38  ? 36.682   91.948  42.514  1.00 32.53 ? 30   THR C N   1 
ATOM   4485  C  CA  . THR C  1 38  ? 37.549   92.539  43.513  1.00 32.94 ? 30   THR C CA  1 
ATOM   4486  C  C   . THR C  1 38  ? 38.187   93.821  42.993  1.00 34.23 ? 30   THR C C   1 
ATOM   4487  O  O   . THR C  1 38  ? 38.534   94.661  43.787  1.00 35.75 ? 30   THR C O   1 
ATOM   4488  C  CB  . THR C  1 38  ? 38.615   91.517  44.103  1.00 32.83 ? 30   THR C CB  1 
ATOM   4489  O  OG1 . THR C  1 38  ? 39.605   91.235  43.141  1.00 35.11 ? 30   THR C OG1 1 
ATOM   4490  C  CG2 . THR C  1 38  ? 37.999   90.215  44.455  1.00 26.99 ? 30   THR C CG2 1 
ATOM   4491  N  N   . GLU C  1 39  ? 38.244   94.014  41.695  1.00 34.54 ? 31   GLU C N   1 
ATOM   4492  C  CA  . GLU C  1 39  ? 38.687   95.238  41.104  1.00 35.50 ? 31   GLU C CA  1 
ATOM   4493  C  C   . GLU C  1 39  ? 37.599   96.288  40.910  1.00 34.27 ? 31   GLU C C   1 
ATOM   4494  O  O   . GLU C  1 39  ? 37.833   97.314  40.344  1.00 33.84 ? 31   GLU C O   1 
ATOM   4495  C  CB  . GLU C  1 39  ? 39.288   94.910  39.772  1.00 36.64 ? 31   GLU C CB  1 
ATOM   4496  C  CG  . GLU C  1 39  ? 40.491   94.000  39.818  1.00 43.94 ? 31   GLU C CG  1 
ATOM   4497  C  CD  . GLU C  1 39  ? 40.214   92.531  40.209  1.00 51.61 ? 31   GLU C CD  1 
ATOM   4498  O  OE1 . GLU C  1 39  ? 39.317   91.876  39.651  1.00 52.22 ? 31   GLU C OE1 1 
ATOM   4499  O  OE2 . GLU C  1 39  ? 40.943   92.030  41.071  1.00 54.87 ? 31   GLU C OE2 1 
ATOM   4500  N  N   . GLY C  1 40  ? 36.398   95.996  41.350  1.00 32.45 ? 32   GLY C N   1 
ATOM   4501  C  CA  . GLY C  1 40  ? 35.292   96.928  41.210  1.00 31.94 ? 32   GLY C CA  1 
ATOM   4502  C  C   . GLY C  1 40  ? 34.667   97.005  39.839  1.00 31.03 ? 32   GLY C C   1 
ATOM   4503  O  O   . GLY C  1 40  ? 34.059   98.000  39.507  1.00 30.58 ? 32   GLY C O   1 
ATOM   4504  N  N   . THR C  1 41  ? 34.784   95.955  39.046  1.00 30.18 ? 33   THR C N   1 
ATOM   4505  C  CA  . THR C  1 41  ? 34.113   95.930  37.756  1.00 29.96 ? 33   THR C CA  1 
ATOM   4506  C  C   . THR C  1 41  ? 32.988   94.917  37.838  1.00 29.94 ? 33   THR C C   1 
ATOM   4507  O  O   . THR C  1 41  ? 32.890   94.164  38.805  1.00 28.37 ? 33   THR C O   1 
ATOM   4508  C  CB  . THR C  1 41  ? 35.053   95.598  36.649  1.00 30.60 ? 33   THR C CB  1 
ATOM   4509  O  OG1 . THR C  1 41  ? 35.498   94.248  36.814  1.00 31.20 ? 33   THR C OG1 1 
ATOM   4510  C  CG2 . THR C  1 41  ? 36.279   96.542  36.688  1.00 29.15 ? 33   THR C CG2 1 
ATOM   4511  N  N   . VAL C  1 42  ? 32.071   94.981  36.886  1.00 29.78 ? 34   VAL C N   1 
ATOM   4512  C  CA  . VAL C  1 42  ? 30.958   94.047  36.859  1.00 29.02 ? 34   VAL C CA  1 
ATOM   4513  C  C   . VAL C  1 42  ? 31.126   93.075  35.678  1.00 29.39 ? 34   VAL C C   1 
ATOM   4514  O  O   . VAL C  1 42  ? 31.620   93.452  34.623  1.00 29.14 ? 34   VAL C O   1 
ATOM   4515  C  CB  . VAL C  1 42  ? 29.577   94.768  36.757  1.00 28.82 ? 34   VAL C CB  1 
ATOM   4516  C  CG1 . VAL C  1 42  ? 29.201   95.476  38.082  1.00 27.41 ? 34   VAL C CG1 1 
ATOM   4517  C  CG2 . VAL C  1 42  ? 29.521   95.670  35.522  1.00 26.22 ? 34   VAL C CG2 1 
ATOM   4518  N  N   . ARG C  1 43  ? 30.690   91.843  35.888  1.00 29.99 ? 35   ARG C N   1 
ATOM   4519  C  CA  . ARG C  1 43  ? 30.617   90.788  34.868  1.00 30.82 ? 35   ARG C CA  1 
ATOM   4520  C  C   . ARG C  1 43  ? 29.270   90.117  34.916  1.00 29.38 ? 35   ARG C C   1 
ATOM   4521  O  O   . ARG C  1 43  ? 28.727   89.876  36.010  1.00 29.21 ? 35   ARG C O   1 
ATOM   4522  C  CB  . ARG C  1 43  ? 31.635   89.682  35.130  1.00 31.48 ? 35   ARG C CB  1 
ATOM   4523  C  CG  . ARG C  1 43  ? 33.084   90.100  34.971  1.00 35.53 ? 35   ARG C CG  1 
ATOM   4524  C  CD  . ARG C  1 43  ? 34.074   88.974  35.379  1.00 39.05 ? 35   ARG C CD  1 
ATOM   4525  N  NE  . ARG C  1 43  ? 34.091   87.905  34.371  1.00 43.24 ? 35   ARG C NE  1 
ATOM   4526  C  CZ  . ARG C  1 43  ? 34.715   86.729  34.490  1.00 43.08 ? 35   ARG C CZ  1 
ATOM   4527  N  NH1 . ARG C  1 43  ? 35.396   86.450  35.586  1.00 41.24 ? 35   ARG C NH1 1 
ATOM   4528  N  NH2 . ARG C  1 43  ? 34.652   85.833  33.494  1.00 41.47 ? 35   ARG C NH2 1 
ATOM   4529  N  N   . VAL C  1 44  ? 28.756   89.786  33.734  1.00 28.16 ? 36   VAL C N   1 
ATOM   4530  C  CA  . VAL C  1 44  ? 27.576   88.988  33.614  1.00 27.50 ? 36   VAL C CA  1 
ATOM   4531  C  C   . VAL C  1 44  ? 27.988   87.523  33.386  1.00 27.97 ? 36   VAL C C   1 
ATOM   4532  O  O   . VAL C  1 44  ? 28.412   87.142  32.308  1.00 29.37 ? 36   VAL C O   1 
ATOM   4533  C  CB  . VAL C  1 44  ? 26.619   89.497  32.516  1.00 27.57 ? 36   VAL C CB  1 
ATOM   4534  C  CG1 . VAL C  1 44  ? 25.390   88.609  32.503  1.00 26.08 ? 36   VAL C CG1 1 
ATOM   4535  C  CG2 . VAL C  1 44  ? 26.183   90.966  32.767  1.00 26.00 ? 36   VAL C CG2 1 
ATOM   4536  N  N   . ILE C  1 45  ? 27.868   86.700  34.416  1.00 27.84 ? 37   ILE C N   1 
ATOM   4537  C  CA  . ILE C  1 45  ? 28.259   85.307  34.337  1.00 27.63 ? 37   ILE C CA  1 
ATOM   4538  C  C   . ILE C  1 45  ? 27.300   84.436  35.201  1.00 27.74 ? 37   ILE C C   1 
ATOM   4539  O  O   . ILE C  1 45  ? 26.717   84.930  36.178  1.00 27.15 ? 37   ILE C O   1 
ATOM   4540  C  CB  . ILE C  1 45  ? 29.718   85.089  34.806  1.00 27.66 ? 37   ILE C CB  1 
ATOM   4541  C  CG1 . ILE C  1 45  ? 29.967   85.757  36.165  1.00 27.74 ? 37   ILE C CG1 1 
ATOM   4542  C  CG2 . ILE C  1 45  ? 30.731   85.557  33.736  1.00 27.24 ? 37   ILE C CG2 1 
ATOM   4543  C  CD1 . ILE C  1 45  ? 31.412   85.544  36.749  1.00 27.32 ? 37   ILE C CD1 1 
ATOM   4544  N  N   . PRO C  1 46  ? 27.151   83.132  34.843  1.00 27.25 ? 38   PRO C N   1 
ATOM   4545  C  CA  . PRO C  1 46  ? 26.401   82.186  35.659  1.00 26.92 ? 38   PRO C CA  1 
ATOM   4546  C  C   . PRO C  1 46  ? 26.947   82.027  37.090  1.00 26.45 ? 38   PRO C C   1 
ATOM   4547  O  O   . PRO C  1 46  ? 28.133   82.218  37.343  1.00 25.24 ? 38   PRO C O   1 
ATOM   4548  C  CB  . PRO C  1 46  ? 26.513   80.866  34.892  1.00 26.25 ? 38   PRO C CB  1 
ATOM   4549  C  CG  . PRO C  1 46  ? 26.862   81.234  33.540  1.00 27.61 ? 38   PRO C CG  1 
ATOM   4550  C  CD  . PRO C  1 46  ? 27.703   82.476  33.648  1.00 27.56 ? 38   PRO C CD  1 
ATOM   4551  N  N   . VAL C  1 47  ? 26.038   81.712  38.002  1.00 25.98 ? 39   VAL C N   1 
ATOM   4552  C  CA  . VAL C  1 47  ? 26.351   81.695  39.404  1.00 26.32 ? 39   VAL C CA  1 
ATOM   4553  C  C   . VAL C  1 47  ? 25.835   80.346  39.926  1.00 25.98 ? 39   VAL C C   1 
ATOM   4554  O  O   . VAL C  1 47  ? 26.142   79.296  39.341  1.00 25.94 ? 39   VAL C O   1 
ATOM   4555  C  CB  . VAL C  1 47  ? 25.809   82.962  40.154  1.00 27.22 ? 39   VAL C CB  1 
ATOM   4556  C  CG1 . VAL C  1 47  ? 26.351   83.055  41.634  1.00 27.48 ? 39   VAL C CG1 1 
ATOM   4557  C  CG2 . VAL C  1 47  ? 26.146   84.238  39.366  1.00 26.74 ? 39   VAL C CG2 1 
ATOM   4558  N  N   . LEU C  1 48  ? 25.061   80.337  40.983  1.00 24.75 ? 40   LEU C N   1 
ATOM   4559  C  CA  . LEU C  1 48  ? 24.898   79.094  41.693  1.00 24.64 ? 40   LEU C CA  1 
ATOM   4560  C  C   . LEU C  1 48  ? 23.542   78.444  41.372  1.00 23.79 ? 40   LEU C C   1 
ATOM   4561  O  O   . LEU C  1 48  ? 22.797   78.958  40.571  1.00 22.97 ? 40   LEU C O   1 
ATOM   4562  C  CB  . LEU C  1 48  ? 25.161   79.308  43.218  1.00 24.82 ? 40   LEU C CB  1 
ATOM   4563  C  CG  . LEU C  1 48  ? 24.518   80.492  43.917  1.00 25.94 ? 40   LEU C CG  1 
ATOM   4564  C  CD1 . LEU C  1 48  ? 23.012   80.219  43.949  1.00 24.81 ? 40   LEU C CD1 1 
ATOM   4565  C  CD2 . LEU C  1 48  ? 25.098   80.695  45.316  1.00 23.42 ? 40   LEU C CD2 1 
ATOM   4566  N  N   . GLY C  1 49  ? 23.254   77.299  41.992  1.00 22.69 ? 41   GLY C N   1 
ATOM   4567  C  CA  . GLY C  1 49  ? 21.996   76.599  41.805  1.00 21.69 ? 41   GLY C CA  1 
ATOM   4568  C  C   . GLY C  1 49  ? 21.946   75.729  40.574  1.00 20.94 ? 41   GLY C C   1 
ATOM   4569  O  O   . GLY C  1 49  ? 22.935   75.551  39.902  1.00 19.99 ? 41   GLY C O   1 
ATOM   4570  N  N   . GLY C  1 50  ? 20.773   75.176  40.295  1.00 20.82 ? 42   GLY C N   1 
ATOM   4571  C  CA  . GLY C  1 50  ? 20.547   74.446  39.074  1.00 20.72 ? 42   GLY C CA  1 
ATOM   4572  C  C   . GLY C  1 50  ? 21.114   73.039  38.996  1.00 21.07 ? 42   GLY C C   1 
ATOM   4573  O  O   . GLY C  1 50  ? 21.685   72.499  39.938  1.00 20.56 ? 42   GLY C O   1 
ATOM   4574  N  N   . ILE C  1 51  ? 20.864   72.438  37.848  1.00 21.23 ? 43   ILE C N   1 
ATOM   4575  C  CA  . ILE C  1 51  ? 21.626   71.336  37.322  1.00 21.48 ? 43   ILE C CA  1 
ATOM   4576  C  C   . ILE C  1 51  ? 22.712   71.982  36.446  1.00 21.25 ? 43   ILE C C   1 
ATOM   4577  O  O   . ILE C  1 51  ? 22.399   72.637  35.453  1.00 20.91 ? 43   ILE C O   1 
ATOM   4578  C  CB  . ILE C  1 51  ? 20.708   70.409  36.458  1.00 21.56 ? 43   ILE C CB  1 
ATOM   4579  C  CG1 . ILE C  1 51  ? 19.509   69.917  37.280  1.00 21.38 ? 43   ILE C CG1 1 
ATOM   4580  C  CG2 . ILE C  1 51  ? 21.508   69.231  35.855  1.00 19.91 ? 43   ILE C CG2 1 
ATOM   4581  C  CD1 . ILE C  1 51  ? 18.146   69.956  36.553  1.00 20.24 ? 43   ILE C CD1 1 
ATOM   4582  N  N   . THR C  1 52  ? 23.970   71.847  36.832  1.00 21.27 ? 44   THR C N   1 
ATOM   4583  C  CA  . THR C  1 52  ? 25.085   72.369  36.029  1.00 21.28 ? 44   THR C CA  1 
ATOM   4584  C  C   . THR C  1 52  ? 25.619   71.227  35.160  1.00 22.07 ? 44   THR C C   1 
ATOM   4585  O  O   . THR C  1 52  ? 26.105   70.225  35.675  1.00 22.06 ? 44   THR C O   1 
ATOM   4586  C  CB  . THR C  1 52  ? 26.121   72.963  36.941  1.00 20.52 ? 44   THR C CB  1 
ATOM   4587  O  OG1 . THR C  1 52  ? 25.489   74.005  37.688  1.00 22.07 ? 44   THR C OG1 1 
ATOM   4588  C  CG2 . THR C  1 52  ? 27.287   73.558  36.195  1.00 19.44 ? 44   THR C CG2 1 
ATOM   4589  N  N   . TYR C  1 53  ? 25.478   71.363  33.845  1.00 22.66 ? 45   TYR C N   1 
ATOM   4590  C  CA  . TYR C  1 53  ? 25.624   70.216  32.961  1.00 23.15 ? 45   TYR C CA  1 
ATOM   4591  C  C   . TYR C  1 53  ? 27.052   69.860  32.696  1.00 22.91 ? 45   TYR C C   1 
ATOM   4592  O  O   . TYR C  1 53  ? 27.331   68.728  32.490  1.00 22.23 ? 45   TYR C O   1 
ATOM   4593  C  CB  . TYR C  1 53  ? 24.858   70.391  31.647  1.00 24.13 ? 45   TYR C CB  1 
ATOM   4594  C  CG  . TYR C  1 53  ? 23.353   70.475  31.840  1.00 24.18 ? 45   TYR C CG  1 
ATOM   4595  C  CD1 . TYR C  1 53  ? 22.600   69.340  31.982  1.00 22.45 ? 45   TYR C CD1 1 
ATOM   4596  C  CD2 . TYR C  1 53  ? 22.696   71.705  31.920  1.00 24.04 ? 45   TYR C CD2 1 
ATOM   4597  C  CE1 . TYR C  1 53  ? 21.219   69.411  32.211  1.00 24.06 ? 45   TYR C CE1 1 
ATOM   4598  C  CE2 . TYR C  1 53  ? 21.294   71.777  32.131  1.00 23.47 ? 45   TYR C CE2 1 
ATOM   4599  C  CZ  . TYR C  1 53  ? 20.576   70.631  32.286  1.00 23.11 ? 45   TYR C CZ  1 
ATOM   4600  O  OH  . TYR C  1 53  ? 19.210   70.664  32.509  1.00 21.24 ? 45   TYR C OH  1 
ATOM   4601  N  N   . ASN C  1 54  ? 27.966   70.816  32.784  1.00 23.38 ? 46   ASN C N   1 
ATOM   4602  C  CA  . ASN C  1 54  ? 29.333   70.581  32.373  1.00 23.18 ? 46   ASN C CA  1 
ATOM   4603  C  C   . ASN C  1 54  ? 30.396   70.901  33.416  1.00 23.87 ? 46   ASN C C   1 
ATOM   4604  O  O   . ASN C  1 54  ? 31.559   71.138  33.071  1.00 25.31 ? 46   ASN C O   1 
ATOM   4605  C  CB  . ASN C  1 54  ? 29.603   71.366  31.116  1.00 23.20 ? 46   ASN C CB  1 
ATOM   4606  C  CG  . ASN C  1 54  ? 29.559   72.868  31.343  1.00 24.59 ? 46   ASN C CG  1 
ATOM   4607  O  OD1 . ASN C  1 54  ? 28.760   73.358  32.122  1.00 21.22 ? 46   ASN C OD1 1 
ATOM   4608  N  ND2 . ASN C  1 54  ? 30.401   73.596  30.639  1.00 21.49 ? 46   ASN C ND2 1 
ATOM   4609  N  N   . VAL C  1 55  ? 30.021   70.921  34.689  1.00 23.28 ? 47   VAL C N   1 
ATOM   4610  C  CA  . VAL C  1 55  ? 30.981   71.082  35.776  1.00 22.96 ? 47   VAL C CA  1 
ATOM   4611  C  C   . VAL C  1 55  ? 30.633   70.035  36.803  1.00 23.25 ? 47   VAL C C   1 
ATOM   4612  O  O   . VAL C  1 55  ? 29.488   69.939  37.207  1.00 22.26 ? 47   VAL C O   1 
ATOM   4613  C  CB  . VAL C  1 55  ? 30.941   72.467  36.438  1.00 23.29 ? 47   VAL C CB  1 
ATOM   4614  C  CG1 . VAL C  1 55  ? 32.040   72.561  37.524  1.00 20.56 ? 47   VAL C CG1 1 
ATOM   4615  C  CG2 . VAL C  1 55  ? 31.108   73.582  35.399  1.00 21.84 ? 47   VAL C CG2 1 
ATOM   4616  N  N   . LYS C  1 56  ? 31.612   69.226  37.184  1.00 23.85 ? 48   LYS C N   1 
ATOM   4617  C  CA  . LYS C  1 56  ? 31.349   68.090  38.035  1.00 25.02 ? 48   LYS C CA  1 
ATOM   4618  C  C   . LYS C  1 56  ? 32.468   67.853  39.009  1.00 23.63 ? 48   LYS C C   1 
ATOM   4619  O  O   . LYS C  1 56  ? 33.573   68.444  38.897  1.00 22.61 ? 48   LYS C O   1 
ATOM   4620  C  CB  . LYS C  1 56  ? 31.077   66.846  37.185  1.00 26.94 ? 48   LYS C CB  1 
ATOM   4621  C  CG  . LYS C  1 56  ? 32.236   66.395  36.357  1.00 33.50 ? 48   LYS C CG  1 
ATOM   4622  C  CD  . LYS C  1 56  ? 31.966   65.051  35.537  1.00 40.28 ? 48   LYS C CD  1 
ATOM   4623  C  CE  . LYS C  1 56  ? 33.249   64.608  34.736  1.00 43.45 ? 48   LYS C CE  1 
ATOM   4624  N  NZ  . LYS C  1 56  ? 33.992   65.817  34.035  1.00 45.27 ? 48   LYS C NZ  1 
ATOM   4625  N  N   . VAL C  1 57  ? 32.182   67.035  40.012  1.00 21.94 ? 49   VAL C N   1 
ATOM   4626  C  CA  . VAL C  1 57  ? 33.190   66.757  41.031  1.00 21.35 ? 49   VAL C CA  1 
ATOM   4627  C  C   . VAL C  1 57  ? 34.379   66.134  40.310  1.00 21.41 ? 49   VAL C C   1 
ATOM   4628  O  O   . VAL C  1 57  ? 34.197   65.367  39.408  1.00 21.49 ? 49   VAL C O   1 
ATOM   4629  C  CB  . VAL C  1 57  ? 32.636   65.885  42.201  1.00 20.99 ? 49   VAL C CB  1 
ATOM   4630  C  CG1 . VAL C  1 57  ? 32.236   64.488  41.681  1.00 19.65 ? 49   VAL C CG1 1 
ATOM   4631  C  CG2 . VAL C  1 57  ? 33.641   65.822  43.369  1.00 17.20 ? 49   VAL C CG2 1 
ATOM   4632  N  N   . GLY C  1 58  ? 35.586   66.548  40.637  1.00 21.80 ? 50   GLY C N   1 
ATOM   4633  C  CA  . GLY C  1 58  ? 36.768   66.101  39.913  1.00 22.30 ? 50   GLY C CA  1 
ATOM   4634  C  C   . GLY C  1 58  ? 37.343   67.145  38.966  1.00 23.09 ? 50   GLY C C   1 
ATOM   4635  O  O   . GLY C  1 58  ? 38.534   67.091  38.657  1.00 23.78 ? 50   GLY C O   1 
ATOM   4636  N  N   . ASP C  1 59  ? 36.514   68.071  38.486  1.00 22.66 ? 51   ASP C N   1 
ATOM   4637  C  CA  . ASP C  1 59  ? 36.967   69.131  37.585  1.00 23.20 ? 51   ASP C CA  1 
ATOM   4638  C  C   . ASP C  1 59  ? 37.653   70.183  38.417  1.00 22.97 ? 51   ASP C C   1 
ATOM   4639  O  O   . ASP C  1 59  ? 37.508   70.227  39.647  1.00 22.45 ? 51   ASP C O   1 
ATOM   4640  C  CB  . ASP C  1 59  ? 35.793   69.822  36.834  1.00 23.48 ? 51   ASP C CB  1 
ATOM   4641  C  CG  . ASP C  1 59  ? 35.059   68.917  35.886  1.00 24.22 ? 51   ASP C CG  1 
ATOM   4642  O  OD1 . ASP C  1 59  ? 35.576   67.839  35.516  1.00 29.89 ? 51   ASP C OD1 1 
ATOM   4643  O  OD2 . ASP C  1 59  ? 33.910   69.237  35.518  1.00 25.28 ? 51   ASP C OD2 1 
ATOM   4644  N  N   . SER C  1 60  ? 38.376   71.057  37.739  1.00 22.78 ? 52   SER C N   1 
ATOM   4645  C  CA  . SER C  1 60  ? 39.047   72.149  38.411  1.00 22.24 ? 52   SER C CA  1 
ATOM   4646  C  C   . SER C  1 60  ? 38.010   73.108  39.020  1.00 20.91 ? 52   SER C C   1 
ATOM   4647  O  O   . SER C  1 60  ? 36.970   73.347  38.425  1.00 19.23 ? 52   SER C O   1 
ATOM   4648  C  CB  . SER C  1 60  ? 39.936   72.899  37.412  1.00 21.91 ? 52   SER C CB  1 
ATOM   4649  O  OG  . SER C  1 60  ? 40.542   74.030  38.032  1.00 24.52 ? 52   SER C OG  1 
ATOM   4650  N  N   . ALA C  1 61  ? 38.318   73.647  40.192  1.00 20.81 ? 53   ALA C N   1 
ATOM   4651  C  CA  . ALA C  1 61  ? 37.572   74.755  40.788  1.00 21.37 ? 53   ALA C CA  1 
ATOM   4652  C  C   . ALA C  1 61  ? 37.865   76.094  40.104  1.00 22.39 ? 53   ALA C C   1 
ATOM   4653  O  O   . ALA C  1 61  ? 37.073   77.042  40.284  1.00 22.39 ? 53   ALA C O   1 
ATOM   4654  C  CB  . ALA C  1 61  ? 37.839   74.872  42.265  1.00 20.41 ? 53   ALA C CB  1 
ATOM   4655  N  N   . TYR C  1 62  ? 38.935   76.152  39.301  1.00 22.82 ? 54   TYR C N   1 
ATOM   4656  C  CA  . TYR C  1 62  ? 39.335   77.362  38.595  1.00 24.39 ? 54   TYR C CA  1 
ATOM   4657  C  C   . TYR C  1 62  ? 39.138   77.288  37.106  1.00 25.07 ? 54   TYR C C   1 
ATOM   4658  O  O   . TYR C  1 62  ? 38.885   76.225  36.575  1.00 25.21 ? 54   TYR C O   1 
ATOM   4659  C  CB  . TYR C  1 62  ? 40.783   77.694  38.870  1.00 23.56 ? 54   TYR C CB  1 
ATOM   4660  C  CG  . TYR C  1 62  ? 40.991   78.077  40.284  1.00 25.16 ? 54   TYR C CG  1 
ATOM   4661  C  CD1 . TYR C  1 62  ? 41.319   77.132  41.248  1.00 24.92 ? 54   TYR C CD1 1 
ATOM   4662  C  CD2 . TYR C  1 62  ? 40.879   79.405  40.685  1.00 25.87 ? 54   TYR C CD2 1 
ATOM   4663  C  CE1 . TYR C  1 62  ? 41.534   77.518  42.551  1.00 25.13 ? 54   TYR C CE1 1 
ATOM   4664  C  CE2 . TYR C  1 62  ? 41.074   79.775  41.985  1.00 23.14 ? 54   TYR C CE2 1 
ATOM   4665  C  CZ  . TYR C  1 62  ? 41.390   78.838  42.901  1.00 25.76 ? 54   TYR C CZ  1 
ATOM   4666  O  OH  . TYR C  1 62  ? 41.536   79.232  44.198  1.00 30.01 ? 54   TYR C OH  1 
ATOM   4667  N  N   . GLY C  1 63  ? 39.245   78.451  36.458  1.00 25.92 ? 55   GLY C N   1 
ATOM   4668  C  CA  . GLY C  1 63  ? 39.121   78.571  35.016  1.00 27.03 ? 55   GLY C CA  1 
ATOM   4669  C  C   . GLY C  1 63  ? 37.717   78.597  34.387  1.00 27.88 ? 55   GLY C C   1 
ATOM   4670  O  O   . GLY C  1 63  ? 37.610   78.539  33.157  1.00 28.82 ? 55   GLY C O   1 
ATOM   4671  N  N   . TRP C  1 64  ? 36.651   78.680  35.182  1.00 26.36 ? 56   TRP C N   1 
ATOM   4672  C  CA  . TRP C  1 64  ? 35.313   78.696  34.604  1.00 25.89 ? 56   TRP C CA  1 
ATOM   4673  C  C   . TRP C  1 64  ? 34.826   80.135  34.547  1.00 25.82 ? 56   TRP C C   1 
ATOM   4674  O  O   . TRP C  1 64  ? 35.134   80.903  35.433  1.00 23.19 ? 56   TRP C O   1 
ATOM   4675  C  CB  . TRP C  1 64  ? 34.336   77.869  35.430  1.00 25.59 ? 56   TRP C CB  1 
ATOM   4676  C  CG  . TRP C  1 64  ? 34.637   76.435  35.499  1.00 25.37 ? 56   TRP C CG  1 
ATOM   4677  C  CD1 . TRP C  1 64  ? 35.247   75.794  36.524  1.00 25.41 ? 56   TRP C CD1 1 
ATOM   4678  C  CD2 . TRP C  1 64  ? 34.389   75.457  34.510  1.00 23.61 ? 56   TRP C CD2 1 
ATOM   4679  N  NE1 . TRP C  1 64  ? 35.372   74.469  36.252  1.00 24.96 ? 56   TRP C NE1 1 
ATOM   4680  C  CE2 . TRP C  1 64  ? 34.860   74.233  35.007  1.00 25.40 ? 56   TRP C CE2 1 
ATOM   4681  C  CE3 . TRP C  1 64  ? 33.843   75.493  33.243  1.00 27.81 ? 56   TRP C CE3 1 
ATOM   4682  C  CZ2 . TRP C  1 64  ? 34.776   73.028  34.282  1.00 27.01 ? 56   TRP C CZ2 1 
ATOM   4683  C  CZ3 . TRP C  1 64  ? 33.760   74.280  32.501  1.00 28.24 ? 56   TRP C CZ3 1 
ATOM   4684  C  CH2 . TRP C  1 64  ? 34.215   73.077  33.041  1.00 26.51 ? 56   TRP C CH2 1 
ATOM   4685  N  N   . ALA C  1 65  ? 34.088   80.503  33.488  1.00 26.28 ? 57   ALA C N   1 
ATOM   4686  C  CA  . ALA C  1 65  ? 33.492   81.837  33.398  1.00 26.69 ? 57   ALA C CA  1 
ATOM   4687  C  C   . ALA C  1 65  ? 32.187   81.837  34.242  1.00 27.10 ? 57   ALA C C   1 
ATOM   4688  O  O   . ALA C  1 65  ? 31.086   81.782  33.732  1.00 27.08 ? 57   ALA C O   1 
ATOM   4689  C  CB  . ALA C  1 65  ? 33.251   82.229  31.942  1.00 26.83 ? 57   ALA C CB  1 
ATOM   4690  N  N   . GLY C  1 66  ? 32.352   81.890  35.558  1.00 27.92 ? 58   GLY C N   1 
ATOM   4691  C  CA  . GLY C  1 66  ? 31.266   81.665  36.495  1.00 27.89 ? 58   GLY C CA  1 
ATOM   4692  C  C   . GLY C  1 66  ? 31.699   82.047  37.876  1.00 28.27 ? 58   GLY C C   1 
ATOM   4693  O  O   . GLY C  1 66  ? 32.861   82.266  38.128  1.00 28.02 ? 58   GLY C O   1 
ATOM   4694  N  N   . ASP C  1 67  ? 30.739   82.198  38.760  1.00 29.14 ? 59   ASP C N   1 
ATOM   4695  C  CA  . ASP C  1 67  ? 31.036   82.581  40.111  1.00 29.78 ? 59   ASP C CA  1 
ATOM   4696  C  C   . ASP C  1 67  ? 30.273   81.620  40.992  1.00 28.46 ? 59   ASP C C   1 
ATOM   4697  O  O   . ASP C  1 67  ? 29.114   81.339  40.763  1.00 27.11 ? 59   ASP C O   1 
ATOM   4698  C  CB  . ASP C  1 67  ? 30.609   84.029  40.355  1.00 31.26 ? 59   ASP C CB  1 
ATOM   4699  C  CG  . ASP C  1 67  ? 30.814   84.471  41.814  1.00 36.47 ? 59   ASP C CG  1 
ATOM   4700  O  OD1 . ASP C  1 67  ? 31.987   84.762  42.125  1.00 41.93 ? 59   ASP C OD1 1 
ATOM   4701  O  OD2 . ASP C  1 67  ? 29.826   84.496  42.645  1.00 42.37 ? 59   ASP C OD2 1 
ATOM   4702  N  N   . HIS C  1 68  ? 30.935   81.107  42.013  1.00 28.54 ? 60   HIS C N   1 
ATOM   4703  C  CA  . HIS C  1 68  ? 30.300   80.195  42.970  1.00 29.07 ? 60   HIS C CA  1 
ATOM   4704  C  C   . HIS C  1 68  ? 29.639   79.006  42.242  1.00 26.90 ? 60   HIS C C   1 
ATOM   4705  O  O   . HIS C  1 68  ? 28.573   78.537  42.641  1.00 25.83 ? 60   HIS C O   1 
ATOM   4706  C  CB  . HIS C  1 68  ? 29.237   80.928  43.819  1.00 30.30 ? 60   HIS C CB  1 
ATOM   4707  C  CG  . HIS C  1 68  ? 29.785   81.827  44.882  1.00 36.04 ? 60   HIS C CG  1 
ATOM   4708  N  ND1 . HIS C  1 68  ? 29.999   83.184  44.680  1.00 39.37 ? 60   HIS C ND1 1 
ATOM   4709  C  CD2 . HIS C  1 68  ? 30.106   81.572  46.183  1.00 40.83 ? 60   HIS C CD2 1 
ATOM   4710  C  CE1 . HIS C  1 68  ? 30.456   83.713  45.810  1.00 43.59 ? 60   HIS C CE1 1 
ATOM   4711  N  NE2 . HIS C  1 68  ? 30.545   82.757  46.730  1.00 43.97 ? 60   HIS C NE2 1 
ATOM   4712  N  N   . VAL C  1 69  ? 30.247   78.516  41.164  1.00 24.93 ? 61   VAL C N   1 
ATOM   4713  C  CA  . VAL C  1 69  ? 29.563   77.467  40.427  1.00 23.47 ? 61   VAL C CA  1 
ATOM   4714  C  C   . VAL C  1 69  ? 29.519   76.173  41.267  1.00 22.31 ? 61   VAL C C   1 
ATOM   4715  O  O   . VAL C  1 69  ? 30.516   75.772  41.833  1.00 20.48 ? 61   VAL C O   1 
ATOM   4716  C  CB  . VAL C  1 69  ? 30.160   77.227  39.047  1.00 23.94 ? 61   VAL C CB  1 
ATOM   4717  C  CG1 . VAL C  1 69  ? 29.399   76.070  38.315  1.00 20.60 ? 61   VAL C CG1 1 
ATOM   4718  C  CG2 . VAL C  1 69  ? 30.153   78.564  38.241  1.00 23.89 ? 61   VAL C CG2 1 
ATOM   4719  N  N   . GLU C  1 70  ? 28.345   75.559  41.338  1.00 20.92 ? 62   GLU C N   1 
ATOM   4720  C  CA  . GLU C  1 70  ? 28.115   74.377  42.092  1.00 20.33 ? 62   GLU C CA  1 
ATOM   4721  C  C   . GLU C  1 70  ? 28.080   73.213  41.144  1.00 20.67 ? 62   GLU C C   1 
ATOM   4722  O  O   . GLU C  1 70  ? 27.187   73.156  40.304  1.00 21.66 ? 62   GLU C O   1 
ATOM   4723  C  CB  . GLU C  1 70  ? 26.774   74.501  42.829  1.00 20.34 ? 62   GLU C CB  1 
ATOM   4724  C  CG  . GLU C  1 70  ? 26.770   75.613  43.935  1.00 19.96 ? 62   GLU C CG  1 
ATOM   4725  C  CD  . GLU C  1 70  ? 25.454   75.825  44.658  1.00 19.55 ? 62   GLU C CD  1 
ATOM   4726  O  OE1 . GLU C  1 70  ? 24.349   75.583  44.113  1.00 18.79 ? 62   GLU C OE1 1 
ATOM   4727  O  OE2 . GLU C  1 70  ? 25.515   76.268  45.814  1.00 21.49 ? 62   GLU C OE2 1 
ATOM   4728  N  N   . PRO C  1 71  ? 29.016   72.257  41.263  1.00 20.11 ? 63   PRO C N   1 
ATOM   4729  C  CA  . PRO C  1 71  ? 29.017   71.091  40.368  1.00 20.76 ? 63   PRO C CA  1 
ATOM   4730  C  C   . PRO C  1 71  ? 27.759   70.247  40.512  1.00 20.42 ? 63   PRO C C   1 
ATOM   4731  O  O   . PRO C  1 71  ? 27.204   70.150  41.579  1.00 19.44 ? 63   PRO C O   1 
ATOM   4732  C  CB  . PRO C  1 71  ? 30.170   70.231  40.887  1.00 20.70 ? 63   PRO C CB  1 
ATOM   4733  C  CG  . PRO C  1 71  ? 30.329   70.654  42.263  1.00 21.17 ? 63   PRO C CG  1 
ATOM   4734  C  CD  . PRO C  1 71  ? 30.040   72.127  42.291  1.00 19.98 ? 63   PRO C CD  1 
ATOM   4735  N  N   . GLY C  1 72  ? 27.348   69.612  39.440  1.00 20.15 ? 64   GLY C N   1 
ATOM   4736  C  CA  . GLY C  1 72  ? 26.237   68.673  39.495  1.00 20.44 ? 64   GLY C CA  1 
ATOM   4737  C  C   . GLY C  1 72  ? 24.901   69.334  39.789  1.00 19.96 ? 64   GLY C C   1 
ATOM   4738  O  O   . GLY C  1 72  ? 24.582   70.374  39.253  1.00 18.68 ? 64   GLY C O   1 
ATOM   4739  N  N   . VAL C  1 73  ? 24.156   68.712  40.692  1.00 19.78 ? 65   VAL C N   1 
ATOM   4740  C  CA  . VAL C  1 73  ? 22.808   69.084  40.972  1.00 19.52 ? 65   VAL C CA  1 
ATOM   4741  C  C   . VAL C  1 73  ? 22.725   69.774  42.317  1.00 19.91 ? 65   VAL C C   1 
ATOM   4742  O  O   . VAL C  1 73  ? 23.115   69.192  43.332  1.00 19.87 ? 65   VAL C O   1 
ATOM   4743  C  CB  . VAL C  1 73  ? 21.942   67.840  40.952  1.00 19.50 ? 65   VAL C CB  1 
ATOM   4744  C  CG1 . VAL C  1 73  ? 20.518   68.183  41.434  1.00 17.70 ? 65   VAL C CG1 1 
ATOM   4745  C  CG2 . VAL C  1 73  ? 22.010   67.225  39.540  1.00 16.72 ? 65   VAL C CG2 1 
ATOM   4746  N  N   . SER C  1 74  ? 22.245   71.019  42.327  1.00 19.48 ? 66   SER C N   1 
ATOM   4747  C  CA  . SER C  1 74  ? 22.013   71.733  43.567  1.00 19.13 ? 66   SER C CA  1 
ATOM   4748  C  C   . SER C  1 74  ? 20.636   71.426  44.160  1.00 19.99 ? 66   SER C C   1 
ATOM   4749  O  O   . SER C  1 74  ? 19.628   71.399  43.447  1.00 20.04 ? 66   SER C O   1 
ATOM   4750  C  CB  . SER C  1 74  ? 22.141   73.209  43.314  1.00 19.45 ? 66   SER C CB  1 
ATOM   4751  O  OG  . SER C  1 74  ? 23.451   73.524  42.872  1.00 18.43 ? 66   SER C OG  1 
ATOM   4752  N  N   . VAL C  1 75  ? 20.609   71.134  45.466  1.00 20.48 ? 67   VAL C N   1 
ATOM   4753  C  CA  . VAL C  1 75  ? 19.400   70.735  46.161  1.00 19.90 ? 67   VAL C CA  1 
ATOM   4754  C  C   . VAL C  1 75  ? 19.072   71.718  47.249  1.00 20.52 ? 67   VAL C C   1 
ATOM   4755  O  O   . VAL C  1 75  ? 19.910   72.012  48.077  1.00 19.78 ? 67   VAL C O   1 
ATOM   4756  C  CB  . VAL C  1 75  ? 19.538   69.342  46.739  1.00 20.30 ? 67   VAL C CB  1 
ATOM   4757  C  CG1 . VAL C  1 75  ? 18.264   68.948  47.484  1.00 17.48 ? 67   VAL C CG1 1 
ATOM   4758  C  CG2 . VAL C  1 75  ? 19.835   68.345  45.598  1.00 18.08 ? 67   VAL C CG2 1 
ATOM   4759  N  N   . MET C  1 76  ? 17.856   72.278  47.209  1.00 20.75 ? 68   MET C N   1 
ATOM   4760  C  CA  . MET C  1 76  ? 17.467   73.247  48.178  1.00 20.90 ? 68   MET C CA  1 
ATOM   4761  C  C   . MET C  1 76  ? 16.332   72.669  49.000  1.00 20.72 ? 68   MET C C   1 
ATOM   4762  O  O   . MET C  1 76  ? 15.782   71.616  48.656  1.00 19.17 ? 68   MET C O   1 
ATOM   4763  C  CB  . MET C  1 76  ? 17.122   74.596  47.515  1.00 21.25 ? 68   MET C CB  1 
ATOM   4764  C  CG  . MET C  1 76  ? 15.804   74.682  46.809  1.00 24.67 ? 68   MET C CG  1 
ATOM   4765  S  SD  . MET C  1 76  ? 15.385   76.263  46.034  1.00 24.40 ? 68   MET C SD  1 
ATOM   4766  C  CE  . MET C  1 76  ? 14.873   77.172  47.512  1.00 36.39 ? 68   MET C CE  1 
ATOM   4767  N  N   . ALA C  1 77  ? 16.027   73.340  50.110  1.00 19.86 ? 69   ALA C N   1 
ATOM   4768  C  CA  . ALA C  1 77  ? 14.885   72.971  50.944  1.00 20.98 ? 69   ALA C CA  1 
ATOM   4769  C  C   . ALA C  1 77  ? 13.561   73.313  50.264  1.00 21.89 ? 69   ALA C C   1 
ATOM   4770  O  O   . ALA C  1 77  ? 13.481   74.259  49.497  1.00 22.06 ? 69   ALA C O   1 
ATOM   4771  C  CB  . ALA C  1 77  ? 14.962   73.671  52.305  1.00 19.86 ? 69   ALA C CB  1 
ATOM   4772  N  N   . ARG C  1 78  ? 12.509   72.580  50.625  1.00 23.40 ? 70   ARG C N   1 
ATOM   4773  C  CA  . ARG C  1 78  ? 11.131   72.922  50.258  1.00 24.25 ? 70   ARG C CA  1 
ATOM   4774  C  C   . ARG C  1 78  ? 10.680   74.259  50.827  1.00 24.36 ? 70   ARG C C   1 
ATOM   4775  O  O   . ARG C  1 78  ? 9.841    74.902  50.274  1.00 23.16 ? 70   ARG C O   1 
ATOM   4776  C  CB  . ARG C  1 78  ? 10.158   71.842  50.753  1.00 24.43 ? 70   ARG C CB  1 
ATOM   4777  C  CG  . ARG C  1 78  ? 10.466   70.452  50.220  1.00 25.39 ? 70   ARG C CG  1 
ATOM   4778  C  CD  . ARG C  1 78  ? 9.405    69.396  50.529  1.00 23.88 ? 70   ARG C CD  1 
ATOM   4779  N  NE  . ARG C  1 78  ? 9.216    69.212  51.956  1.00 26.00 ? 70   ARG C NE  1 
ATOM   4780  C  CZ  . ARG C  1 78  ? 8.303    68.433  52.537  1.00 26.99 ? 70   ARG C CZ  1 
ATOM   4781  N  NH1 . ARG C  1 78  ? 7.472    67.694  51.843  1.00 28.49 ? 70   ARG C NH1 1 
ATOM   4782  N  NH2 . ARG C  1 78  ? 8.208    68.400  53.841  1.00 28.73 ? 70   ARG C NH2 1 
ATOM   4783  N  N   . ARG C  1 79  ? 11.222   74.644  51.960  1.00 25.27 ? 71   ARG C N   1 
ATOM   4784  C  CA  . ARG C  1 79  ? 10.781   75.849  52.655  1.00 26.94 ? 71   ARG C CA  1 
ATOM   4785  C  C   . ARG C  1 79  ? 11.819   76.133  53.734  1.00 27.03 ? 71   ARG C C   1 
ATOM   4786  O  O   . ARG C  1 79  ? 12.608   75.251  54.079  1.00 25.48 ? 71   ARG C O   1 
ATOM   4787  C  CB  . ARG C  1 79  ? 9.418    75.622  53.355  1.00 27.67 ? 71   ARG C CB  1 
ATOM   4788  C  CG  . ARG C  1 79  ? 9.375    74.379  54.323  1.00 31.00 ? 71   ARG C CG  1 
ATOM   4789  C  CD  . ARG C  1 79  ? 8.044    74.295  55.084  1.00 35.76 ? 71   ARG C CD  1 
ATOM   4790  N  NE  . ARG C  1 79  ? 6.953    74.223  54.135  1.00 37.70 ? 71   ARG C NE  1 
ATOM   4791  C  CZ  . ARG C  1 79  ? 6.626    73.136  53.445  1.00 41.36 ? 71   ARG C CZ  1 
ATOM   4792  N  NH1 . ARG C  1 79  ? 5.637    73.199  52.569  1.00 42.31 ? 71   ARG C NH1 1 
ATOM   4793  N  NH2 . ARG C  1 79  ? 7.281    71.988  53.595  1.00 42.02 ? 71   ARG C NH2 1 
ATOM   4794  N  N   . LYS C  1 80  ? 11.762   77.331  54.290  1.00 27.14 ? 72   LYS C N   1 
ATOM   4795  C  CA  . LYS C  1 80  ? 12.781   77.814  55.157  1.00 29.31 ? 72   LYS C CA  1 
ATOM   4796  C  C   . LYS C  1 80  ? 13.009   77.013  56.427  1.00 28.74 ? 72   LYS C C   1 
ATOM   4797  O  O   . LYS C  1 80  ? 14.107   76.825  56.857  1.00 27.29 ? 72   LYS C O   1 
ATOM   4798  C  CB  . LYS C  1 80  ? 12.491   79.239  55.507  1.00 30.91 ? 72   LYS C CB  1 
ATOM   4799  C  CG  . LYS C  1 80  ? 13.699   79.924  56.105  1.00 37.02 ? 72   LYS C CG  1 
ATOM   4800  C  CD  . LYS C  1 80  ? 13.282   81.163  56.838  1.00 46.08 ? 72   LYS C CD  1 
ATOM   4801  C  CE  . LYS C  1 80  ? 14.469   81.769  57.603  1.00 50.80 ? 72   LYS C CE  1 
ATOM   4802  N  NZ  . LYS C  1 80  ? 15.272   82.711  56.740  1.00 52.57 ? 72   LYS C NZ  1 
ATOM   4803  N  N   . GLU C  1 81  ? 11.948   76.534  57.007  1.00 29.12 ? 73   GLU C N   1 
ATOM   4804  C  CA  . GLU C  1 81  ? 12.005   75.780  58.222  1.00 30.58 ? 73   GLU C CA  1 
ATOM   4805  C  C   . GLU C  1 81  ? 12.837   74.511  57.983  1.00 29.06 ? 73   GLU C C   1 
ATOM   4806  O  O   . GLU C  1 81  ? 13.361   73.947  58.917  1.00 28.38 ? 73   GLU C O   1 
ATOM   4807  C  CB  . GLU C  1 81  ? 10.591   75.343  58.643  1.00 32.08 ? 73   GLU C CB  1 
ATOM   4808  C  CG  . GLU C  1 81  ? 9.525    76.488  58.884  1.00 40.08 ? 73   GLU C CG  1 
ATOM   4809  C  CD  . GLU C  1 81  ? 9.253    77.488  57.660  1.00 46.69 ? 73   GLU C CD  1 
ATOM   4810  O  OE1 . GLU C  1 81  ? 9.566    78.698  57.865  1.00 49.70 ? 73   GLU C OE1 1 
ATOM   4811  O  OE2 . GLU C  1 81  ? 8.781    77.108  56.547  1.00 47.15 ? 73   GLU C OE2 1 
ATOM   4812  N  N   . GLU C  1 82  ? 12.921   74.045  56.739  1.00 26.22 ? 74   GLU C N   1 
ATOM   4813  C  CA  . GLU C  1 82  ? 13.607   72.811  56.470  1.00 24.48 ? 74   GLU C CA  1 
ATOM   4814  C  C   . GLU C  1 82  ? 15.075   72.957  56.091  1.00 23.88 ? 74   GLU C C   1 
ATOM   4815  O  O   . GLU C  1 82  ? 15.715   71.962  55.781  1.00 22.70 ? 74   GLU C O   1 
ATOM   4816  C  CB  . GLU C  1 82  ? 12.840   72.042  55.404  1.00 24.00 ? 74   GLU C CB  1 
ATOM   4817  C  CG  . GLU C  1 82  ? 11.681   71.409  55.973  1.00 23.24 ? 74   GLU C CG  1 
ATOM   4818  C  CD  . GLU C  1 82  ? 10.691   70.859  54.970  1.00 25.70 ? 74   GLU C CD  1 
ATOM   4819  O  OE1 . GLU C  1 82  ? 11.061   70.287  53.943  1.00 24.90 ? 74   GLU C OE1 1 
ATOM   4820  O  OE2 . GLU C  1 82  ? 9.484    70.915  55.222  1.00 25.11 ? 74   GLU C OE2 1 
ATOM   4821  N  N   . GLU C  1 83  ? 15.605   74.174  56.116  1.00 22.66 ? 75   GLU C N   1 
ATOM   4822  C  CA  . GLU C  1 83  ? 16.982   74.431  55.695  1.00 22.93 ? 75   GLU C CA  1 
ATOM   4823  C  C   . GLU C  1 83  ? 18.024   73.932  56.697  1.00 21.98 ? 75   GLU C C   1 
ATOM   4824  O  O   . GLU C  1 83  ? 19.011   73.325  56.294  1.00 20.56 ? 75   GLU C O   1 
ATOM   4825  C  CB  . GLU C  1 83  ? 17.227   75.932  55.409  1.00 23.05 ? 75   GLU C CB  1 
ATOM   4826  C  CG  . GLU C  1 83  ? 16.494   76.388  54.183  1.00 27.25 ? 75   GLU C CG  1 
ATOM   4827  C  CD  . GLU C  1 83  ? 16.676   77.873  53.810  1.00 31.04 ? 75   GLU C CD  1 
ATOM   4828  O  OE1 . GLU C  1 83  ? 17.641   78.516  54.279  1.00 30.44 ? 75   GLU C OE1 1 
ATOM   4829  O  OE2 . GLU C  1 83  ? 15.842   78.377  53.025  1.00 32.97 ? 75   GLU C OE2 1 
ATOM   4830  N  N   . ILE C  1 84  ? 17.841   74.239  57.973  1.00 21.11 ? 76   ILE C N   1 
ATOM   4831  C  CA  . ILE C  1 84  ? 18.792   73.765  58.976  1.00 20.89 ? 76   ILE C CA  1 
ATOM   4832  C  C   . ILE C  1 84  ? 19.018   72.245  58.930  1.00 20.90 ? 76   ILE C C   1 
ATOM   4833  O  O   . ILE C  1 84  ? 20.129   71.813  58.873  1.00 20.37 ? 76   ILE C O   1 
ATOM   4834  C  CB  . ILE C  1 84  ? 18.428   74.236  60.364  1.00 20.53 ? 76   ILE C CB  1 
ATOM   4835  C  CG1 . ILE C  1 84  ? 18.623   75.757  60.438  1.00 22.92 ? 76   ILE C CG1 1 
ATOM   4836  C  CG2 . ILE C  1 84  ? 19.315   73.614  61.430  1.00 18.75 ? 76   ILE C CG2 1 
ATOM   4837  C  CD1 . ILE C  1 84  ? 18.263   76.433  61.823  1.00 21.96 ? 76   ILE C CD1 1 
ATOM   4838  N  N   . PRO C  1 85  ? 17.967   71.429  58.919  1.00 21.67 ? 77   PRO C N   1 
ATOM   4839  C  CA  . PRO C  1 85  ? 18.224   69.991  58.889  1.00 21.51 ? 77   PRO C CA  1 
ATOM   4840  C  C   . PRO C  1 85  ? 18.826   69.560  57.567  1.00 20.90 ? 77   PRO C C   1 
ATOM   4841  O  O   . PRO C  1 85  ? 19.650   68.664  57.541  1.00 20.40 ? 77   PRO C O   1 
ATOM   4842  C  CB  . PRO C  1 85  ? 16.818   69.347  59.098  1.00 21.96 ? 77   PRO C CB  1 
ATOM   4843  C  CG  . PRO C  1 85  ? 15.858   70.424  58.720  1.00 23.68 ? 77   PRO C CG  1 
ATOM   4844  C  CD  . PRO C  1 85  ? 16.533   71.733  59.066  1.00 22.59 ? 77   PRO C CD  1 
ATOM   4845  N  N   . LEU C  1 86  ? 18.381   70.142  56.457  1.00 20.46 ? 78   LEU C N   1 
ATOM   4846  C  CA  . LEU C  1 86  ? 18.984   69.807  55.167  1.00 20.05 ? 78   LEU C CA  1 
ATOM   4847  C  C   . LEU C  1 86  ? 20.487   70.021  55.186  1.00 20.16 ? 78   LEU C C   1 
ATOM   4848  O  O   . LEU C  1 86  ? 21.236   69.165  54.713  1.00 18.55 ? 78   LEU C O   1 
ATOM   4849  C  CB  . LEU C  1 86  ? 18.407   70.659  54.025  1.00 20.52 ? 78   LEU C CB  1 
ATOM   4850  C  CG  . LEU C  1 86  ? 19.049   70.572  52.626  1.00 19.34 ? 78   LEU C CG  1 
ATOM   4851  C  CD1 . LEU C  1 86  ? 18.838   69.195  52.082  1.00 15.83 ? 78   LEU C CD1 1 
ATOM   4852  C  CD2 . LEU C  1 86  ? 18.534   71.662  51.684  1.00 16.74 ? 78   LEU C CD2 1 
ATOM   4853  N  N   . MET C  1 87  ? 20.893   71.185  55.685  1.00 19.32 ? 79   MET C N   1 
ATOM   4854  C  CA  . MET C  1 87  ? 22.251   71.593  55.632  1.00 20.44 ? 79   MET C CA  1 
ATOM   4855  C  C   . MET C  1 87  ? 23.102   70.923  56.725  1.00 20.80 ? 79   MET C C   1 
ATOM   4856  O  O   . MET C  1 87  ? 24.329   70.766  56.543  1.00 20.23 ? 79   MET C O   1 
ATOM   4857  C  CB  . MET C  1 87  ? 22.364   73.135  55.781  1.00 20.49 ? 79   MET C CB  1 
ATOM   4858  C  CG  . MET C  1 87  ? 21.835   73.913  54.608  1.00 21.50 ? 79   MET C CG  1 
ATOM   4859  S  SD  . MET C  1 87  ? 22.676   73.495  53.094  1.00 19.81 ? 79   MET C SD  1 
ATOM   4860  C  CE  . MET C  1 87  ? 24.291   74.154  53.464  1.00 20.86 ? 79   MET C CE  1 
ATOM   4861  N  N   . THR C  1 88  ? 22.471   70.591  57.858  1.00 20.16 ? 80   THR C N   1 
ATOM   4862  C  CA  . THR C  1 88  ? 23.186   70.056  58.977  1.00 19.76 ? 80   THR C CA  1 
ATOM   4863  C  C   . THR C  1 88  ? 23.362   68.538  58.834  1.00 20.11 ? 80   THR C C   1 
ATOM   4864  O  O   . THR C  1 88  ? 24.444   68.020  59.078  1.00 20.38 ? 80   THR C O   1 
ATOM   4865  C  CB  . THR C  1 88  ? 22.519   70.387  60.313  1.00 20.36 ? 80   THR C CB  1 
ATOM   4866  O  OG1 . THR C  1 88  ? 22.373   71.794  60.408  1.00 18.79 ? 80   THR C OG1 1 
ATOM   4867  C  CG2 . THR C  1 88  ? 23.364   69.848  61.484  1.00 16.32 ? 80   THR C CG2 1 
ATOM   4868  N  N   . LEU C  1 89  ? 22.340   67.826  58.405  1.00 19.45 ? 81   LEU C N   1 
ATOM   4869  C  CA  . LEU C  1 89  ? 22.393   66.371  58.478  1.00 19.62 ? 81   LEU C CA  1 
ATOM   4870  C  C   . LEU C  1 89  ? 23.016   65.736  57.261  1.00 19.41 ? 81   LEU C C   1 
ATOM   4871  O  O   . LEU C  1 89  ? 23.473   64.590  57.333  1.00 19.03 ? 81   LEU C O   1 
ATOM   4872  C  CB  . LEU C  1 89  ? 21.006   65.784  58.746  1.00 19.66 ? 81   LEU C CB  1 
ATOM   4873  C  CG  . LEU C  1 89  ? 20.313   66.208  60.061  1.00 21.05 ? 81   LEU C CG  1 
ATOM   4874  C  CD1 . LEU C  1 89  ? 18.859   65.671  60.176  1.00 21.26 ? 81   LEU C CD1 1 
ATOM   4875  C  CD2 . LEU C  1 89  ? 21.118   65.733  61.248  1.00 19.78 ? 81   LEU C CD2 1 
ATOM   4876  N  N   . SER C  1 90  ? 23.011   66.454  56.140  1.00 19.27 ? 82   SER C N   1 
ATOM   4877  C  CA  . SER C  1 90  ? 23.510   65.929  54.892  1.00 19.15 ? 82   SER C CA  1 
ATOM   4878  C  C   . SER C  1 90  ? 25.064   65.842  54.974  1.00 19.50 ? 82   SER C C   1 
ATOM   4879  O  O   . SER C  1 90  ? 25.732   66.822  55.311  1.00 19.25 ? 82   SER C O   1 
ATOM   4880  C  CB  . SER C  1 90  ? 23.073   66.815  53.745  1.00 19.16 ? 82   SER C CB  1 
ATOM   4881  O  OG  . SER C  1 90  ? 21.677   66.802  53.571  1.00 18.23 ? 82   SER C OG  1 
ATOM   4882  N  N   . CYS C  1 91  ? 25.611   64.667  54.700  1.00 18.96 ? 83   CYS C N   1 
ATOM   4883  C  CA  . CYS C  1 91  ? 27.068   64.439  54.797  1.00 19.29 ? 83   CYS C CA  1 
ATOM   4884  C  C   . CYS C  1 91  ? 27.625   64.008  53.456  1.00 18.03 ? 83   CYS C C   1 
ATOM   4885  O  O   . CYS C  1 91  ? 26.944   63.328  52.709  1.00 17.89 ? 83   CYS C O   1 
ATOM   4886  C  CB  . CYS C  1 91  ? 27.395   63.364  55.860  1.00 19.63 ? 83   CYS C CB  1 
ATOM   4887  S  SG  . CYS C  1 91  ? 27.103   63.894  57.537  1.00 19.23 ? 83   CYS C SG  1 
ATOM   4888  N  N   . ILE C  1 92  ? 28.858   64.417  53.174  1.00 17.81 ? 84   ILE C N   1 
ATOM   4889  C  CA  . ILE C  1 92  ? 29.530   64.146  51.932  1.00 17.65 ? 84   ILE C CA  1 
ATOM   4890  C  C   . ILE C  1 92  ? 29.625   62.622  51.785  1.00 19.89 ? 84   ILE C C   1 
ATOM   4891  O  O   . ILE C  1 92  ? 30.018   61.906  52.710  1.00 19.10 ? 84   ILE C O   1 
ATOM   4892  C  CB  . ILE C  1 92  ? 30.940   64.790  51.910  1.00 17.97 ? 84   ILE C CB  1 
ATOM   4893  C  CG1 . ILE C  1 92  ? 30.843   66.341  51.933  1.00 18.09 ? 84   ILE C CG1 1 
ATOM   4894  C  CG2 . ILE C  1 92  ? 31.706   64.340  50.700  1.00 13.95 ? 84   ILE C CG2 1 
ATOM   4895  C  CD1 . ILE C  1 92  ? 32.174   67.090  52.089  1.00 19.01 ? 84   ILE C CD1 1 
ATOM   4896  N  N   . GLY C  1 93  ? 29.205   62.112  50.637  1.00 20.55 ? 85   GLY C N   1 
ATOM   4897  C  CA  . GLY C  1 93  ? 29.151   60.678  50.432  1.00 20.99 ? 85   GLY C CA  1 
ATOM   4898  C  C   . GLY C  1 93  ? 27.796   60.007  50.702  1.00 21.41 ? 85   GLY C C   1 
ATOM   4899  O  O   . GLY C  1 93  ? 27.595   58.869  50.345  1.00 21.31 ? 85   GLY C O   1 
ATOM   4900  N  N   . ASN C  1 94  ? 26.869   60.691  51.333  1.00 22.07 ? 86   ASN C N   1 
ATOM   4901  C  CA  . ASN C  1 94  ? 25.561   60.101  51.590  1.00 22.70 ? 86   ASN C CA  1 
ATOM   4902  C  C   . ASN C  1 94  ? 24.838   59.785  50.282  1.00 23.57 ? 86   ASN C C   1 
ATOM   4903  O  O   . ASN C  1 94  ? 24.986   60.489  49.295  1.00 23.72 ? 86   ASN C O   1 
ATOM   4904  C  CB  . ASN C  1 94  ? 24.675   61.032  52.425  1.00 22.58 ? 86   ASN C CB  1 
ATOM   4905  C  CG  . ASN C  1 94  ? 25.029   61.080  53.901  1.00 22.83 ? 86   ASN C CG  1 
ATOM   4906  O  OD1 . ASN C  1 94  ? 24.533   61.971  54.610  1.00 20.16 ? 86   ASN C OD1 1 
ATOM   4907  N  ND2 . ASN C  1 94  ? 25.888   60.152  54.379  1.00 18.78 ? 86   ASN C ND2 1 
ATOM   4908  N  N   . GLU C  1 95  ? 24.020   58.743  50.310  1.00 24.64 ? 87   GLU C N   1 
ATOM   4909  C  CA  . GLU C  1 95  ? 23.229   58.312  49.179  1.00 26.19 ? 87   GLU C CA  1 
ATOM   4910  C  C   . GLU C  1 95  ? 22.077   59.257  48.949  1.00 24.50 ? 87   GLU C C   1 
ATOM   4911  O  O   . GLU C  1 95  ? 21.493   59.749  49.896  1.00 23.90 ? 87   GLU C O   1 
ATOM   4912  C  CB  . GLU C  1 95  ? 22.687   56.924  49.477  1.00 27.77 ? 87   GLU C CB  1 
ATOM   4913  C  CG  . GLU C  1 95  ? 21.895   56.346  48.356  1.00 34.53 ? 87   GLU C CG  1 
ATOM   4914  C  CD  . GLU C  1 95  ? 21.446   54.863  48.600  1.00 42.10 ? 87   GLU C CD  1 
ATOM   4915  O  OE1 . GLU C  1 95  ? 20.865   54.531  49.670  1.00 45.17 ? 87   GLU C OE1 1 
ATOM   4916  O  OE2 . GLU C  1 95  ? 21.680   54.045  47.670  1.00 49.34 ? 87   GLU C OE2 1 
ATOM   4917  N  N   . VAL C  1 96  ? 21.793   59.528  47.692  1.00 23.35 ? 88   VAL C N   1 
ATOM   4918  C  CA  . VAL C  1 96  ? 20.732   60.417  47.289  1.00 23.09 ? 88   VAL C CA  1 
ATOM   4919  C  C   . VAL C  1 96  ? 19.872   59.713  46.243  1.00 23.90 ? 88   VAL C C   1 
ATOM   4920  O  O   . VAL C  1 96  ? 20.402   59.050  45.345  1.00 23.97 ? 88   VAL C O   1 
ATOM   4921  C  CB  . VAL C  1 96  ? 21.275   61.736  46.670  1.00 22.71 ? 88   VAL C CB  1 
ATOM   4922  C  CG1 . VAL C  1 96  ? 20.132   62.679  46.362  1.00 18.88 ? 88   VAL C CG1 1 
ATOM   4923  C  CG2 . VAL C  1 96  ? 22.281   62.399  47.621  1.00 20.90 ? 88   VAL C CG2 1 
ATOM   4924  N  N   . ILE C  1 97  ? 18.559   59.823  46.375  1.00 24.36 ? 89   ILE C N   1 
ATOM   4925  C  CA  . ILE C  1 97  ? 17.647   59.208  45.434  1.00 25.45 ? 89   ILE C CA  1 
ATOM   4926  C  C   . ILE C  1 97  ? 16.659   60.245  44.910  1.00 25.22 ? 89   ILE C C   1 
ATOM   4927  O  O   . ILE C  1 97  ? 16.096   61.006  45.680  1.00 23.85 ? 89   ILE C O   1 
ATOM   4928  C  CB  . ILE C  1 97  ? 16.846   58.024  46.060  1.00 26.79 ? 89   ILE C CB  1 
ATOM   4929  C  CG1 . ILE C  1 97  ? 17.784   56.982  46.664  1.00 29.55 ? 89   ILE C CG1 1 
ATOM   4930  C  CG2 . ILE C  1 97  ? 16.015   57.310  45.003  1.00 25.95 ? 89   ILE C CG2 1 
ATOM   4931  C  CD1 . ILE C  1 97  ? 17.444   56.663  48.079  1.00 33.36 ? 89   ILE C CD1 1 
ATOM   4932  N  N   . VAL C  1 98  ? 16.478   60.254  43.596  1.00 25.87 ? 90   VAL C N   1 
ATOM   4933  C  CA  . VAL C  1 98  ? 15.537   61.116  42.925  1.00 26.55 ? 90   VAL C CA  1 
ATOM   4934  C  C   . VAL C  1 98  ? 14.163   60.487  43.113  1.00 27.98 ? 90   VAL C C   1 
ATOM   4935  O  O   . VAL C  1 98  ? 13.956   59.308  42.812  1.00 27.55 ? 90   VAL C O   1 
ATOM   4936  C  CB  . VAL C  1 98  ? 15.843   61.227  41.403  1.00 26.96 ? 90   VAL C CB  1 
ATOM   4937  C  CG1 . VAL C  1 98  ? 14.885   62.230  40.737  1.00 25.87 ? 90   VAL C CG1 1 
ATOM   4938  C  CG2 . VAL C  1 98  ? 17.307   61.622  41.170  1.00 24.37 ? 90   VAL C CG2 1 
ATOM   4939  N  N   . MET C  1 99  ? 13.227   61.279  43.610  1.00 28.95 ? 91   MET C N   1 
ATOM   4940  C  CA  . MET C  1 99  ? 11.929   60.748  43.978  1.00 30.62 ? 91   MET C CA  1 
ATOM   4941  C  C   . MET C  1 99  ? 10.708   61.255  43.135  1.00 30.52 ? 91   MET C C   1 
ATOM   4942  O  O   . MET C  1 99  ? 9.596    60.800  43.327  1.00 30.34 ? 91   MET C O   1 
ATOM   4943  C  CB  . MET C  1 99  ? 11.738   60.989  45.460  1.00 31.36 ? 91   MET C CB  1 
ATOM   4944  C  CG  . MET C  1 99  ? 12.732   60.223  46.339  1.00 33.86 ? 91   MET C CG  1 
ATOM   4945  S  SD  . MET C  1 99  ? 12.619   58.399  46.441  1.00 39.11 ? 91   MET C SD  1 
ATOM   4946  C  CE  . MET C  1 99  ? 10.983   58.022  46.950  1.00 32.55 ? 91   MET C CE  1 
ATOM   4947  N  N   . SER C  1 100 ? 10.931   62.141  42.176  1.00 30.44 ? 92   SER C N   1 
ATOM   4948  C  CA  . SER C  1 100 ? 9.918    62.441  41.172  1.00 30.35 ? 92   SER C CA  1 
ATOM   4949  C  C   . SER C  1 100 ? 10.561   62.764  39.824  1.00 31.01 ? 92   SER C C   1 
ATOM   4950  O  O   . SER C  1 100 ? 11.789   62.835  39.724  1.00 31.22 ? 92   SER C O   1 
ATOM   4951  C  CB  . SER C  1 100 ? 9.022    63.584  41.636  1.00 29.52 ? 92   SER C CB  1 
ATOM   4952  O  OG  . SER C  1 100 ? 9.726    64.786  41.701  1.00 28.10 ? 92   SER C OG  1 
ATOM   4953  N  N   . GLY C  1 101 ? 9.729    62.949  38.795  1.00 31.17 ? 93   GLY C N   1 
ATOM   4954  C  CA  . GLY C  1 101 ? 10.183   63.283  37.472  1.00 31.70 ? 93   GLY C CA  1 
ATOM   4955  C  C   . GLY C  1 101 ? 10.762   62.125  36.699  1.00 32.99 ? 93   GLY C C   1 
ATOM   4956  O  O   . GLY C  1 101 ? 10.741   61.001  37.147  1.00 31.70 ? 93   GLY C O   1 
ATOM   4957  N  N   . ASP C  1 102 ? 11.333   62.419  35.540  1.00 34.58 ? 94   ASP C N   1 
ATOM   4958  C  CA  . ASP C  1 102 ? 11.804   61.351  34.653  1.00 36.83 ? 94   ASP C CA  1 
ATOM   4959  C  C   . ASP C  1 102 ? 12.982   60.517  35.114  1.00 36.27 ? 94   ASP C C   1 
ATOM   4960  O  O   . ASP C  1 102 ? 13.217   59.463  34.539  1.00 36.76 ? 94   ASP C O   1 
ATOM   4961  C  CB  . ASP C  1 102 ? 12.157   61.911  33.290  1.00 37.68 ? 94   ASP C CB  1 
ATOM   4962  C  CG  . ASP C  1 102 ? 10.975   62.548  32.620  1.00 42.56 ? 94   ASP C CG  1 
ATOM   4963  O  OD1 . ASP C  1 102 ? 9.830    62.029  32.798  1.00 45.74 ? 94   ASP C OD1 1 
ATOM   4964  O  OD2 . ASP C  1 102 ? 11.202   63.604  31.951  1.00 49.77 ? 94   ASP C OD2 1 
ATOM   4965  N  N   . ALA C  1 103 ? 13.736   60.995  36.097  1.00 35.14 ? 95   ALA C N   1 
ATOM   4966  C  CA  . ALA C  1 103 ? 14.898   60.270  36.599  1.00 34.66 ? 95   ALA C CA  1 
ATOM   4967  C  C   . ALA C  1 103 ? 14.564   59.494  37.856  1.00 34.49 ? 95   ALA C C   1 
ATOM   4968  O  O   . ALA C  1 103 ? 15.439   58.966  38.507  1.00 34.47 ? 95   ALA C O   1 
ATOM   4969  C  CB  . ALA C  1 103 ? 16.032   61.242  36.880  1.00 34.34 ? 95   ALA C CB  1 
ATOM   4970  N  N   . LYS C  1 104 ? 13.288   59.444  38.217  1.00 34.65 ? 96   LYS C N   1 
ATOM   4971  C  CA  . LYS C  1 104 ? 12.862   58.808  39.446  1.00 34.57 ? 96   LYS C CA  1 
ATOM   4972  C  C   . LYS C  1 104 ? 13.548   57.482  39.647  1.00 33.69 ? 96   LYS C C   1 
ATOM   4973  O  O   . LYS C  1 104 ? 13.565   56.655  38.745  1.00 32.55 ? 96   LYS C O   1 
ATOM   4974  C  CB  . LYS C  1 104 ? 11.367   58.580  39.395  1.00 35.42 ? 96   LYS C CB  1 
ATOM   4975  C  CG  . LYS C  1 104 ? 10.756   58.047  40.669  1.00 38.70 ? 96   LYS C CG  1 
ATOM   4976  C  CD  . LYS C  1 104 ? 9.221    58.116  40.560  1.00 43.41 ? 96   LYS C CD  1 
ATOM   4977  C  CE  . LYS C  1 104 ? 8.550    57.728  41.860  1.00 46.29 ? 96   LYS C CE  1 
ATOM   4978  N  NZ  . LYS C  1 104 ? 9.180    56.536  42.404  1.00 49.46 ? 96   LYS C NZ  1 
ATOM   4979  N  N   . GLY C  1 105 ? 14.097   57.276  40.838  1.00 32.82 ? 97   GLY C N   1 
ATOM   4980  C  CA  . GLY C  1 105 ? 14.826   56.055  41.152  1.00 32.10 ? 97   GLY C CA  1 
ATOM   4981  C  C   . GLY C  1 105 ? 16.322   56.165  40.960  1.00 31.49 ? 97   GLY C C   1 
ATOM   4982  O  O   . GLY C  1 105 ? 17.053   55.356  41.475  1.00 30.96 ? 97   GLY C O   1 
ATOM   4983  N  N   . SER C  1 106 ? 16.791   57.161  40.222  1.00 31.58 ? 98   SER C N   1 
ATOM   4984  C  CA  . SER C  1 106 ? 18.228   57.341  40.020  1.00 31.80 ? 98   SER C CA  1 
ATOM   4985  C  C   . SER C  1 106 ? 18.899   57.665  41.353  1.00 31.22 ? 98   SER C C   1 
ATOM   4986  O  O   . SER C  1 106 ? 18.329   58.328  42.213  1.00 29.25 ? 98   SER C O   1 
ATOM   4987  C  CB  . SER C  1 106 ? 18.526   58.454  39.008  1.00 32.03 ? 98   SER C CB  1 
ATOM   4988  O  OG  . SER C  1 106 ? 18.089   58.071  37.721  1.00 34.46 ? 98   SER C OG  1 
ATOM   4989  N  N   . ARG C  1 107 ? 20.116   57.180  41.496  1.00 31.45 ? 99   ARG C N   1 
ATOM   4990  C  CA  . ARG C  1 107 ? 20.874   57.328  42.733  1.00 32.88 ? 99   ARG C CA  1 
ATOM   4991  C  C   . ARG C  1 107 ? 22.168   58.109  42.505  1.00 30.37 ? 99   ARG C C   1 
ATOM   4992  O  O   . ARG C  1 107 ? 22.835   57.923  41.513  1.00 28.93 ? 99   ARG C O   1 
ATOM   4993  C  CB  . ARG C  1 107 ? 21.228   55.944  43.293  1.00 34.04 ? 99   ARG C CB  1 
ATOM   4994  C  CG  . ARG C  1 107 ? 20.051   55.284  43.906  1.00 42.23 ? 99   ARG C CG  1 
ATOM   4995  C  CD  . ARG C  1 107 ? 20.264   53.767  44.161  1.00 53.16 ? 99   ARG C CD  1 
ATOM   4996  N  NE  . ARG C  1 107 ? 18.961   53.155  44.451  1.00 61.08 ? 99   ARG C NE  1 
ATOM   4997  C  CZ  . ARG C  1 107 ? 18.357   53.146  45.641  1.00 65.94 ? 99   ARG C CZ  1 
ATOM   4998  N  NH1 . ARG C  1 107 ? 18.938   53.676  46.713  1.00 68.33 ? 99   ARG C NH1 1 
ATOM   4999  N  NH2 . ARG C  1 107 ? 17.167   52.585  45.761  1.00 67.12 ? 99   ARG C NH2 1 
ATOM   5000  N  N   . GLY C  1 108 ? 22.514   58.948  43.459  1.00 28.55 ? 100  GLY C N   1 
ATOM   5001  C  CA  . GLY C  1 108 ? 23.764   59.668  43.431  1.00 27.21 ? 100  GLY C CA  1 
ATOM   5002  C  C   . GLY C  1 108 ? 24.324   59.808  44.836  1.00 26.46 ? 100  GLY C C   1 
ATOM   5003  O  O   . GLY C  1 108 ? 23.882   59.131  45.757  1.00 23.38 ? 100  GLY C O   1 
ATOM   5004  N  N   . PHE C  1 109 ? 25.288   60.726  44.970  1.00 26.26 ? 101  PHE C N   1 
ATOM   5005  C  CA  . PHE C  1 109 ? 26.053   60.948  46.191  1.00 26.92 ? 101  PHE C CA  1 
ATOM   5006  C  C   . PHE C  1 109 ? 26.212   62.447  46.410  1.00 24.12 ? 101  PHE C C   1 
ATOM   5007  O  O   . PHE C  1 109 ? 26.448   63.202  45.490  1.00 22.78 ? 101  PHE C O   1 
ATOM   5008  C  CB  . PHE C  1 109 ? 27.470   60.353  46.053  1.00 29.01 ? 101  PHE C CB  1 
ATOM   5009  C  CG  . PHE C  1 109 ? 27.482   58.883  45.921  1.00 39.46 ? 101  PHE C CG  1 
ATOM   5010  C  CD1 . PHE C  1 109 ? 27.093   58.051  47.021  1.00 49.50 ? 101  PHE C CD1 1 
ATOM   5011  C  CD2 . PHE C  1 109 ? 27.833   58.272  44.709  1.00 49.60 ? 101  PHE C CD2 1 
ATOM   5012  C  CE1 . PHE C  1 109 ? 27.072   56.608  46.922  1.00 51.71 ? 101  PHE C CE1 1 
ATOM   5013  C  CE2 . PHE C  1 109 ? 27.830   56.804  44.587  1.00 52.89 ? 101  PHE C CE2 1 
ATOM   5014  C  CZ  . PHE C  1 109 ? 27.453   55.996  45.711  1.00 53.84 ? 101  PHE C CZ  1 
ATOM   5015  N  N   . VAL C  1 110 ? 26.165   62.843  47.658  1.00 21.74 ? 102  VAL C N   1 
ATOM   5016  C  CA  . VAL C  1 110 ? 26.419   64.204  48.073  1.00 19.94 ? 102  VAL C CA  1 
ATOM   5017  C  C   . VAL C  1 110 ? 27.894   64.472  47.929  1.00 19.41 ? 102  VAL C C   1 
ATOM   5018  O  O   . VAL C  1 110 ? 28.683   63.732  48.425  1.00 18.10 ? 102  VAL C O   1 
ATOM   5019  C  CB  . VAL C  1 110 ? 26.022   64.372  49.557  1.00 19.92 ? 102  VAL C CB  1 
ATOM   5020  C  CG1 . VAL C  1 110 ? 26.432   65.753  50.106  1.00 15.96 ? 102  VAL C CG1 1 
ATOM   5021  C  CG2 . VAL C  1 110 ? 24.534   64.084  49.721  1.00 16.74 ? 102  VAL C CG2 1 
ATOM   5022  N  N   . THR C  1 111 ? 28.243   65.505  47.187  1.00 19.03 ? 103  THR C N   1 
ATOM   5023  C  CA  . THR C  1 111 ? 29.624   65.915  47.027  1.00 18.47 ? 103  THR C CA  1 
ATOM   5024  C  C   . THR C  1 111 ? 29.981   67.071  47.953  1.00 18.47 ? 103  THR C C   1 
ATOM   5025  O  O   . THR C  1 111 ? 31.161   67.348  48.174  1.00 17.20 ? 103  THR C O   1 
ATOM   5026  C  CB  . THR C  1 111 ? 29.851   66.387  45.617  1.00 19.04 ? 103  THR C CB  1 
ATOM   5027  O  OG1 . THR C  1 111 ? 29.040   67.552  45.384  1.00 17.89 ? 103  THR C OG1 1 
ATOM   5028  C  CG2 . THR C  1 111 ? 29.478   65.257  44.570  1.00 17.32 ? 103  THR C CG2 1 
ATOM   5029  N  N   . GLY C  1 112 ? 28.967   67.765  48.490  1.00 18.22 ? 104  GLY C N   1 
ATOM   5030  C  CA  . GLY C  1 112 ? 29.229   68.960  49.242  1.00 17.71 ? 104  GLY C CA  1 
ATOM   5031  C  C   . GLY C  1 112 ? 27.970   69.694  49.629  1.00 18.17 ? 104  GLY C C   1 
ATOM   5032  O  O   . GLY C  1 112 ? 26.885   69.220  49.399  1.00 16.87 ? 104  GLY C O   1 
ATOM   5033  N  N   . LYS C  1 113 ? 28.156   70.853  50.233  1.00 17.89 ? 105  LYS C N   1 
ATOM   5034  C  CA  . LYS C  1 113 ? 27.078   71.676  50.629  1.00 18.55 ? 105  LYS C CA  1 
ATOM   5035  C  C   . LYS C  1 113 ? 27.593   73.110  50.755  1.00 19.55 ? 105  LYS C C   1 
ATOM   5036  O  O   . LYS C  1 113 ? 28.757   73.339  50.978  1.00 17.77 ? 105  LYS C O   1 
ATOM   5037  C  CB  . LYS C  1 113 ? 26.433   71.175  51.894  1.00 18.06 ? 105  LYS C CB  1 
ATOM   5038  C  CG  . LYS C  1 113 ? 27.320   71.018  53.114  1.00 19.56 ? 105  LYS C CG  1 
ATOM   5039  C  CD  . LYS C  1 113 ? 26.540   70.284  54.223  1.00 17.61 ? 105  LYS C CD  1 
ATOM   5040  C  CE  . LYS C  1 113 ? 27.276   70.064  55.485  1.00 18.19 ? 105  LYS C CE  1 
ATOM   5041  N  NZ  . LYS C  1 113 ? 26.508   69.261  56.463  1.00 14.56 ? 105  LYS C NZ  1 
ATOM   5042  N  N   . HIS C  1 114 ? 26.707   74.061  50.495  1.00 21.11 ? 106  HIS C N   1 
ATOM   5043  C  CA  . HIS C  1 114 ? 27.039   75.464  50.405  1.00 22.05 ? 106  HIS C CA  1 
ATOM   5044  C  C   . HIS C  1 114 ? 26.096   76.338  51.222  1.00 22.43 ? 106  HIS C C   1 
ATOM   5045  O  O   . HIS C  1 114 ? 24.905   76.411  50.946  1.00 21.83 ? 106  HIS C O   1 
ATOM   5046  C  CB  . HIS C  1 114 ? 27.009   75.870  48.940  1.00 22.26 ? 106  HIS C CB  1 
ATOM   5047  C  CG  . HIS C  1 114 ? 27.435   77.276  48.710  1.00 26.25 ? 106  HIS C CG  1 
ATOM   5048  N  ND1 . HIS C  1 114 ? 27.174   77.943  47.547  1.00 31.94 ? 106  HIS C ND1 1 
ATOM   5049  C  CD2 . HIS C  1 114 ? 28.092   78.154  49.511  1.00 27.98 ? 106  HIS C CD2 1 
ATOM   5050  C  CE1 . HIS C  1 114 ? 27.628   79.183  47.656  1.00 33.62 ? 106  HIS C CE1 1 
ATOM   5051  N  NE2 . HIS C  1 114 ? 28.198   79.330  48.833  1.00 27.29 ? 106  HIS C NE2 1 
ATOM   5052  N  N   . GLY C  1 115 ? 26.635   76.997  52.229  1.00 23.37 ? 107  GLY C N   1 
ATOM   5053  C  CA  . GLY C  1 115 ? 25.865   77.868  53.113  1.00 24.77 ? 107  GLY C CA  1 
ATOM   5054  C  C   . GLY C  1 115 ? 25.477   79.187  52.498  1.00 26.15 ? 107  GLY C C   1 
ATOM   5055  O  O   . GLY C  1 115 ? 26.073   79.624  51.541  1.00 28.01 ? 107  GLY C O   1 
ATOM   5056  N  N   . GLY C  1 116 ? 24.485   79.855  53.070  1.00 27.34 ? 108  GLY C N   1 
ATOM   5057  C  CA  . GLY C  1 116 ? 23.976   81.145  52.531  1.00 26.79 ? 108  GLY C CA  1 
ATOM   5058  C  C   . GLY C  1 116 ? 22.680   80.809  51.818  1.00 26.86 ? 108  GLY C C   1 
ATOM   5059  O  O   . GLY C  1 116 ? 21.651   80.753  52.447  1.00 26.65 ? 108  GLY C O   1 
ATOM   5060  N  N   . VAL C  1 117 ? 22.760   80.460  50.544  1.00 25.68 ? 109  VAL C N   1 
ATOM   5061  C  CA  . VAL C  1 117 ? 21.643   79.916  49.838  1.00 25.17 ? 109  VAL C CA  1 
ATOM   5062  C  C   . VAL C  1 117 ? 21.228   78.569  50.360  1.00 24.53 ? 109  VAL C C   1 
ATOM   5063  O  O   . VAL C  1 117 ? 20.092   78.156  50.148  1.00 25.44 ? 109  VAL C O   1 
ATOM   5064  C  CB  . VAL C  1 117 ? 21.934   79.784  48.298  1.00 26.13 ? 109  VAL C CB  1 
ATOM   5065  C  CG1 . VAL C  1 117 ? 22.047   81.171  47.717  1.00 27.66 ? 109  VAL C CG1 1 
ATOM   5066  C  CG2 . VAL C  1 117 ? 23.198   78.892  48.019  1.00 23.19 ? 109  VAL C CG2 1 
ATOM   5067  N  N   . ASN C  1 118 ? 22.139   77.865  51.006  1.00 23.00 ? 110  ASN C N   1 
ATOM   5068  C  CA  . ASN C  1 118 ? 21.830   76.599  51.650  1.00 22.14 ? 110  ASN C CA  1 
ATOM   5069  C  C   . ASN C  1 118 ? 21.478   75.510  50.670  1.00 21.62 ? 110  ASN C C   1 
ATOM   5070  O  O   . ASN C  1 118 ? 20.347   75.004  50.612  1.00 21.16 ? 110  ASN C O   1 
ATOM   5071  C  CB  . ASN C  1 118 ? 20.803   76.765  52.771  1.00 21.80 ? 110  ASN C CB  1 
ATOM   5072  C  CG  . ASN C  1 118 ? 21.392   77.502  53.971  1.00 24.30 ? 110  ASN C CG  1 
ATOM   5073  O  OD1 . ASN C  1 118 ? 22.611   77.457  54.196  1.00 25.48 ? 110  ASN C OD1 1 
ATOM   5074  N  ND2 . ASN C  1 118 ? 20.548   78.185  54.750  1.00 21.88 ? 110  ASN C ND2 1 
ATOM   5075  N  N   . HIS C  1 119 ? 22.494   75.122  49.906  1.00 20.95 ? 111  HIS C N   1 
ATOM   5076  C  CA  . HIS C  1 119 ? 22.344   74.054  48.953  1.00 19.94 ? 111  HIS C CA  1 
ATOM   5077  C  C   . HIS C  1 119 ? 23.189   72.868  49.345  1.00 18.77 ? 111  HIS C C   1 
ATOM   5078  O  O   . HIS C  1 119 ? 24.299   73.042  49.817  1.00 17.13 ? 111  HIS C O   1 
ATOM   5079  C  CB  . HIS C  1 119 ? 22.769   74.533  47.564  1.00 20.50 ? 111  HIS C CB  1 
ATOM   5080  C  CG  . HIS C  1 119 ? 21.828   75.504  46.923  1.00 20.38 ? 111  HIS C CG  1 
ATOM   5081  N  ND1 . HIS C  1 119 ? 22.137   76.158  45.751  1.00 19.86 ? 111  HIS C ND1 1 
ATOM   5082  C  CD2 . HIS C  1 119 ? 20.602   75.956  47.292  1.00 23.66 ? 111  HIS C CD2 1 
ATOM   5083  C  CE1 . HIS C  1 119 ? 21.135   76.957  45.413  1.00 21.99 ? 111  HIS C CE1 1 
ATOM   5084  N  NE2 . HIS C  1 119 ? 20.183   76.844  46.323  1.00 21.65 ? 111  HIS C NE2 1 
ATOM   5085  N  N   . VAL C  1 120 ? 22.657   71.663  49.104  1.00 18.48 ? 112  VAL C N   1 
ATOM   5086  C  CA  . VAL C  1 120 ? 23.414   70.426  49.125  1.00 18.25 ? 112  VAL C CA  1 
ATOM   5087  C  C   . VAL C  1 120 ? 23.670   70.001  47.678  1.00 18.86 ? 112  VAL C C   1 
ATOM   5088  O  O   . VAL C  1 120 ? 22.774   70.023  46.841  1.00 19.74 ? 112  VAL C O   1 
ATOM   5089  C  CB  . VAL C  1 120 ? 22.649   69.338  49.932  1.00 18.65 ? 112  VAL C CB  1 
ATOM   5090  C  CG1 . VAL C  1 120 ? 23.276   67.970  49.809  1.00 16.29 ? 112  VAL C CG1 1 
ATOM   5091  C  CG2 . VAL C  1 120 ? 22.504   69.790  51.377  1.00 16.45 ? 112  VAL C CG2 1 
ATOM   5092  N  N   . LEU C  1 121 ? 24.898   69.618  47.390  1.00 18.63 ? 113  LEU C N   1 
ATOM   5093  C  CA  . LEU C  1 121 ? 25.354   69.350  46.037  1.00 19.24 ? 113  LEU C CA  1 
ATOM   5094  C  C   . LEU C  1 121 ? 25.525   67.881  45.787  1.00 20.04 ? 113  LEU C C   1 
ATOM   5095  O  O   . LEU C  1 121 ? 26.068   67.148  46.623  1.00 20.89 ? 113  LEU C O   1 
ATOM   5096  C  CB  . LEU C  1 121 ? 26.683   70.070  45.804  1.00 19.53 ? 113  LEU C CB  1 
ATOM   5097  C  CG  . LEU C  1 121 ? 26.641   71.554  46.293  1.00 18.91 ? 113  LEU C CG  1 
ATOM   5098  C  CD1 . LEU C  1 121 ? 27.946   72.254  45.998  1.00 18.36 ? 113  LEU C CD1 1 
ATOM   5099  C  CD2 . LEU C  1 121 ? 25.456   72.310  45.647  1.00 16.43 ? 113  LEU C CD2 1 
ATOM   5100  N  N   . VAL C  1 122 ? 25.094   67.435  44.620  1.00 20.32 ? 114  VAL C N   1 
ATOM   5101  C  CA  . VAL C  1 122 ? 24.944   66.035  44.394  1.00 20.87 ? 114  VAL C CA  1 
ATOM   5102  C  C   . VAL C  1 122 ? 25.420   65.624  43.033  1.00 22.30 ? 114  VAL C C   1 
ATOM   5103  O  O   . VAL C  1 122 ? 25.121   66.281  42.032  1.00 23.05 ? 114  VAL C O   1 
