data_3N9V
# 
_entry.id   3N9V 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3N9V         
RCSB  RCSB059562   
WWPDB D_1000059562 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3MTC 'Complex between INPP5B and product PtdIns-4-phosphate' unspecified 
PDB 3NR8 .                                                       unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3N9V 
_pdbx_database_status.recvd_initial_deposition_date   2010-05-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tresaugues, L.'                       1  
'Welin, M.'                            2  
'Arrowsmith, C.H.'                     3  
'Berglund, H.'                         4  
'Bountra, C.'                          5  
'Collins, R.'                          6  
'Edwards, A.M.'                        7  
'Flodin, S.'                           8  
'Flores, A.'                           9  
'Graslund, S.'                         10 
'Hammarstrom, M.'                      11 
'Johansson, I.'                        12 
'Karlberg, T.'                         13 
'Kol, S.'                              14 
'Kotenyova, T.'                        15 
'Moche, M.'                            16 
'Nyman, T.'                            17 
'Persson, C.'                          18 
'Schuler, H.'                          19 
'Schutz, P.'                           20 
'Siponen, M.I.'                        21 
'Thorsell, A.G.'                       22 
'van der Berg, S.'                     23 
'Wahlberg, E.'                         24 
'Weigelt, J.'                          25 
'Wisniewska, M.'                       26 
'Nordlund, P.'                         27 
'Structural Genomics Consortium (SGC)' 28 
# 
_citation.id                        primary 
_citation.title                     
;Structural basis for phosphoinositide substrate recognition, catalysis, and membrane interactions in human inositol polyphosphate 5-phosphatases
;
_citation.journal_abbrev            Structure 
_citation.journal_volume            22 
_citation.page_first                744 
_citation.page_last                 755 
_citation.year                      2014 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24704254 
_citation.pdbx_database_id_DOI      10.1016/j.str.2014.01.013 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tresaugues, L.'  1 
primary 'Silvander, C.'   2 
primary 'Flodin, S.'      3 
primary 'Welin, M.'       4 
primary 'Nyman, T.'       5 
primary 'Graslund, S.'    6 
primary 'Hammarstrom, M.' 7 
primary 'Berglund, H.'    8 
primary 'Nordlund, P.'    9 
# 
_cell.entry_id           3N9V 
_cell.length_a           96.160 
_cell.length_b           110.660 
_cell.length_c           159.380 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3N9V 
_symmetry.space_group_name_H-M             'I 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                24 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Type II inositol-1,4,5-trisphosphate 5-phosphatase' 36131.945 2  3.1.3.36 ? 'UNP residues 342-647' ? 
2 non-polymer syn 'MAGNESIUM ION'                                      24.305    2  ?        ? ?                      ? 
3 non-polymer syn 'CALCIUM ION'                                        40.078    2  ?        ? ?                      ? 
4 non-polymer syn GLYCEROL                                             92.094    1  ?        ? ?                      ? 
5 water       nat water                                                18.015    57 ?        ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Phosphoinositide 5-phosphatase, 5PTase, 75 kDa inositol polyphosphate-5-phosphatase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MIQNFRFFAGTYNVNGQSPKECLRLWLSNGIQAPDVYCVGFQELDLSKEAFFFHDTPKEEEWFKAVSEGLHPDAKYAKVK
LIRLVGIMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSHLAAHIEEYERRNQDYKDICS
RMQFCQPDPSLPPLTISNHDVILWLGDLNYRIEELDVEKVKKLIEEKDFQMLYAYDQLKIQVAAKTVFEGFTEGELTFQP
TYKYDTGSDDWDTSEKCRAPAWCDRILWKGKNITQLSYQSHMALKTSDHKPVSSVFDIGVRVVNDEAHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MIQNFRFFAGTYNVNGQSPKECLRLWLSNGIQAPDVYCVGFQELDLSKEAFFFHDTPKEEEWFKAVSEGLHPDAKYAKVK
LIRLVGIMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSHLAAHIEEYERRNQDYKDICS
RMQFCQPDPSLPPLTISNHDVILWLGDLNYRIEELDVEKVKKLIEEKDFQMLYAYDQLKIQVAAKTVFEGFTEGELTFQP
TYKYDTGSDDWDTSEKCRAPAWCDRILWKGKNITQLSYQSHMALKTSDHKPVSSVFDIGVRVVNDEAHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ILE n 
1 3   GLN n 
1 4   ASN n 
1 5   PHE n 
1 6   ARG n 
1 7   PHE n 
1 8   PHE n 
1 9   ALA n 
1 10  GLY n 
1 11  THR n 
1 12  TYR n 
1 13  ASN n 
1 14  VAL n 
1 15  ASN n 
1 16  GLY n 
1 17  GLN n 
1 18  SER n 
1 19  PRO n 
1 20  LYS n 
1 21  GLU n 
1 22  CYS n 
1 23  LEU n 
1 24  ARG n 
1 25  LEU n 
1 26  TRP n 
1 27  LEU n 
1 28  SER n 
1 29  ASN n 
1 30  GLY n 
1 31  ILE n 
1 32  GLN n 
1 33  ALA n 
1 34  PRO n 
1 35  ASP n 
1 36  VAL n 
1 37  TYR n 
1 38  CYS n 
1 39  VAL n 
1 40  GLY n 
1 41  PHE n 
1 42  GLN n 
1 43  GLU n 
1 44  LEU n 
1 45  ASP n 
1 46  LEU n 
1 47  SER n 
1 48  LYS n 
1 49  GLU n 
1 50  ALA n 
1 51  PHE n 
1 52  PHE n 
1 53  PHE n 
1 54  HIS n 
1 55  ASP n 
1 56  THR n 
1 57  PRO n 
1 58  LYS n 
1 59  GLU n 
1 60  GLU n 
1 61  GLU n 
1 62  TRP n 
1 63  PHE n 
1 64  LYS n 
1 65  ALA n 
1 66  VAL n 
1 67  SER n 
1 68  GLU n 
1 69  GLY n 
1 70  LEU n 
1 71  HIS n 
1 72  PRO n 
1 73  ASP n 
1 74  ALA n 
1 75  LYS n 
1 76  TYR n 
1 77  ALA n 
1 78  LYS n 
1 79  VAL n 
1 80  LYS n 
1 81  LEU n 
1 82  ILE n 
1 83  ARG n 
1 84  LEU n 
1 85  VAL n 
1 86  GLY n 
1 87  ILE n 
1 88  MET n 
1 89  LEU n 
1 90  LEU n 
1 91  LEU n 
1 92  TYR n 
1 93  VAL n 
1 94  LYS n 
1 95  GLN n 
1 96  GLU n 
1 97  HIS n 
1 98  ALA n 
1 99  ALA n 
1 100 TYR n 
1 101 ILE n 
1 102 SER n 
1 103 GLU n 
1 104 VAL n 
1 105 GLU n 
1 106 ALA n 
1 107 GLU n 
1 108 THR n 
1 109 VAL n 
1 110 GLY n 
1 111 THR n 
1 112 GLY n 
1 113 ILE n 
1 114 MET n 
1 115 GLY n 
1 116 ARG n 
1 117 MET n 
1 118 GLY n 
1 119 ASN n 
1 120 LYS n 
1 121 GLY n 
1 122 GLY n 
1 123 VAL n 
1 124 ALA n 
1 125 ILE n 
1 126 ARG n 
1 127 PHE n 
1 128 GLN n 
1 129 PHE n 
1 130 HIS n 
1 131 ASN n 
1 132 THR n 
1 133 SER n 
1 134 ILE n 
1 135 CYS n 
1 136 VAL n 
1 137 VAL n 
1 138 ASN n 
1 139 SER n 
1 140 HIS n 
1 141 LEU n 
1 142 ALA n 
1 143 ALA n 
1 144 HIS n 
1 145 ILE n 
1 146 GLU n 
1 147 GLU n 
1 148 TYR n 
1 149 GLU n 
1 150 ARG n 
1 151 ARG n 
1 152 ASN n 
1 153 GLN n 
1 154 ASP n 
1 155 TYR n 
1 156 LYS n 
1 157 ASP n 
1 158 ILE n 
1 159 CYS n 
1 160 SER n 
1 161 ARG n 
1 162 MET n 
1 163 GLN n 
1 164 PHE n 
1 165 CYS n 
1 166 GLN n 
1 167 PRO n 
1 168 ASP n 
1 169 PRO n 
1 170 SER n 
1 171 LEU n 
1 172 PRO n 
1 173 PRO n 
1 174 LEU n 
1 175 THR n 
1 176 ILE n 
1 177 SER n 
1 178 ASN n 
1 179 HIS n 
1 180 ASP n 
1 181 VAL n 
1 182 ILE n 
1 183 LEU n 
1 184 TRP n 
1 185 LEU n 
1 186 GLY n 
1 187 ASP n 
1 188 LEU n 
1 189 ASN n 
1 190 TYR n 
1 191 ARG n 
1 192 ILE n 
1 193 GLU n 
1 194 GLU n 
1 195 LEU n 
1 196 ASP n 
1 197 VAL n 
1 198 GLU n 
1 199 LYS n 
1 200 VAL n 
1 201 LYS n 
1 202 LYS n 
1 203 LEU n 
1 204 ILE n 
1 205 GLU n 
1 206 GLU n 
1 207 LYS n 
1 208 ASP n 
1 209 PHE n 
1 210 GLN n 
1 211 MET n 
1 212 LEU n 
1 213 TYR n 
1 214 ALA n 
1 215 TYR n 
1 216 ASP n 
1 217 GLN n 
1 218 LEU n 
1 219 LYS n 
1 220 ILE n 
1 221 GLN n 
1 222 VAL n 
1 223 ALA n 
1 224 ALA n 
1 225 LYS n 
1 226 THR n 
1 227 VAL n 
1 228 PHE n 
1 229 GLU n 
1 230 GLY n 
1 231 PHE n 
1 232 THR n 
1 233 GLU n 
1 234 GLY n 
1 235 GLU n 
1 236 LEU n 
1 237 THR n 
1 238 PHE n 
1 239 GLN n 
1 240 PRO n 
1 241 THR n 
1 242 TYR n 
1 243 LYS n 
1 244 TYR n 
1 245 ASP n 
1 246 THR n 
1 247 GLY n 
1 248 SER n 
1 249 ASP n 
1 250 ASP n 
1 251 TRP n 
1 252 ASP n 
1 253 THR n 
1 254 SER n 
1 255 GLU n 
1 256 LYS n 
1 257 CYS n 
1 258 ARG n 
1 259 ALA n 
1 260 PRO n 
1 261 ALA n 
1 262 TRP n 
1 263 CYS n 
1 264 ASP n 
1 265 ARG n 
1 266 ILE n 
1 267 LEU n 
1 268 TRP n 
1 269 LYS n 
1 270 GLY n 
1 271 LYS n 
1 272 ASN n 
1 273 ILE n 
1 274 THR n 
1 275 GLN n 
1 276 LEU n 
1 277 SER n 
1 278 TYR n 
1 279 GLN n 
1 280 SER n 
1 281 HIS n 
1 282 MET n 
1 283 ALA n 
1 284 LEU n 
1 285 LYS n 
1 286 THR n 
1 287 SER n 
1 288 ASP n 
1 289 HIS n 
1 290 LYS n 
1 291 PRO n 
1 292 VAL n 
1 293 SER n 
1 294 SER n 
1 295 VAL n 
1 296 PHE n 
1 297 ASP n 
1 298 ILE n 
1 299 GLY n 
1 300 VAL n 
1 301 ARG n 
1 302 VAL n 
1 303 VAL n 
1 304 ASN n 
1 305 ASP n 
1 306 GLU n 
1 307 ALA n 
1 308 HIS n 
1 309 HIS n 
1 310 HIS n 
1 311 HIS n 
1 312 HIS n 
1 313 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 INPP5B 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3) R3 pRARE' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC-CH2 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    I5P2_HUMAN 
_struct_ref.pdbx_db_accession          P32019 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;IQNFRFFAGTYNVNGQSPKECLRLWLSNGIQAPDVYCVGFQELDLSKEAFFFHDTPKEEEWFKAVSEGLHPDAKYAKVKL
IRLVGIMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSHLAAHIEEYERRNQDYKDICSR
MQFCQPDPSLPPLTISNHDVILWLGDLNYRIEELDVEKVKKLIEEKDFQMLYAYDQLKIQVAAKTVFEGFTEGELTFQPT
YKYDTGSDDWDTSEKCRAPAWCDRILWKGKNITQLSYQSHMALKTSDHKPVSSVFDIGVRVVNDEL
;
_struct_ref.pdbx_align_begin           342 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3N9V A 2 ? 307 ? P32019 342 ? 647 ? 262 567 
2 1 3N9V B 2 ? 307 ? P32019 342 ? 647 ? 262 567 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3N9V MET A 1   ? UNP P32019 ? ? 'INITIATING METHIONINE' 261 1  
1 3N9V HIS A 308 ? UNP P32019 ? ? 'EXPRESSION TAG'        568 2  
1 3N9V HIS A 309 ? UNP P32019 ? ? 'EXPRESSION TAG'        569 3  
1 3N9V HIS A 310 ? UNP P32019 ? ? 'EXPRESSION TAG'        570 4  
1 3N9V HIS A 311 ? UNP P32019 ? ? 'EXPRESSION TAG'        571 5  
1 3N9V HIS A 312 ? UNP P32019 ? ? 'EXPRESSION TAG'        572 6  
1 3N9V HIS A 313 ? UNP P32019 ? ? 'EXPRESSION TAG'        573 7  
2 3N9V MET B 1   ? UNP P32019 ? ? 'INITIATING METHIONINE' 261 8  
2 3N9V HIS B 308 ? UNP P32019 ? ? 'EXPRESSION TAG'        568 9  
2 3N9V HIS B 309 ? UNP P32019 ? ? 'EXPRESSION TAG'        569 10 
2 3N9V HIS B 310 ? UNP P32019 ? ? 'EXPRESSION TAG'        570 11 
2 3N9V HIS B 311 ? UNP P32019 ? ? 'EXPRESSION TAG'        571 12 
2 3N9V HIS B 312 ? UNP P32019 ? ? 'EXPRESSION TAG'        572 13 
2 3N9V HIS B 313 ? UNP P32019 ? ? 'EXPRESSION TAG'        573 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ?                               'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ?                               'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3N9V 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.93 
_exptl_crystal.density_percent_sol   58.07 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'0.2M Magnesium Chloride, 0.1M Tris-HCl pH 8.5, 20% PEG 8000, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2009-10-23 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si (111) double crystal monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.96860 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I03' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I03 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.96860 
# 
_reflns.entry_id                     3N9V 
_reflns.observed_criterion_sigma_I   . 
_reflns.observed_criterion_sigma_F   . 
_reflns.d_resolution_low             72.548 
_reflns.d_resolution_high            2.600 
_reflns.number_obs                   25062 
_reflns.number_all                   25087 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.077 
_reflns.pdbx_Rsym_value              0.077 
_reflns.pdbx_netI_over_sigmaI        11.9 
_reflns.B_iso_Wilson_estimate        79.4 
_reflns.pdbx_redundancy              4.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.600 
_reflns_shell.d_res_low              2.793 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           0.62 
_reflns_shell.pdbx_Rsym_value        0.62 
_reflns_shell.meanI_over_sigI_obs    2.1 
_reflns_shell.pdbx_redundancy        4.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3602 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3N9V 
_refine.ls_number_reflns_obs                     25049 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          . 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             53.661 
_refine.ls_d_res_high                            2.650 
_refine.ls_percent_reflns_obs                    99.82 
_refine.ls_R_factor_obs                          0.1914 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1896 
_refine.ls_R_factor_R_free                       0.2308 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.58 
_refine.ls_number_reflns_R_free                  1146 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            10.1499 
_refine.aniso_B[2][2]                            -0.4532 
_refine.aniso_B[3][3]                            -9.6967 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.339 
_refine.solvent_model_param_bsol                 49.562 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1I9Y' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.41 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4645 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             57 
_refine_hist.number_atoms_total               4712 
_refine_hist.d_res_high                       2.650 
_refine_hist.d_res_low                        53.661 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.011  ? ? 4763 'X-RAY DIFFRACTION' ? 
f_angle_d          1.257  ? ? 6458 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.633 ? ? 1655 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.076  ? ? 703  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 829  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 2.6500 2.7706  2935 0.2631 100.00 0.3311 . . 149 . . . . 'X-RAY DIFFRACTION' 
. 2.7706 2.9167  2971 0.2358 100.00 0.2676 . . 130 . . . . 'X-RAY DIFFRACTION' 
. 2.9167 3.0994  2953 0.2193 100.00 0.2880 . . 145 . . . . 'X-RAY DIFFRACTION' 
. 3.0994 3.3387  2952 0.1909 100.00 0.2629 . . 150 . . . . 'X-RAY DIFFRACTION' 
. 3.3387 3.6746  2954 0.1771 100.00 0.2164 . . 149 . . . . 'X-RAY DIFFRACTION' 
. 3.6746 4.2061  2975 0.1609 100.00 0.1966 . . 152 . . . . 'X-RAY DIFFRACTION' 
. 4.2061 5.2986  3031 0.1429 100.00 0.1688 . . 139 . . . . 'X-RAY DIFFRACTION' 
. 5.2986 53.6725 3132 0.2075 99.00  0.2582 . . 132 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3N9V 
_struct.title                     'Crystal Structure of INPP5B' 
_struct.pdbx_descriptor           'Type II inositol-1,4,5-trisphosphate 5-phosphatase (E.C.3.1.3.36)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            Y 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3N9V 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;INPP5B, Phosphoinositide 5-phosphatase, inositol signalling, phosphatase, magnesium, structural genomics, SGC, SGC Stockholm, Structural Genomics Consortium, HYDROLASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 2 ? 
G N N 3 ? 
H N N 5 ? 
I N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 23  ? SER A 28  ? LEU A 283 SER A 288 1 ? 6  
HELX_P HELX_P2  2  SER A 47  ? HIS A 54  ? SER A 307 HIS A 314 1 ? 8  
HELX_P HELX_P3  3  PRO A 57  ? LEU A 70  ? PRO A 317 LEU A 330 1 ? 14 
HELX_P HELX_P4  4  GLU A 96  ? ALA A 99  ? GLU A 356 ALA A 359 5 ? 4  
HELX_P HELX_P5  5  GLY A 112 ? ARG A 116 ? GLY A 372 ARG A 376 5 ? 5  
HELX_P HELX_P6  6  TYR A 148 ? MET A 162 ? TYR A 408 MET A 422 1 ? 15 
HELX_P HELX_P7  7  ASP A 196 ? GLU A 206 ? ASP A 456 GLU A 466 1 ? 11 
HELX_P HELX_P8  8  ASP A 208 ? ALA A 214 ? ASP A 468 ALA A 474 1 ? 7  
HELX_P HELX_P9  9  ASP A 216 ? ALA A 224 ? ASP A 476 ALA A 484 1 ? 9  
HELX_P HELX_P10 10 LEU B 23  ? SER B 28  ? LEU B 283 SER B 288 1 ? 6  
HELX_P HELX_P11 11 SER B 47  ? HIS B 54  ? SER B 307 HIS B 314 1 ? 8  
HELX_P HELX_P12 12 PRO B 57  ? LEU B 70  ? PRO B 317 LEU B 330 1 ? 14 
HELX_P HELX_P13 13 GLU B 96  ? ALA B 99  ? GLU B 356 ALA B 359 5 ? 4  
HELX_P HELX_P14 14 GLY B 112 ? ARG B 116 ? GLY B 372 ARG B 376 5 ? 5  
HELX_P HELX_P15 15 GLU B 147 ? MET B 162 ? GLU B 407 MET B 422 1 ? 16 
HELX_P HELX_P16 16 ASP B 196 ? LYS B 207 ? ASP B 456 LYS B 467 1 ? 12 
HELX_P HELX_P17 17 ASP B 208 ? TYR B 215 ? ASP B 468 TYR B 475 1 ? 8  
HELX_P HELX_P18 18 ASP B 216 ? ALA B 224 ? ASP B 476 ALA B 484 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A THR 111 O   ? ? ? 1_555 D CA  . CA ? ? A THR 371 A CA  64 1_555 ? ? ? ? ? ? ? 2.084 ? 
metalc2  metalc ? ? C MG  .   MG  ? ? ? 1_555 H HOH . O  ? ? A MG  61  A HOH 18 1_555 ? ? ? ? ? ? ? 2.096 ? 
metalc3  metalc ? ? B THR 111 O   ? ? ? 1_555 G CA  . CA ? ? B THR 371 B CA  63 1_555 ? ? ? ? ? ? ? 2.107 ? 
metalc4  metalc ? ? A ASN 15  OD1 ? ? ? 1_555 C MG  . MG ? ? A ASN 275 A MG  61 1_555 ? ? ? ? ? ? ? 2.145 ? 
metalc5  metalc ? ? D CA  .   CA  ? ? ? 1_555 H HOH . O  ? ? A CA  64  A HOH 24 1_555 ? ? ? ? ? ? ? 2.257 ? 
metalc6  metalc ? ? B GLU 43  OE1 ? ? ? 1_555 F MG  . MG ? ? B GLU 303 B MG  62 1_555 ? ? ? ? ? ? ? 2.265 ? 
metalc7  metalc ? ? C MG  .   MG  ? ? ? 1_555 H HOH . O  ? ? A MG  61  A HOH 17 1_555 ? ? ? ? ? ? ? 2.351 ? 
metalc8  metalc ? ? A ASP 154 OD1 ? ? ? 1_555 D CA  . CA ? ? A ASP 414 A CA  64 1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc9  metalc ? ? A GLU 43  OE1 ? ? ? 1_555 C MG  . MG ? ? A GLU 303 A MG  61 1_555 ? ? ? ? ? ? ? 2.449 ? 
metalc10 metalc ? ? B ASN 15  OD1 ? ? ? 1_555 F MG  . MG ? ? B ASN 275 B MG  62 1_555 ? ? ? ? ? ? ? 2.477 ? 
metalc11 metalc ? ? D CA  .   CA  ? ? ? 1_555 H HOH . O  ? ? A CA  64  A HOH 39 1_555 ? ? ? ? ? ? ? 2.489 ? 
metalc12 metalc ? ? B ASP 154 OD1 ? ? ? 1_555 G CA  . CA ? ? B ASP 414 B CA  63 1_555 ? ? ? ? ? ? ? 2.518 ? 
metalc13 metalc ? ? G CA  .   CA  ? ? ? 1_555 I HOH . O  ? ? B CA  63  B HOH 4  1_555 ? ? ? ? ? ? ? 2.791 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 242 A . ? TYR 502 A LYS 243 A ? LYS 503 A 1 0.73  
2 TYR 242 B . ? TYR 502 B LYS 243 B ? LYS 503 B 1 -0.37 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 5 ? 
C ? 6 ? 
D ? 5 ? 
E ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 76  ? LEU A 84  ? TYR A 336 LEU A 344 
A 2 ILE A 87  ? LYS A 94  ? ILE A 347 LYS A 354 
A 3 VAL A 36  ? GLN A 42  ? VAL A 296 GLN A 302 
A 4 ILE A 2   ? ASN A 13  ? ILE A 262 ASN A 273 
A 5 VAL A 292 ? ARG A 301 ? VAL A 552 ARG A 561 
A 6 ILE A 273 ? SER A 280 ? ILE A 533 SER A 540 
B 1 ILE A 101 ? GLY A 110 ? ILE A 361 GLY A 370 
B 2 GLY A 121 ? PHE A 129 ? GLY A 381 PHE A 389 
B 3 THR A 132 ? HIS A 140 ? THR A 392 HIS A 400 
B 4 VAL A 181 ? ASP A 187 ? VAL A 441 ASP A 447 
B 5 ASP A 264 ? GLY A 270 ? ASP A 524 GLY A 530 
C 1 TYR B 76  ? LEU B 84  ? TYR B 336 LEU B 344 
C 2 ILE B 87  ? LYS B 94  ? ILE B 347 LYS B 354 
C 3 VAL B 36  ? GLN B 42  ? VAL B 296 GLN B 302 
C 4 ILE B 2   ? ASN B 13  ? ILE B 262 ASN B 273 
C 5 VAL B 292 ? ARG B 301 ? VAL B 552 ARG B 561 
C 6 ILE B 273 ? SER B 280 ? ILE B 533 SER B 540 
D 1 ILE B 101 ? GLY B 110 ? ILE B 361 GLY B 370 
D 2 GLY B 121 ? PHE B 129 ? GLY B 381 PHE B 389 
D 3 THR B 132 ? HIS B 140 ? THR B 392 HIS B 400 
D 4 VAL B 181 ? ASP B 187 ? VAL B 441 ASP B 447 
D 5 ASP B 264 ? LYS B 269 ? ASP B 524 LYS B 529 
E 1 TYR B 242 ? TYR B 244 ? TYR B 502 TYR B 504 
E 2 TRP B 251 ? ALA B 261 ? TRP B 511 ALA B 521 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ALA A 77  ? N ALA A 337 O VAL A 93  ? O VAL A 353 
A 2 3 O TYR A 92  ? O TYR A 352 N TYR A 37  ? N TYR A 297 
A 3 4 O GLY A 40  ? O GLY A 300 N GLY A 10  ? N GLY A 270 
A 4 5 N ALA A 9   ? N ALA A 269 O SER A 294 ? O SER A 554 
A 5 6 O VAL A 295 ? O VAL A 555 N LEU A 276 ? N LEU A 536 
B 1 2 N SER A 102 ? N SER A 362 O GLN A 128 ? O GLN A 388 
B 2 3 N GLY A 121 ? N GLY A 381 O HIS A 140 ? O HIS A 400 
B 3 4 N VAL A 137 ? N VAL A 397 O LEU A 185 ? O LEU A 445 
B 4 5 N TRP A 184 ? N TRP A 444 O LEU A 267 ? O LEU A 527 
C 1 2 N ALA B 77  ? N ALA B 337 O VAL B 93  ? O VAL B 353 
C 2 3 O TYR B 92  ? O TYR B 352 N TYR B 37  ? N TYR B 297 
C 3 4 O VAL B 36  ? O VAL B 296 N PHE B 8   ? N PHE B 268 
C 4 5 N PHE B 7   ? N PHE B 267 O PHE B 296 ? O PHE B 556 
C 5 6 O VAL B 295 ? O VAL B 555 N LEU B 276 ? N LEU B 536 
D 1 2 N SER B 102 ? N SER B 362 O GLN B 128 ? O GLN B 388 
D 2 3 N PHE B 127 ? N PHE B 387 O ILE B 134 ? O ILE B 394 
D 3 4 N VAL B 137 ? N VAL B 397 O LEU B 185 ? O LEU B 445 
D 4 5 N TRP B 184 ? N TRP B 444 O LEU B 267 ? O LEU B 527 
E 1 2 N TYR B 242 ? N TYR B 502 O ALA B 261 ? O ALA B 521 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG A 61'  
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CA A 64'  
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE GOL A 65' 
AC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MG B 62'  
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CA B 63'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 HOH H .   ? HOH A 17  . ? 1_555 ? 
2  AC1 5 HOH H .   ? HOH A 18  . ? 1_555 ? 
3  AC1 5 ASN A 15  ? ASN A 275 . ? 1_555 ? 
4  AC1 5 GLU A 43  ? GLU A 303 . ? 1_555 ? 
5  AC1 5 ASP A 288 ? ASP A 548 . ? 1_555 ? 
6  AC2 4 HOH H .   ? HOH A 24  . ? 1_555 ? 
7  AC2 4 HOH H .   ? HOH A 39  . ? 1_555 ? 
8  AC2 4 THR A 111 ? THR A 371 . ? 1_555 ? 
9  AC2 4 ASP A 154 ? ASP A 414 . ? 1_555 ? 
10 AC3 5 PHE A 5   ? PHE A 265 . ? 1_555 ? 
11 AC3 5 GLN A 32  ? GLN A 292 . ? 7_455 ? 
12 AC3 5 HIS A 97  ? HIS A 357 . ? 1_555 ? 
13 AC3 5 TYR A 100 ? TYR A 360 . ? 1_555 ? 
14 AC3 5 HIS A 130 ? HIS A 390 . ? 1_555 ? 
15 AC4 2 ASN B 15  ? ASN B 275 . ? 1_555 ? 
16 AC4 2 GLU B 43  ? GLU B 303 . ? 1_555 ? 
17 AC5 4 HOH I .   ? HOH B 4   . ? 1_555 ? 
18 AC5 4 THR B 111 ? THR B 371 . ? 1_555 ? 
19 AC5 4 GLY B 112 ? GLY B 372 . ? 1_555 ? 
20 AC5 4 ASP B 154 ? ASP B 414 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3N9V 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3N9V 
_atom_sites.fract_transf_matrix[1][1]   0.010399 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009037 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006274 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 1   ? -15.302 -31.391 -0.708  1.00 74.99  ? 261 MET A N   1 
ATOM   2    C  CA  . MET A 1 1   ? -16.780 -31.203 -0.587  1.00 77.02  ? 261 MET A CA  1 
ATOM   3    C  C   . MET A 1 1   ? -17.274 -30.295 -1.710  1.00 72.81  ? 261 MET A C   1 
ATOM   4    O  O   . MET A 1 1   ? -16.753 -29.202 -1.885  1.00 65.02  ? 261 MET A O   1 
ATOM   5    C  CB  . MET A 1 1   ? -17.152 -30.594 0.780   1.00 76.35  ? 261 MET A CB  1 
ATOM   6    N  N   . ILE A 1 2   ? -18.269 -30.765 -2.463  1.00 71.78  ? 262 ILE A N   1 
ATOM   7    C  CA  . ILE A 1 2   ? -18.925 -29.965 -3.494  1.00 66.54  ? 262 ILE A CA  1 
ATOM   8    C  C   . ILE A 1 2   ? -19.970 -29.050 -2.878  1.00 65.83  ? 262 ILE A C   1 
ATOM   9    O  O   . ILE A 1 2   ? -20.878 -29.506 -2.196  1.00 66.06  ? 262 ILE A O   1 
ATOM   10   C  CB  . ILE A 1 2   ? -19.670 -30.830 -4.514  1.00 65.99  ? 262 ILE A CB  1 
ATOM   11   C  CG1 . ILE A 1 2   ? -18.722 -31.803 -5.205  1.00 67.41  ? 262 ILE A CG1 1 
ATOM   12   C  CG2 . ILE A 1 2   ? -20.339 -29.943 -5.546  1.00 64.09  ? 262 ILE A CG2 1 
ATOM   13   C  CD1 . ILE A 1 2   ? -17.655 -31.110 -6.013  1.00 70.84  ? 262 ILE A CD1 1 
ATOM   14   N  N   . GLN A 1 3   ? -19.840 -27.759 -3.120  1.00 64.76  ? 263 GLN A N   1 
ATOM   15   C  CA  . GLN A 1 3   ? -20.860 -26.816 -2.741  1.00 64.79  ? 263 GLN A CA  1 
ATOM   16   C  C   . GLN A 1 3   ? -21.316 -26.043 -3.971  1.00 62.06  ? 263 GLN A C   1 
ATOM   17   O  O   . GLN A 1 3   ? -20.495 -25.568 -4.746  1.00 61.18  ? 263 GLN A O   1 
ATOM   18   C  CB  . GLN A 1 3   ? -20.324 -25.868 -1.676  1.00 70.31  ? 263 GLN A CB  1 
ATOM   19   C  CG  . GLN A 1 3   ? -21.196 -24.625 -1.509  1.00 83.04  ? 263 GLN A CG  1 
ATOM   20   C  CD  . GLN A 1 3   ? -20.867 -23.827 -0.268  1.00 93.53  ? 263 GLN A CD  1 
ATOM   21   O  OE1 . GLN A 1 3   ? -20.351 -24.373 0.727   1.00 98.70  ? 263 GLN A OE1 1 
ATOM   22   N  NE2 . GLN A 1 3   ? -21.175 -22.519 -0.310  1.00 92.96  ? 263 GLN A NE2 1 
ATOM   23   N  N   . ASN A 1 4   ? -22.631 -25.916 -4.130  1.00 58.57  ? 264 ASN A N   1 
ATOM   24   C  CA  . ASN A 1 4   ? -23.227 -25.218 -5.262  1.00 55.95  ? 264 ASN A CA  1 
ATOM   25   C  C   . ASN A 1 4   ? -23.227 -23.706 -5.101  1.00 55.40  ? 264 ASN A C   1 
ATOM   26   O  O   . ASN A 1 4   ? -23.503 -23.170 -4.035  1.00 56.78  ? 264 ASN A O   1 
ATOM   27   C  CB  . ASN A 1 4   ? -24.653 -25.698 -5.515  1.00 58.97  ? 264 ASN A CB  1 
ATOM   28   C  CG  . ASN A 1 4   ? -24.703 -27.124 -6.076  1.00 68.94  ? 264 ASN A CG  1 
ATOM   29   O  OD1 . ASN A 1 4   ? -23.754 -27.594 -6.706  1.00 73.90  ? 264 ASN A OD1 1 
ATOM   30   N  ND2 . ASN A 1 4   ? -25.823 -27.814 -5.855  1.00 72.29  ? 264 ASN A ND2 1 
ATOM   31   N  N   . PHE A 1 5   ? -22.876 -23.037 -6.189  1.00 52.07  ? 265 PHE A N   1 
ATOM   32   C  CA  . PHE A 1 5   ? -22.970 -21.608 -6.293  1.00 52.49  ? 265 PHE A CA  1 
ATOM   33   C  C   . PHE A 1 5   ? -23.814 -21.279 -7.524  1.00 51.78  ? 265 PHE A C   1 
ATOM   34   O  O   . PHE A 1 5   ? -23.889 -22.065 -8.471  1.00 55.80  ? 265 PHE A O   1 
ATOM   35   C  CB  . PHE A 1 5   ? -21.578 -21.015 -6.445  1.00 53.64  ? 265 PHE A CB  1 
ATOM   36   C  CG  . PHE A 1 5   ? -20.721 -21.198 -5.247  1.00 57.54  ? 265 PHE A CG  1 
ATOM   37   C  CD1 . PHE A 1 5   ? -20.568 -20.179 -4.323  1.00 58.70  ? 265 PHE A CD1 1 
ATOM   38   C  CD2 . PHE A 1 5   ? -20.072 -22.386 -5.035  1.00 54.57  ? 265 PHE A CD2 1 
ATOM   39   C  CE1 . PHE A 1 5   ? -19.778 -20.357 -3.213  1.00 57.25  ? 265 PHE A CE1 1 
ATOM   40   C  CE2 . PHE A 1 5   ? -19.291 -22.571 -3.913  1.00 52.98  ? 265 PHE A CE2 1 
ATOM   41   C  CZ  . PHE A 1 5   ? -19.139 -21.562 -3.004  1.00 53.30  ? 265 PHE A CZ  1 
ATOM   42   N  N   . ARG A 1 6   ? -24.450 -20.119 -7.508  1.00 46.63  ? 266 ARG A N   1 
ATOM   43   C  CA  . ARG A 1 6   ? -25.288 -19.736 -8.608  1.00 51.75  ? 266 ARG A CA  1 
ATOM   44   C  C   . ARG A 1 6   ? -24.517 -18.877 -9.587  1.00 47.89  ? 266 ARG A C   1 
ATOM   45   O  O   . ARG A 1 6   ? -24.017 -17.816 -9.214  1.00 44.46  ? 266 ARG A O   1 
ATOM   46   C  CB  . ARG A 1 6   ? -26.520 -18.995 -8.102  1.00 58.90  ? 266 ARG A CB  1 
ATOM   47   C  CG  . ARG A 1 6   ? -27.698 -19.897 -7.919  1.00 69.76  ? 266 ARG A CG  1 
ATOM   48   C  CD  . ARG A 1 6   ? -28.933 -19.130 -7.483  1.00 80.54  ? 266 ARG A CD  1 
ATOM   49   N  NE  . ARG A 1 6   ? -30.129 -19.955 -7.662  1.00 91.40  ? 266 ARG A NE  1 
ATOM   50   C  CZ  . ARG A 1 6   ? -30.441 -20.998 -6.891  1.00 101.75 ? 266 ARG A CZ  1 
ATOM   51   N  NH1 . ARG A 1 6   ? -29.655 -21.352 -5.864  1.00 104.79 ? 266 ARG A NH1 1 
ATOM   52   N  NH2 . ARG A 1 6   ? -31.556 -21.693 -7.125  1.00 104.83 ? 266 ARG A NH2 1 
ATOM   53   N  N   . PHE A 1 7   ? -24.445 -19.334 -10.836 1.00 46.31  ? 267 PHE A N   1 
ATOM   54   C  CA  . PHE A 1 7   ? -23.772 -18.597 -11.907 1.00 44.76  ? 267 PHE A CA  1 
ATOM   55   C  C   . PHE A 1 7   ? -24.797 -18.027 -12.882 1.00 46.66  ? 267 PHE A C   1 
ATOM   56   O  O   . PHE A 1 7   ? -25.666 -18.745 -13.389 1.00 48.42  ? 267 PHE A O   1 
ATOM   57   C  CB  . PHE A 1 7   ? -22.843 -19.522 -12.700 1.00 41.51  ? 267 PHE A CB  1 
ATOM   58   C  CG  . PHE A 1 7   ? -21.532 -19.774 -12.059 1.00 41.99  ? 267 PHE A CG  1 
ATOM   59   C  CD1 . PHE A 1 7   ? -20.372 -19.299 -12.635 1.00 43.51  ? 267 PHE A CD1 1 
ATOM   60   C  CD2 . PHE A 1 7   ? -21.450 -20.503 -10.900 1.00 42.26  ? 267 PHE A CD2 1 
ATOM   61   C  CE1 . PHE A 1 7   ? -19.130 -19.523 -12.047 1.00 46.13  ? 267 PHE A CE1 1 
ATOM   62   C  CE2 . PHE A 1 7   ? -20.227 -20.750 -10.306 1.00 45.23  ? 267 PHE A CE2 1 
ATOM   63   C  CZ  . PHE A 1 7   ? -19.055 -20.251 -10.876 1.00 45.67  ? 267 PHE A CZ  1 
ATOM   64   N  N   . PHE A 1 8   ? -24.682 -16.735 -13.152 1.00 47.34  ? 268 PHE A N   1 
ATOM   65   C  CA  . PHE A 1 8   ? -25.491 -16.086 -14.175 1.00 46.90  ? 268 PHE A CA  1 
ATOM   66   C  C   . PHE A 1 8   ? -24.610 -15.890 -15.402 1.00 46.18  ? 268 PHE A C   1 
ATOM   67   O  O   . PHE A 1 8   ? -23.496 -15.326 -15.295 1.00 45.45  ? 268 PHE A O   1 
ATOM   68   C  CB  . PHE A 1 8   ? -25.970 -14.733 -13.662 1.00 43.48  ? 268 PHE A CB  1 
ATOM   69   C  CG  . PHE A 1 8   ? -26.689 -13.917 -14.680 1.00 45.93  ? 268 PHE A CG  1 
ATOM   70   C  CD1 . PHE A 1 8   ? -28.062 -13.863 -14.689 1.00 49.58  ? 268 PHE A CD1 1 
ATOM   71   C  CD2 . PHE A 1 8   ? -25.993 -13.185 -15.624 1.00 42.89  ? 268 PHE A CD2 1 
ATOM   72   C  CE1 . PHE A 1 8   ? -28.736 -13.101 -15.631 1.00 49.80  ? 268 PHE A CE1 1 
ATOM   73   C  CE2 . PHE A 1 8   ? -26.648 -12.428 -16.556 1.00 40.79  ? 268 PHE A CE2 1 
ATOM   74   C  CZ  . PHE A 1 8   ? -28.025 -12.385 -16.562 1.00 45.32  ? 268 PHE A CZ  1 
ATOM   75   N  N   . ALA A 1 9   ? -25.094 -16.366 -16.547 1.00 45.61  ? 269 ALA A N   1 
ATOM   76   C  CA  . ALA A 1 9   ? -24.457 -16.112 -17.841 1.00 47.45  ? 269 ALA A CA  1 
ATOM   77   C  C   . ALA A 1 9   ? -25.409 -15.275 -18.702 1.00 47.88  ? 269 ALA A C   1 
ATOM   78   O  O   . ALA A 1 9   ? -26.614 -15.600 -18.801 1.00 51.13  ? 269 ALA A O   1 
ATOM   79   C  CB  . ALA A 1 9   ? -24.123 -17.424 -18.541 1.00 44.47  ? 269 ALA A CB  1 
ATOM   80   N  N   . GLY A 1 10  ? -24.890 -14.204 -19.308 1.00 45.19  ? 270 GLY A N   1 
ATOM   81   C  CA  . GLY A 1 10  ? -25.690 -13.353 -20.206 1.00 46.61  ? 270 GLY A CA  1 
ATOM   82   C  C   . GLY A 1 10  ? -24.935 -12.983 -21.471 1.00 50.54  ? 270 GLY A C   1 
ATOM   83   O  O   . GLY A 1 10  ? -23.715 -12.799 -21.429 1.00 52.33  ? 270 GLY A O   1 
ATOM   84   N  N   . THR A 1 11  ? -25.657 -12.879 -22.591 1.00 48.90  ? 271 THR A N   1 
ATOM   85   C  CA  . THR A 1 11  ? -25.083 -12.446 -23.871 1.00 46.00  ? 271 THR A CA  1 
ATOM   86   C  C   . THR A 1 11  ? -26.059 -11.476 -24.540 1.00 46.54  ? 271 THR A C   1 
ATOM   87   O  O   . THR A 1 11  ? -27.263 -11.711 -24.538 1.00 48.37  ? 271 THR A O   1 
ATOM   88   C  CB  . THR A 1 11  ? -24.810 -13.630 -24.816 1.00 43.20  ? 271 THR A CB  1 
ATOM   89   O  OG1 . THR A 1 11  ? -24.219 -13.162 -26.033 1.00 42.31  ? 271 THR A OG1 1 
ATOM   90   C  CG2 . THR A 1 11  ? -26.095 -14.361 -25.144 1.00 45.02  ? 271 THR A CG2 1 
ATOM   91   N  N   . TYR A 1 12  ? -25.520 -10.404 -25.117 1.00 45.37  ? 272 TYR A N   1 
ATOM   92   C  CA  . TYR A 1 12  ? -26.304 -9.299  -25.687 1.00 48.94  ? 272 TYR A CA  1 
ATOM   93   C  C   . TYR A 1 12  ? -25.515 -8.654  -26.818 1.00 51.80  ? 272 TYR A C   1 
ATOM   94   O  O   . TYR A 1 12  ? -24.390 -8.200  -26.608 1.00 50.69  ? 272 TYR A O   1 
ATOM   95   C  CB  . TYR A 1 12  ? -26.579 -8.238  -24.604 1.00 48.29  ? 272 TYR A CB  1 
ATOM   96   C  CG  . TYR A 1 12  ? -27.686 -7.239  -24.914 1.00 54.71  ? 272 TYR A CG  1 
ATOM   97   C  CD1 . TYR A 1 12  ? -28.602 -7.452  -25.933 1.00 55.61  ? 272 TYR A CD1 1 
ATOM   98   C  CD2 . TYR A 1 12  ? -27.853 -6.100  -24.131 1.00 56.53  ? 272 TYR A CD2 1 
ATOM   99   C  CE1 . TYR A 1 12  ? -29.635 -6.544  -26.184 1.00 54.42  ? 272 TYR A CE1 1 
ATOM   100  C  CE2 . TYR A 1 12  ? -28.883 -5.186  -24.381 1.00 56.18  ? 272 TYR A CE2 1 
ATOM   101  C  CZ  . TYR A 1 12  ? -29.765 -5.423  -25.411 1.00 55.32  ? 272 TYR A CZ  1 
ATOM   102  O  OH  . TYR A 1 12  ? -30.780 -4.539  -25.676 1.00 55.19  ? 272 TYR A OH  1 
ATOM   103  N  N   . ASN A 1 13  ? -26.078 -8.647  -28.016 1.00 54.85  ? 273 ASN A N   1 
ATOM   104  C  CA  . ASN A 1 13  ? -25.494 -7.912  -29.136 1.00 54.33  ? 273 ASN A CA  1 
ATOM   105  C  C   . ASN A 1 13  ? -26.214 -6.569  -29.202 1.00 53.89  ? 273 ASN A C   1 
ATOM   106  O  O   . ASN A 1 13  ? -27.387 -6.497  -29.577 1.00 57.94  ? 273 ASN A O   1 
ATOM   107  C  CB  . ASN A 1 13  ? -25.668 -8.710  -30.434 1.00 53.32  ? 273 ASN A CB  1 
ATOM   108  C  CG  . ASN A 1 13  ? -25.232 -7.938  -31.679 1.00 59.81  ? 273 ASN A CG  1 
ATOM   109  O  OD1 . ASN A 1 13  ? -25.428 -6.721  -31.786 1.00 62.30  ? 273 ASN A OD1 1 
ATOM   110  N  ND2 . ASN A 1 13  ? -24.648 -8.653  -32.638 1.00 60.91  ? 273 ASN A ND2 1 
ATOM   111  N  N   . VAL A 1 14  ? -25.496 -5.508  -28.849 1.00 50.08  ? 274 VAL A N   1 
ATOM   112  C  CA  . VAL A 1 14  ? -26.098 -4.186  -28.603 1.00 50.52  ? 274 VAL A CA  1 
ATOM   113  C  C   . VAL A 1 14  ? -26.021 -3.277  -29.824 1.00 54.91  ? 274 VAL A C   1 
ATOM   114  O  O   . VAL A 1 14  ? -26.311 -2.082  -29.756 1.00 56.48  ? 274 VAL A O   1 
ATOM   115  C  CB  . VAL A 1 14  ? -25.403 -3.511  -27.408 1.00 49.25  ? 274 VAL A CB  1 
ATOM   116  C  CG1 . VAL A 1 14  ? -25.507 -4.402  -26.153 1.00 46.83  ? 274 VAL A CG1 1 
ATOM   117  C  CG2 . VAL A 1 14  ? -23.922 -3.233  -27.713 1.00 44.08  ? 274 VAL A CG2 1 
ATOM   118  N  N   . ASN A 1 15  ? -25.605 -3.845  -30.948 1.00 55.96  ? 275 ASN A N   1 
ATOM   119  C  CA  . ASN A 1 15  ? -25.699 -3.167  -32.231 1.00 60.24  ? 275 ASN A CA  1 
ATOM   120  C  C   . ASN A 1 15  ? -25.148 -1.738  -32.217 1.00 60.25  ? 275 ASN A C   1 
ATOM   121  O  O   . ASN A 1 15  ? -25.704 -0.850  -32.829 1.00 58.83  ? 275 ASN A O   1 
ATOM   122  C  CB  . ASN A 1 15  ? -27.151 -3.179  -32.704 1.00 60.99  ? 275 ASN A CB  1 
ATOM   123  C  CG  . ASN A 1 15  ? -27.293 -2.800  -34.164 1.00 61.18  ? 275 ASN A CG  1 
ATOM   124  O  OD1 . ASN A 1 15  ? -26.651 -3.391  -35.030 1.00 64.63  ? 275 ASN A OD1 1 
ATOM   125  N  ND2 . ASN A 1 15  ? -28.126 -1.819  -34.440 1.00 56.34  ? 275 ASN A ND2 1 
ATOM   126  N  N   . GLY A 1 16  ? -24.049 -1.533  -31.499 1.00 60.47  ? 276 GLY A N   1 
ATOM   127  C  CA  . GLY A 1 16  ? -23.289 -0.285  -31.596 1.00 59.10  ? 276 GLY A CA  1 
ATOM   128  C  C   . GLY A 1 16  ? -23.854 0.851   -30.772 1.00 59.15  ? 276 GLY A C   1 
ATOM   129  O  O   . GLY A 1 16  ? -23.351 1.976   -30.843 1.00 59.02  ? 276 GLY A O   1 
ATOM   130  N  N   . GLN A 1 17  ? -24.860 0.529   -29.954 1.00 57.81  ? 277 GLN A N   1 
ATOM   131  C  CA  . GLN A 1 17  ? -25.648 1.513   -29.237 1.00 59.81  ? 277 GLN A CA  1 
ATOM   132  C  C   . GLN A 1 17  ? -25.124 1.724   -27.854 1.00 60.45  ? 277 GLN A C   1 
ATOM   133  O  O   . GLN A 1 17  ? -24.585 0.818   -27.261 1.00 60.86  ? 277 GLN A O   1 
ATOM   134  C  CB  . GLN A 1 17  ? -27.082 1.026   -29.089 1.00 60.94  ? 277 GLN A CB  1 
ATOM   135  C  CG  . GLN A 1 17  ? -27.777 0.739   -30.398 1.00 65.49  ? 277 GLN A CG  1 
ATOM   136  C  CD  . GLN A 1 17  ? -27.875 1.960   -31.292 1.00 64.33  ? 277 GLN A CD  1 
ATOM   137  O  OE1 . GLN A 1 17  ? -28.553 2.937   -30.971 1.00 66.02  ? 277 GLN A OE1 1 
ATOM   138  N  NE2 . GLN A 1 17  ? -27.192 1.908   -32.411 1.00 59.08  ? 277 GLN A NE2 1 
ATOM   139  N  N   . SER A 1 18  ? -25.341 2.921   -27.324 1.00 60.53  ? 278 SER A N   1 
ATOM   140  C  CA  . SER A 1 18  ? -25.180 3.181   -25.902 1.00 57.33  ? 278 SER A CA  1 
ATOM   141  C  C   . SER A 1 18  ? -26.397 2.643   -25.147 1.00 58.28  ? 278 SER A C   1 
ATOM   142  O  O   . SER A 1 18  ? -27.496 2.573   -25.700 1.00 60.48  ? 278 SER A O   1 
ATOM   143  C  CB  . SER A 1 18  ? -25.033 4.679   -25.663 1.00 55.42  ? 278 SER A CB  1 
ATOM   144  O  OG  . SER A 1 18  ? -23.926 5.182   -26.384 1.00 57.71  ? 278 SER A OG  1 
ATOM   145  N  N   . PRO A 1 19  ? -26.209 2.269   -23.882 1.00 59.27  ? 279 PRO A N   1 
ATOM   146  C  CA  . PRO A 1 19  ? -27.345 1.823   -23.085 1.00 61.79  ? 279 PRO A CA  1 
ATOM   147  C  C   . PRO A 1 19  ? -28.368 2.923   -22.897 1.00 68.43  ? 279 PRO A C   1 
ATOM   148  O  O   . PRO A 1 19  ? -28.025 4.040   -22.495 1.00 66.12  ? 279 PRO A O   1 
ATOM   149  C  CB  . PRO A 1 19  ? -26.721 1.472   -21.735 1.00 56.29  ? 279 PRO A CB  1 
ATOM   150  C  CG  . PRO A 1 19  ? -25.481 2.266   -21.665 1.00 55.88  ? 279 PRO A CG  1 
ATOM   151  C  CD  . PRO A 1 19  ? -24.983 2.408   -23.079 1.00 56.05  ? 279 PRO A CD  1 
ATOM   152  N  N   . LYS A 1 20  ? -29.615 2.602   -23.221 1.00 73.34  ? 280 LYS A N   1 
ATOM   153  C  CA  . LYS A 1 20  ? -30.745 3.507   -23.031 1.00 75.86  ? 280 LYS A CA  1 
ATOM   154  C  C   . LYS A 1 20  ? -31.605 3.038   -21.867 1.00 80.07  ? 280 LYS A C   1 
ATOM   155  O  O   . LYS A 1 20  ? -32.264 3.840   -21.211 1.00 83.17  ? 280 LYS A O   1 
ATOM   156  C  CB  . LYS A 1 20  ? -31.610 3.555   -24.296 1.00 75.75  ? 280 LYS A CB  1 
ATOM   157  C  CG  . LYS A 1 20  ? -31.150 4.530   -25.415 1.00 83.73  ? 280 LYS A CG  1 
ATOM   158  C  CD  . LYS A 1 20  ? -29.981 3.991   -26.236 1.00 82.88  ? 280 LYS A CD  1 
ATOM   159  C  CE  . LYS A 1 20  ? -30.038 4.406   -27.715 1.00 87.98  ? 280 LYS A CE  1 
ATOM   160  N  NZ  . LYS A 1 20  ? -30.455 3.259   -28.615 1.00 92.35  ? 280 LYS A NZ  1 
ATOM   161  N  N   . GLU A 1 21  ? -31.587 1.735   -21.609 1.00 78.90  ? 281 GLU A N   1 
ATOM   162  C  CA  . GLU A 1 21  ? -32.504 1.116   -20.670 1.00 74.48  ? 281 GLU A CA  1 
ATOM   163  C  C   . GLU A 1 21  ? -31.818 0.571   -19.440 1.00 67.19  ? 281 GLU A C   1 
ATOM   164  O  O   . GLU A 1 21  ? -30.648 0.220   -19.450 1.00 65.88  ? 281 GLU A O   1 
ATOM   165  C  CB  . GLU A 1 21  ? -33.254 -0.019  -21.368 1.00 76.59  ? 281 GLU A CB  1 
ATOM   166  C  CG  . GLU A 1 21  ? -34.209 0.481   -22.456 1.00 81.79  ? 281 GLU A CG  1 
ATOM   167  C  CD  . GLU A 1 21  ? -34.473 -0.541  -23.553 1.00 87.24  ? 281 GLU A CD  1 
ATOM   168  O  OE1 . GLU A 1 21  ? -33.496 -1.168  -24.038 1.00 89.57  ? 281 GLU A OE1 1 
ATOM   169  O  OE2 . GLU A 1 21  ? -35.661 -0.702  -23.939 1.00 89.11  ? 281 GLU A OE2 1 
ATOM   170  N  N   . CYS A 1 22  ? -32.586 0.528   -18.368 1.00 65.76  ? 282 CYS A N   1 
ATOM   171  C  CA  . CYS A 1 22  ? -32.213 -0.175  -17.178 1.00 63.49  ? 282 CYS A CA  1 
ATOM   172  C  C   . CYS A 1 22  ? -32.071 -1.652  -17.511 1.00 64.50  ? 282 CYS A C   1 
ATOM   173  O  O   . CYS A 1 22  ? -32.927 -2.223  -18.168 1.00 67.25  ? 282 CYS A O   1 
ATOM   174  C  CB  . CYS A 1 22  ? -33.291 0.006   -16.121 1.00 58.14  ? 282 CYS A CB  1 
ATOM   175  S  SG  . CYS A 1 22  ? -33.007 -1.036  -14.712 1.00 76.05  ? 282 CYS A SG  1 
ATOM   176  N  N   . LEU A 1 23  ? -30.994 -2.262  -17.039 1.00 60.41  ? 283 LEU A N   1 
ATOM   177  C  CA  . LEU A 1 23  ? -30.688 -3.656  -17.327 1.00 56.03  ? 283 LEU A CA  1 
ATOM   178  C  C   . LEU A 1 23  ? -31.203 -4.640  -16.278 1.00 57.38  ? 283 LEU A C   1 
ATOM   179  O  O   . LEU A 1 23  ? -31.065 -5.835  -16.445 1.00 57.40  ? 283 LEU A O   1 
ATOM   180  C  CB  . LEU A 1 23  ? -29.171 -3.826  -17.457 1.00 51.97  ? 283 LEU A CB  1 
ATOM   181  C  CG  . LEU A 1 23  ? -28.522 -3.094  -18.627 1.00 52.42  ? 283 LEU A CG  1 
ATOM   182  C  CD1 . LEU A 1 23  ? -27.016 -3.326  -18.608 1.00 53.20  ? 283 LEU A CD1 1 
ATOM   183  C  CD2 . LEU A 1 23  ? -29.155 -3.528  -19.945 1.00 43.63  ? 283 LEU A CD2 1 
ATOM   184  N  N   . ARG A 1 24  ? -31.788 -4.154  -15.196 1.00 59.46  ? 284 ARG A N   1 
ATOM   185  C  CA  . ARG A 1 24  ? -32.355 -5.047  -14.199 1.00 61.07  ? 284 ARG A CA  1 
ATOM   186  C  C   . ARG A 1 24  ? -33.230 -6.136  -14.815 1.00 63.32  ? 284 ARG A C   1 
ATOM   187  O  O   . ARG A 1 24  ? -33.220 -7.263  -14.343 1.00 60.81  ? 284 ARG A O   1 
ATOM   188  C  CB  . ARG A 1 24  ? -33.197 -4.261  -13.219 1.00 64.36  ? 284 ARG A CB  1 
ATOM   189  C  CG  . ARG A 1 24  ? -32.411 -3.314  -12.354 1.00 68.92  ? 284 ARG A CG  1 
ATOM   190  C  CD  . ARG A 1 24  ? -31.745 -4.001  -11.175 1.00 72.33  ? 284 ARG A CD  1 
ATOM   191  N  NE  . ARG A 1 24  ? -31.868 -3.123  -10.009 1.00 79.96  ? 284 ARG A NE  1 
ATOM   192  C  CZ  . ARG A 1 24  ? -30.885 -2.771  -9.184  1.00 82.18  ? 284 ARG A CZ  1 
ATOM   193  N  NH1 . ARG A 1 24  ? -29.652 -3.250  -9.332  1.00 80.06  ? 284 ARG A NH1 1 
ATOM   194  N  NH2 . ARG A 1 24  ? -31.154 -1.950  -8.170  1.00 83.49  ? 284 ARG A NH2 1 
ATOM   195  N  N   . LEU A 1 25  ? -34.000 -5.794  -15.850 1.00 65.65  ? 285 LEU A N   1 
ATOM   196  C  CA  . LEU A 1 25  ? -34.855 -6.774  -16.547 1.00 69.93  ? 285 LEU A CA  1 
ATOM   197  C  C   . LEU A 1 25  ? -34.033 -7.967  -16.991 1.00 69.03  ? 285 LEU A C   1 
ATOM   198  O  O   . LEU A 1 25  ? -34.460 -9.105  -16.886 1.00 71.38  ? 285 LEU A O   1 
ATOM   199  C  CB  . LEU A 1 25  ? -35.523 -6.153  -17.786 1.00 74.99  ? 285 LEU A CB  1 
ATOM   200  C  CG  . LEU A 1 25  ? -36.783 -5.304  -17.581 1.00 81.66  ? 285 LEU A CG  1 
ATOM   201  C  CD1 . LEU A 1 25  ? -36.887 -4.139  -18.592 1.00 83.59  ? 285 LEU A CD1 1 
ATOM   202  C  CD2 . LEU A 1 25  ? -38.012 -6.185  -17.648 1.00 84.32  ? 285 LEU A CD2 1 
ATOM   203  N  N   . TRP A 1 26  ? -32.847 -7.686  -17.491 1.00 63.49  ? 286 TRP A N   1 
ATOM   204  C  CA  . TRP A 1 26  ? -31.969 -8.702  -18.010 1.00 58.59  ? 286 TRP A CA  1 
ATOM   205  C  C   . TRP A 1 26  ? -31.178 -9.388  -16.893 1.00 58.56  ? 286 TRP A C   1 
ATOM   206  O  O   . TRP A 1 26  ? -31.157 -10.610 -16.824 1.00 58.97  ? 286 TRP A O   1 
ATOM   207  C  CB  . TRP A 1 26  ? -31.027 -8.046  -19.020 1.00 53.88  ? 286 TRP A CB  1 
ATOM   208  C  CG  . TRP A 1 26  ? -29.962 -8.911  -19.564 1.00 51.38  ? 286 TRP A CG  1 
ATOM   209  C  CD1 . TRP A 1 26  ? -30.037 -10.244 -19.810 1.00 51.12  ? 286 TRP A CD1 1 
ATOM   210  C  CD2 . TRP A 1 26  ? -28.672 -8.491  -19.991 1.00 45.34  ? 286 TRP A CD2 1 
ATOM   211  N  NE1 . TRP A 1 26  ? -28.854 -10.689 -20.333 1.00 48.17  ? 286 TRP A NE1 1 
ATOM   212  C  CE2 . TRP A 1 26  ? -28.001 -9.625  -20.463 1.00 43.43  ? 286 TRP A CE2 1 
ATOM   213  C  CE3 . TRP A 1 26  ? -28.015 -7.266  -20.006 1.00 44.75  ? 286 TRP A CE3 1 
ATOM   214  C  CZ2 . TRP A 1 26  ? -26.703 -9.576  -20.958 1.00 39.42  ? 286 TRP A CZ2 1 
ATOM   215  C  CZ3 . TRP A 1 26  ? -26.716 -7.213  -20.488 1.00 45.09  ? 286 TRP A CZ3 1 
ATOM   216  C  CH2 . TRP A 1 26  ? -26.072 -8.365  -20.951 1.00 42.71  ? 286 TRP A CH2 1 
ATOM   217  N  N   . LEU A 1 27  ? -30.552 -8.603  -16.018 1.00 58.32  ? 287 LEU A N   1 
ATOM   218  C  CA  . LEU A 1 27  ? -29.564 -9.116  -15.064 1.00 59.47  ? 287 LEU A CA  1 
ATOM   219  C  C   . LEU A 1 27  ? -30.100 -9.460  -13.655 1.00 60.76  ? 287 LEU A C   1 
ATOM   220  O  O   . LEU A 1 27  ? -29.415 -10.122 -12.883 1.00 62.27  ? 287 LEU A O   1 
ATOM   221  C  CB  . LEU A 1 27  ? -28.402 -8.118  -14.944 1.00 57.85  ? 287 LEU A CB  1 
ATOM   222  C  CG  . LEU A 1 27  ? -27.576 -7.822  -16.210 1.00 56.54  ? 287 LEU A CG  1 
ATOM   223  C  CD1 . LEU A 1 27  ? -26.813 -6.486  -16.050 1.00 54.77  ? 287 LEU A CD1 1 
ATOM   224  C  CD2 . LEU A 1 27  ? -26.587 -8.961  -16.573 1.00 49.12  ? 287 LEU A CD2 1 
ATOM   225  N  N   . SER A 1 28  ? -31.301 -9.016  -13.304 1.00 63.25  ? 288 SER A N   1 
ATOM   226  C  CA  . SER A 1 28  ? -31.899 -9.384  -12.001 1.00 66.32  ? 288 SER A CA  1 
ATOM   227  C  C   . SER A 1 28  ? -33.420 -9.183  -11.979 1.00 76.29  ? 288 SER A C   1 
ATOM   228  O  O   . SER A 1 28  ? -33.941 -8.248  -11.370 1.00 81.99  ? 288 SER A O   1 
ATOM   229  C  CB  . SER A 1 28  ? -31.217 -8.627  -10.862 1.00 63.36  ? 288 SER A CB  1 
ATOM   230  O  OG  . SER A 1 28  ? -30.886 -7.313  -11.249 1.00 63.66  ? 288 SER A OG  1 
ATOM   231  N  N   . ASN A 1 29  ? -34.109 -10.076 -12.682 1.00 80.13  ? 289 ASN A N   1 
ATOM   232  C  CA  . ASN A 1 29  ? -35.542 -9.997  -12.930 1.00 83.70  ? 289 ASN A CA  1 
ATOM   233  C  C   . ASN A 1 29  ? -36.114 -11.261 -12.341 1.00 80.81  ? 289 ASN A C   1 
ATOM   234  O  O   . ASN A 1 29  ? -36.106 -12.303 -12.996 1.00 81.83  ? 289 ASN A O   1 
ATOM   235  C  CB  . ASN A 1 29  ? -35.777 -9.921  -14.454 1.00 86.94  ? 289 ASN A CB  1 
ATOM   236  C  CG  . ASN A 1 29  ? -37.286 -9.981  -14.887 1.00 119.80 ? 289 ASN A CG  1 
ATOM   237  O  OD1 . ASN A 1 29  ? -38.234 -9.750  -14.107 1.00 120.08 ? 289 ASN A OD1 1 
ATOM   238  N  ND2 . ASN A 1 29  ? -37.484 -10.275 -16.177 1.00 120.23 ? 289 ASN A ND2 1 
ATOM   239  N  N   . GLY A 1 30  ? -36.561 -11.178 -11.091 1.00 74.60  ? 290 GLY A N   1 
ATOM   240  C  CA  . GLY A 1 30  ? -37.102 -12.332 -10.377 1.00 74.90  ? 290 GLY A CA  1 
ATOM   241  C  C   . GLY A 1 30  ? -36.167 -13.531 -10.237 1.00 73.77  ? 290 GLY A C   1 
ATOM   242  O  O   . GLY A 1 30  ? -36.619 -14.669 -10.293 1.00 75.52  ? 290 GLY A O   1 
ATOM   243  N  N   . ILE A 1 31  ? -34.868 -13.283 -10.075 1.00 69.37  ? 291 ILE A N   1 
ATOM   244  C  CA  . ILE A 1 31  ? -33.915 -14.344 -9.767  1.00 66.26  ? 291 ILE A CA  1 
ATOM   245  C  C   . ILE A 1 31  ? -33.242 -14.099 -8.413  1.00 68.04  ? 291 ILE A C   1 
ATOM   246  O  O   . ILE A 1 31  ? -33.146 -12.960 -7.963  1.00 68.09  ? 291 ILE A O   1 
ATOM   247  C  CB  . ILE A 1 31  ? -32.865 -14.510 -10.889 1.00 58.88  ? 291 ILE A CB  1 
ATOM   248  C  CG1 . ILE A 1 31  ? -31.951 -13.273 -11.020 1.00 51.56  ? 291 ILE A CG1 1 
ATOM   249  C  CG2 . ILE A 1 31  ? -33.581 -14.814 -12.192 1.00 56.56  ? 291 ILE A CG2 1 
ATOM   250  C  CD1 . ILE A 1 31  ? -30.715 -13.472 -11.924 1.00 47.71  ? 291 ILE A CD1 1 
ATOM   251  N  N   . GLN A 1 32  ? -32.814 -15.171 -7.748  1.00 68.42  ? 292 GLN A N   1 
ATOM   252  C  CA  . GLN A 1 32  ? -31.991 -15.038 -6.556  1.00 67.28  ? 292 GLN A CA  1 
ATOM   253  C  C   . GLN A 1 32  ? -30.693 -14.404 -6.996  1.00 63.75  ? 292 GLN A C   1 
ATOM   254  O  O   . GLN A 1 32  ? -30.244 -14.625 -8.114  1.00 62.15  ? 292 GLN A O   1 
ATOM   255  C  CB  . GLN A 1 32  ? -31.682 -16.392 -5.919  1.00 74.57  ? 292 GLN A CB  1 
ATOM   256  C  CG  . GLN A 1 32  ? -32.823 -17.037 -5.141  1.00 85.45  ? 292 GLN A CG  1 
ATOM   257  C  CD  . GLN A 1 32  ? -32.375 -18.285 -4.355  1.00 95.24  ? 292 GLN A CD  1 
ATOM   258  O  OE1 . GLN A 1 32  ? -31.232 -18.363 -3.868  1.00 95.10  ? 292 GLN A OE1 1 
ATOM   259  N  NE2 . GLN A 1 32  ? -33.283 -19.260 -4.219  1.00 101.01 ? 292 GLN A NE2 1 
ATOM   260  N  N   . ALA A 1 33  ? -30.101 -13.624 -6.102  1.00 61.53  ? 293 ALA A N   1 
ATOM   261  C  CA  . ALA A 1 33  ? -28.828 -12.957 -6.353  1.00 55.90  ? 293 ALA A CA  1 
ATOM   262  C  C   . ALA A 1 33  ? -27.792 -13.985 -6.762  1.00 56.59  ? 293 ALA A C   1 
ATOM   263  O  O   . ALA A 1 33  ? -27.472 -14.863 -5.987  1.00 61.45  ? 293 ALA A O   1 
ATOM   264  C  CB  . ALA A 1 33  ? -28.375 -12.234 -5.096  1.00 48.37  ? 293 ALA A CB  1 
ATOM   265  N  N   . PRO A 1 34  ? -27.268 -13.902 -7.984  1.00 53.20  ? 294 PRO A N   1 
ATOM   266  C  CA  . PRO A 1 34  ? -26.225 -14.880 -8.301  1.00 49.09  ? 294 PRO A CA  1 
ATOM   267  C  C   . PRO A 1 34  ? -24.959 -14.653 -7.500  1.00 50.47  ? 294 PRO A C   1 
ATOM   268  O  O   . PRO A 1 34  ? -24.642 -13.520 -7.128  1.00 52.08  ? 294 PRO A O   1 
ATOM   269  C  CB  . PRO A 1 34  ? -25.948 -14.644 -9.791  1.00 43.31  ? 294 PRO A CB  1 
ATOM   270  C  CG  . PRO A 1 34  ? -27.152 -13.913 -10.301 1.00 43.90  ? 294 PRO A CG  1 
ATOM   271  C  CD  . PRO A 1 34  ? -27.597 -13.062 -9.146  1.00 50.93  ? 294 PRO A CD  1 
ATOM   272  N  N   . ASP A 1 35  ? -24.246 -15.736 -7.234  1.00 48.45  ? 295 ASP A N   1 
ATOM   273  C  CA  . ASP A 1 35  ? -22.929 -15.651 -6.633  1.00 49.64  ? 295 ASP A CA  1 
ATOM   274  C  C   . ASP A 1 35  ? -21.918 -15.074 -7.612  1.00 50.89  ? 295 ASP A C   1 
ATOM   275  O  O   . ASP A 1 35  ? -21.046 -14.294 -7.228  1.00 51.76  ? 295 ASP A O   1 
ATOM   276  C  CB  . ASP A 1 35  ? -22.480 -17.028 -6.211  1.00 50.05  ? 295 ASP A CB  1 
ATOM   277  C  CG  . ASP A 1 35  ? -23.308 -17.564 -5.112  1.00 52.51  ? 295 ASP A CG  1 
ATOM   278  O  OD1 . ASP A 1 35  ? -23.225 -16.981 -4.029  1.00 58.64  ? 295 ASP A OD1 1 
ATOM   279  O  OD2 . ASP A 1 35  ? -24.041 -18.541 -5.321  1.00 46.72  ? 295 ASP A OD2 1 
ATOM   280  N  N   . VAL A 1 36  ? -22.042 -15.466 -8.876  1.00 50.03  ? 296 VAL A N   1 
ATOM   281  C  CA  . VAL A 1 36  ? -21.109 -15.060 -9.912  1.00 47.02  ? 296 VAL A CA  1 
ATOM   282  C  C   . VAL A 1 36  ? -21.860 -14.575 -11.145 1.00 48.02  ? 296 VAL A C   1 
ATOM   283  O  O   . VAL A 1 36  ? -22.844 -15.191 -11.565 1.00 51.97  ? 296 VAL A O   1 
ATOM   284  C  CB  . VAL A 1 36  ? -20.202 -16.241 -10.306 1.00 46.29  ? 296 VAL A CB  1 
ATOM   285  C  CG1 . VAL A 1 36  ? -19.134 -15.793 -11.318 1.00 48.49  ? 296 VAL A CG1 1 
ATOM   286  C  CG2 . VAL A 1 36  ? -19.566 -16.849 -9.077  1.00 44.17  ? 296 VAL A CG2 1 
ATOM   287  N  N   . TYR A 1 37  ? -21.389 -13.488 -11.744 1.00 45.34  ? 297 TYR A N   1 
ATOM   288  C  CA  . TYR A 1 37  ? -22.025 -12.939 -12.950 1.00 45.67  ? 297 TYR A CA  1 
ATOM   289  C  C   . TYR A 1 37  ? -21.024 -12.932 -14.119 1.00 44.31  ? 297 TYR A C   1 
ATOM   290  O  O   . TYR A 1 37  ? -19.915 -12.414 -13.999 1.00 40.60  ? 297 TYR A O   1 
ATOM   291  C  CB  . TYR A 1 37  ? -22.453 -11.507 -12.706 1.00 44.31  ? 297 TYR A CB  1 
ATOM   292  C  CG  . TYR A 1 37  ? -23.868 -11.245 -12.276 1.00 46.69  ? 297 TYR A CG  1 
ATOM   293  C  CD1 . TYR A 1 37  ? -24.907 -11.255 -13.190 1.00 46.04  ? 297 TYR A CD1 1 
ATOM   294  C  CD2 . TYR A 1 37  ? -24.152 -10.856 -10.990 1.00 50.23  ? 297 TYR A CD2 1 
ATOM   295  C  CE1 . TYR A 1 37  ? -26.210 -10.929 -12.814 1.00 47.33  ? 297 TYR A CE1 1 
ATOM   296  C  CE2 . TYR A 1 37  ? -25.443 -10.537 -10.604 1.00 49.99  ? 297 TYR A CE2 1 
ATOM   297  C  CZ  . TYR A 1 37  ? -26.468 -10.564 -11.515 1.00 49.13  ? 297 TYR A CZ  1 
ATOM   298  O  OH  . TYR A 1 37  ? -27.748 -10.255 -11.093 1.00 47.30  ? 297 TYR A OH  1 
ATOM   299  N  N   . CYS A 1 38  ? -21.441 -13.513 -15.238 1.00 45.59  ? 298 CYS A N   1 
ATOM   300  C  CA  . CYS A 1 38  ? -20.642 -13.595 -16.448 1.00 43.05  ? 298 CYS A CA  1 
ATOM   301  C  C   . CYS A 1 38  ? -21.462 -12.937 -17.506 1.00 41.79  ? 298 CYS A C   1 
ATOM   302  O  O   . CYS A 1 38  ? -22.490 -13.480 -17.885 1.00 44.00  ? 298 CYS A O   1 
ATOM   303  C  CB  . CYS A 1 38  ? -20.438 -15.044 -16.851 1.00 43.39  ? 298 CYS A CB  1 
ATOM   304  S  SG  . CYS A 1 38  ? -19.777 -16.067 -15.538 1.00 51.54  ? 298 CYS A SG  1 
ATOM   305  N  N   . VAL A 1 39  ? -21.035 -11.769 -17.971 1.00 36.92  ? 299 VAL A N   1 
ATOM   306  C  CA  . VAL A 1 39  ? -21.890 -10.953 -18.816 1.00 41.25  ? 299 VAL A CA  1 
ATOM   307  C  C   . VAL A 1 39  ? -21.193 -10.568 -20.087 1.00 42.12  ? 299 VAL A C   1 
ATOM   308  O  O   . VAL A 1 39  ? -20.173 -9.906  -20.050 1.00 44.88  ? 299 VAL A O   1 
ATOM   309  C  CB  . VAL A 1 39  ? -22.309 -9.676  -18.091 1.00 43.12  ? 299 VAL A CB  1 
ATOM   310  C  CG1 . VAL A 1 39  ? -23.172 -8.791  -19.010 1.00 39.85  ? 299 VAL A CG1 1 
ATOM   311  C  CG2 . VAL A 1 39  ? -23.034 -10.044 -16.776 1.00 41.92  ? 299 VAL A CG2 1 
ATOM   312  N  N   . GLY A 1 40  ? -21.762 -10.970 -21.213 1.00 41.42  ? 300 GLY A N   1 
ATOM   313  C  CA  . GLY A 1 40  ? -21.090 -10.833 -22.496 1.00 41.48  ? 300 GLY A CA  1 
ATOM   314  C  C   . GLY A 1 40  ? -21.818 -9.917  -23.446 1.00 41.76  ? 300 GLY A C   1 
ATOM   315  O  O   . GLY A 1 40  ? -23.040 -9.939  -23.517 1.00 42.32  ? 300 GLY A O   1 
ATOM   316  N  N   . PHE A 1 41  ? -21.051 -9.120  -24.184 1.00 44.34  ? 301 PHE A N   1 
ATOM   317  C  CA  . PHE A 1 41  ? -21.588 -8.205  -25.186 1.00 45.93  ? 301 PHE A CA  1 
ATOM   318  C  C   . PHE A 1 41  ? -20.908 -8.452  -26.496 1.00 44.92  ? 301 PHE A C   1 
ATOM   319  O  O   . PHE A 1 41  ? -19.756 -8.913  -26.528 1.00 42.91  ? 301 PHE A O   1 
ATOM   320  C  CB  . PHE A 1 41  ? -21.316 -6.766  -24.795 1.00 44.77  ? 301 PHE A CB  1 
ATOM   321  C  CG  . PHE A 1 41  ? -22.074 -6.323  -23.587 1.00 49.20  ? 301 PHE A CG  1 
ATOM   322  C  CD1 . PHE A 1 41  ? -23.382 -5.938  -23.693 1.00 50.87  ? 301 PHE A CD1 1 
ATOM   323  C  CD2 . PHE A 1 41  ? -21.472 -6.279  -22.354 1.00 49.80  ? 301 PHE A CD2 1 
ATOM   324  C  CE1 . PHE A 1 41  ? -24.064 -5.526  -22.607 1.00 52.97  ? 301 PHE A CE1 1 
ATOM   325  C  CE2 . PHE A 1 41  ? -22.162 -5.872  -21.249 1.00 50.96  ? 301 PHE A CE2 1 
ATOM   326  C  CZ  . PHE A 1 41  ? -23.448 -5.506  -21.368 1.00 53.66  ? 301 PHE A CZ  1 
ATOM   327  N  N   . GLN A 1 42  ? -21.628 -8.168  -27.579 1.00 48.24  ? 302 GLN A N   1 
ATOM   328  C  CA  . GLN A 1 42  ? -21.020 -8.069  -28.912 1.00 47.89  ? 302 GLN A CA  1 
ATOM   329  C  C   . GLN A 1 42  ? -21.454 -6.760  -29.560 1.00 50.03  ? 302 GLN A C   1 
ATOM   330  O  O   . GLN A 1 42  ? -22.443 -6.149  -29.139 1.00 49.73  ? 302 GLN A O   1 
ATOM   331  C  CB  . GLN A 1 42  ? -21.373 -9.254  -29.806 1.00 43.38  ? 302 GLN A CB  1 
ATOM   332  C  CG  . GLN A 1 42  ? -21.150 -10.598 -29.153 1.00 43.40  ? 302 GLN A CG  1 
ATOM   333  C  CD  . GLN A 1 42  ? -22.252 -10.963 -28.177 1.00 46.66  ? 302 GLN A CD  1 
ATOM   334  O  OE1 . GLN A 1 42  ? -23.400 -10.587 -28.370 1.00 51.30  ? 302 GLN A OE1 1 
ATOM   335  N  NE2 . GLN A 1 42  ? -21.904 -11.693 -27.119 1.00 43.49  ? 302 GLN A NE2 1 
ATOM   336  N  N   . GLU A 1 43  ? -20.708 -6.342  -30.583 1.00 52.34  ? 303 GLU A N   1 
ATOM   337  C  CA  . GLU A 1 43  ? -20.950 -5.077  -31.248 1.00 52.89  ? 303 GLU A CA  1 
ATOM   338  C  C   . GLU A 1 43  ? -21.093 -3.917  -30.246 1.00 50.56  ? 303 GLU A C   1 
ATOM   339  O  O   . GLU A 1 43  ? -21.992 -3.075  -30.369 1.00 50.39  ? 303 GLU A O   1 
ATOM   340  C  CB  . GLU A 1 43  ? -22.175 -5.165  -32.188 1.00 54.71  ? 303 GLU A CB  1 
ATOM   341  C  CG  . GLU A 1 43  ? -22.026 -6.214  -33.269 1.00 58.77  ? 303 GLU A CG  1 
ATOM   342  C  CD  . GLU A 1 43  ? -23.097 -6.160  -34.344 1.00 65.93  ? 303 GLU A CD  1 
ATOM   343  O  OE1 . GLU A 1 43  ? -23.912 -5.218  -34.366 1.00 70.41  ? 303 GLU A OE1 1 
ATOM   344  O  OE2 . GLU A 1 43  ? -23.127 -7.056  -35.201 1.00 68.38  ? 303 GLU A OE2 1 
ATOM   345  N  N   . LEU A 1 44  ? -20.181 -3.857  -29.287 1.00 48.29  ? 304 LEU A N   1 
ATOM   346  C  CA  . LEU A 1 44  ? -20.213 -2.798  -28.290 1.00 47.85  ? 304 LEU A CA  1 
ATOM   347  C  C   . LEU A 1 44  ? -20.030 -1.433  -28.916 1.00 51.37  ? 304 LEU A C   1 
ATOM   348  O  O   . LEU A 1 44  ? -20.627 -0.465  -28.458 1.00 54.35  ? 304 LEU A O   1 
ATOM   349  C  CB  . LEU A 1 44  ? -19.154 -3.011  -27.202 1.00 44.91  ? 304 LEU A CB  1 
ATOM   350  C  CG  . LEU A 1 44  ? -19.544 -2.353  -25.874 1.00 45.72  ? 304 LEU A CG  1 
ATOM   351  C  CD1 . LEU A 1 44  ? -20.646 -3.222  -25.205 1.00 42.40  ? 304 LEU A CD1 1 
ATOM   352  C  CD2 . LEU A 1 44  ? -18.359 -2.104  -24.936 1.00 38.72  ? 304 LEU A CD2 1 
ATOM   353  N  N   . ASP A 1 45  ? -19.195 -1.345  -29.945 1.00 47.80  ? 305 ASP A N   1 
ATOM   354  C  CA  . ASP A 1 45  ? -18.955 -0.093  -30.658 1.00 47.96  ? 305 ASP A CA  1 
ATOM   355  C  C   . ASP A 1 45  ? -18.650 -0.497  -32.101 1.00 56.28  ? 305 ASP A C   1 
ATOM   356  O  O   . ASP A 1 45  ? -17.797 -1.359  -32.324 1.00 59.07  ? 305 ASP A O   1 
ATOM   357  C  CB  . ASP A 1 45  ? -17.784 0.638   -30.008 1.00 47.90  ? 305 ASP A CB  1 