ATOM   5104  C  CB  . VAL C  1 122 ? 23.451   65.593  44.549  1.00 22.13 ? 114  VAL C CB  1 
ATOM   5105  C  CG1 . VAL C  1 122 ? 23.343   64.072  44.367  1.00 18.81 ? 114  VAL C CG1 1 
ATOM   5106  C  CG2 . VAL C  1 122 ? 22.854   66.100  45.923  1.00 17.43 ? 114  VAL C CG2 1 
ATOM   5107  N  N   . HIS C  1 123 ? 26.136   64.506  43.006  1.00 23.09 ? 115  HIS C N   1 
ATOM   5108  C  CA  . HIS C  1 123 ? 26.613   63.891  41.800  1.00 24.99 ? 115  HIS C CA  1 
ATOM   5109  C  C   . HIS C  1 123 ? 25.748   62.713  41.402  1.00 26.24 ? 115  HIS C C   1 
ATOM   5110  O  O   . HIS C  1 123 ? 25.592   61.756  42.183  1.00 26.82 ? 115  HIS C O   1 
ATOM   5111  C  CB  . HIS C  1 123 ? 28.023   63.349  42.005  1.00 25.23 ? 115  HIS C CB  1 
ATOM   5112  C  CG  . HIS C  1 123 ? 28.541   62.599  40.825  1.00 26.53 ? 115  HIS C CG  1 
ATOM   5113  N  ND1 . HIS C  1 123 ? 29.160   63.223  39.773  1.00 29.62 ? 115  HIS C ND1 1 
ATOM   5114  C  CD2 . HIS C  1 123 ? 28.470   61.289  40.501  1.00 28.63 ? 115  HIS C CD2 1 
ATOM   5115  C  CE1 . HIS C  1 123 ? 29.494   62.320  38.867  1.00 29.20 ? 115  HIS C CE1 1 
ATOM   5116  N  NE2 . HIS C  1 123 ? 29.094   61.138  39.291  1.00 28.98 ? 115  HIS C NE2 1 
ATOM   5117  N  N   . PHE C  1 124 ? 25.210   62.784  40.199  1.00 27.62 ? 116  PHE C N   1 
ATOM   5118  C  CA  . PHE C  1 124 ? 24.624   61.654  39.525  1.00 29.40 ? 116  PHE C CA  1 
ATOM   5119  C  C   . PHE C  1 124 ? 25.484   61.366  38.288  1.00 32.10 ? 116  PHE C C   1 
ATOM   5120  O  O   . PHE C  1 124 ? 26.182   62.228  37.794  1.00 31.72 ? 116  PHE C O   1 
ATOM   5121  C  CB  . PHE C  1 124 ? 23.200   61.947  39.063  1.00 28.18 ? 116  PHE C CB  1 
ATOM   5122  C  CG  . PHE C  1 124 ? 22.279   62.315  40.149  1.00 26.46 ? 116  PHE C CG  1 
ATOM   5123  C  CD1 . PHE C  1 124 ? 21.580   61.348  40.847  1.00 26.05 ? 116  PHE C CD1 1 
ATOM   5124  C  CD2 . PHE C  1 124 ? 22.065   63.620  40.470  1.00 24.58 ? 116  PHE C CD2 1 
ATOM   5125  C  CE1 . PHE C  1 124 ? 20.739   61.685  41.868  1.00 24.93 ? 116  PHE C CE1 1 
ATOM   5126  C  CE2 . PHE C  1 124 ? 21.163   63.958  41.489  1.00 24.23 ? 116  PHE C CE2 1 
ATOM   5127  C  CZ  . PHE C  1 124 ? 20.528   62.992  42.183  1.00 22.69 ? 116  PHE C CZ  1 
ATOM   5128  N  N   . GLU C  1 125 ? 25.405   60.139  37.795  1.00 35.95 ? 117  GLU C N   1 
ATOM   5129  C  CA  . GLU C  1 125 ? 25.933   59.777  36.486  1.00 39.47 ? 117  GLU C CA  1 
ATOM   5130  C  C   . GLU C  1 125 ? 25.407   60.679  35.367  1.00 39.63 ? 117  GLU C C   1 
ATOM   5131  O  O   . GLU C  1 125 ? 24.288   61.161  35.377  1.00 38.06 ? 117  GLU C O   1 
ATOM   5132  C  CB  . GLU C  1 125 ? 25.552   58.331  36.170  1.00 41.72 ? 117  GLU C CB  1 
ATOM   5133  C  CG  . GLU C  1 125 ? 26.228   57.248  37.061  1.00 48.42 ? 117  GLU C CG  1 
ATOM   5134  C  CD  . GLU C  1 125 ? 25.618   55.823  36.858  1.00 59.68 ? 117  GLU C CD  1 
ATOM   5135  O  OE1 . GLU C  1 125 ? 24.981   55.559  35.781  1.00 66.17 ? 117  GLU C OE1 1 
ATOM   5136  O  OE2 . GLU C  1 125 ? 25.793   54.961  37.777  1.00 64.87 ? 117  GLU C OE2 1 
ATOM   5137  N  N   . GLU C  1 126 ? 26.244   60.894  34.384  1.00 41.50 ? 118  GLU C N   1 
ATOM   5138  C  CA  . GLU C  1 126 ? 25.935   61.814  33.296  1.00 43.73 ? 118  GLU C CA  1 
ATOM   5139  C  C   . GLU C  1 126 ? 24.561   61.605  32.607  1.00 42.55 ? 118  GLU C C   1 
ATOM   5140  O  O   . GLU C  1 126 ? 23.887   62.533  32.289  1.00 41.55 ? 118  GLU C O   1 
ATOM   5141  C  CB  . GLU C  1 126 ? 27.073   61.705  32.274  1.00 45.31 ? 118  GLU C CB  1 
ATOM   5142  C  CG  . GLU C  1 126 ? 27.217   62.859  31.274  1.00 51.77 ? 118  GLU C CG  1 
ATOM   5143  C  CD  . GLU C  1 126 ? 28.318   62.561  30.225  1.00 60.32 ? 118  GLU C CD  1 
ATOM   5144  O  OE1 . GLU C  1 126 ? 28.932   61.454  30.283  1.00 63.93 ? 118  GLU C OE1 1 
ATOM   5145  O  OE2 . GLU C  1 126 ? 28.557   63.427  29.335  1.00 65.69 ? 118  GLU C OE2 1 
ATOM   5146  N  N   . GLU C  1 127 ? 24.165   60.374  32.386  1.00 42.81 ? 119  GLU C N   1 
ATOM   5147  C  CA  . GLU C  1 127 ? 22.925   60.095  31.681  1.00 44.29 ? 119  GLU C CA  1 
ATOM   5148  C  C   . GLU C  1 127 ? 21.707   60.561  32.462  1.00 42.13 ? 119  GLU C C   1 
ATOM   5149  O  O   . GLU C  1 127 ? 20.692   60.869  31.872  1.00 43.23 ? 119  GLU C O   1 
ATOM   5150  C  CB  . GLU C  1 127 ? 22.788   58.594  31.238  1.00 45.96 ? 119  GLU C CB  1 
ATOM   5151  C  CG  . GLU C  1 127 ? 23.476   57.478  32.119  1.00 52.58 ? 119  GLU C CG  1 
ATOM   5152  C  CD  . GLU C  1 127 ? 25.041   57.336  31.917  1.00 60.53 ? 119  GLU C CD  1 
ATOM   5153  O  OE1 . GLU C  1 127 ? 25.449   56.829  30.833  1.00 66.85 ? 119  GLU C OE1 1 
ATOM   5154  O  OE2 . GLU C  1 127 ? 25.860   57.684  32.826  1.00 59.47 ? 119  GLU C OE2 1 
ATOM   5155  N  N   . VAL C  1 128 ? 21.798   60.620  33.780  1.00 39.85 ? 120  VAL C N   1 
ATOM   5156  C  CA  . VAL C  1 128 ? 20.690   61.090  34.601  1.00 37.31 ? 120  VAL C CA  1 
ATOM   5157  C  C   . VAL C  1 128 ? 20.412   62.599  34.383  1.00 36.68 ? 120  VAL C C   1 
ATOM   5158  O  O   . VAL C  1 128 ? 19.261   63.043  34.438  1.00 35.64 ? 120  VAL C O   1 
ATOM   5159  C  CB  . VAL C  1 128 ? 20.960   60.779  36.069  1.00 36.73 ? 120  VAL C CB  1 
ATOM   5160  C  CG1 . VAL C  1 128 ? 20.054   61.555  36.988  1.00 34.23 ? 120  VAL C CG1 1 
ATOM   5161  C  CG2 . VAL C  1 128 ? 20.889   59.277  36.322  1.00 34.89 ? 120  VAL C CG2 1 
ATOM   5162  N  N   . LEU C  1 129 ? 21.446   63.380  34.073  1.00 35.41 ? 121  LEU C N   1 
ATOM   5163  C  CA  . LEU C  1 129 ? 21.330   64.825  34.161  1.00 34.25 ? 121  LEU C CA  1 
ATOM   5164  C  C   . LEU C  1 129 ? 20.319   65.384  33.195  1.00 34.67 ? 121  LEU C C   1 
ATOM   5165  O  O   . LEU C  1 129 ? 19.519   66.266  33.533  1.00 33.12 ? 121  LEU C O   1 
ATOM   5166  C  CB  . LEU C  1 129 ? 22.689   65.466  33.945  1.00 34.33 ? 121  LEU C CB  1 
ATOM   5167  C  CG  . LEU C  1 129 ? 23.732   65.204  35.053  1.00 33.75 ? 121  LEU C CG  1 
ATOM   5168  C  CD1 . LEU C  1 129 ? 24.875   66.201  35.014  1.00 32.43 ? 121  LEU C CD1 1 
ATOM   5169  C  CD2 . LEU C  1 129 ? 23.083   65.257  36.381  1.00 30.95 ? 121  LEU C CD2 1 
ATOM   5170  N  N   . GLY C  1 130 ? 20.362   64.862  31.965  1.00 36.13 ? 122  GLY C N   1 
ATOM   5171  C  CA  . GLY C  1 130 ? 19.448   65.270  30.883  1.00 35.91 ? 122  GLY C CA  1 
ATOM   5172  C  C   . GLY C  1 130 ? 17.994   64.942  31.154  1.00 36.10 ? 122  GLY C C   1 
ATOM   5173  O  O   . GLY C  1 130 ? 17.146   65.484  30.531  1.00 36.79 ? 122  GLY C O   1 
ATOM   5174  N  N   . LYS C  1 131 ? 17.717   64.045  32.094  1.00 36.36 ? 123  LYS C N   1 
ATOM   5175  C  CA  . LYS C  1 131 ? 16.346   63.753  32.540  1.00 36.32 ? 123  LYS C CA  1 
ATOM   5176  C  C   . LYS C  1 131 ? 15.854   64.604  33.723  1.00 33.64 ? 123  LYS C C   1 
ATOM   5177  O  O   . LYS C  1 131 ? 14.659   64.680  33.987  1.00 32.90 ? 123  LYS C O   1 
ATOM   5178  C  CB  . LYS C  1 131 ? 16.251   62.291  32.972  1.00 37.19 ? 123  LYS C CB  1 
ATOM   5179  C  CG  . LYS C  1 131 ? 16.756   61.255  31.958  1.00 42.51 ? 123  LYS C CG  1 
ATOM   5180  C  CD  . LYS C  1 131 ? 16.463   59.816  32.505  1.00 49.09 ? 123  LYS C CD  1 
ATOM   5181  C  CE  . LYS C  1 131 ? 16.453   58.743  31.401  1.00 53.65 ? 123  LYS C CE  1 
ATOM   5182  N  NZ  . LYS C  1 131 ? 17.715   57.955  31.274  1.00 56.64 ? 123  LYS C NZ  1 
ATOM   5183  N  N   . LEU C  1 132 ? 16.766   65.214  34.463  1.00 31.17 ? 124  LEU C N   1 
ATOM   5184  C  CA  . LEU C  1 132 ? 16.377   66.007  35.613  1.00 29.13 ? 124  LEU C CA  1 
ATOM   5185  C  C   . LEU C  1 132 ? 15.677   67.322  35.246  1.00 28.13 ? 124  LEU C C   1 
ATOM   5186  O  O   . LEU C  1 132 ? 15.866   67.867  34.183  1.00 26.52 ? 124  LEU C O   1 
ATOM   5187  C  CB  . LEU C  1 132 ? 17.576   66.286  36.505  1.00 28.55 ? 124  LEU C CB  1 
ATOM   5188  C  CG  . LEU C  1 132 ? 18.282   65.063  37.115  1.00 28.26 ? 124  LEU C CG  1 
ATOM   5189  C  CD1 . LEU C  1 132 ? 19.555   65.508  37.896  1.00 26.24 ? 124  LEU C CD1 1 
ATOM   5190  C  CD2 . LEU C  1 132 ? 17.385   64.216  38.004  1.00 25.30 ? 124  LEU C CD2 1 
ATOM   5191  N  N   . MET C  1 133 ? 14.857   67.796  36.184  1.00 27.53 ? 125  MET C N   1 
ATOM   5192  C  CA  . MET C  1 133 ? 14.190   69.076  36.112  1.00 27.01 ? 125  MET C CA  1 
ATOM   5193  C  C   . MET C  1 133 ? 14.193   69.779  37.482  1.00 25.56 ? 125  MET C C   1 
ATOM   5194  O  O   . MET C  1 133 ? 14.012   69.147  38.516  1.00 24.80 ? 125  MET C O   1 
ATOM   5195  C  CB  . MET C  1 133 ? 12.724   68.858  35.658  1.00 27.42 ? 125  MET C CB  1 
ATOM   5196  C  CG  . MET C  1 133 ? 11.914   70.149  35.522  1.00 28.61 ? 125  MET C CG  1 
ATOM   5197  S  SD  . MET C  1 133 ? 12.731   71.380  34.491  1.00 30.38 ? 125  MET C SD  1 
ATOM   5198  C  CE  . MET C  1 133 ? 11.531   72.712  34.363  1.00 30.04 ? 125  MET C CE  1 
ATOM   5199  N  N   . VAL C  1 134 ? 14.366   71.093  37.460  1.00 24.66 ? 126  VAL C N   1 
ATOM   5200  C  CA  . VAL C  1 134 ? 14.322   71.914  38.632  1.00 24.17 ? 126  VAL C CA  1 
ATOM   5201  C  C   . VAL C  1 134 ? 12.937   71.666  39.273  1.00 25.47 ? 126  VAL C C   1 
ATOM   5202  O  O   . VAL C  1 134 ? 11.916   71.660  38.571  1.00 26.52 ? 126  VAL C O   1 
ATOM   5203  C  CB  . VAL C  1 134 ? 14.480   73.426  38.272  1.00 23.86 ? 126  VAL C CB  1 
ATOM   5204  C  CG1 . VAL C  1 134 ? 14.157   74.314  39.488  1.00 21.37 ? 126  VAL C CG1 1 
ATOM   5205  C  CG2 . VAL C  1 134 ? 15.828   73.711  37.693  1.00 22.04 ? 126  VAL C CG2 1 
ATOM   5206  N  N   . GLY C  1 135 ? 12.900   71.495  40.597  1.00 25.43 ? 127  GLY C N   1 
ATOM   5207  C  CA  . GLY C  1 135 ? 11.670   71.140  41.292  1.00 25.06 ? 127  GLY C CA  1 
ATOM   5208  C  C   . GLY C  1 135 ? 11.511   69.665  41.643  1.00 24.64 ? 127  GLY C C   1 
ATOM   5209  O  O   . GLY C  1 135 ? 10.700   69.335  42.480  1.00 23.58 ? 127  GLY C O   1 
ATOM   5210  N  N   . ASP C  1 136 ? 12.256   68.776  40.989  1.00 25.19 ? 128  ASP C N   1 
ATOM   5211  C  CA  . ASP C  1 136 ? 12.152   67.340  41.212  1.00 25.33 ? 128  ASP C CA  1 
ATOM   5212  C  C   . ASP C  1 136 ? 12.559   67.048  42.636  1.00 25.54 ? 128  ASP C C   1 
ATOM   5213  O  O   . ASP C  1 136 ? 13.509   67.619  43.146  1.00 25.15 ? 128  ASP C O   1 
ATOM   5214  C  CB  . ASP C  1 136 ? 13.038   66.555  40.231  1.00 26.05 ? 128  ASP C CB  1 
ATOM   5215  C  CG  . ASP C  1 136 ? 12.469   66.522  38.783  1.00 28.78 ? 128  ASP C CG  1 
ATOM   5216  O  OD1 . ASP C  1 136 ? 11.345   67.075  38.550  1.00 32.19 ? 128  ASP C OD1 1 
ATOM   5217  O  OD2 . ASP C  1 136 ? 13.136   65.928  37.887  1.00 30.08 ? 128  ASP C OD2 1 
ATOM   5218  N  N   . LYS C  1 137 ? 11.806   66.172  43.289  1.00 26.14 ? 129  LYS C N   1 
ATOM   5219  C  CA  . LYS C  1 137 ? 11.985   65.863  44.689  1.00 26.10 ? 129  LYS C CA  1 
ATOM   5220  C  C   . LYS C  1 137 ? 13.218   65.015  44.908  1.00 24.43 ? 129  LYS C C   1 
ATOM   5221  O  O   . LYS C  1 137 ? 13.474   64.114  44.124  1.00 22.66 ? 129  LYS C O   1 
ATOM   5222  C  CB  . LYS C  1 137 ? 10.782   65.118  45.210  1.00 27.18 ? 129  LYS C CB  1 
ATOM   5223  C  CG  . LYS C  1 137 ? 9.509    65.898  45.164  1.00 31.63 ? 129  LYS C CG  1 
ATOM   5224  C  CD  . LYS C  1 137 ? 8.385    64.938  45.301  1.00 38.27 ? 129  LYS C CD  1 
ATOM   5225  C  CE  . LYS C  1 137 ? 7.067    65.611  45.599  1.00 43.03 ? 129  LYS C CE  1 
ATOM   5226  N  NZ  . LYS C  1 137 ? 6.169    64.431  46.040  1.00 47.04 ? 129  LYS C NZ  1 
ATOM   5227  N  N   . ILE C  1 138 ? 13.947   65.304  45.998  1.00 23.03 ? 130  ILE C N   1 
ATOM   5228  C  CA  . ILE C  1 138 ? 15.201   64.646  46.276  1.00 22.97 ? 130  ILE C CA  1 
ATOM   5229  C  C   . ILE C  1 138 ? 15.204   64.140  47.687  1.00 23.44 ? 130  ILE C C   1 
ATOM   5230  O  O   . ILE C  1 138 ? 14.776   64.853  48.596  1.00 23.59 ? 130  ILE C O   1 
ATOM   5231  C  CB  . ILE C  1 138 ? 16.412   65.601  46.146  1.00 22.55 ? 130  ILE C CB  1 
ATOM   5232  C  CG1 . ILE C  1 138 ? 16.516   66.184  44.728  1.00 22.08 ? 130  ILE C CG1 1 
ATOM   5233  C  CG2 . ILE C  1 138 ? 17.664   64.902  46.502  1.00 20.00 ? 130  ILE C CG2 1 
ATOM   5234  C  CD1 . ILE C  1 138 ? 16.819   65.215  43.639  1.00 20.34 ? 130  ILE C CD1 1 
ATOM   5235  N  N   . LEU C  1 139 ? 15.687   62.905  47.855  1.00 23.32 ? 131  LEU C N   1 
ATOM   5236  C  CA  . LEU C  1 139 ? 15.791   62.260  49.171  1.00 23.00 ? 131  LEU C CA  1 
ATOM   5237  C  C   . LEU C  1 139 ? 17.263   61.976  49.425  1.00 21.88 ? 131  LEU C C   1 
ATOM   5238  O  O   . LEU C  1 139 ? 17.918   61.349  48.593  1.00 19.67 ? 131  LEU C O   1 
ATOM   5239  C  CB  . LEU C  1 139 ? 15.015   60.937  49.195  1.00 23.14 ? 131  LEU C CB  1 
ATOM   5240  C  CG  . LEU C  1 139 ? 15.228   60.044  50.430  1.00 24.72 ? 131  LEU C CG  1 
ATOM   5241  C  CD1 . LEU C  1 139 ? 14.559   60.655  51.650  1.00 21.54 ? 131  LEU C CD1 1 
ATOM   5242  C  CD2 . LEU C  1 139 ? 14.659   58.617  50.158  1.00 24.96 ? 131  LEU C CD2 1 
ATOM   5243  N  N   . ILE C  1 140 ? 17.763   62.485  50.555  1.00 21.67 ? 132  ILE C N   1 
ATOM   5244  C  CA  . ILE C  1 140 ? 19.134   62.272  51.017  1.00 20.89 ? 132  ILE C CA  1 
ATOM   5245  C  C   . ILE C  1 140 ? 19.014   61.337  52.218  1.00 21.76 ? 132  ILE C C   1 
ATOM   5246  O  O   . ILE C  1 140 ? 18.348   61.643  53.188  1.00 20.75 ? 132  ILE C O   1 
ATOM   5247  C  CB  . ILE C  1 140 ? 19.788   63.583  51.438  1.00 20.91 ? 132  ILE C CB  1 
ATOM   5248  C  CG1 . ILE C  1 140 ? 19.959   64.521  50.225  1.00 20.98 ? 132  ILE C CG1 1 
ATOM   5249  C  CG2 . ILE C  1 140 ? 21.153   63.354  52.182  1.00 16.66 ? 132  ILE C CG2 1 
ATOM   5250  C  CD1 . ILE C  1 140 ? 19.964   65.987  50.562  1.00 16.44 ? 132  ILE C CD1 1 
ATOM   5251  N  N   . LYS C  1 141 ? 19.593   60.159  52.114  1.00 22.56 ? 133  LYS C N   1 
ATOM   5252  C  CA  . LYS C  1 141 ? 19.665   59.266  53.259  1.00 24.29 ? 133  LYS C CA  1 
ATOM   5253  C  C   . LYS C  1 141 ? 20.815   59.746  54.187  1.00 23.19 ? 133  LYS C C   1 
ATOM   5254  O  O   . LYS C  1 141 ? 21.953   59.311  54.103  1.00 22.77 ? 133  LYS C O   1 
ATOM   5255  C  CB  . LYS C  1 141 ? 19.721   57.794  52.774  1.00 25.70 ? 133  LYS C CB  1 
ATOM   5256  C  CG  . LYS C  1 141 ? 18.295   57.321  52.187  1.00 30.90 ? 133  LYS C CG  1 
ATOM   5257  C  CD  . LYS C  1 141 ? 18.131   55.845  51.671  1.00 39.67 ? 133  LYS C CD  1 
ATOM   5258  C  CE  . LYS C  1 141 ? 18.362   54.749  52.810  1.00 44.16 ? 133  LYS C CE  1 
ATOM   5259  N  NZ  . LYS C  1 141 ? 17.646   53.412  52.618  1.00 45.94 ? 133  LYS C NZ  1 
ATOM   5260  N  N   . ALA C  1 142 ? 20.482   60.703  55.050  1.00 22.15 ? 134  ALA C N   1 
ATOM   5261  C  CA  . ALA C  1 142 ? 21.469   61.435  55.841  1.00 21.89 ? 134  ALA C CA  1 
ATOM   5262  C  C   . ALA C  1 142 ? 22.038   60.586  56.977  1.00 22.36 ? 134  ALA C C   1 
ATOM   5263  O  O   . ALA C  1 142 ? 21.274   60.009  57.764  1.00 20.65 ? 134  ALA C O   1 
ATOM   5264  C  CB  . ALA C  1 142 ? 20.887   62.736  56.410  1.00 19.73 ? 134  ALA C CB  1 
ATOM   5265  N  N   . TRP C  1 143 ? 23.371   60.579  57.090  1.00 22.51 ? 135  TRP C N   1 
ATOM   5266  C  CA  . TRP C  1 143 ? 24.089   59.675  57.977  1.00 23.50 ? 135  TRP C CA  1 
ATOM   5267  C  C   . TRP C  1 143 ? 25.512   60.183  58.112  1.00 22.71 ? 135  TRP C C   1 
ATOM   5268  O  O   . TRP C  1 143 ? 26.210   60.304  57.114  1.00 22.72 ? 135  TRP C O   1 
ATOM   5269  C  CB  . TRP C  1 143 ? 24.094   58.267  57.331  1.00 24.76 ? 135  TRP C CB  1 
ATOM   5270  C  CG  . TRP C  1 143 ? 24.698   57.194  58.132  1.00 28.27 ? 135  TRP C CG  1 
ATOM   5271  C  CD1 . TRP C  1 143 ? 24.458   56.921  59.443  1.00 34.03 ? 135  TRP C CD1 1 
ATOM   5272  C  CD2 . TRP C  1 143 ? 25.613   56.206  57.687  1.00 29.87 ? 135  TRP C CD2 1 
ATOM   5273  N  NE1 . TRP C  1 143 ? 25.200   55.822  59.853  1.00 32.99 ? 135  TRP C NE1 1 
ATOM   5274  C  CE2 . TRP C  1 143 ? 25.925   55.381  58.793  1.00 31.85 ? 135  TRP C CE2 1 
ATOM   5275  C  CE3 . TRP C  1 143 ? 26.197   55.932  56.467  1.00 31.82 ? 135  TRP C CE3 1 
ATOM   5276  C  CZ2 . TRP C  1 143 ? 26.785   54.312  58.707  1.00 34.85 ? 135  TRP C CZ2 1 
ATOM   5277  C  CZ3 . TRP C  1 143 ? 27.074   54.876  56.384  1.00 33.04 ? 135  TRP C CZ3 1 
ATOM   5278  C  CH2 . TRP C  1 143 ? 27.354   54.075  57.494  1.00 33.92 ? 135  TRP C CH2 1 
ATOM   5279  N  N   . GLY C  1 144 ? 25.938   60.478  59.335  1.00 22.34 ? 136  GLY C N   1 
ATOM   5280  C  CA  . GLY C  1 144 ? 27.292   60.862  59.618  1.00 21.84 ? 136  GLY C CA  1 
ATOM   5281  C  C   . GLY C  1 144 ? 27.499   61.799  60.798  1.00 22.17 ? 136  GLY C C   1 
ATOM   5282  O  O   . GLY C  1 144 ? 28.554   61.748  61.444  1.00 21.75 ? 136  GLY C O   1 
ATOM   5283  N  N   . GLN C  1 145 ? 26.535   62.678  61.076  1.00 21.92 ? 137  GLN C N   1 
ATOM   5284  C  CA  . GLN C  1 145 ? 26.694   63.622  62.135  1.00 21.60 ? 137  GLN C CA  1 
ATOM   5285  C  C   . GLN C  1 145 ? 26.473   62.861  63.423  1.00 22.13 ? 137  GLN C C   1 
ATOM   5286  O  O   . GLN C  1 145 ? 25.534   62.055  63.544  1.00 21.65 ? 137  GLN C O   1 
ATOM   5287  C  CB  . GLN C  1 145 ? 25.728   64.799  62.027  1.00 21.99 ? 137  GLN C CB  1 
ATOM   5288  C  CG  . GLN C  1 145 ? 25.823   65.699  60.794  1.00 22.49 ? 137  GLN C CG  1 
ATOM   5289  C  CD  . GLN C  1 145 ? 27.160   66.439  60.592  1.00 22.67 ? 137  GLN C CD  1 
ATOM   5290  O  OE1 . GLN C  1 145 ? 28.224   66.001  61.052  1.00 19.36 ? 137  GLN C OE1 1 
ATOM   5291  N  NE2 . GLN C  1 145 ? 27.108   67.535  59.845  1.00 19.04 ? 137  GLN C NE2 1 
ATOM   5292  N  N   . GLY C  1 146 ? 27.352   63.148  64.382  1.00 22.26 ? 138  GLY C N   1 
ATOM   5293  C  CA  . GLY C  1 146 ? 27.507   62.420  65.626  1.00 22.31 ? 138  GLY C CA  1 
ATOM   5294  C  C   . GLY C  1 146 ? 28.666   61.415  65.603  1.00 22.71 ? 138  GLY C C   1 
ATOM   5295  O  O   . GLY C  1 146 ? 28.959   60.799  66.626  1.00 22.19 ? 138  GLY C O   1 
ATOM   5296  N  N   . LEU C  1 147 ? 29.302   61.221  64.440  1.00 23.32 ? 139  LEU C N   1 
ATOM   5297  C  CA  . LEU C  1 147 ? 30.427   60.315  64.331  1.00 23.87 ? 139  LEU C CA  1 
ATOM   5298  C  C   . LEU C  1 147 ? 31.564   60.747  65.278  1.00 25.26 ? 139  LEU C C   1 
ATOM   5299  O  O   . LEU C  1 147 ? 31.898   61.924  65.371  1.00 24.22 ? 139  LEU C O   1 
ATOM   5300  C  CB  . LEU C  1 147 ? 30.962   60.260  62.914  1.00 23.87 ? 139  LEU C CB  1 
ATOM   5301  C  CG  . LEU C  1 147 ? 32.076   59.240  62.561  1.00 23.90 ? 139  LEU C CG  1 
ATOM   5302  C  CD1 . LEU C  1 147 ? 31.560   57.809  62.682  1.00 21.00 ? 139  LEU C CD1 1 
ATOM   5303  C  CD2 . LEU C  1 147 ? 32.608   59.453  61.163  1.00 20.53 ? 139  LEU C CD2 1 
ATOM   5304  N  N   . LYS C  1 148 ? 32.144   59.769  65.968  1.00 26.58 ? 140  LYS C N   1 
ATOM   5305  C  CA  . LYS C  1 148 ? 33.277   59.975  66.859  1.00 28.09 ? 140  LYS C CA  1 
ATOM   5306  C  C   . LYS C  1 148 ? 34.367   58.942  66.664  1.00 27.15 ? 140  LYS C C   1 
ATOM   5307  O  O   . LYS C  1 148 ? 34.115   57.776  66.365  1.00 25.56 ? 140  LYS C O   1 
ATOM   5308  C  CB  . LYS C  1 148 ? 32.848   59.928  68.297  1.00 29.99 ? 140  LYS C CB  1 
ATOM   5309  C  CG  . LYS C  1 148 ? 31.940   61.055  68.742  1.00 34.94 ? 140  LYS C CG  1 
ATOM   5310  C  CD  . LYS C  1 148 ? 31.399   60.685  70.094  1.00 42.87 ? 140  LYS C CD  1 
ATOM   5311  C  CE  . LYS C  1 148 ? 30.909   61.876  70.851  1.00 49.63 ? 140  LYS C CE  1 
ATOM   5312  N  NZ  . LYS C  1 148 ? 30.722   61.477  72.284  1.00 53.24 ? 140  LYS C NZ  1 
ATOM   5313  N  N   . LEU C  1 149 ? 35.599   59.415  66.782  1.00 26.95 ? 141  LEU C N   1 
ATOM   5314  C  CA  . LEU C  1 149 ? 36.756   58.555  66.781  1.00 27.81 ? 141  LEU C CA  1 
ATOM   5315  C  C   . LEU C  1 149 ? 36.988   58.164  68.241  1.00 28.52 ? 141  LEU C C   1 
ATOM   5316  O  O   . LEU C  1 149 ? 37.391   58.977  69.074  1.00 27.14 ? 141  LEU C O   1 
ATOM   5317  C  CB  . LEU C  1 149 ? 37.961   59.249  66.139  1.00 27.64 ? 141  LEU C CB  1 
ATOM   5318  C  CG  . LEU C  1 149 ? 37.760   59.815  64.729  1.00 26.36 ? 141  LEU C CG  1 
ATOM   5319  C  CD1 . LEU C  1 149 ? 39.033   60.486  64.224  1.00 25.47 ? 141  LEU C CD1 1 
ATOM   5320  C  CD2 . LEU C  1 149 ? 37.284   58.792  63.717  1.00 25.75 ? 141  LEU C CD2 1 
ATOM   5321  N  N   . LEU C  1 150 ? 36.617   56.933  68.565  1.00 29.75 ? 142  LEU C N   1 
ATOM   5322  C  CA  . LEU C  1 150 ? 36.563   56.524  69.973  1.00 31.39 ? 142  LEU C CA  1 
ATOM   5323  C  C   . LEU C  1 150 ? 37.953   56.496  70.576  1.00 32.13 ? 142  LEU C C   1 
ATOM   5324  O  O   . LEU C  1 150 ? 38.069   56.766  71.713  1.00 31.12 ? 142  LEU C O   1 
ATOM   5325  C  CB  . LEU C  1 150 ? 35.832   55.175  70.158  1.00 31.70 ? 142  LEU C CB  1 
ATOM   5326  C  CG  . LEU C  1 150 ? 34.312   55.246  69.836  1.00 31.43 ? 142  LEU C CG  1 
ATOM   5327  C  CD1 . LEU C  1 150 ? 33.753   53.868  69.851  1.00 28.02 ? 142  LEU C CD1 1 
ATOM   5328  C  CD2 . LEU C  1 150 ? 33.520   56.221  70.739  1.00 24.59 ? 142  LEU C CD2 1 
ATOM   5329  N  N   . ASP C  1 151 ? 39.006   56.227  69.803  1.00 33.68 ? 143  ASP C N   1 
ATOM   5330  C  CA  . ASP C  1 151 ? 40.382   56.337  70.335  1.00 35.13 ? 143  ASP C CA  1 
ATOM   5331  C  C   . ASP C  1 151 ? 41.002   57.743  70.275  1.00 35.42 ? 143  ASP C C   1 
ATOM   5332  O  O   . ASP C  1 151 ? 42.091   57.937  70.756  1.00 35.19 ? 143  ASP C O   1 
ATOM   5333  C  CB  . ASP C  1 151 ? 41.315   55.327  69.651  1.00 35.33 ? 143  ASP C CB  1 
ATOM   5334  C  CG  . ASP C  1 151 ? 40.881   53.886  69.892  1.00 36.08 ? 143  ASP C CG  1 
ATOM   5335  O  OD1 . ASP C  1 151 ? 40.551   53.584  71.046  1.00 36.66 ? 143  ASP C OD1 1 
ATOM   5336  O  OD2 . ASP C  1 151 ? 40.802   53.074  68.930  1.00 35.46 ? 143  ASP C OD2 1 
ATOM   5337  N  N   . HIS C  1 152 ? 40.320   58.726  69.684  1.00 36.17 ? 144  HIS C N   1 
ATOM   5338  C  CA  . HIS C  1 152 ? 40.861   60.088  69.591  1.00 35.38 ? 144  HIS C CA  1 
ATOM   5339  C  C   . HIS C  1 152 ? 39.819   61.100  69.967  1.00 35.44 ? 144  HIS C C   1 
ATOM   5340  O  O   . HIS C  1 152 ? 39.364   61.862  69.147  1.00 35.26 ? 144  HIS C O   1 
ATOM   5341  C  CB  . HIS C  1 152 ? 41.380   60.353  68.201  1.00 35.25 ? 144  HIS C CB  1 
ATOM   5342  C  CG  . HIS C  1 152 ? 42.259   59.267  67.693  1.00 34.97 ? 144  HIS C CG  1 
ATOM   5343  N  ND1 . HIS C  1 152 ? 43.605   59.208  67.985  1.00 34.27 ? 144  HIS C ND1 1 
ATOM   5344  C  CD2 . HIS C  1 152 ? 41.975   58.164  66.962  1.00 34.68 ? 144  HIS C CD2 1 
ATOM   5345  C  CE1 . HIS C  1 152 ? 44.113   58.120  67.430  1.00 36.14 ? 144  HIS C CE1 1 
ATOM   5346  N  NE2 . HIS C  1 152 ? 43.147   57.476  66.797  1.00 34.54 ? 144  HIS C NE2 1 
ATOM   5347  N  N   . PRO C  1 153 ? 39.456   61.129  71.233  1.00 36.46 ? 145  PRO C N   1 
ATOM   5348  C  CA  . PRO C  1 153 ? 38.375   61.992  71.696  1.00 37.14 ? 145  PRO C CA  1 
ATOM   5349  C  C   . PRO C  1 153 ? 38.584   63.464  71.393  1.00 36.62 ? 145  PRO C C   1 
ATOM   5350  O  O   . PRO C  1 153 ? 37.621   64.192  71.296  1.00 36.68 ? 145  PRO C O   1 
ATOM   5351  C  CB  . PRO C  1 153 ? 38.337   61.744  73.232  1.00 37.77 ? 145  PRO C CB  1 
ATOM   5352  C  CG  . PRO C  1 153 ? 39.715   61.240  73.561  1.00 37.48 ? 145  PRO C CG  1 
ATOM   5353  C  CD  . PRO C  1 153 ? 40.170   60.469  72.349  1.00 36.87 ? 145  PRO C CD  1 
ATOM   5354  N  N   . ASP C  1 154 ? 39.817   63.896  71.223  1.00 36.78 ? 146  ASP C N   1 
ATOM   5355  C  CA  . ASP C  1 154 ? 40.064   65.298  70.913  1.00 37.21 ? 146  ASP C CA  1 
ATOM   5356  C  C   . ASP C  1 154 ? 40.164   65.625  69.413  1.00 35.24 ? 146  ASP C C   1 
ATOM   5357  O  O   . ASP C  1 154 ? 40.427   66.755  69.052  1.00 35.08 ? 146  ASP C O   1 
ATOM   5358  C  CB  . ASP C  1 154 ? 41.310   65.774  71.674  1.00 38.48 ? 146  ASP C CB  1 
ATOM   5359  C  CG  . ASP C  1 154 ? 41.037   65.971  73.209  1.00 43.62 ? 146  ASP C CG  1 
ATOM   5360  O  OD1 . ASP C  1 154 ? 40.002   66.577  73.612  1.00 47.50 ? 146  ASP C OD1 1 
ATOM   5361  O  OD2 . ASP C  1 154 ? 41.886   65.528  74.021  1.00 49.91 ? 146  ASP C OD2 1 
ATOM   5362  N  N   . VAL C  1 155 ? 39.937   64.656  68.544  1.00 33.06 ? 147  VAL C N   1 
ATOM   5363  C  CA  . VAL C  1 155 ? 39.842   64.925  67.115  1.00 31.57 ? 147  VAL C CA  1 
ATOM   5364  C  C   . VAL C  1 155 ? 38.373   64.851  66.725  1.00 30.69 ? 147  VAL C C   1 
ATOM   5365  O  O   . VAL C  1 155 ? 37.781   63.823  66.843  1.00 31.10 ? 147  VAL C O   1 
ATOM   5366  C  CB  . VAL C  1 155 ? 40.654   63.913  66.333  1.00 30.74 ? 147  VAL C CB  1 
ATOM   5367  C  CG1 . VAL C  1 155 ? 40.564   64.171  64.844  1.00 29.98 ? 147  VAL C CG1 1 
ATOM   5368  C  CG2 . VAL C  1 155 ? 42.075   63.954  66.812  1.00 29.10 ? 147  VAL C CG2 1 
ATOM   5369  N  N   . LYS C  1 156 ? 37.786   65.935  66.251  1.00 29.75 ? 148  LYS C N   1 
ATOM   5370  C  CA  . LYS C  1 156 ? 36.410   65.907  65.860  1.00 29.39 ? 148  LYS C CA  1 
ATOM   5371  C  C   . LYS C  1 156 ? 36.270   65.623  64.363  1.00 27.09 ? 148  LYS C C   1 
ATOM   5372  O  O   . LYS C  1 156 ? 37.021   66.148  63.569  1.00 25.56 ? 148  LYS C O   1 
ATOM   5373  C  CB  . LYS C  1 156 ? 35.705   67.213  66.198  1.00 30.93 ? 148  LYS C CB  1 
ATOM   5374  C  CG  . LYS C  1 156 ? 35.888   67.749  67.599  1.00 36.65 ? 148  LYS C CG  1 
ATOM   5375  C  CD  . LYS C  1 156 ? 35.461   66.760  68.720  1.00 44.58 ? 148  LYS C CD  1 
ATOM   5376  C  CE  . LYS C  1 156 ? 35.306   67.471  70.113  1.00 48.26 ? 148  LYS C CE  1 
ATOM   5377  N  NZ  . LYS C  1 156 ? 36.325   67.038  71.083  1.00 48.13 ? 148  LYS C NZ  1 
ATOM   5378  N  N   . VAL C  1 157 ? 35.296   64.778  64.016  1.00 25.01 ? 149  VAL C N   1 
ATOM   5379  C  CA  . VAL C  1 157 ? 34.921   64.506  62.647  1.00 24.01 ? 149  VAL C CA  1 
ATOM   5380  C  C   . VAL C  1 157 ? 33.477   64.899  62.457  1.00 23.17 ? 149  VAL C C   1 
ATOM   5381  O  O   . VAL C  1 157 ? 32.711   64.950  63.420  1.00 22.32 ? 149  VAL C O   1 
ATOM   5382  C  CB  . VAL C  1 157 ? 35.125   63.036  62.244  1.00 24.52 ? 149  VAL C CB  1 
ATOM   5383  C  CG1 . VAL C  1 157 ? 36.601   62.699  62.284  1.00 23.77 ? 149  VAL C CG1 1 
ATOM   5384  C  CG2 . VAL C  1 157 ? 34.404   62.134  63.175  1.00 25.68 ? 149  VAL C CG2 1 
ATOM   5385  N  N   . MET C  1 158 ? 33.126   65.170  61.206  1.00 22.32 ? 150  MET C N   1 
ATOM   5386  C  CA  . MET C  1 158 ? 31.829   65.716  60.838  1.00 22.59 ? 150  MET C CA  1 
ATOM   5387  C  C   . MET C  1 158 ? 31.642   65.775  59.338  1.00 21.49 ? 150  MET C C   1 
ATOM   5388  O  O   . MET C  1 158 ? 32.610   65.678  58.562  1.00 20.49 ? 150  MET C O   1 
ATOM   5389  C  CB  . MET C  1 158 ? 31.721   67.157  61.321  1.00 23.38 ? 150  MET C CB  1 
ATOM   5390  C  CG  . MET C  1 158 ? 32.703   68.143  60.615  1.00 26.01 ? 150  MET C CG  1 
ATOM   5391  S  SD  . MET C  1 158 ? 32.810   69.758  61.434  1.00 29.73 ? 150  MET C SD  1 
ATOM   5392  C  CE  . MET C  1 158 ? 33.804   69.294  62.876  1.00 27.63 ? 150  MET C CE  1 
ATOM   5393  N  N   . ASN C  1 159 ? 30.396   65.975  58.935  1.00 19.57 ? 151  ASN C N   1 
ATOM   5394  C  CA  . ASN C  1 159 ? 30.076   66.242  57.549  1.00 19.49 ? 151  ASN C CA  1 
ATOM   5395  C  C   . ASN C  1 159 ? 30.414   65.106  56.570  1.00 19.39 ? 151  ASN C C   1 
ATOM   5396  O  O   . ASN C  1 159 ? 30.359   65.300  55.359  1.00 19.15 ? 151  ASN C O   1 
ATOM   5397  C  CB  . ASN C  1 159 ? 30.737   67.558  57.106  1.00 18.55 ? 151  ASN C CB  1 
ATOM   5398  C  CG  . ASN C  1 159 ? 30.134   68.769  57.773  1.00 18.86 ? 151  ASN C CG  1 
ATOM   5399  O  OD1 . ASN C  1 159 ? 28.922   68.803  58.021  1.00 19.38 ? 151  ASN C OD1 1 
ATOM   5400  N  ND2 . ASN C  1 159 ? 30.946   69.789  58.030  1.00 14.01 ? 151  ASN C ND2 1 
ATOM   5401  N  N   . ILE C  1 160 ? 30.738   63.918  57.078  1.00 19.50 ? 152  ILE C N   1 
ATOM   5402  C  CA  . ILE C  1 160 ? 31.180   62.850  56.217  1.00 19.82 ? 152  ILE C CA  1 
ATOM   5403  C  C   . ILE C  1 160 ? 30.518   61.514  56.512  1.00 20.95 ? 152  ILE C C   1 
ATOM   5404  O  O   . ILE C  1 160 ? 30.410   61.075  57.663  1.00 20.27 ? 152  ILE C O   1 
ATOM   5405  C  CB  . ILE C  1 160 ? 32.705   62.724  56.253  1.00 20.14 ? 152  ILE C CB  1 
ATOM   5406  C  CG1 . ILE C  1 160 ? 33.130   61.770  55.147  1.00 22.00 ? 152  ILE C CG1 1 
ATOM   5407  C  CG2 . ILE C  1 160 ? 33.199   62.339  57.659  1.00 17.80 ? 152  ILE C CG2 1 
ATOM   5408  C  CD1 . ILE C  1 160 ? 34.295   62.192  54.400  1.00 24.81 ? 152  ILE C CD1 1 
ATOM   5409  N  N   . ASP C  1 161 ? 30.016   60.903  55.451  1.00 21.57 ? 153  ASP C N   1 
ATOM   5410  C  CA  . ASP C  1 161 ? 29.474   59.546  55.484  1.00 22.28 ? 153  ASP C CA  1 
ATOM   5411  C  C   . ASP C  1 161 ? 30.543   58.607  56.021  1.00 22.64 ? 153  ASP C C   1 
ATOM   5412  O  O   . ASP C  1 161 ? 31.641   58.593  55.508  1.00 21.88 ? 153  ASP C O   1 
ATOM   5413  C  CB  . ASP C  1 161 ? 29.112   59.147  54.063  1.00 22.93 ? 153  ASP C CB  1 
ATOM   5414  C  CG  . ASP C  1 161 ? 28.452   57.800  53.971  1.00 24.19 ? 153  ASP C CG  1 
ATOM   5415  O  OD1 . ASP C  1 161 ? 29.196   56.822  54.127  1.00 25.76 ? 153  ASP C OD1 1 
ATOM   5416  O  OD2 . ASP C  1 161 ? 27.218   57.732  53.680  1.00 22.55 ? 153  ASP C OD2 1 
ATOM   5417  N  N   . PRO C  1 162 ? 30.227   57.813  57.031  1.00 23.40 ? 154  PRO C N   1 
ATOM   5418  C  CA  . PRO C  1 162 ? 31.242   56.952  57.638  1.00 25.11 ? 154  PRO C CA  1 
ATOM   5419  C  C   . PRO C  1 162 ? 31.868   55.942  56.697  1.00 26.38 ? 154  PRO C C   1 
ATOM   5420  O  O   . PRO C  1 162 ? 33.049   55.610  56.862  1.00 27.31 ? 154  PRO C O   1 
ATOM   5421  C  CB  . PRO C  1 162 ? 30.476   56.254  58.769  1.00 25.06 ? 154  PRO C CB  1 
ATOM   5422  C  CG  . PRO C  1 162 ? 29.438   57.295  59.164  1.00 24.66 ? 154  PRO C CG  1 
ATOM   5423  C  CD  . PRO C  1 162 ? 29.005   57.855  57.842  1.00 24.27 ? 154  PRO C CD  1 
ATOM   5424  N  N   . ASP C  1 163 ? 31.117   55.463  55.715  1.00 27.15 ? 155  ASP C N   1 
ATOM   5425  C  CA  . ASP C  1 163 ? 31.692   54.548  54.744  1.00 28.25 ? 155  ASP C CA  1 
ATOM   5426  C  C   . ASP C  1 163 ? 32.687   55.256  53.849  1.00 27.92 ? 155  ASP C C   1 
ATOM   5427  O  O   . ASP C  1 163 ? 33.708   54.666  53.520  1.00 28.41 ? 155  ASP C O   1 
ATOM   5428  C  CB  . ASP C  1 163 ? 30.599   53.855  53.900  1.00 28.98 ? 155  ASP C CB  1 
ATOM   5429  C  CG  . ASP C  1 163 ? 29.764   52.811  54.721  1.00 31.37 ? 155  ASP C CG  1 
ATOM   5430  O  OD1 . ASP C  1 163 ? 30.107   52.375  55.829  1.00 33.57 ? 155  ASP C OD1 1 
ATOM   5431  O  OD2 . ASP C  1 163 ? 28.709   52.425  54.237  1.00 39.42 ? 155  ASP C OD2 1 
ATOM   5432  N  N   . LEU C  1 164 ? 32.390   56.493  53.431  1.00 27.15 ? 156  LEU C N   1 
ATOM   5433  C  CA  . LEU C  1 164 ? 33.315   57.269  52.598  1.00 26.68 ? 156  LEU C CA  1 
ATOM   5434  C  C   . LEU C  1 164 ? 34.552   57.631  53.418  1.00 26.87 ? 156  LEU C C   1 
ATOM   5435  O  O   . LEU C  1 164 ? 35.646   57.625  52.895  1.00 26.49 ? 156  LEU C O   1 
ATOM   5436  C  CB  . LEU C  1 164 ? 32.678   58.543  52.031  1.00 25.97 ? 156  LEU C CB  1 
ATOM   5437  C  CG  . LEU C  1 164 ? 33.602   59.461  51.202  1.00 26.04 ? 156  LEU C CG  1 
ATOM   5438  C  CD1 . LEU C  1 164 ? 34.313   58.675  50.051  1.00 22.30 ? 156  LEU C CD1 1 
ATOM   5439  C  CD2 . LEU C  1 164 ? 32.875   60.657  50.620  1.00 23.58 ? 156  LEU C CD2 1 
ATOM   5440  N  N   . PHE C  1 165 ? 34.363   57.914  54.705  1.00 26.94 ? 157  PHE C N   1 
ATOM   5441  C  CA  . PHE C  1 165 ? 35.449   58.257  55.589  1.00 27.90 ? 157  PHE C CA  1 
ATOM   5442  C  C   . PHE C  1 165 ? 36.525   57.159  55.639  1.00 29.74 ? 157  PHE C C   1 
ATOM   5443  O  O   . PHE C  1 165 ? 37.725   57.452  55.646  1.00 28.80 ? 157  PHE C O   1 
ATOM   5444  C  CB  . PHE C  1 165 ? 34.929   58.467  56.986  1.00 27.37 ? 157  PHE C CB  1 
ATOM   5445  C  CG  . PHE C  1 165 ? 35.968   58.899  57.945  1.00 26.54 ? 157  PHE C CG  1 
ATOM   5446  C  CD1 . PHE C  1 165 ? 36.501   60.157  57.871  1.00 25.93 ? 157  PHE C CD1 1 
ATOM   5447  C  CD2 . PHE C  1 165 ? 36.422   58.046  58.928  1.00 29.76 ? 157  PHE C CD2 1 
ATOM   5448  C  CE1 . PHE C  1 165 ? 37.460   60.582  58.766  1.00 27.34 ? 157  PHE C CE1 1 
ATOM   5449  C  CE2 . PHE C  1 165 ? 37.415   58.453  59.835  1.00 29.00 ? 157  PHE C CE2 1 
ATOM   5450  C  CZ  . PHE C  1 165 ? 37.910   59.734  59.754  1.00 28.39 ? 157  PHE C CZ  1 
ATOM   5451  N  N   . GLU C  1 166 ? 36.069   55.914  55.681  1.00 30.65 ? 158  GLU C N   1 
ATOM   5452  C  CA  . GLU C  1 166 ? 36.944   54.777  55.632  1.00 32.83 ? 158  GLU C CA  1 
ATOM   5453  C  C   . GLU C  1 166 ? 37.706   54.581  54.326  1.00 33.10 ? 158  GLU C C   1 
ATOM   5454  O  O   . GLU C  1 166 ? 38.630   53.837  54.282  1.00 32.94 ? 158  GLU C O   1 
ATOM   5455  C  CB  . GLU C  1 166 ? 36.154   53.510  55.888  1.00 33.56 ? 158  GLU C CB  1 
ATOM   5456  C  CG  . GLU C  1 166 ? 35.686   53.405  57.333  1.00 37.84 ? 158  GLU C CG  1 
ATOM   5457  C  CD  . GLU C  1 166 ? 34.686   52.266  57.525  1.00 44.63 ? 158  GLU C CD  1 
ATOM   5458  O  OE1 . GLU C  1 166 ? 34.538   51.455  56.539  1.00 47.56 ? 158  GLU C OE1 1 
ATOM   5459  O  OE2 . GLU C  1 166 ? 34.057   52.205  58.624  1.00 45.47 ? 158  GLU C OE2 1 
ATOM   5460  N  N   . LYS C  1 167 ? 37.341   55.249  53.261  1.00 33.80 ? 159  LYS C N   1 
ATOM   5461  C  CA  . LYS C  1 167 ? 38.032   55.058  52.030  1.00 34.18 ? 159  LYS C CA  1 
ATOM   5462  C  C   . LYS C  1 167 ? 38.964   56.195  51.734  1.00 33.89 ? 159  LYS C C   1 
ATOM   5463  O  O   . LYS C  1 167 ? 39.514   56.241  50.652  1.00 35.06 ? 159  LYS C O   1 
ATOM   5464  C  CB  . LYS C  1 167 ? 37.028   54.969  50.885  1.00 35.12 ? 159  LYS C CB  1 
ATOM   5465  C  CG  . LYS C  1 167 ? 36.044   53.825  50.980  1.00 38.15 ? 159  LYS C CG  1 
ATOM   5466  C  CD  . LYS C  1 167 ? 35.023   53.960  49.853  1.00 42.91 ? 159  LYS C CD  1 
ATOM   5467  C  CE  . LYS C  1 167 ? 33.953   52.851  49.887  1.00 47.12 ? 159  LYS C CE  1 
ATOM   5468  N  NZ  . LYS C  1 167 ? 32.830   53.164  48.934  1.00 49.81 ? 159  LYS C NZ  1 
ATOM   5469  N  N   . LEU C  1 168 ? 39.168   57.141  52.634  1.00 33.58 ? 160  LEU C N   1 
ATOM   5470  C  CA  . LEU C  1 168 ? 39.992   58.290  52.248  1.00 33.40 ? 160  LEU C CA  1 
ATOM   5471  C  C   . LEU C  1 168 ? 41.501   58.072  52.360  1.00 34.27 ? 160  LEU C C   1 
ATOM   5472  O  O   . LEU C  1 168 ? 42.298   58.996  52.087  1.00 34.71 ? 160  LEU C O   1 
ATOM   5473  C  CB  . LEU C  1 168 ? 39.633   59.520  53.040  1.00 32.46 ? 160  LEU C CB  1 
ATOM   5474  C  CG  . LEU C  1 168 ? 38.210   59.988  52.881  1.00 31.98 ? 160  LEU C CG  1 
ATOM   5475  C  CD1 . LEU C  1 168 ? 38.072   61.186  53.764  1.00 30.58 ? 160  LEU C CD1 1 
ATOM   5476  C  CD2 . LEU C  1 168 ? 37.960   60.322  51.482  1.00 29.17 ? 160  LEU C CD2 1 
ATOM   5477  N  N   . GLY C  1 169 ? 41.929   56.896  52.783  1.00 33.55 ? 161  GLY C N   1 
ATOM   5478  C  CA  . GLY C  1 169 ? 43.353   56.701  52.903  1.00 33.56 ? 161  GLY C CA  1 
ATOM   5479  C  C   . GLY C  1 169 ? 43.923   57.298  54.167  1.00 33.91 ? 161  GLY C C   1 
ATOM   5480  O  O   . GLY C  1 169 ? 45.116   57.381  54.296  1.00 33.23 ? 161  GLY C O   1 
ATOM   5481  N  N   . ILE C  1 170 ? 43.069   57.696  55.103  1.00 34.24 ? 162  ILE C N   1 
ATOM   5482  C  CA  . ILE C  1 170 ? 43.507   58.203  56.380  1.00 35.33 ? 162  ILE C CA  1 
ATOM   5483  C  C   . ILE C  1 170 ? 44.140   57.031  57.161  1.00 37.62 ? 162  ILE C C   1 
ATOM   5484  O  O   . ILE C  1 170 ? 43.547   55.975  57.215  1.00 37.69 ? 162  ILE C O   1 
ATOM   5485  C  CB  . ILE C  1 170 ? 42.318   58.766  57.169  1.00 34.42 ? 162  ILE C CB  1 
ATOM   5486  C  CG1 . ILE C  1 170 ? 41.816   60.054  56.506  1.00 34.60 ? 162  ILE C CG1 1 
ATOM   5487  C  CG2 . ILE C  1 170 ? 42.714   58.993  58.576  1.00 33.55 ? 162  ILE C CG2 1 
ATOM   5488  C  CD1 . ILE C  1 170 ? 40.500   60.562  57.000  1.00 32.82 ? 162  ILE C CD1 1 
ATOM   5489  N  N   . GLN C  1 171 ? 45.327   57.211  57.748  1.00 39.06 ? 163  GLN C N   1 
ATOM   5490  C  CA  . GLN C  1 171 ? 45.956   56.158  58.544  1.00 40.80 ? 163  GLN C CA  1 
ATOM   5491  C  C   . GLN C  1 171 ? 46.340   56.573  59.941  1.00 39.77 ? 163  GLN C C   1 
ATOM   5492  O  O   . GLN C  1 171 ? 47.031   57.528  60.145  1.00 37.93 ? 163  GLN C O   1 
ATOM   5493  C  CB  . GLN C  1 171 ? 47.205   55.638  57.856  1.00 42.36 ? 163  GLN C CB  1 
ATOM   5494  C  CG  . GLN C  1 171 ? 46.870   54.779  56.667  1.00 48.76 ? 163  GLN C CG  1 
ATOM   5495  C  CD  . GLN C  1 171 ? 48.095   54.283  55.935  1.00 55.84 ? 163  GLN C CD  1 
ATOM   5496  O  OE1 . GLN C  1 171 ? 49.209   54.810  56.105  1.00 60.02 ? 163  GLN C OE1 1 
ATOM   5497  N  NE2 . GLN C  1 171 ? 47.901   53.254  55.119  1.00 59.60 ? 163  GLN C NE2 1 
ATOM   5498  N  N   . GLU C  1 172 ? 45.901   55.792  60.891  1.00 40.41 ? 164  GLU C N   1 
ATOM   5499  C  CA  . GLU C  1 172 ? 46.293   55.944  62.261  1.00 41.87 ? 164  GLU C CA  1 
ATOM   5500  C  C   . GLU C  1 172 ? 47.597   55.160  62.448  1.00 41.82 ? 164  GLU C C   1 
ATOM   5501  O  O   . GLU C  1 172 ? 47.689   53.994  62.099  1.00 42.53 ? 164  GLU C O   1 
ATOM   5502  C  CB  . GLU C  1 172 ? 45.156   55.425  63.124  1.00 41.89 ? 164  GLU C CB  1 
ATOM   5503  C  CG  . GLU C  1 172 ? 45.356   55.422  64.604  1.00 45.61 ? 164  GLU C CG  1 
ATOM   5504  C  CD  . GLU C  1 172 ? 44.223   54.677  65.306  1.00 47.74 ? 164  GLU C CD  1 
ATOM   5505  O  OE1 . GLU C  1 172 ? 44.183   53.427  65.218  1.00 51.97 ? 164  GLU C OE1 1 
ATOM   5506  O  OE2 . GLU C  1 172 ? 43.372   55.336  65.922  1.00 46.57 ? 164  GLU C OE2 1 
ATOM   5507  N  N   . LYS C  1 173 ? 48.613   55.811  62.963  1.00 41.81 ? 165  LYS C N   1 
ATOM   5508  C  CA  . LYS C  1 173 ? 49.873   55.181  63.182  1.00 42.92 ? 165  LYS C CA  1 
ATOM   5509  C  C   . LYS C  1 173 ? 50.556   55.847  64.380  1.00 41.13 ? 165  LYS C C   1 
ATOM   5510  O  O   . LYS C  1 173 ? 50.773   57.040  64.396  1.00 40.29 ? 165  LYS C O   1 
ATOM   5511  C  CB  . LYS C  1 173 ? 50.695   55.261  61.911  1.00 43.91 ? 165  LYS C CB  1 
ATOM   5512  C  CG  . LYS C  1 173 ? 52.017   54.529  61.982  1.00 50.37 ? 165  LYS C CG  1 
ATOM   5513  C  CD  . LYS C  1 173 ? 52.789   54.535  60.643  1.00 56.33 ? 165  LYS C CD  1 
ATOM   5514  C  CE  . LYS C  1 173 ? 54.252   55.018  60.856  1.00 60.45 ? 165  LYS C CE  1 
ATOM   5515  N  NZ  . LYS C  1 173 ? 54.911   55.620  59.639  1.00 61.75 ? 165  LYS C NZ  1 
ATOM   5516  N  N   . ASN C  1 174 ? 50.848   55.046  65.391  1.00 40.35 ? 166  ASN C N   1 
ATOM   5517  C  CA  . ASN C  1 174 ? 51.469   55.483  66.663  1.00 40.37 ? 166  ASN C CA  1 
ATOM   5518  C  C   . ASN C  1 174 ? 50.712   56.603  67.353  1.00 39.35 ? 166  ASN C C   1 
ATOM   5519  O  O   . ASN C  1 174 ? 51.294   57.553  67.792  1.00 38.20 ? 166  ASN C O   1 
ATOM   5520  C  CB  . ASN C  1 174 ? 52.951   55.852  66.461  1.00 40.14 ? 166  ASN C CB  1 
ATOM   5521  C  CG  . ASN C  1 174 ? 53.787   54.651  65.990  1.00 40.40 ? 166  ASN C CG  1 
ATOM   5522  O  OD1 . ASN C  1 174 ? 53.671   53.553  66.524  1.00 36.86 ? 166  ASN C OD1 1 
ATOM   5523  N  ND2 . ASN C  1 174 ? 54.586   54.854  64.959  1.00 38.59 ? 166  ASN C ND2 1 
ATOM   5524  N  N   . GLY C  1 175 ? 49.398   56.480  67.391  1.00 38.58 ? 167  GLY C N   1 
ATOM   5525  C  CA  . GLY C  1 175 ? 48.567   57.483  67.985  1.00 38.82 ? 167  GLY C CA  1 
ATOM   5526  C  C   . GLY C  1 175 ? 48.326   58.730  67.146  1.00 38.08 ? 167  GLY C C   1 
ATOM   5527  O  O   . GLY C  1 175 ? 47.668   59.616  67.594  1.00 38.29 ? 167  GLY C O   1 
ATOM   5528  N  N   . LYS C  1 176 ? 48.842   58.808  65.934  1.00 36.93 ? 168  LYS C N   1 
ATOM   5529  C  CA  . LYS C  1 176 ? 48.650   59.996  65.124  1.00 36.35 ? 168  LYS C CA  1 
ATOM   5530  C  C   . LYS C  1 176 ? 47.832   59.719  63.886  1.00 33.33 ? 168  LYS C C   1 
ATOM   5531  O  O   . LYS C  1 176 ? 47.845   58.632  63.357  1.00 31.17 ? 168  LYS C O   1 
ATOM   5532  C  CB  . LYS C  1 176 ? 49.998   60.566  64.757  1.00 37.34 ? 168  LYS C CB  1 
ATOM   5533  C  CG  . LYS C  1 176 ? 50.699   61.120  65.972  1.00 42.69 ? 168  LYS C CG  1 
ATOM   5534  C  CD  . LYS C  1 176 ? 51.978   61.804  65.563  1.00 50.52 ? 168  LYS C CD  1 
ATOM   5535  C  CE  . LYS C  1 176 ? 52.567   62.715  66.675  1.00 54.24 ? 168  LYS C CE  1 
ATOM   5536  N  NZ  . LYS C  1 176 ? 52.358   62.154  68.017  1.00 55.63 ? 168  LYS C NZ  1 
ATOM   5537  N  N   . ILE C  1 177 ? 47.093   60.707  63.425  1.00 30.70 ? 169  ILE C N   1 
ATOM   5538  C  CA  . ILE C  1 177 ? 46.251   60.478  62.272  1.00 29.44 ? 169  ILE C CA  1 
ATOM   5539  C  C   . ILE C  1 177 ? 46.844   61.126  61.029  1.00 28.24 ? 169  ILE C C   1 
ATOM   5540  O  O   . ILE C  1 177 ? 46.849   62.349  60.928  1.00 28.19 ? 169  ILE C O   1 
ATOM   5541  C  CB  . ILE C  1 177 ? 44.831   60.981  62.537  1.00 29.12 ? 169  ILE C CB  1 
ATOM   5542  C  CG1 . ILE C  1 177 ? 44.279   60.357  63.827  1.00 29.47 ? 169  ILE C CG1 1 
ATOM   5543  C  CG2 . ILE C  1 177 ? 43.951   60.714  61.374  1.00 25.11 ? 169  ILE C CG2 1 
ATOM   5544  C  CD1 . ILE C  1 177 ? 42.950   61.004  64.293  1.00 28.94 ? 169  ILE C CD1 1 
ATOM   5545  N  N   . HIS C  1 178 ? 47.319   60.315  60.081  1.00 27.22 ? 170  HIS C N   1 
ATOM   5546  C  CA  . HIS C  1 178 ? 47.914   60.799  58.815  1.00 26.94 ? 170  HIS C CA  1 
ATOM   5547  C  C   . HIS C  1 178 ? 46.794   60.940  57.756  1.00 25.72 ? 170  HIS C C   1 
ATOM   5548  O  O   . HIS C  1 178 ? 45.983   60.038  57.576  1.00 25.40 ? 170  HIS C O   1 
ATOM   5549  C  CB  . HIS C  1 178 ? 49.027   59.870  58.305  1.00 26.51 ? 170  HIS C CB  1 
ATOM   5550  C  CG  . HIS C  1 178 ? 50.178   59.719  59.245  1.00 29.48 ? 170  HIS C CG  1 
ATOM   5551  N  ND1 . HIS C  1 178 ? 51.394   60.344  59.052  1.00 32.85 ? 170  HIS C ND1 1 
ATOM   5552  C  CD2 . HIS C  1 178 ? 50.314   58.992  60.378  1.00 31.84 ? 170  HIS C CD2 1 
ATOM   5553  C  CE1 . HIS C  1 178 ? 52.215   60.034  60.036  1.00 31.05 ? 170  HIS C CE1 1 
ATOM   5554  N  NE2 . HIS C  1 178 ? 51.599   59.183  60.833  1.00 33.29 ? 170  HIS C NE2 1 
ATOM   5555  N  N   . VAL C  1 179 ? 46.751   62.095  57.101  1.00 24.25 ? 171  VAL C N   1 
ATOM   5556  C  CA  . VAL C  1 179 ? 45.656   62.457  56.210  1.00 23.42 ? 171  VAL C CA  1 
ATOM   5557  C  C   . VAL C  1 179 ? 46.258   62.984  54.947  1.00 22.60 ? 171  VAL C C   1 
ATOM   5558  O  O   . VAL C  1 179 ? 46.911   63.996  54.952  1.00 21.92 ? 171  VAL C O   1 
ATOM   5559  C  CB  . VAL C  1 179 ? 44.701   63.587  56.787  1.00 22.81 ? 171  VAL C CB  1 
ATOM   5560  C  CG1 . VAL C  1 179 ? 43.484   63.822  55.849  1.00 20.21 ? 171  VAL C CG1 1 
ATOM   5561  C  CG2 . VAL C  1 179 ? 44.174   63.252  58.148  1.00 22.84 ? 171  VAL C CG2 1 
ATOM   5562  N  N   . PRO C  1 180 ? 46.013   62.314  53.849  1.00 23.16 ? 172  PRO C N   1 
ATOM   5563  C  CA  . PRO C  1 180 ? 46.428   62.790  52.539  1.00 23.31 ? 172  PRO C CA  1 
ATOM   5564  C  C   . PRO C  1 180 ? 45.640   64.003  52.103  1.00 22.46 ? 172  PRO C C   1 
ATOM   5565  O  O   . PRO C  1 180 ? 44.443   63.973  52.161  1.00 21.85 ? 172  PRO C O   1 
ATOM   5566  C  CB  . PRO C  1 180 ? 46.103   61.636  51.606  1.00 24.05 ? 172  PRO C CB  1 
ATOM   5567  C  CG  . PRO C  1 180 ? 45.467   60.549  52.429  1.00 24.45 ? 172  PRO C CG  1 
ATOM   5568  C  CD  . PRO C  1 180 ? 45.176   61.107  53.785  1.00 23.92 ? 172  PRO C CD  1 
ATOM   5569  N  N   . VAL C  1 181 ? 46.341   65.065  51.694  1.00 22.31 ? 173  VAL C N   1 
ATOM   5570  C  CA  . VAL C  1 181 ? 45.746   66.304  51.229  1.00 20.85 ? 173  VAL C CA  1 
ATOM   5571  C  C   . VAL C  1 181 ? 46.503   66.820  49.998  1.00 21.27 ? 173  VAL C C   1 
ATOM   5572  O  O   . VAL C  1 181 ? 47.649   66.472  49.801  1.00 20.82 ? 173  VAL C O   1 
ATOM   5573  C  CB  . VAL C  1 181 ? 45.809   67.364  52.325  1.00 21.06 ? 173  VAL C CB  1 
ATOM   5574  C  CG1 . VAL C  1 181 ? 45.018   66.915  53.593  1.00 17.86 ? 173  VAL C CG1 1 
ATOM   5575  C  CG2 . VAL C  1 181 ? 47.234   67.707  52.622  1.00 16.50 ? 173  VAL C CG2 1 
ATOM   5576  N  N   . VAL C  1 182 ? 45.854   67.620  49.162  1.00 21.08 ? 174  VAL C N   1 
ATOM   5577  C  CA  . VAL C  1 182 ? 46.506   68.133  48.001  1.00 22.74 ? 174  VAL C CA  1 
ATOM   5578  C  C   . VAL C  1 182 ? 47.169   69.475  48.297  1.00 23.57 ? 174  VAL C C   1 
ATOM   5579  O  O   . VAL C  1 182 ? 47.985   69.937  47.521  1.00 24.35 ? 174  VAL C O   1 
ATOM   5580  C  CB  . VAL C  1 182 ? 45.561   68.337  46.794  1.00 22.67 ? 174  VAL C CB  1 
ATOM   5581  C  CG1 . VAL C  1 182 ? 44.966   67.062  46.355  1.00 23.35 ? 174  VAL C CG1 1 
ATOM   5582  C  CG2 . VAL C  1 182 ? 44.503   69.339  47.131  1.00 22.73 ? 174  VAL C CG2 1 
ATOM   5583  N  N   . ALA C  1 183 ? 46.798   70.118  49.390  1.00 23.56 ? 175  ALA C N   1 
ATOM   5584  C  CA  . ALA C  1 183 ? 47.336   71.431  49.689  1.00 23.70 ? 175  ALA C CA  1 
ATOM   5585  C  C   . ALA C  1 183 ? 47.156   71.754  51.158  1.00 23.58 ? 175  ALA C C   1 
ATOM   5586  O  O   . ALA C  1 183 ? 46.257   71.235  51.824  1.00 23.08 ? 175  ALA C O   1 
ATOM   5587  C  CB  . ALA C  1 183 ? 46.661   72.483  48.815  1.00 23.24 ? 175  ALA C CB  1 
ATOM   5588  N  N   . LYS C  1 184 ? 48.037   72.601  51.659  1.00 24.36 ? 176  LYS C N   1 
ATOM   5589  C  CA  . LYS C  1 184 ? 47.951   73.093  53.020  1.00 25.38 ? 176  LYS C CA  1 
ATOM   5590  C  C   . LYS C  1 184 ? 47.692   74.568  52.935  1.00 24.32 ? 176  LYS C C   1 
ATOM   5591  O  O   . LYS C  1 184 ? 48.507   75.261  52.457  1.00 23.26 ? 176  LYS C O   1 
ATOM   5592  C  CB  . LYS C  1 184 ? 49.242   72.805  53.790  1.00 25.61 ? 176  LYS C CB  1 
ATOM   5593  C  CG  . LYS C  1 184 ? 49.469   71.310  53.987  1.00 29.19 ? 176  LYS C CG  1 
ATOM   5594  C  CD  . LYS C  1 184 ? 50.815   70.978  54.661  1.00 32.32 ? 176  LYS C CD  1 
ATOM   5595  C  CE  . LYS C  1 184 ? 51.121   69.521  54.427  1.00 35.14 ? 176  LYS C CE  1 
ATOM   5596  N  NZ  . LYS C  1 184 ? 52.273   68.993  55.211  1.00 35.89 ? 176  LYS C NZ  1 
ATOM   5597  N  N   . ILE C  1 185 ? 46.534   75.017  53.392  1.00 24.11 ? 177  ILE C N   1 
ATOM   5598  C  CA  . ILE C  1 185 ? 46.103   76.371  53.195  1.00 23.56 ? 177  ILE C CA  1 
ATOM   5599  C  C   . ILE C  1 185 ? 46.304   77.130  54.486  1.00 23.90 ? 177  ILE C C   1 
ATOM   5600  O  O   . ILE C  1 185 ? 45.849   76.695  55.526  1.00 23.54 ? 177  ILE C O   1 
ATOM   5601  C  CB  . ILE C  1 185 ? 44.673   76.404  52.804  1.00 23.83 ? 177  ILE C CB  1 
ATOM   5602  C  CG1 . ILE C  1 185 ? 44.541   75.715  51.433  1.00 26.74 ? 177  ILE C CG1 1 
ATOM   5603  C  CG2 . ILE C  1 185 ? 44.163   77.848  52.713  1.00 22.63 ? 177  ILE C CG2 1 
ATOM   5604  C  CD1 . ILE C  1 185 ? 43.191   75.125  51.183  1.00 26.41 ? 177  ILE C CD1 1 
ATOM   5605  N  N   . PRO C  1 186 ? 46.987   78.281  54.421  1.00 24.04 ? 178  PRO C N   1 
ATOM   5606  C  CA  . PRO C  1 186 ? 47.195   79.076  55.597  1.00 23.72 ? 178  PRO C CA  1 
ATOM   5607  C  C   . PRO C  1 186 ? 45.926   79.760  56.046  1.00 23.06 ? 178  PRO C C   1 
ATOM   5608  O  O   . PRO C  1 186 ? 45.081   80.051  55.224  1.00 22.00 ? 178  PRO C O   1 
ATOM   5609  C  CB  . PRO C  1 186 ? 48.225   80.125  55.154  1.00 24.19 ? 178  PRO C CB  1 
ATOM   5610  C  CG  . PRO C  1 186 ? 48.615   79.819  53.849  1.00 24.76 ? 178  PRO C CG  1 
ATOM   5611  C  CD  . PRO C  1 186 ? 47.665   78.846  53.238  1.00 23.93 ? 178  PRO C CD  1 
ATOM   5612  N  N   . ALA C  1 187 ? 45.819   80.032  57.344  1.00 22.40 ? 179  ALA C N   1 
ATOM   5613  C  CA  . ALA C  1 187 ? 44.632   80.679  57.930  1.00 23.08 ? 179  ALA C CA  1 
ATOM   5614  C  C   . ALA C  1 187 ? 44.200   81.926  57.168  1.00 23.25 ? 179  ALA C C   1 
ATOM   5615  O  O   . ALA C  1 187 ? 42.987   82.117  56.897  1.00 22.87 ? 179  ALA C O   1 
ATOM   5616  C  CB  . ALA C  1 187 ? 44.857   81.024  59.396  1.00 21.84 ? 179  ALA C CB  1 
ATOM   5617  N  N   . HIS C  1 188 ? 45.172   82.732  56.775  1.00 22.92 ? 180  HIS C N   1 
ATOM   5618  C  CA  . HIS C  1 188 ? 44.872   83.980  56.113  1.00 24.34 ? 180  HIS C CA  1 
ATOM   5619  C  C   . HIS C  1 188 ? 44.247   83.838  54.741  1.00 23.95 ? 180  HIS C C   1 
ATOM   5620  O  O   . HIS C  1 188 ? 43.659   84.811  54.234  1.00 23.59 ? 180  HIS C O   1 
ATOM   5621  C  CB  . HIS C  1 188 ? 46.087   84.941  56.051  1.00 24.80 ? 180  HIS C CB  1 
ATOM   5622  C  CG  . HIS C  1 188 ? 47.191   84.473  55.166  1.00 24.72 ? 180  HIS C CG  1 
ATOM   5623  N  ND1 . HIS C  1 188 ? 48.307   83.824  55.647  1.00 26.32 ? 180  HIS C ND1 1 
ATOM   5624  C  CD2 . HIS C  1 188 ? 47.363   84.577  53.832  1.00 25.82 ? 180  HIS C CD2 1 
ATOM   5625  C  CE1 . HIS C  1 188 ? 49.129   83.562  54.650  1.00 25.41 ? 180  HIS C CE1 1 
ATOM   5626  N  NE2 . HIS C  1 188 ? 48.571   83.988  53.536  1.00 25.04 ? 180  HIS C NE2 1 
ATOM   5627  N  N   . MET C  1 189 ? 44.351   82.671  54.135  1.00 24.54 ? 181  MET C N   1 
ATOM   5628  C  CA  . MET C  1 189 ? 43.653   82.444  52.872  1.00 25.66 ? 181  MET C CA  1 
ATOM   5629  C  C   . MET C  1 189 ? 42.185   82.069  53.031  1.00 25.75 ? 181  MET C C   1 
ATOM   5630  O  O   . MET C  1 189 ? 41.479   81.965  52.052  1.00 26.80 ? 181  MET C O   1 
ATOM   5631  C  CB  . MET C  1 189 ? 44.391   81.467  51.998  1.00 26.63 ? 181  MET C CB  1 
ATOM   5632  C  CG  . MET C  1 189 ? 45.779   81.990  51.492  1.00 29.39 ? 181  MET C CG  1 
ATOM   5633  S  SD  . MET C  1 189 ? 45.631   83.375  50.347  1.00 35.55 ? 181  MET C SD  1 
ATOM   5634  C  CE  . MET C  1 189 ? 44.535   82.810  49.087  1.00 33.17 ? 181  MET C CE  1 
ATOM   5635  N  N   . MET C  1 190 ? 41.686   81.960  54.259  1.00 25.44 ? 182  MET C N   1 
ATOM   5636  C  CA  . MET C  1 190 ? 40.259   81.698  54.444  1.00 24.96 ? 182  MET C CA  1 
ATOM   5637  C  C   . MET C  1 190 ? 39.448   82.988  54.630  1.00 25.77 ? 182  MET C C   1 
ATOM   5638  O  O   . MET C  1 190 ? 39.880   83.903  55.345  1.00 25.85 ? 182  MET C O   1 
ATOM   5639  C  CB  . MET C  1 190 ? 40.026   80.742  55.601  1.00 24.21 ? 182  MET C CB  1 
ATOM   5640  C  CG  . MET C  1 190 ? 40.808   79.436  55.490  1.00 23.11 ? 182  MET C CG  1 
ATOM   5641  S  SD  . MET C  1 190 ? 40.483   78.469  54.002  1.00 21.19 ? 182  MET C SD  1 
ATOM   5642  C  CE  . MET C  1 190 ? 38.680   78.200  54.211  1.00 16.12 ? 182  MET C CE  1 
ATOM   5643  N  N   . GLY C  1 191 ? 38.283   83.052  53.967  1.00 25.42 ? 183  GLY C N   1 
ATOM   5644  C  CA  . GLY C  1 191 ? 37.376   84.191  54.076  1.00 26.04 ? 183  GLY C CA  1 
ATOM   5645  C  C   . GLY C  1 191 ? 35.912   83.836  54.377  1.00 25.95 ? 183  GLY C C   1 
ATOM   5646  O  O   . GLY C  1 191 ? 35.597   83.297  55.414  1.00 26.03 ? 183  GLY C O   1 
ATOM   5647  N  N   . SER C  1 192 ? 35.039   84.127  53.427  1.00 25.96 ? 184  SER C N   1 
ATOM   5648  C  CA  . SER C  1 192 ? 33.603   84.083  53.614  1.00 25.86 ? 184  SER C CA  1 
ATOM   5649  C  C   . SER C  1 192 ? 33.110   82.803  54.269  1.00 24.87 ? 184  SER C C   1 
ATOM   5650  O  O   . SER C  1 192 ? 33.339   81.742  53.764  1.00 24.74 ? 184  SER C O   1 
ATOM   5651  C  CB  . SER C  1 192 ? 32.907   84.248  52.258  1.00 25.87 ? 184  SER C CB  1 
ATOM   5652  O  OG  . SER C  1 192 ? 31.514   84.415  52.432  1.00 25.59 ? 184  SER C OG  1 
ATOM   5653  N  N   . GLY C  1 193 ? 32.386   82.948  55.373  1.00 24.33 ? 185  GLY C N   1 
ATOM   5654  C  CA  . GLY C  1 193 ? 31.864   81.843  56.134  1.00 23.84 ? 185  GLY C CA  1 
ATOM   5655  C  C   . GLY C  1 193 ? 32.493   81.785  57.511  1.00 24.43 ? 185  GLY C C   1 
ATOM   5656  O  O   . GLY C  1 193 ? 31.895   81.206  58.442  1.00 24.06 ? 185  GLY C O   1 
ATOM   5657  N  N   . ILE C  1 194 ? 33.702   82.349  57.666  1.00 24.11 ? 186  ILE C N   1 
ATOM   5658  C  CA  . ILE C  1 194 ? 34.249   82.456  58.993  1.00 24.37 ? 186  ILE C CA  1 
ATOM   5659  C  C   . ILE C  1 194 ? 33.163   83.071  59.872  1.00 24.68 ? 186  ILE C C   1 
ATOM   5660  O  O   . ILE C  1 194 ? 32.463   84.037  59.503  1.00 24.42 ? 186  ILE C O   1 
ATOM   5661  C  CB  . ILE C  1 194 ? 35.556   83.292  59.075  1.00 25.32 ? 186  ILE C CB  1 
ATOM   5662  C  CG1 . ILE C  1 194 ? 36.709   82.587  58.323  1.00 26.16 ? 186  ILE C CG1 1 
ATOM   5663  C  CG2 . ILE C  1 194 ? 35.997   83.475  60.546  1.00 22.20 ? 186  ILE C CG2 1 
ATOM   5664  C  CD1 . ILE C  1 194 ? 38.011   83.403  58.176  1.00 26.54 ? 186  ILE C CD1 1 
ATOM   5665  N  N   . GLY C  1 195 ? 33.015   82.478  61.039  1.00 25.28 ? 187  GLY C N   1 
ATOM   5666  C  CA  . GLY C  1 195 ? 32.029   82.922  62.017  1.00 25.94 ? 187  GLY C CA  1 
ATOM   5667  C  C   . GLY C  1 195 ? 30.641   82.311  61.855  1.00 25.11 ? 187  GLY C C   1 
ATOM   5668  O  O   . GLY C  1 195 ? 29.762   82.582  62.669  1.00 25.44 ? 187  GLY C O   1 
ATOM   5669  N  N   . ALA C  1 196 ? 30.443   81.455  60.853  1.00 24.36 ? 188  ALA C N   1 
ATOM   5670  C  CA  . ALA C  1 196 ? 29.174   80.763  60.768  1.00 24.23 ? 188  ALA C CA  1 
ATOM   5671  C  C   . ALA C  1 196 ? 29.008   80.034  62.115  1.00 24.87 ? 188  ALA C C   1 
ATOM   5672  O  O   . ALA C  1 196 ? 29.966   79.610  62.789  1.00 23.38 ? 188  ALA C O   1 
ATOM   5673  C  CB  . ALA C  1 196 ? 29.058   79.799  59.533  1.00 22.94 ? 188  ALA C CB  1 
ATOM   5674  N  N   . SER C  1 197 ? 27.766   79.951  62.516  1.00 25.18 ? 189  SER C N   1 
ATOM   5675  C  CA  . SER C  1 197 ? 27.406   79.408  63.782  1.00 26.38 ? 189  SER C CA  1 
ATOM   5676  C  C   . SER C  1 197 ? 27.875   77.948  64.034  1.00 25.46 ? 189  SER C C   1 
ATOM   5677  O  O   . SER C  1 197 ? 28.244   77.590  65.164  1.00 24.58 ? 189  SER C O   1 
ATOM   5678  C  CB  . SER C  1 197 ? 25.899   79.506  63.855  1.00 27.14 ? 189  SER C CB  1 
ATOM   5679  O  OG  . SER C  1 197 ? 25.537   79.012  65.094  1.00 34.05 ? 189  SER C OG  1 
ATOM   5680  N  N   . SER C  1 198 ? 27.855   77.115  62.984  1.00 24.07 ? 190  SER C N   1 
ATOM   5681  C  CA  . SER C  1 198 ? 28.254   75.718  63.081  1.00 22.91 ? 190  SER C CA  1 
ATOM   5682  C  C   . SER C  1 198 ? 28.948   75.203  61.820  1.00 21.75 ? 190  SER C C   1 
ATOM   5683  O  O   . SER C  1 198 ? 28.435   75.300  60.715  1.00 20.84 ? 190  SER C O   1 
ATOM   5684  C  CB  . SER C  1 198 ? 27.039   74.829  63.382  1.00 23.47 ? 190  SER C CB  1 
ATOM   5685  O  OG  . SER C  1 198 ? 27.372   73.433  63.300  1.00 23.88 ? 190  SER C OG  1 
ATOM   5686  N  N   . SER C  1 199 ? 30.113   74.611  62.006  1.00 20.28 ? 191  SER C N   1 
ATOM   5687  C  CA  . SER C  1 199 ? 30.805   73.980  60.908  1.00 19.96 ? 191  SER C CA  1 
ATOM   5688  C  C   . SER C  1 199 ? 30.068   72.768  60.335  1.00 19.81 ? 191  SER C C   1 
ATOM   5689  O  O   . SER C  1 199 ? 30.422   72.312  59.258  1.00 19.34 ? 191  SER C O   1 
ATOM   5690  C  CB  . SER C  1 199 ? 32.202   73.567  61.358  1.00 19.97 ? 191  SER C CB  1 
ATOM   5691  O  OG  . SER C  1 199 ? 32.096   72.719  62.488  1.00 17.15 ? 191  SER C OG  1 
ATOM   5692  N  N   . ALA C  1 200 ? 29.051   72.261  61.040  1.00 19.73 ? 192  ALA C N   1 
ATOM   5693  C  CA  . ALA C  1 200 ? 28.217   71.162  60.559  1.00 19.87 ? 192  ALA C CA  1 
ATOM   5694  C  C   . ALA C  1 200 ? 27.200   71.581  59.507  1.00 20.22 ? 192  ALA C C   1 
ATOM   5695  O  O   . ALA C  1 200 ? 26.573   70.703  58.917  1.00 20.40 ? 192  ALA C O   1 
ATOM   5696  C  CB  . ALA C  1 200 ? 27.478   70.472  61.738  1.00 18.97 ? 192  ALA C CB  1 
ATOM   5697  N  N   . SER C  1 201 ? 27.014   72.882  59.270  1.00 20.32 ? 193  SER C N   1 
ATOM   5698  C  CA  . SER C  1 201 ? 25.924   73.318  58.396  1.00 21.40 ? 193  SER C CA  1 
ATOM   5699  C  C   . SER C  1 201 ? 26.351   74.274  57.284  1.00 21.77 ? 193  SER C C   1 
ATOM   5700  O  O   . SER C  1 201 ? 25.522   74.890  56.601  1.00 22.81 ? 193  SER C O   1 
ATOM   5701  C  CB  . SER C  1 201 ? 24.788   73.897  59.236  1.00 21.44 ? 193  SER C CB  1 
ATOM   5702  O  OG  . SER C  1 201 ? 25.249   74.987  59.965  1.00 24.06 ? 193  SER C OG  1 
ATOM   5703  N  N   . THR C  1 202 ? 27.644   74.382  57.061  1.00 21.68 ? 194  THR C N   1 
ATOM   5704  C  CA  . THR C  1 202 ? 28.101   75.274  56.025  1.00 21.58 ? 194  THR C CA  1 
ATOM   5705  C  C   . THR C  1 202 ? 29.496   74.934  55.528  1.00 22.45 ? 194  THR C C   1 
ATOM   5706  O  O   . THR C  1 202 ? 30.236   74.163  56.153  1.00 22.74 ? 194  THR C O   1 
ATOM   5707  C  CB  . THR C  1 202 ? 28.044   76.771  56.498  1.00 21.53 ? 194  THR C CB  1 
ATOM   5708  O  OG1 . THR C  1 202 ? 28.183   77.626  55.365  1.00 18.85 ? 194  THR C OG1 1 
ATOM   5709  C  CG2 . THR C  1 202 ? 29.109   77.079  57.466  1.00 19.14 ? 194  THR C CG2 1 
ATOM   5710  N  N   . ASP C  1 203 ? 29.823   75.508  54.373  1.00 22.29 ? 195  ASP C N   1 
ATOM   5711  C  CA  . ASP C  1 203 ? 31.179   75.591  53.902  1.00 22.26 ? 195  ASP C CA  1 
ATOM   5712  C  C   . ASP C  1 203 ? 31.766   76.949  54.242  1.00 21.40 ? 195  ASP C C   1 
ATOM   5713  O  O   . ASP C  1 203 ? 31.074   77.822  54.700  1.00 22.33 ? 195  ASP C O   1 
ATOM   5714  C  CB  . ASP C  1 203 ? 31.207   75.392  52.402  1.00 22.51 ? 195  ASP C CB  1 
ATOM   5715  C  CG  . ASP C  1 203 ? 30.480   76.495  51.655  1.00 23.64 ? 195  ASP C CG  1 
ATOM   5716  O  OD1 . ASP C  1 203 ? 29.533   77.088  52.197  1.00 23.65 ? 195  ASP C OD1 1 
ATOM   5717  O  OD2 . ASP C  1 203 ? 30.874   76.803  50.525  1.00 28.77 ? 195  ASP C OD2 1 
ATOM   5718  N  N   . TYR C  1 204 ? 33.047   77.115  54.015  1.00 21.39 ? 196  TYR C N   1 
ATOM   5719  C  CA  . TYR C  1 204 ? 33.672   78.453  53.945  1.00 21.62 ? 196  TYR C CA  1 
ATOM   5720  C  C   . TYR C  1 204 ? 34.833   78.498  52.953  1.00 21.66 ? 196  TYR C C   1 
ATOM   5721  O  O   . TYR C  1 204 ? 35.382   77.461  52.589  1.00 20.77 ? 196  TYR C O   1 
ATOM   5722  C  CB  . TYR C  1 204 ? 34.054   79.023  55.309  1.00 20.70 ? 196  TYR C CB  1 
ATOM   5723  C  CG  . TYR C  1 204 ? 35.255   78.457  56.067  1.00 21.58 ? 196  TYR C CG  1 