ATOM   358  C  CG  . ASP A 1 45  ? -17.541 2.039   -30.578 1.00 59.58  ? 305 ASP A CG  1 
ATOM   359  O  OD1 . ASP A 1 45  ? -17.337 2.185   -31.809 1.00 63.98  ? 305 ASP A OD1 1 
ATOM   360  O  OD2 . ASP A 1 45  ? -17.506 3.010   -29.785 1.00 60.53  ? 305 ASP A OD2 1 
ATOM   361  N  N   . LEU A 1 46  ? -19.360 0.085   -33.073 1.00 55.85  ? 306 LEU A N   1 
ATOM   362  C  CA  . LEU A 1 46  ? -19.230 -0.302  -34.488 1.00 52.73  ? 306 LEU A CA  1 
ATOM   363  C  C   . LEU A 1 46  ? -18.443 0.695   -35.325 1.00 53.94  ? 306 LEU A C   1 
ATOM   364  O  O   . LEU A 1 46  ? -18.277 0.500   -36.520 1.00 54.47  ? 306 LEU A O   1 
ATOM   365  C  CB  . LEU A 1 46  ? -20.617 -0.498  -35.115 1.00 51.44  ? 306 LEU A CB  1 
ATOM   366  C  CG  . LEU A 1 46  ? -21.382 -1.746  -34.680 1.00 49.53  ? 306 LEU A CG  1 
ATOM   367  C  CD1 . LEU A 1 46  ? -22.790 -1.724  -35.238 1.00 47.43  ? 306 LEU A CD1 1 
ATOM   368  C  CD2 . LEU A 1 46  ? -20.638 -3.030  -35.086 1.00 44.62  ? 306 LEU A CD2 1 
ATOM   369  N  N   . SER A 1 47  ? -17.957 1.751   -34.692 1.00 53.98  ? 307 SER A N   1 
ATOM   370  C  CA  . SER A 1 47  ? -17.116 2.736   -35.345 1.00 52.04  ? 307 SER A CA  1 
ATOM   371  C  C   . SER A 1 47  ? -15.799 2.156   -35.865 1.00 55.41  ? 307 SER A C   1 
ATOM   372  O  O   . SER A 1 47  ? -15.245 1.232   -35.295 1.00 54.90  ? 307 SER A O   1 
ATOM   373  C  CB  . SER A 1 47  ? -16.802 3.879   -34.365 1.00 49.31  ? 307 SER A CB  1 
ATOM   374  O  OG  . SER A 1 47  ? -15.766 3.527   -33.463 1.00 49.72  ? 307 SER A OG  1 
ATOM   375  N  N   . LYS A 1 48  ? -15.286 2.746   -36.937 1.00 64.23  ? 308 LYS A N   1 
ATOM   376  C  CA  . LYS A 1 48  ? -13.974 2.379   -37.454 1.00 67.78  ? 308 LYS A CA  1 
ATOM   377  C  C   . LYS A 1 48  ? -12.898 2.816   -36.448 1.00 66.66  ? 308 LYS A C   1 
ATOM   378  O  O   . LYS A 1 48  ? -11.902 2.115   -36.246 1.00 65.66  ? 308 LYS A O   1 
ATOM   379  C  CB  . LYS A 1 48  ? -13.708 2.990   -38.833 1.00 71.39  ? 308 LYS A CB  1 
ATOM   380  C  CG  . LYS A 1 48  ? -14.902 3.008   -39.807 1.00 77.29  ? 308 LYS A CG  1 
ATOM   381  C  CD  . LYS A 1 48  ? -15.481 1.618   -40.100 1.00 79.79  ? 308 LYS A CD  1 
ATOM   382  C  CE  . LYS A 1 48  ? -16.511 1.634   -41.284 1.00 94.10  ? 308 LYS A CE  1 
ATOM   383  N  NZ  . LYS A 1 48  ? -17.960 1.494   -40.850 1.00 92.31  ? 308 LYS A NZ  1 
ATOM   384  N  N   . GLU A 1 49  ? -13.121 3.956   -35.798 1.00 67.69  ? 309 GLU A N   1 
ATOM   385  C  CA  . GLU A 1 49  ? -12.203 4.448   -34.767 1.00 69.58  ? 309 GLU A CA  1 
ATOM   386  C  C   . GLU A 1 49  ? -11.959 3.408   -33.683 1.00 72.10  ? 309 GLU A C   1 
ATOM   387  O  O   . GLU A 1 49  ? -10.811 3.124   -33.328 1.00 73.24  ? 309 GLU A O   1 
ATOM   388  C  CB  . GLU A 1 49  ? -12.736 5.734   -34.140 1.00 69.57  ? 309 GLU A CB  1 
ATOM   389  C  CG  . GLU A 1 49  ? -11.673 6.519   -33.380 1.00 72.07  ? 309 GLU A CG  1 
ATOM   390  C  CD  . GLU A 1 49  ? -12.025 7.990   -33.176 1.00 77.08  ? 309 GLU A CD  1 
ATOM   391  O  OE1 . GLU A 1 49  ? -11.171 8.724   -32.630 1.00 79.07  ? 309 GLU A OE1 1 
ATOM   392  O  OE2 . GLU A 1 49  ? -13.136 8.412   -33.565 1.00 78.22  ? 309 GLU A OE2 1 
ATOM   393  N  N   . ALA A 1 50  ? -13.045 2.837   -33.170 1.00 70.60  ? 310 ALA A N   1 
ATOM   394  C  CA  . ALA A 1 50  ? -12.963 1.801   -32.149 1.00 67.48  ? 310 ALA A CA  1 
ATOM   395  C  C   . ALA A 1 50  ? -12.198 0.588   -32.658 1.00 67.22  ? 310 ALA A C   1 
ATOM   396  O  O   . ALA A 1 50  ? -11.390 0.018   -31.944 1.00 65.06  ? 310 ALA A O   1 
ATOM   397  C  CB  . ALA A 1 50  ? -14.357 1.397   -31.698 1.00 67.39  ? 310 ALA A CB  1 
ATOM   398  N  N   . PHE A 1 51  ? -12.445 0.204   -33.905 1.00 69.61  ? 311 PHE A N   1 
ATOM   399  C  CA  . PHE A 1 51  ? -11.772 -0.947  -34.525 1.00 72.06  ? 311 PHE A CA  1 
ATOM   400  C  C   . PHE A 1 51  ? -10.275 -0.718  -34.677 1.00 73.21  ? 311 PHE A C   1 
ATOM   401  O  O   . PHE A 1 51  ? -9.501  -1.645  -34.902 1.00 76.95  ? 311 PHE A O   1 
ATOM   402  C  CB  . PHE A 1 51  ? -12.375 -1.215  -35.910 1.00 74.65  ? 311 PHE A CB  1 
ATOM   403  C  CG  . PHE A 1 51  ? -11.731 -2.354  -36.643 1.00 77.84  ? 311 PHE A CG  1 
ATOM   404  C  CD1 . PHE A 1 51  ? -12.038 -3.656  -36.314 1.00 77.50  ? 311 PHE A CD1 1 
ATOM   405  C  CD2 . PHE A 1 51  ? -10.813 -2.117  -37.646 1.00 83.06  ? 311 PHE A CD2 1 
ATOM   406  C  CE1 . PHE A 1 51  ? -11.458 -4.703  -36.967 1.00 80.58  ? 311 PHE A CE1 1 
ATOM   407  C  CE2 . PHE A 1 51  ? -10.219 -3.162  -38.321 1.00 84.11  ? 311 PHE A CE2 1 
ATOM   408  C  CZ  . PHE A 1 51  ? -10.543 -4.460  -37.982 1.00 84.88  ? 311 PHE A CZ  1 
ATOM   409  N  N   . PHE A 1 52  ? -9.884  0.531   -34.532 1.00 72.42  ? 312 PHE A N   1 
ATOM   410  C  CA  . PHE A 1 52  ? -8.581  0.985   -34.913 1.00 74.99  ? 312 PHE A CA  1 
ATOM   411  C  C   . PHE A 1 52  ? -7.710  1.224   -33.704 1.00 68.28  ? 312 PHE A C   1 
ATOM   412  O  O   . PHE A 1 52  ? -6.583  0.767   -33.671 1.00 64.20  ? 312 PHE A O   1 
ATOM   413  C  CB  . PHE A 1 52  ? -8.768  2.303   -35.636 1.00 86.23  ? 312 PHE A CB  1 
ATOM   414  C  CG  . PHE A 1 52  ? -8.092  2.375   -36.937 1.00 94.39  ? 312 PHE A CG  1 
ATOM   415  C  CD1 . PHE A 1 52  ? -8.309  1.409   -37.913 1.00 97.59  ? 312 PHE A CD1 1 
ATOM   416  C  CD2 . PHE A 1 52  ? -7.264  3.430   -37.210 1.00 99.29  ? 312 PHE A CD2 1 
ATOM   417  C  CE1 . PHE A 1 52  ? -7.673  1.498   -39.136 1.00 101.29 ? 312 PHE A CE1 1 
ATOM   418  C  CE2 . PHE A 1 52  ? -6.646  3.531   -38.424 1.00 104.98 ? 312 PHE A CE2 1 
ATOM   419  C  CZ  . PHE A 1 52  ? -6.843  2.559   -39.400 1.00 105.23 ? 312 PHE A CZ  1 
ATOM   420  N  N   . PHE A 1 53  ? -8.237  1.970   -32.733 1.00 69.67  ? 313 PHE A N   1 
ATOM   421  C  CA  . PHE A 1 53  ? -7.501  2.306   -31.512 1.00 75.25  ? 313 PHE A CA  1 
ATOM   422  C  C   . PHE A 1 53  ? -8.109  1.739   -30.245 1.00 70.99  ? 313 PHE A C   1 
ATOM   423  O  O   . PHE A 1 53  ? -7.723  2.141   -29.162 1.00 71.20  ? 313 PHE A O   1 
ATOM   424  C  CB  . PHE A 1 53  ? -7.395  3.819   -31.342 1.00 83.63  ? 313 PHE A CB  1 
ATOM   425  C  CG  . PHE A 1 53  ? -7.040  4.544   -32.595 1.00 92.48  ? 313 PHE A CG  1 
ATOM   426  C  CD1 . PHE A 1 53  ? -5.743  4.581   -33.034 1.00 97.10  ? 313 PHE A CD1 1 
ATOM   427  C  CD2 . PHE A 1 53  ? -8.009  5.200   -33.324 1.00 96.69  ? 313 PHE A CD2 1 
ATOM   428  C  CE1 . PHE A 1 53  ? -5.416  5.247   -34.189 1.00 102.24 ? 313 PHE A CE1 1 
ATOM   429  C  CE2 . PHE A 1 53  ? -7.692  5.870   -34.465 1.00 100.91 ? 313 PHE A CE2 1 
ATOM   430  C  CZ  . PHE A 1 53  ? -6.392  5.895   -34.906 1.00 103.51 ? 313 PHE A CZ  1 
ATOM   431  N  N   . HIS A 1 54  ? -9.069  0.836   -30.369 1.00 70.00  ? 314 HIS A N   1 
ATOM   432  C  CA  . HIS A 1 54  ? -9.583  0.071   -29.229 1.00 69.83  ? 314 HIS A CA  1 
ATOM   433  C  C   . HIS A 1 54  ? -10.436 0.873   -28.248 1.00 67.31  ? 314 HIS A C   1 
ATOM   434  O  O   . HIS A 1 54  ? -11.503 0.427   -27.864 1.00 66.73  ? 314 HIS A O   1 
ATOM   435  C  CB  . HIS A 1 54  ? -8.430  -0.631  -28.469 1.00 70.73  ? 314 HIS A CB  1 
ATOM   436  C  CG  . HIS A 1 54  ? -8.845  -1.294  -27.184 1.00 70.67  ? 314 HIS A CG  1 
ATOM   437  N  ND1 . HIS A 1 54  ? -9.531  -2.492  -27.147 1.00 68.54  ? 314 HIS A ND1 1 
ATOM   438  C  CD2 . HIS A 1 54  ? -8.645  -0.936  -25.892 1.00 70.43  ? 314 HIS A CD2 1 
ATOM   439  C  CE1 . HIS A 1 54  ? -9.740  -2.838  -25.887 1.00 66.59  ? 314 HIS A CE1 1 
ATOM   440  N  NE2 . HIS A 1 54  ? -9.217  -1.910  -25.105 1.00 68.58  ? 314 HIS A NE2 1 
ATOM   441  N  N   . ASP A 1 55  ? -9.940  2.026   -27.811 1.00 67.45  ? 315 ASP A N   1 
ATOM   442  C  CA  . ASP A 1 55  ? -10.644 2.873   -26.840 1.00 69.73  ? 315 ASP A CA  1 
ATOM   443  C  C   . ASP A 1 55  ? -12.032 3.293   -27.318 1.00 66.82  ? 315 ASP A C   1 
ATOM   444  O  O   . ASP A 1 55  ? -12.250 3.582   -28.477 1.00 69.73  ? 315 ASP A O   1 
ATOM   445  C  CB  . ASP A 1 55  ? -9.814  4.119   -26.528 1.00 77.14  ? 315 ASP A CB  1 
ATOM   446  C  CG  . ASP A 1 55  ? -8.551  3.800   -25.719 1.00 85.02  ? 315 ASP A CG  1 
ATOM   447  O  OD1 . ASP A 1 55  ? -7.523  4.525   -25.891 1.00 88.02  ? 315 ASP A OD1 1 
ATOM   448  O  OD2 . ASP A 1 55  ? -8.601  2.829   -24.919 1.00 86.13  ? 315 ASP A OD2 1 
ATOM   449  N  N   . THR A 1 56  ? -12.981 3.306   -26.405 1.00 63.35  ? 316 THR A N   1 
ATOM   450  C  CA  . THR A 1 56  ? -14.338 3.665   -26.746 1.00 59.73  ? 316 THR A CA  1 
ATOM   451  C  C   . THR A 1 56  ? -15.095 3.940   -25.468 1.00 57.42  ? 316 THR A C   1 
ATOM   452  O  O   . THR A 1 56  ? -14.951 3.210   -24.482 1.00 59.21  ? 316 THR A O   1 
ATOM   453  C  CB  . THR A 1 56  ? -15.050 2.555   -27.523 1.00 58.06  ? 316 THR A CB  1 
ATOM   454  O  OG1 . THR A 1 56  ? -16.456 2.813   -27.512 1.00 62.37  ? 316 THR A OG1 1 
ATOM   455  C  CG2 . THR A 1 56  ? -14.788 1.194   -26.909 1.00 51.39  ? 316 THR A CG2 1 
ATOM   456  N  N   . PRO A 1 57  ? -15.906 5.000   -25.473 1.00 52.13  ? 317 PRO A N   1 
ATOM   457  C  CA  . PRO A 1 57  ? -16.632 5.335   -24.273 1.00 50.32  ? 317 PRO A CA  1 
ATOM   458  C  C   . PRO A 1 57  ? -17.790 4.399   -24.051 1.00 53.82  ? 317 PRO A C   1 
ATOM   459  O  O   . PRO A 1 57  ? -18.474 4.516   -23.055 1.00 61.45  ? 317 PRO A O   1 
ATOM   460  C  CB  . PRO A 1 57  ? -17.119 6.752   -24.549 1.00 46.87  ? 317 PRO A CB  1 
ATOM   461  C  CG  . PRO A 1 57  ? -17.260 6.823   -25.988 1.00 45.88  ? 317 PRO A CG  1 
ATOM   462  C  CD  . PRO A 1 57  ? -16.217 5.923   -26.573 1.00 46.34  ? 317 PRO A CD  1 
ATOM   463  N  N   . LYS A 1 58  ? -18.019 3.478   -24.970 1.00 52.43  ? 318 LYS A N   1 
ATOM   464  C  CA  . LYS A 1 58  ? -19.081 2.516   -24.809 1.00 53.36  ? 318 LYS A CA  1 
ATOM   465  C  C   . LYS A 1 58  ? -18.734 1.543   -23.676 1.00 55.75  ? 318 LYS A C   1 
ATOM   466  O  O   . LYS A 1 58  ? -19.616 1.038   -22.975 1.00 58.55  ? 318 LYS A O   1 
ATOM   467  C  CB  . LYS A 1 58  ? -19.314 1.764   -26.126 1.00 52.35  ? 318 LYS A CB  1 
ATOM   468  C  CG  . LYS A 1 58  ? -19.802 2.624   -27.273 1.00 49.40  ? 318 LYS A CG  1 
ATOM   469  C  CD  . LYS A 1 58  ? -21.275 2.918   -27.159 1.00 50.23  ? 318 LYS A CD  1 
ATOM   470  C  CE  . LYS A 1 58  ? -21.758 3.819   -28.300 1.00 51.63  ? 318 LYS A CE  1 
ATOM   471  N  NZ  . LYS A 1 58  ? -21.260 5.210   -28.077 1.00 59.84  ? 318 LYS A NZ  1 
ATOM   472  N  N   . GLU A 1 59  ? -17.444 1.279   -23.490 1.00 53.36  ? 319 GLU A N   1 
ATOM   473  C  CA  . GLU A 1 59  ? -16.981 0.399   -22.413 1.00 45.10  ? 319 GLU A CA  1 
ATOM   474  C  C   . GLU A 1 59  ? -17.428 0.869   -21.029 1.00 46.76  ? 319 GLU A C   1 
ATOM   475  O  O   . GLU A 1 59  ? -18.046 0.104   -20.324 1.00 48.57  ? 319 GLU A O   1 
ATOM   476  C  CB  . GLU A 1 59  ? -15.464 0.255   -22.461 1.00 40.76  ? 319 GLU A CB  1 
ATOM   477  C  CG  . GLU A 1 59  ? -14.881 -0.517  -21.323 1.00 43.51  ? 319 GLU A CG  1 
ATOM   478  C  CD  . GLU A 1 59  ? -13.458 -0.894  -21.553 1.00 54.08  ? 319 GLU A CD  1 
ATOM   479  O  OE1 . GLU A 1 59  ? -13.174 -1.659  -22.493 1.00 57.86  ? 319 GLU A OE1 1 
ATOM   480  O  OE2 . GLU A 1 59  ? -12.598 -0.428  -20.792 1.00 60.68  ? 319 GLU A OE2 1 
ATOM   481  N  N   . GLU A 1 60  ? -17.109 2.107   -20.629 1.00 48.22  ? 320 GLU A N   1 
ATOM   482  C  CA  . GLU A 1 60  ? -17.532 2.589   -19.306 1.00 47.40  ? 320 GLU A CA  1 
ATOM   483  C  C   . GLU A 1 60  ? -19.048 2.627   -19.269 1.00 49.02  ? 320 GLU A C   1 
ATOM   484  O  O   . GLU A 1 60  ? -19.635 2.259   -18.277 1.00 49.86  ? 320 GLU A O   1 
ATOM   485  C  CB  . GLU A 1 60  ? -16.931 3.947   -18.914 1.00 47.24  ? 320 GLU A CB  1 
ATOM   486  N  N   . GLU A 1 61  ? -19.679 3.014   -20.371 1.00 49.82  ? 321 GLU A N   1 
ATOM   487  C  CA  . GLU A 1 61  ? -21.137 3.095   -20.437 1.00 50.90  ? 321 GLU A CA  1 
ATOM   488  C  C   . GLU A 1 61  ? -21.854 1.800   -20.130 1.00 54.82  ? 321 GLU A C   1 
ATOM   489  O  O   . GLU A 1 61  ? -22.798 1.790   -19.353 1.00 58.78  ? 321 GLU A O   1 
ATOM   490  C  CB  . GLU A 1 61  ? -21.578 3.590   -21.798 1.00 50.35  ? 321 GLU A CB  1 
ATOM   491  C  CG  . GLU A 1 61  ? -21.371 5.052   -21.916 1.00 57.30  ? 321 GLU A CG  1 
ATOM   492  C  CD  . GLU A 1 61  ? -21.715 5.596   -23.268 1.00 62.17  ? 321 GLU A CD  1 
ATOM   493  O  OE1 . GLU A 1 61  ? -22.126 4.808   -24.151 1.00 59.62  ? 321 GLU A OE1 1 
ATOM   494  O  OE2 . GLU A 1 61  ? -21.577 6.834   -23.420 1.00 66.48  ? 321 GLU A OE2 1 
ATOM   495  N  N   . TRP A 1 62  ? -21.430 0.711   -20.745 1.00 52.86  ? 322 TRP A N   1 
ATOM   496  C  CA  . TRP A 1 62  ? -22.086 -0.567  -20.520 1.00 50.61  ? 322 TRP A CA  1 
ATOM   497  C  C   . TRP A 1 62  ? -21.652 -1.189  -19.177 1.00 51.08  ? 322 TRP A C   1 
ATOM   498  O  O   . TRP A 1 62  ? -22.428 -1.884  -18.500 1.00 48.37  ? 322 TRP A O   1 
ATOM   499  C  CB  . TRP A 1 62  ? -21.831 -1.488  -21.704 1.00 47.13  ? 322 TRP A CB  1 
ATOM   500  C  CG  . TRP A 1 62  ? -22.708 -1.173  -22.865 1.00 50.16  ? 322 TRP A CG  1 
ATOM   501  C  CD1 . TRP A 1 62  ? -22.360 -0.515  -24.004 1.00 51.48  ? 322 TRP A CD1 1 
ATOM   502  C  CD2 . TRP A 1 62  ? -24.088 -1.502  -23.001 1.00 52.46  ? 322 TRP A CD2 1 
ATOM   503  N  NE1 . TRP A 1 62  ? -23.440 -0.417  -24.846 1.00 50.11  ? 322 TRP A NE1 1 
ATOM   504  C  CE2 . TRP A 1 62  ? -24.511 -1.025  -24.255 1.00 51.91  ? 322 TRP A CE2 1 
ATOM   505  C  CE3 . TRP A 1 62  ? -25.005 -2.172  -22.192 1.00 52.41  ? 322 TRP A CE3 1 
ATOM   506  C  CZ2 . TRP A 1 62  ? -25.807 -1.177  -24.708 1.00 53.35  ? 322 TRP A CZ2 1 
ATOM   507  C  CZ3 . TRP A 1 62  ? -26.302 -2.325  -22.645 1.00 52.04  ? 322 TRP A CZ3 1 
ATOM   508  C  CH2 . TRP A 1 62  ? -26.691 -1.835  -23.889 1.00 53.42  ? 322 TRP A CH2 1 
ATOM   509  N  N   . PHE A 1 63  ? -20.421 -0.905  -18.776 1.00 48.72  ? 323 PHE A N   1 
ATOM   510  C  CA  . PHE A 1 63  ? -19.955 -1.326  -17.484 1.00 51.58  ? 323 PHE A CA  1 
ATOM   511  C  C   . PHE A 1 63  ? -20.805 -0.682  -16.385 1.00 52.94  ? 323 PHE A C   1 
ATOM   512  O  O   . PHE A 1 63  ? -21.297 -1.376  -15.507 1.00 54.18  ? 323 PHE A O   1 
ATOM   513  C  CB  . PHE A 1 63  ? -18.471 -0.993  -17.278 1.00 50.56  ? 323 PHE A CB  1 
ATOM   514  C  CG  . PHE A 1 63  ? -17.960 -1.452  -15.959 1.00 55.66  ? 323 PHE A CG  1 
ATOM   515  C  CD1 . PHE A 1 63  ? -17.906 -2.789  -15.666 1.00 55.29  ? 323 PHE A CD1 1 
ATOM   516  C  CD2 . PHE A 1 63  ? -17.624 -0.557  -14.985 1.00 59.08  ? 323 PHE A CD2 1 
ATOM   517  C  CE1 . PHE A 1 63  ? -17.459 -3.229  -14.445 1.00 57.01  ? 323 PHE A CE1 1 
ATOM   518  C  CE2 . PHE A 1 63  ? -17.180 -0.991  -13.736 1.00 60.57  ? 323 PHE A CE2 1 
ATOM   519  C  CZ  . PHE A 1 63  ? -17.098 -2.333  -13.474 1.00 59.42  ? 323 PHE A CZ  1 
ATOM   520  N  N   . LYS A 1 64  ? -20.963 0.635   -16.419 1.00 48.70  ? 324 LYS A N   1 
ATOM   521  C  CA  . LYS A 1 64  ? -21.835 1.319   -15.457 1.00 49.05  ? 324 LYS A CA  1 
ATOM   522  C  C   . LYS A 1 64  ? -23.221 0.690   -15.539 1.00 50.50  ? 324 LYS A C   1 
ATOM   523  O  O   . LYS A 1 64  ? -23.796 0.342   -14.504 1.00 54.74  ? 324 LYS A O   1 
ATOM   524  C  CB  . LYS A 1 64  ? -21.913 2.838   -15.698 1.00 51.54  ? 324 LYS A CB  1 
ATOM   525  C  CG  . LYS A 1 64  ? -20.732 3.685   -15.126 1.00 49.07  ? 324 LYS A CG  1 
ATOM   526  N  N   . ALA A 1 65  ? -23.721 0.480   -16.764 1.00 44.78  ? 325 ALA A N   1 
ATOM   527  C  CA  . ALA A 1 65  ? -25.052 -0.094  -16.987 1.00 42.58  ? 325 ALA A CA  1 
ATOM   528  C  C   . ALA A 1 65  ? -25.219 -1.499  -16.388 1.00 50.01  ? 325 ALA A C   1 
ATOM   529  O  O   . ALA A 1 65  ? -26.285 -1.827  -15.862 1.00 52.40  ? 325 ALA A O   1 
ATOM   530  C  CB  . ALA A 1 65  ? -25.355 -0.131  -18.440 1.00 41.37  ? 325 ALA A CB  1 
ATOM   531  N  N   . VAL A 1 66  ? -24.183 -2.333  -16.479 1.00 48.83  ? 326 VAL A N   1 
ATOM   532  C  CA  . VAL A 1 66  ? -24.270 -3.688  -15.943 1.00 47.63  ? 326 VAL A CA  1 
ATOM   533  C  C   . VAL A 1 66  ? -24.215 -3.617  -14.408 1.00 49.44  ? 326 VAL A C   1 
ATOM   534  O  O   . VAL A 1 66  ? -25.043 -4.242  -13.713 1.00 48.46  ? 326 VAL A O   1 
ATOM   535  C  CB  . VAL A 1 66  ? -23.190 -4.603  -16.548 1.00 42.65  ? 326 VAL A CB  1 
ATOM   536  C  CG1 . VAL A 1 66  ? -23.037 -5.879  -15.783 1.00 39.92  ? 326 VAL A CG1 1 
ATOM   537  C  CG2 . VAL A 1 66  ? -23.514 -4.904  -17.982 1.00 41.42  ? 326 VAL A CG2 1 
ATOM   538  N  N   . SER A 1 67  ? -23.301 -2.807  -13.880 1.00 51.04  ? 327 SER A N   1 
ATOM   539  C  CA  . SER A 1 67  ? -23.095 -2.749  -12.437 1.00 47.29  ? 327 SER A CA  1 
ATOM   540  C  C   . SER A 1 67  ? -24.359 -2.250  -11.763 1.00 52.33  ? 327 SER A C   1 
ATOM   541  O  O   . SER A 1 67  ? -24.811 -2.822  -10.780 1.00 54.71  ? 327 SER A O   1 
ATOM   542  C  CB  . SER A 1 67  ? -21.892 -1.870  -12.092 1.00 43.20  ? 327 SER A CB  1 
ATOM   543  O  OG  . SER A 1 67  ? -20.714 -2.357  -12.720 1.00 45.48  ? 327 SER A OG  1 
ATOM   544  N  N   . GLU A 1 68  ? -24.952 -1.199  -12.317 1.00 55.03  ? 328 GLU A N   1 
ATOM   545  C  CA  . GLU A 1 68  ? -26.251 -0.721  -11.856 1.00 57.62  ? 328 GLU A CA  1 
ATOM   546  C  C   . GLU A 1 68  ? -27.348 -1.778  -11.992 1.00 60.38  ? 328 GLU A C   1 
ATOM   547  O  O   . GLU A 1 68  ? -28.299 -1.769  -11.233 1.00 61.19  ? 328 GLU A O   1 
ATOM   548  C  CB  . GLU A 1 68  ? -26.655 0.553   -12.597 1.00 59.98  ? 328 GLU A CB  1 
ATOM   549  C  CG  . GLU A 1 68  ? -25.848 1.780   -12.172 1.00 68.56  ? 328 GLU A CG  1 
ATOM   550  C  CD  . GLU A 1 68  ? -26.080 3.012   -13.073 1.00 81.56  ? 328 GLU A CD  1 
ATOM   551  O  OE1 . GLU A 1 68  ? -26.135 4.135   -12.523 1.00 87.94  ? 328 GLU A OE1 1 
ATOM   552  O  OE2 . GLU A 1 68  ? -26.209 2.878   -14.324 1.00 82.56  ? 328 GLU A OE2 1 
ATOM   553  N  N   . GLY A 1 69  ? -27.216 -2.698  -12.937 1.00 52.32  ? 329 GLY A N   1 
ATOM   554  C  CA  . GLY A 1 69  ? -28.253 -3.708  -13.161 1.00 52.55  ? 329 GLY A CA  1 
ATOM   555  C  C   . GLY A 1 69  ? -28.139 -4.993  -12.351 1.00 54.70  ? 329 GLY A C   1 
ATOM   556  O  O   . GLY A 1 69  ? -29.066 -5.814  -12.354 1.00 56.87  ? 329 GLY A O   1 
ATOM   557  N  N   . LEU A 1 70  ? -27.010 -5.197  -11.672 1.00 52.33  ? 330 LEU A N   1 
ATOM   558  C  CA  . LEU A 1 70  ? -26.792 -6.466  -10.951 1.00 52.32  ? 330 LEU A CA  1 
ATOM   559  C  C   . LEU A 1 70  ? -27.784 -6.548  -9.818  1.00 53.96  ? 330 LEU A C   1 
ATOM   560  O  O   . LEU A 1 70  ? -28.335 -5.534  -9.434  1.00 58.86  ? 330 LEU A O   1 
ATOM   561  C  CB  . LEU A 1 70  ? -25.364 -6.572  -10.400 1.00 49.56  ? 330 LEU A CB  1 
ATOM   562  C  CG  . LEU A 1 70  ? -24.248 -6.524  -11.433 1.00 48.67  ? 330 LEU A CG  1 
ATOM   563  C  CD1 . LEU A 1 70  ? -22.877 -6.549  -10.760 1.00 48.39  ? 330 LEU A CD1 1 
ATOM   564  C  CD2 . LEU A 1 70  ? -24.406 -7.670  -12.424 1.00 44.87  ? 330 LEU A CD2 1 
ATOM   565  N  N   . HIS A 1 71  ? -27.998 -7.742  -9.279  1.00 53.60  ? 331 HIS A N   1 
ATOM   566  C  CA  . HIS A 1 71  ? -28.998 -7.952  -8.215  1.00 54.57  ? 331 HIS A CA  1 
ATOM   567  C  C   . HIS A 1 71  ? -28.775 -7.076  -6.974  1.00 58.38  ? 331 HIS A C   1 
ATOM   568  O  O   . HIS A 1 71  ? -27.711 -7.114  -6.363  1.00 60.20  ? 331 HIS A O   1 
ATOM   569  C  CB  . HIS A 1 71  ? -29.004 -9.415  -7.792  1.00 52.19  ? 331 HIS A CB  1 
ATOM   570  C  CG  . HIS A 1 71  ? -30.296 -9.864  -7.188  1.00 52.09  ? 331 HIS A CG  1 
ATOM   571  N  ND1 . HIS A 1 71  ? -30.780 -9.363  -6.003  1.00 53.36  ? 331 HIS A ND1 1 
ATOM   572  C  CD2 . HIS A 1 71  ? -31.187 -10.795 -7.595  1.00 48.84  ? 331 HIS A CD2 1 
ATOM   573  C  CE1 . HIS A 1 71  ? -31.924 -9.953  -5.715  1.00 51.69  ? 331 HIS A CE1 1 
ATOM   574  N  NE2 . HIS A 1 71  ? -32.189 -10.832 -6.662  1.00 50.93  ? 331 HIS A NE2 1 
ATOM   575  N  N   . PRO A 1 72  ? -29.782 -6.295  -6.582  1.00 61.25  ? 332 PRO A N   1 
ATOM   576  C  CA  . PRO A 1 72  ? -29.571 -5.352  -5.466  1.00 63.64  ? 332 PRO A CA  1 
ATOM   577  C  C   . PRO A 1 72  ? -29.371 -5.970  -4.066  1.00 64.81  ? 332 PRO A C   1 
ATOM   578  O  O   . PRO A 1 72  ? -28.916 -5.266  -3.156  1.00 65.25  ? 332 PRO A O   1 
ATOM   579  C  CB  . PRO A 1 72  ? -30.845 -4.491  -5.486  1.00 60.64  ? 332 PRO A CB  1 
ATOM   580  C  CG  . PRO A 1 72  ? -31.883 -5.365  -6.112  1.00 60.57  ? 332 PRO A CG  1 
ATOM   581  C  CD  . PRO A 1 72  ? -31.158 -6.235  -7.110  1.00 61.02  ? 332 PRO A CD  1 
ATOM   582  N  N   . ASP A 1 73  ? -29.703 -7.251  -3.892  1.00 62.70  ? 333 ASP A N   1 
ATOM   583  C  CA  . ASP A 1 73  ? -29.602 -7.889  -2.587  1.00 65.97  ? 333 ASP A CA  1 
ATOM   584  C  C   . ASP A 1 73  ? -28.191 -8.302  -2.225  1.00 67.81  ? 333 ASP A C   1 
ATOM   585  O  O   . ASP A 1 73  ? -27.983 -8.793  -1.114  1.00 73.87  ? 333 ASP A O   1 
ATOM   586  C  CB  . ASP A 1 73  ? -30.493 -9.130  -2.495  1.00 66.12  ? 333 ASP A CB  1 
ATOM   587  C  CG  . ASP A 1 73  ? -31.959 -8.801  -2.400  1.00 69.09  ? 333 ASP A CG  1 
ATOM   588  O  OD1 . ASP A 1 73  ? -32.328 -7.611  -2.250  1.00 72.55  ? 333 ASP A OD1 1 
ATOM   589  O  OD2 . ASP A 1 73  ? -32.751 -9.761  -2.479  1.00 68.43  ? 333 ASP A OD2 1 
ATOM   590  N  N   . ALA A 1 74  ? -27.233 -8.156  -3.139  1.00 61.76  ? 334 ALA A N   1 
ATOM   591  C  CA  . ALA A 1 74  ? -25.819 -8.381  -2.803  1.00 56.98  ? 334 ALA A CA  1 
ATOM   592  C  C   . ALA A 1 74  ? -24.923 -7.269  -3.333  1.00 56.96  ? 334 ALA A C   1 
ATOM   593  O  O   . ALA A 1 74  ? -25.289 -6.577  -4.270  1.00 57.02  ? 334 ALA A O   1 
ATOM   594  C  CB  . ALA A 1 74  ? -25.349 -9.717  -3.332  1.00 51.09  ? 334 ALA A CB  1 
ATOM   595  N  N   . LYS A 1 75  ? -23.753 -7.106  -2.711  1.00 57.08  ? 335 LYS A N   1 
ATOM   596  C  CA  . LYS A 1 75  ? -22.702 -6.258  -3.253  1.00 54.21  ? 335 LYS A CA  1 
ATOM   597  C  C   . LYS A 1 75  ? -21.735 -7.122  -4.075  1.00 52.43  ? 335 LYS A C   1 
ATOM   598  O  O   . LYS A 1 75  ? -21.344 -8.211  -3.656  1.00 52.32  ? 335 LYS A O   1 
ATOM   599  C  CB  . LYS A 1 75  ? -21.984 -5.400  -2.182  1.00 53.14  ? 335 LYS A CB  1 
ATOM   600  C  CG  . LYS A 1 75  ? -21.914 -5.935  -0.766  1.00 61.50  ? 335 LYS A CG  1 
ATOM   601  C  CD  . LYS A 1 75  ? -21.170 -4.985  0.223   1.00 64.61  ? 335 LYS A CD  1 
ATOM   602  C  CE  . LYS A 1 75  ? -22.077 -3.939  0.839   1.00 70.37  ? 335 LYS A CE  1 
ATOM   603  N  NZ  . LYS A 1 75  ? -21.741 -3.605  2.287   1.00 77.44  ? 335 LYS A NZ  1 
ATOM   604  N  N   . TYR A 1 76  ? -21.368 -6.631  -5.258  1.00 48.36  ? 336 TYR A N   1 
ATOM   605  C  CA  . TYR A 1 76  ? -20.585 -7.401  -6.207  1.00 46.05  ? 336 TYR A CA  1 
ATOM   606  C  C   . TYR A 1 76  ? -19.273 -6.698  -6.453  1.00 48.25  ? 336 TYR A C   1 
ATOM   607  O  O   . TYR A 1 76  ? -19.236 -5.496  -6.476  1.00 53.10  ? 336 TYR A O   1 
ATOM   608  C  CB  . TYR A 1 76  ? -21.355 -7.553  -7.524  1.00 41.11  ? 336 TYR A CB  1 
ATOM   609  C  CG  . TYR A 1 76  ? -22.544 -8.466  -7.413  1.00 43.48  ? 336 TYR A CG  1 
ATOM   610  C  CD1 . TYR A 1 76  ? -22.398 -9.828  -7.552  1.00 42.84  ? 336 TYR A CD1 1 
ATOM   611  C  CD2 . TYR A 1 76  ? -23.801 -7.969  -7.141  1.00 44.39  ? 336 TYR A CD2 1 
ATOM   612  C  CE1 . TYR A 1 76  ? -23.457 -10.676 -7.444  1.00 45.22  ? 336 TYR A CE1 1 
ATOM   613  C  CE2 . TYR A 1 76  ? -24.886 -8.824  -7.028  1.00 47.09  ? 336 TYR A CE2 1 
ATOM   614  C  CZ  . TYR A 1 76  ? -24.707 -10.182 -7.178  1.00 47.74  ? 336 TYR A CZ  1 
ATOM   615  O  OH  . TYR A 1 76  ? -25.779 -11.044 -7.035  1.00 48.87  ? 336 TYR A OH  1 
ATOM   616  N  N   . ALA A 1 77  ? -18.198 -7.464  -6.614  1.00 45.91  ? 337 ALA A N   1 
ATOM   617  C  CA  . ALA A 1 77  ? -16.896 -6.934  -6.951  1.00 44.49  ? 337 ALA A CA  1 
ATOM   618  C  C   . ALA A 1 77  ? -16.627 -7.336  -8.385  1.00 47.27  ? 337 ALA A C   1 
ATOM   619  O  O   . ALA A 1 77  ? -16.864 -8.496  -8.758  1.00 47.71  ? 337 ALA A O   1 
ATOM   620  C  CB  . ALA A 1 77  ? -15.826 -7.516  -6.045  1.00 41.36  ? 337 ALA A CB  1 
ATOM   621  N  N   . LYS A 1 78  ? -16.135 -6.385  -9.183  1.00 45.70  ? 338 LYS A N   1 
ATOM   622  C  CA  . LYS A 1 78  ? -15.686 -6.691  -10.515 1.00 46.04  ? 338 LYS A CA  1 
ATOM   623  C  C   . LYS A 1 78  ? -14.368 -7.428  -10.401 1.00 47.48  ? 338 LYS A C   1 
ATOM   624  O  O   . LYS A 1 78  ? -13.431 -6.926  -9.795  1.00 46.45  ? 338 LYS A O   1 
ATOM   625  C  CB  . LYS A 1 78  ? -15.472 -5.435  -11.349 1.00 44.94  ? 338 LYS A CB  1 
ATOM   626  C  CG  . LYS A 1 78  ? -15.009 -5.780  -12.803 1.00 54.66  ? 338 LYS A CG  1 
ATOM   627  C  CD  . LYS A 1 78  ? -14.185 -4.642  -13.469 1.00 52.93  ? 338 LYS A CD  1 
ATOM   628  C  CE  . LYS A 1 78  ? -12.812 -4.466  -12.817 1.00 52.33  ? 338 LYS A CE  1 
ATOM   629  N  NZ  . LYS A 1 78  ? -12.081 -3.402  -13.518 1.00 56.01  ? 338 LYS A NZ  1 
ATOM   630  N  N   . VAL A 1 79  ? -14.300 -8.615  -10.997 1.00 44.72  ? 339 VAL A N   1 
ATOM   631  C  CA  . VAL A 1 79  ? -13.091 -9.407  -10.977 1.00 43.57  ? 339 VAL A CA  1 
ATOM   632  C  C   . VAL A 1 79  ? -12.242 -9.118  -12.192 1.00 45.89  ? 339 VAL A C   1 
ATOM   633  O  O   . VAL A 1 79  ? -11.048 -8.913  -12.073 1.00 48.10  ? 339 VAL A O   1 
ATOM   634  C  CB  . VAL A 1 79  ? -13.400 -10.890 -10.938 1.00 42.91  ? 339 VAL A CB  1 
ATOM   635  C  CG1 . VAL A 1 79  ? -12.097 -11.691 -11.051 1.00 42.13  ? 339 VAL A CG1 1 
ATOM   636  C  CG2 . VAL A 1 79  ? -14.187 -11.234 -9.643  1.00 48.11  ? 339 VAL A CG2 1 
ATOM   637  N  N   . LYS A 1 80  ? -12.850 -9.116  -13.371 1.00 44.09  ? 340 LYS A N   1 
ATOM   638  C  CA  . LYS A 1 80  ? -12.094 -8.864  -14.599 1.00 41.93  ? 340 LYS A CA  1 
ATOM   639  C  C   . LYS A 1 80  ? -12.993 -8.353  -15.719 1.00 40.52  ? 340 LYS A C   1 
ATOM   640  O  O   . LYS A 1 80  ? -14.162 -8.724  -15.812 1.00 38.14  ? 340 LYS A O   1 
ATOM   641  C  CB  . LYS A 1 80  ? -11.338 -10.141 -15.003 1.00 44.31  ? 340 LYS A CB  1 
ATOM   642  C  CG  . LYS A 1 80  ? -10.612 -10.116 -16.308 1.00 45.50  ? 340 LYS A CG  1 
ATOM   643  C  CD  . LYS A 1 80  ? -9.562  -9.032  -16.420 1.00 46.24  ? 340 LYS A CD  1 
ATOM   644  C  CE  . LYS A 1 80  ? -8.256  -9.408  -15.783 1.00 50.27  ? 340 LYS A CE  1 
ATOM   645  N  NZ  . LYS A 1 80  ? -7.129  -8.716  -16.544 1.00 54.68  ? 340 LYS A NZ  1 
ATOM   646  N  N   . LEU A 1 81  ? -12.434 -7.461  -16.528 1.00 39.67  ? 341 LEU A N   1 
ATOM   647  C  CA  . LEU A 1 81  ? -13.087 -6.965  -17.734 1.00 41.23  ? 341 LEU A CA  1 
ATOM   648  C  C   . LEU A 1 81  ? -12.152 -7.258  -18.887 1.00 45.26  ? 341 LEU A C   1 
ATOM   649  O  O   . LEU A 1 81  ? -10.961 -7.044  -18.749 1.00 50.42  ? 341 LEU A O   1 
ATOM   650  C  CB  . LEU A 1 81  ? -13.326 -5.466  -17.630 1.00 41.09  ? 341 LEU A CB  1 
ATOM   651  C  CG  . LEU A 1 81  ? -13.887 -4.760  -18.856 1.00 39.83  ? 341 LEU A CG  1 
ATOM   652  C  CD1 . LEU A 1 81  ? -14.489 -3.390  -18.495 1.00 34.15  ? 341 LEU A CD1 1 
ATOM   653  C  CD2 . LEU A 1 81  ? -12.810 -4.622  -19.958 1.00 33.27  ? 341 LEU A CD2 1 
ATOM   654  N  N   . ILE A 1 82  ? -12.661 -7.778  -20.008 1.00 40.90  ? 342 ILE A N   1 
ATOM   655  C  CA  . ILE A 1 82  ? -11.804 -7.975  -21.181 1.00 43.40  ? 342 ILE A CA  1 
ATOM   656  C  C   . ILE A 1 82  ? -12.567 -7.622  -22.465 1.00 44.04  ? 342 ILE A C   1 
ATOM   657  O  O   . ILE A 1 82  ? -13.756 -7.930  -22.579 1.00 44.18  ? 342 ILE A O   1 
ATOM   658  C  CB  . ILE A 1 82  ? -11.226 -9.412  -21.224 1.00 40.65  ? 342 ILE A CB  1 
ATOM   659  C  CG1 . ILE A 1 82  ? -10.168 -9.548  -22.343 1.00 41.83  ? 342 ILE A CG1 1 
ATOM   660  C  CG2 . ILE A 1 82  ? -12.331 -10.435 -21.386 1.00 34.25  ? 342 ILE A CG2 1 
ATOM   661  C  CD1 . ILE A 1 82  ? -8.838  -8.774  -22.123 1.00 37.19  ? 342 ILE A CD1 1 
ATOM   662  N  N   . ARG A 1 83  ? -11.893 -6.969  -23.420 1.00 41.91  ? 343 ARG A N   1 
ATOM   663  C  CA  . ARG A 1 83  ? -12.556 -6.551  -24.665 1.00 41.27  ? 343 ARG A CA  1 
ATOM   664  C  C   . ARG A 1 83  ? -11.650 -6.640  -25.859 1.00 44.17  ? 343 ARG A C   1 
ATOM   665  O  O   . ARG A 1 83  ? -10.473 -6.283  -25.780 1.00 50.30  ? 343 ARG A O   1 
ATOM   666  C  CB  . ARG A 1 83  ? -13.061 -5.121  -24.554 1.00 43.60  ? 343 ARG A CB  1 
ATOM   667  C  CG  . ARG A 1 83  ? -13.911 -4.670  -25.723 1.00 47.52  ? 343 ARG A CG  1 
ATOM   668  C  CD  . ARG A 1 83  ? -14.592 -3.349  -25.446 1.00 48.65  ? 343 ARG A CD  1 
ATOM   669  N  NE  . ARG A 1 83  ? -13.655 -2.308  -25.059 1.00 50.72  ? 343 ARG A NE  1 
ATOM   670  C  CZ  . ARG A 1 83  ? -12.927 -1.600  -25.908 1.00 50.74  ? 343 ARG A CZ  1 
ATOM   671  N  NH1 . ARG A 1 83  ? -12.991 -1.839  -27.209 1.00 49.17  ? 343 ARG A NH1 1 
ATOM   672  N  NH2 . ARG A 1 83  ? -12.123 -0.649  -25.458 1.00 49.51  ? 343 ARG A NH2 1 
ATOM   673  N  N   . LEU A 1 84  ? -12.200 -7.117  -26.974 1.00 43.25  ? 344 LEU A N   1 
ATOM   674  C  CA  . LEU A 1 84  ? -11.514 -7.081  -28.272 1.00 41.90  ? 344 LEU A CA  1 
ATOM   675  C  C   . LEU A 1 84  ? -12.478 -6.365  -29.183 1.00 44.93  ? 344 LEU A C   1 
ATOM   676  O  O   . LEU A 1 84  ? -13.519 -6.909  -29.550 1.00 42.52  ? 344 LEU A O   1 
ATOM   677  C  CB  . LEU A 1 84  ? -11.226 -8.485  -28.785 1.00 40.26  ? 344 LEU A CB  1 
ATOM   678  C  CG  . LEU A 1 84  ? -10.697 -8.645  -30.218 1.00 41.42  ? 344 LEU A CG  1 
ATOM   679  C  CD1 . LEU A 1 84  ? -9.337  -7.993  -30.388 1.00 38.97  ? 344 LEU A CD1 1 
ATOM   680  C  CD2 . LEU A 1 84  ? -10.641 -10.114 -30.604 1.00 40.36  ? 344 LEU A CD2 1 
ATOM   681  N  N   . VAL A 1 85  ? -12.139 -5.118  -29.485 1.00 45.33  ? 345 VAL A N   1 
ATOM   682  C  CA  . VAL A 1 85  ? -12.990 -4.234  -30.269 1.00 45.59  ? 345 VAL A CA  1 
ATOM   683  C  C   . VAL A 1 85  ? -14.417 -4.164  -29.675 1.00 45.37  ? 345 VAL A C   1 
ATOM   684  O  O   . VAL A 1 85  ? -14.626 -3.475  -28.681 1.00 42.37  ? 345 VAL A O   1 
ATOM   685  C  CB  . VAL A 1 85  ? -12.934 -4.599  -31.779 1.00 39.85  ? 345 VAL A CB  1 
ATOM   686  C  CG1 . VAL A 1 85  ? -13.727 -3.596  -32.592 1.00 39.19  ? 345 VAL A CG1 1 
ATOM   687  C  CG2 . VAL A 1 85  ? -11.484 -4.617  -32.252 1.00 35.44  ? 345 VAL A CG2 1 
ATOM   688  N  N   . GLY A 1 86  ? -15.370 -4.898  -30.242 1.00 46.86  ? 346 GLY A N   1 
ATOM   689  C  CA  . GLY A 1 86  ? -16.770 -4.809  -29.834 1.00 43.58  ? 346 GLY A CA  1 
ATOM   690  C  C   . GLY A 1 86  ? -17.251 -5.941  -28.961 1.00 44.88  ? 346 GLY A C   1 
ATOM   691  O  O   . GLY A 1 86  ? -18.435 -6.004  -28.635 1.00 45.48  ? 346 GLY A O   1 
ATOM   692  N  N   . ILE A 1 87  ? -16.324 -6.811  -28.555 1.00 45.08  ? 347 ILE A N   1 
ATOM   693  C  CA  . ILE A 1 87  ? -16.628 -8.044  -27.832 1.00 44.86  ? 347 ILE A CA  1 
ATOM   694  C  C   . ILE A 1 87  ? -16.113 -7.924  -26.397 1.00 45.12  ? 347 ILE A C   1 
ATOM   695  O  O   . ILE A 1 87  ? -14.912 -7.957  -26.169 1.00 47.74  ? 347 ILE A O   1 
ATOM   696  C  CB  . ILE A 1 87  ? -15.933 -9.244  -28.491 1.00 45.81  ? 347 ILE A CB  1 
ATOM   697  C  CG1 . ILE A 1 87  ? -16.157 -9.247  -30.013 1.00 48.74  ? 347 ILE A CG1 1 
ATOM   698  C  CG2 . ILE A 1 87  ? -16.429 -10.521 -27.874 1.00 42.80  ? 347 ILE A CG2 1 
ATOM   699  C  CD1 . ILE A 1 87  ? -15.547 -10.431 -30.731 1.00 50.38  ? 347 ILE A CD1 1 
ATOM   700  N  N   . MET A 1 88  ? -17.008 -7.787  -25.430 1.00 43.10  ? 348 MET A N   1 
ATOM   701  C  CA  . MET A 1 88  ? -16.592 -7.546  -24.058 1.00 42.96  ? 348 MET A CA  1 
ATOM   702  C  C   . MET A 1 88  ? -17.229 -8.546  -23.163 1.00 42.71  ? 348 MET A C   1 
ATOM   703  O  O   . MET A 1 88  ? -18.381 -8.912  -23.357 1.00 44.64  ? 348 MET A O   1 
ATOM   704  C  CB  . MET A 1 88  ? -17.019 -6.166  -23.593 1.00 42.12  ? 348 MET A CB  1 
ATOM   705  C  CG  . MET A 1 88  ? -16.328 -5.722  -22.327 1.00 37.81  ? 348 MET A CG  1 
ATOM   706  S  SD  . MET A 1 88  ? -16.808 -4.035  -21.904 1.00 49.44  ? 348 MET A SD  1 
ATOM   707  C  CE  . MET A 1 88  ? -18.571 -4.289  -21.655 1.00 35.13  ? 348 MET A CE  1 
ATOM   708  N  N   . LEU A 1 89  ? -16.468 -8.974  -22.169 1.00 42.60  ? 349 LEU A N   1 
ATOM   709  C  CA  . LEU A 1 89  ? -16.939 -9.921  -21.146 1.00 42.52  ? 349 LEU A CA  1 
ATOM   710  C  C   . LEU A 1 89  ? -16.560 -9.363  -19.794 1.00 42.84  ? 349 LEU A C   1 
ATOM   711  O  O   . LEU A 1 89  ? -15.408 -8.906  -19.594 1.00 42.92  ? 349 LEU A O   1 
ATOM   712  C  CB  . LEU A 1 89  ? -16.294 -11.286 -21.326 1.00 40.46  ? 349 LEU A CB  1 
ATOM   713  C  CG  . LEU A 1 89  ? -16.835 -12.415 -20.441 1.00 39.68  ? 349 LEU A CG  1 
ATOM   714  C  CD1 . LEU A 1 89  ? -18.302 -12.596 -20.625 1.00 41.10  ? 349 LEU A CD1 1 
ATOM   715  C  CD2 . LEU A 1 89  ? -16.141 -13.674 -20.787 1.00 32.65  ? 349 LEU A CD2 1 
ATOM   716  N  N   . LEU A 1 90  ? -17.523 -9.404  -18.883 1.00 42.15  ? 350 LEU A N   1 
ATOM   717  C  CA  . LEU A 1 90  ? -17.351 -8.899  -17.525 1.00 40.83  ? 350 LEU A CA  1 
ATOM   718  C  C   . LEU A 1 90  ? -17.543 -10.067 -16.555 1.00 38.98  ? 350 LEU A C   1 
ATOM   719  O  O   . LEU A 1 90  ? -18.456 -10.880 -16.722 1.00 35.71  ? 350 LEU A O   1 
ATOM   720  C  CB  . LEU A 1 90  ? -18.386 -7.816  -17.252 1.00 39.41  ? 350 LEU A CB  1 
ATOM   721  C  CG  . LEU A 1 90  ? -18.442 -6.650  -18.228 1.00 44.88  ? 350 LEU A CG  1 
ATOM   722  C  CD1 . LEU A 1 90  ? -19.523 -5.695  -17.844 1.00 46.01  ? 350 LEU A CD1 1 
ATOM   723  C  CD2 . LEU A 1 90  ? -17.132 -5.921  -18.265 1.00 48.12  ? 350 LEU A CD2 1 
ATOM   724  N  N   . LEU A 1 91  ? -16.683 -10.163 -15.554 1.00 38.02  ? 351 LEU A N   1 
ATOM   725  C  CA  . LEU A 1 91  ? -16.861 -11.153 -14.509 1.00 37.91  ? 351 LEU A CA  1 
ATOM   726  C  C   . LEU A 1 91  ? -16.949 -10.445 -13.173 1.00 43.20  ? 351 LEU A C   1 
ATOM   727  O  O   . LEU A 1 91  ? -16.036 -9.698  -12.790 1.00 44.25  ? 351 LEU A O   1 
ATOM   728  C  CB  . LEU A 1 91  ? -15.717 -12.143 -14.505 1.00 37.39  ? 351 LEU A CB  1 
ATOM   729  C  CG  . LEU A 1 91  ? -15.670 -13.164 -13.359 1.00 40.43  ? 351 LEU A CG  1 
ATOM   730  C  CD1 . LEU A 1 91  ? -16.715 -14.249 -13.532 1.00 35.50  ? 351 LEU A CD1 1 
ATOM   731  C  CD2 . LEU A 1 91  ? -14.250 -13.758 -13.263 1.00 39.62  ? 351 LEU A CD2 1 
ATOM   732  N  N   . TYR A 1 92  ? -18.079 -10.647 -12.492 1.00 43.36  ? 352 TYR A N   1 
ATOM   733  C  CA  . TYR A 1 92  ? -18.284 -10.156 -11.135 1.00 42.97  ? 352 TYR A CA  1 
ATOM   734  C  C   . TYR A 1 92  ? -18.593 -11.340 -10.197 1.00 43.70  ? 352 TYR A C   1 
ATOM   735  O  O   . TYR A 1 92  ? -19.222 -12.327 -10.606 1.00 43.77  ? 352 TYR A O   1 
ATOM   736  C  CB  . TYR A 1 92  ? -19.489 -9.235  -11.044 1.00 40.73  ? 352 TYR A CB  1 
ATOM   737  C  CG  . TYR A 1 92  ? -19.594 -8.034  -11.928 1.00 43.43  ? 352 TYR A CG  1 
ATOM   738  C  CD1 . TYR A 1 92  ? -19.373 -6.777  -11.425 1.00 41.96  ? 352 TYR A CD1 1 
ATOM   739  C  CD2 . TYR A 1 92  ? -20.043 -8.136  -13.239 1.00 43.06  ? 352 TYR A CD2 1 
ATOM   740  C  CE1 . TYR A 1 92  ? -19.519 -5.638  -12.220 1.00 41.46  ? 352 TYR A CE1 1 
ATOM   741  C  CE2 . TYR A 1 92  ? -20.217 -6.993  -14.046 1.00 40.98  ? 352 TYR A CE2 1 
ATOM   742  C  CZ  . TYR A 1 92  ? -19.952 -5.754  -13.524 1.00 42.80  ? 352 TYR A CZ  1 
ATOM   743  O  OH  . TYR A 1 92  ? -20.122 -4.603  -14.276 1.00 45.74  ? 352 TYR A OH  1 
ATOM   744  N  N   . VAL A 1 93  ? -18.201 -11.207 -8.937  1.00 41.71  ? 353 VAL A N   1 
ATOM   745  C  CA  . VAL A 1 93  ? -18.569 -12.153 -7.899  1.00 42.28  ? 353 VAL A CA  1 
ATOM   746  C  C   . VAL A 1 93  ? -19.057 -11.352 -6.688  1.00 46.31  ? 353 VAL A C   1 
ATOM   747  O  O   . VAL A 1 93  ? -18.647 -10.202 -6.491  1.00 46.47  ? 353 VAL A O   1 
ATOM   748  C  CB  . VAL A 1 93  ? -17.367 -13.026 -7.430  1.00 43.32  ? 353 VAL A CB  1 
ATOM   749  C  CG1 . VAL A 1 93  ? -16.827 -13.900 -8.560  1.00 43.29  ? 353 VAL A CG1 1 
ATOM   750  C  CG2 . VAL A 1 93  ? -16.274 -12.162 -6.816  1.00 42.50  ? 353 VAL A CG2 1 
ATOM   751  N  N   . LYS A 1 94  ? -19.914 -11.955 -5.871  1.00 45.58  ? 354 LYS A N   1 
ATOM   752  C  CA  . LYS A 1 94  ? -20.286 -11.324 -4.636  1.00 49.15  ? 354 LYS A CA  1 
ATOM   753  C  C   . LYS A 1 94  ? -19.023 -11.013 -3.832  1.00 50.08  ? 354 LYS A C   1 
ATOM   754  O  O   . LYS A 1 94  ? -18.072 -11.800 -3.812  1.00 45.24  ? 354 LYS A O   1 
ATOM   755  C  CB  . LYS A 1 94  ? -21.174 -12.245 -3.806  1.00 51.42  ? 354 LYS A CB  1 
ATOM   756  C  CG  . LYS A 1 94  ? -22.568 -12.496 -4.309  1.00 48.89  ? 354 LYS A CG  1 
ATOM   757  C  CD  . LYS A 1 94  ? -23.252 -13.496 -3.370  1.00 45.31  ? 354 LYS A CD  1 
ATOM   758  C  CE  . LYS A 1 94  ? -24.738 -13.603 -3.643  1.00 46.28  ? 354 LYS A CE  1 
ATOM   759  N  NZ  . LYS A 1 94  ? -25.395 -14.651 -2.845  1.00 49.96  ? 354 LYS A NZ  1 
ATOM   760  N  N   . GLN A 1 95  ? -19.032 -9.886  -3.129  1.00 51.99  ? 355 GLN A N   1 
ATOM   761  C  CA  . GLN A 1 95  ? -17.834 -9.448  -2.400  1.00 53.15  ? 355 GLN A CA  1 
ATOM   762  C  C   . GLN A 1 95  ? -17.272 -10.540 -1.491  1.00 56.66  ? 355 GLN A C   1 
ATOM   763  O  O   . GLN A 1 95  ? -16.072 -10.693 -1.361  1.00 57.08  ? 355 GLN A O   1 
ATOM   764  C  CB  . GLN A 1 95  ? -18.128 -8.181  -1.599  1.00 56.48  ? 355 GLN A CB  1 
ATOM   765  C  CG  . GLN A 1 95  ? -16.884 -7.511  -1.006  1.00 66.23  ? 355 GLN A CG  1 
ATOM   766  C  CD  . GLN A 1 95  ? -15.866 -7.074  -2.068  1.00 72.38  ? 355 GLN A CD  1 
ATOM   767  O  OE1 . GLN A 1 95  ? -16.120 -6.134  -2.828  1.00 75.01  ? 355 GLN A OE1 1 
ATOM   768  N  NE2 . GLN A 1 95  ? -14.706 -7.750  -2.115  1.00 73.18  ? 355 GLN A NE2 1 
ATOM   769  N  N   . GLU A 1 96  ? -18.149 -11.318 -0.878  1.00 59.87  ? 356 GLU A N   1 
ATOM   770  C  CA  . GLU A 1 96  ? -17.733 -12.354 0.059   1.00 58.59  ? 356 GLU A CA  1 
ATOM   771  C  C   . GLU A 1 96  ? -17.010 -13.505 -0.599  1.00 59.51  ? 356 GLU A C   1 
ATOM   772  O  O   . GLU A 1 96  ? -16.376 -14.275 0.083   1.00 60.40  ? 356 GLU A O   1 
ATOM   773  C  CB  . GLU A 1 96  ? -18.940 -12.892 0.817   1.00 64.82  ? 356 GLU A CB  1 
ATOM   774  C  CG  . GLU A 1 96  ? -19.928 -13.668 -0.055  1.00 73.27  ? 356 GLU A CG  1 
ATOM   775  C  CD  . GLU A 1 96  ? -21.327 -13.739 0.545   1.00 80.25  ? 356 GLU A CD  1 
ATOM   776  O  OE1 . GLU A 1 96  ? -21.756 -14.879 0.855   1.00 83.14  ? 356 GLU A OE1 1 
ATOM   777  O  OE2 . GLU A 1 96  ? -21.994 -12.671 0.705   1.00 80.96  ? 356 GLU A OE2 1 
ATOM   778  N  N   . HIS A 1 97  ? -17.120 -13.653 -1.918  1.00 56.94  ? 357 HIS A N   1 
ATOM   779  C  CA  . HIS A 1 97  ? -16.400 -14.721 -2.629  1.00 54.50  ? 357 HIS A CA  1 
ATOM   780  C  C   . HIS A 1 97  ? -15.042 -14.286 -3.172  1.00 54.20  ? 357 HIS A C   1 
ATOM   781  O  O   . HIS A 1 97  ? -14.228 -15.127 -3.529  1.00 57.32  ? 357 HIS A O   1 
ATOM   782  C  CB  . HIS A 1 97  ? -17.205 -15.219 -3.809  1.00 53.96  ? 357 HIS A CB  1 
ATOM   783  C  CG  . HIS A 1 97  ? -18.525 -15.810 -3.445  1.00 54.22  ? 357 HIS A CG  1 
ATOM   784  N  ND1 . HIS A 1 97  ? -18.716 -16.570 -2.318  1.00 55.91  ? 357 HIS A ND1 1 
ATOM   785  C  CD2 . HIS A 1 97  ? -19.712 -15.789 -4.092  1.00 53.45  ? 357 HIS A CD2 1 
ATOM   786  C  CE1 . HIS A 1 97  ? -19.971 -16.979 -2.274  1.00 55.98  ? 357 HIS A CE1 1 
ATOM   787  N  NE2 . HIS A 1 97  ? -20.594 -16.524 -3.342  1.00 55.18  ? 357 HIS A NE2 1 
ATOM   788  N  N   . ALA A 1 98  ? -14.812 -12.979 -3.238  1.00 51.45  ? 358 ALA A N   1 
ATOM   789  C  CA  . ALA A 1 98  ? -13.625 -12.404 -3.879  1.00 47.74  ? 358 ALA A CA  1 
ATOM   790  C  C   . ALA A 1 98  ? -12.328 -13.071 -3.437  1.00 50.59  ? 358 ALA A C   1 
ATOM   791  O  O   . ALA A 1 98  ? -11.490 -13.383 -4.268  1.00 57.75  ? 358 ALA A O   1 
ATOM   792  C  CB  . ALA A 1 98  ? -13.559 -10.880 -3.633  1.00 43.38  ? 358 ALA A CB  1 
ATOM   793  N  N   . ALA A 1 99  ? -12.184 -13.331 -2.147  1.00 46.77  ? 359 ALA A N   1 
ATOM   794  C  CA  . ALA A 1 99  ? -10.956 -13.921 -1.610  1.00 46.48  ? 359 ALA A CA  1 
ATOM   795  C  C   . ALA A 1 99  ? -10.694 -15.325 -2.131  1.00 49.24  ? 359 ALA A C   1 
ATOM   796  O  O   . ALA A 1 99  ? -9.577  -15.818 -2.024  1.00 51.48  ? 359 ALA A O   1 
ATOM   797  C  CB  . ALA A 1 99  ? -10.994 -13.945 -0.080  1.00 41.88  ? 359 ALA A CB  1 
ATOM   798  N  N   . TYR A 1 100 ? -11.715 -15.976 -2.675  1.00 45.22  ? 360 TYR A N   1 
ATOM   799  C  CA  . TYR A 1 100 ? -11.578 -17.353 -3.094  1.00 47.31  ? 360 TYR A CA  1 
ATOM   800  C  C   . TYR A 1 100 ? -11.417 -17.474 -4.586  1.00 52.38  ? 360 TYR A C   1 
ATOM   801  O  O   . TYR A 1 100 ? -11.351 -18.591 -5.100  1.00 54.62  ? 360 TYR A O   1 
ATOM   802  C  CB  . TYR A 1 100 ? -12.765 -18.170 -2.565  1.00 48.55  ? 360 TYR A CB  1 
ATOM   803  C  CG  . TYR A 1 100 ? -12.805 -18.110 -1.062  1.00 54.46  ? 360 TYR A CG  1 
ATOM   804  C  CD1 . TYR A 1 100 ? -12.095 -19.014 -0.286  1.00 54.01  ? 360 TYR A CD1 1 
ATOM   805  C  CD2 . TYR A 1 100 ? -13.487 -17.087 -0.421  1.00 58.68  ? 360 TYR A CD2 1 
ATOM   806  C  CE1 . TYR A 1 100 ? -12.094 -18.914 1.108   1.00 59.64  ? 360 TYR A CE1 1 
ATOM   807  C  CE2 . TYR A 1 100 ? -13.505 -16.982 0.963   1.00 64.47  ? 360 TYR A CE2 1 
ATOM   808  C  CZ  . TYR A 1 100 ? -12.809 -17.888 1.730   1.00 66.92  ? 360 TYR A CZ  1 
ATOM   809  O  OH  . TYR A 1 100 ? -12.854 -17.751 3.118   1.00 73.70  ? 360 TYR A OH  1 
ATOM   810  N  N   . ILE A 1 101 ? -11.344 -16.323 -5.271  1.00 53.43  ? 361 ILE A N   1 
ATOM   811  C  CA  . ILE A 1 101 ? -11.036 -16.247 -6.706  1.00 49.59  ? 361 ILE A CA  1 
ATOM   812  C  C   . ILE A 1 101 ? -9.553  -16.029 -6.912  1.00 48.70  ? 361 ILE A C   1 
ATOM   813  O  O   . ILE A 1 101 ? -8.978  -15.118 -6.347  1.00 50.24  ? 361 ILE A O   1 
ATOM   814  C  CB  . ILE A 1 101 ? -11.741 -15.080 -7.399  1.00 46.33  ? 361 ILE A CB  1 
ATOM   815  C  CG1 . ILE A 1 101 ? -13.271 -15.275 -7.364  1.00 46.63  ? 361 ILE A CG1 1 
ATOM   816  C  CG2 . ILE A 1 101 ? -11.242 -14.949 -8.831  1.00 40.03  ? 361 ILE A CG2 1 
ATOM   817  C  CD1 . ILE A 1 101 ? -13.849 -16.298 -8.369  1.00 44.30  ? 361 ILE A CD1 1 
ATOM   818  N  N   . SER A 1 102 ? -8.931  -16.868 -7.725  1.00 44.60  ? 362 SER A N   1 
ATOM   819  C  CA  . SER A 1 102 ? -7.522  -16.701 -8.005  1.00 43.81  ? 362 SER A CA  1 
ATOM   820  C  C   . SER A 1 102 ? -7.207  -17.108 -9.430  1.00 45.45  ? 362 SER A C   1 
ATOM   821  O  O   . SER A 1 102 ? -8.064  -17.612 -10.158 1.00 44.84  ? 362 SER A O   1 
ATOM   822  C  CB  . SER A 1 102 ? -6.689  -17.517 -7.021  1.00 44.44  ? 362 SER A CB  1 
ATOM   823  O  OG  . SER A 1 102 ? -7.113  -18.872 -6.965  1.00 45.46  ? 362 SER A OG  1 
ATOM   824  N  N   . GLU A 1 103 ? -5.956  -16.850 -9.809  1.00 48.57  ? 363 GLU A N   1 
ATOM   825  C  CA  . GLU A 1 103 ? -5.410  -17.202 -11.104 1.00 49.76  ? 363 GLU A CA  1 
ATOM   826  C  C   . GLU A 1 103 ? -6.285  -16.739 -12.231 1.00 47.80  ? 363 GLU A C   1 
ATOM   827  O  O   . GLU A 1 103 ? -6.591  -17.494 -13.154 1.00 51.26  ? 363 GLU A O   1 
ATOM   828  C  CB  . GLU A 1 103 ? -5.221  -18.695 -11.171 1.00 53.75  ? 363 GLU A CB  1 
ATOM   829  C  CG  . GLU A 1 103 ? -4.114  -19.217 -10.290 1.00 62.23  ? 363 GLU A CG  1 
ATOM   830  C  CD  . GLU A 1 103 ? -4.179  -20.737 -10.231 1.00 80.63  ? 363 GLU A CD  1 
ATOM   831  O  OE1 . GLU A 1 103 ? -3.510  -21.331 -9.331  1.00 90.20  ? 363 GLU A OE1 1 
ATOM   832  O  OE2 . GLU A 1 103 ? -4.926  -21.343 -11.076 1.00 83.09  ? 363 GLU A OE2 1 
ATOM   833  N  N   . VAL A 1 104 ? -6.707  -15.492 -12.142 1.00 43.39  ? 364 VAL A N   1 
ATOM   834  C  CA  . VAL A 1 104 ? -7.551  -14.891 -13.156 1.00 42.70  ? 364 VAL A CA  1 
ATOM   835  C  C   . VAL A 1 104 ? -6.674  -14.559 -14.349 1.00 44.76  ? 364 VAL A C   1 
ATOM   836  O  O   . VAL A 1 104 ? -5.615  -13.950 -14.180 1.00 44.38  ? 364 VAL A O   1 
ATOM   837  C  CB  . VAL A 1 104 ? -8.225  -13.610 -12.619 1.00 37.70  ? 364 VAL A CB  1 
ATOM   838  C  CG1 . VAL A 1 104 ? -9.021  -12.936 -13.696 1.00 34.23  ? 364 VAL A CG1 1 
ATOM   839  C  CG2 . VAL A 1 104 ? -9.123  -13.964 -11.424 1.00 36.52  ? 364 VAL A CG2 1 
ATOM   840  N  N   . GLU A 1 105 ? -7.091  -14.999 -15.538 1.00 41.84  ? 365 GLU A N   1 
ATOM   841  C  CA  . GLU A 1 105 ? -6.395  -14.682 -16.791 1.00 39.84  ? 365 GLU A CA  1 
ATOM   842  C  C   . GLU A 1 105 ? -7.406  -14.389 -17.856 1.00 38.10  ? 365 GLU A C   1 
ATOM   843  O  O   . GLU A 1 105 ? -8.456  -14.987 -17.880 1.00 37.38  ? 365 GLU A O   1 
ATOM   844  C  CB  . GLU A 1 105 ? -5.530  -15.838 -17.254 1.00 38.58  ? 365 GLU A CB  1 
ATOM   845  C  CG  . GLU A 1 105 ? -4.420  -16.208 -16.298 1.00 46.01  ? 365 GLU A CG  1 
ATOM   846  C  CD  . GLU A 1 105 ? -3.367  -15.127 -16.120 1.00 56.00  ? 365 GLU A CD  1 
ATOM   847  O  OE1 . GLU A 1 105 ? -3.325  -14.167 -16.923 1.00 55.92  ? 365 GLU A OE1 1 
ATOM   848  O  OE2 . GLU A 1 105 ? -2.570  -15.248 -15.164 1.00 64.05  ? 365 GLU A OE2 1 
ATOM   849  N  N   . ALA A 1 106 ? -7.081  -13.471 -18.746 1.00 37.30  ? 366 ALA A N   1 
ATOM   850  C  CA  . ALA A 1 106 ? -8.011  -13.070 -19.789 1.00 37.24  ? 366 ALA A CA  1 
ATOM   851  C  C   . ALA A 1 106 ? -7.276  -12.956 -21.118 1.00 44.72  ? 366 ALA A C   1 
ATOM   852  O  O   . ALA A 1 106 ? -6.172  -12.410 -21.184 1.00 46.30  ? 366 ALA A O   1 
ATOM   853  C  CB  . ALA A 1 106 ? -8.695  -11.748 -19.417 1.00 35.36  ? 366 ALA A CB  1 
ATOM   854  N  N   . GLU A 1 107 ? -7.870  -13.488 -22.180 1.00 45.94  ? 367 GLU A N   1 
ATOM   855  C  CA  . GLU A 1 107 ? -7.244  -13.440 -23.476 1.00 45.97  ? 367 GLU A CA  1 
ATOM   856  C  C   . GLU A 1 107 ? -8.238  -13.207 -24.572 1.00 46.01  ? 367 GLU A C   1 
ATOM   857  O  O   . GLU A 1 107 ? -9.433  -13.344 -24.351 1.00 47.18  ? 367 GLU A O   1 
ATOM   858  C  CB  . GLU A 1 107 ? -6.476  -14.715 -23.713 1.00 50.15  ? 367 GLU A CB  1 
ATOM   859  C  CG  . GLU A 1 107 ? -5.006  -14.582 -23.301 1.00 57.88  ? 367 GLU A CG  1 
ATOM   860  C  CD  . GLU A 1 107 ? -4.176  -13.890 -24.367 1.00 67.16  ? 367 GLU A CD  1 
ATOM   861  O  OE1 . GLU A 1 107 ? -4.734  -13.128 -25.202 1.00 64.50  ? 367 GLU A OE1 1 
ATOM   862  O  OE2 . GLU A 1 107 ? -2.950  -14.108 -24.358 1.00 77.10  ? 367 GLU A OE2 1 
ATOM   863  N  N   . THR A 1 108 ? -7.728  -12.801 -25.737 1.00 43.74  ? 368 THR A N   1 
ATOM   864  C  CA  . THR A 1 108 ? -8.552  -12.554 -26.909 1.00 42.81  ? 368 THR A CA  1 
ATOM   865  C  C   . THR A 1 108 ? -7.973  -13.178 -28.198 1.00 45.50  ? 368 THR A C   1 
ATOM   866  O  O   . THR A 1 108 ? -6.761  -13.439 -28.332 1.00 48.15  ? 368 THR A O   1 
ATOM   867  C  CB  . THR A 1 108 ? -8.828  -11.052 -27.094 1.00 44.75  ? 368 THR A CB  1 
ATOM   868  O  OG1 . THR A 1 108 ? -7.723  -10.413 -27.724 1.00 50.40  ? 368 THR A OG1 1 
ATOM   869  C  CG2 . THR A 1 108 ? -9.096  -10.362 -25.769 1.00 41.36  ? 368 THR A CG2 1 
ATOM   870  N  N   . VAL A 1 109 ? -8.867  -13.457 -29.134 1.00 41.61  ? 369 VAL A N   1 
ATOM   871  C  CA  . VAL A 1 109 ? -8.482  -14.062 -30.396 1.00 43.18  ? 369 VAL A CA  1 
ATOM   872  C  C   . VAL A 1 109 ? -9.387  -13.474 -31.456 1.00 44.76  ? 369 VAL A C   1 
ATOM   873  O  O   . VAL A 1 109 ? -10.614 -13.580 -31.349 1.00 43.89  ? 369 VAL A O   1 
ATOM   874  C  CB  . VAL A 1 109 ? -8.609  -15.579 -30.347 1.00 42.41  ? 369 VAL A CB  1 
ATOM   875  C  CG1 . VAL A 1 109 ? -8.596  -16.159 -31.728 1.00 45.04  ? 369 VAL A CG1 1 
ATOM   876  C  CG2 . VAL A 1 109 ? -7.481  -16.176 -29.518 1.00 44.79  ? 369 VAL A CG2 1 
ATOM   877  N  N   . GLY A 1 110 ? -8.776  -12.793 -32.428 1.00 43.60  ? 370 GLY A N   1 
ATOM   878  C  CA  . GLY A 1 110 ? -9.481  -12.220 -33.557 1.00 43.79  ? 370 GLY A CA  1 
ATOM   879  C  C   . GLY A 1 110 ? -9.576  -13.240 -34.667 1.00 47.49  ? 370 GLY A C   1 
ATOM   880  O  O   . GLY A 1 110 ? -8.607  -13.927 -34.971 1.00 49.09  ? 370 GLY A O   1 
ATOM   881  N  N   . THR A 1 111 ? -10.761 -13.361 -35.249 1.00 50.28  ? 371 THR A N   1 
ATOM   882  C  CA  . THR A 1 111 ? -11.000 -14.330 -36.305 1.00 55.03  ? 371 THR A CA  1 
ATOM   883  C  C   . THR A 1 111 ? -11.804 -13.742 -37.458 1.00 57.02  ? 371 THR A C   1 
ATOM   884  O  O   . THR A 1 111 ? -12.557 -14.462 -38.110 1.00 63.92  ? 371 THR A O   1 
ATOM   885  C  CB  . THR A 1 111 ? -11.784 -15.533 -35.767 1.00 51.49  ? 371 THR A CB  1 
ATOM   886  O  OG1 . THR A 1 111 ? -13.124 -15.122 -35.445 1.00 46.52  ? 371 THR A OG1 1 
ATOM   887  C  CG2 . THR A 1 111 ? -11.086 -16.095 -34.547 1.00 51.11  ? 371 THR A CG2 1 
ATOM   888  N  N   . GLY A 1 112 ? -11.647 -12.452 -37.728 1.00 53.03  ? 372 GLY A N   1 
ATOM   889  C  CA  . GLY A 1 112 ? -12.411 -11.799 -38.791 1.00 54.51  ? 372 GLY A CA  1 
ATOM   890  C  C   . GLY A 1 112 ? -11.578 -11.602 -40.031 1.00 57.94  ? 372 GLY A C   1 
ATOM   891  O  O   . GLY A 1 112 ? -11.201 -12.579 -40.709 1.00 55.99  ? 372 GLY A O   1 
ATOM   892  N  N   . ILE A 1 113 ? -11.289 -10.334 -40.315 1.00 57.47  ? 373 ILE A N   1 
ATOM   893  C  CA  . ILE A 1 113 ? -10.562 -9.945  -41.516 1.00 63.97  ? 373 ILE A CA  1 
ATOM   894  C  C   . ILE A 1 113 ? -9.200  -10.630 -41.518 1.00 67.24  ? 373 ILE A C   1 
ATOM   895  O  O   . ILE A 1 113 ? -8.525  -10.645 -40.500 1.00 65.70  ? 373 ILE A O   1 
ATOM   896  C  CB  . ILE A 1 113 ? -10.414 -8.405  -41.584 1.00 65.35  ? 373 ILE A CB  1 
ATOM   897  C  CG1 . ILE A 1 113 ? -11.773 -7.758  -41.858 1.00 64.30  ? 373 ILE A CG1 1 
ATOM   898  C  CG2 . ILE A 1 113 ? -9.426  -7.985  -42.651 1.00 66.76  ? 373 ILE A CG2 1 
ATOM   899  C  CD1 . ILE A 1 113 ? -12.015 -6.472  -41.087 1.00 60.50  ? 373 ILE A CD1 1 
ATOM   900  N  N   . MET A 1 114 ? -8.819  -11.209 -42.661 1.00 70.69  ? 374 MET A N   1 
ATOM   901  C  CA  . MET A 1 114 ? -7.577  -12.002 -42.806 1.00 71.69  ? 374 MET A CA  1 
ATOM   902  C  C   . MET A 1 114 ? -7.550  -13.179 -41.823 1.00 71.73  ? 374 MET A C   1 
ATOM   903  O  O   . MET A 1 114 ? -6.492  -13.739 -41.523 1.00 73.22  ? 374 MET A O   1 
ATOM   904  C  CB  . MET A 1 114 ? -6.321  -11.126 -42.632 1.00 72.56  ? 374 MET A CB  1 
ATOM   905  C  CG  . MET A 1 114 ? -6.159  -10.041 -43.703 1.00 75.91  ? 374 MET A CG  1 
ATOM   906  S  SD  . MET A 1 114 ? -4.762  -8.926  -43.379 1.00 90.82  ? 374 MET A SD  1 
ATOM   907  C  CE  . MET A 1 114 ? -4.383  -8.330  -45.014 1.00 94.86  ? 374 MET A CE  1 
ATOM   908  N  N   . GLY A 1 115 ? -8.724  -13.548 -41.321 1.00 68.28  ? 375 GLY A N   1 
ATOM   909  C  CA  . GLY A 1 115 ? -8.822  -14.572 -40.325 1.00 64.86  ? 375 GLY A CA  1 
ATOM   910  C  C   . GLY A 1 115 ? -8.163  -14.197 -39.017 1.00 62.46  ? 375 GLY A C   1 
ATOM   911  O  O   . GLY A 1 115 ? -7.926  -15.080 -38.198 1.00 63.87  ? 375 GLY A O   1 
ATOM   912  N  N   . ARG A 1 116 ? -7.867  -12.920 -38.783 1.00 58.12  ? 376 ARG A N   1 
ATOM   913  C  CA  . ARG A 1 116 ? -7.176  -12.570 -37.534 1.00 59.51  ? 376 ARG A CA  1 
ATOM   914  C  C   . ARG A 1 116 ? -7.545  -11.257 -36.827 1.00 59.19  ? 376 ARG A C   1 
ATOM   915  O  O   . ARG A 1 116 ? -7.115  -11.023 -35.697 1.00 58.31  ? 376 ARG A O   1 
ATOM   916  C  CB  . ARG A 1 116 ? -5.668  -12.680 -37.730 1.00 63.55  ? 376 ARG A CB  1 
ATOM   917  C  CG  . ARG A 1 116 ? -5.118  -11.721 -38.729 1.00 72.02  ? 376 ARG A CG  1 
ATOM   918  C  CD  . ARG A 1 116 ? -3.725  -12.109 -39.225 1.00 76.82  ? 376 ARG A CD  1 
ATOM   919  N  NE  . ARG A 1 116 ? -2.735  -11.994 -38.164 1.00 79.19  ? 376 ARG A NE  1 
ATOM   920  C  CZ  . ARG A 1 116 ? -1.429  -11.822 -38.338 1.00 82.93  ? 376 ARG A CZ  1 
ATOM   921  N  NH1 . ARG A 1 116 ? -0.904  -11.712 -39.552 1.00 84.18  ? 376 ARG A NH1 1 
ATOM   922  N  NH2 . ARG A 1 116 ? -0.637  -11.753 -37.272 1.00 84.49  ? 376 ARG A NH2 1 
ATOM   923  N  N   . MET A 1 117 ? -8.370  -10.421 -37.448 1.00 57.57  ? 377 MET A N   1 
ATOM   924  C  CA  . MET A 1 117 ? -8.720  -9.132  -36.846 1.00 55.60  ? 377 MET A CA  1 
ATOM   925  C  C   . MET A 1 117 ? -9.949  -9.247  -35.994 1.00 49.63  ? 377 MET A C   1 
ATOM   926  O  O   . MET A 1 117 ? -10.698 -10.188 -36.109 1.00 48.65  ? 377 MET A O   1 
ATOM   927  C  CB  . MET A 1 117 ? -8.905  -8.048  -37.909 1.00 58.10  ? 377 MET A CB  1 
ATOM   928  C  CG  . MET A 1 117 ? -7.652  -7.804  -38.721 1.00 62.23  ? 377 MET A CG  1 
ATOM   929  S  SD  . MET A 1 117 ? -7.799  -6.378  -39.813 1.00 73.19  ? 377 MET A SD  1 
ATOM   930  C  CE  . MET A 1 117 ? -7.258  -5.131  -38.636 1.00 65.13  ? 377 MET A CE  1 
ATOM   931  N  N   . GLY A 1 118 ? -10.159 -8.255  -35.145 1.00 47.39  ? 378 GLY A N   1 
ATOM   932  C  CA  . GLY A 1 118 ? -11.155 -8.363  -34.089 1.00 47.52  ? 378 GLY A CA  1 
ATOM   933  C  C   . GLY A 1 118 ? -12.563 -7.923  -34.377 1.00 51.19  ? 378 GLY A C   1 
ATOM   934  O  O   . GLY A 1 118 ? -13.306 -7.699  -33.441 1.00 53.80  ? 378 GLY A O   1 
ATOM   935  N  N   . ASN A 1 119 ? -12.928 -7.773  -35.651 1.00 52.05  ? 379 ASN A N   1 
ATOM   936  C  CA  . ASN A 1 119 ? -14.322 -7.509  -36.046 1.00 49.80  ? 379 ASN A CA  1 
ATOM   937  C  C   . ASN A 1 119 ? -15.238 -8.692  -35.713 1.00 49.46  ? 379 ASN A C   1 
ATOM   938  O  O   . ASN A 1 119 ? -16.433 -8.535  -35.485 1.00 51.22  ? 379 ASN A O   1 
ATOM   939  C  CB  . ASN A 1 119 ? -14.415 -7.147  -37.526 1.00 53.09  ? 379 ASN A CB  1 
ATOM   940  C  CG  . ASN A 1 119 ? -13.841 -8.226  -38.464 1.00 61.52  ? 379 ASN A CG  1 
ATOM   941  O  OD1 . ASN A 1 119 ? -12.628 -8.453  -38.531 1.00 63.68  ? 379 ASN A OD1 1 
ATOM   942  N  ND2 . ASN A 1 119 ? -14.718 -8.845  -39.241 1.00 65.60  ? 379 ASN A ND2 1 
ATOM   943  N  N   . LYS A 1 120 ? -14.647 -9.879  -35.714 1.00 49.37  ? 380 LYS A N   1 
ATOM   944  C  CA  . LYS A 1 120 ? -15.248 -11.094 -35.190 1.00 52.14  ? 380 LYS A CA  1 
ATOM   945  C  C   . LYS A 1 120 ? -14.174 -11.831 -34.367 1.00 53.61  ? 380 LYS A C   1 
ATOM   946  O  O   . LYS A 1 120 ? -12.983 -11.556 -34.501 1.00 54.75  ? 380 LYS A O   1 
ATOM   947  C  CB  . LYS A 1 120 ? -15.752 -11.970 -36.340 1.00 53.67  ? 380 LYS A CB  1 
ATOM   948  C  CG  . LYS A 1 120 ? -17.261 -11.938 -36.565 1.00 55.30  ? 380 LYS A CG  1 
ATOM   949  C  CD  . LYS A 1 120 ? -17.676 -10.790 -37.427 1.00 59.09  ? 380 LYS A CD  1 
ATOM   950  C  CE  . LYS A 1 120 ? -19.029 -10.206 -37.025 1.00 62.18  ? 380 LYS A CE  1 
ATOM   951  N  NZ  . LYS A 1 120 ? -19.306 -8.972  -37.855 1.00 69.52  ? 380 LYS A NZ  1 
ATOM   952  N  N   . GLY A 1 121 ? -14.571 -12.752 -33.506 1.00 53.19  ? 381 GLY A N   1 
ATOM   953  C  CA  . GLY A 1 121 ? -13.589 -13.488 -32.704 1.00 53.84  ? 381 GLY A CA  1 
ATOM   954  C  C   . GLY A 1 121 ? -14.121 -13.818 -31.322 1.00 52.66  ? 381 GLY A C   1 
ATOM   955  O  O   . GLY A 1 121 ? -15.334 -13.923 -31.138 1.00 53.98  ? 381 GLY A O   1 
ATOM   956  N  N   . GLY A 1 122 ? -13.215 -13.969 -30.356 1.00 43.94  ? 382 GLY A N   1 
ATOM   957  C  CA  . GLY A 1 122 ? -13.586 -14.420 -29.028 1.00 40.63  ? 382 GLY A CA  1 
ATOM   958  C  C   . GLY A 1 122 ? -12.779 -13.733 -27.958 1.00 41.74  ? 382 GLY A C   1 
ATOM   959  O  O   . GLY A 1 122 ? -11.656 -13.289 -28.206 1.00 44.19  ? 382 GLY A O   1 
ATOM   960  N  N   . VAL A 1 123 ? -13.370 -13.604 -26.780 1.00 39.90  ? 383 VAL A N   1 
ATOM   961  C  CA  . VAL A 1 123 ? -12.614 -13.241 -25.592 1.00 42.16  ? 383 VAL A CA  1 
ATOM   962  C  C   . VAL A 1 123 ? -12.965 -14.212 -24.498 1.00 40.30  ? 383 VAL A C   1 
ATOM   963  O  O   . VAL A 1 123 ? -14.017 -14.837 -24.544 1.00 40.74  ? 383 VAL A O   1 
ATOM   964  C  CB  . VAL A 1 123 ? -12.884 -11.806 -25.147 1.00 38.52  ? 383 VAL A CB  1 
ATOM   965  C  CG1 . VAL A 1 123 ? -12.546 -10.840 -26.296 1.00 39.37  ? 383 VAL A CG1 1 
ATOM   966  C  CG2 . VAL A 1 123 ? -14.301 -11.655 -24.648 1.00 30.28  ? 383 VAL A CG2 1 
ATOM   967  N  N   . ALA A 1 124 ? -12.076 -14.362 -23.530 1.00 37.55  ? 384 ALA A N   1 
ATOM   968  C  CA  . ALA A 1 124 ? -12.271 -15.339 -22.448 1.00 38.60  ? 384 ALA A CA  1 
ATOM   969  C  C   . ALA A 1 124 ? -11.646 -14.877 -21.118 1.00 42.16  ? 384 ALA A C   1 
ATOM   970  O  O   . ALA A 1 124 ? -10.617 -14.172 -21.099 1.00 40.92  ? 384 ALA A O   1 
ATOM   971  C  CB  . ALA A 1 124 ? -11.698 -16.669 -22.859 1.00 38.64  ? 384 ALA A CB  1 
ATOM   972  N  N   . ILE A 1 125 ? -12.292 -15.255 -20.011 1.00 39.63  ? 385 ILE A N   1 
ATOM   973  C  CA  . ILE A 1 125 ? -11.733 -15.066 -18.676 1.00 40.66  ? 385 ILE A CA  1 
ATOM   974  C  C   . ILE A 1 125 ? -11.741 -16.430 -18.049 1.00 39.83  ? 385 ILE A C   1 
ATOM   975  O  O   . ILE A 1 125 ? -12.780 -17.056 -18.007 1.00 41.11  ? 385 ILE A O   1 
ATOM   976  C  CB  . ILE A 1 125 ? -12.594 -14.106 -17.804 1.00 37.33  ? 385 ILE A CB  1 
ATOM   977  C  CG1 . ILE A 1 125 ? -12.696 -12.700 -18.436 1.00 37.27  ? 385 ILE A CG1 1 
ATOM   978  C  CG2 . ILE A 1 125 ? -12.018 -13.961 -16.425 1.00 33.43  ? 385 ILE A CG2 1 
ATOM   979  C  CD1 . ILE A 1 125 ? -13.761 -11.791 -17.797 1.00 32.74  ? 385 ILE A CD1 1 
ATOM   980  N  N   . ARG A 1 126 ? -10.598 -16.910 -17.591 1.00 38.37  ? 386 ARG A N   1 
ATOM   981  C  CA  . ARG A 1 126 ? -10.585 -18.111 -16.765 1.00 42.33  ? 386 ARG A CA  1 
ATOM   982  C  C   . ARG A 1 126 ? -10.076 -17.773 -15.393 1.00 43.91  ? 386 ARG A C   1 
ATOM   983  O  O   . ARG A 1 126 ? -9.332  -16.806 -15.205 1.00 44.25  ? 386 ARG A O   1 
ATOM   984  C  CB  . ARG A 1 126 ? -9.749  -19.257 -17.353 1.00 38.38  ? 386 ARG A CB  1 
ATOM   985  C  CG  . ARG A 1 126 ? -8.266  -18.962 -17.491 1.00 35.90  ? 386 ARG A CG  1 
ATOM   986  C  CD  . ARG A 1 126 ? -7.514  -19.186 -16.210 1.00 40.31  ? 386 ARG A CD  1 
ATOM   987  N  NE  . ARG A 1 126 ? -7.609  -20.584 -15.821 1.00 44.58  ? 386 ARG A NE  1 
ATOM   988  C  CZ  . ARG A 1 126 ? -7.246  -21.051 -14.637 1.00 46.13  ? 386 ARG A CZ  1 
ATOM   989  N  NH1 . ARG A 1 126 ? -6.748  -20.253 -13.700 1.00 47.54  ? 386 ARG A NH1 1 
ATOM   990  N  NH2 . ARG A 1 126 ? -7.373  -22.330 -14.397 1.00 45.86  ? 386 ARG A NH2 1 
ATOM   991  N  N   . PHE A 1 127 ? -10.462 -18.598 -14.437 1.00 40.90  ? 387 PHE A N   1 
ATOM   992  C  CA  . PHE A 1 127 ? -10.089 -18.369 -13.080 1.00 43.96  ? 387 PHE A CA  1 
ATOM   993  C  C   . PHE A 1 127 ? -10.285 -19.609 -12.244 1.00 47.09  ? 387 PHE A C   1 
ATOM   994  O  O   . PHE A 1 127 ? -10.915 -20.595 -12.647 1.00 44.82  ? 387 PHE A O   1 
ATOM   995  C  CB  . PHE A 1 127 ? -10.897 -17.203 -12.524 1.00 41.48  ? 387 PHE A CB  1 
ATOM   996  C  CG  . PHE A 1 127 ? -12.373 -17.408 -12.561 1.00 44.27  ? 387 PHE A CG  1 
ATOM   997  C  CD1 . PHE A 1 127 ? -13.061 -17.799 -11.427 1.00 45.77  ? 387 PHE A CD1 1 
ATOM   998  C  CD2 . PHE A 1 127 ? -13.087 -17.188 -13.711 1.00 44.65  ? 387 PHE A CD2 1 
ATOM   999  C  CE1 . PHE A 1 127 ? -14.455 -17.996 -11.457 1.00 44.90  ? 387 PHE A CE1 1 
ATOM   1000 C  CE2 . PHE A 1 127 ? -14.478 -17.368 -13.742 1.00 44.78  ? 387 PHE A CE2 1 
ATOM   1001 C  CZ  . PHE A 1 127 ? -15.158 -17.771 -12.611 1.00 44.06  ? 387 PHE A CZ  1 
ATOM   1002 N  N   . GLN A 1 128 ? -9.715  -19.570 -11.064 1.00 47.40  ? 388 GLN A N   1 
ATOM   1003 C  CA  . GLN A 1 128 ? -9.979  -20.607 -10.108 1.00 53.22  ? 388 GLN A CA  1 
ATOM   1004 C  C   . GLN A 1 128 ? -10.925 -20.031 -9.041  1.00 51.12  ? 388 GLN A C   1 
ATOM   1005 O  O   . GLN A 1 128 ? -10.739 -18.886 -8.590  1.00 47.44  ? 388 GLN A O   1 
ATOM   1006 C  CB  . GLN A 1 128 ? -8.670  -21.099 -9.508  1.00 58.25  ? 388 GLN A CB  1 
ATOM   1007 C  CG  . GLN A 1 128 ? -8.460  -22.587 -9.659  1.00 65.34  ? 388 GLN A CG  1 
ATOM   1008 C  CD  . GLN A 1 128 ? -7.721  -23.159 -8.493  1.00 75.27  ? 388 GLN A CD  1 
ATOM   1009 O  OE1 . GLN A 1 128 ? -6.803  -22.539 -7.963  1.00 78.99  ? 388 GLN A OE1 1 
ATOM   1010 N  NE2 . GLN A 1 128 ? -8.119  -24.343 -8.072  1.00 79.55  ? 388 GLN A NE2 1 
ATOM   1011 N  N   . PHE A 1 129 ? -11.938 -20.819 -8.668  1.00 48.18  ? 389 PHE A N   1 
ATOM   1012 C  CA  . PHE A 1 129 ? -12.869 -20.456 -7.600  1.00 48.95  ? 389 PHE A CA  1 
ATOM   1013 C  C   . PHE A 1 129 ? -12.841 -21.565 -6.591  1.00 49.97  ? 389 PHE A C   1 
ATOM   1014 O  O   . PHE A 1 129 ? -13.295 -22.665 -6.880  1.00 50.35  ? 389 PHE A O   1 
ATOM   1015 C  CB  . PHE A 1 129 ? -14.277 -20.297 -8.164  1.00 47.72  ? 389 PHE A CB  1 
ATOM   1016 C  CG  . PHE A 1 129 ? -15.304 -19.827 -7.166  1.00 51.55  ? 389 PHE A CG  1 
ATOM   1017 C  CD1 . PHE A 1 129 ? -14.959 -19.053 -6.075  1.00 54.80  ? 389 PHE A CD1 1 
ATOM   1018 C  CD2 . PHE A 1 129 ? -16.645 -20.112 -7.372  1.00 50.52  ? 389 PHE A CD2 1 
ATOM   1019 C  CE1 . PHE A 1 129 ? -15.944 -18.602 -5.179  1.00 52.70  ? 389 PHE A CE1 1 
ATOM   1020 C  CE2 . PHE A 1 129 ? -17.628 -19.674 -6.492  1.00 51.21  ? 389 PHE A CE2 1 
ATOM   1021 C  CZ  . PHE A 1 129 ? -17.279 -18.922 -5.395  1.00 52.06  ? 389 PHE A CZ  1 
ATOM   1022 N  N   . HIS A 1 130 ? -12.314 -21.277 -5.408  1.00 49.27  ? 390 HIS A N   1 
ATOM   1023 C  CA  . HIS A 1 130 ? -11.991 -22.316 -4.433  1.00 51.21  ? 390 HIS A CA  1 
ATOM   1024 C  C   . HIS A 1 130 ? -11.052 -23.310 -5.108  1.00 53.06  ? 390 HIS A C   1 
ATOM   1025 O  O   . HIS A 1 130 ? -9.969  -22.931 -5.484  1.00 56.28  ? 390 HIS A O   1 
ATOM   1026 C  CB  . HIS A 1 130 ? -13.252 -22.961 -3.819  1.00 48.96  ? 390 HIS A CB  1 
ATOM   1027 C  CG  . HIS A 1 130 ? -14.025 -22.034 -2.942  1.00 48.93  ? 390 HIS A CG  1 
ATOM   1028 N  ND1 . HIS A 1 130 ? -13.748 -21.876 -1.602  1.00 53.61  ? 390 HIS A ND1 1 
ATOM   1029 C  CD2 . HIS A 1 130 ? -15.034 -21.180 -3.223  1.00 47.82  ? 390 HIS A CD2 1 
ATOM   1030 C  CE1 . HIS A 1 130 ? -14.556 -20.962 -1.095  1.00 53.67  ? 390 HIS A CE1 1 
ATOM   1031 N  NE2 . HIS A 1 130 ? -15.348 -20.526 -2.058  1.00 53.71  ? 390 HIS A NE2 1 
ATOM   1032 N  N   . ASN A 1 131 ? -11.447 -24.556 -5.304  1.00 54.53  ? 391 ASN A N   1 
ATOM   1033 C  CA  . ASN A 1 131 ? -10.579 -25.506 -5.992  1.00 57.61  ? 391 ASN A CA  1 
ATOM   1034 C  C   . ASN A 1 131 ? -11.158 -25.997 -7.297  1.00 61.20  ? 391 ASN A C   1 
ATOM   1035 O  O   . ASN A 1 131 ? -10.950 -27.140 -7.663  1.00 70.01  ? 391 ASN A O   1 
ATOM   1036 C  CB  . ASN A 1 131 ? -10.267 -26.689 -5.088  1.00 61.17  ? 391 ASN A CB  1 
ATOM   1037 C  CG  . ASN A 1 131 ? -9.113  -26.406 -4.166  1.00 72.84  ? 391 ASN A CG  1 
ATOM   1038 O  OD1 . ASN A 1 131 ? -8.879  -25.259 -3.736  1.00 74.61  ? 391 ASN A OD1 1 
ATOM   1039 N  ND2 . ASN A 1 131 ? -8.360  -27.446 -3.864  1.00 82.41  ? 391 ASN A ND2 1 
ATOM   1040 N  N   . THR A 1 132 ? -11.886 -25.140 -7.995  1.00 56.54  ? 392 THR A N   1 
ATOM   1041 C  CA  . THR A 1 132 ? -12.476 -25.503 -9.267  1.00 52.59  ? 392 THR A CA  1 
ATOM   1042 C  C   . THR A 1 132 ? -12.054 -24.492 -10.333 1.00 52.01  ? 392 THR A C   1 
ATOM   1043 O  O   . THR A 1 132 ? -12.028 -23.283 -10.071 1.00 49.31  ? 392 THR A O   1 
ATOM   1044 C  CB  . THR A 1 132 ? -14.002 -25.612 -9.130  1.00 51.75  ? 392 THR A CB  1 
ATOM   1045 O  OG1 . THR A 1 132 ? -14.299 -26.747 -8.304  1.00 56.42  ? 392 THR A OG1 1 
ATOM   1046 C  CG2 . THR A 1 132 ? -14.672 -25.786 -10.472 1.00 49.27  ? 392 THR A CG2 1 
ATOM   1047 N  N   . SER A 1 133 ? -11.697 -25.010 -11.511 1.00 49.62  ? 393 SER A N   1 
ATOM   1048 C  CA  . SER A 1 133 ? -11.162 -24.206 -12.577 1.00 47.66  ? 393 SER A CA  1 
ATOM   1049 C  C   . SER A 1 133 ? -12.305 -23.897 -13.502 1.00 47.31  ? 393 SER A C   1 
ATOM   1050 O  O   . SER A 1 133 ? -13.055 -24.787 -13.835 1.00 50.07  ? 393 SER A O   1 
ATOM   1051 C  CB  . SER A 1 133 ? -10.069 -24.975 -13.319 1.00 48.85  ? 393 SER A CB  1 
ATOM   1052 O  OG  . SER A 1 133 ? -10.524 -26.244 -13.755 1.00 50.32  ? 393 SER A OG  1 
ATOM   1053 N  N   . ILE A 1 134 ? -12.447 -22.642 -13.908 1.00 46.35  ? 394 ILE A N   1 
ATOM   1054 C  CA  . ILE A 1 134 ? -13.588 -22.214 -14.727 1.00 45.62  ? 394 ILE A CA  1 
ATOM   1055 C  C   . ILE A 1 134 ? -13.100 -21.326 -15.861 1.00 45.40  ? 394 ILE A C   1 
ATOM   1056 O  O   . ILE A 1 134 ? -12.204 -20.483 -15.669 1.00 42.50  ? 394 ILE A O   1 
ATOM   1057 C  CB  . ILE A 1 134 ? -14.609 -21.370 -13.907 1.00 40.17  ? 394 ILE A CB  1 
ATOM   1058 C  CG1 . ILE A 1 134 ? -15.000 -22.088 -12.604 1.00 39.99  ? 394 ILE A CG1 1 
ATOM   1059 C  CG2 . ILE A 1 134 ? -15.838 -21.036 -14.737 1.00 29.48  ? 394 ILE A CG2 1 
ATOM   1060 C  CD1 . ILE A 1 134 ? -15.848 -21.256 -11.686 1.00 36.92  ? 394 ILE A CD1 1 
ATOM   1061 N  N   . CYS A 1 135 ? -13.698 -21.497 -17.038 1.00 44.38  ? 395 CYS A N   1 
ATOM   1062 C  CA  . CYS A 1 135 ? -13.372 -20.654 -18.167 1.00 44.58  ? 395 CYS A CA  1 
ATOM   1063 C  C   . CYS A 1 135 ? -14.650 -20.266 -18.841 1.00 43.52  ? 395 CYS A C   1 
ATOM   1064 O  O   . CYS A 1 135 ? -15.470 -21.122 -19.115 1.00 47.43  ? 395 CYS A O   1 
ATOM   1065 C  CB  . CYS A 1 135 ? -12.439 -21.382 -19.148 1.00 42.83  ? 395 CYS A CB  1 
ATOM   1066 S  SG  . CYS A 1 135 ? -12.021 -20.364 -20.606 1.00 48.75  ? 395 CYS A SG  1 
ATOM   1067 N  N   . VAL A 1 136 ? -14.804 -18.973 -19.097 1.00 37.06  ? 396 VAL A N   1 
ATOM   1068 C  CA  . VAL A 1 136 ? -15.995 -18.388 -19.687 1.00 36.34  ? 396 VAL A CA  1 
ATOM   1069 C  C   . VAL A 1 136 ? -15.596 -17.659 -20.958 1.00 40.04  ? 396 VAL A C   1 
ATOM   1070 O  O   . VAL A 1 136 ? -14.769 -16.776 -20.923 1.00 41.52  ? 396 VAL A O   1 
ATOM   1071 C  CB  . VAL A 1 136 ? -16.590 -17.358 -18.736 1.00 36.01  ? 396 VAL A CB  1 
ATOM   1072 C  CG1 . VAL A 1 136 ? -17.855 -16.731 -19.319 1.00 31.92  ? 396 VAL A CG1 1 
ATOM   1073 C  CG2 . VAL A 1 136 ? -16.849 -18.014 -17.364 1.00 36.64  ? 396 VAL A CG2 1 
ATOM   1074 N  N   . VAL A 1 137 ? -16.184 -18.047 -22.081 1.00 44.00  ? 397 VAL A N   1 
ATOM   1075 C  CA  . VAL A 1 137 ? -15.846 -17.500 -23.389 1.00 45.98  ? 397 VAL A CA  1 
ATOM   1076 C  C   . VAL A 1 137 ? -17.059 -16.769 -23.914 1.00 45.23  ? 397 VAL A C   1 
ATOM   1077 O  O   . VAL A 1 137 ? -18.191 -17.262 -23.812 1.00 49.01  ? 397 VAL A O   1 
ATOM   1078 C  CB  . VAL A 1 137 ? -15.506 -18.633 -24.411 1.00 44.41  ? 397 VAL A CB  1 
ATOM   1079 C  CG1 . VAL A 1 137 ? -14.921 -18.049 -25.713 1.00 41.71  ? 397 VAL A CG1 1 
ATOM   1080 C  CG2 . VAL A 1 137 ? -14.564 -19.686 -23.792 1.00 41.89  ? 397 VAL A CG2 1 
ATOM   1081 N  N   . ASN A 1 138 ? -16.813 -15.587 -24.457 1.00 42.19  ? 398 ASN A N   1 
ATOM   1082 C  CA  . ASN A 1 138 ? -17.800 -14.807 -25.203 1.00 44.60  ? 398 ASN A CA  1 
ATOM   1083 C  C   . ASN A 1 138 ? -17.264 -14.649 -26.626 1.00 46.98  ? 398 ASN A C   1 
ATOM   1084 O  O   . ASN A 1 138 ? -16.131 -14.191 -26.822 1.00 47.39  ? 398 ASN A O   1 
ATOM   1085 C  CB  . ASN A 1 138 ? -17.962 -13.423 -24.564 1.00 41.31  ? 398 ASN A CB  1 
ATOM   1086 C  CG  . ASN A 1 138 ? -18.747 -12.460 -25.428 1.00 43.08  ? 398 ASN A CG  1 
ATOM   1087 O  OD1 . ASN A 1 138 ? -19.445 -12.869 -26.349 1.00 47.85  ? 398 ASN A OD1 1 
ATOM   1088 N  ND2 . ASN A 1 138 ? -18.648 -11.173 -25.124 1.00 39.22  ? 398 ASN A ND2 1 
ATOM   1089 N  N   . SER A 1 139 ? -18.063 -15.020 -27.613 1.00 44.72  ? 399 SER A N   1 
ATOM   1090 C  CA  . SER A 1 139 ? -17.579 -15.010 -28.974 1.00 47.72  ? 399 SER A CA  1 
ATOM   1091 C  C   . SER A 1 139 ? -18.602 -14.420 -29.901 1.00 48.01  ? 399 SER A C   1 
ATOM   1092 O  O   . SER A 1 139 ? -19.789 -14.514 -29.631 1.00 49.13  ? 399 SER A O   1 
ATOM   1093 C  CB  . SER A 1 139 ? -17.252 -16.423 -29.413 1.00 46.82  ? 399 SER A CB  1 
ATOM   1094 O  OG  . SER A 1 139 ? -18.421 -17.215 -29.527 1.00 49.33  ? 399 SER A OG  1 
ATOM   1095 N  N   . HIS A 1 140 ? -18.122 -13.824 -30.993 1.00 49.45  ? 400 HIS A N   1 
ATOM   1096 C  CA  . HIS A 1 140 ? -18.954 -13.239 -32.041 1.00 48.98  ? 400 HIS A CA  1 
ATOM   1097 C  C   . HIS A 1 140 ? -18.475 -13.811 -33.375 1.00 51.55  ? 400 HIS A C   1 
ATOM   1098 O  O   . HIS A 1 140 ? -17.399 -13.452 -33.846 1.00 52.20  ? 400 HIS A O   1 
ATOM   1099 C  CB  . HIS A 1 140 ? -18.810 -11.727 -32.009 1.00 46.47  ? 400 HIS A CB  1 
ATOM   1100 C  CG  . HIS A 1 140 ? -19.811 -10.999 -32.849 1.00 51.56  ? 400 HIS A CG  1 
ATOM   1101 N  ND1 . HIS A 1 140 ? -19.658 -9.673  -33.201 1.00 52.36  ? 400 HIS A ND1 1 
ATOM   1102 C  CD2 . HIS A 1 140 ? -20.976 -11.404 -33.408 1.00 51.64  ? 400 HIS A CD2 1 
ATOM   1103 C  CE1 . HIS A 1 140 ? -20.687 -9.297  -33.942 1.00 51.91  ? 400 HIS A CE1 1 
ATOM   1104 N  NE2 . HIS A 1 140 ? -21.498 -10.326 -34.084 1.00 52.21  ? 400 HIS A NE2 1 
ATOM   1105 N  N   . LEU A 1 141 ? -19.253 -14.721 -33.961 1.00 50.57  ? 401 LEU A N   1 
ATOM   1106 C  CA  . LEU A 1 141 ? -18.791 -15.504 -35.109 1.00 54.15  ? 401 LEU A CA  1 
ATOM   1107 C  C   . LEU A 1 141 ? -19.323 -14.950 -36.420 1.00 53.67  ? 401 LEU A C   1 
ATOM   1108 O  O   . LEU A 1 141 ? -20.298 -14.201 -36.428 1.00 57.02  ? 401 LEU A O   1 
ATOM   1109 C  CB  . LEU A 1 141 ? -19.228 -16.961 -34.962 1.00 53.98  ? 401 LEU A CB  1 
ATOM   1110 C  CG  . LEU A 1 141 ? -18.967 -17.626 -33.606 1.00 49.94  ? 401 LEU A CG  1 
ATOM   1111 C  CD1 . LEU A 1 141 ? -19.421 -19.082 -33.619 1.00 48.57  ? 401 LEU A CD1 1 
ATOM   1112 C  CD2 . LEU A 1 141 ? -17.504 -17.505 -33.198 1.00 46.18  ? 401 LEU A CD2 1 
ATOM   1113 N  N   . ALA A 1 142 ? -18.676 -15.323 -37.523 1.00 52.24  ? 402 ALA A N   1 
ATOM   1114 C  CA  . ALA A 1 142 ? -19.037 -14.870 -38.887 1.00 48.11  ? 402 ALA A CA  1 
ATOM   1115 C  C   . ALA A 1 142 ? -20.532 -14.716 -39.077 1.00 52.12  ? 402 ALA A C   1 
ATOM   1116 O  O   . ALA A 1 142 ? -21.288 -15.577 -38.664 1.00 56.40  ? 402 ALA A O   1 
ATOM   1117 C  CB  . ALA A 1 142 ? -18.487 -15.841 -39.932 1.00 42.09  ? 402 ALA A CB  1 
ATOM   1118 N  N   . ALA A 1 143 ? -20.946 -13.631 -39.733 1.00 54.80  ? 403 ALA A N   1 
ATOM   1119 C  CA  . ALA A 1 143 ? -22.371 -13.361 -40.008 1.00 60.16  ? 403 ALA A CA  1 
ATOM   1120 C  C   . ALA A 1 143 ? -22.942 -13.867 -41.352 1.00 63.71  ? 403 ALA A C   1 
ATOM   1121 O  O   . ALA A 1 143 ? -24.139 -13.728 -41.578 1.00 67.65  ? 403 ALA A O   1 
ATOM   1122 C  CB  . ALA A 1 143 ? -22.650 -11.865 -39.866 1.00 59.41  ? 403 ALA A CB  1 
ATOM   1123 N  N   . HIS A 1 144 ? -22.142 -14.438 -42.248 1.00 61.22  ? 404 HIS A N   1 
ATOM   1124 C  CA  . HIS A 1 144 ? -22.690 -14.828 -43.567 1.00 67.45  ? 404 HIS A CA  1 
ATOM   1125 C  C   . HIS A 1 144 ? -23.951 -15.713 -43.402 1.00 71.32  ? 404 HIS A C   1 
ATOM   1126 O  O   . HIS A 1 144 ? -23.925 -16.689 -42.644 1.00 72.24  ? 404 HIS A O   1 
ATOM   1127 C  CB  . HIS A 1 144 ? -21.634 -15.544 -44.427 1.00 70.59  ? 404 HIS A CB  1 
ATOM   1128 C  CG  . HIS A 1 144 ? -21.969 -15.585 -45.890 1.00 81.05  ? 404 HIS A CG  1 
ATOM   1129 N  ND1 . HIS A 1 144 ? -23.021 -16.320 -46.395 1.00 83.38  ? 404 HIS A ND1 1 
ATOM   1130 C  CD2 . HIS A 1 144 ? -21.394 -14.976 -46.958 1.00 82.99  ? 404 HIS A CD2 1 
ATOM   1131 C  CE1 . HIS A 1 144 ? -23.079 -16.164 -47.707 1.00 82.68  ? 404 HIS A CE1 1 
ATOM   1132 N  NE2 . HIS A 1 144 ? -22.102 -15.353 -48.073 1.00 82.15  ? 404 HIS A NE2 1 
ATOM   1133 N  N   . ILE A 1 145 ? -25.049 -15.369 -44.076 1.00 72.77  ? 405 ILE A N   1 
ATOM   1134 C  CA  . ILE A 1 145 ? -26.323 -16.077 -43.871 1.00 77.13  ? 405 ILE A CA  1 
ATOM   1135 C  C   . ILE A 1 145 ? -26.225 -17.574 -44.238 1.00 78.72  ? 405 ILE A C   1 
ATOM   1136 O  O   . ILE A 1 145 ? -26.638 -18.444 -43.479 1.00 77.24  ? 405 ILE A O   1 
ATOM   1137 C  CB  . ILE A 1 145 ? -27.505 -15.407 -44.646 1.00 58.43  ? 405 ILE A CB  1 
ATOM   1138 N  N   . GLU A 1 146 ? -25.648 -17.867 -45.390 1.00 80.71  ? 406 GLU A N   1 
ATOM   1139 C  CA  . GLU A 1 146 ? -25.605 -19.232 -45.914 1.00 82.55  ? 406 GLU A CA  1 
ATOM   1140 C  C   . GLU A 1 146 ? -24.396 -20.026 -45.409 1.00 82.33  ? 406 GLU A C   1 
ATOM   1141 O  O   . GLU A 1 146 ? -24.505 -21.232 -45.189 1.00 80.69  ? 406 GLU A O   1 
ATOM   1142 C  CB  . GLU A 1 146 ? -25.612 -19.203 -47.457 1.00 81.32  ? 406 GLU A CB  1 
ATOM   1143 N  N   . GLU A 1 147 ? -23.259 -19.350 -45.205 1.00 84.09  ? 407 GLU A N   1 
ATOM   1144 C  CA  . GLU A 1 147 ? -21.959 -20.035 -45.114 1.00 84.15  ? 407 GLU A CA  1 
ATOM   1145 C  C   . GLU A 1 147 ? -21.499 -20.214 -43.690 1.00 78.73  ? 407 GLU A C   1 
ATOM   1146 O  O   . GLU A 1 147 ? -20.597 -19.526 -43.218 1.00 74.88  ? 407 GLU A O   1 
ATOM   1147 C  CB  . GLU A 1 147 ? -20.886 -19.323 -45.962 1.00 86.15  ? 407 GLU A CB  1 
ATOM   1148 C  CG  . GLU A 1 147 ? -21.029 -19.584 -47.489 1.00 95.06  ? 407 GLU A CG  1 
ATOM   1149 C  CD  . GLU A 1 147 ? -19.812 -19.125 -48.304 1.00 96.48  ? 407 GLU A CD  1 
ATOM   1150 O  OE1 . GLU A 1 147 ? -18.831 -18.666 -47.670 1.00 97.31  ? 407 GLU A OE1 1 
ATOM   1151 O  OE2 . GLU A 1 147 ? -19.835 -19.223 -49.564 1.00 95.33  ? 407 GLU A OE2 1 
ATOM   1152 N  N   . TYR A 1 148 ? -22.132 -21.170 -43.019 1.00 78.17  ? 408 TYR A N   1 
ATOM   1153 C  CA  . TYR A 1 148 ? -21.813 -21.526 -41.636 1.00 72.29  ? 408 TYR A CA  1 
ATOM   1154 C  C   . TYR A 1 148 ? -20.399 -22.092 -41.471 1.00 75.17  ? 408 TYR A C   1 
ATOM   1155 O  O   . TYR A 1 148 ? -19.878 -22.113 -40.368 1.00 78.90  ? 408 TYR A O   1 
ATOM   1156 C  CB  . TYR A 1 148 ? -22.835 -22.532 -41.092 1.00 70.59  ? 408 TYR A CB  1 
ATOM   1157 C  CG  . TYR A 1 148 ? -22.944 -23.791 -41.916 1.00 75.69  ? 408 TYR A CG  1 
ATOM   1158 C  CD1 . TYR A 1 148 ? -21.964 -24.768 -41.856 1.00 74.84  ? 408 TYR A CD1 1 
ATOM   1159 C  CD2 . TYR A 1 148 ? -24.026 -23.996 -42.776 1.00 79.81  ? 408 TYR A CD2 1 
ATOM   1160 C  CE1 . TYR A 1 148 ? -22.053 -25.915 -42.617 1.00 80.05  ? 408 TYR A CE1 1 
ATOM   1161 C  CE2 . TYR A 1 148 ? -24.124 -25.135 -43.544 1.00 83.60  ? 408 TYR A CE2 1 
ATOM   1162 C  CZ  . TYR A 1 148 ? -23.134 -26.100 -43.465 1.00 85.46  ? 408 TYR A CZ  1 
ATOM   1163 O  OH  . TYR A 1 148 ? -23.210 -27.255 -44.233 1.00 87.08  ? 408 TYR A OH  1 
ATOM   1164 N  N   . GLU A 1 149 ? -19.778 -22.553 -42.549 1.00 75.88  ? 409 GLU A N   1 
ATOM   1165 C  CA  . GLU A 1 149 ? -18.402 -23.049 -42.484 1.00 76.50  ? 409 GLU A CA  1 
ATOM   1166 C  C   . GLU A 1 149 ? -17.475 -21.990 -41.850 1.00 75.07  ? 409 GLU A C   1 
ATOM   1167 O  O   . GLU A 1 149 ? -16.539 -22.318 -41.099 1.00 73.79  ? 409 GLU A O   1 
ATOM   1168 C  CB  . GLU A 1 149 ? -17.896 -23.442 -43.881 1.00 80.06  ? 409 GLU A CB  1 
ATOM   1169 C  CG  . GLU A 1 149 ? -18.706 -24.565 -44.626 1.00 136.89 ? 409 GLU A CG  1 
ATOM   1170 C  CD  . GLU A 1 149 ? -19.873 -24.047 -45.542 1.00 117.69 ? 409 GLU A CD  1 
ATOM   1171 O  OE1 . GLU A 1 149 ? -20.535 -23.032 -45.205 1.00 111.98 ? 409 GLU A OE1 1 
ATOM   1172 O  OE2 . GLU A 1 149 ? -20.142 -24.682 -46.593 1.00 123.55 ? 409 GLU A OE2 1 
ATOM   1173 N  N   . ARG A 1 150 ? -17.765 -20.720 -42.129 1.00 74.28  ? 410 ARG A N   1 
ATOM   1174 C  CA  . ARG A 1 150 ? -17.006 -19.603 -41.576 1.00 70.24  ? 410 ARG A CA  1 
ATOM   1175 C  C   . ARG A 1 150 ? -17.181 -19.457 -40.071 1.00 65.81  ? 410 ARG A C   1 
ATOM   1176 O  O   . ARG A 1 150 ? -16.274 -19.017 -39.375 1.00 62.47  ? 410 ARG A O   1 
ATOM   1177 C  CB  . ARG A 1 150 ? -17.425 -18.305 -42.256 1.00 70.43  ? 410 ARG A CB  1 
ATOM   1178 C  CG  . ARG A 1 150 ? -16.994 -18.208 -43.689 1.00 75.77  ? 410 ARG A CG  1 
ATOM   1179 C  CD  . ARG A 1 150 ? -17.460 -16.901 -44.292 1.00 80.72  ? 410 ARG A CD  1 
ATOM   1180 N  NE  . ARG A 1 150 ? -17.188 -16.820 -45.729 1.00 88.54  ? 410 ARG A NE  1 
ATOM   1181 C  CZ  . ARG A 1 150 ? -17.551 -15.791 -46.492 1.00 93.24  ? 410 ARG A CZ  1 
ATOM   1182 N  NH1 . ARG A 1 150 ? -18.195 -14.751 -45.964 1.00 91.11  ? 410 ARG A NH1 1 
ATOM   1183 N  NH2 . ARG A 1 150 ? -17.276 -15.790 -47.786 1.00 96.48  ? 410 ARG A NH2 1 
ATOM   1184 N  N   . ARG A 1 151 ? -18.354 -19.803 -39.564 1.00 63.68  ? 411 ARG A N   1 
ATOM   1185 C  CA  . ARG A 1 151 ? -18.554 -19.818 -38.118 1.00 61.96  ? 411 ARG A CA  1 
ATOM   1186 C  C   . ARG A 1 151 ? -17.799 -20.983 -37.508 1.00 61.00  ? 411 ARG A C   1 
ATOM   1187 O  O   . ARG A 1 151 ? -17.051 -20.810 -36.566 1.00 63.87  ? 411 ARG A O   1 
ATOM   1188 C  CB  . ARG A 1 151 ? -20.041 -19.864 -37.769 1.00 61.30  ? 411 ARG A CB  1 
ATOM   1189 C  CG  . ARG A 1 151 ? -20.780 -18.603 -38.221 1.00 61.35  ? 411 ARG A CG  1 
ATOM   1190 C  CD  . ARG A 1 151 ? -22.239 -18.655 -37.873 1.00 63.72  ? 411 ARG A CD  1 
ATOM   1191 N  NE  . ARG A 1 151 ? -23.074 -19.112 -38.981 1.00 71.65  ? 411 ARG A NE  1 
ATOM   1192 C  CZ  . ARG A 1 151 ? -23.410 -18.365 -40.030 1.00 73.40  ? 411 ARG A CZ  1 
ATOM   1193 N  NH1 . ARG A 1 151 ? -24.200 -18.866 -40.972 1.00 72.06  ? 411 ARG A NH1 1 
ATOM   1194 N  NH2 . ARG A 1 151 ? -22.950 -17.120 -40.154 1.00 72.29  ? 411 ARG A NH2 1 
ATOM   1195 N  N   . ASN A 1 152 ? -17.956 -22.162 -38.074 1.00 61.50  ? 412 ASN A N   1 
ATOM   1196 C  CA  . ASN A 1 152 ? -17.140 -23.284 -37.651 1.00 62.51  ? 412 ASN A CA  1 
ATOM   1197 C  C   . ASN A 1 152 ? -15.642 -22.939 -37.671 1.00 60.36  ? 412 ASN A C   1 
ATOM   1198 O  O   . ASN A 1 152 ? -14.922 -23.283 -36.741 1.00 59.53  ? 412 ASN A O   1 
ATOM   1199 C  CB  . ASN A 1 152 ? -17.406 -24.525 -38.503 1.00 66.97  ? 412 ASN A CB  1 
ATOM   1200 C  CG  . ASN A 1 152 ? -18.880 -24.897 -38.557 1.00 71.12  ? 412 ASN A CG  1 
ATOM   1201 O  OD1 . ASN A 1 152 ? -19.710 -24.332 -37.832 1.00 66.33  ? 412 ASN A OD1 1 
ATOM   1202 N  ND2 . ASN A 1 152 ? -19.216 -25.846 -39.436 1.00 76.05  ? 412 ASN A ND2 1 
ATOM   1203 N  N   . GLN A 1 153 ? -15.156 -22.259 -38.705 1.00 60.75  ? 413 GLN A N   1 
ATOM   1204 C  CA  . GLN A 1 153 ? -13.741 -21.901 -38.711 1.00 59.35  ? 413 GLN A CA  1 
ATOM   1205 C  C   . GLN A 1 153 ? -13.418 -20.969 -37.546 1.00 62.65  ? 413 GLN A C   1 
ATOM   1206 O  O   . GLN A 1 153 ? -12.391 -21.127 -36.902 1.00 66.14  ? 413 GLN A O   1 
ATOM   1207 C  CB  . GLN A 1 153 ? -13.323 -21.262 -40.019 1.00 58.55  ? 413 GLN A CB  1 
ATOM   1208 C  CG  . GLN A 1 153 ? -11.810 -20.947 -40.095 1.00 65.52  ? 413 GLN A CG  1 
ATOM   1209 C  CD  . GLN A 1 153 ? -10.925 -22.168 -40.392 1.00 74.87  ? 413 GLN A CD  1 
ATOM   1210 O  OE1 . GLN A 1 153 ? -10.900 -22.668 -41.522 1.00 84.42  ? 413 GLN A OE1 1 
ATOM   1211 N  NE2 . GLN A 1 153 ? -10.176 -22.625 -39.389 1.00 70.93  ? 413 GLN A NE2 1 
ATOM   1212 N  N   . ASP A 1 154 ? -14.281 -20.000 -37.264 1.00 60.24  ? 414 ASP A N   1 
ATOM   1213 C  CA  . ASP A 1 154 ? -14.017 -19.086 -36.151 1.00 57.21  ? 414 ASP A CA  1 
ATOM   1214 C  C   . ASP A 1 154 ? -13.968 -19.881 -34.843 1.00 57.17  ? 414 ASP A C   1 
ATOM   1215 O  O   . ASP A 1 154 ? -13.070 -19.710 -34.013 1.00 55.46  ? 414 ASP A O   1 
ATOM   1216 C  CB  . ASP A 1 154 ? -15.081 -17.980 -36.074 1.00 54.91  ? 414 ASP A CB  1 
ATOM   1217 C  CG  . ASP A 1 154 ? -14.960 -16.956 -37.207 1.00 60.79  ? 414 ASP A CG  1 
ATOM   1218 O  OD1 . ASP A 1 154 ? -13.927 -16.933 -37.907 1.00 65.59  ? 414 ASP A OD1 1 
ATOM   1219 O  OD2 . ASP A 1 154 ? -15.903 -16.151 -37.409 1.00 60.45  ? 414 ASP A OD2 1 
ATOM   1220 N  N   . TYR A 1 155 ? -14.926 -20.771 -34.659 1.00 54.74  ? 415 TYR A N   1 
ATOM   1221 C  CA  . TYR A 1 155 ? -14.926 -21.555 -33.458 1.00 54.60  ? 415 TYR A CA  1 
ATOM   1222 C  C   . TYR A 1 155 ? -13.669 -22.417 -33.331 1.00 57.12  ? 415 TYR A C   1 
ATOM   1223 O  O   . TYR A 1 155 ? -13.117 -22.521 -32.247 1.00 60.75  ? 415 TYR A O   1 
ATOM   1224 C  CB  . TYR A 1 155 ? -16.157 -22.430 -33.372 1.00 54.25  ? 415 TYR A CB  1 
ATOM   1225 C  CG  . TYR A 1 155 ? -16.058 -23.376 -32.229 1.00 52.55  ? 415 TYR A CG  1 
ATOM   1226 C  CD1 . TYR A 1 155 ? -16.511 -23.020 -30.986 1.00 51.08  ? 415 TYR A CD1 1 
ATOM   1227 C  CD2 . TYR A 1 155 ? -15.448 -24.618 -32.386 1.00 48.15  ? 415 TYR A CD2 1 
ATOM   1228 C  CE1 . TYR A 1 155 ? -16.393 -23.896 -29.915 1.00 51.69  ? 415 TYR A CE1 1 
ATOM   1229 C  CE2 . TYR A 1 155 ? -15.318 -25.488 -31.337 1.00 47.59  ? 415 TYR A CE2 1 
ATOM   1230 C  CZ  . TYR A 1 155 ? -15.799 -25.125 -30.108 1.00 53.55  ? 415 TYR A CZ  1 
ATOM   1231 O  OH  . TYR A 1 155 ? -15.691 -25.993 -29.072 1.00 56.54  ? 415 TYR A OH  1 
ATOM   1232 N  N   . LYS A 1 156 ? -13.228 -23.040 -34.413 1.00 53.86  ? 416 LYS A N   1 
ATOM   1233 C  CA  . LYS A 1 156 ? -12.044 -23.887 -34.354 1.00 53.29  ? 416 LYS A CA  1 
ATOM   1234 C  C   . LYS A 1 156 ? -10.826 -23.039 -34.004 1.00 53.54  ? 416 LYS A C   1 
ATOM   1235 O  O   . LYS A 1 156 ? -9.980  -23.463 -33.222 1.00 54.92  ? 416 LYS A O   1 
ATOM   1236 C  CB  . LYS A 1 156 ? -11.837 -24.681 -35.667 1.00 52.12  ? 416 LYS A CB  1 
ATOM   1237 N  N   . ASP A 1 157 ? -10.765 -21.827 -34.543 1.00 51.43  ? 417 ASP A N   1 
ATOM   1238 C  CA  . ASP A 1 157 ? -9.619  -20.948 -34.338 1.00 53.61  ? 417 ASP A CA  1 
ATOM   1239 C  C   . ASP A 1 157 ? -9.584  -20.307 -32.923 1.00 56.51  ? 417 ASP A C   1 
ATOM   1240 O  O   . ASP A 1 157 ? -8.508  -20.064 -32.376 1.00 56.55  ? 417 ASP A O   1 
ATOM   1241 C  CB  . ASP A 1 157 ? -9.592  -19.855 -35.421 1.00 56.12  ? 417 ASP A CB  1 
ATOM   1242 C  CG  . ASP A 1 157 ? -9.173  -20.381 -36.804 1.00 65.53  ? 417 ASP A CG  1 
ATOM   1243 O  OD1 . ASP A 1 157 ? -8.840  -21.588 -36.932 1.00 71.11  ? 417 ASP A OD1 1 
ATOM   1244 O  OD2 . ASP A 1 157 ? -9.176  -19.579 -37.774 1.00 64.75  ? 417 ASP A OD2 1 
ATOM   1245 N  N   . ILE A 1 158 ? -10.741 -20.007 -32.335 1.00 48.76  ? 418 ILE A N   1 
ATOM   1246 C  CA  . ILE A 1 158 ? -10.760 -19.541 -30.965 1.00 48.15  ? 418 ILE A CA  1 
ATOM   1247 C  C   . ILE A 1 158 ? -10.167 -20.656 -30.075 1.00 51.41  ? 418 ILE A C   1 
ATOM   1248 O  O   . ILE A 1 158 ? -9.289  -20.416 -29.244 1.00 50.25  ? 418 ILE A O   1 
ATOM   1249 C  CB  . ILE A 1 158 ? -12.202 -19.144 -30.515 1.00 39.99  ? 418 ILE A CB  1 
ATOM   1250 C  CG1 . ILE A 1 158 ? -12.658 -17.877 -31.262 1.00 38.49  ? 418 ILE A CG1 1 
ATOM   1251 C  CG2 . ILE A 1 158 ? -12.288 -18.925 -29.002 1.00 30.69  ? 418 ILE A CG2 1 
ATOM   1252 C  CD1 . ILE A 1 158 ? -14.211 -17.602 -31.201 1.00 39.23  ? 418 ILE A CD1 1 
ATOM   1253 N  N   . CYS A 1 159 ? -10.627 -21.882 -30.277 1.00 52.05  ? 419 CYS A N   1 
ATOM   1254 C  CA  . CYS A 1 159 ? -10.137 -23.009 -29.487 1.00 49.52  ? 419 CYS A CA  1 
ATOM   1255 C  C   . CYS A 1 159 ? -8.643  -23.250 -29.666 1.00 54.95  ? 419 CYS A C   1 
ATOM   1256 O  O   . CYS A 1 159 ? -7.943  -23.481 -28.703 1.00 56.97  ? 419 CYS A O   1 
ATOM   1257 C  CB  . CYS A 1 159 ? -10.924 -24.278 -29.798 1.00 41.62  ? 419 CYS A CB  1 
ATOM   1258 S  SG  . CYS A 1 159 ? -12.628 -24.069 -29.310 1.00 53.94  ? 419 CYS A SG  1 
ATOM   1259 N  N   . SER A 1 160 ? -8.132  -23.180 -30.883 1.00 55.61  ? 420 SER A N   1 
ATOM   1260 C  CA  . SER A 1 160 ? -6.735  -23.532 -31.056 1.00 56.81  ? 420 SER A CA  1 
ATOM   1261 C  C   . SER A 1 160 ? -5.795  -22.382 -30.663 1.00 55.55  ? 420 SER A C   1 
ATOM   1262 O  O   . SER A 1 160 ? -4.658  -22.644 -30.271 1.00 58.19  ? 420 SER A O   1 
ATOM   1263 C  CB  . SER A 1 160 ? -6.453  -24.067 -32.463 1.00 54.63  ? 420 SER A CB  1 
ATOM   1264 O  OG  . SER A 1 160 ? -6.300  -23.011 -33.373 1.00 59.57  ? 420 SER A OG  1 
ATOM   1265 N  N   . ARG A 1 161 ? -6.265  -21.135 -30.709 1.00 49.57  ? 421 ARG A N   1 
ATOM   1266 C  CA  . ARG A 1 161 ? -5.360  -19.996 -30.524 1.00 51.70  ? 421 ARG A CA  1 
ATOM   1267 C  C   . ARG A 1 161 ? -5.471  -19.369 -29.145 1.00 52.34  ? 421 ARG A C   1 
ATOM   1268 O  O   . ARG A 1 161 ? -4.571  -18.655 -28.718 1.00 55.44  ? 421 ARG A O   1 
ATOM   1269 C  CB  . ARG A 1 161 ? -5.570  -18.922 -31.605 1.00 54.29  ? 421 ARG A CB  1 
ATOM   1270 C  CG  . ARG A 1 161 ? -5.849  -19.461 -33.018 1.00 56.15  ? 421 ARG A CG  1 
ATOM   1271 C  CD  . ARG A 1 161 ? -5.226  -18.627 -34.102 1.00 61.79  ? 421 ARG A CD  1 
ATOM   1272 N  NE  . ARG A 1 161 ? -5.990  -17.428 -34.422 1.00 66.70  ? 421 ARG A NE  1 
ATOM   1273 C  CZ  . ARG A 1 161 ? -6.363  -17.047 -35.654 1.00 70.41  ? 421 ARG A CZ  1 
ATOM   1274 N  NH1 . ARG A 1 161 ? -6.073  -17.757 -36.752 1.00 64.10  ? 421 ARG A NH1 1 
ATOM   1275 N  NH2 . ARG A 1 161 ? -7.045  -15.914 -35.780 1.00 73.51  ? 421 ARG A NH2 1 
ATOM   1276 N  N   . MET A 1 162 ? -6.566  -19.631 -28.443 1.00 53.69  ? 422 MET A N   1 
ATOM   1277 C  CA  . MET A 1 162 ? -6.773  -19.063 -27.113 1.00 52.43  ? 422 MET A CA  1 
ATOM   1278 C  C   . MET A 1 162 ? -5.921  -19.857 -26.121 1.00 54.15  ? 422 MET A C   1 
ATOM   1279 O  O   . MET A 1 162 ? -6.146  -21.043 -25.906 1.00 53.78  ? 422 MET A O   1 
ATOM   1280 C  CB  . MET A 1 162 ? -8.261  -19.095 -26.736 1.00 50.40  ? 422 MET A CB  1 
ATOM   1281 C  CG  . MET A 1 162 ? -8.627  -18.411 -25.411 1.00 46.56  ? 422 MET A CG  1 
ATOM   1282 S  SD  . MET A 1 162 ? -8.875  -16.633 -25.502 1.00 53.54  ? 422 MET A SD  1 
ATOM   1283 C  CE  . MET A 1 162 ? -10.407 -16.427 -26.422 1.00 35.67  ? 422 MET A CE  1 
ATOM   1284 N  N   . GLN A 1 163 ? -4.925  -19.180 -25.554 1.00 52.43  ? 423 GLN A N   1 
ATOM   1285 C  CA  . GLN A 1 163 ? -3.982  -19.765 -24.625 1.00 48.94  ? 423 GLN A CA  1 
ATOM   1286 C  C   . GLN A 1 163 ? -3.785  -18.876 -23.396 1.00 53.68  ? 423 GLN A C   1 
ATOM   1287 O  O   . GLN A 1 163 ? -3.430  -17.708 -23.520 1.00 56.00  ? 423 GLN A O   1 
ATOM   1288 C  CB  . GLN A 1 163 ? -2.658  -19.926 -25.319 1.00 46.86  ? 423 GLN A CB  1 
ATOM   1289 C  CG  . GLN A 1 163 ? -2.744  -20.850 -26.515 1.00 58.86  ? 423 GLN A CG  1 
ATOM   1290 C  CD  . GLN A 1 163 ? -1.417  -21.529 -26.814 1.00 66.23  ? 423 GLN A CD  1 
ATOM   1291 O  OE1 . GLN A 1 163 ? -0.362  -20.867 -26.916 1.00 65.55  ? 423 GLN A OE1 1 
ATOM   1292 N  NE2 . GLN A 1 163 ? -1.453  -22.865 -26.914 1.00 68.92  ? 423 GLN A NE2 1 
ATOM   1293 N  N   . PHE A 1 164 ? -4.006  -19.428 -22.210 1.00 49.64  ? 424 PHE A N   1 
ATOM   1294 C  CA  . PHE A 1 164 ? -3.782  -18.691 -20.987 1.00 46.80  ? 424 PHE A CA  1 
ATOM   1295 C  C   . PHE A 1 164 ? -2.434  -19.103 -20.426 1.00 52.46  ? 424 PHE A C   1 
ATOM   1296 O  O   . PHE A 1 164 ? -2.149  -20.295 -20.302 1.00 56.51  ? 424 PHE A O   1 
ATOM   1297 C  CB  . PHE A 1 164 ? -4.862  -19.008 -19.985 1.00 41.33  ? 424 PHE A CB  1 
ATOM   1298 C  CG  . PHE A 1 164 ? -6.240  -18.831 -20.516 1.00 42.09  ? 424 PHE A CG  1 
ATOM   1299 C  CD1 . PHE A 1 164 ? -6.857  -17.597 -20.471 1.00 38.91  ? 424 PHE A CD1 1 
ATOM   1300 C  CD2 . PHE A 1 164 ? -6.923  -19.892 -21.064 1.00 39.89  ? 424 PHE A CD2 1 
ATOM   1301 C  CE1 . PHE A 1 164 ? -8.112  -17.436 -20.938 1.00 37.21  ? 424 PHE A CE1 1 
ATOM   1302 C  CE2 . PHE A 1 164 ? -8.198  -19.724 -21.547 1.00 39.69  ? 424 PHE A CE2 1 
ATOM   1303 C  CZ  . PHE A 1 164 ? -8.795  -18.507 -21.479 1.00 40.07  ? 424 PHE A CZ  1 
ATOM   1304 N  N   . CYS A 1 165 ? -1.608  -18.123 -20.079 1.00 53.51  ? 425 CYS A N   1 
ATOM   1305 C  CA  . CYS A 1 165 ? -0.320  -18.417 -19.494 1.00 61.05  ? 425 CYS A CA  1 
ATOM   1306 C  C   . CYS A 1 165 ? -0.479  -18.772 -18.031 1.00 62.79  ? 425 CYS A C   1 
ATOM   1307 O  O   . CYS A 1 165 ? -1.557  -18.593 -17.434 1.00 59.69  ? 425 CYS A O   1 
ATOM   1308 C  CB  . CYS A 1 165 ? 0.610   -17.223 -19.616 1.00 63.35  ? 425 CYS A CB  1 
ATOM   1309 S  SG  . CYS A 1 165 ? -0.011  -15.875 -18.644 1.00 103.49 ? 425 CYS A SG  1 
ATOM   1310 N  N   . GLN A 1 166 ? 0.605   -19.282 -17.457 1.00 64.65  ? 426 GLN A N   1 
ATOM   1311 C  CA  . GLN A 1 166 ? 0.612   -19.666 -16.059 1.00 67.16  ? 426 GLN A CA  1 
ATOM   1312 C  C   . GLN A 1 166 ? 1.784   -18.995 -15.317 1.00 69.58  ? 426 GLN A C   1 
ATOM   1313 O  O   . GLN A 1 166 ? 2.843   -18.734 -15.906 1.00 69.02  ? 426 GLN A O   1 
ATOM   1314 C  CB  . GLN A 1 166 ? 0.648   -21.199 -15.933 1.00 67.28  ? 426 GLN A CB  1 
ATOM   1315 C  CG  . GLN A 1 166 ? -0.725  -21.858 -16.156 1.00 67.58  ? 426 GLN A CG  1 
ATOM   1316 C  CD  . GLN A 1 166 ? -0.722  -23.399 -16.008 1.00 70.22  ? 426 GLN A CD  1 
ATOM   1317 O  OE1 . GLN A 1 166 ? -1.326  -23.962 -15.077 1.00 65.83  ? 426 GLN A OE1 1 
ATOM   1318 N  NE2 . GLN A 1 166 ? -0.053  -24.076 -16.934 1.00 74.06  ? 426 GLN A NE2 1 
ATOM   1319 N  N   . PRO A 1 167 ? 1.593   -18.700 -14.021 1.00 65.73  ? 427 PRO A N   1 
ATOM   1320 C  CA  . PRO A 1 167 ? 2.661   -18.177 -13.160 1.00 63.45  ? 427 PRO A CA  1 
ATOM   1321 C  C   . PRO A 1 167 ? 3.943   -18.963 -13.251 1.00 63.84  ? 427 PRO A C   1 
ATOM   1322 O  O   . PRO A 1 167 ? 5.027   -18.365 -13.330 1.00 65.53  ? 427 PRO A O   1 
ATOM   1323 C  CB  . PRO A 1 167 ? 2.077   -18.323 -11.748 1.00 60.12  ? 427 PRO A CB  1 
ATOM   1324 C  CG  . PRO A 1 167 ? 0.885   -19.240 -11.903 1.00 58.26  ? 427 PRO A CG  1 
ATOM   1325 C  CD  . PRO A 1 167 ? 0.357   -18.900 -13.253 1.00 59.42  ? 427 PRO A CD  1 
ATOM   1326 N  N   . ASP A 1 168 ? 3.823   -20.291 -13.214 1.00 61.70  ? 428 ASP A N   1 
ATOM   1327 C  CA  . ASP A 1 168 ? 4.994   -21.164 -13.361 1.00 63.78  ? 428 ASP A CA  1 
ATOM   1328 C  C   . ASP A 1 168 ? 5.449   -21.006 -14.804 1.00 65.59  ? 428 ASP A C   1 
ATOM   1329 O  O   . ASP A 1 168 ? 4.710   -21.333 -15.733 1.00 65.30  ? 428 ASP A O   1 
ATOM   1330 C  CB  . ASP A 1 168 ? 4.654   -22.623 -13.036 1.00 61.50  ? 428 ASP A CB  1 
ATOM   1331 C  CG  . ASP A 1 168 ? 5.876   -23.469 -12.764 1.00 67.54  ? 428 ASP A CG  1 
ATOM   1332 O  OD1 . ASP A 1 168 ? 6.918   -23.310 -13.420 1.00 68.39  ? 428 ASP A OD1 1 
ATOM   1333 O  OD2 . ASP A 1 168 ? 5.798   -24.320 -11.868 1.00 75.85  ? 428 ASP A OD2 1 
ATOM   1334 N  N   . PRO A 1 169 ? 6.638   -20.446 -15.005 1.00 71.19  ? 429 PRO A N   1 
ATOM   1335 C  CA  . PRO A 1 169 ? 7.067   -20.198 -16.359 1.00 75.93  ? 429 PRO A CA  1 
ATOM   1336 C  C   . PRO A 1 169 ? 7.681   -21.444 -17.032 1.00 75.50  ? 429 PRO A C   1 
ATOM   1337 O  O   . PRO A 1 169 ? 8.294   -21.333 -18.088 1.00 78.29  ? 429 PRO A O   1 
ATOM   1338 C  CB  . PRO A 1 169 ? 8.118   -19.098 -16.170 1.00 76.70  ? 429 PRO A CB  1 
ATOM   1339 C  CG  . PRO A 1 169 ? 8.801   -19.507 -14.895 1.00 78.82  ? 429 PRO A CG  1 
ATOM   1340 C  CD  . PRO A 1 169 ? 7.652   -20.011 -14.030 1.00 76.66  ? 429 PRO A CD  1 
ATOM   1341 N  N   . SER A 1 170 ? 7.540   -22.611 -16.424 1.00 69.67  ? 430 SER A N   1 
ATOM   1342 C  CA  . SER A 1 170 ? 8.004   -23.839 -17.044 1.00 67.48  ? 430 SER A CA  1 
ATOM   1343 C  C   . SER A 1 170 ? 6.829   -24.781 -17.355 1.00 64.93  ? 430 SER A C   1 
ATOM   1344 O  O   . SER A 1 170 ? 7.038   -25.919 -17.728 1.00 68.53  ? 430 SER A O   1 
ATOM   1345 C  CB  . SER A 1 170 ? 9.028   -24.525 -16.144 1.00 68.14  ? 430 SER A CB  1 
ATOM   1346 O  OG  . SER A 1 170 ? 8.400   -25.115 -15.033 1.00 69.02  ? 430 SER A OG  1 
ATOM   1347 N  N   . LEU A 1 171 ? 5.604   -24.313 -17.218 1.00 57.46  ? 431 LEU A N   1 
ATOM   1348 C  CA  . LEU A 1 171 ? 4.462   -25.142 -17.498 1.00 58.26  ? 431 LEU A CA  1 
ATOM   1349 C  C   . LEU A 1 171 ? 3.840   -24.765 -18.835 1.00 60.73  ? 431 LEU A C   1 
ATOM   1350 O  O   . LEU A 1 171 ? 3.931   -23.616 -19.246 1.00 59.63  ? 431 LEU A O   1 
ATOM   1351 C  CB  . LEU A 1 171 ? 3.420   -24.975 -16.401 1.00 55.81  ? 431 LEU A CB  1 
ATOM   1352 C  CG  . LEU A 1 171 ? 3.810   -25.634 -15.083 1.00 59.55  ? 431 LEU A CG  1 
ATOM   1353 C  CD1 . LEU A 1 171 ? 2.765   -25.345 -14.032 1.00 55.73  ? 431 LEU A CD1 1 
ATOM   1354 C  CD2 . LEU A 1 171 ? 3.973   -27.127 -15.280 1.00 60.40  ? 431 LEU A CD2 1 
ATOM   1355 N  N   . PRO A 1 172 ? 3.183   -25.726 -19.514 1.00 62.17  ? 432 PRO A N   1 
ATOM   1356 C  CA  . PRO A 1 172 ? 2.460   -25.402 -20.750 1.00 56.86  ? 432 PRO A CA  1 
ATOM   1357 C  C   . PRO A 1 172 ? 1.337   -24.441 -20.502 1.00 56.22  ? 432 PRO A C   1 
ATOM   1358 O  O   . PRO A 1 172 ? 0.805   -24.413 -19.413 1.00 57.99  ? 432 PRO A O   1 
ATOM   1359 C  CB  . PRO A 1 172 ? 1.856   -26.735 -21.164 1.00 57.71  ? 432 PRO A CB  1 
ATOM   1360 C  CG  . PRO A 1 172 ? 1.860   -27.564 -19.926 1.00 62.05  ? 432 PRO A CG  1 
ATOM   1361 C  CD  . PRO A 1 172 ? 3.063   -27.153 -19.175 1.00 64.32  ? 432 PRO A CD  1 
ATOM   1362 N  N   . PRO A 1 173 ? 0.946   -23.672 -21.509 1.00 54.22  ? 433 PRO A N   1 
ATOM   1363 C  CA  . PRO A 1 173 ? -0.228  -22.826 -21.341 1.00 50.09  ? 433 PRO A CA  1 
ATOM   1364 C  C   . PRO A 1 173 ? -1.529  -23.619 -21.272 1.00 51.08  ? 433 PRO A C   1 
ATOM   1365 O  O   . PRO A 1 173 ? -1.576  -24.764 -21.733 1.00 58.32  ? 433 PRO A O   1 
ATOM   1366 C  CB  . PRO A 1 173 ? -0.212  -21.960 -22.599 1.00 49.04  ? 433 PRO A CB  1 
ATOM   1367 C  CG  . PRO A 1 173 ? 0.639   -22.672 -23.572 1.00 46.53  ? 433 PRO A CG  1 
ATOM   1368 C  CD  . PRO A 1 173 ? 1.567   -23.526 -22.830 1.00 49.47  ? 433 PRO A CD  1 
ATOM   1369 N  N   . LEU A 1 174 ? -2.571  -23.020 -20.706 1.00 46.08  ? 434 LEU A N   1 
ATOM   1370 C  CA  . LEU A 1 174 ? -3.876  -23.657 -20.652 1.00 45.00  ? 434 LEU A CA  1 
ATOM   1371 C  C   . LEU A 1 174 ? -4.683  -23.226 -21.854 1.00 49.34  ? 434 LEU A C   1 
ATOM   1372 O  O   . LEU A 1 174 ? -4.635  -22.062 -22.259 1.00 50.37  ? 434 LEU A O   1 
ATOM   1373 C  CB  . LEU A 1 174 ? -4.640  -23.253 -19.399 1.00 41.54  ? 434 LEU A CB  1 
ATOM   1374 C  CG  . LEU A 1 174 ? -3.978  -23.517 -18.040 1.00 43.56  ? 434 LEU A CG  1 
ATOM   1375 C  CD1 . LEU A 1 174 ? -4.840  -22.889 -16.965 1.00 39.61  ? 434 LEU A CD1 1 
ATOM   1376 C  CD2 . LEU A 1 174 ? -3.723  -25.006 -17.761 1.00 41.14  ? 434 LEU A CD2 1 
ATOM   1377 N  N   . THR A 1 175 ? -5.443  -24.159 -22.412 1.00 47.78  ? 435 THR A N   1 
ATOM   1378 C  CA  . THR A 1 175 ? -6.403  -23.847 -23.451 1.00 46.23  ? 435 THR A CA  1 
ATOM   1379 C  C   . THR A 1 175 ? -7.779  -23.815 -22.796 1.00 46.97  ? 435 THR A C   1 
ATOM   1380 O  O   . THR A 1 175 ? -7.917  -24.144 -21.638 1.00 51.02  ? 435 THR A O   1 
ATOM   1381 C  CB  . THR A 1 175 ? -6.381  -24.923 -24.512 1.00 47.46  ? 435 THR A CB  1 
ATOM   1382 O  OG1 . THR A 1 175 ? -6.881  -26.139 -23.938 1.00 55.25  ? 435 THR A OG1 1 
ATOM   1383 C  CG2 . THR A 1 175 ? -4.957  -25.157 -25.010 1.00 40.08  ? 435 THR A CG2 1 
ATOM   1384 N  N   . ILE A 1 176 ? -8.803  -23.434 -23.541 1.00 43.09  ? 436 ILE A N   1 
ATOM   1385 C  CA  . ILE A 1 176 ? -10.172 -23.385 -23.036 1.00 41.00  ? 436 ILE A CA  1 
ATOM   1386 C  C   . ILE A 1 176 ? -10.630 -24.730 -22.473 1.00 47.26  ? 436 ILE A C   1 
ATOM   1387 O  O   . ILE A 1 176 ? -11.308 -24.805 -21.462 1.00 52.08  ? 436 ILE A O   1 
ATOM   1388 C  CB  . ILE A 1 176 ? -11.138 -22.958 -24.168 1.00 42.01  ? 436 ILE A CB  1 
ATOM   1389 C  CG1 . ILE A 1 176 ? -10.857 -21.498 -24.582 1.00 47.28  ? 436 ILE A CG1 1 
ATOM   1390 C  CG2 . ILE A 1 176 ? -12.610 -23.132 -23.755 1.00 36.02  ? 436 ILE A CG2 1 
ATOM   1391 C  CD1 . ILE A 1 176 ? -11.475 -21.084 -25.918 1.00 43.31  ? 436 ILE A CD1 1 
ATOM   1392 N  N   . SER A 1 177 ? -10.241 -25.811 -23.105 1.00 48.15  ? 437 SER A N   1 
ATOM   1393 C  CA  . SER A 1 177 ? -10.724 -27.105 -22.670 1.00 49.75  ? 437 SER A CA  1 
ATOM   1394 C  C   . SER A 1 177 ? -10.090 -27.603 -21.370 1.00 51.79  ? 437 SER A C   1 
ATOM   1395 O  O   . SER A 1 177 ? -10.563 -28.572 -20.803 1.00 54.85  ? 437 SER A O   1 
ATOM   1396 C  CB  . SER A 1 177 ? -10.501 -28.132 -23.771 1.00 52.19  ? 437 SER A CB  1 
ATOM   1397 O  OG  . SER A 1 177 ? -9.121  -28.386 -23.886 1.00 56.23  ? 437 SER A OG  1 
ATOM   1398 N  N   . ASN A 1 178 ? -9.035  -26.954 -20.894 1.00 48.71  ? 438 ASN A N   1 
ATOM   1399 C  CA  . ASN A 1 178 ? -8.334  -27.409 -19.692 1.00 47.34  ? 438 ASN A CA  1 
ATOM   1400 C  C   . ASN A 1 178 ? -8.961  -26.816 -18.430 1.00 50.65  ? 438 ASN A C   1 
ATOM   1401 O  O   . ASN A 1 178 ? -8.279  -26.228 -17.580 1.00 54.52  ? 438 ASN A O   1 
ATOM   1402 C  CB  . ASN A 1 178 ? -6.842  -27.058 -19.777 1.00 46.22  ? 438 ASN A CB  1 
ATOM   1403 C  CG  . ASN A 1 178 ? -6.111  -27.825 -20.885 1.00 47.21  ? 438 ASN A CG  1 
ATOM   1404 O  OD1 . ASN A 1 178 ? -5.602  -27.239 -21.825 1.00 46.46  ? 438 ASN A OD1 1 
ATOM   1405 N  ND2 . ASN A 1 178 ? -6.046  -29.120 -20.756 1.00 48.03  ? 438 ASN A ND2 1 
ATOM   1406 N  N   . HIS A 1 179 ? -10.274 -26.959 -18.306 1.00 48.36  ? 439 HIS A N   1 
ATOM   1407 C  CA  . HIS A 1 179 ? -10.989 -26.385 -17.175 1.00 48.00  ? 439 HIS A CA  1 
ATOM   1408 C  C   . HIS A 1 179 ? -12.091 -27.336 -16.738 1.00 50.44  ? 439 HIS A C   1 
ATOM   1409 O  O   . HIS A 1 179 ? -12.667 -28.045 -17.558 1.00 51.32  ? 439 HIS A O   1 
ATOM   1410 C  CB  . HIS A 1 179 ? -11.528 -25.021 -17.553 1.00 47.14  ? 439 HIS A CB  1 
ATOM   1411 C  CG  . HIS A 1 179 ? -10.452 -24.005 -17.809 1.00 49.46  ? 439 HIS A CG  1 
ATOM   1412 N  ND1 . HIS A 1 179 ? -9.794  -23.900 -19.015 1.00 50.90  ? 439 HIS A ND1 1 
ATOM   1413 C  CD2 . HIS A 1 179 ? -9.899  -23.072 -17.002 1.00 51.02  ? 439 HIS A CD2 1 
ATOM   1414 C  CE1 . HIS A 1 179 ? -8.888  -22.945 -18.938 1.00 49.19  ? 439 HIS A CE1 1 
ATOM   1415 N  NE2 . HIS A 1 179 ? -8.927  -22.431 -17.725 1.00 51.07  ? 439 HIS A NE2 1 
ATOM   1416 N  N   . ASP A 1 180 ? -12.339 -27.393 -15.434 1.00 47.42  ? 440 ASP A N   1 
ATOM   1417 C  CA  . ASP A 1 180 ? -13.370 -28.264 -14.892 1.00 46.74  ? 440 ASP A CA  1 
ATOM   1418 C  C   . ASP A 1 180 ? -14.730 -27.800 -15.411 1.00 46.63  ? 440 ASP A C   1 
ATOM   1419 O  O   . ASP A 1 180 ? -15.646 -28.603 -15.568 1.00 49.91  ? 440 ASP A O   1 
ATOM   1420 C  CB  . ASP A 1 180 ? -13.385 -28.225 -13.358 1.00 44.31  ? 440 ASP A CB  1 
ATOM   1421 C  CG  . ASP A 1 180 ? -12.104 -28.741 -12.730 1.00 52.42  ? 440 ASP A CG  1 
ATOM   1422 O  OD1 . ASP A 1 180 ? -11.489 -29.698 -13.283 1.00 55.60  ? 440 ASP A OD1 1 
ATOM   1423 O  OD2 . ASP A 1 180 ? -11.729 -28.193 -11.655 1.00 54.53  ? 440 ASP A OD2 1 
ATOM   1424 N  N   . VAL A 1 181 ? -14.850 -26.504 -15.676 1.00 42.45  ? 441 VAL A N   1 
ATOM   1425 C  CA  . VAL A 1 181 ? -16.119 -25.918 -16.059 1.00 45.92  ? 441 VAL A CA  1 
ATOM   1426 C  C   . VAL A 1 181 ? -15.929 -24.918 -17.170 1.00 46.26  ? 441 VAL A C   1 
ATOM   1427 O  O   . VAL A 1 181 ? -15.156 -23.994 -17.022 1.00 50.63  ? 441 VAL A O   1 
ATOM   1428 C  CB  . VAL A 1 181 ? -16.759 -25.164 -14.868 1.00 45.50  ? 441 VAL A CB  1 
ATOM   1429 C  CG1 . VAL A 1 181 ? -17.885 -24.210 -15.366 1.00 39.71  ? 441 VAL A CG1 1 
ATOM   1430 C  CG2 . VAL A 1 181 ? -17.268 -26.138 -13.863 1.00 43.01  ? 441 VAL A CG2 1 
ATOM   1431 N  N   . ILE A 1 182 ? -16.650 -25.085 -18.269 1.00 46.94  ? 442 ILE A N   1 
ATOM   1432 C  CA  . ILE A 1 182 ? -16.573 -24.130 -19.365 1.00 50.44  ? 442 ILE A CA  1 
ATOM   1433 C  C   . ILE A 1 182 ? -17.960 -23.603 -19.654 1.00 51.60  ? 442 ILE A C   1 
ATOM   1434 O  O   . ILE A 1 182 ? -18.881 -24.393 -19.881 1.00 53.06  ? 442 ILE A O   1 
ATOM   1435 C  CB  . ILE A 1 182 ? -16.029 -24.755 -20.661 1.00 51.55  ? 442 ILE A CB  1 
ATOM   1436 C  CG1 . ILE A 1 182 ? -14.638 -25.365 -20.460 1.00 47.71  ? 442 ILE A CG1 1 
ATOM   1437 C  CG2 . ILE A 1 182 ? -15.953 -23.697 -21.769 1.00 52.03  ? 442 ILE A CG2 1 
ATOM   1438 C  CD1 . ILE A 1 182 ? -14.276 -26.321 -21.542 1.00 46.83  ? 442 ILE A CD1 1 
ATOM   1439 N  N   . LEU A 1 183 ? -18.115 -22.277 -19.601 1.00 49.69  ? 443 LEU A N   1 
ATOM   1440 C  CA  . LEU A 1 183 ? -19.309 -21.624 -20.129 1.00 51.03  ? 443 LEU A CA  1 
ATOM   1441 C  C   . LEU A 1 183 ? -18.961 -20.863 -21.401 1.00 50.18  ? 443 LEU A C   1 
ATOM   1442 O  O   . LEU A 1 183 ? -18.020 -20.081 -21.406 1.00 48.66  ? 443 LEU A O   1 
ATOM   1443 C  CB  . LEU A 1 183 ? -19.884 -20.650 -19.112 1.00 50.89  ? 443 LEU A CB  1 
ATOM   1444 C  CG  . LEU A 1 183 ? -20.195 -21.236 -17.746 1.00 52.79  ? 443 LEU A CG  1 
ATOM   1445 C  CD1 . LEU A 1 183 ? -20.748 -20.158 -16.822 1.00 50.83  ? 443 LEU A CD1 1 
ATOM   1446 C  CD2 . LEU A 1 183 ? -21.173 -22.363 -17.936 1.00 54.96  ? 443 LEU A CD2 1 
ATOM   1447 N  N   . TRP A 1 184 ? -19.726 -21.093 -22.464 1.00 48.12  ? 444 TRP A N   1 
ATOM   1448 C  CA  . TRP A 1 184 ? -19.511 -20.423 -23.734 1.00 49.62  ? 444 TRP A CA  1 
ATOM   1449 C  C   . TRP A 1 184 ? -20.792 -19.735 -24.128 1.00 50.78  ? 444 TRP A C   1 
ATOM   1450 O  O   . TRP A 1 184 ? -21.847 -20.360 -24.199 1.00 51.80  ? 444 TRP A O   1 
ATOM   1451 C  CB  . TRP A 1 184 ? -19.131 -21.422 -24.822 1.00 49.72  ? 444 TRP A CB  1 
ATOM   1452 C  CG  . TRP A 1 184 ? -18.576 -20.776 -26.055 1.00 51.93  ? 444 TRP A CG  1 
ATOM   1453 C  CD1 . TRP A 1 184 ? -19.167 -19.803 -26.822 1.00 51.06  ? 444 TRP A CD1 1 
ATOM   1454 C  CD2 . TRP A 1 184 ? -17.333 -21.084 -26.694 1.00 50.37  ? 444 TRP A CD2 1 
ATOM   1455 N  NE1 . TRP A 1 184 ? -18.351 -19.472 -27.893 1.00 50.15  ? 444 TRP A NE1 1 
ATOM   1456 C  CE2 . TRP A 1 184 ? -17.221 -20.244 -27.835 1.00 50.25  ? 444 TRP A CE2 1 
ATOM   1457 C  CE3 . TRP A 1 184 ? -16.297 -21.978 -26.413 1.00 43.10  ? 444 TRP A CE3 1 
ATOM   1458 C  CZ2 . TRP A 1 184 ? -16.111 -20.269 -28.678 1.00 44.15  ? 444 TRP A CZ2 1 
ATOM   1459 C  CZ3 . TRP A 1 184 ? -15.185 -21.998 -27.265 1.00 42.96  ? 444 TRP A CZ3 1 
ATOM   1460 C  CH2 . TRP A 1 184 ? -15.108 -21.148 -28.374 1.00 43.58  ? 444 TRP A CH2 1 
ATOM   1461 N  N   . LEU A 1 185 ? -20.691 -18.442 -24.400 1.00 52.12  ? 445 LEU A N   1 
ATOM   1462 C  CA  . LEU A 1 185 ? -21.859 -17.614 -24.705 1.00 51.10  ? 445 LEU A CA  1 
ATOM   1463 C  C   . LEU A 1 185 ? -21.505 -16.690 -25.855 1.00 51.28  ? 445 LEU A C   1 
ATOM   1464 O  O   . LEU A 1 185 ? -20.318 -16.521 -26.175 1.00 50.25  ? 445 LEU A O   1 
ATOM   1465 C  CB  . LEU A 1 185 ? -22.278 -16.824 -23.470 1.00 44.46  ? 445 LEU A CB  1 
ATOM   1466 C  CG  . LEU A 1 185 ? -21.167 -16.034 -22.773 1.00 42.72  ? 445 LEU A CG  1 
ATOM   1467 C  CD1 . LEU A 1 185 ? -21.020 -14.676 -23.432 1.00 40.21  ? 445 LEU A CD1 1 
ATOM   1468 C  CD2 . LEU A 1 185 ? -21.440 -15.885 -21.270 1.00 41.16  ? 445 LEU A CD2 1 
ATOM   1469 N  N   . GLY A 1 186 ? -22.514 -16.127 -26.513 1.00 49.80  ? 446 GLY A N   1 
ATOM   1470 C  CA  . GLY A 1 186 ? -22.245 -15.151 -27.565 1.00 47.72  ? 446 GLY A CA  1 
ATOM   1471 C  C   . GLY A 1 186 ? -23.286 -15.050 -28.647 1.00 49.97  ? 446 GLY A C   1 
ATOM   1472 O  O   . GLY A 1 186 ? -24.303 -15.742 -28.613 1.00 52.38  ? 446 GLY A O   1 
ATOM   1473 N  N   . ASP A 1 187 ? -23.043 -14.139 -29.589 1.00 51.22  ? 447 ASP A N   1 
ATOM   1474 C  CA  . ASP A 1 187 ? -23.791 -14.085 -30.838 1.00 53.24  ? 447 ASP A CA  1 
ATOM   1475 C  C   . ASP A 1 187 ? -23.031 -15.020 -31.732 1.00 53.34  ? 447 ASP A C   1 
ATOM   1476 O  O   . ASP A 1 187 ? -21.998 -14.646 -32.294 1.00 53.37  ? 447 ASP A O   1 
ATOM   1477 C  CB  . ASP A 1 187 ? -23.780 -12.673 -31.419 1.00 56.57  ? 447 ASP A CB  1 
ATOM   1478 C  CG  . ASP A 1 187 ? -24.370 -12.597 -32.827 1.00 61.07  ? 447 ASP A CG  1 
ATOM   1479 O  OD1 . ASP A 1 187 ? -24.717 -13.659 -33.389 1.00 63.14  ? 447 ASP A OD1 1 
ATOM   1480 O  OD2 . ASP A 1 187 ? -24.495 -11.464 -33.368 1.00 61.27  ? 447 ASP A OD2 1 
ATOM   1481 N  N   . LEU A 1 188 ? -23.517 -16.248 -31.831 1.00 51.79  ? 448 LEU A N   1 
ATOM   1482 C  CA  . LEU A 1 188 ? -22.825 -17.272 -32.581 1.00 55.46  ? 448 LEU A CA  1 
ATOM   1483 C  C   . LEU A 1 188 ? -23.243 -17.232 -34.042 1.00 58.62  ? 448 LEU A C   1 
ATOM   1484 O  O   . LEU A 1 188 ? -22.560 -17.771 -34.903 1.00 59.29  ? 448 LEU A O   1 
ATOM   1485 C  CB  . LEU A 1 188 ? -23.076 -18.638 -31.945 1.00 56.56  ? 448 LEU A CB  1 
ATOM   1486 C  CG  . LEU A 1 188 ? -22.680 -18.783 -30.460 1.00 52.91  ? 448 LEU A CG  1 
ATOM   1487 C  CD1 . LEU A 1 188 ? -23.058 -20.185 -29.958 1.00 57.70  ? 448 LEU A CD1 1 
ATOM   1488 C  CD2 . LEU A 1 188 ? -21.188 -18.506 -30.231 1.00 46.02  ? 448 LEU A CD2 1 
ATOM   1489 N  N   . ASN A 1 189 ? -24.380 -16.600 -34.311 1.00 61.04  ? 449 ASN A N   1 
ATOM   1490 C  CA  . ASN A 1 189 ? -24.801 -16.240 -35.677 1.00 64.17  ? 449 ASN A CA  1 
ATOM   1491 C  C   . ASN A 1 189 ? -25.277 -17.375 -36.585 1.00 69.33  ? 449 ASN A C   1 
ATOM   1492 O  O   . ASN A 1 189 ? -25.460 -17.175 -37.793 1.00 74.41  ? 449 ASN A O   1 
ATOM   1493 C  CB  . ASN A 1 189 ? -23.693 -15.430 -36.391 1.00 63.87  ? 449 ASN A CB  1 
ATOM   1494 C  CG  . ASN A 1 189 ? -24.010 -13.956 -36.492 1.00 63.86  ? 449 ASN A CG  1 
ATOM   1495 O  OD1 . ASN A 1 189 ? -25.174 -13.556 -36.659 1.00 64.93  ? 449 ASN A OD1 1 
ATOM   1496 N  ND2 . ASN A 1 189 ? -22.972 -13.132 -36.405 1.00 61.38  ? 449 ASN A ND2 1 
ATOM   1497 N  N   . TYR A 1 190 ? -25.494 -18.559 -36.029 1.00 70.35  ? 450 TYR A N   1 
ATOM   1498 C  CA  . TYR A 1 190 ? -26.067 -19.661 -36.819 1.00 67.42  ? 450 TYR A CA  1 
ATOM   1499 C  C   . TYR A 1 190 ? -27.518 -19.307 -37.058 1.00 69.89  ? 450 TYR A C   1 
ATOM   1500 O  O   . TYR A 1 190 ? -28.155 -18.712 -36.198 1.00 70.02  ? 450 TYR A O   1 
ATOM   1501 C  CB  . TYR A 1 190 ? -25.915 -21.007 -36.101 1.00 61.44  ? 450 TYR A CB  1 
ATOM   1502 C  CG  . TYR A 1 190 ? -24.488 -21.473 -36.048 1.00 62.00  ? 450 TYR A CG  1 
ATOM   1503 C  CD1 . TYR A 1 190 ? -23.974 -22.330 -36.992 1.00 63.98  ? 450 TYR A CD1 1 
ATOM   1504 C  CD2 . TYR A 1 190 ? -23.643 -21.025 -35.062 1.00 62.21  ? 450 TYR A CD2 1 
ATOM   1505 C  CE1 . TYR A 1 190 ? -22.663 -22.738 -36.942 1.00 64.06  ? 450 TYR A CE1 1 
ATOM   1506 C  CE2 . TYR A 1 190 ? -22.343 -21.432 -35.002 1.00 62.36  ? 450 TYR A CE2 1 
ATOM   1507 C  CZ  . TYR A 1 190 ? -21.858 -22.275 -35.945 1.00 65.15  ? 450 TYR A CZ  1 
ATOM   1508 O  OH  . TYR A 1 190 ? -20.548 -22.645 -35.860 1.00 68.48  ? 450 TYR A OH  1 
ATOM   1509 N  N   . ARG A 1 191 ? -28.028 -19.637 -38.233 1.00 71.30  ? 451 ARG A N   1 
ATOM   1510 C  CA  . ARG A 1 191 ? -29.357 -19.199 -38.633 1.00 69.57  ? 451 ARG A CA  1 
ATOM   1511 C  C   . ARG A 1 191 ? -30.244 -20.402 -38.898 1.00 72.23  ? 451 ARG A C   1 
ATOM   1512 O  O   . ARG A 1 191 ? -29.868 -21.529 -38.552 1.00 71.72  ? 451 ARG A O   1 
ATOM   1513 C  CB  . ARG A 1 191 ? -29.255 -18.328 -39.879 1.00 65.75  ? 451 ARG A CB  1 
ATOM   1514 C  CG  . ARG A 1 191 ? -28.159 -17.279 -39.806 1.00 63.98  ? 451 ARG A CG  1 
ATOM   1515 C  CD  . ARG A 1 191 ? -28.396 -16.314 -38.677 1.00 62.83  ? 451 ARG A CD  1 
ATOM   1516 N  NE  . ARG A 1 191 ? -27.401 -15.256 -38.680 1.00 61.95  ? 451 ARG A NE  1 
ATOM   1517 C  CZ  . ARG A 1 191 ? -27.442 -14.159 -39.430 1.00 65.83  ? 451 ARG A CZ  1 
ATOM   1518 N  NH1 . ARG A 1 191 ? -28.442 -13.928 -40.268 1.00 72.07  ? 451 ARG A NH1 1 
ATOM   1519 N  NH2 . ARG A 1 191 ? -26.465 -13.269 -39.333 1.00 64.36  ? 451 ARG A NH2 1 
ATOM   1520 N  N   . ILE A 1 192 ? -31.424 -20.157 -39.474 1.00 71.39  ? 452 ILE A N   1 
ATOM   1521 C  CA  . ILE A 1 192 ? -32.323 -21.226 -39.901 1.00 78.19  ? 452 ILE A CA  1 
ATOM   1522 C  C   . ILE A 1 192 ? -32.204 -21.416 -41.423 1.00 85.71  ? 452 ILE A C   1 
ATOM   1523 O  O   . ILE A 1 192 ? -32.108 -20.437 -42.177 1.00 84.30  ? 452 ILE A O   1 
ATOM   1524 C  CB  . ILE A 1 192 ? -33.783 -20.906 -39.545 1.00 78.91  ? 452 ILE A CB  1 
ATOM   1525 C  CG1 . ILE A 1 192 ? -33.914 -20.517 -38.066 1.00 73.89  ? 452 ILE A CG1 1 
ATOM   1526 C  CG2 . ILE A 1 192 ? -34.670 -22.090 -39.861 1.00 83.52  ? 452 ILE A CG2 1 
ATOM   1527 C  CD1 . ILE A 1 192 ? -33.532 -21.597 -37.110 1.00 71.21  ? 452 ILE A CD1 1 
ATOM   1528 N  N   . GLU A 1 193 ? -32.205 -22.668 -41.875 1.00 88.77  ? 453 GLU A N   1 
ATOM   1529 C  CA  . GLU A 1 193 ? -32.001 -22.948 -43.296 1.00 93.59  ? 453 GLU A CA  1 
ATOM   1530 C  C   . GLU A 1 193 ? -33.145 -23.755 -43.958 1.00 99.91  ? 453 GLU A C   1 
ATOM   1531 O  O   . GLU A 1 193 ? -33.932 -24.422 -43.288 1.00 100.05 ? 453 GLU A O   1 
ATOM   1532 C  CB  . GLU A 1 193 ? -30.642 -23.615 -43.504 1.00 92.77  ? 453 GLU A CB  1 
ATOM   1533 C  CG  . GLU A 1 193 ? -30.497 -24.948 -42.825 1.00 97.83  ? 453 GLU A CG  1 
ATOM   1534 C  CD  . GLU A 1 193 ? -29.306 -25.713 -43.349 1.00 104.23 ? 453 GLU A CD  1 
ATOM   1535 O  OE1 . GLU A 1 193 ? -28.181 -25.167 -43.267 1.00 104.78 ? 453 GLU A OE1 1 
ATOM   1536 O  OE2 . GLU A 1 193 ? -29.504 -26.848 -43.846 1.00 108.93 ? 453 GLU A OE2 1 
ATOM   1537 N  N   . GLU A 1 194 ? -33.233 -23.664 -45.279 1.00 103.05 ? 454 GLU A N   1 
ATOM   1538 C  CA  . GLU A 1 194 ? -34.316 -24.292 -46.047 1.00 108.94 ? 454 GLU A CA  1 
ATOM   1539 C  C   . GLU A 1 194 ? -35.688 -23.619 -45.844 1.00 109.85 ? 454 GLU A C   1 
ATOM   1540 O  O   . GLU A 1 194 ? -36.326 -23.238 -46.828 1.00 113.75 ? 454 GLU A O   1 
ATOM   1541 C  CB  . GLU A 1 194 ? -34.411 -25.805 -45.775 1.00 109.30 ? 454 GLU A CB  1 
ATOM   1542 N  N   . LEU A 1 195 ? -36.139 -23.475 -44.595 1.00 104.24 ? 455 LEU A N   1 
ATOM   1543 C  CA  . LEU A 1 195 ? -37.481 -22.944 -44.314 1.00 102.36 ? 455 LEU A CA  1 
ATOM   1544 C  C   . LEU A 1 195 ? -37.642 -21.485 -44.757 1.00 103.72 ? 455 LEU A C   1 
ATOM   1545 O  O   . LEU A 1 195 ? -36.752 -20.657 -44.540 1.00 99.80  ? 455 LEU A O   1 
ATOM   1546 C  CB  . LEU A 1 195 ? -37.831 -23.070 -42.827 1.00 97.21  ? 455 LEU A CB  1 
ATOM   1547 C  CG  . LEU A 1 195 ? -37.820 -24.468 -42.190 1.00 94.49  ? 455 LEU A CG  1 
ATOM   1548 C  CD1 . LEU A 1 195 ? -38.103 -24.399 -40.674 1.00 91.15  ? 455 LEU A CD1 1 
ATOM   1549 C  CD2 . LEU A 1 195 ? -38.798 -25.387 -42.886 1.00 93.45  ? 455 LEU A CD2 1 
ATOM   1550 N  N   . ASP A 1 196 ? -38.791 -21.194 -45.372 1.00 108.36 ? 456 ASP A N   1 
ATOM   1551 C  CA  . ASP A 1 196 ? -39.102 -19.873 -45.919 1.00 109.44 ? 456 ASP A CA  1 
ATOM   1552 C  C   . ASP A 1 196 ? -39.314 -18.878 -44.786 1.00 110.40 ? 456 ASP A C   1 
ATOM   1553 O  O   . ASP A 1 196 ? -39.726 -19.259 -43.687 1.00 108.87 ? 456 ASP A O   1 
ATOM   1554 C  CB  . ASP A 1 196 ? -40.357 -19.934 -46.807 1.00 110.16 ? 456 ASP A CB  1 
ATOM   1555 N  N   . VAL A 1 197 ? -39.036 -17.602 -45.059 1.00 111.10 ? 457 VAL A N   1 
ATOM   1556 C  CA  . VAL A 1 197 ? -39.170 -16.547 -44.047 1.00 107.72 ? 457 VAL A CA  1 
ATOM   1557 C  C   . VAL A 1 197 ? -40.623 -16.430 -43.564 1.00 108.99 ? 457 VAL A C   1 