ATOM   5724  C  CD1 . TYR C  1 204 ? 36.150   79.313  56.710  1.00 21.03 ? 196  TYR C CD1 1 
ATOM   5725  C  CD2 . TYR C  1 204 ? 35.449   77.118  56.240  1.00 20.14 ? 196  TYR C CD2 1 
ATOM   5726  C  CE1 . TYR C  1 204 ? 37.202   78.850  57.438  1.00 20.44 ? 196  TYR C CE1 1 
ATOM   5727  C  CE2 . TYR C  1 204 ? 36.493   76.622  57.015  1.00 19.96 ? 196  TYR C CE2 1 
ATOM   5728  C  CZ  . TYR C  1 204 ? 37.383   77.488  57.612  1.00 23.29 ? 196  TYR C CZ  1 
ATOM   5729  O  OH  . TYR C  1 204 ? 38.454   77.023  58.374  1.00 19.27 ? 196  TYR C OH  1 
ATOM   5730  N  N   . ASP C  1 205 ? 35.185   79.719  52.547  1.00 22.22 ? 197  ASP C N   1 
ATOM   5731  C  CA  . ASP C  1 205 ? 35.884   79.981  51.306  1.00 23.10 ? 197  ASP C CA  1 
ATOM   5732  C  C   . ASP C  1 205 ? 37.383   80.089  51.477  1.00 23.14 ? 197  ASP C C   1 
ATOM   5733  O  O   . ASP C  1 205 ? 37.867   80.710  52.375  1.00 22.77 ? 197  ASP C O   1 
ATOM   5734  C  CB  . ASP C  1 205 ? 35.320   81.265  50.616  1.00 24.03 ? 197  ASP C CB  1 
ATOM   5735  C  CG  . ASP C  1 205 ? 33.898   81.071  50.004  1.00 24.80 ? 197  ASP C CG  1 
ATOM   5736  O  OD1 . ASP C  1 205 ? 33.173   80.063  50.282  1.00 28.39 ? 197  ASP C OD1 1 
ATOM   5737  O  OD2 . ASP C  1 205 ? 33.496   81.946  49.202  1.00 28.43 ? 197  ASP C OD2 1 
ATOM   5738  N  N   . ILE C  1 206 ? 38.109   79.420  50.597  1.00 24.11 ? 198  ILE C N   1 
ATOM   5739  C  CA  . ILE C  1 206 ? 39.503   79.701  50.347  1.00 24.84 ? 198  ILE C CA  1 
ATOM   5740  C  C   . ILE C  1 206 ? 39.444   80.881  49.381  1.00 26.01 ? 198  ILE C C   1 
ATOM   5741  O  O   . ILE C  1 206 ? 38.963   80.761  48.245  1.00 25.56 ? 198  ILE C O   1 
ATOM   5742  C  CB  . ILE C  1 206 ? 40.178   78.546  49.604  1.00 24.53 ? 198  ILE C CB  1 
ATOM   5743  C  CG1 . ILE C  1 206 ? 40.108   77.250  50.397  1.00 25.51 ? 198  ILE C CG1 1 
ATOM   5744  C  CG2 . ILE C  1 206 ? 41.595   78.863  49.255  1.00 23.19 ? 198  ILE C CG2 1 
ATOM   5745  C  CD1 . ILE C  1 206 ? 40.400   76.053  49.529  1.00 22.66 ? 198  ILE C CD1 1 
ATOM   5746  N  N   . MET C  1 207 ? 39.926   82.021  49.797  1.00 27.19 ? 199  MET C N   1 
ATOM   5747  C  CA  . MET C  1 207 ? 39.821   83.190  48.902  1.00 28.89 ? 199  MET C CA  1 
ATOM   5748  C  C   . MET C  1 207 ? 41.072   83.446  48.045  1.00 29.60 ? 199  MET C C   1 
ATOM   5749  O  O   . MET C  1 207 ? 41.540   84.522  47.977  1.00 32.03 ? 199  MET C O   1 
ATOM   5750  C  CB  . MET C  1 207 ? 39.401   84.431  49.690  1.00 29.24 ? 199  MET C CB  1 
ATOM   5751  C  CG  . MET C  1 207 ? 40.196   84.731  50.972  1.00 27.60 ? 199  MET C CG  1 
ATOM   5752  S  SD  . MET C  1 207 ? 40.064   86.486  51.313  1.00 24.55 ? 199  MET C SD  1 
ATOM   5753  C  CE  . MET C  1 207 ? 40.849   86.323  52.928  1.00 23.89 ? 199  MET C CE  1 
ATOM   5754  N  N   . ALA C  1 208 ? 41.581   82.425  47.388  1.00 29.82 ? 200  ALA C N   1 
ATOM   5755  C  CA  . ALA C  1 208 ? 42.685   82.520  46.476  1.00 29.79 ? 200  ALA C CA  1 
ATOM   5756  C  C   . ALA C  1 208 ? 42.077   82.737  45.111  1.00 30.30 ? 200  ALA C C   1 
ATOM   5757  O  O   . ALA C  1 208 ? 41.185   81.980  44.707  1.00 29.25 ? 200  ALA C O   1 
ATOM   5758  C  CB  . ALA C  1 208 ? 43.468   81.201  46.496  1.00 28.84 ? 200  ALA C CB  1 
ATOM   5759  N  N   . SER C  1 209 ? 42.539   83.753  44.397  1.00 30.93 ? 201  SER C N   1 
ATOM   5760  C  CA  . SER C  1 209 ? 42.073   83.978  43.023  1.00 32.95 ? 201  SER C CA  1 
ATOM   5761  C  C   . SER C  1 209 ? 42.604   82.972  42.048  1.00 32.68 ? 201  SER C C   1 
ATOM   5762  O  O   . SER C  1 209 ? 42.012   82.778  41.038  1.00 32.29 ? 201  SER C O   1 
ATOM   5763  C  CB  . SER C  1 209 ? 42.515   85.338  42.505  1.00 33.22 ? 201  SER C CB  1 
ATOM   5764  O  OG  . SER C  1 209 ? 42.304   86.253  43.502  1.00 36.17 ? 201  SER C OG  1 
ATOM   5765  N  N   . ASN C  1 210 ? 43.757   82.416  42.365  1.00 33.47 ? 202  ASN C N   1 
ATOM   5766  C  CA  . ASN C  1 210 ? 44.470   81.497  41.535  1.00 35.32 ? 202  ASN C CA  1 
ATOM   5767  C  C   . ASN C  1 210 ? 45.033   80.423  42.393  1.00 34.29 ? 202  ASN C C   1 
ATOM   5768  O  O   . ASN C  1 210 ? 45.392   80.674  43.511  1.00 33.03 ? 202  ASN C O   1 
ATOM   5769  C  CB  . ASN C  1 210 ? 45.648   82.204  40.896  1.00 36.45 ? 202  ASN C CB  1 
ATOM   5770  C  CG  . ASN C  1 210 ? 45.205   83.241  39.929  1.00 41.89 ? 202  ASN C CG  1 
ATOM   5771  O  OD1 . ASN C  1 210 ? 44.542   82.914  38.933  1.00 47.92 ? 202  ASN C OD1 1 
ATOM   5772  N  ND2 . ASN C  1 210 ? 45.489   84.515  40.228  1.00 43.99 ? 202  ASN C ND2 1 
ATOM   5773  N  N   . PRO C  1 211 ? 45.163   79.234  41.846  1.00 33.97 ? 203  PRO C N   1 
ATOM   5774  C  CA  . PRO C  1 211 ? 45.711   78.111  42.587  1.00 34.50 ? 203  PRO C CA  1 
ATOM   5775  C  C   . PRO C  1 211 ? 47.143   78.390  43.017  1.00 35.05 ? 203  PRO C C   1 
ATOM   5776  O  O   . PRO C  1 211 ? 47.563   77.996  44.082  1.00 33.98 ? 203  PRO C O   1 
ATOM   5777  C  CB  . PRO C  1 211 ? 45.642   76.947  41.585  1.00 34.72 ? 203  PRO C CB  1 
ATOM   5778  C  CG  . PRO C  1 211 ? 45.073   77.519  40.327  1.00 34.88 ? 203  PRO C CG  1 
ATOM   5779  C  CD  . PRO C  1 211 ? 44.535   78.847  40.588  1.00 33.97 ? 203  PRO C CD  1 
ATOM   5780  N  N   . GLU C  1 212 ? 47.846   79.120  42.199  1.00 36.40 ? 204  GLU C N   1 
ATOM   5781  C  CA  . GLU C  1 212 ? 49.216   79.473  42.408  1.00 38.96 ? 204  GLU C CA  1 
ATOM   5782  C  C   . GLU C  1 212 ? 49.404   80.273  43.666  1.00 38.25 ? 204  GLU C C   1 
ATOM   5783  O  O   . GLU C  1 212 ? 50.421   80.214  44.272  1.00 36.38 ? 204  GLU C O   1 
ATOM   5784  C  CB  . GLU C  1 212 ? 49.710   80.238  41.199  1.00 40.24 ? 204  GLU C CB  1 
ATOM   5785  C  CG  . GLU C  1 212 ? 49.857   79.399  39.991  1.00 45.36 ? 204  GLU C CG  1 
ATOM   5786  C  CD  . GLU C  1 212 ? 48.633   79.347  39.054  1.00 51.88 ? 204  GLU C CD  1 
ATOM   5787  O  OE1 . GLU C  1 212 ? 47.637   80.072  39.201  1.00 51.18 ? 204  GLU C OE1 1 
ATOM   5788  O  OE2 . GLU C  1 212 ? 48.692   78.554  38.127  1.00 55.31 ? 204  GLU C OE2 1 
ATOM   5789  N  N   . ASP C  1 213 ? 48.375   81.003  44.044  1.00 38.74 ? 205  ASP C N   1 
ATOM   5790  C  CA  . ASP C  1 213 ? 48.317   81.713  45.319  1.00 38.82 ? 205  ASP C CA  1 
ATOM   5791  C  C   . ASP C  1 213 ? 48.371   80.754  46.499  1.00 37.82 ? 205  ASP C C   1 
ATOM   5792  O  O   . ASP C  1 213 ? 48.775   81.147  47.558  1.00 37.92 ? 205  ASP C O   1 
ATOM   5793  C  CB  . ASP C  1 213 ? 47.055   82.568  45.406  1.00 39.20 ? 205  ASP C CB  1 
ATOM   5794  C  CG  . ASP C  1 213 ? 47.027   83.678  44.380  1.00 41.01 ? 205  ASP C CG  1 
ATOM   5795  O  OD1 . ASP C  1 213 ? 48.111   84.205  44.060  1.00 42.47 ? 205  ASP C OD1 1 
ATOM   5796  O  OD2 . ASP C  1 213 ? 45.926   84.028  43.892  1.00 42.05 ? 205  ASP C OD2 1 
ATOM   5797  N  N   . LEU C  1 214 ? 47.959   79.507  46.303  1.00 36.52 ? 206  LEU C N   1 
ATOM   5798  C  CA  . LEU C  1 214 ? 48.132   78.459  47.286  1.00 35.75 ? 206  LEU C CA  1 
ATOM   5799  C  C   . LEU C  1 214 ? 49.331   77.540  47.032  1.00 35.70 ? 206  LEU C C   1 
ATOM   5800  O  O   . LEU C  1 214 ? 49.441   76.484  47.621  1.00 34.62 ? 206  LEU C O   1 
ATOM   5801  C  CB  . LEU C  1 214 ? 46.877   77.589  47.344  1.00 35.42 ? 206  LEU C CB  1 
ATOM   5802  C  CG  . LEU C  1 214 ? 45.502   78.243  47.389  1.00 34.37 ? 206  LEU C CG  1 
ATOM   5803  C  CD1 . LEU C  1 214 ? 44.416   77.214  47.057  1.00 30.07 ? 206  LEU C CD1 1 
ATOM   5804  C  CD2 . LEU C  1 214 ? 45.307   78.866  48.739  1.00 29.99 ? 206  LEU C CD2 1 
ATOM   5805  N  N   . GLY C  1 215 ? 50.218   77.900  46.121  1.00 36.27 ? 207  GLY C N   1 
ATOM   5806  C  CA  . GLY C  1 215 ? 51.398   77.077  45.885  1.00 35.54 ? 207  GLY C CA  1 
ATOM   5807  C  C   . GLY C  1 215 ? 51.111   75.755  45.183  1.00 35.59 ? 207  GLY C C   1 
ATOM   5808  O  O   . GLY C  1 215 ? 51.915   74.852  45.279  1.00 35.75 ? 207  GLY C O   1 
ATOM   5809  N  N   . VAL C  1 216 ? 49.988   75.649  44.461  1.00 33.70 ? 208  VAL C N   1 
ATOM   5810  C  CA  . VAL C  1 216 ? 49.670   74.449  43.704  1.00 32.85 ? 208  VAL C CA  1 
ATOM   5811  C  C   . VAL C  1 216 ? 49.273   74.847  42.306  1.00 31.90 ? 208  VAL C C   1 
ATOM   5812  O  O   . VAL C  1 216 ? 48.927   75.984  42.058  1.00 31.79 ? 208  VAL C O   1 
ATOM   5813  C  CB  . VAL C  1 216 ? 48.569   73.605  44.390  1.00 33.24 ? 208  VAL C CB  1 
ATOM   5814  C  CG1 . VAL C  1 216 ? 49.087   73.144  45.728  1.00 33.34 ? 208  VAL C CG1 1 
ATOM   5815  C  CG2 . VAL C  1 216 ? 47.251   74.398  44.518  1.00 30.72 ? 208  VAL C CG2 1 
ATOM   5816  N  N   . ALA C  1 217 ? 49.390   73.918  41.379  1.00 30.37 ? 209  ALA C N   1 
ATOM   5817  C  CA  . ALA C  1 217 ? 49.095   74.204  39.996  1.00 30.46 ? 209  ALA C CA  1 
ATOM   5818  C  C   . ALA C  1 217 ? 47.596   74.176  39.702  1.00 29.54 ? 209  ALA C C   1 
ATOM   5819  O  O   . ALA C  1 217 ? 47.164   74.790  38.744  1.00 29.28 ? 209  ALA C O   1 
ATOM   5820  C  CB  . ALA C  1 217 ? 49.841   73.192  39.058  1.00 30.52 ? 209  ALA C CB  1 
ATOM   5821  N  N   . ASP C  1 218 ? 46.826   73.446  40.499  1.00 28.73 ? 210  ASP C N   1 
ATOM   5822  C  CA  . ASP C  1 218 ? 45.382   73.363  40.318  1.00 29.22 ? 210  ASP C CA  1 
ATOM   5823  C  C   . ASP C  1 218 ? 44.773   72.966  41.644  1.00 28.38 ? 210  ASP C C   1 
ATOM   5824  O  O   . ASP C  1 218 ? 45.472   72.481  42.539  1.00 28.18 ? 210  ASP C O   1 
ATOM   5825  C  CB  . ASP C  1 218 ? 45.011   72.365  39.215  1.00 29.71 ? 210  ASP C CB  1 
ATOM   5826  C  CG  . ASP C  1 218 ? 43.550   72.459  38.776  1.00 31.46 ? 210  ASP C CG  1 
ATOM   5827  O  OD1 . ASP C  1 218 ? 42.831   73.473  38.991  1.00 32.30 ? 210  ASP C OD1 1 
ATOM   5828  O  OD2 . ASP C  1 218 ? 43.089   71.465  38.209  1.00 35.58 ? 210  ASP C OD2 1 
ATOM   5829  N  N   . LEU C  1 219 ? 43.497   73.308  41.819  1.00 26.65 ? 211  LEU C N   1 
ATOM   5830  C  CA  . LEU C  1 219 ? 42.723   72.842  42.934  1.00 24.98 ? 211  LEU C CA  1 
ATOM   5831  C  C   . LEU C  1 219 ? 41.437   72.380  42.316  1.00 24.52 ? 211  LEU C C   1 
ATOM   5832  O  O   . LEU C  1 219 ? 40.845   73.090  41.501  1.00 23.73 ? 211  LEU C O   1 
ATOM   5833  C  CB  . LEU C  1 219 ? 42.492   73.960  43.912  1.00 24.68 ? 211  LEU C CB  1 
ATOM   5834  C  CG  . LEU C  1 219 ? 41.821   73.588  45.234  1.00 24.10 ? 211  LEU C CG  1 
ATOM   5835  C  CD1 . LEU C  1 219 ? 42.729   72.734  46.154  1.00 23.21 ? 211  LEU C CD1 1 
ATOM   5836  C  CD2 . LEU C  1 219 ? 41.369   74.894  45.975  1.00 21.11 ? 211  LEU C CD2 1 
ATOM   5837  N  N   . LYS C  1 220 ? 41.033   71.172  42.653  1.00 23.60 ? 212  LYS C N   1 
ATOM   5838  C  CA  . LYS C  1 220 ? 39.833   70.561  42.094  1.00 23.36 ? 212  LYS C CA  1 
ATOM   5839  C  C   . LYS C  1 220 ? 38.640   70.479  43.033  1.00 21.95 ? 212  LYS C C   1 
ATOM   5840  O  O   . LYS C  1 220 ? 38.761   70.241  44.239  1.00 19.97 ? 212  LYS C O   1 
ATOM   5841  C  CB  . LYS C  1 220 ? 40.145   69.149  41.628  1.00 24.30 ? 212  LYS C CB  1 
ATOM   5842  C  CG  . LYS C  1 220 ? 41.162   69.094  40.521  1.00 26.70 ? 212  LYS C CG  1 
ATOM   5843  C  CD  . LYS C  1 220 ? 41.742   67.730  40.374  1.00 30.65 ? 212  LYS C CD  1 
ATOM   5844  C  CE  . LYS C  1 220 ? 42.642   67.701  39.160  1.00 34.38 ? 212  LYS C CE  1 
ATOM   5845  N  NZ  . LYS C  1 220 ? 43.692   68.774  39.279  1.00 38.05 ? 212  LYS C NZ  1 
ATOM   5846  N  N   . LEU C  1 221 ? 37.460   70.632  42.443  1.00 21.47 ? 213  LEU C N   1 
ATOM   5847  C  CA  . LEU C  1 221 ? 36.214   70.249  43.116  1.00 20.47 ? 213  LEU C CA  1 
ATOM   5848  C  C   . LEU C  1 221 ? 36.381   68.816  43.591  1.00 20.84 ? 213  LEU C C   1 
ATOM   5849  O  O   . LEU C  1 221 ? 36.768   67.937  42.811  1.00 21.29 ? 213  LEU C O   1 
ATOM   5850  C  CB  . LEU C  1 221 ? 35.050   70.375  42.165  1.00 19.76 ? 213  LEU C CB  1 
ATOM   5851  C  CG  . LEU C  1 221 ? 34.906   71.789  41.567  1.00 19.02 ? 213  LEU C CG  1 
ATOM   5852  C  CD1 . LEU C  1 221 ? 33.870   71.778  40.460  1.00 13.86 ? 213  LEU C CD1 1 
ATOM   5853  C  CD2 . LEU C  1 221 ? 34.581   72.770  42.652  1.00 12.28 ? 213  LEU C CD2 1 
ATOM   5854  N  N   . GLY C  1 222 ? 36.179   68.591  44.886  1.00 21.18 ? 214  GLY C N   1 
ATOM   5855  C  CA  . GLY C  1 222 ? 36.361   67.272  45.481  1.00 21.07 ? 214  GLY C CA  1 
ATOM   5856  C  C   . GLY C  1 222 ? 37.709   67.018  46.159  1.00 20.83 ? 214  GLY C C   1 
ATOM   5857  O  O   . GLY C  1 222 ? 37.904   65.981  46.819  1.00 20.27 ? 214  GLY C O   1 
ATOM   5858  N  N   . ASP C  1 223 ? 38.633   67.950  46.024  1.00 20.51 ? 215  ASP C N   1 
ATOM   5859  C  CA  . ASP C  1 223 ? 39.943   67.810  46.657  1.00 20.78 ? 215  ASP C CA  1 
ATOM   5860  C  C   . ASP C  1 223 ? 39.870   67.881  48.180  1.00 19.94 ? 215  ASP C C   1 
ATOM   5861  O  O   . ASP C  1 223 ? 39.044   68.597  48.730  1.00 20.41 ? 215  ASP C O   1 
ATOM   5862  C  CB  . ASP C  1 223 ? 40.917   68.877  46.142  1.00 20.69 ? 215  ASP C CB  1 
ATOM   5863  C  CG  . ASP C  1 223 ? 41.617   68.486  44.817  1.00 24.23 ? 215  ASP C CG  1 
ATOM   5864  O  OD1 . ASP C  1 223 ? 41.456   67.310  44.338  1.00 23.73 ? 215  ASP C OD1 1 
ATOM   5865  O  OD2 . ASP C  1 223 ? 42.336   69.386  44.256  1.00 24.57 ? 215  ASP C OD2 1 
ATOM   5866  N  N   . ILE C  1 224 ? 40.734   67.119  48.841  1.00 19.28 ? 216  ILE C N   1 
ATOM   5867  C  CA  . ILE C  1 224 ? 40.903   67.159  50.276  1.00 18.78 ? 216  ILE C CA  1 
ATOM   5868  C  C   . ILE C  1 224 ? 42.095   68.041  50.583  1.00 18.53 ? 216  ILE C C   1 
ATOM   5869  O  O   . ILE C  1 224 ? 43.181   67.842  50.022  1.00 17.91 ? 216  ILE C O   1 
ATOM   5870  C  CB  . ILE C  1 224 ? 41.135   65.751  50.828  1.00 20.01 ? 216  ILE C CB  1 
ATOM   5871  C  CG1 . ILE C  1 224 ? 39.925   64.884  50.488  1.00 21.89 ? 216  ILE C CG1 1 
ATOM   5872  C  CG2 . ILE C  1 224 ? 41.367   65.755  52.336  1.00 15.83 ? 216  ILE C CG2 1 
ATOM   5873  C  CD1 . ILE C  1 224 ? 40.256   63.523  50.347  1.00 26.26 ? 216  ILE C CD1 1 
ATOM   5874  N  N   . VAL C  1 225 ? 41.853   69.031  51.442  1.00 17.34 ? 217  VAL C N   1 
ATOM   5875  C  CA  . VAL C  1 225 ? 42.798   70.056  51.784  1.00 17.08 ? 217  VAL C CA  1 
ATOM   5876  C  C   . VAL C  1 225 ? 42.936   70.107  53.319  1.00 17.95 ? 217  VAL C C   1 
ATOM   5877  O  O   . VAL C  1 225 ? 42.025   69.705  54.046  1.00 17.48 ? 217  VAL C O   1 
ATOM   5878  C  CB  . VAL C  1 225 ? 42.363   71.450  51.286  1.00 16.47 ? 217  VAL C CB  1 
ATOM   5879  C  CG1 . VAL C  1 225 ? 42.322   71.499  49.733  1.00 16.36 ? 217  VAL C CG1 1 
ATOM   5880  C  CG2 . VAL C  1 225 ? 41.046   71.874  51.949  1.00 13.72 ? 217  VAL C CG2 1 
ATOM   5881  N  N   . ALA C  1 226 ? 44.072   70.615  53.786  1.00 18.18 ? 218  ALA C N   1 
ATOM   5882  C  CA  . ALA C  1 226 ? 44.250   70.982  55.193  1.00 19.02 ? 218  ALA C CA  1 
ATOM   5883  C  C   . ALA C  1 226 ? 44.124   72.484  55.300  1.00 19.21 ? 218  ALA C C   1 
ATOM   5884  O  O   . ALA C  1 226 ? 44.595   73.208  54.440  1.00 19.96 ? 218  ALA C O   1 
ATOM   5885  C  CB  . ALA C  1 226 ? 45.649   70.544  55.731  1.00 16.98 ? 218  ALA C CB  1 
ATOM   5886  N  N   . ILE C  1 227 ? 43.552   72.949  56.386  1.00 20.32 ? 219  ILE C N   1 
ATOM   5887  C  CA  . ILE C  1 227 ? 43.568   74.349  56.685  1.00 20.99 ? 219  ILE C CA  1 
ATOM   5888  C  C   . ILE C  1 227 ? 44.380   74.503  57.928  1.00 21.31 ? 219  ILE C C   1 
ATOM   5889  O  O   . ILE C  1 227 ? 44.000   74.014  58.933  1.00 21.22 ? 219  ILE C O   1 
ATOM   5890  C  CB  . ILE C  1 227 ? 42.153   74.920  56.875  1.00 20.84 ? 219  ILE C CB  1 
ATOM   5891  C  CG1 . ILE C  1 227 ? 41.357   74.686  55.601  1.00 22.38 ? 219  ILE C CG1 1 
ATOM   5892  C  CG2 . ILE C  1 227 ? 42.218   76.386  57.149  1.00 18.28 ? 219  ILE C CG2 1 
ATOM   5893  C  CD1 . ILE C  1 227 ? 39.931   74.831  55.765  1.00 25.63 ? 219  ILE C CD1 1 
ATOM   5894  N  N   . GLN C  1 228 ? 45.491   75.204  57.832  1.00 21.95 ? 220  GLN C N   1 
ATOM   5895  C  CA  . GLN C  1 228 ? 46.380   75.456  58.957  1.00 23.06 ? 220  GLN C CA  1 
ATOM   5896  C  C   . GLN C  1 228 ? 45.881   76.522  59.955  1.00 22.49 ? 220  GLN C C   1 
ATOM   5897  O  O   . GLN C  1 228 ? 45.383   77.570  59.569  1.00 20.81 ? 220  GLN C O   1 
ATOM   5898  C  CB  . GLN C  1 228 ? 47.726   75.891  58.383  1.00 24.16 ? 220  GLN C CB  1 
ATOM   5899  C  CG  . GLN C  1 228 ? 48.381   74.803  57.523  1.00 29.33 ? 220  GLN C CG  1 
ATOM   5900  C  CD  . GLN C  1 228 ? 49.735   75.234  56.888  1.00 35.32 ? 220  GLN C CD  1 
ATOM   5901  O  OE1 . GLN C  1 228 ? 49.898   76.367  56.382  1.00 35.55 ? 220  GLN C OE1 1 
ATOM   5902  N  NE2 . GLN C  1 228 ? 50.697   74.292  56.888  1.00 36.22 ? 220  GLN C NE2 1 
ATOM   5903  N  N   . ASP C  1 229 ? 46.009   76.216  61.239  1.00 22.13 ? 221  ASP C N   1 
ATOM   5904  C  CA  . ASP C  1 229 ? 45.716   77.123  62.330  1.00 22.28 ? 221  ASP C CA  1 
ATOM   5905  C  C   . ASP C  1 229 ? 44.261   77.586  62.417  1.00 22.52 ? 221  ASP C C   1 
ATOM   5906  O  O   . ASP C  1 229 ? 43.968   78.707  62.913  1.00 20.97 ? 221  ASP C O   1 
ATOM   5907  C  CB  . ASP C  1 229 ? 46.667   78.312  62.283  1.00 23.51 ? 221  ASP C CB  1 
ATOM   5908  C  CG  . ASP C  1 229 ? 48.130   77.875  62.177  1.00 23.70 ? 221  ASP C CG  1 
ATOM   5909  O  OD1 . ASP C  1 229 ? 48.558   77.062  63.007  1.00 23.90 ? 221  ASP C OD1 1 
ATOM   5910  O  OD2 . ASP C  1 229 ? 48.840   78.327  61.248  1.00 24.85 ? 221  ASP C OD2 1 
ATOM   5911  N  N   . HIS C  1 230 ? 43.354   76.714  61.959  1.00 21.58 ? 222  HIS C N   1 
ATOM   5912  C  CA  . HIS C  1 230 ? 41.936   76.907  62.156  1.00 21.73 ? 222  HIS C CA  1 
ATOM   5913  C  C   . HIS C  1 230 ? 41.338   75.745  62.887  1.00 21.39 ? 222  HIS C C   1 
ATOM   5914  O  O   . HIS C  1 230 ? 41.549   74.576  62.522  1.00 20.32 ? 222  HIS C O   1 
ATOM   5915  C  CB  . HIS C  1 230 ? 41.204   77.081  60.827  1.00 21.72 ? 222  HIS C CB  1 
ATOM   5916  C  CG  . HIS C  1 230 ? 41.102   78.494  60.382  1.00 22.10 ? 222  HIS C CG  1 
ATOM   5917  N  ND1 . HIS C  1 230 ? 40.114   78.922  59.525  1.00 22.41 ? 222  HIS C ND1 1 
ATOM   5918  C  CD2 . HIS C  1 230 ? 41.879   79.578  60.642  1.00 24.34 ? 222  HIS C CD2 1 
ATOM   5919  C  CE1 . HIS C  1 230 ? 40.280   80.217  59.290  1.00 24.13 ? 222  HIS C CE1 1 
ATOM   5920  N  NE2 . HIS C  1 230 ? 41.333   80.644  59.969  1.00 22.64 ? 222  HIS C NE2 1 
ATOM   5921  N  N   . ASP C  1 231 ? 40.586   76.079  63.917  1.00 22.10 ? 223  ASP C N   1 
ATOM   5922  C  CA  . ASP C  1 231 ? 39.793   75.136  64.639  1.00 23.02 ? 223  ASP C CA  1 
ATOM   5923  C  C   . ASP C  1 231 ? 38.368   75.299  64.195  1.00 23.10 ? 223  ASP C C   1 
ATOM   5924  O  O   . ASP C  1 231 ? 37.851   76.422  64.226  1.00 22.66 ? 223  ASP C O   1 
ATOM   5925  C  CB  . ASP C  1 231 ? 39.839   75.373  66.148  1.00 24.56 ? 223  ASP C CB  1 
ATOM   5926  C  CG  . ASP C  1 231 ? 38.677   74.666  66.858  1.00 27.14 ? 223  ASP C CG  1 
ATOM   5927  O  OD1 . ASP C  1 231 ? 38.710   73.483  67.104  1.00 30.05 ? 223  ASP C OD1 1 
ATOM   5928  O  OD2 . ASP C  1 231 ? 37.625   75.260  67.056  1.00 38.22 ? 223  ASP C OD2 1 
ATOM   5929  N  N   . ASN C  1 232 ? 37.720   74.181  63.849  1.00 22.46 ? 224  ASN C N   1 
ATOM   5930  C  CA  . ASN C  1 232 ? 36.310   74.184  63.423  1.00 22.47 ? 224  ASN C CA  1 
ATOM   5931  C  C   . ASN C  1 232 ? 35.393   73.275  64.287  1.00 22.02 ? 224  ASN C C   1 
ATOM   5932  O  O   . ASN C  1 232 ? 34.429   72.665  63.809  1.00 21.13 ? 224  ASN C O   1 
ATOM   5933  C  CB  . ASN C  1 232 ? 36.268   73.790  61.935  1.00 22.17 ? 224  ASN C CB  1 
ATOM   5934  C  CG  . ASN C  1 232 ? 36.675   74.934  61.029  1.00 21.92 ? 224  ASN C CG  1 
ATOM   5935  O  OD1 . ASN C  1 232 ? 35.902   75.862  60.895  1.00 20.00 ? 224  ASN C OD1 1 
ATOM   5936  N  ND2 . ASN C  1 232 ? 37.901   74.888  60.416  1.00 17.08 ? 224  ASN C ND2 1 
ATOM   5937  N  N   . SER C  1 233 ? 35.699   73.182  65.567  1.00 22.41 ? 225  SER C N   1 
ATOM   5938  C  CA  . SER C  1 233 ? 34.969   72.260  66.455  1.00 23.20 ? 225  SER C CA  1 
ATOM   5939  C  C   . SER C  1 233 ? 33.542   72.674  66.664  1.00 23.40 ? 225  SER C C   1 
ATOM   5940  O  O   . SER C  1 233 ? 32.681   71.849  66.782  1.00 23.44 ? 225  SER C O   1 
ATOM   5941  C  CB  . SER C  1 233 ? 35.614   72.159  67.824  1.00 23.07 ? 225  SER C CB  1 
ATOM   5942  O  OG  . SER C  1 233 ? 36.961   71.761  67.724  1.00 22.74 ? 225  SER C OG  1 
ATOM   5943  N  N   . TYR C  1 234 ? 33.294   73.961  66.763  1.00 24.43 ? 226  TYR C N   1 
ATOM   5944  C  CA  . TYR C  1 234 ? 31.907   74.446  66.924  1.00 25.14 ? 226  TYR C CA  1 
ATOM   5945  C  C   . TYR C  1 234 ? 31.581   75.406  65.789  1.00 24.57 ? 226  TYR C C   1 
ATOM   5946  O  O   . TYR C  1 234 ? 31.153   74.956  64.727  1.00 23.82 ? 226  TYR C O   1 
ATOM   5947  C  CB  . TYR C  1 234 ? 31.720   75.017  68.355  1.00 25.84 ? 226  TYR C CB  1 
ATOM   5948  C  CG  . TYR C  1 234 ? 32.042   73.898  69.328  1.00 26.35 ? 226  TYR C CG  1 
ATOM   5949  C  CD1 . TYR C  1 234 ? 31.152   72.835  69.483  1.00 28.26 ? 226  TYR C CD1 1 
ATOM   5950  C  CD2 . TYR C  1 234 ? 33.298   73.796  69.957  1.00 29.15 ? 226  TYR C CD2 1 
ATOM   5951  C  CE1 . TYR C  1 234 ? 31.439   71.754  70.291  1.00 27.68 ? 226  TYR C CE1 1 
ATOM   5952  C  CE2 . TYR C  1 234 ? 33.602   72.656  70.773  1.00 28.30 ? 226  TYR C CE2 1 
ATOM   5953  C  CZ  . TYR C  1 234 ? 32.635   71.664  70.914  1.00 27.94 ? 226  TYR C CZ  1 
ATOM   5954  O  OH  . TYR C  1 234 ? 32.820   70.557  71.655  1.00 29.35 ? 226  TYR C OH  1 
ATOM   5955  N  N   . GLY C  1 235 ? 31.832   76.693  65.994  1.00 24.36 ? 227  GLY C N   1 
ATOM   5956  C  CA  . GLY C  1 235 ? 31.703   77.687  64.920  1.00 24.05 ? 227  GLY C CA  1 
ATOM   5957  C  C   . GLY C  1 235 ? 32.865   77.579  63.932  1.00 23.34 ? 227  GLY C C   1 
ATOM   5958  O  O   . GLY C  1 235 ? 33.867   76.952  64.219  1.00 22.63 ? 227  GLY C O   1 
ATOM   5959  N  N   . VAL C  1 236 ? 32.691   78.176  62.758  1.00 22.67 ? 228  VAL C N   1 
ATOM   5960  C  CA  . VAL C  1 236 ? 33.646   78.111  61.677  1.00 21.70 ? 228  VAL C CA  1 
ATOM   5961  C  C   . VAL C  1 236 ? 34.817   79.079  61.836  1.00 22.14 ? 228  VAL C C   1 
ATOM   5962  O  O   . VAL C  1 236 ? 34.660   80.245  62.120  1.00 20.99 ? 228  VAL C O   1 
ATOM   5963  C  CB  . VAL C  1 236 ? 32.959   78.344  60.309  1.00 21.72 ? 228  VAL C CB  1 
ATOM   5964  C  CG1 . VAL C  1 236 ? 34.001   78.432  59.161  1.00 18.44 ? 228  VAL C CG1 1 
ATOM   5965  C  CG2 . VAL C  1 236 ? 31.914   77.237  60.049  1.00 18.31 ? 228  VAL C CG2 1 
ATOM   5966  N  N   . GLY C  1 237 ? 36.007   78.562  61.672  1.00 22.41 ? 229  GLY C N   1 
ATOM   5967  C  CA  . GLY C  1 237 ? 37.162   79.414  61.378  1.00 23.49 ? 229  GLY C CA  1 
ATOM   5968  C  C   . GLY C  1 237 ? 37.800   80.138  62.546  1.00 24.04 ? 229  GLY C C   1 
ATOM   5969  O  O   . GLY C  1 237 ? 38.304   81.237  62.355  1.00 22.42 ? 229  GLY C O   1 
ATOM   5970  N  N   . LYS C  1 238 ? 37.801   79.520  63.738  1.00 24.34 ? 230  LYS C N   1 
ATOM   5971  C  CA  . LYS C  1 238 ? 38.600   80.047  64.843  1.00 25.66 ? 230  LYS C CA  1 
ATOM   5972  C  C   . LYS C  1 238 ? 40.097   79.936  64.509  1.00 24.48 ? 230  LYS C C   1 
ATOM   5973  O  O   . LYS C  1 238 ? 40.602   78.843  64.336  1.00 22.40 ? 230  LYS C O   1 
ATOM   5974  C  CB  . LYS C  1 238 ? 38.280   79.338  66.160  1.00 26.52 ? 230  LYS C CB  1 
ATOM   5975  C  CG  . LYS C  1 238 ? 39.259   79.596  67.331  1.00 31.77 ? 230  LYS C CG  1 
ATOM   5976  C  CD  . LYS C  1 238 ? 38.790   80.706  68.235  1.00 40.11 ? 230  LYS C CD  1 
ATOM   5977  C  CE  . LYS C  1 238 ? 39.870   81.432  69.119  1.00 43.18 ? 230  LYS C CE  1 
ATOM   5978  N  NZ  . LYS C  1 238 ? 39.482   82.941  69.323  1.00 45.48 ? 230  LYS C NZ  1 
ATOM   5979  N  N   . TYR C  1 239 ? 40.783   81.071  64.407  1.00 24.53 ? 231  TYR C N   1 
ATOM   5980  C  CA  . TYR C  1 239 ? 42.232   81.059  64.318  1.00 24.41 ? 231  TYR C CA  1 
ATOM   5981  C  C   . TYR C  1 239 ? 42.783   80.587  65.654  1.00 24.44 ? 231  TYR C C   1 
ATOM   5982  O  O   . TYR C  1 239 ? 42.423   81.108  66.698  1.00 24.15 ? 231  TYR C O   1 
ATOM   5983  C  CB  . TYR C  1 239 ? 42.827   82.428  63.974  1.00 24.65 ? 231  TYR C CB  1 
ATOM   5984  C  CG  . TYR C  1 239 ? 44.335   82.400  63.998  1.00 25.23 ? 231  TYR C CG  1 
ATOM   5985  C  CD1 . TYR C  1 239 ? 45.064   81.931  62.902  1.00 24.60 ? 231  TYR C CD1 1 
ATOM   5986  C  CD2 . TYR C  1 239 ? 45.040   82.773  65.147  1.00 25.69 ? 231  TYR C CD2 1 
ATOM   5987  C  CE1 . TYR C  1 239 ? 46.479   81.853  62.950  1.00 25.84 ? 231  TYR C CE1 1 
ATOM   5988  C  CE2 . TYR C  1 239 ? 46.440   82.692  65.196  1.00 26.93 ? 231  TYR C CE2 1 
ATOM   5989  C  CZ  . TYR C  1 239 ? 47.143   82.248  64.091  1.00 26.68 ? 231  TYR C CZ  1 
ATOM   5990  O  OH  . TYR C  1 239 ? 48.496   82.166  64.136  1.00 26.97 ? 231  TYR C OH  1 
ATOM   5991  N  N   A ARG C  1 240 ? 43.636   79.569  65.592  0.50 24.40 ? 232  ARG C N   1 
ATOM   5992  N  N   B ARG C  1 240 ? 43.641   79.578  65.607  0.50 24.47 ? 232  ARG C N   1 
ATOM   5993  C  CA  A ARG C  1 240 ? 44.367   79.054  66.738  0.50 25.16 ? 232  ARG C CA  1 
ATOM   5994  C  CA  B ARG C  1 240 ? 44.414   79.167  66.760  0.50 25.29 ? 232  ARG C CA  1 
ATOM   5995  C  C   A ARG C  1 240 ? 45.683   78.452  66.268  0.50 25.98 ? 232  ARG C C   1 
ATOM   5996  C  C   B ARG C  1 240 ? 45.671   78.450  66.312  0.50 26.06 ? 232  ARG C C   1 
ATOM   5997  O  O   A ARG C  1 240 ? 45.694   77.513  65.488  0.50 25.36 ? 232  ARG C O   1 
ATOM   5998  O  O   B ARG C  1 240 ? 45.627   77.447  65.603  0.50 25.44 ? 232  ARG C O   1 
ATOM   5999  C  CB  A ARG C  1 240 ? 43.553   77.983  67.442  0.50 25.35 ? 232  ARG C CB  1 
ATOM   6000  C  CB  B ARG C  1 240 ? 43.615   78.274  67.677  0.50 25.76 ? 232  ARG C CB  1 
ATOM   6001  C  CG  A ARG C  1 240 ? 44.294   77.321  68.624  0.50 26.09 ? 232  ARG C CG  1 
ATOM   6002  C  CG  B ARG C  1 240 ? 44.389   77.877  68.964  0.50 26.35 ? 232  ARG C CG  1 
ATOM   6003  C  CD  A ARG C  1 240 ? 43.362   76.372  69.387  0.50 24.15 ? 232  ARG C CD  1 
ATOM   6004  C  CD  B ARG C  1 240 ? 43.768   76.604  69.554  0.50 25.79 ? 232  ARG C CD  1 
ATOM   6005  N  NE  A ARG C  1 240 ? 43.489   74.961  69.003  0.50 21.63 ? 232  ARG C NE  1 
ATOM   6006  N  NE  B ARG C  1 240 ? 42.341   76.786  69.866  0.50 24.36 ? 232  ARG C NE  1 
ATOM   6007  C  CZ  A ARG C  1 240 ? 44.615   74.230  69.087  0.50 17.78 ? 232  ARG C CZ  1 
ATOM   6008  C  CZ  B ARG C  1 240 ? 41.402   75.847  69.786  0.50 23.92 ? 232  ARG C CZ  1 
ATOM   6009  N  NH1 A ARG C  1 240 ? 45.774   74.739  69.468  0.50 17.09 ? 232  ARG C NH1 1 
ATOM   6010  N  NH1 B ARG C  1 240 ? 41.701   74.631  69.342  0.50 22.19 ? 232  ARG C NH1 1 
ATOM   6011  N  NH2 A ARG C  1 240 ? 44.595   72.980  68.725  0.50 15.89 ? 232  ARG C NH2 1 
ATOM   6012  N  NH2 B ARG C  1 240 ? 40.150   76.153  70.130  0.50 24.04 ? 232  ARG C NH2 1 
ATOM   6013  N  N   . LYS C  1 241 ? 46.800   78.990  66.732  1.00 27.22 ? 233  LYS C N   1 
ATOM   6014  C  CA  . LYS C  1 241 ? 48.094   78.497  66.299  1.00 29.14 ? 233  LYS C CA  1 
ATOM   6015  C  C   . LYS C  1 241 ? 48.232   77.084  66.781  1.00 27.76 ? 233  LYS C C   1 
ATOM   6016  O  O   . LYS C  1 241 ? 48.100   76.845  67.934  1.00 28.38 ? 233  LYS C O   1 
ATOM   6017  C  CB  . LYS C  1 241 ? 49.204   79.368  66.891  1.00 30.52 ? 233  LYS C CB  1 
ATOM   6018  C  CG  . LYS C  1 241 ? 50.594   78.994  66.411  1.00 36.36 ? 233  LYS C CG  1 
ATOM   6019  C  CD  . LYS C  1 241 ? 50.992   79.738  65.166  1.00 44.21 ? 233  LYS C CD  1 
ATOM   6020  C  CE  . LYS C  1 241 ? 52.460   79.488  64.784  1.00 47.83 ? 233  LYS C CE  1 
ATOM   6021  N  NZ  . LYS C  1 241 ? 52.524   79.099  63.320  1.00 49.18 ? 233  LYS C NZ  1 
ATOM   6022  N  N   . GLY C  1 242 ? 48.447   76.145  65.885  1.00 27.31 ? 234  GLY C N   1 
ATOM   6023  C  CA  . GLY C  1 242 ? 48.536   74.764  66.271  1.00 26.86 ? 234  GLY C CA  1 
ATOM   6024  C  C   . GLY C  1 242 ? 47.297   73.927  65.933  1.00 26.36 ? 234  GLY C C   1 
ATOM   6025  O  O   . GLY C  1 242 ? 47.400   72.697  65.910  1.00 26.05 ? 234  GLY C O   1 
ATOM   6026  N  N   . ALA C  1 243 ? 46.150   74.563  65.665  1.00 24.16 ? 235  ALA C N   1 
ATOM   6027  C  CA  . ALA C  1 243 ? 44.974   73.807  65.241  1.00 23.00 ? 235  ALA C CA  1 
ATOM   6028  C  C   . ALA C  1 243 ? 45.187   73.411  63.783  1.00 21.99 ? 235  ALA C C   1 
ATOM   6029  O  O   . ALA C  1 243 ? 45.917   74.048  63.050  1.00 21.11 ? 235  ALA C O   1 
ATOM   6030  C  CB  . ALA C  1 243 ? 43.677   74.617  65.402  1.00 22.26 ? 235  ALA C CB  1 
ATOM   6031  N  N   . VAL C  1 244 ? 44.541   72.329  63.388  1.00 21.24 ? 236  VAL C N   1 
ATOM   6032  C  CA  A VAL C  1 244 ? 44.473   71.980  61.983  0.50 19.91 ? 236  VAL C CA  1 
ATOM   6033  C  CA  B VAL C  1 244 ? 44.509   71.851  62.010  0.50 20.12 ? 236  VAL C CA  1 
ATOM   6034  C  C   . VAL C  1 244 ? 43.083   71.443  61.665  1.00 19.20 ? 236  VAL C C   1 
ATOM   6035  O  O   . VAL C  1 244 ? 42.461   70.834  62.474  1.00 18.44 ? 236  VAL C O   1 
ATOM   6036  C  CB  A VAL C  1 244 ? 45.573   70.980  61.586  0.50 20.25 ? 236  VAL C CB  1 
ATOM   6037  C  CB  B VAL C  1 244 ? 45.375   70.566  61.868  0.50 20.31 ? 236  VAL C CB  1 
ATOM   6038  C  CG1 A VAL C  1 244 ? 45.345   69.638  62.296  0.50 18.44 ? 236  VAL C CG1 1 
ATOM   6039  C  CG1 B VAL C  1 244 ? 45.175   69.929  60.477  0.50 19.34 ? 236  VAL C CG1 1 
ATOM   6040  C  CG2 A VAL C  1 244 ? 45.644   70.861  60.040  0.50 18.02 ? 236  VAL C CG2 1 
ATOM   6041  C  CG2 B VAL C  1 244 ? 46.845   70.864  62.155  0.50 19.14 ? 236  VAL C CG2 1 
ATOM   6042  N  N   . SER C  1 245 ? 42.589   71.780  60.486  1.00 19.03 ? 237  SER C N   1 
ATOM   6043  C  CA  . SER C  1 245 ? 41.337   71.237  59.996  1.00 19.63 ? 237  SER C CA  1 
ATOM   6044  C  C   . SER C  1 245 ? 41.578   70.591  58.639  1.00 19.70 ? 237  SER C C   1 
ATOM   6045  O  O   . SER C  1 245 ? 42.519   70.977  57.934  1.00 19.69 ? 237  SER C O   1 
ATOM   6046  C  CB  . SER C  1 245 ? 40.279   72.331  59.865  1.00 19.21 ? 237  SER C CB  1 
ATOM   6047  O  OG  . SER C  1 245 ? 39.948   72.891  61.136  1.00 20.28 ? 237  SER C OG  1 
ATOM   6048  N  N   . ILE C  1 246 ? 40.734   69.611  58.304  1.00 19.30 ? 238  ILE C N   1 
ATOM   6049  C  CA  . ILE C  1 246 ? 40.765   68.905  57.039  1.00 18.35 ? 238  ILE C CA  1 
ATOM   6050  C  C   . ILE C  1 246 ? 39.407   69.141  56.414  1.00 18.39 ? 238  ILE C C   1 
ATOM   6051  O  O   . ILE C  1 246 ? 38.397   69.056  57.093  1.00 16.65 ? 238  ILE C O   1 
ATOM   6052  C  CB  . ILE C  1 246 ? 40.958   67.407  57.218  1.00 18.85 ? 238  ILE C CB  1 
ATOM   6053  C  CG1 . ILE C  1 246 ? 42.227   67.146  58.048  1.00 19.47 ? 238  ILE C CG1 1 
ATOM   6054  C  CG2 . ILE C  1 246 ? 41.056   66.656  55.846  1.00 14.82 ? 238  ILE C CG2 1 
ATOM   6055  C  CD1 . ILE C  1 246 ? 43.506   67.498  57.339  1.00 16.73 ? 238  ILE C CD1 1 
ATOM   6056  N  N   . GLY C  1 247 ? 39.399   69.450  55.120  1.00 17.84 ? 239  GLY C N   1 
ATOM   6057  C  CA  . GLY C  1 247 ? 38.155   69.718  54.422  1.00 18.00 ? 239  GLY C CA  1 
ATOM   6058  C  C   . GLY C  1 247 ? 38.134   69.290  52.970  1.00 17.28 ? 239  GLY C C   1 
ATOM   6059  O  O   . GLY C  1 247 ? 39.175   68.913  52.426  1.00 17.42 ? 239  GLY C O   1 
ATOM   6060  N  N   . VAL C  1 248 ? 36.940   69.348  52.382  1.00 16.22 ? 240  VAL C N   1 
ATOM   6061  C  CA  . VAL C  1 248 ? 36.683   68.994  51.008  1.00 15.63 ? 240  VAL C CA  1 
ATOM   6062  C  C   . VAL C  1 248 ? 36.237   70.216  50.236  1.00 16.42 ? 240  VAL C C   1 
ATOM   6063  O  O   . VAL C  1 248 ? 35.384   70.967  50.702  1.00 17.13 ? 240  VAL C O   1 
ATOM   6064  C  CB  . VAL C  1 248 ? 35.597   67.942  50.924  1.00 16.28 ? 240  VAL C CB  1 
ATOM   6065  C  CG1 . VAL C  1 248 ? 35.301   67.559  49.440  1.00 13.65 ? 240  VAL C CG1 1 
ATOM   6066  C  CG2 . VAL C  1 248 ? 35.997   66.721  51.776  1.00 14.22 ? 240  VAL C CG2 1 
ATOM   6067  N  N   . VAL C  1 249 ? 36.833   70.437  49.063  1.00 17.00 ? 241  VAL C N   1 
ATOM   6068  C  CA  . VAL C  1 249 ? 36.442   71.512  48.167  1.00 16.47 ? 241  VAL C CA  1 
ATOM   6069  C  C   . VAL C  1 249 ? 35.119   71.211  47.461  1.00 17.23 ? 241  VAL C C   1 
ATOM   6070  O  O   . VAL C  1 249 ? 34.959   70.157  46.805  1.00 17.21 ? 241  VAL C O   1 
ATOM   6071  C  CB  . VAL C  1 249 ? 37.537   71.794  47.117  1.00 17.09 ? 241  VAL C CB  1 
ATOM   6072  C  CG1 . VAL C  1 249 ? 37.125   72.976  46.198  1.00 13.65 ? 241  VAL C CG1 1 
ATOM   6073  C  CG2 . VAL C  1 249 ? 38.849   72.133  47.805  1.00 15.28 ? 241  VAL C CG2 1 
ATOM   6074  N  N   . VAL C  1 250 ? 34.170   72.151  47.551  1.00 18.02 ? 242  VAL C N   1 
ATOM   6075  C  CA  . VAL C  1 250 ? 32.777   71.876  47.145  1.00 17.63 ? 242  VAL C CA  1 
ATOM   6076  C  C   . VAL C  1 250 ? 32.205   72.749  46.066  1.00 18.76 ? 242  VAL C C   1 
ATOM   6077  O  O   . VAL C  1 250 ? 31.187   72.366  45.475  1.00 18.23 ? 242  VAL C O   1 
ATOM   6078  C  CB  . VAL C  1 250 ? 31.835   71.857  48.355  1.00 17.40 ? 242  VAL C CB  1 
ATOM   6079  C  CG1 . VAL C  1 250 ? 32.304   70.764  49.340  1.00 16.88 ? 242  VAL C CG1 1 
ATOM   6080  C  CG2 . VAL C  1 250 ? 31.787   73.253  49.055  1.00 15.77 ? 242  VAL C CG2 1 
ATOM   6081  N  N   . HIS C  1 251 ? 32.786   73.939  45.841  1.00 19.50 ? 243  HIS C N   1 
ATOM   6082  C  CA  . HIS C  1 251 ? 32.338   74.810  44.741  1.00 19.45 ? 243  HIS C CA  1 
ATOM   6083  C  C   . HIS C  1 251 ? 33.464   75.589  44.116  1.00 20.15 ? 243  HIS C C   1 
ATOM   6084  O  O   . HIS C  1 251 ? 34.555   75.657  44.631  1.00 19.94 ? 243  HIS C O   1 
ATOM   6085  C  CB  . HIS C  1 251 ? 31.134   75.708  45.138  1.00 19.74 ? 243  HIS C CB  1 
ATOM   6086  C  CG  . HIS C  1 251 ? 31.454   76.835  46.075  1.00 20.74 ? 243  HIS C CG  1 
ATOM   6087  N  ND1 . HIS C  1 251 ? 32.226   77.913  45.710  1.00 22.80 ? 243  HIS C ND1 1 
ATOM   6088  C  CD2 . HIS C  1 251 ? 31.061   77.076  47.345  1.00 21.55 ? 243  HIS C CD2 1 
ATOM   6089  C  CE1 . HIS C  1 251 ? 32.321   78.752  46.726  1.00 21.54 ? 243  HIS C CE1 1 
ATOM   6090  N  NE2 . HIS C  1 251 ? 31.645   78.254  47.738  1.00 21.35 ? 243  HIS C NE2 1 
ATOM   6091  N  N   . SER C  1 252 ? 33.187   76.186  42.973  1.00 21.60 ? 244  SER C N   1 
ATOM   6092  C  CA  . SER C  1 252 ? 34.225   76.801  42.178  1.00 23.12 ? 244  SER C CA  1 
ATOM   6093  C  C   . SER C  1 252 ? 34.635   78.184  42.718  1.00 23.26 ? 244  SER C C   1 
ATOM   6094  O  O   . SER C  1 252 ? 34.036   78.722  43.644  1.00 22.98 ? 244  SER C O   1 
ATOM   6095  C  CB  . SER C  1 252 ? 33.767   76.915  40.701  1.00 23.59 ? 244  SER C CB  1 
ATOM   6096  O  OG  . SER C  1 252 ? 32.990   78.101  40.536  1.00 25.64 ? 244  SER C OG  1 
ATOM   6097  N  N   . ALA C  1 253 ? 35.672   78.722  42.097  1.00 24.30 ? 245  ALA C N   1 
ATOM   6098  C  CA  . ALA C  1 253 ? 36.217   80.029  42.409  1.00 25.58 ? 245  ALA C CA  1 
ATOM   6099  C  C   . ALA C  1 253 ? 35.193   81.138  42.169  1.00 26.98 ? 245  ALA C C   1 
ATOM   6100  O  O   . ALA C  1 253 ? 34.178   80.951  41.500  1.00 27.39 ? 245  ALA C O   1 
ATOM   6101  C  CB  . ALA C  1 253 ? 37.480   80.284  41.619  1.00 24.99 ? 245  ALA C CB  1 
ATOM   6102  N  N   . CYS C  1 254 ? 35.480   82.287  42.756  1.00 28.15 ? 246  CYS C N   1 
ATOM   6103  C  CA  . CYS C  1 254 ? 34.555   83.390  42.808  1.00 29.24 ? 246  CYS C CA  1 
ATOM   6104  C  C   . CYS C  1 254 ? 35.293   84.639  42.371  1.00 28.98 ? 246  CYS C C   1 
ATOM   6105  O  O   . CYS C  1 254 ? 36.511   84.688  42.422  1.00 28.98 ? 246  CYS C O   1 
ATOM   6106  C  CB  . CYS C  1 254 ? 34.006   83.514  44.247  1.00 29.54 ? 246  CYS C CB  1 
ATOM   6107  S  SG  . CYS C  1 254 ? 33.081   81.962  44.790  1.00 33.41 ? 246  CYS C SG  1 
ATOM   6108  N  N   . VAL C  1 255 ? 34.553   85.638  41.940  1.00 28.94 ? 247  VAL C N   1 
ATOM   6109  C  CA  . VAL C  1 255 ? 35.159   86.840  41.425  1.00 29.26 ? 247  VAL C CA  1 
ATOM   6110  C  C   . VAL C  1 255 ? 35.226   87.959  42.467  1.00 29.22 ? 247  VAL C C   1 
ATOM   6111  O  O   . VAL C  1 255 ? 35.988   88.878  42.313  1.00 29.21 ? 247  VAL C O   1 
ATOM   6112  C  CB  . VAL C  1 255 ? 34.414   87.305  40.162  1.00 30.11 ? 247  VAL C CB  1 
ATOM   6113  C  CG1 . VAL C  1 255 ? 34.543   86.208  39.023  1.00 28.72 ? 247  VAL C CG1 1 
ATOM   6114  C  CG2 . VAL C  1 255 ? 32.994   87.608  40.498  1.00 28.38 ? 247  VAL C CG2 1 
ATOM   6115  N  N   . SER C  1 256 ? 34.435   87.863  43.524  1.00 28.67 ? 248  SER C N   1 
ATOM   6116  C  CA  . SER C  1 256 ? 34.281   88.936  44.499  1.00 28.60 ? 248  SER C CA  1 
ATOM   6117  C  C   . SER C  1 256 ? 35.264   88.848  45.657  1.00 28.07 ? 248  SER C C   1 
ATOM   6118  O  O   . SER C  1 256 ? 35.805   87.787  45.933  1.00 27.38 ? 248  SER C O   1 
ATOM   6119  C  CB  . SER C  1 256 ? 32.870   88.899  45.081  1.00 28.19 ? 248  SER C CB  1 
ATOM   6120  O  OG  . SER C  1 256 ? 31.938   89.184  44.076  1.00 29.63 ? 248  SER C OG  1 
ATOM   6121  N  N   . ALA C  1 257 ? 35.436   89.971  46.356  1.00 27.69 ? 249  ALA C N   1 
ATOM   6122  C  CA  . ALA C  1 257 ? 36.368   90.064  47.466  1.00 26.86 ? 249  ALA C CA  1 
ATOM   6123  C  C   . ALA C  1 257 ? 35.894   89.155  48.584  1.00 26.21 ? 249  ALA C C   1 
ATOM   6124  O  O   . ALA C  1 257 ? 34.699   89.142  48.936  1.00 24.82 ? 249  ALA C O   1 
ATOM   6125  C  CB  . ALA C  1 257 ? 36.506   91.513  47.968  1.00 27.08 ? 249  ALA C CB  1 
ATOM   6126  N  N   . GLY C  1 258 ? 36.860   88.388  49.113  1.00 25.91 ? 250  GLY C N   1 
ATOM   6127  C  CA  . GLY C  1 258 ? 36.676   87.501  50.232  1.00 25.25 ? 250  GLY C CA  1 
ATOM   6128  C  C   . GLY C  1 258 ? 36.096   86.141  49.934  1.00 25.13 ? 250  GLY C C   1 
ATOM   6129  O  O   . GLY C  1 258 ? 35.859   85.367  50.854  1.00 25.19 ? 250  GLY C O   1 
ATOM   6130  N  N   . HIS C  1 259 ? 35.872   85.837  48.667  1.00 25.26 ? 251  HIS C N   1 
ATOM   6131  C  CA  . HIS C  1 259 ? 35.222   84.589  48.259  1.00 25.10 ? 251  HIS C CA  1 
ATOM   6132  C  C   . HIS C  1 259 ? 36.187   83.720  47.436  1.00 24.27 ? 251  HIS C C   1 
ATOM   6133  O  O   . HIS C  1 259 ? 37.187   84.175  46.881  1.00 23.31 ? 251  HIS C O   1 
ATOM   6134  C  CB  . HIS C  1 259 ? 33.956   84.856  47.441  1.00 25.48 ? 251  HIS C CB  1 
ATOM   6135  C  CG  . HIS C  1 259 ? 32.802   85.401  48.231  1.00 27.54 ? 251  HIS C CG  1 
ATOM   6136  N  ND1 . HIS C  1 259 ? 31.811   84.594  48.762  1.00 30.03 ? 251  HIS C ND1 1 
ATOM   6137  C  CD2 . HIS C  1 259 ? 32.471   86.669  48.567  1.00 28.16 ? 251  HIS C CD2 1 
ATOM   6138  C  CE1 . HIS C  1 259 ? 30.928   85.342  49.397  1.00 29.01 ? 251  HIS C CE1 1 
ATOM   6139  N  NE2 . HIS C  1 259 ? 31.300   86.603  49.290  1.00 28.80 ? 251  HIS C NE2 1 
ATOM   6140  N  N   . GLY C  1 260 ? 35.846   82.453  47.342  1.00 23.63 ? 252  GLY C N   1 
ATOM   6141  C  CA  . GLY C  1 260 ? 36.670   81.530  46.617  1.00 23.48 ? 252  GLY C CA  1 
ATOM   6142  C  C   . GLY C  1 260 ? 36.103   80.161  46.768  1.00 22.95 ? 252  GLY C C   1 
ATOM   6143  O  O   . GLY C  1 260 ? 34.991   80.006  47.285  1.00 22.82 ? 252  GLY C O   1 
ATOM   6144  N  N   . PRO C  1 261 ? 36.834   79.156  46.292  1.00 22.36 ? 253  PRO C N   1 
ATOM   6145  C  CA  . PRO C  1 261 ? 36.288   77.806  46.378  1.00 21.91 ? 253  PRO C CA  1 
ATOM   6146  C  C   . PRO C  1 261 ? 35.929   77.411  47.816  1.00 20.74 ? 253  PRO C C   1 
ATOM   6147  O  O   . PRO C  1 261 ? 36.691   77.565  48.723  1.00 19.76 ? 253  PRO C O   1 
ATOM   6148  C  CB  . PRO C  1 261 ? 37.414   76.919  45.830  1.00 21.73 ? 253  PRO C CB  1 
ATOM   6149  C  CG  . PRO C  1 261 ? 38.252   77.840  44.990  1.00 23.18 ? 253  PRO C CG  1 
ATOM   6150  C  CD  . PRO C  1 261 ? 38.158   79.193  45.654  1.00 22.76 ? 253  PRO C CD  1 
ATOM   6151  N  N   . GLY C  1 262 ? 34.753   76.861  47.982  1.00 20.69 ? 254  GLY C N   1 
ATOM   6152  C  CA  . GLY C  1 262 ? 34.240   76.543  49.293  1.00 20.05 ? 254  GLY C CA  1 
ATOM   6153  C  C   . GLY C  1 262 ? 34.855   75.254  49.778  1.00 19.51 ? 254  GLY C C   1 
ATOM   6154  O  O   . GLY C  1 262 ? 35.106   74.352  48.986  1.00 18.38 ? 254  GLY C O   1 
ATOM   6155  N  N   . VAL C  1 263 ? 35.055   75.183  51.088  1.00 19.28 ? 255  VAL C N   1 
ATOM   6156  C  CA  . VAL C  1 263 ? 35.502   73.983  51.801  1.00 19.30 ? 255  VAL C CA  1 
ATOM   6157  C  C   . VAL C  1 263 ? 34.500   73.582  52.888  1.00 18.75 ? 255  VAL C C   1 
ATOM   6158  O  O   . VAL C  1 263 ? 34.085   74.408  53.682  1.00 19.35 ? 255  VAL C O   1 
ATOM   6159  C  CB  . VAL C  1 263 ? 36.874   74.279  52.455  1.00 19.43 ? 255  VAL C CB  1 
ATOM   6160  C  CG1 . VAL C  1 263 ? 37.350   73.104  53.329  1.00 20.70 ? 255  VAL C CG1 1 
ATOM   6161  C  CG2 . VAL C  1 263 ? 37.839   74.588  51.367  1.00 19.60 ? 255  VAL C CG2 1 
ATOM   6162  N  N   . VAL C  1 264 ? 34.106   72.325  52.918  1.00 17.71 ? 256  VAL C N   1 
ATOM   6163  C  CA  . VAL C  1 264 ? 33.320   71.800  54.000  1.00 16.76 ? 256  VAL C CA  1 
ATOM   6164  C  C   . VAL C  1 264 ? 34.310   71.025  54.862  1.00 17.48 ? 256  VAL C C   1 
ATOM   6165  O  O   . VAL C  1 264 ? 34.986   70.135  54.377  1.00 16.30 ? 256  VAL C O   1 
ATOM   6166  C  CB  . VAL C  1 264 ? 32.223   70.844  53.487  1.00 16.91 ? 256  VAL C CB  1 
ATOM   6167  C  CG1 . VAL C  1 264 ? 31.680   69.915  54.623  1.00 13.45 ? 256  VAL C CG1 1 
ATOM   6168  C  CG2 . VAL C  1 264 ? 31.107   71.650  52.779  1.00 14.62 ? 256  VAL C CG2 1 
ATOM   6169  N  N   . VAL C  1 265 ? 34.377   71.350  56.140  1.00 17.31 ? 257  VAL C N   1 
ATOM   6170  C  CA  . VAL C  1 265 ? 35.296   70.699  57.061  1.00 17.44 ? 257  VAL C CA  1 
ATOM   6171  C  C   . VAL C  1 265 ? 34.829   69.292  57.430  1.00 18.08 ? 257  VAL C C   1 
ATOM   6172  O  O   . VAL C  1 265 ? 33.648   69.087  57.729  1.00 17.42 ? 257  VAL C O   1 
ATOM   6173  C  CB  . VAL C  1 265 ? 35.417   71.527  58.352  1.00 17.64 ? 257  VAL C CB  1 
ATOM   6174  C  CG1 . VAL C  1 265 ? 36.298   70.798  59.356  1.00 15.67 ? 257  VAL C CG1 1 
ATOM   6175  C  CG2 . VAL C  1 265 ? 35.900   72.943  58.028  1.00 14.69 ? 257  VAL C CG2 1 
ATOM   6176  N  N   . ILE C  1 266 ? 35.751   68.328  57.387  1.00 18.17 ? 258  ILE C N   1 
ATOM   6177  C  CA  . ILE C  1 266 ? 35.443   66.984  57.818  1.00 18.63 ? 258  ILE C CA  1 
ATOM   6178  C  C   . ILE C  1 266 ? 36.207   66.533  59.059  1.00 19.02 ? 258  ILE C C   1 
ATOM   6179  O  O   . ILE C  1 266 ? 35.821   65.569  59.701  1.00 17.67 ? 258  ILE C O   1 
ATOM   6180  C  CB  . ILE C  1 266 ? 35.586   65.951  56.697  1.00 19.29 ? 258  ILE C CB  1 
ATOM   6181  C  CG1 . ILE C  1 266 ? 37.042   65.824  56.221  1.00 20.56 ? 258  ILE C CG1 1 
ATOM   6182  C  CG2 . ILE C  1 266 ? 34.660   66.331  55.546  1.00 18.01 ? 258  ILE C CG2 1 
ATOM   6183  C  CD1 . ILE C  1 266 ? 37.343   64.610  55.255  1.00 17.28 ? 258  ILE C CD1 1 
ATOM   6184  N  N   . MET C  1 267 ? 37.250   67.242  59.442  1.00 20.20 ? 259  MET C N   1 
ATOM   6185  C  CA  . MET C  1 267 ? 38.013   66.845  60.608  1.00 21.13 ? 259  MET C CA  1 
ATOM   6186  C  C   . MET C  1 267 ? 38.683   68.070  61.188  1.00 20.17 ? 259  MET C C   1 
ATOM   6187  O  O   . MET C  1 267 ? 39.110   68.928  60.468  1.00 18.79 ? 259  MET C O   1 
ATOM   6188  C  CB  . MET C  1 267 ? 39.048   65.769  60.220  1.00 22.07 ? 259  MET C CB  1 
ATOM   6189  C  CG  . MET C  1 267 ? 39.875   65.223  61.388  1.00 26.61 ? 259  MET C CG  1 
ATOM   6190  S  SD  . MET C  1 267 ? 41.140   63.948  60.963  1.00 32.10 ? 259  MET C SD  1 
ATOM   6191  C  CE  . MET C  1 267 ? 40.149   62.847  59.965  1.00 29.57 ? 259  MET C CE  1 
ATOM   6192  N  N   . THR C  1 268 ? 38.777   68.149  62.498  1.00 19.81 ? 260  THR C N   1 
ATOM   6193  C  CA  . THR C  1 268 ? 39.431   69.273  63.094  1.00 20.98 ? 260  THR C CA  1 
ATOM   6194  C  C   . THR C  1 268 ? 40.040   68.883  64.436  1.00 22.11 ? 260  THR C C   1 
ATOM   6195  O  O   . THR C  1 268 ? 39.475   68.057  65.142  1.00 22.74 ? 260  THR C O   1 
ATOM   6196  C  CB  . THR C  1 268 ? 38.453   70.473  63.253  1.00 21.24 ? 260  THR C CB  1 
ATOM   6197  O  OG1 . THR C  1 268 ? 39.203   71.633  63.621  1.00 18.66 ? 260  THR C OG1 1 
ATOM   6198  C  CG2 . THR C  1 268 ? 37.380   70.204  64.284  1.00 17.13 ? 260  THR C CG2 1 
ATOM   6199  N  N   . GLY C  1 269 ? 41.186   69.449  64.763  1.00 22.64 ? 261  GLY C N   1 
ATOM   6200  C  CA  . GLY C  1 269 ? 41.895   69.144  66.019  1.00 24.56 ? 261  GLY C CA  1 
ATOM   6201  C  C   . GLY C  1 269 ? 43.292   69.774  66.079  1.00 26.12 ? 261  GLY C C   1 
ATOM   6202  O  O   . GLY C  1 269 ? 43.552   70.794  65.430  1.00 27.14 ? 261  GLY C O   1 
ATOM   6203  N  N   . ASP C  1 270 ? 44.192   69.178  66.836  1.00 27.37 ? 262  ASP C N   1 
ATOM   6204  C  CA  . ASP C  1 270 ? 45.502   69.752  67.085  1.00 28.81 ? 262  ASP C CA  1 
ATOM   6205  C  C   . ASP C  1 270 ? 46.515   69.112  66.157  1.00 29.04 ? 262  ASP C C   1 
ATOM   6206  O  O   . ASP C  1 270 ? 46.395   67.973  65.778  1.00 27.89 ? 262  ASP C O   1 
ATOM   6207  C  CB  . ASP C  1 270 ? 45.920   69.539  68.549  1.00 29.72 ? 262  ASP C CB  1 
ATOM   6208  C  CG  . ASP C  1 270 ? 47.266   70.251  68.903  1.00 35.05 ? 262  ASP C CG  1 
ATOM   6209  O  OD1 . ASP C  1 270 ? 47.297   71.512  69.058  1.00 39.99 ? 262  ASP C OD1 1 
ATOM   6210  O  OD2 . ASP C  1 270 ? 48.315   69.550  69.014  1.00 38.87 ? 262  ASP C OD2 1 
ATOM   6211  N  N   . GLU C  1 271 ? 47.518   69.872  65.779  1.00 30.42 ? 263  GLU C N   1 
ATOM   6212  C  CA  . GLU C  1 271 ? 48.602   69.416  64.913  1.00 31.87 ? 263  GLU C CA  1 
ATOM   6213  C  C   . GLU C  1 271 ? 49.460   68.275  65.488  1.00 31.84 ? 263  GLU C C   1 
ATOM   6214  O  O   . GLU C  1 271 ? 50.105   67.575  64.732  1.00 31.28 ? 263  GLU C O   1 
ATOM   6215  C  CB  . GLU C  1 271 ? 49.533   70.593  64.601  1.00 32.67 ? 263  GLU C CB  1 
ATOM   6216  C  CG  . GLU C  1 271 ? 50.320   71.085  65.819  1.00 35.57 ? 263  GLU C CG  1 
ATOM   6217  C  CD  . GLU C  1 271 ? 51.213   72.279  65.508  1.00 39.02 ? 263  GLU C CD  1 
ATOM   6218  O  OE1 . GLU C  1 271 ? 51.160   72.801  64.365  1.00 41.11 ? 263  GLU C OE1 1 
ATOM   6219  O  OE2 . GLU C  1 271 ? 51.929   72.693  66.431  1.00 39.35 ? 263  GLU C OE2 1 
ATOM   6220  N  N   . SER C  1 272 ? 49.486   68.133  66.802  1.00 31.50 ? 264  SER C N   1 
ATOM   6221  C  CA  . SER C  1 272 ? 50.118   66.990  67.431  1.00 32.49 ? 264  SER C CA  1 
ATOM   6222  C  C   . SER C  1 272 ? 49.377   65.698  67.102  1.00 32.54 ? 264  SER C C   1 
ATOM   6223  O  O   . SER C  1 272 ? 49.952   64.656  67.138  1.00 33.43 ? 264  SER C O   1 
ATOM   6224  C  CB  . SER C  1 272 ? 50.221   67.179  68.961  1.00 32.25 ? 264  SER C CB  1 
ATOM   6225  O  OG  . SER C  1 272 ? 48.951   67.079  69.611  1.00 33.70 ? 264  SER C OG  1 
ATOM   6226  N  N   . LYS C  1 273 ? 48.106   65.771  66.746  1.00 32.54 ? 265  LYS C N   1 
ATOM   6227  C  CA  . LYS C  1 273 ? 47.334   64.595  66.448  1.00 32.55 ? 265  LYS C CA  1 
ATOM   6228  C  C   . LYS C  1 273 ? 46.976   64.412  65.003  1.00 30.60 ? 265  LYS C C   1 
ATOM   6229  O  O   . LYS C  1 273 ? 46.899   63.280  64.566  1.00 30.52 ? 265  LYS C O   1 
ATOM   6230  C  CB  . LYS C  1 273 ? 46.043   64.590  67.252  1.00 33.80 ? 265  LYS C CB  1 
ATOM   6231  C  CG  . LYS C  1 273 ? 46.144   63.890  68.586  1.00 39.75 ? 265  LYS C CG  1 
ATOM   6232  C  CD  . LYS C  1 273 ? 46.341   64.917  69.691  1.00 48.71 ? 265  LYS C CD  1 
ATOM   6233  C  CE  . LYS C  1 273 ? 46.572   64.299  71.088  1.00 51.89 ? 265  LYS C CE  1 
ATOM   6234  N  NZ  . LYS C  1 273 ? 45.327   64.501  71.918  1.00 54.32 ? 265  LYS C NZ  1 
ATOM   6235  N  N   . ILE C  1 274 ? 46.712   65.492  64.269  1.00 28.92 ? 266  ILE C N   1 
ATOM   6236  C  CA  . ILE C  1 274 ? 46.388   65.382  62.845  1.00 27.39 ? 266  ILE C CA  1 
ATOM   6237  C  C   . ILE C  1 274 ? 47.589   65.767  62.028  1.00 27.64 ? 266  ILE C C   1 
ATOM   6238  O  O   . ILE C  1 274 ? 48.074   66.874  62.175  1.00 28.10 ? 266  ILE C O   1 
ATOM   6239  C  CB  . ILE C  1 274 ? 45.193   66.259  62.424  1.00 26.61 ? 266  ILE C CB  1 
ATOM   6240  C  CG1 . ILE C  1 274 ? 44.000   65.936  63.300  1.00 25.52 ? 266  ILE C CG1 1 
ATOM   6241  C  CG2 . ILE C  1 274 ? 44.877   66.038  60.970  1.00 22.08 ? 266  ILE C CG2 1 
ATOM   6242  C  CD1 . ILE C  1 274 ? 42.857   66.889  63.204  1.00 25.91 ? 266  ILE C CD1 1 
ATOM   6243  N  N   . LEU C  1 275 ? 48.057   64.868  61.160  1.00 27.39 ? 267  LEU C N   1 
ATOM   6244  C  CA  . LEU C  1 275 ? 49.254   65.114  60.360  1.00 28.35 ? 267  LEU C CA  1 
ATOM   6245  C  C   . LEU C  1 275 ? 48.905   65.108  58.878  1.00 27.41 ? 267  LEU C C   1 
ATOM   6246  O  O   . LEU C  1 275 ? 48.867   64.053  58.269  1.00 27.81 ? 267  LEU C O   1 
ATOM   6247  C  CB  . LEU C  1 275 ? 50.346   64.057  60.615  1.00 28.97 ? 267  LEU C CB  1 
ATOM   6248  C  CG  . LEU C  1 275 ? 50.949   63.921  62.026  1.00 32.28 ? 267  LEU C CG  1 
ATOM   6249  C  CD1 . LEU C  1 275 ? 52.149   62.960  61.949  1.00 32.51 ? 267  LEU C CD1 1 
ATOM   6250  C  CD2 . LEU C  1 275 ? 51.364   65.198  62.632  1.00 31.51 ? 267  LEU C CD2 1 
ATOM   6251  N  N   . PRO C  1 276 ? 48.664   66.283  58.289  1.00 26.82 ? 268  PRO C N   1 
ATOM   6252  C  CA  . PRO C  1 276 ? 48.389   66.292  56.856  1.00 26.63 ? 268  PRO C CA  1 
ATOM   6253  C  C   . PRO C  1 276 ? 49.626   65.979  56.058  1.00 26.50 ? 268  PRO C C   1 
ATOM   6254  O  O   . PRO C  1 276 ? 50.691   66.480  56.343  1.00 25.19 ? 268  PRO C O   1 
ATOM   6255  C  CB  . PRO C  1 276 ? 47.906   67.724  56.587  1.00 26.70 ? 268  PRO C CB  1 
ATOM   6256  C  CG  . PRO C  1 276 ? 47.703   68.351  57.985  1.00 27.34 ? 268  PRO C CG  1 
ATOM   6257  C  CD  . PRO C  1 276 ? 48.615   67.631  58.879  1.00 26.55 ? 268  PRO C CD  1 
ATOM   6258  N  N   . GLU C  1 277 ? 49.455   65.155  55.057  1.00 27.13 ? 269  GLU C N   1 
ATOM   6259  C  CA  . GLU C  1 277 ? 50.505   64.793  54.175  1.00 28.74 ? 269  GLU C CA  1 
ATOM   6260  C  C   . GLU C  1 277 ? 50.170   65.155  52.770  1.00 29.02 ? 269  GLU C C   1 
ATOM   6261  O  O   . GLU C  1 277 ? 49.194   64.622  52.190  1.00 28.58 ? 269  GLU C O   1 
ATOM   6262  C  CB  . GLU C  1 277 ? 50.806   63.296  54.316  1.00 29.74 ? 269  GLU C CB  1 
ATOM   6263  C  CG  . GLU C  1 277 ? 52.072   63.172  55.241  1.00 35.54 ? 269  GLU C CG  1 
ATOM   6264  C  CD  . GLU C  1 277 ? 51.949   62.129  56.255  1.00 42.49 ? 269  GLU C CD  1 
ATOM   6265  O  OE1 . GLU C  1 277 ? 51.372   61.074  55.911  1.00 50.54 ? 269  GLU C OE1 1 
ATOM   6266  O  OE2 . GLU C  1 277 ? 52.433   62.349  57.381  1.00 46.39 ? 269  GLU C OE2 1 
ATOM   6267  N  N   . GLU C  1 278 ? 50.977   66.057  52.218  1.00 29.13 ? 270  GLU C N   1 
ATOM   6268  C  CA  . GLU C  1 278 ? 50.712   66.589  50.905  1.00 30.31 ? 270  GLU C CA  1 
ATOM   6269  C  C   . GLU C  1 278 ? 51.126   65.570  49.859  1.00 30.13 ? 270  GLU C C   1 
ATOM   6270  O  O   . GLU C  1 278 ? 52.265   65.177  49.810  1.00 29.21 ? 270  GLU C O   1 
ATOM   6271  C  CB  . GLU C  1 278 ? 51.407   67.913  50.724  1.00 30.74 ? 270  GLU C CB  1 
ATOM   6272  C  CG  . GLU C  1 278 ? 51.194   68.550  49.398  1.00 35.01 ? 270  GLU C CG  1 
ATOM   6273  C  CD  . GLU C  1 278 ? 51.471   70.062  49.416  1.00 42.18 ? 270  GLU C CD  1 
ATOM   6274  O  OE1 . GLU C  1 278 ? 51.829   70.651  50.470  1.00 44.33 ? 270  GLU C OE1 1 
ATOM   6275  O  OE2 . GLU C  1 278 ? 51.301   70.685  48.350  1.00 46.03 ? 270  GLU C OE2 1 
ATOM   6276  N  N   . VAL C  1 279 ? 50.152   65.166  49.050  1.00 29.49 ? 271  VAL C N   1 
ATOM   6277  C  CA  . VAL C  1 279 ? 50.298   64.165  48.031  1.00 29.37 ? 271  VAL C CA  1 
ATOM   6278  C  C   . VAL C  1 279 ? 49.772   64.730  46.724  1.00 31.11 ? 271  VAL C C   1 
ATOM   6279  O  O   . VAL C  1 279 ? 49.171   65.799  46.675  1.00 30.44 ? 271  VAL C O   1 
ATOM   6280  C  CB  . VAL C  1 279 ? 49.560   62.863  48.375  1.00 29.15 ? 271  VAL C CB  1 
ATOM   6281  C  CG1 . VAL C  1 279 ? 50.210   62.228  49.580  1.00 27.62 ? 271  VAL C CG1 1 
ATOM   6282  C  CG2 . VAL C  1 279 ? 48.039   63.096  48.619  1.00 25.98 ? 271  VAL C CG2 1 
ATOM   6283  N  N   . GLU C  1 280 ? 49.964   63.965  45.681  1.00 33.06 ? 272  GLU C N   1 
ATOM   6284  C  CA  . GLU C  1 280 ? 49.637   64.403  44.361  1.00 35.49 ? 272  GLU C CA  1 
ATOM   6285  C  C   . GLU C  1 280 ? 48.147   64.304  44.068  1.00 33.53 ? 272  GLU C C   1 
ATOM   6286  O  O   . GLU C  1 280 ? 47.605   65.141  43.412  1.00 32.57 ? 272  GLU C O   1 
ATOM   6287  C  CB  . GLU C  1 280 ? 50.514   63.677  43.326  1.00 38.08 ? 272  GLU C CB  1 
ATOM   6288  C  CG  . GLU C  1 280 ? 50.643   62.146  43.475  1.00 45.58 ? 272  GLU C CG  1 
ATOM   6289  C  CD  . GLU C  1 280 ? 51.863   61.643  44.288  1.00 54.11 ? 272  GLU C CD  1 
ATOM   6290  O  OE1 . GLU C  1 280 ? 52.846   61.183  43.684  1.00 56.12 ? 272  GLU C OE1 1 
ATOM   6291  O  OE2 . GLU C  1 280 ? 51.807   61.643  45.522  1.00 53.92 ? 272  GLU C OE2 1 
ATOM   6292  N  N   . ARG C  1 281 ? 47.492   63.300  44.602  1.00 31.80 ? 273  ARG C N   1 
ATOM   6293  C  CA  . ARG C  1 281 ? 46.064   63.193  44.426  1.00 30.54 ? 273  ARG C CA  1 
ATOM   6294  C  C   . ARG C  1 281 ? 45.286   62.808  45.661  1.00 27.35 ? 273  ARG C C   1 
ATOM   6295  O  O   . ARG C  1 281 ? 45.614   61.867  46.333  1.00 25.15 ? 273  ARG C O   1 
ATOM   6296  C  CB  . ARG C  1 281 ? 45.713   62.252  43.273  1.00 31.52 ? 273  ARG C CB  1 
ATOM   6297  C  CG  . ARG C  1 281 ? 44.245   62.349  42.940  1.00 35.88 ? 273  ARG C CG  1 
ATOM   6298  C  CD  . ARG C  1 281 ? 43.913   61.712  41.676  1.00 40.62 ? 273  ARG C CD  1 
ATOM   6299  N  NE  . ARG C  1 281 ? 42.466   61.715  41.444  1.00 42.65 ? 273  ARG C NE  1 
ATOM   6300  C  CZ  . ARG C  1 281 ? 41.759   62.700  40.861  1.00 42.56 ? 273  ARG C CZ  1 
ATOM   6301  N  NH1 . ARG C  1 281 ? 42.308   63.840  40.444  1.00 41.54 ? 273  ARG C NH1 1 
ATOM   6302  N  NH2 . ARG C  1 281 ? 40.456   62.545  40.718  1.00 41.18 ? 273  ARG C NH2 1 
ATOM   6303  N  N   . ALA C  1 282 ? 44.224   63.561  45.906  1.00 24.46 ? 274  ALA C N   1 
ATOM   6304  C  CA  . ALA C  1 282 ? 43.334   63.319  47.008  1.00 24.24 ? 274  ALA C CA  1 
ATOM   6305  C  C   . ALA C  1 282 ? 41.978   63.944  46.713  1.00 23.58 ? 274  ALA C C   1 
ATOM   6306  O  O   . ALA C  1 282 ? 41.749   65.100  46.983  1.00 22.61 ? 274  ALA C O   1 
ATOM   6307  C  CB  . ALA C  1 282 ? 43.912   63.846  48.306  1.00 22.36 ? 274  ALA C CB  1 
ATOM   6308  N  N   . ASN C  1 283 ? 41.081   63.152  46.155  1.00 23.20 ? 275  ASN C N   1 
ATOM   6309  C  CA  . ASN C  1 283 ? 39.846   63.646  45.645  1.00 23.54 ? 275  ASN C CA  1 
ATOM   6310  C  C   . ASN C  1 283 ? 38.723   62.638  45.816  1.00 24.32 ? 275  ASN C C   1 
ATOM   6311  O  O   . ASN C  1 283 ? 38.874   61.469  45.450  1.00 24.21 ? 275  ASN C O   1 
ATOM   6312  C  CB  . ASN C  1 283 ? 40.022   63.999  44.190  1.00 23.47 ? 275  ASN C CB  1 
ATOM   6313  C  CG  . ASN C  1 283 ? 38.867   64.802  43.655  1.00 23.52 ? 275  ASN C CG  1 
ATOM   6314  O  OD1 . ASN C  1 283 ? 37.765   64.240  43.451  1.00 22.50 ? 275  ASN C OD1 1 
ATOM   6315  N  ND2 . ASN C  1 283 ? 39.091   66.113  43.425  1.00 17.34 ? 275  ASN C ND2 1 
ATOM   6316  N  N   . ILE C  1 284 ? 37.606   63.084  46.383  1.00 24.52 ? 276  ILE C N   1 
ATOM   6317  C  CA  . ILE C  1 284 ? 36.508   62.201  46.657  1.00 24.99 ? 276  ILE C CA  1 
ATOM   6318  C  C   . ILE C  1 284 ? 35.882   61.604  45.381  1.00 26.39 ? 276  ILE C C   1 
ATOM   6319  O  O   . ILE C  1 284 ? 35.205   60.603  45.461  1.00 26.12 ? 276  ILE C O   1 
ATOM   6320  C  CB  . ILE C  1 284 ? 35.408   62.852  47.519  1.00 24.72 ? 276  ILE C CB  1 
ATOM   6321  C  CG1 . ILE C  1 284 ? 34.615   63.895  46.739  1.00 24.13 ? 276  ILE C CG1 1 
ATOM   6322  C  CG2 . ILE C  1 284 ? 35.984   63.370  48.813  1.00 22.06 ? 276  ILE C CG2 1 
ATOM   6323  C  CD1 . ILE C  1 284 ? 33.483   64.509  47.556  1.00 23.03 ? 276  ILE C CD1 1 
ATOM   6324  N  N   . SER C  1 285 ? 36.119   62.183  44.219  1.00 27.40 ? 277  SER C N   1 
ATOM   6325  C  CA  . SER C  1 285 ? 35.541   61.618  43.049  1.00 30.13 ? 277  SER C CA  1 
ATOM   6326  C  C   . SER C  1 285 ? 36.103   60.229  42.801  1.00 33.25 ? 277  SER C C   1 
ATOM   6327  O  O   . SER C  1 285 ? 35.402   59.395  42.260  1.00 33.92 ? 277  SER C O   1 
ATOM   6328  C  CB  . SER C  1 285 ? 35.721   62.489  41.798  1.00 30.05 ? 277  SER C CB  1 
ATOM   6329  O  OG  . SER C  1 285 ? 37.065   62.653  41.486  1.00 30.75 ? 277  SER C OG  1 
ATOM   6330  N  N   . ASP C  1 286 ? 37.342   59.948  43.209  1.00 36.09 ? 278  ASP C N   1 
ATOM   6331  C  CA  . ASP C  1 286 ? 37.880   58.604  43.031  1.00 37.99 ? 278  ASP C CA  1 
ATOM   6332  C  C   . ASP C  1 286 ? 37.099   57.562  43.801  1.00 41.04 ? 278  ASP C C   1 
ATOM   6333  O  O   . ASP C  1 286 ? 37.251   56.396  43.493  1.00 42.10 ? 278  ASP C O   1 
ATOM   6334  C  CB  . ASP C  1 286 ? 39.340   58.494  43.461  1.00 37.87 ? 278  ASP C CB  1 
ATOM   6335  C  CG  . ASP C  1 286 ? 40.240   59.409  42.692  1.00 36.24 ? 278  ASP C CG  1 
ATOM   6336  O  OD1 . ASP C  1 286 ? 39.941   59.684  41.547  1.00 35.59 ? 278  ASP C OD1 1 
ATOM   6337  O  OD2 . ASP C  1 286 ? 41.236   59.906  43.227  1.00 36.07 ? 278  ASP C OD2 1 
ATOM   6338  N  N   . TYR C  1 287 ? 36.288   57.936  44.801  1.00 43.27 ? 279  TYR C N   1 
ATOM   6339  C  CA  . TYR C  1 287 ? 35.560   56.928  45.574  1.00 44.92 ? 279  TYR C CA  1 
ATOM   6340  C  C   . TYR C  1 287 ? 34.075   56.944  45.312  1.00 47.30 ? 279  TYR C C   1 
ATOM   6341  O  O   . TYR C  1 287 ? 33.344   56.237  45.935  1.00 48.18 ? 279  TYR C O   1 
ATOM   6342  C  CB  . TYR C  1 287 ? 35.843   57.087  47.050  1.00 44.55 ? 279  TYR C CB  1 
ATOM   6343  C  CG  . TYR C  1 287 ? 37.280   57.426  47.318  1.00 44.63 ? 279  TYR C CG  1 