ATOM   1558 O  O   . VAL A 1 197 ? -40.876 -16.044 -42.423 1.00 107.96 ? 457 VAL A O   1 
ATOM   1559 C  CB  . VAL A 1 197 ? -38.631 -15.176 -44.568 1.00 85.97  ? 457 VAL A CB  1 
ATOM   1560 C  CG1 . VAL A 1 197 ? -39.578 -14.553 -45.580 1.00 89.32  ? 457 VAL A CG1 1 
ATOM   1561 C  CG2 . VAL A 1 197 ? -38.379 -14.223 -43.407 1.00 82.58  ? 457 VAL A CG2 1 
ATOM   1562 N  N   . GLU A 1 198 ? -41.565 -16.787 -44.439 1.00 110.26 ? 458 GLU A N   1 
ATOM   1563 C  CA  . GLU A 1 198 ? -42.980 -16.851 -44.087 1.00 108.72 ? 458 GLU A CA  1 
ATOM   1564 C  C   . GLU A 1 198 ? -43.232 -17.963 -43.055 1.00 104.88 ? 458 GLU A C   1 
ATOM   1565 O  O   . GLU A 1 198 ? -43.812 -17.707 -41.996 1.00 102.76 ? 458 GLU A O   1 
ATOM   1566 C  CB  . GLU A 1 198 ? -43.837 -17.064 -45.346 1.00 112.47 ? 458 GLU A CB  1 
ATOM   1567 N  N   . LYS A 1 199 ? -42.785 -19.183 -43.354 1.00 102.86 ? 459 LYS A N   1 
ATOM   1568 C  CA  . LYS A 1 199 ? -43.016 -20.322 -42.459 1.00 101.12 ? 459 LYS A CA  1 
ATOM   1569 C  C   . LYS A 1 199 ? -42.333 -20.109 -41.113 1.00 101.82 ? 459 LYS A C   1 
ATOM   1570 O  O   . LYS A 1 199 ? -42.870 -20.476 -40.063 1.00 100.70 ? 459 LYS A O   1 
ATOM   1571 C  CB  . LYS A 1 199 ? -42.514 -21.623 -43.089 1.00 98.50  ? 459 LYS A CB  1 
ATOM   1572 N  N   . VAL A 1 200 ? -41.147 -19.506 -41.152 1.00 102.68 ? 460 VAL A N   1 
ATOM   1573 C  CA  . VAL A 1 200 ? -40.330 -19.324 -39.964 1.00 97.77  ? 460 VAL A CA  1 
ATOM   1574 C  C   . VAL A 1 200 ? -40.962 -18.325 -39.014 1.00 100.36 ? 460 VAL A C   1 
ATOM   1575 O  O   . VAL A 1 200 ? -40.850 -18.481 -37.804 1.00 103.09 ? 460 VAL A O   1 
ATOM   1576 C  CB  . VAL A 1 200 ? -38.905 -18.869 -40.330 1.00 92.37  ? 460 VAL A CB  1 
ATOM   1577 C  CG1 . VAL A 1 200 ? -38.147 -18.388 -39.090 1.00 88.33  ? 460 VAL A CG1 1 
ATOM   1578 C  CG2 . VAL A 1 200 ? -38.163 -20.000 -41.021 1.00 90.30  ? 460 VAL A CG2 1 
ATOM   1579 N  N   . LYS A 1 201 ? -41.616 -17.299 -39.551 1.00 99.55  ? 461 LYS A N   1 
ATOM   1580 C  CA  . LYS A 1 201 ? -42.316 -16.339 -38.707 1.00 96.10  ? 461 LYS A CA  1 
ATOM   1581 C  C   . LYS A 1 201 ? -43.570 -16.984 -38.129 1.00 100.07 ? 461 LYS A C   1 
ATOM   1582 O  O   . LYS A 1 201 ? -43.836 -16.858 -36.932 1.00 100.57 ? 461 LYS A O   1 
ATOM   1583 C  CB  . LYS A 1 201 ? -42.690 -15.082 -39.487 1.00 93.64  ? 461 LYS A CB  1 
ATOM   1584 C  CG  . LYS A 1 201 ? -41.557 -14.084 -39.725 1.00 90.30  ? 461 LYS A CG  1 
ATOM   1585 C  CD  . LYS A 1 201 ? -42.096 -12.918 -40.577 1.00 93.34  ? 461 LYS A CD  1 
ATOM   1586 C  CE  . LYS A 1 201 ? -41.138 -11.733 -40.727 1.00 91.59  ? 461 LYS A CE  1 
ATOM   1587 N  NZ  . LYS A 1 201 ? -41.901 -10.508 -41.161 1.00 93.50  ? 461 LYS A NZ  1 
ATOM   1588 N  N   . LYS A 1 202 ? -44.329 -17.678 -38.979 1.00 102.21 ? 462 LYS A N   1 
ATOM   1589 C  CA  . LYS A 1 202 ? -45.594 -18.319 -38.572 1.00 101.82 ? 462 LYS A CA  1 
ATOM   1590 C  C   . LYS A 1 202 ? -45.350 -19.375 -37.498 1.00 102.38 ? 462 LYS A C   1 
ATOM   1591 O  O   . LYS A 1 202 ? -46.065 -19.429 -36.499 1.00 102.34 ? 462 LYS A O   1 
ATOM   1592 C  CB  . LYS A 1 202 ? -46.328 -18.940 -39.772 1.00 99.51  ? 462 LYS A CB  1 
ATOM   1593 N  N   . LEU A 1 203 ? -44.332 -20.206 -37.689 1.00 102.72 ? 463 LEU A N   1 
ATOM   1594 C  CA  . LEU A 1 203 ? -43.953 -21.154 -36.652 1.00 104.25 ? 463 LEU A CA  1 
ATOM   1595 C  C   . LEU A 1 203 ? -43.724 -20.416 -35.328 1.00 102.43 ? 463 LEU A C   1 
ATOM   1596 O  O   . LEU A 1 203 ? -44.151 -20.885 -34.274 1.00 103.26 ? 463 LEU A O   1 
ATOM   1597 C  CB  . LEU A 1 203 ? -42.703 -21.945 -37.050 1.00 103.25 ? 463 LEU A CB  1 
ATOM   1598 C  CG  . LEU A 1 203 ? -42.896 -23.118 -38.014 1.00 105.50 ? 463 LEU A CG  1 
ATOM   1599 C  CD1 . LEU A 1 203 ? -41.548 -23.652 -38.480 1.00 103.84 ? 463 LEU A CD1 1 
ATOM   1600 C  CD2 . LEU A 1 203 ? -43.713 -24.235 -37.363 1.00 106.78 ? 463 LEU A CD2 1 
ATOM   1601 N  N   . ILE A 1 204 ? -43.074 -19.256 -35.390 1.00 99.87  ? 464 ILE A N   1 
ATOM   1602 C  CA  . ILE A 1 204 ? -42.828 -18.449 -34.192 1.00 99.72  ? 464 ILE A CA  1 
ATOM   1603 C  C   . ILE A 1 204 ? -44.124 -17.873 -33.606 1.00 102.66 ? 464 ILE A C   1 
ATOM   1604 O  O   . ILE A 1 204 ? -44.246 -17.753 -32.390 1.00 101.18 ? 464 ILE A O   1 
ATOM   1605 C  CB  . ILE A 1 204 ? -41.799 -17.314 -34.454 1.00 95.35  ? 464 ILE A CB  1 
ATOM   1606 C  CG1 . ILE A 1 204 ? -40.416 -17.897 -34.756 1.00 92.87  ? 464 ILE A CG1 1 
ATOM   1607 C  CG2 . ILE A 1 204 ? -41.675 -16.400 -33.247 1.00 91.40  ? 464 ILE A CG2 1 
ATOM   1608 C  CD1 . ILE A 1 204 ? -39.436 -16.895 -35.338 1.00 90.18  ? 464 ILE A CD1 1 
ATOM   1609 N  N   . GLU A 1 205 ? -45.091 -17.526 -34.448 1.00 106.54 ? 465 GLU A N   1 
ATOM   1610 C  CA  . GLU A 1 205 ? -46.407 -17.119 -33.932 1.00 109.45 ? 465 GLU A CA  1 
ATOM   1611 C  C   . GLU A 1 205 ? -46.963 -18.171 -32.968 1.00 109.67 ? 465 GLU A C   1 
ATOM   1612 O  O   . GLU A 1 205 ? -47.146 -17.886 -31.786 1.00 109.25 ? 465 GLU A O   1 
ATOM   1613 C  CB  . GLU A 1 205 ? -47.422 -16.849 -35.055 1.00 112.34 ? 465 GLU A CB  1 
ATOM   1614 C  CG  . GLU A 1 205 ? -47.424 -15.417 -35.561 1.00 112.19 ? 465 GLU A CG  1 
ATOM   1615 N  N   . GLU A 1 206 ? -47.185 -19.389 -33.462 1.00 110.58 ? 466 GLU A N   1 
ATOM   1616 C  CA  . GLU A 1 206 ? -47.831 -20.442 -32.659 1.00 112.67 ? 466 GLU A CA  1 
ATOM   1617 C  C   . GLU A 1 206 ? -46.867 -21.128 -31.676 1.00 107.48 ? 466 GLU A C   1 
ATOM   1618 O  O   . GLU A 1 206 ? -47.187 -22.168 -31.106 1.00 107.06 ? 466 GLU A O   1 
ATOM   1619 C  CB  . GLU A 1 206 ? -48.533 -21.476 -33.565 1.00 117.66 ? 466 GLU A CB  1 
ATOM   1620 N  N   . LYS A 1 207 ? -45.692 -20.537 -31.479 1.00 102.38 ? 467 LYS A N   1 
ATOM   1621 C  CA  . LYS A 1 207 ? -44.762 -20.947 -30.427 1.00 95.14  ? 467 LYS A CA  1 
ATOM   1622 C  C   . LYS A 1 207 ? -44.217 -22.380 -30.568 1.00 96.39  ? 467 LYS A C   1 
ATOM   1623 O  O   . LYS A 1 207 ? -43.731 -22.953 -29.597 1.00 92.22  ? 467 LYS A O   1 
ATOM   1624 C  CB  . LYS A 1 207 ? -45.391 -20.711 -29.036 1.00 89.81  ? 467 LYS A CB  1 
ATOM   1625 C  CG  . LYS A 1 207 ? -45.464 -19.230 -28.628 1.00 85.85  ? 467 LYS A CG  1 
ATOM   1626 C  CD  . LYS A 1 207 ? -46.013 -19.008 -27.205 1.00 85.45  ? 467 LYS A CD  1 
ATOM   1627 C  CE  . LYS A 1 207 ? -45.112 -19.574 -26.071 1.00 119.44 ? 467 LYS A CE  1 
ATOM   1628 N  NZ  . LYS A 1 207 ? -43.724 -18.959 -25.944 1.00 115.18 ? 467 LYS A NZ  1 
ATOM   1629 N  N   . ASP A 1 208 ? -44.258 -22.940 -31.775 1.00 102.50 ? 468 ASP A N   1 
ATOM   1630 C  CA  . ASP A 1 208 ? -43.757 -24.297 -32.013 1.00 105.90 ? 468 ASP A CA  1 
ATOM   1631 C  C   . ASP A 1 208 ? -42.253 -24.248 -32.301 1.00 101.05 ? 468 ASP A C   1 
ATOM   1632 O  O   . ASP A 1 208 ? -41.805 -24.418 -33.437 1.00 101.44 ? 468 ASP A O   1 
ATOM   1633 C  CB  . ASP A 1 208 ? -44.530 -24.978 -33.159 1.00 113.10 ? 468 ASP A CB  1 
ATOM   1634 C  CG  . ASP A 1 208 ? -44.363 -26.504 -33.170 1.00 119.12 ? 468 ASP A CG  1 
ATOM   1635 O  OD1 . ASP A 1 208 ? -43.300 -27.016 -32.745 1.00 118.03 ? 468 ASP A OD1 1 
ATOM   1636 O  OD2 . ASP A 1 208 ? -45.308 -27.200 -33.608 1.00 125.56 ? 468 ASP A OD2 1 
ATOM   1637 N  N   . PHE A 1 209 ? -41.475 -24.031 -31.249 1.00 96.78  ? 469 PHE A N   1 
ATOM   1638 C  CA  . PHE A 1 209 ? -40.036 -23.879 -31.387 1.00 93.43  ? 469 PHE A CA  1 
ATOM   1639 C  C   . PHE A 1 209 ? -39.304 -25.205 -31.535 1.00 94.67  ? 469 PHE A C   1 
ATOM   1640 O  O   . PHE A 1 209 ? -38.091 -25.213 -31.764 1.00 95.14  ? 469 PHE A O   1 
ATOM   1641 C  CB  . PHE A 1 209 ? -39.469 -23.129 -30.186 1.00 89.60  ? 469 PHE A CB  1 
ATOM   1642 C  CG  . PHE A 1 209 ? -40.089 -21.786 -29.974 1.00 89.31  ? 469 PHE A CG  1 
ATOM   1643 C  CD1 . PHE A 1 209 ? -40.051 -20.828 -30.978 1.00 88.84  ? 469 PHE A CD1 1 
ATOM   1644 C  CD2 . PHE A 1 209 ? -40.701 -21.472 -28.774 1.00 88.68  ? 469 PHE A CD2 1 
ATOM   1645 C  CE1 . PHE A 1 209 ? -40.616 -19.579 -30.792 1.00 89.23  ? 469 PHE A CE1 1 
ATOM   1646 C  CE2 . PHE A 1 209 ? -41.275 -20.222 -28.580 1.00 90.58  ? 469 PHE A CE2 1 
ATOM   1647 C  CZ  . PHE A 1 209 ? -41.232 -19.274 -29.595 1.00 90.00  ? 469 PHE A CZ  1 
ATOM   1648 N  N   . GLN A 1 210 ? -40.012 -26.320 -31.382 1.00 95.40  ? 470 GLN A N   1 
ATOM   1649 C  CA  . GLN A 1 210 ? -39.378 -27.625 -31.504 1.00 96.44  ? 470 GLN A CA  1 
ATOM   1650 C  C   . GLN A 1 210 ? -39.069 -27.931 -32.972 1.00 97.85  ? 470 GLN A C   1 
ATOM   1651 O  O   . GLN A 1 210 ? -37.947 -28.318 -33.305 1.00 96.41  ? 470 GLN A O   1 
ATOM   1652 C  CB  . GLN A 1 210 ? -40.244 -28.720 -30.859 1.00 102.12 ? 470 GLN A CB  1 
ATOM   1653 C  CG  . GLN A 1 210 ? -40.215 -28.688 -29.312 1.00 104.38 ? 470 GLN A CG  1 
ATOM   1654 C  CD  . GLN A 1 210 ? -40.755 -29.969 -28.653 1.00 109.18 ? 470 GLN A CD  1 
ATOM   1655 O  OE1 . GLN A 1 210 ? -41.514 -30.740 -29.267 1.00 114.29 ? 470 GLN A OE1 1 
ATOM   1656 N  NE2 . GLN A 1 210 ? -40.364 -30.192 -27.390 1.00 104.61 ? 470 GLN A NE2 1 
ATOM   1657 N  N   . MET A 1 211 ? -40.056 -27.725 -33.844 1.00 99.74  ? 471 MET A N   1 
ATOM   1658 C  CA  . MET A 1 211 ? -39.902 -27.997 -35.276 1.00 102.01 ? 471 MET A CA  1 
ATOM   1659 C  C   . MET A 1 211 ? -38.828 -27.125 -35.893 1.00 99.45  ? 471 MET A C   1 
ATOM   1660 O  O   . MET A 1 211 ? -38.062 -27.580 -36.737 1.00 101.34 ? 471 MET A O   1 
ATOM   1661 C  CB  . MET A 1 211 ? -41.222 -27.756 -36.015 1.00 107.28 ? 471 MET A CB  1 
ATOM   1662 C  CG  . MET A 1 211 ? -41.177 -27.989 -37.535 1.00 109.42 ? 471 MET A CG  1 
ATOM   1663 S  SD  . MET A 1 211 ? -40.735 -29.670 -38.054 1.00 128.29 ? 471 MET A SD  1 
ATOM   1664 C  CE  . MET A 1 211 ? -41.592 -29.783 -39.634 1.00 159.05 ? 471 MET A CE  1 
ATOM   1665 N  N   . LEU A 1 212 ? -38.783 -25.869 -35.469 1.00 96.32  ? 472 LEU A N   1 
ATOM   1666 C  CA  . LEU A 1 212 ? -37.829 -24.905 -36.010 1.00 93.85  ? 472 LEU A CA  1 
ATOM   1667 C  C   . LEU A 1 212 ? -36.394 -25.320 -35.693 1.00 89.82  ? 472 LEU A C   1 
ATOM   1668 O  O   . LEU A 1 212 ? -35.497 -25.202 -36.529 1.00 86.97  ? 472 LEU A O   1 
ATOM   1669 C  CB  . LEU A 1 212 ? -38.127 -23.515 -35.445 1.00 91.86  ? 472 LEU A CB  1 
ATOM   1670 C  CG  . LEU A 1 212 ? -37.818 -22.306 -36.323 1.00 94.50  ? 472 LEU A CG  1 
ATOM   1671 C  CD1 . LEU A 1 212 ? -38.542 -22.373 -37.643 1.00 100.14 ? 472 LEU A CD1 1 
ATOM   1672 C  CD2 . LEU A 1 212 ? -38.213 -21.045 -35.586 1.00 93.94  ? 472 LEU A CD2 1 
ATOM   1673 N  N   . TYR A 1 213 ? -36.197 -25.828 -34.482 1.00 90.95  ? 473 TYR A N   1 
ATOM   1674 C  CA  . TYR A 1 213 ? -34.883 -26.244 -34.022 1.00 89.70  ? 473 TYR A CA  1 
ATOM   1675 C  C   . TYR A 1 213 ? -34.276 -27.251 -35.001 1.00 90.62  ? 473 TYR A C   1 
ATOM   1676 O  O   . TYR A 1 213 ? -33.104 -27.157 -35.343 1.00 88.97  ? 473 TYR A O   1 
ATOM   1677 C  CB  . TYR A 1 213 ? -34.971 -26.807 -32.597 1.00 89.66  ? 473 TYR A CB  1 
ATOM   1678 C  CG  . TYR A 1 213 ? -33.629 -27.065 -31.920 1.00 92.12  ? 473 TYR A CG  1 
ATOM   1679 C  CD1 . TYR A 1 213 ? -32.564 -26.163 -32.029 1.00 89.65  ? 473 TYR A CD1 1 
ATOM   1680 C  CD2 . TYR A 1 213 ? -33.429 -28.207 -31.142 1.00 92.46  ? 473 TYR A CD2 1 
ATOM   1681 C  CE1 . TYR A 1 213 ? -31.348 -26.403 -31.400 1.00 84.54  ? 473 TYR A CE1 1 
ATOM   1682 C  CE2 . TYR A 1 213 ? -32.207 -28.444 -30.507 1.00 88.76  ? 473 TYR A CE2 1 
ATOM   1683 C  CZ  . TYR A 1 213 ? -31.181 -27.543 -30.648 1.00 86.63  ? 473 TYR A CZ  1 
ATOM   1684 O  OH  . TYR A 1 213 ? -29.984 -27.794 -30.023 1.00 89.09  ? 473 TYR A OH  1 
ATOM   1685 N  N   . ALA A 1 214 ? -35.082 -28.175 -35.504 1.00 93.79  ? 474 ALA A N   1 
ATOM   1686 C  CA  . ALA A 1 214 ? -34.591 -29.161 -36.470 1.00 93.57  ? 474 ALA A CA  1 
ATOM   1687 C  C   . ALA A 1 214 ? -33.865 -28.537 -37.678 1.00 92.35  ? 474 ALA A C   1 
ATOM   1688 O  O   . ALA A 1 214 ? -33.115 -29.235 -38.366 1.00 92.20  ? 474 ALA A O   1 
ATOM   1689 C  CB  . ALA A 1 214 ? -35.738 -30.059 -36.947 1.00 94.31  ? 474 ALA A CB  1 
ATOM   1690 N  N   . TYR A 1 215 ? -34.094 -27.245 -37.939 1.00 91.28  ? 475 TYR A N   1 
ATOM   1691 C  CA  . TYR A 1 215 ? -33.437 -26.532 -39.045 1.00 92.12  ? 475 TYR A CA  1 
ATOM   1692 C  C   . TYR A 1 215 ? -32.427 -25.473 -38.560 1.00 91.14  ? 475 TYR A C   1 
ATOM   1693 O  O   . TYR A 1 215 ? -31.867 -24.722 -39.364 1.00 90.17  ? 475 TYR A O   1 
ATOM   1694 C  CB  . TYR A 1 215 ? -34.486 -25.869 -39.945 1.00 95.37  ? 475 TYR A CB  1 
ATOM   1695 C  CG  . TYR A 1 215 ? -35.419 -26.833 -40.645 1.00 100.70 ? 475 TYR A CG  1 
ATOM   1696 C  CD1 . TYR A 1 215 ? -35.071 -27.403 -41.873 1.00 105.13 ? 475 TYR A CD1 1 
ATOM   1697 C  CD2 . TYR A 1 215 ? -36.658 -27.166 -40.096 1.00 102.31 ? 475 TYR A CD2 1 
ATOM   1698 C  CE1 . TYR A 1 215 ? -35.925 -28.293 -42.535 1.00 109.47 ? 475 TYR A CE1 1 
ATOM   1699 C  CE2 . TYR A 1 215 ? -37.522 -28.057 -40.749 1.00 107.16 ? 475 TYR A CE2 1 
ATOM   1700 C  CZ  . TYR A 1 215 ? -37.149 -28.618 -41.971 1.00 110.31 ? 475 TYR A CZ  1 
ATOM   1701 O  OH  . TYR A 1 215 ? -37.993 -29.494 -42.631 1.00 112.74 ? 475 TYR A OH  1 
ATOM   1702 N  N   . ASP A 1 216 ? -32.187 -25.411 -37.253 1.00 89.21  ? 476 ASP A N   1 
ATOM   1703 C  CA  . ASP A 1 216 ? -31.224 -24.459 -36.707 1.00 83.16  ? 476 ASP A CA  1 
ATOM   1704 C  C   . ASP A 1 216 ? -29.822 -24.939 -37.026 1.00 79.07  ? 476 ASP A C   1 
ATOM   1705 O  O   . ASP A 1 216 ? -29.459 -26.068 -36.688 1.00 76.94  ? 476 ASP A O   1 
ATOM   1706 C  CB  . ASP A 1 216 ? -31.393 -24.300 -35.197 1.00 81.90  ? 476 ASP A CB  1 
ATOM   1707 C  CG  . ASP A 1 216 ? -30.229 -23.556 -34.546 1.00 79.58  ? 476 ASP A CG  1 
ATOM   1708 O  OD1 . ASP A 1 216 ? -30.045 -22.345 -34.788 1.00 79.82  ? 476 ASP A OD1 1 
ATOM   1709 O  OD2 . ASP A 1 216 ? -29.500 -24.186 -33.766 1.00 77.10  ? 476 ASP A OD2 1 
ATOM   1710 N  N   . GLN A 1 217 ? -29.043 -24.069 -37.670 1.00 77.10  ? 477 GLN A N   1 
ATOM   1711 C  CA  . GLN A 1 217 ? -27.689 -24.400 -38.124 1.00 74.42  ? 477 GLN A CA  1 
ATOM   1712 C  C   . GLN A 1 217 ? -26.799 -24.882 -36.983 1.00 71.78  ? 477 GLN A C   1 
ATOM   1713 O  O   . GLN A 1 217 ? -25.948 -25.741 -37.183 1.00 73.11  ? 477 GLN A O   1 
ATOM   1714 C  CB  . GLN A 1 217 ? -27.016 -23.195 -38.792 1.00 71.93  ? 477 GLN A CB  1 
ATOM   1715 C  CG  . GLN A 1 217 ? -27.386 -22.934 -40.226 1.00 76.31  ? 477 GLN A CG  1 
ATOM   1716 C  CD  . GLN A 1 217 ? -26.651 -21.724 -40.803 1.00 78.54  ? 477 GLN A CD  1 
ATOM   1717 O  OE1 . GLN A 1 217 ? -26.079 -20.907 -40.078 1.00 71.86  ? 477 GLN A OE1 1 
ATOM   1718 N  NE2 . GLN A 1 217 ? -26.681 -21.605 -42.118 1.00 83.69  ? 477 GLN A NE2 1 
ATOM   1719 N  N   . LEU A 1 218 ? -26.976 -24.330 -35.789 1.00 66.53  ? 478 LEU A N   1 
ATOM   1720 C  CA  . LEU A 1 218 ? -26.137 -24.749 -34.674 1.00 66.11  ? 478 LEU A CA  1 
ATOM   1721 C  C   . LEU A 1 218 ? -26.470 -26.172 -34.259 1.00 67.02  ? 478 LEU A C   1 
ATOM   1722 O  O   . LEU A 1 218 ? -25.555 -26.951 -34.003 1.00 69.17  ? 478 LEU A O   1 
ATOM   1723 C  CB  . LEU A 1 218 ? -26.243 -23.800 -33.480 1.00 65.72  ? 478 LEU A CB  1 
ATOM   1724 C  CG  . LEU A 1 218 ? -25.422 -24.192 -32.251 1.00 61.99  ? 478 LEU A CG  1 
ATOM   1725 C  CD1 . LEU A 1 218 ? -23.987 -24.496 -32.618 1.00 60.11  ? 478 LEU A CD1 1 
ATOM   1726 C  CD2 . LEU A 1 218 ? -25.489 -23.073 -31.216 1.00 62.30  ? 478 LEU A CD2 1 
ATOM   1727 N  N   . LYS A 1 219 ? -27.759 -26.517 -34.200 1.00 65.76  ? 479 LYS A N   1 
ATOM   1728 C  CA  . LYS A 1 219 ? -28.148 -27.874 -33.858 1.00 69.48  ? 479 LYS A CA  1 
ATOM   1729 C  C   . LYS A 1 219 ? -27.485 -28.830 -34.828 1.00 74.85  ? 479 LYS A C   1 
ATOM   1730 O  O   . LYS A 1 219 ? -26.789 -29.763 -34.407 1.00 77.97  ? 479 LYS A O   1 
ATOM   1731 C  CB  . LYS A 1 219 ? -29.657 -28.078 -33.914 1.00 75.63  ? 479 LYS A CB  1 
ATOM   1732 C  CG  . LYS A 1 219 ? -30.092 -29.474 -33.443 1.00 80.33  ? 479 LYS A CG  1 
ATOM   1733 C  CD  . LYS A 1 219 ? -31.447 -29.896 -34.000 1.00 85.58  ? 479 LYS A CD  1 
ATOM   1734 C  CE  . LYS A 1 219 ? -31.901 -31.251 -33.446 1.00 88.71  ? 479 LYS A CE  1 
ATOM   1735 N  NZ  . LYS A 1 219 ? -31.393 -32.404 -34.251 1.00 90.93  ? 479 LYS A NZ  1 
ATOM   1736 N  N   . ILE A 1 220 ? -27.689 -28.585 -36.121 1.00 73.40  ? 480 ILE A N   1 
ATOM   1737 C  CA  . ILE A 1 220 ? -27.156 -29.459 -37.162 1.00 75.32  ? 480 ILE A CA  1 
ATOM   1738 C  C   . ILE A 1 220 ? -25.644 -29.696 -37.020 1.00 76.08  ? 480 ILE A C   1 
ATOM   1739 O  O   . ILE A 1 220 ? -25.197 -30.849 -37.040 1.00 78.53  ? 480 ILE A O   1 
ATOM   1740 C  CB  . ILE A 1 220 ? -27.494 -28.919 -38.566 1.00 74.75  ? 480 ILE A CB  1 
ATOM   1741 C  CG1 . ILE A 1 220 ? -28.994 -29.087 -38.835 1.00 72.00  ? 480 ILE A CG1 1 
ATOM   1742 C  CG2 . ILE A 1 220 ? -26.710 -29.660 -39.633 1.00 76.25  ? 480 ILE A CG2 1 
ATOM   1743 C  CD1 . ILE A 1 220 ? -29.514 -28.232 -39.954 1.00 71.54  ? 480 ILE A CD1 1 
ATOM   1744 N  N   . GLN A 1 221 ? -24.879 -28.616 -36.840 1.00 73.22  ? 481 GLN A N   1 
ATOM   1745 C  CA  . GLN A 1 221 ? -23.407 -28.684 -36.790 1.00 73.11  ? 481 GLN A CA  1 
ATOM   1746 C  C   . GLN A 1 221 ? -22.880 -29.390 -35.547 1.00 73.14  ? 481 GLN A C   1 
ATOM   1747 O  O   . GLN A 1 221 ? -21.886 -30.113 -35.621 1.00 73.39  ? 481 GLN A O   1 
ATOM   1748 C  CB  . GLN A 1 221 ? -22.771 -27.285 -36.870 1.00 70.02  ? 481 GLN A CB  1 
ATOM   1749 C  CG  . GLN A 1 221 ? -22.946 -26.545 -38.199 1.00 71.20  ? 481 GLN A CG  1 
ATOM   1750 C  CD  . GLN A 1 221 ? -22.672 -27.416 -39.412 1.00 76.25  ? 481 GLN A CD  1 
ATOM   1751 O  OE1 . GLN A 1 221 ? -21.628 -28.079 -39.481 1.00 76.49  ? 481 GLN A OE1 1 
ATOM   1752 N  NE2 . GLN A 1 221 ? -23.619 -27.429 -40.378 1.00 75.59  ? 481 GLN A NE2 1 
ATOM   1753 N  N   . VAL A 1 222 ? -23.534 -29.169 -34.410 1.00 72.00  ? 482 VAL A N   1 
ATOM   1754 C  CA  . VAL A 1 222 ? -23.200 -29.892 -33.184 1.00 73.08  ? 482 VAL A CA  1 
ATOM   1755 C  C   . VAL A 1 222 ? -23.427 -31.407 -33.366 1.00 77.08  ? 482 VAL A C   1 
ATOM   1756 O  O   . VAL A 1 222 ? -22.578 -32.206 -32.999 1.00 81.23  ? 482 VAL A O   1 
ATOM   1757 C  CB  . VAL A 1 222 ? -23.992 -29.351 -31.970 1.00 68.16  ? 482 VAL A CB  1 
ATOM   1758 C  CG1 . VAL A 1 222 ? -23.774 -30.227 -30.742 1.00 62.15  ? 482 VAL A CG1 1 
ATOM   1759 C  CG2 . VAL A 1 222 ? -23.593 -27.911 -31.680 1.00 64.34  ? 482 VAL A CG2 1 
ATOM   1760 N  N   . ALA A 1 223 ? -24.545 -31.799 -33.956 1.00 74.84  ? 483 ALA A N   1 
ATOM   1761 C  CA  . ALA A 1 223 ? -24.770 -33.206 -34.279 1.00 74.26  ? 483 ALA A CA  1 
ATOM   1762 C  C   . ALA A 1 223 ? -23.734 -33.747 -35.268 1.00 76.77  ? 483 ALA A C   1 
ATOM   1763 O  O   . ALA A 1 223 ? -23.398 -34.933 -35.236 1.00 79.95  ? 483 ALA A O   1 
ATOM   1764 C  CB  . ALA A 1 223 ? -26.161 -33.395 -34.838 1.00 74.48  ? 483 ALA A CB  1 
ATOM   1765 N  N   . ALA A 1 224 ? -23.236 -32.881 -36.151 1.00 77.42  ? 484 ALA A N   1 
ATOM   1766 C  CA  . ALA A 1 224 ? -22.207 -33.265 -37.140 1.00 80.06  ? 484 ALA A CA  1 
ATOM   1767 C  C   . ALA A 1 224 ? -20.799 -33.276 -36.546 1.00 81.51  ? 484 ALA A C   1 
ATOM   1768 O  O   . ALA A 1 224 ? -19.838 -33.648 -37.215 1.00 82.07  ? 484 ALA A O   1 
ATOM   1769 C  CB  . ALA A 1 224 ? -22.252 -32.324 -38.337 1.00 76.81  ? 484 ALA A CB  1 
ATOM   1770 N  N   . LYS A 1 225 ? -20.700 -32.833 -35.299 1.00 79.59  ? 485 LYS A N   1 
ATOM   1771 C  CA  . LYS A 1 225 ? -19.461 -32.820 -34.529 1.00 78.12  ? 485 LYS A CA  1 
ATOM   1772 C  C   . LYS A 1 225 ? -18.376 -31.904 -35.114 1.00 76.54  ? 485 LYS A C   1 
ATOM   1773 O  O   . LYS A 1 225 ? -17.185 -32.139 -34.918 1.00 79.21  ? 485 LYS A O   1 
ATOM   1774 C  CB  . LYS A 1 225 ? -18.965 -34.248 -34.289 1.00 80.43  ? 485 LYS A CB  1 
ATOM   1775 C  CG  . LYS A 1 225 ? -20.101 -35.195 -33.856 1.00 83.82  ? 485 LYS A CG  1 
ATOM   1776 C  CD  . LYS A 1 225 ? -19.687 -36.259 -32.820 1.00 86.41  ? 485 LYS A CD  1 
ATOM   1777 C  CE  . LYS A 1 225 ? -20.006 -35.823 -31.375 1.00 87.80  ? 485 LYS A CE  1 
ATOM   1778 N  NZ  . LYS A 1 225 ? -21.457 -35.975 -31.011 1.00 87.81  ? 485 LYS A NZ  1 
ATOM   1779 N  N   . THR A 1 226 ? -18.807 -30.829 -35.778 1.00 70.54  ? 486 THR A N   1 
ATOM   1780 C  CA  . THR A 1 226 ? -17.903 -29.808 -36.299 1.00 71.56  ? 486 THR A CA  1 
ATOM   1781 C  C   . THR A 1 226 ? -17.686 -28.640 -35.322 1.00 74.01  ? 486 THR A C   1 
ATOM   1782 O  O   . THR A 1 226 ? -16.847 -27.765 -35.569 1.00 74.13  ? 486 THR A O   1 
ATOM   1783 C  CB  . THR A 1 226 ? -18.399 -29.255 -37.680 1.00 78.97  ? 486 THR A CB  1 
ATOM   1784 O  OG1 . THR A 1 226 ? -19.714 -28.692 -37.560 1.00 80.57  ? 486 THR A OG1 1 
ATOM   1785 C  CG2 . THR A 1 226 ? -18.419 -30.357 -38.722 1.00 80.62  ? 486 THR A CG2 1 
ATOM   1786 N  N   . VAL A 1 227 ? -18.439 -28.617 -34.224 1.00 71.42  ? 487 VAL A N   1 
ATOM   1787 C  CA  . VAL A 1 227 ? -18.269 -27.594 -33.189 1.00 70.78  ? 487 VAL A CA  1 
ATOM   1788 C  C   . VAL A 1 227 ? -18.894 -28.010 -31.859 1.00 72.47  ? 487 VAL A C   1 
ATOM   1789 O  O   . VAL A 1 227 ? -19.809 -28.828 -31.824 1.00 77.43  ? 487 VAL A O   1 
ATOM   1790 C  CB  . VAL A 1 227 ? -18.906 -26.251 -33.588 1.00 68.36  ? 487 VAL A CB  1 
ATOM   1791 C  CG1 . VAL A 1 227 ? -18.044 -25.521 -34.610 1.00 70.48  ? 487 VAL A CG1 1 
ATOM   1792 C  CG2 . VAL A 1 227 ? -20.328 -26.459 -34.086 1.00 67.83  ? 487 VAL A CG2 1 
ATOM   1793 N  N   . PHE A 1 228 ? -18.389 -27.441 -30.770 1.00 63.89  ? 488 PHE A N   1 
ATOM   1794 C  CA  . PHE A 1 228 ? -18.963 -27.635 -29.453 1.00 60.48  ? 488 PHE A CA  1 
ATOM   1795 C  C   . PHE A 1 228 ? -19.060 -29.110 -29.046 1.00 59.76  ? 488 PHE A C   1 
ATOM   1796 O  O   . PHE A 1 228 ? -20.080 -29.552 -28.507 1.00 59.99  ? 488 PHE A O   1 
ATOM   1797 C  CB  . PHE A 1 228 ? -20.323 -26.913 -29.368 1.00 60.46  ? 488 PHE A CB  1 
ATOM   1798 C  CG  . PHE A 1 228 ? -20.194 -25.426 -29.358 1.00 63.39  ? 488 PHE A CG  1 
ATOM   1799 C  CD1 . PHE A 1 228 ? -19.968 -24.751 -28.176 1.00 63.62  ? 488 PHE A CD1 1 
ATOM   1800 C  CD2 . PHE A 1 228 ? -20.235 -24.703 -30.535 1.00 65.95  ? 488 PHE A CD2 1 
ATOM   1801 C  CE1 . PHE A 1 228 ? -19.800 -23.358 -28.161 1.00 61.21  ? 488 PHE A CE1 1 
ATOM   1802 C  CE2 . PHE A 1 228 ? -20.075 -23.316 -30.539 1.00 66.76  ? 488 PHE A CE2 1 
ATOM   1803 C  CZ  . PHE A 1 228 ? -19.860 -22.638 -29.341 1.00 63.65  ? 488 PHE A CZ  1 
ATOM   1804 N  N   . GLU A 1 229 ? -17.985 -29.864 -29.276 1.00 58.11  ? 489 GLU A N   1 
ATOM   1805 C  CA  . GLU A 1 229 ? -17.966 -31.277 -28.895 1.00 57.29  ? 489 GLU A CA  1 
ATOM   1806 C  C   . GLU A 1 229 ? -18.012 -31.325 -27.381 1.00 55.94  ? 489 GLU A C   1 
ATOM   1807 O  O   . GLU A 1 229 ? -17.205 -30.685 -26.704 1.00 57.29  ? 489 GLU A O   1 
ATOM   1808 C  CB  . GLU A 1 229 ? -16.727 -32.038 -29.414 1.00 54.96  ? 489 GLU A CB  1 
ATOM   1809 C  CG  . GLU A 1 229 ? -16.360 -31.784 -30.901 1.00 85.01  ? 489 GLU A CG  1 
ATOM   1810 C  CD  . GLU A 1 229 ? -15.580 -32.945 -31.584 1.00 95.08  ? 489 GLU A CD  1 
ATOM   1811 O  OE1 . GLU A 1 229 ? -15.145 -32.748 -32.749 1.00 93.66  ? 489 GLU A OE1 1 
ATOM   1812 O  OE2 . GLU A 1 229 ? -15.413 -34.048 -30.987 1.00 96.87  ? 489 GLU A OE2 1 
ATOM   1813 N  N   . GLY A 1 230 ? -18.985 -32.055 -26.859 1.00 52.36  ? 490 GLY A N   1 
ATOM   1814 C  CA  . GLY A 1 230 ? -19.141 -32.223 -25.436 1.00 51.14  ? 490 GLY A CA  1 
ATOM   1815 C  C   . GLY A 1 230 ? -19.966 -31.153 -24.750 1.00 54.60  ? 490 GLY A C   1 
ATOM   1816 O  O   . GLY A 1 230 ? -20.199 -31.247 -23.552 1.00 56.02  ? 490 GLY A O   1 
ATOM   1817 N  N   . PHE A 1 231 ? -20.418 -30.142 -25.482 1.00 53.79  ? 491 PHE A N   1 
ATOM   1818 C  CA  . PHE A 1 231 ? -21.238 -29.101 -24.879 1.00 55.34  ? 491 PHE A CA  1 
ATOM   1819 C  C   . PHE A 1 231 ? -22.745 -29.405 -24.908 1.00 58.37  ? 491 PHE A C   1 
ATOM   1820 O  O   . PHE A 1 231 ? -23.233 -30.156 -25.739 1.00 61.30  ? 491 PHE A O   1 
ATOM   1821 C  CB  . PHE A 1 231 ? -21.005 -27.766 -25.572 1.00 55.96  ? 491 PHE A CB  1 
ATOM   1822 C  CG  . PHE A 1 231 ? -19.663 -27.163 -25.301 1.00 54.84  ? 491 PHE A CG  1 
ATOM   1823 C  CD1 . PHE A 1 231 ? -19.546 -26.061 -24.480 1.00 52.59  ? 491 PHE A CD1 1 
ATOM   1824 C  CD2 . PHE A 1 231 ? -18.525 -27.679 -25.893 1.00 52.06  ? 491 PHE A CD2 1 
ATOM   1825 C  CE1 . PHE A 1 231 ? -18.316 -25.491 -24.246 1.00 49.70  ? 491 PHE A CE1 1 
ATOM   1826 C  CE2 . PHE A 1 231 ? -17.299 -27.122 -25.655 1.00 50.34  ? 491 PHE A CE2 1 
ATOM   1827 C  CZ  . PHE A 1 231 ? -17.190 -26.022 -24.831 1.00 50.99  ? 491 PHE A CZ  1 
ATOM   1828 N  N   . THR A 1 232 ? -23.469 -28.778 -23.992 1.00 56.17  ? 492 THR A N   1 
ATOM   1829 C  CA  . THR A 1 232 ? -24.905 -28.892 -23.919 1.00 53.64  ? 492 THR A CA  1 
ATOM   1830 C  C   . THR A 1 232 ? -25.503 -27.517 -24.114 1.00 55.58  ? 492 THR A C   1 
ATOM   1831 O  O   . THR A 1 232 ? -24.880 -26.518 -23.791 1.00 58.52  ? 492 THR A O   1 
ATOM   1832 C  CB  . THR A 1 232 ? -25.335 -29.439 -22.556 1.00 51.22  ? 492 THR A CB  1 
ATOM   1833 O  OG1 . THR A 1 232 ? -24.618 -30.644 -22.280 1.00 51.34  ? 492 THR A OG1 1 
ATOM   1834 C  CG2 . THR A 1 232 ? -26.814 -29.733 -22.540 1.00 52.10  ? 492 THR A CG2 1 
ATOM   1835 N  N   . GLU A 1 233 ? -26.696 -27.473 -24.690 1.00 55.29  ? 493 GLU A N   1 
ATOM   1836 C  CA  . GLU A 1 233 ? -27.501 -26.271 -24.705 1.00 55.14  ? 493 GLU A CA  1 
ATOM   1837 C  C   . GLU A 1 233 ? -28.813 -26.683 -24.107 1.00 58.78  ? 493 GLU A C   1 
ATOM   1838 O  O   . GLU A 1 233 ? -29.281 -27.784 -24.371 1.00 64.06  ? 493 GLU A O   1 
ATOM   1839 C  CB  . GLU A 1 233 ? -27.716 -25.732 -26.113 1.00 51.61  ? 493 GLU A CB  1 
ATOM   1840 C  CG  . GLU A 1 233 ? -28.376 -24.359 -26.089 1.00 56.24  ? 493 GLU A CG  1 
ATOM   1841 C  CD  . GLU A 1 233 ? -28.725 -23.756 -27.462 1.00 62.02  ? 493 GLU A CD  1 
ATOM   1842 O  OE1 . GLU A 1 233 ? -28.906 -22.521 -27.488 1.00 58.23  ? 493 GLU A OE1 1 
ATOM   1843 O  OE2 . GLU A 1 233 ? -28.861 -24.485 -28.486 1.00 67.77  ? 493 GLU A OE2 1 
ATOM   1844 N  N   . GLY A 1 234 ? -29.406 -25.822 -23.290 1.00 57.33  ? 494 GLY A N   1 
ATOM   1845 C  CA  . GLY A 1 234 ? -30.729 -26.089 -22.753 1.00 57.33  ? 494 GLY A CA  1 
ATOM   1846 C  C   . GLY A 1 234 ? -31.735 -25.989 -23.866 1.00 62.18  ? 494 GLY A C   1 
ATOM   1847 O  O   . GLY A 1 234 ? -31.443 -25.396 -24.891 1.00 64.85  ? 494 GLY A O   1 
ATOM   1848 N  N   . GLU A 1 235 ? -32.919 -26.558 -23.674 1.00 65.21  ? 495 GLU A N   1 
ATOM   1849 C  CA  . GLU A 1 235 ? -33.982 -26.425 -24.669 1.00 69.91  ? 495 GLU A CA  1 
ATOM   1850 C  C   . GLU A 1 235 ? -34.268 -24.938 -24.921 1.00 68.99  ? 495 GLU A C   1 
ATOM   1851 O  O   . GLU A 1 235 ? -34.299 -24.124 -23.980 1.00 66.38  ? 495 GLU A O   1 
ATOM   1852 C  CB  . GLU A 1 235 ? -35.256 -27.154 -24.214 1.00 75.66  ? 495 GLU A CB  1 
ATOM   1853 C  CG  . GLU A 1 235 ? -36.316 -27.362 -25.296 1.00 82.44  ? 495 GLU A CG  1 
ATOM   1854 C  CD  . GLU A 1 235 ? -37.657 -27.856 -24.726 1.00 89.13  ? 495 GLU A CD  1 
ATOM   1855 O  OE1 . GLU A 1 235 ? -37.675 -28.274 -23.545 1.00 90.49  ? 495 GLU A OE1 1 
ATOM   1856 O  OE2 . GLU A 1 235 ? -38.685 -27.826 -25.454 1.00 92.68  ? 495 GLU A OE2 1 
ATOM   1857 N  N   . LEU A 1 236 ? -34.432 -24.594 -26.198 1.00 68.02  ? 496 LEU A N   1 
ATOM   1858 C  CA  . LEU A 1 236 ? -34.779 -23.238 -26.603 1.00 67.26  ? 496 LEU A CA  1 
ATOM   1859 C  C   . LEU A 1 236 ? -36.283 -23.092 -26.470 1.00 75.31  ? 496 LEU A C   1 
ATOM   1860 O  O   . LEU A 1 236 ? -37.043 -23.584 -27.320 1.00 82.51  ? 496 LEU A O   1 
ATOM   1861 C  CB  . LEU A 1 236 ? -34.354 -22.977 -28.050 1.00 64.04  ? 496 LEU A CB  1 
ATOM   1862 C  CG  . LEU A 1 236 ? -32.848 -22.796 -28.275 1.00 60.72  ? 496 LEU A CG  1 
ATOM   1863 C  CD1 . LEU A 1 236 ? -32.489 -23.022 -29.749 1.00 56.81  ? 496 LEU A CD1 1 
ATOM   1864 C  CD2 . LEU A 1 236 ? -32.385 -21.404 -27.772 1.00 53.52  ? 496 LEU A CD2 1 
ATOM   1865 N  N   . THR A 1 237 ? -36.717 -22.442 -25.395 1.00 73.19  ? 497 THR A N   1 
ATOM   1866 C  CA  . THR A 1 237 ? -38.147 -22.244 -25.134 1.00 72.41  ? 497 THR A CA  1 
ATOM   1867 C  C   . THR A 1 237 ? -38.574 -20.793 -25.378 1.00 71.04  ? 497 THR A C   1 
ATOM   1868 O  O   . THR A 1 237 ? -39.722 -20.451 -25.143 1.00 76.77  ? 497 THR A O   1 
ATOM   1869 C  CB  . THR A 1 237 ? -38.498 -22.637 -23.692 1.00 70.94  ? 497 THR A CB  1 
ATOM   1870 O  OG1 . THR A 1 237 ? -37.973 -21.653 -22.793 1.00 72.12  ? 497 THR A OG1 1 
ATOM   1871 C  CG2 . THR A 1 237 ? -37.896 -23.991 -23.356 1.00 65.83  ? 497 THR A CG2 1 
ATOM   1872 N  N   . PHE A 1 238 ? -37.645 -19.962 -25.858 1.00 65.49  ? 498 PHE A N   1 
ATOM   1873 C  CA  . PHE A 1 238 ? -37.917 -18.566 -26.212 1.00 65.44  ? 498 PHE A CA  1 
ATOM   1874 C  C   . PHE A 1 238 ? -37.761 -18.365 -27.707 1.00 66.17  ? 498 PHE A C   1 
ATOM   1875 O  O   . PHE A 1 238 ? -37.014 -19.094 -28.346 1.00 62.55  ? 498 PHE A O   1 
ATOM   1876 C  CB  . PHE A 1 238 ? -36.956 -17.625 -25.486 1.00 64.40  ? 498 PHE A CB  1 
ATOM   1877 C  CG  . PHE A 1 238 ? -35.506 -17.979 -25.663 1.00 64.66  ? 498 PHE A CG  1 
ATOM   1878 C  CD1 . PHE A 1 238 ? -34.788 -17.507 -26.742 1.00 68.50  ? 498 PHE A CD1 1 
ATOM   1879 C  CD2 . PHE A 1 238 ? -34.860 -18.778 -24.747 1.00 63.06  ? 498 PHE A CD2 1 
ATOM   1880 C  CE1 . PHE A 1 238 ? -33.443 -17.827 -26.906 1.00 68.97  ? 498 PHE A CE1 1 
ATOM   1881 C  CE2 . PHE A 1 238 ? -33.520 -19.101 -24.906 1.00 63.77  ? 498 PHE A CE2 1 
ATOM   1882 C  CZ  . PHE A 1 238 ? -32.816 -18.627 -25.986 1.00 67.14  ? 498 PHE A CZ  1 
ATOM   1883 N  N   . GLN A 1 239 ? -38.448 -17.361 -28.254 1.00 70.90  ? 499 GLN A N   1 
ATOM   1884 C  CA  . GLN A 1 239 ? -38.403 -17.098 -29.700 1.00 73.04  ? 499 GLN A CA  1 
ATOM   1885 C  C   . GLN A 1 239 ? -37.056 -16.509 -30.128 1.00 70.84  ? 499 GLN A C   1 
ATOM   1886 O  O   . GLN A 1 239 ? -36.360 -15.864 -29.333 1.00 66.79  ? 499 GLN A O   1 
ATOM   1887 C  CB  . GLN A 1 239 ? -39.560 -16.197 -30.163 1.00 75.96  ? 499 GLN A CB  1 
ATOM   1888 C  CG  . GLN A 1 239 ? -39.343 -14.706 -29.928 1.00 76.02  ? 499 GLN A CG  1 
ATOM   1889 C  CD  . GLN A 1 239 ? -40.568 -13.832 -30.228 1.00 77.81  ? 499 GLN A CD  1 
ATOM   1890 O  OE1 . GLN A 1 239 ? -41.724 -14.261 -30.108 1.00 78.83  ? 499 GLN A OE1 1 
ATOM   1891 N  NE2 . GLN A 1 239 ? -40.305 -12.584 -30.601 1.00 76.96  ? 499 GLN A NE2 1 
ATOM   1892 N  N   . PRO A 1 240 ? -36.687 -16.727 -31.396 1.00 72.24  ? 500 PRO A N   1 
ATOM   1893 C  CA  . PRO A 1 240 ? -35.435 -16.214 -31.917 1.00 69.65  ? 500 PRO A CA  1 
ATOM   1894 C  C   . PRO A 1 240 ? -35.225 -14.736 -31.615 1.00 67.23  ? 500 PRO A C   1 
ATOM   1895 O  O   . PRO A 1 240 ? -36.180 -13.946 -31.601 1.00 65.50  ? 500 PRO A O   1 
ATOM   1896 C  CB  . PRO A 1 240 ? -35.558 -16.473 -33.415 1.00 71.91  ? 500 PRO A CB  1 
ATOM   1897 C  CG  . PRO A 1 240 ? -36.353 -17.704 -33.493 1.00 72.02  ? 500 PRO A CG  1 
ATOM   1898 C  CD  . PRO A 1 240 ? -37.380 -17.558 -32.397 1.00 73.12  ? 500 PRO A CD  1 
ATOM   1899 N  N   . THR A 1 241 ? -33.956 -14.398 -31.388 1.00 67.16  ? 501 THR A N   1 
ATOM   1900 C  CA  . THR A 1 241 ? -33.549 -13.154 -30.750 1.00 64.52  ? 501 THR A CA  1 
ATOM   1901 C  C   . THR A 1 241 ? -33.042 -12.122 -31.748 1.00 68.38  ? 501 THR A C   1 
ATOM   1902 O  O   . THR A 1 241 ? -32.529 -11.079 -31.339 1.00 69.60  ? 501 THR A O   1 
ATOM   1903 C  CB  . THR A 1 241 ? -32.429 -13.446 -29.753 1.00 55.50  ? 501 THR A CB  1 
ATOM   1904 O  OG1 . THR A 1 241 ? -31.299 -13.964 -30.457 1.00 53.20  ? 501 THR A OG1 1 
ATOM   1905 C  CG2 . THR A 1 241 ? -32.889 -14.489 -28.737 1.00 55.60  ? 501 THR A CG2 1 
ATOM   1906 N  N   . TYR A 1 242 ? -33.199 -12.423 -33.042 1.00 67.72  ? 502 TYR A N   1 
ATOM   1907 C  CA  . TYR A 1 242 ? -32.705 -11.597 -34.140 1.00 68.52  ? 502 TYR A CA  1 
ATOM   1908 C  C   . TYR A 1 242 ? -33.602 -11.884 -35.338 1.00 75.57  ? 502 TYR A C   1 
ATOM   1909 O  O   . TYR A 1 242 ? -34.013 -13.032 -35.508 1.00 75.57  ? 502 TYR A O   1 
ATOM   1910 C  CB  . TYR A 1 242 ? -31.283 -12.019 -34.455 1.00 64.22  ? 502 TYR A CB  1 
ATOM   1911 C  CG  . TYR A 1 242 ? -30.572 -11.309 -35.601 1.00 66.75  ? 502 TYR A CG  1 
ATOM   1912 C  CD1 . TYR A 1 242 ? -30.033 -10.045 -35.437 1.00 66.09  ? 502 TYR A CD1 1 
ATOM   1913 C  CD2 . TYR A 1 242 ? -30.356 -11.943 -36.814 1.00 66.20  ? 502 TYR A CD2 1 
ATOM   1914 C  CE1 . TYR A 1 242 ? -29.330 -9.422  -36.462 1.00 67.35  ? 502 TYR A CE1 1 
ATOM   1915 C  CE2 . TYR A 1 242 ? -29.652 -11.330 -37.829 1.00 68.26  ? 502 TYR A CE2 1 
ATOM   1916 C  CZ  . TYR A 1 242 ? -29.147 -10.068 -37.648 1.00 70.93  ? 502 TYR A CZ  1 
ATOM   1917 O  OH  . TYR A 1 242 ? -28.459 -9.446  -38.660 1.00 73.81  ? 502 TYR A OH  1 
ATOM   1918 N  N   . LYS A 1 243 ? -33.929 -10.890 -36.173 1.00 77.04  ? 503 LYS A N   1 
ATOM   1919 C  CA  . LYS A 1 243 ? -33.494 -9.488  -36.077 1.00 73.47  ? 503 LYS A CA  1 
ATOM   1920 C  C   . LYS A 1 243 ? -34.728 -8.614  -35.891 1.00 77.40  ? 503 LYS A C   1 
ATOM   1921 O  O   . LYS A 1 243 ? -35.692 -8.771  -36.621 1.00 80.96  ? 503 LYS A O   1 
ATOM   1922 C  CB  . LYS A 1 243 ? -32.788 -9.093  -37.373 1.00 72.03  ? 503 LYS A CB  1 
ATOM   1923 C  CG  . LYS A 1 243 ? -32.484 -7.610  -37.553 1.00 70.42  ? 503 LYS A CG  1 
ATOM   1924 C  CD  . LYS A 1 243 ? -31.442 -7.359  -38.664 1.00 69.90  ? 503 LYS A CD  1 
ATOM   1925 C  CE  . LYS A 1 243 ? -31.116 -5.863  -38.822 1.00 72.71  ? 503 LYS A CE  1 
ATOM   1926 N  NZ  . LYS A 1 243 ? -29.771 -5.635  -39.420 1.00 73.63  ? 503 LYS A NZ  1 
ATOM   1927 N  N   . TYR A 1 244 ? -34.690 -7.692  -34.927 1.00 76.84  ? 504 TYR A N   1 
ATOM   1928 C  CA  . TYR A 1 244 ? -35.837 -6.836  -34.608 1.00 76.08  ? 504 TYR A CA  1 
ATOM   1929 C  C   . TYR A 1 244 ? -35.624 -5.377  -35.016 1.00 80.39  ? 504 TYR A C   1 
ATOM   1930 O  O   . TYR A 1 244 ? -34.499 -4.910  -35.113 1.00 78.23  ? 504 TYR A O   1 
ATOM   1931 C  CB  . TYR A 1 244 ? -36.107 -6.869  -33.106 1.00 71.09  ? 504 TYR A CB  1 
ATOM   1932 C  CG  . TYR A 1 244 ? -36.550 -8.205  -32.586 1.00 70.46  ? 504 TYR A CG  1 
ATOM   1933 C  CD1 . TYR A 1 244 ? -37.896 -8.542  -32.542 1.00 71.56  ? 504 TYR A CD1 1 
ATOM   1934 C  CD2 . TYR A 1 244 ? -35.632 -9.135  -32.129 1.00 65.62  ? 504 TYR A CD2 1 
ATOM   1935 C  CE1 . TYR A 1 244 ? -38.317 -9.778  -32.055 1.00 68.39  ? 504 TYR A CE1 1 
ATOM   1936 C  CE2 . TYR A 1 244 ? -36.044 -10.371 -31.648 1.00 60.81  ? 504 TYR A CE2 1 
ATOM   1937 C  CZ  . TYR A 1 244 ? -37.387 -10.683 -31.613 1.00 64.63  ? 504 TYR A CZ  1 
ATOM   1938 O  OH  . TYR A 1 244 ? -37.790 -11.903 -31.134 1.00 69.84  ? 504 TYR A OH  1 
ATOM   1939 N  N   . ASP A 1 245 ? -36.721 -4.662  -35.245 1.00 86.87  ? 505 ASP A N   1 
ATOM   1940 C  CA  . ASP A 1 245 ? -36.677 -3.206  -35.389 1.00 89.85  ? 505 ASP A CA  1 
ATOM   1941 C  C   . ASP A 1 245 ? -36.253 -2.623  -34.054 1.00 85.18  ? 505 ASP A C   1 
ATOM   1942 O  O   . ASP A 1 245 ? -36.861 -2.920  -33.027 1.00 81.10  ? 505 ASP A O   1 
ATOM   1943 C  CB  . ASP A 1 245 ? -38.064 -2.619  -35.744 1.00 95.36  ? 505 ASP A CB  1 
ATOM   1944 C  CG  . ASP A 1 245 ? -38.225 -2.250  -37.219 1.00 98.05  ? 505 ASP A CG  1 
ATOM   1945 O  OD1 . ASP A 1 245 ? -39.382 -1.943  -37.592 1.00 102.72 ? 505 ASP A OD1 1 
ATOM   1946 O  OD2 . ASP A 1 245 ? -37.235 -2.248  -37.986 1.00 96.58  ? 505 ASP A OD2 1 
ATOM   1947 N  N   . THR A 1 246 ? -35.233 -1.774  -34.072 1.00 85.10  ? 506 THR A N   1 
ATOM   1948 C  CA  . THR A 1 246 ? -34.770 -1.122  -32.852 1.00 82.50  ? 506 THR A CA  1 
ATOM   1949 C  C   . THR A 1 246 ? -35.947 -0.415  -32.243 1.00 83.46  ? 506 THR A C   1 
ATOM   1950 O  O   . THR A 1 246 ? -36.724 0.205   -32.957 1.00 86.44  ? 506 THR A O   1 
ATOM   1951 C  CB  . THR A 1 246 ? -33.665 -0.076  -33.121 1.00 80.12  ? 506 THR A CB  1 
ATOM   1952 O  OG1 . THR A 1 246 ? -32.752 -0.586  -34.096 1.00 81.13  ? 506 THR A OG1 1 
ATOM   1953 C  CG2 . THR A 1 246 ? -32.900 0.236   -31.838 1.00 75.40  ? 506 THR A CG2 1 
ATOM   1954 N  N   . GLY A 1 247 ? -36.090 -0.537  -30.930 1.00 78.05  ? 507 GLY A N   1 
ATOM   1955 C  CA  . GLY A 1 247 ? -37.153 0.143   -30.206 1.00 73.82  ? 507 GLY A CA  1 
ATOM   1956 C  C   . GLY A 1 247 ? -38.497 -0.533  -30.316 1.00 72.49  ? 507 GLY A C   1 
ATOM   1957 O  O   . GLY A 1 247 ? -39.507 0.078   -29.992 1.00 74.18  ? 507 GLY A O   1 
ATOM   1958 N  N   . SER A 1 248 ? -38.511 -1.792  -30.756 1.00 74.13  ? 508 SER A N   1 
ATOM   1959 C  CA  . SER A 1 248 ? -39.758 -2.575  -30.824 1.00 83.00  ? 508 SER A CA  1 
ATOM   1960 C  C   . SER A 1 248 ? -39.528 -4.094  -30.876 1.00 84.33  ? 508 SER A C   1 
ATOM   1961 O  O   . SER A 1 248 ? -38.393 -4.562  -30.768 1.00 84.07  ? 508 SER A O   1 
ATOM   1962 C  CB  . SER A 1 248 ? -40.579 -2.156  -32.043 1.00 87.50  ? 508 SER A CB  1 
ATOM   1963 O  OG  . SER A 1 248 ? -40.061 -2.778  -33.201 1.00 88.52  ? 508 SER A OG  1 
ATOM   1964 N  N   . ASP A 1 249 ? -40.624 -4.839  -31.055 1.00 85.14  ? 509 ASP A N   1 
ATOM   1965 C  CA  . ASP A 1 249 ? -40.599 -6.299  -31.198 1.00 85.44  ? 509 ASP A CA  1 
ATOM   1966 C  C   . ASP A 1 249 ? -40.988 -6.790  -32.608 1.00 87.86  ? 509 ASP A C   1 
ATOM   1967 O  O   . ASP A 1 249 ? -41.238 -7.979  -32.802 1.00 88.30  ? 509 ASP A O   1 
ATOM   1968 C  CB  . ASP A 1 249 ? -41.539 -6.929  -30.165 1.00 88.30  ? 509 ASP A CB  1 
ATOM   1969 C  CG  . ASP A 1 249 ? -41.146 -6.601  -28.736 1.00 88.78  ? 509 ASP A CG  1 
ATOM   1970 O  OD1 . ASP A 1 249 ? -39.944 -6.386  -28.466 1.00 85.79  ? 509 ASP A OD1 1 
ATOM   1971 O  OD2 . ASP A 1 249 ? -42.044 -6.571  -27.872 1.00 92.06  ? 509 ASP A OD2 1 
ATOM   1972 N  N   . ASP A 1 250 ? -41.032 -5.883  -33.584 1.00 88.49  ? 510 ASP A N   1 
ATOM   1973 C  CA  . ASP A 1 250 ? -41.294 -6.252  -34.979 1.00 90.50  ? 510 ASP A CA  1 
ATOM   1974 C  C   . ASP A 1 250 ? -40.002 -6.673  -35.662 1.00 88.96  ? 510 ASP A C   1 
ATOM   1975 O  O   . ASP A 1 250 ? -38.922 -6.249  -35.260 1.00 86.83  ? 510 ASP A O   1 
ATOM   1976 C  CB  . ASP A 1 250 ? -41.897 -5.070  -35.742 1.00 94.00  ? 510 ASP A CB  1 
ATOM   1977 C  CG  . ASP A 1 250 ? -43.211 -4.602  -35.155 1.00 96.54  ? 510 ASP A CG  1 
ATOM   1978 O  OD1 . ASP A 1 250 ? -43.809 -5.351  -34.353 1.00 94.45  ? 510 ASP A OD1 1 
ATOM   1979 O  OD2 . ASP A 1 250 ? -43.642 -3.480  -35.499 1.00 98.26  ? 510 ASP A OD2 1 
ATOM   1980 N  N   . TRP A 1 251 ? -40.117 -7.488  -36.705 1.00 89.32  ? 511 TRP A N   1 
ATOM   1981 C  CA  . TRP A 1 251 ? -38.950 -7.992  -37.427 1.00 90.58  ? 511 TRP A CA  1 
ATOM   1982 C  C   . TRP A 1 251 ? -38.421 -7.012  -38.486 1.00 96.41  ? 511 TRP A C   1 
ATOM   1983 O  O   . TRP A 1 251 ? -39.160 -6.167  -38.999 1.00 103.53 ? 511 TRP A O   1 
ATOM   1984 C  CB  . TRP A 1 251 ? -39.283 -9.304  -38.145 1.00 93.20  ? 511 TRP A CB  1 
ATOM   1985 C  CG  . TRP A 1 251 ? -39.913 -10.393 -37.312 1.00 94.66  ? 511 TRP A CG  1 
ATOM   1986 C  CD1 . TRP A 1 251 ? -41.210 -10.812 -37.365 1.00 97.23  ? 511 TRP A CD1 1 
ATOM   1987 C  CD2 . TRP A 1 251 ? -39.263 -11.228 -36.350 1.00 91.83  ? 511 TRP A CD2 1 
ATOM   1988 N  NE1 . TRP A 1 251 ? -41.414 -11.839 -36.481 1.00 95.92  ? 511 TRP A NE1 1 
ATOM   1989 C  CE2 . TRP A 1 251 ? -40.235 -12.115 -35.844 1.00 92.71  ? 511 TRP A CE2 1 
ATOM   1990 C  CE3 . TRP A 1 251 ? -37.958 -11.302 -35.856 1.00 88.32  ? 511 TRP A CE3 1 
ATOM   1991 C  CZ2 . TRP A 1 251 ? -39.947 -13.064 -34.869 1.00 91.65  ? 511 TRP A CZ2 1 
ATOM   1992 C  CZ3 . TRP A 1 251 ? -37.668 -12.245 -34.880 1.00 88.61  ? 511 TRP A CZ3 1 
ATOM   1993 C  CH2 . TRP A 1 251 ? -38.660 -13.116 -34.399 1.00 90.16  ? 511 TRP A CH2 1 
ATOM   1994 N  N   . ASP A 1 252 ? -37.138 -7.152  -38.817 1.00 95.08  ? 512 ASP A N   1 
ATOM   1995 C  CA  . ASP A 1 252 ? -36.533 -6.488  -39.977 1.00 101.42 ? 512 ASP A CA  1 
ATOM   1996 C  C   . ASP A 1 252 ? -35.651 -7.494  -40.728 1.00 106.00 ? 512 ASP A C   1 
ATOM   1997 O  O   . ASP A 1 252 ? -34.882 -8.220  -40.111 1.00 105.53 ? 512 ASP A O   1 
ATOM   1998 C  CB  . ASP A 1 252 ? -35.712 -5.271  -39.538 1.00 101.08 ? 512 ASP A CB  1 
ATOM   1999 C  CG  . ASP A 1 252 ? -35.317 -4.366  -40.714 1.00 106.48 ? 512 ASP A CG  1 
ATOM   2000 O  OD1 . ASP A 1 252 ? -36.185 -4.016  -41.565 1.00 109.40 ? 512 ASP A OD1 1 
ATOM   2001 O  OD2 . ASP A 1 252 ? -34.122 -3.995  -40.770 1.00 106.47 ? 512 ASP A OD2 1 
ATOM   2002 N  N   . THR A 1 253 ? -35.758 -7.542  -42.055 1.00 111.45 ? 513 THR A N   1 
ATOM   2003 C  CA  . THR A 1 253 ? -35.103 -8.604  -42.832 1.00 112.93 ? 513 THR A CA  1 
ATOM   2004 C  C   . THR A 1 253 ? -34.480 -8.120  -44.153 1.00 116.25 ? 513 THR A C   1 
ATOM   2005 O  O   . THR A 1 253 ? -35.139 -8.103  -45.197 1.00 120.01 ? 513 THR A O   1 
ATOM   2006 C  CB  . THR A 1 253 ? -36.098 -9.773  -43.111 1.00 104.33 ? 513 THR A CB  1 
ATOM   2007 O  OG1 . THR A 1 253 ? -37.240 -9.289  -43.828 1.00 107.39 ? 513 THR A OG1 1 
ATOM   2008 C  CG2 . THR A 1 253 ? -36.553 -10.418 -41.794 1.00 101.55 ? 513 THR A CG2 1 
ATOM   2009 N  N   . SER A 1 254 ? -33.197 -7.754  -44.087 1.00 114.66 ? 514 SER A N   1 
ATOM   2010 C  CA  . SER A 1 254 ? -32.410 -7.322  -45.258 1.00 116.10 ? 514 SER A CA  1 
ATOM   2011 C  C   . SER A 1 254 ? -31.725 -8.509  -45.930 1.00 115.07 ? 514 SER A C   1 
ATOM   2012 O  O   . SER A 1 254 ? -30.744 -9.047  -45.408 1.00 112.05 ? 514 SER A O   1 
ATOM   2013 C  CB  . SER A 1 254 ? -31.350 -6.290  -44.838 1.00 115.09 ? 514 SER A CB  1 
ATOM   2014 O  OG  . SER A 1 254 ? -30.638 -6.707  -43.667 1.00 111.96 ? 514 SER A OG  1 
ATOM   2015 N  N   . ARG A 1 258 ? -33.274 -13.843 -45.195 1.00 94.25  ? 518 ARG A N   1 
ATOM   2016 C  CA  . ARG A 1 258 ? -32.949 -13.519 -43.814 1.00 92.90  ? 518 ARG A CA  1 
ATOM   2017 C  C   . ARG A 1 258 ? -34.213 -13.731 -42.997 1.00 99.32  ? 518 ARG A C   1 
ATOM   2018 O  O   . ARG A 1 258 ? -34.971 -12.791 -42.741 1.00 104.29 ? 518 ARG A O   1 
ATOM   2019 C  CB  . ARG A 1 258 ? -32.438 -12.071 -43.668 1.00 90.59  ? 518 ARG A CB  1 
ATOM   2020 C  CG  . ARG A 1 258 ? -32.240 -11.582 -42.210 1.00 106.11 ? 518 ARG A CG  1 
ATOM   2021 C  CD  . ARG A 1 258 ? -30.785 -11.281 -41.883 1.00 102.96 ? 518 ARG A CD  1 
ATOM   2022 N  NE  . ARG A 1 258 ? -30.250 -10.185 -42.711 1.00 105.27 ? 518 ARG A NE  1 
ATOM   2023 C  CZ  . ARG A 1 258 ? -28.981 -9.763  -42.688 1.00 101.66 ? 518 ARG A CZ  1 
ATOM   2024 N  NH1 . ARG A 1 258 ? -28.092 -10.349 -41.881 1.00 98.57  ? 518 ARG A NH1 1 
ATOM   2025 N  NH2 . ARG A 1 258 ? -28.597 -8.758  -43.479 1.00 97.51  ? 518 ARG A NH2 1 
ATOM   2026 N  N   . ALA A 1 259 ? -34.442 -14.983 -42.611 1.00 98.54  ? 519 ALA A N   1 
ATOM   2027 C  CA  . ALA A 1 259 ? -35.455 -15.313 -41.617 1.00 95.27  ? 519 ALA A CA  1 
ATOM   2028 C  C   . ALA A 1 259 ? -34.922 -14.971 -40.233 1.00 90.22  ? 519 ALA A C   1 
ATOM   2029 O  O   . ALA A 1 259 ? -33.708 -14.803 -40.058 1.00 84.35  ? 519 ALA A O   1 
ATOM   2030 C  CB  . ALA A 1 259 ? -35.817 -16.789 -41.689 1.00 95.20  ? 519 ALA A CB  1 
ATOM   2031 N  N   . PRO A 1 260 ? -35.828 -14.854 -39.247 1.00 89.74  ? 520 PRO A N   1 
ATOM   2032 C  CA  . PRO A 1 260 ? -35.431 -14.794 -37.852 1.00 86.56  ? 520 PRO A CA  1 
ATOM   2033 C  C   . PRO A 1 260 ? -34.466 -15.914 -37.493 1.00 81.33  ? 520 PRO A C   1 
ATOM   2034 O  O   . PRO A 1 260 ? -34.389 -16.916 -38.216 1.00 82.17  ? 520 PRO A O   1 
ATOM   2035 C  CB  . PRO A 1 260 ? -36.761 -14.952 -37.120 1.00 88.60  ? 520 PRO A CB  1 
ATOM   2036 C  CG  . PRO A 1 260 ? -37.725 -14.256 -38.009 1.00 89.38  ? 520 PRO A CG  1 
ATOM   2037 C  CD  . PRO A 1 260 ? -37.272 -14.601 -39.399 1.00 91.43  ? 520 PRO A CD  1 
ATOM   2038 N  N   . ALA A 1 261 ? -33.727 -15.737 -36.401 1.00 74.42  ? 521 ALA A N   1 
ATOM   2039 C  CA  . ALA A 1 261 ? -32.656 -16.662 -36.068 1.00 68.72  ? 521 ALA A CA  1 
ATOM   2040 C  C   . ALA A 1 261 ? -32.345 -16.666 -34.581 1.00 69.89  ? 521 ALA A C   1 
ATOM   2041 O  O   . ALA A 1 261 ? -32.490 -15.646 -33.920 1.00 72.35  ? 521 ALA A O   1 
ATOM   2042 C  CB  . ALA A 1 261 ? -31.419 -16.307 -36.861 1.00 61.50  ? 521 ALA A CB  1 
ATOM   2043 N  N   . TRP A 1 262 ? -31.931 -17.820 -34.056 1.00 70.39  ? 522 TRP A N   1 
ATOM   2044 C  CA  . TRP A 1 262 ? -31.427 -17.907 -32.696 1.00 67.81  ? 522 TRP A CA  1 
ATOM   2045 C  C   . TRP A 1 262 ? -29.953 -17.567 -32.736 1.00 67.97  ? 522 TRP A C   1 
ATOM   2046 O  O   . TRP A 1 262 ? -29.094 -18.421 -32.529 1.00 69.27  ? 522 TRP A O   1 
ATOM   2047 C  CB  . TRP A 1 262 ? -31.631 -19.305 -32.111 1.00 68.70  ? 522 TRP A CB  1 
ATOM   2048 C  CG  . TRP A 1 262 ? -33.025 -19.551 -31.593 1.00 73.36  ? 522 TRP A CG  1 
ATOM   2049 C  CD1 . TRP A 1 262 ? -33.649 -18.886 -30.580 1.00 72.76  ? 522 TRP A CD1 1 
ATOM   2050 C  CD2 . TRP A 1 262 ? -33.947 -20.552 -32.042 1.00 75.21  ? 522 TRP A CD2 1 
ATOM   2051 N  NE1 . TRP A 1 262 ? -34.906 -19.395 -30.385 1.00 74.51  ? 522 TRP A NE1 1 
ATOM   2052 C  CE2 . TRP A 1 262 ? -35.113 -20.421 -31.265 1.00 75.41  ? 522 TRP A CE2 1 
ATOM   2053 C  CE3 . TRP A 1 262 ? -33.897 -21.544 -33.022 1.00 76.48  ? 522 TRP A CE3 1 
ATOM   2054 C  CZ2 . TRP A 1 262 ? -36.220 -21.239 -31.437 1.00 78.23  ? 522 TRP A CZ2 1 
ATOM   2055 C  CZ3 . TRP A 1 262 ? -35.006 -22.356 -33.203 1.00 80.71  ? 522 TRP A CZ3 1 
ATOM   2056 C  CH2 . TRP A 1 262 ? -36.154 -22.196 -32.412 1.00 81.93  ? 522 TRP A CH2 1 
ATOM   2057 N  N   . CYS A 1 263 ? -29.645 -16.315 -33.021 1.00 66.22  ? 523 CYS A N   1 
ATOM   2058 C  CA  . CYS A 1 263 ? -28.258 -15.913 -33.103 1.00 65.40  ? 523 CYS A CA  1 
ATOM   2059 C  C   . CYS A 1 263 ? -27.523 -16.098 -31.784 1.00 64.52  ? 523 CYS A C   1 
ATOM   2060 O  O   . CYS A 1 263 ? -26.368 -16.514 -31.772 1.00 62.41  ? 523 CYS A O   1 
ATOM   2061 C  CB  . CYS A 1 263 ? -28.149 -14.460 -33.539 1.00 63.87  ? 523 CYS A CB  1 
ATOM   2062 S  SG  . CYS A 1 263 ? -28.332 -14.251 -35.300 1.00 68.44  ? 523 CYS A SG  1 
ATOM   2063 N  N   . ASP A 1 264 ? -28.215 -15.819 -30.684 1.00 63.25  ? 524 ASP A N   1 
ATOM   2064 C  CA  . ASP A 1 264 ? -27.578 -15.592 -29.392 1.00 58.22  ? 524 ASP A CA  1 
ATOM   2065 C  C   . ASP A 1 264 ? -27.810 -16.762 -28.444 1.00 57.77  ? 524 ASP A C   1 
ATOM   2066 O  O   . ASP A 1 264 ? -28.938 -17.068 -28.097 1.00 60.22  ? 524 ASP A O   1 
ATOM   2067 C  CB  . ASP A 1 264 ? -28.104 -14.277 -28.819 1.00 57.04  ? 524 ASP A CB  1 
ATOM   2068 C  CG  . ASP A 1 264 ? -28.069 -13.170 -29.850 1.00 61.44  ? 524 ASP A CG  1 
ATOM   2069 O  OD1 . ASP A 1 264 ? -26.953 -12.726 -30.184 1.00 63.35  ? 524 ASP A OD1 1 
ATOM   2070 O  OD2 . ASP A 1 264 ? -29.136 -12.781 -30.371 1.00 62.02  ? 524 ASP A OD2 1 
ATOM   2071 N  N   . ARG A 1 265 ? -26.712 -17.391 -28.019 1.00 56.66  ? 525 ARG A N   1 
ATOM   2072 C  CA  . ARG A 1 265 ? -26.743 -18.709 -27.371 1.00 56.35  ? 525 ARG A CA  1 
ATOM   2073 C  C   . ARG A 1 265 ? -25.791 -18.823 -26.184 1.00 54.12  ? 525 ARG A C   1 
ATOM   2074 O  O   . ARG A 1 265 ? -24.818 -18.076 -26.076 1.00 52.77  ? 525 ARG A O   1 
ATOM   2075 C  CB  . ARG A 1 265 ? -26.366 -19.791 -28.386 1.00 54.71  ? 525 ARG A CB  1 
ATOM   2076 C  CG  . ARG A 1 265 ? -26.973 -19.617 -29.774 1.00 50.85  ? 525 ARG A CG  1 
ATOM   2077 C  CD  . ARG A 1 265 ? -28.442 -19.872 -29.787 1.00 51.85  ? 525 ARG A CD  1 
ATOM   2078 N  NE  . ARG A 1 265 ? -28.709 -21.293 -29.950 1.00 60.83  ? 525 ARG A NE  1 
ATOM   2079 C  CZ  . ARG A 1 265 ? -28.857 -21.937 -31.109 1.00 59.97  ? 525 ARG A CZ  1 
ATOM   2080 N  NH1 . ARG A 1 265 ? -28.801 -21.298 -32.277 1.00 55.98  ? 525 ARG A NH1 1 
ATOM   2081 N  NH2 . ARG A 1 265 ? -29.090 -23.247 -31.088 1.00 57.65  ? 525 ARG A NH2 1 
ATOM   2082 N  N   . ILE A 1 266 ? -26.097 -19.765 -25.299 1.00 52.95  ? 526 ILE A N   1 
ATOM   2083 C  CA  . ILE A 1 266 ? -25.241 -20.107 -24.174 1.00 47.11  ? 526 ILE A CA  1 
ATOM   2084 C  C   . ILE A 1 266 ? -25.115 -21.624 -24.100 1.00 50.58  ? 526 ILE A C   1 
ATOM   2085 O  O   . ILE A 1 266 ? -26.120 -22.329 -23.981 1.00 52.53  ? 526 ILE A O   1 
ATOM   2086 C  CB  . ILE A 1 266 ? -25.828 -19.626 -22.838 1.00 46.42  ? 526 ILE A CB  1 
ATOM   2087 C  CG1 . ILE A 1 266 ? -26.082 -18.110 -22.871 1.00 46.38  ? 526 ILE A CG1 1 
ATOM   2088 C  CG2 . ILE A 1 266 ? -24.882 -20.016 -21.665 1.00 38.34  ? 526 ILE A CG2 1 
ATOM   2089 C  CD1 . ILE A 1 266 ? -26.661 -17.544 -21.569 1.00 45.24  ? 526 ILE A CD1 1 
ATOM   2090 N  N   . LEU A 1 267 ? -23.891 -22.126 -24.193 1.00 51.39  ? 527 LEU A N   1 
ATOM   2091 C  CA  . LEU A 1 267 ? -23.637 -23.558 -24.046 1.00 52.12  ? 527 LEU A CA  1 
ATOM   2092 C  C   . LEU A 1 267 ? -22.626 -23.781 -22.912 1.00 51.15  ? 527 LEU A C   1 
ATOM   2093 O  O   . LEU A 1 267 ? -21.967 -22.833 -22.466 1.00 47.40  ? 527 LEU A O   1 
ATOM   2094 C  CB  . LEU A 1 267 ? -23.103 -24.145 -25.350 1.00 51.26  ? 527 LEU A CB  1 
ATOM   2095 C  CG  . LEU A 1 267 ? -23.955 -24.061 -26.614 1.00 51.19  ? 527 LEU A CG  1 
ATOM   2096 C  CD1 . LEU A 1 267 ? -23.657 -22.800 -27.450 1.00 53.09  ? 527 LEU A CD1 1 
ATOM   2097 C  CD2 . LEU A 1 267 ? -23.749 -25.323 -27.464 1.00 47.89  ? 527 LEU A CD2 1 
ATOM   2098 N  N   . TRP A 1 268 ? -22.505 -25.033 -22.467 1.00 52.20  ? 528 TRP A N   1 
ATOM   2099 C  CA  . TRP A 1 268 ? -21.658 -25.387 -21.315 1.00 52.89  ? 528 TRP A CA  1 
ATOM   2100 C  C   . TRP A 1 268 ? -21.154 -26.828 -21.324 1.00 51.88  ? 528 TRP A C   1 
ATOM   2101 O  O   . TRP A 1 268 ? -21.809 -27.725 -21.867 1.00 54.14  ? 528 TRP A O   1 
ATOM   2102 C  CB  . TRP A 1 268 ? -22.420 -25.173 -20.001 1.00 55.10  ? 528 TRP A CB  1 
ATOM   2103 C  CG  . TRP A 1 268 ? -23.393 -26.274 -19.636 1.00 61.26  ? 528 TRP A CG  1 
ATOM   2104 C  CD1 . TRP A 1 268 ? -23.118 -27.438 -18.965 1.00 63.43  ? 528 TRP A CD1 1 
ATOM   2105 C  CD2 . TRP A 1 268 ? -24.788 -26.291 -19.896 1.00 60.91  ? 528 TRP A CD2 1 
ATOM   2106 N  NE1 . TRP A 1 268 ? -24.265 -28.189 -18.823 1.00 60.90  ? 528 TRP A NE1 1 
ATOM   2107 C  CE2 . TRP A 1 268 ? -25.302 -27.493 -19.385 1.00 62.79  ? 528 TRP A CE2 1 
ATOM   2108 C  CE3 . TRP A 1 268 ? -25.652 -25.409 -20.526 1.00 62.28  ? 528 TRP A CE3 1 
ATOM   2109 C  CZ2 . TRP A 1 268 ? -26.635 -27.824 -19.485 1.00 67.16  ? 528 TRP A CZ2 1 
ATOM   2110 C  CZ3 . TRP A 1 268 ? -26.971 -25.735 -20.629 1.00 66.31  ? 528 TRP A CZ3 1 
ATOM   2111 C  CH2 . TRP A 1 268 ? -27.459 -26.929 -20.111 1.00 68.95  ? 528 TRP A CH2 1 
ATOM   2112 N  N   . LYS A 1 269 ? -19.996 -27.047 -20.708 1.00 47.58  ? 529 LYS A N   1 
ATOM   2113 C  CA  . LYS A 1 269 ? -19.603 -28.392 -20.365 1.00 53.14  ? 529 LYS A CA  1 
ATOM   2114 C  C   . LYS A 1 269 ? -18.799 -28.474 -19.089 1.00 57.53  ? 529 LYS A C   1 
ATOM   2115 O  O   . LYS A 1 269 ? -17.997 -27.591 -18.790 1.00 61.57  ? 529 LYS A O   1 
ATOM   2116 C  CB  . LYS A 1 269 ? -18.914 -29.118 -21.525 1.00 56.24  ? 529 LYS A CB  1 
ATOM   2117 C  CG  . LYS A 1 269 ? -17.434 -28.957 -21.665 1.00 58.65  ? 529 LYS A CG  1 
ATOM   2118 C  CD  . LYS A 1 269 ? -16.923 -29.782 -22.870 1.00 65.25  ? 529 LYS A CD  1 
ATOM   2119 C  CE  . LYS A 1 269 ? -16.184 -31.041 -22.453 1.00 70.29  ? 529 LYS A CE  1 
ATOM   2120 N  NZ  . LYS A 1 269 ? -15.536 -31.648 -23.664 1.00 74.05  ? 529 LYS A NZ  1 
ATOM   2121 N  N   . GLY A 1 270 ? -19.053 -29.546 -18.340 1.00 56.68  ? 530 GLY A N   1 
ATOM   2122 C  CA  . GLY A 1 270 ? -18.465 -29.759 -17.035 1.00 54.76  ? 530 GLY A CA  1 
ATOM   2123 C  C   . GLY A 1 270 ? -19.345 -30.665 -16.214 1.00 54.19  ? 530 GLY A C   1 
ATOM   2124 O  O   . GLY A 1 270 ? -20.549 -30.752 -16.445 1.00 54.61  ? 530 GLY A O   1 
ATOM   2125 N  N   . LYS A 1 271 ? -18.734 -31.361 -15.268 1.00 55.10  ? 531 LYS A N   1 
ATOM   2126 C  CA  . LYS A 1 271 ? -19.467 -32.051 -14.223 1.00 58.38  ? 531 LYS A CA  1 
ATOM   2127 C  C   . LYS A 1 271 ? -20.097 -31.016 -13.280 1.00 62.82  ? 531 LYS A C   1 
ATOM   2128 O  O   . LYS A 1 271 ? -19.668 -29.863 -13.219 1.00 62.82  ? 531 LYS A O   1 
ATOM   2129 C  CB  . LYS A 1 271 ? -18.525 -32.928 -13.408 1.00 57.49  ? 531 LYS A CB  1 
ATOM   2130 C  CG  . LYS A 1 271 ? -17.885 -34.086 -14.149 1.00 60.48  ? 531 LYS A CG  1 
ATOM   2131 C  CD  . LYS A 1 271 ? -16.734 -34.655 -13.286 1.00 64.94  ? 531 LYS A CD  1 
ATOM   2132 C  CE  . LYS A 1 271 ? -16.246 -36.022 -13.727 1.00 65.77  ? 531 LYS A CE  1 
ATOM   2133 N  NZ  . LYS A 1 271 ? -16.350 -36.199 -15.173 1.00 68.61  ? 531 LYS A NZ  1 
ATOM   2134 N  N   . ASN A 1 272 ? -21.108 -31.447 -12.535 1.00 66.13  ? 532 ASN A N   1 
ATOM   2135 C  CA  . ASN A 1 272 ? -21.738 -30.626 -11.506 1.00 65.61  ? 532 ASN A CA  1 
ATOM   2136 C  C   . ASN A 1 272 ? -22.231 -29.287 -11.996 1.00 66.81  ? 532 ASN A C   1 
ATOM   2137 O  O   . ASN A 1 272 ? -22.031 -28.279 -11.321 1.00 68.83  ? 532 ASN A O   1 
ATOM   2138 C  CB  . ASN A 1 272 ? -20.775 -30.403 -10.345 1.00 65.42  ? 532 ASN A CB  1 
ATOM   2139 C  CG  . ASN A 1 272 ? -20.420 -31.674 -9.657  1.00 67.25  ? 532 ASN A CG  1 
ATOM   2140 O  OD1 . ASN A 1 272 ? -21.243 -32.562 -9.541  1.00 69.17  ? 532 ASN A OD1 1 
ATOM   2141 N  ND2 . ASN A 1 272 ? -19.190 -31.776 -9.199  1.00 67.68  ? 532 ASN A ND2 1 
ATOM   2142 N  N   . ILE A 1 273 ? -22.865 -29.271 -13.168 1.00 64.75  ? 533 ILE A N   1 
ATOM   2143 C  CA  . ILE A 1 273 ? -23.486 -28.065 -13.703 1.00 60.28  ? 533 ILE A CA  1 
ATOM   2144 C  C   . ILE A 1 273 ? -24.948 -28.383 -13.960 1.00 64.40  ? 533 ILE A C   1 
ATOM   2145 O  O   . ILE A 1 273 ? -25.241 -29.324 -14.677 1.00 68.81  ? 533 ILE A O   1 
ATOM   2146 C  CB  . ILE A 1 273 ? -22.878 -27.674 -15.025 1.00 53.37  ? 533 ILE A CB  1 
ATOM   2147 C  CG1 . ILE A 1 273 ? -21.406 -27.345 -14.865 1.00 46.91  ? 533 ILE A CG1 1 
ATOM   2148 C  CG2 . ILE A 1 273 ? -23.624 -26.503 -15.610 1.00 53.45  ? 533 ILE A CG2 1 
ATOM   2149 C  CD1 . ILE A 1 273 ? -20.771 -26.846 -16.155 1.00 47.48  ? 533 ILE A CD1 1 
ATOM   2150 N  N   . THR A 1 274 ? -25.859 -27.615 -13.374 1.00 59.72  ? 534 THR A N   1 
ATOM   2151 C  CA  . THR A 1 274 ? -27.281 -27.799 -13.603 1.00 57.31  ? 534 THR A CA  1 
ATOM   2152 C  C   . THR A 1 274 ? -27.826 -26.491 -14.125 1.00 57.28  ? 534 THR A C   1 
ATOM   2153 O  O   . THR A 1 274 ? -27.471 -25.458 -13.600 1.00 61.91  ? 534 THR A O   1 
ATOM   2154 C  CB  . THR A 1 274 ? -27.967 -28.218 -12.304 1.00 54.81  ? 534 THR A CB  1 
ATOM   2155 O  OG1 . THR A 1 274 ? -27.298 -29.367 -11.773 1.00 54.50  ? 534 THR A OG1 1 
ATOM   2156 C  CG2 . THR A 1 274 ? -29.414 -28.571 -12.541 1.00 53.14  ? 534 THR A CG2 1 
ATOM   2157 N  N   . GLN A 1 275 ? -28.632 -26.511 -15.183 1.00 55.21  ? 535 GLN A N   1 
ATOM   2158 C  CA  . GLN A 1 275 ? -29.140 -25.261 -15.761 1.00 53.86  ? 535 GLN A CA  1 
ATOM   2159 C  C   . GLN A 1 275 ? -30.487 -24.976 -15.175 1.00 55.26  ? 535 GLN A C   1 
ATOM   2160 O  O   . GLN A 1 275 ? -31.365 -25.820 -15.255 1.00 58.94  ? 535 GLN A O   1 
ATOM   2161 C  CB  . GLN A 1 275 ? -29.251 -25.330 -17.287 1.00 51.41  ? 535 GLN A CB  1 
ATOM   2162 C  CG  . GLN A 1 275 ? -29.545 -23.970 -17.930 1.00 54.03  ? 535 GLN A CG  1 
ATOM   2163 C  CD  . GLN A 1 275 ? -29.342 -23.970 -19.435 1.00 60.22  ? 535 GLN A CD  1 
ATOM   2164 O  OE1 . GLN A 1 275 ? -29.813 -24.861 -20.130 1.00 66.06  ? 535 GLN A OE1 1 
ATOM   2165 N  NE2 . GLN A 1 275 ? -28.641 -22.969 -19.945 1.00 59.23  ? 535 GLN A NE2 1 
ATOM   2166 N  N   . LEU A 1 276 ? -30.659 -23.810 -14.564 1.00 50.90  ? 536 LEU A N   1 
ATOM   2167 C  CA  . LEU A 1 276 ? -31.922 -23.511 -13.876 1.00 51.84  ? 536 LEU A CA  1 
ATOM   2168 C  C   . LEU A 1 276 ? -32.911 -22.797 -14.797 1.00 58.28  ? 536 LEU A C   1 
ATOM   2169 O  O   . LEU A 1 276 ? -34.121 -22.880 -14.600 1.00 61.29  ? 536 LEU A O   1 
ATOM   2170 C  CB  . LEU A 1 276 ? -31.673 -22.700 -12.597 1.00 49.18  ? 536 LEU A CB  1 
ATOM   2171 C  CG  . LEU A 1 276 ? -30.810 -23.374 -11.511 1.00 51.06  ? 536 LEU A CG  1 
ATOM   2172 C  CD1 . LEU A 1 276 ? -30.802 -22.564 -10.209 1.00 49.21  ? 536 LEU A CD1 1 
ATOM   2173 C  CD2 . LEU A 1 276 ? -31.246 -24.813 -11.236 1.00 50.97  ? 536 LEU A CD2 1 
ATOM   2174 N  N   . SER A 1 277 ? -32.384 -22.124 -15.820 1.00 59.61  ? 537 SER A N   1 
ATOM   2175 C  CA  . SER A 1 277 ? -33.186 -21.333 -16.727 1.00 61.81  ? 537 SER A CA  1 
ATOM   2176 C  C   . SER A 1 277 ? -32.410 -20.976 -18.009 1.00 63.71  ? 537 SER A C   1 
ATOM   2177 O  O   . SER A 1 277 ? -31.163 -20.888 -17.994 1.00 67.21  ? 537 SER A O   1 
ATOM   2178 C  CB  . SER A 1 277 ? -33.608 -20.056 -16.006 1.00 62.35  ? 537 SER A CB  1 
ATOM   2179 O  OG  . SER A 1 277 ? -32.476 -19.265 -15.685 1.00 63.68  ? 537 SER A OG  1 
ATOM   2180 N  N   . TYR A 1 278 ? -33.150 -20.772 -19.105 1.00 60.69  ? 538 TYR A N   1 
ATOM   2181 C  CA  . TYR A 1 278 ? -32.590 -20.289 -20.369 1.00 55.39  ? 538 TYR A CA  1 
ATOM   2182 C  C   . TYR A 1 278 ? -33.629 -19.412 -21.031 1.00 57.31  ? 538 TYR A C   1 
ATOM   2183 O  O   . TYR A 1 278 ? -34.639 -19.912 -21.487 1.00 60.79  ? 538 TYR A O   1 
ATOM   2184 C  CB  . TYR A 1 278 ? -32.236 -21.475 -21.270 1.00 55.27  ? 538 TYR A CB  1 
ATOM   2185 C  CG  . TYR A 1 278 ? -31.357 -21.197 -22.498 1.00 56.68  ? 538 TYR A CG  1 
ATOM   2186 C  CD1 . TYR A 1 278 ? -30.469 -20.126 -22.544 1.00 56.24  ? 538 TYR A CD1 1 
ATOM   2187 C  CD2 . TYR A 1 278 ? -31.352 -22.079 -23.577 1.00 55.39  ? 538 TYR A CD2 1 
ATOM   2188 C  CE1 . TYR A 1 278 ? -29.655 -19.918 -23.642 1.00 54.03  ? 538 TYR A CE1 1 
ATOM   2189 C  CE2 . TYR A 1 278 ? -30.527 -21.874 -24.676 1.00 54.89  ? 538 TYR A CE2 1 
ATOM   2190 C  CZ  . TYR A 1 278 ? -29.687 -20.792 -24.704 1.00 53.69  ? 538 TYR A CZ  1 
ATOM   2191 O  OH  . TYR A 1 278 ? -28.875 -20.573 -25.793 1.00 50.73  ? 538 TYR A OH  1 
ATOM   2192 N  N   . GLN A 1 279 ? -33.384 -18.104 -21.079 1.00 60.85  ? 539 GLN A N   1 
ATOM   2193 C  CA  . GLN A 1 279 ? -34.405 -17.112 -21.506 1.00 68.15  ? 539 GLN A CA  1 
ATOM   2194 C  C   . GLN A 1 279 ? -33.849 -16.065 -22.469 1.00 66.79  ? 539 GLN A C   1 
ATOM   2195 O  O   . GLN A 1 279 ? -32.635 -15.800 -22.486 1.00 67.91  ? 539 GLN A O   1 
ATOM   2196 C  CB  . GLN A 1 279 ? -34.939 -16.330 -20.288 1.00 73.11  ? 539 GLN A CB  1 
ATOM   2197 C  CG  . GLN A 1 279 ? -35.269 -17.176 -19.050 1.00 82.41  ? 539 GLN A CG  1 
ATOM   2198 C  CD  . GLN A 1 279 ? -34.642 -16.614 -17.776 1.00 91.73  ? 539 GLN A CD  1 
ATOM   2199 O  OE1 . GLN A 1 279 ? -33.397 -16.499 -17.657 1.00 93.05  ? 539 GLN A OE1 1 
ATOM   2200 N  NE2 . GLN A 1 279 ? -35.502 -16.257 -16.807 1.00 95.15  ? 539 GLN A NE2 1 
ATOM   2201 N  N   . SER A 1 280 ? -34.742 -15.454 -23.240 1.00 64.81  ? 540 SER A N   1 
ATOM   2202 C  CA  . SER A 1 280 ? -34.468 -14.141 -23.823 1.00 63.37  ? 540 SER A CA  1 
ATOM   2203 C  C   . SER A 1 280 ? -35.267 -13.090 -23.054 1.00 64.66  ? 540 SER A C   1 
ATOM   2204 O  O   . SER A 1 280 ? -36.057 -13.418 -22.186 1.00 68.75  ? 540 SER A O   1 
ATOM   2205 C  CB  . SER A 1 280 ? -34.792 -14.093 -25.316 1.00 63.09  ? 540 SER A CB  1 
ATOM   2206 O  OG  . SER A 1 280 ? -36.177 -14.171 -25.553 1.00 68.86  ? 540 SER A OG  1 
ATOM   2207 N  N   . HIS A 1 281 ? -35.043 -11.824 -23.364 1.00 62.90  ? 541 HIS A N   1 
ATOM   2208 C  CA  . HIS A 1 281 ? -35.671 -10.729 -22.652 1.00 60.67  ? 541 HIS A CA  1 
ATOM   2209 C  C   . HIS A 1 281 ? -36.182 -9.735  -23.671 1.00 66.12  ? 541 HIS A C   1 
ATOM   2210 O  O   . HIS A 1 281 ? -35.489 -8.807  -24.053 1.00 67.72  ? 541 HIS A O   1 
ATOM   2211 C  CB  . HIS A 1 281 ? -34.659 -10.082 -21.722 1.00 58.30  ? 541 HIS A CB  1 
ATOM   2212 C  CG  . HIS A 1 281 ? -34.072 -11.032 -20.731 1.00 62.69  ? 541 HIS A CG  1 
ATOM   2213 N  ND1 . HIS A 1 281 ? -34.534 -11.139 -19.441 1.00 62.87  ? 541 HIS A ND1 1 
ATOM   2214 C  CD2 . HIS A 1 281 ? -33.072 -11.937 -20.847 1.00 62.83  ? 541 HIS A CD2 1 
ATOM   2215 C  CE1 . HIS A 1 281 ? -33.835 -12.057 -18.797 1.00 59.55  ? 541 HIS A CE1 1 
ATOM   2216 N  NE2 . HIS A 1 281 ? -32.935 -12.553 -19.626 1.00 59.83  ? 541 HIS A NE2 1 
ATOM   2217 N  N   . MET A 1 282 ? -37.413 -9.951  -24.112 1.00 70.08  ? 542 MET A N   1 
ATOM   2218 C  CA  . MET A 1 282 ? -38.007 -9.175  -25.193 1.00 68.00  ? 542 MET A CA  1 
ATOM   2219 C  C   . MET A 1 282 ? -38.118 -7.712  -24.826 1.00 67.77  ? 542 MET A C   1 
ATOM   2220 O  O   . MET A 1 282 ? -37.942 -6.866  -25.678 1.00 71.19  ? 542 MET A O   1 
ATOM   2221 C  CB  . MET A 1 282 ? -39.390 -9.722  -25.537 1.00 65.49  ? 542 MET A CB  1 
ATOM   2222 C  CG  . MET A 1 282 ? -39.375 -11.133 -26.088 1.00 61.15  ? 542 MET A CG  1 
ATOM   2223 S  SD  . MET A 1 282 ? -39.095 -11.170 -27.872 1.00 88.67  ? 542 MET A SD  1 
ATOM   2224 C  CE  . MET A 1 282 ? -37.703 -12.317 -27.889 1.00 86.49  ? 542 MET A CE  1 
ATOM   2225 N  N   . ALA A 1 283 ? -38.386 -7.408  -23.559 1.00 67.11  ? 543 ALA A N   1 
ATOM   2226 C  CA  . ALA A 1 283 ? -38.697 -6.031  -23.166 1.00 65.86  ? 543 ALA A CA  1 
ATOM   2227 C  C   . ALA A 1 283 ? -37.565 -5.021  -23.422 1.00 65.51  ? 543 ALA A C   1 
ATOM   2228 O  O   . ALA A 1 283 ? -37.821 -3.830  -23.497 1.00 71.00  ? 543 ALA A O   1 
ATOM   2229 C  CB  . ALA A 1 283 ? -39.156 -5.971  -21.709 1.00 62.07  ? 543 ALA A CB  1 
ATOM   2230 N  N   . LEU A 1 284 ? -36.332 -5.481  -23.564 1.00 60.88  ? 544 LEU A N   1 
ATOM   2231 C  CA  . LEU A 1 284 ? -35.231 -4.592  -23.935 1.00 60.87  ? 544 LEU A CA  1 
ATOM   2232 C  C   . LEU A 1 284 ? -35.211 -4.402  -25.447 1.00 60.66  ? 544 LEU A C   1 
ATOM   2233 O  O   . LEU A 1 284 ? -35.106 -5.366  -26.200 1.00 60.55  ? 544 LEU A O   1 
ATOM   2234 C  CB  . LEU A 1 284 ? -33.896 -5.158  -23.445 1.00 60.65  ? 544 LEU A CB  1 
ATOM   2235 C  CG  . LEU A 1 284 ? -33.781 -5.196  -21.917 1.00 62.70  ? 544 LEU A CG  1 
ATOM   2236 C  CD1 . LEU A 1 284 ? -32.584 -5.990  -21.504 1.00 60.77  ? 544 LEU A CD1 1 
ATOM   2237 C  CD2 . LEU A 1 284 ? -33.699 -3.777  -21.374 1.00 65.35  ? 544 LEU A CD2 1 
ATOM   2238 N  N   . LYS A 1 285 ? -35.319 -3.153  -25.882 1.00 60.28  ? 545 LYS A N   1 
ATOM   2239 C  CA  . LYS A 1 285 ? -35.496 -2.832  -27.293 1.00 63.50  ? 545 LYS A CA  1 
ATOM   2240 C  C   . LYS A 1 285 ? -34.424 -1.862  -27.778 1.00 63.99  ? 545 LYS A C   1 
ATOM   2241 O  O   . LYS A 1 285 ? -34.618 -1.156  -28.756 1.00 66.63  ? 545 LYS A O   1 
ATOM   2242 C  CB  . LYS A 1 285 ? -36.877 -2.204  -27.535 1.00 66.50  ? 545 LYS A CB  1 
ATOM   2243 C  CG  . LYS A 1 285 ? -38.073 -3.007  -27.020 1.00 69.65  ? 545 LYS A CG  1 
ATOM   2244 C  CD  . LYS A 1 285 ? -39.335 -2.134  -26.959 1.00 73.47  ? 545 LYS A CD  1 
ATOM   2245 C  CE  . LYS A 1 285 ? -40.556 -2.878  -26.431 1.00 76.35  ? 545 LYS A CE  1 
ATOM   2246 N  NZ  . LYS A 1 285 ? -40.398 -3.253  -24.991 1.00 79.01  ? 545 LYS A NZ  1 
ATOM   2247 N  N   . THR A 1 286 ? -33.287 -1.824  -27.109 1.00 60.32  ? 546 THR A N   1 
ATOM   2248 C  CA  . THR A 1 286 ? -32.241 -0.901  -27.512 1.00 63.22  ? 546 THR A CA  1 
ATOM   2249 C  C   . THR A 1 286 ? -31.549 -1.383  -28.786 1.00 64.92  ? 546 THR A C   1 
ATOM   2250 O  O   . THR A 1 286 ? -31.094 -0.559  -29.594 1.00 67.22  ? 546 THR A O   1 
ATOM   2251 C  CB  . THR A 1 286 ? -31.245 -0.639  -26.359 1.00 63.61  ? 546 THR A CB  1 
ATOM   2252 O  OG1 . THR A 1 286 ? -31.769 0.417   -25.539 1.00 66.57  ? 546 THR A OG1 1 
ATOM   2253 C  CG2 . THR A 1 286 ? -29.894 -0.219  -26.880 1.00 62.32  ? 546 THR A CG2 1 
ATOM   2254 N  N   . SER A 1 287 ? -31.539 -2.700  -28.987 1.00 63.23  ? 547 SER A N   1 
ATOM   2255 C  CA  . SER A 1 287 ? -30.836 -3.325  -30.095 1.00 62.30  ? 547 SER A CA  1 
ATOM   2256 C  C   . SER A 1 287 ? -31.733 -4.094  -31.062 1.00 64.48  ? 547 SER A C   1 
ATOM   2257 O  O   . SER A 1 287 ? -32.916 -4.302  -30.802 1.00 67.44  ? 547 SER A O   1 
ATOM   2258 C  CB  . SER A 1 287 ? -29.818 -4.280  -29.514 1.00 59.47  ? 547 SER A CB  1 
ATOM   2259 O  OG  . SER A 1 287 ? -29.048 -4.878  -30.525 1.00 61.42  ? 547 SER A OG  1 
ATOM   2260 N  N   . ASP A 1 288 ? -31.152 -4.505  -32.186 1.00 61.47  ? 548 ASP A N   1 
ATOM   2261 C  CA  . ASP A 1 288 ? -31.822 -5.388  -33.150 1.00 63.03  ? 548 ASP A CA  1 
ATOM   2262 C  C   . ASP A 1 288 ? -31.769 -6.867  -32.697 1.00 62.08  ? 548 ASP A C   1 
ATOM   2263 O  O   . ASP A 1 288 ? -32.453 -7.721  -33.272 1.00 61.66  ? 548 ASP A O   1 
ATOM   2264 C  CB  . ASP A 1 288 ? -31.298 -5.190  -34.607 1.00 44.82  ? 548 ASP A CB  1 
ATOM   2265 C  CG  . ASP A 1 288 ? -29.753 -5.300  -34.746 1.00 59.93  ? 548 ASP A CG  1 
ATOM   2266 O  OD1 . ASP A 1 288 ? -29.068 -5.474  -33.732 1.00 57.87  ? 548 ASP A OD1 1 
ATOM   2267 O  OD2 . ASP A 1 288 ? -29.209 -5.214  -35.878 1.00 57.23  ? 548 ASP A OD2 1 
ATOM   2268 N  N   . HIS A 1 289 ? -30.970 -7.166  -31.667 1.00 60.17  ? 549 HIS A N   1 
ATOM   2269 C  CA  . HIS A 1 289 ? -31.065 -8.459  -30.961 1.00 58.00  ? 549 HIS A CA  1 
ATOM   2270 C  C   . HIS A 1 289 ? -31.756 -8.258  -29.622 1.00 55.08  ? 549 HIS A C   1 
ATOM   2271 O  O   . HIS A 1 289 ? -31.749 -7.164  -29.075 1.00 51.46  ? 549 HIS A O   1 
ATOM   2272 C  CB  . HIS A 1 289 ? -29.698 -9.055  -30.636 1.00 51.57  ? 549 HIS A CB  1 
ATOM   2273 C  CG  . HIS A 1 289 ? -28.864 -9.416  -31.823 1.00 54.50  ? 549 HIS A CG  1 
ATOM   2274 N  ND1 . HIS A 1 289 ? -28.533 -10.718 -32.126 1.00 57.45  ? 549 HIS A ND1 1 
ATOM   2275 C  CD2 . HIS A 1 289 ? -28.221 -8.643  -32.730 1.00 58.35  ? 549 HIS A CD2 1 
ATOM   2276 C  CE1 . HIS A 1 289 ? -27.749 -10.733 -33.190 1.00 59.50  ? 549 HIS A CE1 1 
ATOM   2277 N  NE2 . HIS A 1 289 ? -27.548 -9.486  -33.580 1.00 60.56  ? 549 HIS A NE2 1 
ATOM   2278 N  N   . LYS A 1 290 ? -32.317 -9.334  -29.085 1.00 56.19  ? 550 LYS A N   1 
ATOM   2279 C  CA  . LYS A 1 290 ? -32.691 -9.369  -27.669 1.00 59.73  ? 550 LYS A CA  1 
ATOM   2280 C  C   . LYS A 1 290 ? -31.588 -10.040 -26.846 1.00 59.57  ? 550 LYS A C   1 
ATOM   2281 O  O   . LYS A 1 290 ? -30.854 -10.875 -27.358 1.00 58.27  ? 550 LYS A O   1 
ATOM   2282 C  CB  . LYS A 1 290 ? -34.011 -10.102 -27.458 1.00 59.07  ? 550 LYS A CB  1 
ATOM   2283 C  CG  . LYS A 1 290 ? -35.167 -9.533  -28.276 1.00 61.41  ? 550 LYS A CG  1 
ATOM   2284 C  CD  . LYS A 1 290 ? -35.486 -8.094  -27.926 1.00 61.67  ? 550 LYS A CD  1 
ATOM   2285 C  CE  . LYS A 1 290 ? -36.779 -7.662  -28.590 1.00 64.15  ? 550 LYS A CE  1 
ATOM   2286 N  NZ  . LYS A 1 290 ? -37.028 -6.218  -28.397 1.00 66.83  ? 550 LYS A NZ  1 
ATOM   2287 N  N   . PRO A 1 291 ? -31.448 -9.658  -25.569 1.00 59.97  ? 551 PRO A N   1 
ATOM   2288 C  CA  . PRO A 1 291 ? -30.454 -10.349 -24.781 1.00 56.43  ? 551 PRO A CA  1 
ATOM   2289 C  C   . PRO A 1 291 ? -30.976 -11.698 -24.321 1.00 57.49  ? 551 PRO A C   1 
ATOM   2290 O  O   . PRO A 1 291 ? -32.191 -11.960 -24.346 1.00 61.28  ? 551 PRO A O   1 
ATOM   2291 C  CB  . PRO A 1 291 ? -30.204 -9.411  -23.592 1.00 52.42  ? 551 PRO A CB  1 
ATOM   2292 C  CG  . PRO A 1 291 ? -31.313 -8.485  -23.553 1.00 55.01  ? 551 PRO A CG  1 
ATOM   2293 C  CD  . PRO A 1 291 ? -32.166 -8.646  -24.783 1.00 59.42  ? 551 PRO A CD  1 
ATOM   2294 N  N   . VAL A 1 292 ? -30.040 -12.537 -23.907 1.00 54.07  ? 552 VAL A N   1 
ATOM   2295 C  CA  . VAL A 1 292 ? -30.318 -13.902 -23.507 1.00 55.33  ? 552 VAL A CA  1 
ATOM   2296 C  C   . VAL A 1 292 ? -29.588 -14.101 -22.186 1.00 57.07  ? 552 VAL A C   1 
ATOM   2297 O  O   . VAL A 1 292 ? -28.541 -13.476 -21.934 1.00 59.89  ? 552 VAL A O   1 
ATOM   2298 C  CB  . VAL A 1 292 ? -29.837 -14.897 -24.597 1.00 48.35  ? 552 VAL A CB  1 
ATOM   2299 C  CG1 . VAL A 1 292 ? -29.858 -16.312 -24.107 1.00 47.80  ? 552 VAL A CG1 1 
ATOM   2300 C  CG2 . VAL A 1 292 ? -30.679 -14.728 -25.857 1.00 49.43  ? 552 VAL A CG2 1 
ATOM   2301 N  N   . SER A 1 293 ? -30.147 -14.940 -21.327 1.00 56.46  ? 553 SER A N   1 
ATOM   2302 C  CA  . SER A 1 293 ? -29.549 -15.168 -20.030 1.00 55.17  ? 553 SER A CA  1 
ATOM   2303 C  C   . SER A 1 293 ? -29.786 -16.607 -19.626 1.00 57.16  ? 553 SER A C   1 
ATOM   2304 O  O   . SER A 1 293 ? -30.728 -17.258 -20.113 1.00 58.97  ? 553 SER A O   1 
ATOM   2305 C  CB  . SER A 1 293 ? -30.155 -14.226 -18.986 1.00 53.58  ? 553 SER A CB  1 
ATOM   2306 O  OG  . SER A 1 293 ? -31.478 -14.628 -18.645 1.00 57.32  ? 553 SER A OG  1 
ATOM   2307 N  N   . SER A 1 294 ? -28.921 -17.097 -18.744 1.00 52.03  ? 554 SER A N   1 
ATOM   2308 C  CA  . SER A 1 294 ? -29.108 -18.393 -18.130 1.00 49.86  ? 554 SER A CA  1 
ATOM   2309 C  C   . SER A 1 294 ? -28.519 -18.376 -16.722 1.00 57.19  ? 554 SER A C   1 
ATOM   2310 O  O   . SER A 1 294 ? -27.463 -17.766 -16.485 1.00 57.15  ? 554 SER A O   1 
ATOM   2311 C  CB  . SER A 1 294 ? -28.413 -19.465 -18.944 1.00 45.83  ? 554 SER A CB  1 
ATOM   2312 O  OG  . SER A 1 294 ? -28.528 -20.705 -18.294 1.00 50.52  ? 554 SER A OG  1 
ATOM   2313 N  N   . VAL A 1 295 ? -29.212 -19.030 -15.788 1.00 57.57  ? 555 VAL A N   1 
ATOM   2314 C  CA  . VAL A 1 295 ? -28.680 -19.228 -14.451 1.00 53.84  ? 555 VAL A CA  1 
ATOM   2315 C  C   . VAL A 1 295 ? -28.379 -20.708 -14.253 1.00 52.32  ? 555 VAL A C   1 
ATOM   2316 O  O   . VAL A 1 295 ? -29.177 -21.576 -14.634 1.00 52.29  ? 555 VAL A O   1 
ATOM   2317 C  CB  . VAL A 1 295 ? -29.644 -18.712 -13.377 1.00 52.31  ? 555 VAL A CB  1 
ATOM   2318 C  CG1 . VAL A 1 295 ? -29.102 -19.000 -11.994 1.00 49.95  ? 555 VAL A CG1 1 
ATOM   2319 C  CG2 . VAL A 1 295 ? -29.838 -17.246 -13.565 1.00 50.16  ? 555 VAL A CG2 1 
ATOM   2320 N  N   . PHE A 1 296 ? -27.208 -20.971 -13.676 1.00 50.96  ? 556 PHE A N   1 
ATOM   2321 C  CA  . PHE A 1 296 ? -26.757 -22.327 -13.375 1.00 51.75  ? 556 PHE A CA  1 
ATOM   2322 C  C   . PHE A 1 296 ? -26.484 -22.463 -11.905 1.00 54.11  ? 556 PHE A C   1 
ATOM   2323 O  O   . PHE A 1 296 ? -25.946 -21.541 -11.295 1.00 56.99  ? 556 PHE A O   1 
ATOM   2324 C  CB  . PHE A 1 296 ? -25.435 -22.626 -14.057 1.00 51.76  ? 556 PHE A CB  1 
ATOM   2325 C  CG  . PHE A 1 296 ? -25.473 -22.565 -15.552 1.00 52.57  ? 556 PHE A CG  1 
ATOM   2326 C  CD1 . PHE A 1 296 ? -25.811 -23.676 -16.283 1.00 51.61  ? 556 PHE A CD1 1 
ATOM   2327 C  CD2 . PHE A 1 296 ? -25.103 -21.413 -16.222 1.00 50.78  ? 556 PHE A CD2 1 
ATOM   2328 C  CE1 . PHE A 1 296 ? -25.818 -23.636 -17.657 1.00 52.02  ? 556 PHE A CE1 1 
ATOM   2329 C  CE2 . PHE A 1 296 ? -25.110 -21.377 -17.611 1.00 52.33  ? 556 PHE A CE2 1 
ATOM   2330 C  CZ  . PHE A 1 296 ? -25.461 -22.493 -18.325 1.00 50.72  ? 556 PHE A CZ  1 
ATOM   2331 N  N   . ASP A 1 297 ? -26.829 -23.617 -11.358 1.00 54.21  ? 557 ASP A N   1 
ATOM   2332 C  CA  . ASP A 1 297 ? -26.283 -24.087 -10.091 1.00 55.35  ? 557 ASP A CA  1 
ATOM   2333 C  C   . ASP A 1 297 ? -25.047 -24.894 -10.480 1.00 54.26  ? 557 ASP A C   1 
ATOM   2334 O  O   . ASP A 1 297 ? -25.171 -25.935 -11.117 1.00 57.09  ? 557 ASP A O   1 
ATOM   2335 C  CB  . ASP A 1 297 ? -27.288 -25.004 -9.339  1.00 60.73  ? 557 ASP A CB  1 
ATOM   2336 C  CG  . ASP A 1 297 ? -27.901 -24.353 -8.075  1.00 67.90  ? 557 ASP A CG  1 
ATOM   2337 O  OD1 . ASP A 1 297 ? -27.569 -23.203 -7.712  1.00 69.50  ? 557 ASP A OD1 1 
ATOM   2338 O  OD2 . ASP A 1 297 ? -28.728 -25.019 -7.417  1.00 74.23  ? 557 ASP A OD2 1 
ATOM   2339 N  N   . ILE A 1 298 ? -23.865 -24.409 -10.114 1.00 51.10  ? 558 ILE A N   1 
ATOM   2340 C  CA  . ILE A 1 298 ? -22.625 -25.133 -10.367 1.00 51.36  ? 558 ILE A CA  1 
ATOM   2341 C  C   . ILE A 1 298 ? -21.960 -25.641 -9.094  1.00 52.85  ? 558 ILE A C   1 
ATOM   2342 O  O   . ILE A 1 298 ? -21.782 -24.904 -8.150  1.00 55.88  ? 558 ILE A O   1 
ATOM   2343 C  CB  . ILE A 1 298 ? -21.636 -24.262 -11.112 1.00 48.83  ? 558 ILE A CB  1 
ATOM   2344 C  CG1 . ILE A 1 298 ? -22.216 -23.935 -12.499 1.00 48.11  ? 558 ILE A CG1 1 
ATOM   2345 C  CG2 . ILE A 1 298 ? -20.286 -24.969 -11.190 1.00 45.80  ? 558 ILE A CG2 1 
ATOM   2346 C  CD1 . ILE A 1 298 ? -21.362 -23.029 -13.347 1.00 46.13  ? 558 ILE A CD1 1 
ATOM   2347 N  N   . GLY A 1 299 ? -21.599 -26.911 -9.074  1.00 52.27  ? 559 GLY A N   1 
ATOM   2348 C  CA  . GLY A 1 299 ? -20.926 -27.479 -7.927  1.00 56.48  ? 559 GLY A CA  1 
ATOM   2349 C  C   . GLY A 1 299 ? -19.456 -27.152 -7.974  1.00 56.75  ? 559 GLY A C   1 
ATOM   2350 O  O   . GLY A 1 299 ? -18.796 -27.486 -8.944  1.00 60.09  ? 559 GLY A O   1 
ATOM   2351 N  N   . VAL A 1 300 ? -18.963 -26.486 -6.932  1.00 51.46  ? 560 VAL A N   1 
ATOM   2352 C  CA  . VAL A 1 300 ? -17.571 -26.105 -6.820  1.00 51.89  ? 560 VAL A CA  1 
ATOM   2353 C  C   . VAL A 1 300 ? -16.953 -26.868 -5.647  1.00 55.87  ? 560 VAL A C   1 
ATOM   2354 O  O   . VAL A 1 300 ? -17.561 -26.971 -4.598  1.00 53.41  ? 560 VAL A O   1 
ATOM   2355 C  CB  . VAL A 1 300 ? -17.438 -24.595 -6.537  1.00 52.32  ? 560 VAL A CB  1 
ATOM   2356 C  CG1 . VAL A 1 300 ? -15.990 -24.252 -6.168  1.00 54.10  ? 560 VAL A CG1 1 
ATOM   2357 C  CG2 . VAL A 1 300 ? -17.940 -23.740 -7.721  1.00 48.26  ? 560 VAL A CG2 1 
ATOM   2358 N  N   . ARG A 1 301 ? -15.738 -27.388 -5.829  1.00 59.64  ? 561 ARG A N   1 
ATOM   2359 C  CA  . ARG A 1 301 ? -15.057 -28.142 -4.782  1.00 64.60  ? 561 ARG A CA  1 
ATOM   2360 C  C   . ARG A 1 301 ? -14.396 -27.158 -3.838  1.00 64.45  ? 561 ARG A C   1 
ATOM   2361 O  O   . ARG A 1 301 ? -13.542 -26.367 -4.229  1.00 62.11  ? 561 ARG A O   1 
ATOM   2362 C  CB  . ARG A 1 301 ? -14.020 -29.133 -5.338  1.00 68.83  ? 561 ARG A CB  1 
ATOM   2363 C  CG  . ARG A 1 301 ? -14.431 -29.849 -6.633  1.00 75.77  ? 561 ARG A CG  1 
ATOM   2364 C  CD  . ARG A 1 301 ? -13.799 -31.248 -6.794  1.00 84.97  ? 561 ARG A CD  1 
ATOM   2365 N  NE  . ARG A 1 301 ? -14.651 -32.249 -6.145  1.00 97.38  ? 561 ARG A NE  1 
ATOM   2366 C  CZ  . ARG A 1 301 ? -14.305 -33.031 -5.108  1.00 104.38 ? 561 ARG A CZ  1 
ATOM   2367 N  NH1 . ARG A 1 301 ? -13.074 -33.025 -4.576  1.00 105.44 ? 561 ARG A NH1 1 
ATOM   2368 N  NH2 . ARG A 1 301 ? -15.207 -33.868 -4.606  1.00 105.42 ? 561 ARG A NH2 1 
ATOM   2369 N  N   . VAL A 1 302 ? -14.821 -27.218 -2.586  1.00 66.88  ? 562 VAL A N   1 
ATOM   2370 C  CA  . VAL A 1 302 ? -14.380 -26.315 -1.547  1.00 66.64  ? 562 VAL A CA  1 
ATOM   2371 C  C   . VAL A 1 302 ? -13.546 -27.114 -0.565  1.00 74.72  ? 562 VAL A C   1 
ATOM   2372 O  O   . VAL A 1 302 ? -14.006 -28.141 -0.054  1.00 79.14  ? 562 VAL A O   1 
ATOM   2373 C  CB  . VAL A 1 302 ? -15.580 -25.738 -0.830  1.00 61.11  ? 562 VAL A CB  1 
ATOM   2374 C  CG1 . VAL A 1 302 ? -15.130 -24.833 0.317   1.00 61.93  ? 562 VAL A CG1 1 
ATOM   2375 C  CG2 . VAL A 1 302 ? -16.440 -24.998 -1.818  1.00 54.35  ? 562 VAL A CG2 1 
ATOM   2376 N  N   . VAL A 1 303 ? -12.320 -26.657 -0.315  1.00 76.87  ? 563 VAL A N   1 
ATOM   2377 C  CA  . VAL A 1 303 ? -11.390 -27.359 0.589   1.00 80.29  ? 563 VAL A CA  1 
ATOM   2378 C  C   . VAL A 1 303 ? -10.923 -26.425 1.700   1.00 77.61  ? 563 VAL A C   1 
ATOM   2379 O  O   . VAL A 1 303 ? -10.803 -26.846 2.839   1.00 78.29  ? 563 VAL A O   1 
ATOM   2380 C  CB  . VAL A 1 303 ? -10.144 -27.940 -0.174  1.00 87.82  ? 563 VAL A CB  1 
ATOM   2381 N  N   . MET B 1 1   ? 6.589   -4.015  10.989  1.00 100.40 ? 261 MET B N   1 
ATOM   2382 C  CA  . MET B 1 1   ? 5.845   -2.910  10.324  1.00 102.78 ? 261 MET B CA  1 
ATOM   2383 C  C   . MET B 1 1   ? 6.362   -2.698  8.899   1.00 101.66 ? 261 MET B C   1 
ATOM   2384 O  O   . MET B 1 1   ? 5.591   -2.766  7.948   1.00 101.67 ? 261 MET B O   1 
ATOM   2385 C  CB  . MET B 1 1   ? 5.970   -1.618  11.136  1.00 103.85 ? 261 MET B CB  1 
ATOM   2386 N  N   . ILE B 1 2   ? 7.668   -2.459  8.771   1.00 99.25  ? 262 ILE B N   1 
ATOM   2387 C  CA  . ILE B 1 2   ? 8.319   -2.175  7.489   1.00 92.32  ? 262 ILE B CA  1 
ATOM   2388 C  C   . ILE B 1 2   ? 9.519   -3.088  7.276   1.00 91.71  ? 262 ILE B C   1 
ATOM   2389 O  O   . ILE B 1 2   ? 10.547  -2.925  7.926   1.00 90.25  ? 262 ILE B O   1 
ATOM   2390 C  CB  . ILE B 1 2   ? 8.843   -0.722  7.429   1.00 91.08  ? 262 ILE B CB  1 
ATOM   2391 C  CG1 . ILE B 1 2   ? 7.707   0.290   7.640   1.00 92.95  ? 262 ILE B CG1 1 
ATOM   2392 C  CG2 . ILE B 1 2   ? 9.573   -0.465  6.114   1.00 86.41  ? 262 ILE B CG2 1 
ATOM   2393 C  CD1 . ILE B 1 2   ? 6.685   0.308   6.542   1.00 90.47  ? 262 ILE B CD1 1 
ATOM   2394 N  N   . GLN B 1 3   ? 9.385   -4.038  6.355   1.00 93.24  ? 263 GLN B N   1 
ATOM   2395 C  CA  . GLN B 1 3   ? 10.482  -4.919  5.961   1.00 91.88  ? 263 GLN B CA  1 
ATOM   2396 C  C   . GLN B 1 3   ? 10.964  -4.493  4.577   1.00 88.45  ? 263 GLN B C   1 
ATOM   2397 O  O   . GLN B 1 3   ? 10.165  -4.049  3.765   1.00 87.65  ? 263 GLN B O   1 
ATOM   2398 C  CB  . GLN B 1 3   ? 9.985   -6.367  5.947   1.00 94.82  ? 263 GLN B CB  1 
ATOM   2399 C  CG  . GLN B 1 3   ? 11.070  -7.437  5.797   1.00 101.33 ? 263 GLN B CG  1 
ATOM   2400 C  CD  . GLN B 1 3   ? 10.479  -8.850  5.665   1.00 106.56 ? 263 GLN B CD  1 
ATOM   2401 O  OE1 . GLN B 1 3   ? 9.781   -9.324  6.569   1.00 109.61 ? 263 GLN B OE1 1 
ATOM   2402 N  NE2 . GLN B 1 3   ? 10.757  -9.521  4.536   1.00 105.47 ? 263 GLN B NE2 1 
ATOM   2403 N  N   . ASN B 1 4   ? 12.264  -4.610  4.316   1.00 87.55  ? 264 ASN B N   1 
ATOM   2404 C  CA  . ASN B 1 4   ? 12.841  -4.232  3.019   1.00 89.66  ? 264 ASN B CA  1 
ATOM   2405 C  C   . ASN B 1 4   ? 12.915  -5.419  2.045   1.00 90.58  ? 264 ASN B C   1 
ATOM   2406 O  O   . ASN B 1 4   ? 13.276  -6.537  2.440   1.00 91.32  ? 264 ASN B O   1 
ATOM   2407 C  CB  . ASN B 1 4   ? 14.253  -3.648  3.190   1.00 93.07  ? 264 ASN B CB  1 
ATOM   2408 C  CG  . ASN B 1 4   ? 14.275  -2.348  4.005   1.00 98.62  ? 264 ASN B CG  1 
ATOM   2409 O  OD1 . ASN B 1 4   ? 13.499  -1.425  3.757   1.00 97.45  ? 264 ASN B OD1 1 
ATOM   2410 N  ND2 . ASN B 1 4   ? 15.187  -2.273  4.967   1.00 103.19 ? 264 ASN B ND2 1 
ATOM   2411 N  N   . PHE B 1 5   ? 12.591  -5.157  0.774   1.00 85.47  ? 265 PHE B N   1 
ATOM   2412 C  CA  . PHE B 1 5   ? 12.687  -6.147  -0.295  1.00 77.71  ? 265 PHE B CA  1 
ATOM   2413 C  C   . PHE B 1 5   ? 13.546  -5.628  -1.436  1.00 76.64  ? 265 PHE B C   1 
ATOM   2414 O  O   . PHE B 1 5   ? 13.542  -4.433  -1.727  1.00 75.23  ? 265 PHE B O   1 
ATOM   2415 C  CB  . PHE B 1 5   ? 11.302  -6.484  -0.849  1.00 75.01  ? 265 PHE B CB  1 
ATOM   2416 C  CG  . PHE B 1 5   ? 10.401  -7.160  0.139   1.00 78.19  ? 265 PHE B CG  1 
ATOM   2417 C  CD1 . PHE B 1 5   ? 10.218  -8.535  0.105   1.00 77.46  ? 265 PHE B CD1 1 
ATOM   2418 C  CD2 . PHE B 1 5   ? 9.731   -6.421  1.103   1.00 80.13  ? 265 PHE B CD2 1 
ATOM   2419 C  CE1 . PHE B 1 5   ? 9.385   -9.164  1.013   1.00 76.11  ? 265 PHE B CE1 1 
ATOM   2420 C  CE2 . PHE B 1 5   ? 8.894   -7.043  2.013   1.00 80.00  ? 265 PHE B CE2 1 
ATOM   2421 C  CZ  . PHE B 1 5   ? 8.723   -8.421  1.966   1.00 77.68  ? 265 PHE B CZ  1 
ATOM   2422 N  N   . ARG B 1 6   ? 14.262  -6.547  -2.090  1.00 77.45  ? 266 ARG B N   1 
ATOM   2423 C  CA  . ARG B 1 6   ? 15.115  -6.221  -3.237  1.00 76.58  ? 266 ARG B CA  1 
ATOM   2424 C  C   . ARG B 1 6   ? 14.264  -6.156  -4.484  1.00 70.80  ? 266 ARG B C   1 
ATOM   2425 O  O   . ARG B 1 6   ? 13.614  -7.147  -4.841  1.00 68.22  ? 266 ARG B O   1 
ATOM   2426 C  CB  . ARG B 1 6   ? 16.217  -7.269  -3.442  1.00 79.21  ? 266 ARG B CB  1 
ATOM   2427 C  CG  . ARG B 1 6   ? 17.299  -7.303  -2.370  1.00 84.14  ? 266 ARG B CG  1 
ATOM   2428 C  CD  . ARG B 1 6   ? 18.249  -6.121  -2.511  1.00 90.81  ? 266 ARG B CD  1 
ATOM   2429 N  NE  . ARG B 1 6   ? 19.003  -5.840  -1.286  1.00 96.72  ? 266 ARG B NE  1 
ATOM   2430 C  CZ  . ARG B 1 6   ? 20.084  -6.508  -0.884  1.00 101.62 ? 266 ARG B CZ  1 
ATOM   2431 N  NH1 . ARG B 1 6   ? 20.553  -7.530  -1.590  1.00 101.42 ? 266 ARG B NH1 1 
ATOM   2432 N  NH2 . ARG B 1 6   ? 20.697  -6.166  0.245   1.00 105.16 ? 266 ARG B NH2 1 
ATOM   2433 N  N   . PHE B 1 7   ? 14.265  -4.990  -5.133  1.00 69.59  ? 267 PHE B N   1 
ATOM   2434 C  CA  . PHE B 1 7   ? 13.576  -4.795  -6.405  1.00 69.25  ? 267 PHE B CA  1 
ATOM   2435 C  C   . PHE B 1 7   ? 14.611  -4.574  -7.491  1.00 71.71  ? 267 PHE B C   1 
ATOM   2436 O  O   . PHE B 1 7   ? 15.394  -3.632  -7.424  1.00 73.98  ? 267 PHE B O   1 
ATOM   2437 C  CB  . PHE B 1 7   ? 12.643  -3.580  -6.364  1.00 68.87  ? 267 PHE B CB  1 
ATOM   2438 C  CG  . PHE B 1 7   ? 11.308  -3.846  -5.718  1.00 69.98  ? 267 PHE B CG  1 
ATOM   2439 C  CD1 . PHE B 1 7   ? 10.142  -3.793  -6.461  1.00 65.54  ? 267 PHE B CD1 1 
ATOM   2440 C  CD2 . PHE B 1 7   ? 11.218  -4.127  -4.361  1.00 73.45  ? 267 PHE B CD2 1 
ATOM   2441 C  CE1 . PHE B 1 7   ? 8.913   -4.031  -5.878  1.00 66.09  ? 267 PHE B CE1 1 
ATOM   2442 C  CE2 . PHE B 1 7   ? 9.979   -4.369  -3.765  1.00 72.89  ? 267 PHE B CE2 1 
ATOM   2443 C  CZ  . PHE B 1 7   ? 8.827   -4.321  -4.530  1.00 69.88  ? 267 PHE B CZ  1 
ATOM   2444 N  N   . PHE B 1 8   ? 14.617  -5.460  -8.483  1.00 72.20  ? 268 PHE B N   1 
ATOM   2445 C  CA  . PHE B 1 8   ? 15.382  -5.248  -9.704  1.00 69.34  ? 268 PHE B CA  1 
ATOM   2446 C  C   . PHE B 1 8   ? 14.517  -4.502  -10.701 1.00 63.23  ? 268 PHE B C   1 
ATOM   2447 O  O   . PHE B 1 8   ? 13.383  -4.889  -10.941 1.00 58.90  ? 268 PHE B O   1 
ATOM   2448 C  CB  . PHE B 1 8   ? 15.815  -6.580  -10.315 1.00 67.85  ? 268 PHE B CB  1 
ATOM   2449 C  CG  . PHE B 1 8   ? 16.633  -6.433  -11.567 1.00 69.71  ? 268 PHE B CG  1 
ATOM   2450 C  CD1 . PHE B 1 8   ? 18.011  -6.583  -11.536 1.00 73.34  ? 268 PHE B CD1 1 
ATOM   2451 C  CD2 . PHE B 1 8   ? 16.031  -6.133  -12.777 1.00 68.18  ? 268 PHE B CD2 1 
ATOM   2452 C  CE1 . PHE B 1 8   ? 18.772  -6.458  -12.702 1.00 74.14  ? 268 PHE B CE1 1 
ATOM   2453 C  CE2 . PHE B 1 8   ? 16.788  -5.997  -13.944 1.00 68.91  ? 268 PHE B CE2 1 
ATOM   2454 C  CZ  . PHE B 1 8   ? 18.154  -6.171  -13.908 1.00 71.28  ? 268 PHE B CZ  1 
ATOM   2455 N  N   . ALA B 1 9   ? 15.067  -3.434  -11.272 1.00 63.80  ? 269 ALA B N   1 
ATOM   2456 C  CA  . ALA B 1 9   ? 14.463  -2.750  -12.419 1.00 65.60  ? 269 ALA B CA  1 
ATOM   2457 C  C   . ALA B 1 9   ? 15.422  -2.816  -13.605 1.00 67.20  ? 269 ALA B C   1 
ATOM   2458 O  O   . ALA B 1 9   ? 16.630  -2.614  -13.456 1.00 67.91  ? 269 ALA B O   1 
ATOM   2459 C  CB  . ALA B 1 9   ? 14.132  -1.304  -12.085 1.00 64.66  ? 269 ALA B CB  1 
ATOM   2460 N  N   . GLY B 1 10  ? 14.872  -3.118  -14.776 1.00 65.53  ? 270 GLY B N   1 
ATOM   2461 C  CA  . GLY B 1 10  ? 15.647  -3.168  -16.012 1.00 62.42  ? 270 GLY B CA  1 
ATOM   2462 C  C   . GLY B 1 10  ? 14.929  -2.477  -17.160 1.00 61.38  ? 270 GLY B C   1 
ATOM   2463 O  O   . GLY B 1 10  ? 13.690  -2.390  -17.174 1.00 60.91  ? 270 GLY B O   1 
ATOM   2464 N  N   . THR B 1 11  ? 15.716  -1.969  -18.109 1.00 60.50  ? 271 THR B N   1 
ATOM   2465 C  CA  . THR B 1 11  ? 15.195  -1.420  -19.356 1.00 61.64  ? 271 THR B CA  1 
ATOM   2466 C  C   . THR B 1 11  ? 16.181  -1.732  -20.470 1.00 66.28  ? 271 THR B C   1 
ATOM   2467 O  O   . THR B 1 11  ? 17.389  -1.610  -20.292 1.00 69.94  ? 271 THR B O   1 
ATOM   2468 C  CB  . THR B 1 11  ? 14.954  0.105   -19.283 1.00 61.49  ? 271 THR B CB  1 
ATOM   2469 O  OG1 . THR B 1 11  ? 14.690  0.606   -20.603 1.00 65.00  ? 271 THR B OG1 1 
ATOM   2470 C  CG2 . THR B 1 11  ? 16.159  0.827   -18.699 1.00 60.13  ? 271 THR B CG2 1 
ATOM   2471 N  N   . TYR B 1 12  ? 15.663  -2.142  -21.620 1.00 65.44  ? 272 TYR B N   1 
ATOM   2472 C  CA  . TYR B 1 12  ? 16.516  -2.577  -22.731 1.00 65.33  ? 272 TYR B CA  1 
ATOM   2473 C  C   . TYR B 1 12  ? 15.792  -2.342  -24.043 1.00 68.73  ? 272 TYR B C   1 
ATOM   2474 O  O   . TYR B 1 12  ? 14.700  -2.864  -24.272 1.00 66.31  ? 272 TYR B O   1 
ATOM   2475 C  CB  . TYR B 1 12  ? 16.845  -4.058  -22.572 1.00 64.20  ? 272 TYR B CB  1 
ATOM   2476 C  CG  . TYR B 1 12  ? 17.957  -4.621  -23.433 1.00 66.52  ? 272 TYR B CG  1 
ATOM   2477 C  CD1 . TYR B 1 12  ? 18.842  -3.806  -24.145 1.00 67.09  ? 272 TYR B CD1 1 
ATOM   2478 C  CD2 . TYR B 1 12  ? 18.174  -5.997  -23.464 1.00 64.41  ? 272 TYR B CD2 1 
ATOM   2479 C  CE1 . TYR B 1 12  ? 19.884  -4.367  -24.902 1.00 66.31  ? 272 TYR B CE1 1 
ATOM   2480 C  CE2 . TYR B 1 12  ? 19.207  -6.557  -24.206 1.00 63.21  ? 272 TYR B CE2 1 
ATOM   2481 C  CZ  . TYR B 1 12  ? 20.059  -5.748  -24.923 1.00 62.91  ? 272 TYR B CZ  1 
ATOM   2482 O  OH  . TYR B 1 12  ? 21.064  -6.338  -25.657 1.00 60.12  ? 272 TYR B OH  1 
ATOM   2483 N  N   . ASN B 1 13  ? 16.387  -1.506  -24.879 1.00 72.99  ? 273 ASN B N   1 
ATOM   2484 C  CA  . ASN B 1 13  ? 15.858  -1.245  -26.192 1.00 70.98  ? 273 ASN B CA  1 
ATOM   2485 C  C   . ASN B 1 13  ? 16.539  -2.216  -27.121 1.00 69.31  ? 273 ASN B C   1 
ATOM   2486 O  O   . ASN B 1 13  ? 17.709  -2.052  -27.429 1.00 69.39  ? 273 ASN B O   1 
ATOM   2487 C  CB  . ASN B 1 13  ? 16.142  0.192   -26.604 1.00 71.59  ? 273 ASN B CB  1 
ATOM   2488 C  CG  . ASN B 1 13  ? 15.662  0.499   -27.999 1.00 72.42  ? 273 ASN B CG  1 
ATOM   2489 O  OD1 . ASN B 1 13  ? 15.724  -0.352  -28.893 1.00 75.20  ? 273 ASN B OD1 1 
ATOM   2490 N  ND2 . ASN B 1 13  ? 15.178  1.718   -28.200 1.00 69.83  ? 273 ASN B ND2 1 
ATOM   2491 N  N   . VAL B 1 14  ? 15.794  -3.230  -27.548 1.00 68.40  ? 274 VAL B N   1 
ATOM   2492 C  CA  . VAL B 1 14  ? 16.367  -4.334  -28.299 1.00 71.69  ? 274 VAL B CA  1 
ATOM   2493 C  C   . VAL B 1 14  ? 16.408  -4.085  -29.816 1.00 78.87  ? 274 VAL B C   1 
ATOM   2494 O  O   . VAL B 1 14  ? 16.867  -4.943  -30.570 1.00 82.96  ? 274 VAL B O   1 
ATOM   2495 C  CB  . VAL B 1 14  ? 15.652  -5.676  -27.981 1.00 63.84  ? 274 VAL B CB  1 
ATOM   2496 C  CG1 . VAL B 1 14  ? 15.709  -5.960  -26.477 1.00 63.23  ? 274 VAL B CG1 1 
ATOM   2497 C  CG2 . VAL B 1 14  ? 14.239  -5.658  -28.469 1.00 64.46  ? 274 VAL B CG2 1 
ATOM   2498 N  N   . ASN B 1 15  ? 15.952  -2.920  -30.271 1.00 79.54  ? 275 ASN B N   1 
ATOM   2499 C  CA  . ASN B 1 15  ? 16.062  -2.569  -31.687 1.00 81.11  ? 275 ASN B CA  1 
ATOM   2500 C  C   . ASN B 1 15  ? 15.524  -3.682  -32.599 1.00 79.82  ? 275 ASN B C   1 
ATOM   2501 O  O   . ASN B 1 15  ? 16.146  -4.058  -33.588 1.00 78.48  ? 275 ASN B O   1 
ATOM   2502 C  CB  . ASN B 1 15  ? 17.521  -2.238  -32.027 1.00 82.74  ? 275 ASN B CB  1 
ATOM   2503 C  CG  . ASN B 1 15  ? 17.659  -1.305  -33.238 1.00 85.07  ? 275 ASN B CG  1 
ATOM   2504 O  OD1 . ASN B 1 15  ? 16.981  -0.264  -33.341 1.00 86.43  ? 275 ASN B OD1 1 
ATOM   2505 N  ND2 . ASN B 1 15  ? 18.564  -1.664  -34.140 1.00 84.52  ? 275 ASN B ND2 1 
ATOM   2506 N  N   . GLY B 1 16  ? 14.377  -4.228  -32.220 1.00 78.66  ? 276 GLY B N   1 
ATOM   2507 C  CA  . GLY B 1 16  ? 13.674  -5.195  -33.050 1.00 78.53  ? 276 GLY B CA  1 
ATOM   2508 C  C   . GLY B 1 16  ? 14.369  -6.525  -33.226 1.00 78.65  ? 276 GLY B C   1 
ATOM   2509 O  O   . GLY B 1 16  ? 14.045  -7.270  -34.153 1.00 79.20  ? 276 GLY B O   1 
ATOM   2510 N  N   . GLN B 1 17  ? 15.305  -6.829  -32.331 1.00 78.28  ? 277 GLN B N   1 
ATOM   2511 C  CA  . GLN B 1 17  ? 16.120  -8.030  -32.439 1.00 79.04  ? 277 GLN B CA  1 
ATOM   2512 C  C   . GLN B 1 17  ? 15.519  -9.177  -31.630 1.00 80.82  ? 277 GLN B C   1 
ATOM   2513 O  O   . GLN B 1 17  ? 14.801  -8.966  -30.638 1.00 81.55  ? 277 GLN B O   1 
ATOM   2514 C  CB  . GLN B 1 17  ? 17.540  -7.756  -31.941 1.00 78.60  ? 277 GLN B CB  1 
ATOM   2515 C  CG  . GLN B 1 17  ? 18.306  -6.749  -32.766 1.00 84.41  ? 277 GLN B CG  1 
ATOM   2516 C  CD  . GLN B 1 17  ? 18.774  -7.332  -34.084 1.00 89.68  ? 277 GLN B CD  1 
ATOM   2517 O  OE1 . GLN B 1 17  ? 18.058  -7.255  -35.077 1.00 90.70  ? 277 GLN B OE1 1 
ATOM   2518 N  NE2 . GLN B 1 17  ? 19.963  -7.950  -34.092 1.00 91.28  ? 277 GLN B NE2 1 
ATOM   2519 N  N   . SER B 1 18  ? 15.819  -10.397 -32.060 1.00 79.88  ? 278 SER B N   1 
ATOM   2520 C  CA  . SER B 1 18  ? 15.552  -11.562 -31.245 1.00 77.31  ? 278 SER B CA  1 
ATOM   2521 C  C   . SER B 1 18  ? 16.687  -11.655 -30.237 1.00 76.13  ? 278 SER B C   1 
ATOM   2522 O  O   . SER B 1 18  ? 17.808  -11.220 -30.539 1.00 75.40  ? 278 SER B O   1 
ATOM   2523 C  CB  . SER B 1 18  ? 15.492  -12.830 -32.104 1.00 77.32  ? 278 SER B CB  1 
ATOM   2524 O  OG  . SER B 1 18  ? 14.300  -12.872 -32.866 1.00 77.75  ? 278 SER B OG  1 
ATOM   2525 N  N   . PRO B 1 19  ? 16.410  -12.226 -29.044 1.00 72.14  ? 279 PRO B N   1 
ATOM   2526 C  CA  . PRO B 1 19  ? 17.454  -12.479 -28.059 1.00 70.76  ? 279 PRO B CA  1 
ATOM   2527 C  C   . PRO B 1 19  ? 18.511  -13.441 -28.599 1.00 74.45  ? 279 PRO B C   1 
ATOM   2528 O  O   . PRO B 1 19  ? 18.239  -14.624 -28.775 1.00 70.63  ? 279 PRO B O   1 
ATOM   2529 C  CB  . PRO B 1 19  ? 16.691  -13.098 -26.887 1.00 63.08  ? 279 PRO B CB  1 
ATOM   2530 C  CG  . PRO B 1 19  ? 15.528  -13.680 -27.468 1.00 63.33  ? 279 PRO B CG  1 
ATOM   2531 C  CD  . PRO B 1 19  ? 15.138  -12.834 -28.636 1.00 65.17  ? 279 PRO B CD  1 
ATOM   2532 N  N   . LYS B 1 20  ? 19.694  -12.898 -28.884 1.00 79.56  ? 280 LYS B N   1 
ATOM   2533 C  CA  . LYS B 1 20  ? 20.839  -13.657 -29.406 1.00 79.96  ? 280 LYS B CA  1 
ATOM   2534 C  C   . LYS B 1 20  ? 21.840  -14.057 -28.300 1.00 83.18  ? 280 LYS B C   1 
ATOM   2535 O  O   . LYS B 1 20  ? 22.709  -14.893 -28.528 1.00 86.47  ? 280 LYS B O   1 
ATOM   2536 C  CB  . LYS B 1 20  ? 21.558  -12.849 -30.505 1.00 78.67  ? 280 LYS B CB  1 
ATOM   2537 C  CG  . LYS B 1 20  ? 21.083  -13.138 -31.955 1.00 113.35 ? 280 LYS B CG  1 
ATOM   2538 C  CD  . LYS B 1 20  ? 20.073  -12.106 -32.530 1.00 71.41  ? 280 LYS B CD  1 
ATOM   2539 C  CE  . LYS B 1 20  ? 20.644  -11.270 -33.685 1.00 71.17  ? 280 LYS B CE  1 
ATOM   2540 N  N   . GLU B 1 21  ? 21.706  -13.470 -27.111 1.00 83.78  ? 281 GLU B N   1 
ATOM   2541 C  CA  . GLU B 1 21  ? 22.664  -13.663 -26.018 1.00 87.20  ? 281 GLU B CA  1 
ATOM   2542 C  C   . GLU B 1 21  ? 21.960  -14.046 -24.712 1.00 84.66  ? 281 GLU B C   1 
ATOM   2543 O  O   . GLU B 1 21  ? 20.819  -13.642 -24.466 1.00 83.56  ? 281 GLU B O   1 
ATOM   2544 C  CB  . GLU B 1 21  ? 23.461  -12.372 -25.755 1.00 89.62  ? 281 GLU B CB  1 
ATOM   2545 C  CG  . GLU B 1 21  ? 24.205  -11.767 -26.959 1.00 94.24  ? 281 GLU B CG  1 
ATOM   2546 C  CD  . GLU B 1 21  ? 24.519  -10.263 -26.780 1.00 98.40  ? 281 GLU B CD  1 
ATOM   2547 O  OE1 . GLU B 1 21  ? 23.629  -9.497  -26.338 1.00 100.85 ? 281 GLU B OE1 1 
ATOM   2548 O  OE2 . GLU B 1 21  ? 25.654  -9.837  -27.091 1.00 98.94  ? 281 GLU B OE2 1 
ATOM   2549 N  N   . CYS B 1 22  ? 22.668  -14.795 -23.864 1.00 80.87  ? 282 CYS B N   1 
ATOM   2550 C  CA  . CYS B 1 22  ? 22.235  -15.043 -22.482 1.00 75.61  ? 282 CYS B CA  1 
ATOM   2551 C  C   . CYS B 1 22  ? 22.045  -13.722 -21.694 1.00 75.17  ? 282 CYS B C   1 
ATOM   2552 O  O   . CYS B 1 22  ? 22.887  -12.828 -21.783 1.00 78.10  ? 282 CYS B O   1 
ATOM   2553 C  CB  . CYS B 1 22  ? 23.260  -15.917 -21.779 1.00 70.48  ? 282 CYS B CB  1 
ATOM   2554 S  SG  . CYS B 1 22  ? 22.853  -16.176 -20.071 1.00 86.96  ? 282 CYS B SG  1 
ATOM   2555 N  N   . LEU B 1 23  ? 20.956  -13.605 -20.930 1.00 68.02  ? 283 LEU B N   1 
ATOM   2556 C  CA  . LEU B 1 23  ? 20.620  -12.337 -20.269 1.00 69.33  ? 283 LEU B CA  1 
ATOM   2557 C  C   . LEU B 1 23  ? 21.049  -12.257 -18.803 1.00 72.85  ? 283 LEU B C   1 
ATOM   2558 O  O   . LEU B 1 23  ? 20.744  -11.281 -18.119 1.00 71.41  ? 283 LEU B O   1 
ATOM   2559 C  CB  . LEU B 1 23  ? 19.112  -12.062 -20.363 1.00 68.45  ? 283 LEU B CB  1 
ATOM   2560 C  CG  . LEU B 1 23  ? 18.480  -11.832 -21.737 1.00 67.78  ? 283 LEU B CG  1 
ATOM   2561 C  CD1 . LEU B 1 23  ? 17.029  -11.397 -21.589 1.00 65.89  ? 283 LEU B CD1 1 
ATOM   2562 C  CD2 . LEU B 1 23  ? 19.259  -10.810 -22.517 1.00 67.86  ? 283 LEU B CD2 1 
ATOM   2563 N  N   . ARG B 1 24  ? 21.755  -13.277 -18.322 1.00 77.79  ? 284 ARG B N   1 
ATOM   2564 C  CA  . ARG B 1 24  ? 22.239  -13.306 -16.942 1.00 78.94  ? 284 ARG B CA  1 
ATOM   2565 C  C   . ARG B 1 24  ? 23.086  -12.065 -16.665 1.00 77.39  ? 284 ARG B C   1 
ATOM   2566 O  O   . ARG B 1 24  ? 23.033  -11.490 -15.588 1.00 74.51  ? 284 ARG B O   1 
ATOM   2567 C  CB  . ARG B 1 24  ? 23.093  -14.555 -16.691 1.00 83.80  ? 284 ARG B CB  1 
ATOM   2568 C  CG  . ARG B 1 24  ? 22.407  -15.921 -16.843 1.00 89.02  ? 284 ARG B CG  1 
ATOM   2569 C  CD  . ARG B 1 24  ? 21.654  -16.392 -15.602 1.00 95.07  ? 284 ARG B CD  1 
ATOM   2570 N  NE  . ARG B 1 24  ? 22.300  -16.012 -14.337 1.00 103.52 ? 284 ARG B NE  1 
ATOM   2571 C  CZ  . ARG B 1 24  ? 23.294  -16.676 -13.737 1.00 105.79 ? 284 ARG B CZ  1 
ATOM   2572 N  NH1 . ARG B 1 24  ? 23.807  -17.780 -14.275 1.00 109.50 ? 284 ARG B NH1 1 
ATOM   2573 N  NH2 . ARG B 1 24  ? 23.775  -16.225 -12.582 1.00 100.30 ? 284 ARG B NH2 1 
ATOM   2574 N  N   . LEU B 1 25  ? 23.867  -11.658 -17.659 1.00 81.88  ? 285 LEU B N   1 
ATOM   2575 C  CA  . LEU B 1 25  ? 24.811  -10.541 -17.512 1.00 85.59  ? 285 LEU B CA  1 
ATOM   2576 C  C   . LEU B 1 25  ? 24.111  -9.231  -17.141 1.00 83.88  ? 285 LEU B C   1 
ATOM   2577 O  O   . LEU B 1 25  ? 24.722  -8.331  -16.571 1.00 85.66  ? 285 LEU B O   1 
ATOM   2578 C  CB  . LEU B 1 25  ? 25.618  -10.346 -18.811 1.00 90.81  ? 285 LEU B CB  1 
ATOM   2579 C  CG  . LEU B 1 25  ? 26.756  -11.319 -19.173 1.00 96.39  ? 285 LEU B CG  1 
ATOM   2580 C  CD1 . LEU B 1 25  ? 26.544  -12.769 -18.673 1.00 97.81  ? 285 LEU B CD1 1 
ATOM   2581 C  CD2 . LEU B 1 25  ? 26.984  -11.303 -20.694 1.00 96.53  ? 285 LEU B CD2 1 
ATOM   2582 N  N   . TRP B 1 26  ? 22.836  -9.135  -17.492 1.00 82.00  ? 286 TRP B N   1 
ATOM   2583 C  CA  . TRP B 1 26  ? 22.008  -7.969  -17.207 1.00 79.54  ? 286 TRP B CA  1 
ATOM   2584 C  C   . TRP B 1 26  ? 21.117  -8.200  -15.974 1.00 79.72  ? 286 TRP B C   1 
ATOM   2585 O  O   . TRP B 1 26  ? 20.942  -7.306  -15.147 1.00 78.32  ? 286 TRP B O   1 
ATOM   2586 C  CB  . TRP B 1 26  ? 21.161  -7.681  -18.446 1.00 75.00  ? 286 TRP B CB  1 
ATOM   2587 C  CG  . TRP B 1 26  ? 20.067  -6.708  -18.265 1.00 71.67  ? 286 TRP B CG  1 
ATOM   2588 C  CD1 . TRP B 1 26  ? 20.087  -5.590  -17.500 1.00 69.09  ? 286 TRP B CD1 1 
ATOM   2589 C  CD2 . TRP B 1 26  ? 18.791  -6.733  -18.913 1.00 69.54  ? 286 TRP B CD2 1 
ATOM   2590 N  NE1 . TRP B 1 26  ? 18.891  -4.925  -17.604 1.00 66.98  ? 286 TRP B NE1 1 
ATOM   2591 C  CE2 . TRP B 1 26  ? 18.076  -5.605  -18.469 1.00 68.28  ? 286 TRP B CE2 1 
ATOM   2592 C  CE3 . TRP B 1 26  ? 18.173  -7.612  -19.810 1.00 67.04  ? 286 TRP B CE3 1 
ATOM   2593 C  CZ2 . TRP B 1 26  ? 16.771  -5.333  -18.887 1.00 66.33  ? 286 TRP B CZ2 1 
ATOM   2594 C  CZ3 . TRP B 1 26  ? 16.882  -7.337  -20.229 1.00 65.23  ? 286 TRP B CZ3 1 
ATOM   2595 C  CH2 . TRP B 1 26  ? 16.197  -6.209  -19.768 1.00 65.32  ? 286 TRP B CH2 1 
ATOM   2596 N  N   . LEU B 1 27  ? 20.581  -9.415  -15.858 1.00 80.52  ? 287 LEU B N   1 
ATOM   2597 C  CA  . LEU B 1 27  ? 19.524  -9.736  -14.905 1.00 76.71  ? 287 LEU B CA  1 
ATOM   2598 C  C   . LEU B 1 27  ? 20.024  -10.336 -13.597 1.00 74.83  ? 287 LEU B C   1 
ATOM   2599 O  O   . LEU B 1 27  ? 19.336  -10.247 -12.590 1.00 73.47  ? 287 LEU B O   1 
ATOM   2600 C  CB  . LEU B 1 27  ? 18.544  -10.720 -15.548 1.00 73.20  ? 287 LEU B CB  1 
ATOM   2601 C  CG  . LEU B 1 27  ? 17.757  -10.210 -16.750 1.00 69.16  ? 287 LEU B CG  1 
ATOM   2602 C  CD1 . LEU B 1 27  ? 17.171  -11.408 -17.487 1.00 68.17  ? 287 LEU B CD1 1 
ATOM   2603 C  CD2 . LEU B 1 27  ? 16.659  -9.218  -16.316 1.00 66.19  ? 287 LEU B CD2 1 
ATOM   2604 N  N   . SER B 1 28  ? 21.187  -10.970 -13.609 1.00 75.10  ? 288 SER B N   1 
ATOM   2605 C  CA  . SER B 1 28  ? 21.725  -11.554 -12.384 1.00 80.19  ? 288 SER B CA  1 
ATOM   2606 C  C   . SER B 1 28  ? 23.254  -11.696 -12.413 1.00 87.65  ? 288 SER B C   1 
ATOM   2607 O  O   . SER B 1 28  ? 23.791  -12.811 -12.382 1.00 89.25  ? 288 SER B O   1 
ATOM   2608 C  CB  . SER B 1 28  ? 21.035  -12.889 -12.094 1.00 76.94  ? 288 SER B CB  1 
ATOM   2609 O  OG  . SER B 1 28  ? 21.040  -13.729 -13.230 1.00 78.23  ? 288 SER B OG  1 
ATOM   2610 N  N   . ASN B 1 29  ? 23.941  -10.548 -12.461 1.00 90.94  ? 289 ASN B N   1 
ATOM   2611 C  CA  . ASN B 1 29  ? 25.412  -10.497 -12.532 1.00 93.47  ? 289 ASN B CA  1 
ATOM   2612 C  C   . ASN B 1 29  ? 26.033  -10.055 -11.211 1.00 96.69  ? 289 ASN B C   1 
ATOM   2613 O  O   . ASN B 1 29  ? 26.263  -8.863  -11.013 1.00 99.38  ? 289 ASN B O   1 
ATOM   2614 C  CB  . ASN B 1 29  ? 25.871  -9.536  -13.641 1.00 90.81  ? 289 ASN B CB  1 
ATOM   2615 N  N   . GLY B 1 30  ? 26.296  -11.012 -10.320 1.00 95.16  ? 290 GLY B N   1 
ATOM   2616 C  CA  . GLY B 1 30  ? 26.943  -10.733 -9.032  1.00 97.87  ? 290 GLY B CA  1 
ATOM   2617 C  C   . GLY B 1 30  ? 26.104  -9.931  -8.043  1.00 98.98  ? 290 GLY B C   1 
ATOM   2618 O  O   . GLY B 1 30  ? 26.648  -9.129  -7.270  1.00 101.12 ? 290 GLY B O   1 
ATOM   2619 N  N   . ILE B 1 31  ? 24.786  -10.149 -8.077  1.00 95.88  ? 291 ILE B N   1 
ATOM   2620 C  CA  . ILE B 1 31  ? 23.823  -9.543  -7.132  1.00 93.47  ? 291 ILE B CA  1 
ATOM   2621 C  C   . ILE B 1 31  ? 23.115  -10.671 -6.375  1.00 91.06  ? 291 ILE B C   1 
ATOM   2622 O  O   . ILE B 1 31  ? 23.036  -11.790 -6.881  1.00 91.78  ? 291 ILE B O   1 
ATOM   2623 C  CB  . ILE B 1 31  ? 22.753  -8.659  -7.866  1.00 79.14  ? 291 ILE B CB  1 
ATOM   2624 C  CG1 . ILE B 1 31  ? 21.796  -9.528  -8.719  1.00 79.17  ? 291 ILE B CG1 1 
ATOM   2625 C  CG2 . ILE B 1 31  ? 23.436  -7.583  -8.708  1.00 75.26  ? 291 ILE B CG2 1 
ATOM   2626 C  CD1 . ILE B 1 31  ? 20.894  -8.762  -9.697  1.00 75.12  ? 291 ILE B CD1 1 
ATOM   2627 N  N   . GLN B 1 32  ? 22.597  -10.395 -5.179  1.00 90.37  ? 292 GLN B N   1 
ATOM   2628 C  CA  . GLN B 1 32  ? 21.740  -11.376 -4.492  1.00 88.96  ? 292 GLN B CA  1 
ATOM   2629 C  C   . GLN B 1 32  ? 20.446  -11.531 -5.296  1.00 86.27  ? 292 GLN B C   1 
ATOM   2630 O  O   . GLN B 1 32  ? 20.040  -10.597 -5.986  1.00 87.00  ? 292 GLN B O   1 
ATOM   2631 C  CB  . GLN B 1 32  ? 21.426  -10.944 -3.059  1.00 88.72  ? 292 GLN B CB  1 
ATOM   2632 C  CG  . GLN B 1 32  ? 22.657  -10.791 -2.183  1.00 92.94  ? 292 GLN B CG  1 
ATOM   2633 C  CD  . GLN B 1 32  ? 22.309  -10.512 -0.728  1.00 96.05  ? 292 GLN B CD  1 
ATOM   2634 O  OE1 . GLN B 1 32  ? 22.467  -9.390  -0.238  1.00 96.69  ? 292 GLN B OE1 1 
ATOM   2635 N  NE2 . GLN B 1 32  ? 21.824  -11.535 -0.033  1.00 97.30  ? 292 GLN B NE2 1 
ATOM   2636 N  N   . ALA B 1 33  ? 19.805  -12.697 -5.230  1.00 81.83  ? 293 ALA B N   1 
ATOM   2637 C  CA  . ALA B 1 33  ? 18.544  -12.909 -5.963  1.00 78.69  ? 293 ALA B CA  1 
ATOM   2638 C  C   . ALA B 1 33  ? 17.491  -11.866 -5.542  1.00 79.60  ? 293 ALA B C   1 
ATOM   2639 O  O   . ALA B 1 33  ? 17.151  -11.781 -4.363  1.00 80.85  ? 293 ALA B O   1 
ATOM   2640 C  CB  . ALA B 1 33  ? 18.016  -14.330 -5.739  1.00 73.92  ? 293 ALA B CB  1 
ATOM   2641 N  N   . PRO B 1 34  ? 16.997  -11.049 -6.494  1.00 76.86  ? 294 PRO B N   1 
ATOM   2642 C  CA  . PRO B 1 34  ? 15.950  -10.090 -6.172  1.00 73.67  ? 294 PRO B CA  1 
ATOM   2643 C  C   . PRO B 1 34  ? 14.665  -10.730 -5.672  1.00 75.19  ? 294 PRO B C   1 
ATOM   2644 O  O   . PRO B 1 34  ? 14.389  -11.897 -5.966  1.00 73.56  ? 294 PRO B O   1 
ATOM   2645 C  CB  . PRO B 1 34  ? 15.683  -9.416  -7.512  1.00 66.70  ? 294 PRO B CB  1 
ATOM   2646 C  CG  . PRO B 1 34  ? 16.958  -9.501  -8.210  1.00 66.79  ? 294 PRO B CG  1 
ATOM   2647 C  CD  . PRO B 1 34  ? 17.497  -10.844 -7.860  1.00 71.77  ? 294 PRO B CD  1 
ATOM   2648 N  N   . ASP B 1 35  ? 13.893  -9.954  -4.917  1.00 74.82  ? 295 ASP B N   1 
ATOM   2649 C  CA  . ASP B 1 35  ? 12.582  -10.375 -4.458  1.00 73.73  ? 295 ASP B CA  1 
ATOM   2650 C  C   . ASP B 1 35  ? 11.566  -10.081 -5.525  1.00 72.99  ? 295 ASP B C   1 
ATOM   2651 O  O   . ASP B 1 35  ? 10.633  -10.851 -5.719  1.00 74.07  ? 295 ASP B O   1 
ATOM   2652 C  CB  . ASP B 1 35  ? 12.203  -9.655  -3.174  1.00 73.51  ? 295 ASP B CB  1 
ATOM   2653 C  CG  . ASP B 1 35  ? 13.123  -10.008 -2.029  1.00 77.71  ? 295 ASP B CG  1 
ATOM   2654 O  OD1 . ASP B 1 35  ? 13.240  -11.213 -1.708  1.00 78.92  ? 295 ASP B OD1 1 
ATOM   2655 O  OD2 . ASP B 1 35  ? 13.739  -9.080  -1.452  1.00 78.29  ? 295 ASP B OD2 1 
ATOM   2656 N  N   . VAL B 1 36  ? 11.742  -8.958  -6.212  1.00 72.88  ? 296 VAL B N   1 
ATOM   2657 C  CA  . VAL B 1 36  ? 10.821  -8.559  -7.288  1.00 69.88  ? 296 VAL B CA  1 
ATOM   2658 C  C   . VAL B 1 36  ? 11.588  -8.131  -8.537  1.00 65.22  ? 296 VAL B C   1 
ATOM   2659 O  O   . VAL B 1 36  ? 12.549  -7.366  -8.452  1.00 64.49  ? 296 VAL B O   1 
ATOM   2660 C  CB  . VAL B 1 36  ? 9.896   -7.410  -6.838  1.00 65.71  ? 296 VAL B CB  1 
ATOM   2661 C  CG1 . VAL B 1 36  ? 8.867   -7.116  -7.912  1.00 61.94  ? 296 VAL B CG1 1 
ATOM   2662 C  CG2 . VAL B 1 36  ? 9.226   -7.759  -5.514  1.00 63.59  ? 296 VAL B CG2 1 
ATOM   2663 N  N   . TYR B 1 37  ? 11.167  -8.655  -9.683  1.00 61.39  ? 297 TYR B N   1 
ATOM   2664 C  CA  . TYR B 1 37  ? 11.774  -8.322  -10.972 1.00 61.37  ? 297 TYR B CA  1 
ATOM   2665 C  C   . TYR B 1 37  ? 10.782  -7.539  -11.820 1.00 59.56  ? 297 TYR B C   1 
ATOM   2666 O  O   . TYR B 1 37  ? 9.683   -8.022  -12.088 1.00 60.73  ? 297 TYR B O   1 
ATOM   2667 C  CB  . TYR B 1 37  ? 12.148  -9.597  -11.733 1.00 61.02  ? 297 TYR B CB  1 
ATOM   2668 C  CG  . TYR B 1 37  ? 13.572  -10.080 -11.575 1.00 60.59  ? 297 TYR B CG  1 
ATOM   2669 C  CD1 . TYR B 1 37  ? 14.620  -9.411  -12.192 1.00 60.97  ? 297 TYR B CD1 1 
ATOM   2670 C  CD2 . TYR B 1 37  ? 13.866  -11.236 -10.849 1.00 57.10  ? 297 TYR B CD2 1 
ATOM   2671 C  CE1 . TYR B 1 37  ? 15.929  -9.873  -12.078 1.00 61.51  ? 297 TYR B CE1 1 
ATOM   2672 C  CE2 . TYR B 1 37  ? 15.160  -11.697 -10.732 1.00 55.70  ? 297 TYR B CE2 1 
ATOM   2673 C  CZ  . TYR B 1 37  ? 16.186  -11.016 -11.349 1.00 60.96  ? 297 TYR B CZ  1 
ATOM   2674 O  OH  . TYR B 1 37  ? 17.481  -11.455 -11.232 1.00 63.77  ? 297 TYR B OH  1 
ATOM   2675 N  N   . CYS B 1 38  ? 11.176  -6.338  -12.228 1.00 57.40  ? 298 CYS B N   1 
ATOM   2676 C  CA  . CYS B 1 38  ? 10.419  -5.529  -13.173 1.00 59.97  ? 298 CYS B CA  1 
ATOM   2677 C  C   . CYS B 1 38  ? 11.315  -5.264  -14.392 1.00 62.81  ? 298 CYS B C   1 
ATOM   2678 O  O   . CYS B 1 38  ? 12.315  -4.555  -14.290 1.00 67.70  ? 298 CYS B O   1 
ATOM   2679 C  CB  . CYS B 1 38  ? 10.019  -4.197  -12.519 1.00 60.89  ? 298 CYS B CB  1 
ATOM   2680 S  SG  . CYS B 1 38  ? 9.626   -4.245  -10.740 1.00 68.04  ? 298 CYS B SG  1 
ATOM   2681 N  N   . VAL B 1 39  ? 11.002  -5.848  -15.537 1.00 60.67  ? 299 VAL B N   1 
ATOM   2682 C  CA  . VAL B 1 39  ? 11.905  -5.763  -16.696 1.00 55.89  ? 299 VAL B CA  1 
ATOM   2683 C  C   . VAL B 1 39  ? 11.210  -5.186  -17.925 1.00 57.14  ? 299 VAL B C   1 
ATOM   2684 O  O   . VAL B 1 39  ? 10.166  -5.687  -18.364 1.00 56.57  ? 299 VAL B O   1 
ATOM   2685 C  CB  . VAL B 1 39  ? 12.441  -7.137  -17.080 1.00 54.63  ? 299 VAL B CB  1 
ATOM   2686 C  CG1 . VAL B 1 39  ? 13.474  -6.998  -18.185 1.00 54.93  ? 299 VAL B CG1 1 
ATOM   2687 C  CG2 . VAL B 1 39  ? 12.997  -7.846  -15.866 1.00 53.55  ? 299 VAL B CG2 1 
ATOM   2688 N  N   . GLY B 1 40  ? 11.824  -4.154  -18.494 1.00 56.82  ? 300 GLY B N   1 
ATOM   2689 C  CA  . GLY B 1 40  ? 11.224  -3.391  -19.567 1.00 53.12  ? 300 GLY B CA  1 
ATOM   2690 C  C   . GLY B 1 40  ? 12.008  -3.407  -20.854 1.00 58.26  ? 300 GLY B C   1 
ATOM   2691 O  O   . GLY B 1 40  ? 13.243  -3.310  -20.860 1.00 60.40  ? 300 GLY B O   1 
ATOM   2692 N  N   . PHE B 1 41  ? 11.272  -3.501  -21.956 1.00 58.23  ? 301 PHE B N   1 
ATOM   2693 C  CA  . PHE B 1 41  ? 11.864  -3.476  -23.281 1.00 58.05  ? 301 PHE B CA  1 
ATOM   2694 C  C   . PHE B 1 41  ? 11.268  -2.355  -24.074 1.00 61.48  ? 301 PHE B C   1 
ATOM   2695 O  O   . PHE B 1 41  ? 10.188  -1.859  -23.751 1.00 63.92  ? 301 PHE B O   1 
ATOM   2696 C  CB  . PHE B 1 41  ? 11.600  -4.794  -24.016 1.00 56.89  ? 301 PHE B CB  1 
ATOM   2697 C  CG  . PHE B 1 41  ? 12.260  -5.968  -23.376 1.00 57.45  ? 301 PHE B CG  1 
ATOM   2698 C  CD1 . PHE B 1 41  ? 13.583  -6.249  -23.631 1.00 60.91  ? 301 PHE B CD1 1 
ATOM   2699 C  CD2 . PHE B 1 41  ? 11.577  -6.763  -22.489 1.00 54.29  ? 301 PHE B CD2 1 
ATOM   2700 C  CE1 . PHE B 1 41  ? 14.202  -7.317  -23.031 1.00 63.28  ? 301 PHE B CE1 1 
ATOM   2701 C  CE2 . PHE B 1 41  ? 12.191  -7.841  -21.892 1.00 56.68  ? 301 PHE B CE2 1 
ATOM   2702 C  CZ  . PHE B 1 41  ? 13.500  -8.117  -22.155 1.00 60.46  ? 301 PHE B CZ  1 
ATOM   2703 N  N   . GLN B 1 42  ? 11.978  -1.952  -25.118 1.00 63.54  ? 302 GLN B N   1 
ATOM   2704 C  CA  . GLN B 1 42  ? 11.402  -1.120  -26.150 1.00 62.89  ? 302 GLN B CA  1 
ATOM   2705 C  C   . GLN B 1 42  ? 11.875  -1.655  -27.485 1.00 65.20  ? 302 GLN B C   1 
ATOM   2706 O  O   . GLN B 1 42  ? 12.949  -2.248  -27.566 1.00 61.11  ? 302 GLN B O   1 
ATOM   2707 C  CB  . GLN B 1 42  ? 11.836  0.322   -25.982 1.00 61.92  ? 302 GLN B CB  1 
ATOM   2708 C  CG  . GLN B 1 42  ? 11.539  0.912   -24.621 1.00 63.49  ? 302 GLN B CG  1 
ATOM   2709 C  CD  . GLN B 1 42  ? 12.609  0.606   -23.600 1.00 65.60  ? 302 GLN B CD  1 
ATOM   2710 O  OE1 . GLN B 1 42  ? 13.786  0.412   -23.938 1.00 68.69  ? 302 GLN B OE1 1 
ATOM   2711 N  NE2 . GLN B 1 42  ? 12.208  0.567   -22.339 1.00 61.87  ? 302 GLN B NE2 1 
ATOM   2712 N  N   . GLU B 1 43  ? 11.062  -1.435  -28.521 1.00 68.74  ? 303 GLU B N   1 
ATOM   2713 C  CA  . GLU B 1 43  ? 11.329  -1.932  -29.882 1.00 68.01  ? 303 GLU B CA  1 
ATOM   2714 C  C   . GLU B 1 43  ? 11.478  -3.453  -29.887 1.00 65.92  ? 303 GLU B C   1 
ATOM   2715 O  O   . GLU B 1 43  ? 12.369  -4.004  -30.533 1.00 66.68  ? 303 GLU B O   1 
ATOM   2716 C  CB  . GLU B 1 43  ? 12.560  -1.238  -30.493 1.00 68.74  ? 303 GLU B CB  1 
ATOM   2717 C  CG  . GLU B 1 43  ? 12.510  0.268   -30.336 1.00 72.38  ? 303 GLU B CG  1 
ATOM   2718 C  CD  . GLU B 1 43  ? 13.461  1.027   -31.229 1.00 78.58  ? 303 GLU B CD  1 
ATOM   2719 O  OE1 . GLU B 1 43  ? 14.585  0.541   -31.514 1.00 82.37  ? 303 GLU B OE1 1 
ATOM   2720 O  OE2 . GLU B 1 43  ? 13.087  2.146   -31.635 1.00 81.59  ? 303 GLU B OE2 1 
ATOM   2721 N  N   . LEU B 1 44  ? 10.589  -4.125  -29.162 1.00 62.06  ? 304 LEU B N   1 
ATOM   2722 C  CA  . LEU B 1 44  ? 10.582  -5.584  -29.125 1.00 63.23  ? 304 LEU B CA  1 
ATOM   2723 C  C   . LEU B 1 44  ? 10.421  -6.180  -30.535 1.00 69.95  ? 304 LEU B C   1 
ATOM   2724 O  O   . LEU B 1 44  ? 11.065  -7.196  -30.865 1.00 71.78  ? 304 LEU B O   1 
ATOM   2725 C  CB  . LEU B 1 44  ? 9.464   -6.089  -28.225 1.00 57.64  ? 304 LEU B CB  1 
ATOM   2726 C  CG  . LEU B 1 44  ? 9.841   -7.386  -27.536 1.00 58.40  ? 304 LEU B CG  1 
ATOM   2727 C  CD1 . LEU B 1 44  ? 10.860  -7.089  -26.431 1.00 61.36  ? 304 LEU B CD1 1 
ATOM   2728 C  CD2 . LEU B 1 44  ? 8.621   -8.079  -26.980 1.00 56.57  ? 304 LEU B CD2 1 
ATOM   2729 N  N   . ASP B 1 45  ? 9.567   -5.544  -31.352 1.00 66.96  ? 305 ASP B N   1 
ATOM   2730 C  CA  . ASP B 1 45  ? 9.377   -5.927  -32.751 1.00 65.18  ? 305 ASP B CA  1 
ATOM   2731 C  C   . ASP B 1 45  ? 9.083   -4.693  -33.637 1.00 67.47  ? 305 ASP B C   1 
ATOM   2732 O  O   . ASP B 1 45  ? 8.112   -3.973  -33.418 1.00 66.84  ? 305 ASP B O   1 
ATOM   2733 C  CB  . ASP B 1 45  ? 8.270   -6.975  -32.850 1.00 61.04  ? 305 ASP B CB  1 
ATOM   2734 C  CG  . ASP B 1 45  ? 8.097   -7.520  -34.255 1.00 64.11  ? 305 ASP B CG  1 
ATOM   2735 O  OD1 . ASP B 1 45  ? 8.355   -6.786  -35.228 1.00 62.84  ? 305 ASP B OD1 1 
ATOM   2736 O  OD2 . ASP B 1 45  ? 7.671   -8.683  -34.396 1.00 65.94  ? 305 ASP B OD2 1 
ATOM   2737 N  N   . LEU B 1 46  ? 9.938   -4.463  -34.635 1.00 67.45  ? 306 LEU B N   1 
ATOM   2738 C  CA  . LEU B 1 46  ? 9.841   -3.288  -35.510 1.00 67.74  ? 306 LEU B CA  1 
ATOM   2739 C  C   . LEU B 1 46  ? 9.124   -3.577  -36.821 1.00 70.75  ? 306 LEU B C   1 
ATOM   2740 O  O   . LEU B 1 46  ? 8.933   -2.679  -37.641 1.00 69.93  ? 306 LEU B O   1 
ATOM   2741 C  CB  . LEU B 1 46  ? 11.235  -2.739  -35.811 1.00 66.95  ? 306 LEU B CB  1 
ATOM   2742 C  CG  . LEU B 1 46  ? 11.924  -2.091  -34.612 1.00 67.02  ? 306 LEU B CG  1 
ATOM   2743 C  CD1 . LEU B 1 46  ? 13.425  -1.927  -34.876 1.00 68.46  ? 306 LEU B CD1 1 
ATOM   2744 C  CD2 . LEU B 1 46  ? 11.235  -0.760  -34.267 1.00 62.73  ? 306 LEU B CD2 1 
ATOM   2745 N  N   . SER B 1 47  ? 8.720   -4.826  -37.020 1.00 71.86  ? 307 SER B N   1 
ATOM   2746 C  CA  . SER B 1 47  ? 7.974   -5.182  -38.211 1.00 73.42  ? 307 SER B CA  1 
ATOM   2747 C  C   . SER B 1 47  ? 6.659   -4.415  -38.255 1.00 74.66  ? 307 SER B C   1 
ATOM   2748 O  O   . SER B 1 47  ? 6.084   -4.068  -37.217 1.00 74.23  ? 307 SER B O   1 
ATOM   2749 C  CB  . SER B 1 47  ? 7.715   -6.693  -38.274 1.00 72.05  ? 307 SER B CB  1 
ATOM   2750 O  OG  . SER B 1 47  ? 6.744   -7.092  -37.320 1.00 73.76  ? 307 SER B OG  1 
ATOM   2751 N  N   . LYS B 1 48  ? 6.194   -4.161  -39.471 1.00 76.98  ? 308 LYS B N   1 
ATOM   2752 C  CA  . LYS B 1 48  ? 4.933   -3.466  -39.690 1.00 77.61  ? 308 LYS B CA  1 
ATOM   2753 C  C   . LYS B 1 48  ? 3.783   -4.368  -39.249 1.00 76.33  ? 308 LYS B C   1 
ATOM   2754 O  O   . LYS B 1 48  ? 2.819   -3.912  -38.638 1.00 75.42  ? 308 LYS B O   1 
ATOM   2755 C  CB  . LYS B 1 48  ? 4.768   -3.080  -41.166 1.00 80.74  ? 308 LYS B CB  1 
ATOM   2756 C  CG  . LYS B 1 48  ? 5.943   -2.320  -41.809 1.00 82.89  ? 308 LYS B CG  1 
ATOM   2757 C  CD  . LYS B 1 48  ? 6.182   -0.956  -41.159 1.00 86.13  ? 308 LYS B CD  1 
ATOM   2758 C  CE  . LYS B 1 48  ? 6.917   0.008   -42.096 1.00 92.74  ? 308 LYS B CE  1 