ATOM   6344  C  CD1 . TYR C  1 287 ? 38.294   56.501  47.110  1.00 47.08 ? 279  TYR C CD1 1 
ATOM   6345  C  CD2 . TYR C  1 287 ? 37.631   58.678  47.743  1.00 44.38 ? 279  TYR C CD2 1 
ATOM   6346  C  CE1 . TYR C  1 287 ? 39.630   56.835  47.353  1.00 47.15 ? 279  TYR C CE1 1 
ATOM   6347  C  CE2 . TYR C  1 287 ? 38.937   59.023  47.999  1.00 45.79 ? 279  TYR C CE2 1 
ATOM   6348  C  CZ  . TYR C  1 287 ? 39.937   58.111  47.793  1.00 47.48 ? 279  TYR C CZ  1 
ATOM   6349  O  OH  . TYR C  1 287 ? 41.233   58.511  48.038  1.00 48.85 ? 279  TYR C OH  1 
ATOM   6350  N  N   . LEU C  1 288 ? 33.615   57.690  44.330  1.00 50.32 ? 280  LEU C N   1 
ATOM   6351  C  CA  . LEU C  1 288 ? 32.198   57.688  44.043  1.00 52.12 ? 280  LEU C CA  1 
ATOM   6352  C  C   . LEU C  1 288 ? 31.856   58.368  42.716  1.00 53.10 ? 280  LEU C C   1 
ATOM   6353  O  O   . LEU C  1 288 ? 31.864   57.734  41.664  1.00 54.25 ? 280  LEU C O   1 
ATOM   6354  C  CB  . LEU C  1 288 ? 31.459   58.368  45.214  1.00 52.62 ? 280  LEU C CB  1 
ATOM   6355  C  CG  . LEU C  1 288 ? 31.621   59.851  45.570  1.00 53.13 ? 280  LEU C CG  1 
ATOM   6356  C  CD1 . LEU C  1 288 ? 30.658   60.839  44.703  1.00 53.46 ? 280  LEU C CD1 1 
ATOM   6357  C  CD2 . LEU C  1 288 ? 31.373   59.930  47.074  1.00 48.88 ? 280  LEU C CD2 1 
ATOM   6358  N  N   . GLY D  1 7   ? -49.897  58.212  42.017  1.00 51.43 ? -1   GLY D N   1 
ATOM   6359  C  CA  . GLY D  1 7   ? -49.064  59.270  41.342  1.00 51.50 ? -1   GLY D CA  1 
ATOM   6360  C  C   . GLY D  1 7   ? -48.416  60.275  42.317  1.00 51.27 ? -1   GLY D C   1 
ATOM   6361  O  O   . GLY D  1 7   ? -48.477  60.098  43.541  1.00 52.58 ? -1   GLY D O   1 
ATOM   6362  N  N   . HIS D  1 8   ? -47.820  61.351  41.795  1.00 49.87 ? 0    HIS D N   1 
ATOM   6363  C  CA  . HIS D  1 8   ? -47.041  62.279  42.628  1.00 48.95 ? 0    HIS D CA  1 
ATOM   6364  C  C   . HIS D  1 8   ? -47.556  63.727  42.542  1.00 46.28 ? 0    HIS D C   1 
ATOM   6365  O  O   . HIS D  1 8   ? -48.316  64.062  41.649  1.00 44.40 ? 0    HIS D O   1 
ATOM   6366  C  CB  . HIS D  1 8   ? -45.530  62.137  42.285  1.00 49.99 ? 0    HIS D CB  1 
ATOM   6367  C  CG  . HIS D  1 8   ? -44.964  60.754  42.566  1.00 56.95 ? 0    HIS D CG  1 
ATOM   6368  N  ND1 . HIS D  1 8   ? -44.391  59.955  41.581  1.00 62.43 ? 0    HIS D ND1 1 
ATOM   6369  C  CD2 . HIS D  1 8   ? -44.903  60.021  43.718  1.00 60.97 ? 0    HIS D CD2 1 
ATOM   6370  C  CE1 . HIS D  1 8   ? -43.999  58.802  42.111  1.00 62.58 ? 0    HIS D CE1 1 
ATOM   6371  N  NE2 . HIS D  1 8   ? -44.295  58.817  43.405  1.00 63.41 ? 0    HIS D NE2 1 
ATOM   6372  N  N   . MET D  1 9   ? -47.161  64.570  43.498  1.00 47.02 ? 1    MET D N   1 
ATOM   6373  C  CA  . MET D  1 9   ? -47.613  65.965  43.527  1.00 45.37 ? 1    MET D CA  1 
ATOM   6374  C  C   . MET D  1 9   ? -47.039  66.752  42.337  1.00 42.63 ? 1    MET D C   1 
ATOM   6375  O  O   . MET D  1 9   ? -45.963  66.483  41.874  1.00 41.55 ? 1    MET D O   1 
ATOM   6376  C  CB  . MET D  1 9   ? -47.256  66.644  44.871  1.00 45.43 ? 1    MET D CB  1 
ATOM   6377  C  CG  . MET D  1 9   ? -48.221  66.355  46.021  1.00 47.12 ? 1    MET D CG  1 
ATOM   6378  S  SD  . MET D  1 9   ? -47.893  67.104  47.633  1.00 45.49 ? 1    MET D SD  1 
ATOM   6379  C  CE  . MET D  1 9   ? -46.285  66.414  47.958  1.00 47.97 ? 1    MET D CE  1 
ATOM   6380  N  N   . ARG D  1 10  ? -47.785  67.719  41.843  1.00 40.33 ? 2    ARG D N   1 
ATOM   6381  C  CA  . ARG D  1 10  ? -47.329  68.578  40.763  1.00 39.08 ? 2    ARG D CA  1 
ATOM   6382  C  C   . ARG D  1 10  ? -46.203  69.539  41.232  1.00 35.89 ? 2    ARG D C   1 
ATOM   6383  O  O   . ARG D  1 10  ? -46.389  70.282  42.189  1.00 33.87 ? 2    ARG D O   1 
ATOM   6384  C  CB  . ARG D  1 10  ? -48.468  69.464  40.260  1.00 39.73 ? 2    ARG D CB  1 
ATOM   6385  C  CG  . ARG D  1 10  ? -49.359  68.925  39.195  1.00 43.28 ? 2    ARG D CG  1 
ATOM   6386  C  CD  . ARG D  1 10  ? -49.957  70.076  38.321  1.00 44.14 ? 2    ARG D CD  1 
ATOM   6387  N  NE  . ARG D  1 10  ? -50.523  71.169  39.100  1.00 43.80 ? 2    ARG D NE  1 
ATOM   6388  C  CZ  . ARG D  1 10  ? -50.426  72.457  38.780  1.00 44.63 ? 2    ARG D CZ  1 
ATOM   6389  N  NH1 . ARG D  1 10  ? -49.754  72.840  37.707  1.00 46.86 ? 2    ARG D NH1 1 
ATOM   6390  N  NH2 . ARG D  1 10  ? -51.002  73.375  39.534  1.00 42.87 ? 2    ARG D NH2 1 
ATOM   6391  N  N   . THR D  1 11  ? -45.091  69.535  40.515  1.00 32.82 ? 3    THR D N   1 
ATOM   6392  C  CA  . THR D  1 11  ? -43.995  70.411  40.796  1.00 31.88 ? 3    THR D CA  1 
ATOM   6393  C  C   . THR D  1 11  ? -43.441  71.082  39.568  1.00 31.68 ? 3    THR D C   1 
ATOM   6394  O  O   . THR D  1 11  ? -43.686  70.645  38.449  1.00 30.82 ? 3    THR D O   1 
ATOM   6395  C  CB  . THR D  1 11  ? -42.836  69.665  41.473  1.00 31.28 ? 3    THR D CB  1 
ATOM   6396  O  OG1 . THR D  1 11  ? -42.159  68.843  40.529  1.00 30.12 ? 3    THR D OG1 1 
ATOM   6397  C  CG2 . THR D  1 11  ? -43.329  68.798  42.605  1.00 30.41 ? 3    THR D CG2 1 
ATOM   6398  N  N   . ASN D  1 12  ? -42.654  72.133  39.811  1.00 30.85 ? 4    ASN D N   1 
ATOM   6399  C  CA  . ASN D  1 12  ? -41.876  72.800  38.794  1.00 30.49 ? 4    ASN D CA  1 
ATOM   6400  C  C   . ASN D  1 12  ? -40.547  72.126  38.523  1.00 31.02 ? 4    ASN D C   1 
ATOM   6401  O  O   . ASN D  1 12  ? -39.605  72.780  38.115  1.00 31.48 ? 4    ASN D O   1 
ATOM   6402  C  CB  . ASN D  1 12  ? -41.618  74.249  39.195  1.00 29.76 ? 4    ASN D CB  1 
ATOM   6403  C  CG  . ASN D  1 12  ? -40.710  74.380  40.435  1.00 28.96 ? 4    ASN D CG  1 
ATOM   6404  O  OD1 . ASN D  1 12  ? -40.490  73.402  41.167  1.00 25.47 ? 4    ASN D OD1 1 
ATOM   6405  N  ND2 . ASN D  1 12  ? -40.195  75.595  40.672  1.00 23.50 ? 4    ASN D ND2 1 
ATOM   6406  N  N   . LYS D  1 13  ? -40.433  70.837  38.743  1.00 32.14 ? 5    LYS D N   1 
ATOM   6407  C  CA  . LYS D  1 13  ? -39.123  70.217  38.690  1.00 34.66 ? 5    LYS D CA  1 
ATOM   6408  C  C   . LYS D  1 13  ? -38.356  70.336  37.372  1.00 35.41 ? 5    LYS D C   1 
ATOM   6409  O  O   . LYS D  1 13  ? -37.133  70.360  37.376  1.00 34.77 ? 5    LYS D O   1 
ATOM   6410  C  CB  . LYS D  1 13  ? -39.140  68.783  39.179  1.00 35.24 ? 5    LYS D CB  1 
ATOM   6411  C  CG  . LYS D  1 13  ? -39.623  67.742  38.250  1.00 40.68 ? 5    LYS D CG  1 
ATOM   6412  C  CD  . LYS D  1 13  ? -39.239  66.415  38.870  1.00 46.53 ? 5    LYS D CD  1 
ATOM   6413  C  CE  . LYS D  1 13  ? -39.860  65.211  38.195  1.00 50.16 ? 5    LYS D CE  1 
ATOM   6414  N  NZ  . LYS D  1 13  ? -39.193  63.983  38.839  1.00 53.50 ? 5    LYS D NZ  1 
ATOM   6415  N  N   . ASP D  1 14  ? -39.078  70.451  36.271  1.00 36.81 ? 6    ASP D N   1 
ATOM   6416  C  CA  . ASP D  1 14  ? -38.479  70.599  34.949  1.00 37.99 ? 6    ASP D CA  1 
ATOM   6417  C  C   . ASP D  1 14  ? -37.820  71.950  34.747  1.00 36.95 ? 6    ASP D C   1 
ATOM   6418  O  O   . ASP D  1 14  ? -36.996  72.094  33.858  1.00 37.59 ? 6    ASP D O   1 
ATOM   6419  C  CB  . ASP D  1 14  ? -39.541  70.342  33.859  1.00 39.32 ? 6    ASP D CB  1 
ATOM   6420  C  CG  . ASP D  1 14  ? -39.920  68.838  33.748  1.00 43.86 ? 6    ASP D CG  1 
ATOM   6421  O  OD1 . ASP D  1 14  ? -39.168  67.950  34.276  1.00 49.07 ? 6    ASP D OD1 1 
ATOM   6422  O  OD2 . ASP D  1 14  ? -40.966  68.536  33.129  1.00 50.85 ? 6    ASP D OD2 1 
ATOM   6423  N  N   . ARG D  1 15  ? -38.173  72.914  35.576  1.00 35.10 ? 7    ARG D N   1 
ATOM   6424  C  CA  . ARG D  1 15  ? -37.574  74.198  35.534  1.00 35.58 ? 7    ARG D CA  1 
ATOM   6425  C  C   . ARG D  1 15  ? -36.409  74.359  36.501  1.00 32.59 ? 7    ARG D C   1 
ATOM   6426  O  O   . ARG D  1 15  ? -35.840  75.443  36.582  1.00 31.89 ? 7    ARG D O   1 
ATOM   6427  C  CB  . ARG D  1 15  ? -38.624  75.264  35.877  1.00 37.16 ? 7    ARG D CB  1 
ATOM   6428  C  CG  . ARG D  1 15  ? -39.765  75.369  34.873  1.00 44.02 ? 7    ARG D CG  1 
ATOM   6429  C  CD  . ARG D  1 15  ? -40.739  76.534  35.270  1.00 53.55 ? 7    ARG D CD  1 
ATOM   6430  N  NE  . ARG D  1 15  ? -41.910  76.639  34.374  1.00 62.52 ? 7    ARG D NE  1 
ATOM   6431  C  CZ  . ARG D  1 15  ? -41.884  76.950  33.065  1.00 68.29 ? 7    ARG D CZ  1 
ATOM   6432  N  NH1 . ARG D  1 15  ? -40.748  77.214  32.415  1.00 70.29 ? 7    ARG D NH1 1 
ATOM   6433  N  NH2 . ARG D  1 15  ? -43.023  77.000  32.382  1.00 70.42 ? 7    ARG D NH2 1 
ATOM   6434  N  N   . LEU D  1 16  ? -36.070  73.328  37.253  1.00 29.90 ? 8    LEU D N   1 
ATOM   6435  C  CA  . LEU D  1 16  ? -34.996  73.467  38.230  1.00 29.43 ? 8    LEU D CA  1 
ATOM   6436  C  C   . LEU D  1 16  ? -33.655  73.378  37.525  1.00 28.36 ? 8    LEU D C   1 
ATOM   6437  O  O   . LEU D  1 16  ? -33.512  72.636  36.580  1.00 27.32 ? 8    LEU D O   1 
ATOM   6438  C  CB  . LEU D  1 16  ? -35.089  72.427  39.358  1.00 27.93 ? 8    LEU D CB  1 
ATOM   6439  C  CG  . LEU D  1 16  ? -36.410  72.503  40.122  1.00 28.40 ? 8    LEU D CG  1 
ATOM   6440  C  CD1 . LEU D  1 16  ? -36.515  71.452  41.220  1.00 26.15 ? 8    LEU D CD1 1 
ATOM   6441  C  CD2 . LEU D  1 16  ? -36.654  73.900  40.672  1.00 26.55 ? 8    LEU D CD2 1 
ATOM   6442  N  N   . VAL D  1 17  ? -32.700  74.173  38.003  1.00 27.38 ? 9    VAL D N   1 
ATOM   6443  C  CA  . VAL D  1 17  ? -31.320  74.169  37.477  1.00 26.82 ? 9    VAL D CA  1 
ATOM   6444  C  C   . VAL D  1 17  ? -30.471  73.128  38.176  1.00 26.50 ? 9    VAL D C   1 
ATOM   6445  O  O   . VAL D  1 17  ? -30.441  73.103  39.388  1.00 27.36 ? 9    VAL D O   1 
ATOM   6446  C  CB  . VAL D  1 17  ? -30.676  75.589  37.614  1.00 26.46 ? 9    VAL D CB  1 
ATOM   6447  C  CG1 . VAL D  1 17  ? -29.255  75.607  37.082  1.00 23.65 ? 9    VAL D CG1 1 
ATOM   6448  C  CG2 . VAL D  1 17  ? -31.545  76.555  36.860  1.00 25.22 ? 9    VAL D CG2 1 
ATOM   6449  N  N   . ARG D  1 18  ? -29.818  72.273  37.404  1.00 26.26 ? 10   ARG D N   1 
ATOM   6450  C  CA  A ARG D  1 18  ? -28.915  71.244  37.929  0.50 26.10 ? 10   ARG D CA  1 
ATOM   6451  C  CA  B ARG D  1 18  ? -28.935  71.243  37.899  0.50 26.61 ? 10   ARG D CA  1 
ATOM   6452  C  C   . ARG D  1 18  ? -27.474  71.690  37.623  1.00 26.36 ? 10   ARG D C   1 
ATOM   6453  O  O   . ARG D  1 18  ? -27.110  72.006  36.467  1.00 26.95 ? 10   ARG D O   1 
ATOM   6454  C  CB  A ARG D  1 18  ? -29.240  69.848  37.342  0.50 26.61 ? 10   ARG D CB  1 
ATOM   6455  C  CB  B ARG D  1 18  ? -29.286  69.947  37.166  0.50 27.52 ? 10   ARG D CB  1 
ATOM   6456  C  CG  A ARG D  1 18  ? -28.302  68.629  37.802  0.50 27.90 ? 10   ARG D CG  1 
ATOM   6457  C  CG  B ARG D  1 18  ? -29.169  68.651  37.975  0.50 30.88 ? 10   ARG D CG  1 
ATOM   6458  C  CD  A ARG D  1 18  ? -28.771  67.173  37.287  0.50 29.54 ? 10   ARG D CD  1 
ATOM   6459  C  CD  B ARG D  1 18  ? -29.499  67.391  37.123  0.50 35.00 ? 10   ARG D CD  1 
ATOM   6460  N  NE  A ARG D  1 18  ? -29.417  67.217  35.960  0.50 31.58 ? 10   ARG D NE  1 
ATOM   6461  N  NE  B ARG D  1 18  ? -30.918  67.260  36.765  0.50 36.36 ? 10   ARG D NE  1 
ATOM   6462  C  CZ  A ARG D  1 18  ? -28.902  66.678  34.857  0.50 31.61 ? 10   ARG D CZ  1 
ATOM   6463  C  CZ  B ARG D  1 18  ? -31.634  66.168  37.039  0.50 39.81 ? 10   ARG D CZ  1 
ATOM   6464  N  NH1 A ARG D  1 18  ? -27.745  66.028  34.936  0.50 30.94 ? 10   ARG D NH1 1 
ATOM   6465  N  NH1 B ARG D  1 18  ? -31.066  65.131  37.656  0.50 40.73 ? 10   ARG D NH1 1 
ATOM   6466  N  NH2 A ARG D  1 18  ? -29.537  66.795  33.688  0.50 29.04 ? 10   ARG D NH2 1 
ATOM   6467  N  NH2 B ARG D  1 18  ? -32.908  66.087  36.694  0.50 40.42 ? 10   ARG D NH2 1 
ATOM   6468  N  N   . ILE D  1 19  ? -26.644  71.728  38.660  1.00 25.09 ? 11   ILE D N   1 
ATOM   6469  C  CA  . ILE D  1 19  ? -25.382  72.410  38.606  1.00 24.76 ? 11   ILE D CA  1 
ATOM   6470  C  C   . ILE D  1 19  ? -24.310  71.705  39.446  1.00 25.17 ? 11   ILE D C   1 
ATOM   6471  O  O   . ILE D  1 19  ? -24.630  71.095  40.490  1.00 24.51 ? 11   ILE D O   1 
ATOM   6472  C  CB  . ILE D  1 19  ? -25.576  73.882  39.041  1.00 24.47 ? 11   ILE D CB  1 
ATOM   6473  C  CG1 . ILE D  1 19  ? -24.413  74.739  38.603  1.00 25.39 ? 11   ILE D CG1 1 
ATOM   6474  C  CG2 . ILE D  1 19  ? -25.769  74.051  40.564  1.00 23.70 ? 11   ILE D CG2 1 
ATOM   6475  C  CD1 . ILE D  1 19  ? -24.687  76.254  38.760  1.00 24.35 ? 11   ILE D CD1 1 
ATOM   6476  N  N   . SER D  1 20  ? -23.049  71.798  38.998  1.00 24.19 ? 12   SER D N   1 
ATOM   6477  C  CA  . SER D  1 20  ? -21.930  71.165  39.701  1.00 23.92 ? 12   SER D CA  1 
ATOM   6478  C  C   . SER D  1 20  ? -21.553  71.902  40.974  1.00 24.53 ? 12   SER D C   1 
ATOM   6479  O  O   . SER D  1 20  ? -21.204  73.078  40.932  1.00 22.98 ? 12   SER D O   1 
ATOM   6480  C  CB  . SER D  1 20  ? -20.689  71.121  38.834  1.00 24.37 ? 12   SER D CB  1 
ATOM   6481  O  OG  . SER D  1 20  ? -20.324  72.452  38.483  1.00 25.44 ? 12   SER D OG  1 
ATOM   6482  N  N   . VAL D  1 21  ? -21.609  71.185  42.109  1.00 24.88 ? 13   VAL D N   1 
ATOM   6483  C  CA  . VAL D  1 21  ? -21.166  71.718  43.382  1.00 24.70 ? 13   VAL D CA  1 
ATOM   6484  C  C   . VAL D  1 21  ? -19.971  70.877  43.851  1.00 25.07 ? 13   VAL D C   1 
ATOM   6485  O  O   . VAL D  1 21  ? -20.088  69.677  44.018  1.00 25.12 ? 13   VAL D O   1 
ATOM   6486  C  CB  . VAL D  1 21  ? -22.261  71.686  44.394  1.00 24.36 ? 13   VAL D CB  1 
ATOM   6487  C  CG1 . VAL D  1 21  ? -21.638  71.920  45.797  1.00 23.65 ? 13   VAL D CG1 1 
ATOM   6488  C  CG2 . VAL D  1 21  ? -23.261  72.757  44.065  1.00 24.38 ? 13   VAL D CG2 1 
ATOM   6489  N  N   . VAL D  1 22  ? -18.813  71.500  44.007  1.00 25.34 ? 14   VAL D N   1 
ATOM   6490  C  CA  . VAL D  1 22  ? -17.622  70.763  44.379  1.00 25.35 ? 14   VAL D CA  1 
ATOM   6491  C  C   . VAL D  1 22  ? -17.229  71.001  45.795  1.00 23.87 ? 14   VAL D C   1 
ATOM   6492  O  O   . VAL D  1 22  ? -17.510  72.057  46.380  1.00 22.19 ? 14   VAL D O   1 
ATOM   6493  C  CB  . VAL D  1 22  ? -16.381  71.159  43.563  1.00 27.40 ? 14   VAL D CB  1 
ATOM   6494  C  CG1 . VAL D  1 22  ? -16.613  70.636  42.187  1.00 32.50 ? 14   VAL D CG1 1 
ATOM   6495  C  CG2 . VAL D  1 22  ? -16.128  72.688  43.610  1.00 24.99 ? 14   VAL D CG2 1 
ATOM   6496  N  N   . GLY D  1 23  ? -16.556  69.980  46.308  1.00 23.20 ? 15   GLY D N   1 
ATOM   6497  C  CA  . GLY D  1 23  ? -15.834  70.048  47.544  1.00 22.63 ? 15   GLY D CA  1 
ATOM   6498  C  C   . GLY D  1 23  ? -14.747  68.987  47.592  1.00 22.73 ? 15   GLY D C   1 
ATOM   6499  O  O   . GLY D  1 23  ? -14.318  68.374  46.574  1.00 21.55 ? 15   GLY D O   1 
ATOM   6500  N  N   . GLU D  1 24  ? -14.309  68.732  48.803  1.00 22.70 ? 16   GLU D N   1 
ATOM   6501  C  CA  . GLU D  1 24  ? -13.322  67.694  48.995  1.00 23.47 ? 16   GLU D CA  1 
ATOM   6502  C  C   . GLU D  1 24  ? -13.580  66.978  50.317  1.00 21.37 ? 16   GLU D C   1 
ATOM   6503  O  O   . GLU D  1 24  ? -14.167  67.552  51.198  1.00 21.25 ? 16   GLU D O   1 
ATOM   6504  C  CB  . GLU D  1 24  ? -11.918  68.326  48.938  1.00 23.91 ? 16   GLU D CB  1 
ATOM   6505  C  CG  . GLU D  1 24  ? -11.612  69.233  50.160  1.00 27.15 ? 16   GLU D CG  1 
ATOM   6506  C  CD  . GLU D  1 24  ? -10.315  70.030  49.990  1.00 31.35 ? 16   GLU D CD  1 
ATOM   6507  O  OE1 . GLU D  1 24  ? -10.146  70.684  48.915  1.00 32.93 ? 16   GLU D OE1 1 
ATOM   6508  O  OE2 . GLU D  1 24  ? -9.475   69.989  50.923  1.00 30.81 ? 16   GLU D OE2 1 
ATOM   6509  N  N   . ILE D  1 25  ? -13.118  65.746  50.456  1.00 20.73 ? 17   ILE D N   1 
ATOM   6510  C  CA  . ILE D  1 25  ? -13.310  65.025  51.706  1.00 20.41 ? 17   ILE D CA  1 
ATOM   6511  C  C   . ILE D  1 25  ? -12.552  65.757  52.822  1.00 20.79 ? 17   ILE D C   1 
ATOM   6512  O  O   . ILE D  1 25  ? -11.348  66.049  52.688  1.00 20.75 ? 17   ILE D O   1 
ATOM   6513  C  CB  . ILE D  1 25  ? -12.874  63.577  51.637  1.00 20.25 ? 17   ILE D CB  1 
ATOM   6514  C  CG1 . ILE D  1 25  ? -13.700  62.837  50.605  1.00 19.87 ? 17   ILE D CG1 1 
ATOM   6515  C  CG2 . ILE D  1 25  ? -13.028  62.915  53.006  1.00 17.61 ? 17   ILE D CG2 1 
ATOM   6516  C  CD1 . ILE D  1 25  ? -13.287  61.341  50.466  1.00 19.13 ? 17   ILE D CD1 1 
ATOM   6517  N  N   . ALA D  1 26  ? -13.310  66.120  53.867  1.00 20.01 ? 18   ALA D N   1 
ATOM   6518  C  CA  . ALA D  1 26  ? -12.847  66.898  54.996  1.00 20.38 ? 18   ALA D CA  1 
ATOM   6519  C  C   . ALA D  1 26  ? -12.117  65.986  56.004  1.00 20.71 ? 18   ALA D C   1 
ATOM   6520  O  O   . ALA D  1 26  ? -12.442  64.807  56.137  1.00 21.61 ? 18   ALA D O   1 
ATOM   6521  C  CB  . ALA D  1 26  ? -14.021  67.606  55.673  1.00 19.62 ? 18   ALA D CB  1 
ATOM   6522  N  N   . PRO D  1 27  ? -11.082  66.509  56.665  1.00 20.84 ? 19   PRO D N   1 
ATOM   6523  C  CA  . PRO D  1 27  ? -10.437  65.811  57.774  1.00 21.48 ? 19   PRO D CA  1 
ATOM   6524  C  C   . PRO D  1 27  ? -11.381  65.690  58.980  1.00 21.91 ? 19   PRO D C   1 
ATOM   6525  O  O   . PRO D  1 27  ? -12.406  66.381  59.030  1.00 22.01 ? 19   PRO D O   1 
ATOM   6526  C  CB  . PRO D  1 27  ? -9.266   66.744  58.154  1.00 21.89 ? 19   PRO D CB  1 
ATOM   6527  C  CG  . PRO D  1 27  ? -9.771   68.159  57.778  1.00 22.27 ? 19   PRO D CG  1 
ATOM   6528  C  CD  . PRO D  1 27  ? -10.663  67.925  56.552  1.00 21.25 ? 19   PRO D CD  1 
ATOM   6529  N  N   . ALA D  1 28  ? -11.042  64.818  59.926  1.00 22.04 ? 20   ALA D N   1 
ATOM   6530  C  CA  . ALA D  1 28  ? -11.685  64.821  61.229  1.00 22.31 ? 20   ALA D CA  1 
ATOM   6531  C  C   . ALA D  1 28  ? -11.269  66.146  61.844  1.00 22.98 ? 20   ALA D C   1 
ATOM   6532  O  O   . ALA D  1 28  ? -10.121  66.521  61.709  1.00 22.56 ? 20   ALA D O   1 
ATOM   6533  C  CB  . ALA D  1 28  ? -11.214  63.635  62.081  1.00 21.46 ? 20   ALA D CB  1 
ATOM   6534  N  N   . LYS D  1 29  ? -12.200  66.871  62.467  1.00 23.98 ? 21   LYS D N   1 
ATOM   6535  C  CA  . LYS D  1 29  ? -11.895  68.192  63.038  1.00 25.65 ? 21   LYS D CA  1 
ATOM   6536  C  C   . LYS D  1 29  ? -12.189  68.240  64.517  1.00 27.48 ? 21   LYS D C   1 
ATOM   6537  O  O   . LYS D  1 29  ? -13.180  67.661  64.973  1.00 28.64 ? 21   LYS D O   1 
ATOM   6538  C  CB  . LYS D  1 29  ? -12.719  69.289  62.365  1.00 25.25 ? 21   LYS D CB  1 
ATOM   6539  C  CG  . LYS D  1 29  ? -12.441  69.464  60.874  1.00 24.90 ? 21   LYS D CG  1 
ATOM   6540  C  CD  . LYS D  1 29  ? -13.340  70.589  60.285  1.00 24.46 ? 21   LYS D CD  1 
ATOM   6541  C  CE  . LYS D  1 29  ? -13.191  70.734  58.760  1.00 22.74 ? 21   LYS D CE  1 
ATOM   6542  N  NZ  . LYS D  1 29  ? -14.036  71.828  58.167  1.00 24.49 ? 21   LYS D NZ  1 
ATOM   6543  N  N   . MET D  1 30  ? -11.328  68.944  65.254  1.00 29.32 ? 22   MET D N   1 
ATOM   6544  C  CA  . MET D  1 30  ? -11.463  69.167  66.689  1.00 30.52 ? 22   MET D CA  1 
ATOM   6545  C  C   . MET D  1 30  ? -10.729  70.457  66.996  1.00 32.57 ? 22   MET D C   1 
ATOM   6546  O  O   . MET D  1 30  ? -9.537   70.610  66.639  1.00 32.03 ? 22   MET D O   1 
ATOM   6547  C  CB  . MET D  1 30  ? -10.769  68.069  67.500  1.00 31.19 ? 22   MET D CB  1 
ATOM   6548  C  CG  . MET D  1 30  ? -11.286  66.679  67.247  1.00 31.78 ? 22   MET D CG  1 
ATOM   6549  S  SD  . MET D  1 30  ? -10.493  65.412  68.236  1.00 31.06 ? 22   MET D SD  1 
ATOM   6550  C  CE  . MET D  1 30  ? -11.143  65.747  69.872  1.00 28.28 ? 22   MET D CE  1 
ATOM   6551  N  N   . ARG D  1 31  ? -11.410  71.377  67.672  1.00 34.39 ? 23   ARG D N   1 
ATOM   6552  C  CA  . ARG D  1 31  ? -10.790  72.634  68.077  1.00 36.62 ? 23   ARG D CA  1 
ATOM   6553  C  C   . ARG D  1 31  ? -10.152  72.556  69.457  1.00 34.96 ? 23   ARG D C   1 
ATOM   6554  O  O   . ARG D  1 31  ? -9.443   73.458  69.896  1.00 35.09 ? 23   ARG D O   1 
ATOM   6555  C  CB  . ARG D  1 31  ? -11.837  73.724  67.988  1.00 38.94 ? 23   ARG D CB  1 
ATOM   6556  C  CG  . ARG D  1 31  ? -12.373  73.833  66.529  1.00 48.49 ? 23   ARG D CG  1 
ATOM   6557  C  CD  . ARG D  1 31  ? -12.978  75.204  66.152  1.00 61.45 ? 23   ARG D CD  1 
ATOM   6558  N  NE  . ARG D  1 31  ? -13.843  75.761  67.202  1.00 72.57 ? 23   ARG D NE  1 
ATOM   6559  C  CZ  . ARG D  1 31  ? -15.064  75.312  67.529  1.00 80.74 ? 23   ARG D CZ  1 
ATOM   6560  N  NH1 . ARG D  1 31  ? -15.617  74.270  66.907  1.00 83.03 ? 23   ARG D NH1 1 
ATOM   6561  N  NH2 . ARG D  1 31  ? -15.743  75.913  68.503  1.00 83.68 ? 23   ARG D NH2 1 
ATOM   6562  N  N   . SER D  1 32  ? -10.383  71.428  70.116  1.00 33.35 ? 24   SER D N   1 
ATOM   6563  C  CA  . SER D  1 32  ? -9.829   71.117  71.421  1.00 32.27 ? 24   SER D CA  1 
ATOM   6564  C  C   . SER D  1 32  ? -9.913   69.583  71.565  1.00 31.39 ? 24   SER D C   1 
ATOM   6565  O  O   . SER D  1 32  ? -10.771  68.951  70.962  1.00 31.09 ? 24   SER D O   1 
ATOM   6566  C  CB  . SER D  1 32  ? -10.651  71.801  72.535  1.00 32.00 ? 24   SER D CB  1 
ATOM   6567  O  OG  . SER D  1 32  ? -10.422  71.173  73.802  1.00 30.62 ? 24   SER D OG  1 
ATOM   6568  N  N   . PRO D  1 33  ? -9.042   68.985  72.368  1.00 30.58 ? 25   PRO D N   1 
ATOM   6569  C  CA  . PRO D  1 33  ? -9.200   67.553  72.588  1.00 30.38 ? 25   PRO D CA  1 
ATOM   6570  C  C   . PRO D  1 33  ? -10.473  67.235  73.393  1.00 30.22 ? 25   PRO D C   1 
ATOM   6571  O  O   . PRO D  1 33  ? -10.991  66.117  73.334  1.00 29.77 ? 25   PRO D O   1 
ATOM   6572  C  CB  . PRO D  1 33  ? -7.941   67.169  73.380  1.00 31.00 ? 25   PRO D CB  1 
ATOM   6573  C  CG  . PRO D  1 33  ? -7.377   68.520  73.932  1.00 31.77 ? 25   PRO D CG  1 
ATOM   6574  C  CD  . PRO D  1 33  ? -7.816   69.555  72.970  1.00 31.04 ? 25   PRO D CD  1 
ATOM   6575  N  N   . TYR D  1 34  ? -10.958  68.222  74.133  1.00 29.92 ? 26   TYR D N   1 
ATOM   6576  C  CA  . TYR D  1 34  ? -12.089  68.037  75.044  1.00 30.18 ? 26   TYR D CA  1 
ATOM   6577  C  C   . TYR D  1 34  ? -13.379  68.545  74.412  1.00 29.83 ? 26   TYR D C   1 
ATOM   6578  O  O   . TYR D  1 34  ? -13.382  69.568  73.713  1.00 29.90 ? 26   TYR D O   1 
ATOM   6579  C  CB  . TYR D  1 34  ? -11.878  68.809  76.359  1.00 29.59 ? 26   TYR D CB  1 
ATOM   6580  C  CG  . TYR D  1 34  ? -10.706  68.339  77.188  1.00 29.61 ? 26   TYR D CG  1 
ATOM   6581  C  CD1 . TYR D  1 34  ? -10.654  67.037  77.665  1.00 29.04 ? 26   TYR D CD1 1 
ATOM   6582  C  CD2 . TYR D  1 34  ? -9.683   69.220  77.570  1.00 30.61 ? 26   TYR D CD2 1 
ATOM   6583  C  CE1 . TYR D  1 34  ? -9.630   66.594  78.451  1.00 28.79 ? 26   TYR D CE1 1 
ATOM   6584  C  CE2 . TYR D  1 34  ? -8.620   68.781  78.367  1.00 29.55 ? 26   TYR D CE2 1 
ATOM   6585  C  CZ  . TYR D  1 34  ? -8.613   67.459  78.800  1.00 30.12 ? 26   TYR D CZ  1 
ATOM   6586  O  OH  . TYR D  1 34  ? -7.593   66.980  79.595  1.00 29.35 ? 26   TYR D OH  1 
ATOM   6587  N  N   . SER D  1 35  ? -14.447  67.802  74.673  1.00 29.55 ? 27   SER D N   1 
ATOM   6588  C  CA  . SER D  1 35  ? -15.817  68.227  74.478  1.00 29.47 ? 27   SER D CA  1 
ATOM   6589  C  C   . SER D  1 35  ? -16.404  68.487  75.879  1.00 30.03 ? 27   SER D C   1 
ATOM   6590  O  O   . SER D  1 35  ? -16.177  67.701  76.808  1.00 28.83 ? 27   SER D O   1 
ATOM   6591  C  CB  . SER D  1 35  ? -16.611  67.118  73.772  1.00 29.71 ? 27   SER D CB  1 
ATOM   6592  O  OG  . SER D  1 35  ? -16.074  66.833  72.475  1.00 30.07 ? 27   SER D OG  1 
ATOM   6593  N  N   . VAL D  1 36  ? -17.143  69.590  76.023  1.00 29.93 ? 28   VAL D N   1 
ATOM   6594  C  CA  . VAL D  1 36  ? -17.695  70.002  77.309  1.00 29.54 ? 28   VAL D CA  1 
ATOM   6595  C  C   . VAL D  1 36  ? -19.138  69.556  77.395  1.00 30.72 ? 28   VAL D C   1 
ATOM   6596  O  O   . VAL D  1 36  ? -19.964  69.900  76.550  1.00 31.07 ? 28   VAL D O   1 
ATOM   6597  C  CB  . VAL D  1 36  ? -17.615  71.511  77.470  1.00 30.21 ? 28   VAL D CB  1 
ATOM   6598  C  CG1 . VAL D  1 36  ? -18.182  71.969  78.851  1.00 26.90 ? 28   VAL D CG1 1 
ATOM   6599  C  CG2 . VAL D  1 36  ? -16.157  71.988  77.168  1.00 27.74 ? 28   VAL D CG2 1 
ATOM   6600  N  N   . THR D  1 37  ? -19.442  68.765  78.411  1.00 32.07 ? 29   THR D N   1 
ATOM   6601  C  CA  . THR D  1 37  ? -20.796  68.295  78.618  1.00 32.21 ? 29   THR D CA  1 
ATOM   6602  C  C   . THR D  1 37  ? -21.665  69.322  79.325  1.00 33.98 ? 29   THR D C   1 
ATOM   6603  O  O   . THR D  1 37  ? -21.180  70.300  79.871  1.00 33.53 ? 29   THR D O   1 
ATOM   6604  C  CB  . THR D  1 37  ? -20.855  67.039  79.470  1.00 32.65 ? 29   THR D CB  1 
ATOM   6605  O  OG1 . THR D  1 37  ? -20.437  67.367  80.809  1.00 31.58 ? 29   THR D OG1 1 
ATOM   6606  C  CG2 . THR D  1 37  ? -19.987  65.954  78.887  1.00 30.20 ? 29   THR D CG2 1 
ATOM   6607  N  N   . THR D  1 38  ? -22.973  69.059  79.271  1.00 35.17 ? 30   THR D N   1 
ATOM   6608  C  CA  . THR D  1 38  ? -24.002  69.863  79.918  1.00 36.77 ? 30   THR D CA  1 
ATOM   6609  C  C   . THR D  1 38  ? -23.820  69.813  81.426  1.00 36.29 ? 30   THR D C   1 
ATOM   6610  O  O   . THR D  1 38  ? -24.232  70.687  82.099  1.00 37.59 ? 30   THR D O   1 
ATOM   6611  C  CB  . THR D  1 38  ? -25.447  69.349  79.536  1.00 37.40 ? 30   THR D CB  1 
ATOM   6612  O  OG1 . THR D  1 38  ? -25.547  67.951  79.848  1.00 41.56 ? 30   THR D OG1 1 
ATOM   6613  C  CG2 . THR D  1 38  ? -25.694  69.479  78.060  1.00 34.91 ? 30   THR D CG2 1 
ATOM   6614  N  N   . GLU D  1 39  ? -23.160  68.802  81.944  1.00 36.43 ? 31   GLU D N   1 
ATOM   6615  C  CA  . GLU D  1 39  ? -22.791  68.753  83.376  1.00 37.52 ? 31   GLU D CA  1 
ATOM   6616  C  C   . GLU D  1 39  ? -21.496  69.521  83.732  1.00 36.23 ? 31   GLU D C   1 
ATOM   6617  O  O   . GLU D  1 39  ? -21.090  69.501  84.853  1.00 37.48 ? 31   GLU D O   1 
ATOM   6618  C  CB  . GLU D  1 39  ? -22.612  67.293  83.804  1.00 38.53 ? 31   GLU D CB  1 
ATOM   6619  C  CG  . GLU D  1 39  ? -23.917  66.457  83.734  1.00 45.31 ? 31   GLU D CG  1 
ATOM   6620  C  CD  . GLU D  1 39  ? -24.389  66.117  82.244  1.00 54.26 ? 31   GLU D CD  1 
ATOM   6621  O  OE1 . GLU D  1 39  ? -23.559  65.629  81.400  1.00 56.70 ? 31   GLU D OE1 1 
ATOM   6622  O  OE2 . GLU D  1 39  ? -25.602  66.356  81.926  1.00 58.42 ? 31   GLU D OE2 1 
ATOM   6623  N  N   . GLY D  1 40  ? -20.826  70.145  82.771  1.00 34.25 ? 32   GLY D N   1 
ATOM   6624  C  CA  . GLY D  1 40  ? -19.583  70.852  83.002  1.00 33.25 ? 32   GLY D CA  1 
ATOM   6625  C  C   . GLY D  1 40  ? -18.381  69.963  83.197  1.00 32.87 ? 32   GLY D C   1 
ATOM   6626  O  O   . GLY D  1 40  ? -17.453  70.353  83.882  1.00 32.19 ? 32   GLY D O   1 
ATOM   6627  N  N   . THR D  1 41  ? -18.391  68.774  82.598  1.00 31.28 ? 33   THR D N   1 
ATOM   6628  C  CA  . THR D  1 41  ? -17.235  67.921  82.608  1.00 30.67 ? 33   THR D CA  1 
ATOM   6629  C  C   . THR D  1 41  ? -16.713  67.841  81.185  1.00 31.07 ? 33   THR D C   1 
ATOM   6630  O  O   . THR D  1 41  ? -17.381  68.304  80.235  1.00 30.54 ? 33   THR D O   1 
ATOM   6631  C  CB  . THR D  1 41  ? -17.573  66.520  83.097  1.00 31.43 ? 33   THR D CB  1 
ATOM   6632  O  OG1 . THR D  1 41  ? -18.514  65.912  82.196  1.00 31.45 ? 33   THR D OG1 1 
ATOM   6633  C  CG2 . THR D  1 41  ? -18.172  66.562  84.499  1.00 29.44 ? 33   THR D CG2 1 
ATOM   6634  N  N   . VAL D  1 42  ? -15.507  67.298  81.043  1.00 29.98 ? 34   VAL D N   1 
ATOM   6635  C  CA  . VAL D  1 42  ? -14.875  67.199  79.758  1.00 29.65 ? 34   VAL D CA  1 
ATOM   6636  C  C   . VAL D  1 42  ? -14.666  65.719  79.409  1.00 30.01 ? 34   VAL D C   1 
ATOM   6637  O  O   . VAL D  1 42  ? -14.359  64.889  80.268  1.00 29.52 ? 34   VAL D O   1 
ATOM   6638  C  CB  . VAL D  1 42  ? -13.530  67.967  79.697  1.00 29.79 ? 34   VAL D CB  1 
ATOM   6639  C  CG1 . VAL D  1 42  ? -13.768  69.463  79.838  1.00 30.37 ? 34   VAL D CG1 1 
ATOM   6640  C  CG2 . VAL D  1 42  ? -12.532  67.445  80.723  1.00 28.11 ? 34   VAL D CG2 1 
ATOM   6641  N  N   . ARG D  1 43  ? -14.836  65.417  78.131  1.00 30.37 ? 35   ARG D N   1 
ATOM   6642  C  CA  . ARG D  1 43  ? -14.625  64.104  77.595  1.00 31.27 ? 35   ARG D CA  1 
ATOM   6643  C  C   . ARG D  1 43  ? -13.736  64.254  76.396  1.00 30.25 ? 35   ARG D C   1 
ATOM   6644  O  O   . ARG D  1 43  ? -13.866  65.246  75.630  1.00 29.97 ? 35   ARG D O   1 
ATOM   6645  C  CB  . ARG D  1 43  ? -15.963  63.529  77.138  1.00 33.05 ? 35   ARG D CB  1 
ATOM   6646  C  CG  . ARG D  1 43  ? -16.913  63.298  78.281  1.00 36.81 ? 35   ARG D CG  1 
ATOM   6647  C  CD  . ARG D  1 43  ? -18.247  62.667  77.849  1.00 41.85 ? 35   ARG D CD  1 
ATOM   6648  N  NE  . ARG D  1 43  ? -18.034  61.368  77.210  1.00 45.24 ? 35   ARG D NE  1 
ATOM   6649  C  CZ  . ARG D  1 43  ? -18.984  60.668  76.591  1.00 44.67 ? 35   ARG D CZ  1 
ATOM   6650  N  NH1 . ARG D  1 43  ? -20.217  61.146  76.557  1.00 44.64 ? 35   ARG D NH1 1 
ATOM   6651  N  NH2 . ARG D  1 43  ? -18.690  59.503  75.991  1.00 42.81 ? 35   ARG D NH2 1 
ATOM   6652  N  N   . VAL D  1 44  ? -12.847  63.279  76.216  1.00 29.25 ? 36   VAL D N   1 
ATOM   6653  C  CA  . VAL D  1 44  ? -12.079  63.157  74.981  1.00 27.84 ? 36   VAL D CA  1 
ATOM   6654  C  C   . VAL D  1 44  ? -12.724  62.119  74.074  1.00 27.71 ? 36   VAL D C   1 
ATOM   6655  O  O   . VAL D  1 44  ? -12.604  60.945  74.288  1.00 27.86 ? 36   VAL D O   1 
ATOM   6656  C  CB  . VAL D  1 44  ? -10.628  62.784  75.235  1.00 28.00 ? 36   VAL D CB  1 
ATOM   6657  C  CG1 . VAL D  1 44  ? -9.886   62.819  73.889  1.00 25.59 ? 36   VAL D CG1 1 
ATOM   6658  C  CG2 . VAL D  1 44  ? -10.002  63.731  76.281  1.00 26.80 ? 36   VAL D CG2 1 
ATOM   6659  N  N   . ILE D  1 45  ? -13.426  62.574  73.047  1.00 28.45 ? 37   ILE D N   1 
ATOM   6660  C  CA  . ILE D  1 45  ? -14.142  61.689  72.132  1.00 27.99 ? 37   ILE D CA  1 
ATOM   6661  C  C   . ILE D  1 45  ? -14.063  62.259  70.714  1.00 27.63 ? 37   ILE D C   1 
ATOM   6662  O  O   . ILE D  1 45  ? -13.887  63.469  70.535  1.00 27.30 ? 37   ILE D O   1 
ATOM   6663  C  CB  . ILE D  1 45  ? -15.611  61.530  72.548  1.00 28.06 ? 37   ILE D CB  1 
ATOM   6664  C  CG1 . ILE D  1 45  ? -16.232  62.910  72.884  1.00 28.54 ? 37   ILE D CG1 1 
ATOM   6665  C  CG2 . ILE D  1 45  ? -15.708  60.541  73.722  1.00 27.43 ? 37   ILE D CG2 1 
ATOM   6666  C  CD1 . ILE D  1 45  ? -17.800  62.909  72.999  1.00 27.34 ? 37   ILE D CD1 1 
ATOM   6667  N  N   . PRO D  1 46  ? -14.196  61.382  69.712  1.00 27.19 ? 38   PRO D N   1 
ATOM   6668  C  CA  . PRO D  1 46  ? -14.263  61.824  68.324  1.00 27.06 ? 38   PRO D CA  1 
ATOM   6669  C  C   . PRO D  1 46  ? -15.422  62.780  68.036  1.00 26.67 ? 38   PRO D C   1 
ATOM   6670  O  O   . PRO D  1 46  ? -16.402  62.785  68.757  1.00 26.31 ? 38   PRO D O   1 
ATOM   6671  C  CB  . PRO D  1 46  ? -14.418  60.517  67.532  1.00 26.22 ? 38   PRO D CB  1 
ATOM   6672  C  CG  . PRO D  1 46  ? -13.827  59.488  68.420  1.00 27.15 ? 38   PRO D CG  1 
ATOM   6673  C  CD  . PRO D  1 46  ? -14.223  59.910  69.810  1.00 27.41 ? 38   PRO D CD  1 
ATOM   6674  N  N   . VAL D  1 47  ? -15.256  63.604  67.006  1.00 26.74 ? 39   VAL D N   1 
ATOM   6675  C  CA  . VAL D  1 47  ? -16.225  64.644  66.697  1.00 26.72 ? 39   VAL D CA  1 
ATOM   6676  C  C   . VAL D  1 47  ? -16.600  64.574  65.224  1.00 25.84 ? 39   VAL D C   1 
ATOM   6677  O  O   . VAL D  1 47  ? -16.884  63.513  64.717  1.00 26.01 ? 39   VAL D O   1 
ATOM   6678  C  CB  . VAL D  1 47  ? -15.736  66.046  67.212  1.00 27.30 ? 39   VAL D CB  1 
ATOM   6679  C  CG1 . VAL D  1 47  ? -16.900  67.093  67.181  1.00 27.21 ? 39   VAL D CG1 1 
ATOM   6680  C  CG2 . VAL D  1 47  ? -15.209  65.904  68.626  1.00 26.76 ? 39   VAL D CG2 1 
ATOM   6681  N  N   . LEU D  1 48  ? -16.556  65.672  64.497  1.00 25.52 ? 40   LEU D N   1 
ATOM   6682  C  CA  . LEU D  1 48  ? -17.118  65.646  63.154  1.00 24.71 ? 40   LEU D CA  1 
ATOM   6683  C  C   . LEU D  1 48  ? -16.024  65.472  62.118  1.00 24.36 ? 40   LEU D C   1 
ATOM   6684  O  O   . LEU D  1 48  ? -14.851  65.329  62.482  1.00 24.30 ? 40   LEU D O   1 
ATOM   6685  C  CB  . LEU D  1 48  ? -17.925  66.914  62.917  1.00 25.19 ? 40   LEU D CB  1 
ATOM   6686  C  CG  . LEU D  1 48  ? -17.394  68.240  63.435  1.00 26.21 ? 40   LEU D CG  1 
ATOM   6687  C  CD1 . LEU D  1 48  ? -16.348  68.729  62.461  1.00 25.51 ? 40   LEU D CD1 1 
ATOM   6688  C  CD2 . LEU D  1 48  ? -18.538  69.200  63.607  1.00 24.01 ? 40   LEU D CD2 1 
ATOM   6689  N  N   . GLY D  1 49  ? -16.419  65.464  60.840  1.00 22.69 ? 41   GLY D N   1 
ATOM   6690  C  CA  . GLY D  1 49  ? -15.501  65.447  59.736  1.00 22.01 ? 41   GLY D CA  1 
ATOM   6691  C  C   . GLY D  1 49  ? -15.128  64.039  59.367  1.00 22.47 ? 41   GLY D C   1 
ATOM   6692  O  O   . GLY D  1 49  ? -15.618  63.074  59.961  1.00 23.40 ? 41   GLY D O   1 
ATOM   6693  N  N   . GLY D  1 50  ? -14.249  63.927  58.387  1.00 21.93 ? 42   GLY D N   1 
ATOM   6694  C  CA  . GLY D  1 50  ? -13.633  62.683  58.040  1.00 22.04 ? 42   GLY D CA  1 
ATOM   6695  C  C   . GLY D  1 50  ? -14.464  61.670  57.256  1.00 21.76 ? 42   GLY D C   1 
ATOM   6696  O  O   . GLY D  1 50  ? -15.568  61.936  56.844  1.00 21.57 ? 42   GLY D O   1 
ATOM   6697  N  N   . ILE D  1 51  ? -13.849  60.519  57.004  1.00 21.61 ? 43   ILE D N   1 
ATOM   6698  C  CA  . ILE D  1 51  ? -14.553  59.306  56.665  1.00 21.98 ? 43   ILE D CA  1 
ATOM   6699  C  C   . ILE D  1 51  ? -14.790  58.600  57.986  1.00 22.50 ? 43   ILE D C   1 
ATOM   6700  O  O   . ILE D  1 51  ? -13.837  58.268  58.689  1.00 22.51 ? 43   ILE D O   1 
ATOM   6701  C  CB  . ILE D  1 51  ? -13.761  58.434  55.698  1.00 22.22 ? 43   ILE D CB  1 
ATOM   6702  C  CG1 . ILE D  1 51  ? -13.348  59.253  54.450  1.00 22.28 ? 43   ILE D CG1 1 
ATOM   6703  C  CG2 . ILE D  1 51  ? -14.561  57.177  55.319  1.00 20.97 ? 43   ILE D CG2 1 
ATOM   6704  C  CD1 . ILE D  1 51  ? -11.892  59.018  53.976  1.00 23.21 ? 43   ILE D CD1 1 
ATOM   6705  N  N   . THR D  1 52  ? -16.060  58.444  58.358  1.00 22.49 ? 44   THR D N   1 
ATOM   6706  C  CA  . THR D  1 52  ? -16.408  57.766  59.594  1.00 22.38 ? 44   THR D CA  1 
ATOM   6707  C  C   . THR D  1 52  ? -16.766  56.325  59.183  1.00 23.06 ? 44   THR D C   1 
ATOM   6708  O  O   . THR D  1 52  ? -17.700  56.116  58.462  1.00 24.00 ? 44   THR D O   1 
ATOM   6709  C  CB  . THR D  1 52  ? -17.551  58.510  60.270  1.00 22.32 ? 44   THR D CB  1 
ATOM   6710  O  OG1 . THR D  1 52  ? -17.102  59.838  60.614  1.00 21.12 ? 44   THR D OG1 1 
ATOM   6711  C  CG2 . THR D  1 52  ? -18.031  57.801  61.542  1.00 20.89 ? 44   THR D CG2 1 
ATOM   6712  N  N   . TYR D  1 53  ? -15.990  55.341  59.609  1.00 23.05 ? 45   TYR D N   1 
ATOM   6713  C  CA  . TYR D  1 53  ? -16.064  54.029  59.002  1.00 23.66 ? 45   TYR D CA  1 
ATOM   6714  C  C   . TYR D  1 53  ? -17.201  53.185  59.524  1.00 23.92 ? 45   TYR D C   1 
ATOM   6715  O  O   . TYR D  1 53  ? -17.686  52.361  58.800  1.00 23.98 ? 45   TYR D O   1 
ATOM   6716  C  CB  . TYR D  1 53  ? -14.742  53.266  59.151  1.00 23.88 ? 45   TYR D CB  1 
ATOM   6717  C  CG  . TYR D  1 53  ? -13.635  53.921  58.404  1.00 24.02 ? 45   TYR D CG  1 
ATOM   6718  C  CD1 . TYR D  1 53  ? -13.449  53.702  57.048  1.00 24.01 ? 45   TYR D CD1 1 
ATOM   6719  C  CD2 . TYR D  1 53  ? -12.757  54.804  59.053  1.00 24.90 ? 45   TYR D CD2 1 
ATOM   6720  C  CE1 . TYR D  1 53  ? -12.381  54.345  56.347  1.00 23.78 ? 45   TYR D CE1 1 
ATOM   6721  C  CE2 . TYR D  1 53  ? -11.694  55.429  58.360  1.00 23.42 ? 45   TYR D CE2 1 
ATOM   6722  C  CZ  . TYR D  1 53  ? -11.526  55.223  57.027  1.00 23.53 ? 45   TYR D CZ  1 
ATOM   6723  O  OH  . TYR D  1 53  ? -10.486  55.907  56.367  1.00 24.43 ? 45   TYR D OH  1 
ATOM   6724  N  N   . ASN D  1 54  ? -17.673  53.453  60.735  1.00 24.41 ? 46   ASN D N   1 
ATOM   6725  C  CA  . ASN D  1 54  ? -18.658  52.576  61.405  1.00 24.26 ? 46   ASN D CA  1 
ATOM   6726  C  C   . ASN D  1 54  ? -19.967  53.258  61.842  1.00 24.33 ? 46   ASN D C   1 
ATOM   6727  O  O   . ASN D  1 54  ? -20.681  52.720  62.628  1.00 25.70 ? 46   ASN D O   1 
ATOM   6728  C  CB  . ASN D  1 54  ? -17.988  51.874  62.598  1.00 23.82 ? 46   ASN D CB  1 
ATOM   6729  C  CG  . ASN D  1 54  ? -17.657  52.806  63.709  1.00 24.34 ? 46   ASN D CG  1 
ATOM   6730  O  OD1 . ASN D  1 54  ? -17.254  53.968  63.490  1.00 21.17 ? 46   ASN D OD1 1 
ATOM   6731  N  ND2 . ASN D  1 54  ? -17.771  52.298  64.936  1.00 21.11 ? 46   ASN D ND2 1 
ATOM   6732  N  N   . VAL D  1 55  ? -20.257  54.438  61.325  1.00 24.33 ? 47   VAL D N   1 
ATOM   6733  C  CA  . VAL D  1 55  ? -21.492  55.148  61.596  1.00 23.60 ? 47   VAL D CA  1 
ATOM   6734  C  C   . VAL D  1 55  ? -22.020  55.568  60.255  1.00 24.21 ? 47   VAL D C   1 
ATOM   6735  O  O   . VAL D  1 55  ? -21.345  56.295  59.522  1.00 23.92 ? 47   VAL D O   1 
ATOM   6736  C  CB  . VAL D  1 55  ? -21.286  56.378  62.487  1.00 24.14 ? 47   VAL D CB  1 
ATOM   6737  C  CG1 . VAL D  1 55  ? -22.654  57.054  62.865  1.00 20.49 ? 47   VAL D CG1 1 
ATOM   6738  C  CG2 . VAL D  1 55  ? -20.481  55.944  63.766  1.00 21.96 ? 47   VAL D CG2 1 
ATOM   6739  N  N   . LYS D  1 56  ? -23.203  55.064  59.913  1.00 24.42 ? 48   LYS D N   1 
ATOM   6740  C  CA  . LYS D  1 56  ? -23.768  55.320  58.609  1.00 25.49 ? 48   LYS D CA  1 
ATOM   6741  C  C   . LYS D  1 56  ? -25.233  55.718  58.697  1.00 23.90 ? 48   LYS D C   1 
ATOM   6742  O  O   . LYS D  1 56  ? -25.865  55.558  59.761  1.00 22.57 ? 48   LYS D O   1 
ATOM   6743  C  CB  . LYS D  1 56  ? -23.553  54.095  57.732  1.00 27.46 ? 48   LYS D CB  1 
ATOM   6744  C  CG  . LYS D  1 56  ? -24.432  52.931  58.079  1.00 33.10 ? 48   LYS D CG  1 
ATOM   6745  C  CD  . LYS D  1 56  ? -24.076  51.625  57.280  1.00 41.13 ? 48   LYS D CD  1 
ATOM   6746  C  CE  . LYS D  1 56  ? -24.969  50.381  57.735  1.00 42.91 ? 48   LYS D CE  1 
ATOM   6747  N  NZ  . LYS D  1 56  ? -24.758  50.017  59.233  1.00 45.34 ? 48   LYS D NZ  1 
ATOM   6748  N  N   . VAL D  1 57  ? -25.766  56.273  57.608  1.00 22.40 ? 49   VAL D N   1 
ATOM   6749  C  CA  . VAL D  1 57  ? -27.177  56.646  57.594  1.00 21.82 ? 49   VAL D CA  1 
ATOM   6750  C  C   . VAL D  1 57  ? -28.027  55.393  57.895  1.00 22.11 ? 49   VAL D C   1 
ATOM   6751  O  O   . VAL D  1 57  ? -27.681  54.311  57.478  1.00 20.71 ? 49   VAL D O   1 
ATOM   6752  C  CB  . VAL D  1 57  ? -27.593  57.317  56.280  1.00 22.44 ? 49   VAL D CB  1 
ATOM   6753  C  CG1 . VAL D  1 57  ? -27.406  56.356  55.115  1.00 20.19 ? 49   VAL D CG1 1 
ATOM   6754  C  CG2 . VAL D  1 57  ? -29.059  57.932  56.394  1.00 18.86 ? 49   VAL D CG2 1 
ATOM   6755  N  N   . GLY D  1 58  ? -29.094  55.525  58.676  1.00 21.75 ? 50   GLY D N   1 
ATOM   6756  C  CA  . GLY D  1 58  ? -29.820  54.333  59.121  1.00 22.26 ? 50   GLY D CA  1 
ATOM   6757  C  C   . GLY D  1 58  ? -29.445  53.816  60.513  1.00 23.01 ? 50   GLY D C   1 
ATOM   6758  O  O   . GLY D  1 58  ? -30.271  53.191  61.184  1.00 22.49 ? 50   GLY D O   1 
ATOM   6759  N  N   . ASP D  1 59  ? -28.217  54.082  60.954  1.00 22.65 ? 51   ASP D N   1 
ATOM   6760  C  CA  . ASP D  1 59  ? -27.829  53.807  62.316  1.00 23.81 ? 51   ASP D CA  1 
ATOM   6761  C  C   . ASP D  1 59  ? -28.499  54.781  63.285  1.00 23.72 ? 51   ASP D C   1 
ATOM   6762  O  O   . ASP D  1 59  ? -28.974  55.872  62.907  1.00 24.34 ? 51   ASP D O   1 
ATOM   6763  C  CB  . ASP D  1 59  ? -26.321  53.962  62.510  1.00 24.55 ? 51   ASP D CB  1 
ATOM   6764  C  CG  . ASP D  1 59  ? -25.501  52.916  61.764  1.00 26.47 ? 51   ASP D CG  1 
ATOM   6765  O  OD1 . ASP D  1 59  ? -26.024  51.859  61.305  1.00 28.66 ? 51   ASP D OD1 1 
ATOM   6766  O  OD2 . ASP D  1 59  ? -24.279  53.166  61.666  1.00 29.19 ? 51   ASP D OD2 1 
ATOM   6767  N  N   . SER D  1 60  ? -28.499  54.385  64.542  1.00 23.08 ? 52   SER D N   1 
ATOM   6768  C  CA  . SER D  1 60  ? -28.943  55.247  65.624  1.00 23.66 ? 52   SER D CA  1 
ATOM   6769  C  C   . SER D  1 60  ? -28.074  56.525  65.760  1.00 23.06 ? 52   SER D C   1 
ATOM   6770  O  O   . SER D  1 60  ? -26.869  56.452  65.630  1.00 22.99 ? 52   SER D O   1 
ATOM   6771  C  CB  . SER D  1 60  ? -28.898  54.481  66.983  1.00 23.31 ? 52   SER D CB  1 
ATOM   6772  O  OG  . SER D  1 60  ? -29.395  55.337  68.039  1.00 24.61 ? 52   SER D OG  1 
ATOM   6773  N  N   . ALA D  1 61  ? -28.705  57.638  66.100  1.00 22.19 ? 53   ALA D N   1 
ATOM   6774  C  CA  . ALA D  1 61  ? -28.057  58.888  66.350  1.00 22.38 ? 53   ALA D CA  1 
ATOM   6775  C  C   . ALA D  1 61  ? -27.571  58.964  67.767  1.00 23.77 ? 53   ALA D C   1 
ATOM   6776  O  O   . ALA D  1 61  ? -26.774  59.866  68.107  1.00 24.51 ? 53   ALA D O   1 
ATOM   6777  C  CB  . ALA D  1 61  ? -29.010  60.021  66.094  1.00 21.29 ? 53   ALA D CB  1 
ATOM   6778  N  N   . TYR D  1 62  ? -28.084  58.060  68.615  1.00 24.90 ? 54   TYR D N   1 
ATOM   6779  C  CA  . TYR D  1 62  ? -27.704  57.976  70.029  1.00 24.96 ? 54   TYR D CA  1 
ATOM   6780  C  C   . TYR D  1 62  ? -26.845  56.788  70.275  1.00 25.43 ? 54   TYR D C   1 
ATOM   6781  O  O   . TYR D  1 62  ? -26.801  55.896  69.469  1.00 24.44 ? 54   TYR D O   1 
ATOM   6782  C  CB  . TYR D  1 62  ? -28.914  57.880  70.913  1.00 24.62 ? 54   TYR D CB  1 
ATOM   6783  C  CG  . TYR D  1 62  ? -29.691  59.153  70.916  1.00 26.71 ? 54   TYR D CG  1 
ATOM   6784  C  CD1 . TYR D  1 62  ? -30.739  59.376  70.018  1.00 27.71 ? 54   TYR D CD1 1 
ATOM   6785  C  CD2 . TYR D  1 62  ? -29.360  60.166  71.773  1.00 26.29 ? 54   TYR D CD2 1 
ATOM   6786  C  CE1 . TYR D  1 62  ? -31.446  60.567  70.021  1.00 27.43 ? 54   TYR D CE1 1 
ATOM   6787  C  CE2 . TYR D  1 62  ? -30.071  61.357  71.772  1.00 28.34 ? 54   TYR D CE2 1 
ATOM   6788  C  CZ  . TYR D  1 62  ? -31.104  61.541  70.910  1.00 28.82 ? 54   TYR D CZ  1 
ATOM   6789  O  OH  . TYR D  1 62  ? -31.731  62.758  70.934  1.00 33.15 ? 54   TYR D OH  1 
ATOM   6790  N  N   . GLY D  1 63  ? -26.144  56.812  71.406  1.00 26.51 ? 55   GLY D N   1 
ATOM   6791  C  CA  . GLY D  1 63  ? -25.359  55.673  71.839  1.00 27.55 ? 55   GLY D CA  1 
ATOM   6792  C  C   . GLY D  1 63  ? -23.897  55.579  71.389  1.00 28.41 ? 55   GLY D C   1 
ATOM   6793  O  O   . GLY D  1 63  ? -23.236  54.585  71.680  1.00 30.06 ? 55   GLY D O   1 
ATOM   6794  N  N   . TRP D  1 64  ? -23.391  56.575  70.662  1.00 27.57 ? 56   TRP D N   1 
ATOM   6795  C  CA  . TRP D  1 64  ? -22.006  56.548  70.217  1.00 27.00 ? 56   TRP D CA  1 
ATOM   6796  C  C   . TRP D  1 64  ? -21.151  57.322  71.209  1.00 26.25 ? 56   TRP D C   1 
ATOM   6797  O  O   . TRP D  1 64  ? -21.558  58.356  71.695  1.00 24.18 ? 56   TRP D O   1 
ATOM   6798  C  CB  . TRP D  1 64  ? -21.891  57.170  68.828  1.00 26.77 ? 56   TRP D CB  1 
ATOM   6799  C  CG  . TRP D  1 64  ? -22.646  56.376  67.791  1.00 26.87 ? 56   TRP D CG  1 
ATOM   6800  C  CD1 . TRP D  1 64  ? -23.862  56.686  67.241  1.00 25.56 ? 56   TRP D CD1 1 
ATOM   6801  C  CD2 . TRP D  1 64  ? -22.250  55.132  67.211  1.00 23.88 ? 56   TRP D CD2 1 
ATOM   6802  N  NE1 . TRP D  1 64  ? -24.216  55.719  66.333  1.00 23.68 ? 56   TRP D NE1 1 
ATOM   6803  C  CE2 . TRP D  1 64  ? -23.255  54.751  66.310  1.00 24.08 ? 56   TRP D CE2 1 
ATOM   6804  C  CE3 . TRP D  1 64  ? -21.138  54.315  67.355  1.00 25.96 ? 56   TRP D CE3 1 
ATOM   6805  C  CZ2 . TRP D  1 64  ? -23.178  53.585  65.560  1.00 26.59 ? 56   TRP D CZ2 1 
ATOM   6806  C  CZ3 . TRP D  1 64  ? -21.053  53.157  66.610  1.00 27.28 ? 56   TRP D CZ3 1 
ATOM   6807  C  CH2 . TRP D  1 64  ? -22.063  52.804  65.714  1.00 26.43 ? 56   TRP D CH2 1 
ATOM   6808  N  N   . ALA D  1 65  ? -19.980  56.790  71.524  1.00 26.17 ? 57   ALA D N   1 
ATOM   6809  C  CA  . ALA D  1 65  ? -18.953  57.572  72.273  1.00 26.92 ? 57   ALA D CA  1 
ATOM   6810  C  C   . ALA D  1 65  ? -18.302  58.650  71.359  1.00 26.85 ? 57   ALA D C   1 
ATOM   6811  O  O   . ALA D  1 65  ? -17.180  58.518  70.911  1.00 27.13 ? 57   ALA D O   1 
ATOM   6812  C  CB  . ALA D  1 65  ? -17.909  56.646  72.844  1.00 26.25 ? 57   ALA D CB  1 
ATOM   6813  N  N   . GLY D  1 66  ? -19.045  59.712  71.095  1.00 27.68 ? 58   GLY D N   1 
ATOM   6814  C  CA  . GLY D  1 66  ? -18.694  60.713  70.126  1.00 27.86 ? 58   GLY D CA  1 
ATOM   6815  C  C   . GLY D  1 66  ? -19.640  61.870  70.215  1.00 28.60 ? 58   GLY D C   1 
ATOM   6816  O  O   . GLY D  1 66  ? -20.669  61.780  70.829  1.00 29.27 ? 58   GLY D O   1 
ATOM   6817  N  N   . ASP D  1 67  ? -19.269  62.970  69.580  1.00 30.19 ? 59   ASP D N   1 
ATOM   6818  C  CA  . ASP D  1 67  ? -20.025  64.200  69.616  1.00 30.91 ? 59   ASP D CA  1 
ATOM   6819  C  C   . ASP D  1 67  ? -20.159  64.752  68.213  1.00 29.77 ? 59   ASP D C   1 
ATOM   6820  O  O   . ASP D  1 67  ? -19.192  64.859  67.510  1.00 29.84 ? 59   ASP D O   1 
ATOM   6821  C  CB  . ASP D  1 67  ? -19.314  65.219  70.499  1.00 31.78 ? 59   ASP D CB  1 
ATOM   6822  C  CG  . ASP D  1 67  ? -20.040  66.566  70.530  1.00 37.27 ? 59   ASP D CG  1 
ATOM   6823  O  OD1 . ASP D  1 67  ? -21.157  66.605  71.103  1.00 42.04 ? 59   ASP D OD1 1 
ATOM   6824  O  OD2 . ASP D  1 67  ? -19.496  67.570  69.962  1.00 43.29 ? 59   ASP D OD2 1 
ATOM   6825  N  N   . HIS D  1 68  ? -21.367  65.098  67.813  1.00 29.81 ? 60   HIS D N   1 
ATOM   6826  C  CA  . HIS D  1 68  ? -21.640  65.622  66.469  1.00 30.44 ? 60   HIS D CA  1 
ATOM   6827  C  C   . HIS D  1 68  ? -21.119  64.692  65.365  1.00 28.69 ? 60   HIS D C   1 
ATOM   6828  O  O   . HIS D  1 68  ? -20.636  65.170  64.350  1.00 28.44 ? 60   HIS D O   1 
ATOM   6829  C  CB  . HIS D  1 68  ? -21.017  67.008  66.279  1.00 31.38 ? 60   HIS D CB  1 
ATOM   6830  C  CG  . HIS D  1 68  ? -21.800  68.138  66.882  1.00 37.34 ? 60   HIS D CG  1 
ATOM   6831  N  ND1 . HIS D  1 68  ? -21.553  68.627  68.160  1.00 41.92 ? 60   HIS D ND1 1 
ATOM   6832  C  CD2 . HIS D  1 68  ? -22.779  68.930  66.351  1.00 41.86 ? 60   HIS D CD2 1 
ATOM   6833  C  CE1 . HIS D  1 68  ? -22.359  69.665  68.387  1.00 45.42 ? 60   HIS D CE1 1 
ATOM   6834  N  NE2 . HIS D  1 68  ? -23.128  69.854  67.317  1.00 44.26 ? 60   HIS D NE2 1 
ATOM   6835  N  N   . VAL D  1 69  ? -21.221  63.371  65.560  1.00 26.67 ? 61   VAL D N   1 
ATOM   6836  C  CA  . VAL D  1 69  ? -20.640  62.446  64.605  1.00 24.91 ? 61   VAL D CA  1 
ATOM   6837  C  C   . VAL D  1 69  ? -21.421  62.488  63.269  1.00 24.33 ? 61   VAL D C   1 
ATOM   6838  O  O   . VAL D  1 69  ? -22.665  62.398  63.256  1.00 23.67 ? 61   VAL D O   1 
ATOM   6839  C  CB  . VAL D  1 69  ? -20.516  61.017  65.145  1.00 24.51 ? 61   VAL D CB  1 
ATOM   6840  C  CG1 . VAL D  1 69  ? -19.812  60.144  64.125  1.00 21.61 ? 61   VAL D CG1 1 
ATOM   6841  C  CG2 . VAL D  1 69  ? -19.755  61.055  66.439  1.00 24.64 ? 61   VAL D CG2 1 
ATOM   6842  N  N   . GLU D  1 70  ? -20.671  62.652  62.171  1.00 22.61 ? 62   GLU D N   1 
ATOM   6843  C  CA  . GLU D  1 70  ? -21.247  62.760  60.854  1.00 21.74 ? 62   GLU D CA  1 
ATOM   6844  C  C   . GLU D  1 70  ? -21.140  61.416  60.243  1.00 20.98 ? 62   GLU D C   1 
ATOM   6845  O  O   . GLU D  1 70  ? -20.042  60.935  60.111  1.00 22.54 ? 62   GLU D O   1 
ATOM   6846  C  CB  . GLU D  1 70  ? -20.517  63.815  60.030  1.00 21.29 ? 62   GLU D CB  1 
ATOM   6847  C  CG  . GLU D  1 70  ? -20.736  65.213  60.633  1.00 20.98 ? 62   GLU D CG  1 
ATOM   6848  C  CD  . GLU D  1 70  ? -19.945  66.345  60.003  1.00 21.95 ? 62   GLU D CD  1 
ATOM   6849  O  OE1 . GLU D  1 70  ? -18.847  66.083  59.413  1.00 20.64 ? 62   GLU D OE1 1 
ATOM   6850  O  OE2 . GLU D  1 70  ? -20.429  67.515  60.146  1.00 22.05 ? 62   GLU D OE2 1 
ATOM   6851  N  N   . PRO D  1 71  ? -22.259  60.786  59.889  1.00 20.14 ? 63   PRO D N   1 
ATOM   6852  C  CA  . PRO D  1 71  ? -22.214  59.484  59.208  1.00 21.10 ? 63   PRO D CA  1 
ATOM   6853  C  C   . PRO D  1 71  ? -21.521  59.551  57.864  1.00 20.85 ? 63   PRO D C   1 
ATOM   6854  O  O   . PRO D  1 71  ? -21.622  60.560  57.200  1.00 20.40 ? 63   PRO D O   1 
ATOM   6855  C  CB  . PRO D  1 71  ? -23.696  59.149  58.977  1.00 20.77 ? 63   PRO D CB  1 
ATOM   6856  C  CG  . PRO D  1 71  ? -24.375  60.389  59.071  1.00 20.61 ? 63   PRO D CG  1 
ATOM   6857  C  CD  . PRO D  1 71  ? -23.643  61.217  60.077  1.00 20.28 ? 63   PRO D CD  1 
ATOM   6858  N  N   . GLY D  1 72  ? -20.843  58.482  57.478  1.00 20.80 ? 64   GLY D N   1 
ATOM   6859  C  CA  . GLY D  1 72  ? -20.177  58.385  56.148  1.00 20.86 ? 64   GLY D CA  1 
ATOM   6860  C  C   . GLY D  1 72  ? -19.061  59.409  55.886  1.00 20.80 ? 64   GLY D C   1 
ATOM   6861  O  O   . GLY D  1 72  ? -18.184  59.632  56.748  1.00 20.56 ? 64   GLY D O   1 
ATOM   6862  N  N   . VAL D  1 73  ? -19.140  60.065  54.724  1.00 20.33 ? 65   VAL D N   1 
ATOM   6863  C  CA  . VAL D  1 73  ? -18.115  60.956  54.244  1.00 20.32 ? 65   VAL D CA  1 
ATOM   6864  C  C   . VAL D  1 73  ? -18.507  62.404  54.374  1.00 20.77 ? 65   VAL D C   1 
ATOM   6865  O  O   . VAL D  1 73  ? -19.488  62.805  53.800  1.00 21.72 ? 65   VAL D O   1 
ATOM   6866  C  CB  . VAL D  1 73  ? -17.775  60.644  52.802  1.00 20.89 ? 65   VAL D CB  1 
ATOM   6867  C  CG1 . VAL D  1 73  ? -16.752  61.669  52.251  1.00 19.59 ? 65   VAL D CG1 1 
ATOM   6868  C  CG2 . VAL D  1 73  ? -17.268  59.214  52.714  1.00 18.04 ? 65   VAL D CG2 1 
ATOM   6869  N  N   . SER D  1 74  ? -17.761  63.182  55.168  1.00 20.46 ? 66   SER D N   1 
ATOM   6870  C  CA  . SER D  1 74  ? -17.981  64.601  55.261  1.00 20.52 ? 66   SER D CA  1 
ATOM   6871  C  C   . SER D  1 74  ? -17.241  65.338  54.167  1.00 21.39 ? 66   SER D C   1 
ATOM   6872  O  O   . SER D  1 74  ? -16.064  65.095  53.960  1.00 22.92 ? 66   SER D O   1 
ATOM   6873  C  CB  . SER D  1 74  ? -17.484  65.127  56.580  1.00 21.56 ? 66   SER D CB  1 
ATOM   6874  O  OG  . SER D  1 74  ? -18.160  64.539  57.661  1.00 19.08 ? 66   SER D OG  1 
ATOM   6875  N  N   . VAL D  1 75  ? -17.933  66.249  53.477  1.00 21.44 ? 67   VAL D N   1 
ATOM   6876  C  CA  . VAL D  1 75  ? -17.395  66.991  52.342  1.00 20.51 ? 67   VAL D CA  1 
ATOM   6877  C  C   . VAL D  1 75  ? -17.377  68.473  52.705  1.00 21.37 ? 67   VAL D C   1 
ATOM   6878  O  O   . VAL D  1 75  ? -18.409  69.037  53.115  1.00 20.01 ? 67   VAL D O   1 
ATOM   6879  C  CB  . VAL D  1 75  ? -18.261  66.744  51.110  1.00 20.98 ? 67   VAL D CB  1 
ATOM   6880  C  CG1 . VAL D  1 75  ? -17.830  67.662  49.948  1.00 19.47 ? 67   VAL D CG1 1 
ATOM   6881  C  CG2 . VAL D  1 75  ? -18.163  65.285  50.706  1.00 17.49 ? 67   VAL D CG2 1 
ATOM   6882  N  N   . MET D  1 76  ? -16.189  69.095  52.620  1.00 22.04 ? 68   MET D N   1 
ATOM   6883  C  CA  . MET D  1 76  ? -16.053  70.532  52.897  1.00 22.25 ? 68   MET D CA  1 
ATOM   6884  C  C   . MET D  1 76  ? -15.723  71.274  51.615  1.00 21.69 ? 68   MET D C   1 
ATOM   6885  O  O   . MET D  1 76  ? -15.385  70.672  50.581  1.00 22.09 ? 68   MET D O   1 
ATOM   6886  C  CB  . MET D  1 76  ? -15.007  70.830  53.974  1.00 22.97 ? 68   MET D CB  1 
ATOM   6887  C  CG  . MET D  1 76  ? -13.587  70.455  53.613  1.00 26.22 ? 68   MET D CG  1 
ATOM   6888  S  SD  . MET D  1 76  ? -12.339  70.794  54.845  1.00 29.49 ? 68   MET D SD  1 
ATOM   6889  C  CE  . MET D  1 76  ? -12.047  72.531  54.551  1.00 39.12 ? 68   MET D CE  1 
ATOM   6890  N  N   . ALA D  1 77  ? -15.834  72.579  51.683  1.00 20.82 ? 69   ALA D N   1 
ATOM   6891  C  CA  . ALA D  1 77  ? -15.489  73.450  50.551  1.00 22.67 ? 69   ALA D CA  1 
ATOM   6892  C  C   . ALA D  1 77  ? -13.998  73.463  50.341  1.00 23.59 ? 69   ALA D C   1 
ATOM   6893  O  O   . ALA D  1 77  ? -13.255  73.209  51.268  1.00 25.11 ? 69   ALA D O   1 
ATOM   6894  C  CB  . ALA D  1 77  ? -15.990  74.846  50.777  1.00 21.15 ? 69   ALA D CB  1 
ATOM   6895  N  N   . ARG D  1 78  ? -13.570  73.757  49.125  1.00 25.45 ? 70   ARG D N   1 
ATOM   6896  C  CA  . ARG D  1 78  ? -12.148  73.972  48.806  1.00 26.42 ? 70   ARG D CA  1 
ATOM   6897  C  C   . ARG D  1 78  ? -11.572  75.215  49.473  1.00 26.91 ? 70   ARG D C   1 
ATOM   6898  O  O   . ARG D  1 78  ? -10.377  75.309  49.686  1.00 26.83 ? 70   ARG D O   1 
ATOM   6899  C  CB  . ARG D  1 78  ? -11.964  74.102  47.286  1.00 26.17 ? 70   ARG D CB  1 
ATOM   6900  C  CG  . ARG D  1 78  ? -12.295  72.826  46.503  1.00 27.17 ? 70   ARG D CG  1 
ATOM   6901  C  CD  . ARG D  1 78  ? -11.934  72.919  44.970  1.00 27.57 ? 70   ARG D CD  1 
ATOM   6902  N  NE  . ARG D  1 78  ? -12.480  74.134  44.380  1.00 26.96 ? 70   ARG D NE  1 
ATOM   6903  C  CZ  . ARG D  1 78  ? -12.237  74.541  43.155  1.00 29.45 ? 70   ARG D CZ  1 
ATOM   6904  N  NH1 . ARG D  1 78  ? -11.462  73.822  42.361  1.00 31.81 ? 70   ARG D NH1 1 
ATOM   6905  N  NH2 . ARG D  1 78  ? -12.736  75.696  42.735  1.00 30.78 ? 70   ARG D NH2 1 
ATOM   6906  N  N   . ARG D  1 79  ? -12.433  76.183  49.727  1.00 28.07 ? 71   ARG D N   1 
ATOM   6907  C  CA  . ARG D  1 79  ? -12.051  77.493  50.262  1.00 29.01 ? 71   ARG D CA  1 
ATOM   6908  C  C   . ARG D  1 79  ? -13.341  78.133  50.705  1.00 29.56 ? 71   ARG D C   1 
ATOM   6909  O  O   . ARG D  1 79  ? -14.438  77.740  50.282  1.00 27.91 ? 71   ARG D O   1 
ATOM   6910  C  CB  . ARG D  1 79  ? -11.402  78.394  49.196  1.00 29.73 ? 71   ARG D CB  1 
ATOM   6911  C  CG  . ARG D  1 79  ? -12.263  78.599  47.891  1.00 32.23 ? 71   ARG D CG  1 
ATOM   6912  C  CD  . ARG D  1 79  ? -11.625  79.614  46.943  1.00 36.27 ? 71   ARG D CD  1 
ATOM   6913  N  NE  . ARG D  1 79  ? -10.257  79.195  46.653  1.00 40.38 ? 71   ARG D NE  1 
ATOM   6914  C  CZ  . ARG D  1 79  ? -9.925   78.203  45.810  1.00 43.58 ? 71   ARG D CZ  1 
ATOM   6915  N  NH1 . ARG D  1 79  ? -10.831  77.541  45.103  1.00 44.64 ? 71   ARG D NH1 1 
ATOM   6916  N  NH2 . ARG D  1 79  ? -8.673   77.865  45.668  1.00 44.28 ? 71   ARG D NH2 1 
ATOM   6917  N  N   . LYS D  1 80  ? -13.200  79.150  51.533  1.00 30.47 ? 72   LYS D N   1 
ATOM   6918  C  CA  . LYS D  1 80  ? -14.315  79.773  52.171  1.00 31.81 ? 72   LYS D CA  1 
ATOM   6919  C  C   . LYS D  1 80  ? -15.376  80.338  51.255  1.00 30.93 ? 72   LYS D C   1 
ATOM   6920  O  O   . LYS D  1 80  ? -16.541  80.272  51.574  1.00 30.50 ? 72   LYS D O   1 
ATOM   6921  C  CB  . LYS D  1 80  ? -13.804  80.880  53.018  1.00 33.01 ? 72   LYS D CB  1 
ATOM   6922  C  CG  . LYS D  1 80  ? -14.892  81.478  53.821  1.00 38.77 ? 72   LYS D CG  1 
ATOM   6923  C  CD  . LYS D  1 80  ? -14.413  82.737  54.490  1.00 48.07 ? 72   LYS D CD  1 
ATOM   6924  C  CE  . LYS D  1 80  ? -15.382  83.162  55.617  1.00 52.55 ? 72   LYS D CE  1 
ATOM   6925  N  NZ  . LYS D  1 80  ? -15.918  81.952  56.341  1.00 54.64 ? 72   LYS D NZ  1 
ATOM   6926  N  N   . GLU D  1 81  ? -14.952  80.906  50.140  1.00 31.17 ? 73   GLU D N   1 
ATOM   6927  C  CA  . GLU D  1 81  ? -15.854  81.495  49.146  1.00 32.50 ? 73   GLU D CA  1 
ATOM   6928  C  C   . GLU D  1 81  ? -16.803  80.435  48.579  1.00 29.99 ? 73   GLU D C   1 
ATOM   6929  O  O   . GLU D  1 81  ? -17.872  80.759  48.165  1.00 29.58 ? 73   GLU D O   1 
ATOM   6930  C  CB  . GLU D  1 81  ? -15.050  82.087  47.984  1.00 34.11 ? 73   GLU D CB  1 
ATOM   6931  C  CG  . GLU D  1 81  ? -14.227  83.323  48.361  1.00 41.46 ? 73   GLU D CG  1 
ATOM   6932  C  CD  . GLU D  1 81  ? -12.774  83.061  48.980  1.00 48.32 ? 73   GLU D CD  1 
ATOM   6933  O  OE1 . GLU D  1 81  ? -12.366  81.936  49.409  1.00 45.87 ? 73   GLU D OE1 1 
ATOM   6934  O  OE2 . GLU D  1 81  ? -12.041  84.073  49.057  1.00 55.66 ? 73   GLU D OE2 1 
ATOM   6935  N  N   . GLU D  1 82  ? -16.383  79.177  48.554  1.00 27.55 ? 74   GLU D N   1 
ATOM   6936  C  CA  . GLU D  1 82  ? -17.187  78.110  48.018  1.00 25.86 ? 74   GLU D CA  1 
ATOM   6937  C  C   . GLU D  1 82  ? -18.148  77.479  49.041  1.00 24.55 ? 74   GLU D C   1 
ATOM   6938  O  O   . GLU D  1 82  ? -18.893  76.554  48.716  1.00 24.59 ? 74   GLU D O   1 
ATOM   6939  C  CB  . GLU D  1 82  ? -16.252  77.052  47.438  1.00 26.11 ? 74   GLU D CB  1 
ATOM   6940  C  CG  . GLU D  1 82  ? -15.917  77.323  46.016  1.00 26.76 ? 74   GLU D CG  1 
ATOM   6941  C  CD  . GLU D  1 82  ? -14.606  76.799  45.528  1.00 26.19 ? 74   GLU D CD  1 
ATOM   6942  O  OE1 . GLU D  1 82  ? -14.298  75.625  45.737  1.00 29.16 ? 74   GLU D OE1 1 
ATOM   6943  O  OE2 . GLU D  1 82  ? -13.869  77.572  44.913  1.00 28.32 ? 74   GLU D OE2 1 
ATOM   6944  N  N   . GLU D  1 83  ? -18.153  77.964  50.260  1.00 23.52 ? 75   GLU D N   1 
ATOM   6945  C  CA  . GLU D  1 83  ? -18.977  77.376  51.302  1.00 23.74 ? 75   GLU D CA  1 
ATOM   6946  C  C   . GLU D  1 83  ? -20.472  77.601  51.108  1.00 22.97 ? 75   GLU D C   1 
ATOM   6947  O  O   . GLU D  1 83  ? -21.228  76.644  51.186  1.00 21.38 ? 75   GLU D O   1 
ATOM   6948  C  CB  . GLU D  1 83  ? -18.592  77.861  52.698  1.00 24.82 ? 75   GLU D CB  1 
ATOM   6949  C  CG  . GLU D  1 83  ? -17.416  77.103  53.245  1.00 28.34 ? 75   GLU D CG  1 
ATOM   6950  C  CD  . GLU D  1 83  ? -16.890  77.598  54.612  1.00 32.27 ? 75   GLU D CD  1 
ATOM   6951  O  OE1 . GLU D  1 83  ? -17.669  78.043  55.478  1.00 31.30 ? 75   GLU D OE1 1 
ATOM   6952  O  OE2 . GLU D  1 83  ? -15.652  77.494  54.800  1.00 36.94 ? 75   GLU D OE2 1 
ATOM   6953  N  N   . ILE D  1 84  ? -20.888  78.837  50.841  1.00 22.39 ? 76   ILE D N   1 
ATOM   6954  C  CA  . ILE D  1 84  ? -22.306  79.136  50.710  1.00 22.36 ? 76   ILE D CA  1 
ATOM   6955  C  C   . ILE D  1 84  ? -22.975  78.279  49.635  1.00 23.14 ? 76   ILE D C   1 
ATOM   6956  O  O   . ILE D  1 84  ? -23.971  77.651  49.921  1.00 24.12 ? 76   ILE D O   1 
ATOM   6957  C  CB  . ILE D  1 84  ? -22.573  80.632  50.535  1.00 22.71 ? 76   ILE D CB  1 
ATOM   6958  C  CG1 . ILE D  1 84  ? -22.308  81.376  51.858  1.00 24.35 ? 76   ILE D CG1 1 
ATOM   6959  C  CG2 . ILE D  1 84  ? -23.989  80.939  50.048  1.00 20.89 ? 76   ILE D CG2 1 
ATOM   6960  C  CD1 . ILE D  1 84  ? -22.093  82.953  51.647  1.00 23.66 ? 76   ILE D CD1 1 
ATOM   6961  N  N   . PRO D  1 85  ? -22.406  78.180  48.436  1.00 23.92 ? 77   PRO D N   1 
ATOM   6962  C  CA  . PRO D  1 85  ? -23.074  77.345  47.440  1.00 23.82 ? 77   PRO D CA  1 
ATOM   6963  C  C   . PRO D  1 85  ? -23.044  75.874  47.751  1.00 23.44 ? 77   PRO D C   1 
ATOM   6964  O  O   . PRO D  1 85  ? -24.021  75.145  47.436  1.00 24.17 ? 77   PRO D O   1 
ATOM   6965  C  CB  . PRO D  1 85  ? -22.297  77.642  46.137  1.00 24.55 ? 77   PRO D CB  1 
ATOM   6966  C  CG  . PRO D  1 85  ? -20.964  78.219  46.593  1.00 25.18 ? 77   PRO D CG  1 
ATOM   6967  C  CD  . PRO D  1 85  ? -21.257  78.931  47.873  1.00 24.71 ? 77   PRO D CD  1 
ATOM   6968  N  N   . LEU D  1 86  ? -21.954  75.411  48.354  1.00 22.93 ? 78   LEU D N   1 
ATOM   6969  C  CA  . LEU D  1 86  ? -21.861  73.994  48.779  1.00 22.29 ? 78   LEU D CA  1 
ATOM   6970  C  C   . LEU D  1 86  ? -23.026  73.647  49.699  1.00 22.57 ? 78   LEU D C   1 
ATOM   6971  O  O   . LEU D  1 86  ? -23.692  72.606  49.514  1.00 22.61 ? 78   LEU D O   1 
ATOM   6972  C  CB  . LEU D  1 86  ? -20.583  73.725  49.555  1.00 22.08 ? 78   LEU D CB  1 
ATOM   6973  C  CG  . LEU D  1 86  ? -20.417  72.332  50.171  1.00 21.62 ? 78   LEU D CG  1 
ATOM   6974  C  CD1 . LEU D  1 86  ? -20.495  71.247  49.158  1.00 15.37 ? 78   LEU D CD1 1 
ATOM   6975  C  CD2 . LEU D  1 86  ? -19.087  72.159  51.036  1.00 19.38 ? 78   LEU D CD2 1 
ATOM   6976  N  N   . MET D  1 87  ? -23.267  74.537  50.659  1.00 21.40 ? 79   MET D N   1 
ATOM   6977  C  CA  . MET D  1 87  ? -24.230  74.307  51.684  1.00 21.98 ? 79   MET D CA  1 
ATOM   6978  C  C   . MET D  1 87  ? -25.645  74.603  51.260  1.00 22.59 ? 79   MET D C   1 
ATOM   6979  O  O   . MET D  1 87  ? -26.568  73.999  51.837  1.00 22.95 ? 79   MET D O   1 
ATOM   6980  C  CB  . MET D  1 87  ? -23.935  75.166  52.909  1.00 21.93 ? 79   MET D CB  1 
ATOM   6981  C  CG  . MET D  1 87  ? -22.674  74.729  53.645  1.00 23.60 ? 79   MET D CG  1 
ATOM   6982  S  SD  . MET D  1 87  ? -22.644  73.029  54.256  1.00 23.19 ? 79   MET D SD  1 
ATOM   6983  C  CE  . MET D  1 87  ? -23.961  73.128  55.479  1.00 23.19 ? 79   MET D CE  1 
ATOM   6984  N  N   . THR D  1 88  ? -25.819  75.526  50.303  1.00 22.32 ? 80   THR D N   1 
ATOM   6985  C  CA  . THR D  1 88  ? -27.127  75.984  49.914  1.00 21.69 ? 80   THR D CA  1 
ATOM   6986  C  C   . THR D  1 88  ? -27.676  75.067  48.831  1.00 22.37 ? 80   THR D C   1 
ATOM   6987  O  O   . THR D  1 88  ? -28.823  74.678  48.894  1.00 23.23 ? 80   THR D O   1 
ATOM   6988  C  CB  . THR D  1 88  ? -27.125  77.465  49.443  1.00 22.48 ? 80   THR D CB  1 
ATOM   6989  O  OG1 . THR D  1 88  ? -26.652  78.296  50.496  1.00 21.10 ? 80   THR D OG1 1 
ATOM   6990  C  CG2 . THR D  1 88  ? -28.530  77.973  49.075  1.00 20.54 ? 80   THR D CG2 1 
ATOM   6991  N  N   . LEU D  1 89  ? -26.888  74.722  47.833  1.00 22.50 ? 81   LEU D N   1 
ATOM   6992  C  CA  . LEU D  1 89  ? -27.407  73.977  46.682  1.00 22.59 ? 81   LEU D CA  1 
ATOM   6993  C  C   . LEU D  1 89  ? -27.482  72.446  46.834  1.00 22.39 ? 81   LEU D C   1 
ATOM   6994  O  O   . LEU D  1 89  ? -28.242  71.776  46.097  1.00 22.75 ? 81   LEU D O   1 
ATOM   6995  C  CB  . LEU D  1 89  ? -26.581  74.334  45.423  1.00 23.84 ? 81   LEU D CB  1 
ATOM   6996  C  CG  . LEU D  1 89  ? -26.571  75.850  45.083  1.00 24.04 ? 81   LEU D CG  1 
ATOM   6997  C  CD1 . LEU D  1 89  ? -25.662  76.108  43.878  1.00 24.08 ? 81   LEU D CD1 1 
ATOM   6998  C  CD2 . LEU D  1 89  ? -28.002  76.348  44.835  1.00 23.23 ? 81   LEU D CD2 1 
ATOM   6999  N  N   . SER D  1 90  ? -26.660  71.889  47.717  1.00 21.27 ? 82   SER D N   1 
ATOM   7000  C  CA  . SER D  1 90  ? -26.576  70.476  47.888  1.00 21.25 ? 82   SER D CA  1 
ATOM   7001  C  C   . SER D  1 90  ? -27.901  69.995  48.567  1.00 21.40 ? 82   SER D C   1 
ATOM   7002  O  O   . SER D  1 90  ? -28.285  70.522  49.602  1.00 20.69 ? 82   SER D O   1 
ATOM   7003  C  CB  . SER D  1 90  ? -25.375  70.150  48.749  1.00 21.26 ? 82   SER D CB  1 
ATOM   7004  O  OG  . SER D  1 90  ? -24.129  70.464  48.129  1.00 22.35 ? 82   SER D OG  1 
ATOM   7005  N  N   . CYS D  1 91  ? -28.595  69.019  47.976  1.00 20.30 ? 83   CYS D N   1 
ATOM   7006  C  CA  . CYS D  1 91  ? -29.867  68.538  48.523  1.00 20.09 ? 83   CYS D CA  1 
ATOM   7007  C  C   . CYS D  1 91  ? -29.796  67.038  48.884  1.00 19.42 ? 83   CYS D C   1 
ATOM   7008  O  O   . CYS D  1 91  ? -29.144  66.281  48.197  1.00 18.51 ? 83   CYS D O   1 
ATOM   7009  C  CB  . CYS D  1 91  ? -31.011  68.798  47.509  1.00 20.02 ? 83   CYS D CB  1 
ATOM   7010  S  SG  . CYS D  1 91  ? -31.400  70.554  47.309  1.00 22.58 ? 83   CYS D SG  1 
ATOM   7011  N  N   . ILE D  1 92  ? -30.554  66.622  49.911  1.00 19.12 ? 84   ILE D N   1 
ATOM   7012  C  CA  . ILE D  1 92  ? -30.550  65.283  50.382  1.00 18.39 ? 84   ILE D CA  1 
ATOM   7013  C  C   . ILE D  1 92  ? -31.024  64.443  49.218  1.00 19.71 ? 84   ILE D C   1 
ATOM   7014  O  O   . ILE D  1 92  ? -31.988  64.761  48.596  1.00 19.64 ? 84   ILE D O   1 
ATOM   7015  C  CB  . ILE D  1 92  ? -31.431  65.146  51.640  1.00 19.58 ? 84   ILE D CB  1 
ATOM   7016  C  CG1 . ILE D  1 92  ? -30.872  65.994  52.802  1.00 17.88 ? 84   ILE D CG1 1 
ATOM   7017  C  CG2 . ILE D  1 92  ? -31.502  63.706  52.096  1.00 16.22 ? 84   ILE D CG2 1 
ATOM   7018  C  CD1 . ILE D  1 92  ? -31.777  66.091  54.033  1.00 17.47 ? 84   ILE D CD1 1 
ATOM   7019  N  N   . GLY D  1 93  ? -30.247  63.434  48.850  1.00 20.38 ? 85   GLY D N   1 
ATOM   7020  C  CA  . GLY D  1 93  ? -30.550  62.582  47.739  1.00 20.88 ? 85   GLY D CA  1 
ATOM   7021  C  C   . GLY D  1 93  ? -29.752  62.879  46.466  1.00 21.89 ? 85   GLY D C   1 
ATOM   7022  O  O   . GLY D  1 93  ? -29.697  62.055  45.586  1.00 22.41 ? 85   GLY D O   1 
ATOM   7023  N  N   . ASN D  1 94  ? -29.136  64.046  46.353  1.00 22.56 ? 86   ASN D N   1 
ATOM   7024  C  CA  . ASN D  1 94  ? -28.398  64.365  45.138  1.00 22.94 ? 86   ASN D CA  1 
ATOM   7025  C  C   . ASN D  1 94  ? -27.262  63.363  44.940  1.00 23.07 ? 86   ASN D C   1 
ATOM   7026  O  O   . ASN D  1 94  ? -26.695  62.872  45.875  1.00 23.39 ? 86   ASN D O   1 
ATOM   7027  C  CB  . ASN D  1 94  ? -27.839  65.780  45.185  1.00 22.26 ? 86   ASN D CB  1 
ATOM   7028  C  CG  . ASN D  1 94  ? -28.880  66.850  45.007  1.00 22.80 ? 86   ASN D CG  1 
ATOM   7029  O  OD1 . ASN D  1 94  ? -28.595  67.997  45.359  1.00 22.76 ? 86   ASN D OD1 1 
ATOM   7030  N  ND2 . ASN D  1 94  ? -30.087  66.518  44.445  1.00 17.69 ? 86   ASN D ND2 1 
ATOM   7031  N  N   . GLU D  1 95  ? -26.982  63.058  43.700  1.00 24.58 ? 87   GLU D N   1 
ATOM   7032  C  CA  . GLU D  1 95  ? -25.870  62.216  43.299  1.00 26.16 ? 87   GLU D CA  1 
ATOM   7033  C  C   . GLU D  1 95  ? -24.497  62.880  43.542  1.00 24.36 ? 87   GLU D C   1 
ATOM   7034  O  O   . GLU D  1 95  ? -24.368  64.085  43.396  1.00 23.08 ? 87   GLU D O   1 
ATOM   7035  C  CB  . GLU D  1 95  ? -26.017  61.927  41.821  1.00 27.42 ? 87   GLU D CB  1 
ATOM   7036  C  CG  . GLU D  1 95  ? -25.047  60.881  41.316  1.00 34.97 ? 87   GLU D CG  1 
ATOM   7037  C  CD  . GLU D  1 95  ? -25.224  60.555  39.820  1.00 42.76 ? 87   GLU D CD  1 
ATOM   7038  O  OE1 . GLU D  1 95  ? -25.366  61.489  38.969  1.00 46.02 ? 87   GLU D OE1 1 
ATOM   7039  O  OE2 . GLU D  1 95  ? -25.193  59.331  39.527  1.00 49.71 ? 87   GLU D OE2 1 
ATOM   7040  N  N   . VAL D  1 96  ? -23.509  62.066  43.918  1.00 23.44 ? 88   VAL D N   1 
ATOM   7041  C  CA  . VAL D  1 96  ? -22.200  62.526  44.290  1.00 23.48 ? 88   VAL D CA  1 
ATOM   7042  C  C   . VAL D  1 96  ? -21.242  61.611  43.594  1.00 24.68 ? 88   VAL D C   1 
ATOM   7043  O  O   . VAL D  1 96  ? -21.412  60.421  43.615  1.00 23.93 ? 88   VAL D O   1 
ATOM   7044  C  CB  . VAL D  1 96  ? -21.971  62.424  45.841  1.00 23.42 ? 88   VAL D CB  1 
ATOM   7045  C  CG1 . VAL D  1 96  ? -20.597  62.945  46.242  1.00 20.94 ? 88   VAL D CG1 1 
ATOM   7046  C  CG2 . VAL D  1 96  ? -23.060  63.165  46.608  1.00 21.59 ? 88   VAL D CG2 1 
ATOM   7047  N  N   . ILE D  1 97  ? -20.229  62.161  42.936  1.00 26.18 ? 89   ILE D N   1 
ATOM   7048  C  CA  . ILE D  1 97  ? -19.219  61.337  42.281  1.00 26.00 ? 89   ILE D CA  1 
ATOM   7049  C  C   . ILE D  1 97  ? -17.862  61.677  42.843  1.00 25.55 ? 89   ILE D C   1 
ATOM   7050  O  O   . ILE D  1 97  ? -17.511  62.845  42.996  1.00 24.43 ? 89   ILE D O   1 
ATOM   7051  C  CB  . ILE D  1 97  ? -19.186  61.564  40.741  1.00 27.57 ? 89   ILE D CB  1 
ATOM   7052  C  CG1 . ILE D  1 97  ? -20.563  61.426  40.154  1.00 29.71 ? 89   ILE D CG1 1 
ATOM   7053  C  CG2 . ILE D  1 97  ? -18.274  60.482  40.016  1.00 27.44 ? 89   ILE D CG2 1 
ATOM   7054  C  CD1 . ILE D  1 97  ? -21.052  62.686  39.633  1.00 35.61 ? 89   ILE D CD1 1 
ATOM   7055  N  N   . VAL D  1 98  ? -17.094  60.649  43.151  1.00 26.30 ? 90   VAL D N   1 
ATOM   7056  C  CA  . VAL D  1 98  ? -15.720  60.819  43.541  1.00 27.01 ? 90   VAL D CA  1 
ATOM   7057  C  C   . VAL D  1 98  ? -14.879  61.105  42.288  1.00 29.07 ? 90   VAL D C   1 
ATOM   7058  O  O   . VAL D  1 98  ? -14.933  60.341  41.294  1.00 29.21 ? 90   VAL D O   1 
ATOM   7059  C  CB  . VAL D  1 98  ? -15.176  59.593  44.237  1.00 27.07 ? 90   VAL D CB  1 
ATOM   7060  C  CG1 . VAL D  1 98  ? -13.730  59.874  44.647  1.00 24.27 ? 90   VAL D CG1 1 
ATOM   7061  C  CG2 . VAL D  1 98  ? -16.082  59.216  45.486  1.00 24.38 ? 90   VAL D CG2 1 
ATOM   7062  N  N   . MET D  1 99  ? -14.132  62.204  42.330  1.00 29.82 ? 91   MET D N   1 
ATOM   7063  C  CA  . MET D  1 99  ? -13.437  62.683  41.148  1.00 31.86 ? 91   MET D CA  1 
ATOM   7064  C  C   . MET D  1 99  ? -11.893  62.608  41.203  1.00 32.17 ? 91   MET D C   1 
ATOM   7065  O  O   . MET D  1 99  ? -11.274  62.955  40.232  1.00 33.41 ? 91   MET D O   1 
ATOM   7066  C  CB  . MET D  1 99  ? -13.909  64.102  40.849  1.00 32.21 ? 91   MET D CB  1 
ATOM   7067  C  CG  . MET D  1 99  ? -15.400  64.128  40.450  1.00 34.79 ? 91   MET D CG  1 
ATOM   7068  S  SD  . MET D  1 99  ? -15.800  63.439  38.820  1.00 39.39 ? 91   MET D SD  1 
ATOM   7069  C  CE  . MET D  1 99  ? -14.534  64.055  37.774  1.00 35.48 ? 91   MET D CE  1 
ATOM   7070  N  N   . SER D  1 100 ? -11.298  62.190  42.326  1.00 31.79 ? 92   SER D N   1 
ATOM   7071  C  CA  . SER D  1 100 ? -9.884   61.826  42.402  1.00 31.49 ? 92   SER D CA  1 
ATOM   7072  C  C   . SER D  1 100 ? -9.634   60.702  43.386  1.00 31.84 ? 92   SER D C   1 
ATOM   7073  O  O   . SER D  1 100 ? -10.533  60.268  44.065  1.00 30.99 ? 92   SER D O   1 
ATOM   7074  C  CB  . SER D  1 100 ? -9.062   63.039  42.787  1.00 31.61 ? 92   SER D CB  1 
ATOM   7075  O  OG  . SER D  1 100 ? -9.376   63.504  44.074  1.00 31.07 ? 92   SER D OG  1 
ATOM   7076  N  N   . GLY D  1 101 ? -8.399   60.217  43.450  1.00 33.18 ? 93   GLY D N   1 
ATOM   7077  C  CA  . GLY D  1 101 ? -7.992   59.180  44.411  1.00 33.09 ? 93   GLY D CA  1 
ATOM   7078  C  C   . GLY D  1 101 ? -8.355   57.799  43.931  1.00 34.21 ? 93   GLY D C   1 
ATOM   7079  O  O   . GLY D  1 101 ? -8.862   57.642  42.850  1.00 34.47 ? 93   GLY D O   1 
ATOM   7080  N  N   . ASP D  1 102 ? -8.136   56.780  44.743  1.00 35.74 ? 94   ASP D N   1 
ATOM   7081  C  CA  . ASP D  1 102 ? -8.401   55.407  44.278  1.00 37.49 ? 94   ASP D CA  1 
ATOM   7082  C  C   . ASP D  1 102 ? -9.861   55.024  44.064  1.00 37.05 ? 94   ASP D C   1 
ATOM   7083  O  O   . ASP D  1 102 ? -10.113  53.982  43.438  1.00 37.36 ? 94   ASP D O   1 
ATOM   7084  C  CB  . ASP D  1 102 ? -7.816   54.368  45.238  1.00 38.44 ? 94   ASP D CB  1 
ATOM   7085  C  CG  . ASP D  1 102 ? -6.361   54.534  45.435  1.00 41.66 ? 94   ASP D CG  1 
ATOM   7086  O  OD1 . ASP D  1 102 ? -5.643   54.758  44.438  1.00 47.46 ? 94   ASP D OD1 1 
ATOM   7087  O  OD2 . ASP D  1 102 ? -5.925   54.449  46.593  1.00 48.97 ? 94   ASP D OD2 1 
ATOM   7088  N  N   . ALA D  1 103 ? -10.808  55.801  44.598  1.00 35.67 ? 95   ALA D N   1 
ATOM   7089  C  CA  . ALA D  1 103 ? -12.237  55.453  44.459  1.00 35.45 ? 95   ALA D CA  1 
ATOM   7090  C  C   . ALA D  1 103 ? -12.905  56.273  43.339  1.00 35.36 ? 95   ALA D C   1 
ATOM   7091  O  O   . ALA D  1 103 ? -14.130  56.326  43.215  1.00 34.81 ? 95   ALA D O   1 
ATOM   7092  C  CB  . ALA D  1 103 ? -12.941  55.644  45.768  1.00 34.44 ? 95   ALA D CB  1 
ATOM   7093  N  N   . LYS D  1 104 ? -12.074  56.912  42.536  1.00 35.18 ? 96   LYS D N   1 
ATOM   7094  C  CA  . LYS D  1 104 ? -12.518  57.784  41.471  1.00 35.97 ? 96   LYS D CA  1 
ATOM   7095  C  C   . LYS D  1 104 ? -13.552  57.100  40.631  1.00 35.17 ? 96   LYS D C   1 
ATOM   7096  O  O   . LYS D  1 104 ? -13.345  55.969  40.274  1.00 35.39 ? 96   LYS D O   1 
ATOM   7097  C  CB  . LYS D  1 104 ? -11.324  58.120  40.597  1.00 36.92 ? 96   LYS D CB  1 
ATOM   7098  C  CG  . LYS D  1 104 ? -11.600  59.055  39.471  1.00 39.26 ? 96   LYS D CG  1 
ATOM   7099  C  CD  . LYS D  1 104 ? -10.286  59.409  38.803  1.00 43.65 ? 96   LYS D CD  1 
ATOM   7100  C  CE  . LYS D  1 104 ? -10.447  60.476  37.775  1.00 47.36 ? 96   LYS D CE  1 
ATOM   7101  N  NZ  . LYS D  1 104 ? -11.318  59.958  36.729  1.00 50.99 ? 96   LYS D NZ  1 
ATOM   7102  N  N   . GLY D  1 105 ? -14.660  57.769  40.331  1.00 34.06 ? 97   GLY D N   1 
ATOM   7103  C  CA  . GLY D  1 105 ? -15.743  57.138  39.594  1.00 33.63 ? 97   GLY D CA  1 
ATOM   7104  C  C   . GLY D  1 105 ? -16.854  56.607  40.482  1.00 33.54 ? 97   GLY D C   1 
ATOM   7105  O  O   . GLY D  1 105 ? -17.951  56.415  40.016  1.00 33.45 ? 97   GLY D O   1 
ATOM   7106  N  N   . SER D  1 106 ? -16.591  56.381  41.760  1.00 32.72 ? 98   SER D N   1 
ATOM   7107  C  CA  . SER D  1 106 ? -17.613  55.850  42.631  1.00 32.98 ? 98   SER D CA  1 
ATOM   7108  C  C   . SER D  1 106 ? -18.731  56.876  42.867  1.00 32.53 ? 98   SER D C   1 
ATOM   7109  O  O   . SER D  1 106 ? -18.475  58.045  42.925  1.00 31.01 ? 98   SER D O   1 
ATOM   7110  C  CB  . SER D  1 106 ? -16.995  55.436  43.966  1.00 32.78 ? 98   SER D CB  1 
ATOM   7111  O  OG  . SER D  1 106 ? -16.060  54.418  43.732  1.00 33.27 ? 98   SER D OG  1 
ATOM   7112  N  N   . ARG D  1 107 ? -19.951  56.389  43.024  1.00 32.84 ? 99   ARG D N   1 
ATOM   7113  C  CA  . ARG D  1 107 ? -21.122  57.225  43.169  1.00 33.44 ? 99   ARG D CA  1 
ATOM   7114  C  C   . ARG D  1 107 ? -21.778  56.967  44.483  1.00 31.58 ? 99   ARG D C   1 
ATOM   7115  O  O   . ARG D  1 107 ? -21.849  55.828  44.917  1.00 31.09 ? 99   ARG D O   1 
ATOM   7116  C  CB  . ARG D  1 107 ? -22.114  56.895  42.066  1.00 34.86 ? 99   ARG D CB  1 
ATOM   7117  C  CG  . ARG D  1 107 ? -21.554  57.280  40.733  1.00 43.44 ? 99   ARG D CG  1 
ATOM   7118  C  CD  . ARG D  1 107 ? -22.373  56.839  39.528  1.00 53.79 ? 99   ARG D CD  1 
ATOM   7119  N  NE  . ARG D  1 107 ? -21.652  57.268  38.321  1.00 61.55 ? 99   ARG D NE  1 
ATOM   7120  C  CZ  . ARG D  1 107 ? -21.890  58.383  37.619  1.00 66.88 ? 99   ARG D CZ  1 
ATOM   7121  N  NH1 . ARG D  1 107 ? -22.885  59.212  37.925  1.00 68.86 ? 99   ARG D NH1 1 
ATOM   7122  N  NH2 . ARG D  1 107 ? -21.133  58.658  36.570  1.00 68.49 ? 99   ARG D NH2 1 
ATOM   7123  N  N   . GLY D  1 108 ? -22.282  58.031  45.091  1.00 29.75 ? 100  GLY D N   1 
ATOM   7124  C  CA  . GLY D  1 108 ? -23.036  57.976  46.314  1.00 28.19 ? 100  GLY D CA  1 
ATOM   7125  C  C   . GLY D  1 108 ? -24.134  59.028  46.348  1.00 27.74 ? 100  GLY D C   1 
ATOM   7126  O  O   . GLY D  1 108 ? -24.469  59.640  45.347  1.00 26.55 ? 100  GLY D O   1 
ATOM   7127  N  N   . PHE D  1 109 ? -24.646  59.289  47.550  1.00 27.79 ? 101  PHE D N   1 
ATOM   7128  C  CA  . PHE D  1 109 ? -25.809  60.157  47.744  1.00 27.72 ? 101  PHE D CA  1 
ATOM   7129  C  C   . PHE D  1 109 ? -25.634  61.069  48.917  1.00 23.80 ? 101  PHE D C   1 
ATOM   7130  O  O   . PHE D  1 109 ? -25.159  60.648  49.906  1.00 22.26 ? 101  PHE D O   1 
ATOM   7131  C  CB  . PHE D  1 109 ? -27.048  59.307  48.027  1.00 29.52 ? 101  PHE D CB  1 
ATOM   7132  C  CG  . PHE D  1 109 ? -27.405  58.394  46.917  1.00 40.04 ? 101  PHE D CG  1 
ATOM   7133  C  CD1 . PHE D  1 109 ? -27.916  58.905  45.693  1.00 49.16 ? 101  PHE D CD1 1 
ATOM   7134  C  CD2 . PHE D  1 109 ? -27.249  56.998  47.056  1.00 49.09 ? 101  PHE D CD2 1 
ATOM   7135  C  CE1 . PHE D  1 109 ? -28.287  58.018  44.604  1.00 52.58 ? 101  PHE D CE1 1 
ATOM   7136  C  CE2 . PHE D  1 109 ? -27.611  56.090  45.954  1.00 51.65 ? 101  PHE D CE2 1 
ATOM   7137  C  CZ  . PHE D  1 109 ? -28.132  56.610  44.752  1.00 53.07 ? 101  PHE D CZ  1 
ATOM   7138  N  N   . VAL D  1 110 ? -26.132  62.296  48.819  1.00 22.37 ? 102  VAL D N   1 
ATOM   7139  C  CA  . VAL D  1 110 ? -26.110  63.247  49.911  1.00 20.59 ? 102  VAL D CA  1 
ATOM   7140  C  C   . VAL D  1 110 ? -27.128  62.747  50.924  1.00 21.14 ? 102  VAL D C   1 
ATOM   7141  O  O   . VAL D  1 110 ? -28.252  62.456  50.562  1.00 21.75 ? 102  VAL D O   1 
ATOM   7142  C  CB  . VAL D  1 110 ? -26.471  64.641  49.404  1.00 20.32 ? 102  VAL D CB  1 
ATOM   7143  C  CG1 . VAL D  1 110 ? -26.639  65.628  50.545  1.00 15.40 ? 102  VAL D CG1 1 
ATOM   7144  C  CG2 . VAL D  1 110 ? -25.430  65.107  48.403  1.00 18.06 ? 102  VAL D CG2 1 
ATOM   7145  N  N   . THR D  1 111 ? -26.711  62.568  52.172  1.00 20.78 ? 103  THR D N   1 
ATOM   7146  C  CA  . THR D  1 111 ? -27.599  62.172  53.271  1.00 20.10 ? 103  THR D CA  1 
ATOM   7147  C  C   . THR D  1 111 ? -28.010  63.351  54.110  1.00 19.83 ? 103  THR D C   1 
ATOM   7148  O  O   . THR D  1 111 ? -28.982  63.274  54.806  1.00 20.12 ? 103  THR D O   1 
ATOM   7149  C  CB  . THR D  1 111 ? -26.900  61.203  54.221  1.00 20.44 ? 103  THR D CB  1 
ATOM   7150  O  OG1 . THR D  1 111 ? -25.749  61.848  54.804  1.00 19.96 ? 103  THR D OG1 1 
ATOM   7151  C  CG2 . THR D  1 111 ? -26.460  59.955  53.470  1.00 19.93 ? 103  THR D CG2 1 
ATOM   7152  N  N   . GLY D  1 112 ? -27.231  64.432  54.080  1.00 20.31 ? 104  GLY D N   1 
ATOM   7153  C  CA  . GLY D  1 112 ? -27.506  65.607  54.866  1.00 19.81 ? 104  GLY D CA  1 
ATOM   7154  C  C   . GLY D  1 112 ? -26.447  66.671  54.736  1.00 20.23 ? 104  GLY D C   1 
ATOM   7155  O  O   . GLY D  1 112 ? -25.513  66.570  53.942  1.00 21.00 ? 104  GLY D O   1 
ATOM   7156  N  N   . LYS D  1 113 ? -26.578  67.687  55.553  1.00 20.47 ? 105  LYS D N   1 
ATOM   7157  C  CA  . LYS D  1 113 ? -25.608  68.741  55.624  1.00 20.62 ? 105  LYS D CA  1 
ATOM   7158  C  C   . LYS D  1 113 ? -25.613  69.361  57.026  1.00 21.29 ? 105  LYS D C   1 
ATOM   7159  O  O   . LYS D  1 113 ? -26.597  69.310  57.729  1.00 20.73 ? 105  LYS D O   1 
ATOM   7160  C  CB  . LYS D  1 113 ? -25.844  69.770  54.532  1.00 19.99 ? 105  LYS D CB  1 
ATOM   7161  C  CG  . LYS D  1 113 ? -27.190  70.521  54.528  1.00 20.07 ? 105  LYS D CG  1 
ATOM   7162  C  CD  . LYS D  1 113 ? -27.420  71.113  53.102  1.00 18.74 ? 105  LYS D CD  1 
ATOM   7163  C  CE  . LYS D  1 113 ? -28.662  71.889  52.915  1.00 20.56 ? 105  LYS D CE  1 
ATOM   7164  N  NZ  . LYS D  1 113 ? -28.877  72.438  51.493  1.00 17.03 ? 105  LYS D NZ  1 
ATOM   7165  N  N   . HIS D  1 114 ? -24.466  69.882  57.433  1.00 22.20 ? 106  HIS D N   1 
ATOM   7166  C  CA  . HIS D  1 114 ? -24.255  70.354  58.776  1.00 23.35 ? 106  HIS D CA  1 
ATOM   7167  C  C   . HIS D  1 114 ? -23.629  71.747  58.748  1.00 23.96 ? 106  HIS D C   1 
ATOM   7168  O  O   . HIS D  1 114 ? -22.525  71.917  58.227  1.00 23.95 ? 106  HIS D O   1 
ATOM   7169  C  CB  . HIS D  1 114 ? -23.320  69.395  59.491  1.00 22.90 ? 106  HIS D CB  1 
ATOM   7170  C  CG  . HIS D  1 114 ? -23.084  69.752  60.906  1.00 25.77 ? 106  HIS D CG  1 
ATOM   7171  N  ND1 . HIS D  1 114 ? -22.032  69.236  61.632  1.00 31.03 ? 106  HIS D ND1 1 
ATOM   7172  C  CD2 . HIS D  1 114 ? -23.746  70.602  61.730  1.00 26.25 ? 106  HIS D CD2 1 
ATOM   7173  C  CE1 . HIS D  1 114 ? -22.053  69.772  62.844  1.00 31.57 ? 106  HIS D CE1 1 
ATOM   7174  N  NE2 . HIS D  1 114 ? -23.070  70.615  62.920  1.00 28.82 ? 106  HIS D NE2 1 
ATOM   7175  N  N   . GLY D  1 115 ? -24.324  72.717  59.319  1.00 24.79 ? 107  GLY D N   1 
ATOM   7176  C  CA  . GLY D  1 115 ? -23.926  74.130  59.254  1.00 26.11 ? 107  GLY D CA  1 
ATOM   7177  C  C   . GLY D  1 115 ? -22.897  74.432  60.319  1.00 27.00 ? 107  GLY D C   1 
ATOM   7178  O  O   . GLY D  1 115 ? -22.834  73.732  61.276  1.00 27.97 ? 107  GLY D O   1 
ATOM   7179  N  N   . GLY D  1 116 ? -22.075  75.464  60.125  1.00 28.38 ? 108  GLY D N   1 
ATOM   7180  C  CA  . GLY D  1 116 ? -21.037  75.886  61.106  1.00 28.91 ? 108  GLY D CA  1 
ATOM   7181  C  C   . GLY D  1 116 ? -19.720  75.517  60.457  1.00 29.28 ? 108  GLY D C   1 
ATOM   7182  O  O   . GLY D  1 116 ? -19.152  76.304  59.724  1.00 29.88 ? 108  GLY D O   1 
ATOM   7183  N  N   . VAL D  1 117 ? -19.295  74.266  60.640  1.00 29.13 ? 109  VAL D N   1 
ATOM   7184  C  CA  . VAL D  1 117 ? -18.200  73.746  59.854  1.00 28.45 ? 109  VAL D CA  1 
ATOM   7185  C  C   . VAL D  1 117 ? -18.568  73.678  58.403  1.00 27.82 ? 109  VAL D C   1 
ATOM   7186  O  O   . VAL D  1 117 ? -17.687  73.651  57.563  1.00 29.22 ? 109  VAL D O   1 
ATOM   7187  C  CB  . VAL D  1 117 ? -17.792  72.358  60.319  1.00 29.12 ? 109  VAL D CB  1 
ATOM   7188  C  CG1 . VAL D  1 117 ? -17.206  72.479  61.728  1.00 30.10 ? 109  VAL D CG1 1 
ATOM   7189  C  CG2 . VAL D  1 117 ? -18.984  71.418  60.304  1.00 26.12 ? 109  VAL D CG2 1 
ATOM   7190  N  N   . ASN D  1 118 ? -19.860  73.672  58.082  1.00 26.09 ? 110  ASN D N   1 
ATOM   7191  C  CA  . ASN D  1 118 ? -20.284  73.635  56.689  1.00 24.06 ? 110  ASN D CA  1 
ATOM   7192  C  C   . ASN D  1 118 ? -19.788  72.426  55.921  1.00 22.95 ? 110  ASN D C   1 
ATOM   7193  O  O   . ASN D  1 118 ? -18.964  72.542  55.015  1.00 22.77 ? 110  ASN D O   1 
ATOM   7194  C  CB  . ASN D  1 118 ? -19.896  74.930  55.989  1.00 24.21 ? 110  ASN D CB  1 
ATOM   7195  C  CG  . ASN D  1 118 ? -20.721  76.109  56.489  1.00 25.97 ? 110  ASN D CG  1 
ATOM   7196  O  OD1 . ASN D  1 118 ? -21.791  75.912  57.048  1.00 26.53 ? 110  ASN D OD1 1 
ATOM   7197  N  ND2 . ASN D  1 118 ? -20.224  77.326  56.304  1.00 23.38 ? 110  ASN D ND2 1 
ATOM   7198  N  N   . HIS D  1 119 ? -20.320  71.260  56.284  1.00 21.96 ? 111  HIS D N   1 
ATOM   7199  C  CA  . HIS D  1 119 ? -20.049  70.009  55.601  1.00 20.82 ? 111  HIS D CA  1 
ATOM   7200  C  C   . HIS D  1 119 ? -21.319  69.438  54.958  1.00 20.61 ? 111  HIS D C   1 
ATOM   7201  O  O   . HIS D  1 119 ? -22.423  69.594  55.490  1.00 20.77 ? 111  HIS D O   1 
ATOM   7202  C  CB  . HIS D  1 119 ? -19.556  68.966  56.593  1.00 21.42 ? 111  HIS D CB  1 
ATOM   7203  C  CG  . HIS D  1 119 ? -18.189  69.209  57.151  1.00 22.59 ? 111  HIS D CG  1 
ATOM   7204  N  ND1 . HIS D  1 119 ? -17.687  68.481  58.220  1.00 21.65 ? 111  HIS D ND1 1 
ATOM   7205  C  CD2 . HIS D  1 119 ? -17.237  70.125  56.830  1.00 21.99 ? 111  HIS D CD2 1 
ATOM   7206  C  CE1 . HIS D  1 119 ? -16.469  68.923  58.505  1.00 25.04 ? 111  HIS D CE1 1 
ATOM   7207  N  NE2 . HIS D  1 119 ? -16.174  69.924  57.680  1.00 23.40 ? 111  HIS D NE2 1 
ATOM   7208  N  N   . VAL D  1 120 ? -21.158  68.782  53.809  1.00 20.20 ? 112  VAL D N   1 
ATOM   7209  C  CA  . VAL D  1 120 ? -22.215  68.053  53.183  1.00 19.45 ? 112  VAL D CA  1 
ATOM   7210  C  C   . VAL D  1 120 ? -21.856  66.596  53.415  1.00 19.96 ? 112  VAL D C   1 
ATOM   7211  O  O   . VAL D  1 120 ? -20.724  66.231  53.318  1.00 20.60 ? 112  VAL D O   1 
ATOM   7212  C  CB  . VAL D  1 120 ? -22.352  68.424  51.698  1.00 19.41 ? 112  VAL D CB  1 
ATOM   7213  C  CG1 . VAL D  1 120 ? -23.309  67.490  51.001  1.00 18.22 ? 112  VAL D CG1 1 
ATOM   7214  C  CG2 . VAL D  1 120 ? -22.816  69.841  51.583  1.00 16.60 ? 112  VAL D CG2 1 
ATOM   7215  N  N   . LEU D  1 121 ? -22.838  65.770  53.754  1.00 20.56 ? 113  LEU D N   1 
ATOM   7216  C  CA  . LEU D  1 121 ? -22.597  64.430  54.262  1.00 20.58 ? 113  LEU D CA  1 
ATOM   7217  C  C   . LEU D  1 121 ? -23.048  63.425  53.230  1.00 21.07 ? 113  LEU D C   1 
ATOM   7218  O  O   . LEU D  1 121 ? -24.144  63.576  52.669  1.00 22.29 ? 113  LEU D O   1 
ATOM   7219  C  CB  . LEU D  1 121 ? -23.367  64.251  55.576  1.00 20.69 ? 113  LEU D CB  1 
ATOM   7220  C  CG  . LEU D  1 121 ? -23.078  65.334  56.633  1.00 19.89 ? 113  LEU D CG  1 
ATOM   7221  C  CD1 . LEU D  1 121 ? -23.770  64.982  57.930  1.00 19.52 ? 113  LEU D CD1 1 
ATOM   7222  C  CD2 . LEU D  1 121 ? -21.548  65.526  56.868  1.00 16.29 ? 113  LEU D CD2 1 
ATOM   7223  N  N   . VAL D  1 122 ? -22.224  62.418  52.950  1.00 20.78 ? 114  VAL D N   1 
ATOM   7224  C  CA  . VAL D  1 122 ? -22.426  61.607  51.765  1.00 21.59 ? 114  VAL D CA  1 
ATOM   7225  C  C   . VAL D  1 122 ? -22.307  60.109  52.105  1.00 23.25 ? 114  VAL D C   1 
ATOM   7226  O  O   . VAL D  1 122 ? -21.367  59.686  52.814  1.00 22.51 ? 114  VAL D O   1 
ATOM   7227  C  CB  . VAL D  1 122 ? -21.402  61.987  50.620  1.00 22.05 ? 114  VAL D CB  1 
ATOM   7228  C  CG1 . VAL D  1 122 ? -21.662  61.173  49.401  1.00 20.49 ? 114  VAL D CG1 1 
ATOM   7229  C  CG2 . VAL D  1 122 ? -21.419  63.473  50.310  1.00 19.69 ? 114  VAL D CG2 1 
ATOM   7230  N  N   . HIS D  1 123 ? -23.255  59.320  51.614  1.00 23.70 ? 115  HIS D N   1 
ATOM   7231  C  CA  . HIS D  1 123 ? -23.221  57.864  51.790  1.00 25.73 ? 115  HIS D CA  1 
ATOM   7232  C  C   . HIS D  1 123 ? -22.658  57.187  50.560  1.00 27.08 ? 115  HIS D C   1 
ATOM   7233  O  O   . HIS D  1 123 ? -23.054  57.479  49.468  1.00 28.58 ? 115  HIS D O   1 
ATOM   7234  C  CB  . HIS D  1 123 ? -24.611  57.304  52.041  1.00 25.80 ? 115  HIS D CB  1 
ATOM   7235  C  CG  . HIS D  1 123 ? -24.681  55.819  51.920  1.00 27.94 ? 115  HIS D CG  1 
ATOM   7236  N  ND1 . HIS D  1 123 ? -24.337  54.959  52.948  1.00 30.01 ? 115  HIS D ND1 1 
ATOM   7237  C  CD2 . HIS D  1 123 ? -25.038  55.038  50.875  1.00 27.81 ? 115  HIS D CD2 1 
ATOM   7238  C  CE1 . HIS D  1 123 ? -24.482  53.707  52.527  1.00 30.61 ? 115  HIS D CE1 1 
ATOM   7239  N  NE2 . HIS D  1 123 ? -24.902  53.734  51.273  1.00 28.71 ? 115  HIS D NE2 1 
ATOM   7240  N  N   . PHE D  1 124 ? -21.700  56.308  50.737  1.00 28.54 ? 116  PHE D N   1 
ATOM   7241  C  CA  . PHE D  1 124 ? -21.169  55.529  49.664  1.00 30.14 ? 116  PHE D CA  1 
ATOM   7242  C  C   . PHE D  1 124 ? -21.303  54.118  50.156  1.00 32.40 ? 116  PHE D C   1 
ATOM   7243  O  O   . PHE D  1 124 ? -21.317  53.880  51.359  1.00 31.95 ? 116  PHE D O   1 
ATOM   7244  C  CB  . PHE D  1 124 ? -19.680  55.814  49.440  1.00 29.90 ? 116  PHE D CB  1 
ATOM   7245  C  CG  . PHE D  1 124 ? -19.397  57.126  48.801  1.00 27.99 ? 116  PHE D CG  1 
ATOM   7246  C  CD1 . PHE D  1 124 ? -19.564  57.287  47.464  1.00 28.60 ? 116  PHE D CD1 1 
ATOM   7247  C  CD2 . PHE D  1 124 ? -18.922  58.193  49.526  1.00 27.07 ? 116  PHE D CD2 1 
ATOM   7248  C  CE1 . PHE D  1 124 ? -19.283  58.502  46.862  1.00 27.55 ? 116  PHE D CE1 1 
ATOM   7249  C  CE2 . PHE D  1 124 ? -18.651  59.379  48.931  1.00 25.99 ? 116  PHE D CE2 1 
ATOM   7250  C  CZ  . PHE D  1 124 ? -18.843  59.534  47.606  1.00 24.86 ? 116  PHE D CZ  1 
ATOM   7251  N  N   . GLU D  1 125 ? -21.321  53.183  49.232  1.00 35.03 ? 117  GLU D N   1 
ATOM   7252  C  CA  . GLU D  1 125 ? -21.308  51.784  49.581  1.00 37.54 ? 117  GLU D CA  1 
ATOM   7253  C  C   . GLU D  1 125 ? -20.007  51.454  50.322  1.00 38.76 ? 117  GLU D C   1 
ATOM   7254  O  O   . GLU D  1 125 ? -18.981  52.063  50.133  1.00 38.18 ? 117  GLU D O   1 
ATOM   7255  C  CB  . GLU D  1 125 ? -21.531  50.931  48.313  1.00 38.58 ? 117  GLU D CB  1 
ATOM   7256  N  N   . GLU D  1 126 ? -20.107  50.484  51.185  1.00 40.79 ? 118  GLU D N   1 
ATOM   7257  C  CA  . GLU D  1 126 ? -19.093  50.115  52.148  1.00 43.44 ? 118  GLU D CA  1 
ATOM   7258  C  C   . GLU D  1 126 ? -17.725  49.801  51.564  1.00 42.96 ? 118  GLU D C   1 
ATOM   7259  O  O   . GLU D  1 126 ? -16.717  50.177  52.082  1.00 42.46 ? 118  GLU D O   1 
ATOM   7260  C  CB  . GLU D  1 126 ? -19.673  48.884  52.797  1.00 45.45 ? 118  GLU D CB  1 
ATOM   7261  C  CG  . GLU D  1 126 ? -18.922  48.244  53.921  1.00 52.59 ? 118  GLU D CG  1 
ATOM   7262  C  CD  . GLU D  1 126 ? -19.863  47.310  54.706  1.00 60.96 ? 118  GLU D CD  1 
ATOM   7263  O  OE1 . GLU D  1 126 ? -20.573  46.468  54.063  1.00 64.38 ? 118  GLU D OE1 1 
ATOM   7264  O  OE2 . GLU D  1 126 ? -19.927  47.470  55.955  1.00 65.48 ? 118  GLU D OE2 1 
ATOM   7265  N  N   . GLU D  1 127 ? -17.728  49.105  50.454  1.00 43.68 ? 119  GLU D N   1 
ATOM   7266  C  CA  . GLU D  1 127 ? -16.519  48.730  49.716  1.00 44.53 ? 119  GLU D CA  1 
ATOM   7267  C  C   . GLU D  1 127 ? -15.740  49.958  49.253  1.00 41.92 ? 119  GLU D C   1 
ATOM   7268  O  O   . GLU D  1 127 ? -14.554  49.890  49.114  1.00 42.04 ? 119  GLU D O   1 
ATOM   7269  C  CB  . GLU D  1 127 ? -16.879  47.813  48.520  1.00 46.26 ? 119  GLU D CB  1 
ATOM   7270  C  CG  . GLU D  1 127 ? -18.258  48.152  47.801  1.00 52.99 ? 119  GLU D CG  1 
ATOM   7271  C  CD  . GLU D  1 127 ? -19.584  47.640  48.539  1.00 58.87 ? 119  GLU D CD  1 
ATOM   7272  O  OE1 . GLU D  1 127 ? -19.635  47.516  49.782  1.00 61.46 ? 119  GLU D OE1 1 
ATOM   7273  O  OE2 . GLU D  1 127 ? -20.601  47.400  47.855  1.00 61.66 ? 119  GLU D OE2 1 
ATOM   7274  N  N   . VAL D  1 128 ? -16.425  51.070  49.026  1.00 39.51 ? 120  VAL D N   1 
ATOM   7275  C  CA  . VAL D  1 128 ? -15.778  52.337  48.664  1.00 37.65 ? 120  VAL D CA  1 
ATOM   7276  C  C   . VAL D  1 128 ? -14.980  53.029  49.783  1.00 36.54 ? 120  VAL D C   1 
ATOM   7277  O  O   . VAL D  1 128 ? -13.974  53.648  49.528  1.00 35.03 ? 120  VAL D O   1 
ATOM   7278  C  CB  . VAL D  1 128 ? -16.812  53.333  48.134  1.00 37.30 ? 120  VAL D CB  1 
ATOM   7279  C  CG1 . VAL D  1 128 ? -16.192  54.635  47.839  1.00 35.58 ? 120  VAL D CG1 1 
ATOM   7280  C  CG2 . VAL D  1 128 ? -17.468  52.797  46.894  1.00 35.01 ? 120  VAL D CG2 1 
ATOM   7281  N  N   . LEU D  1 129 ? -15.449  52.944  51.011  1.00 35.52 ? 121  LEU D N   1 
ATOM   7282  C  CA  . LEU D  1 129 ? -14.938  53.761  52.078  1.00 34.54 ? 121  LEU D CA  1 
ATOM   7283  C  C   . LEU D  1 129 ? -13.483  53.462  52.329  1.00 34.96 ? 121  LEU D C   1 
ATOM   7284  O  O   . LEU D  1 129 ? -12.692  54.343  52.667  1.00 34.13 ? 121  LEU D O   1 
ATOM   7285  C  CB  . LEU D  1 129 ? -15.718  53.487  53.359  1.00 34.71 ? 121  LEU D CB  1 
ATOM   7286  C  CG  . LEU D  1 129 ? -17.207  53.843  53.393  1.00 34.48 ? 121  LEU D CG  1 
ATOM   7287  C  CD1 . LEU D  1 129 ? -17.795  53.568  54.794  1.00 32.67 ? 121  LEU D CD1 1 
ATOM   7288  C  CD2 . LEU D  1 129 ? -17.394  55.279  52.980  1.00 32.55 ? 121  LEU D CD2 1 
ATOM   7289  N  N   . GLY D  1 130 ? -13.117  52.204  52.182  1.00 35.30 ? 122  GLY D N   1 
ATOM   7290  C  CA  . GLY D  1 130 ? -11.717  51.823  52.349  1.00 35.87 ? 122  GLY D CA  1 
ATOM   7291  C  C   . GLY D  1 130 ? -10.753  52.385  51.300  1.00 36.56 ? 122  GLY D C   1 
ATOM   7292  O  O   . GLY D  1 130 ? -9.565   52.441  51.521  1.00 37.09 ? 122  GLY D O   1 
ATOM   7293  N  N   . LYS D  1 131 ? -11.247  52.832  50.164  1.00 36.18 ? 123  LYS D N   1 
ATOM   7294  C  CA  . LYS D  1 131 ? -10.372  53.389  49.191  1.00 36.40 ? 123  LYS D CA  1 
ATOM   7295  C  C   . LYS D  1 131 ? -10.244  54.908  49.280  1.00 34.80 ? 123  LYS D C   1 
ATOM   7296  O  O   . LYS D  1 131 ? -9.409   55.486  48.594  1.00 35.58 ? 123  LYS D O   1 
ATOM   7297  C  CB  . LYS D  1 131 ? -10.889  53.034  47.830  1.00 37.87 ? 123  LYS D CB  1 
ATOM   7298  C  CG  . LYS D  1 131 ? -11.062  51.535  47.579  1.00 42.39 ? 123  LYS D CG  1 
ATOM   7299  C  CD  . LYS D  1 131 ? -11.195  51.312  46.070  1.00 49.44 ? 123  LYS D CD  1 
ATOM   7300  C  CE  . LYS D  1 131 ? -11.396  49.832  45.706  1.00 53.83 ? 123  LYS D CE  1 
ATOM   7301  N  NZ  . LYS D  1 131 ? -12.860  49.529  45.500  1.00 56.52 ? 123  LYS D NZ  1 
ATOM   7302  N  N   . LEU D  1 132 ? -11.057  55.560  50.095  1.00 31.63 ? 124  LEU D N   1 
ATOM   7303  C  CA  . LEU D  1 132 ? -11.098  56.992  50.052  1.00 30.00 ? 124  LEU D CA  1 
ATOM   7304  C  C   . LEU D  1 132 ? -9.995   57.598  50.928  1.00 28.71 ? 124  LEU D C   1 
ATOM   7305  O  O   . LEU D  1 132 ? -9.487   56.969  51.813  1.00 27.09 ? 124  LEU D O   1 
ATOM   7306  C  CB  . LEU D  1 132 ? -12.456  57.497  50.544  1.00 29.39 ? 124  LEU D CB  1 
ATOM   7307  C  CG  . LEU D  1 132 ? -13.731  57.160  49.773  1.00 29.65 ? 124  LEU D CG  1 
ATOM   7308  C  CD1 . LEU D  1 132 ? -15.036  57.559  50.567  1.00 25.44 ? 124  LEU D CD1 1 
ATOM   7309  C  CD2 . LEU D  1 132 ? -13.666  57.813  48.376  1.00 25.73 ? 124  LEU D CD2 1 
ATOM   7310  N  N   . MET D  1 133 ? -9.690   58.861  50.689  1.00 27.63 ? 125  MET D N   1 
ATOM   7311  C  CA  . MET D  1 133 ? -8.706   59.584  51.460  1.00 26.54 ? 125  MET D CA  1 
ATOM   7312  C  C   . MET D  1 133 ? -9.159   61.004  51.627  1.00 25.27 ? 125  MET D C   1 
ATOM   7313  O  O   . MET D  1 133 ? -9.714   61.610  50.697  1.00 24.25 ? 125  MET D O   1 
ATOM   7314  C  CB  . MET D  1 133 ? -7.358   59.578  50.724  1.00 27.01 ? 125  MET D CB  1 
ATOM   7315  C  CG  . MET D  1 133 ? -6.261   60.308  51.452  1.00 28.43 ? 125  MET D CG  1 
ATOM   7316  S  SD  . MET D  1 133 ? -5.989   59.729  53.153  1.00 31.40 ? 125  MET D SD  1 
ATOM   7317  C  CE  . MET D  1 133 ? -4.584   60.778  53.614  1.00 32.35 ? 125  MET D CE  1 
ATOM   7318  N  N   . VAL D  1 134 ? -8.881   61.562  52.798  1.00 24.44 ? 126  VAL D N   1 
ATOM   7319  C  CA  . VAL D  1 134 ? -9.155   62.939  53.047  1.00 23.65 ? 126  VAL D CA  1 
ATOM   7320  C  C   . VAL D  1 134 ? -8.462   63.772  51.969  1.00 24.71 ? 126  VAL D C   1 
ATOM   7321  O  O   . VAL D  1 134 ? -7.301   63.512  51.598  1.00 25.05 ? 126  VAL D O   1 
ATOM   7322  C  CB  . VAL D  1 134 ? -8.671   63.364  54.452  1.00 23.70 ? 126  VAL D CB  1 
ATOM   7323  C  CG1 . VAL D  1 134 ? -8.818   64.890  54.651  1.00 21.86 ? 126  VAL D CG1 1 
ATOM   7324  C  CG2 . VAL D  1 134 ? -9.420   62.593  55.512  1.00 20.13 ? 126  VAL D CG2 1 
ATOM   7325  N  N   . GLY D  1 135 ? -9.154   64.785  51.467  1.00 24.59 ? 127  GLY D N   1 
ATOM   7326  C  CA  . GLY D  1 135 ? -8.637   65.610  50.367  1.00 24.22 ? 127  GLY D CA  1 
ATOM   7327  C  C   . GLY D  1 135 ? -9.123   65.216  48.984  1.00 24.04 ? 127  GLY D C   1 
ATOM   7328  O  O   . GLY D  1 135 ? -9.005   65.969  48.063  1.00 23.51 ? 127  GLY D O   1 
ATOM   7329  N  N   . ASP D  1 136 ? -9.667   64.022  48.837  1.00 24.77 ? 128  ASP D N   1 
ATOM   7330  C  CA  . ASP D  1 136 ? -10.148  63.560  47.556  1.00 25.98 ? 128  ASP D CA  1 
ATOM   7331  C  C   . ASP D  1 136 ? -11.276  64.435  47.068  1.00 26.58 ? 128  ASP D C   1 
ATOM   7332  O  O   . ASP D  1 136 ? -12.121  64.874  47.873  1.00 26.29 ? 128  ASP D O   1 
ATOM   7333  C  CB  . ASP D  1 136 ? -10.620  62.101  47.649  1.00 27.02 ? 128  ASP D CB  1 
ATOM   7334  C  CG  . ASP D  1 136 ? -9.440   61.076  47.718  1.00 29.74 ? 128  ASP D CG  1 
ATOM   7335  O  OD1 . ASP D  1 136 ? -8.228   61.471  47.596  1.00 30.13 ? 128  ASP D OD1 1 
ATOM   7336  O  OD2 . ASP D  1 136 ? -9.778   59.867  47.874  1.00 32.79 ? 128  ASP D OD2 1 
ATOM   7337  N  N   . LYS D  1 137 ? -11.272  64.725  45.763  1.00 27.06 ? 129  LYS D N   1 
ATOM   7338  C  CA  . LYS D  1 137 ? -12.233  65.646  45.169  1.00 27.61 ? 129  LYS D CA  1 
ATOM   7339  C  C   . LYS D  1 137 ? -13.603  65.038  45.022  1.00 26.13 ? 129  LYS D C   1 
ATOM   7340  O  O   . LYS D  1 137 ? -13.736  63.889  44.647  1.00 25.49 ? 129  LYS D O   1 
ATOM   7341  C  CB  . LYS D  1 137 ? -11.767  66.123  43.817  1.00 28.45 ? 129  LYS D CB  1 
ATOM   7342  C  CG  . LYS D  1 137 ? -10.470  66.866  43.871  1.00 33.57 ? 129  LYS D CG  1 
ATOM   7343  C  CD  . LYS D  1 137 ? -10.045  67.151  42.446  1.00 40.12 ? 129  LYS D CD  1 
ATOM   7344  C  CE  . LYS D  1 137 ? -8.689   67.843  42.338  1.00 43.79 ? 129  LYS D CE  1 
ATOM   7345  N  NZ  . LYS D  1 137 ? -8.428   67.857  40.824  1.00 48.08 ? 129  LYS D NZ  1 
ATOM   7346  N  N   . ILE D  1 138 ? -14.611  65.861  45.301  1.00 25.57 ? 130  ILE D N   1 
ATOM   7347  C  CA  . ILE D  1 138 ? -16.018  65.450  45.296  1.00 24.49 ? 130  ILE D CA  1 
ATOM   7348  C  C   . ILE D  1 138 ? -16.879  66.393  44.457  1.00 24.39 ? 130  ILE D C   1 
ATOM   7349  O  O   . ILE D  1 138 ? -16.825  67.612  44.652  1.00 24.73 ? 130  ILE D O   1 
ATOM   7350  C  CB  . ILE D  1 138 ? -16.576  65.475  46.725  1.00 23.28 ? 130  ILE D CB  1 
ATOM   7351  C  CG1 . ILE D  1 138 ? -15.820  64.511  47.637  1.00 22.68 ? 130  ILE D CG1 1 
ATOM   7352  C  CG2 . ILE D  1 138 ? -17.996  65.093  46.709  1.00 23.45 ? 130  ILE D CG2 1 
ATOM   7353  C  CD1 . ILE D  1 138 ? -15.852  63.036  47.280  1.00 21.05 ? 130  ILE D CD1 1 
ATOM   7354  N  N   . LEU D  1 139 ? -17.675  65.815  43.558  1.00 24.19 ? 131  LEU D N   1 
ATOM   7355  C  CA  . LEU D  1 139 ? -18.653  66.547  42.741  1.00 24.44 ? 131  LEU D CA  1 
ATOM   7356  C  C   . LEU D  1 139 ? -20.060  66.133  43.204  1.00 24.09 ? 131  LEU D C   1 
ATOM   7357  O  O   . LEU D  1 139 ? -20.423  64.941  43.208  1.00 23.20 ? 131  LEU D O   1 
ATOM   7358  C  CB  . LEU D  1 139 ? -18.506  66.190  41.259  1.00 25.08 ? 131  LEU D CB  1 
ATOM   7359  C  CG  . LEU D  1 139 ? -19.612  66.577  40.272  1.00 26.54 ? 131  LEU D CG  1 
ATOM   7360  C  CD1 . LEU D  1 139 ? -19.700  68.070  40.139  1.00 24.13 ? 131  LEU D CD1 1 
ATOM   7361  C  CD2 . LEU D  1 139 ? -19.300  65.961  38.867  1.00 29.07 ? 131  LEU D CD2 1 
ATOM   7362  N  N   . ILE D  1 140 ? -20.837  67.123  43.609  1.00 23.28 ? 132  ILE D N   1 
ATOM   7363  C  CA  . ILE D  1 140 ? -22.213  66.901  43.966  1.00 22.85 ? 132  ILE D CA  1 
ATOM   7364  C  C   . ILE D  1 140 ? -23.037  67.402  42.812  1.00 23.28 ? 132  ILE D C   1 
ATOM   7365  O  O   . ILE D  1 140 ? -22.878  68.533  42.380  1.00 22.84 ? 132  ILE D O   1 
ATOM   7366  C  CB  . ILE D  1 140 ? -22.579  67.686  45.259  1.00 23.01 ? 132  ILE D CB  1 
ATOM   7367  C  CG1 . ILE D  1 140 ? -21.821  67.111  46.485  1.00 20.66 ? 132  ILE D CG1 1 
ATOM   7368  C  CG2 . ILE D  1 140 ? -24.085  67.625  45.508  1.00 19.45 ? 132  ILE D CG2 1 
ATOM   7369  C  CD1 . ILE D  1 140 ? -21.508  68.129  47.532  1.00 18.02 ? 132  ILE D CD1 1 
ATOM   7370  N  N   . LYS D  1 141 ? -23.927  66.589  42.279  1.00 24.29 ? 133  LYS D N   1 
ATOM   7371  C  CA  . LYS D  1 141 ? -24.752  67.119  41.180  1.00 25.66 ? 133  LYS D CA  1 
ATOM   7372  C  C   . LYS D  1 141 ? -25.965  67.802  41.799  1.00 24.49 ? 133  LYS D C   1 
ATOM   7373  O  O   . LYS D  1 141 ? -26.963  67.183  42.092  1.00 24.94 ? 133  LYS D O   1 
ATOM   7374  C  CB  . LYS D  1 141 ? -25.080  66.019  40.195  1.00 27.10 ? 133  LYS D CB  1 
ATOM   7375  C  CG  . LYS D  1 141 ? -23.882  65.580  39.306  1.00 31.43 ? 133  LYS D CG  1 
ATOM   7376  C  CD  . LYS D  1 141 ? -24.437  65.095  37.991  1.00 40.12 ? 133  LYS D CD  1 
ATOM   7377  C  CE  . LYS D  1 141 ? -23.455  64.377  37.074  1.00 45.62 ? 133  LYS D CE  1 
ATOM   7378  N  NZ  . LYS D  1 141 ? -24.267  64.052  35.780  1.00 47.59 ? 133  LYS D NZ  1 
ATOM   7379  N  N   . ALA D  1 142 ? -25.823  69.081  42.107  1.00 23.99 ? 134  ALA D N   1 
ATOM   7380  C  CA  . ALA D  1 142 ? -26.778  69.753  42.979  1.00 23.21 ? 134  ALA D CA  1 
ATOM   7381  C  C   . ALA D  1 142 ? -28.087  70.049  42.255  1.00 23.91 ? 134  ALA D C   1 
ATOM   7382  O  O   . ALA D  1 142 ? -28.100  70.740  41.235  1.00 24.13 ? 134  ALA D O   1 
ATOM   7383  C  CB  . ALA D  1 142 ? -26.222  71.010  43.536  1.00 20.99 ? 134  ALA D CB  1 
ATOM   7384  N  N   . TRP D  1 143 ? -29.188  69.632  42.862  1.00 23.96 ? 135  TRP D N   1 
ATOM   7385  C  CA  . TRP D  1 143 ? -30.502  69.706  42.213  1.00 25.13 ? 135  TRP D CA  1 
ATOM   7386  C  C   . TRP D  1 143 ? -31.603  69.631  43.271  1.00 23.69 ? 135  TRP D C   1 
ATOM   7387  O  O   . TRP D  1 143 ? -31.645  68.665  44.023  1.00 22.73 ? 135  TRP D O   1 
ATOM   7388  C  CB  . TRP D  1 143 ? -30.626  68.499  41.283  1.00 25.29 ? 135  TRP D CB  1 
ATOM   7389  C  CG  . TRP D  1 143 ? -31.829  68.462  40.489  1.00 29.87 ? 135  TRP D CG  1 
ATOM   7390  C  CD1 . TRP D  1 143 ? -32.380  69.491  39.796  1.00 35.38 ? 135  TRP D CD1 1 
ATOM   7391  C  CD2 . TRP D  1 143 ? -32.646  67.334  40.237  1.00 32.24 ? 135  TRP D CD2 1 
ATOM   7392  N  NE1 . TRP D  1 143 ? -33.505  69.075  39.122  1.00 34.50 ? 135  TRP D NE1 1 
ATOM   7393  C  CE2 . TRP D  1 143 ? -33.691  67.753  39.377  1.00 33.98 ? 135  TRP D CE2 1 
ATOM   7394  C  CE3 . TRP D  1 143 ? -32.587  66.019  40.624  1.00 32.82 ? 135  TRP D CE3 1 
ATOM   7395  C  CZ2 . TRP D  1 143 ? -34.673  66.905  38.918  1.00 35.30 ? 135  TRP D CZ2 1 
ATOM   7396  C  CZ3 . TRP D  1 143 ? -33.581  65.172  40.180  1.00 36.21 ? 135  TRP D CZ3 1 
ATOM   7397  C  CH2 . TRP D  1 143 ? -34.612  65.619  39.336  1.00 35.49 ? 135  TRP D CH2 1 
ATOM   7398  N  N   . GLY D  1 144 ? -32.453  70.659  43.337  1.00 23.35 ? 136  GLY D N   1 
ATOM   7399  C  CA  . GLY D  1 144 ? -33.629  70.665  44.219  1.00 22.06 ? 136  GLY D CA  1 
ATOM   7400  C  C   . GLY D  1 144 ? -34.041  72.019  44.747  1.00 22.36 ? 136  GLY D C   1 
ATOM   7401  O  O   . GLY D  1 144 ? -35.201  72.224  45.150  1.00 21.21 ? 136  GLY D O   1 
ATOM   7402  N  N   . GLN D  1 145 ? -33.099  72.944  44.841  1.00 22.25 ? 137  GLN D N   1 
ATOM   7403  C  CA  . GLN D  1 145 ? -33.459  74.209  45.381  1.00 23.03 ? 137  GLN D CA  1 
ATOM   7404  C  C   . GLN D  1 145 ? -34.214  74.947  44.278  1.00 23.83 ? 137  GLN D C   1 
ATOM   7405  O  O   . GLN D  1 145 ? -33.837  74.926  43.081  1.00 23.74 ? 137  GLN D O   1 
ATOM   7406  C  CB  . GLN D  1 145 ? -32.267  75.031  45.909  1.00 23.52 ? 137  GLN D CB  1 
ATOM   7407  C  CG  . GLN D  1 145 ? -31.445  74.360  47.040  1.00 25.40 ? 137  GLN D CG  1 
ATOM   7408  C  CD  . GLN D  1 145 ? -32.167  74.249  48.398  1.00 25.76 ? 137  GLN D CD  1 
ATOM   7409  O  OE1 . GLN D  1 145 ? -33.378  74.002  48.459  1.00 25.46 ? 137  GLN D OE1 1 
ATOM   7410  N  NE2 . GLN D  1 145 ? -31.396  74.359  49.495  1.00 21.62 ? 137  GLN D NE2 1 
ATOM   7411  N  N   . GLY D  1 146 ? -35.280  75.599  44.729  1.00 23.90 ? 138  GLY D N   1 
ATOM   7412  C  CA  . GLY D  1 146 ? -36.264  76.220  43.902  1.00 24.34 ? 138  GLY D CA  1 
ATOM   7413  C  C   . GLY D  1 146 ? -37.508  75.402  43.700  1.00 24.31 ? 138  GLY D C   1 
ATOM   7414  O  O   . GLY D  1 146 ? -38.441  75.895  43.100  1.00 24.72 ? 138  GLY D O   1 
ATOM   7415  N  N   . LEU D  1 147 ? -37.505  74.156  44.166  1.00 24.44 ? 139  LEU D N   1 
ATOM   7416  C  CA  . LEU D  1 147 ? -38.636  73.257  43.992  1.00 24.98 ? 139  LEU D CA  1 
ATOM   7417  C  C   . LEU D  1 147 ? -39.882  73.851  44.637  1.00 26.29 ? 139  LEU D C   1 
ATOM   7418  O  O   . LEU D  1 147 ? -39.808  74.361  45.754  1.00 25.10 ? 139  LEU D O   1 
ATOM   7419  C  CB  . LEU D  1 147 ? -38.359  71.869  44.592  1.00 24.49 ? 139  LEU D CB  1 
ATOM   7420  C  CG  . LEU D  1 147 ? -39.427  70.779  44.494  1.00 24.82 ? 139  LEU D CG  1 
ATOM   7421  C  CD1 . LEU D  1 147 ? -39.649  70.414  43.020  1.00 20.99 ? 139  LEU D CD1 1 
ATOM   7422  C  CD2 . LEU D  1 147 ? -39.046  69.539  45.314  1.00 22.17 ? 139  LEU D CD2 1 
ATOM   7423  N  N   . LYS D  1 148 ? -41.007  73.755  43.907  1.00 27.91 ? 140  LYS D N   1 
ATOM   7424  C  CA  . LYS D  1 148 ? -42.321  74.185  44.353  1.00 29.98 ? 140  LYS D CA  1 
ATOM   7425  C  C   . LYS D  1 148 ? -43.414  73.169  44.089  1.00 29.13 ? 140  LYS D C   1 
ATOM   7426  O  O   . LYS D  1 148 ? -43.414  72.454  43.096  1.00 28.61 ? 140  LYS D O   1 
ATOM   7427  C  CB  . LYS D  1 148 ? -42.737  75.462  43.658  1.00 31.76 ? 140  LYS D CB  1 
ATOM   7428  C  CG  . LYS D  1 148 ? -41.887  76.639  43.954  1.00 37.18 ? 140  LYS D CG  1 
ATOM   7429  C  CD  . LYS D  1 148 ? -42.292  77.802  43.067  1.00 44.97 ? 140  LYS D CD  1 
ATOM   7430  C  CE  . LYS D  1 148 ? -41.947  79.159  43.713  1.00 50.60 ? 140  LYS D CE  1 
ATOM   7431  N  NZ  . LYS D  1 148 ? -42.412  80.243  42.747  1.00 56.00 ? 140  LYS D NZ  1 
ATOM   7432  N  N   . LEU D  1 149 ? -44.341  73.121  45.020  1.00 29.18 ? 141  LEU D N   1 
ATOM   7433  C  CA  . LEU D  1 149 ? -45.554  72.323  44.909  1.00 29.72 ? 141  LEU D CA  1 
ATOM   7434  C  C   . LEU D  1 149 ? -46.572  73.265  44.282  1.00 29.79 ? 141  LEU D C   1 
ATOM   7435  O  O   . LEU D  1 149 ? -47.053  74.192  44.907  1.00 28.45 ? 141  LEU D O   1 
ATOM   7436  C  CB  . LEU D  1 149 ? -46.016  71.881  46.308  1.00 29.35 ? 141  LEU D CB  1 
ATOM   7437  C  CG  . LEU D  1 149 ? -45.023  71.067  47.133  1.00 29.09 ? 141  LEU D CG  1 
ATOM   7438  C  CD1 . LEU D  1 149 ? -45.648  70.641  48.450  1.00 25.15 ? 141  LEU D CD1 1 
ATOM   7439  C  CD2 . LEU D  1 149 ? -44.517  69.838  46.401  1.00 27.60 ? 141  LEU D CD2 1 
ATOM   7440  N  N   . LEU D  1 150 ? -46.848  73.047  43.020  1.00 31.43 ? 142  LEU D N   1 
ATOM   7441  C  CA  . LEU D  1 150 ? -47.653  74.000  42.248  1.00 32.91 ? 142  LEU D CA  1 
ATOM   7442  C  C   . LEU D  1 150 ? -49.109  74.066  42.719  1.00 33.54 ? 142  LEU D C   1 
ATOM   7443  O  O   . LEU D  1 150 ? -49.705  75.109  42.635  1.00 33.18 ? 142  LEU D O   1 
ATOM   7444  C  CB  . LEU D  1 150 ? -47.565  73.663  40.760  1.00 33.00 ? 142  LEU D CB  1 
ATOM   7445  C  CG  . LEU D  1 150 ? -46.161  73.862  40.163  1.00 33.16 ? 142  LEU D CG  1 
ATOM   7446  C  CD1 . LEU D  1 150 ? -46.088  73.373  38.717  1.00 31.61 ? 142  LEU D CD1 1 
ATOM   7447  C  CD2 . LEU D  1 150 ? -45.755  75.332  40.289  1.00 31.08 ? 142  LEU D CD2 1 
ATOM   7448  N  N   . ASP D  1 151 ? -49.664  72.973  43.241  1.00 34.58 ? 143  ASP D N   1 
ATOM   7449  C  CA  . ASP D  1 151 ? -51.003  73.044  43.895  1.00 36.25 ? 143  ASP D CA  1 
ATOM   7450  C  C   . ASP D  1 151 ? -51.007  73.472  45.358  1.00 36.78 ? 143  ASP D C   1 
ATOM   7451  O  O   . ASP D  1 151 ? -52.074  73.572  45.917  1.00 37.81 ? 143  ASP D O   1 
ATOM   7452  C  CB  . ASP D  1 151 ? -51.758  71.714  43.811  1.00 35.92 ? 143  ASP D CB  1 
ATOM   7453  C  CG  . ASP D  1 151 ? -51.953  71.258  42.396  1.00 36.23 ? 143  ASP D CG  1 
ATOM   7454  O  OD1 . ASP D  1 151 ? -52.273  72.078  41.531  1.00 38.04 ? 143  ASP D OD1 1 
ATOM   7455  O  OD2 . ASP D  1 151 ? -51.712  70.088  42.121  1.00 37.52 ? 143  ASP D OD2 1 
ATOM   7456  N  N   . HIS D  1 152 ? -49.849  73.704  45.984  1.00 36.85 ? 144  HIS D N   1 
ATOM   7457  C  CA  . HIS D  1 152 ? -49.805  74.048  47.418  1.00 35.95 ? 144  HIS D CA  1 
ATOM   7458  C  C   . HIS D  1 152 ? -48.863  75.166  47.631  1.00 36.37 ? 144  HIS D C   1 
ATOM   7459  O  O   . HIS D  1 152 ? -47.868  75.019  48.281  1.00 36.59 ? 144  HIS D O   1 
ATOM   7460  C  CB  . HIS D  1 152 ? -49.384  72.869  48.248  1.00 35.37 ? 144  HIS D CB  1 
ATOM   7461  C  CG  . HIS D  1 152 ? -50.182  71.650  47.973  1.00 35.36 ? 144  HIS D CG  1 
ATOM   7462  N  ND1 . HIS D  1 152 ? -51.410  71.418  48.554  1.00 35.56 ? 144  HIS D ND1 1 
ATOM   7463  C  CD2 . HIS D  1 152 ? -49.969  70.627  47.111  1.00 36.66 ? 144  HIS D CD2 1 
ATOM   7464  C  CE1 . HIS D  1 152 ? -51.898  70.283  48.092  1.00 36.82 ? 144  HIS D CE1 1 
ATOM   7465  N  NE2 . HIS D  1 152 ? -51.039  69.777  47.219  1.00 34.78 ? 144  HIS D NE2 1 
ATOM   7466  N  N   . PRO D  1 153 ? -49.198  76.325  47.094  1.00 37.58 ? 145  PRO D N   1 
ATOM   7467  C  CA  . PRO D  1 153 ? -48.276  77.455  47.088  1.00 38.23 ? 145  PRO D CA  1 
ATOM   7468  C  C   . PRO D  1 153 ? -47.819  77.926  48.470  1.00 37.94 ? 145  PRO D C   1 
ATOM   7469  O  O   . PRO D  1 153 ? -46.766  78.555  48.589  1.00 38.00 ? 145  PRO D O   1 
ATOM   7470  C  CB  . PRO D  1 153 ? -49.080  78.566  46.336  1.00 38.91 ? 145  PRO D CB  1 
ATOM   7471  C  CG  . PRO D  1 153 ? -50.490  78.092  46.334  1.00 37.84 ? 145  PRO D CG  1 
ATOM   7472  C  CD  . PRO D  1 153 ? -50.481  76.633  46.438  1.00 37.30 ? 145  PRO D CD  1 
ATOM   7473  N  N   . ASP D  1 154 ? -48.570  77.610  49.508  1.00 37.84 ? 146  ASP D N   1 
ATOM   7474  C  CA  . ASP D  1 154 ? -48.160  77.997  50.845  1.00 38.22 ? 146  ASP D CA  1 
ATOM   7475  C  C   . ASP D  1 154 ? -47.420  76.927  51.611  1.00 36.48 ? 146  ASP D C   1 
ATOM   7476  O  O   . ASP D  1 154 ? -47.198  77.070  52.796  1.00 36.23 ? 146  ASP D O   1 
ATOM   7477  C  CB  . ASP D  1 154 ? -49.371  78.428  51.646  1.00 39.43 ? 146  ASP D CB  1 
ATOM   7478  C  CG  . ASP D  1 154 ? -50.030  79.697  51.076  1.00 44.25 ? 146  ASP D CG  1 
ATOM   7479  O  OD1 . ASP D  1 154 ? -49.297  80.647  50.691  1.00 48.76 ? 146  ASP D OD1 1 
ATOM   7480  O  OD2 . ASP D  1 154 ? -51.287  79.741  51.021  1.00 49.97 ? 146  ASP D OD2 1 
ATOM   7481  N  N   . VAL D  1 155 ? -47.089  75.826  50.960  1.00 35.13 ? 147  VAL D N   1 
ATOM   7482  C  CA  . VAL D  1 155 ? -46.269  74.790  51.579  1.00 33.51 ? 147  VAL D CA  1 
ATOM   7483  C  C   . VAL D  1 155 ? -44.927  74.878  50.875  1.00 33.34 ? 147  VAL D C   1 
ATOM   7484  O  O   . VAL D  1 155 ? -44.868  74.752  49.653  1.00 34.24 ? 147  VAL D O   1 
ATOM   7485  C  CB  . VAL D  1 155 ? -46.894  73.426  51.391  1.00 32.99 ? 147  VAL D CB  1 
ATOM   7486  C  CG1 . VAL D  1 155 ? -45.954  72.338  51.849  1.00 30.99 ? 147  VAL D CG1 1 
ATOM   7487  C  CG2 . VAL D  1 155 ? -48.252  73.390  52.100  1.00 31.28 ? 147  VAL D CG2 1 
ATOM   7488  N  N   . LYS D  1 156 ? -43.857  75.155  51.617  1.00 32.16 ? 148  LYS D N   1 
ATOM   7489  C  CA  . LYS D  1 156 ? -42.551  75.298  51.015  1.00 31.61 ? 148  LYS D CA  1 
ATOM   7490  C  C   . LYS D  1 156 ? -41.785  74.014  51.167  1.00 29.22 ? 148  LYS D C   1 
ATOM   7491  O  O   . LYS D  1 156 ? -41.875  73.374  52.187  1.00 29.25 ? 148  LYS D O   1 
ATOM   7492  C  CB  . LYS D  1 156 ? -41.797  76.492  51.602  1.00 32.75 ? 148  LYS D CB  1 
ATOM   7493  C  CG  . LYS D  1 156 ? -42.638  77.809  51.672  1.00 38.70 ? 148  LYS D CG  1 
ATOM   7494  C  CD  . LYS D  1 156 ? -43.017  78.465  50.305  1.00 45.93 ? 148  LYS D CD  1 
ATOM   7495  C  CE  . LYS D  1 156 ? -44.113  79.640  50.409  1.00 49.95 ? 148  LYS D CE  1 
ATOM   7496  N  NZ  . LYS D  1 156 ? -43.694  81.010  51.017  1.00 52.91 ? 148  LYS D NZ  1 
ATOM   7497  N  N   . VAL D  1 157 ? -41.080  73.616  50.118  1.00 27.48 ? 149  VAL D N   1 
ATOM   7498  C  CA  . VAL D  1 157 ? -40.169  72.488  50.142  1.00 26.09 ? 149  VAL D CA  1 
ATOM   7499  C  C   . VAL D  1 157 ? -38.780  73.012  49.778  1.00 25.44 ? 149  VAL D C   1 
ATOM   7500  O  O   . VAL D  1 157 ? -38.624  74.072  49.181  1.00 24.03 ? 149  VAL D O   1 
ATOM   7501  C  CB  . VAL D  1 157 ? -40.569  71.355  49.189  1.00 26.53 ? 149  VAL D CB  1 
ATOM   7502  C  CG1 . VAL D  1 157 ? -41.824  70.737  49.627  1.00 26.72 ? 149  VAL D CG1 1 
ATOM   7503  C  CG2 . VAL D  1 157 ? -40.785  71.889  47.812  1.00 28.95 ? 149  VAL D CG2 1 
ATOM   7504  N  N   . MET D  1 158 ? -37.767  72.283  50.237  1.00 24.50 ? 150  MET D N   1 
ATOM   7505  C  CA  . MET D  1 158 ? -36.392  72.706  50.147  1.00 24.14 ? 150  MET D CA  1 
ATOM   7506  C  C   . MET D  1 158 ? -35.454  71.553  50.474  1.00 22.30 ? 150  MET D C   1 
ATOM   7507  O  O   . MET D  1 158 ? -35.847  70.551  51.045  1.00 20.28 ? 150  MET D O   1 
ATOM   7508  C  CB  . MET D  1 158 ? -36.121  73.838  51.152  1.00 24.85 ? 150  MET D CB  1 
ATOM   7509  C  CG  . MET D  1 158 ? -36.423  73.459  52.607  1.00 27.85 ? 150  MET D CG  1 
ATOM   7510  S  SD  . MET D  1 158 ? -36.142  74.844  53.759  1.00 30.53 ? 150  MET D SD  1 
ATOM   7511  C  CE  . MET D  1 158 ? -37.648  75.750  53.382  1.00 33.48 ? 150  MET D CE  1 
ATOM   7512  N  N   . ASN D  1 159 ? -34.193  71.740  50.124  1.00 20.68 ? 151  ASN D N   1 
ATOM   7513  C  CA  . ASN D  1 159 ? -33.135  70.851  50.578  1.00 20.16 ? 151  ASN D CA  1 
ATOM   7514  C  C   . ASN D  1 159 ? -33.344  69.396  50.192  1.00 20.30 ? 151  ASN D C   1 
ATOM   7515  O  O   . ASN D  1 159 ? -32.758  68.525  50.823  1.00 20.68 ? 151  ASN D O   1 
ATOM   7516  C  CB  . ASN D  1 159 ? -32.946  70.904  52.095  1.00 18.59 ? 151  ASN D CB  1 
ATOM   7517  C  CG  . ASN D  1 159 ? -32.461  72.232  52.593  1.00 19.84 ? 151  ASN D CG  1 
ATOM   7518  O  OD1 . ASN D  1 159 ? -31.611  72.880  51.966  1.00 19.83 ? 151  ASN D OD1 1 
ATOM   7519  N  ND2 . ASN D  1 159 ? -32.999  72.663  53.746  1.00 16.87 ? 151  ASN D ND2 1 
ATOM   7520  N  N   . ILE D  1 160 ? -34.126  69.115  49.162  1.00 20.27 ? 152  ILE D N   1 
ATOM   7521  C  CA  . ILE D  1 160 ? -34.426  67.733  48.846  1.00 21.07 ? 152  ILE D CA  1 
ATOM   7522  C  C   . ILE D  1 160 ? -34.437  67.469  47.317  1.00 21.71 ? 152  ILE D C   1 
ATOM   7523  O  O   . ILE D  1 160 ? -35.041  68.215  46.516  1.00 21.22 ? 152  ILE D O   1 
ATOM   7524  C  CB  . ILE D  1 160 ? -35.770  67.301  49.534  1.00 21.57 ? 152  ILE D CB  1 
ATOM   7525  C  CG1 . ILE D  1 160 ? -36.085  65.813  49.257  1.00 24.35 ? 152  ILE D CG1 1 
ATOM   7526  C  CG2 . ILE D  1 160 ? -36.942  68.143  49.073  1.00 19.01 ? 152  ILE D CG2 1 
ATOM   7527  C  CD1 . ILE D  1 160 ? -35.585  64.868  50.237  1.00 22.77 ? 152  ILE D CD1 1 
ATOM   7528  N  N   . ASP D  1 161 ? -33.749  66.413  46.935  1.00 21.69 ? 153  ASP D N   1 
ATOM   7529  C  CA  . ASP D  1 161 ? -33.677  65.972  45.553  1.00 22.98 ? 153  ASP D CA  1 
ATOM   7530  C  C   . ASP D  1 161 ? -35.093  65.597  45.150  1.00 23.63 ? 153  ASP D C   1 
ATOM   7531  O  O   . ASP D  1 161 ? -35.758  64.831  45.860  1.00 22.35 ? 153  ASP D O   1 
ATOM   7532  C  CB  . ASP D  1 161 ? -32.766  64.739  45.489  1.00 23.38 ? 153  ASP D CB  1 
ATOM   7533  C  CG  . ASP D  1 161 ? -32.609  64.180  44.093  1.00 24.72 ? 153  ASP D CG  1 
ATOM   7534  O  OD1 . ASP D  1 161 ? -33.549  63.512  43.613  1.00 29.37 ? 153  ASP D OD1 1 
ATOM   7535  O  OD2 . ASP D  1 161 ? -31.522  64.334  43.517  1.00 24.39 ? 153  ASP D OD2 1 
ATOM   7536  N  N   . PRO D  1 162 ? -35.564  66.153  44.036  1.00 25.03 ? 154  PRO D N   1 
ATOM   7537  C  CA  . PRO D  1 162 ? -36.949  65.915  43.624  1.00 25.97 ? 154  PRO D CA  1 
ATOM   7538  C  C   . PRO D  1 162 ? -37.271  64.448  43.376  1.00 27.37 ? 154  PRO D C   1 
ATOM   7539  O  O   . PRO D  1 162 ? -38.385  64.033  43.677  1.00 28.07 ? 154  PRO D O   1 
ATOM   7540  C  CB  . PRO D  1 162 ? -37.100  66.756  42.359  1.00 25.94 ? 154  PRO D CB  1 
ATOM   7541  C  CG  . PRO D  1 162 ? -36.042  67.833  42.482  1.00 26.73 ? 154  PRO D CG  1 
ATOM   7542  C  CD  . PRO D  1 162 ? -34.902  67.193  43.212  1.00 25.87 ? 154  PRO D CD  1 
ATOM   7543  N  N   . ASP D  1 163 ? -36.324  63.643  42.897  1.00 28.07 ? 155  ASP D N   1 
ATOM   7544  C  CA  . ASP D  1 163 ? -36.639  62.242  42.748  1.00 29.44 ? 155  ASP D CA  1 
ATOM   7545  C  C   . ASP D  1 163 ? -36.772  61.546  44.089  1.00 29.40 ? 155  ASP D C   1 
ATOM   7546  O  O   . ASP D  1 163 ? -37.640  60.697  44.224  1.00 29.93 ? 155  ASP D O   1 
ATOM   7547  C  CB  . ASP D  1 163 ? -35.633  61.492  41.860  1.00 30.48 ? 155  ASP D CB  1 
ATOM   7548  C  CG  . ASP D  1 163 ? -35.647  61.989  40.393  1.00 34.29 ? 155  ASP D CG  1 
ATOM   7549  O  OD1 . ASP D  1 163 ? -36.649  62.605  39.900  1.00 37.32 ? 155  ASP D OD1 1 
ATOM   7550  O  OD2 . ASP D  1 163 ? -34.597  61.802  39.743  1.00 40.37 ? 155  ASP D OD2 1 
ATOM   7551  N  N   . LEU D  1 164 ? -35.919  61.872  45.072  1.00 28.37 ? 156  LEU D N   1 
ATOM   7552  C  CA  . LEU D  1 164 ? -36.048  61.255  46.396  1.00 27.55 ? 156  LEU D CA  1 
ATOM   7553  C  C   . LEU D  1 164 ? -37.358  61.692  47.052  1.00 27.52 ? 156  LEU D C   1 
ATOM   7554  O  O   . LEU D  1 164 ? -38.023  60.900  47.728  1.00 27.32 ? 156  LEU D O   1 
ATOM   7555  C  CB  . LEU D  1 164 ? -34.902  61.652  47.320  1.00 27.33 ? 156  LEU D CB  1 
ATOM   7556  C  CG  . LEU D  1 164 ? -35.006  61.231  48.769  1.00 26.48 ? 156  LEU D CG  1 
ATOM   7557  C  CD1 . LEU D  1 164 ? -35.035  59.685  48.782  1.00 24.06 ? 156  LEU D CD1 1 
ATOM   7558  C  CD2 . LEU D  1 164 ? -33.846  61.791  49.598  1.00 25.89 ? 156  LEU D CD2 1 
ATOM   7559  N  N   . PHE D  1 165 ? -37.702  62.961  46.876  1.00 28.00 ? 157  PHE D N   1 
ATOM   7560  C  CA  . PHE D  1 165 ? -38.938  63.523  47.418  1.00 28.33 ? 157  PHE D CA  1 
ATOM   7561  C  C   . PHE D  1 165 ? -40.148  62.649  47.033  1.00 29.93 ? 157  PHE D C   1 
ATOM   7562  O  O   . PHE D  1 165 ? -40.944  62.320  47.882  1.00 29.08 ? 157  PHE D O   1 
ATOM   7563  C  CB  . PHE D  1 165 ? -39.116  64.932  46.925  1.00 27.72 ? 157  PHE D CB  1 
ATOM   7564  C  CG  . PHE D  1 165 ? -40.317  65.606  47.471  1.00 28.36 ? 157  PHE D CG  1 
ATOM   7565  C  CD1 . PHE D  1 165 ? -40.363  65.984  48.799  1.00 28.29 ? 157  PHE D CD1 1 
ATOM   7566  C  CD2 . PHE D  1 165 ? -41.409  65.876  46.660  1.00 30.20 ? 157  PHE D CD2 1 
ATOM   7567  C  CE1 . PHE D  1 165 ? -41.483  66.641  49.350  1.00 28.66 ? 157  PHE D CE1 1 
ATOM   7568  C  CE2 . PHE D  1 165 ? -42.547  66.487  47.197  1.00 33.03 ? 157  PHE D CE2 1 
ATOM   7569  C  CZ  . PHE D  1 165 ? -42.569  66.888  48.562  1.00 31.17 ? 157  PHE D CZ  1 
ATOM   7570  N  N   . GLU D  1 166 ? -40.209  62.199  45.779  1.00 31.60 ? 158  GLU D N   1 
ATOM   7571  C  CA  . GLU D  1 166 ? -41.318  61.376  45.315  1.00 33.74 ? 158  GLU D CA  1 
ATOM   7572  C  C   . GLU D  1 166 ? -41.357  59.980  45.957  1.00 34.16 ? 158  GLU D C   1 
ATOM   7573  O  O   . GLU D  1 166 ? -42.329  59.255  45.825  1.00 34.48 ? 158  GLU D O   1 
ATOM   7574  C  CB  . GLU D  1 166 ? -41.258  61.197  43.787  1.00 34.92 ? 158  GLU D CB  1 
ATOM   7575  C  CG  . GLU D  1 166 ? -41.720  62.421  42.993  1.00 38.68 ? 158  GLU D CG  1 
ATOM   7576  C  CD  . GLU D  1 166 ? -41.292  62.401  41.507  1.00 44.60 ? 158  GLU D CD  1 
ATOM   7577  O  OE1 . GLU D  1 166 ? -40.792  61.348  40.995  1.00 47.20 ? 158  GLU D OE1 1 
ATOM   7578  O  OE2 . GLU D  1 166 ? -41.439  63.480  40.867  1.00 47.85 ? 158  GLU D OE2 1 
ATOM   7579  N  N   . LYS D  1 167 ? -40.300  59.583  46.640  1.00 34.45 ? 159  LYS D N   1 
ATOM   7580  C  CA  . LYS D  1 167 ? -40.232  58.254  47.176  1.00 34.69 ? 159  LYS D CA  1 
ATOM   7581  C  C   . LYS D  1 167 ? -40.506  58.224  48.664  1.00 34.13 ? 159  LYS D C   1 
ATOM   7582  O  O   . LYS D  1 167 ? -40.444  57.165  49.267  1.00 34.82 ? 159  LYS D O   1 
ATOM   7583  C  CB  . LYS D  1 167 ? -38.837  57.687  46.949  1.00 35.39 ? 159  LYS D CB  1 