ATOM   2759 N  NZ  . LYS B 1 48  ? 8.239   -0.520  -42.528 1.00 96.80  ? 308 LYS B NZ  1 
ATOM   2760 N  N   . GLU B 1 49  ? 3.913   -5.658  -39.547 1.00 78.22  ? 309 GLU B N   1 
ATOM   2761 C  CA  . GLU B 1 49  ? 2.933   -6.662  -39.137 1.00 76.27  ? 309 GLU B CA  1 
ATOM   2762 C  C   . GLU B 1 49  ? 2.632   -6.575  -37.642 1.00 75.76  ? 309 GLU B C   1 
ATOM   2763 O  O   . GLU B 1 49  ? 1.478   -6.542  -37.233 1.00 78.72  ? 309 GLU B O   1 
ATOM   2764 C  CB  . GLU B 1 49  ? 3.457   -8.047  -39.491 1.00 74.96  ? 309 GLU B CB  1 
ATOM   2765 C  CG  . GLU B 1 49  ? 2.482   -9.177  -39.223 1.00 79.67  ? 309 GLU B CG  1 
ATOM   2766 C  CD  . GLU B 1 49  ? 2.866   -10.452 -39.964 1.00 88.62  ? 309 GLU B CD  1 
ATOM   2767 O  OE1 . GLU B 1 49  ? 2.386   -11.551 -39.588 1.00 90.07  ? 309 GLU B OE1 1 
ATOM   2768 O  OE2 . GLU B 1 49  ? 3.648   -10.344 -40.932 1.00 92.27  ? 309 GLU B OE2 1 
ATOM   2769 N  N   . ALA B 1 50  ? 3.677   -6.523  -36.832 1.00 72.87  ? 310 ALA B N   1 
ATOM   2770 C  CA  . ALA B 1 50  ? 3.513   -6.380  -35.393 1.00 70.56  ? 310 ALA B CA  1 
ATOM   2771 C  C   . ALA B 1 50  ? 2.858   -5.042  -35.046 1.00 72.14  ? 310 ALA B C   1 
ATOM   2772 O  O   . ALA B 1 50  ? 2.039   -4.969  -34.122 1.00 69.71  ? 310 ALA B O   1 
ATOM   2773 C  CB  . ALA B 1 50  ? 4.862   -6.507  -34.689 1.00 68.26  ? 310 ALA B CB  1 
ATOM   2774 N  N   . PHE B 1 51  ? 3.230   -3.982  -35.770 1.00 72.43  ? 311 PHE B N   1 
ATOM   2775 C  CA  . PHE B 1 51  ? 2.632   -2.673  -35.530 1.00 72.87  ? 311 PHE B CA  1 
ATOM   2776 C  C   . PHE B 1 51  ? 1.144   -2.732  -35.811 1.00 73.33  ? 311 PHE B C   1 
ATOM   2777 O  O   . PHE B 1 51  ? 0.325   -2.118  -35.131 1.00 73.02  ? 311 PHE B O   1 
ATOM   2778 C  CB  . PHE B 1 51  ? 3.270   -1.583  -36.392 1.00 73.54  ? 311 PHE B CB  1 
ATOM   2779 C  CG  . PHE B 1 51  ? 2.658   -0.221  -36.180 1.00 76.43  ? 311 PHE B CG  1 
ATOM   2780 C  CD1 . PHE B 1 51  ? 2.848   0.457   -34.983 1.00 74.31  ? 311 PHE B CD1 1 
ATOM   2781 C  CD2 . PHE B 1 51  ? 1.877   0.374   -37.172 1.00 81.27  ? 311 PHE B CD2 1 
ATOM   2782 C  CE1 . PHE B 1 51  ? 2.275   1.708   -34.770 1.00 76.17  ? 311 PHE B CE1 1 
ATOM   2783 C  CE2 . PHE B 1 51  ? 1.301   1.631   -36.973 1.00 81.03  ? 311 PHE B CE2 1 
ATOM   2784 C  CZ  . PHE B 1 51  ? 1.495   2.294   -35.767 1.00 79.75  ? 311 PHE B CZ  1 
ATOM   2785 N  N   . PHE B 1 52  ? 0.799   -3.510  -36.809 1.00 73.31  ? 312 PHE B N   1 
ATOM   2786 C  CA  . PHE B 1 52  ? -0.557  -3.541  -37.276 1.00 75.42  ? 312 PHE B CA  1 
ATOM   2787 C  C   . PHE B 1 52  ? -1.448  -4.500  -36.482 1.00 73.95  ? 312 PHE B C   1 
ATOM   2788 O  O   . PHE B 1 52  ? -2.557  -4.142  -36.112 1.00 72.17  ? 312 PHE B O   1 
ATOM   2789 C  CB  . PHE B 1 52  ? -0.535  -3.915  -38.747 1.00 75.96  ? 312 PHE B CB  1 
ATOM   2790 C  CG  . PHE B 1 52  ? -1.690  -3.422  -39.492 1.00 77.88  ? 312 PHE B CG  1 
ATOM   2791 C  CD1 . PHE B 1 52  ? -1.822  -2.068  -39.763 1.00 81.47  ? 312 PHE B CD1 1 
ATOM   2792 C  CD2 . PHE B 1 52  ? -2.652  -4.298  -39.933 1.00 81.00  ? 312 PHE B CD2 1 
ATOM   2793 C  CE1 . PHE B 1 52  ? -2.912  -1.594  -40.474 1.00 83.63  ? 312 PHE B CE1 1 
ATOM   2794 C  CE2 . PHE B 1 52  ? -3.735  -3.846  -40.635 1.00 85.19  ? 312 PHE B CE2 1 
ATOM   2795 C  CZ  . PHE B 1 52  ? -3.871  -2.479  -40.915 1.00 84.86  ? 312 PHE B CZ  1 
ATOM   2796 N  N   . PHE B 1 53  ? -0.945  -5.705  -36.214 1.00 76.83  ? 313 PHE B N   1 
ATOM   2797 C  CA  . PHE B 1 53  ? -1.763  -6.799  -35.666 1.00 80.04  ? 313 PHE B CA  1 
ATOM   2798 C  C   . PHE B 1 53  ? -1.502  -7.114  -34.198 1.00 77.56  ? 313 PHE B C   1 
ATOM   2799 O  O   . PHE B 1 53  ? -2.144  -8.000  -33.652 1.00 74.09  ? 313 PHE B O   1 
ATOM   2800 C  CB  . PHE B 1 53  ? -1.543  -8.084  -36.474 1.00 80.96  ? 313 PHE B CB  1 
ATOM   2801 C  CG  . PHE B 1 53  ? -2.096  -8.032  -37.853 1.00 83.63  ? 313 PHE B CG  1 
ATOM   2802 C  CD1 . PHE B 1 53  ? -3.460  -8.141  -38.068 1.00 84.54  ? 313 PHE B CD1 1 
ATOM   2803 C  CD2 . PHE B 1 53  ? -1.256  -7.905  -38.948 1.00 84.76  ? 313 PHE B CD2 1 
ATOM   2804 C  CE1 . PHE B 1 53  ? -3.984  -8.113  -39.355 1.00 83.70  ? 313 PHE B CE1 1 
ATOM   2805 C  CE2 . PHE B 1 53  ? -1.773  -7.870  -40.233 1.00 85.29  ? 313 PHE B CE2 1 
ATOM   2806 C  CZ  . PHE B 1 53  ? -3.138  -7.974  -40.433 1.00 85.82  ? 313 PHE B CZ  1 
ATOM   2807 N  N   . HIS B 1 54  ? -0.558  -6.400  -33.587 1.00 80.10  ? 314 HIS B N   1 
ATOM   2808 C  CA  . HIS B 1 54  ? -0.090  -6.625  -32.198 1.00 79.98  ? 314 HIS B CA  1 
ATOM   2809 C  C   . HIS B 1 54  ? 0.761   -7.883  -32.046 1.00 78.75  ? 314 HIS B C   1 
ATOM   2810 O  O   . HIS B 1 54  ? 1.876   -7.824  -31.543 1.00 77.68  ? 314 HIS B O   1 
ATOM   2811 C  CB  . HIS B 1 54  ? -1.235  -6.633  -31.173 1.00 81.93  ? 314 HIS B CB  1 
ATOM   2812 C  CG  . HIS B 1 54  ? -0.798  -6.972  -29.773 1.00 84.53  ? 314 HIS B CG  1 
ATOM   2813 N  ND1 . HIS B 1 54  ? -0.292  -6.028  -28.895 1.00 86.19  ? 314 HIS B ND1 1 
ATOM   2814 C  CD2 . HIS B 1 54  ? -0.813  -8.148  -29.095 1.00 81.12  ? 314 HIS B CD2 1 
ATOM   2815 C  CE1 . HIS B 1 54  ? -0.006  -6.611  -27.742 1.00 83.61  ? 314 HIS B CE1 1 
ATOM   2816 N  NE2 . HIS B 1 54  ? -0.310  -7.896  -27.838 1.00 81.67  ? 314 HIS B NE2 1 
ATOM   2817 N  N   . ASP B 1 55  ? 0.225   -9.019  -32.464 1.00 82.53  ? 315 ASP B N   1 
ATOM   2818 C  CA  . ASP B 1 55  ? 0.934   -10.295 -32.369 1.00 84.22  ? 315 ASP B CA  1 
ATOM   2819 C  C   . ASP B 1 55  ? 2.362   -10.229 -32.886 1.00 79.75  ? 315 ASP B C   1 
ATOM   2820 O  O   . ASP B 1 55  ? 2.635   -9.598  -33.907 1.00 83.78  ? 315 ASP B O   1 
ATOM   2821 C  CB  . ASP B 1 55  ? 0.168   -11.382 -33.137 1.00 90.10  ? 315 ASP B CB  1 
ATOM   2822 C  CG  . ASP B 1 55  ? -0.966  -11.970 -32.326 1.00 93.66  ? 315 ASP B CG  1 
ATOM   2823 O  OD1 . ASP B 1 55  ? -1.846  -12.629 -32.922 1.00 101.10 ? 315 ASP B OD1 1 
ATOM   2824 O  OD2 . ASP B 1 55  ? -0.968  -11.787 -31.090 1.00 87.87  ? 315 ASP B OD2 1 
ATOM   2825 N  N   . THR B 1 56  ? 3.259   -10.881 -32.158 1.00 72.15  ? 316 THR B N   1 
ATOM   2826 C  CA  . THR B 1 56  ? 4.646   -11.010 -32.557 1.00 69.83  ? 316 THR B CA  1 
ATOM   2827 C  C   . THR B 1 56  ? 5.264   -12.170 -31.816 1.00 68.37  ? 316 THR B C   1 
ATOM   2828 O  O   . THR B 1 56  ? 5.056   -12.321 -30.617 1.00 67.56  ? 316 THR B O   1 
ATOM   2829 C  CB  . THR B 1 56  ? 5.488   -9.737  -32.262 1.00 71.32  ? 316 THR B CB  1 
ATOM   2830 O  OG1 . THR B 1 56  ? 6.880   -10.055 -32.401 1.00 75.80  ? 316 THR B OG1 1 
ATOM   2831 C  CG2 . THR B 1 56  ? 5.240   -9.188  -30.849 1.00 63.38  ? 316 THR B CG2 1 
ATOM   2832 N  N   . PRO B 1 57  ? 6.042   -12.993 -32.525 1.00 66.97  ? 317 PRO B N   1 
ATOM   2833 C  CA  . PRO B 1 57  ? 6.709   -14.109 -31.855 1.00 65.70  ? 317 PRO B CA  1 
ATOM   2834 C  C   . PRO B 1 57  ? 7.859   -13.666 -30.965 1.00 67.19  ? 317 PRO B C   1 
ATOM   2835 O  O   . PRO B 1 57  ? 8.393   -14.482 -30.217 1.00 70.56  ? 317 PRO B O   1 
ATOM   2836 C  CB  . PRO B 1 57  ? 7.212   -14.979 -33.012 1.00 62.95  ? 317 PRO B CB  1 
ATOM   2837 C  CG  . PRO B 1 57  ? 7.333   -14.066 -34.168 1.00 62.78  ? 317 PRO B CG  1 
ATOM   2838 C  CD  . PRO B 1 57  ? 6.362   -12.925 -33.959 1.00 62.62  ? 317 PRO B CD  1 
ATOM   2839 N  N   . LYS B 1 58  ? 8.232   -12.388 -31.037 1.00 66.29  ? 318 LYS B N   1 
ATOM   2840 C  CA  . LYS B 1 58  ? 9.301   -11.862 -30.197 1.00 66.23  ? 318 LYS B CA  1 
ATOM   2841 C  C   . LYS B 1 58  ? 8.880   -11.677 -28.754 1.00 63.67  ? 318 LYS B C   1 
ATOM   2842 O  O   . LYS B 1 58  ? 9.735   -11.641 -27.888 1.00 68.10  ? 318 LYS B O   1 
ATOM   2843 C  CB  . LYS B 1 58  ? 9.886   -10.565 -30.779 1.00 65.08  ? 318 LYS B CB  1 
ATOM   2844 C  CG  . LYS B 1 58  ? 11.095  -10.842 -31.671 1.00 65.79  ? 318 LYS B CG  1 
ATOM   2845 C  CD  . LYS B 1 58  ? 11.255  -9.880  -32.809 1.00 66.43  ? 318 LYS B CD  1 
ATOM   2846 C  CE  . LYS B 1 58  ? 12.416  -10.308 -33.714 1.00 70.47  ? 318 LYS B CE  1 
ATOM   2847 N  NZ  . LYS B 1 58  ? 12.107  -11.432 -34.645 1.00 70.86  ? 318 LYS B NZ  1 
ATOM   2848 N  N   . GLU B 1 59  ? 7.581   -11.573 -28.488 1.00 59.29  ? 319 GLU B N   1 
ATOM   2849 C  CA  . GLU B 1 59  ? 7.089   -11.482 -27.111 1.00 59.30  ? 319 GLU B CA  1 
ATOM   2850 C  C   . GLU B 1 59  ? 7.529   -12.715 -26.321 1.00 61.01  ? 319 GLU B C   1 
ATOM   2851 O  O   . GLU B 1 59  ? 8.159   -12.612 -25.271 1.00 58.92  ? 319 GLU B O   1 
ATOM   2852 C  CB  . GLU B 1 59  ? 5.556   -11.331 -27.070 1.00 57.17  ? 319 GLU B CB  1 
ATOM   2853 C  CG  . GLU B 1 59  ? 4.942   -11.586 -25.692 1.00 59.50  ? 319 GLU B CG  1 
ATOM   2854 C  CD  . GLU B 1 59  ? 3.464   -11.223 -25.595 1.00 64.66  ? 319 GLU B CD  1 
ATOM   2855 O  OE1 . GLU B 1 59  ? 3.095   -10.055 -25.807 1.00 64.74  ? 319 GLU B OE1 1 
ATOM   2856 O  OE2 . GLU B 1 59  ? 2.659   -12.110 -25.274 1.00 69.89  ? 319 GLU B OE2 1 
ATOM   2857 N  N   . GLU B 1 60  ? 7.207   -13.884 -26.855 1.00 62.36  ? 320 GLU B N   1 
ATOM   2858 C  CA  . GLU B 1 60  ? 7.572   -15.126 -26.215 1.00 61.82  ? 320 GLU B CA  1 
ATOM   2859 C  C   . GLU B 1 60  ? 9.083   -15.345 -26.228 1.00 65.13  ? 320 GLU B C   1 
ATOM   2860 O  O   . GLU B 1 60  ? 9.631   -15.885 -25.274 1.00 66.92  ? 320 GLU B O   1 
ATOM   2861 C  CB  . GLU B 1 60  ? 6.809   -16.289 -26.837 1.00 64.45  ? 320 GLU B CB  1 
ATOM   2862 C  CG  . GLU B 1 60  ? 7.541   -17.606 -26.861 1.00 74.33  ? 320 GLU B CG  1 
ATOM   2863 C  CD  . GLU B 1 60  ? 6.759   -18.684 -26.182 1.00 84.77  ? 320 GLU B CD  1 
ATOM   2864 O  OE1 . GLU B 1 60  ? 6.189   -19.570 -26.885 1.00 87.67  ? 320 GLU B OE1 1 
ATOM   2865 O  OE2 . GLU B 1 60  ? 6.726   -18.624 -24.928 1.00 87.16  ? 320 GLU B OE2 1 
ATOM   2866 N  N   . GLU B 1 61  ? 9.758   -14.917 -27.288 1.00 65.35  ? 321 GLU B N   1 
ATOM   2867 C  CA  . GLU B 1 61  ? 11.207  -15.059 -27.357 1.00 66.52  ? 321 GLU B CA  1 
ATOM   2868 C  C   . GLU B 1 61  ? 11.891  -14.391 -26.171 1.00 67.72  ? 321 GLU B C   1 
ATOM   2869 O  O   . GLU B 1 61  ? 12.717  -15.015 -25.500 1.00 69.53  ? 321 GLU B O   1 
ATOM   2870 C  CB  . GLU B 1 61  ? 11.756  -14.474 -28.650 1.00 68.27  ? 321 GLU B CB  1 
ATOM   2871 C  CG  . GLU B 1 61  ? 11.560  -15.365 -29.849 1.00 72.57  ? 321 GLU B CG  1 
ATOM   2872 C  CD  . GLU B 1 61  ? 11.913  -14.687 -31.171 1.00 76.59  ? 321 GLU B CD  1 
ATOM   2873 O  OE1 . GLU B 1 61  ? 12.518  -13.590 -31.163 1.00 77.10  ? 321 GLU B OE1 1 
ATOM   2874 O  OE2 . GLU B 1 61  ? 11.574  -15.270 -32.221 1.00 77.67  ? 321 GLU B OE2 1 
ATOM   2875 N  N   . TRP B 1 62  ? 11.555  -13.131 -25.917 1.00 65.47  ? 322 TRP B N   1 
ATOM   2876 C  CA  . TRP B 1 62  ? 12.221  -12.361 -24.848 1.00 67.90  ? 322 TRP B CA  1 
ATOM   2877 C  C   . TRP B 1 62  ? 11.727  -12.731 -23.447 1.00 68.30  ? 322 TRP B C   1 
ATOM   2878 O  O   . TRP B 1 62  ? 12.500  -12.744 -22.493 1.00 68.98  ? 322 TRP B O   1 
ATOM   2879 C  CB  . TRP B 1 62  ? 12.063  -10.851 -25.072 1.00 67.14  ? 322 TRP B CB  1 
ATOM   2880 C  CG  . TRP B 1 62  ? 12.944  -10.333 -26.159 1.00 65.45  ? 322 TRP B CG  1 
ATOM   2881 C  CD1 . TRP B 1 62  ? 12.591  -10.090 -27.442 1.00 63.17  ? 322 TRP B CD1 1 
ATOM   2882 C  CD2 . TRP B 1 62  ? 14.328  -10.005 -26.052 1.00 65.78  ? 322 TRP B CD2 1 
ATOM   2883 N  NE1 . TRP B 1 62  ? 13.661  -9.621  -28.152 1.00 67.24  ? 322 TRP B NE1 1 
ATOM   2884 C  CE2 . TRP B 1 62  ? 14.748  -9.560  -27.321 1.00 68.81  ? 322 TRP B CE2 1 
ATOM   2885 C  CE3 . TRP B 1 62  ? 15.256  -10.040 -25.005 1.00 63.50  ? 322 TRP B CE3 1 
ATOM   2886 C  CZ2 . TRP B 1 62  ? 16.068  -9.155  -27.580 1.00 67.48  ? 322 TRP B CZ2 1 
ATOM   2887 C  CZ3 . TRP B 1 62  ? 16.557  -9.635  -25.257 1.00 64.22  ? 322 TRP B CZ3 1 
ATOM   2888 C  CH2 . TRP B 1 62  ? 16.951  -9.196  -26.538 1.00 64.47  ? 322 TRP B CH2 1 
ATOM   2889 N  N   . PHE B 1 63  ? 10.440  -13.030 -23.328 1.00 64.99  ? 323 PHE B N   1 
ATOM   2890 C  CA  . PHE B 1 63  ? 9.897   -13.530 -22.085 1.00 64.02  ? 323 PHE B CA  1 
ATOM   2891 C  C   . PHE B 1 63  ? 10.631  -14.796 -21.625 1.00 62.73  ? 323 PHE B C   1 
ATOM   2892 O  O   . PHE B 1 63  ? 10.969  -14.930 -20.463 1.00 59.83  ? 323 PHE B O   1 
ATOM   2893 C  CB  . PHE B 1 63  ? 8.418   -13.846 -22.250 1.00 67.65  ? 323 PHE B CB  1 
ATOM   2894 C  CG  . PHE B 1 63  ? 7.825   -14.453 -21.041 1.00 73.33  ? 323 PHE B CG  1 
ATOM   2895 C  CD1 . PHE B 1 63  ? 7.609   -13.684 -19.925 1.00 70.85  ? 323 PHE B CD1 1 
ATOM   2896 C  CD2 . PHE B 1 63  ? 7.534   -15.807 -20.998 1.00 79.28  ? 323 PHE B CD2 1 
ATOM   2897 C  CE1 . PHE B 1 63  ? 7.085   -14.230 -18.789 1.00 74.77  ? 323 PHE B CE1 1 
ATOM   2898 C  CE2 . PHE B 1 63  ? 7.010   -16.379 -19.848 1.00 80.76  ? 323 PHE B CE2 1 
ATOM   2899 C  CZ  . PHE B 1 63  ? 6.784   -15.579 -18.737 1.00 78.85  ? 323 PHE B CZ  1 
ATOM   2900 N  N   . LYS B 1 64  ? 10.848  -15.727 -22.546 1.00 61.33  ? 324 LYS B N   1 
ATOM   2901 C  CA  . LYS B 1 64  ? 11.631  -16.901 -22.254 1.00 61.69  ? 324 LYS B CA  1 
ATOM   2902 C  C   . LYS B 1 64  ? 13.086  -16.520 -21.978 1.00 61.97  ? 324 LYS B C   1 
ATOM   2903 O  O   . LYS B 1 64  ? 13.699  -17.094 -21.097 1.00 69.38  ? 324 LYS B O   1 
ATOM   2904 C  CB  . LYS B 1 64  ? 11.556  -17.936 -23.391 1.00 66.85  ? 324 LYS B CB  1 
ATOM   2905 C  CG  . LYS B 1 64  ? 10.344  -18.909 -23.348 1.00 77.13  ? 324 LYS B CG  1 
ATOM   2906 N  N   . ALA B 1 65  ? 13.645  -15.557 -22.700 1.00 57.79  ? 325 ALA B N   1 
ATOM   2907 C  CA  . ALA B 1 65  ? 15.045  -15.181 -22.481 1.00 57.55  ? 325 ALA B CA  1 
ATOM   2908 C  C   . ALA B 1 65  ? 15.217  -14.625 -21.075 1.00 60.69  ? 325 ALA B C   1 
ATOM   2909 O  O   . ALA B 1 65  ? 16.154  -14.976 -20.356 1.00 63.61  ? 325 ALA B O   1 
ATOM   2910 C  CB  . ALA B 1 65  ? 15.479  -14.156 -23.490 1.00 56.76  ? 325 ALA B CB  1 
ATOM   2911 N  N   . VAL B 1 66  ? 14.294  -13.748 -20.698 1.00 58.80  ? 326 VAL B N   1 
ATOM   2912 C  CA  . VAL B 1 66  ? 14.301  -13.110 -19.396 1.00 58.26  ? 326 VAL B CA  1 
ATOM   2913 C  C   . VAL B 1 66  ? 14.144  -14.166 -18.327 1.00 60.20  ? 326 VAL B C   1 
ATOM   2914 O  O   . VAL B 1 66  ? 14.900  -14.180 -17.372 1.00 64.00  ? 326 VAL B O   1 
ATOM   2915 C  CB  . VAL B 1 66  ? 13.155  -12.085 -19.269 1.00 58.26  ? 326 VAL B CB  1 
ATOM   2916 C  CG1 . VAL B 1 66  ? 12.928  -11.705 -17.828 1.00 57.16  ? 326 VAL B CG1 1 
ATOM   2917 C  CG2 . VAL B 1 66  ? 13.463  -10.860 -20.088 1.00 60.96  ? 326 VAL B CG2 1 
ATOM   2918 N  N   . SER B 1 67  ? 13.167  -15.047 -18.486 1.00 56.72  ? 327 SER B N   1 
ATOM   2919 C  CA  . SER B 1 67  ? 12.915  -16.067 -17.485 1.00 56.84  ? 327 SER B CA  1 
ATOM   2920 C  C   . SER B 1 67  ? 14.165  -16.877 -17.196 1.00 57.02  ? 327 SER B C   1 
ATOM   2921 O  O   . SER B 1 67  ? 14.512  -17.118 -16.034 1.00 55.03  ? 327 SER B O   1 
ATOM   2922 C  CB  . SER B 1 67  ? 11.763  -16.972 -17.916 1.00 55.25  ? 327 SER B CB  1 
ATOM   2923 O  OG  . SER B 1 67  ? 10.540  -16.277 -17.722 1.00 57.07  ? 327 SER B OG  1 
ATOM   2924 N  N   . GLU B 1 68  ? 14.843  -17.249 -18.275 1.00 59.86  ? 328 GLU B N   1 
ATOM   2925 C  CA  . GLU B 1 68  ? 16.051  -18.064 -18.222 1.00 63.48  ? 328 GLU B CA  1 
ATOM   2926 C  C   . GLU B 1 68  ? 17.237  -17.300 -17.646 1.00 67.51  ? 328 GLU B C   1 
ATOM   2927 O  O   . GLU B 1 68  ? 18.195  -17.912 -17.192 1.00 69.40  ? 328 GLU B O   1 
ATOM   2928 C  CB  . GLU B 1 68  ? 16.397  -18.588 -19.614 1.00 64.11  ? 328 GLU B CB  1 
ATOM   2929 C  CG  . GLU B 1 68  ? 15.366  -19.567 -20.171 1.00 67.78  ? 328 GLU B CG  1 
ATOM   2930 C  CD  . GLU B 1 68  ? 15.552  -19.866 -21.671 1.00 75.02  ? 328 GLU B CD  1 
ATOM   2931 O  OE1 . GLU B 1 68  ? 16.195  -19.058 -22.383 1.00 74.56  ? 328 GLU B OE1 1 
ATOM   2932 O  OE2 . GLU B 1 68  ? 15.053  -20.923 -22.139 1.00 80.79  ? 328 GLU B OE2 1 
ATOM   2933 N  N   . GLY B 1 69  ? 17.160  -15.974 -17.662 1.00 66.66  ? 329 GLY B N   1 
ATOM   2934 C  CA  . GLY B 1 69  ? 18.206  -15.110 -17.114 1.00 65.32  ? 329 GLY B CA  1 
ATOM   2935 C  C   . GLY B 1 69  ? 17.997  -14.640 -15.679 1.00 67.55  ? 329 GLY B C   1 
ATOM   2936 O  O   . GLY B 1 69  ? 18.920  -14.097 -15.078 1.00 70.16  ? 329 GLY B O   1 
ATOM   2937 N  N   . LEU B 1 70  ? 16.806  -14.836 -15.115 1.00 66.14  ? 330 LEU B N   1 
ATOM   2938 C  CA  . LEU B 1 70  ? 16.561  -14.472 -13.718 1.00 65.66  ? 330 LEU B CA  1 
ATOM   2939 C  C   . LEU B 1 70  ? 17.508  -15.245 -12.788 1.00 71.85  ? 330 LEU B C   1 
ATOM   2940 O  O   . LEU B 1 70  ? 17.983  -16.351 -13.129 1.00 76.51  ? 330 LEU B O   1 
ATOM   2941 C  CB  . LEU B 1 70  ? 15.116  -14.750 -13.304 1.00 59.89  ? 330 LEU B CB  1 
ATOM   2942 C  CG  . LEU B 1 70  ? 13.988  -14.048 -14.076 1.00 59.21  ? 330 LEU B CG  1 
ATOM   2943 C  CD1 . LEU B 1 70  ? 12.625  -14.474 -13.518 1.00 59.46  ? 330 LEU B CD1 1 
ATOM   2944 C  CD2 . LEU B 1 70  ? 14.156  -12.531 -14.078 1.00 56.45  ? 330 LEU B CD2 1 
ATOM   2945 N  N   . HIS B 1 71  ? 17.778  -14.659 -11.619 1.00 67.94  ? 331 HIS B N   1 
ATOM   2946 C  CA  . HIS B 1 71  ? 18.747  -15.213 -10.687 1.00 66.73  ? 331 HIS B CA  1 
ATOM   2947 C  C   . HIS B 1 71  ? 18.376  -16.642 -10.281 1.00 66.95  ? 331 HIS B C   1 
ATOM   2948 O  O   . HIS B 1 71  ? 17.267  -16.893 -9.803  1.00 65.48  ? 331 HIS B O   1 
ATOM   2949 C  CB  . HIS B 1 71  ? 18.877  -14.330 -9.443  1.00 67.46  ? 331 HIS B CB  1 
ATOM   2950 C  CG  . HIS B 1 71  ? 20.104  -14.611 -8.638  1.00 69.11  ? 331 HIS B CG  1 
ATOM   2951 N  ND1 . HIS B 1 71  ? 20.312  -15.810 -7.994  1.00 70.03  ? 331 HIS B ND1 1 
ATOM   2952 C  CD2 . HIS B 1 71  ? 21.199  -13.854 -8.391  1.00 69.95  ? 331 HIS B CD2 1 
ATOM   2953 C  CE1 . HIS B 1 71  ? 21.485  -15.784 -7.384  1.00 70.91  ? 331 HIS B CE1 1 
ATOM   2954 N  NE2 . HIS B 1 71  ? 22.040  -14.605 -7.603  1.00 72.57  ? 331 HIS B NE2 1 
ATOM   2955 N  N   . PRO B 1 72  ? 19.324  -17.577 -10.443 1.00 66.42  ? 332 PRO B N   1 
ATOM   2956 C  CA  . PRO B 1 72  ? 19.037  -19.003 -10.316 1.00 67.39  ? 332 PRO B CA  1 
ATOM   2957 C  C   . PRO B 1 72  ? 18.794  -19.515 -8.903  1.00 71.16  ? 332 PRO B C   1 
ATOM   2958 O  O   . PRO B 1 72  ? 18.401  -20.670 -8.735  1.00 72.09  ? 332 PRO B O   1 
ATOM   2959 C  CB  . PRO B 1 72  ? 20.291  -19.662 -10.906 1.00 65.18  ? 332 PRO B CB  1 
ATOM   2960 C  CG  . PRO B 1 72  ? 21.361  -18.673 -10.739 1.00 64.98  ? 332 PRO B CG  1 
ATOM   2961 C  CD  . PRO B 1 72  ? 20.731  -17.329 -10.805 1.00 65.06  ? 332 PRO B CD  1 
ATOM   2962 N  N   . ASP B 1 73  ? 19.029  -18.674 -7.903  1.00 75.23  ? 333 ASP B N   1 
ATOM   2963 C  CA  . ASP B 1 73  ? 18.847  -19.074 -6.503  1.00 78.26  ? 333 ASP B CA  1 
ATOM   2964 C  C   . ASP B 1 73  ? 17.390  -19.192 -6.080  1.00 77.42  ? 333 ASP B C   1 
ATOM   2965 O  O   . ASP B 1 73  ? 17.114  -19.840 -5.082  1.00 80.93  ? 333 ASP B O   1 
ATOM   2966 C  CB  . ASP B 1 73  ? 19.564  -18.116 -5.543  1.00 77.39  ? 333 ASP B CB  1 
ATOM   2967 C  CG  . ASP B 1 73  ? 21.018  -18.483 -5.318  1.00 80.66  ? 333 ASP B CG  1 
ATOM   2968 O  OD1 . ASP B 1 73  ? 21.516  -19.480 -5.892  1.00 83.99  ? 333 ASP B OD1 1 
ATOM   2969 O  OD2 . ASP B 1 73  ? 21.673  -17.757 -4.553  1.00 81.04  ? 333 ASP B OD2 1 
ATOM   2970 N  N   . ALA B 1 74  ? 16.470  -18.568 -6.811  1.00 73.97  ? 334 ALA B N   1 
ATOM   2971 C  CA  . ALA B 1 74  ? 15.049  -18.659 -6.481  1.00 71.17  ? 334 ALA B CA  1 
ATOM   2972 C  C   . ALA B 1 74  ? 14.223  -19.064 -7.691  1.00 70.38  ? 334 ALA B C   1 
ATOM   2973 O  O   . ALA B 1 74  ? 14.667  -18.953 -8.828  1.00 69.15  ? 334 ALA B O   1 
ATOM   2974 C  CB  . ALA B 1 74  ? 14.543  -17.344 -5.910  1.00 67.64  ? 334 ALA B CB  1 
ATOM   2975 N  N   . LYS B 1 75  ? 13.031  -19.575 -7.411  1.00 72.32  ? 335 LYS B N   1 
ATOM   2976 C  CA  . LYS B 1 75  ? 12.018  -19.839 -8.414  1.00 71.75  ? 335 LYS B CA  1 
ATOM   2977 C  C   . LYS B 1 75  ? 11.124  -18.619 -8.408  1.00 72.21  ? 335 LYS B C   1 
ATOM   2978 O  O   . LYS B 1 75  ? 10.557  -18.279 -7.364  1.00 73.49  ? 335 LYS B O   1 
ATOM   2979 C  CB  . LYS B 1 75  ? 11.209  -21.071 -8.020  1.00 74.66  ? 335 LYS B CB  1 
ATOM   2980 C  CG  . LYS B 1 75  ? 10.178  -21.526 -9.043  1.00 78.50  ? 335 LYS B CG  1 
ATOM   2981 C  CD  . LYS B 1 75  ? 9.570   -22.895 -8.636  1.00 198.90 ? 335 LYS B CD  1 
ATOM   2982 C  CE  . LYS B 1 75  ? 8.527   -23.409 -9.661  1.00 142.41 ? 335 LYS B CE  1 
ATOM   2983 N  NZ  . LYS B 1 75  ? 8.294   -24.890 -9.574  1.00 143.31 ? 335 LYS B NZ  1 
ATOM   2984 N  N   . TYR B 1 76  ? 11.025  -17.944 -9.550  1.00 67.64  ? 336 TYR B N   1 
ATOM   2985 C  CA  . TYR B 1 76  ? 10.171  -16.769 -9.689  1.00 63.83  ? 336 TYR B CA  1 
ATOM   2986 C  C   . TYR B 1 76  ? 8.852   -17.139 -10.351 1.00 64.01  ? 336 TYR B C   1 
ATOM   2987 O  O   . TYR B 1 76  ? 8.794   -18.077 -11.134 1.00 66.33  ? 336 TYR B O   1 
ATOM   2988 C  CB  . TYR B 1 76  ? 10.887  -15.696 -10.502 1.00 62.20  ? 336 TYR B CB  1 
ATOM   2989 C  CG  . TYR B 1 76  ? 12.070  -15.133 -9.771  1.00 63.07  ? 336 TYR B CG  1 
ATOM   2990 C  CD1 . TYR B 1 76  ? 11.923  -14.103 -8.855  1.00 63.08  ? 336 TYR B CD1 1 
ATOM   2991 C  CD2 . TYR B 1 76  ? 13.320  -15.654 -9.958  1.00 63.18  ? 336 TYR B CD2 1 
ATOM   2992 C  CE1 . TYR B 1 76  ? 12.986  -13.612 -8.173  1.00 62.54  ? 336 TYR B CE1 1 
ATOM   2993 C  CE2 . TYR B 1 76  ? 14.401  -15.164 -9.272  1.00 64.64  ? 336 TYR B CE2 1 
ATOM   2994 C  CZ  . TYR B 1 76  ? 14.237  -14.145 -8.388  1.00 65.61  ? 336 TYR B CZ  1 
ATOM   2995 O  OH  . TYR B 1 76  ? 15.351  -13.667 -7.720  1.00 68.72  ? 336 TYR B OH  1 
ATOM   2996 N  N   . ALA B 1 77  ? 7.796   -16.408 -10.007 1.00 62.14  ? 337 ALA B N   1 
ATOM   2997 C  CA  . ALA B 1 77  ? 6.489   -16.541 -10.642 1.00 61.95  ? 337 ALA B CA  1 
ATOM   2998 C  C   . ALA B 1 77  ? 6.214   -15.264 -11.435 1.00 63.05  ? 337 ALA B C   1 
ATOM   2999 O  O   . ALA B 1 77  ? 6.545   -14.164 -10.985 1.00 63.66  ? 337 ALA B O   1 
ATOM   3000 C  CB  . ALA B 1 77  ? 5.409   -16.767 -9.609  1.00 62.57  ? 337 ALA B CB  1 
ATOM   3001 N  N   . LYS B 1 78  ? 5.636   -15.419 -12.624 1.00 61.30  ? 338 LYS B N   1 
ATOM   3002 C  CA  . LYS B 1 78  ? 5.329   -14.290 -13.467 1.00 60.24  ? 338 LYS B CA  1 
ATOM   3003 C  C   . LYS B 1 78  ? 3.992   -13.736 -13.048 1.00 61.23  ? 338 LYS B C   1 
ATOM   3004 O  O   . LYS B 1 78  ? 2.970   -14.395 -13.227 1.00 63.54  ? 338 LYS B O   1 
ATOM   3005 C  CB  . LYS B 1 78  ? 5.249   -14.712 -14.928 1.00 65.38  ? 338 LYS B CB  1 
ATOM   3006 C  CG  . LYS B 1 78  ? 4.959   -13.536 -15.893 1.00 68.03  ? 338 LYS B CG  1 
ATOM   3007 C  CD  . LYS B 1 78  ? 4.070   -13.968 -17.078 1.00 71.75  ? 338 LYS B CD  1 
ATOM   3008 C  CE  . LYS B 1 78  ? 2.625   -14.248 -16.635 1.00 73.17  ? 338 LYS B CE  1 
ATOM   3009 N  NZ  . LYS B 1 78  ? 1.793   -14.515 -17.806 1.00 74.30  ? 338 LYS B NZ  1 
ATOM   3010 N  N   . VAL B 1 79  ? 4.008   -12.513 -12.520 1.00 58.17  ? 339 VAL B N   1 
ATOM   3011 C  CA  . VAL B 1 79  ? 2.800   -11.854 -12.034 1.00 54.67  ? 339 VAL B CA  1 
ATOM   3012 C  C   . VAL B 1 79  ? 2.004   -11.214 -13.180 1.00 56.93  ? 339 VAL B C   1 
ATOM   3013 O  O   . VAL B 1 79  ? 0.773   -11.327 -13.210 1.00 57.06  ? 339 VAL B O   1 
ATOM   3014 C  CB  . VAL B 1 79  ? 3.130   -10.789 -10.993 1.00 53.64  ? 339 VAL B CB  1 
ATOM   3015 C  CG1 . VAL B 1 79  ? 1.864   -10.163 -10.465 1.00 50.56  ? 339 VAL B CG1 1 
ATOM   3016 C  CG2 . VAL B 1 79  ? 3.931   -11.393 -9.877  1.00 56.20  ? 339 VAL B CG2 1 
ATOM   3017 N  N   . LYS B 1 80  ? 2.708   -10.550 -14.107 1.00 56.93  ? 340 LYS B N   1 
ATOM   3018 C  CA  . LYS B 1 80  ? 2.056   -9.849  -15.217 1.00 57.40  ? 340 LYS B CA  1 
ATOM   3019 C  C   . LYS B 1 80  ? 2.989   -9.515  -16.375 1.00 56.98  ? 340 LYS B C   1 
ATOM   3020 O  O   . LYS B 1 80  ? 4.168   -9.242  -16.187 1.00 59.20  ? 340 LYS B O   1 
ATOM   3021 C  CB  . LYS B 1 80  ? 1.386   -8.571  -14.702 1.00 59.81  ? 340 LYS B CB  1 
ATOM   3022 C  CG  . LYS B 1 80  ? 0.686   -7.702  -15.745 1.00 64.56  ? 340 LYS B CG  1 
ATOM   3023 C  CD  . LYS B 1 80  ? -0.432  -8.397  -16.507 1.00 68.96  ? 340 LYS B CD  1 
ATOM   3024 C  CE  . LYS B 1 80  ? -1.706  -8.587  -15.689 1.00 72.00  ? 340 LYS B CE  1 
ATOM   3025 N  NZ  . LYS B 1 80  ? -2.851  -8.587  -16.636 1.00 73.11  ? 340 LYS B NZ  1 
ATOM   3026 N  N   . LEU B 1 81  ? 2.434   -9.583  -17.583 1.00 55.73  ? 341 LEU B N   1 
ATOM   3027 C  CA  . LEU B 1 81  ? 3.085   -9.113  -18.803 1.00 57.97  ? 341 LEU B CA  1 
ATOM   3028 C  C   . LEU B 1 81  ? 2.122   -8.145  -19.477 1.00 60.28  ? 341 LEU B C   1 
ATOM   3029 O  O   . LEU B 1 81  ? 0.945   -8.457  -19.646 1.00 62.21  ? 341 LEU B O   1 
ATOM   3030 C  CB  . LEU B 1 81  ? 3.396   -10.284 -19.753 1.00 56.01  ? 341 LEU B CB  1 
ATOM   3031 C  CG  . LEU B 1 81  ? 3.955   -10.058 -21.173 1.00 54.66  ? 341 LEU B CG  1 
ATOM   3032 C  CD1 . LEU B 1 81  ? 4.341   -11.396 -21.798 1.00 54.05  ? 341 LEU B CD1 1 
ATOM   3033 C  CD2 . LEU B 1 81  ? 2.991   -9.333  -22.105 1.00 52.32  ? 341 LEU B CD2 1 
ATOM   3034 N  N   . ILE B 1 82  ? 2.639   -6.976  -19.848 1.00 59.10  ? 342 ILE B N   1 
ATOM   3035 C  CA  . ILE B 1 82  ? 1.905   -6.025  -20.653 1.00 58.97  ? 342 ILE B CA  1 
ATOM   3036 C  C   . ILE B 1 82  ? 2.776   -5.545  -21.800 1.00 59.59  ? 342 ILE B C   1 
ATOM   3037 O  O   . ILE B 1 82  ? 3.967   -5.287  -21.617 1.00 60.13  ? 342 ILE B O   1 
ATOM   3038 C  CB  . ILE B 1 82  ? 1.438   -4.805  -19.837 1.00 54.75  ? 342 ILE B CB  1 
ATOM   3039 C  CG1 . ILE B 1 82  ? 0.427   -3.993  -20.650 1.00 50.13  ? 342 ILE B CG1 1 
ATOM   3040 C  CG2 . ILE B 1 82  ? 2.632   -3.932  -19.399 1.00 55.96  ? 342 ILE B CG2 1 
ATOM   3041 C  CD1 . ILE B 1 82  ? -0.897  -4.693  -20.858 1.00 47.27  ? 342 ILE B CD1 1 
ATOM   3042 N  N   . ARG B 1 83  ? 2.166   -5.411  -22.974 1.00 59.03  ? 343 ARG B N   1 
ATOM   3043 C  CA  . ARG B 1 83  ? 2.871   -4.956  -24.150 1.00 62.74  ? 343 ARG B CA  1 
ATOM   3044 C  C   . ARG B 1 83  ? 1.962   -4.070  -25.011 1.00 66.64  ? 343 ARG B C   1 
ATOM   3045 O  O   . ARG B 1 83  ? 0.765   -4.337  -25.144 1.00 66.63  ? 343 ARG B O   1 
ATOM   3046 C  CB  . ARG B 1 83  ? 3.385   -6.159  -24.949 1.00 62.95  ? 343 ARG B CB  1 
ATOM   3047 C  CG  . ARG B 1 83  ? 4.064   -5.808  -26.284 1.00 63.50  ? 343 ARG B CG  1 
ATOM   3048 C  CD  . ARG B 1 83  ? 4.835   -7.008  -26.849 1.00 60.09  ? 343 ARG B CD  1 
ATOM   3049 N  NE  . ARG B 1 83  ? 3.924   -8.020  -27.336 1.00 59.80  ? 343 ARG B NE  1 
ATOM   3050 C  CZ  . ARG B 1 83  ? 3.255   -7.922  -28.478 1.00 64.38  ? 343 ARG B CZ  1 
ATOM   3051 N  NH1 . ARG B 1 83  ? 3.413   -6.858  -29.260 1.00 65.32  ? 343 ARG B NH1 1 
ATOM   3052 N  NH2 . ARG B 1 83  ? 2.422   -8.890  -28.855 1.00 64.92  ? 343 ARG B NH2 1 
ATOM   3053 N  N   . LEU B 1 84  ? 2.547   -2.997  -25.548 1.00 64.49  ? 344 LEU B N   1 
ATOM   3054 C  CA  . LEU B 1 84  ? 1.929   -2.172  -26.568 1.00 60.63  ? 344 LEU B CA  1 
ATOM   3055 C  C   . LEU B 1 84  ? 2.908   -2.091  -27.725 1.00 62.53  ? 344 LEU B C   1 
ATOM   3056 O  O   . LEU B 1 84  ? 3.929   -1.406  -27.633 1.00 61.63  ? 344 LEU B O   1 
ATOM   3057 C  CB  . LEU B 1 84  ? 1.638   -0.783  -26.027 1.00 56.55  ? 344 LEU B CB  1 
ATOM   3058 C  CG  . LEU B 1 84  ? 1.028   0.227   -27.009 1.00 58.06  ? 344 LEU B CG  1 
ATOM   3059 C  CD1 . LEU B 1 84  ? -0.369  -0.212  -27.473 1.00 54.94  ? 344 LEU B CD1 1 
ATOM   3060 C  CD2 . LEU B 1 84  ? 0.991   1.620   -26.365 1.00 56.67  ? 344 LEU B CD2 1 
ATOM   3061 N  N   . VAL B 1 85  ? 2.596   -2.805  -28.803 1.00 63.06  ? 345 VAL B N   1 
ATOM   3062 C  CA  . VAL B 1 85  ? 3.521   -2.983  -29.924 1.00 65.40  ? 345 VAL B CA  1 
ATOM   3063 C  C   . VAL B 1 85  ? 4.870   -3.499  -29.393 1.00 66.23  ? 345 VAL B C   1 
ATOM   3064 O  O   . VAL B 1 85  ? 4.961   -4.662  -28.990 1.00 66.68  ? 345 VAL B O   1 
ATOM   3065 C  CB  . VAL B 1 85  ? 3.642   -1.696  -30.788 1.00 76.44  ? 345 VAL B CB  1 
ATOM   3066 C  CG1 . VAL B 1 85  ? 4.606   -1.911  -31.953 1.00 78.03  ? 345 VAL B CG1 1 
ATOM   3067 C  CG2 . VAL B 1 85  ? 2.270   -1.293  -31.317 1.00 74.84  ? 345 VAL B CG2 1 
ATOM   3068 N  N   . GLY B 1 86  ? 5.890   -2.648  -29.328 1.00 64.42  ? 346 GLY B N   1 
ATOM   3069 C  CA  . GLY B 1 86  ? 7.231   -3.091  -28.888 1.00 65.61  ? 346 GLY B CA  1 
ATOM   3070 C  C   . GLY B 1 86  ? 7.645   -2.630  -27.487 1.00 66.86  ? 346 GLY B C   1 
ATOM   3071 O  O   . GLY B 1 86  ? 8.825   -2.767  -27.101 1.00 67.40  ? 346 GLY B O   1 
ATOM   3072 N  N   . ILE B 1 87  ? 6.685   -2.075  -26.737 1.00 62.95  ? 347 ILE B N   1 
ATOM   3073 C  CA  . ILE B 1 87  ? 6.932   -1.587  -25.396 1.00 57.33  ? 347 ILE B CA  1 
ATOM   3074 C  C   . ILE B 1 87  ? 6.369   -2.654  -24.461 1.00 59.46  ? 347 ILE B C   1 
ATOM   3075 O  O   . ILE B 1 87  ? 5.165   -2.731  -24.269 1.00 61.24  ? 347 ILE B O   1 
ATOM   3076 C  CB  . ILE B 1 87  ? 6.255   -0.218  -25.181 1.00 56.43  ? 347 ILE B CB  1 
ATOM   3077 C  CG1 . ILE B 1 87  ? 6.819   0.818   -26.162 1.00 58.24  ? 347 ILE B CG1 1 
ATOM   3078 C  CG2 . ILE B 1 87  ? 6.468   0.279   -23.769 1.00 52.91  ? 347 ILE B CG2 1 
ATOM   3079 C  CD1 . ILE B 1 87  ? 5.984   2.091   -26.291 1.00 55.34  ? 347 ILE B CD1 1 
ATOM   3080 N  N   . MET B 1 88  ? 7.240   -3.493  -23.910 1.00 57.35  ? 348 MET B N   1 
ATOM   3081 C  CA  . MET B 1 88  ? 6.817   -4.591  -23.036 1.00 57.06  ? 348 MET B CA  1 
ATOM   3082 C  C   . MET B 1 88  ? 7.436   -4.460  -21.648 1.00 61.29  ? 348 MET B C   1 
ATOM   3083 O  O   . MET B 1 88  ? 8.620   -4.100  -21.517 1.00 63.60  ? 348 MET B O   1 
ATOM   3084 C  CB  . MET B 1 88  ? 7.206   -5.945  -23.634 1.00 55.02  ? 348 MET B CB  1 
ATOM   3085 C  CG  . MET B 1 88  ? 6.815   -7.154  -22.798 1.00 48.97  ? 348 MET B CG  1 
ATOM   3086 S  SD  . MET B 1 88  ? 7.016   -8.719  -23.690 1.00 68.53  ? 348 MET B SD  1 
ATOM   3087 C  CE  . MET B 1 88  ? 8.772   -9.015  -23.565 1.00 60.70  ? 348 MET B CE  1 
ATOM   3088 N  N   . LEU B 1 89  ? 6.614   -4.745  -20.634 1.00 57.97  ? 349 LEU B N   1 
ATOM   3089 C  CA  . LEU B 1 89  ? 7.028   -4.774  -19.240 1.00 56.51  ? 349 LEU B CA  1 
ATOM   3090 C  C   . LEU B 1 89  ? 6.572   -6.100  -18.613 1.00 60.12  ? 349 LEU B C   1 
ATOM   3091 O  O   . LEU B 1 89  ? 5.393   -6.485  -18.743 1.00 60.97  ? 349 LEU B O   1 
ATOM   3092 C  CB  . LEU B 1 89  ? 6.401   -3.606  -18.473 1.00 55.59  ? 349 LEU B CB  1 
ATOM   3093 C  CG  . LEU B 1 89  ? 6.881   -3.428  -17.026 1.00 54.53  ? 349 LEU B CG  1 
ATOM   3094 C  CD1 . LEU B 1 89  ? 8.407   -3.218  -17.027 1.00 55.07  ? 349 LEU B CD1 1 
ATOM   3095 C  CD2 . LEU B 1 89  ? 6.159   -2.272  -16.299 1.00 51.09  ? 349 LEU B CD2 1 
ATOM   3096 N  N   . LEU B 1 90  ? 7.499   -6.787  -17.939 1.00 59.28  ? 350 LEU B N   1 
ATOM   3097 C  CA  . LEU B 1 90  ? 7.208   -8.031  -17.222 1.00 59.98  ? 350 LEU B CA  1 
ATOM   3098 C  C   . LEU B 1 90  ? 7.380   -7.782  -15.722 1.00 60.33  ? 350 LEU B C   1 
ATOM   3099 O  O   . LEU B 1 90  ? 8.260   -7.027  -15.324 1.00 60.02  ? 350 LEU B O   1 
ATOM   3100 C  CB  . LEU B 1 90  ? 8.190   -9.118  -17.649 1.00 57.77  ? 350 LEU B CB  1 
ATOM   3101 C  CG  . LEU B 1 90  ? 8.342   -9.378  -19.141 1.00 56.50  ? 350 LEU B CG  1 
ATOM   3102 C  CD1 . LEU B 1 90  ? 9.594   -10.169 -19.401 1.00 56.74  ? 350 LEU B CD1 1 
ATOM   3103 C  CD2 . LEU B 1 90  ? 7.119   -10.103 -19.648 1.00 58.32  ? 350 LEU B CD2 1 
ATOM   3104 N  N   . LEU B 1 91  ? 6.562   -8.420  -14.896 1.00 59.06  ? 351 LEU B N   1 
ATOM   3105 C  CA  . LEU B 1 91  ? 6.744   -8.361  -13.457 1.00 58.89  ? 351 LEU B CA  1 
ATOM   3106 C  C   . LEU B 1 91  ? 6.819   -9.781  -12.946 1.00 58.80  ? 351 LEU B C   1 
ATOM   3107 O  O   . LEU B 1 91  ? 5.881   -10.557 -13.173 1.00 57.41  ? 351 LEU B O   1 
ATOM   3108 C  CB  . LEU B 1 91  ? 5.579   -7.641  -12.769 1.00 56.97  ? 351 LEU B CB  1 
ATOM   3109 C  CG  . LEU B 1 91  ? 5.671   -7.568  -11.237 1.00 57.36  ? 351 LEU B CG  1 
ATOM   3110 C  CD1 . LEU B 1 91  ? 6.839   -6.656  -10.831 1.00 56.82  ? 351 LEU B CD1 1 
ATOM   3111 C  CD2 . LEU B 1 91  ? 4.370   -7.100  -10.595 1.00 54.81  ? 351 LEU B CD2 1 
ATOM   3112 N  N   . TYR B 1 92  ? 7.928   -10.106 -12.271 1.00 57.74  ? 352 TYR B N   1 
ATOM   3113 C  CA  . TYR B 1 92  ? 8.095   -11.384 -11.582 1.00 58.61  ? 352 TYR B CA  1 
ATOM   3114 C  C   . TYR B 1 92  ? 8.326   -11.151 -10.076 1.00 64.09  ? 352 TYR B C   1 
ATOM   3115 O  O   . TYR B 1 92  ? 8.916   -10.128 -9.671  1.00 60.98  ? 352 TYR B O   1 
ATOM   3116 C  CB  . TYR B 1 92  ? 9.323   -12.145 -12.083 1.00 55.84  ? 352 TYR B CB  1 
ATOM   3117 C  CG  . TYR B 1 92  ? 9.469   -12.462 -13.567 1.00 61.60  ? 352 TYR B CG  1 
ATOM   3118 C  CD1 . TYR B 1 92  ? 9.219   -13.744 -14.061 1.00 62.89  ? 352 TYR B CD1 1 
ATOM   3119 C  CD2 . TYR B 1 92  ? 9.963   -11.522 -14.456 1.00 60.04  ? 352 TYR B CD2 1 
ATOM   3120 C  CE1 . TYR B 1 92  ? 9.404   -14.044 -15.408 1.00 62.18  ? 352 TYR B CE1 1 
ATOM   3121 C  CE2 . TYR B 1 92  ? 10.152  -11.819 -15.783 1.00 59.00  ? 352 TYR B CE2 1 
ATOM   3122 C  CZ  . TYR B 1 92  ? 9.870   -13.068 -16.251 1.00 61.56  ? 352 TYR B CZ  1 
ATOM   3123 O  OH  . TYR B 1 92  ? 10.083  -13.339 -17.577 1.00 63.65  ? 352 TYR B OH  1 
ATOM   3124 N  N   . VAL B 1 93  ? 7.898   -12.118 -9.259  1.00 64.65  ? 353 VAL B N   1 
ATOM   3125 C  CA  . VAL B 1 93  ? 8.283   -12.173 -7.847  1.00 63.55  ? 353 VAL B CA  1 
ATOM   3126 C  C   . VAL B 1 93  ? 8.704   -13.589 -7.455  1.00 62.31  ? 353 VAL B C   1 
ATOM   3127 O  O   . VAL B 1 93  ? 8.169   -14.562 -7.989  1.00 58.04  ? 353 VAL B O   1 
ATOM   3128 C  CB  . VAL B 1 93  ? 7.142   -11.698 -6.906  1.00 64.84  ? 353 VAL B CB  1 
ATOM   3129 C  CG1 . VAL B 1 93  ? 6.726   -10.296 -7.257  1.00 66.54  ? 353 VAL B CG1 1 
ATOM   3130 C  CG2 . VAL B 1 93  ? 5.958   -12.619 -6.965  1.00 63.63  ? 353 VAL B CG2 1 
ATOM   3131 N  N   . LYS B 1 94  ? 9.671   -13.700 -6.537  1.00 64.37  ? 354 LYS B N   1 
ATOM   3132 C  CA  . LYS B 1 94  ? 10.007  -14.995 -5.937  1.00 69.22  ? 354 LYS B CA  1 
ATOM   3133 C  C   . LYS B 1 94  ? 8.707   -15.682 -5.557  1.00 74.04  ? 354 LYS B C   1 
ATOM   3134 O  O   . LYS B 1 94  ? 7.791   -15.037 -5.019  1.00 75.34  ? 354 LYS B O   1 
ATOM   3135 C  CB  . LYS B 1 94  ? 10.799  -14.839 -4.641  1.00 70.62  ? 354 LYS B CB  1 
ATOM   3136 C  CG  . LYS B 1 94  ? 12.231  -14.377 -4.762  1.00 71.21  ? 354 LYS B CG  1 
ATOM   3137 C  CD  . LYS B 1 94  ? 12.989  -14.736 -3.485  1.00 70.07  ? 354 LYS B CD  1 
ATOM   3138 C  CE  . LYS B 1 94  ? 14.381  -14.129 -3.429  1.00 73.37  ? 354 LYS B CE  1 
ATOM   3139 N  NZ  . LYS B 1 94  ? 14.902  -14.033 -2.019  1.00 78.07  ? 354 LYS B NZ  1 
ATOM   3140 N  N   . GLN B 1 95  ? 8.625   -16.984 -5.790  1.00 73.10  ? 355 GLN B N   1 
ATOM   3141 C  CA  . GLN B 1 95  ? 7.397   -17.697 -5.489  1.00 77.29  ? 355 GLN B CA  1 
ATOM   3142 C  C   . GLN B 1 95  ? 6.885   -17.420 -4.063  1.00 78.35  ? 355 GLN B C   1 
ATOM   3143 O  O   . GLN B 1 95  ? 5.687   -17.231 -3.857  1.00 76.48  ? 355 GLN B O   1 
ATOM   3144 C  CB  . GLN B 1 95  ? 7.572   -19.194 -5.716  1.00 83.74  ? 355 GLN B CB  1 
ATOM   3145 C  CG  . GLN B 1 95  ? 6.250   -19.917 -5.854  1.00 93.24  ? 355 GLN B CG  1 
ATOM   3146 C  CD  . GLN B 1 95  ? 6.424   -21.390 -6.183  1.00 103.35 ? 355 GLN B CD  1 
ATOM   3147 O  OE1 . GLN B 1 95  ? 6.979   -21.737 -7.238  1.00 106.66 ? 355 GLN B OE1 1 
ATOM   3148 N  NE2 . GLN B 1 95  ? 5.932   -22.272 -5.292  1.00 105.93 ? 355 GLN B NE2 1 
ATOM   3149 N  N   . GLU B 1 96  ? 7.785   -17.359 -3.084  1.00 79.79  ? 356 GLU B N   1 
ATOM   3150 C  CA  . GLU B 1 96  ? 7.357   -17.135 -1.691  1.00 83.62  ? 356 GLU B CA  1 
ATOM   3151 C  C   . GLU B 1 96  ? 6.585   -15.832 -1.443  1.00 84.87  ? 356 GLU B C   1 
ATOM   3152 O  O   . GLU B 1 96  ? 5.871   -15.734 -0.437  1.00 86.79  ? 356 GLU B O   1 
ATOM   3153 C  CB  . GLU B 1 96  ? 8.537   -17.224 -0.716  1.00 85.16  ? 356 GLU B CB  1 
ATOM   3154 C  CG  . GLU B 1 96  ? 9.602   -16.135 -0.860  1.00 87.14  ? 356 GLU B CG  1 
ATOM   3155 C  CD  . GLU B 1 96  ? 10.804  -16.383 0.046   1.00 90.67  ? 356 GLU B CD  1 
ATOM   3156 O  OE1 . GLU B 1 96  ? 10.644  -16.303 1.279   1.00 96.69  ? 356 GLU B OE1 1 
ATOM   3157 O  OE2 . GLU B 1 96  ? 11.905  -16.669 -0.477  1.00 89.14  ? 356 GLU B OE2 1 
ATOM   3158 N  N   . HIS B 1 97  ? 6.745   -14.846 -2.337  1.00 80.64  ? 357 HIS B N   1 
ATOM   3159 C  CA  . HIS B 1 97  ? 6.055   -13.552 -2.231  1.00 73.24  ? 357 HIS B CA  1 
ATOM   3160 C  C   . HIS B 1 97  ? 4.756   -13.491 -3.016  1.00 69.69  ? 357 HIS B C   1 
ATOM   3161 O  O   . HIS B 1 97  ? 4.011   -12.533 -2.877  1.00 68.09  ? 357 HIS B O   1 
ATOM   3162 C  CB  . HIS B 1 97  ? 6.929   -12.430 -2.760  1.00 70.11  ? 357 HIS B CB  1 
ATOM   3163 C  CG  . HIS B 1 97  ? 8.276   -12.360 -2.130  1.00 75.54  ? 357 HIS B CG  1 
ATOM   3164 N  ND1 . HIS B 1 97  ? 8.464   -12.425 -0.768  1.00 79.62  ? 357 HIS B ND1 1 
ATOM   3165 C  CD2 . HIS B 1 97  ? 9.503   -12.191 -2.673  1.00 77.01  ? 357 HIS B CD2 1 
ATOM   3166 C  CE1 . HIS B 1 97  ? 9.751   -12.317 -0.498  1.00 79.95  ? 357 HIS B CE1 1 
ATOM   3167 N  NE2 . HIS B 1 97  ? 10.404  -12.171 -1.636  1.00 79.77  ? 357 HIS B NE2 1 
ATOM   3168 N  N   . ALA B 1 98  ? 4.494   -14.492 -3.851  1.00 68.14  ? 358 ALA B N   1 
ATOM   3169 C  CA  . ALA B 1 98  ? 3.323   -14.467 -4.736  1.00 67.99  ? 358 ALA B CA  1 
ATOM   3170 C  C   . ALA B 1 98  ? 2.001   -14.387 -3.968  1.00 75.66  ? 358 ALA B C   1 
ATOM   3171 O  O   . ALA B 1 98  ? 1.081   -13.711 -4.414  1.00 79.46  ? 358 ALA B O   1 
ATOM   3172 C  CB  . ALA B 1 98  ? 3.321   -15.672 -5.693  1.00 58.02  ? 358 ALA B CB  1 
ATOM   3173 N  N   . ALA B 1 99  ? 1.905   -15.055 -2.822  1.00 75.95  ? 359 ALA B N   1 
ATOM   3174 C  CA  . ALA B 1 99  ? 0.674   -15.022 -2.027  1.00 78.80  ? 359 ALA B CA  1 
ATOM   3175 C  C   . ALA B 1 99  ? 0.324   -13.617 -1.511  1.00 82.11  ? 359 ALA B C   1 
ATOM   3176 O  O   . ALA B 1 99  ? -0.809  -13.381 -1.094  1.00 82.82  ? 359 ALA B O   1 
ATOM   3177 C  CB  . ALA B 1 99  ? 0.776   -15.992 -0.852  1.00 78.03  ? 359 ALA B CB  1 
ATOM   3178 N  N   . TYR B 1 100 ? 1.296   -12.701 -1.527  1.00 82.10  ? 360 TYR B N   1 
ATOM   3179 C  CA  . TYR B 1 100 ? 1.134   -11.367 -0.948  1.00 83.77  ? 360 TYR B CA  1 
ATOM   3180 C  C   . TYR B 1 100 ? 1.080   -10.267 -2.018  1.00 83.43  ? 360 TYR B C   1 
ATOM   3181 O  O   . TYR B 1 100 ? 1.083   -9.075  -1.696  1.00 83.05  ? 360 TYR B O   1 
ATOM   3182 C  CB  . TYR B 1 100 ? 2.259   -11.114 0.060   1.00 85.64  ? 360 TYR B CB  1 
ATOM   3183 C  CG  . TYR B 1 100 ? 2.402   -12.236 1.088   1.00 89.07  ? 360 TYR B CG  1 
ATOM   3184 C  CD1 . TYR B 1 100 ? 1.470   -12.390 2.120   1.00 90.87  ? 360 TYR B CD1 1 
ATOM   3185 C  CD2 . TYR B 1 100 ? 3.457   -13.149 1.016   1.00 87.56  ? 360 TYR B CD2 1 
ATOM   3186 C  CE1 . TYR B 1 100 ? 1.586   -13.423 3.058   1.00 91.99  ? 360 TYR B CE1 1 
ATOM   3187 C  CE2 . TYR B 1 100 ? 3.583   -14.181 1.938   1.00 90.39  ? 360 TYR B CE2 1 
ATOM   3188 C  CZ  . TYR B 1 100 ? 2.647   -14.314 2.966   1.00 92.37  ? 360 TYR B CZ  1 
ATOM   3189 O  OH  . TYR B 1 100 ? 2.773   -15.337 3.890   1.00 91.62  ? 360 TYR B OH  1 
ATOM   3190 N  N   . ILE B 1 101 ? 1.016   -10.678 -3.284  1.00 80.01  ? 361 ILE B N   1 
ATOM   3191 C  CA  . ILE B 1 101 ? 0.752   -9.783  -4.402  1.00 75.08  ? 361 ILE B CA  1 
ATOM   3192 C  C   . ILE B 1 101 ? -0.755  -9.792  -4.664  1.00 73.60  ? 361 ILE B C   1 
ATOM   3193 O  O   . ILE B 1 101 ? -1.350  -10.863 -4.783  1.00 73.67  ? 361 ILE B O   1 
ATOM   3194 C  CB  . ILE B 1 101 ? 1.473   -10.264 -5.681  1.00 69.54  ? 361 ILE B CB  1 
ATOM   3195 C  CG1 . ILE B 1 101 ? 2.998   -10.160 -5.516  1.00 69.13  ? 361 ILE B CG1 1 
ATOM   3196 C  CG2 . ILE B 1 101 ? 0.994   -9.482  -6.900  1.00 63.14  ? 361 ILE B CG2 1 
ATOM   3197 C  CD1 . ILE B 1 101 ? 3.532   -8.745  -5.474  1.00 67.68  ? 361 ILE B CD1 1 
ATOM   3198 N  N   . SER B 1 102 ? -1.369  -8.607  -4.734  1.00 70.45  ? 362 SER B N   1 
ATOM   3199 C  CA  . SER B 1 102 ? -2.795  -8.474  -5.063  1.00 68.74  ? 362 SER B CA  1 
ATOM   3200 C  C   . SER B 1 102 ? -3.050  -7.179  -5.836  1.00 72.25  ? 362 SER B C   1 
ATOM   3201 O  O   . SER B 1 102 ? -2.127  -6.380  -6.041  1.00 73.84  ? 362 SER B O   1 
ATOM   3202 C  CB  . SER B 1 102 ? -3.646  -8.506  -3.799  1.00 70.22  ? 362 SER B CB  1 
ATOM   3203 O  OG  . SER B 1 102 ? -3.384  -7.378  -2.987  1.00 69.97  ? 362 SER B OG  1 
ATOM   3204 N  N   . GLU B 1 103 ? -4.297  -6.993  -6.278  1.00 72.50  ? 363 GLU B N   1 
ATOM   3205 C  CA  . GLU B 1 103 ? -4.704  -5.808  -7.034  1.00 73.63  ? 363 GLU B CA  1 
ATOM   3206 C  C   . GLU B 1 103 ? -3.812  -5.504  -8.245  1.00 70.20  ? 363 GLU B C   1 
ATOM   3207 O  O   . GLU B 1 103 ? -3.517  -4.340  -8.528  1.00 67.03  ? 363 GLU B O   1 
ATOM   3208 C  CB  . GLU B 1 103 ? -4.747  -4.574  -6.123  1.00 79.71  ? 363 GLU B CB  1 
ATOM   3209 C  CG  . GLU B 1 103 ? -5.757  -4.631  -4.985  1.00 85.94  ? 363 GLU B CG  1 
ATOM   3210 C  CD  . GLU B 1 103 ? -5.958  -3.265  -4.299  1.00 90.58  ? 363 GLU B CD  1 
ATOM   3211 O  OE1 . GLU B 1 103 ? -7.049  -3.063  -3.705  1.00 94.07  ? 363 GLU B OE1 1 
ATOM   3212 O  OE2 . GLU B 1 103 ? -5.037  -2.400  -4.355  1.00 88.53  ? 363 GLU B OE2 1 
ATOM   3213 N  N   . VAL B 1 104 ? -3.404  -6.535  -8.976  1.00 68.95  ? 364 VAL B N   1 
ATOM   3214 C  CA  . VAL B 1 104 ? -2.562  -6.324  -10.162 1.00 68.93  ? 364 VAL B CA  1 
ATOM   3215 C  C   . VAL B 1 104 ? -3.353  -5.717  -11.343 1.00 66.72  ? 364 VAL B C   1 
ATOM   3216 O  O   . VAL B 1 104 ? -4.443  -6.155  -11.655 1.00 66.47  ? 364 VAL B O   1 
ATOM   3217 C  CB  . VAL B 1 104 ? -1.854  -7.626  -10.598 1.00 68.66  ? 364 VAL B CB  1 
ATOM   3218 C  CG1 . VAL B 1 104 ? -0.890  -7.335  -11.735 1.00 68.48  ? 364 VAL B CG1 1 
ATOM   3219 C  CG2 . VAL B 1 104 ? -1.109  -8.239  -9.419  1.00 67.56  ? 364 VAL B CG2 1 
ATOM   3220 N  N   . GLU B 1 105 ? -2.803  -4.685  -11.968 1.00 65.21  ? 365 GLU B N   1 
ATOM   3221 C  CA  . GLU B 1 105 ? -3.462  -4.009  -13.084 1.00 68.79  ? 365 GLU B CA  1 
ATOM   3222 C  C   . GLU B 1 105 ? -2.425  -3.457  -14.062 1.00 67.19  ? 365 GLU B C   1 
ATOM   3223 O  O   . GLU B 1 105 ? -1.372  -2.936  -13.653 1.00 67.25  ? 365 GLU B O   1 
ATOM   3224 C  CB  . GLU B 1 105 ? -4.320  -2.835  -12.603 1.00 74.88  ? 365 GLU B CB  1 
ATOM   3225 C  CG  . GLU B 1 105 ? -5.495  -3.166  -11.672 1.00 80.79  ? 365 GLU B CG  1 
ATOM   3226 C  CD  . GLU B 1 105 ? -6.552  -4.093  -12.266 1.00 85.24  ? 365 GLU B CD  1 
ATOM   3227 O  OE1 . GLU B 1 105 ? -6.613  -4.293  -13.490 1.00 82.05  ? 365 GLU B OE1 1 
ATOM   3228 O  OE2 . GLU B 1 105 ? -7.335  -4.636  -11.467 1.00 91.57  ? 365 GLU B OE2 1 
ATOM   3229 N  N   . ALA B 1 106 ? -2.729  -3.566  -15.351 1.00 63.76  ? 366 ALA B N   1 
ATOM   3230 C  CA  . ALA B 1 106 ? -1.827  -3.122  -16.395 1.00 62.29  ? 366 ALA B CA  1 
ATOM   3231 C  C   . ALA B 1 106 ? -2.616  -2.275  -17.364 1.00 68.24  ? 366 ALA B C   1 
ATOM   3232 O  O   . ALA B 1 106 ? -3.717  -2.644  -17.757 1.00 73.19  ? 366 ALA B O   1 
ATOM   3233 C  CB  . ALA B 1 106 ? -1.209  -4.318  -17.118 1.00 57.22  ? 366 ALA B CB  1 
ATOM   3234 N  N   . GLU B 1 107 ? -2.075  -1.127  -17.741 1.00 69.01  ? 367 GLU B N   1 
ATOM   3235 C  CA  . GLU B 1 107 ? -2.643  -0.368  -18.841 1.00 70.91  ? 367 GLU B CA  1 
ATOM   3236 C  C   . GLU B 1 107 ? -1.569  0.025   -19.844 1.00 69.32  ? 367 GLU B C   1 
ATOM   3237 O  O   . GLU B 1 107 ? -0.356  -0.142  -19.585 1.00 68.12  ? 367 GLU B O   1 
ATOM   3238 C  CB  . GLU B 1 107 ? -3.441  0.849   -18.342 1.00 72.55  ? 367 GLU B CB  1 
ATOM   3239 C  CG  . GLU B 1 107 ? -4.960  0.543   -18.141 1.00 76.89  ? 367 GLU B CG  1 
ATOM   3240 C  CD  . GLU B 1 107 ? -5.761  0.368   -19.476 1.00 103.47 ? 367 GLU B CD  1 
ATOM   3241 O  OE1 . GLU B 1 107 ? -5.157  0.066   -20.562 1.00 101.89 ? 367 GLU B OE1 1 
ATOM   3242 O  OE2 . GLU B 1 107 ? -7.014  0.531   -19.423 1.00 103.87 ? 367 GLU B OE2 1 
ATOM   3243 N  N   . THR B 1 108 ? -2.038  0.489   -21.010 1.00 65.65  ? 368 THR B N   1 
ATOM   3244 C  CA  . THR B 1 108 ? -1.164  1.030   -22.040 1.00 63.26  ? 368 THR B CA  1 
ATOM   3245 C  C   . THR B 1 108 ? -1.735  2.372   -22.531 1.00 64.86  ? 368 THR B C   1 
ATOM   3246 O  O   . THR B 1 108 ? -2.954  2.556   -22.626 1.00 66.02  ? 368 THR B O   1 
ATOM   3247 C  CB  . THR B 1 108 ? -0.985  0.045   -23.229 1.00 52.82  ? 368 THR B CB  1 
ATOM   3248 O  OG1 . THR B 1 108 ? -2.238  -0.171  -23.868 1.00 57.29  ? 368 THR B OG1 1 
ATOM   3249 C  CG2 . THR B 1 108 ? -0.470  -1.282  -22.771 1.00 46.54  ? 368 THR B CG2 1 
ATOM   3250 N  N   . VAL B 1 109 ? -0.828  3.303   -22.810 1.00 61.55  ? 369 VAL B N   1 
ATOM   3251 C  CA  . VAL B 1 109 ? -1.151  4.562   -23.444 1.00 61.82  ? 369 VAL B CA  1 
ATOM   3252 C  C   . VAL B 1 109 ? -0.168  4.813   -24.597 1.00 60.19  ? 369 VAL B C   1 
ATOM   3253 O  O   . VAL B 1 109 ? 1.034   4.902   -24.380 1.00 60.96  ? 369 VAL B O   1 
ATOM   3254 C  CB  . VAL B 1 109 ? -1.053  5.725   -22.432 1.00 62.11  ? 369 VAL B CB  1 
ATOM   3255 C  CG1 . VAL B 1 109 ? -1.067  7.077   -23.160 1.00 60.10  ? 369 VAL B CG1 1 
ATOM   3256 C  CG2 . VAL B 1 109 ? -2.177  5.621   -21.365 1.00 58.24  ? 369 VAL B CG2 1 
ATOM   3257 N  N   . GLY B 1 110 ? -0.685  4.900   -25.817 1.00 58.62  ? 370 GLY B N   1 
ATOM   3258 C  CA  . GLY B 1 110 ? 0.117   5.267   -26.978 1.00 59.94  ? 370 GLY B CA  1 
ATOM   3259 C  C   . GLY B 1 110 ? 0.193   6.771   -27.175 1.00 63.73  ? 370 GLY B C   1 
ATOM   3260 O  O   . GLY B 1 110 ? -0.782  7.491   -26.986 1.00 64.05  ? 370 GLY B O   1 
ATOM   3261 N  N   . THR B 1 111 ? 1.367   7.248   -27.560 1.00 66.02  ? 371 THR B N   1 
ATOM   3262 C  CA  . THR B 1 111 ? 1.614   8.673   -27.665 1.00 68.83  ? 371 THR B CA  1 
ATOM   3263 C  C   . THR B 1 111 ? 2.444   9.027   -28.896 1.00 70.88  ? 371 THR B C   1 
ATOM   3264 O  O   . THR B 1 111 ? 3.024   10.116  -28.961 1.00 76.98  ? 371 THR B O   1 
ATOM   3265 C  CB  . THR B 1 111 ? 2.414   9.152   -26.437 1.00 71.24  ? 371 THR B CB  1 
ATOM   3266 O  OG1 . THR B 1 111 ? 3.670   8.456   -26.414 1.00 73.62  ? 371 THR B OG1 1 
ATOM   3267 C  CG2 . THR B 1 111 ? 1.659   8.919   -25.124 1.00 66.24  ? 371 THR B CG2 1 
ATOM   3268 N  N   . GLY B 1 112 ? 2.512   8.124   -29.869 1.00 67.18  ? 372 GLY B N   1 
ATOM   3269 C  CA  . GLY B 1 112 ? 3.413   8.301   -31.000 1.00 67.17  ? 372 GLY B CA  1 
ATOM   3270 C  C   . GLY B 1 112 ? 2.749   9.051   -32.133 1.00 70.29  ? 372 GLY B C   1 
ATOM   3271 O  O   . GLY B 1 112 ? 2.420   10.226  -32.000 1.00 72.72  ? 372 GLY B O   1 
ATOM   3272 N  N   . ILE B 1 113 ? 2.544   8.349   -33.241 1.00 69.89  ? 373 ILE B N   1 
ATOM   3273 C  CA  . ILE B 1 113 ? 1.861   8.882   -34.417 1.00 74.64  ? 373 ILE B CA  1 
ATOM   3274 C  C   . ILE B 1 113 ? 0.509   9.504   -34.060 1.00 76.39  ? 373 ILE B C   1 
ATOM   3275 O  O   . ILE B 1 113 ? -0.271  8.910   -33.324 1.00 74.80  ? 373 ILE B O   1 
ATOM   3276 C  CB  . ILE B 1 113 ? 1.638   7.752   -35.466 1.00 76.35  ? 373 ILE B CB  1 
ATOM   3277 C  CG1 . ILE B 1 113 ? 2.978   7.328   -36.098 1.00 72.11  ? 373 ILE B CG1 1 
ATOM   3278 C  CG2 . ILE B 1 113 ? 0.623   8.186   -36.530 1.00 76.72  ? 373 ILE B CG2 1 
ATOM   3279 C  CD1 . ILE B 1 113 ? 2.973   5.935   -36.685 1.00 66.91  ? 373 ILE B CD1 1 
ATOM   3280 N  N   . MET B 1 114 ? 0.245   10.699  -34.590 1.00 80.90  ? 374 MET B N   1 
ATOM   3281 C  CA  . MET B 1 114 ? -0.959  11.470  -34.251 1.00 79.85  ? 374 MET B CA  1 
ATOM   3282 C  C   . MET B 1 114 ? -1.183  11.538  -32.726 1.00 78.47  ? 374 MET B C   1 
ATOM   3283 O  O   . MET B 1 114 ? -2.308  11.620  -32.230 1.00 74.42  ? 374 MET B O   1 
ATOM   3284 C  CB  . MET B 1 114 ? -2.173  10.903  -34.998 1.00 76.32  ? 374 MET B CB  1 
ATOM   3285 C  CG  . MET B 1 114 ? -2.134  11.159  -36.515 1.00 80.00  ? 374 MET B CG  1 
ATOM   3286 S  SD  . MET B 1 114 ? -2.064  12.916  -37.053 1.00 102.10 ? 374 MET B SD  1 
ATOM   3287 C  CE  . MET B 1 114 ? -0.276  13.048  -37.249 1.00 146.18 ? 374 MET B CE  1 
ATOM   3288 N  N   . GLY B 1 115 ? -0.073  11.514  -31.996 1.00 79.20  ? 375 GLY B N   1 
ATOM   3289 C  CA  . GLY B 1 115 ? -0.084  11.548  -30.554 1.00 76.85  ? 375 GLY B CA  1 
ATOM   3290 C  C   . GLY B 1 115 ? -0.933  10.482  -29.910 1.00 77.86  ? 375 GLY B C   1 
ATOM   3291 O  O   . GLY B 1 115 ? -1.489  10.731  -28.850 1.00 81.49  ? 375 GLY B O   1 
ATOM   3292 N  N   . ARG B 1 116 ? -1.043  9.300   -30.525 1.00 76.47  ? 376 ARG B N   1 
ATOM   3293 C  CA  . ARG B 1 116 ? -1.832  8.216   -29.907 1.00 74.92  ? 376 ARG B CA  1 
ATOM   3294 C  C   . ARG B 1 116 ? -1.543  6.778   -30.321 1.00 69.68  ? 376 ARG B C   1 
ATOM   3295 O  O   . ARG B 1 116 ? -1.971  5.839   -29.643 1.00 64.43  ? 376 ARG B O   1 
ATOM   3296 C  CB  . ARG B 1 116 ? -3.341  8.499   -29.990 1.00 75.82  ? 376 ARG B CB  1 
ATOM   3297 C  CG  . ARG B 1 116 ? -3.887  8.721   -31.359 1.00 79.00  ? 376 ARG B CG  1 
ATOM   3298 C  CD  . ARG B 1 116 ? -5.298  9.350   -31.294 1.00 81.86  ? 376 ARG B CD  1 
ATOM   3299 N  NE  . ARG B 1 116 ? -6.293  8.412   -30.770 1.00 82.26  ? 376 ARG B NE  1 
ATOM   3300 C  CZ  . ARG B 1 116 ? -7.594  8.434   -31.057 1.00 82.56  ? 376 ARG B CZ  1 
ATOM   3301 N  NH1 . ARG B 1 116 ? -8.101  9.343   -31.880 1.00 82.92  ? 376 ARG B NH1 1 
ATOM   3302 N  NH2 . ARG B 1 116 ? -8.400  7.523   -30.524 1.00 79.82  ? 376 ARG B NH2 1 
ATOM   3303 N  N   . MET B 1 117 ? -0.802  6.573   -31.389 1.00 69.65  ? 377 MET B N   1 
ATOM   3304 C  CA  . MET B 1 117 ? -0.467  5.208   -31.743 1.00 69.04  ? 377 MET B CA  1 
ATOM   3305 C  C   . MET B 1 117 ? 0.737   4.706   -30.951 1.00 63.76  ? 377 MET B C   1 
ATOM   3306 O  O   . MET B 1 117 ? 1.594   5.471   -30.514 1.00 58.77  ? 377 MET B O   1 
ATOM   3307 C  CB  . MET B 1 117 ? -0.248  5.076   -33.245 1.00 72.73  ? 377 MET B CB  1 
ATOM   3308 C  CG  . MET B 1 117 ? -1.543  5.178   -34.051 1.00 74.31  ? 377 MET B CG  1 
ATOM   3309 S  SD  . MET B 1 117 ? -1.316  5.008   -35.837 1.00 81.03  ? 377 MET B SD  1 
ATOM   3310 C  CE  . MET B 1 117 ? -2.773  4.016   -36.145 1.00 79.57  ? 377 MET B CE  1 
ATOM   3311 N  N   . GLY B 1 118 ? 0.789   3.392   -30.790 1.00 64.75  ? 378 GLY B N   1 
ATOM   3312 C  CA  . GLY B 1 118 ? 1.758   2.751   -29.904 1.00 64.78  ? 378 GLY B CA  1 
ATOM   3313 C  C   . GLY B 1 118 ? 3.210   2.609   -30.344 1.00 64.16  ? 378 GLY B C   1 
ATOM   3314 O  O   . GLY B 1 118 ? 3.951   1.842   -29.729 1.00 62.33  ? 378 GLY B O   1 
ATOM   3315 N  N   . ASN B 1 119 ? 3.632   3.341   -31.375 1.00 64.40  ? 379 ASN B N   1 
ATOM   3316 C  CA  . ASN B 1 119 ? 5.046   3.350   -31.760 1.00 65.77  ? 379 ASN B CA  1 
ATOM   3317 C  C   . ASN B 1 119 ? 5.909   4.067   -30.714 1.00 66.20  ? 379 ASN B C   1 
ATOM   3318 O  O   . ASN B 1 119 ? 7.136   3.910   -30.680 1.00 63.26  ? 379 ASN B O   1 
ATOM   3319 C  CB  . ASN B 1 119 ? 5.239   3.990   -33.130 1.00 69.26  ? 379 ASN B CB  1 
ATOM   3320 C  CG  . ASN B 1 119 ? 4.698   5.400   -33.197 1.00 74.51  ? 379 ASN B CG  1 
ATOM   3321 O  OD1 . ASN B 1 119 ? 3.579   5.661   -32.781 1.00 76.55  ? 379 ASN B OD1 1 
ATOM   3322 N  ND2 . ASN B 1 119 ? 5.486   6.308   -33.741 1.00 77.70  ? 379 ASN B ND2 1 
ATOM   3323 N  N   . LYS B 1 120 ? 5.246   4.890   -29.906 1.00 67.65  ? 380 LYS B N   1 
ATOM   3324 C  CA  . LYS B 1 120 ? 5.795   5.461   -28.690 1.00 67.57  ? 380 LYS B CA  1 
ATOM   3325 C  C   . LYS B 1 120 ? 4.653   5.548   -27.694 1.00 67.30  ? 380 LYS B C   1 
ATOM   3326 O  O   . LYS B 1 120 ? 3.480   5.389   -28.042 1.00 61.56  ? 380 LYS B O   1 
ATOM   3327 C  CB  . LYS B 1 120 ? 6.400   6.855   -28.930 1.00 68.94  ? 380 LYS B CB  1 
ATOM   3328 C  CG  . LYS B 1 120 ? 7.930   6.884   -29.113 1.00 71.44  ? 380 LYS B CG  1 
ATOM   3329 C  CD  . LYS B 1 120 ? 8.339   6.774   -30.581 1.00 78.02  ? 380 LYS B CD  1 
ATOM   3330 C  CE  . LYS B 1 120 ? 9.630   5.959   -30.787 1.00 80.38  ? 380 LYS B CE  1 
ATOM   3331 N  NZ  . LYS B 1 120 ? 9.776   5.546   -32.229 1.00 82.13  ? 380 LYS B NZ  1 
ATOM   3332 N  N   . GLY B 1 121 ? 5.015   5.813   -26.448 1.00 69.54  ? 381 GLY B N   1 
ATOM   3333 C  CA  . GLY B 1 121 ? 4.068   5.792   -25.344 1.00 67.43  ? 381 GLY B CA  1 
ATOM   3334 C  C   . GLY B 1 121 ? 4.662   5.084   -24.154 1.00 66.83  ? 381 GLY B C   1 
ATOM   3335 O  O   . GLY B 1 121 ? 5.894   5.003   -24.007 1.00 67.30  ? 381 GLY B O   1 
ATOM   3336 N  N   . GLY B 1 122 ? 3.776   4.584   -23.297 1.00 65.38  ? 382 GLY B N   1 
ATOM   3337 C  CA  . GLY B 1 122 ? 4.184   3.856   -22.099 1.00 62.54  ? 382 GLY B CA  1 
ATOM   3338 C  C   . GLY B 1 122 ? 3.213   2.764   -21.724 1.00 62.80  ? 382 GLY B C   1 
ATOM   3339 O  O   . GLY B 1 122 ? 2.028   2.815   -22.071 1.00 65.70  ? 382 GLY B O   1 
ATOM   3340 N  N   . VAL B 1 123 ? 3.733   1.749   -21.052 1.00 63.09  ? 383 VAL B N   1 
ATOM   3341 C  CA  . VAL B 1 123 ? 2.909   0.698   -20.454 1.00 62.16  ? 383 VAL B CA  1 
ATOM   3342 C  C   . VAL B 1 123 ? 3.204   0.765   -18.974 1.00 58.65  ? 383 VAL B C   1 
ATOM   3343 O  O   . VAL B 1 123 ? 4.222   1.331   -18.571 1.00 56.65  ? 383 VAL B O   1 
ATOM   3344 C  CB  . VAL B 1 123 ? 3.248   -0.720  -21.007 1.00 49.26  ? 383 VAL B CB  1 
ATOM   3345 C  CG1 . VAL B 1 123 ? 3.047   -0.784  -22.505 1.00 47.75  ? 383 VAL B CG1 1 
ATOM   3346 C  CG2 . VAL B 1 123 ? 4.664   -1.102  -20.658 1.00 51.59  ? 383 VAL B CG2 1 
ATOM   3347 N  N   . ALA B 1 124 ? 2.324   0.214   -18.155 1.00 58.15  ? 384 ALA B N   1 
ATOM   3348 C  CA  . ALA B 1 124 ? 2.575   0.207   -16.717 1.00 62.93  ? 384 ALA B CA  1 
ATOM   3349 C  C   . ALA B 1 124 ? 1.814   -0.898  -15.977 1.00 64.16  ? 384 ALA B C   1 
ATOM   3350 O  O   . ALA B 1 124 ? 0.693   -1.258  -16.362 1.00 63.22  ? 384 ALA B O   1 
ATOM   3351 C  CB  . ALA B 1 124 ? 2.249   1.569   -16.126 1.00 62.92  ? 384 ALA B CB  1 
ATOM   3352 N  N   . ILE B 1 125 ? 2.440   -1.448  -14.934 1.00 61.85  ? 385 ILE B N   1 
ATOM   3353 C  CA  . ILE B 1 125 ? 1.798   -2.464  -14.104 1.00 59.92  ? 385 ILE B CA  1 
ATOM   3354 C  C   . ILE B 1 125 ? 1.822   -1.929  -12.699 1.00 65.34  ? 385 ILE B C   1 
ATOM   3355 O  O   . ILE B 1 125 ? 2.888   -1.581  -12.191 1.00 66.39  ? 385 ILE B O   1 
ATOM   3356 C  CB  . ILE B 1 125 ? 2.545   -3.819  -14.108 1.00 53.89  ? 385 ILE B CB  1 
ATOM   3357 C  CG1 . ILE B 1 125 ? 2.672   -4.397  -15.514 1.00 50.65  ? 385 ILE B CG1 1 
ATOM   3358 C  CG2 . ILE B 1 125 ? 1.802   -4.831  -13.272 1.00 55.26  ? 385 ILE B CG2 1 
ATOM   3359 C  CD1 . ILE B 1 125 ? 3.742   -5.461  -15.607 1.00 48.14  ? 385 ILE B CD1 1 
ATOM   3360 N  N   . ARG B 1 126 ? 0.657   -1.855  -12.071 1.00 67.60  ? 386 ARG B N   1 
ATOM   3361 C  CA  . ARG B 1 126 ? 0.597   -1.501  -10.664 1.00 68.30  ? 386 ARG B CA  1 
ATOM   3362 C  C   . ARG B 1 126 ? 0.035   -2.671  -9.884  1.00 70.93  ? 386 ARG B C   1 
ATOM   3363 O  O   . ARG B 1 126 ? -0.605  -3.571  -10.445 1.00 72.97  ? 386 ARG B O   1 
ATOM   3364 C  CB  . ARG B 1 126 ? -0.221  -0.221  -10.433 1.00 66.49  ? 386 ARG B CB  1 
ATOM   3365 C  CG  . ARG B 1 126 ? -1.701  -0.325  -10.735 1.00 68.06  ? 386 ARG B CG  1 
ATOM   3366 C  CD  . ARG B 1 126 ? -2.488  -0.999  -9.619  1.00 71.86  ? 386 ARG B CD  1 
ATOM   3367 N  NE  . ARG B 1 126 ? -2.525  -0.179  -8.413  1.00 74.43  ? 386 ARG B NE  1 
ATOM   3368 C  CZ  . ARG B 1 126 ? -2.831  -0.627  -7.195  1.00 72.17  ? 386 ARG B CZ  1 
ATOM   3369 N  NH1 . ARG B 1 126 ? -3.142  -1.903  -6.991  1.00 68.39  ? 386 ARG B NH1 1 
ATOM   3370 N  NH2 . ARG B 1 126 ? -2.838  0.219   -6.169  1.00 73.52  ? 386 ARG B NH2 1 
ATOM   3371 N  N   . PHE B 1 127 ? 0.282   -2.660  -8.584  1.00 69.91  ? 387 PHE B N   1 
ATOM   3372 C  CA  . PHE B 1 127 ? -0.113  -3.769  -7.727  1.00 70.36  ? 387 PHE B CA  1 
ATOM   3373 C  C   . PHE B 1 127 ? 0.135   -3.416  -6.262  1.00 71.74  ? 387 PHE B C   1 
ATOM   3374 O  O   . PHE B 1 127 ? 0.849   -2.461  -5.947  1.00 67.98  ? 387 PHE B O   1 
ATOM   3375 C  CB  . PHE B 1 127 ? 0.636   -5.068  -8.109  1.00 66.20  ? 387 PHE B CB  1 
ATOM   3376 C  CG  . PHE B 1 127 ? 2.138   -4.970  -8.006  1.00 64.01  ? 387 PHE B CG  1 
ATOM   3377 C  CD1 . PHE B 1 127 ? 2.816   -5.599  -6.977  1.00 63.93  ? 387 PHE B CD1 1 
ATOM   3378 C  CD2 . PHE B 1 127 ? 2.875   -4.259  -8.939  1.00 62.21  ? 387 PHE B CD2 1 
ATOM   3379 C  CE1 . PHE B 1 127 ? 4.207   -5.514  -6.882  1.00 63.80  ? 387 PHE B CE1 1 
ATOM   3380 C  CE2 . PHE B 1 127 ? 4.264   -4.165  -8.845  1.00 61.60  ? 387 PHE B CE2 1 
ATOM   3381 C  CZ  . PHE B 1 127 ? 4.926   -4.789  -7.828  1.00 63.69  ? 387 PHE B CZ  1 
ATOM   3382 N  N   . GLN B 1 128 ? -0.468  -4.187  -5.374  1.00 74.51  ? 388 GLN B N   1 
ATOM   3383 C  CA  . GLN B 1 128 ? -0.216  -4.028  -3.968  1.00 81.30  ? 388 GLN B CA  1 
ATOM   3384 C  C   . GLN B 1 128 ? 0.604   -5.217  -3.519  1.00 81.34  ? 388 GLN B C   1 
ATOM   3385 O  O   . GLN B 1 128 ? 0.278   -6.360  -3.841  1.00 82.17  ? 388 GLN B O   1 
ATOM   3386 C  CB  . GLN B 1 128 ? -1.526  -3.946  -3.191  1.00 87.81  ? 388 GLN B CB  1 
ATOM   3387 C  CG  . GLN B 1 128 ? -1.397  -3.371  -1.781  1.00 91.19  ? 388 GLN B CG  1 
ATOM   3388 C  CD  . GLN B 1 128 ? -2.748  -3.201  -1.087  1.00 97.10  ? 388 GLN B CD  1 
ATOM   3389 O  OE1 . GLN B 1 128 ? -3.799  -3.169  -1.732  1.00 98.36  ? 388 GLN B OE1 1 
ATOM   3390 N  NE2 . GLN B 1 128 ? -2.720  -3.081  0.233   1.00 100.91 ? 388 GLN B NE2 1 
ATOM   3391 N  N   . PHE B 1 129 ? 1.687   -4.931  -2.802  1.00 78.92  ? 389 PHE B N   1 
ATOM   3392 C  CA  . PHE B 1 129 ? 2.516   -5.953  -2.183  1.00 77.05  ? 389 PHE B CA  1 
ATOM   3393 C  C   . PHE B 1 129 ? 2.421   -5.728  -0.673  1.00 80.11  ? 389 PHE B C   1 
ATOM   3394 O  O   . PHE B 1 129 ? 2.814   -4.681  -0.158  1.00 76.10  ? 389 PHE B O   1 
ATOM   3395 C  CB  . PHE B 1 129 ? 3.954   -5.857  -2.715  1.00 72.50  ? 389 PHE B CB  1 
ATOM   3396 C  CG  . PHE B 1 129 ? 4.889   -6.931  -2.207  1.00 73.87  ? 389 PHE B CG  1 
ATOM   3397 C  CD1 . PHE B 1 129 ? 4.460   -8.239  -2.006  1.00 75.74  ? 389 PHE B CD1 1 
ATOM   3398 C  CD2 . PHE B 1 129 ? 6.221   -6.636  -1.967  1.00 73.77  ? 389 PHE B CD2 1 
ATOM   3399 C  CE1 . PHE B 1 129 ? 5.337   -9.214  -1.551  1.00 74.81  ? 389 PHE B CE1 1 
ATOM   3400 C  CE2 . PHE B 1 129 ? 7.101   -7.610  -1.514  1.00 73.34  ? 389 PHE B CE2 1 
ATOM   3401 C  CZ  . PHE B 1 129 ? 6.661   -8.894  -1.313  1.00 74.09  ? 389 PHE B CZ  1 
ATOM   3402 N  N   . HIS B 1 130 ? 1.872   -6.727  0.013   1.00 83.67  ? 390 HIS B N   1 
ATOM   3403 C  CA  . HIS B 1 130 ? 1.459   -6.617  1.410   1.00 84.07  ? 390 HIS B CA  1 
ATOM   3404 C  C   . HIS B 1 130 ? 0.526   -5.417  1.546   1.00 87.14  ? 390 HIS B C   1 
ATOM   3405 O  O   . HIS B 1 130 ? -0.552  -5.435  0.958   1.00 85.98  ? 390 HIS B O   1 
ATOM   3406 C  CB  . HIS B 1 130 ? 2.664   -6.585  2.344   1.00 82.03  ? 390 HIS B CB  1 
ATOM   3407 C  CG  . HIS B 1 130 ? 3.458   -7.856  2.339   1.00 82.34  ? 390 HIS B CG  1 
ATOM   3408 N  ND1 . HIS B 1 130 ? 3.188   -8.905  3.190   1.00 83.04  ? 390 HIS B ND1 1 
ATOM   3409 C  CD2 . HIS B 1 130 ? 4.514   -8.246  1.585   1.00 81.37  ? 390 HIS B CD2 1 
ATOM   3410 C  CE1 . HIS B 1 130 ? 4.045   -9.886  2.964   1.00 81.21  ? 390 HIS B CE1 1 
ATOM   3411 N  NE2 . HIS B 1 130 ? 4.864   -9.509  1.999   1.00 80.40  ? 390 HIS B NE2 1 
ATOM   3412 N  N   . ASN B 1 131 ? 0.911   -4.371  2.272   1.00 91.08  ? 391 ASN B N   1 
ATOM   3413 C  CA  . ASN B 1 131 ? 0.059   -3.179  2.352   1.00 93.00  ? 391 ASN B CA  1 
ATOM   3414 C  C   . ASN B 1 131 ? 0.676   -1.960  1.675   1.00 90.84  ? 391 ASN B C   1 
ATOM   3415 O  O   . ASN B 1 131 ? 0.431   -0.827  2.079   1.00 93.84  ? 391 ASN B O   1 
ATOM   3416 C  CB  . ASN B 1 131 ? -0.323  -2.904  3.797   1.00 95.75  ? 391 ASN B CB  1 
ATOM   3417 C  CG  . ASN B 1 131 ? -1.052  -4.078  4.423   1.00 100.55 ? 391 ASN B CG  1 
ATOM   3418 O  OD1 . ASN B 1 131 ? -1.676  -4.875  3.717   1.00 98.23  ? 391 ASN B OD1 1 
ATOM   3419 N  ND2 . ASN B 1 131 ? -0.973  -4.200  5.748   1.00 107.70 ? 391 ASN B ND2 1 
ATOM   3420 N  N   . THR B 1 132 ? 1.444   -2.221  0.614   1.00 84.33  ? 392 THR B N   1 
ATOM   3421 C  CA  . THR B 1 132 ? 2.129   -1.186  -0.152  1.00 80.47  ? 392 THR B CA  1 
ATOM   3422 C  C   . THR B 1 132 ? 1.667   -1.234  -1.602  1.00 78.04  ? 392 THR B C   1 
ATOM   3423 O  O   . THR B 1 132 ? 1.587   -2.306  -2.195  1.00 78.59  ? 392 THR B O   1 
ATOM   3424 C  CB  . THR B 1 132 ? 3.664   -1.369  -0.110  1.00 76.42  ? 392 THR B CB  1 
ATOM   3425 O  OG1 . THR B 1 132 ? 4.114   -1.311  1.247   1.00 81.95  ? 392 THR B OG1 1 
ATOM   3426 C  CG2 . THR B 1 132 ? 4.369   -0.282  -0.897  1.00 71.01  ? 392 THR B CG2 1 
ATOM   3427 N  N   . SER B 1 133 ? 1.370   -0.065  -2.158  1.00 75.27  ? 393 SER B N   1 
ATOM   3428 C  CA  . SER B 1 133 ? 0.958   0.060   -3.543  1.00 77.21  ? 393 SER B CA  1 
ATOM   3429 C  C   . SER B 1 133 ? 2.165   0.482   -4.391  1.00 78.62  ? 393 SER B C   1 
ATOM   3430 O  O   . SER B 1 133 ? 2.809   1.494   -4.122  1.00 81.14  ? 393 SER B O   1 
ATOM   3431 C  CB  . SER B 1 133 ? -0.178  1.077   -3.663  1.00 78.76  ? 393 SER B CB  1 
ATOM   3432 O  OG  . SER B 1 133 ? 0.217   2.352   -3.177  1.00 83.15  ? 393 SER B OG  1 
ATOM   3433 N  N   . ILE B 1 134 ? 2.474   -0.313  -5.409  1.00 74.79  ? 394 ILE B N   1 
ATOM   3434 C  CA  . ILE B 1 134 ? 3.620   -0.067  -6.271  1.00 70.25  ? 394 ILE B CA  1 
ATOM   3435 C  C   . ILE B 1 134 ? 3.087   0.030   -7.669  1.00 66.40  ? 394 ILE B C   1 
ATOM   3436 O  O   . ILE B 1 134 ? 2.208   -0.752  -8.039  1.00 66.16  ? 394 ILE B O   1 
ATOM   3437 C  CB  . ILE B 1 134 ? 4.631   -1.239  -6.220  1.00 68.72  ? 394 ILE B CB  1 
ATOM   3438 C  CG1 . ILE B 1 134 ? 5.112   -1.482  -4.772  1.00 68.12  ? 394 ILE B CG1 1 
ATOM   3439 C  CG2 . ILE B 1 134 ? 5.800   -0.972  -7.164  1.00 64.70  ? 394 ILE B CG2 1 
ATOM   3440 C  CD1 . ILE B 1 134 ? 5.544   -2.897  -4.497  1.00 66.28  ? 394 ILE B CD1 1 
ATOM   3441 N  N   . CYS B 1 135 ? 3.591   1.002   -8.427  1.00 65.34  ? 395 CYS B N   1 
ATOM   3442 C  CA  . CYS B 1 135 ? 3.264   1.144   -9.853  1.00 66.95  ? 395 CYS B CA  1 
ATOM   3443 C  C   . CYS B 1 135 ? 4.540   1.286   -10.632 1.00 66.57  ? 395 CYS B C   1 
ATOM   3444 O  O   . CYS B 1 135 ? 5.393   2.096   -10.282 1.00 67.76  ? 395 CYS B O   1 
ATOM   3445 C  CB  . CYS B 1 135 ? 2.382   2.359   -10.137 1.00 65.80  ? 395 CYS B CB  1 
ATOM   3446 S  SG  . CYS B 1 135 ? 2.125   2.658   -11.937 1.00 75.74  ? 395 CYS B SG  1 
ATOM   3447 N  N   . VAL B 1 136 ? 4.652   0.503   -11.696 1.00 60.62  ? 396 VAL B N   1 
ATOM   3448 C  CA  . VAL B 1 136 ? 5.860   0.434   -12.487 1.00 60.70  ? 396 VAL B CA  1 
ATOM   3449 C  C   . VAL B 1 136 ? 5.542   0.800   -13.935 1.00 63.68  ? 396 VAL B C   1 
ATOM   3450 O  O   . VAL B 1 136 ? 4.711   0.152   -14.587 1.00 65.89  ? 396 VAL B O   1 
ATOM   3451 C  CB  . VAL B 1 136 ? 6.458   -0.991  -12.464 1.00 61.63  ? 396 VAL B CB  1 
ATOM   3452 C  CG1 . VAL B 1 136 ? 7.644   -1.062  -13.417 1.00 62.50  ? 396 VAL B CG1 1 
ATOM   3453 C  CG2 . VAL B 1 136 ? 6.859   -1.425  -11.046 1.00 57.13  ? 396 VAL B CG2 1 
ATOM   3454 N  N   . VAL B 1 137 ? 6.209   1.828   -14.442 1.00 62.62  ? 397 VAL B N   1 
ATOM   3455 C  CA  . VAL B 1 137 ? 5.966   2.307   -15.787 1.00 62.26  ? 397 VAL B CA  1 
ATOM   3456 C  C   . VAL B 1 137 ? 7.172   2.097   -16.656 1.00 63.82  ? 397 VAL B C   1 
ATOM   3457 O  O   . VAL B 1 137 ? 8.297   2.333   -16.227 1.00 66.32  ? 397 VAL B O   1 
ATOM   3458 C  CB  . VAL B 1 137 ? 5.706   3.806   -15.813 1.00 61.52  ? 397 VAL B CB  1 
ATOM   3459 C  CG1 . VAL B 1 137 ? 5.374   4.213   -17.226 1.00 60.50  ? 397 VAL B CG1 1 
ATOM   3460 C  CG2 . VAL B 1 137 ? 4.587   4.184   -14.830 1.00 59.29  ? 397 VAL B CG2 1 
ATOM   3461 N  N   . ASN B 1 138 ? 6.912   1.687   -17.890 1.00 62.99  ? 398 ASN B N   1 
ATOM   3462 C  CA  . ASN B 1 138 ? 7.922   1.581   -18.939 1.00 61.11  ? 398 ASN B CA  1 
ATOM   3463 C  C   . ASN B 1 138 ? 7.476   2.459   -20.093 1.00 61.20  ? 398 ASN B C   1 
ATOM   3464 O  O   . ASN B 1 138 ? 6.395   2.265   -20.624 1.00 60.98  ? 398 ASN B O   1 
ATOM   3465 C  CB  . ASN B 1 138 ? 8.008   0.134   -19.408 1.00 58.11  ? 398 ASN B CB  1 
ATOM   3466 C  CG  . ASN B 1 138 ? 8.982   -0.067  -20.539 1.00 60.35  ? 398 ASN B CG  1 
ATOM   3467 O  OD1 . ASN B 1 138 ? 9.900   0.726   -20.740 1.00 63.55  ? 398 ASN B OD1 1 
ATOM   3468 N  ND2 . ASN B 1 138 ? 8.791   -1.148  -21.284 1.00 60.27  ? 398 ASN B ND2 1 
ATOM   3469 N  N   . SER B 1 139 ? 8.291   3.428   -20.474 1.00 62.24  ? 399 SER B N   1 
ATOM   3470 C  CA  . SER B 1 139 ? 7.912   4.338   -21.546 1.00 66.10  ? 399 SER B CA  1 
ATOM   3471 C  C   . SER B 1 139 ? 8.999   4.420   -22.596 1.00 68.04  ? 399 SER B C   1 
ATOM   3472 O  O   . SER B 1 139 ? 10.182  4.385   -22.277 1.00 72.15  ? 399 SER B O   1 
ATOM   3473 C  CB  . SER B 1 139 ? 7.603   5.733   -21.004 1.00 66.34  ? 399 SER B CB  1 
ATOM   3474 O  OG  . SER B 1 139 ? 8.774   6.365   -20.508 1.00 67.91  ? 399 SER B OG  1 
ATOM   3475 N  N   . HIS B 1 140 ? 8.582   4.505   -23.853 1.00 66.82  ? 400 HIS B N   1 
ATOM   3476 C  CA  . HIS B 1 140 ? 9.493   4.767   -24.958 1.00 68.95  ? 400 HIS B CA  1 
ATOM   3477 C  C   . HIS B 1 140 ? 9.056   6.113   -25.509 1.00 69.18  ? 400 HIS B C   1 
ATOM   3478 O  O   . HIS B 1 140 ? 7.964   6.221   -26.056 1.00 71.49  ? 400 HIS B O   1 
ATOM   3479 C  CB  . HIS B 1 140 ? 9.384   3.652   -26.003 1.00 69.18  ? 400 HIS B CB  1 
ATOM   3480 C  CG  . HIS B 1 140 ? 10.433  3.711   -27.065 1.00 71.70  ? 400 HIS B CG  1 
ATOM   3481 N  ND1 . HIS B 1 140 ? 10.396  2.911   -28.188 1.00 70.89  ? 400 HIS B ND1 1 
ATOM   3482 C  CD2 . HIS B 1 140 ? 11.542  4.480   -27.186 1.00 72.69  ? 400 HIS B CD2 1 
ATOM   3483 C  CE1 . HIS B 1 140 ? 11.443  3.181   -28.949 1.00 70.14  ? 400 HIS B CE1 1 
ATOM   3484 N  NE2 . HIS B 1 140 ? 12.156  4.125   -28.363 1.00 72.88  ? 400 HIS B NE2 1 
ATOM   3485 N  N   . LEU B 1 141 ? 9.870   7.144   -25.308 1.00 67.11  ? 401 LEU B N   1 
ATOM   3486 C  CA  . LEU B 1 141 ? 9.465   8.507   -25.646 1.00 71.49  ? 401 LEU B CA  1 
ATOM   3487 C  C   . LEU B 1 141 ? 10.024  8.909   -26.998 1.00 74.20  ? 401 LEU B C   1 
ATOM   3488 O  O   . LEU B 1 141 ? 10.888  8.229   -27.539 1.00 77.10  ? 401 LEU B O   1 
ATOM   3489 C  CB  . LEU B 1 141 ? 9.930   9.492   -24.571 1.00 72.82  ? 401 LEU B CB  1 
ATOM   3490 C  CG  . LEU B 1 141 ? 9.473   9.172   -23.148 1.00 71.63  ? 401 LEU B CG  1 
ATOM   3491 C  CD1 . LEU B 1 141 ? 9.959   10.232  -22.181 1.00 72.98  ? 401 LEU B CD1 1 
ATOM   3492 C  CD2 . LEU B 1 141 ? 7.963   9.034   -23.082 1.00 69.91  ? 401 LEU B CD2 1 
ATOM   3493 N  N   . ALA B 1 142 ? 9.536   10.025  -27.534 1.00 73.72  ? 402 ALA B N   1 
ATOM   3494 C  CA  . ALA B 1 142 ? 9.916   10.486  -28.867 1.00 74.24  ? 402 ALA B CA  1 
ATOM   3495 C  C   . ALA B 1 142 ? 11.443  10.605  -29.068 1.00 80.75  ? 402 ALA B C   1 
ATOM   3496 O  O   . ALA B 1 142 ? 12.173  10.939  -28.134 1.00 82.87  ? 402 ALA B O   1 
ATOM   3497 C  CB  . ALA B 1 142 ? 9.239   11.791  -29.144 1.00 72.86  ? 402 ALA B CB  1 
ATOM   3498 N  N   . ALA B 1 143 ? 11.901  10.358  -30.302 1.00 85.11  ? 403 ALA B N   1 
ATOM   3499 C  CA  . ALA B 1 143 ? 13.337  10.201  -30.634 1.00 89.04  ? 403 ALA B CA  1 
ATOM   3500 C  C   . ALA B 1 143 ? 14.016  11.361  -31.388 1.00 94.06  ? 403 ALA B C   1 
ATOM   3501 O  O   . ALA B 1 143 ? 15.171  11.218  -31.804 1.00 92.56  ? 403 ALA B O   1 
ATOM   3502 C  CB  . ALA B 1 143 ? 13.531  8.921   -31.442 1.00 88.12  ? 403 ALA B CB  1 
ATOM   3503 N  N   . HIS B 1 144 ? 13.322  12.485  -31.576 1.00 99.21  ? 404 HIS B N   1 
ATOM   3504 C  CA  . HIS B 1 144 ? 13.873  13.616  -32.340 1.00 104.89 ? 404 HIS B CA  1 
ATOM   3505 C  C   . HIS B 1 144 ? 15.138  14.096  -31.632 1.00 109.56 ? 404 HIS B C   1 
ATOM   3506 O  O   . HIS B 1 144 ? 15.202  14.066  -30.403 1.00 109.48 ? 404 HIS B O   1 
ATOM   3507 C  CB  . HIS B 1 144 ? 12.840  14.759  -32.431 1.00 108.32 ? 404 HIS B CB  1 
ATOM   3508 C  CG  . HIS B 1 144 ? 13.117  15.771  -33.510 1.00 112.71 ? 404 HIS B CG  1 
ATOM   3509 N  ND1 . HIS B 1 144 ? 14.266  16.533  -33.550 1.00 114.56 ? 404 HIS B ND1 1 
ATOM   3510 C  CD2 . HIS B 1 144 ? 12.370  16.170  -34.568 1.00 113.17 ? 404 HIS B CD2 1 
ATOM   3511 C  CE1 . HIS B 1 144 ? 14.225  17.338  -34.597 1.00 116.83 ? 404 HIS B CE1 1 
ATOM   3512 N  NE2 . HIS B 1 144 ? 13.086  17.135  -35.233 1.00 116.12 ? 404 HIS B NE2 1 
ATOM   3513 N  N   . ILE B 1 145 ? 16.148  14.517  -32.388 1.00 102.67 ? 405 ILE B N   1 
ATOM   3514 C  CA  . ILE B 1 145 ? 17.413  14.947  -31.780 1.00 107.03 ? 405 ILE B CA  1 
ATOM   3515 C  C   . ILE B 1 145 ? 17.234  16.181  -30.873 1.00 108.03 ? 405 ILE B C   1 
ATOM   3516 O  O   . ILE B 1 145 ? 17.616  16.164  -29.702 1.00 107.90 ? 405 ILE B O   1 
ATOM   3517 C  CB  . ILE B 1 145 ? 18.485  15.247  -32.860 1.00 87.54  ? 405 ILE B CB  1 
ATOM   3518 N  N   . GLU B 1 146 ? 16.638  17.234  -31.426 1.00 108.67 ? 406 GLU B N   1 
ATOM   3519 C  CA  . GLU B 1 146 ? 16.525  18.526  -30.748 1.00 109.41 ? 406 GLU B CA  1 
ATOM   3520 C  C   . GLU B 1 146 ? 15.187  18.725  -30.032 1.00 109.37 ? 406 GLU B C   1 
ATOM   3521 O  O   . GLU B 1 146 ? 15.131  19.432  -29.018 1.00 112.87 ? 406 GLU B O   1 
ATOM   3522 C  CB  . GLU B 1 146 ? 16.743  19.668  -31.749 1.00 110.36 ? 406 GLU B CB  1 
ATOM   3523 N  N   . GLU B 1 147 ? 14.114  18.122  -30.544 1.00 104.39 ? 407 GLU B N   1 
ATOM   3524 C  CA  . GLU B 1 147 ? 12.777  18.424  -30.022 1.00 106.27 ? 407 GLU B CA  1 
ATOM   3525 C  C   . GLU B 1 147 ? 12.464  17.637  -28.750 1.00 103.80 ? 407 GLU B C   1 
ATOM   3526 O  O   . GLU B 1 147 ? 11.658  16.709  -28.749 1.00 100.22 ? 407 GLU B O   1 
ATOM   3527 C  CB  . GLU B 1 147 ? 11.682  18.249  -31.093 1.00 107.18 ? 407 GLU B CB  1 
ATOM   3528 C  CG  . GLU B 1 147 ? 11.692  19.347  -32.180 1.00 107.77 ? 407 GLU B CG  1 
ATOM   3529 C  CD  . GLU B 1 147 ? 10.303  19.919  -32.498 1.00 107.11 ? 407 GLU B CD  1 
ATOM   3530 O  OE1 . GLU B 1 147 ? 9.338   19.151  -32.658 1.00 103.78 ? 407 GLU B OE1 1 
ATOM   3531 O  OE2 . GLU B 1 147 ? 10.176  21.152  -32.605 1.00 110.54 ? 407 GLU B OE2 1 
ATOM   3532 N  N   . TYR B 1 148 ? 13.104  18.049  -27.657 1.00 105.17 ? 408 TYR B N   1 
ATOM   3533 C  CA  . TYR B 1 148 ? 12.810  17.516  -26.332 1.00 101.34 ? 408 TYR B CA  1 
ATOM   3534 C  C   . TYR B 1 148 ? 11.373  17.807  -25.880 1.00 100.59 ? 408 TYR B C   1 
ATOM   3535 O  O   . TYR B 1 148 ? 10.854  17.115  -25.017 1.00 98.60  ? 408 TYR B O   1 
ATOM   3536 C  CB  . TYR B 1 148 ? 13.827  18.024  -25.292 1.00 102.02 ? 408 TYR B CB  1 
ATOM   3537 C  CG  . TYR B 1 148 ? 13.901  19.530  -25.107 1.00 104.93 ? 408 TYR B CG  1 
ATOM   3538 C  CD1 . TYR B 1 148 ? 12.978  20.200  -24.311 1.00 105.56 ? 408 TYR B CD1 1 
ATOM   3539 C  CD2 . TYR B 1 148 ? 14.916  20.282  -25.703 1.00 107.37 ? 408 TYR B CD2 1 
ATOM   3540 C  CE1 . TYR B 1 148 ? 13.049  21.591  -24.130 1.00 109.22 ? 408 TYR B CE1 1 
ATOM   3541 C  CE2 . TYR B 1 148 ? 14.993  21.667  -25.530 1.00 110.58 ? 408 TYR B CE2 1 
ATOM   3542 C  CZ  . TYR B 1 148 ? 14.056  22.317  -24.742 1.00 110.81 ? 408 TYR B CZ  1 
ATOM   3543 O  OH  . TYR B 1 148 ? 14.120  23.685  -24.560 1.00 111.30 ? 408 TYR B OH  1 
ATOM   3544 N  N   . GLU B 1 149 ? 10.729  18.821  -26.455 1.00 102.22 ? 409 GLU B N   1 
ATOM   3545 C  CA  . GLU B 1 149 ? 9.318   19.088  -26.158 1.00 101.27 ? 409 GLU B CA  1 
ATOM   3546 C  C   . GLU B 1 149 ? 8.415   17.893  -26.463 1.00 94.25  ? 409 GLU B C   1 
ATOM   3547 O  O   . GLU B 1 149 ? 7.406   17.704  -25.791 1.00 93.06  ? 409 GLU B O   1 
ATOM   3548 C  CB  . GLU B 1 149 ? 8.798   20.309  -26.923 1.00 107.90 ? 409 GLU B CB  1 
ATOM   3549 C  CG  . GLU B 1 149 ? 9.374   21.655  -26.466 1.00 117.35 ? 409 GLU B CG  1 
ATOM   3550 C  CD  . GLU B 1 149 ? 10.311  22.303  -27.485 1.00 122.78 ? 409 GLU B CD  1 
ATOM   3551 O  OE1 . GLU B 1 149 ? 10.633  21.644  -28.512 1.00 121.13 ? 409 GLU B OE1 1 
ATOM   3552 O  OE2 . GLU B 1 149 ? 10.715  23.475  -27.250 1.00 125.64 ? 409 GLU B OE2 1 
ATOM   3553 N  N   . ARG B 1 150 ? 8.762   17.098  -27.473 1.00 91.72  ? 410 ARG B N   1 
ATOM   3554 C  CA  . ARG B 1 150 ? 7.952   15.924  -27.816 1.00 92.94  ? 410 ARG B CA  1 
ATOM   3555 C  C   . ARG B 1 150 ? 8.022   14.876  -26.708 1.00 88.98  ? 410 ARG B C   1 
ATOM   3556 O  O   . ARG B 1 150 ? 7.014   14.271  -26.345 1.00 85.13  ? 410 ARG B O   1 
ATOM   3557 C  CB  . ARG B 1 150 ? 8.351   15.328  -29.175 1.00 95.44  ? 410 ARG B CB  1 
ATOM   3558 C  CG  . ARG B 1 150 ? 7.822   16.140  -30.353 1.00 100.97 ? 410 ARG B CG  1 
ATOM   3559 C  CD  . ARG B 1 150 ? 8.128   15.523  -31.725 1.00 106.26 ? 410 ARG B CD  1 
ATOM   3560 N  NE  . ARG B 1 150 ? 7.824   16.487  -32.792 1.00 114.32 ? 410 ARG B NE  1 
ATOM   3561 C  CZ  . ARG B 1 150 ? 8.010   16.304  -34.105 1.00 114.60 ? 410 ARG B CZ  1 
ATOM   3562 N  NH1 . ARG B 1 150 ? 8.505   15.163  -34.585 1.00 110.76 ? 410 ARG B NH1 1 
ATOM   3563 N  NH2 . ARG B 1 150 ? 7.691   17.286  -34.951 1.00 115.89 ? 410 ARG B NH2 1 
ATOM   3564 N  N   . ARG B 1 151 ? 9.210   14.677  -26.161 1.00 87.05  ? 411 ARG B N   1 
ATOM   3565 C  CA  . ARG B 1 151 ? 9.369   13.805  -25.008 1.00 83.60  ? 411 ARG B CA  1 
ATOM   3566 C  C   . ARG B 1 151 ? 8.565   14.333  -23.826 1.00 83.43  ? 411 ARG B C   1 
ATOM   3567 O  O   . ARG B 1 151 ? 7.830   13.591  -23.193 1.00 82.00  ? 411 ARG B O   1 
ATOM   3568 C  CB  . ARG B 1 151 ? 10.845  13.669  -24.634 1.00 84.55  ? 411 ARG B CB  1 
ATOM   3569 C  CG  . ARG B 1 151 ? 11.667  12.991  -25.715 1.00 85.69  ? 411 ARG B CG  1 
ATOM   3570 C  CD  . ARG B 1 151 ? 13.126  12.825  -25.307 1.00 90.33  ? 411 ARG B CD  1 
ATOM   3571 N  NE  . ARG B 1 151 ? 13.968  13.906  -25.803 1.00 95.46  ? 411 ARG B NE  1 
ATOM   3572 C  CZ  . ARG B 1 151 ? 14.268  14.094  -27.088 1.00 95.23  ? 411 ARG B CZ  1 
ATOM   3573 N  NH1 . ARG B 1 151 ? 15.048  15.115  -27.429 1.00 95.41  ? 411 ARG B NH1 1 
ATOM   3574 N  NH2 . ARG B 1 151 ? 13.781  13.282  -28.035 1.00 92.82  ? 411 ARG B NH2 1 
ATOM   3575 N  N   . ASN B 1 152 ? 8.693   15.622  -23.541 1.00 85.39  ? 412 ASN B N   1 
ATOM   3576 C  CA  . ASN B 1 152 ? 7.915   16.241  -22.480 1.00 87.08  ? 412 ASN B CA  1 
ATOM   3577 C  C   . ASN B 1 152 ? 6.426   15.972  -22.672 1.00 84.68  ? 412 ASN B C   1 
ATOM   3578 O  O   . ASN B 1 152 ? 5.733   15.603  -21.731 1.00 83.99  ? 412 ASN B O   1 
ATOM   3579 C  CB  . ASN B 1 152 ? 8.188   17.756  -22.411 1.00 91.15  ? 412 ASN B CB  1 
ATOM   3580 C  CG  . ASN B 1 152 ? 9.607   18.087  -21.926 1.00 93.54  ? 412 ASN B CG  1 
ATOM   3581 O  OD1 . ASN B 1 152 ? 10.365  17.198  -21.538 1.00 95.19  ? 412 ASN B OD1 1 
ATOM   3582 N  ND2 . ASN B 1 152 ? 9.962   19.370  -21.950 1.00 94.88  ? 412 ASN B ND2 1 
ATOM   3583 N  N   . GLN B 1 153 ? 5.946   16.133  -23.900 1.00 82.75  ? 413 GLN B N   1 
ATOM   3584 C  CA  . GLN B 1 153 ? 4.538   15.902  -24.201 1.00 82.44  ? 413 GLN B CA  1 
ATOM   3585 C  C   . GLN B 1 153 ? 4.153   14.441  -23.982 1.00 80.13  ? 413 GLN B C   1 
ATOM   3586 O  O   . GLN B 1 153 ? 3.083   14.153  -23.453 1.00 78.44  ? 413 GLN B O   1 
ATOM   3587 C  CB  . GLN B 1 153 ? 4.219   16.322  -25.634 1.00 83.06  ? 413 GLN B CB  1 
ATOM   3588 C  CG  . GLN B 1 153 ? 2.731   16.374  -25.960 1.00 83.92  ? 413 GLN B CG  1 
ATOM   3589 C  CD  . GLN B 1 153 ? 1.971   17.386  -25.115 1.00 86.69  ? 413 GLN B CD  1 
ATOM   3590 O  OE1 . GLN B 1 153 ? 2.020   18.582  -25.372 1.00 89.67  ? 413 GLN B OE1 1 
ATOM   3591 N  NE2 . GLN B 1 153 ? 1.260   16.902  -24.106 1.00 85.21  ? 413 GLN B NE2 1 
ATOM   3592 N  N   . ASP B 1 154 ? 5.029   13.521  -24.377 1.00 81.01  ? 414 ASP B N   1 
ATOM   3593 C  CA  . ASP B 1 154 ? 4.771   12.089  -24.177 1.00 80.52  ? 414 ASP B CA  1 
ATOM   3594 C  C   . ASP B 1 154 ? 4.635   11.735  -22.690 1.00 75.59  ? 414 ASP B C   1 
ATOM   3595 O  O   . ASP B 1 154 ? 3.728   10.997  -22.310 1.00 73.59  ? 414 ASP B O   1 
ATOM   3596 C  CB  . ASP B 1 154 ? 5.874   11.223  -24.807 1.00 82.88  ? 414 ASP B CB  1 
ATOM   3597 C  CG  . ASP B 1 154 ? 5.711   11.042  -26.295 1.00 84.55  ? 414 ASP B CG  1 
ATOM   3598 O  OD1 . ASP B 1 154 ? 4.619   11.318  -26.825 1.00 84.70  ? 414 ASP B OD1 1 
ATOM   3599 O  OD2 . ASP B 1 154 ? 6.690   10.607  -26.941 1.00 85.03  ? 414 ASP B OD2 1 
ATOM   3600 N  N   . TYR B 1 155 ? 5.536   12.241  -21.856 1.00 72.65  ? 415 TYR B N   1 
ATOM   3601 C  CA  . TYR B 1 155 ? 5.447   11.986  -20.418 1.00 73.34  ? 415 TYR B CA  1 
ATOM   3602 C  C   . TYR B 1 155 ? 4.150   12.550  -19.842 1.00 73.48  ? 415 TYR B C   1 
ATOM   3603 O  O   . TYR B 1 155 ? 3.444   11.859  -19.122 1.00 71.07  ? 415 TYR B O   1 
ATOM   3604 C  CB  . TYR B 1 155 ? 6.660   12.559  -19.688 1.00 78.16  ? 415 TYR B CB  1 
ATOM   3605 C  CG  . TYR B 1 155 ? 6.548   12.546  -18.184 1.00 83.15  ? 415 TYR B CG  1 
ATOM   3606 C  CD1 . TYR B 1 155 ? 7.092   11.508  -17.428 1.00 83.49  ? 415 TYR B CD1 1 
ATOM   3607 C  CD2 . TYR B 1 155 ? 5.915   13.585  -17.510 1.00 87.78  ? 415 TYR B CD2 1 
ATOM   3608 C  CE1 . TYR B 1 155 ? 6.993   11.502  -16.026 1.00 86.53  ? 415 TYR B CE1 1 
ATOM   3609 C  CE2 . TYR B 1 155 ? 5.805   13.589  -16.118 1.00 92.00  ? 415 TYR B CE2 1 
ATOM   3610 C  CZ  . TYR B 1 155 ? 6.346   12.551  -15.379 1.00 91.29  ? 415 TYR B CZ  1 
ATOM   3611 O  OH  . TYR B 1 155 ? 6.233   12.582  -14.002 1.00 93.36  ? 415 TYR B OH  1 
ATOM   3612 N  N   . LYS B 1 156 ? 3.837   13.801  -20.170 1.00 75.87  ? 416 LYS B N   1 
ATOM   3613 C  CA  . LYS B 1 156 ? 2.607   14.438  -19.697 1.00 76.49  ? 416 LYS B CA  1 
ATOM   3614 C  C   . LYS B 1 156 ? 1.372   13.595  -20.048 1.00 80.26  ? 416 LYS B C   1 
ATOM   3615 O  O   . LYS B 1 156 ? 0.536   13.341  -19.179 1.00 82.81  ? 416 LYS B O   1 
ATOM   3616 C  CB  . LYS B 1 156 ? 2.470   15.859  -20.260 1.00 75.63  ? 416 LYS B CB  1 
ATOM   3617 N  N   . ASP B 1 157 ? 1.281   13.142  -21.303 1.00 80.11  ? 417 ASP B N   1 
ATOM   3618 C  CA  . ASP B 1 157 ? 0.123   12.369  -21.790 1.00 77.67  ? 417 ASP B CA  1 
ATOM   3619 C  C   . ASP B 1 157 ? 0.038   10.966  -21.174 1.00 74.37  ? 417 ASP B C   1 
ATOM   3620 O  O   . ASP B 1 157 ? -1.047  10.485  -20.862 1.00 73.24  ? 417 ASP B O   1 
ATOM   3621 C  CB  . ASP B 1 157 ? 0.179   12.206  -23.312 1.00 79.50  ? 417 ASP B CB  1 
ATOM   3622 C  CG  . ASP B 1 157 ? -0.023  13.504  -24.076 1.00 87.73  ? 417 ASP B CG  1 
ATOM   3623 O  OD1 . ASP B 1 157 ? -0.459  14.527  -23.506 1.00 92.11  ? 417 ASP B OD1 1 
ATOM   3624 O  OD2 . ASP B 1 157 ? 0.258   13.479  -25.292 1.00 90.28  ? 417 ASP B OD2 1 
ATOM   3625 N  N   . ILE B 1 158 ? 1.173   10.290  -21.036 1.00 71.13  ? 418 ILE B N   1 
ATOM   3626 C  CA  . ILE B 1 158 ? 1.183   9.027   -20.313 1.00 71.13  ? 418 ILE B CA  1 
ATOM   3627 C  C   . ILE B 1 158 ? 0.615   9.288   -18.913 1.00 73.24  ? 418 ILE B C   1 
ATOM   3628 O  O   . ILE B 1 158 ? -0.307  8.603   -18.486 1.00 73.07  ? 418 ILE B O   1 
ATOM   3629 C  CB  . ILE B 1 158 ? 2.592   8.396   -20.233 1.00 68.86  ? 418 ILE B CB  1 
ATOM   3630 C  CG1 . ILE B 1 158 ? 3.021   7.909   -21.624 1.00 65.92  ? 418 ILE B CG1 1 
ATOM   3631 C  CG2 . ILE B 1 158 ? 2.616   7.235   -19.222 1.00 64.17  ? 418 ILE B CG2 1 
ATOM   3632 C  CD1 . ILE B 1 158 ? 4.518   7.540   -21.768 1.00 62.79  ? 418 ILE B CD1 1 
ATOM   3633 N  N   . CYS B 1 159 ? 1.125   10.306  -18.221 1.00 73.06  ? 419 CYS B N   1 
ATOM   3634 C  CA  . CYS B 1 159 ? 0.663   10.587  -16.860 1.00 77.55  ? 419 CYS B CA  1 
ATOM   3635 C  C   . CYS B 1 159 ? -0.835  10.872  -16.799 1.00 78.11  ? 419 CYS B C   1 
ATOM   3636 O  O   . CYS B 1 159 ? -1.518  10.371  -15.908 1.00 78.50  ? 419 CYS B O   1 
ATOM   3637 C  CB  . CYS B 1 159 ? 1.449   11.739  -16.220 1.00 81.13  ? 419 CYS B CB  1 
ATOM   3638 S  SG  . CYS B 1 159 ? 3.144   11.288  -15.808 1.00 73.71  ? 419 CYS B SG  1 
ATOM   3639 N  N   . SER B 1 160 ? -1.349  11.650  -17.746 1.00 75.73  ? 420 SER B N   1 
ATOM   3640 C  CA  . SER B 1 160 ? -2.757  12.044  -17.704 1.00 78.29  ? 420 SER B CA  1 
ATOM   3641 C  C   . SER B 1 160 ? -3.704  10.947  -18.205 1.00 77.49  ? 420 SER B C   1 
ATOM   3642 O  O   . SER B 1 160 ? -4.763  10.738  -17.619 1.00 78.86  ? 420 SER B O   1 
ATOM   3643 C  CB  . SER B 1 160 ? -2.985  13.349  -18.471 1.00 82.14  ? 420 SER B CB  1 
ATOM   3644 O  OG  . SER B 1 160 ? -2.941  13.140  -19.868 1.00 86.71  ? 420 SER B OG  1 
ATOM   3645 N  N   . ARG B 1 161 ? -3.320  10.240  -19.267 1.00 75.30  ? 421 ARG B N   1 
ATOM   3646 C  CA  . ARG B 1 161 ? -4.191  9.223   -19.883 1.00 73.78  ? 421 ARG B CA  1 
ATOM   3647 C  C   . ARG B 1 161 ? -4.181  7.855   -19.168 1.00 74.09  ? 421 ARG B C   1 
ATOM   3648 O  O   . ARG B 1 161 ? -5.183  7.148   -19.185 1.00 73.74  ? 421 ARG B O   1 
ATOM   3649 C  CB  . ARG B 1 161 ? -3.831  9.027   -21.366 1.00 70.70  ? 421 ARG B CB  1 
ATOM   3650 C  CG  . ARG B 1 161 ? -3.823  10.306  -22.206 1.00 76.57  ? 421 ARG B CG  1 
ATOM   3651 C  CD  . ARG B 1 161 ? -4.555  10.163  -23.551 1.00 80.19  ? 421 ARG B CD  1 
ATOM   3652 N  NE  . ARG B 1 161 ? -3.686  9.739   -24.655 1.00 81.20  ? 421 ARG B NE  1 
ATOM   3653 C  CZ  . ARG B 1 161 ? -3.187  10.536  -25.607 1.00 81.83  ? 421 ARG B CZ  1 
ATOM   3654 N  NH1 . ARG B 1 161 ? -3.432  11.849  -25.625 1.00 81.56  ? 421 ARG B NH1 1 
ATOM   3655 N  NH2 . ARG B 1 161 ? -2.415  10.004  -26.555 1.00 81.02  ? 421 ARG B NH2 1 
ATOM   3656 N  N   . MET B 1 162 ? -3.048  7.472   -18.574 1.00 74.59  ? 422 MET B N   1 
ATOM   3657 C  CA  . MET B 1 162 ? -2.905  6.182   -17.904 1.00 74.01  ? 422 MET B CA  1 
ATOM   3658 C  C   . MET B 1 162 ? -3.806  6.180   -16.684 1.00 80.14  ? 422 MET B C   1 
ATOM   3659 O  O   . MET B 1 162 ? -3.594  6.947   -15.742 1.00 86.02  ? 422 MET B O   1 
ATOM   3660 C  CB  . MET B 1 162 ? -1.444  5.970   -17.487 1.00 73.88  ? 422 MET B CB  1 
ATOM   3661 C  CG  . MET B 1 162 ? -1.098  4.642   -16.801 1.00 72.28  ? 422 MET B CG  1 
ATOM   3662 S  SD  . MET B 1 162 ? -0.831  3.239   -17.913 1.00 82.17  ? 422 MET B SD  1 
ATOM   3663 C  CE  . MET B 1 162 ? 0.553   3.797   -18.928 1.00 55.75  ? 422 MET B CE  1 
ATOM   3664 N  N   . GLN B 1 163 ? -4.831  5.335   -16.724 1.00 81.14  ? 423 GLN B N   1 
ATOM   3665 C  CA  . GLN B 1 163 ? -5.777  5.177   -15.619 1.00 85.83  ? 423 GLN B CA  1 
ATOM   3666 C  C   . GLN B 1 163 ? -5.957  3.696   -15.298 1.00 84.39  ? 423 GLN B C   1 
ATOM   3667 O  O   . GLN B 1 163 ? -6.289  2.910   -16.187 1.00 83.98  ? 423 GLN B O   1 
ATOM   3668 C  CB  . GLN B 1 163 ? -7.142  5.739   -16.004 1.00 87.78  ? 423 GLN B CB  1 
ATOM   3669 C  CG  . GLN B 1 163 ? -7.383  7.194   -15.656 1.00 93.31  ? 423 GLN B CG  1 
ATOM   3670 C  CD  . GLN B 1 163 ? -8.846  7.567   -15.837 1.00 101.01 ? 423 GLN B CD  1 
ATOM   3671 O  OE1 . GLN B 1 163 ? -9.594  6.872   -16.534 1.00 101.44 ? 423 GLN B OE1 1 
ATOM   3672 N  NE2 . GLN B 1 163 ? -9.266  8.655   -15.205 1.00 105.67 ? 423 GLN B NE2 1 
ATOM   3673 N  N   . PHE B 1 164 ? -5.747  3.319   -14.040 1.00 82.42  ? 424 PHE B N   1 
ATOM   3674 C  CA  . PHE B 1 164 ? -6.051  1.965   -13.591 1.00 81.08  ? 424 PHE B CA  1 
ATOM   3675 C  C   . PHE B 1 164 ? -7.389  2.030   -12.872 1.00 90.49  ? 424 PHE B C   1 
ATOM   3676 O  O   . PHE B 1 164 ? -7.660  3.003   -12.150 1.00 97.17  ? 424 PHE B O   1 
ATOM   3677 C  CB  . PHE B 1 164 ? -4.972  1.431   -12.643 1.00 77.33  ? 424 PHE B CB  1 
ATOM   3678 C  CG  . PHE B 1 164 ? -3.571  1.590   -13.148 1.00 76.28  ? 424 PHE B CG  1 
ATOM   3679 C  CD1 . PHE B 1 164 ? -2.992  0.618   -13.950 1.00 74.48  ? 424 PHE B CD1 1 
ATOM   3680 C  CD2 . PHE B 1 164 ? -2.816  2.701   -12.800 1.00 77.49  ? 424 PHE B CD2 1 
ATOM   3681 C  CE1 . PHE B 1 164 ? -1.688  0.759   -14.419 1.00 73.29  ? 424 PHE B CE1 1 
ATOM   3682 C  CE2 . PHE B 1 164 ? -1.510  2.846   -13.256 1.00 77.31  ? 424 PHE B CE2 1 
ATOM   3683 C  CZ  . PHE B 1 164 ? -0.947  1.870   -14.071 1.00 75.54  ? 424 PHE B CZ  1 
ATOM   3684 N  N   . CYS B 1 165 ? -8.211  0.995   -13.050 1.00 91.35  ? 425 CYS B N   1 
ATOM   3685 C  CA  . CYS B 1 165 ? -9.563  0.956   -12.464 1.00 97.56  ? 425 CYS B CA  1 
ATOM   3686 C  C   . CYS B 1 165 ? -9.552  0.742   -10.947 1.00 98.88  ? 425 CYS B C   1 
ATOM   3687 O  O   . CYS B 1 165 ? -8.736  -0.011  -10.419 1.00 97.17  ? 425 CYS B O   1 
ATOM   3688 C  CB  . CYS B 1 165 ? -10.402 -0.142  -13.130 1.00 98.22  ? 425 CYS B CB  1 
ATOM   3689 S  SG  . CYS B 1 165 ? -9.588  -1.760  -13.146 1.00 113.83 ? 425 CYS B SG  1 
ATOM   3690 N  N   . LEU B 1 174 ? -7.355  5.223   -10.478 1.00 77.61  ? 434 LEU B N   1 
ATOM   3691 C  CA  . LEU B 1 174 ? -6.004  5.483   -9.977  1.00 79.61  ? 434 LEU B CA  1 
ATOM   3692 C  C   . LEU B 1 174 ? -5.071  5.986   -11.094 1.00 78.58  ? 434 LEU B C   1 
ATOM   3693 O  O   . LEU B 1 174 ? -5.017  5.404   -12.183 1.00 73.26  ? 434 LEU B O   1 
ATOM   3694 C  CB  . LEU B 1 174 ? -5.384  4.219   -9.338  1.00 78.58  ? 434 LEU B CB  1 
ATOM   3695 C  CG  . LEU B 1 174 ? -6.237  3.215   -8.543  1.00 81.03  ? 434 LEU B CG  1 
ATOM   3696 C  CD1 . LEU B 1 174 ? -5.349  2.106   -7.992  1.00 79.81  ? 434 LEU B CD1 1 
ATOM   3697 C  CD2 . LEU B 1 174 ? -7.043  3.863   -7.403  1.00 83.85  ? 434 LEU B CD2 1 
ATOM   3698 N  N   . THR B 1 175 ? -4.347  7.069   -10.808 1.00 81.91  ? 435 THR B N   1 
ATOM   3699 C  CA  . THR B 1 175 ? -3.254  7.532   -11.662 1.00 81.42  ? 435 THR B CA  1 
ATOM   3700 C  C   . THR B 1 175 ? -1.951  6.882   -11.212 1.00 80.12  ? 435 THR B C   1 
ATOM   3701 O  O   . THR B 1 175 ? -1.876  6.284   -10.136 1.00 82.77  ? 435 THR B O   1 
ATOM   3702 C  CB  . THR B 1 175 ? -3.071  9.081   -11.601 1.00 82.67  ? 435 THR B CB  1 
ATOM   3703 O  OG1 . THR B 1 175 ? -2.802  9.496   -10.248 1.00 86.60  ? 435 THR B OG1 1 
ATOM   3704 C  CG2 . THR B 1 175 ? -4.311  9.810   -12.148 1.00 78.97  ? 435 THR B CG2 1 
ATOM   3705 N  N   . ILE B 1 176 ? -0.929  7.011   -12.047 1.00 76.56  ? 436 ILE B N   1 
ATOM   3706 C  CA  . ILE B 1 176 ? 0.426   6.593   -11.701 1.00 76.33  ? 436 ILE B CA  1 
ATOM   3707 C  C   . ILE B 1 176 ? 0.832   7.176   -10.342 1.00 83.99  ? 436 ILE B C   1 
ATOM   3708 O  O   . ILE B 1 176 ? 1.312   6.462   -9.450  1.00 87.36  ? 436 ILE B O   1 
ATOM   3709 C  CB  . ILE B 1 176 ? 1.435   7.093   -12.759 1.00 74.13  ? 436 ILE B CB  1 
ATOM   3710 C  CG1 . ILE B 1 176 ? 1.183   6.412   -14.111 1.00 70.69  ? 436 ILE B CG1 1 
ATOM   3711 C  CG2 . ILE B 1 176 ? 2.872   6.865   -12.286 1.00 74.81  ? 436 ILE B CG2 1 
ATOM   3712 C  CD1 . ILE B 1 176 ? 2.227   6.705   -15.163 1.00 67.42  ? 436 ILE B CD1 1 
ATOM   3713 N  N   . SER B 1 177 ? 0.615   8.482   -10.194 1.00 84.96  ? 437 SER B N   1 
ATOM   3714 C  CA  . SER B 1 177 ? 0.980   9.212   -8.973  1.00 83.76  ? 437 SER B CA  1 
ATOM   3715 C  C   . SER B 1 177 ? 0.372   8.655   -7.684  1.00 80.04  ? 437 SER B C   1 
ATOM   3716 O  O   . SER B 1 177 ? 0.960   8.812   -6.632  1.00 78.90  ? 437 SER B O   1 
ATOM   3717 C  CB  . SER B 1 177 ? 0.605   10.693  -9.102  1.00 83.96  ? 437 SER B CB  1 
ATOM   3718 O  OG  . SER B 1 177 ? 1.393   11.322  -10.096 1.00 84.43  ? 437 SER B OG  1 
ATOM   3719 N  N   . ASN B 1 178 ? -0.786  8.004   -7.770  1.00 76.07  ? 438 ASN B N   1 
ATOM   3720 C  CA  . ASN B 1 178 ? -1.491  7.523   -6.590  1.00 78.01  ? 438 ASN B CA  1 
ATOM   3721 C  C   . ASN B 1 178 ? -0.938  6.168   -6.117  1.00 77.31  ? 438 ASN B C   1 
ATOM   3722 O  O   . ASN B 1 178 ? -1.656  5.170   -6.016  1.00 76.72  ? 438 ASN B O   1 
ATOM   3723 C  CB  . ASN B 1 178 ? -2.998  7.468   -6.884  1.00 79.47  ? 438 ASN B CB  1 
ATOM   3724 C  CG  . ASN B 1 178 ? -3.854  7.529   -5.624  1.00 85.65  ? 438 ASN B CG  1 
ATOM   3725 O  OD1 . ASN B 1 178 ? -3.351  7.669   -4.510  1.00 86.25  ? 438 ASN B OD1 1 
ATOM   3726 N  ND2 . ASN B 1 178 ? -5.162  7.427   -5.804  1.00 88.69  ? 438 ASN B ND2 1 
ATOM   3727 N  N   . HIS B 1 179 ? 0.354   6.149   -5.806  1.00 76.35  ? 439 HIS B N   1 
ATOM   3728 C  CA  . HIS B 1 179 ? 1.045   4.925   -5.405  1.00 75.71  ? 439 HIS B CA  1 
ATOM   3729 C  C   . HIS B 1 179 ? 2.172   5.233   -4.418  1.00 75.14  ? 439 HIS B C   1 
ATOM   3730 O  O   . HIS B 1 179 ? 2.942   6.180   -4.626  1.00 74.27  ? 439 HIS B O   1 
ATOM   3731 C  CB  . HIS B 1 179 ? 1.624   4.226   -6.645  1.00 77.26  ? 439 HIS B CB  1 
ATOM   3732 C  CG  . HIS B 1 179 ? 0.585   3.599   -7.526  1.00 75.06  ? 439 HIS B CG  1 
ATOM   3733 N  ND1 . HIS B 1 179 ? -0.082  4.302   -8.508  1.00 73.64  ? 439 HIS B ND1 1 
ATOM   3734 C  CD2 . HIS B 1 179 ? 0.083   2.341   -7.552  1.00 70.34  ? 439 HIS B CD2 1 
ATOM   3735 C  CE1 . HIS B 1 179 ? -0.948  3.500   -9.101  1.00 72.83  ? 439 HIS B CE1 1 
ATOM   3736 N  NE2 . HIS B 1 179 ? -0.868  2.308   -8.539  1.00 70.36  ? 439 HIS B NE2 1 
ATOM   3737 N  N   . ASP B 1 180 ? 2.269   4.433   -3.354  1.00 74.88  ? 440 ASP B N   1 
ATOM   3738 C  CA  . ASP B 1 180 ? 3.366   4.560   -2.384  1.00 78.99  ? 440 ASP B CA  1 
ATOM   3739 C  C   . ASP B 1 180 ? 4.723   4.578   -3.098  1.00 81.49  ? 440 ASP B C   1 
ATOM   3740 O  O   . ASP B 1 180 ? 5.560   5.428   -2.813  1.00 83.99  ? 440 ASP B O   1 
ATOM   3741 C  CB  . ASP B 1 180 ? 3.359   3.403   -1.371  1.00 81.07  ? 440 ASP B CB  1 
ATOM   3742 C  CG  . ASP B 1 180 ? 2.079   3.326   -0.560  1.00 87.80  ? 440 ASP B CG  1 
ATOM   3743 O  OD1 . ASP B 1 180 ? 1.377   4.356   -0.442  1.00 93.37  ? 440 ASP B OD1 1 
ATOM   3744 O  OD2 . ASP B 1 180 ? 1.780   2.233   -0.027  1.00 86.94  ? 440 ASP B OD2 1 
ATOM   3745 N  N   . VAL B 1 181 ? 4.925   3.635   -4.025  1.00 82.15  ? 441 VAL B N   1 
ATOM   3746 C  CA  . VAL B 1 181 ? 6.175   3.516   -4.799  1.00 81.78  ? 441 VAL B CA  1 
ATOM   3747 C  C   . VAL B 1 181 ? 5.895   3.595   -6.299  1.00 77.06  ? 441 VAL B C   1 
ATOM   3748 O  O   . VAL B 1 181 ? 4.997   2.938   -6.796  1.00 75.60  ? 441 VAL B O   1 
ATOM   3749 C  CB  . VAL B 1 181 ? 6.901   2.179   -4.473  1.00 71.79  ? 441 VAL B CB  1 
ATOM   3750 C  CG1 . VAL B 1 181 ? 8.006   1.880   -5.471  1.00 66.30  ? 441 VAL B CG1 1 
ATOM   3751 C  CG2 . VAL B 1 181 ? 7.449   2.221   -3.048  1.00 76.47  ? 441 VAL B CG2 1 
ATOM   3752 N  N   . ILE B 1 182 ? 6.651   4.432   -7.003  1.00 76.35  ? 442 ILE B N   1 
ATOM   3753 C  CA  . ILE B 1 182 ? 6.642   4.455   -8.464  1.00 75.10  ? 442 ILE B CA  1 
ATOM   3754 C  C   . ILE B 1 182 ? 8.057   4.220   -8.956  1.00 73.77  ? 442 ILE B C   1 
ATOM   3755 O  O   . ILE B 1 182 ? 8.983   4.933   -8.582  1.00 71.41  ? 442 ILE B O   1 
ATOM   3756 C  CB  . ILE B 1 182 ? 6.191   5.815   -9.056  1.00 73.33  ? 442 ILE B CB  1 
ATOM   3757 C  CG1 . ILE B 1 182 ? 4.846   6.267   -8.477  1.00 76.39  ? 442 ILE B CG1 1 
ATOM   3758 C  CG2 . ILE B 1 182 ? 6.117   5.734   -10.585 1.00 68.57  ? 442 ILE B CG2 1 
ATOM   3759 C  CD1 . ILE B 1 182 ? 4.667   7.760   -8.502  1.00 78.61  ? 442 ILE B CD1 1 
ATOM   3760 N  N   . LEU B 1 183 ? 8.223   3.200   -9.781  1.00 70.65  ? 443 LEU B N   1 
ATOM   3761 C  CA  . LEU B 1 183 ? 9.441   3.047   -10.546 1.00 66.84  ? 443 LEU B CA  1 
ATOM   3762 C  C   . LEU B 1 183 ? 9.082   3.422   -11.963 1.00 65.96  ? 443 LEU B C   1 
ATOM   3763 O  O   . LEU B 1 183 ? 8.064   2.979   -12.474 1.00 67.14  ? 443 LEU B O   1 
ATOM   3764 C  CB  . LEU B 1 183 ? 9.944   1.609   -10.473 1.00 65.68  ? 443 LEU B CB  1 
ATOM   3765 C  CG  . LEU B 1 183 ? 10.160  1.079   -9.051  1.00 69.32  ? 443 LEU B CG  1 
ATOM   3766 C  CD1 . LEU B 1 183 ? 10.795  -0.305  -9.114  1.00 64.08  ? 443 LEU B CD1 1 
ATOM   3767 C  CD2 . LEU B 1 183 ? 11.011  2.057   -8.222  1.00 73.05  ? 443 LEU B CD2 1 
ATOM   3768 N  N   . TRP B 1 184 ? 9.891   4.276   -12.575 1.00 67.52  ? 444 TRP B N   1 
ATOM   3769 C  CA  . TRP B 1 184 ? 9.709   4.631   -13.969 1.00 69.36  ? 444 TRP B CA  1 
ATOM   3770 C  C   . TRP B 1 184 ? 10.992  4.298   -14.700 1.00 68.96  ? 444 TRP B C   1 
ATOM   3771 O  O   . TRP B 1 184 ? 12.072  4.770   -14.339 1.00 69.86  ? 444 TRP B O   1 
ATOM   3772 C  CB  . TRP B 1 184 ? 9.374   6.123   -14.127 1.00 70.36  ? 444 TRP B CB  1 
ATOM   3773 C  CG  . TRP B 1 184 ? 8.834   6.482   -15.492 1.00 69.79  ? 444 TRP B CG  1 
ATOM   3774 C  CD1 . TRP B 1 184 ? 9.440   6.272   -16.699 1.00 66.48  ? 444 TRP B CD1 1 
ATOM   3775 C  CD2 . TRP B 1 184 ? 7.590   7.119   -15.778 1.00 73.00  ? 444 TRP B CD2 1 
ATOM   3776 N  NE1 . TRP B 1 184 ? 8.646   6.739   -17.718 1.00 66.74  ? 444 TRP B NE1 1 
ATOM   3777 C  CE2 . TRP B 1 184 ? 7.503   7.261   -17.179 1.00 70.45  ? 444 TRP B CE2 1 
ATOM   3778 C  CE3 . TRP B 1 184 ? 6.536   7.584   -14.987 1.00 75.55  ? 444 TRP B CE3 1 
ATOM   3779 C  CZ2 . TRP B 1 184 ? 6.400   7.841   -17.806 1.00 70.13  ? 444 TRP B CZ2 1 
ATOM   3780 C  CZ3 . TRP B 1 184 ? 5.443   8.177   -15.612 1.00 75.38  ? 444 TRP B CZ3 1 
ATOM   3781 C  CH2 . TRP B 1 184 ? 5.386   8.299   -17.007 1.00 72.12  ? 444 TRP B CH2 1 
ATOM   3782 N  N   . LEU B 1 185 ? 10.869  3.492   -15.736 1.00 64.62  ? 445 LEU B N   1 
ATOM   3783 C  CA  . LEU B 1 185 ? 12.026  3.083   -16.492 1.00 66.16  ? 445 LEU B CA  1 
ATOM   3784 C  C   . LEU B 1 185 ? 11.753  3.288   -17.960 1.00 68.41  ? 445 LEU B C   1 
ATOM   3785 O  O   . LEU B 1 185 ? 10.624  3.583   -18.344 1.00 68.82  ? 445 LEU B O   1 
ATOM   3786 C  CB  . LEU B 1 185 ? 12.373  1.620   -16.193 1.00 65.58  ? 445 LEU B CB  1 
ATOM   3787 C  CG  . LEU B 1 185 ? 11.339  0.504   -16.444 1.00 65.09  ? 445 LEU B CG  1 
ATOM   3788 C  CD1 . LEU B 1 185 ? 11.601  -0.165  -17.801 1.00 63.46  ? 445 LEU B CD1 1 
ATOM   3789 C  CD2 . LEU B 1 185 ? 11.328  -0.547  -15.310 1.00 59.07  ? 445 LEU B CD2 1 
ATOM   3790 N  N   . GLY B 1 186 ? 12.794  3.188   -18.778 1.00 68.46  ? 446 GLY B N   1 
ATOM   3791 C  CA  . GLY B 1 186 ? 12.586  3.107   -20.214 1.00 66.18  ? 446 GLY B CA  1 
ATOM   3792 C  C   . GLY B 1 186 ? 13.605  3.777   -21.082 1.00 64.87  ? 446 GLY B C   1 
ATOM   3793 O  O   . GLY B 1 186 ? 14.654  4.214   -20.606 1.00 65.58  ? 446 GLY B O   1 
ATOM   3794 N  N   . ASP B 1 187 ? 13.276  3.822   -22.371 1.00 66.54  ? 447 ASP B N   1 
ATOM   3795 C  CA  . ASP B 1 187 ? 14.036  4.582   -23.363 1.00 72.41  ? 447 ASP B CA  1 
ATOM   3796 C  C   . ASP B 1 187 ? 13.428  5.970   -23.487 1.00 71.35  ? 447 ASP B C   1 
ATOM   3797 O  O   . ASP B 1 187 ? 12.671  6.248   -24.396 1.00 71.65  ? 447 ASP B O   1 
ATOM   3798 C  CB  . ASP B 1 187 ? 14.022  3.856   -24.713 1.00 74.27  ? 447 ASP B CB  1 
ATOM   3799 C  CG  . ASP B 1 187 ? 14.972  4.467   -25.716 1.00 83.02  ? 447 ASP B CG  1 
ATOM   3800 O  OD1 . ASP B 1 187 ? 15.405  5.629   -25.523 1.00 86.47  ? 447 ASP B OD1 1 
ATOM   3801 O  OD2 . ASP B 1 187 ? 15.303  3.774   -26.702 1.00 85.89  ? 447 ASP B OD2 1 
ATOM   3802 N  N   . LEU B 1 188 ? 13.769  6.835   -22.549 1.00 72.17  ? 448 LEU B N   1 
ATOM   3803 C  CA  . LEU B 1 188 ? 13.217  8.176   -22.486 1.00 75.36  ? 448 LEU B CA  1 
ATOM   3804 C  C   . LEU B 1 188 ? 13.793  9.069   -23.576 1.00 77.80  ? 448 LEU B C   1 
ATOM   3805 O  O   . LEU B 1 188 ? 13.260  10.141  -23.836 1.00 76.89  ? 448 LEU B O   1 
ATOM   3806 C  CB  . LEU B 1 188 ? 13.502  8.802   -21.121 1.00 75.77  ? 448 LEU B CB  1 
ATOM   3807 C  CG  . LEU B 1 188 ? 13.124  7.964   -19.901 1.00 73.46  ? 448 LEU B CG  1 
ATOM   3808 C  CD1 . LEU B 1 188 ? 13.132  8.828   -18.649 1.00 77.47  ? 448 LEU B CD1 1 
ATOM   3809 C  CD2 . LEU B 1 188 ? 11.771  7.328   -20.109 1.00 69.27  ? 448 LEU B CD2 1 
ATOM   3810 N  N   . ASN B 1 189 ? 14.899  8.637   -24.176 1.00 79.27  ? 449 ASN B N   1 
ATOM   3811 C  CA  . ASN B 1 189 ? 15.427  9.238   -25.405 1.00 82.60  ? 449 ASN B CA  1 
ATOM   3812 C  C   . ASN B 1 189 ? 15.943  10.690  -25.325 1.00 88.99  ? 449 ASN B C   1 
ATOM   3813 O  O   . ASN B 1 189 ? 16.138  11.343  -26.353 1.00 89.78  ? 449 ASN B O   1 
ATOM   3814 C  CB  . ASN B 1 189 ? 14.400  9.085   -26.547 1.00 80.96  ? 449 ASN B CB  1 
ATOM   3815 C  CG  . ASN B 1 189 ? 14.884  8.157   -27.636 1.00 80.44  ? 449 ASN B CG  1 
ATOM   3816 O  OD1 . ASN B 1 189 ? 16.027  8.257   -28.071 1.00 80.87  ? 449 ASN B OD1 1 
ATOM   3817 N  ND2 . ASN B 1 189 ? 14.023  7.251   -28.084 1.00 81.25  ? 449 ASN B ND2 1 
ATOM   3818 N  N   . TYR B 1 190 ? 16.183  11.190  -24.117 1.00 91.73  ? 450 TYR B N   1 
ATOM   3819 C  CA  . TYR B 1 190 ? 16.762  12.522  -23.953 1.00 93.65  ? 450 TYR B CA  1 
ATOM   3820 C  C   . TYR B 1 190 ? 18.270  12.475  -24.242 1.00 98.28  ? 450 TYR B C   1 
ATOM   3821 O  O   . TYR B 1 190 ? 18.929  11.462  -23.991 1.00 98.43  ? 450 TYR B O   1 
ATOM   3822 C  CB  . TYR B 1 190 ? 16.503  13.065  -22.547 1.00 89.46  ? 450 TYR B CB  1 
ATOM   3823 C  CG  . TYR B 1 190 ? 15.061  13.425  -22.243 1.00 84.37  ? 450 TYR B CG  1 
ATOM   3824 C  CD1 . TYR B 1 190 ? 14.563  14.688  -22.519 1.00 85.13  ? 450 TYR B CD1 1 
ATOM   3825 C  CD2 . TYR B 1 190 ? 14.206  12.513  -21.643 1.00 81.03  ? 450 TYR B CD2 1 
ATOM   3826 C  CE1 . TYR B 1 190 ? 13.244  15.031  -22.226 1.00 84.43  ? 450 TYR B CE1 1 
ATOM   3827 C  CE2 . TYR B 1 190 ? 12.888  12.852  -21.341 1.00 81.65  ? 450 TYR B CE2 1 
ATOM   3828 C  CZ  . TYR B 1 190 ? 12.417  14.114  -21.632 1.00 82.76  ? 450 TYR B CZ  1 
ATOM   3829 O  OH  . TYR B 1 190 ? 11.119  14.453  -21.332 1.00 81.91  ? 450 TYR B OH  1 
ATOM   3830 N  N   . ARG B 1 191 ? 18.806  13.578  -24.761 1.00 101.21 ? 451 ARG B N   1 
ATOM   3831 C  CA  . ARG B 1 191 ? 20.150  13.600  -25.326 1.00 100.89 ? 451 ARG B CA  1 
ATOM   3832 C  C   . ARG B 1 191 ? 21.056  14.619  -24.647 1.00 103.68 ? 451 ARG B C   1 
ATOM   3833 O  O   . ARG B 1 191 ? 20.679  15.256  -23.664 1.00 105.44 ? 451 ARG B O   1 
ATOM   3834 C  CB  . ARG B 1 191 ? 20.074  13.909  -26.835 1.00 99.38  ? 451 ARG B CB  1 
ATOM   3835 C  CG  . ARG B 1 191 ? 19.101  13.032  -27.631 1.00 95.55  ? 451 ARG B CG  1 
ATOM   3836 C  CD  . ARG B 1 191 ? 19.431  11.539  -27.522 1.00 92.30  ? 451 ARG B CD  1 
ATOM   3837 N  NE  . ARG B 1 191 ? 18.377  10.697  -28.094 1.00 90.59  ? 451 ARG B NE  1 
ATOM   3838 C  CZ  . ARG B 1 191 ? 18.223  10.427  -29.390 1.00 89.44  ? 451 ARG B CZ  1 
ATOM   3839 N  NH1 . ARG B 1 191 ? 19.046  10.928  -30.299 1.00 92.96  ? 451 ARG B NH1 1 
ATOM   3840 N  NH2 . ARG B 1 191 ? 17.223  9.651   -29.782 1.00 84.83  ? 451 ARG B NH2 1 
ATOM   3841 N  N   . ILE B 1 192 ? 22.268  14.744  -25.179 1.00 105.69 ? 452 ILE B N   1 
ATOM   3842 C  CA  . ILE B 1 192 ? 23.176  15.804  -24.803 1.00 110.86 ? 452 ILE B CA  1 
ATOM   3843 C  C   . ILE B 1 192 ? 23.008  16.913  -25.837 1.00 114.95 ? 452 ILE B C   1 
ATOM   3844 O  O   . ILE B 1 192 ? 22.894  16.643  -27.033 1.00 112.65 ? 452 ILE B O   1 
ATOM   3845 C  CB  . ILE B 1 192 ? 24.643  15.311  -24.775 1.00 111.78 ? 452 ILE B CB  1 
ATOM   3846 C  CG1 . ILE B 1 192 ? 24.760  13.952  -24.060 1.00 106.39 ? 452 ILE B CG1 1 
ATOM   3847 C  CG2 . ILE B 1 192 ? 25.548  16.334  -24.095 1.00 116.96 ? 452 ILE B CG2 1 
ATOM   3848 C  CD1 . ILE B 1 192 ? 24.211  13.936  -22.646 1.00 103.81 ? 452 ILE B CD1 1 
ATOM   3849 N  N   . GLU B 1 193 ? 22.976  18.155  -25.361 1.00 121.61 ? 453 GLU B N   1 
ATOM   3850 C  CA  . GLU B 1 193 ? 22.815  19.344  -26.210 1.00 125.50 ? 453 GLU B CA  1 
ATOM   3851 C  C   . GLU B 1 193 ? 24.093  20.209  -26.171 1.00 126.68 ? 453 GLU B C   1 
ATOM   3852 O  O   . GLU B 1 193 ? 25.012  19.940  -25.389 1.00 125.08 ? 453 GLU B O   1 
ATOM   3853 C  CB  . GLU B 1 193 ? 21.591  20.154  -25.745 1.00 128.14 ? 453 GLU B CB  1 
ATOM   3854 C  CG  . GLU B 1 193 ? 21.765  20.831  -24.366 1.00 131.98 ? 453 GLU B CG  1 
ATOM   3855 C  CD  . GLU B 1 193 ? 20.453  21.264  -23.721 1.00 133.41 ? 453 GLU B CD  1 
ATOM   3856 O  OE1 . GLU B 1 193 ? 19.590  20.390  -23.470 1.00 131.31 ? 453 GLU B OE1 1 
ATOM   3857 O  OE2 . GLU B 1 193 ? 20.299  22.478  -23.436 1.00 136.35 ? 453 GLU B OE2 1 
ATOM   3858 N  N   . GLU B 1 194 ? 24.147  21.238  -27.015 1.00 128.76 ? 454 GLU B N   1 
ATOM   3859 C  CA  . GLU B 1 194 ? 25.306  22.134  -27.092 1.00 131.68 ? 454 GLU B CA  1 
ATOM   3860 C  C   . GLU B 1 194 ? 26.587  21.414  -27.530 1.00 133.16 ? 454 GLU B C   1 
ATOM   3861 O  O   . GLU B 1 194 ? 27.047  21.615  -28.651 1.00 134.40 ? 454 GLU B O   1 
ATOM   3862 C  CB  . GLU B 1 194 ? 25.535  22.850  -25.754 1.00 132.00 ? 454 GLU B CB  1 
ATOM   3863 N  N   . LEU B 1 195 ? 27.137  20.570  -26.655 1.00 133.66 ? 455 LEU B N   1 
ATOM   3864 C  CA  . LEU B 1 195 ? 28.458  19.945  -26.849 1.00 136.12 ? 455 LEU B CA  1 
ATOM   3865 C  C   . LEU B 1 195 ? 28.655  19.285  -28.210 1.00 138.63 ? 455 LEU B C   1 
ATOM   3866 O  O   . LEU B 1 195 ? 27.706  18.787  -28.811 1.00 138.30 ? 455 LEU B O   1 
ATOM   3867 C  CB  . LEU B 1 195 ? 28.730  18.905  -25.754 1.00 132.71 ? 455 LEU B CB  1 
ATOM   3868 C  CG  . LEU B 1 195 ? 28.747  19.384  -24.297 1.00 133.44 ? 455 LEU B CG  1 
ATOM   3869 C  CD1 . LEU B 1 195 ? 29.358  18.324  -23.399 1.00 130.73 ? 455 LEU B CD1 1 
ATOM   3870 C  CD2 . LEU B 1 195 ? 29.511  20.699  -24.147 1.00 138.90 ? 455 LEU B CD2 1 
ATOM   3871 N  N   . ASP B 1 196 ? 29.905  19.266  -28.672 1.00 142.21 ? 456 ASP B N   1 
ATOM   3872 C  CA  . ASP B 1 196 ? 30.248  18.756  -30.002 1.00 143.77 ? 456 ASP B CA  1 
ATOM   3873 C  C   . ASP B 1 196 ? 30.169  17.228  -30.053 1.00 143.79 ? 456 ASP B C   1 
ATOM   3874 O  O   . ASP B 1 196 ? 29.972  16.568  -29.026 1.00 141.23 ? 456 ASP B O   1 
ATOM   3875 C  CB  . ASP B 1 196 ? 31.650  19.230  -30.423 1.00 145.23 ? 456 ASP B CB  1 
ATOM   3876 N  N   . VAL B 1 197 ? 30.311  16.678  -31.258 1.00 145.65 ? 457 VAL B N   1 
ATOM   3877 C  CA  . VAL B 1 197 ? 30.295  15.225  -31.460 1.00 143.79 ? 457 VAL B CA  1 
ATOM   3878 C  C   . VAL B 1 197 ? 31.623  14.600  -31.023 1.00 146.01 ? 457 VAL B C   1 
ATOM   3879 O  O   . VAL B 1 197 ? 31.634  13.659  -30.225 1.00 145.04 ? 457 VAL B O   1 
ATOM   3880 C  CB  . VAL B 1 197 ? 29.977  14.847  -32.940 1.00 161.63 ? 457 VAL B CB  1 
ATOM   3881 C  CG1 . VAL B 1 197 ? 30.697  13.558  -33.344 1.00 160.44 ? 457 VAL B CG1 1 
ATOM   3882 C  CG2 . VAL B 1 197 ? 28.457  14.703  -33.140 1.00 157.99 ? 457 VAL B CG2 1 
ATOM   3883 N  N   . GLU B 1 198 ? 32.729  15.130  -31.544 1.00 148.10 ? 458 GLU B N   1 
ATOM   3884 C  CA  . GLU B 1 198 ? 34.068  14.636  -31.210 1.00 147.16 ? 458 GLU B CA  1 
ATOM   3885 C  C   . GLU B 1 198 ? 34.373  14.756  -29.712 1.00 146.03 ? 458 GLU B C   1 
ATOM   3886 O  O   . GLU B 1 198 ? 35.026  13.882  -29.137 1.00 143.89 ? 458 GLU B O   1 
ATOM   3887 C  CB  . GLU B 1 198 ? 35.131  15.389  -32.021 1.00 150.38 ? 458 GLU B CB  1 
ATOM   3888 N  N   . LYS B 1 199 ? 33.879  15.827  -29.089 1.00 147.21 ? 459 LYS B N   1 
ATOM   3889 C  CA  . LYS B 1 199 ? 34.217  16.169  -27.702 1.00 148.07 ? 459 LYS B CA  1 
ATOM   3890 C  C   . LYS B 1 199 ? 33.571  15.258  -26.659 1.00 145.96 ? 459 LYS B C   1 
ATOM   3891 O  O   . LYS B 1 199 ? 34.205  14.911  -25.662 1.00 144.56 ? 459 LYS B O   1 
ATOM   3892 C  CB  . LYS B 1 199 ? 33.838  17.626  -27.407 1.00 149.08 ? 459 LYS B CB  1 
ATOM   3893 N  N   . VAL B 1 200 ? 32.313  14.883  -26.883 1.00 145.00 ? 460 VAL B N   1 
ATOM   3894 C  CA  . VAL B 1 200 ? 31.572  14.027  -25.945 1.00 140.89 ? 460 VAL B CA  1 
ATOM   3895 C  C   . VAL B 1 200 ? 32.226  12.655  -25.806 1.00 138.71 ? 460 VAL B C   1 
ATOM   3896 O  O   . VAL B 1 200 ? 32.287  12.100  -24.710 1.00 138.41 ? 460 VAL B O   1 
ATOM   3897 C  CB  . VAL B 1 200 ? 30.093  13.850  -26.375 1.00 145.98 ? 460 VAL B CB  1 
ATOM   3898 C  CG1 . VAL B 1 200 ? 29.385  12.783  -25.521 1.00 142.03 ? 460 VAL B CG1 1 
ATOM   3899 C  CG2 . VAL B 1 200 ? 29.354  15.175  -26.287 1.00 147.31 ? 460 VAL B CG2 1 
ATOM   3900 N  N   . LYS B 1 201 ? 32.723  12.121  -26.918 1.00 136.87 ? 461 LYS B N   1 
ATOM   3901 C  CA  . LYS B 1 201 ? 33.357  10.803  -26.930 1.00 133.28 ? 461 LYS B CA  1 
ATOM   3902 C  C   . LYS B 1 201 ? 34.665  10.775  -26.130 1.00 136.61 ? 461 LYS B C   1 
ATOM   3903 O  O   . LYS B 1 201 ? 34.968  9.774   -25.473 1.00 133.61 ? 461 LYS B O   1 
ATOM   3904 C  CB  . LYS B 1 201 ? 33.606  10.344  -28.370 1.00 130.45 ? 461 LYS B CB  1 
ATOM   3905 C  CG  . LYS B 1 201 ? 32.330  10.151  -29.183 1.00 125.87 ? 461 LYS B CG  1 
ATOM   3906 C  CD  . LYS B 1 201 ? 32.634  9.854   -30.644 1.00 125.31 ? 461 LYS B CD  1 
ATOM   3907 C  CE  . LYS B 1 201 ? 31.378  9.932   -31.495 1.00 122.07 ? 461 LYS B CE  1 
ATOM   3908 N  NZ  . LYS B 1 201 ? 31.673  9.639   -32.916 1.00 123.76 ? 461 LYS B NZ  1 
ATOM   3909 N  N   . LYS B 1 202 ? 35.424  11.872  -26.184 1.00 142.29 ? 462 LYS B N   1 
ATOM   3910 C  CA  . LYS B 1 202 ? 36.685  11.999  -25.428 1.00 145.35 ? 462 LYS B CA  1 
ATOM   3911 C  C   . LYS B 1 202 ? 36.454  12.202  -23.923 1.00 143.66 ? 462 LYS B C   1 
ATOM   3912 O  O   . LYS B 1 202 ? 37.373  12.010  -23.121 1.00 145.78 ? 462 LYS B O   1 
ATOM   3913 C  CB  . LYS B 1 202 ? 37.549  13.143  -25.983 1.00 149.46 ? 462 LYS B CB  1 
ATOM   3914 N  N   . LEU B 1 203 ? 35.237  12.607  -23.553 1.00 139.15 ? 463 LEU B N   1 
ATOM   3915 C  CA  . LEU B 1 203 ? 34.832  12.684  -22.149 1.00 134.79 ? 463 LEU B CA  1 
ATOM   3916 C  C   . LEU B 1 203 ? 34.455  11.297  -21.628 1.00 130.76 ? 463 LEU B C   1 
ATOM   3917 O  O   . LEU B 1 203 ? 34.766  10.954  -20.489 1.00 127.80 ? 463 LEU B O   1 
ATOM   3918 C  CB  . LEU B 1 203 ? 33.656  13.650  -21.977 1.00 129.92 ? 463 LEU B CB  1 
ATOM   3919 C  CG  . LEU B 1 203 ? 33.979  15.125  -22.219 1.00 128.99 ? 463 LEU B CG  1 
ATOM   3920 C  CD1 . LEU B 1 203 ? 32.718  15.939  -22.473 1.00 126.26 ? 463 LEU B CD1 1 
ATOM   3921 C  CD2 . LEU B 1 203 ? 34.754  15.687  -21.041 1.00 130.12 ? 463 LEU B CD2 1 
ATOM   3922 N  N   . ILE B 1 204 ? 33.775  10.511  -22.461 1.00 130.78 ? 464 ILE B N   1 
ATOM   3923 C  CA  . ILE B 1 204 ? 33.479  9.114   -22.140 1.00 129.90 ? 464 ILE B CA  1 
ATOM   3924 C  C   . ILE B 1 204 ? 34.786  8.324   -22.026 1.00 132.83 ? 464 ILE B C   1 
ATOM   3925 O  O   . ILE B 1 204 ? 34.897  7.418   -21.197 1.00 131.98 ? 464 ILE B O   1 
ATOM   3926 C  CB  . ILE B 1 204 ? 32.557  8.463   -23.195 1.00 125.65 ? 464 ILE B CB  1 
ATOM   3927 N  N   . GLU B 1 205 ? 35.772  8.680   -22.851 1.00 134.66 ? 465 GLU B N   1 
ATOM   3928 C  CA  . GLU B 1 205 ? 37.114  8.111   -22.742 1.00 135.34 ? 465 GLU B CA  1 
ATOM   3929 C  C   . GLU B 1 205 ? 37.740  8.479   -21.397 1.00 138.11 ? 465 GLU B C   1 
ATOM   3930 O  O   . GLU B 1 205 ? 38.079  7.595   -20.612 1.00 137.64 ? 465 GLU B O   1 
ATOM   3931 C  CB  . GLU B 1 205 ? 38.023  8.583   -23.887 1.00 137.08 ? 465 GLU B CB  1 
ATOM   3932 C  CG  . GLU B 1 205 ? 37.797  7.863   -25.210 1.00 135.78 ? 465 GLU B CG  1 
ATOM   3933 N  N   . GLU B 1 206 ? 37.877  9.780   -21.129 1.00 140.42 ? 466 GLU B N   1 
ATOM   3934 C  CA  . GLU B 1 206 ? 38.446  10.265  -19.859 1.00 141.72 ? 466 GLU B CA  1 
ATOM   3935 C  C   . GLU B 1 206 ? 37.483  10.089  -18.668 1.00 139.44 ? 466 GLU B C   1 
ATOM   3936 O  O   . GLU B 1 206 ? 37.841  10.387  -17.530 1.00 141.53 ? 466 GLU B O   1 
ATOM   3937 C  CB  . GLU B 1 206 ? 38.886  11.732  -19.983 1.00 144.90 ? 466 GLU B CB  1 
ATOM   3938 N  N   . LYS B 1 207 ? 36.264  9.624   -18.945 1.00 134.16 ? 467 LYS B N   1 
ATOM   3939 C  CA  . LYS B 1 207 ? 35.311  9.168   -17.922 1.00 126.91 ? 467 LYS B CA  1 
ATOM   3940 C  C   . LYS B 1 207 ? 34.798  10.259  -16.970 1.00 127.08 ? 467 LYS B C   1 
ATOM   3941 O  O   . LYS B 1 207 ? 34.462  9.973   -15.821 1.00 122.71 ? 467 LYS B O   1 
ATOM   3942 C  CB  . LYS B 1 207 ? 35.891  7.978   -17.135 1.00 122.43 ? 467 LYS B CB  1 
ATOM   3943 C  CG  . LYS B 1 207 ? 36.094  6.723   -17.980 1.00 120.07 ? 467 LYS B CG  1 
ATOM   3944 N  N   . ASP B 1 208 ? 34.705  11.495  -17.465 1.00 132.46 ? 468 ASP B N   1 
ATOM   3945 C  CA  . ASP B 1 208 ? 34.197  12.627  -16.678 1.00 135.63 ? 468 ASP B CA  1 
ATOM   3946 C  C   . ASP B 1 208 ? 32.686  12.771  -16.906 1.00 133.61 ? 468 ASP B C   1 
ATOM   3947 O  O   . ASP B 1 208 ? 32.238  13.604  -17.695 1.00 135.29 ? 468 ASP B O   1 
ATOM   3948 C  CB  . ASP B 1 208 ? 34.950  13.915  -17.058 1.00 140.43 ? 468 ASP B CB  1 
ATOM   3949 C  CG  . ASP B 1 208 ? 34.896  14.987  -15.969 1.00 145.37 ? 468 ASP B CG  1 
ATOM   3950 O  OD1 . ASP B 1 208 ? 33.807  15.237  -15.411 1.00 144.02 ? 468 ASP B OD1 1 
ATOM   3951 O  OD2 . ASP B 1 208 ? 35.953  15.598  -15.684 1.00 150.86 ? 468 ASP B OD2 1 
ATOM   3952 N  N   . PHE B 1 209 ? 31.907  11.947  -16.208 1.00 128.74 ? 469 PHE B N   1 
ATOM   3953 C  CA  . PHE B 1 209 ? 30.453  11.894  -16.409 1.00 123.06 ? 469 PHE B CA  1 
ATOM   3954 C  C   . PHE B 1 209 ? 29.700  13.010  -15.681 1.00 124.16 ? 469 PHE B C   1 
ATOM   3955 O  O   . PHE B 1 209 ? 28.580  13.352  -16.067 1.00 123.43 ? 469 PHE B O   1 
ATOM   3956 C  CB  . PHE B 1 209 ? 29.892  10.526  -15.986 1.00 116.18 ? 469 PHE B CB  1 
ATOM   3957 C  CG  . PHE B 1 209 ? 30.484  9.362   -16.745 1.00 113.14 ? 469 PHE B CG  1 
ATOM   3958 C  CD1 . PHE B 1 209 ? 30.410  9.305   -18.131 1.00 111.02 ? 469 PHE B CD1 1 
ATOM   3959 C  CD2 . PHE B 1 209 ? 31.110  8.318   -16.072 1.00 112.12 ? 469 PHE B CD2 1 