ATOM   7584  C  CG  . LYS D  1 167 ? -38.437  57.480  45.532  1.00 38.20 ? 159  LYS D CG  1 
ATOM   7585  C  CD  . LYS D  1 167 ? -37.046  56.789  45.541  1.00 42.19 ? 159  LYS D CD  1 
ATOM   7586  C  CE  . LYS D  1 167 ? -36.404  56.739  44.156  1.00 45.47 ? 159  LYS D CE  1 
ATOM   7587  N  NZ  . LYS D  1 167 ? -34.982  56.229  44.279  1.00 50.46 ? 159  LYS D NZ  1 
ATOM   7588  N  N   . LEU D  1 168 ? -40.793  59.355  49.280  1.00 33.78 ? 160  LEU D N   1 
ATOM   7589  C  CA  . LEU D  1 168 ? -40.866  59.383  50.730  1.00 33.83 ? 160  LEU D CA  1 
ATOM   7590  C  C   . LEU D  1 168 ? -42.182  58.858  51.284  1.00 34.58 ? 160  LEU D C   1 
ATOM   7591  O  O   . LEU D  1 168 ? -42.342  58.795  52.506  1.00 35.17 ? 160  LEU D O   1 
ATOM   7592  C  CB  . LEU D  1 168 ? -40.675  60.808  51.253  1.00 33.13 ? 160  LEU D CB  1 
ATOM   7593  C  CG  . LEU D  1 168 ? -39.284  61.401  51.040  1.00 33.67 ? 160  LEU D CG  1 
ATOM   7594  C  CD1 . LEU D  1 168 ? -39.234  62.840  51.655  1.00 31.18 ? 160  LEU D CD1 1 
ATOM   7595  C  CD2 . LEU D  1 168 ? -38.212  60.459  51.591  1.00 30.18 ? 160  LEU D CD2 1 
ATOM   7596  N  N   . GLY D  1 169 ? -43.147  58.542  50.432  1.00 34.05 ? 161  GLY D N   1 
ATOM   7597  C  CA  . GLY D  1 169 ? -44.439  58.107  50.946  1.00 33.99 ? 161  GLY D CA  1 
ATOM   7598  C  C   . GLY D  1 169 ? -45.366  59.252  51.360  1.00 33.87 ? 161  GLY D C   1 
ATOM   7599  O  O   . GLY D  1 169 ? -46.311  59.053  52.077  1.00 32.75 ? 161  GLY D O   1 
ATOM   7600  N  N   . ILE D  1 170 ? -45.086  60.454  50.904  1.00 34.35 ? 162  ILE D N   1 
ATOM   7601  C  CA  . ILE D  1 170 ? -45.943  61.566  51.155  1.00 35.17 ? 162  ILE D CA  1 
ATOM   7602  C  C   . ILE D  1 170 ? -47.171  61.368  50.246  1.00 37.37 ? 162  ILE D C   1 
ATOM   7603  O  O   . ILE D  1 170 ? -47.022  61.077  49.049  1.00 37.36 ? 162  ILE D O   1 
ATOM   7604  C  CB  . ILE D  1 170 ? -45.181  62.857  50.852  1.00 34.86 ? 162  ILE D CB  1 
ATOM   7605  C  CG1 . ILE D  1 170 ? -44.045  63.004  51.861  1.00 33.95 ? 162  ILE D CG1 1 
ATOM   7606  C  CG2 . ILE D  1 170 ? -46.074  64.061  50.863  1.00 33.59 ? 162  ILE D CG2 1 
ATOM   7607  C  CD1 . ILE D  1 170 ? -43.134  64.130  51.531  1.00 32.45 ? 162  ILE D CD1 1 
ATOM   7608  N  N   . GLN D  1 171 ? -48.368  61.481  50.830  1.00 38.82 ? 163  GLN D N   1 
ATOM   7609  C  CA  . GLN D  1 171 ? -49.636  61.410  50.097  1.00 40.56 ? 163  GLN D CA  1 
ATOM   7610  C  C   . GLN D  1 171 ? -50.457  62.683  50.232  1.00 39.73 ? 163  GLN D C   1 
ATOM   7611  O  O   . GLN D  1 171 ? -50.748  63.149  51.334  1.00 37.36 ? 163  GLN D O   1 
ATOM   7612  C  CB  . GLN D  1 171 ? -50.509  60.291  50.619  1.00 41.84 ? 163  GLN D CB  1 
ATOM   7613  C  CG  . GLN D  1 171 ? -49.996  58.873  50.369  1.00 48.37 ? 163  GLN D CG  1 
ATOM   7614  C  CD  . GLN D  1 171 ? -50.982  57.807  50.942  1.00 56.50 ? 163  GLN D CD  1 
ATOM   7615  O  OE1 . GLN D  1 171 ? -52.155  58.130  51.323  1.00 60.60 ? 163  GLN D OE1 1 
ATOM   7616  N  NE2 . GLN D  1 171 ? -50.518  56.546  51.010  1.00 58.83 ? 163  GLN D NE2 1 
ATOM   7617  N  N   . GLU D  1 172 ? -50.856  63.201  49.087  1.00 40.06 ? 164  GLU D N   1 
ATOM   7618  C  CA  . GLU D  1 172 ? -51.786  64.291  49.008  1.00 40.96 ? 164  GLU D CA  1 
ATOM   7619  C  C   . GLU D  1 172 ? -53.159  63.639  48.965  1.00 40.84 ? 164  GLU D C   1 
ATOM   7620  O  O   . GLU D  1 172 ? -53.405  62.709  48.227  1.00 40.34 ? 164  GLU D O   1 
ATOM   7621  C  CB  . GLU D  1 172 ? -51.479  65.134  47.791  1.00 41.25 ? 164  GLU D CB  1 
ATOM   7622  C  CG  . GLU D  1 172 ? -52.465  66.237  47.454  1.00 45.52 ? 164  GLU D CG  1 
ATOM   7623  C  CD  . GLU D  1 172 ? -52.197  66.857  46.070  1.00 48.99 ? 164  GLU D CD  1 
ATOM   7624  O  OE1 . GLU D  1 172 ? -52.552  66.257  45.012  1.00 53.68 ? 164  GLU D OE1 1 
ATOM   7625  O  OE2 . GLU D  1 172 ? -51.600  67.951  46.049  1.00 51.69 ? 164  GLU D OE2 1 
ATOM   7626  N  N   . LYS D  1 173 ? -54.045  64.108  49.806  1.00 41.44 ? 165  LYS D N   1 
ATOM   7627  C  CA  . LYS D  1 173 ? -55.369  63.534  49.909  1.00 42.77 ? 165  LYS D CA  1 
ATOM   7628  C  C   . LYS D  1 173 ? -56.338  64.596  50.440  1.00 41.37 ? 165  LYS D C   1 
ATOM   7629  O  O   . LYS D  1 173 ? -56.061  65.223  51.441  1.00 40.80 ? 165  LYS D O   1 
ATOM   7630  C  CB  . LYS D  1 173 ? -55.325  62.295  50.784  1.00 43.58 ? 165  LYS D CB  1 
ATOM   7631  C  CG  . LYS D  1 173 ? -56.594  61.484  50.755  1.00 49.18 ? 165  LYS D CG  1 
ATOM   7632  C  CD  . LYS D  1 173 ? -56.362  59.969  51.027  1.00 55.55 ? 165  LYS D CD  1 
ATOM   7633  C  CE  . LYS D  1 173 ? -56.568  59.574  52.501  1.00 58.83 ? 165  LYS D CE  1 
ATOM   7634  N  NZ  . LYS D  1 173 ? -57.883  60.016  53.067  1.00 60.32 ? 165  LYS D NZ  1 
ATOM   7635  N  N   . ASN D  1 174 ? -57.423  64.846  49.707  1.00 40.50 ? 166  ASN D N   1 
ATOM   7636  C  CA  . ASN D  1 174 ? -58.375  65.937  50.006  1.00 40.70 ? 166  ASN D CA  1 
ATOM   7637  C  C   . ASN D  1 174 ? -57.756  67.320  50.262  1.00 39.80 ? 166  ASN D C   1 
ATOM   7638  O  O   . ASN D  1 174 ? -58.122  68.024  51.188  1.00 39.67 ? 166  ASN D O   1 
ATOM   7639  C  CB  . ASN D  1 174 ? -59.329  65.489  51.125  1.00 40.47 ? 166  ASN D CB  1 
ATOM   7640  C  CG  . ASN D  1 174 ? -60.158  64.265  50.697  1.00 40.35 ? 166  ASN D CG  1 
ATOM   7641  O  OD1 . ASN D  1 174 ? -60.781  64.276  49.634  1.00 36.00 ? 166  ASN D OD1 1 
ATOM   7642  N  ND2 . ASN D  1 174 ? -60.123  63.204  51.485  1.00 37.27 ? 166  ASN D ND2 1 
ATOM   7643  N  N   . GLY D  1 175 ? -56.802  67.675  49.414  1.00 39.26 ? 167  GLY D N   1 
ATOM   7644  C  CA  . GLY D  1 175 ? -56.059  68.913  49.539  1.00 39.42 ? 167  GLY D CA  1 
ATOM   7645  C  C   . GLY D  1 175 ? -55.022  68.995  50.674  1.00 39.27 ? 167  GLY D C   1 
ATOM   7646  O  O   . GLY D  1 175 ? -54.398  70.040  50.851  1.00 39.15 ? 167  GLY D O   1 
ATOM   7647  N  N   . LYS D  1 176 ? -54.850  67.920  51.447  1.00 37.82 ? 168  LYS D N   1 
ATOM   7648  C  CA  . LYS D  1 176 ? -53.877  67.895  52.535  1.00 37.53 ? 168  LYS D CA  1 
ATOM   7649  C  C   . LYS D  1 176 ? -52.682  66.981  52.278  1.00 34.92 ? 168  LYS D C   1 
ATOM   7650  O  O   . LYS D  1 176 ? -52.789  65.986  51.595  1.00 34.30 ? 168  LYS D O   1 
ATOM   7651  C  CB  . LYS D  1 176 ? -54.596  67.519  53.806  1.00 38.35 ? 168  LYS D CB  1 
ATOM   7652  C  CG  . LYS D  1 176 ? -55.439  68.712  54.253  1.00 43.89 ? 168  LYS D CG  1 
ATOM   7653  C  CD  . LYS D  1 176 ? -56.596  68.341  55.155  1.00 50.33 ? 168  LYS D CD  1 
ATOM   7654  C  CE  . LYS D  1 176 ? -57.556  69.545  55.318  1.00 53.08 ? 168  LYS D CE  1 
ATOM   7655  N  NZ  . LYS D  1 176 ? -57.171  70.437  56.439  1.00 55.71 ? 168  LYS D NZ  1 
ATOM   7656  N  N   . ILE D  1 177 ? -51.525  67.352  52.807  1.00 32.72 ? 169  ILE D N   1 
ATOM   7657  C  CA  . ILE D  1 177 ? -50.292  66.596  52.606  1.00 30.37 ? 169  ILE D CA  1 
ATOM   7658  C  C   . ILE D  1 177 ? -50.002  65.775  53.843  1.00 28.94 ? 169  ILE D C   1 
ATOM   7659  O  O   . ILE D  1 177 ? -49.702  66.305  54.896  1.00 28.82 ? 169  ILE D O   1 
ATOM   7660  C  CB  . ILE D  1 177 ? -49.131  67.554  52.283  1.00 30.82 ? 169  ILE D CB  1 
ATOM   7661  C  CG1 . ILE D  1 177 ? -49.491  68.419  51.071  1.00 30.06 ? 169  ILE D CG1 1 
ATOM   7662  C  CG2 . ILE D  1 177 ? -47.799  66.810  52.065  1.00 27.38 ? 169  ILE D CG2 1 
ATOM   7663  C  CD1 . ILE D  1 177 ? -48.415  69.447  50.803  1.00 32.00 ? 169  ILE D CD1 1 
ATOM   7664  N  N   . HIS D  1 178 ? -50.096  64.469  53.707  1.00 27.79 ? 170  HIS D N   1 
ATOM   7665  C  CA  . HIS D  1 178 ? -49.858  63.533  54.791  1.00 27.63 ? 170  HIS D CA  1 
ATOM   7666  C  C   . HIS D  1 178 ? -48.375  63.138  54.721  1.00 26.67 ? 170  HIS D C   1 
ATOM   7667  O  O   . HIS D  1 178 ? -47.898  62.729  53.677  1.00 26.57 ? 170  HIS D O   1 
ATOM   7668  C  CB  . HIS D  1 178 ? -50.765  62.272  54.651  1.00 27.56 ? 170  HIS D CB  1 
ATOM   7669  C  CG  . HIS D  1 178 ? -52.233  62.540  54.878  1.00 31.06 ? 170  HIS D CG  1 
ATOM   7670  N  ND1 . HIS D  1 178 ? -52.875  62.253  56.066  1.00 31.15 ? 170  HIS D ND1 1 
ATOM   7671  C  CD2 . HIS D  1 178 ? -53.185  63.070  54.062  1.00 30.91 ? 170  HIS D CD2 1 
ATOM   7672  C  CE1 . HIS D  1 178 ? -54.143  62.600  55.978  1.00 30.92 ? 170  HIS D CE1 1 
ATOM   7673  N  NE2 . HIS D  1 178 ? -54.359  63.090  54.775  1.00 33.38 ? 170  HIS D NE2 1 
ATOM   7674  N  N   . VAL D  1 179 ? -47.646  63.265  55.818  1.00 25.50 ? 171  VAL D N   1 
ATOM   7675  C  CA  . VAL D  1 179 ? -46.223  62.944  55.822  1.00 24.46 ? 171  VAL D CA  1 
ATOM   7676  C  C   . VAL D  1 179 ? -45.859  61.918  56.905  1.00 24.12 ? 171  VAL D C   1 
ATOM   7677  O  O   . VAL D  1 179 ? -46.010  62.165  58.089  1.00 23.88 ? 171  VAL D O   1 
ATOM   7678  C  CB  . VAL D  1 179 ? -45.402  64.189  56.043  1.00 24.44 ? 171  VAL D CB  1 
ATOM   7679  C  CG1 . VAL D  1 179 ? -43.875  63.858  55.903  1.00 21.62 ? 171  VAL D CG1 1 
ATOM   7680  C  CG2 . VAL D  1 179 ? -45.872  65.309  55.050  1.00 24.39 ? 171  VAL D CG2 1 
ATOM   7681  N  N   . PRO D  1 180 ? -45.346  60.769  56.504  1.00 23.51 ? 172  PRO D N   1 
ATOM   7682  C  CA  . PRO D  1 180 ? -44.874  59.788  57.493  1.00 23.67 ? 172  PRO D CA  1 
ATOM   7683  C  C   . PRO D  1 180 ? -43.648  60.294  58.239  1.00 22.90 ? 172  PRO D C   1 
ATOM   7684  O  O   . PRO D  1 180 ? -42.687  60.745  57.612  1.00 21.03 ? 172  PRO D O   1 
ATOM   7685  C  CB  . PRO D  1 180 ? -44.507  58.550  56.657  1.00 24.15 ? 172  PRO D CB  1 
ATOM   7686  C  CG  . PRO D  1 180 ? -44.983  58.829  55.276  1.00 24.55 ? 172  PRO D CG  1 
ATOM   7687  C  CD  . PRO D  1 180 ? -45.094  60.346  55.134  1.00 23.62 ? 172  PRO D CD  1 
ATOM   7688  N  N   . VAL D  1 181 ? -43.719  60.280  59.569  1.00 22.45 ? 173  VAL D N   1 
ATOM   7689  C  CA  . VAL D  1 181 ? -42.593  60.684  60.382  1.00 21.85 ? 173  VAL D CA  1 
ATOM   7690  C  C   . VAL D  1 181 ? -42.416  59.683  61.542  1.00 22.91 ? 173  VAL D C   1 
ATOM   7691  O  O   . VAL D  1 181 ? -43.341  58.948  61.852  1.00 21.52 ? 173  VAL D O   1 
ATOM   7692  C  CB  . VAL D  1 181 ? -42.791  62.114  60.911  1.00 22.33 ? 173  VAL D CB  1 
ATOM   7693  C  CG1 . VAL D  1 181 ? -42.946  63.099  59.730  1.00 19.68 ? 173  VAL D CG1 1 
ATOM   7694  C  CG2 . VAL D  1 181 ? -43.967  62.171  61.882  1.00 18.32 ? 173  VAL D CG2 1 
ATOM   7695  N  N   . VAL D  1 182 ? -41.229  59.640  62.151  1.00 22.83 ? 174  VAL D N   1 
ATOM   7696  C  CA  . VAL D  1 182 ? -41.039  58.767  63.287  1.00 24.54 ? 174  VAL D CA  1 
ATOM   7697  C  C   . VAL D  1 182 ? -41.315  59.423  64.616  1.00 24.99 ? 174  VAL D C   1 
ATOM   7698  O  O   . VAL D  1 182 ? -41.491  58.730  65.590  1.00 27.96 ? 174  VAL D O   1 
ATOM   7699  C  CB  . VAL D  1 182 ? -39.644  58.133  63.353  1.00 24.10 ? 174  VAL D CB  1 
ATOM   7700  C  CG1 . VAL D  1 182 ? -39.382  57.371  62.112  1.00 25.61 ? 174  VAL D CG1 1 
ATOM   7701  C  CG2 . VAL D  1 182 ? -38.619  59.201  63.546  1.00 24.28 ? 174  VAL D CG2 1 
ATOM   7702  N  N   . ALA D  1 183 ? -41.322  60.742  64.673  1.00 25.05 ? 175  ALA D N   1 
ATOM   7703  C  CA  . ALA D  1 183 ? -41.477  61.485  65.922  1.00 24.54 ? 175  ALA D CA  1 
ATOM   7704  C  C   . ALA D  1 183 ? -41.985  62.874  65.549  1.00 24.88 ? 175  ALA D C   1 
ATOM   7705  O  O   . ALA D  1 183 ? -41.743  63.367  64.448  1.00 24.29 ? 175  ALA D O   1 
ATOM   7706  C  CB  . ALA D  1 183 ? -40.134  61.587  66.713  1.00 23.35 ? 175  ALA D CB  1 
ATOM   7707  N  N   . LYS D  1 184 ? -42.703  63.476  66.479  1.00 25.79 ? 176  LYS D N   1 
ATOM   7708  C  CA  . LYS D  1 184 ? -43.175  64.825  66.376  1.00 26.91 ? 176  LYS D CA  1 
ATOM   7709  C  C   . LYS D  1 184 ? -42.489  65.573  67.494  1.00 26.89 ? 176  LYS D C   1 
ATOM   7710  O  O   . LYS D  1 184 ? -42.698  65.237  68.627  1.00 26.85 ? 176  LYS D O   1 
ATOM   7711  C  CB  . LYS D  1 184 ? -44.659  64.841  66.578  1.00 27.41 ? 176  LYS D CB  1 
ATOM   7712  C  CG  . LYS D  1 184 ? -45.432  64.135  65.456  1.00 29.92 ? 176  LYS D CG  1 
ATOM   7713  C  CD  . LYS D  1 184 ? -46.977  64.200  65.695  1.00 32.42 ? 176  LYS D CD  1 
ATOM   7714  C  CE  . LYS D  1 184 ? -47.642  63.106  64.864  1.00 35.55 ? 176  LYS D CE  1 
ATOM   7715  N  NZ  . LYS D  1 184 ? -49.126  63.169  64.630  1.00 37.29 ? 176  LYS D NZ  1 
ATOM   7716  N  N   . ILE D  1 185 ? -41.632  66.539  67.156  1.00 26.95 ? 177  ILE D N   1 
ATOM   7717  C  CA  . ILE D  1 185 ? -40.729  67.193  68.105  1.00 26.70 ? 177  ILE D CA  1 
ATOM   7718  C  C   . ILE D  1 185 ? -41.267  68.571  68.487  1.00 27.08 ? 177  ILE D C   1 
ATOM   7719  O  O   . ILE D  1 185 ? -41.470  69.420  67.621  1.00 27.71 ? 177  ILE D O   1 
ATOM   7720  C  CB  . ILE D  1 185 ? -39.320  67.344  67.497  1.00 27.05 ? 177  ILE D CB  1 
ATOM   7721  C  CG1 . ILE D  1 185 ? -38.767  65.936  67.201  1.00 27.75 ? 177  ILE D CG1 1 
ATOM   7722  C  CG2 . ILE D  1 185 ? -38.412  68.125  68.453  1.00 25.33 ? 177  ILE D CG2 1 
ATOM   7723  C  CD1 . ILE D  1 185 ? -37.614  65.910  66.333  1.00 27.13 ? 177  ILE D CD1 1 
ATOM   7724  N  N   . PRO D  1 186 ? -41.520  68.803  69.778  1.00 27.28 ? 178  PRO D N   1 
ATOM   7725  C  CA  . PRO D  1 186 ? -42.020  70.143  70.165  1.00 26.91 ? 178  PRO D CA  1 
ATOM   7726  C  C   . PRO D  1 186 ? -40.980  71.256  69.930  1.00 26.58 ? 178  PRO D C   1 
ATOM   7727  O  O   . PRO D  1 186 ? -39.760  71.005  69.946  1.00 25.61 ? 178  PRO D O   1 
ATOM   7728  C  CB  . PRO D  1 186 ? -42.327  70.012  71.675  1.00 27.12 ? 178  PRO D CB  1 
ATOM   7729  C  CG  . PRO D  1 186 ? -42.222  68.568  72.012  1.00 28.36 ? 178  PRO D CG  1 
ATOM   7730  C  CD  . PRO D  1 186 ? -41.371  67.891  70.932  1.00 27.38 ? 178  PRO D CD  1 
ATOM   7731  N  N   . ALA D  1 187 ? -41.488  72.469  69.715  1.00 26.00 ? 179  ALA D N   1 
ATOM   7732  C  CA  . ALA D  1 187 ? -40.675  73.642  69.441  1.00 26.18 ? 179  ALA D CA  1 
ATOM   7733  C  C   . ALA D  1 187 ? -39.538  73.763  70.460  1.00 26.43 ? 179  ALA D C   1 
ATOM   7734  O  O   . ALA D  1 187 ? -38.393  73.938  70.099  1.00 26.02 ? 179  ALA D O   1 
ATOM   7735  C  CB  . ALA D  1 187 ? -41.535  74.888  69.441  1.00 24.98 ? 179  ALA D CB  1 
ATOM   7736  N  N   . HIS D  1 188 ? -39.864  73.578  71.725  1.00 26.47 ? 180  HIS D N   1 
ATOM   7737  C  CA  . HIS D  1 188 ? -38.898  73.782  72.793  1.00 27.82 ? 180  HIS D CA  1 
ATOM   7738  C  C   . HIS D  1 188 ? -37.754  72.761  72.849  1.00 28.22 ? 180  HIS D C   1 
ATOM   7739  O  O   . HIS D  1 188 ? -36.800  73.001  73.598  1.00 28.40 ? 180  HIS D O   1 
ATOM   7740  C  CB  . HIS D  1 188 ? -39.600  73.852  74.190  1.00 27.98 ? 180  HIS D CB  1 
ATOM   7741  C  CG  . HIS D  1 188 ? -40.183  72.554  74.646  1.00 28.55 ? 180  HIS D CG  1 
ATOM   7742  N  ND1 . HIS D  1 188 ? -41.529  72.267  74.545  1.00 30.58 ? 180  HIS D ND1 1 
ATOM   7743  C  CD2 . HIS D  1 188 ? -39.601  71.445  75.165  1.00 30.62 ? 180  HIS D CD2 1 
ATOM   7744  C  CE1 . HIS D  1 188 ? -41.753  71.054  75.028  1.00 29.24 ? 180  HIS D CE1 1 
ATOM   7745  N  NE2 . HIS D  1 188 ? -40.604  70.540  75.423  1.00 28.56 ? 180  HIS D NE2 1 
ATOM   7746  N  N   . MET D  1 189 ? -37.859  71.630  72.142  1.00 27.80 ? 181  MET D N   1 
ATOM   7747  C  CA  . MET D  1 189 ? -36.749  70.722  72.041  1.00 28.23 ? 181  MET D CA  1 
ATOM   7748  C  C   . MET D  1 189 ? -35.783  71.073  70.937  1.00 28.30 ? 181  MET D C   1 
ATOM   7749  O  O   . MET D  1 189 ? -34.813  70.324  70.710  1.00 27.95 ? 181  MET D O   1 
ATOM   7750  C  CB  . MET D  1 189 ? -37.220  69.309  71.808  1.00 28.97 ? 181  MET D CB  1 
ATOM   7751  C  CG  . MET D  1 189 ? -37.904  68.657  73.026  1.00 32.41 ? 181  MET D CG  1 
ATOM   7752  S  SD  . MET D  1 189 ? -36.867  68.560  74.485  1.00 39.93 ? 181  MET D SD  1 
ATOM   7753  C  CE  . MET D  1 189 ? -35.527  67.519  73.975  1.00 37.97 ? 181  MET D CE  1 
ATOM   7754  N  N   . MET D  1 190 ? -36.019  72.182  70.226  1.00 28.20 ? 182  MET D N   1 
ATOM   7755  C  CA  . MET D  1 190 ? -35.068  72.570  69.169  1.00 27.74 ? 182  MET D CA  1 
ATOM   7756  C  C   . MET D  1 190 ? -34.096  73.603  69.716  1.00 27.99 ? 182  MET D C   1 
ATOM   7757  O  O   . MET D  1 190 ? -34.476  74.445  70.514  1.00 28.51 ? 182  MET D O   1 
ATOM   7758  C  CB  . MET D  1 190 ? -35.789  73.130  67.951  1.00 27.55 ? 182  MET D CB  1 
ATOM   7759  C  CG  . MET D  1 190 ? -36.691  72.180  67.264  1.00 25.78 ? 182  MET D CG  1 
ATOM   7760  S  SD  . MET D  1 190 ? -35.935  70.633  66.783  1.00 25.35 ? 182  MET D SD  1 
ATOM   7761  C  CE  . MET D  1 190 ? -34.710  71.136  65.571  1.00 19.74 ? 182  MET D CE  1 
ATOM   7762  N  N   . GLY D  1 191 ? -32.853  73.559  69.258  1.00 28.14 ? 183  GLY D N   1 
ATOM   7763  C  CA  . GLY D  1 191 ? -31.810  74.451  69.781  1.00 28.42 ? 183  GLY D CA  1 
ATOM   7764  C  C   . GLY D  1 191 ? -30.808  74.997  68.775  1.00 28.88 ? 183  GLY D C   1 
ATOM   7765  O  O   . GLY D  1 191 ? -31.140  75.826  67.917  1.00 29.60 ? 183  GLY D O   1 
ATOM   7766  N  N   . SER D  1 192 ? -29.569  74.533  68.878  1.00 29.32 ? 184  SER D N   1 
ATOM   7767  C  CA  . SER D  1 192 ? -28.470  75.130  68.127  1.00 29.11 ? 184  SER D CA  1 
ATOM   7768  C  C   . SER D  1 192 ? -28.761  75.213  66.623  1.00 28.44 ? 184  SER D C   1 
ATOM   7769  O  O   . SER D  1 192 ? -29.023  74.206  65.950  1.00 28.77 ? 184  SER D O   1 
ATOM   7770  C  CB  . SER D  1 192 ? -27.151  74.384  68.357  1.00 29.62 ? 184  SER D CB  1 
ATOM   7771  O  OG  . SER D  1 192 ? -26.092  75.058  67.627  1.00 31.10 ? 184  SER D OG  1 
ATOM   7772  N  N   . GLY D  1 193 ? -28.676  76.435  66.115  1.00 27.97 ? 185  GLY D N   1 
ATOM   7773  C  CA  . GLY D  1 193 ? -28.972  76.752  64.729  1.00 27.56 ? 185  GLY D CA  1 
ATOM   7774  C  C   . GLY D  1 193 ? -30.225  77.592  64.520  1.00 27.38 ? 185  GLY D C   1 
ATOM   7775  O  O   . GLY D  1 193 ? -30.439  78.112  63.423  1.00 28.49 ? 185  GLY D O   1 
ATOM   7776  N  N   . ILE D  1 194 ? -31.100  77.656  65.515  1.00 27.38 ? 186  ILE D N   1 
ATOM   7777  C  CA  . ILE D  1 194 ? -32.231  78.548  65.424  1.00 27.27 ? 186  ILE D CA  1 
ATOM   7778  C  C   . ILE D  1 194 ? -31.624  79.893  65.133  1.00 27.57 ? 186  ILE D C   1 
ATOM   7779  O  O   . ILE D  1 194 ? -30.628  80.286  65.760  1.00 27.72 ? 186  ILE D O   1 
ATOM   7780  C  CB  . ILE D  1 194 ? -33.033  78.643  66.767  1.00 28.36 ? 186  ILE D CB  1 
ATOM   7781  C  CG1 . ILE D  1 194 ? -33.775  77.355  67.049  1.00 28.43 ? 186  ILE D CG1 1 
ATOM   7782  C  CG2 . ILE D  1 194 ? -34.083  79.779  66.737  1.00 25.99 ? 186  ILE D CG2 1 
ATOM   7783  C  CD1 . ILE D  1 194 ? -34.522  77.436  68.331  1.00 28.85 ? 186  ILE D CD1 1 
ATOM   7784  N  N   . GLY D  1 195 ? -32.214  80.611  64.184  1.00 27.99 ? 187  GLY D N   1 
ATOM   7785  C  CA  . GLY D  1 195 ? -31.734  81.944  63.819  1.00 27.79 ? 187  GLY D CA  1 
ATOM   7786  C  C   . GLY D  1 195 ? -30.747  81.987  62.662  1.00 27.57 ? 187  GLY D C   1 
ATOM   7787  O  O   . GLY D  1 195 ? -30.370  83.087  62.210  1.00 28.48 ? 187  GLY D O   1 
ATOM   7788  N  N   . ALA D  1 196 ? -30.287  80.834  62.181  1.00 26.82 ? 188  ALA D N   1 
ATOM   7789  C  CA  . ALA D  1 196 ? -29.437  80.852  61.003  1.00 27.25 ? 188  ALA D CA  1 
ATOM   7790  C  C   . ALA D  1 196 ? -30.234  81.639  59.943  1.00 28.16 ? 188  ALA D C   1 
ATOM   7791  O  O   . ALA D  1 196 ? -31.486  81.626  59.959  1.00 26.72 ? 188  ALA D O   1 
ATOM   7792  C  CB  . ALA D  1 196 ? -29.111  79.419  60.505  1.00 26.70 ? 188  ALA D CB  1 
ATOM   7793  N  N   . SER D  1 197 ? -29.534  82.335  59.038  1.00 28.50 ? 189  SER D N   1 
ATOM   7794  C  CA  . SER D  1 197 ? -30.248  83.179  58.110  1.00 29.61 ? 189  SER D CA  1 
ATOM   7795  C  C   . SER D  1 197 ? -30.992  82.413  57.038  1.00 28.29 ? 189  SER D C   1 
ATOM   7796  O  O   . SER D  1 197 ? -31.945  82.943  56.494  1.00 28.97 ? 189  SER D O   1 
ATOM   7797  C  CB  . SER D  1 197 ? -29.333  84.236  57.481  1.00 31.20 ? 189  SER D CB  1 
ATOM   7798  O  OG  . SER D  1 197 ? -28.409  83.619  56.662  1.00 33.59 ? 189  SER D OG  1 
ATOM   7799  N  N   . SER D  1 198 ? -30.601  81.183  56.721  1.00 26.61 ? 190  SER D N   1 
ATOM   7800  C  CA  . SER D  1 198 ? -31.390  80.430  55.768  1.00 25.22 ? 190  SER D CA  1 
ATOM   7801  C  C   . SER D  1 198 ? -31.499  78.972  56.128  1.00 24.53 ? 190  SER D C   1 
ATOM   7802  O  O   . SER D  1 198 ? -30.519  78.280  56.251  1.00 24.16 ? 190  SER D O   1 
ATOM   7803  C  CB  . SER D  1 198 ? -30.818  80.545  54.362  1.00 25.52 ? 190  SER D CB  1 
ATOM   7804  O  OG  . SER D  1 198 ? -31.676  79.859  53.445  1.00 25.19 ? 190  SER D OG  1 
ATOM   7805  N  N   . SER D  1 199 ? -32.725  78.479  56.196  1.00 24.11 ? 191  SER D N   1 
ATOM   7806  C  CA  . SER D  1 199 ? -32.977  77.048  56.341  1.00 23.02 ? 191  SER D CA  1 
ATOM   7807  C  C   . SER D  1 199 ? -32.474  76.239  55.163  1.00 22.65 ? 191  SER D C   1 
ATOM   7808  O  O   . SER D  1 199 ? -32.395  75.024  55.255  1.00 22.37 ? 191  SER D O   1 
ATOM   7809  C  CB  . SER D  1 199 ? -34.468  76.805  56.540  1.00 22.98 ? 191  SER D CB  1 
ATOM   7810  O  OG  . SER D  1 199 ? -35.213  77.425  55.498  1.00 21.52 ? 191  SER D OG  1 
ATOM   7811  N  N   . ALA D  1 200 ? -32.150  76.888  54.049  1.00 23.29 ? 192  ALA D N   1 
ATOM   7812  C  CA  . ALA D  1 200 ? -31.592  76.166  52.850  1.00 23.27 ? 192  ALA D CA  1 
ATOM   7813  C  C   . ALA D  1 200 ? -30.112  75.807  53.014  1.00 23.22 ? 192  ALA D C   1 
ATOM   7814  O  O   . ALA D  1 200 ? -29.579  75.062  52.213  1.00 22.63 ? 192  ALA D O   1 
ATOM   7815  C  CB  . ALA D  1 200 ? -31.761  76.996  51.570  1.00 22.75 ? 192  ALA D CB  1 
ATOM   7816  N  N   . SER D  1 201 ? -29.442  76.332  54.034  1.00 23.03 ? 193  SER D N   1 
ATOM   7817  C  CA  . SER D  1 201 ? -27.998  76.166  54.071  1.00 24.34 ? 193  SER D CA  1 
ATOM   7818  C  C   . SER D  1 201 ? -27.475  75.655  55.390  1.00 24.35 ? 193  SER D C   1 
ATOM   7819  O  O   . SER D  1 201 ? -26.297  75.673  55.636  1.00 24.43 ? 193  SER D O   1 
ATOM   7820  C  CB  . SER D  1 201 ? -27.318  77.489  53.691  1.00 24.63 ? 193  SER D CB  1 
ATOM   7821  O  OG  . SER D  1 201 ? -27.639  78.437  54.652  1.00 27.83 ? 193  SER D OG  1 
ATOM   7822  N  N   . THR D  1 202 ? -28.362  75.174  56.243  1.00 25.30 ? 194  THR D N   1 
ATOM   7823  C  CA  . THR D  1 202 ? -27.930  74.646  57.521  1.00 24.83 ? 194  THR D CA  1 
ATOM   7824  C  C   . THR D  1 202 ? -28.973  73.698  58.095  1.00 25.73 ? 194  THR D C   1 
ATOM   7825  O  O   . THR D  1 202 ? -30.133  73.702  57.700  1.00 26.06 ? 194  THR D O   1 
ATOM   7826  C  CB  . THR D  1 202 ? -27.610  75.754  58.569  1.00 24.73 ? 194  THR D CB  1 
ATOM   7827  O  OG1 . THR D  1 202 ? -26.946  75.156  59.691  1.00 22.21 ? 194  THR D OG1 1 
ATOM   7828  C  CG2 . THR D  1 202 ? -28.835  76.427  59.049  1.00 22.84 ? 194  THR D CG2 1 
ATOM   7829  N  N   . ASP D  1 203 ? -28.496  72.871  59.012  1.00 25.57 ? 195  ASP D N   1 
ATOM   7830  C  CA  . ASP D  1 203 ? -29.322  72.076  59.891  1.00 24.97 ? 195  ASP D CA  1 
ATOM   7831  C  C   . ASP D  1 203 ? -29.510  72.848  61.180  1.00 24.42 ? 195  ASP D C   1 
ATOM   7832  O  O   . ASP D  1 203 ? -28.892  73.875  61.367  1.00 24.47 ? 195  ASP D O   1 
ATOM   7833  C  CB  . ASP D  1 203 ? -28.615  70.752  60.185  1.00 25.00 ? 195  ASP D CB  1 
ATOM   7834  C  CG  . ASP D  1 203 ? -27.271  70.950  60.848  1.00 26.24 ? 195  ASP D CG  1 
ATOM   7835  O  OD1 . ASP D  1 203 ? -26.589  71.957  60.566  1.00 31.07 ? 195  ASP D OD1 1 
ATOM   7836  O  OD2 . ASP D  1 203 ? -26.875  70.121  61.660  1.00 29.71 ? 195  ASP D OD2 1 
ATOM   7837  N  N   . TYR D  1 204 ? -30.401  72.364  62.038  1.00 24.67 ? 196  TYR D N   1 
ATOM   7838  C  CA  . TYR D  1 204 ? -30.442  72.774  63.443  1.00 24.18 ? 196  TYR D CA  1 
ATOM   7839  C  C   . TYR D  1 204 ? -30.805  71.624  64.360  1.00 23.99 ? 196  TYR D C   1 
ATOM   7840  O  O   . TYR D  1 204 ? -31.238  70.601  63.902  1.00 24.41 ? 196  TYR D O   1 
ATOM   7841  C  CB  . TYR D  1 204 ? -31.304  73.989  63.656  1.00 24.41 ? 196  TYR D CB  1 
ATOM   7842  C  CG  . TYR D  1 204 ? -32.821  73.923  63.566  1.00 23.89 ? 196  TYR D CG  1 
ATOM   7843  C  CD1 . TYR D  1 204 ? -33.477  73.448  62.445  1.00 23.88 ? 196  TYR D CD1 1 
ATOM   7844  C  CD2 . TYR D  1 204 ? -33.609  74.483  64.576  1.00 24.37 ? 196  TYR D CD2 1 
ATOM   7845  C  CE1 . TYR D  1 204 ? -34.884  73.477  62.362  1.00 21.37 ? 196  TYR D CE1 1 
ATOM   7846  C  CE2 . TYR D  1 204 ? -35.010  74.533  64.495  1.00 23.41 ? 196  TYR D CE2 1 
ATOM   7847  C  CZ  . TYR D  1 204 ? -35.638  74.041  63.374  1.00 23.88 ? 196  TYR D CZ  1 
ATOM   7848  O  OH  . TYR D  1 204 ? -37.014  74.117  63.282  1.00 23.07 ? 196  TYR D OH  1 
ATOM   7849  N  N   . ASP D  1 205 ? -30.568  71.770  65.647  1.00 24.75 ? 197  ASP D N   1 
ATOM   7850  C  CA  . ASP D  1 205 ? -30.469  70.620  66.569  1.00 25.67 ? 197  ASP D CA  1 
ATOM   7851  C  C   . ASP D  1 205 ? -31.708  70.319  67.395  1.00 25.75 ? 197  ASP D C   1 
ATOM   7852  O  O   . ASP D  1 205 ? -32.315  71.210  68.003  1.00 25.21 ? 197  ASP D O   1 
ATOM   7853  C  CB  . ASP D  1 205 ? -29.298  70.841  67.562  1.00 27.20 ? 197  ASP D CB  1 
ATOM   7854  C  CG  . ASP D  1 205 ? -27.906  70.732  66.900  1.00 28.14 ? 197  ASP D CG  1 
ATOM   7855  O  OD1 . ASP D  1 205 ? -27.816  70.688  65.670  1.00 30.90 ? 197  ASP D OD1 1 
ATOM   7856  O  OD2 . ASP D  1 205 ? -26.895  70.691  67.629  1.00 32.89 ? 197  ASP D OD2 1 
ATOM   7857  N  N   . ILE D  1 206 ? -32.072  69.033  67.417  1.00 26.56 ? 198  ILE D N   1 
ATOM   7858  C  CA  . ILE D  1 206 ? -32.981  68.517  68.430  1.00 26.81 ? 198  ILE D CA  1 
ATOM   7859  C  C   . ILE D  1 206 ? -32.109  68.330  69.652  1.00 27.79 ? 198  ILE D C   1 
ATOM   7860  O  O   . ILE D  1 206 ? -31.226  67.490  69.669  1.00 26.80 ? 198  ILE D O   1 
ATOM   7861  C  CB  . ILE D  1 206 ? -33.552  67.144  68.096  1.00 26.48 ? 198  ILE D CB  1 
ATOM   7862  C  CG1 . ILE D  1 206 ? -34.357  67.153  66.811  1.00 25.15 ? 198  ILE D CG1 1 
ATOM   7863  C  CG2 . ILE D  1 206 ? -34.437  66.691  69.225  1.00 25.42 ? 198  ILE D CG2 1 
ATOM   7864  C  CD1 . ILE D  1 206 ? -34.398  65.804  66.185  1.00 22.78 ? 198  ILE D CD1 1 
ATOM   7865  N  N   . MET D  1 207 ? -32.333  69.126  70.665  1.00 29.41 ? 199  MET D N   1 
ATOM   7866  C  CA  . MET D  1 207 ? -31.434  69.099  71.814  1.00 31.11 ? 199  MET D CA  1 
ATOM   7867  C  C   . MET D  1 207 ? -31.929  68.164  72.927  1.00 31.95 ? 199  MET D C   1 
ATOM   7868  O  O   . MET D  1 207 ? -31.966  68.542  74.079  1.00 33.80 ? 199  MET D O   1 
ATOM   7869  C  CB  . MET D  1 207 ? -31.206  70.531  72.343  1.00 32.02 ? 199  MET D CB  1 
ATOM   7870  C  CG  . MET D  1 207 ? -32.475  71.345  72.645  1.00 32.27 ? 199  MET D CG  1 
ATOM   7871  S  SD  . MET D  1 207 ? -32.097  72.748  73.707  1.00 32.44 ? 199  MET D SD  1 
ATOM   7872  C  CE  . MET D  1 207 ? -31.500  71.811  75.053  1.00 26.75 ? 199  MET D CE  1 
ATOM   7873  N  N   . ALA D  1 208 ? -32.332  66.960  72.557  1.00 32.02 ? 200  ALA D N   1 
ATOM   7874  C  CA  . ALA D  1 208 ? -32.695  65.900  73.485  1.00 32.54 ? 200  ALA D CA  1 
ATOM   7875  C  C   . ALA D  1 208 ? -31.448  65.068  73.793  1.00 33.23 ? 200  ALA D C   1 
ATOM   7876  O  O   . ALA D  1 208 ? -30.805  64.540  72.880  1.00 32.68 ? 200  ALA D O   1 
ATOM   7877  C  CB  . ALA D  1 208 ? -33.721  64.986  72.856  1.00 31.62 ? 200  ALA D CB  1 
ATOM   7878  N  N   . SER D  1 209 ? -31.154  64.888  75.071  1.00 33.89 ? 201  SER D N   1 
ATOM   7879  C  CA  . SER D  1 209 ? -30.069  64.011  75.476  1.00 35.45 ? 201  SER D CA  1 
ATOM   7880  C  C   . SER D  1 209 ? -30.326  62.554  75.194  1.00 35.39 ? 201  SER D C   1 
ATOM   7881  O  O   . SER D  1 209 ? -29.392  61.814  74.954  1.00 35.11 ? 201  SER D O   1 
ATOM   7882  C  CB  . SER D  1 209 ? -29.807  64.140  76.968  1.00 35.85 ? 201  SER D CB  1 
ATOM   7883  O  OG  . SER D  1 209 ? -29.662  65.500  77.258  1.00 40.02 ? 201  SER D OG  1 
ATOM   7884  N  N   . ASN D  1 210 ? -31.592  62.146  75.275  1.00 36.47 ? 202  ASN D N   1 
ATOM   7885  C  CA  . ASN D  1 210 ? -31.979  60.757  75.131  1.00 36.74 ? 202  ASN D CA  1 
ATOM   7886  C  C   . ASN D  1 210 ? -33.188  60.714  74.234  1.00 36.18 ? 202  ASN D C   1 
ATOM   7887  O  O   . ASN D  1 210 ? -34.004  61.627  74.261  1.00 34.84 ? 202  ASN D O   1 
ATOM   7888  C  CB  . ASN D  1 210 ? -32.405  60.191  76.472  1.00 38.31 ? 202  ASN D CB  1 
ATOM   7889  C  CG  . ASN D  1 210 ? -31.341  60.323  77.554  1.00 42.14 ? 202  ASN D CG  1 
ATOM   7890  O  OD1 . ASN D  1 210 ? -30.249  59.775  77.447  1.00 46.35 ? 202  ASN D OD1 1 
ATOM   7891  N  ND2 . ASN D  1 210 ? -31.685  61.039  78.625  1.00 46.90 ? 202  ASN D ND2 1 
ATOM   7892  N  N   . PRO D  1 211 ? -33.355  59.617  73.482  1.00 36.19 ? 203  PRO D N   1 
ATOM   7893  C  CA  . PRO D  1 211 ? -34.543  59.518  72.610  1.00 36.78 ? 203  PRO D CA  1 
ATOM   7894  C  C   . PRO D  1 211 ? -35.869  59.543  73.379  1.00 37.66 ? 203  PRO D C   1 
ATOM   7895  O  O   . PRO D  1 211 ? -36.853  60.115  72.908  1.00 36.89 ? 203  PRO D O   1 
ATOM   7896  C  CB  . PRO D  1 211 ? -34.334  58.206  71.839  1.00 37.01 ? 203  PRO D CB  1 
ATOM   7897  C  CG  . PRO D  1 211 ? -33.197  57.485  72.573  1.00 37.56 ? 203  PRO D CG  1 
ATOM   7898  C  CD  . PRO D  1 211 ? -32.425  58.485  73.352  1.00 35.75 ? 203  PRO D CD  1 
ATOM   7899  N  N   . GLU D  1 212 ? -35.863  58.973  74.576  1.00 39.76 ? 204  GLU D N   1 
ATOM   7900  C  CA  . GLU D  1 212 ? -37.042  58.924  75.443  1.00 41.90 ? 204  GLU D CA  1 
ATOM   7901  C  C   . GLU D  1 212 ? -37.513  60.312  75.791  1.00 41.80 ? 204  GLU D C   1 
ATOM   7902  O  O   . GLU D  1 212 ? -38.692  60.537  76.000  1.00 42.42 ? 204  GLU D O   1 
ATOM   7903  C  CB  . GLU D  1 212 ? -36.709  58.176  76.731  1.00 43.29 ? 204  GLU D CB  1 
ATOM   7904  C  CG  . GLU D  1 212 ? -36.407  56.662  76.503  1.00 48.05 ? 204  GLU D CG  1 
ATOM   7905  C  CD  . GLU D  1 212 ? -34.909  56.332  76.159  1.00 53.89 ? 204  GLU D CD  1 
ATOM   7906  O  OE1 . GLU D  1 212 ? -34.027  57.255  76.089  1.00 53.25 ? 204  GLU D OE1 1 
ATOM   7907  O  OE2 . GLU D  1 212 ? -34.645  55.116  75.923  1.00 57.42 ? 204  GLU D OE2 1 
ATOM   7908  N  N   . ASP D  1 213 ? -36.586  61.256  75.840  1.00 41.93 ? 205  ASP D N   1 
ATOM   7909  C  CA  . ASP D  1 213 ? -36.942  62.652  76.023  1.00 41.81 ? 205  ASP D CA  1 
ATOM   7910  C  C   . ASP D  1 213 ? -37.849  63.169  74.940  1.00 40.87 ? 205  ASP D C   1 
ATOM   7911  O  O   . ASP D  1 213 ? -38.461  64.180  75.140  1.00 42.12 ? 205  ASP D O   1 
ATOM   7912  C  CB  . ASP D  1 213 ? -35.688  63.508  76.056  1.00 42.02 ? 205  ASP D CB  1 
ATOM   7913  C  CG  . ASP D  1 213 ? -34.843  63.256  77.301  1.00 44.74 ? 205  ASP D CG  1 
ATOM   7914  O  OD1 . ASP D  1 213 ? -35.443  63.108  78.376  1.00 46.33 ? 205  ASP D OD1 1 
ATOM   7915  O  OD2 . ASP D  1 213 ? -33.586  63.225  77.211  1.00 48.94 ? 205  ASP D OD2 1 
ATOM   7916  N  N   . LEU D  1 214 ? -37.906  62.510  73.784  1.00 39.99 ? 206  LEU D N   1 
ATOM   7917  C  CA  . LEU D  1 214 ? -38.859  62.837  72.693  1.00 38.66 ? 206  LEU D CA  1 
ATOM   7918  C  C   . LEU D  1 214 ? -40.027  61.868  72.656  1.00 38.11 ? 206  LEU D C   1 
ATOM   7919  O  O   . LEU D  1 214 ? -40.831  61.905  71.757  1.00 38.10 ? 206  LEU D O   1 
ATOM   7920  C  CB  . LEU D  1 214 ? -38.159  62.803  71.322  1.00 37.66 ? 206  LEU D CB  1 
ATOM   7921  C  CG  . LEU D  1 214 ? -36.840  63.574  71.209  1.00 36.42 ? 206  LEU D CG  1 
ATOM   7922  C  CD1 . LEU D  1 214 ? -36.037  63.111  69.980  1.00 32.72 ? 206  LEU D CD1 1 
ATOM   7923  C  CD2 . LEU D  1 214 ? -37.148  65.089  71.207  1.00 33.37 ? 206  LEU D CD2 1 
ATOM   7924  N  N   . GLY D  1 215 ? -40.114  60.979  73.632  1.00 38.60 ? 207  GLY D N   1 
ATOM   7925  C  CA  . GLY D  1 215 ? -41.142  59.919  73.618  1.00 37.92 ? 207  GLY D CA  1 
ATOM   7926  C  C   . GLY D  1 215 ? -40.918  58.828  72.581  1.00 37.10 ? 207  GLY D C   1 
ATOM   7927  O  O   . GLY D  1 215 ? -41.862  58.226  72.161  1.00 36.92 ? 207  GLY D O   1 
ATOM   7928  N  N   . VAL D  1 216 ? -39.673  58.548  72.200  1.00 35.94 ? 208  VAL D N   1 
ATOM   7929  C  CA  . VAL D  1 216 ? -39.378  57.421  71.311  1.00 35.28 ? 208  VAL D CA  1 
ATOM   7930  C  C   . VAL D  1 216 ? -38.210  56.619  71.862  1.00 34.50 ? 208  VAL D C   1 
ATOM   7931  O  O   . VAL D  1 216 ? -37.482  57.083  72.720  1.00 34.91 ? 208  VAL D O   1 
ATOM   7932  C  CB  . VAL D  1 216 ? -39.156  57.894  69.832  1.00 35.52 ? 208  VAL D CB  1 
ATOM   7933  C  CG1 . VAL D  1 216 ? -40.524  58.469  69.267  1.00 34.27 ? 208  VAL D CG1 1 
ATOM   7934  C  CG2 . VAL D  1 216 ? -38.002  58.930  69.752  1.00 33.27 ? 208  VAL D CG2 1 
ATOM   7935  N  N   . ALA D  1 217 ? -38.094  55.377  71.431  1.00 32.73 ? 209  ALA D N   1 
ATOM   7936  C  CA  . ALA D  1 217 ? -37.055  54.503  71.918  1.00 32.62 ? 209  ALA D CA  1 
ATOM   7937  C  C   . ALA D  1 217 ? -35.733  54.750  71.210  1.00 31.70 ? 209  ALA D C   1 
ATOM   7938  O  O   . ALA D  1 217 ? -34.677  54.398  71.721  1.00 31.06 ? 209  ALA D O   1 
ATOM   7939  C  CB  . ALA D  1 217 ? -37.457  53.017  71.702  1.00 32.32 ? 209  ALA D CB  1 
ATOM   7940  N  N   . ASP D  1 218 ? -35.831  55.261  69.992  1.00 31.01 ? 210  ASP D N   1 
ATOM   7941  C  CA  . ASP D  1 218 ? -34.688  55.516  69.155  1.00 30.68 ? 210  ASP D CA  1 
ATOM   7942  C  C   . ASP D  1 218 ? -34.940  56.676  68.197  1.00 28.89 ? 210  ASP D C   1 
ATOM   7943  O  O   . ASP D  1 218 ? -36.059  57.125  68.018  1.00 28.35 ? 210  ASP D O   1 
ATOM   7944  C  CB  . ASP D  1 218 ? -34.268  54.258  68.417  1.00 30.97 ? 210  ASP D CB  1 
ATOM   7945  C  CG  . ASP D  1 218 ? -32.773  54.291  67.978  1.00 32.96 ? 210  ASP D CG  1 
ATOM   7946  O  OD1 . ASP D  1 218 ? -31.961  55.081  68.535  1.00 33.53 ? 210  ASP D OD1 1 
ATOM   7947  O  OD2 . ASP D  1 218 ? -32.422  53.520  67.060  1.00 36.46 ? 210  ASP D OD2 1 
ATOM   7948  N  N   . LEU D  1 219 ? -33.860  57.240  67.693  1.00 27.27 ? 211  LEU D N   1 
ATOM   7949  C  CA  . LEU D  1 219 ? -33.959  58.189  66.625  1.00 26.45 ? 211  LEU D CA  1 
ATOM   7950  C  C   . LEU D  1 219 ? -32.766  57.873  65.770  1.00 25.43 ? 211  LEU D C   1 
ATOM   7951  O  O   . LEU D  1 219 ? -31.686  57.758  66.309  1.00 24.99 ? 211  LEU D O   1 
ATOM   7952  C  CB  . LEU D  1 219 ? -33.887  59.582  67.175  1.00 25.87 ? 211  LEU D CB  1 
ATOM   7953  C  CG  . LEU D  1 219 ? -34.177  60.705  66.224  1.00 26.22 ? 211  LEU D CG  1 
ATOM   7954  C  CD1 . LEU D  1 219 ? -35.650  60.773  65.775  1.00 25.05 ? 211  LEU D CD1 1 
ATOM   7955  C  CD2 . LEU D  1 219 ? -33.821  61.965  66.930  1.00 27.09 ? 211  LEU D CD2 1 
ATOM   7956  N  N   . LYS D  1 220 ? -32.968  57.662  64.471  1.00 24.26 ? 212  LYS D N   1 
ATOM   7957  C  CA  . LYS D  1 220 ? -31.906  57.213  63.592  1.00 23.89 ? 212  LYS D CA  1 
ATOM   7958  C  C   . LYS D  1 220 ? -31.462  58.294  62.657  1.00 22.72 ? 212  LYS D C   1 
ATOM   7959  O  O   . LYS D  1 220 ? -32.240  59.107  62.200  1.00 21.91 ? 212  LYS D O   1 
ATOM   7960  C  CB  . LYS D  1 220 ? -32.351  56.021  62.782  1.00 24.70 ? 212  LYS D CB  1 
ATOM   7961  C  CG  . LYS D  1 220 ? -32.788  54.833  63.642  1.00 26.94 ? 212  LYS D CG  1 
ATOM   7962  C  CD  . LYS D  1 220 ? -33.296  53.677  62.825  1.00 31.03 ? 212  LYS D CD  1 
ATOM   7963  C  CE  . LYS D  1 220 ? -33.609  52.462  63.727  1.00 34.33 ? 212  LYS D CE  1 
ATOM   7964  N  NZ  . LYS D  1 220 ? -34.659  52.870  64.750  1.00 35.42 ? 212  LYS D NZ  1 
ATOM   7965  N  N   . LEU D  1 221 ? -30.179  58.287  62.374  1.00 21.95 ? 213  LEU D N   1 
ATOM   7966  C  CA  . LEU D  1 221 ? -29.646  59.048  61.265  1.00 21.25 ? 213  LEU D CA  1 
ATOM   7967  C  C   . LEU D  1 221 ? -30.440  58.628  60.039  1.00 21.34 ? 213  LEU D C   1 
ATOM   7968  O  O   . LEU D  1 221 ? -30.617  57.440  59.782  1.00 20.98 ? 213  LEU D O   1 
ATOM   7969  C  CB  . LEU D  1 221 ? -28.167  58.752  61.066  1.00 20.81 ? 213  LEU D CB  1 
ATOM   7970  C  CG  . LEU D  1 221 ? -27.262  58.998  62.278  1.00 20.93 ? 213  LEU D CG  1 
ATOM   7971  C  CD1 . LEU D  1 221 ? -25.902  58.367  62.067  1.00 20.45 ? 213  LEU D CD1 1 
ATOM   7972  C  CD2 . LEU D  1 221 ? -27.141  60.456  62.597  1.00 18.08 ? 213  LEU D CD2 1 
ATOM   7973  N  N   . GLY D  1 222 ? -30.943  59.622  59.310  1.00 21.48 ? 214  GLY D N   1 
ATOM   7974  C  CA  . GLY D  1 222 ? -31.799  59.388  58.172  1.00 21.51 ? 214  GLY D CA  1 
ATOM   7975  C  C   . GLY D  1 222 ? -33.300  59.490  58.453  1.00 21.84 ? 214  GLY D C   1 
ATOM   7976  O  O   . GLY D  1 222 ? -34.097  59.498  57.514  1.00 21.20 ? 214  GLY D O   1 
ATOM   7977  N  N   . ASP D  1 223 ? -33.702  59.558  59.726  1.00 22.00 ? 215  ASP D N   1 
ATOM   7978  C  CA  . ASP D  1 223 ? -35.159  59.579  60.058  1.00 21.75 ? 215  ASP D CA  1 
ATOM   7979  C  C   . ASP D  1 223 ? -35.858  60.867  59.623  1.00 21.23 ? 215  ASP D C   1 
ATOM   7980  O  O   . ASP D  1 223 ? -35.276  61.943  59.675  1.00 21.93 ? 215  ASP D O   1 
ATOM   7981  C  CB  . ASP D  1 223 ? -35.401  59.370  61.564  1.00 21.66 ? 215  ASP D CB  1 
ATOM   7982  C  CG  . ASP D  1 223 ? -35.351  57.846  62.006  1.00 24.53 ? 215  ASP D CG  1 
ATOM   7983  O  OD1 . ASP D  1 223 ? -35.234  56.946  61.115  1.00 23.99 ? 215  ASP D OD1 1 
ATOM   7984  O  OD2 . ASP D  1 223 ? -35.439  57.576  63.252  1.00 25.85 ? 215  ASP D OD2 1 
ATOM   7985  N  N   . ILE D  1 224 ? -37.109  60.752  59.197  1.00 20.66 ? 216  ILE D N   1 
ATOM   7986  C  CA  . ILE D  1 224 ? -37.975  61.899  58.925  1.00 19.96 ? 216  ILE D CA  1 
ATOM   7987  C  C   . ILE D  1 224 ? -38.761  62.227  60.186  1.00 19.85 ? 216  ILE D C   1 
ATOM   7988  O  O   . ILE D  1 224 ? -39.363  61.352  60.777  1.00 20.11 ? 216  ILE D O   1 
ATOM   7989  C  CB  . ILE D  1 224 ? -38.863  61.581  57.735  1.00 20.64 ? 216  ILE D CB  1 
ATOM   7990  C  CG1 . ILE D  1 224 ? -37.942  61.191  56.562  1.00 23.80 ? 216  ILE D CG1 1 
ATOM   7991  C  CG2 . ILE D  1 224 ? -39.752  62.758  57.299  1.00 17.96 ? 216  ILE D CG2 1 
ATOM   7992  C  CD1 . ILE D  1 224 ? -38.607  60.407  55.580  1.00 29.22 ? 216  ILE D CD1 1 
ATOM   7993  N  N   . VAL D  1 225 ? -38.674  63.481  60.612  1.00 19.08 ? 217  VAL D N   1 
ATOM   7994  C  CA  . VAL D  1 225 ? -39.288  63.977  61.814  1.00 18.95 ? 217  VAL D CA  1 
ATOM   7995  C  C   . VAL D  1 225 ? -40.141  65.203  61.474  1.00 19.72 ? 217  VAL D C   1 
ATOM   7996  O  O   . VAL D  1 225 ? -39.993  65.793  60.404  1.00 18.81 ? 217  VAL D O   1 
ATOM   7997  C  CB  . VAL D  1 225 ? -38.254  64.397  62.899  1.00 18.43 ? 217  VAL D CB  1 
ATOM   7998  C  CG1 . VAL D  1 225 ? -37.403  63.198  63.306  1.00 17.17 ? 217  VAL D CG1 1 
ATOM   7999  C  CG2 . VAL D  1 225 ? -37.404  65.580  62.427  1.00 17.17 ? 217  VAL D CG2 1 
ATOM   8000  N  N   . ALA D  1 226 ? -41.077  65.518  62.368  1.00 20.34 ? 218  ALA D N   1 
ATOM   8001  C  CA  . ALA D  1 226 ? -41.902  66.723  62.249  1.00 21.48 ? 218  ALA D CA  1 
ATOM   8002  C  C   . ALA D  1 226 ? -41.470  67.586  63.381  1.00 21.54 ? 218  ALA D C   1 
ATOM   8003  O  O   . ALA D  1 226 ? -41.189  67.073  64.475  1.00 22.16 ? 218  ALA D O   1 
ATOM   8004  C  CB  . ALA D  1 226 ? -43.419  66.402  62.356  1.00 20.28 ? 218  ALA D CB  1 
ATOM   8005  N  N   . ILE D  1 227 ? -41.381  68.884  63.128  1.00 22.28 ? 219  ILE D N   1 
ATOM   8006  C  CA  . ILE D  1 227 ? -41.057  69.844  64.187  1.00 22.30 ? 219  ILE D CA  1 
ATOM   8007  C  C   . ILE D  1 227 ? -42.267  70.717  64.344  1.00 23.21 ? 219  ILE D C   1 
ATOM   8008  O  O   . ILE D  1 227 ? -42.616  71.474  63.448  1.00 22.98 ? 219  ILE D O   1 
ATOM   8009  C  CB  . ILE D  1 227 ? -39.810  70.680  63.865  1.00 22.75 ? 219  ILE D CB  1 
ATOM   8010  C  CG1 . ILE D  1 227 ? -38.603  69.770  63.629  1.00 24.15 ? 219  ILE D CG1 1 
ATOM   8011  C  CG2 . ILE D  1 227 ? -39.518  71.737  64.981  1.00 20.20 ? 219  ILE D CG2 1 
ATOM   8012  C  CD1 . ILE D  1 227 ? -37.408  70.524  63.131  1.00 29.18 ? 219  ILE D CD1 1 
ATOM   8013  N  N   . GLN D  1 228 ? -42.903  70.612  65.494  1.00 24.19 ? 220  GLN D N   1 
ATOM   8014  C  CA  . GLN D  1 228 ? -44.145  71.315  65.766  1.00 25.66 ? 220  GLN D CA  1 
ATOM   8015  C  C   . GLN D  1 228 ? -43.918  72.767  66.115  1.00 25.76 ? 220  GLN D C   1 
ATOM   8016  O  O   . GLN D  1 228 ? -43.031  73.074  66.884  1.00 25.72 ? 220  GLN D O   1 
ATOM   8017  C  CB  . GLN D  1 228 ? -44.857  70.651  66.944  1.00 26.51 ? 220  GLN D CB  1 
ATOM   8018  C  CG  . GLN D  1 228 ? -45.114  69.201  66.691  1.00 30.53 ? 220  GLN D CG  1 
ATOM   8019  C  CD  . GLN D  1 228 ? -45.814  68.486  67.825  1.00 36.96 ? 220  GLN D CD  1 
ATOM   8020  O  OE1 . GLN D  1 228 ? -45.423  68.595  68.997  1.00 38.89 ? 220  GLN D OE1 1 
ATOM   8021  N  NE2 . GLN D  1 228 ? -46.878  67.721  67.470  1.00 39.18 ? 220  GLN D NE2 1 
ATOM   8022  N  N   . ASP D  1 229 ? -44.751  73.640  65.564  1.00 25.48 ? 221  ASP D N   1 
ATOM   8023  C  CA  . ASP D  1 229 ? -44.770  75.050  65.883  1.00 25.98 ? 221  ASP D CA  1 
ATOM   8024  C  C   . ASP D  1 229 ? -43.518  75.808  65.472  1.00 26.25 ? 221  ASP D C   1 
ATOM   8025  O  O   . ASP D  1 229 ? -43.239  76.872  66.031  1.00 27.51 ? 221  ASP D O   1 
ATOM   8026  C  CB  . ASP D  1 229 ? -45.115  75.275  67.349  1.00 26.39 ? 221  ASP D CB  1 
ATOM   8027  C  CG  . ASP D  1 229 ? -46.432  74.578  67.757  1.00 28.45 ? 221  ASP D CG  1 
ATOM   8028  O  OD1 . ASP D  1 229 ? -47.434  74.683  67.012  1.00 27.52 ? 221  ASP D OD1 1 
ATOM   8029  O  OD2 . ASP D  1 229 ? -46.459  73.912  68.828  1.00 31.10 ? 221  ASP D OD2 1 
ATOM   8030  N  N   . HIS D  1 230 ? -42.808  75.300  64.458  1.00 25.63 ? 222  HIS D N   1 
ATOM   8031  C  CA  . HIS D  1 230 ? -41.702  76.035  63.824  1.00 24.94 ? 222  HIS D CA  1 
ATOM   8032  C  C   . HIS D  1 230 ? -41.925  76.234  62.337  1.00 24.68 ? 222  HIS D C   1 
ATOM   8033  O  O   . HIS D  1 230 ? -42.234  75.293  61.612  1.00 23.04 ? 222  HIS D O   1 
ATOM   8034  C  CB  . HIS D  1 230 ? -40.386  75.294  64.009  1.00 25.63 ? 222  HIS D CB  1 
ATOM   8035  C  CG  . HIS D  1 230 ? -39.633  75.676  65.244  1.00 25.27 ? 222  HIS D CG  1 
ATOM   8036  N  ND1 . HIS D  1 230 ? -38.285  75.461  65.373  1.00 23.93 ? 222  HIS D ND1 1 
ATOM   8037  C  CD2 . HIS D  1 230 ? -40.042  76.236  66.409  1.00 27.57 ? 222  HIS D CD2 1 
ATOM   8038  C  CE1 . HIS D  1 230 ? -37.886  75.890  66.558  1.00 28.10 ? 222  HIS D CE1 1 
ATOM   8039  N  NE2 . HIS D  1 230 ? -38.934  76.357  67.212  1.00 28.74 ? 222  HIS D NE2 1 
ATOM   8040  N  N   . ASP D  1 231 ? -41.780  77.487  61.916  1.00 25.93 ? 223  ASP D N   1 
ATOM   8041  C  CA  . ASP D  1 231 ? -41.719  77.881  60.537  1.00 26.65 ? 223  ASP D CA  1 
ATOM   8042  C  C   . ASP D  1 231 ? -40.262  78.087  60.112  1.00 26.77 ? 223  ASP D C   1 
ATOM   8043  O  O   . ASP D  1 231 ? -39.513  78.847  60.759  1.00 27.43 ? 223  ASP D O   1 
ATOM   8044  C  CB  . ASP D  1 231 ? -42.468  79.198  60.291  1.00 28.10 ? 223  ASP D CB  1 
ATOM   8045  C  CG  . ASP D  1 231 ? -42.191  79.719  58.900  1.00 30.21 ? 223  ASP D CG  1 
ATOM   8046  O  OD1 . ASP D  1 231 ? -42.721  79.195  57.945  1.00 36.29 ? 223  ASP D OD1 1 
ATOM   8047  O  OD2 . ASP D  1 231 ? -41.274  80.502  58.707  1.00 40.08 ? 223  ASP D OD2 1 
ATOM   8048  N  N   . ASN D  1 232 ? -39.891  77.465  58.996  1.00 26.34 ? 224  ASN D N   1 
ATOM   8049  C  CA  . ASN D  1 232 ? -38.536  77.510  58.468  1.00 25.70 ? 224  ASN D CA  1 
ATOM   8050  C  C   . ASN D  1 232 ? -38.518  77.998  57.012  1.00 26.39 ? 224  ASN D C   1 
ATOM   8051  O  O   . ASN D  1 232 ? -37.672  77.568  56.192  1.00 26.53 ? 224  ASN D O   1 
ATOM   8052  C  CB  . ASN D  1 232 ? -37.944  76.115  58.582  1.00 25.38 ? 224  ASN D CB  1 
ATOM   8053  C  CG  . ASN D  1 232 ? -37.426  75.825  59.994  1.00 26.61 ? 224  ASN D CG  1 
ATOM   8054  O  OD1 . ASN D  1 232 ? -36.441  76.437  60.397  1.00 25.30 ? 224  ASN D OD1 1 
ATOM   8055  N  ND2 . ASN D  1 232 ? -38.110  74.925  60.766  1.00 22.89 ? 224  ASN D ND2 1 
ATOM   8056  N  N   . SER D  1 233 ? -39.456  78.884  56.690  1.00 26.28 ? 225  SER D N   1 
ATOM   8057  C  CA  . SER D  1 233 ? -39.607  79.384  55.350  1.00 26.77 ? 225  SER D CA  1 
ATOM   8058  C  C   . SER D  1 233 ? -38.418  80.199  54.871  1.00 26.71 ? 225  SER D C   1 
ATOM   8059  O  O   . SER D  1 233 ? -38.087  80.182  53.704  1.00 26.30 ? 225  SER D O   1 
ATOM   8060  C  CB  . SER D  1 233 ? -40.822  80.309  55.305  1.00 27.78 ? 225  SER D CB  1 
ATOM   8061  O  OG  . SER D  1 233 ? -41.965  79.503  55.393  1.00 28.56 ? 225  SER D OG  1 
ATOM   8062  N  N   . TYR D  1 234 ? -37.843  80.985  55.760  1.00 27.13 ? 226  TYR D N   1 
ATOM   8063  C  CA  . TYR D  1 234 ? -36.723  81.831  55.425  1.00 27.66 ? 226  TYR D CA  1 
ATOM   8064  C  C   . TYR D  1 234 ? -35.613  81.490  56.371  1.00 27.38 ? 226  TYR D C   1 
ATOM   8065  O  O   . TYR D  1 234 ? -34.860  80.555  56.081  1.00 27.73 ? 226  TYR D O   1 
ATOM   8066  C  CB  . TYR D  1 234 ? -37.143  83.323  55.379  1.00 28.07 ? 226  TYR D CB  1 
ATOM   8067  C  CG  . TYR D  1 234 ? -38.153  83.454  54.303  1.00 29.81 ? 226  TYR D CG  1 
ATOM   8068  C  CD1 . TYR D  1 234 ? -37.768  83.402  52.949  1.00 31.28 ? 226  TYR D CD1 1 
ATOM   8069  C  CD2 . TYR D  1 234 ? -39.506  83.490  54.598  1.00 31.70 ? 226  TYR D CD2 1 
ATOM   8070  C  CE1 . TYR D  1 234 ? -38.702  83.431  51.924  1.00 30.53 ? 226  TYR D CE1 1 
ATOM   8071  C  CE2 . TYR D  1 234 ? -40.465  83.518  53.565  1.00 32.29 ? 226  TYR D CE2 1 
ATOM   8072  C  CZ  . TYR D  1 234 ? -40.046  83.474  52.231  1.00 32.22 ? 226  TYR D CZ  1 
ATOM   8073  O  OH  . TYR D  1 234 ? -40.981  83.501  51.222  1.00 33.20 ? 226  TYR D OH  1 
ATOM   8074  N  N   . GLY D  1 235 ? -35.502  82.209  57.485  1.00 27.05 ? 227  GLY D N   1 
ATOM   8075  C  CA  . GLY D  1 235 ? -34.540  81.843  58.500  1.00 26.72 ? 227  GLY D CA  1 
ATOM   8076  C  C   . GLY D  1 235 ? -35.031  80.651  59.316  1.00 26.36 ? 227  GLY D C   1 
ATOM   8077  O  O   . GLY D  1 235 ? -36.215  80.304  59.283  1.00 26.25 ? 227  GLY D O   1 
ATOM   8078  N  N   . VAL D  1 236 ? -34.126  80.086  60.113  1.00 25.45 ? 228  VAL D N   1 
ATOM   8079  C  CA  . VAL D  1 236 ? -34.362  78.848  60.850  1.00 24.41 ? 228  VAL D CA  1 
ATOM   8080  C  C   . VAL D  1 236 ? -35.044  79.083  62.189  1.00 25.25 ? 228  VAL D C   1 
ATOM   8081  O  O   . VAL D  1 236 ? -34.671  79.948  62.960  1.00 24.98 ? 228  VAL D O   1 
ATOM   8082  C  CB  . VAL D  1 236 ? -33.036  78.103  61.071  1.00 24.34 ? 228  VAL D CB  1 
ATOM   8083  C  CG1 . VAL D  1 236 ? -33.217  76.843  61.943  1.00 23.22 ? 228  VAL D CG1 1 
ATOM   8084  C  CG2 . VAL D  1 236 ? -32.436  77.729  59.712  1.00 22.17 ? 228  VAL D CG2 1 
ATOM   8085  N  N   . GLY D  1 237 ? -36.091  78.319  62.418  1.00 25.76 ? 229  GLY D N   1 
ATOM   8086  C  CA  . GLY D  1 237 ? -36.724  78.178  63.725  1.00 27.14 ? 229  GLY D CA  1 
ATOM   8087  C  C   . GLY D  1 237 ? -37.559  79.319  64.293  1.00 28.00 ? 229  GLY D C   1 
ATOM   8088  O  O   . GLY D  1 237 ? -37.445  79.588  65.482  1.00 27.84 ? 229  GLY D O   1 
ATOM   8089  N  N   . LYS D  1 238 ? -38.375  79.978  63.464  1.00 28.12 ? 230  LYS D N   1 
ATOM   8090  C  CA  . LYS D  1 238 ? -39.411  80.918  63.947  1.00 29.14 ? 230  LYS D CA  1 
ATOM   8091  C  C   . LYS D  1 238 ? -40.487  80.087  64.667  1.00 28.83 ? 230  LYS D C   1 
ATOM   8092  O  O   . LYS D  1 238 ? -41.132  79.198  64.049  1.00 26.55 ? 230  LYS D O   1 
ATOM   8093  C  CB  . LYS D  1 238 ? -40.029  81.655  62.778  1.00 30.14 ? 230  LYS D CB  1 
ATOM   8094  C  CG  . LYS D  1 238 ? -41.263  82.588  63.043  1.00 36.52 ? 230  LYS D CG  1 
ATOM   8095  C  CD  . LYS D  1 238 ? -40.958  83.848  63.829  1.00 44.31 ? 230  LYS D CD  1 
ATOM   8096  C  CE  . LYS D  1 238 ? -42.189  84.855  63.890  1.00 48.70 ? 230  LYS D CE  1 
ATOM   8097  N  NZ  . LYS D  1 238 ? -41.971  86.017  64.933  1.00 53.06 ? 230  LYS D NZ  1 
ATOM   8098  N  N   . TYR D  1 239 ? -40.622  80.305  65.983  1.00 28.92 ? 231  TYR D N   1 
ATOM   8099  C  CA  . TYR D  1 239 ? -41.744  79.721  66.710  1.00 28.64 ? 231  TYR D CA  1 
ATOM   8100  C  C   . TYR D  1 239 ? -43.003  80.416  66.200  1.00 28.99 ? 231  TYR D C   1 
ATOM   8101  O  O   . TYR D  1 239 ? -43.032  81.638  66.161  1.00 28.46 ? 231  TYR D O   1 
ATOM   8102  C  CB  . TYR D  1 239 ? -41.645  79.919  68.215  1.00 28.53 ? 231  TYR D CB  1 
ATOM   8103  C  CG  . TYR D  1 239 ? -42.907  79.455  68.915  1.00 29.11 ? 231  TYR D CG  1 
ATOM   8104  C  CD1 . TYR D  1 239 ? -43.106  78.099  69.221  1.00 28.69 ? 231  TYR D CD1 1 
ATOM   8105  C  CD2 . TYR D  1 239 ? -43.937  80.360  69.225  1.00 28.94 ? 231  TYR D CD2 1 
ATOM   8106  C  CE1 . TYR D  1 239 ? -44.309  77.674  69.865  1.00 29.55 ? 231  TYR D CE1 1 
ATOM   8107  C  CE2 . TYR D  1 239 ? -45.115  79.949  69.853  1.00 29.03 ? 231  TYR D CE2 1 
ATOM   8108  C  CZ  . TYR D  1 239 ? -45.288  78.613  70.181  1.00 29.73 ? 231  TYR D CZ  1 
ATOM   8109  O  OH  . TYR D  1 239 ? -46.447  78.225  70.792  1.00 32.29 ? 231  TYR D OH  1 
ATOM   8110  N  N   . ARG D  1 240 ? -43.973  79.633  65.751  1.00 29.34 ? 232  ARG D N   1 
ATOM   8111  C  CA  . ARG D  1 240 ? -45.289  80.127  65.369  1.00 31.12 ? 232  ARG D CA  1 
ATOM   8112  C  C   . ARG D  1 240 ? -46.283  79.003  65.620  1.00 31.21 ? 232  ARG D C   1 
ATOM   8113  O  O   . ARG D  1 240 ? -46.138  77.912  65.103  1.00 29.44 ? 232  ARG D O   1 
ATOM   8114  C  CB  . ARG D  1 240 ? -45.311  80.548  63.920  1.00 32.06 ? 232  ARG D CB  1 
ATOM   8115  C  CG  . ARG D  1 240 ? -46.690  81.017  63.390  1.00 35.78 ? 232  ARG D CG  1 
ATOM   8116  C  CD  . ARG D  1 240 ? -46.569  81.700  61.995  1.00 40.81 ? 232  ARG D CD  1 
ATOM   8117  N  NE  . ARG D  1 240 ? -46.316  80.826  60.818  1.00 45.38 ? 232  ARG D NE  1 
ATOM   8118  C  CZ  . ARG D  1 240 ? -47.156  79.846  60.358  1.00 49.11 ? 232  ARG D CZ  1 
ATOM   8119  N  NH1 . ARG D  1 240 ? -48.322  79.531  61.005  1.00 45.12 ? 232  ARG D NH1 1 
ATOM   8120  N  NH2 . ARG D  1 240 ? -46.805  79.111  59.253  1.00 45.78 ? 232  ARG D NH2 1 
ATOM   8121  N  N   . LYS D  1 241 ? -47.240  79.259  66.504  1.00 32.88 ? 233  LYS D N   1 
ATOM   8122  C  CA  . LYS D  1 241 ? -48.212  78.255  66.951  1.00 33.37 ? 233  LYS D CA  1 
ATOM   8123  C  C   . LYS D  1 241 ? -49.053  77.876  65.745  1.00 31.88 ? 233  LYS D C   1 
ATOM   8124  O  O   . LYS D  1 241 ? -49.561  78.746  65.079  1.00 31.84 ? 233  LYS D O   1 
ATOM   8125  C  CB  . LYS D  1 241 ? -49.071  78.847  68.080  1.00 35.30 ? 233  LYS D CB  1 
ATOM   8126  C  CG  . LYS D  1 241 ? -50.249  77.966  68.569  1.00 39.73 ? 233  LYS D CG  1 
ATOM   8127  C  CD  . LYS D  1 241 ? -49.867  77.143  69.758  1.00 46.82 ? 233  LYS D CD  1 
ATOM   8128  C  CE  . LYS D  1 241 ? -51.078  76.356  70.301  1.00 51.31 ? 233  LYS D CE  1 
ATOM   8129  N  NZ  . LYS D  1 241 ? -50.674  74.960  70.759  1.00 53.98 ? 233  LYS D NZ  1 
ATOM   8130  N  N   . GLY D  1 242 ? -49.087  76.590  65.401  1.00 30.70 ? 234  GLY D N   1 
ATOM   8131  C  CA  . GLY D  1 242 ? -49.751  76.142  64.175  1.00 30.35 ? 234  GLY D CA  1 
ATOM   8132  C  C   . GLY D  1 242 ? -48.854  75.927  62.944  1.00 29.67 ? 234  GLY D C   1 
ATOM   8133  O  O   . GLY D  1 242 ? -49.290  75.296  61.981  1.00 29.00 ? 234  GLY D O   1 
ATOM   8134  N  N   . ALA D  1 243 ? -47.613  76.425  62.966  1.00 28.12 ? 235  ALA D N   1 
ATOM   8135  C  CA  . ALA D  1 243 ? -46.645  76.084  61.908  1.00 27.38 ? 235  ALA D CA  1 
ATOM   8136  C  C   . ALA D  1 243 ? -46.241  74.609  62.111  1.00 26.15 ? 235  ALA D C   1 
ATOM   8137  O  O   . ALA D  1 243 ? -46.377  74.067  63.199  1.00 25.69 ? 235  ALA D O   1 
ATOM   8138  C  CB  . ALA D  1 243 ? -45.398  77.010  61.945  1.00 26.43 ? 235  ALA D CB  1 
ATOM   8139  N  N   . VAL D  1 244 ? -45.801  73.963  61.050  1.00 24.66 ? 236  VAL D N   1 
ATOM   8140  C  CA  . VAL D  1 244 ? -45.196  72.647  61.152  1.00 24.05 ? 236  VAL D CA  1 
ATOM   8141  C  C   . VAL D  1 244 ? -44.065  72.571  60.118  1.00 23.01 ? 236  VAL D C   1 
ATOM   8142  O  O   . VAL D  1 244 ? -44.177  73.122  59.021  1.00 22.19 ? 236  VAL D O   1 
ATOM   8143  C  CB  . VAL D  1 244 ? -46.237  71.463  60.962  1.00 24.63 ? 236  VAL D CB  1 
ATOM   8144  C  CG1 . VAL D  1 244 ? -46.933  71.561  59.643  1.00 24.80 ? 236  VAL D CG1 1 
ATOM   8145  C  CG2 . VAL D  1 244 ? -45.551  70.117  61.005  1.00 23.87 ? 236  VAL D CG2 1 
ATOM   8146  N  N   . SER D  1 245 ? -42.973  71.912  60.496  1.00 22.24 ? 237  SER D N   1 
ATOM   8147  C  CA  . SER D  1 245 ? -41.878  71.678  59.602  1.00 22.21 ? 237  SER D CA  1 
ATOM   8148  C  C   . SER D  1 245 ? -41.598  70.185  59.592  1.00 22.14 ? 237  SER D C   1 
ATOM   8149  O  O   . SER D  1 245 ? -41.861  69.503  60.571  1.00 23.22 ? 237  SER D O   1 
ATOM   8150  C  CB  . SER D  1 245 ? -40.646  72.484  60.064  1.00 22.76 ? 237  SER D CB  1 
ATOM   8151  O  OG  . SER D  1 245 ? -40.800  73.906  59.850  1.00 24.16 ? 237  SER D OG  1 
ATOM   8152  N  N   . ILE D  1 246 ? -41.081  69.688  58.474  1.00 21.54 ? 238  ILE D N   1 
ATOM   8153  C  CA  . ILE D  1 246 ? -40.627  68.326  58.311  1.00 19.43 ? 238  ILE D CA  1 
ATOM   8154  C  C   . ILE D  1 246 ? -39.168  68.395  58.006  1.00 18.99 ? 238  ILE D C   1 
ATOM   8155  O  O   . ILE D  1 246 ? -38.751  69.240  57.221  1.00 19.06 ? 238  ILE D O   1 
ATOM   8156  C  CB  . ILE D  1 246 ? -41.297  67.652  57.086  1.00 19.83 ? 238  ILE D CB  1 
ATOM   8157  C  CG1 . ILE D  1 246 ? -42.851  67.761  57.157  1.00 20.71 ? 238  ILE D CG1 1 
ATOM   8158  C  CG2 . ILE D  1 246 ? -40.849  66.153  56.948  1.00 15.99 ? 238  ILE D CG2 1 
ATOM   8159  C  CD1 . ILE D  1 246 ? -43.570  67.001  58.391  1.00 16.26 ? 238  ILE D CD1 1 
ATOM   8160  N  N   . GLY D  1 247 ? -38.388  67.497  58.596  1.00 18.87 ? 239  GLY D N   1 
ATOM   8161  C  CA  . GLY D  1 247 ? -36.962  67.474  58.420  1.00 18.94 ? 239  GLY D CA  1 
ATOM   8162  C  C   . GLY D  1 247 ? -36.366  66.080  58.494  1.00 19.28 ? 239  GLY D C   1 
ATOM   8163  O  O   . GLY D  1 247 ? -37.071  65.119  58.811  1.00 20.16 ? 239  GLY D O   1 
ATOM   8164  N  N   . VAL D  1 248 ? -35.078  65.969  58.140  1.00 18.87 ? 240  VAL D N   1 
ATOM   8165  C  CA  . VAL D  1 248 ? -34.333  64.720  58.149  1.00 18.02 ? 240  VAL D CA  1 
ATOM   8166  C  C   . VAL D  1 248 ? -33.195  64.806  59.160  1.00 18.51 ? 240  VAL D C   1 
ATOM   8167  O  O   . VAL D  1 248 ? -32.510  65.821  59.212  1.00 18.77 ? 240  VAL D O   1 
ATOM   8168  C  CB  . VAL D  1 248 ? -33.713  64.472  56.755  1.00 18.09 ? 240  VAL D CB  1 
ATOM   8169  C  CG1 . VAL D  1 248 ? -32.934  63.157  56.714  1.00 16.12 ? 240  VAL D CG1 1 
ATOM   8170  C  CG2 . VAL D  1 248 ? -34.784  64.546  55.684  1.00 14.77 ? 240  VAL D CG2 1 
ATOM   8171  N  N   . VAL D  1 249 ? -32.978  63.739  59.945  1.00 18.77 ? 241  VAL D N   1 
ATOM   8172  C  CA  . VAL D  1 249 ? -31.928  63.702  60.956  1.00 18.21 ? 241  VAL D CA  1 
ATOM   8173  C  C   . VAL D  1 249 ? -30.623  63.393  60.267  1.00 19.25 ? 241  VAL D C   1 
ATOM   8174  O  O   . VAL D  1 249 ? -30.554  62.412  59.511  1.00 19.88 ? 241  VAL D O   1 
ATOM   8175  C  CB  . VAL D  1 249 ? -32.202  62.650  62.090  1.00 19.47 ? 241  VAL D CB  1 
ATOM   8176  C  CG1 . VAL D  1 249 ? -31.010  62.540  63.041  1.00 16.07 ? 241  VAL D CG1 1 
ATOM   8177  C  CG2 . VAL D  1 249 ? -33.484  62.968  62.862  1.00 17.21 ? 241  VAL D CG2 1 
ATOM   8178  N  N   . VAL D  1 250 ? -29.575  64.199  60.526  1.00 19.24 ? 242  VAL D N   1 
ATOM   8179  C  CA  . VAL D  1 250 ? -28.359  64.153  59.697  1.00 19.29 ? 242  VAL D CA  1 
ATOM   8180  C  C   . VAL D  1 250 ? -27.049  63.928  60.441  1.00 20.11 ? 242  VAL D C   1 
ATOM   8181  O  O   . VAL D  1 250 ? -26.048  63.532  59.797  1.00 19.32 ? 242  VAL D O   1 
ATOM   8182  C  CB  . VAL D  1 250 ? -28.214  65.420  58.871  1.00 19.16 ? 242  VAL D CB  1 
ATOM   8183  C  CG1 . VAL D  1 250 ? -29.446  65.624  58.035  1.00 19.13 ? 242  VAL D CG1 1 
ATOM   8184  C  CG2 . VAL D  1 250 ? -28.030  66.618  59.785  1.00 18.35 ? 242  VAL D CG2 1 
ATOM   8185  N  N   . HIS D  1 251 ? -27.023  64.191  61.749  1.00 19.89 ? 243  HIS D N   1 
ATOM   8186  C  CA  . HIS D  1 251 ? -25.859  63.826  62.557  1.00 20.42 ? 243  HIS D CA  1 
ATOM   8187  C  C   . HIS D  1 251 ? -26.192  63.336  63.969  1.00 21.02 ? 243  HIS D C   1 
ATOM   8188  O  O   . HIS D  1 251 ? -27.313  63.427  64.447  1.00 21.06 ? 243  HIS D O   1 
ATOM   8189  C  CB  . HIS D  1 251 ? -24.803  64.969  62.601  1.00 21.02 ? 243  HIS D CB  1 
ATOM   8190  C  CG  . HIS D  1 251 ? -25.207  66.182  63.392  1.00 20.07 ? 243  HIS D CG  1 
ATOM   8191  N  ND1 . HIS D  1 251 ? -25.331  66.174  64.759  1.00 24.18 ? 243  HIS D ND1 1 
ATOM   8192  C  CD2 . HIS D  1 251 ? -25.488  67.444  63.006  1.00 21.78 ? 243  HIS D CD2 1 
ATOM   8193  C  CE1 . HIS D  1 251 ? -25.678  67.380  65.182  1.00 23.43 ? 243  HIS D CE1 1 
ATOM   8194  N  NE2 . HIS D  1 251 ? -25.775  68.171  64.130  1.00 20.66 ? 243  HIS D NE2 1 
ATOM   8195  N  N   . SER D  1 252 ? -25.175  62.817  64.637  1.00 22.45 ? 244  SER D N   1 
ATOM   8196  C  CA  . SER D  1 252 ? -25.358  62.057  65.902  1.00 23.58 ? 244  SER D CA  1 
ATOM   8197  C  C   . SER D  1 252 ? -25.659  62.987  67.044  1.00 24.05 ? 244  SER D C   1 
ATOM   8198  O  O   . SER D  1 252 ? -25.531  64.189  66.923  1.00 24.63 ? 244  SER D O   1 
ATOM   8199  C  CB  . SER D  1 252 ? -24.098  61.248  66.206  1.00 22.90 ? 244  SER D CB  1 
ATOM   8200  O  OG  . SER D  1 252 ? -23.203  62.039  66.994  1.00 26.02 ? 244  SER D OG  1 
ATOM   8201  N  N   . ALA D  1 253 ? -26.055  62.429  68.164  1.00 25.99 ? 245  ALA D N   1 
ATOM   8202  C  CA  . ALA D  1 253 ? -26.216  63.200  69.421  1.00 27.14 ? 245  ALA D CA  1 
ATOM   8203  C  C   . ALA D  1 253 ? -24.950  63.913  69.867  1.00 28.87 ? 245  ALA D C   1 
ATOM   8204  O  O   . ALA D  1 253 ? -23.846  63.662  69.381  1.00 28.93 ? 245  ALA D O   1 
ATOM   8205  C  CB  . ALA D  1 253 ? -26.672  62.301  70.542  1.00 26.98 ? 245  ALA D CB  1 
ATOM   8206  N  N   . CYS D  1 254 ? -25.138  64.827  70.811  1.00 31.01 ? 246  CYS D N   1 
ATOM   8207  C  CA  . CYS D  1 254 ? -24.075  65.701  71.273  1.00 32.77 ? 246  CYS D CA  1 
ATOM   8208  C  C   . CYS D  1 254 ? -24.063  65.780  72.803  1.00 32.87 ? 246  CYS D C   1 
ATOM   8209  O  O   . CYS D  1 254 ? -25.089  65.556  73.472  1.00 33.84 ? 246  CYS D O   1 
ATOM   8210  C  CB  . CYS D  1 254 ? -24.245  67.098  70.663  1.00 33.19 ? 246  CYS D CB  1 
ATOM   8211  S  SG  . CYS D  1 254 ? -24.288  67.058  68.802  1.00 38.09 ? 246  CYS D SG  1 
ATOM   8212  N  N   . VAL D  1 255 ? -22.897  66.107  73.348  1.00 32.09 ? 247  VAL D N   1 
ATOM   8213  C  CA  . VAL D  1 255 ? -22.715  66.132  74.799  1.00 31.70 ? 247  VAL D CA  1 
ATOM   8214  C  C   . VAL D  1 255 ? -22.955  67.535  75.407  1.00 31.22 ? 247  VAL D C   1 
ATOM   8215  O  O   . VAL D  1 255 ? -23.320  67.635  76.559  1.00 31.17 ? 247  VAL D O   1 
ATOM   8216  C  CB  . VAL D  1 255 ? -21.319  65.574  75.180  1.00 32.14 ? 247  VAL D CB  1 
ATOM   8217  C  CG1 . VAL D  1 255 ? -21.179  64.111  74.666  1.00 30.44 ? 247  VAL D CG1 1 
ATOM   8218  C  CG2 . VAL D  1 255 ? -20.227  66.500  74.661  1.00 29.86 ? 247  VAL D CG2 1 
ATOM   8219  N  N   . SER D  1 256 ? -22.799  68.587  74.614  1.00 30.88 ? 248  SER D N   1 
ATOM   8220  C  CA  . SER D  1 256 ? -22.923  69.990  75.085  1.00 31.72 ? 248  SER D CA  1 
ATOM   8221  C  C   . SER D  1 256 ? -24.341  70.580  75.067  1.00 31.17 ? 248  SER D C   1 
ATOM   8222  O  O   . SER D  1 256 ? -25.207  70.190  74.271  1.00 30.26 ? 248  SER D O   1 
ATOM   8223  C  CB  . SER D  1 256 ? -22.056  70.941  74.201  1.00 31.85 ? 248  SER D CB  1 
ATOM   8224  O  OG  . SER D  1 256 ? -20.717  70.452  74.135  1.00 33.71 ? 248  SER D OG  1 
ATOM   8225  N  N   . ALA D  1 257 ? -24.508  71.609  75.892  1.00 30.61 ? 249  ALA D N   1 
ATOM   8226  C  CA  . ALA D  1 257 ? -25.797  72.226  76.113  1.00 30.44 ? 249  ALA D CA  1 
ATOM   8227  C  C   . ALA D  1 257 ? -26.304  72.884  74.809  1.00 29.54 ? 249  ALA D C   1 
ATOM   8228  O  O   . ALA D  1 257 ? -25.531  73.536  74.075  1.00 29.18 ? 249  ALA D O   1 
ATOM   8229  C  CB  . ALA D  1 257 ? -25.719  73.251  77.302  1.00 30.81 ? 249  ALA D CB  1 
ATOM   8230  N  N   . GLY D  1 258 ? -27.587  72.659  74.509  1.00 28.55 ? 250  GLY D N   1 
ATOM   8231  C  CA  . GLY D  1 258 ? -28.234  73.248  73.332  1.00 28.35 ? 250  GLY D CA  1 
ATOM   8232  C  C   . GLY D  1 258 ? -28.019  72.453  72.051  1.00 28.11 ? 250  GLY D C   1 
ATOM   8233  O  O   . GLY D  1 258 ? -28.572  72.798  71.014  1.00 28.02 ? 250  GLY D O   1 
ATOM   8234  N  N   . HIS D  1 259 ? -27.236  71.383  72.120  1.00 28.06 ? 251  HIS D N   1 
ATOM   8235  C  CA  . HIS D  1 259 ? -26.951  70.593  70.943  1.00 28.13 ? 251  HIS D CA  1 
ATOM   8236  C  C   . HIS D  1 259 ? -27.591  69.197  70.994  1.00 27.68 ? 251  HIS D C   1 
ATOM   8237  O  O   . HIS D  1 259 ? -28.033  68.696  72.036  1.00 27.64 ? 251  HIS D O   1 
ATOM   8238  C  CB  . HIS D  1 259 ? -25.434  70.452  70.723  1.00 28.24 ? 251  HIS D CB  1 
ATOM   8239  C  CG  . HIS D  1 259 ? -24.751  71.725  70.354  1.00 29.47 ? 251  HIS D CG  1 
ATOM   8240  N  ND1 . HIS D  1 259 ? -24.426  72.048  69.049  1.00 32.74 ? 251  HIS D ND1 1 
ATOM   8241  C  CD2 . HIS D  1 259 ? -24.315  72.753  71.117  1.00 30.76 ? 251  HIS D CD2 1 
ATOM   8242  C  CE1 . HIS D  1 259 ? -23.810  73.219  69.038  1.00 33.39 ? 251  HIS D CE1 1 
ATOM   8243  N  NE2 . HIS D  1 259 ? -23.741  73.674  70.282  1.00 30.67 ? 251  HIS D NE2 1 
ATOM   8244  N  N   . GLY D  1 260 ? -27.604  68.561  69.832  1.00 27.03 ? 252  GLY D N   1 
ATOM   8245  C  CA  . GLY D  1 260 ? -28.112  67.192  69.702  1.00 26.27 ? 252  GLY D CA  1 
ATOM   8246  C  C   . GLY D  1 260 ? -28.237  66.901  68.239  1.00 25.33 ? 252  GLY D C   1 
ATOM   8247  O  O   . GLY D  1 260 ? -27.735  67.688  67.403  1.00 26.25 ? 252  GLY D O   1 
ATOM   8248  N  N   . PRO D  1 261 ? -28.903  65.791  67.895  1.00 24.39 ? 253  PRO D N   1 
ATOM   8249  C  CA  . PRO D  1 261 ? -28.947  65.350  66.502  1.00 23.93 ? 253  PRO D CA  1 
ATOM   8250  C  C   . PRO D  1 261 ? -29.492  66.408  65.577  1.00 22.30 ? 253  PRO D C   1 
ATOM   8251  O  O   . PRO D  1 261 ? -30.502  67.010  65.858  1.00 22.06 ? 253  PRO D O   1 
ATOM   8252  C  CB  . PRO D  1 261 ? -29.878  64.123  66.546  1.00 24.27 ? 253  PRO D CB  1 
ATOM   8253  C  CG  . PRO D  1 261 ? -29.767  63.649  67.882  1.00 24.14 ? 253  PRO D CG  1 
ATOM   8254  C  CD  . PRO D  1 261 ? -29.672  64.886  68.744  1.00 24.70 ? 253  PRO D CD  1 
ATOM   8255  N  N   . GLY D  1 262 ? -28.779  66.645  64.491  1.00 22.00 ? 254  GLY D N   1 
ATOM   8256  C  CA  . GLY D  1 262 ? -29.103  67.748  63.605  1.00 21.41 ? 254  GLY D CA  1 
ATOM   8257  C  C   . GLY D  1 262 ? -30.242  67.381  62.696  1.00 20.66 ? 254  GLY D C   1 
ATOM   8258  O  O   . GLY D  1 262 ? -30.338  66.242  62.256  1.00 18.52 ? 254  GLY D O   1 
ATOM   8259  N  N   . VAL D  1 263 ? -31.081  68.367  62.401  1.00 20.90 ? 255  VAL D N   1 
ATOM   8260  C  CA  . VAL D  1 263 ? -32.167  68.220  61.434  1.00 20.82 ? 255  VAL D CA  1 
ATOM   8261  C  C   . VAL D  1 263 ? -32.054  69.217  60.282  1.00 20.45 ? 255  VAL D C   1 
ATOM   8262  O  O   . VAL D  1 263 ? -31.903  70.398  60.535  1.00 21.11 ? 255  VAL D O   1 
ATOM   8263  C  CB  . VAL D  1 263 ? -33.548  68.424  62.145  1.00 21.70 ? 255  VAL D CB  1 
ATOM   8264  C  CG1 . VAL D  1 263 ? -34.739  68.334  61.131  1.00 22.12 ? 255  VAL D CG1 1 
ATOM   8265  C  CG2 . VAL D  1 263 ? -33.678  67.400  63.255  1.00 21.35 ? 255  VAL D CG2 1 
ATOM   8266  N  N   . VAL D  1 264 ? -32.127  68.728  59.038  1.00 19.64 ? 256  VAL D N   1 
ATOM   8267  C  CA  . VAL D  1 264 ? -32.261  69.545  57.870  1.00 19.19 ? 256  VAL D CA  1 
ATOM   8268  C  C   . VAL D  1 264 ? -33.735  69.605  57.471  1.00 20.19 ? 256  VAL D C   1 
ATOM   8269  O  O   . VAL D  1 264 ? -34.379  68.554  57.308  1.00 20.47 ? 256  VAL D O   1 
ATOM   8270  C  CB  . VAL D  1 264 ? -31.397  69.018  56.719  1.00 19.65 ? 256  VAL D CB  1 
ATOM   8271  C  CG1 . VAL D  1 264 ? -31.786  69.659  55.322  1.00 16.31 ? 256  VAL D CG1 1 
ATOM   8272  C  CG2 . VAL D  1 264 ? -29.921  69.267  57.064  1.00 18.98 ? 256  VAL D CG2 1 
ATOM   8273  N  N   . VAL D  1 265 ? -34.266  70.823  57.318  1.00 19.55 ? 257  VAL D N   1 
ATOM   8274  C  CA  . VAL D  1 265 ? -35.660  70.982  56.993  1.00 19.98 ? 257  VAL D CA  1 
ATOM   8275  C  C   . VAL D  1 265 ? -35.879  70.691  55.502  1.00 21.00 ? 257  VAL D C   1 
ATOM   8276  O  O   . VAL D  1 265 ? -35.080  71.127  54.656  1.00 22.40 ? 257  VAL D O   1 
ATOM   8277  C  CB  . VAL D  1 265 ? -36.174  72.367  57.336  1.00 19.63 ? 257  VAL D CB  1 
ATOM   8278  C  CG1 . VAL D  1 265 ? -37.635  72.471  56.950  1.00 20.36 ? 257  VAL D CG1 1 
ATOM   8279  C  CG2 . VAL D  1 265 ? -36.065  72.641  58.837  1.00 17.83 ? 257  VAL D CG2 1 
ATOM   8280  N  N   . ILE D  1 266 ? -36.925  69.923  55.186  1.00 20.94 ? 258  ILE D N   1 
ATOM   8281  C  CA  . ILE D  1 266 ? -37.338  69.667  53.806  1.00 20.04 ? 258  ILE D CA  1 
ATOM   8282  C  C   . ILE D  1 266 ? -38.718  70.189  53.436  1.00 20.72 ? 258  ILE D C   1 
ATOM   8283  O  O   . ILE D  1 266 ? -39.014  70.311  52.260  1.00 19.94 ? 258  ILE D O   1 
ATOM   8284  C  CB  . ILE D  1 266 ? -37.258  68.197  53.451  1.00 20.67 ? 258  ILE D CB  1 
ATOM   8285  C  CG1 . ILE D  1 266 ? -38.277  67.339  54.210  1.00 20.73 ? 258  ILE D CG1 1 
ATOM   8286  C  CG2 . ILE D  1 266 ? -35.792  67.664  53.644  1.00 19.44 ? 258  ILE D CG2 1 
ATOM   8287  C  CD1 . ILE D  1 266 ? -38.278  65.799  53.749  1.00 17.48 ? 258  ILE D CD1 1 
ATOM   8288  N  N   . MET D  1 267 ? -39.553  70.525  54.420  1.00 21.99 ? 259  MET D N   1 
ATOM   8289  C  CA  . MET D  1 267 ? -40.877  71.065  54.164  1.00 22.89 ? 259  MET D CA  1 
ATOM   8290  C  C   . MET D  1 267 ? -41.333  71.894  55.348  1.00 22.35 ? 259  MET D C   1 
ATOM   8291  O  O   . MET D  1 267 ? -41.066  71.548  56.484  1.00 21.20 ? 259  MET D O   1 
ATOM   8292  C  CB  . MET D  1 267 ? -41.859  69.927  53.869  1.00 23.34 ? 259  MET D CB  1 
ATOM   8293  C  CG  . MET D  1 267 ? -43.298  70.320  53.644  1.00 27.50 ? 259  MET D CG  1 
ATOM   8294  S  SD  . MET D  1 267 ? -44.445  68.915  53.237  1.00 34.68 ? 259  MET D SD  1 
ATOM   8295  C  CE  . MET D  1 267 ? -43.548  67.956  52.047  1.00 32.77 ? 259  MET D CE  1 
ATOM   8296  N  N   . THR D  1 268 ? -42.009  72.998  55.072  1.00 22.39 ? 260  THR D N   1 
ATOM   8297  C  CA  . THR D  1 268 ? -42.528  73.818  56.129  1.00 23.75 ? 260  THR D CA  1 
ATOM   8298  C  C   . THR D  1 268 ? -43.813  74.497  55.713  1.00 24.67 ? 260  THR D C   1 
ATOM   8299  O  O   . THR D  1 268 ? -44.002  74.787  54.548  1.00 24.24 ? 260  THR D O   1 
ATOM   8300  C  CB  . THR D  1 268 ? -41.466  74.880  56.556  1.00 24.77 ? 260  THR D CB  1 
ATOM   8301  O  OG1 . THR D  1 268 ? -41.896  75.535  57.742  1.00 23.73 ? 260  THR D OG1 1 
ATOM   8302  C  CG2 . THR D  1 268 ? -41.201  75.888  55.455  1.00 21.51 ? 260  THR D CG2 1 
ATOM   8303  N  N   . GLY D  1 269 ? -44.707  74.749  56.664  1.00 25.94 ? 261  GLY D N   1 
ATOM   8304  C  CA  . GLY D  1 269 ? -46.031  75.307  56.338  1.00 26.79 ? 261  GLY D CA  1 
ATOM   8305  C  C   . GLY D  1 269 ? -46.981  75.302  57.511  1.00 27.94 ? 261  GLY D C   1 
ATOM   8306  O  O   . GLY D  1 269 ? -46.569  75.241  58.639  1.00 28.67 ? 261  GLY D O   1 
ATOM   8307  N  N   . ASP D  1 270 ? -48.269  75.353  57.239  1.00 29.59 ? 262  ASP D N   1 
ATOM   8308  C  CA  . ASP D  1 270 ? -49.271  75.385  58.268  1.00 30.32 ? 262  ASP D CA  1 
ATOM   8309  C  C   . ASP D  1 270 ? -49.805  73.987  58.581  1.00 29.96 ? 262  ASP D C   1 
ATOM   8310  O  O   . ASP D  1 270 ? -49.929  73.143  57.704  1.00 27.53 ? 262  ASP D O   1 
ATOM   8311  C  CB  . ASP D  1 270 ? -50.423  76.317  57.880  1.00 30.96 ? 262  ASP D CB  1 
ATOM   8312  C  CG  . ASP D  1 270 ? -51.424  76.475  59.028  1.00 35.77 ? 262  ASP D CG  1 
ATOM   8313  O  OD1 . ASP D  1 270 ? -51.143  77.199  60.010  1.00 41.87 ? 262  ASP D OD1 1 
ATOM   8314  O  OD2 . ASP D  1 270 ? -52.465  75.796  59.026  1.00 41.07 ? 262  ASP D OD2 1 
ATOM   8315  N  N   . GLU D  1 271 ? -50.156  73.768  59.843  1.00 30.92 ? 263  GLU D N   1 
ATOM   8316  C  CA  . GLU D  1 271 ? -50.735  72.487  60.294  1.00 32.84 ? 263  GLU D CA  1 
ATOM   8317  C  C   . GLU D  1 271 ? -52.091  72.099  59.658  1.00 32.85 ? 263  GLU D C   1 
ATOM   8318  O  O   . GLU D  1 271 ? -52.515  70.941  59.741  1.00 31.72 ? 263  GLU D O   1 
ATOM   8319  C  CB  . GLU D  1 271 ? -50.893  72.477  61.817  1.00 33.24 ? 263  GLU D CB  1 
ATOM   8320  C  CG  . GLU D  1 271 ? -52.129  73.190  62.305  1.00 37.26 ? 263  GLU D CG  1 
ATOM   8321  C  CD  . GLU D  1 271 ? -52.196  73.340  63.830  1.00 41.75 ? 263  GLU D CD  1 
ATOM   8322  O  OE1 . GLU D  1 271 ? -51.450  72.648  64.600  1.00 43.63 ? 263  GLU D OE1 1 
ATOM   8323  O  OE2 . GLU D  1 271 ? -52.982  74.221  64.219  1.00 42.96 ? 263  GLU D OE2 1 
ATOM   8324  N  N   . SER D  1 272 ? -52.758  73.070  59.057  1.00 33.19 ? 264  SER D N   1 
ATOM   8325  C  CA  . SER D  1 272 ? -53.970  72.807  58.336  1.00 34.85 ? 264  SER D CA  1 
ATOM   8326  C  C   . SER D  1 272 ? -53.645  72.137  57.003  1.00 34.98 ? 264  SER D C   1 
ATOM   8327  O  O   . SER D  1 272 ? -54.538  71.671  56.352  1.00 36.81 ? 264  SER D O   1 
ATOM   8328  C  CB  . SER D  1 272 ? -54.760  74.106  58.072  1.00 34.36 ? 264  SER D CB  1 
ATOM   8329  O  OG  . SER D  1 272 ? -54.107  74.934  57.105  1.00 36.64 ? 264  SER D OG  1 
ATOM   8330  N  N   . LYS D  1 273 ? -52.406  72.175  56.550  1.00 33.80 ? 265  LYS D N   1 
ATOM   8331  C  CA  . LYS D  1 273 ? -52.084  71.617  55.287  1.00 33.52 ? 265  LYS D CA  1 
ATOM   8332  C  C   . LYS D  1 273 ? -51.096  70.484  55.385  1.00 31.58 ? 265  LYS D C   1 
ATOM   8333  O  O   . LYS D  1 273 ? -51.158  69.599  54.570  1.00 31.39 ? 265  LYS D O   1 
ATOM   8334  C  CB  . LYS D  1 273 ? -51.560  72.686  54.359  1.00 34.77 ? 265  LYS D CB  1 
ATOM   8335  C  CG  . LYS D  1 273 ? -52.639  73.332  53.521  1.00 41.29 ? 265  LYS D CG  1 
ATOM   8336  C  CD  . LYS D  1 273 ? -52.470  74.851  53.494  1.00 49.37 ? 265  LYS D CD  1 
ATOM   8337  C  CE  . LYS D  1 273 ? -53.686  75.570  52.830  1.00 53.48 ? 265  LYS D CE  1 
ATOM   8338  N  NZ  . LYS D  1 273 ? -53.238  77.007  52.615  1.00 56.43 ? 265  LYS D NZ  1 
ATOM   8339  N  N   . ILE D  1 274 ? -50.176  70.499  56.345  1.00 29.39 ? 266  ILE D N   1 
ATOM   8340  C  CA  . ILE D  1 274 ? -49.222  69.435  56.441  1.00 27.54 ? 266  ILE D CA  1 
ATOM   8341  C  C   . ILE D  1 274 ? -49.663  68.632  57.617  1.00 27.73 ? 266  ILE D C   1 
ATOM   8342  O  O   . ILE D  1 274 ? -49.792  69.179  58.689  1.00 28.43 ? 266  ILE D O   1 
ATOM   8343  C  CB  . ILE D  1 274 ? -47.804  69.935  56.677  1.00 27.59 ? 266  ILE D CB  1 
ATOM   8344  C  CG1 . ILE D  1 274 ? -47.402  70.948  55.589  1.00 27.34 ? 266  ILE D CG1 1 
ATOM   8345  C  CG2 . ILE D  1 274 ? -46.844  68.760  56.792  1.00 22.94 ? 266  ILE D CG2 1 
ATOM   8346  C  CD1 . ILE D  1 274 ? -46.072  71.623  55.847  1.00 26.45 ? 266  ILE D CD1 1 
ATOM   8347  N  N   . LEU D  1 275 ? -49.899  67.338  57.413  1.00 27.14 ? 267  LEU D N   1 
ATOM   8348  C  CA  . LEU D  1 275 ? -50.361  66.470  58.448  1.00 27.77 ? 267  LEU D CA  1 
ATOM   8349  C  C   . LEU D  1 275 ? -49.349  65.354  58.683  1.00 26.93 ? 267  LEU D C   1 
ATOM   8350  O  O   . LEU D  1 275 ? -49.350  64.347  57.969  1.00 26.69 ? 267  LEU D O   1 
ATOM   8351  C  CB  . LEU D  1 275 ? -51.729  65.878  58.105  1.00 28.10 ? 267  LEU D CB  1 
ATOM   8352  C  CG  . LEU D  1 275 ? -52.967  66.772  57.876  1.00 32.21 ? 267  LEU D CG  1 
ATOM   8353  C  CD1 . LEU D  1 275 ? -54.241  65.889  57.756  1.00 32.05 ? 267  LEU D CD1 1 
ATOM   8354  C  CD2 . LEU D  1 275 ? -53.182  67.761  58.934  1.00 32.89 ? 267  LEU D CD2 1 
ATOM   8355  N  N   . PRO D  1 276 ? -48.510  65.494  59.713  1.00 27.32 ? 268  PRO D N   1 
ATOM   8356  C  CA  . PRO D  1 276 ? -47.581  64.420  60.039  1.00 27.99 ? 268  PRO D CA  1 
ATOM   8357  C  C   . PRO D  1 276 ? -48.252  63.216  60.647  1.00 28.15 ? 268  PRO D C   1 
ATOM   8358  O  O   . PRO D  1 276 ? -49.109  63.334  61.499  1.00 28.12 ? 268  PRO D O   1 
ATOM   8359  C  CB  . PRO D  1 276 ? -46.643  65.051  61.067  1.00 27.62 ? 268  PRO D CB  1 
ATOM   8360  C  CG  . PRO D  1 276 ? -46.935  66.480  61.061  1.00 27.56 ? 268  PRO D CG  1 
ATOM   8361  C  CD  . PRO D  1 276 ? -48.313  66.639  60.605  1.00 27.85 ? 268  PRO D CD  1 
ATOM   8362  N  N   . GLU D  1 277 ? -47.789  62.063  60.240  1.00 28.95 ? 269  GLU D N   1 
ATOM   8363  C  CA  . GLU D  1 277 ? -48.403  60.823  60.566  1.00 30.68 ? 269  GLU D CA  1 
ATOM   8364  C  C   . GLU D  1 277 ? -47.301  60.013  61.193  1.00 30.25 ? 269  GLU D C   1 
ATOM   8365  O  O   . GLU D  1 277 ? -46.378  59.589  60.518  1.00 29.84 ? 269  GLU D O   1 
ATOM   8366  C  CB  . GLU D  1 277 ? -48.929  60.192  59.258  1.00 31.78 ? 269  GLU D CB  1 
ATOM   8367  C  CG  . GLU D  1 277 ? -50.376  59.729  59.287  1.00 38.43 ? 269  GLU D CG  1 
ATOM   8368  C  CD  . GLU D  1 277 ? -51.425  60.843  59.086  1.00 45.43 ? 269  GLU D CD  1 
ATOM   8369  O  OE1 . GLU D  1 277 ? -51.805  61.115  57.926  1.00 48.61 ? 269  GLU D OE1 1 
ATOM   8370  O  OE2 . GLU D  1 277 ? -51.931  61.394  60.096  1.00 51.54 ? 269  GLU D OE2 1 
ATOM   8371  N  N   . GLU D  1 278 ? -47.346  59.846  62.495  1.00 30.58 ? 270  GLU D N   1 
ATOM   8372  C  CA  . GLU D  1 278 ? -46.355  59.063  63.189  1.00 31.09 ? 270  GLU D CA  1 
ATOM   8373  C  C   . GLU D  1 278 ? -46.449  57.575  62.954  1.00 30.90 ? 270  GLU D C   1 
ATOM   8374  O  O   . GLU D  1 278 ? -47.398  56.964  63.252  1.00 30.90 ? 270  GLU D O   1 
ATOM   8375  C  CB  . GLU D  1 278 ? -46.343  59.356  64.669  1.00 32.18 ? 270  GLU D CB  1 
ATOM   8376  C  CG  . GLU D  1 278 ? -45.227  58.663  65.384  1.00 36.37 ? 270  GLU D CG  1 
ATOM   8377  C  CD  . GLU D  1 278 ? -44.920  59.210  66.743  1.00 42.67 ? 270  GLU D CD  1 
ATOM   8378  O  OE1 . GLU D  1 278 ? -44.377  58.468  67.540  1.00 46.21 ? 270  GLU D OE1 1 
ATOM   8379  O  OE2 . GLU D  1 278 ? -45.228  60.353  67.036  1.00 45.13 ? 270  GLU D OE2 1 
ATOM   8380  N  N   . VAL D  1 279 ? -45.414  57.033  62.358  1.00 31.19 ? 271  VAL D N   1 
ATOM   8381  C  CA  . VAL D  1 279 ? -45.323  55.649  61.997  1.00 30.80 ? 271  VAL D CA  1 
ATOM   8382  C  C   . VAL D  1 279 ? -44.077  55.013  62.541  1.00 32.40 ? 271  VAL D C   1 
ATOM   8383  O  O   . VAL D  1 279 ? -43.275  55.637  63.167  1.00 30.67 ? 271  VAL D O   1 
ATOM   8384  C  CB  . VAL D  1 279 ? -45.371  55.475  60.513  1.00 30.61 ? 271  VAL D CB  1 
ATOM   8385  C  CG1 . VAL D  1 279 ? -46.620  56.020  60.003  1.00 30.15 ? 271  VAL D CG1 1 
ATOM   8386  C  CG2 . VAL D  1 279 ? -44.276  56.192  59.875  1.00 29.33 ? 271  VAL D CG2 1 
ATOM   8387  N  N   . GLU D  1 280 ? -43.943  53.733  62.304  1.00 34.44 ? 272  GLU D N   1 
ATOM   8388  C  CA  . GLU D  1 280 ? -42.872  52.988  62.873  1.00 36.54 ? 272  GLU D CA  1 
ATOM   8389  C  C   . GLU D  1 280 ? -41.543  53.195  62.164  1.00 35.17 ? 272  GLU D C   1 
ATOM   8390  O  O   . GLU D  1 280 ? -40.540  53.294  62.785  1.00 33.73 ? 272  GLU D O   1 
ATOM   8391  C  CB  . GLU D  1 280 ? -43.255  51.513  63.070  1.00 38.81 ? 272  GLU D CB  1 
ATOM   8392  C  CG  . GLU D  1 280 ? -43.871  50.772  61.871  1.00 46.34 ? 272  GLU D CG  1 
ATOM   8393  C  CD  . GLU D  1 280 ? -45.413  50.611  61.887  1.00 54.21 ? 272  GLU D CD  1 
ATOM   8394  O  OE1 . GLU D  1 280 ? -46.087  51.542  61.439  1.00 54.41 ? 272  GLU D OE1 1 
ATOM   8395  O  OE2 . GLU D  1 280 ? -45.940  49.548  62.285  1.00 54.70 ? 272  GLU D OE2 1 
ATOM   8396  N  N   . ARG D  1 281 ? -41.559  53.316  60.864  1.00 33.80 ? 273  ARG D N   1 
ATOM   8397  C  CA  . ARG D  1 281 ? -40.352  53.587  60.138  1.00 32.32 ? 273  ARG D CA  1 
ATOM   8398  C  C   . ARG D  1 281 ? -40.492  54.627  59.058  1.00 29.93 ? 273  ARG D C   1 
ATOM   8399  O  O   . ARG D  1 281 ? -41.380  54.590  58.308  1.00 28.12 ? 273  ARG D O   1 
ATOM   8400  C  CB  . ARG D  1 281 ? -39.772  52.312  59.537  1.00 33.43 ? 273  ARG D CB  1 
ATOM   8401  C  CG  . ARG D  1 281 ? -38.353  52.464  59.162  1.00 36.42 ? 273  ARG D CG  1 
ATOM   8402  C  CD  . ARG D  1 281 ? -37.772  51.276  58.584  1.00 39.53 ? 273  ARG D CD  1 
ATOM   8403  N  NE  . ARG D  1 281 ? -36.497  51.576  57.986  1.00 42.02 ? 273  ARG D NE  1 
ATOM   8404  C  CZ  . ARG D  1 281 ? -35.369  51.739  58.639  1.00 41.58 ? 273  ARG D CZ  1 
ATOM   8405  N  NH1 . ARG D  1 281 ? -35.339  51.629  59.929  1.00 41.10 ? 273  ARG D NH1 1 
ATOM   8406  N  NH2 . ARG D  1 281 ? -34.281  52.011  57.988  1.00 39.08 ? 273  ARG D NH2 1 
ATOM   8407  N  N   . ALA D  1 282 ? -39.565  55.555  59.009  1.00 27.52 ? 274  ALA D N   1 
ATOM   8408  C  CA  . ALA D  1 282 ? -39.513  56.559  57.988  1.00 26.58 ? 274  ALA D CA  1 
ATOM   8409  C  C   . ALA D  1 282 ? -38.064  57.036  57.938  1.00 25.55 ? 274  ALA D C   1 
ATOM   8410  O  O   . ALA D  1 282 ? -37.646  57.852  58.706  1.00 24.65 ? 274  ALA D O   1 
ATOM   8411  C  CB  . ALA D  1 282 ? -40.501  57.709  58.309  1.00 24.89 ? 274  ALA D CB  1 
ATOM   8412  N  N   . ASN D  1 283 ? -37.287  56.477  57.047  1.00 25.42 ? 275  ASN D N   1 
ATOM   8413  C  CA  . ASN D  1 283 ? -35.833  56.703  57.020  1.00 25.51 ? 275  ASN D CA  1 
ATOM   8414  C  C   . ASN D  1 283 ? -35.346  56.715  55.574  1.00 25.71 ? 275  ASN D C   1 
ATOM   8415  O  O   . ASN D  1 283 ? -35.664  55.808  54.825  1.00 25.07 ? 275  ASN D O   1 
ATOM   8416  C  CB  . ASN D  1 283 ? -35.129  55.636  57.841  1.00 25.45 ? 275  ASN D CB  1 
ATOM   8417  C  CG  . ASN D  1 283 ? -33.652  55.946  58.091  1.00 25.16 ? 275  ASN D CG  1 
ATOM   8418  O  OD1 . ASN D  1 283 ? -32.812  55.793  57.205  1.00 24.30 ? 275  ASN D OD1 1 
ATOM   8419  N  ND2 . ASN D  1 283 ? -33.338  56.358  59.304  1.00 22.55 ? 275  ASN D ND2 1 
ATOM   8420  N  N   . ILE D  1 284 ? -34.623  57.765  55.182  1.00 26.29 ? 276  ILE D N   1 
ATOM   8421  C  CA  . ILE D  1 284 ? -34.159  57.903  53.794  1.00 26.32 ? 276  ILE D CA  1 
ATOM   8422  C  C   . ILE D  1 284 ? -33.175  56.797  53.406  1.00 28.02 ? 276  ILE D C   1 
ATOM   8423  O  O   . ILE D  1 284 ? -32.953  56.547  52.228  1.00 28.79 ? 276  ILE D O   1 
ATOM   8424  C  CB  . ILE D  1 284 ? -33.512  59.317  53.495  1.00 26.43 ? 276  ILE D CB  1 
ATOM   8425  C  CG1 . ILE D  1 284 ? -32.122  59.474  54.149  1.00 26.07 ? 276  ILE D CG1 1 
ATOM   8426  C  CG2 . ILE D  1 284 ? -34.453  60.451  53.875  1.00 23.75 ? 276  ILE D CG2 1 
ATOM   8427  C  CD1 . ILE D  1 284 ? -31.434  60.757  53.761  1.00 24.33 ? 276  ILE D CD1 1 
ATOM   8428  N  N   . SER D  1 285 ? -32.569  56.107  54.361  1.00 29.31 ? 277  SER D N   1 
ATOM   8429  C  CA  . SER D  1 285 ? -31.694  55.024  53.940  1.00 31.35 ? 277  SER D CA  1 
ATOM   8430  C  C   . SER D  1 285 ? -32.454  53.949  53.182  1.00 34.03 ? 277  SER D C   1 
ATOM   8431  O  O   . SER D  1 285 ? -31.874  53.245  52.388  1.00 35.60 ? 277  SER D O   1 
ATOM   8432  C  CB  . SER D  1 285 ? -31.010  54.373  55.114  1.00 31.26 ? 277  SER D CB  1 
ATOM   8433  O  OG  . SER D  1 285 ? -31.953  53.703  55.904  1.00 32.99 ? 277  SER D OG  1 
ATOM   8434  N  N   . ASP D  1 286 ? -33.748  53.800  53.421  1.00 36.38 ? 278  ASP D N   1 
ATOM   8435  C  CA  . ASP D  1 286 ? -34.513  52.835  52.655  1.00 38.31 ? 278  ASP D CA  1 
ATOM   8436  C  C   . ASP D  1 286 ? -34.630  53.185  51.184  1.00 40.92 ? 278  ASP D C   1 
ATOM   8437  O  O   . ASP D  1 286 ? -35.061  52.346  50.450  1.00 41.43 ? 278  ASP D O   1 
ATOM   8438  C  CB  . ASP D  1 286 ? -35.928  52.663  53.206  1.00 37.52 ? 278  ASP D CB  1 
ATOM   8439  C  CG  . ASP D  1 286 ? -35.940  52.144  54.624  1.00 36.78 ? 278  ASP D CG  1 
ATOM   8440  O  OD1 . ASP D  1 286 ? -34.994  51.444  54.996  1.00 35.04 ? 278  ASP D OD1 1 
ATOM   8441  O  OD2 . ASP D  1 286 ? -36.872  52.458  55.394  1.00 35.31 ? 278  ASP D OD2 1 
ATOM   8442  N  N   . TYR D  1 287 ? -34.312  54.399  50.729  1.00 43.34 ? 279  TYR D N   1 
ATOM   8443  C  CA  . TYR D  1 287 ? -34.500  54.692  49.309  1.00 45.22 ? 279  TYR D CA  1 
ATOM   8444  C  C   . TYR D  1 287 ? -33.199  55.033  48.600  1.00 47.80 ? 279  TYR D C   1 
ATOM   8445  O  O   . TYR D  1 287 ? -33.217  55.698  47.586  1.00 49.27 ? 279  TYR D O   1 
ATOM   8446  C  CB  . TYR D  1 287 ? -35.478  55.825  49.151  1.00 44.77 ? 279  TYR D CB  1 
ATOM   8447  C  CG  . TYR D  1 287 ? -36.607  55.768  50.127  1.00 45.66 ? 279  TYR D CG  1 
ATOM   8448  C  CD1 . TYR D  1 287 ? -37.644  54.844  49.992  1.00 47.66 ? 279  TYR D CD1 1 
ATOM   8449  C  CD2 . TYR D  1 287 ? -36.651  56.635  51.192  1.00 45.26 ? 279  TYR D CD2 1 
ATOM   8450  C  CE1 . TYR D  1 287 ? -38.713  54.810  50.922  1.00 47.42 ? 279  TYR D CE1 1 
ATOM   8451  C  CE2 . TYR D  1 287 ? -37.693  56.629  52.100  1.00 46.11 ? 279  TYR D CE2 1 
ATOM   8452  C  CZ  . TYR D  1 287 ? -38.718  55.707  51.985  1.00 47.26 ? 279  TYR D CZ  1 
ATOM   8453  O  OH  . TYR D  1 287 ? -39.722  55.715  52.947  1.00 47.71 ? 279  TYR D OH  1 
ATOM   8454  N  N   . LEU D  1 288 ? -32.080  54.548  49.108  1.00 50.47 ? 280  LEU D N   1 
ATOM   8455  C  CA  . LEU D  1 288 ? -30.770  55.014  48.681  1.00 52.42 ? 280  LEU D CA  1 
ATOM   8456  C  C   . LEU D  1 288 ? -29.777  53.842  48.567  1.00 53.43 ? 280  LEU D C   1 
ATOM   8457  O  O   . LEU D  1 288 ? -29.452  53.184  49.581  1.00 54.46 ? 280  LEU D O   1 
ATOM   8458  C  CB  . LEU D  1 288 ? -30.247  56.073  49.709  1.00 52.91 ? 280  LEU D CB  1 
ATOM   8459  C  CG  . LEU D  1 288 ? -30.243  57.594  49.370  1.00 53.89 ? 280  LEU D CG  1 
ATOM   8460  C  CD1 . LEU D  1 288 ? -31.572  58.137  48.879  1.00 50.74 ? 280  LEU D CD1 1 
ATOM   8461  C  CD2 . LEU D  1 288 ? -29.667  58.415  50.566  1.00 53.57 ? 280  LEU D CD2 1 
ATOM   8462  N  N   . GLY E  1 7   ? -10.366  35.243  79.101  1.00 51.06 ? -1   GLY E N   1 
ATOM   8463  C  CA  . GLY E  1 7   ? -11.119  36.288  78.335  1.00 51.23 ? -1   GLY E CA  1 
ATOM   8464  C  C   . GLY E  1 7   ? -10.704  37.738  78.666  1.00 51.14 ? -1   GLY E C   1 
ATOM   8465  O  O   . GLY E  1 7   ? -9.610   37.998  79.229  1.00 51.70 ? -1   GLY E O   1 
ATOM   8466  N  N   . HIS E  1 8   ? -11.569  38.704  78.342  1.00 49.88 ? 0    HIS E N   1 
ATOM   8467  C  CA  . HIS E  1 8   ? -11.161  40.129  78.429  1.00 49.07 ? 0    HIS E CA  1 
ATOM   8468  C  C   . HIS E  1 8   ? -12.070  41.036  79.234  1.00 46.06 ? 0    HIS E C   1 
ATOM   8469  O  O   . HIS E  1 8   ? -13.211  40.721  79.485  1.00 44.73 ? 0    HIS E O   1 
ATOM   8470  C  CB  . HIS E  1 8   ? -10.816  40.653  77.015  1.00 49.78 ? 0    HIS E CB  1 
ATOM   8471  C  CG  . HIS E  1 8   ? -9.539   40.043  76.492  1.00 55.72 ? 0    HIS E CG  1 
ATOM   8472  N  ND1 . HIS E  1 8   ? -9.487   39.248  75.356  1.00 60.74 ? 0    HIS E ND1 1 
ATOM   8473  C  CD2 . HIS E  1 8   ? -8.285   40.018  77.026  1.00 58.53 ? 0    HIS E CD2 1 
ATOM   8474  C  CE1 . HIS E  1 8   ? -8.249   38.803  75.187  1.00 61.62 ? 0    HIS E CE1 1 
ATOM   8475  N  NE2 . HIS E  1 8   ? -7.502   39.254  76.188  1.00 61.89 ? 0    HIS E NE2 1 
ATOM   8476  N  N   . MET E  1 9   ? -11.530  42.153  79.691  1.00 46.88 ? 1    MET E N   1 
ATOM   8477  C  CA  . MET E  1 9   ? -12.332  43.091  80.436  1.00 45.10 ? 1    MET E CA  1 
ATOM   8478  C  C   . MET E  1 9   ? -13.483  43.646  79.563  1.00 42.12 ? 1    MET E C   1 
ATOM   8479  O  O   . MET E  1 9   ? -13.332  43.868  78.380  1.00 39.99 ? 1    MET E O   1 
ATOM   8480  C  CB  . MET E  1 9   ? -11.449  44.199  80.996  1.00 45.47 ? 1    MET E CB  1 
ATOM   8481  C  CG  . MET E  1 9   ? -10.600  43.772  82.164  1.00 47.19 ? 1    MET E CG  1 
ATOM   8482  S  SD  . MET E  1 9   ? -9.706   45.127  82.960  1.00 46.30 ? 1    MET E SD  1 
ATOM   8483  C  CE  . MET E  1 9   ? -8.389   45.294  81.784  1.00 47.32 ? 1    MET E CE  1 
ATOM   8484  N  N   . ARG E  1 10  ? -14.637  43.829  80.186  1.00 39.47 ? 2    ARG E N   1 
ATOM   8485  C  CA  . ARG E  1 10  ? -15.795  44.399  79.538  1.00 38.03 ? 2    ARG E CA  1 
ATOM   8486  C  C   . ARG E  1 10  ? -15.587  45.882  79.189  1.00 35.00 ? 2    ARG E C   1 
ATOM   8487  O  O   . ARG E  1 10  ? -15.231  46.674  80.062  1.00 31.95 ? 2    ARG E O   1 
ATOM   8488  C  CB  . ARG E  1 10  ? -16.987  44.348  80.466  1.00 38.92 ? 2    ARG E CB  1 
ATOM   8489  C  CG  . ARG E  1 10  ? -17.930  43.193  80.262  1.00 42.54 ? 2    ARG E CG  1 
ATOM   8490  C  CD  . ARG E  1 10  ? -19.368  43.593  80.674  1.00 43.44 ? 2    ARG E CD  1 
ATOM   8491  N  NE  . ARG E  1 10  ? -19.386  44.378  81.906  1.00 43.52 ? 2    ARG E NE  1 
ATOM   8492  C  CZ  . ARG E  1 10  ? -20.209  45.392  82.125  1.00 44.13 ? 2    ARG E CZ  1 
ATOM   8493  N  NH1 . ARG E  1 10  ? -21.095  45.727  81.195  1.00 46.46 ? 2    ARG E NH1 1 
ATOM   8494  N  NH2 . ARG E  1 10  ? -20.152  46.077  83.257  1.00 41.64 ? 2    ARG E NH2 1 
ATOM   8495  N  N   . THR E  1 11  ? -15.869  46.221  77.929  1.00 32.07 ? 3    THR E N   1 
ATOM   8496  C  CA  . THR E  1 11  ? -15.698  47.557  77.422  1.00 30.90 ? 3    THR E CA  1 
ATOM   8497  C  C   . THR E  1 11  ? -16.859  48.015  76.544  1.00 30.67 ? 3    THR E C   1 
ATOM   8498  O  O   . THR E  1 11  ? -17.670  47.211  76.090  1.00 30.11 ? 3    THR E O   1 
ATOM   8499  C  CB  . THR E  1 11  ? -14.369  47.731  76.621  1.00 30.32 ? 3    THR E CB  1 
ATOM   8500  O  OG1 . THR E  1 11  ? -14.487  47.107  75.344  1.00 27.20 ? 3    THR E OG1 1 
ATOM   8501  C  CG2 . THR E  1 11  ? -13.158  47.164  77.376  1.00 28.64 ? 3    THR E CG2 1 
ATOM   8502  N  N   . ASN E  1 12  ? -16.909  49.332  76.322  1.00 29.88 ? 4    ASN E N   1 
ATOM   8503  C  CA  . ASN E  1 12  ? -17.808  49.960  75.392  1.00 29.58 ? 4    ASN E CA  1 
ATOM   8504  C  C   . ASN E  1 12  ? -17.235  49.994  73.986  1.00 30.84 ? 4    ASN E C   1 
ATOM   8505  O  O   . ASN E  1 12  ? -17.601  50.886  73.209  1.00 30.87 ? 4    ASN E O   1 
ATOM   8506  C  CB  . ASN E  1 12  ? -18.103  51.390  75.837  1.00 29.06 ? 4    ASN E CB  1 
ATOM   8507  C  CG  . ASN E  1 12  ? -16.877  52.289  75.758  1.00 27.46 ? 4    ASN E CG  1 
ATOM   8508  O  OD1 . ASN E  1 12  ? -15.764  51.783  75.620  1.00 24.61 ? 4    ASN E OD1 1 
ATOM   8509  N  ND2 . ASN E  1 12  ? -17.062  53.604  75.864  1.00 20.72 ? 4    ASN E ND2 1 
ATOM   8510  N  N   . LYS E  1 13  ? -16.355  49.051  73.629  1.00 31.74 ? 5    LYS E N   1 
ATOM   8511  C  CA  . LYS E  1 13  ? -15.697  49.126  72.342  1.00 34.14 ? 5    LYS E CA  1 
ATOM   8512  C  C   . LYS E  1 13  ? -16.623  49.237  71.138  1.00 34.53 ? 5    LYS E C   1 
ATOM   8513  O  O   . LYS E  1 13  ? -16.302  49.878  70.207  1.00 33.91 ? 5    LYS E O   1 
ATOM   8514  C  CB  . LYS E  1 13  ? -14.595  48.061  72.157  1.00 35.49 ? 5    LYS E CB  1 
ATOM   8515  C  CG  . LYS E  1 13  ? -14.965  46.657  71.749  1.00 40.21 ? 5    LYS E CG  1 
ATOM   8516  C  CD  . LYS E  1 13  ? -13.656  45.872  71.593  1.00 45.96 ? 5    LYS E CD  1 
ATOM   8517  C  CE  . LYS E  1 13  ? -13.865  44.420  71.131  1.00 49.68 ? 5    LYS E CE  1 
ATOM   8518  N  NZ  . LYS E  1 13  ? -12.535  43.727  71.082  1.00 53.03 ? 5    LYS E NZ  1 
ATOM   8519  N  N   . ASP E  1 14  ? -17.775  48.602  71.186  1.00 36.42 ? 6    ASP E N   1 
ATOM   8520  C  CA  . ASP E  1 14  ? -18.712  48.608  70.070  1.00 37.87 ? 6    ASP E CA  1 
ATOM   8521  C  C   . ASP E  1 14  ? -19.338  49.972  69.829  1.00 36.80 ? 6    ASP E C   1 
ATOM   8522  O  O   . ASP E  1 14  ? -19.867  50.196  68.756  1.00 37.60 ? 6    ASP E O   1 
ATOM   8523  C  CB  . ASP E  1 14  ? -19.839  47.579  70.319  1.00 39.23 ? 6    ASP E CB  1 
ATOM   8524  C  CG  . ASP E  1 14  ? -19.359  46.092  70.143  1.00 44.33 ? 6    ASP E CG  1 
ATOM   8525  O  OD1 . ASP E  1 14  ? -18.224  45.833  69.605  1.00 48.75 ? 6    ASP E OD1 1 
ATOM   8526  O  OD2 . ASP E  1 14  ? -20.129  45.169  70.553  1.00 49.99 ? 6    ASP E OD2 1 
ATOM   8527  N  N   . ARG E  1 15  ? -19.292  50.852  70.817  1.00 34.85 ? 7    ARG E N   1 
ATOM   8528  C  CA  . ARG E  1 15  ? -19.849  52.170  70.686  1.00 34.67 ? 7    ARG E CA  1 
ATOM   8529  C  C   . ARG E  1 15  ? -18.824  53.213  70.344  1.00 31.68 ? 7    ARG E C   1 
ATOM   8530  O  O   . ARG E  1 15  ? -19.157  54.397  70.282  1.00 30.36 ? 7    ARG E O   1 
ATOM   8531  C  CB  . ARG E  1 15  ? -20.513  52.589  71.989  1.00 36.01 ? 7    ARG E CB  1 
ATOM   8532  C  CG  . ARG E  1 15  ? -21.758  51.777  72.281  1.00 42.82 ? 7    ARG E CG  1 
ATOM   8533  C  CD  . ARG E  1 15  ? -21.934  51.627  73.807  1.00 52.22 ? 7    ARG E CD  1 
ATOM   8534  N  NE  . ARG E  1 15  ? -22.933  52.500  74.425  1.00 60.90 ? 7    ARG E NE  1 
ATOM   8535  C  CZ  . ARG E  1 15  ? -24.269  52.347  74.331  1.00 67.70 ? 7    ARG E CZ  1 
ATOM   8536  N  NH1 . ARG E  1 15  ? -24.821  51.364  73.602  1.00 68.39 ? 7    ARG E NH1 1 
ATOM   8537  N  NH2 . ARG E  1 15  ? -25.077  53.208  74.966  1.00 70.10 ? 7    ARG E NH2 1 
ATOM   8538  N  N   . LEU E  1 16  ? -17.578  52.797  70.152  1.00 29.25 ? 8    LEU E N   1 
ATOM   8539  C  CA  . LEU E  1 16  ? -16.549  53.753  69.776  1.00 28.29 ? 8    LEU E CA  1 
ATOM   8540  C  C   . LEU E  1 16  ? -16.635  54.090  68.302  1.00 27.11 ? 8    LEU E C   1 
ATOM   8541  O  O   . LEU E  1 16  ? -16.968  53.249  67.477  1.00 27.56 ? 8    LEU E O   1 
ATOM   8542  C  CB  . LEU E  1 16  ? -15.181  53.217  70.078  1.00 27.27 ? 8    LEU E CB  1 
ATOM   8543  C  CG  . LEU E  1 16  ? -14.961  52.797  71.510  1.00 27.23 ? 8    LEU E CG  1 
ATOM   8544  C  CD1 . LEU E  1 16  ? -13.550  52.228  71.582  1.00 24.47 ? 8    LEU E CD1 1 
ATOM   8545  C  CD2 . LEU E  1 16  ? -15.217  53.918  72.518  1.00 24.31 ? 8    LEU E CD2 1 
ATOM   8546  N  N   . VAL E  1 17  ? -16.317  55.329  67.990  1.00 26.01 ? 9    VAL E N   1 
ATOM   8547  C  CA  . VAL E  1 17  ? -16.292  55.816  66.625  1.00 25.29 ? 9    VAL E CA  1 
ATOM   8548  C  C   . VAL E  1 17  ? -14.895  55.649  66.037  1.00 25.09 ? 9    VAL E C   1 
ATOM   8549  O  O   . VAL E  1 17  ? -13.890  55.933  66.702  1.00 24.88 ? 9    VAL E O   1 
ATOM   8550  C  CB  . VAL E  1 17  ? -16.784  57.279  66.580  1.00 25.93 ? 9    VAL E CB  1 
ATOM   8551  C  CG1 . VAL E  1 17  ? -16.624  57.889  65.165  1.00 24.31 ? 9    VAL E CG1 1 
ATOM   8552  C  CG2 . VAL E  1 17  ? -18.289  57.316  67.091  1.00 24.31 ? 9    VAL E CG2 1 
ATOM   8553  N  N   . ARG E  1 18  ? -14.880  55.141  64.810  1.00 25.22 ? 10   ARG E N   1 
ATOM   8554  C  CA  A ARG E  1 18  ? -13.690  54.872  64.033  0.50 25.34 ? 10   ARG E CA  1 
ATOM   8555  C  CA  B ARG E  1 18  ? -13.653  54.887  64.043  0.50 25.27 ? 10   ARG E CA  1 
ATOM   8556  C  C   . ARG E  1 18  ? -13.661  55.876  62.873  1.00 25.07 ? 10   ARG E C   1 
ATOM   8557  O  O   . ARG E  1 18  ? -14.613  55.948  62.081  1.00 25.81 ? 10   ARG E O   1 
ATOM   8558  C  CB  A ARG E  1 18  ? -13.825  53.440  63.521  0.50 25.74 ? 10   ARG E CB  1 
ATOM   8559  C  CB  B ARG E  1 18  ? -13.567  53.416  63.552  0.50 25.48 ? 10   ARG E CB  1 
ATOM   8560  C  CG  A ARG E  1 18  ? -12.614  52.803  62.962  0.50 28.33 ? 10   ARG E CG  1 
ATOM   8561  C  CG  B ARG E  1 18  ? -12.147  52.944  63.096  0.50 28.14 ? 10   ARG E CG  1 
ATOM   8562  C  CD  A ARG E  1 18  ? -12.782  51.252  62.974  0.50 31.89 ? 10   ARG E CD  1 
ATOM   8563  C  CD  B ARG E  1 18  ? -12.051  51.488  62.436  0.50 30.73 ? 10   ARG E CD  1 
ATOM   8564  N  NE  A ARG E  1 18  ? -13.372  50.731  61.740  0.50 32.46 ? 10   ARG E NE  1 
ATOM   8565  N  NE  B ARG E  1 18  ? -11.922  50.320  63.345  0.50 32.47 ? 10   ARG E NE  1 
ATOM   8566  C  CZ  A ARG E  1 18  ? -12.668  50.444  60.652  0.50 33.09 ? 10   ARG E CZ  1 
ATOM   8567  C  CZ  B ARG E  1 18  ? -12.949  49.655  63.904  0.50 32.04 ? 10   ARG E CZ  1 
ATOM   8568  N  NH1 A ARG E  1 18  ? -11.351  50.604  60.683  0.50 33.93 ? 10   ARG E NH1 1 
ATOM   8569  N  NH1 B ARG E  1 18  ? -12.711  48.597  64.684  0.50 29.97 ? 10   ARG E NH1 1 
ATOM   8570  N  NH2 A ARG E  1 18  ? -13.282  50.004  59.551  0.50 32.10 ? 10   ARG E NH2 1 
ATOM   8571  N  NH2 B ARG E  1 18  ? -14.210  50.043  63.688  0.50 29.46 ? 10   ARG E NH2 1 
ATOM   8572  N  N   . ILE E  1 19  ? -12.607  56.661  62.762  1.00 23.92 ? 11   ILE E N   1 
ATOM   8573  C  CA  . ILE E  1 19  ? -12.603  57.801  61.878  1.00 24.00 ? 11   ILE E CA  1 
ATOM   8574  C  C   . ILE E  1 19  ? -11.207  58.003  61.213  1.00 24.34 ? 11   ILE E C   1 
ATOM   8575  O  O   . ILE E  1 19  ? -10.166  57.649  61.785  1.00 24.59 ? 11   ILE E O   1 
ATOM   8576  C  CB  . ILE E  1 19  ? -13.062  59.034  62.665  1.00 23.50 ? 11   ILE E CB  1 
ATOM   8577  C  CG1 . ILE E  1 19  ? -13.419  60.187  61.747  1.00 25.37 ? 11   ILE E CG1 1 
ATOM   8578  C  CG2 . ILE E  1 19  ? -11.977  59.529  63.618  1.00 22.31 ? 11   ILE E CG2 1 
ATOM   8579  C  CD1 . ILE E  1 19  ? -14.088  61.361  62.514  1.00 23.17 ? 11   ILE E CD1 1 
ATOM   8580  N  N   . SER E  1 20  ? -11.215  58.520  59.985  1.00 23.99 ? 12   SER E N   1 
ATOM   8581  C  CA  . SER E  1 20  ? -10.002  58.791  59.215  1.00 23.39 ? 12   SER E CA  1 
ATOM   8582  C  C   . SER E  1 20  ? -9.260   59.996  59.780  1.00 23.55 ? 12   SER E C   1 
ATOM   8583  O  O   . SER E  1 20  ? -9.813   61.084  59.852  1.00 23.17 ? 12   SER E O   1 
ATOM   8584  C  CB  . SER E  1 20  ? -10.373  59.115  57.785  1.00 23.62 ? 12   SER E CB  1 
ATOM   8585  O  OG  . SER E  1 20  ? -11.131  60.329  57.733  1.00 22.17 ? 12   SER E OG  1 
ATOM   8586  N  N   . VAL E  1 21  ? -8.013   59.789  60.184  1.00 23.56 ? 13   VAL E N   1 
ATOM   8587  C  CA  . VAL E  1 21  ? -7.137   60.885  60.629  1.00 23.62 ? 13   VAL E CA  1 
ATOM   8588  C  C   . VAL E  1 21  ? -5.975   60.936  59.673  1.00 23.92 ? 13   VAL E C   1 
ATOM   8589  O  O   . VAL E  1 21  ? -5.324   59.941  59.460  1.00 24.02 ? 13   VAL E O   1 
ATOM   8590  C  CB  . VAL E  1 21  ? -6.645   60.657  62.059  1.00 23.31 ? 13   VAL E CB  1 
ATOM   8591  C  CG1 . VAL E  1 21  ? -5.519   61.571  62.350  1.00 22.85 ? 13   VAL E CG1 1 
ATOM   8592  C  CG2 . VAL E  1 21  ? -7.798   60.918  63.001  1.00 22.26 ? 13   VAL E CG2 1 
ATOM   8593  N  N   . VAL E  1 22  ? -5.764   62.076  59.044  1.00 24.80 ? 14   VAL E N   1 
ATOM   8594  C  CA  . VAL E  1 22  ? -4.719   62.227  58.038  1.00 25.03 ? 14   VAL E CA  1 
ATOM   8595  C  C   . VAL E  1 22  ? -3.565   63.069  58.506  1.00 23.72 ? 14   VAL E C   1 
ATOM   8596  O  O   . VAL E  1 22  ? -3.705   63.968  59.328  1.00 22.23 ? 14   VAL E O   1 
ATOM   8597  C  CB  . VAL E  1 22  ? -5.215   62.876  56.720  1.00 26.63 ? 14   VAL E CB  1 
ATOM   8598  C  CG1 . VAL E  1 22  ? -6.163   61.861  56.053  1.00 30.72 ? 14   VAL E CG1 1 
ATOM   8599  C  CG2 . VAL E  1 22  ? -5.854   64.230  56.986  1.00 24.96 ? 14   VAL E CG2 1 
ATOM   8600  N  N   . GLY E  1 23  ? -2.421   62.713  57.939  1.00 23.22 ? 15   GLY E N   1 
ATOM   8601  C  CA  . GLY E  1 23  ? -1.254   63.554  57.917  1.00 22.77 ? 15   GLY E CA  1 
ATOM   8602  C  C   . GLY E  1 23  ? -0.384   63.194  56.720  1.00 22.83 ? 15   GLY E C   1 
ATOM   8603  O  O   . GLY E  1 23  ? -0.839   62.588  55.725  1.00 21.79 ? 15   GLY E O   1 
ATOM   8604  N  N   . GLU E  1 24  ? 0.887    63.537  56.851  1.00 22.88 ? 16   GLU E N   1 
ATOM   8605  C  CA  . GLU E  1 24  ? 1.890    63.296  55.801  1.00 23.47 ? 16   GLU E CA  1 
ATOM   8606  C  C   . GLU E  1 24  ? 3.228    62.980  56.462  1.00 21.75 ? 16   GLU E C   1 
ATOM   8607  O  O   . GLU E  1 24  ? 3.455    63.348  57.612  1.00 21.14 ? 16   GLU E O   1 
ATOM   8608  C  CB  . GLU E  1 24  ? 1.998    64.502  54.882  1.00 23.76 ? 16   GLU E CB  1 
ATOM   8609  C  CG  . GLU E  1 24  ? 2.480    65.764  55.601  1.00 26.57 ? 16   GLU E CG  1 
ATOM   8610  C  CD  . GLU E  1 24  ? 2.469    66.986  54.704  1.00 30.73 ? 16   GLU E CD  1 
ATOM   8611  O  OE1 . GLU E  1 24  ? 1.356    67.390  54.268  1.00 33.18 ? 16   GLU E OE1 1 
ATOM   8612  O  OE2 . GLU E  1 24  ? 3.567    67.523  54.420  1.00 30.68 ? 16   GLU E OE2 1 
ATOM   8613  N  N   . ILE E  1 25  ? 4.098    62.270  55.768  1.00 21.21 ? 17   ILE E N   1 
ATOM   8614  C  CA  . ILE E  1 25  ? 5.386    61.962  56.370  1.00 20.82 ? 17   ILE E CA  1 
ATOM   8615  C  C   . ILE E  1 25  ? 6.142    63.299  56.614  1.00 20.59 ? 17   ILE E C   1 
ATOM   8616  O  O   . ILE E  1 25  ? 6.271    64.142  55.728  1.00 21.50 ? 17   ILE E O   1 
ATOM   8617  C  CB  . ILE E  1 25  ? 6.203    61.000  55.551  1.00 20.73 ? 17   ILE E CB  1 
ATOM   8618  C  CG1 . ILE E  1 25  ? 5.460    59.661  55.437  1.00 21.01 ? 17   ILE E CG1 1 
ATOM   8619  C  CG2 . ILE E  1 25  ? 7.551    60.814  56.183  1.00 17.46 ? 17   ILE E CG2 1 
ATOM   8620  C  CD1 . ILE E  1 25  ? 6.202    58.569  54.606  1.00 18.88 ? 17   ILE E CD1 1 
ATOM   8621  N  N   . ALA E  1 26  ? 6.558    63.483  57.840  1.00 19.71 ? 18   ALA E N   1 
ATOM   8622  C  CA  . ALA E  1 26  ? 7.178    64.691  58.295  1.00 20.37 ? 18   ALA E CA  1 
ATOM   8623  C  C   . ALA E  1 26  ? 8.667    64.707  57.903  1.00 20.49 ? 18   ALA E C   1 
ATOM   8624  O  O   . ALA E  1 26  ? 9.308    63.682  57.868  1.00 20.01 ? 18   ALA E O   1 
ATOM   8625  C  CB  . ALA E  1 26  ? 7.048    64.774  59.803  1.00 19.14 ? 18   ALA E CB  1 
ATOM   8626  N  N   . PRO E  1 27  ? 9.206    65.878  57.577  1.00 21.56 ? 19   PRO E N   1 
ATOM   8627  C  CA  . PRO E  1 27  ? 10.659   65.956  57.375  1.00 21.78 ? 19   PRO E CA  1 
ATOM   8628  C  C   . PRO E  1 27  ? 11.422   65.741  58.697  1.00 22.36 ? 19   PRO E C   1 
ATOM   8629  O  O   . PRO E  1 27  ? 10.841   65.839  59.773  1.00 21.24 ? 19   PRO E O   1 
ATOM   8630  C  CB  . PRO E  1 27  ? 10.876   67.395  56.936  1.00 22.62 ? 19   PRO E CB  1 
ATOM   8631  C  CG  . PRO E  1 27  ? 9.687    68.172  57.591  1.00 22.46 ? 19   PRO E CG  1 
ATOM   8632  C  CD  . PRO E  1 27  ? 8.540    67.194  57.502  1.00 21.20 ? 19   PRO E CD  1 
ATOM   8633  N  N   . ALA E  1 28  ? 12.714   65.428  58.604  1.00 22.51 ? 20   ALA E N   1 
ATOM   8634  C  CA  . ALA E  1 28  ? 13.639   65.631  59.727  1.00 22.34 ? 20   ALA E CA  1 
ATOM   8635  C  C   . ALA E  1 28  ? 13.566   67.114  60.155  1.00 22.60 ? 20   ALA E C   1 
ATOM   8636  O  O   . ALA E  1 28  ? 13.606   67.981  59.321  1.00 20.98 ? 20   ALA E O   1 
ATOM   8637  C  CB  . ALA E  1 28  ? 15.093   65.247  59.300  1.00 21.43 ? 20   ALA E CB  1 
ATOM   8638  N  N   . LYS E  1 29  ? 13.418   67.391  61.450  1.00 23.99 ? 21   LYS E N   1 
ATOM   8639  C  CA  . LYS E  1 29  ? 13.320   68.756  61.920  1.00 25.28 ? 21   LYS E CA  1 
ATOM   8640  C  C   . LYS E  1 29  ? 14.464   69.087  62.884  1.00 26.76 ? 21   LYS E C   1 
ATOM   8641  O  O   . LYS E  1 29  ? 14.877   68.256  63.691  1.00 27.51 ? 21   LYS E O   1 
ATOM   8642  C  CB  . LYS E  1 29  ? 11.962   68.988  62.584  1.00 25.32 ? 21   LYS E CB  1 
ATOM   8643  C  CG  . LYS E  1 29  ? 10.720   68.932  61.604  1.00 26.20 ? 21   LYS E CG  1 
ATOM   8644  C  CD  . LYS E  1 29  ? 9.360    69.114  62.344  1.00 24.68 ? 21   LYS E CD  1 
ATOM   8645  C  CE  . LYS E  1 29  ? 8.153    68.969  61.450  1.00 23.97 ? 21   LYS E CE  1 
ATOM   8646  N  NZ  . LYS E  1 29  ? 6.849    68.964  62.249  1.00 24.90 ? 21   LYS E NZ  1 
ATOM   8647  N  N   . MET E  1 30  ? 14.984   70.297  62.772  1.00 28.58 ? 22   MET E N   1 
ATOM   8648  C  CA  . MET E  1 30  ? 15.964   70.844  63.709  1.00 30.27 ? 22   MET E CA  1 
ATOM   8649  C  C   . MET E  1 30  ? 15.752   72.343  63.719  1.00 31.74 ? 22   MET E C   1 
ATOM   8650  O  O   . MET E  1 30  ? 15.782   72.989  62.685  1.00 29.85 ? 22   MET E O   1 
ATOM   8651  C  CB  . MET E  1 30  ? 17.420   70.602  63.267  1.00 30.31 ? 22   MET E CB  1 
ATOM   8652  C  CG  . MET E  1 30  ? 17.820   69.168  63.032  1.00 31.10 ? 22   MET E CG  1 
ATOM   8653  S  SD  . MET E  1 30  ? 19.557   68.941  62.647  1.00 31.98 ? 22   MET E SD  1 
ATOM   8654  C  CE  . MET E  1 30  ? 20.398   69.329  64.205  1.00 28.72 ? 22   MET E CE  1 
ATOM   8655  N  N   . ARG E  1 31  ? 15.551   72.894  64.906  1.00 34.32 ? 23   ARG E N   1 
ATOM   8656  C  CA  . ARG E  1 31  ? 15.471   74.358  65.076  1.00 36.78 ? 23   ARG E CA  1 
ATOM   8657  C  C   . ARG E  1 31  ? 16.851   75.066  65.148  1.00 35.06 ? 23   ARG E C   1 
ATOM   8658  O  O   . ARG E  1 31  ? 16.975   76.267  64.947  1.00 34.78 ? 23   ARG E O   1 
ATOM   8659  C  CB  . ARG E  1 31  ? 14.601   74.650  66.285  1.00 38.91 ? 23   ARG E CB  1 
ATOM   8660  C  CG  . ARG E  1 31  ? 13.110   74.470  65.928  1.00 48.53 ? 23   ARG E CG  1 
ATOM   8661  C  CD  . ARG E  1 31  ? 12.222   73.969  67.070  1.00 61.26 ? 23   ARG E CD  1 
ATOM   8662  N  NE  . ARG E  1 31  ? 11.991   74.992  68.099  1.00 72.98 ? 23   ARG E NE  1 
ATOM   8663  C  CZ  . ARG E  1 31  ? 12.666   75.106  69.257  1.00 81.74 ? 23   ARG E CZ  1 
ATOM   8664  N  NH1 . ARG E  1 31  ? 13.647   74.251  69.591  1.00 84.11 ? 23   ARG E NH1 1 
ATOM   8665  N  NH2 . ARG E  1 31  ? 12.353   76.092  70.099  1.00 84.36 ? 23   ARG E NH2 1 
ATOM   8666  N  N   . SER E  1 32  ? 17.886   74.274  65.404  1.00 33.46 ? 24   SER E N   1 
ATOM   8667  C  CA  . SER E  1 32  ? 19.259   74.730  65.477  1.00 32.00 ? 24   SER E CA  1 
ATOM   8668  C  C   . SER E  1 32  ? 20.090   73.515  65.097  1.00 31.37 ? 24   SER E C   1 
ATOM   8669  O  O   . SER E  1 32  ? 19.652   72.395  65.308  1.00 29.76 ? 24   SER E O   1 
ATOM   8670  C  CB  . SER E  1 32  ? 19.580   75.130  66.921  1.00 31.66 ? 24   SER E CB  1 
ATOM   8671  O  OG  . SER E  1 32  ? 20.963   75.360  67.062  1.00 30.47 ? 24   SER E OG  1 
ATOM   8672  N  N   . PRO E  1 33  ? 21.298   73.719  64.561  1.00 31.17 ? 25   PRO E N   1 
ATOM   8673  C  CA  . PRO E  1 33  ? 22.177   72.556  64.407  1.00 30.63 ? 25   PRO E CA  1 
ATOM   8674  C  C   . PRO E  1 33  ? 22.577   71.970  65.759  1.00 30.12 ? 25   PRO E C   1 
ATOM   8675  O  O   . PRO E  1 33  ? 22.898   70.788  65.846  1.00 29.28 ? 25   PRO E O   1 
ATOM   8676  C  CB  . PRO E  1 33  ? 23.405   73.130  63.701  1.00 31.01 ? 25   PRO E CB  1 
ATOM   8677  C  CG  . PRO E  1 33  ? 23.347   74.618  63.977  1.00 31.71 ? 25   PRO E CG  1 
ATOM   8678  C  CD  . PRO E  1 33  ? 21.923   74.977  64.112  1.00 31.74 ? 25   PRO E CD  1 
ATOM   8679  N  N   . TYR E  1 34  ? 22.557   72.785  66.800  1.00 29.50 ? 26   TYR E N   1 
ATOM   8680  C  CA  . TYR E  1 34  ? 23.011   72.321  68.111  1.00 30.36 ? 26   TYR E CA  1 
ATOM   8681  C  C   . TYR E  1 34  ? 21.861   71.815  68.997  1.00 30.06 ? 26   TYR E C   1 
ATOM   8682  O  O   . TYR E  1 34  ? 20.764   72.337  68.937  1.00 29.14 ? 26   TYR E O   1 
ATOM   8683  C  CB  . TYR E  1 34  ? 23.757   73.431  68.869  1.00 30.06 ? 26   TYR E CB  1 
ATOM   8684  C  CG  . TYR E  1 34  ? 25.024   73.890  68.195  1.00 29.86 ? 26   TYR E CG  1 
ATOM   8685  C  CD1 . TYR E  1 34  ? 26.125   73.039  68.081  1.00 30.81 ? 26   TYR E CD1 1 
ATOM   8686  C  CD2 . TYR E  1 34  ? 25.146   75.182  67.692  1.00 30.71 ? 26   TYR E CD2 1 
ATOM   8687  C  CE1 . TYR E  1 34  ? 27.300   73.456  67.492  1.00 29.88 ? 26   TYR E CE1 1 
ATOM   8688  C  CE2 . TYR E  1 34  ? 26.338   75.619  67.083  1.00 30.19 ? 26   TYR E CE2 1 
ATOM   8689  C  CZ  . TYR E  1 34  ? 27.411   74.744  67.005  1.00 30.08 ? 26   TYR E CZ  1 
ATOM   8690  O  OH  . TYR E  1 34  ? 28.583   75.120  66.381  1.00 29.35 ? 26   TYR E OH  1 
ATOM   8691  N  N   . SER E  1 35  ? 22.165   70.779  69.776  1.00 29.63 ? 27   SER E N   1 
ATOM   8692  C  CA  . SER E  1 35  ? 21.373   70.358  70.903  1.00 29.59 ? 27   SER E CA  1 
ATOM   8693  C  C   . SER E  1 35  ? 22.164   70.734  72.164  1.00 29.80 ? 27   SER E C   1 
ATOM   8694  O  O   . SER E  1 35  ? 23.367   70.516  72.224  1.00 28.41 ? 27   SER E O   1 
ATOM   8695  C  CB  . SER E  1 35  ? 21.131   68.834  70.855  1.00 29.07 ? 27   SER E CB  1 
ATOM   8696  O  OG  . SER E  1 35  ? 20.377   68.471  69.715  1.00 29.80 ? 27   SER E OG  1 
ATOM   8697  N  N   . VAL E  1 36  ? 21.491   71.318  73.156  1.00 30.52 ? 28   VAL E N   1 
ATOM   8698  C  CA  . VAL E  1 36  ? 22.153   71.776  74.402  1.00 30.75 ? 28   VAL E CA  1 
ATOM   8699  C  C   . VAL E  1 36  ? 22.004   70.730  75.496  1.00 31.63 ? 28   VAL E C   1 
ATOM   8700  O  O   . VAL E  1 36  ? 20.881   70.326  75.810  1.00 31.43 ? 28   VAL E O   1 
ATOM   8701  C  CB  . VAL E  1 36  ? 21.560   73.078  74.937  1.00 31.38 ? 28   VAL E CB  1 
ATOM   8702  C  CG1 . VAL E  1 36  ? 22.286   73.469  76.262  1.00 28.18 ? 28   VAL E CG1 1 
ATOM   8703  C  CG2 . VAL E  1 36  ? 21.564   74.183  73.837  1.00 28.45 ? 28   VAL E CG2 1 
ATOM   8704  N  N   . THR E  1 37  ? 23.130   70.318  76.086  1.00 32.58 ? 29   THR E N   1 
ATOM   8705  C  CA  . THR E  1 37  ? 23.142   69.241  77.060  1.00 32.95 ? 29   THR E CA  1 
ATOM   8706  C  C   . THR E  1 37  ? 22.854   69.804  78.440  1.00 34.27 ? 29   THR E C   1 
ATOM   8707  O  O   . THR E  1 37  ? 22.830   71.038  78.646  1.00 34.10 ? 29   THR E O   1 
ATOM   8708  C  CB  . THR E  1 37  ? 24.524   68.482  77.126  1.00 33.66 ? 29   THR E CB  1 
ATOM   8709  O  OG1 . THR E  1 37  ? 25.519   69.351  77.687  1.00 31.76 ? 29   THR E OG1 1 
ATOM   8710  C  CG2 . THR E  1 37  ? 24.965   67.959  75.760  1.00 31.13 ? 29   THR E CG2 1 
ATOM   8711  N  N   . THR E  1 38  ? 22.667   68.889  79.393  1.00 35.21 ? 30   THR E N   1 
ATOM   8712  C  CA  . THR E  1 38  ? 22.425   69.263  80.801  1.00 36.75 ? 30   THR E CA  1 
ATOM   8713  C  C   . THR E  1 38  ? 23.713   69.872  81.411  1.00 37.32 ? 30   THR E C   1 
ATOM   8714  O  O   . THR E  1 38  ? 23.608   70.672  82.334  1.00 37.73 ? 30   THR E O   1 
ATOM   8715  C  CB  . THR E  1 38  ? 21.846   68.077  81.687  1.00 36.94 ? 30   THR E CB  1 
ATOM   8716  O  OG1 . THR E  1 38  ? 22.811   67.032  81.759  1.00 41.17 ? 30   THR E OG1 1 
ATOM   8717  C  CG2 . THR E  1 38  ? 20.598   67.461  81.093  1.00 34.10 ? 30   THR E CG2 1 
ATOM   8718  N  N   . GLU E  1 39  ? 24.894   69.557  80.841  1.00 37.31 ? 31   GLU E N   1 
ATOM   8719  C  CA  . GLU E  1 39  ? 26.189   70.192  81.237  1.00 38.69 ? 31   GLU E CA  1 
ATOM   8720  C  C   . GLU E  1 39  ? 26.451   71.605  80.600  1.00 37.09 ? 31   GLU E C   1 
ATOM   8721  O  O   . GLU E  1 39  ? 27.494   72.209  80.847  1.00 37.57 ? 31   GLU E O   1 
ATOM   8722  C  CB  . GLU E  1 39  ? 27.372   69.275  80.878  1.00 39.89 ? 31   GLU E CB  1 
ATOM   8723  C  CG  . GLU E  1 39  ? 27.481   67.924  81.702  1.00 46.75 ? 31   GLU E CG  1 
ATOM   8724  C  CD  . GLU E  1 39  ? 26.165   67.038  81.690  1.00 54.84 ? 31   GLU E CD  1 
ATOM   8725  O  OE1 . GLU E  1 39  ? 25.679   66.590  80.579  1.00 57.08 ? 31   GLU E OE1 1 
ATOM   8726  O  OE2 . GLU E  1 39  ? 25.625   66.805  82.823  1.00 58.93 ? 31   GLU E OE2 1 
ATOM   8727  N  N   . GLY E  1 40  ? 25.529   72.098  79.774  1.00 34.02 ? 32   GLY E N   1 
ATOM   8728  C  CA  . GLY E  1 40  ? 25.714   73.352  79.077  1.00 33.70 ? 32   GLY E CA  1 
ATOM   8729  C  C   . GLY E  1 40  ? 26.715   73.302  77.934  1.00 33.41 ? 32   GLY E C   1 
ATOM   8730  O  O   . GLY E  1 40  ? 27.393   74.273  77.684  1.00 34.12 ? 32   GLY E O   1 
ATOM   8731  N  N   . THR E  1 41  ? 26.852   72.159  77.279  1.00 32.20 ? 33   THR E N   1 
ATOM   8732  C  CA  . THR E  1 41  ? 27.651   72.061  76.087  1.00 31.97 ? 33   THR E CA  1 
ATOM   8733  C  C   . THR E  1 41  ? 26.705   71.811  74.900  1.00 31.91 ? 33   THR E C   1 
ATOM   8734  O  O   . THR E  1 41  ? 25.478   71.625  75.080  1.00 30.62 ? 33   THR E O   1 
ATOM   8735  C  CB  . THR E  1 41  ? 28.672   70.954  76.191  1.00 32.59 ? 33   THR E CB  1 
ATOM   8736  O  OG1 . THR E  1 41  ? 27.976   69.702  76.326  1.00 33.35 ? 33   THR E OG1 1 
ATOM   8737  C  CG2 . THR E  1 41  ? 29.643   71.200  77.384  1.00 31.05 ? 33   THR E CG2 1 
ATOM   8738  N  N   . VAL E  1 42  ? 27.239   71.904  73.689  1.00 31.18 ? 34   VAL E N   1 
ATOM   8739  C  CA  . VAL E  1 42  ? 26.418   71.737  72.503  1.00 30.58 ? 34   VAL E CA  1 
ATOM   8740  C  C   . VAL E  1 42  ? 26.941   70.552  71.698  1.00 30.27 ? 34   VAL E C   1 
ATOM   8741  O  O   . VAL E  1 42  ? 28.136   70.299  71.649  1.00 29.66 ? 34   VAL E O   1 
ATOM   8742  C  CB  . VAL E  1 42  ? 26.360   73.025  71.648  1.00 30.95 ? 34   VAL E CB  1 
ATOM   8743  C  CG1 . VAL E  1 42  ? 25.631   74.155  72.447  1.00 30.49 ? 34   VAL E CG1 1 
ATOM   8744  C  CG2 . VAL E  1 42  ? 27.777   73.442  71.163  1.00 27.17 ? 34   VAL E CG2 1 
ATOM   8745  N  N   . ARG E  1 43  ? 26.022   69.837  71.089  1.00 30.53 ? 35   ARG E N   1 
ATOM   8746  C  CA  . ARG E  1 43  ? 26.328   68.703  70.234  1.00 32.00 ? 35   ARG E CA  1 
ATOM   8747  C  C   . ARG E  1 43  ? 25.530   68.842  68.969  1.00 31.08 ? 35   ARG E C   1 
ATOM   8748  O  O   . ARG E  1 43  ? 24.336   69.258  69.033  1.00 31.62 ? 35   ARG E O   1 
ATOM   8749  C  CB  . ARG E  1 43  ? 25.877   67.408  70.894  1.00 33.06 ? 35   ARG E CB  1 
ATOM   8750  C  CG  . ARG E  1 43  ? 26.592   67.095  72.150  1.00 37.40 ? 35   ARG E CG  1 
ATOM   8751  C  CD  . ARG E  1 43  ? 26.089   65.793  72.744  1.00 42.38 ? 35   ARG E CD  1 
ATOM   8752  N  NE  . ARG E  1 43  ? 26.364   64.654  71.857  1.00 45.79 ? 35   ARG E NE  1 
ATOM   8753  C  CZ  . ARG E  1 43  ? 25.873   63.413  72.011  1.00 46.40 ? 35   ARG E CZ  1 
ATOM   8754  N  NH1 . ARG E  1 43  ? 25.033   63.128  73.022  1.00 45.67 ? 35   ARG E NH1 1 
ATOM   8755  N  NH2 . ARG E  1 43  ? 26.214   62.457  71.127  1.00 45.03 ? 35   ARG E NH2 1 
ATOM   8756  N  N   . VAL E  1 44  ? 26.166   68.502  67.838  1.00 29.72 ? 36   VAL E N   1 
ATOM   8757  C  CA  . VAL E  1 44  ? 25.480   68.397  66.585  1.00 28.17 ? 36   VAL E CA  1 
ATOM   8758  C  C   . VAL E  1 44  ? 25.081   66.946  66.326  1.00 28.57 ? 36   VAL E C   1 
ATOM   8759  O  O   . VAL E  1 44  ? 25.892   66.121  65.962  1.00 27.40 ? 36   VAL E O   1 
ATOM   8760  C  CB  . VAL E  1 44  ? 26.260   68.946  65.415  1.00 28.42 ? 36   VAL E CB  1 
ATOM   8761  C  CG1 . VAL E  1 44  ? 25.346   68.889  64.170  1.00 24.66 ? 36   VAL E CG1 1 
ATOM   8762  C  CG2 . VAL E  1 44  ? 26.715   70.417  65.693  1.00 28.09 ? 36   VAL E CG2 1 
ATOM   8763  N  N   . ILE E  1 45  ? 23.793   66.664  66.531  1.00 29.24 ? 37   ILE E N   1 
ATOM   8764  C  CA  . ILE E  1 45  ? 23.254   65.309  66.356  1.00 28.98 ? 37   ILE E CA  1 
ATOM   8765  C  C   . ILE E  1 45  ? 21.839   65.353  65.748  1.00 28.68 ? 37   ILE E C   1 
ATOM   8766  O  O   . ILE E  1 45  ? 21.130   66.371  65.896  1.00 29.02 ? 37   ILE E O   1 
ATOM   8767  C  CB  . ILE E  1 45  ? 23.220   64.503  67.693  1.00 29.27 ? 37   ILE E CB  1 
ATOM   8768  C  CG1 . ILE E  1 45  ? 22.463   65.272  68.782  1.00 28.91 ? 37   ILE E CG1 1 
ATOM   8769  C  CG2 . ILE E  1 45  ? 24.670   64.102  68.114  1.00 28.26 ? 37   ILE E CG2 1 
ATOM   8770  C  CD1 . ILE E  1 45  ? 22.316   64.497  70.119  1.00 28.23 ? 37   ILE E CD1 1 
ATOM   8771  N  N   . PRO E  1 46  ? 21.442   64.262  65.051  1.00 27.34 ? 38   PRO E N   1 
ATOM   8772  C  CA  . PRO E  1 46  ? 20.091   64.112  64.523  1.00 27.23 ? 38   PRO E CA  1 
ATOM   8773  C  C   . PRO E  1 46  ? 19.031   64.182  65.601  1.00 26.51 ? 38   PRO E C   1 
ATOM   8774  O  O   . PRO E  1 46  ? 19.325   63.841  66.759  1.00 27.37 ? 38   PRO E O   1 
ATOM   8775  C  CB  . PRO E  1 46  ? 20.112   62.722  63.874  1.00 26.88 ? 38   PRO E CB  1 
ATOM   8776  C  CG  . PRO E  1 46  ? 21.506   62.465  63.533  1.00 27.14 ? 38   PRO E CG  1 
ATOM   8777  C  CD  . PRO E  1 46  ? 22.287   63.119  64.673  1.00 27.94 ? 38   PRO E CD  1 
ATOM   8778  N  N   . VAL E  1 47  ? 17.834   64.632  65.230  1.00 25.59 ? 39   VAL E N   1 
ATOM   8779  C  CA  . VAL E  1 47  ? 16.761   64.878  66.180  1.00 25.46 ? 39   VAL E CA  1 
ATOM   8780  C  C   . VAL E  1 47  ? 15.478   64.162  65.705  1.00 25.45 ? 39   VAL E C   1 
ATOM   8781  O  O   . VAL E  1 47  ? 15.473   62.959  65.380  1.00 25.95 ? 39   VAL E O   1 
ATOM   8782  C  CB  . VAL E  1 47  ? 16.600   66.407  66.459  1.00 26.21 ? 39   VAL E CB  1 
ATOM   8783  C  CG1 . VAL E  1 47  ? 15.717   66.690  67.680  1.00 26.64 ? 39   VAL E CG1 1 
ATOM   8784  C  CG2 . VAL E  1 47  ? 17.920   67.061  66.725  1.00 26.77 ? 39   VAL E CG2 1 
ATOM   8785  N  N   . LEU E  1 48  ? 14.371   64.868  65.635  1.00 25.26 ? 40   LEU E N   1 
ATOM   8786  C  CA  . LEU E  1 48  ? 13.083   64.198  65.402  1.00 24.81 ? 40   LEU E CA  1 
ATOM   8787  C  C   . LEU E  1 48  ? 12.625   64.309  63.934  1.00 23.80 ? 40   LEU E C   1 
ATOM   8788  O  O   . LEU E  1 48  ? 13.328   64.871  63.085  1.00 22.76 ? 40   LEU E O   1 
ATOM   8789  C  CB  . LEU E  1 48  ? 12.017   64.722  66.384  1.00 25.01 ? 40   LEU E CB  1 
ATOM   8790  C  CG  . LEU E  1 48  ? 11.941   66.238  66.589  1.00 27.25 ? 40   LEU E CG  1 
ATOM   8791  C  CD1 . LEU E  1 48  ? 11.156   66.832  65.429  1.00 24.83 ? 40   LEU E CD1 1 
ATOM   8792  C  CD2 . LEU E  1 48  ? 11.320   66.582  67.958  1.00 26.21 ? 40   LEU E CD2 1 
ATOM   8793  N  N   . GLY E  1 49  ? 11.470   63.721  63.646  1.00 22.40 ? 41   GLY E N   1 
ATOM   8794  C  CA  . GLY E  1 49  ? 10.913   63.728  62.323  1.00 22.30 ? 41   GLY E CA  1 
ATOM   8795  C  C   . GLY E  1 49  ? 11.425   62.624  61.419  1.00 22.39 ? 41   GLY E C   1 
ATOM   8796  O  O   . GLY E  1 49  ? 12.176   61.726  61.833  1.00 23.21 ? 41   GLY E O   1 
ATOM   8797  N  N   . GLY E  1 50  ? 10.988   62.674  60.177  1.00 21.68 ? 42   GLY E N   1 
ATOM   8798  C  CA  . GLY E  1 50  ? 11.525   61.833  59.152  1.00 21.67 ? 42   GLY E CA  1 
ATOM   8799  C  C   . GLY E  1 50  ? 11.088   60.393  59.110  1.00 21.28 ? 42   GLY E C   1 
ATOM   8800  O  O   . GLY E  1 50  ? 10.234   59.955  59.861  1.00 20.65 ? 42   GLY E O   1 
ATOM   8801  N  N   . ILE E  1 51  ? 11.650   59.703  58.126  1.00 21.50 ? 43   ILE E N   1 
ATOM   8802  C  CA  . ILE E  1 51  ? 11.798   58.271  58.118  1.00 21.51 ? 43   ILE E CA  1 
ATOM   8803  C  C   . ILE E  1 51  ? 13.164   58.015  58.763  1.00 21.99 ? 43   ILE E C   1 
ATOM   8804  O  O   . ILE E  1 51  ? 14.202   58.415  58.234  1.00 22.53 ? 43   ILE E O   1 
ATOM   8805  C  CB  . ILE E  1 51  ? 11.739   57.695  56.681  1.00 21.66 ? 43   ILE E CB  1 
ATOM   8806  C  CG1 . ILE E  1 51  ? 10.424   58.085  56.019  1.00 21.19 ? 43   ILE E CG1 1 
ATOM   8807  C  CG2 . ILE E  1 51  ? 11.902   56.138  56.682  1.00 19.89 ? 43   ILE E CG2 1 
ATOM   8808  C  CD1 . ILE E  1 51  ? 10.502   58.616  54.634  1.00 20.70 ? 43   ILE E CD1 1 
ATOM   8809  N  N   . THR E  1 52  ? 13.161   57.418  59.942  1.00 21.96 ? 44   THR E N   1 
ATOM   8810  C  CA  . THR E  1 52  ? 14.398   57.043  60.615  1.00 22.10 ? 44   THR E CA  1 
ATOM   8811  C  C   . THR E  1 52  ? 14.641   55.578  60.281  1.00 22.43 ? 44   THR E C   1 
ATOM   8812  O  O   . THR E  1 52  ? 13.863   54.716  60.652  1.00 22.13 ? 44   THR E O   1 
ATOM   8813  C  CB  . THR E  1 52  ? 14.260   57.302  62.093  1.00 22.09 ? 44   THR E CB  1 
ATOM   8814  O  OG1 . THR E  1 52  ? 13.994   58.703  62.278  1.00 20.91 ? 44   THR E OG1 1 
ATOM   8815  C  CG2 . THR E  1 52  ? 15.505   56.892  62.856  1.00 20.26 ? 44   THR E CG2 1 
ATOM   8816  N  N   . TYR E  1 53  ? 15.709   55.311  59.540  1.00 22.77 ? 45   TYR E N   1 
ATOM   8817  C  CA  . TYR E  1 53  ? 15.880   54.031  58.908  1.00 23.39 ? 45   TYR E CA  1 
ATOM   8818  C  C   . TYR E  1 53  ? 16.356   52.942  59.839  1.00 24.34 ? 45   TYR E C   1 
ATOM   8819  O  O   . TYR E  1 53  ? 16.101   51.768  59.580  1.00 25.08 ? 45   TYR E O   1 
ATOM   8820  C  CB  . TYR E  1 53  ? 16.786   54.125  57.678  1.00 23.20 ? 45   TYR E CB  1 
ATOM   8821  C  CG  . TYR E  1 53  ? 16.188   55.010  56.581  1.00 23.43 ? 45   TYR E CG  1 
ATOM   8822  C  CD1 . TYR E  1 53  ? 15.267   54.500  55.680  1.00 23.21 ? 45   TYR E CD1 1 
ATOM   8823  C  CD2 . TYR E  1 53  ? 16.559   56.375  56.449  1.00 23.96 ? 45   TYR E CD2 1 
ATOM   8824  C  CE1 . TYR E  1 53  ? 14.719   55.310  54.684  1.00 24.96 ? 45   TYR E CE1 1 
ATOM   8825  C  CE2 . TYR E  1 53  ? 15.994   57.192  55.458  1.00 23.87 ? 45   TYR E CE2 1 
ATOM   8826  C  CZ  . TYR E  1 53  ? 15.065   56.657  54.587  1.00 24.60 ? 45   TYR E CZ  1 
ATOM   8827  O  OH  . TYR E  1 53  ? 14.480   57.451  53.609  1.00 24.95 ? 45   TYR E OH  1 
ATOM   8828  N  N   . ASN E  1 54  ? 17.022   53.283  60.928  1.00 23.94 ? 46   ASN E N   1 
ATOM   8829  C  CA  . ASN E  1 54  ? 17.681   52.237  61.694  1.00 23.84 ? 46   ASN E CA  1 
ATOM   8830  C  C   . ASN E  1 54  ? 17.336   52.276  63.168  1.00 23.80 ? 46   ASN E C   1 
ATOM   8831  O  O   . ASN E  1 54  ? 18.032   51.721  63.947  1.00 24.39 ? 46   ASN E O   1 
ATOM   8832  C  CB  . ASN E  1 54  ? 19.194   52.349  61.503  1.00 23.71 ? 46   ASN E CB  1 
ATOM   8833  C  CG  . ASN E  1 54  ? 19.768   53.689  62.040  1.00 24.60 ? 46   ASN E CG  1 
ATOM   8834  O  OD1 . ASN E  1 54  ? 19.115   54.710  61.991  1.00 22.80 ? 46   ASN E OD1 1 
ATOM   8835  N  ND2 . ASN E  1 54  ? 20.977   53.655  62.589  1.00 23.54 ? 46   ASN E ND2 1 
ATOM   8836  N  N   . VAL E  1 55  ? 16.285   52.973  63.559  1.00 23.61 ? 47   VAL E N   1 
ATOM   8837  C  CA  . VAL E  1 55  ? 15.824   52.975  64.926  1.00 22.56 ? 47   VAL E CA  1 
ATOM   8838  C  C   . VAL E  1 55  ? 14.363   52.604  64.879  1.00 23.58 ? 47   VAL E C   1 
ATOM   8839  O  O   . VAL E  1 55  ? 13.575   53.234  64.150  1.00 23.18 ? 47   VAL E O   1 
ATOM   8840  C  CB  . VAL E  1 55  ? 15.992   54.349  65.588  1.00 23.24 ? 47   VAL E CB  1 
ATOM   8841  C  CG1 . VAL E  1 55  ? 15.443   54.295  67.059  1.00 21.11 ? 47   VAL E CG1 1 
ATOM   8842  C  CG2 . VAL E  1 55  ? 17.481   54.855  65.512  1.00 19.88 ? 47   VAL E CG2 1 
ATOM   8843  N  N   . LYS E  1 56  ? 13.978   51.557  65.603  1.00 24.16 ? 48   LYS E N   1 
ATOM   8844  C  CA  . LYS E  1 56  ? 12.619   51.086  65.512  1.00 24.97 ? 48   LYS E CA  1 
ATOM   8845  C  C   . LYS E  1 56  ? 12.020   50.640  66.832  1.00 23.82 ? 48   LYS E C   1 
ATOM   8846  O  O   . LYS E  1 56  ? 12.708   50.457  67.834  1.00 23.24 ? 48   LYS E O   1 
ATOM   8847  C  CB  . LYS E  1 56  ? 12.538   49.990  64.479  1.00 26.95 ? 48   LYS E CB  1 
ATOM   8848  C  CG  . LYS E  1 56  ? 13.189   48.700  64.910  1.00 33.57 ? 48   LYS E CG  1 
ATOM   8849  C  CD  . LYS E  1 56  ? 13.156   47.581  63.769  1.00 41.10 ? 48   LYS E CD  1 
ATOM   8850  C  CE  . LYS E  1 56  ? 13.851   46.216  64.227  1.00 42.53 ? 48   LYS E CE  1 
ATOM   8851  N  NZ  . LYS E  1 56  ? 15.217   46.485  64.911  1.00 45.86 ? 48   LYS E NZ  1 
ATOM   8852  N  N   . VAL E  1 57  ? 10.706   50.505  66.849  1.00 22.51 ? 49   VAL E N   1 
ATOM   8853  C  CA  . VAL E  1 57  ? 10.029   50.040  68.038  1.00 21.63 ? 49   VAL E CA  1 
ATOM   8854  C  C   . VAL E  1 57  ? 10.671   48.717  68.424  1.00 22.15 ? 49   VAL E C   1 
ATOM   8855  O  O   . VAL E  1 57  ? 10.887   47.869  67.589  1.00 22.22 ? 49   VAL E O   1 
ATOM   8856  C  CB  . VAL E  1 57  ? 8.499    49.878  67.845  1.00 21.07 ? 49   VAL E CB  1 
ATOM   8857  C  CG1 . VAL E  1 57  ? 8.172    48.748  66.923  1.00 17.94 ? 49   VAL E CG1 1 
ATOM   8858  C  CG2 . VAL E  1 57  ? 7.823    49.657  69.196  1.00 20.32 ? 49   VAL E CG2 1 
ATOM   8859  N  N   . GLY E  1 58  ? 10.994   48.578  69.700  1.00 23.10 ? 50   GLY E N   1 
ATOM   8860  C  CA  . GLY E  1 58  ? 11.727   47.423  70.203  1.00 23.27 ? 50   GLY E CA  1 
ATOM   8861  C  C   . GLY E  1 58  ? 13.190   47.668  70.454  1.00 23.10 ? 50   GLY E C   1 
ATOM   8862  O  O   . GLY E  1 58  ? 13.816   46.928  71.207  1.00 22.72 ? 50   GLY E O   1 
ATOM   8863  N  N   . ASP E  1 59  ? 13.750   48.696  69.829  1.00 22.76 ? 51   ASP E N   1 
ATOM   8864  C  CA  . ASP E  1 59  ? 15.143   49.018  70.053  1.00 23.04 ? 51   ASP E CA  1 
ATOM   8865  C  C   . ASP E  1 59  ? 15.209   49.748  71.360  1.00 23.02 ? 51   ASP E C   1 
ATOM   8866  O  O   . ASP E  1 59  ? 14.179   50.282  71.862  1.00 22.25 ? 51   ASP E O   1 
ATOM   8867  C  CB  . ASP E  1 59  ? 15.697   49.923  68.947  1.00 23.49 ? 51   ASP E CB  1 
ATOM   8868  C  CG  . ASP E  1 59  ? 15.882   49.216  67.619  1.00 25.54 ? 51   ASP E CG  1 
ATOM   8869  O  OD1 . ASP E  1 59  ? 15.832   47.974  67.571  1.00 27.91 ? 51   ASP E OD1 1 
ATOM   8870  O  OD2 . ASP E  1 59  ? 16.100   49.911  66.586  1.00 28.75 ? 51   ASP E OD2 1 
ATOM   8871  N  N   . SER E  1 60  ? 16.408   49.786  71.918  1.00 22.71 ? 52   SER E N   1 
ATOM   8872  C  CA  . SER E  1 60  ? 16.685   50.599  73.081  1.00 22.90 ? 52   SER E CA  1 
ATOM   8873  C  C   . SER E  1 60  ? 16.382   52.100  72.847  1.00 22.36 ? 52   SER E C   1 
ATOM   8874  O  O   . SER E  1 60  ? 16.654   52.644  71.795  1.00 21.25 ? 52   SER E O   1 
ATOM   8875  C  CB  . SER E  1 60  ? 18.155   50.460  73.445  1.00 22.88 ? 52   SER E CB  1 
ATOM   8876  O  OG  . SER E  1 60  ? 18.447   51.195  74.630  1.00 24.28 ? 52   SER E OG  1 
ATOM   8877  N  N   . ALA E  1 61  ? 15.857   52.748  73.875  1.00 22.43 ? 53   ALA E N   1 
ATOM   8878  C  CA  . ALA E  1 61  ? 15.632   54.193  73.927  1.00 22.41 ? 53   ALA E CA  1 
ATOM   8879  C  C   . ALA E  1 61  ? 16.939   54.948  74.183  1.00 23.75 ? 53   ALA E C   1 
ATOM   8880  O  O   . ALA E  1 61  ? 17.042   56.180  73.939  1.00 23.60 ? 53   ALA E O   1 
ATOM   8881  C  CB  . ALA E  1 61  ? 14.641   54.522  75.024  1.00 20.72 ? 53   ALA E CB  1 
ATOM   8882  N  N   . TYR E  1 62  ? 17.935   54.200  74.664  1.00 24.61 ? 54   TYR E N   1 
ATOM   8883  C  CA  . TYR E  1 62  ? 19.225   54.756  75.045  1.00 26.06 ? 54   TYR E CA  1 
ATOM   8884  C  C   . TYR E  1 62  ? 20.319   54.318  74.115  1.00 26.69 ? 54   TYR E C   1 
ATOM   8885  O  O   . TYR E  1 62  ? 20.127   53.391  73.304  1.00 27.34 ? 54   TYR E O   1 
ATOM   8886  C  CB  . TYR E  1 62  ? 19.593   54.330  76.477  1.00 26.26 ? 54   TYR E CB  1 
ATOM   8887  C  CG  . TYR E  1 62  ? 18.737   55.014  77.503  1.00 26.37 ? 54   TYR E CG  1 
ATOM   8888  C  CD1 . TYR E  1 62  ? 17.574   54.414  77.978  1.00 27.46 ? 54   TYR E CD1 1 
ATOM   8889  C  CD2 . TYR E  1 62  ? 19.086   56.258  77.993  1.00 26.27 ? 54   TYR E CD2 1 
ATOM   8890  C  CE1 . TYR E  1 62  ? 16.788   55.040  78.924  1.00 27.46 ? 54   TYR E CE1 1 
ATOM   8891  C  CE2 . TYR E  1 62  ? 18.317   56.889  78.924  1.00 27.28 ? 54   TYR E CE2 1 
ATOM   8892  C  CZ  . TYR E  1 62  ? 17.151   56.271  79.390  1.00 29.78 ? 54   TYR E CZ  1 
ATOM   8893  O  OH  . TYR E  1 62  ? 16.370   56.936  80.316  1.00 31.63 ? 54   TYR E OH  1 
ATOM   8894  N  N   . GLY E  1 63  ? 21.454   55.013  74.204  1.00 27.18 ? 55   GLY E N   1 
ATOM   8895  C  CA  . GLY E  1 63  ? 22.630   54.661  73.397  1.00 27.98 ? 55   GLY E CA  1 
ATOM   8896  C  C   . GLY E  1 63  ? 22.714   55.154  71.936  1.00 28.76 ? 55   GLY E C   1 
ATOM   8897  O  O   . GLY E  1 63  ? 23.672   54.793  71.231  1.00 29.74 ? 55   GLY E O   1 
ATOM   8898  N  N   . TRP E  1 64  ? 21.749   55.956  71.463  1.00 27.54 ? 56   TRP E N   1 
ATOM   8899  C  CA  . TRP E  1 64  ? 21.834   56.538  70.116  1.00 26.92 ? 56   TRP E CA  1 
ATOM   8900  C  C   . TRP E  1 64  ? 22.539   57.882  70.171  1.00 26.15 ? 56   TRP E C   1 
ATOM   8901  O  O   . TRP E  1 64  ? 22.357   58.656  71.099  1.00 25.06 ? 56   TRP E O   1 
ATOM   8902  C  CB  . TRP E  1 64  ? 20.438   56.701  69.506  1.00 27.03 ? 56   TRP E CB  1 
ATOM   8903  C  CG  . TRP E  1 64  ? 19.745   55.378  69.332  1.00 26.37 ? 56   TRP E CG  1 
ATOM   8904  C  CD1 . TRP E  1 64  ? 18.805   54.853  70.148  1.00 25.55 ? 56   TRP E CD1 1 
ATOM   8905  C  CD2 . TRP E  1 64  ? 20.011   54.384  68.337  1.00 25.61 ? 56   TRP E CD2 1 
ATOM   8906  N  NE1 . TRP E  1 64  ? 18.432   53.603  69.714  1.00 25.99 ? 56   TRP E NE1 1 
ATOM   8907  C  CE2 . TRP E  1 64  ? 19.156   53.284  68.604  1.00 26.46 ? 56   TRP E CE2 1 
ATOM   8908  C  CE3 . TRP E  1 64  ? 20.869   54.315  67.250  1.00 26.26 ? 56   TRP E CE3 1 
ATOM   8909  C  CZ2 . TRP E  1 64  ? 19.125   52.131  67.805  1.00 27.22 ? 56   TRP E CZ2 1 
ATOM   8910  C  CZ3 . TRP E  1 64  ? 20.838   53.154  66.441  1.00 29.36 ? 56   TRP E CZ3 1 
ATOM   8911  C  CH2 . TRP E  1 64  ? 19.972   52.076  66.730  1.00 26.47 ? 56   TRP E CH2 1 
ATOM   8912  N  N   . ALA E  1 65  ? 23.363   58.161  69.172  1.00 26.08 ? 57   ALA E N   1 
ATOM   8913  C  CA  . ALA E  1 65  ? 23.913   59.526  68.988  1.00 26.29 ? 57   ALA E CA  1 
ATOM   8914  C  C   . ALA E  1 65  ? 22.833   60.416  68.327  1.00 26.10 ? 57   ALA E C   1 
ATOM   8915  O  O   . ALA E  1 65  ? 22.905   60.753  67.157  1.00 26.69 ? 57   ALA E O   1 
ATOM   8916  C  CB  . ALA E  1 65  ? 25.254   59.502  68.204  1.00 24.68 ? 57   ALA E CB  1 
ATOM   8917  N  N   . GLY E  1 66  ? 21.832   60.768  69.121  1.00 26.94 ? 58   GLY E N   1 
ATOM   8918  C  CA  . GLY E  1 66  ? 20.668   61.512  68.705  1.00 27.16 ? 58   GLY E CA  1 
ATOM   8919  C  C   . GLY E  1 66  ? 19.877   62.050  69.888  1.00 27.89 ? 58   GLY E C   1 
ATOM   8920  O  O   . GLY E  1 66  ? 20.160   61.751  71.019  1.00 27.97 ? 58   GLY E O   1 
ATOM   8921  N  N   . ASP E  1 67  ? 18.896   62.888  69.611  1.00 28.92 ? 59   ASP E N   1 
ATOM   8922  C  CA  . ASP E  1 67  ? 18.108   63.500  70.658  1.00 30.57 ? 59   ASP E CA  1 
ATOM   8923  C  C   . ASP E  1 67  ? 16.639   63.380  70.238  1.00 29.40 ? 59   ASP E C   1 
ATOM   8924  O  O   . ASP E  1 67  ? 16.311   63.656  69.108  1.00 28.59 ? 59   ASP E O   1 
ATOM   8925  C  CB  . ASP E  1 67  ? 18.530   64.984  70.836  1.00 31.86 ? 59   ASP E CB  1 
ATOM   8926  C  CG  . ASP E  1 67  ? 17.627   65.739  71.803  1.00 36.37 ? 59   ASP E CG  1 
ATOM   8927  O  OD1 . ASP E  1 67  ? 17.817   65.524  73.012  1.00 43.20 ? 59   ASP E OD1 1 
ATOM   8928  O  OD2 . ASP E  1 67  ? 16.706   66.500  71.368  1.00 42.44 ? 59   ASP E OD2 1 
ATOM   8929  N  N   . HIS E  1 68  ? 15.766   62.971  71.136  1.00 29.08 ? 60   HIS E N   1 
ATOM   8930  C  CA  . HIS E  1 68  ? 14.330   62.898  70.828  1.00 29.41 ? 60   HIS E CA  1 
ATOM   8931  C  C   . HIS E  1 68  ? 14.111   62.095  69.522  1.00 27.46 ? 60   HIS E C   1 
ATOM   8932  O  O   . HIS E  1 68  ? 13.261   62.470  68.714  1.00 26.56 ? 60   HIS E O   1 
ATOM   8933  C  CB  . HIS E  1 68  ? 13.732   64.304  70.656  1.00 29.81 ? 60   HIS E CB  1 
ATOM   8934  C  CG  . HIS E  1 68  ? 13.449   65.043  71.929  1.00 36.61 ? 60   HIS E CG  1 
ATOM   8935  N  ND1 . HIS E  1 68  ? 14.366   65.899  72.528  1.00 42.12 ? 60   HIS E ND1 1 
ATOM   8936  C  CD2 . HIS E  1 68  ? 12.307   65.135  72.671  1.00 42.22 ? 60   HIS E CD2 1 
ATOM   8937  C  CE1 . HIS E  1 68  ? 13.809   66.439  73.609  1.00 45.26 ? 60   HIS E CE1 1 
ATOM   8938  N  NE2 . HIS E  1 68  ? 12.569   65.976  73.733  1.00 44.33 ? 60   HIS E NE2 1 
ATOM   8939  N  N   . VAL E  1 69  ? 14.894   61.031  69.287  1.00 25.49 ? 61   VAL E N   1 
ATOM   8940  C  CA  . VAL E  1 69  ? 14.779   60.305  68.038  1.00 24.07 ? 61   VAL E CA  1 
ATOM   8941  C  C   . VAL E  1 69  ? 13.464   59.508  68.016  1.00 23.70 ? 61   VAL E C   1 
ATOM   8942  O  O   . VAL E  1 69  ? 13.126   58.810  68.967  1.00 22.88 ? 61   VAL E O   1 
ATOM   8943  C  CB  . VAL E  1 69  ? 15.964   59.407  67.746  1.00 24.94 ? 61   VAL E CB  1 
ATOM   8944  C  CG1 . VAL E  1 69  ? 15.769   58.647  66.414  1.00 21.91 ? 61   VAL E CG1 1 
ATOM   8945  C  CG2 . VAL E  1 69  ? 17.278   60.230  67.737  1.00 23.96 ? 61   VAL E CG2 1 
ATOM   8946  N  N   . GLU E  1 70  ? 12.707   59.663  66.931  1.00 22.22 ? 62   GLU E N   1 
ATOM   8947  C  CA  . GLU E  1 70  ? 11.420   59.009  66.784  1.00 21.14 ? 62   GLU E CA  1 
ATOM   8948  C  C   . GLU E  1 70  ? 11.640   57.811  65.911  1.00 20.72 ? 62   GLU E C   1 
ATOM   8949  O  O   . GLU E  1 70  ? 12.126   57.945  64.767  1.00 21.10 ? 62   GLU E O   1 
ATOM   8950  C  CB  . GLU E  1 70  ? 10.387   59.969  66.172  1.00 20.95 ? 62   GLU E CB  1 
ATOM   8951  C  CG  . GLU E  1 70  ? 10.275   61.302  66.958  1.00 21.13 ? 62   GLU E CG  1 
ATOM   8952  C  CD  . GLU E  1 70  ? 9.327    62.355  66.354  1.00 21.92 ? 62   GLU E CD  1 
ATOM   8953  O  OE1 . GLU E  1 70  ? 9.266    62.512  65.110  1.00 19.85 ? 62   GLU E OE1 1 
ATOM   8954  O  OE2 . GLU E  1 70  ? 8.656    63.060  67.170  1.00 22.36 ? 62   GLU E OE2 1 
ATOM   8955  N  N   . PRO E  1 71  ? 11.331   56.622  66.434  1.00 19.88 ? 63   PRO E N   1 
ATOM   8956  C  CA  . PRO E  1 71  ? 11.455   55.397  65.652  1.00 20.38 ? 63   PRO E CA  1 
ATOM   8957  C  C   . PRO E  1 71  ? 10.532   55.410  64.465  1.00 19.99 ? 63   PRO E C   1 
ATOM   8958  O  O   . PRO E  1 71  ? 9.458    55.970  64.550  1.00 19.99 ? 63   PRO E O   1 
ATOM   8959  C  CB  . PRO E  1 71  ? 10.967   54.311  66.610  1.00 20.40 ? 63   PRO E CB  1 
ATOM   8960  C  CG  . PRO E  1 71  ? 10.164   55.013  67.596  1.00 20.03 ? 63   PRO E CG  1 
ATOM   8961  C  CD  . PRO E  1 71  ? 10.818   56.338  67.775  1.00 19.80 ? 63   PRO E CD  1 
ATOM   8962  N  N   . GLY E  1 72  ? 10.941   54.791  63.381  1.00 19.25 ? 64   GLY E N   1 
ATOM   8963  C  CA  . GLY E  1 72  ? 10.082   54.623  62.239  1.00 19.79 ? 64   GLY E CA  1 
ATOM   8964  C  C   . GLY E  1 72  ? 9.721    55.907  61.501  1.00 19.86 ? 64   GLY E C   1 
ATOM   8965  O  O   . GLY E  1 72  ? 10.579   56.746  61.231  1.00 19.42 ? 64   GLY E O   1 
ATOM   8966  N  N   . VAL E  1 73  ? 8.437    56.037  61.165  1.00 20.18 ? 65   VAL E N   1 
ATOM   8967  C  CA  . VAL E  1 73  ? 7.960    57.092  60.310  1.00 19.67 ? 65   VAL E CA  1 
ATOM   8968  C  C   . VAL E  1 73  ? 7.208    58.077  61.196  1.00 20.01 ? 65   VAL E C   1 
ATOM   8969  O  O   . VAL E  1 73  ? 6.241    57.698  61.844  1.00 19.76 ? 65   VAL E O   1 
ATOM   8970  C  CB  . VAL E  1 73  ? 7.102    56.535  59.184  1.00 20.04 ? 65   VAL E CB  1 
ATOM   8971  C  CG1 . VAL E  1 73  ? 6.409    57.689  58.369  1.00 19.19 ? 65   VAL E CG1 1 
ATOM   8972  C  CG2 . VAL E  1 73  ? 7.942    55.576  58.307  1.00 18.58 ? 65   VAL E CG2 1 
ATOM   8973  N  N   . SER E  1 74  ? 7.693    59.328  61.230  1.00 19.60 ? 66   SER E N   1 
ATOM   8974  C  CA  . SER E  1 74  ? 7.018    60.424  61.860  1.00 19.90 ? 66   SER E CA  1 
ATOM   8975  C  C   . SER E  1 74  ? 6.009    61.035  60.858  1.00 20.54 ? 66   SER E C   1 
ATOM   8976  O  O   . SER E  1 74  ? 6.340    61.322  59.697  1.00 21.31 ? 66   SER E O   1 
ATOM   8977  C  CB  . SER E  1 74  ? 8.019    61.484  62.295  1.00 20.32 ? 66   SER E CB  1 
ATOM   8978  O  OG  . SER E  1 74  ? 9.006    60.931  63.128  1.00 18.78 ? 66   SER E OG  1 
ATOM   8979  N  N   . VAL E  1 75  ? 4.782    61.187  61.329  1.00 20.28 ? 67   VAL E N   1 
ATOM   8980  C  CA  . VAL E  1 75  ? 3.651    61.755  60.582  1.00 20.25 ? 67   VAL E CA  1 
ATOM   8981  C  C   . VAL E  1 75  ? 3.177    63.061  61.227  1.00 20.61 ? 67   VAL E C   1 
ATOM   8982  O  O   . VAL E  1 75  ? 2.846    63.111  62.423  1.00 19.57 ? 67   VAL E O   1 
ATOM   8983  C  CB  . VAL E  1 75  ? 2.481    60.797  60.606  1.00 20.07 ? 67   VAL E CB  1 
ATOM   8984  C  CG1 . VAL E  1 75  ? 1.292    61.382  59.840  1.00 19.09 ? 67   VAL E CG1 1 
ATOM   8985  C  CG2 . VAL E  1 75  ? 2.916    59.463  60.042  1.00 18.83 ? 67   VAL E CG2 1 
ATOM   8986  N  N   . MET E  1 76  ? 3.176    64.130  60.443  1.00 21.46 ? 68   MET E N   1 
ATOM   8987  C  CA  . MET E  1 76  ? 2.686    65.403  60.930  1.00 21.98 ? 68   MET E CA  1 
ATOM   8988  C  C   . MET E  1 76  ? 1.396    65.697  60.193  1.00 22.09 ? 68   MET E C   1 
ATOM   8989  O  O   . MET E  1 76  ? 1.071    65.044  59.178  1.00 21.10 ? 68   MET E O   1 
ATOM   8990  C  CB  . MET E  1 76  ? 3.700    66.538  60.701  1.00 22.62 ? 68   MET E CB  1 
ATOM   8991  C  CG  . MET E  1 76  ? 3.993    66.850  59.219  1.00 24.23 ? 68   MET E CG  1 
ATOM   8992  S  SD  . MET E  1 76  ? 5.306    68.038  58.925  1.00 26.38 ? 68   MET E SD  1 
ATOM   8993  C  CE  . MET E  1 76  ? 4.413    69.485  59.526  1.00 38.39 ? 68   MET E CE  1 
ATOM   8994  N  N   . ALA E  1 77  ? 0.716    66.719  60.701  1.00 21.34 ? 69   ALA E N   1 
ATOM   8995  C  CA  . ALA E  1 77  ? -0.473   67.312  60.072  1.00 22.43 ? 69   ALA E CA  1 
ATOM   8996  C  C   . ALA E  1 77  ? -0.147   68.068  58.775  1.00 22.82 ? 69   ALA E C   1 
ATOM   8997  O  O   . ALA E  1 77  ? 0.930    68.650  58.641  1.00 23.02 ? 69   ALA E O   1 
ATOM   8998  C  CB  . ALA E  1 77  ? -1.142   68.284  61.071  1.00 20.77 ? 69   ALA E CB  1 
ATOM   8999  N  N   . ARG E  1 78  ? -1.135   68.131  57.893  1.00 24.10 ? 70   ARG E N   1 
ATOM   9000  C  CA  . ARG E  1 78  ? -1.104   68.939  56.683  1.00 25.40 ? 70   ARG E CA  1 
ATOM   9001  C  C   . ARG E  1 78  ? -1.008   70.416  56.987  1.00 25.86 ? 70   ARG E C   1 
ATOM   9002  O  O   . ARG E  1 78  ? -0.495   71.167  56.194  1.00 26.56 ? 70   ARG E O   1 
ATOM   9003  C  CB  . ARG E  1 78  ? -2.389   68.706  55.867  1.00 25.13 ? 70   ARG E CB  1 
ATOM   9004  C  CG  . ARG E  1 78  ? -2.487   67.308  55.312  1.00 26.94 ? 70   ARG E CG  1 
ATOM   9005  C  CD  . ARG E  1 78  ? -3.679   67.053  54.344  1.00 27.28 ? 70   ARG E CD  1 
ATOM   9006  N  NE  . ARG E  1 78  ? -4.935   67.551  54.867  1.00 27.06 ? 70   ARG E NE  1 
ATOM   9007  C  CZ  . ARG E  1 78  ? -6.073   67.611  54.196  1.00 29.10 ? 70   ARG E CZ  1 
ATOM   9008  N  NH1 . ARG E  1 78  ? -6.144   67.155  52.965  1.00 31.35 ? 70   ARG E NH1 1 
ATOM   9009  N  NH2 . ARG E  1 78  ? -7.165   68.126  54.765  1.00 29.80 ? 70   ARG E NH2 1 
ATOM   9010  N  N   . ARG E  1 79  ? -1.591   70.832  58.094  1.00 27.25 ? 71   ARG E N   1 
ATOM   9011  C  CA  . ARG E  1 79  ? -1.690   72.241  58.476  1.00 28.44 ? 71   ARG E CA  1 
ATOM   9012  C  C   . ARG E  1 79  ? -2.009   72.272  59.941  1.00 28.92 ? 71   ARG E C   1 
ATOM   9013  O  O   . ARG E  1 79  ? -2.394   71.266  60.521  1.00 27.45 ? 71   ARG E O   1 
ATOM   9014  C  CB  . ARG E  1 79  ? -2.809   72.975  57.698  1.00 29.70 ? 71   ARG E CB  1 
ATOM   9015  C  CG  . ARG E  1 79  ? -4.226   72.351  57.777  1.00 32.03 ? 71   ARG E CG  1 
ATOM   9016  C  CD  . ARG E  1 79  ? -5.270   73.198  57.027  1.00 35.99 ? 71   ARG E CD  1 
ATOM   9017  N  NE  . ARG E  1 79  ? -4.841   73.390  55.646  1.00 39.61 ? 71   ARG E NE  1 
ATOM   9018  C  CZ  . ARG E  1 79  ? -4.898   72.446  54.697  1.00 43.89 ? 71   ARG E CZ  1 
ATOM   9019  N  NH1 . ARG E  1 79  ? -5.399   71.248  54.946  1.00 45.04 ? 71   ARG E NH1 1 
ATOM   9020  N  NH2 . ARG E  1 79  ? -4.448   72.687  53.482  1.00 44.31 ? 71   ARG E NH2 1 
ATOM   9021  N  N   . LYS E  1 80  ? -1.862   73.436  60.546  1.00 30.43 ? 72   LYS E N   1 
ATOM   9022  C  CA  . LYS E  1 80  ? -1.987   73.577  61.990  1.00 31.37 ? 72   LYS E CA  1 
ATOM   9023  C  C   . LYS E  1 80  ? -3.316   73.154  62.589  1.00 31.18 ? 72   LYS E C   1 
ATOM   9024  O  O   . LYS E  1 80  ? -3.365   72.560  63.639  1.00 30.40 ? 72   LYS E O   1 
ATOM   9025  C  CB  . LYS E  1 80  ? -1.756   75.019  62.365  1.00 32.71 ? 72   LYS E CB  1 
ATOM   9026  C  CG  . LYS E  1 80  ? -1.678   75.212  63.856  1.00 38.56 ? 72   LYS E CG  1 
ATOM   9027  C  CD  . LYS E  1 80  ? -1.047   76.541  64.175  1.00 47.77 ? 72   LYS E CD  1 
ATOM   9028  C  CE  . LYS E  1 80  ? -1.491   77.078  65.551  1.00 52.85 ? 72   LYS E CE  1 
ATOM   9029  N  NZ  . LYS E  1 80  ? -0.669   76.482  66.646  1.00 55.86 ? 72   LYS E NZ  1 
ATOM   9030  N  N   . GLU E  1 81  ? -4.383   73.440  61.893  1.00 31.22 ? 73   GLU E N   1 
ATOM   9031  C  CA  . GLU E  1 81  ? -5.718   73.158  62.306  1.00 32.44 ? 73   GLU E CA  1 
ATOM   9032  C  C   . GLU E  1 81  ? -5.996   71.686  62.416  1.00 29.94 ? 73   GLU E C   1 
ATOM   9033  O  O   . GLU E  1 81  ? -6.867   71.288  63.100  1.00 29.74 ? 73   GLU E O   1 
ATOM   9034  C  CB  . GLU E  1 81  ? -6.669   73.789  61.307  1.00 34.06 ? 73   GLU E CB  1 
ATOM   9035  C  CG  . GLU E  1 81  ? -6.490   75.259  61.168  1.00 41.26 ? 73   GLU E CG  1 
ATOM   9036  C  CD  . GLU E  1 81  ? -5.795   75.745  59.873  1.00 49.08 ? 73   GLU E CD  1 
ATOM   9037  O  OE1 . GLU E  1 81  ? -4.588   75.544  59.660  1.00 45.25 ? 73   GLU E OE1 1 
ATOM   9038  O  OE2 . GLU E  1 81  ? -6.492   76.396  59.083  1.00 55.02 ? 73   GLU E OE2 1 
ATOM   9039  N  N   . GLU E  1 82  ? -5.218   70.886  61.734  1.00 26.80 ? 74   GLU E N   1 
ATOM   9040  C  CA  . GLU E  1 82  ? -5.387   69.454  61.769  1.00 25.37 ? 74   GLU E CA  1 
ATOM   9041  C  C   . GLU E  1 82  ? -4.529   68.738  62.828  1.00 24.40 ? 74   GLU E C   1 
ATOM   9042  O  O   . GLU E  1 82  ? -4.554   67.513  62.919  1.00 23.92 ? 74   GLU E O   1 
ATOM   9043  C  CB  . GLU E  1 82  ? -5.081   68.902  60.389  1.00 25.80 ? 74   GLU E CB  1 
ATOM   9044  C  CG  . GLU E  1 82  ? -6.283   68.946  59.492  1.00 27.28 ? 74   GLU E CG  1 
ATOM   9045  C  CD  . GLU E  1 82  ? -5.987   68.953  58.011  1.00 25.83 ? 74   GLU E CD  1 
ATOM   9046  O  OE1 . GLU E  1 82  ? -5.086   68.215  57.555  1.00 28.08 ? 74   GLU E OE1 1 
ATOM   9047  O  OE2 . GLU E  1 82  ? -6.650   69.708  57.302  1.00 25.01 ? 74   GLU E OE2 1 
ATOM   9048  N  N   . GLU E  1 83  ? -3.801   69.488  63.640  1.00 23.30 ? 75   GLU E N   1 
ATOM   9049  C  CA  . GLU E  1 83  ? -2.907   68.899  64.602  1.00 23.62 ? 75   GLU E CA  1 
ATOM   9050  C  C   . GLU E  1 83  ? -3.641   68.299  65.794  1.00 23.16 ? 75   GLU E C   1 
ATOM   9051  O  O   . GLU E  1 83  ? -3.303   67.196  66.249  1.00 21.83 ? 75   GLU E O   1 
ATOM   9052  C  CB  . GLU E  1 83  ? -1.906   69.933  65.129  1.00 24.65 ? 75   GLU E CB  1 
ATOM   9053  C  CG  . GLU E  1 83  ? -0.808   70.266  64.118  1.00 27.16 ? 75   GLU E CG  1 
ATOM   9054  C  CD  . GLU E  1 83  ? 0.286    71.260  64.619  1.00 30.41 ? 75   GLU E CD  1 
ATOM   9055  O  OE1 . GLU E  1 83  ? 0.510    71.515  65.837  1.00 28.14 ? 75   GLU E OE1 1 
ATOM   9056  O  OE2 . GLU E  1 83  ? 0.942    71.785  63.718  1.00 34.01 ? 75   GLU E OE2 1 
ATOM   9057  N  N   . ILE E  1 84  ? -4.599   69.040  66.346  1.00 23.01 ? 76   ILE E N   1 
ATOM   9058  C  CA  . ILE E  1 84  ? -5.315   68.562  67.525  1.00 22.37 ? 76   ILE E CA  1 
ATOM   9059  C  C   . ILE E  1 84  ? -5.997   67.198  67.207  1.00 22.65 ? 76   ILE E C   1 
ATOM   9060  O  O   . ILE E  1 84  ? -5.809   66.259  67.936  1.00 22.50 ? 76   ILE E O   1 
ATOM   9061  C  CB  . ILE E  1 84  ? -6.273   69.614  68.085  1.00 22.48 ? 76   ILE E CB  1 
ATOM   9062  C  CG1 . ILE E  1 84  ? -5.500   70.721  68.799  1.00 24.07 ? 76   ILE E CG1 1 
ATOM   9063  C  CG2 . ILE E  1 84  ? -7.232   69.042  69.101  1.00 19.90 ? 76   ILE E CG2 1 
ATOM   9064  C  CD1 . ILE E  1 84  ? -6.410   71.989  69.162  1.00 20.89 ? 76   ILE E CD1 1 
ATOM   9065  N  N   . PRO E  1 85  ? -6.720   67.073  66.099  1.00 22.48 ? 77   PRO E N   1 
ATOM   9066  C  CA  . PRO E  1 85  ? -7.308   65.747  65.839  1.00 23.13 ? 77   PRO E CA  1 
ATOM   9067  C  C   . PRO E  1 85  ? -6.291   64.631  65.561  1.00 22.27 ? 77   PRO E C   1 
ATOM   9068  O  O   . PRO E  1 85  ? -6.470   63.510  66.037  1.00 21.24 ? 77   PRO E O   1 
ATOM   9069  C  CB  . PRO E  1 85  ? -8.253   65.985  64.619  1.00 23.67 ? 77   PRO E CB  1 
ATOM   9070  C  CG  . PRO E  1 85  ? -7.784   67.281  64.028  1.00 23.68 ? 77   PRO E CG  1 
ATOM   9071  C  CD  . PRO E  1 85  ? -7.232   68.095  65.182  1.00 23.07 ? 77   PRO E CD  1 
ATOM   9072  N  N   . LEU E  1 86  ? -5.231   64.933  64.817  1.00 21.79 ? 78   LEU E N   1 
ATOM   9073  C  CA  . LEU E  1 86  ? -4.129   63.966  64.635  1.00 20.94 ? 78   LEU E CA  1 
ATOM   9074  C  C   . LEU E  1 86  ? -3.601   63.445  65.966  1.00 20.77 ? 78   LEU E C   1 
ATOM   9075  O  O   . LEU E  1 86  ? -3.497   62.256  66.162  1.00 19.27 ? 78   LEU E O   1 
ATOM   9076  C  CB  . LEU E  1 86  ? -2.973   64.631  63.901  1.00 20.63 ? 78   LEU E CB  1 
ATOM   9077  C  CG  . LEU E  1 86  ? -1.742   63.783  63.588  1.00 20.60 ? 78   LEU E CG  1 
ATOM   9078  C  CD1 . LEU E  1 86  ? -2.089   62.566  62.773  1.00 17.05 ? 78   LEU E CD1 1 
ATOM   9079  C  CD2 . LEU E  1 86  ? -0.608   64.591  62.897  1.00 19.54 ? 78   LEU E CD2 1 
ATOM   9080  N  N   . MET E  1 87  ? -3.251   64.364  66.858  1.00 20.51 ? 79   MET E N   1 
ATOM   9081  C  CA  . MET E  1 87  ? -2.627   64.009  68.092  1.00 20.87 ? 79   MET E CA  1 
ATOM   9082  C  C   . MET E  1 87  ? -3.589   63.389  69.094  1.00 21.09 ? 79   MET E C   1 
ATOM   9083  O  O   . MET E  1 87  ? -3.172   62.534  69.884  1.00 20.55 ? 79   MET E O   1 
ATOM   9084  C  CB  . MET E  1 87  ? -1.978   65.225  68.749  1.00 21.13 ? 79   MET E CB  1 
ATOM   9085  C  CG  . MET E  1 87  ? -0.769   65.812  67.971  1.00 22.11 ? 79   MET E CG  1 
ATOM   9086  S  SD  . MET E  1 87  ? 0.510    64.562  67.639  1.00 22.51 ? 79   MET E SD  1 
ATOM   9087  C  CE  . MET E  1 87  ? 1.034    64.272  69.353  1.00 20.78 ? 79   MET E CE  1 
ATOM   9088  N  N   . THR E  1 88  ? -4.858   63.809  69.075  1.00 21.18 ? 80   THR E N   1 
ATOM   9089  C  CA  . THR E  1 88  ? -5.836   63.311  70.019  1.00 20.62 ? 80   THR E CA  1 
ATOM   9090  C  C   . THR E  1 88  ? -6.407   61.953  69.638  1.00 21.08 ? 80   THR E C   1 
ATOM   9091  O  O   . THR E  1 88  ? -6.460   61.066  70.485  1.00 21.93 ? 80   THR E O   1 
ATOM   9092  C  CB  . THR E  1 88  ? -6.958   64.278  70.187  1.00 21.48 ? 80   THR E CB  1 
ATOM   9093  O  OG1 . THR E  1 88  ? -6.400   65.543  70.536  1.00 20.88 ? 80   THR E OG1 1 
ATOM   9094  C  CG2 . THR E  1 88  ? -7.955   63.805  71.286  1.00 17.96 ? 80   THR E CG2 1 
ATOM   9095  N  N   . LEU E  1 89  ? -6.821   61.776  68.384  1.00 20.69 ? 81   LEU E N   1 
ATOM   9096  C  CA  . LEU E  1 89  ? -7.565   60.591  67.984  1.00 20.92 ? 81   LEU E CA  1 
ATOM   9097  C  C   . LEU E  1 89  ? -6.689   59.366  67.711  1.00 20.68 ? 81   LEU E C   1 
ATOM   9098  O  O   . LEU E  1 89  ? -7.147   58.243  67.825  1.00 19.84 ? 81   LEU E O   1 
ATOM   9099  C  CB  . LEU E  1 89  ? -8.467   60.886  66.773  1.00 21.45 ? 81   LEU E CB  1 
ATOM   9100  C  CG  . LEU E  1 89  ? -9.557   61.922  67.039  1.00 22.64 ? 81   LEU E CG  1 
ATOM   9101  C  CD1 . LEU E  1 89  ? -10.376  62.164  65.796  1.00 21.83 ? 81   LEU E CD1 1 
ATOM   9102  C  CD2 . LEU E  1 89  ? -10.451  61.514  68.186  1.00 20.88 ? 81   LEU E CD2 1 
ATOM   9103  N  N   . SER E  1 90  ? -5.424   59.589  67.357  1.00 20.12 ? 82   SER E N   1 
ATOM   9104  C  CA  . SER E  1 90  ? -4.559   58.495  66.962  1.00 19.79 ? 82   SER E CA  1 
ATOM   9105  C  C   . SER E  1 90  ? -4.180   57.688  68.206  1.00 19.48 ? 82   SER E C   1 
ATOM   9106  O  O   . SER E  1 90  ? -3.697   58.239  69.186  1.00 18.19 ? 82   SER E O   1 
ATOM   9107  C  CB  . SER E  1 90  ? -3.294   59.043  66.296  1.00 20.23 ? 82   SER E CB  1 
ATOM   9108  O  OG  . SER E  1 90  ? -3.573   59.863  65.171  1.00 20.00 ? 82   SER E OG  1 
ATOM   9109  N  N   . CYS E  1 91  ? -4.366   56.381  68.151  1.00 19.22 ? 83   CYS E N   1 
ATOM   9110  C  CA  . CYS E  1 91  ? -4.078   55.532  69.286  1.00 19.15 ? 83   CYS E CA  1 
ATOM   9111  C  C   . CYS E  1 91  ? -3.009   54.489  68.940  1.00 18.89 ? 83   CYS E C   1 
ATOM   9112  O  O   . CYS E  1 91  ? -2.938   53.981  67.803  1.00 19.51 ? 83   CYS E O   1 
ATOM   9113  C  CB  . CYS E  1 91  ? -5.381   54.850  69.758  1.00 19.27 ? 83   CYS E CB  1 
ATOM   9114  S  SG  . CYS E  1 91  ? -6.577   56.011  70.523  1.00 20.47 ? 83   CYS E SG  1 
ATOM   9115  N  N   . ILE E  1 92  ? -2.195   54.158  69.936  1.00 18.54 ? 84   ILE E N   1 
ATOM   9116  C  CA  . ILE E  1 92  ? -1.141   53.166  69.807  1.00 18.23 ? 84   ILE E CA  1 
ATOM   9117  C  C   . ILE E  1 92  ? -1.799   51.875  69.381  1.00 19.53 ? 84   ILE E C   1 
ATOM   9118  O  O   . ILE E  1 92  ? -2.749   51.415  69.984  1.00 18.20 ? 84   ILE E O   1 
ATOM   9119  C  CB  . ILE E  1 92  ? -0.339   53.030  71.089  1.00 18.93 ? 84   ILE E CB  1 
ATOM   9120  C  CG1 . ILE E  1 92  ? 0.422    54.349  71.378  1.00 17.64 ? 84   ILE E CG1 1 
ATOM   9121  C  CG2 . ILE E  1 92  ? 0.631    51.868  71.006  1.00 16.66 ? 84   ILE E CG2 1 
ATOM   9122  C  CD1 . ILE E  1 92  ? 0.879    54.449  72.771  1.00 18.24 ? 84   ILE E CD1 1 
ATOM   9123  N  N   . GLY E  1 93  ? -1.351   51.367  68.236  1.00 20.42 ? 85   GLY E N   1 
ATOM   9124  C  CA  . GLY E  1 93  ? -1.902   50.171  67.697  1.00 21.25 ? 85   GLY E CA  1 
ATOM   9125  C  C   . GLY E  1 93  ? -2.819   50.357  66.515  1.00 21.71 ? 85   GLY E C   1 
ATOM   9126  O  O   . GLY E  1 93  ? -3.088   49.396  65.815  1.00 22.09 ? 85   GLY E O   1 
ATOM   9127  N  N   . ASN E  1 94  ? -3.361   51.554  66.319  1.00 22.68 ? 86   ASN E N   1 
ATOM   9128  C  CA  . ASN E  1 94  ? -4.221   51.786  65.144  1.00 22.74 ? 86   ASN E CA  1 
ATOM   9129  C  C   . ASN E  1 94  ? -3.526   51.435  63.812  1.00 23.35 ? 86   ASN E C   1 
ATOM   9130  O  O   . ASN E  1 94  ? -2.306   51.546  63.642  1.00 23.53 ? 86   ASN E O   1 
ATOM   9131  C  CB  . ASN E  1 94  ? -4.762   53.189  65.072  1.00 22.38 ? 86   ASN E CB  1 
ATOM   9132  C  CG  . ASN E  1 94  ? -5.700   53.569  66.228  1.00 22.16 ? 86   ASN E CG  1 
ATOM   9133  O  OD1 . ASN E  1 94  ? -5.851   54.754  66.483  1.00 19.44 ? 86   ASN E OD1 1 
ATOM   9134  N  ND2 . ASN E  1 94  ? -6.320   52.599  66.915  1.00 19.45 ? 86   ASN E ND2 1 
ATOM   9135  N  N   . GLU E  1 95  ? -4.330   50.946  62.891  1.00 23.96 ? 87   GLU E N   1 
ATOM   9136  C  CA  . GLU E  1 95  ? -3.924   50.691  61.543  1.00 25.53 ? 87   GLU E CA  1 
ATOM   9137  C  C   . GLU E  1 95  ? -3.605   52.003  60.813  1.00 23.67 ? 87   GLU E C   1 
ATOM   9138  O  O   . GLU E  1 95  ? -4.286   52.989  60.981  1.00 23.52 ? 87   GLU E O   1 
ATOM   9139  C  CB  . GLU E  1 95  ? -5.040   49.925  60.871  1.00 26.64 ? 87   GLU E CB  1 
ATOM   9140  C  CG  . GLU E  1 95  ? -4.652   49.395  59.531  1.00 34.53 ? 87   GLU E CG  1 
ATOM   9141  C  CD  . GLU E  1 95  ? -5.793   48.628  58.796  1.00 42.28 ? 87   GLU E CD  1 
ATOM   9142  O  OE1 . GLU E  1 95  ? -6.993   49.014  58.893  1.00 44.71 ? 87   GLU E OE1 1 
ATOM   9143  O  OE2 . GLU E  1 95  ? -5.434   47.643  58.104  1.00 48.16 ? 87   GLU E OE2 1 
ATOM   9144  N  N   . VAL E  1 96  ? -2.539   51.996  60.042  1.00 23.51 ? 88   VAL E N   1 
ATOM   9145  C  CA  . VAL E  1 96  ? -2.088   53.121  59.220  1.00 23.18 ? 88   VAL E CA  1 
ATOM   9146  C  C   . VAL E  1 96  ? -1.884   52.658  57.784  1.00 24.17 ? 88   VAL E C   1 
ATOM   9147  O  O   . VAL E  1 96  ? -1.319   51.597  57.572  1.00 23.50 ? 88   VAL E O   1 
ATOM   9148  C  CB  . VAL E  1 96  ? -0.751   53.687  59.743  1.00 23.00 ? 88   VAL E CB  1 
ATOM   9149  C  CG1 . VAL E  1 96  ? -0.325   54.880  58.935  1.00 20.14 ? 88   VAL E CG1 1 
ATOM   9150  C  CG2 . VAL E  1 96  ? -0.864   54.038  61.272  1.00 21.07 ? 88   VAL E CG2 1 
ATOM   9151  N  N   . ILE E  1 97  ? -2.363   53.446  56.812  1.00 25.24 ? 89   ILE E N   1 
ATOM   9152  C  CA  . ILE E  1 97  ? -2.251   53.138  55.387  1.00 25.98 ? 89   ILE E CA  1 
ATOM   9153  C  C   . ILE E  1 97  ? -1.598   54.284  54.617  1.00 26.37 ? 89   ILE E C   1 
ATOM   9154  O  O   . ILE E  1 97  ? -1.935   55.473  54.816  1.00 25.61 ? 89   ILE E O   1 
ATOM   9155  C  CB  . ILE E  1 97  ? -3.637   52.814  54.747  1.00 27.31 ? 89   ILE E CB  1 
ATOM   9156  C  CG1 . ILE E  1 97  ? -4.326   51.712  55.535  1.00 28.97 ? 89   ILE E CG1 1 
ATOM   9157  C  CG2 . ILE E  1 97  ? -3.469   52.293  53.277  1.00 25.95 ? 89   ILE E CG2 1 
ATOM   9158  C  CD1 . ILE E  1 97  ? -5.761   51.927  55.722  1.00 33.99 ? 89   ILE E CD1 1 
ATOM   9159  N  N   . VAL E  1 98  ? -0.626   53.924  53.783  1.00 27.21 ? 90   VAL E N   1 
ATOM   9160  C  CA  . VAL E  1 98  ? 0.121    54.876  52.998  1.00 27.61 ? 90   VAL E CA  1 
ATOM   9161  C  C   . VAL E  1 98  ? -0.780   55.099  51.795  1.00 29.84 ? 90   VAL E C   1 
ATOM   9162  O  O   . VAL E  1 98  ? -1.238   54.118  51.165  1.00 30.63 ? 90   VAL E O   1 
ATOM   9163  C  CB  . VAL E  1 98  ? 1.470    54.318  52.530  1.00 28.35 ? 90   VAL E CB  1 
ATOM   9164  C  CG1 . VAL E  1 98  ? 2.200    55.358  51.666  1.00 26.55 ? 90   VAL E CG1 1 
ATOM   9165  C  CG2 . VAL E  1 98  ? 2.381    53.864  53.725  1.00 25.41 ? 90   VAL E CG2 1 
ATOM   9166  N  N   . MET E  1 99  ? -1.059   56.364  51.477  1.00 30.23 ? 91   MET E N   1 
ATOM   9167  C  CA  . MET E  1 99  ? -2.093   56.685  50.490  1.00 31.22 ? 91   MET E CA  1 
ATOM   9168  C  C   . MET E  1 99  ? -1.600   57.459  49.238  1.00 31.31 ? 91   MET E C   1 
ATOM   9169  O  O   . MET E  1 99  ? -2.388   57.838  48.393  1.00 31.55 ? 91   MET E O   1 
ATOM   9170  C  CB  . MET E  1 99  ? -3.188   57.452  51.221  1.00 31.50 ? 91   MET E CB  1 
ATOM   9171  C  CG  . MET E  1 99  ? -3.986   56.593  52.166  1.00 33.49 ? 91   MET E CG  1 
ATOM   9172  S  SD  . MET E  1 99  ? -4.997   55.341  51.358  1.00 41.37 ? 91   MET E SD  1 
ATOM   9173  C  CE  . MET E  1 99  ? -6.128   56.272  50.392  1.00 36.47 ? 91   MET E CE  1 
ATOM   9174  N  N   . SER E  1 100 ? -0.295   57.680  49.144  1.00 31.66 ? 92   SER E N   1 
ATOM   9175  C  CA  . SER E  1 100 ? 0.361    58.212  47.967  1.00 31.79 ? 92   SER E CA  1 
ATOM   9176  C  C   . SER E  1 100 ? 1.793    57.700  47.945  1.00 32.56 ? 92   SER E C   1 
ATOM   9177  O  O   . SER E  1 100 ? 2.247    57.119  48.917  1.00 32.10 ? 92   SER E O   1 
ATOM   9178  C  CB  . SER E  1 100 ? 0.321    59.735  47.980  1.00 31.09 ? 92   SER E CB  1 
ATOM   9179  O  OG  . SER E  1 100 ? 1.211    60.263  48.934  1.00 30.74 ? 92   SER E OG  1 
ATOM   9180  N  N   . GLY E  1 101 ? 2.496    57.893  46.827  1.00 33.52 ? 93   GLY E N   1 
ATOM   9181  C  CA  . GLY E  1 101 ? 3.908    57.503  46.718  1.00 33.66 ? 93   GLY E CA  1 
ATOM   9182  C  C   . GLY E  1 101 ? 4.120    56.057  46.331  1.00 34.99 ? 93   GLY E C   1 
ATOM   9183  O  O   . GLY E  1 101 ? 3.157    55.313  46.061  1.00 34.95 ? 93   GLY E O   1 
ATOM   9184  N  N   . ASP E  1 102 ? 5.381    55.642  46.324  1.00 35.86 ? 94   ASP E N   1 
ATOM   9185  C  CA  . ASP E  1 102 ? 5.719    54.269  45.904  1.00 38.01 ? 94   ASP E CA  1 
ATOM   9186  C  C   . ASP E  1 102 ? 5.262    53.153  46.803  1.00 37.30 ? 94   ASP E C   1 
ATOM   9187  O  O   . ASP E  1 102 ? 5.245    52.018  46.366  1.00 38.32 ? 94   ASP E O   1 
ATOM   9188  C  CB  . ASP E  1 102 ? 7.227    54.100  45.692  1.00 38.64 ? 94   ASP E CB  1 
ATOM   9189  C  CG  . ASP E  1 102 ? 7.740    54.990  44.608  1.00 42.36 ? 94   ASP E CG  1 
ATOM   9190  O  OD1 . ASP E  1 102 ? 6.993    55.201  43.624  1.00 48.10 ? 94   ASP E OD1 1 
ATOM   9191  O  OD2 . ASP E  1 102 ? 8.858    55.529  44.760  1.00 48.15 ? 94   ASP E OD2 1 
ATOM   9192  N  N   . ALA E  1 103 ? 4.938    53.457  48.052  1.00 36.51 ? 95   ALA E N   1 
ATOM   9193  C  CA  . ALA E  1 103 ? 4.517    52.428  49.010  1.00 35.93 ? 95   ALA E CA  1 
ATOM   9194  C  C   . ALA E  1 103 ? 3.015    52.490  49.219  1.00 35.24 ? 95   ALA E C   1 
ATOM   9195  O  O   . ALA E  1 103 ? 2.504    51.924  50.152  1.00 34.48 ? 95   ALA E O   1 
ATOM   9196  C  CB  . ALA E  1 103 ? 5.240    52.622  50.340  1.00 35.29 ? 95   ALA E CB  1 
ATOM   9197  N  N   . LYS E  1 104 ? 2.324    53.213  48.356  1.00 35.61 ? 96   LYS E N   1 
ATOM   9198  C  CA  . LYS E  1 104 ? 0.864    53.316  48.411  1.00 36.30 ? 96   LYS E CA  1 
ATOM   9199  C  C   . LYS E  1 104 ? 0.227    51.948  48.630  1.00 35.27 ? 96   LYS E C   1 
ATOM   9200  O  O   . LYS E  1 104 ? 0.596    51.006  47.962  1.00 36.12 ? 96   LYS E O   1 
ATOM   9201  C  CB  . LYS E  1 104 ? 0.371    53.887  47.111  1.00 37.14 ? 96   LYS E CB  1 
ATOM   9202  C  CG  . LYS E  1 104 ? -1.113   54.193  47.021  1.00 40.36 ? 96   LYS E CG  1 
ATOM   9203  C  CD  . LYS E  1 104 ? -1.343   54.952  45.700  1.00 44.93 ? 96   LYS E CD  1 
ATOM   9204  C  CE  . LYS E  1 104 ? -2.784   55.205  45.451  1.00 48.22 ? 96   LYS E CE  1 
ATOM   9205  N  NZ  . LYS E  1 104 ? -3.452   53.902  45.480  1.00 52.65 ? 96   LYS E NZ  1 
ATOM   9206  N  N   . GLY E  1 105 ? -0.682   51.835  49.592  1.00 33.91 ? 97   GLY E N   1 
ATOM   9207  C  CA  . GLY E  1 105 ? -1.264   50.558  49.944  1.00 33.45 ? 97   GLY E CA  1 
ATOM   9208  C  C   . GLY E  1 105 ? -0.615   49.829  51.099  1.00 32.82 ? 97   GLY E C   1 
ATOM   9209  O  O   . GLY E  1 105 ? -1.269   49.032  51.739  1.00 31.68 ? 97   GLY E O   1 
ATOM   9210  N  N   . SER E  1 106 ? 0.650    50.119  51.387  1.00 31.90 ? 98   SER E N   1 
ATOM   9211  C  CA  . SER E  1 106 ? 1.300    49.568  52.543  1.00 32.06 ? 98   SER E CA  1 
ATOM   9212  C  C   . SER E  1 106 ? 0.607    49.970  53.861  1.00 31.85 ? 98   SER E C   1 
ATOM   9213  O  O   . SER E  1 106 ? 0.119    51.072  54.019  1.00 29.80 ? 98   SER E O   1 
ATOM   9214  C  CB  . SER E  1 106 ? 2.766    50.006  52.575  1.00 32.15 ? 98   SER E CB  1 
ATOM   9215  O  OG  . SER E  1 106 ? 3.431    49.510  51.449  1.00 32.74 ? 98   SER E OG  1 
ATOM   9216  N  N   . ARG E  1 107 ? 0.597    49.020  54.788  1.00 32.45 ? 99   ARG E N   1 
ATOM   9217  C  CA  . ARG E  1 107 ? -0.052   49.116  56.075  1.00 33.02 ? 99   ARG E CA  1 
ATOM   9218  C  C   . ARG E  1 107 ? 0.974    49.019  57.215  1.00 31.05 ? 99   ARG E C   1 
ATOM   9219  O  O   . ARG E  1 107 ? 1.943    48.276  57.139  1.00 29.54 ? 99   ARG E O   1 
ATOM   9220  C  CB  . ARG E  1 107 ? -1.030   47.963  56.235  1.00 34.42 ? 99   ARG E CB  1 
ATOM   9221  C  CG  . ARG E  1 107 ? -2.180   48.003  55.256  1.00 43.22 ? 99   ARG E CG  1 
ATOM   9222  C  CD  . ARG E  1 107 ? -3.109   46.740  55.266  1.00 53.09 ? 99   ARG E CD  1 
ATOM   9223  N  NE  . ARG E  1 107 ? -4.198   46.964  54.297  1.00 61.20 ? 99   ARG E NE  1 
ATOM   9224  C  CZ  . ARG E  1 107 ? -5.284   47.715  54.519  1.00 66.61 ? 99   ARG E CZ  1 
ATOM   9225  N  NH1 . ARG E  1 107 ? -5.484   48.293  55.688  1.00 69.23 ? 99   ARG E NH1 1 
ATOM   9226  N  NH2 . ARG E  1 107 ? -6.194   47.882  53.576  1.00 68.33 ? 99   ARG E NH2 1 
ATOM   9227  N  N   . GLY E  1 108 ? 0.734    49.782  58.269  1.00 29.46 ? 100  GLY E N   1 
ATOM   9228  C  CA  . GLY E  1 108 ? 1.553    49.749  59.460  1.00 27.96 ? 100  GLY E CA  1 
ATOM   9229  C  C   . GLY E  1 108 ? 0.670    50.050  60.638  1.00 26.96 ? 100  GLY E C   1 
ATOM   9230  O  O   . GLY E  1 108 ? -0.530   50.046  60.481  1.00 26.57 ? 100  GLY E O   1 
ATOM   9231  N  N   . PHE E  1 109 ? 1.291    50.359  61.780  1.00 26.38 ? 101  PHE E N   1 
ATOM   9232  C  CA  . PHE E  1 109 ? 0.667    50.530  63.048  1.00 26.92 ? 101  PHE E CA  1 
ATOM   9233  C  C   . PHE E  1 109 ? 1.271    51.721  63.786  1.00 23.99 ? 101  PHE E C   1 
ATOM   9234  O  O   . PHE E  1 109 ? 2.456    51.880  63.807  1.00 23.00 ? 101  PHE E O   1 
ATOM   9235  C  CB  . PHE E  1 109 ? 0.970    49.314  63.924  1.00 28.73 ? 101  PHE E CB  1 
ATOM   9236  C  CG  . PHE E  1 109 ? 0.462    48.037  63.377  1.00 40.38 ? 101  PHE E CG  1 
ATOM   9237  C  CD1 . PHE E  1 109 ? 1.283    47.199  62.616  1.00 49.30 ? 101  PHE E CD1 1 
ATOM   9238  C  CD2 . PHE E  1 109 ? -0.881   47.619  63.619  1.00 50.00 ? 101  PHE E CD2 1 
ATOM   9239  C  CE1 . PHE E  1 109 ? 0.770    45.943  62.080  1.00 52.56 ? 101  PHE E CE1 1 
ATOM   9240  C  CE2 . PHE E  1 109 ? -1.384   46.351  63.109  1.00 52.85 ? 101  PHE E CE2 1 
ATOM   9241  C  CZ  . PHE E  1 109 ? -0.547   45.532  62.348  1.00 53.80 ? 101  PHE E CZ  1 
ATOM   9242  N  N   . VAL E  1 110 ? 0.446    52.488  64.481  1.00 21.99 ? 102  VAL E N   1 
ATOM   9243  C  CA  . VAL E  1 110 ? 0.898    53.577  65.288  1.00 20.69 ? 102  VAL E CA  1 
ATOM   9244  C  C   . VAL E  1 110 ? 1.616    53.014  66.511  1.00 20.77 ? 102  VAL E C   1 
ATOM   9245  O  O   . VAL E  1 110 ? 1.067    52.173  67.221  1.00 19.44 ? 102  VAL E O   1 
ATOM   9246  C  CB  . VAL E  1 110 ? -0.287   54.446  65.797  1.00 21.01 ? 102  VAL E CB  1 
ATOM   9247  C  CG1 . VAL E  1 110 ? 0.233    55.557  66.728  1.00 17.16 ? 102  VAL E CG1 1 
ATOM   9248  C  CG2 . VAL E  1 110 ? -1.083   54.999  64.652  1.00 17.55 ? 102  VAL E CG2 1 
ATOM   9249  N  N   . THR E  1 111 ? 2.840    53.492  66.751  1.00 20.10 ? 103  THR E N   1 
ATOM   9250  C  CA  . THR E  1 111 ? 3.623    53.029  67.871  1.00 19.18 ? 103  THR E CA  1 
ATOM   9251  C  C   . THR E  1 111 ? 3.597    54.071  68.964  1.00 19.71 ? 103  THR E C   1 
ATOM   9252  O  O   . THR E  1 111 ? 3.915    53.776  70.130  1.00 19.50 ? 103  THR E O   1 
ATOM   9253  C  CB  . THR E  1 111 ? 5.107    52.843  67.498  1.00 19.56 ? 103  THR E CB  1 
ATOM   9254  O  OG1 . THR E  1 111 ? 5.678    54.117  67.166  1.00 17.39 ? 103  THR E OG1 1 
ATOM   9255  C  CG2 . THR E  1 111 ? 5.303    51.846  66.378  1.00 16.11 ? 103  THR E CG2 1 
ATOM   9256  N  N   . GLY E  1 112 ? 3.265    55.312  68.628  1.00 19.49 ? 104  GLY E N   1 
ATOM   9257  C  CA  . GLY E  1 112 ? 3.358    56.350  69.644  1.00 19.50 ? 104  GLY E CA  1 
ATOM   9258  C  C   . GLY E  1 112 ? 3.019    57.694  69.073  1.00 20.10 ? 104  GLY E C   1 
ATOM   9259  O  O   . GLY E  1 112 ? 2.649    57.794  67.912  1.00 20.15 ? 104  GLY E O   1 
ATOM   9260  N  N   . LYS E  1 113 ? 3.139    58.721  69.896  1.00 19.87 ? 105  LYS E N   1 
ATOM   9261  C  CA  . LYS E  1 113 ? 2.925    60.062  69.445  1.00 19.48 ? 105  LYS E CA  1 
ATOM   9262  C  C   . LYS E  1 113 ? 3.690    61.016  70.345  1.00 19.80 ? 105  LYS E C   1 
ATOM   9263  O  O   . LYS E  1 113 ? 3.961    60.708  71.490  1.00 18.73 ? 105  LYS E O   1 
ATOM   9264  C  CB  . LYS E  1 113 ? 1.427    60.386  69.408  1.00 19.46 ? 105  LYS E CB  1 
ATOM   9265  C  CG  . LYS E  1 113 ? 0.672    60.418  70.743  1.00 17.67 ? 105  LYS E CG  1 
ATOM   9266  C  CD  . LYS E  1 113 ? -0.829   60.299  70.386  1.00 18.55 ? 105  LYS E CD  1 
ATOM   9267  C  CE  . LYS E  1 113 ? -1.796   60.168  71.545  1.00 18.85 ? 105  LYS E CE  1 
ATOM   9268  N  NZ  . LYS E  1 113 ? -3.232   60.120  71.123  1.00 14.97 ? 105  LYS E NZ  1 
ATOM   9269  N  N   . HIS E  1 114 ? 4.051    62.165  69.788  1.00 20.87 ? 106  HIS E N   1 
ATOM   9270  C  CA  . HIS E  1 114 ? 4.959    63.083  70.420  1.00 22.30 ? 106  HIS E CA  1 
ATOM   9271  C  C   . HIS E  1 114 ? 4.468    64.525  70.311  1.00 23.25 ? 106  HIS E C   1 
ATOM   9272  O  O   . HIS E  1 114 ? 4.386    65.096  69.212  1.00 23.12 ? 106  HIS E O   1 
ATOM   9273  C  CB  . HIS E  1 114 ? 6.321    62.934  69.793  1.00 22.73 ? 106  HIS E CB  1 
ATOM   9274  C  CG  . HIS E  1 114 ? 7.364    63.814  70.394  1.00 25.77 ? 106  HIS E CG  1 
ATOM   9275  N  ND1 . HIS E  1 114 ? 8.563    64.061  69.774  1.00 31.67 ? 106  HIS E ND1 1 
ATOM   9276  C  CD2 . HIS E  1 114 ? 7.394    64.501  71.554  1.00 28.28 ? 106  HIS E CD2 1 
ATOM   9277  C  CE1 . HIS E  1 114 ? 9.269    64.894  70.515  1.00 32.88 ? 106  HIS E CE1 1 
ATOM   9278  N  NE2 . HIS E  1 114 ? 8.575    65.192  71.593  1.00 30.24 ? 106  HIS E NE2 1 
ATOM   9279  N  N   . GLY E  1 115 ? 4.143    65.109  71.454  1.00 24.20 ? 107  GLY E N   1 
ATOM   9280  C  CA  . GLY E  1 115 ? 3.572    66.450  71.500  1.00 26.36 ? 107  GLY E CA  1 
ATOM   9281  C  C   . GLY E  1 115 ? 4.660    67.490  71.323  1.00 27.40 ? 107  GLY E C   1 
ATOM   9282  O  O   . GLY E  1 115 ? 5.834    67.179  71.528  1.00 27.93 ? 107  GLY E O   1 
ATOM   9283  N  N   . GLY E  1 116 ? 4.259    68.717  70.960  1.00 28.22 ? 108  GLY E N   1 
ATOM   9284  C  CA  . GLY E  1 116 ? 5.179    69.871  70.686  1.00 27.96 ? 108  GLY E CA  1 
ATOM   9285  C  C   . GLY E  1 116 ? 5.227    70.007  69.181  1.00 28.39 ? 108  GLY E C   1 
ATOM   9286  O  O   . GLY E  1 116 ? 4.401    70.697  68.607  1.00 29.07 ? 108  GLY E O   1 
ATOM   9287  N  N   . VAL E  1 117 ? 6.127    69.266  68.527  1.00 27.64 ? 109  VAL E N   1 
ATOM   9288  C  CA  . VAL E  1 117 ? 6.077    69.127  67.076  1.00 27.40 ? 109  VAL E CA  1 
ATOM   9289  C  C   . VAL E  1 117 ? 4.803    68.466  66.577  1.00 26.55 ? 109  VAL E C   1 
ATOM   9290  O  O   . VAL E  1 117 ? 4.447    68.614  65.409  1.00 27.17 ? 109  VAL E O   1 
ATOM   9291  C  CB  . VAL E  1 117 ? 7.286    68.300  66.547  1.00 27.96 ? 109  VAL E CB  1 
ATOM   9292  C  CG1 . VAL E  1 117 ? 8.547    68.939  67.033  1.00 31.79 ? 109  VAL E CG1 1 
ATOM   9293  C  CG2 . VAL E  1 117 ? 7.287    66.886  67.045  1.00 25.81 ? 109  VAL E CG2 1 
ATOM   9294  N  N   . ASN E  1 118 ? 4.151    67.685  67.439  1.00 24.99 ? 110  ASN E N   1 
ATOM   9295  C  CA  . ASN E  1 118 ? 2.905    66.982  67.116  1.00 23.09 ? 110  ASN E CA  1 
ATOM   9296  C  C   . ASN E  1 118 ? 3.030    65.983  65.992  1.00 22.16 ? 110  ASN E C   1 
ATOM   9297  O  O   . ASN E  1 118 ? 2.500    66.157  64.905  1.00 22.49 ? 110  ASN E O   1 
ATOM   9298  C  CB  . ASN E  1 118 ? 1.790    67.973  66.898  1.00 23.16 ? 110  ASN E CB  1 
ATOM   9299  C  CG  . ASN E  1 118 ? 1.402    68.693  68.192  1.00 24.82 ? 110  ASN E CG  1 
ATOM   9300  O  OD1 . ASN E  1 118 ? 1.569    68.153  69.281  1.00 21.61 ? 110  ASN E OD1 1 
ATOM   9301  N  ND2 . ASN E  1 118 ? 0.838    69.901  68.066  1.00 24.58 ? 110  ASN E ND2 1 
ATOM   9302  N  N   . HIS E  1 119 ? 3.765    64.927  66.268  1.00 21.22 ? 111  HIS E N   1 
ATOM   9303  C  CA  . HIS E  1 119 ? 3.937    63.849  65.352  1.00 20.53 ? 111  HIS E CA  1 
ATOM   9304  C  C   . HIS E  1 119 ? 3.311    62.573  65.876  1.00 20.11 ? 111  HIS E C   1 
ATOM   9305  O  O   . HIS E  1 119 ? 3.416    62.282  67.053  1.00 19.58 ? 111  HIS E O   1 
ATOM   9306  C  CB  . HIS E  1 119 ? 5.412    63.573  65.218  1.00 21.10 ? 111  HIS E CB  1 
ATOM   9307  C  CG  . HIS E  1 119 ? 6.153    64.588  64.413  1.00 22.66 ? 111  HIS E CG  1 
ATOM   9308  N  ND1 . HIS E  1 119 ? 7.523    64.544  64.254  1.00 21.78 ? 111  HIS E ND1 1 
ATOM   9309  C  CD2 . HIS E  1 119 ? 5.720    65.681  63.738  1.00 23.54 ? 111  HIS E CD2 1 
ATOM   9310  C  CE1 . HIS E  1 119 ? 7.891    65.567  63.498  1.00 24.95 ? 111  HIS E CE1 1 
ATOM   9311  N  NE2 . HIS E  1 119 ? 6.817    66.267  63.165  1.00 22.56 ? 111  HIS E NE2 1 
ATOM   9312  N  N   . VAL E  1 120 ? 2.718    61.780  64.990  1.00 19.71 ? 112  VAL E N   1 
ATOM   9313  C  CA  . VAL E  1 120 ? 2.325    60.402  65.303  1.00 18.91 ? 112  VAL E CA  1 
ATOM   9314  C  C   . VAL E  1 120 ? 3.360    59.494  64.652  1.00 19.01 ? 112  VAL E C   1 
ATOM   9315  O  O   . VAL E  1 120 ? 3.849    59.744  63.556  1.00 19.25 ? 112  VAL E O   1 
ATOM   9316  C  CB  . VAL E  1 120 ? 0.855    60.126  64.822  1.00 20.09 ? 112  VAL E CB  1 
ATOM   9317  C  CG1 . VAL E  1 120 ? 0.484    58.635  64.832  1.00 18.00 ? 112  VAL E CG1 1 
ATOM   9318  C  CG2 . VAL E  1 120 ? -0.126   61.008  65.579  1.00 16.23 ? 112  VAL E CG2 1 
ATOM   9319  N  N   . LEU E  1 121 ? 3.759    58.461  65.363  1.00 19.63 ? 113  LEU E N   1 
ATOM   9320  C  CA  . LEU E  1 121 ? 4.916    57.647  64.978  1.00 19.79 ? 113  LEU E CA  1 
ATOM   9321  C  C   . LEU E  1 121 ? 4.382    56.313  64.566  1.00 19.99 ? 113  LEU E C   1 
ATOM   9322  O  O   . LEU E  1 121 ? 3.477    55.781  65.220  1.00 21.45 ? 113  LEU E O   1 
ATOM   9323  C  CB  . LEU E  1 121 ? 5.851    57.507  66.162  1.00 19.99 ? 113  LEU E CB  1 
ATOM   9324  C  CG  . LEU E  1 121 ? 6.176    58.831  66.842  1.00 19.94 ? 113  LEU E CG  1 
ATOM   9325  C  CD1 . LEU E  1 121 ? 7.224    58.625  67.943  1.00 19.53 ? 113  LEU E CD1 1 
ATOM   9326  C  CD2 . LEU E  1 121 ? 6.677    59.837  65.808  1.00 17.91 ? 113  LEU E CD2 1 
ATOM   9327  N  N   . VAL E  1 122 ? 4.895    55.781  63.476  1.00 20.06 ? 114  VAL E N   1 
ATOM   9328  C  CA  . VAL E  1 122 ? 4.327    54.626  62.844  1.00 20.43 ? 114  VAL E CA  1 
ATOM   9329  C  C   . VAL E  1 122 ? 5.381    53.603  62.441  1.00 21.79 ? 114  VAL E C   1 
ATOM   9330  O  O   . VAL E  1 122 ? 6.414    53.961  61.861  1.00 21.57 ? 114  VAL E O   1 
ATOM   9331  C  CB  . VAL E  1 122 ? 3.577    55.042  61.559  1.00 21.09 ? 114  VAL E CB  1 
ATOM   9332  C  CG1 . VAL E  1 122 ? 2.918    53.800  60.940  1.00 19.56 ? 114  VAL E CG1 1 
ATOM   9333  C  CG2 . VAL E  1 122 ? 2.564    56.161  61.826  1.00 18.21 ? 114  VAL E CG2 1 
ATOM   9334  N  N   . HIS E  1 123 ? 5.093    52.338  62.693  1.00 22.80 ? 115  HIS E N   1 
ATOM   9335  C  CA  . HIS E  1 123 ? 5.922    51.233  62.269  1.00 24.58 ? 115  HIS E CA  1 
ATOM   9336  C  C   . HIS E  1 123 ? 5.416    50.624  60.975  1.00 25.68 ? 115  HIS E C   1 
ATOM   9337  O  O   . HIS E  1 123 ? 4.288    50.198  60.891  1.00 26.51 ? 115  HIS E O   1 
ATOM   9338  C  CB  . HIS E  1 123 ? 5.930    50.142  63.326  1.00 24.47 ? 115  HIS E CB  1 
ATOM   9339  C  CG  . HIS E  1 123 ? 6.626    48.887  62.897  1.00 27.19 ? 115  HIS E CG  1 
ATOM   9340  N  ND1 . HIS E  1 123 ? 7.968    48.665  63.124  1.00 27.79 ? 115  HIS E ND1 1 
ATOM   9341  C  CD2 . HIS E  1 123 ? 6.161    47.784  62.246  1.00 28.80 ? 115  HIS E CD2 1 
ATOM   9342  C  CE1 . HIS E  1 123 ? 8.298    47.484  62.624  1.00 31.04 ? 115  HIS E CE1 1 
ATOM   9343  N  NE2 . HIS E  1 123 ? 7.220    46.926  62.091  1.00 30.11 ? 115  HIS E NE2 1 
ATOM   9344  N  N   . PHE E  1 124 ? 6.259    50.580  59.973  1.00 27.76 ? 116  PHE E N   1 
ATOM   9345  C  CA  . PHE E  1 124 ? 6.043    49.782  58.779  1.00 30.21 ? 116  PHE E CA  1 
ATOM   9346  C  C   . PHE E  1 124 ? 7.118    48.693  58.768  1.00 33.05 ? 116  PHE E C   1 
ATOM   9347  O  O   . PHE E  1 124 ? 8.142    48.808  59.437  1.00 33.26 ? 116  PHE E O   1 
ATOM   9348  C  CB  . PHE E  1 124 ? 6.165    50.636  57.517  1.00 29.14 ? 116  PHE E CB  1 
ATOM   9349  C  CG  . PHE E  1 124 ? 5.074    51.647  57.372  1.00 28.19 ? 116  PHE E CG  1 
ATOM   9350  C  CD1 . PHE E  1 124 ? 3.820    51.281  56.994  1.00 26.92 ? 116  PHE E CD1 1 
ATOM   9351  C  CD2 . PHE E  1 124 ? 5.293    52.966  57.655  1.00 27.09 ? 116  PHE E CD2 1 
ATOM   9352  C  CE1 . PHE E  1 124 ? 2.845    52.202  56.877  1.00 26.35 ? 116  PHE E CE1 1 
ATOM   9353  C  CE2 . PHE E  1 124 ? 4.290    53.878  57.546  1.00 25.76 ? 116  PHE E CE2 1 
ATOM   9354  C  CZ  . PHE E  1 124 ? 3.092    53.506  57.155  1.00 24.70 ? 116  PHE E CZ  1 
ATOM   9355  N  N   . GLU E  1 125 ? 6.880    47.637  57.998  1.00 36.89 ? 117  GLU E N   1 
ATOM   9356  C  CA  . GLU E  1 125 ? 7.877    46.601  57.745  1.00 39.58 ? 117  GLU E CA  1 
ATOM   9357  C  C   . GLU E  1 125 ? 9.008    47.202  56.982  1.00 40.22 ? 117  GLU E C   1 
ATOM   9358  O  O   . GLU E  1 125 ? 8.838    48.146  56.218  1.00 40.02 ? 117  GLU E O   1 
ATOM   9359  C  CB  . GLU E  1 125 ? 7.276    45.473  56.924  1.00 41.27 ? 117  GLU E CB  1 
ATOM   9360  C  CG  . GLU E  1 125 ? 6.232    44.641  57.721  1.00 48.37 ? 117  GLU E CG  1 
ATOM   9361  C  CD  . GLU E  1 125 ? 5.169    43.920  56.827  1.00 58.79 ? 117  GLU E CD  1 
ATOM   9362  O  OE1 . GLU E  1 125 ? 4.960    42.693  57.065  1.00 65.31 ? 117  GLU E OE1 1 
ATOM   9363  O  OE2 . GLU E  1 125 ? 4.549    44.562  55.909  1.00 62.79 ? 117  GLU E OE2 1 
ATOM   9364  N  N   . GLU E  1 126 ? 10.155   46.603  57.150  1.00 41.80 ? 118  GLU E N   1 
ATOM   9365  C  CA  . GLU E  1 126 ? 11.394   47.160  56.694  1.00 44.03 ? 118  GLU E CA  1 
ATOM   9366  C  C   . GLU E  1 126 ? 11.464   47.386  55.188  1.00 43.13 ? 118  GLU E C   1 
ATOM   9367  O  O   . GLU E  1 126 ? 12.032   48.336  54.715  1.00 41.98 ? 118  GLU E O   1 
ATOM   9368  C  CB  . GLU E  1 126 ? 12.489   46.232  57.184  1.00 45.33 ? 118  GLU E CB  1 
ATOM   9369  C  CG  . GLU E  1 126 ? 13.852   46.834  57.123  1.00 52.64 ? 118  GLU E CG  1 
ATOM   9370  C  CD  . GLU E  1 126 ? 14.961   45.752  57.114  1.00 61.08 ? 118  GLU E CD  1 
ATOM   9371  O  OE1 . GLU E  1 126 ? 14.728   44.600  57.606  1.00 63.80 ? 118  GLU E OE1 1 
ATOM   9372  O  OE2 . GLU E  1 126 ? 16.067   46.066  56.595  1.00 66.55 ? 118  GLU E OE2 1 
ATOM   9373  N  N   . GLU E  1 127 ? 10.837   46.527  54.425  1.00 43.81 ? 119  GLU E N   1 
ATOM   9374  C  CA  . GLU E  1 127 ? 10.854   46.677  52.962  1.00 44.91 ? 119  GLU E CA  1 
ATOM   9375  C  C   . GLU E  1 127 ? 10.216   47.986  52.516  1.00 42.69 ? 119  GLU E C   1 
ATOM   9376  O  O   . GLU E  1 127 ? 10.614   48.549  51.512  1.00 43.37 ? 119  GLU E O   1 
ATOM   9377  C  CB  . GLU E  1 127 ? 10.101   45.517  52.262  1.00 46.55 ? 119  GLU E CB  1 
ATOM   9378  C  CG  . GLU E  1 127 ? 10.429   44.109  52.781  1.00 53.86 ? 119  GLU E CG  1 
ATOM   9379  C  CD  . GLU E  1 127 ? 9.620    43.715  54.087  1.00 60.96 ? 119  GLU E CD  1 
ATOM   9380  O  OE1 . GLU E  1 127 ? 10.210   43.715  55.219  1.00 60.81 ? 119  GLU E OE1 1 
ATOM   9381  O  OE2 . GLU E  1 127 ? 8.389    43.424  53.948  1.00 64.48 ? 119  GLU E OE2 1 
ATOM   9382  N  N   . VAL E  1 128 ? 9.184    48.420  53.239  1.00 40.26 ? 120  VAL E N   1 
ATOM   9383  C  CA  . VAL E  1 128 ? 8.453    49.646  52.957  1.00 37.83 ? 120  VAL E CA  1 
ATOM   9384  C  C   . VAL E  1 128 ? 9.278    50.927  53.157  1.00 36.94 ? 120  VAL E C   1 
ATOM   9385  O  O   . VAL E  1 128 ? 9.091    51.883  52.437  1.00 36.78 ? 120  VAL E O   1 
ATOM   9386  C  CB  . VAL E  1 128 ? 7.183    49.696  53.830  1.00 37.57 ? 120  VAL E CB  1 
ATOM   9387  C  CG1 . VAL E  1 128 ? 6.497    51.045  53.774  1.00 33.16 ? 120  VAL E CG1 1 
ATOM   9388  C  CG2 . VAL E  1 128 ? 6.226    48.538  53.426  1.00 36.12 ? 120  VAL E CG2 1 
ATOM   9389  N  N   . LEU E  1 129 ? 10.213   50.947  54.086  1.00 35.28 ? 121  LEU E N   1 
ATOM   9390  C  CA  . LEU E  1 129 ? 10.873   52.211  54.448  1.00 34.92 ? 121  LEU E CA  1 
ATOM   9391  C  C   . LEU E  1 129 ? 11.647   52.798  53.282  1.00 35.03 ? 121  LEU E C   1 
ATOM   9392  O  O   . LEU E  1 129 ? 11.617   54.005  53.021  1.00 33.79 ? 121  LEU E O   1 
ATOM   9393  C  CB  . LEU E  1 129 ? 11.809   52.041  55.653  1.00 33.75 ? 121  LEU E CB  1 
ATOM   9394  C  CG  . LEU E  1 129 ? 11.142   51.605  56.960  1.00 33.82 ? 121  LEU E CG  1 
ATOM   9395  C  CD1 . LEU E  1 129 ? 12.138   51.595  58.167  1.00 33.81 ? 121  LEU E CD1 1 
ATOM   9396  C  CD2 . LEU E  1 129 ? 9.966    52.463  57.255  1.00 29.45 ? 121  LEU E CD2 1 
ATOM   9397  N  N   . GLY E  1 130 ? 12.347   51.926  52.580  1.00 36.19 ? 122  GLY E N   1 
ATOM   9398  C  CA  . GLY E  1 130 ? 13.089   52.352  51.396  1.00 37.09 ? 122  GLY E CA  1 
ATOM   9399  C  C   . GLY E  1 130 ? 12.233   52.906  50.253  1.00 37.38 ? 122  GLY E C   1 
ATOM   9400  O  O   . GLY E  1 130 ? 12.762   53.535  49.364  1.00 38.70 ? 122  GLY E O   1 
ATOM   9401  N  N   . LYS E  1 131 ? 10.925   52.692  50.254  1.00 36.63 ? 123  LYS E N   1 
ATOM   9402  C  CA  . LYS E  1 131 ? 10.087   53.284  49.225  1.00 37.10 ? 123  LYS E CA  1 
ATOM   9403  C  C   . LYS E  1 131 ? 9.395    54.591  49.636  1.00 34.93 ? 123  LYS E C   1 
ATOM   9404  O  O   . LYS E  1 131 ? 8.869    55.281  48.787  1.00 35.91 ? 123  LYS E O   1 
ATOM   9405  C  CB  . LYS E  1 131 ? 9.011    52.294  48.793  1.00 38.23 ? 123  LYS E CB  1 
ATOM   9406  C  CG  . LYS E  1 131 ? 9.508    50.910  48.401  1.00 42.76 ? 123  LYS E CG  1 
ATOM   9407  C  CD  . LYS E  1 131 ? 8.395    50.181  47.584  1.00 50.52 ? 123  LYS E CD  1 
ATOM   9408  C  CE  . LYS E  1 131 ? 8.496    48.673  47.631  1.00 54.44 ? 123  LYS E CE  1 
ATOM   9409  N  NZ  . LYS E  1 131 ? 7.918    48.206  48.934  1.00 57.26 ? 123  LYS E NZ  1 
ATOM   9410  N  N   . LEU E  1 132 ? 9.399    54.923  50.922  1.00 32.25 ? 124  LEU E N   1 
ATOM   9411  C  CA  . LEU E  1 132 ? 8.710    56.086  51.430  1.00 30.09 ? 124  LEU E CA  1 
ATOM   9412  C  C   . LEU E  1 132 ? 9.450    57.398  51.118  1.00 29.10 ? 124  LEU E C   1 
ATOM   9413  O  O   . LEU E  1 132 ? 10.634   57.431  50.933  1.00 29.36 ? 124  LEU E O   1 
ATOM   9414  C  CB  . LEU E  1 132 ? 8.471    55.939  52.951  1.00 29.30 ? 124  LEU E CB  1 
ATOM   9415  C  CG  . LEU E  1 132 ? 7.560    54.794  53.440  1.00 28.60 ? 124  LEU E CG  1 
ATOM   9416  C  CD1 . LEU E  1 132 ? 7.537    54.688  54.970  1.00 26.84 ? 124  LEU E CD1 1 
ATOM   9417  C  CD2 . LEU E  1 132 ? 6.140    54.896  52.894  1.00 23.47 ? 124  LEU E CD2 1 
ATOM   9418  N  N   . MET E  1 133 ? 8.714    58.483  51.083  1.00 28.10 ? 125  MET E N   1 
ATOM   9419  C  CA  . MET E  1 133 ? 9.236    59.787  50.841  1.00 27.01 ? 125  MET E CA  1 
ATOM   9420  C  C   . MET E  1 133 ? 8.554    60.765  51.772  1.00 25.45 ? 125  MET E C   1 
ATOM   9421  O  O   . MET E  1 133 ? 7.365    60.641  52.062  1.00 23.60 ? 125  MET E O   1 
ATOM   9422  C  CB  . MET E  1 133 ? 8.977    60.188  49.376  1.00 28.13 ? 125  MET E CB  1 
ATOM   9423  C  CG  . MET E  1 133 ? 9.547    61.569  49.005  1.00 28.71 ? 125  MET E CG  1 
ATOM   9424  S  SD  . MET E  1 133 ? 11.301   61.762  49.453  1.00 28.11 ? 125  MET E SD  1 
ATOM   9425  C  CE  . MET E  1 133 ? 11.557   63.466  48.881  1.00 29.88 ? 125  MET E CE  1 
ATOM   9426  N  N   . VAL E  1 134 ? 9.315    61.743  52.242  1.00 24.89 ? 126  VAL E N   1 
ATOM   9427  C  CA  . VAL E  1 134 ? 8.775    62.804  53.046  1.00 23.75 ? 126  VAL E CA  1 
ATOM   9428  C  C   . VAL E  1 134 ? 7.715    63.469  52.214  1.00 24.77 ? 126  VAL E C   1 
ATOM   9429  O  O   . VAL E  1 134 ? 7.892    63.713  51.031  1.00 25.00 ? 126  VAL E O   1 
ATOM   9430  C  CB  . VAL E  1 134 ? 9.829    63.815  53.448  1.00 23.91 ? 126  VAL E CB  1 
ATOM   9431  C  CG1 . VAL E  1 134 ? 9.165    65.092  54.034  1.00 21.57 ? 126  VAL E CG1 1 
ATOM   9432  C  CG2 . VAL E  1 134 ? 10.774   63.176  54.406  1.00 21.33 ? 126  VAL E CG2 1 
ATOM   9433  N  N   . GLY E  1 135 ? 6.570    63.711  52.831  1.00 25.65 ? 127  GLY E N   1 
ATOM   9434  C  CA  . GLY E  1 135 ? 5.456    64.332  52.152  1.00 25.05 ? 127  GLY E CA  1 
ATOM   9435  C  C   . GLY E  1 135 ? 4.391    63.360  51.723  1.00 24.95 ? 127  GLY E C   1 
ATOM   9436  O  O   . GLY E  1 135 ? 3.314    63.795  51.355  1.00 23.29 ? 127  GLY E O   1 
ATOM   9437  N  N   . ASP E  1 136 ? 4.696    62.066  51.722  1.00 24.87 ? 128  ASP E N   1 
ATOM   9438  C  CA  . ASP E  1 136 ? 3.728    61.058  51.326  1.00 25.63 ? 128  ASP E CA  1 
ATOM   9439  C  C   . ASP E  1 136 ? 2.512    61.064  52.258  1.00 25.96 ? 128  ASP E C   1 
ATOM   9440  O  O   . ASP E  1 136 ? 2.634    61.284  53.455  1.00 25.63 ? 128  ASP E O   1 
ATOM   9441  C  CB  . ASP E  1 136 ? 4.357    59.642  51.252  1.00 25.99 ? 128  ASP E CB  1 
ATOM   9442  C  CG  . ASP E  1 136 ? 5.264    59.440  50.000  1.00 29.22 ? 128  ASP E CG  1 
ATOM   9443  O  OD1 . ASP E  1 136 ? 5.319    60.341  49.093  1.00 30.29 ? 128  ASP E OD1 1 
ATOM   9444  O  OD2 . ASP E