ATOM   3960 C  CE1 . PHE B 1 209 ? 30.962  8.238   -18.834 1.00 110.12 ? 469 PHE B CE1 1 
ATOM   3961 C  CE2 . PHE B 1 209 ? 31.660  7.244   -16.772 1.00 109.93 ? 469 PHE B CE2 1 
ATOM   3962 C  CZ  . PHE B 1 209 ? 31.586  7.207   -18.152 1.00 109.05 ? 469 PHE B CZ  1 
ATOM   3963 N  N   . GLN B 1 210 ? 30.306  13.572  -14.635 1.00 123.83 ? 470 GLN B N   1 
ATOM   3964 C  CA  . GLN B 1 210 ? 29.667  14.632  -13.855 1.00 122.18 ? 470 GLN B CA  1 
ATOM   3965 C  C   . GLN B 1 210 ? 29.498  15.904  -14.688 1.00 125.33 ? 470 GLN B C   1 
ATOM   3966 O  O   . GLN B 1 210 ? 28.526  16.643  -14.517 1.00 125.42 ? 470 GLN B O   1 
ATOM   3967 C  CB  . GLN B 1 210 ? 30.477  14.928  -12.589 1.00 122.32 ? 470 GLN B CB  1 
ATOM   3968 N  N   . MET B 1 211 ? 30.444  16.144  -15.594 1.00 127.43 ? 471 MET B N   1 
ATOM   3969 C  CA  . MET B 1 211 ? 30.429  17.334  -16.447 1.00 128.44 ? 471 MET B CA  1 
ATOM   3970 C  C   . MET B 1 211 ? 29.569  17.125  -17.700 1.00 126.52 ? 471 MET B C   1 
ATOM   3971 O  O   . MET B 1 211 ? 29.090  18.096  -18.287 1.00 127.91 ? 471 MET B O   1 
ATOM   3972 C  CB  . MET B 1 211 ? 31.861  17.740  -16.836 1.00 129.68 ? 471 MET B CB  1 
ATOM   3973 N  N   . LEU B 1 212 ? 29.373  15.871  -18.109 1.00 124.45 ? 472 LEU B N   1 
ATOM   3974 C  CA  . LEU B 1 212 ? 28.494  15.568  -19.246 1.00 124.18 ? 472 LEU B CA  1 
ATOM   3975 C  C   . LEU B 1 212 ? 27.021  15.703  -18.846 1.00 124.38 ? 472 LEU B C   1 
ATOM   3976 O  O   . LEU B 1 212 ? 26.202  16.192  -19.624 1.00 126.28 ? 472 LEU B O   1 
ATOM   3977 C  CB  . LEU B 1 212 ? 28.770  14.168  -19.799 1.00 119.58 ? 472 LEU B CB  1 
ATOM   3978 C  CG  . LEU B 1 212 ? 28.186  13.902  -21.190 1.00 116.15 ? 472 LEU B CG  1 
ATOM   3979 N  N   . TYR B 1 213 ? 26.710  15.285  -17.620 1.00 122.77 ? 473 TYR B N   1 
ATOM   3980 C  CA  . TYR B 1 213 ? 25.350  15.328  -17.064 1.00 122.10 ? 473 TYR B CA  1 
ATOM   3981 C  C   . TYR B 1 213 ? 24.800  16.760  -16.913 1.00 126.51 ? 473 TYR B C   1 
ATOM   3982 O  O   . TYR B 1 213 ? 23.590  16.985  -16.964 1.00 124.44 ? 473 TYR B O   1 
ATOM   3983 C  CB  . TYR B 1 213 ? 25.343  14.585  -15.713 1.00 119.71 ? 473 TYR B CB  1 
ATOM   3984 C  CG  . TYR B 1 213 ? 24.002  14.506  -15.006 1.00 116.72 ? 473 TYR B CG  1 
ATOM   3985 C  CD1 . TYR B 1 213 ? 22.952  13.770  -15.541 1.00 111.98 ? 473 TYR B CD1 1 
ATOM   3986 C  CD2 . TYR B 1 213 ? 23.798  15.153  -13.783 1.00 116.99 ? 473 TYR B CD2 1 
ATOM   3987 C  CE1 . TYR B 1 213 ? 21.725  13.691  -14.887 1.00 111.01 ? 473 TYR B CE1 1 
ATOM   3988 C  CE2 . TYR B 1 213 ? 22.577  15.080  -13.121 1.00 114.91 ? 473 TYR B CE2 1 
ATOM   3989 C  CZ  . TYR B 1 213 ? 21.547  14.353  -13.679 1.00 113.29 ? 473 TYR B CZ  1 
ATOM   3990 O  OH  . TYR B 1 213 ? 20.337  14.281  -13.030 1.00 112.84 ? 473 TYR B OH  1 
ATOM   3991 N  N   . ALA B 1 214 ? 25.684  17.730  -16.728 1.00 133.54 ? 474 ALA B N   1 
ATOM   3992 C  CA  . ALA B 1 214 ? 25.265  19.131  -16.745 1.00 139.00 ? 474 ALA B CA  1 
ATOM   3993 C  C   . ALA B 1 214 ? 24.491  19.445  -18.031 1.00 140.19 ? 474 ALA B C   1 
ATOM   3994 O  O   . ALA B 1 214 ? 23.451  20.102  -17.987 1.00 141.02 ? 474 ALA B O   1 
ATOM   3995 C  CB  . ALA B 1 214 ? 26.474  20.057  -16.615 1.00 141.75 ? 474 ALA B CB  1 
ATOM   3996 N  N   . TYR B 1 215 ? 24.999  18.950  -19.162 1.00 139.03 ? 475 TYR B N   1 
ATOM   3997 C  CA  . TYR B 1 215 ? 24.427  19.238  -20.478 1.00 139.29 ? 475 TYR B CA  1 
ATOM   3998 C  C   . TYR B 1 215 ? 23.474  18.127  -20.983 1.00 133.23 ? 475 TYR B C   1 
ATOM   3999 O  O   . TYR B 1 215 ? 23.266  17.982  -22.190 1.00 132.82 ? 475 TYR B O   1 
ATOM   4000 C  CB  . TYR B 1 215 ? 25.558  19.485  -21.495 1.00 143.79 ? 475 TYR B CB  1 
ATOM   4001 C  CG  . TYR B 1 215 ? 26.232  20.839  -21.380 1.00 150.59 ? 475 TYR B CG  1 
ATOM   4002 C  CD1 . TYR B 1 215 ? 25.572  22.002  -21.776 1.00 154.74 ? 475 TYR B CD1 1 
ATOM   4003 C  CD2 . TYR B 1 215 ? 27.539  20.958  -20.900 1.00 154.16 ? 475 TYR B CD2 1 
ATOM   4004 C  CE1 . TYR B 1 215 ? 26.188  23.254  -21.682 1.00 161.06 ? 475 TYR B CE1 1 
ATOM   4005 C  CE2 . TYR B 1 215 ? 28.167  22.207  -20.801 1.00 160.11 ? 475 TYR B CE2 1 
ATOM   4006 C  CZ  . TYR B 1 215 ? 27.484  23.351  -21.193 1.00 163.50 ? 475 TYR B CZ  1 
ATOM   4007 O  OH  . TYR B 1 215 ? 28.089  24.587  -21.102 1.00 167.48 ? 475 TYR B OH  1 
ATOM   4008 N  N   . ASP B 1 216 ? 22.876  17.365  -20.069 1.00 127.05 ? 476 ASP B N   1 
ATOM   4009 C  CA  . ASP B 1 216 ? 21.993  16.255  -20.449 1.00 117.59 ? 476 ASP B CA  1 
ATOM   4010 C  C   . ASP B 1 216 ? 20.530  16.674  -20.387 1.00 112.98 ? 476 ASP B C   1 
ATOM   4011 O  O   . ASP B 1 216 ? 20.058  17.104  -19.341 1.00 114.42 ? 476 ASP B O   1 
ATOM   4012 C  CB  . ASP B 1 216 ? 22.215  15.062  -19.523 1.00 114.89 ? 476 ASP B CB  1 
ATOM   4013 C  CG  . ASP B 1 216 ? 21.198  13.965  -19.740 1.00 110.17 ? 476 ASP B CG  1 
ATOM   4014 O  OD1 . ASP B 1 216 ? 21.292  13.244  -20.756 1.00 109.85 ? 476 ASP B OD1 1 
ATOM   4015 O  OD2 . ASP B 1 216 ? 20.294  13.818  -18.892 1.00 106.03 ? 476 ASP B OD2 1 
ATOM   4016 N  N   . GLN B 1 217 ? 19.808  16.509  -21.492 1.00 108.19 ? 477 GLN B N   1 
ATOM   4017 C  CA  . GLN B 1 217 ? 18.424  17.002  -21.614 1.00 106.01 ? 477 GLN B CA  1 
ATOM   4018 C  C   . GLN B 1 217 ? 17.487  16.631  -20.455 1.00 103.22 ? 477 GLN B C   1 
ATOM   4019 O  O   . GLN B 1 217 ? 16.658  17.450  -20.053 1.00 106.47 ? 477 GLN B O   1 
ATOM   4020 C  CB  . GLN B 1 217 ? 17.788  16.531  -22.930 1.00 102.60 ? 477 GLN B CB  1 
ATOM   4021 C  CG  . GLN B 1 217 ? 18.062  17.408  -24.142 1.00 103.31 ? 477 GLN B CG  1 
ATOM   4022 C  CD  . GLN B 1 217 ? 17.496  16.819  -25.422 1.00 102.16 ? 477 GLN B CD  1 
ATOM   4023 O  OE1 . GLN B 1 217 ? 17.319  15.610  -25.539 1.00 98.50  ? 477 GLN B OE1 1 
ATOM   4024 N  NE2 . GLN B 1 217 ? 17.220  17.673  -26.393 1.00 105.94 ? 477 GLN B NE2 1 
ATOM   4025 N  N   . LEU B 1 218 ? 17.602  15.416  -19.929 1.00 96.41  ? 478 LEU B N   1 
ATOM   4026 C  CA  . LEU B 1 218 ? 16.731  15.001  -18.832 1.00 93.36  ? 478 LEU B CA  1 
ATOM   4027 C  C   . LEU B 1 218 ? 17.004  15.778  -17.550 1.00 98.00  ? 478 LEU B C   1 
ATOM   4028 O  O   . LEU B 1 218 ? 16.066  16.113  -16.827 1.00 100.32 ? 478 LEU B O   1 
ATOM   4029 C  CB  . LEU B 1 218 ? 16.865  13.503  -18.555 1.00 89.81  ? 478 LEU B CB  1 
ATOM   4030 C  CG  . LEU B 1 218 ? 15.859  12.889  -17.563 1.00 88.22  ? 478 LEU B CG  1 
ATOM   4031 C  CD1 . LEU B 1 218 ? 14.419  13.336  -17.832 1.00 87.52  ? 478 LEU B CD1 1 
ATOM   4032 C  CD2 . LEU B 1 218 ? 15.952  11.369  -17.568 1.00 86.35  ? 478 LEU B CD2 1 
ATOM   4033 N  N   . LYS B 1 219 ? 18.279  16.064  -17.276 1.00 98.23  ? 479 LYS B N   1 
ATOM   4034 C  CA  . LYS B 1 219 ? 18.678  16.753  -16.046 1.00 100.64 ? 479 LYS B CA  1 
ATOM   4035 C  C   . LYS B 1 219 ? 18.248  18.214  -16.030 1.00 105.17 ? 479 LYS B C   1 
ATOM   4036 O  O   . LYS B 1 219 ? 18.098  18.803  -14.956 1.00 106.36 ? 479 LYS B O   1 
ATOM   4037 C  CB  . LYS B 1 219 ? 20.192  16.668  -15.847 1.00 101.75 ? 479 LYS B CB  1 
ATOM   4038 N  N   . ILE B 1 220 ? 18.068  18.785  -17.223 1.00 106.53 ? 480 ILE B N   1 
ATOM   4039 C  CA  . ILE B 1 220 ? 17.650  20.181  -17.394 1.00 109.71 ? 480 ILE B CA  1 
ATOM   4040 C  C   . ILE B 1 220 ? 16.140  20.289  -17.292 1.00 110.53 ? 480 ILE B C   1 
ATOM   4041 O  O   . ILE B 1 220 ? 15.608  21.236  -16.714 1.00 115.18 ? 480 ILE B O   1 
ATOM   4042 C  CB  . ILE B 1 220 ? 18.049  20.746  -18.781 1.00 107.67 ? 480 ILE B CB  1 
ATOM   4043 C  CG1 . ILE B 1 220 ? 19.552  20.601  -19.025 1.00 106.80 ? 480 ILE B CG1 1 
ATOM   4044 C  CG2 . ILE B 1 220 ? 17.642  22.215  -18.898 1.00 110.52 ? 480 ILE B CG2 1 
ATOM   4045 C  CD1 . ILE B 1 220 ? 19.998  21.106  -20.380 1.00 107.97 ? 480 ILE B CD1 1 
ATOM   4046 N  N   . GLN B 1 221 ? 15.455  19.313  -17.875 1.00 105.05 ? 481 GLN B N   1 
ATOM   4047 C  CA  . GLN B 1 221 ? 14.002  19.316  -17.902 1.00 103.40 ? 481 GLN B CA  1 
ATOM   4048 C  C   . GLN B 1 221 ? 13.403  19.070  -16.521 1.00 104.57 ? 481 GLN B C   1 
ATOM   4049 O  O   . GLN B 1 221 ? 12.411  19.703  -16.152 1.00 106.14 ? 481 GLN B O   1 
ATOM   4050 C  CB  . GLN B 1 221 ? 13.489  18.307  -18.934 1.00 97.39  ? 481 GLN B CB  1 
ATOM   4051 C  CG  . GLN B 1 221 ? 13.718  18.767  -20.363 1.00 95.24  ? 481 GLN B CG  1 
ATOM   4052 C  CD  . GLN B 1 221 ? 13.335  20.209  -20.541 1.00 100.23 ? 481 GLN B CD  1 
ATOM   4053 O  OE1 . GLN B 1 221 ? 12.204  20.588  -20.247 1.00 100.78 ? 481 GLN B OE1 1 
ATOM   4054 N  NE2 . GLN B 1 221 ? 14.283  21.037  -20.985 1.00 103.54 ? 481 GLN B NE2 1 
ATOM   4055 N  N   . VAL B 1 222 ? 14.016  18.181  -15.748 1.00 102.96 ? 482 VAL B N   1 
ATOM   4056 C  CA  . VAL B 1 222 ? 13.599  17.992  -14.365 1.00 102.29 ? 482 VAL B CA  1 
ATOM   4057 C  C   . VAL B 1 222 ? 13.794  19.297  -13.607 1.00 105.70 ? 482 VAL B C   1 
ATOM   4058 O  O   . VAL B 1 222 ? 12.861  19.807  -12.996 1.00 107.02 ? 482 VAL B O   1 
ATOM   4059 C  CB  . VAL B 1 222 ? 14.374  16.856  -13.683 1.00 98.65  ? 482 VAL B CB  1 
ATOM   4060 C  CG1 . VAL B 1 222 ? 14.092  16.845  -12.179 1.00 96.54  ? 482 VAL B CG1 1 
ATOM   4061 C  CG2 . VAL B 1 222 ? 14.013  15.500  -14.343 1.00 85.36  ? 482 VAL B CG2 1 
ATOM   4062 N  N   . ALA B 1 223 ? 14.999  19.848  -13.684 1.00 106.91 ? 483 ALA B N   1 
ATOM   4063 C  CA  . ALA B 1 223 ? 15.318  21.117  -13.032 1.00 110.84 ? 483 ALA B CA  1 
ATOM   4064 C  C   . ALA B 1 223 ? 14.335  22.235  -13.407 1.00 113.55 ? 483 ALA B C   1 
ATOM   4065 O  O   . ALA B 1 223 ? 14.015  23.093  -12.579 1.00 115.68 ? 483 ALA B O   1 
ATOM   4066 C  CB  . ALA B 1 223 ? 16.747  21.536  -13.367 1.00 110.96 ? 483 ALA B CB  1 
ATOM   4067 N  N   . ALA B 1 224 ? 13.855  22.215  -14.651 1.00 110.99 ? 484 ALA B N   1 
ATOM   4068 C  CA  . ALA B 1 224 ? 12.861  23.184  -15.120 1.00 109.10 ? 484 ALA B CA  1 
ATOM   4069 C  C   . ALA B 1 224 ? 11.423  22.774  -14.758 1.00 109.28 ? 484 ALA B C   1 
ATOM   4070 O  O   . ALA B 1 224 ? 10.466  23.403  -15.204 1.00 108.55 ? 484 ALA B O   1 
ATOM   4071 C  CB  . ALA B 1 224 ? 12.994  23.373  -16.623 1.00 104.28 ? 484 ALA B CB  1 
ATOM   4072 N  N   . LYS B 1 225 ? 11.276  21.718  -13.959 1.00 110.62 ? 485 LYS B N   1 
ATOM   4073 C  CA  . LYS B 1 225 ? 9.967   21.226  -13.518 1.00 110.11 ? 485 LYS B CA  1 
ATOM   4074 C  C   . LYS B 1 225 ? 8.998   20.867  -14.665 1.00 107.77 ? 485 LYS B C   1 
ATOM   4075 O  O   . LYS B 1 225 ? 7.792   20.755  -14.443 1.00 106.62 ? 485 LYS B O   1 
ATOM   4076 C  CB  . LYS B 1 225 ? 9.320   22.236  -12.562 1.00 110.64 ? 485 LYS B CB  1 
ATOM   4077 N  N   . THR B 1 226 ? 9.528   20.652  -15.871 1.00 106.45 ? 486 THR B N   1 
ATOM   4078 C  CA  . THR B 1 226 ? 8.698   20.404  -17.053 1.00 104.64 ? 486 THR B CA  1 
ATOM   4079 C  C   . THR B 1 226 ? 8.225   18.962  -17.107 1.00 104.96 ? 486 THR B C   1 
ATOM   4080 O  O   . THR B 1 226 ? 7.149   18.689  -17.633 1.00 104.74 ? 486 THR B O   1 
ATOM   4081 C  CB  . THR B 1 226 ? 9.444   20.718  -18.371 1.00 101.13 ? 486 THR B CB  1 
ATOM   4082 O  OG1 . THR B 1 226 ? 10.554  19.827  -18.529 1.00 96.27  ? 486 THR B OG1 1 
ATOM   4083 C  CG2 . THR B 1 226 ? 9.937   22.168  -18.398 1.00 104.34 ? 486 THR B CG2 1 
ATOM   4084 N  N   . VAL B 1 227 ? 9.048   18.043  -16.591 1.00 105.43 ? 487 VAL B N   1 
ATOM   4085 C  CA  . VAL B 1 227 ? 8.689   16.618  -16.473 1.00 103.32 ? 487 VAL B CA  1 
ATOM   4086 C  C   . VAL B 1 227 ? 9.311   15.995  -15.225 1.00 103.84 ? 487 VAL B C   1 
ATOM   4087 O  O   . VAL B 1 227 ? 10.291  16.505  -14.696 1.00 108.35 ? 487 VAL B O   1 
ATOM   4088 C  CB  . VAL B 1 227 ? 9.165   15.782  -17.691 1.00 95.76  ? 487 VAL B CB  1 
ATOM   4089 C  CG1 . VAL B 1 227 ? 8.416   16.175  -18.959 1.00 97.14  ? 487 VAL B CG1 1 
ATOM   4090 C  CG2 . VAL B 1 227 ? 10.662  15.924  -17.880 1.00 95.02  ? 487 VAL B CG2 1 
ATOM   4091 N  N   . PHE B 1 228 ? 8.734   14.883  -14.777 1.00 99.57  ? 488 PHE B N   1 
ATOM   4092 C  CA  . PHE B 1 228 ? 9.259   14.090  -13.660 1.00 97.97  ? 488 PHE B CA  1 
ATOM   4093 C  C   . PHE B 1 228 ? 9.366   14.851  -12.331 1.00 99.96  ? 488 PHE B C   1 
ATOM   4094 O  O   . PHE B 1 228 ? 10.297  14.620  -11.554 1.00 94.29  ? 488 PHE B O   1 
ATOM   4095 C  CB  . PHE B 1 228 ? 10.622  13.471  -14.022 1.00 96.47  ? 488 PHE B CB  1 
ATOM   4096 C  CG  . PHE B 1 228 ? 10.536  12.361  -15.021 1.00 93.41  ? 488 PHE B CG  1 
ATOM   4097 C  CD1 . PHE B 1 228 ? 10.210  11.071  -14.614 1.00 90.41  ? 488 PHE B CD1 1 
ATOM   4098 C  CD2 . PHE B 1 228 ? 10.789  12.598  -16.367 1.00 91.77  ? 488 PHE B CD2 1 
ATOM   4099 C  CE1 . PHE B 1 228 ? 10.127  10.031  -15.538 1.00 84.89  ? 488 PHE B CE1 1 
ATOM   4100 C  CE2 . PHE B 1 228 ? 10.707  11.567  -17.299 1.00 88.00  ? 488 PHE B CE2 1 
ATOM   4101 C  CZ  . PHE B 1 228 ? 10.372  10.280  -16.885 1.00 84.13  ? 488 PHE B CZ  1 
ATOM   4102 N  N   . GLU B 1 229 ? 8.402   15.733  -12.062 1.00 105.81 ? 489 GLU B N   1 
ATOM   4103 C  CA  . GLU B 1 229 ? 8.365   16.459  -10.784 1.00 109.80 ? 489 GLU B CA  1 
ATOM   4104 C  C   . GLU B 1 229 ? 8.350   15.440  -9.633  1.00 108.36 ? 489 GLU B C   1 
ATOM   4105 O  O   . GLU B 1 229 ? 7.560   14.485  -9.647  1.00 104.10 ? 489 GLU B O   1 
ATOM   4106 C  CB  . GLU B 1 229 ? 7.144   17.389  -10.690 1.00 112.80 ? 489 GLU B CB  1 
ATOM   4107 C  CG  . GLU B 1 229 ? 6.925   18.301  -11.909 1.00 116.41 ? 489 GLU B CG  1 
ATOM   4108 C  CD  . GLU B 1 229 ? 5.921   19.443  -11.652 1.00 121.98 ? 489 GLU B CD  1 
ATOM   4109 O  OE1 . GLU B 1 229 ? 4.857   19.463  -12.321 1.00 120.93 ? 489 GLU B OE1 1 
ATOM   4110 O  OE2 . GLU B 1 229 ? 6.200   20.320  -10.798 1.00 124.90 ? 489 GLU B OE2 1 
ATOM   4111 N  N   . GLY B 1 230 ? 9.253   15.630  -8.670  1.00 110.27 ? 490 GLY B N   1 
ATOM   4112 C  CA  . GLY B 1 230 ? 9.321   14.786  -7.473  1.00 109.68 ? 490 GLY B CA  1 
ATOM   4113 C  C   . GLY B 1 230 ? 10.087  13.472  -7.569  1.00 105.84 ? 490 GLY B C   1 
ATOM   4114 O  O   . GLY B 1 230 ? 10.257  12.791  -6.554  1.00 105.75 ? 490 GLY B O   1 
ATOM   4115 N  N   . PHE B 1 231 ? 10.548  13.101  -8.764  1.00 101.04 ? 491 PHE B N   1 
ATOM   4116 C  CA  . PHE B 1 231 ? 11.304  11.848  -8.938  1.00 95.63  ? 491 PHE B CA  1 
ATOM   4117 C  C   . PHE B 1 231 ? 12.789  12.019  -8.632  1.00 97.69  ? 491 PHE B C   1 
ATOM   4118 O  O   . PHE B 1 231 ? 13.304  13.128  -8.635  1.00 103.13 ? 491 PHE B O   1 
ATOM   4119 C  CB  . PHE B 1 231 ? 11.169  11.318  -10.366 1.00 88.73  ? 491 PHE B CB  1 
ATOM   4120 C  CG  . PHE B 1 231 ? 9.820   10.759  -10.684 1.00 85.28  ? 491 PHE B CG  1 
ATOM   4121 C  CD1 . PHE B 1 231 ? 9.634   9.386   -10.796 1.00 84.10  ? 491 PHE B CD1 1 
ATOM   4122 C  CD2 . PHE B 1 231 ? 8.736   11.604  -10.893 1.00 84.46  ? 491 PHE B CD2 1 
ATOM   4123 C  CE1 . PHE B 1 231 ? 8.392   8.865   -11.112 1.00 82.38  ? 491 PHE B CE1 1 
ATOM   4124 C  CE2 . PHE B 1 231 ? 7.486   11.093  -11.199 1.00 83.52  ? 491 PHE B CE2 1 
ATOM   4125 C  CZ  . PHE B 1 231 ? 7.311   9.721   -11.306 1.00 82.99  ? 491 PHE B CZ  1 
ATOM   4126 N  N   . THR B 1 232 ? 13.473  10.909  -8.383  1.00 93.96  ? 492 THR B N   1 
ATOM   4127 C  CA  . THR B 1 232 ? 14.919  10.906  -8.181  1.00 90.23  ? 492 THR B CA  1 
ATOM   4128 C  C   . THR B 1 232 ? 15.554  9.921   -9.142  1.00 88.92  ? 492 THR B C   1 
ATOM   4129 O  O   . THR B 1 232 ? 15.056  8.809   -9.312  1.00 87.13  ? 492 THR B O   1 
ATOM   4130 C  CB  . THR B 1 232 ? 15.282  10.454  -6.763  1.00 86.71  ? 492 THR B CB  1 
ATOM   4131 O  OG1 . THR B 1 232 ? 14.618  11.290  -5.813  1.00 89.31  ? 492 THR B OG1 1 
ATOM   4132 C  CG2 . THR B 1 232 ? 16.794  10.505  -6.536  1.00 83.56  ? 492 THR B CG2 1 
ATOM   4133 N  N   . GLU B 1 233 ? 16.642  10.336  -9.776  1.00 89.71  ? 493 GLU B N   1 
ATOM   4134 C  CA  . GLU B 1 233 ? 17.494  9.431   -10.526 1.00 89.45  ? 493 GLU B CA  1 
ATOM   4135 C  C   . GLU B 1 233 ? 18.781  9.282   -9.739  1.00 94.53  ? 493 GLU B C   1 
ATOM   4136 O  O   . GLU B 1 233 ? 19.156  10.170  -8.976  1.00 100.05 ? 493 GLU B O   1 
ATOM   4137 C  CB  . GLU B 1 233 ? 17.801  9.990   -11.914 1.00 87.05  ? 493 GLU B CB  1 
ATOM   4138 C  CG  . GLU B 1 233 ? 18.600  9.040   -12.803 1.00 87.69  ? 493 GLU B CG  1 
ATOM   4139 C  CD  . GLU B 1 233 ? 18.871  9.612   -14.181 1.00 93.16  ? 493 GLU B CD  1 
ATOM   4140 O  OE1 . GLU B 1 233 ? 18.822  8.834   -15.165 1.00 89.82  ? 493 GLU B OE1 1 
ATOM   4141 O  OE2 . GLU B 1 233 ? 19.130  10.840  -14.282 1.00 98.72  ? 493 GLU B OE2 1 
ATOM   4142 N  N   . GLY B 1 234 ? 19.463  8.162   -9.929  1.00 93.67  ? 494 GLY B N   1 
ATOM   4143 C  CA  . GLY B 1 234 ? 20.792  7.990   -9.362  1.00 93.23  ? 494 GLY B CA  1 
ATOM   4144 C  C   . GLY B 1 234 ? 21.848  8.741   -10.144 1.00 95.49  ? 494 GLY B C   1 
ATOM   4145 O  O   . GLY B 1 234 ? 21.591  9.256   -11.234 1.00 93.53  ? 494 GLY B O   1 
ATOM   4146 N  N   . GLU B 1 235 ? 23.045  8.804   -9.578  1.00 101.70 ? 495 GLU B N   1 
ATOM   4147 C  CA  . GLU B 1 235 ? 24.175  9.376   -10.285 1.00 107.09 ? 495 GLU B CA  1 
ATOM   4148 C  C   . GLU B 1 235 ? 24.462  8.449   -11.464 1.00 105.24 ? 495 GLU B C   1 
ATOM   4149 O  O   . GLU B 1 235 ? 24.428  7.216   -11.317 1.00 103.61 ? 495 GLU B O   1 
ATOM   4150 C  CB  . GLU B 1 235 ? 25.398  9.503   -9.366  1.00 109.56 ? 495 GLU B CB  1 
ATOM   4151 C  CG  . GLU B 1 235 ? 26.438  10.519  -9.847  1.00 113.34 ? 495 GLU B CG  1 
ATOM   4152 C  CD  . GLU B 1 235 ? 27.773  10.395  -9.128  1.00 117.83 ? 495 GLU B CD  1 
ATOM   4153 O  OE1 . GLU B 1 235 ? 27.876  9.612   -8.161  1.00 117.46 ? 495 GLU B OE1 1 
ATOM   4154 O  OE2 . GLU B 1 235 ? 28.728  11.083  -9.532  1.00 122.02 ? 495 GLU B OE2 1 
ATOM   4155 N  N   . LEU B 1 236 ? 24.696  9.042   -12.633 1.00 104.31 ? 496 LEU B N   1 
ATOM   4156 C  CA  . LEU B 1 236 ? 25.085  8.280   -13.813 1.00 101.47 ? 496 LEU B CA  1 
ATOM   4157 C  C   . LEU B 1 236 ? 26.599  8.026   -13.775 1.00 105.12 ? 496 LEU B C   1 
ATOM   4158 O  O   . LEU B 1 236 ? 27.391  8.779   -14.340 1.00 108.57 ? 496 LEU B O   1 
ATOM   4159 C  CB  . LEU B 1 236 ? 24.665  9.012   -15.084 1.00 99.13  ? 496 LEU B CB  1 
ATOM   4160 C  CG  . LEU B 1 236 ? 23.148  9.089   -15.300 1.00 97.33  ? 496 LEU B CG  1 
ATOM   4161 C  CD1 . LEU B 1 236 ? 22.714  10.422  -15.902 1.00 98.20  ? 496 LEU B CD1 1 
ATOM   4162 C  CD2 . LEU B 1 236 ? 22.666  7.935   -16.167 1.00 96.39  ? 496 LEU B CD2 1 
ATOM   4163 N  N   . THR B 1 237 ? 26.979  6.967   -13.067 1.00 103.92 ? 497 THR B N   1 
ATOM   4164 C  CA  . THR B 1 237 ? 28.360  6.497   -12.991 1.00 103.25 ? 497 THR B CA  1 
ATOM   4165 C  C   . THR B 1 237 ? 28.799  5.787   -14.274 1.00 99.03  ? 497 THR B C   1 
ATOM   4166 O  O   . THR B 1 237 ? 29.996  5.714   -14.570 1.00 98.57  ? 497 THR B O   1 
ATOM   4167 C  CB  . THR B 1 237 ? 28.509  5.482   -11.850 1.00 103.84 ? 497 THR B CB  1 
ATOM   4168 O  OG1 . THR B 1 237 ? 27.493  4.472   -11.997 1.00 103.72 ? 497 THR B OG1 1 
ATOM   4169 C  CG2 . THR B 1 237 ? 28.362  6.158   -10.499 1.00 101.59 ? 497 THR B CG2 1 
ATOM   4170 N  N   . PHE B 1 238 ? 27.825  5.255   -15.015 1.00 96.81  ? 498 PHE B N   1 
ATOM   4171 C  CA  . PHE B 1 238 ? 28.084  4.453   -16.222 1.00 95.59  ? 498 PHE B CA  1 
ATOM   4172 C  C   . PHE B 1 238 ? 28.026  5.281   -17.503 1.00 96.62  ? 498 PHE B C   1 
ATOM   4173 O  O   . PHE B 1 238 ? 27.314  6.287   -17.578 1.00 96.53  ? 498 PHE B O   1 
ATOM   4174 C  CB  . PHE B 1 238 ? 27.103  3.269   -16.320 1.00 91.72  ? 498 PHE B CB  1 
ATOM   4175 C  CG  . PHE B 1 238 ? 25.642  3.665   -16.333 1.00 90.81  ? 498 PHE B CG  1 
ATOM   4176 C  CD1 . PHE B 1 238 ? 25.017  4.050   -17.511 1.00 88.12  ? 498 PHE B CD1 1 
ATOM   4177 C  CD2 . PHE B 1 238 ? 24.883  3.615   -15.170 1.00 91.37  ? 498 PHE B CD2 1 
ATOM   4178 C  CE1 . PHE B 1 238 ? 23.666  4.393   -17.525 1.00 85.73  ? 498 PHE B CE1 1 
ATOM   4179 C  CE2 . PHE B 1 238 ? 23.534  3.960   -15.177 1.00 89.43  ? 498 PHE B CE2 1 
ATOM   4180 C  CZ  . PHE B 1 238 ? 22.932  4.353   -16.354 1.00 87.56  ? 498 PHE B CZ  1 
ATOM   4181 N  N   . GLN B 1 239 ? 28.764  4.837   -18.518 1.00 97.46  ? 499 GLN B N   1 
ATOM   4182 C  CA  . GLN B 1 239 ? 28.843  5.582   -19.770 1.00 101.63 ? 499 GLN B CA  1 
ATOM   4183 C  C   . GLN B 1 239 ? 27.554  5.452   -20.586 1.00 103.24 ? 499 GLN B C   1 
ATOM   4184 O  O   . GLN B 1 239 ? 26.789  4.504   -20.382 1.00 101.30 ? 499 GLN B O   1 
ATOM   4185 C  CB  . GLN B 1 239 ? 30.074  5.160   -20.592 1.00 103.52 ? 499 GLN B CB  1 
ATOM   4186 C  CG  . GLN B 1 239 ? 29.983  3.825   -21.334 1.00 100.14 ? 499 GLN B CG  1 
ATOM   4187 C  CD  . GLN B 1 239 ? 31.046  3.698   -22.421 1.00 99.45  ? 499 GLN B CD  1 
ATOM   4188 O  OE1 . GLN B 1 239 ? 32.244  3.924   -22.182 1.00 99.79  ? 499 GLN B OE1 1 
ATOM   4189 N  NE2 . GLN B 1 239 ? 30.608  3.344   -23.627 1.00 96.88  ? 499 GLN B NE2 1 
ATOM   4190 N  N   . PRO B 1 240 ? 27.307  6.411   -21.504 1.00 105.73 ? 500 PRO B N   1 
ATOM   4191 C  CA  . PRO B 1 240 ? 26.129  6.436   -22.368 1.00 103.29 ? 500 PRO B CA  1 
ATOM   4192 C  C   . PRO B 1 240 ? 25.820  5.114   -23.046 1.00 102.02 ? 500 PRO B C   1 
ATOM   4193 O  O   . PRO B 1 240 ? 26.736  4.377   -23.417 1.00 103.13 ? 500 PRO B O   1 
ATOM   4194 C  CB  . PRO B 1 240 ? 26.503  7.487   -23.409 1.00 105.15 ? 500 PRO B CB  1 
ATOM   4195 C  CG  . PRO B 1 240 ? 27.262  8.471   -22.640 1.00 106.75 ? 500 PRO B CG  1 
ATOM   4196 C  CD  . PRO B 1 240 ? 28.078  7.659   -21.652 1.00 108.03 ? 500 PRO B CD  1 
ATOM   4197 N  N   . THR B 1 241 ? 24.530  4.850   -23.222 1.00 100.00 ? 501 THR B N   1 
ATOM   4198 C  CA  . THR B 1 241 ? 24.044  3.554   -23.679 1.00 96.87  ? 501 THR B CA  1 
ATOM   4199 C  C   . THR B 1 241 ? 23.512  3.559   -25.112 1.00 94.63  ? 501 THR B C   1 
ATOM   4200 O  O   . THR B 1 241 ? 22.832  2.627   -25.512 1.00 90.72  ? 501 THR B O   1 
ATOM   4201 C  CB  . THR B 1 241 ? 22.919  3.068   -22.753 1.00 95.70  ? 501 THR B CB  1 
ATOM   4202 O  OG1 . THR B 1 241 ? 21.855  4.031   -22.750 1.00 94.71  ? 501 THR B OG1 1 
ATOM   4203 C  CG2 . THR B 1 241 ? 23.454  2.879   -21.345 1.00 95.63  ? 501 THR B CG2 1 
ATOM   4204 N  N   . TYR B 1 242 ? 23.828  4.593   -25.884 1.00 97.86  ? 502 TYR B N   1 
ATOM   4205 C  CA  . TYR B 1 242 ? 23.335  4.728   -27.263 1.00 98.95  ? 502 TYR B CA  1 
ATOM   4206 C  C   . TYR B 1 242 ? 24.156  5.831   -27.895 1.00 103.77 ? 502 TYR B C   1 
ATOM   4207 O  O   . TYR B 1 242 ? 24.510  6.775   -27.187 1.00 107.31 ? 502 TYR B O   1 
ATOM   4208 C  CB  . TYR B 1 242 ? 21.857  5.123   -27.251 1.00 96.33  ? 502 TYR B CB  1 
ATOM   4209 C  CG  . TYR B 1 242 ? 21.201  5.352   -28.601 1.00 95.49  ? 502 TYR B CG  1 
ATOM   4210 C  CD1 . TYR B 1 242 ? 20.771  4.283   -29.383 1.00 93.04  ? 502 TYR B CD1 1 
ATOM   4211 C  CD2 . TYR B 1 242 ? 20.964  6.643   -29.072 1.00 96.16  ? 502 TYR B CD2 1 
ATOM   4212 C  CE1 . TYR B 1 242 ? 20.141  4.495   -30.610 1.00 93.38  ? 502 TYR B CE1 1 
ATOM   4213 C  CE2 . TYR B 1 242 ? 20.342  6.866   -30.298 1.00 95.57  ? 502 TYR B CE2 1 
ATOM   4214 C  CZ  . TYR B 1 242 ? 19.930  5.789   -31.059 1.00 95.57  ? 502 TYR B CZ  1 
ATOM   4215 O  OH  . TYR B 1 242 ? 19.316  6.005   -32.272 1.00 95.85  ? 502 TYR B OH  1 
ATOM   4216 N  N   . LYS B 1 243 ? 24.495  5.748   -29.186 1.00 102.71 ? 503 LYS B N   1 
ATOM   4217 C  CA  . LYS B 1 243 ? 24.153  4.656   -30.102 1.00 98.20  ? 503 LYS B CA  1 
ATOM   4218 C  C   . LYS B 1 243 ? 25.403  3.841   -30.420 1.00 103.03 ? 503 LYS B C   1 
ATOM   4219 O  O   . LYS B 1 243 ? 26.477  4.401   -30.670 1.00 106.18 ? 503 LYS B O   1 
ATOM   4220 C  CB  . LYS B 1 243 ? 23.570  5.228   -31.402 1.00 92.61  ? 503 LYS B CB  1 
ATOM   4221 C  CG  . LYS B 1 243 ? 23.282  4.195   -32.477 1.00 87.17  ? 503 LYS B CG  1 
ATOM   4222 C  CD  . LYS B 1 243 ? 22.449  4.768   -33.625 1.00 86.00  ? 503 LYS B CD  1 
ATOM   4223 C  CE  . LYS B 1 243 ? 22.191  3.709   -34.702 1.00 84.59  ? 503 LYS B CE  1 
ATOM   4224 N  NZ  . LYS B 1 243 ? 21.003  4.002   -35.536 1.00 82.74  ? 503 LYS B NZ  1 
ATOM   4225 N  N   . TYR B 1 244 ? 25.248  2.519   -30.440 1.00 105.30 ? 504 TYR B N   1 
ATOM   4226 C  CA  . TYR B 1 244 ? 26.357  1.602   -30.695 1.00 109.63 ? 504 TYR B CA  1 
ATOM   4227 C  C   . TYR B 1 244 ? 26.236  0.870   -32.030 1.00 110.61 ? 504 TYR B C   1 
ATOM   4228 O  O   . TYR B 1 244 ? 25.134  0.626   -32.525 1.00 107.44 ? 504 TYR B O   1 
ATOM   4229 C  CB  . TYR B 1 244 ? 26.448  0.562   -29.575 1.00 109.52 ? 504 TYR B CB  1 
ATOM   4230 C  CG  . TYR B 1 244 ? 26.962  1.104   -28.263 1.00 111.21 ? 504 TYR B CG  1 
ATOM   4231 C  CD1 . TYR B 1 244 ? 28.332  1.162   -27.996 1.00 114.32 ? 504 TYR B CD1 1 
ATOM   4232 C  CD2 . TYR B 1 244 ? 26.082  1.553   -27.286 1.00 110.86 ? 504 TYR B CD2 1 
ATOM   4233 C  CE1 . TYR B 1 244 ? 28.806  1.658   -26.785 1.00 117.68 ? 504 TYR B CE1 1 
ATOM   4234 C  CE2 . TYR B 1 244 ? 26.542  2.045   -26.076 1.00 113.65 ? 504 TYR B CE2 1 
ATOM   4235 C  CZ  . TYR B 1 244 ? 27.898  2.097   -25.825 1.00 117.81 ? 504 TYR B CZ  1 
ATOM   4236 O  OH  . TYR B 1 244 ? 28.344  2.594   -24.619 1.00 120.75 ? 504 TYR B OH  1 
ATOM   4237 N  N   . ASP B 1 245 ? 27.387  0.525   -32.605 1.00 115.14 ? 505 ASP B N   1 
ATOM   4238 C  CA  . ASP B 1 245 ? 27.431  -0.429  -33.709 1.00 117.65 ? 505 ASP B CA  1 
ATOM   4239 C  C   . ASP B 1 245 ? 27.000  -1.796  -33.158 1.00 114.36 ? 505 ASP B C   1 
ATOM   4240 O  O   . ASP B 1 245 ? 27.334  -2.152  -32.020 1.00 111.25 ? 505 ASP B O   1 
ATOM   4241 C  CB  . ASP B 1 245 ? 28.838  -0.500  -34.337 1.00 121.61 ? 505 ASP B CB  1 
ATOM   4242 C  CG  . ASP B 1 245 ? 29.216  0.771   -35.110 1.00 124.67 ? 505 ASP B CG  1 
ATOM   4243 O  OD1 . ASP B 1 245 ? 30.347  0.831   -35.641 1.00 127.08 ? 505 ASP B OD1 1 
ATOM   4244 O  OD2 . ASP B 1 245 ? 28.390  1.712   -35.184 1.00 123.81 ? 505 ASP B OD2 1 
ATOM   4245 N  N   . THR B 1 246 ? 26.243  -2.547  -33.954 1.00 113.50 ? 506 THR B N   1 
ATOM   4246 C  CA  . THR B 1 246 ? 25.652  -3.797  -33.481 1.00 111.47 ? 506 THR B CA  1 
ATOM   4247 C  C   . THR B 1 246 ? 26.734  -4.878  -33.400 1.00 111.97 ? 506 THR B C   1 
ATOM   4248 O  O   . THR B 1 246 ? 27.544  -5.030  -34.316 1.00 114.63 ? 506 THR B O   1 
ATOM   4249 C  CB  . THR B 1 246 ? 24.471  -4.256  -34.383 1.00 106.78 ? 506 THR B CB  1 
ATOM   4250 O  OG1 . THR B 1 246 ? 23.814  -3.111  -34.946 1.00 108.11 ? 506 THR B OG1 1 
ATOM   4251 C  CG2 . THR B 1 246 ? 23.452  -5.081  -33.581 1.00 101.98 ? 506 THR B CG2 1 
ATOM   4252 N  N   . GLY B 1 247 ? 26.748  -5.603  -32.283 1.00 107.93 ? 507 GLY B N   1 
ATOM   4253 C  CA  . GLY B 1 247 ? 27.741  -6.645  -32.038 1.00 104.56 ? 507 GLY B CA  1 
ATOM   4254 C  C   . GLY B 1 247 ? 29.066  -6.102  -31.543 1.00 103.63 ? 507 GLY B C   1 
ATOM   4255 O  O   . GLY B 1 247 ? 30.085  -6.778  -31.657 1.00 104.10 ? 507 GLY B O   1 
ATOM   4256 N  N   . SER B 1 248 ? 29.059  -4.893  -30.978 1.00 102.92 ? 508 SER B N   1 
ATOM   4257 C  CA  . SER B 1 248 ? 30.294  -4.254  -30.529 1.00 105.11 ? 508 SER B CA  1 
ATOM   4258 C  C   . SER B 1 248 ? 30.066  -3.106  -29.545 1.00 105.13 ? 508 SER B C   1 
ATOM   4259 O  O   . SER B 1 248 ? 28.931  -2.765  -29.228 1.00 103.67 ? 508 SER B O   1 
ATOM   4260 C  CB  . SER B 1 248 ? 31.073  -3.737  -31.743 1.00 108.42 ? 508 SER B CB  1 
ATOM   4261 O  OG  . SER B 1 248 ? 30.316  -2.771  -32.450 1.00 110.31 ? 508 SER B OG  1 
ATOM   4262 N  N   . ASP B 1 249 ? 31.174  -2.529  -29.073 1.00 107.77 ? 509 ASP B N   1 
ATOM   4263 C  CA  . ASP B 1 249 ? 31.184  -1.364  -28.181 1.00 108.75 ? 509 ASP B CA  1 
ATOM   4264 C  C   . ASP B 1 249 ? 31.696  -0.084  -28.890 1.00 115.41 ? 509 ASP B C   1 
ATOM   4265 O  O   . ASP B 1 249 ? 32.249  0.808   -28.242 1.00 115.49 ? 509 ASP B O   1 
ATOM   4266 C  CB  . ASP B 1 249 ? 32.068  -1.661  -26.956 1.00 111.26 ? 509 ASP B CB  1 
ATOM   4267 C  CG  . ASP B 1 249 ? 31.638  -2.921  -26.197 1.00 111.07 ? 509 ASP B CG  1 
ATOM   4268 O  OD1 . ASP B 1 249 ? 30.418  -3.136  -26.025 1.00 109.30 ? 509 ASP B OD1 1 
ATOM   4269 O  OD2 . ASP B 1 249 ? 32.529  -3.688  -25.758 1.00 111.31 ? 509 ASP B OD2 1 
ATOM   4270 N  N   . ASP B 1 250 ? 31.510  -0.003  -30.212 1.00 116.62 ? 510 ASP B N   1 
ATOM   4271 C  CA  . ASP B 1 250 ? 31.876  1.181   -31.008 1.00 118.82 ? 510 ASP B CA  1 
ATOM   4272 C  C   . ASP B 1 250 ? 30.657  2.094   -31.199 1.00 118.58 ? 510 ASP B C   1 
ATOM   4273 O  O   . ASP B 1 250 ? 29.535  1.672   -30.957 1.00 118.16 ? 510 ASP B O   1 
ATOM   4274 C  CB  . ASP B 1 250 ? 32.435  0.757   -32.374 1.00 120.80 ? 510 ASP B CB  1 
ATOM   4275 C  CG  . ASP B 1 250 ? 33.835  0.147   -32.282 1.00 123.39 ? 510 ASP B CG  1 
ATOM   4276 O  OD1 . ASP B 1 250 ? 34.737  0.770   -31.678 1.00 125.42 ? 510 ASP B OD1 1 
ATOM   4277 O  OD2 . ASP B 1 250 ? 34.039  -0.951  -32.838 1.00 122.33 ? 510 ASP B OD2 1 
ATOM   4278 N  N   . TRP B 1 251 ? 30.879  3.328   -31.653 1.00 120.12 ? 511 TRP B N   1 
ATOM   4279 C  CA  . TRP B 1 251 ? 29.821  4.354   -31.742 1.00 119.62 ? 511 TRP B CA  1 
ATOM   4280 C  C   . TRP B 1 251 ? 29.197  4.528   -33.137 1.00 121.28 ? 511 TRP B C   1 
ATOM   4281 O  O   . TRP B 1 251 ? 29.821  4.217   -34.160 1.00 122.69 ? 511 TRP B O   1 
ATOM   4282 C  CB  . TRP B 1 251 ? 30.375  5.727   -31.326 1.00 122.63 ? 511 TRP B CB  1 
ATOM   4283 C  CG  . TRP B 1 251 ? 30.954  5.820   -29.928 1.00 123.75 ? 511 TRP B CG  1 
ATOM   4284 C  CD1 . TRP B 1 251 ? 32.273  5.981   -29.594 1.00 125.26 ? 511 TRP B CD1 1 
ATOM   4285 C  CD2 . TRP B 1 251 ? 30.229  5.794   -28.687 1.00 122.56 ? 511 TRP B CD2 1 
ATOM   4286 N  NE1 . TRP B 1 251 ? 32.412  6.040   -28.227 1.00 125.39 ? 511 TRP B NE1 1 
ATOM   4287 C  CE2 . TRP B 1 251 ? 31.176  5.928   -27.647 1.00 123.81 ? 511 TRP B CE2 1 
ATOM   4288 C  CE3 . TRP B 1 251 ? 28.875  5.661   -28.356 1.00 118.14 ? 511 TRP B CE3 1 
ATOM   4289 C  CZ2 . TRP B 1 251 ? 30.811  5.930   -26.301 1.00 121.44 ? 511 TRP B CZ2 1 
ATOM   4290 C  CZ3 . TRP B 1 251 ? 28.514  5.664   -27.019 1.00 115.71 ? 511 TRP B CZ3 1 
ATOM   4291 C  CH2 . TRP B 1 251 ? 29.478  5.795   -26.009 1.00 117.97 ? 511 TRP B CH2 1 
ATOM   4292 N  N   . ASP B 1 252 ? 27.964  5.051   -33.156 1.00 121.87 ? 512 ASP B N   1 
ATOM   4293 C  CA  . ASP B 1 252 ? 27.321  5.548   -34.392 1.00 122.69 ? 512 ASP B CA  1 
ATOM   4294 C  C   . ASP B 1 252 ? 26.722  6.954   -34.195 1.00 124.37 ? 512 ASP B C   1 
ATOM   4295 O  O   . ASP B 1 252 ? 27.139  7.928   -34.840 1.00 125.08 ? 512 ASP B O   1 
ATOM   4296 C  CB  . ASP B 1 252 ? 26.232  4.580   -34.865 1.00 116.74 ? 512 ASP B CB  1 
ATOM   4297 C  CG  . ASP B 1 252 ? 25.858  4.772   -36.339 1.00 116.38 ? 512 ASP B CG  1 
ATOM   4298 O  OD1 . ASP B 1 252 ? 26.293  5.759   -36.983 1.00 119.61 ? 512 ASP B OD1 1 
ATOM   4299 O  OD2 . ASP B 1 252 ? 25.114  3.913   -36.858 1.00 112.96 ? 512 ASP B OD2 1 
ATOM   4300 N  N   . ALA B 1 259 ? 25.552  11.387  -32.286 1.00 121.29 ? 519 ALA B N   1 
ATOM   4301 C  CA  . ALA B 1 259 ? 25.494  12.117  -31.023 1.00 124.49 ? 519 ALA B CA  1 
ATOM   4302 C  C   . ALA B 1 259 ? 25.087  11.176  -29.868 1.00 124.64 ? 519 ALA B C   1 
ATOM   4303 O  O   . ALA B 1 259 ? 23.900  10.842  -29.739 1.00 122.79 ? 519 ALA B O   1 
ATOM   4304 C  CB  . ALA B 1 259 ? 24.515  13.284  -31.144 1.00 124.96 ? 519 ALA B CB  1 
ATOM   4305 N  N   . PRO B 1 260 ? 26.066  10.740  -29.030 1.00 124.75 ? 520 PRO B N   1 
ATOM   4306 C  CA  . PRO B 1 260 ? 25.775  9.814   -27.919 1.00 120.32 ? 520 PRO B CA  1 
ATOM   4307 C  C   . PRO B 1 260 ? 24.846  10.384  -26.850 1.00 118.50 ? 520 PRO B C   1 
ATOM   4308 O  O   . PRO B 1 260 ? 24.629  11.597  -26.789 1.00 118.87 ? 520 PRO B O   1 
ATOM   4309 C  CB  . PRO B 1 260 ? 27.158  9.522   -27.318 1.00 120.27 ? 520 PRO B CB  1 
ATOM   4310 C  CG  . PRO B 1 260 ? 28.108  9.818   -28.388 1.00 123.39 ? 520 PRO B CG  1 
ATOM   4311 C  CD  . PRO B 1 260 ? 27.516  10.962  -29.160 1.00 126.37 ? 520 PRO B CD  1 
ATOM   4312 N  N   . ALA B 1 261 ? 24.307  9.499   -26.014 1.00 115.88 ? 521 ALA B N   1 
ATOM   4313 C  CA  . ALA B 1 261 ? 23.262  9.879   -25.066 1.00 114.29 ? 521 ALA B CA  1 
ATOM   4314 C  C   . ALA B 1 261 ? 22.993  8.798   -24.022 1.00 110.86 ? 521 ALA B C   1 
ATOM   4315 O  O   . ALA B 1 261 ? 23.222  7.615   -24.270 1.00 109.92 ? 521 ALA B O   1 
ATOM   4316 C  CB  . ALA B 1 261 ? 21.972  10.206  -25.819 1.00 112.26 ? 521 ALA B CB  1 
ATOM   4317 N  N   . TRP B 1 262 ? 22.538  9.231   -22.848 1.00 108.47 ? 522 TRP B N   1 
ATOM   4318 C  CA  . TRP B 1 262 ? 21.921  8.342   -21.884 1.00 105.01 ? 522 TRP B CA  1 
ATOM   4319 C  C   . TRP B 1 262 ? 20.440  8.327   -22.226 1.00 99.81  ? 522 TRP B C   1 
ATOM   4320 O  O   . TRP B 1 262 ? 19.641  9.043   -21.630 1.00 98.88  ? 522 TRP B O   1 
ATOM   4321 C  CB  . TRP B 1 262 ? 22.110  8.833   -20.442 1.00 108.58 ? 522 TRP B CB  1 
ATOM   4322 C  CG  . TRP B 1 262 ? 23.486  8.634   -19.832 1.00 111.39 ? 522 TRP B CG  1 
ATOM   4323 C  CD1 . TRP B 1 262 ? 24.121  7.447   -19.583 1.00 110.38 ? 522 TRP B CD1 1 
ATOM   4324 C  CD2 . TRP B 1 262 ? 24.354  9.659   -19.340 1.00 115.30 ? 522 TRP B CD2 1 
ATOM   4325 N  NE1 . TRP B 1 262 ? 25.344  7.676   -18.991 1.00 112.16 ? 522 TRP B NE1 1 
ATOM   4326 C  CE2 . TRP B 1 262 ? 25.508  9.025   -18.831 1.00 115.40 ? 522 TRP B CE2 1 
ATOM   4327 C  CE3 . TRP B 1 262 ? 24.273  11.057  -19.292 1.00 116.77 ? 522 TRP B CE3 1 
ATOM   4328 C  CZ2 . TRP B 1 262 ? 26.573  9.740   -18.284 1.00 118.43 ? 522 TRP B CZ2 1 
ATOM   4329 C  CZ3 . TRP B 1 262 ? 25.331  11.768  -18.746 1.00 118.32 ? 522 TRP B CZ3 1 
ATOM   4330 C  CH2 . TRP B 1 262 ? 26.468  11.107  -18.249 1.00 119.72 ? 522 TRP B CH2 1 
ATOM   4331 N  N   . CYS B 1 263 ? 20.075  7.537   -23.219 1.00 97.71  ? 523 CYS B N   1 
ATOM   4332 C  CA  . CYS B 1 263 ? 18.674  7.400   -23.581 1.00 95.99  ? 523 CYS B CA  1 
ATOM   4333 C  C   . CYS B 1 263 ? 17.916  6.627   -22.514 1.00 90.82  ? 523 CYS B C   1 
ATOM   4334 O  O   . CYS B 1 263 ? 16.751  6.898   -22.239 1.00 91.64  ? 523 CYS B O   1 
ATOM   4335 C  CB  . CYS B 1 263 ? 18.543  6.685   -24.929 1.00 95.64  ? 523 CYS B CB  1 
ATOM   4336 S  SG  . CYS B 1 263 ? 19.072  7.683   -26.350 1.00 99.02  ? 523 CYS B SG  1 
ATOM   4337 N  N   . ASP B 1 264 ? 18.605  5.685   -21.890 1.00 86.62  ? 524 ASP B N   1 
ATOM   4338 C  CA  . ASP B 1 264 ? 17.970  4.655   -21.096 1.00 82.77  ? 524 ASP B CA  1 
ATOM   4339 C  C   . ASP B 1 264 ? 18.138  4.900   -19.584 1.00 80.85  ? 524 ASP B C   1 
ATOM   4340 O  O   . ASP B 1 264 ? 19.250  4.852   -19.054 1.00 79.80  ? 524 ASP B O   1 
ATOM   4341 C  CB  . ASP B 1 264 ? 18.558  3.319   -21.529 1.00 82.32  ? 524 ASP B CB  1 
ATOM   4342 C  CG  . ASP B 1 264 ? 18.479  3.125   -23.039 1.00 85.23  ? 524 ASP B CG  1 
ATOM   4343 O  OD1 . ASP B 1 264 ? 17.354  2.894   -23.540 1.00 85.75  ? 524 ASP B OD1 1 
ATOM   4344 O  OD2 . ASP B 1 264 ? 19.527  3.214   -23.722 1.00 87.11  ? 524 ASP B OD2 1 
ATOM   4345 N  N   . ARG B 1 265 ? 17.009  5.144   -18.910 1.00 77.16  ? 525 ARG B N   1 
ATOM   4346 C  CA  . ARG B 1 265 ? 16.983  5.674   -17.549 1.00 76.66  ? 525 ARG B CA  1 
ATOM   4347 C  C   . ARG B 1 265 ? 15.987  4.966   -16.645 1.00 78.76  ? 525 ARG B C   1 
ATOM   4348 O  O   . ARG B 1 265 ? 14.945  4.493   -17.105 1.00 79.96  ? 525 ARG B O   1 
ATOM   4349 C  CB  . ARG B 1 265 ? 16.574  7.142   -17.569 1.00 78.28  ? 525 ARG B CB  1 
ATOM   4350 C  CG  . ARG B 1 265 ? 17.181  7.980   -18.679 1.00 81.29  ? 525 ARG B CG  1 
ATOM   4351 C  CD  . ARG B 1 265 ? 18.685  8.154   -18.536 1.00 85.87  ? 525 ARG B CD  1 
ATOM   4352 N  NE  . ARG B 1 265 ? 19.093  9.350   -19.254 1.00 91.00  ? 525 ARG B NE  1 
ATOM   4353 C  CZ  . ARG B 1 265 ? 19.309  10.537  -18.707 1.00 92.79  ? 525 ARG B CZ  1 
ATOM   4354 N  NH1 . ARG B 1 265 ? 19.198  10.736  -17.394 1.00 92.23  ? 525 ARG B NH1 1 
ATOM   4355 N  NH2 . ARG B 1 265 ? 19.647  11.538  -19.498 1.00 95.96  ? 525 ARG B NH2 1 
ATOM   4356 N  N   . ILE B 1 266 ? 16.315  4.933   -15.354 1.00 78.97  ? 526 ILE B N   1 
ATOM   4357 C  CA  . ILE B 1 266 ? 15.403  4.502   -14.300 1.00 77.20  ? 526 ILE B CA  1 
ATOM   4358 C  C   . ILE B 1 266 ? 15.350  5.613   -13.259 1.00 79.49  ? 526 ILE B C   1 
ATOM   4359 O  O   . ILE B 1 266 ? 16.393  6.069   -12.781 1.00 82.22  ? 526 ILE B O   1 
ATOM   4360 C  CB  . ILE B 1 266 ? 15.885  3.213   -13.601 1.00 76.03  ? 526 ILE B CB  1 
ATOM   4361 C  CG1 . ILE B 1 266 ? 16.173  2.112   -14.627 1.00 74.82  ? 526 ILE B CG1 1 
ATOM   4362 C  CG2 . ILE B 1 266 ? 14.854  2.745   -12.579 1.00 73.35  ? 526 ILE B CG2 1 
ATOM   4363 C  CD1 . ILE B 1 266 ? 16.780  0.864   -14.040 1.00 74.04  ? 526 ILE B CD1 1 
ATOM   4364 N  N   . LEU B 1 267 ? 14.139  6.052   -12.925 1.00 77.08  ? 527 LEU B N   1 
ATOM   4365 C  CA  . LEU B 1 267 ? 13.924  7.033   -11.866 1.00 76.42  ? 527 LEU B CA  1 
ATOM   4366 C  C   . LEU B 1 267 ? 12.875  6.472   -10.910 1.00 76.58  ? 527 LEU B C   1 
ATOM   4367 O  O   . LEU B 1 267 ? 12.296  5.429   -11.177 1.00 74.77  ? 527 LEU B O   1 
ATOM   4368 C  CB  . LEU B 1 267 ? 13.460  8.374   -12.451 1.00 77.84  ? 527 LEU B CB  1 
ATOM   4369 C  CG  . LEU B 1 267 ? 14.397  9.062   -13.458 1.00 77.69  ? 527 LEU B CG  1 
ATOM   4370 C  CD1 . LEU B 1 267 ? 14.066  8.646   -14.884 1.00 77.32  ? 527 LEU B CD1 1 
ATOM   4371 C  CD2 . LEU B 1 267 ? 14.345  10.573  -13.338 1.00 74.85  ? 527 LEU B CD2 1 
ATOM   4372 N  N   . TRP B 1 268 ? 12.628  7.159   -9.799  1.00 81.01  ? 528 TRP B N   1 
ATOM   4373 C  CA  . TRP B 1 268 ? 11.632  6.695   -8.838  1.00 81.92  ? 528 TRP B CA  1 
ATOM   4374 C  C   . TRP B 1 268 ? 11.071  7.821   -8.011  1.00 82.83  ? 528 TRP B C   1 
ATOM   4375 O  O   . TRP B 1 268 ? 11.649  8.897   -7.972  1.00 85.56  ? 528 TRP B O   1 
ATOM   4376 C  CB  . TRP B 1 268 ? 12.244  5.644   -7.896  1.00 82.93  ? 528 TRP B CB  1 
ATOM   4377 C  CG  . TRP B 1 268 ? 13.283  6.172   -6.966  1.00 85.67  ? 528 TRP B CG  1 
ATOM   4378 C  CD1 . TRP B 1 268 ? 13.094  6.590   -5.682  1.00 90.33  ? 528 TRP B CD1 1 
ATOM   4379 C  CD2 . TRP B 1 268 ? 14.674  6.341   -7.241  1.00 85.24  ? 528 TRP B CD2 1 
ATOM   4380 N  NE1 . TRP B 1 268 ? 14.284  7.016   -5.141  1.00 90.63  ? 528 TRP B NE1 1 
ATOM   4381 C  CE2 . TRP B 1 268 ? 15.271  6.866   -6.079  1.00 89.16  ? 528 TRP B CE2 1 
ATOM   4382 C  CE3 . TRP B 1 268 ? 15.477  6.089   -8.352  1.00 83.22  ? 528 TRP B CE3 1 
ATOM   4383 C  CZ2 . TRP B 1 268 ? 16.632  7.152   -6.002  1.00 89.96  ? 528 TRP B CZ2 1 
ATOM   4384 C  CZ3 . TRP B 1 268 ? 16.824  6.376   -8.277  1.00 84.97  ? 528 TRP B CZ3 1 
ATOM   4385 C  CH2 . TRP B 1 268 ? 17.390  6.904   -7.112  1.00 88.20  ? 528 TRP B CH2 1 
ATOM   4386 N  N   . LYS B 1 269 ? 9.942   7.564   -7.354  1.00 79.90  ? 529 LYS B N   1 
ATOM   4387 C  CA  . LYS B 1 269 ? 9.499   8.400   -6.237  1.00 81.10  ? 529 LYS B CA  1 
ATOM   4388 C  C   . LYS B 1 269 ? 8.599   7.642   -5.260  1.00 85.11  ? 529 LYS B C   1 
ATOM   4389 O  O   . LYS B 1 269 ? 7.729   6.859   -5.658  1.00 84.81  ? 529 LYS B O   1 
ATOM   4390 C  CB  . LYS B 1 269 ? 8.849   9.721   -6.702  1.00 82.63  ? 529 LYS B CB  1 
ATOM   4391 C  CG  . LYS B 1 269 ? 7.398   9.644   -7.164  1.00 85.74  ? 529 LYS B CG  1 
ATOM   4392 C  CD  . LYS B 1 269 ? 6.764   11.041  -7.211  1.00 90.18  ? 529 LYS B CD  1 
ATOM   4393 C  CE  . LYS B 1 269 ? 6.181   11.408  -5.863  1.00 96.00  ? 529 LYS B CE  1 
ATOM   4394 N  NZ  . LYS B 1 269 ? 5.756   12.826  -5.803  1.00 101.75 ? 529 LYS B NZ  1 
ATOM   4395 N  N   . GLY B 1 270 ? 8.828   7.895   -3.973  1.00 88.85  ? 530 GLY B N   1 
ATOM   4396 C  CA  . GLY B 1 270 ? 8.165   7.178   -2.892  1.00 89.11  ? 530 GLY B CA  1 
ATOM   4397 C  C   . GLY B 1 270 ? 9.081   7.146   -1.693  1.00 93.16  ? 530 GLY B C   1 
ATOM   4398 O  O   . GLY B 1 270 ? 10.292  7.330   -1.831  1.00 91.82  ? 530 GLY B O   1 
ATOM   4399 N  N   . LYS B 1 271 ? 8.507   6.933   -0.513  1.00 98.23  ? 531 LYS B N   1 
ATOM   4400 C  CA  . LYS B 1 271 ? 9.299   6.862   0.710   1.00 102.45 ? 531 LYS B CA  1 
ATOM   4401 C  C   . LYS B 1 271 ? 9.806   5.424   0.902   1.00 101.87 ? 531 LYS B C   1 
ATOM   4402 O  O   . LYS B 1 271 ? 9.190   4.470   0.427   1.00 100.76 ? 531 LYS B O   1 
ATOM   4403 C  CB  . LYS B 1 271 ? 8.480   7.341   1.920   1.00 103.49 ? 531 LYS B CB  1 
ATOM   4404 N  N   . ASN B 1 272 ? 10.947  5.299   1.577   1.00 101.75 ? 532 ASN B N   1 
ATOM   4405 C  CA  . ASN B 1 272 ? 11.588  4.010   1.910   1.00 98.09  ? 532 ASN B CA  1 
ATOM   4406 C  C   . ASN B 1 272 ? 12.321  3.328   0.759   1.00 91.54  ? 532 ASN B C   1 
ATOM   4407 O  O   . ASN B 1 272 ? 12.656  2.149   0.850   1.00 91.98  ? 532 ASN B O   1 
ATOM   4408 C  CB  . ASN B 1 272 ? 10.597  3.038   2.559   1.00 98.23  ? 532 ASN B CB  1 
ATOM   4409 C  CG  . ASN B 1 272 ? 9.909   3.638   3.752   1.00 99.61  ? 532 ASN B CG  1 
ATOM   4410 O  OD1 . ASN B 1 272 ? 8.690   3.781   3.760   1.00 99.82  ? 532 ASN B OD1 1 
ATOM   4411 N  ND2 . ASN B 1 272 ? 10.686  4.024   4.758   1.00 100.28 ? 532 ASN B ND2 1 
ATOM   4412 N  N   . ILE B 1 273 ? 12.600  4.086   -0.296  1.00 87.71  ? 533 ILE B N   1 
ATOM   4413 C  CA  . ILE B 1 273 ? 13.336  3.590   -1.453  1.00 83.27  ? 533 ILE B CA  1 
ATOM   4414 C  C   . ILE B 1 273 ? 14.803  3.967   -1.295  1.00 84.39  ? 533 ILE B C   1 
ATOM   4415 O  O   . ILE B 1 273 ? 15.136  5.143   -1.164  1.00 87.44  ? 533 ILE B O   1 
ATOM   4416 C  CB  . ILE B 1 273 ? 12.802  4.215   -2.759  1.00 81.29  ? 533 ILE B CB  1 
ATOM   4417 C  CG1 . ILE B 1 273 ? 11.301  3.967   -2.902  1.00 77.20  ? 533 ILE B CG1 1 
ATOM   4418 C  CG2 . ILE B 1 273 ? 13.526  3.646   -3.974  1.00 80.58  ? 533 ILE B CG2 1 
ATOM   4419 C  CD1 . ILE B 1 273 ? 10.669  4.784   -3.989  1.00 76.98  ? 533 ILE B CD1 1 
ATOM   4420 N  N   . THR B 1 274 ? 15.670  2.963   -1.285  1.00 81.99  ? 534 THR B N   1 
ATOM   4421 C  CA  . THR B 1 274 ? 17.111  3.167   -1.288  1.00 84.20  ? 534 THR B CA  1 
ATOM   4422 C  C   . THR B 1 274 ? 17.648  2.473   -2.534  1.00 84.66  ? 534 THR B C   1 
ATOM   4423 O  O   . THR B 1 274 ? 17.455  1.270   -2.712  1.00 84.55  ? 534 THR B O   1 
ATOM   4424 C  CB  . THR B 1 274 ? 17.753  2.557   -0.034  1.00 85.08  ? 534 THR B CB  1 
ATOM   4425 O  OG1 . THR B 1 274 ? 16.979  2.919   1.116   1.00 85.20  ? 534 THR B OG1 1 
ATOM   4426 C  CG2 . THR B 1 274 ? 19.207  3.026   0.140   1.00 83.84  ? 534 THR B CG2 1 
ATOM   4427 N  N   . GLN B 1 275 ? 18.279  3.234   -3.422  1.00 85.68  ? 535 GLN B N   1 
ATOM   4428 C  CA  . GLN B 1 275 ? 18.886  2.654   -4.605  1.00 83.07  ? 535 GLN B CA  1 
ATOM   4429 C  C   . GLN B 1 275 ? 20.220  2.067   -4.204  1.00 86.96  ? 535 GLN B C   1 
ATOM   4430 O  O   . GLN B 1 275 ? 21.054  2.770   -3.634  1.00 89.80  ? 535 GLN B O   1 
ATOM   4431 C  CB  . GLN B 1 275 ? 19.094  3.706   -5.674  1.00 79.39  ? 535 GLN B CB  1 
ATOM   4432 C  CG  . GLN B 1 275 ? 19.556  3.117   -6.984  1.00 79.42  ? 535 GLN B CG  1 
ATOM   4433 C  CD  . GLN B 1 275 ? 19.581  4.143   -8.088  1.00 80.78  ? 535 GLN B CD  1 
ATOM   4434 O  OE1 . GLN B 1 275 ? 20.261  5.161   -7.971  1.00 84.15  ? 535 GLN B OE1 1 
ATOM   4435 N  NE2 . GLN B 1 275 ? 18.833  3.890   -9.165  1.00 78.42  ? 535 GLN B NE2 1 
ATOM   4436 N  N   . LEU B 1 276 ? 20.414  0.779   -4.478  1.00 84.50  ? 536 LEU B N   1 
ATOM   4437 C  CA  . LEU B 1 276 ? 21.662  0.097   -4.124  1.00 82.76  ? 536 LEU B CA  1 
ATOM   4438 C  C   . LEU B 1 276 ? 22.645  0.100   -5.281  1.00 85.44  ? 536 LEU B C   1 
ATOM   4439 O  O   . LEU B 1 276 ? 23.834  -0.109  -5.084  1.00 87.13  ? 536 LEU B O   1 
ATOM   4440 C  CB  . LEU B 1 276 ? 21.405  -1.348  -3.696  1.00 77.52  ? 536 LEU B CB  1 
ATOM   4441 C  CG  . LEU B 1 276 ? 20.735  -1.590  -2.343  1.00 80.21  ? 536 LEU B CG  1 
ATOM   4442 C  CD1 . LEU B 1 276 ? 20.514  -3.099  -2.173  1.00 80.69  ? 536 LEU B CD1 1 
ATOM   4443 C  CD2 . LEU B 1 276 ? 21.549  -1.006  -1.173  1.00 79.51  ? 536 LEU B CD2 1 
ATOM   4444 N  N   . SER B 1 277 ? 22.154  0.325   -6.492  1.00 84.83  ? 537 SER B N   1 
ATOM   4445 C  CA  . SER B 1 277 ? 23.016  0.281   -7.660  1.00 84.77  ? 537 SER B CA  1 
ATOM   4446 C  C   . SER B 1 277 ? 22.294  0.850   -8.868  1.00 86.92  ? 537 SER B C   1 
ATOM   4447 O  O   . SER B 1 277 ? 21.071  0.939   -8.893  1.00 90.11  ? 537 SER B O   1 
ATOM   4448 C  CB  . SER B 1 277 ? 23.461  -1.161  -7.948  1.00 82.32  ? 537 SER B CB  1 
ATOM   4449 O  OG  . SER B 1 277 ? 22.348  -2.014  -8.221  1.00 81.64  ? 537 SER B OG  1 
ATOM   4450 N  N   . TYR B 1 278 ? 23.074  1.237   -9.866  1.00 85.40  ? 538 TYR B N   1 
ATOM   4451 C  CA  . TYR B 1 278 ? 22.555  1.817   -11.083 1.00 83.49  ? 538 TYR B CA  1 
ATOM   4452 C  C   . TYR B 1 278 ? 23.644  1.629   -12.133 1.00 84.92  ? 538 TYR B C   1 
ATOM   4453 O  O   . TYR B 1 278 ? 24.659  2.323   -12.108 1.00 89.63  ? 538 TYR B O   1 
ATOM   4454 C  CB  . TYR B 1 278 ? 22.224  3.286   -10.827 1.00 83.22  ? 538 TYR B CB  1 
ATOM   4455 C  CG  . TYR B 1 278 ? 21.460  4.020   -11.916 1.00 85.60  ? 538 TYR B CG  1 
ATOM   4456 C  CD1 . TYR B 1 278 ? 20.542  3.373   -12.746 1.00 81.86  ? 538 TYR B CD1 1 
ATOM   4457 C  CD2 . TYR B 1 278 ? 21.629  5.384   -12.084 1.00 86.62  ? 538 TYR B CD2 1 
ATOM   4458 C  CE1 . TYR B 1 278 ? 19.844  4.075   -13.716 1.00 78.97  ? 538 TYR B CE1 1 
ATOM   4459 C  CE2 . TYR B 1 278 ? 20.939  6.081   -13.058 1.00 86.07  ? 538 TYR B CE2 1 
ATOM   4460 C  CZ  . TYR B 1 278 ? 20.050  5.428   -13.867 1.00 80.64  ? 538 TYR B CZ  1 
ATOM   4461 O  OH  . TYR B 1 278 ? 19.370  6.151   -14.815 1.00 77.86  ? 538 TYR B OH  1 
ATOM   4462 N  N   . GLN B 1 279 ? 23.446  0.644   -13.011 1.00 81.15  ? 539 GLN B N   1 
ATOM   4463 C  CA  . GLN B 1 279 ? 24.495  0.149   -13.908 1.00 80.69  ? 539 GLN B CA  1 
ATOM   4464 C  C   . GLN B 1 279 ? 23.996  0.037   -15.337 1.00 79.79  ? 539 GLN B C   1 
ATOM   4465 O  O   . GLN B 1 279 ? 22.809  -0.101  -15.553 1.00 78.39  ? 539 GLN B O   1 
ATOM   4466 C  CB  . GLN B 1 279 ? 24.959  -1.261  -13.479 1.00 78.06  ? 539 GLN B CB  1 
ATOM   4467 C  CG  . GLN B 1 279 ? 25.262  -1.470  -11.972 1.00 116.13 ? 539 GLN B CG  1 
ATOM   4468 C  CD  . GLN B 1 279 ? 24.246  -2.382  -11.243 1.00 116.22 ? 539 GLN B CD  1 
ATOM   4469 O  OE1 . GLN B 1 279 ? 23.047  -2.432  -11.587 1.00 115.56 ? 539 GLN B OE1 1 
ATOM   4470 N  NE2 . GLN B 1 279 ? 24.735  -3.102  -10.219 1.00 115.87 ? 539 GLN B NE2 1 
ATOM   4471 N  N   . SER B 1 280 ? 24.908  0.083   -16.304 1.00 82.65  ? 540 SER B N   1 
ATOM   4472 C  CA  . SER B 1 280 ? 24.627  -0.356  -17.671 1.00 85.75  ? 540 SER B CA  1 
ATOM   4473 C  C   . SER B 1 280 ? 25.417  -1.623  -17.909 1.00 88.40  ? 540 SER B C   1 
ATOM   4474 O  O   . SER B 1 280 ? 26.335  -1.931  -17.147 1.00 91.50  ? 540 SER B O   1 
ATOM   4475 C  CB  . SER B 1 280 ? 25.025  0.696   -18.709 1.00 90.64  ? 540 SER B CB  1 
ATOM   4476 O  OG  . SER B 1 280 ? 26.375  0.546   -19.143 1.00 94.71  ? 540 SER B OG  1 
ATOM   4477 N  N   . HIS B 1 281 ? 25.086  -2.348  -18.976 1.00 86.75  ? 541 HIS B N   1 
ATOM   4478 C  CA  . HIS B 1 281 ? 25.708  -3.651  -19.222 1.00 86.38  ? 541 HIS B CA  1 
ATOM   4479 C  C   . HIS B 1 281 ? 26.363  -3.763  -20.598 1.00 87.44  ? 541 HIS B C   1 
ATOM   4480 O  O   . HIS B 1 281 ? 25.772  -4.279  -21.560 1.00 83.45  ? 541 HIS B O   1 
ATOM   4481 C  CB  . HIS B 1 281 ? 24.685  -4.746  -18.986 1.00 83.34  ? 541 HIS B CB  1 
ATOM   4482 C  CG  . HIS B 1 281 ? 24.116  -4.723  -17.607 1.00 82.75  ? 541 HIS B CG  1 
ATOM   4483 N  ND1 . HIS B 1 281 ? 24.560  -5.554  -16.608 1.00 83.81  ? 541 HIS B ND1 1 
ATOM   4484 C  CD2 . HIS B 1 281 ? 23.167  -3.939  -17.049 1.00 82.17  ? 541 HIS B CD2 1 
ATOM   4485 C  CE1 . HIS B 1 281 ? 23.894  -5.300  -15.497 1.00 83.12  ? 541 HIS B CE1 1 
ATOM   4486 N  NE2 . HIS B 1 281 ? 23.040  -4.324  -15.739 1.00 81.54  ? 541 HIS B NE2 1 
ATOM   4487 N  N   . MET B 1 282 ? 27.615  -3.304  -20.654 1.00 90.86  ? 542 MET B N   1 
ATOM   4488 C  CA  . MET B 1 282 ? 28.369  -3.208  -21.905 1.00 95.08  ? 542 MET B CA  1 
ATOM   4489 C  C   . MET B 1 282 ? 28.472  -4.535  -22.649 1.00 96.91  ? 542 MET B C   1 
ATOM   4490 O  O   . MET B 1 282 ? 28.307  -4.571  -23.866 1.00 99.51  ? 542 MET B O   1 
ATOM   4491 C  CB  . MET B 1 282 ? 29.775  -2.657  -21.640 1.00 98.61  ? 542 MET B CB  1 
ATOM   4492 C  CG  . MET B 1 282 ? 29.791  -1.197  -21.187 1.00 100.92 ? 542 MET B CG  1 
ATOM   4493 S  SD  . MET B 1 282 ? 29.451  -0.016  -22.519 1.00 112.44 ? 542 MET B SD  1 
ATOM   4494 C  CE  . MET B 1 282 ? 28.102  0.926   -21.762 1.00 106.30 ? 542 MET B CE  1 
ATOM   4495 N  N   . ALA B 1 283 ? 28.718  -5.613  -21.907 1.00 95.64  ? 543 ALA B N   1 
ATOM   4496 C  CA  . ALA B 1 283 ? 28.993  -6.940  -22.479 1.00 93.76  ? 543 ALA B CA  1 
ATOM   4497 C  C   . ALA B 1 283 ? 27.996  -7.431  -23.545 1.00 92.24  ? 543 ALA B C   1 
ATOM   4498 O  O   . ALA B 1 283 ? 28.410  -8.098  -24.501 1.00 92.50  ? 543 ALA B O   1 
ATOM   4499 C  CB  . ALA B 1 283 ? 29.107  -7.971  -21.357 1.00 92.61  ? 543 ALA B CB  1 
ATOM   4500 N  N   . LEU B 1 284 ? 26.707  -7.104  -23.381 1.00 91.64  ? 544 LEU B N   1 
ATOM   4501 C  CA  . LEU B 1 284 ? 25.648  -7.541  -24.310 1.00 92.09  ? 544 LEU B CA  1 
ATOM   4502 C  C   . LEU B 1 284 ? 25.562  -6.653  -25.552 1.00 92.56  ? 544 LEU B C   1 
ATOM   4503 O  O   . LEU B 1 284 ? 25.202  -5.480  -25.456 1.00 94.56  ? 544 LEU B O   1 
ATOM   4504 C  CB  . LEU B 1 284 ? 24.281  -7.535  -23.611 1.00 92.71  ? 544 LEU B CB  1 
ATOM   4505 C  CG  . LEU B 1 284 ? 24.039  -8.549  -22.493 1.00 93.24  ? 544 LEU B CG  1 
ATOM   4506 C  CD1 . LEU B 1 284 ? 22.695  -8.280  -21.853 1.00 91.99  ? 544 LEU B CD1 1 
ATOM   4507 C  CD2 . LEU B 1 284 ? 24.102  -9.973  -23.029 1.00 94.67  ? 544 LEU B CD2 1 
ATOM   4508 N  N   . LYS B 1 285 ? 25.853  -7.222  -26.717 1.00 91.23  ? 545 LYS B N   1 
ATOM   4509 C  CA  . LYS B 1 285 ? 25.994  -6.435  -27.946 1.00 91.99  ? 545 LYS B CA  1 
ATOM   4510 C  C   . LYS B 1 285 ? 24.928  -6.759  -29.006 1.00 92.00  ? 545 LYS B C   1 
ATOM   4511 O  O   . LYS B 1 285 ? 25.111  -6.447  -30.185 1.00 94.78  ? 545 LYS B O   1 
ATOM   4512 C  CB  . LYS B 1 285 ? 27.391  -6.671  -28.547 1.00 89.85  ? 545 LYS B CB  1 
ATOM   4513 C  CG  . LYS B 1 285 ? 28.577  -6.455  -27.592 1.00 90.69  ? 545 LYS B CG  1 
ATOM   4514 C  CD  . LYS B 1 285 ? 29.725  -7.437  -27.880 1.00 90.83  ? 545 LYS B CD  1 
ATOM   4515 C  CE  . LYS B 1 285 ? 31.093  -6.883  -27.468 1.00 93.64  ? 545 LYS B CE  1 
ATOM   4516 N  NZ  . LYS B 1 285 ? 31.097  -6.315  -26.085 1.00 95.54  ? 545 LYS B NZ  1 
ATOM   4517 N  N   . THR B 1 286 ? 23.821  -7.376  -28.598 1.00 87.80  ? 546 THR B N   1 
ATOM   4518 C  CA  . THR B 1 286 ? 22.756  -7.759  -29.546 1.00 86.77  ? 546 THR B CA  1 
ATOM   4519 C  C   . THR B 1 286 ? 22.063  -6.544  -30.178 1.00 89.31  ? 546 THR B C   1 
ATOM   4520 O  O   . THR B 1 286 ? 21.663  -6.585  -31.357 1.00 90.92  ? 546 THR B O   1 
ATOM   4521 C  CB  . THR B 1 286 ? 21.683  -8.655  -28.869 1.00 74.56  ? 546 THR B CB  1 
ATOM   4522 O  OG1 . THR B 1 286 ? 22.160  -10.003 -28.813 1.00 75.92  ? 546 THR B OG1 1 
ATOM   4523 C  CG2 . THR B 1 286 ? 20.362  -8.622  -29.642 1.00 71.06  ? 546 THR B CG2 1 
ATOM   4524 N  N   . SER B 1 287 ? 21.932  -5.476  -29.385 1.00 87.68  ? 547 SER B N   1 
ATOM   4525 C  CA  . SER B 1 287 ? 21.267  -4.244  -29.802 1.00 83.96  ? 547 SER B CA  1 
ATOM   4526 C  C   . SER B 1 287 ? 22.251  -3.086  -29.962 1.00 86.39  ? 547 SER B C   1 
ATOM   4527 O  O   . SER B 1 287 ? 23.427  -3.207  -29.617 1.00 88.01  ? 547 SER B O   1 
ATOM   4528 C  CB  . SER B 1 287 ? 20.212  -3.866  -28.769 1.00 79.03  ? 547 SER B CB  1 
ATOM   4529 O  OG  . SER B 1 287 ? 19.643  -2.609  -29.057 1.00 76.54  ? 547 SER B OG  1 
ATOM   4530 N  N   . ASP B 1 288 ? 21.751  -1.971  -30.502 1.00 85.89  ? 548 ASP B N   1 
ATOM   4531 C  CA  . ASP B 1 288 ? 22.506  -0.718  -30.579 1.00 84.69  ? 548 ASP B CA  1 
ATOM   4532 C  C   . ASP B 1 288 ? 22.366  0.102   -29.288 1.00 85.74  ? 548 ASP B C   1 
ATOM   4533 O  O   . ASP B 1 288 ? 22.966  1.174   -29.160 1.00 86.48  ? 548 ASP B O   1 
ATOM   4534 C  CB  . ASP B 1 288 ? 22.081  0.105   -31.798 1.00 83.45  ? 548 ASP B CB  1 
ATOM   4535 C  CG  . ASP B 1 288 ? 20.622  0.523   -31.763 1.00 84.92  ? 548 ASP B CG  1 
ATOM   4536 O  OD1 . ASP B 1 288 ? 19.952  0.304   -30.733 1.00 84.33  ? 548 ASP B OD1 1 
ATOM   4537 O  OD2 . ASP B 1 288 ? 20.138  1.078   -32.782 1.00 86.75  ? 548 ASP B OD2 1 
ATOM   4538 N  N   . HIS B 1 289 ? 21.547  -0.398  -28.355 1.00 84.13  ? 549 HIS B N   1 
ATOM   4539 C  CA  . HIS B 1 289 ? 21.493  0.112   -26.983 1.00 82.75  ? 549 HIS B CA  1 
ATOM   4540 C  C   . HIS B 1 289 ? 22.109  -0.920  -26.040 1.00 82.31  ? 549 HIS B C   1 
ATOM   4541 O  O   . HIS B 1 289 ? 22.056  -2.120  -26.301 1.00 78.75  ? 549 HIS B O   1 
ATOM   4542 C  CB  . HIS B 1 289 ? 20.049  0.332   -26.513 1.00 80.87  ? 549 HIS B CB  1 
ATOM   4543 C  CG  . HIS B 1 289 ? 19.357  1.515   -27.119 1.00 81.58  ? 549 HIS B CG  1 
ATOM   4544 N  ND1 . HIS B 1 289 ? 19.207  2.710   -26.447 1.00 82.54  ? 549 HIS B ND1 1 
ATOM   4545 C  CD2 . HIS B 1 289 ? 18.701  1.660   -28.294 1.00 80.30  ? 549 HIS B CD2 1 
ATOM   4546 C  CE1 . HIS B 1 289 ? 18.514  3.548   -27.196 1.00 81.86  ? 549 HIS B CE1 1 
ATOM   4547 N  NE2 . HIS B 1 289 ? 18.191  2.934   -28.320 1.00 80.83  ? 549 HIS B NE2 1 
ATOM   4548 N  N   . LYS B 1 290 ? 22.669  -0.440  -24.933 1.00 87.35  ? 550 LYS B N   1 
ATOM   4549 C  CA  . LYS B 1 290 ? 23.063  -1.300  -23.813 1.00 88.06  ? 550 LYS B CA  1 
ATOM   4550 C  C   . LYS B 1 290 ? 21.942  -1.296  -22.776 1.00 84.56  ? 550 LYS B C   1 
ATOM   4551 O  O   . LYS B 1 290 ? 21.296  -0.270  -22.561 1.00 84.76  ? 550 LYS B O   1 
ATOM   4552 C  CB  . LYS B 1 290 ? 24.365  -0.815  -23.157 1.00 92.10  ? 550 LYS B CB  1 
ATOM   4553 C  CG  . LYS B 1 290 ? 25.590  -0.770  -24.077 1.00 96.65  ? 550 LYS B CG  1 
ATOM   4554 C  CD  . LYS B 1 290 ? 26.004  -2.148  -24.611 1.00 97.95  ? 550 LYS B CD  1 
ATOM   4555 C  CE  . LYS B 1 290 ? 27.286  -2.057  -25.434 1.00 102.20 ? 550 LYS B CE  1 
ATOM   4556 N  NZ  . LYS B 1 290 ? 27.369  -3.135  -26.463 1.00 103.90 ? 550 LYS B NZ  1 
ATOM   4557 N  N   . PRO B 1 291 ? 21.695  -2.444  -22.139 1.00 81.00  ? 551 PRO B N   1 
ATOM   4558 C  CA  . PRO B 1 291 ? 20.646  -2.513  -21.135 1.00 78.26  ? 551 PRO B CA  1 
ATOM   4559 C  C   . PRO B 1 291 ? 21.090  -1.903  -19.834 1.00 77.83  ? 551 PRO B C   1 
ATOM   4560 O  O   . PRO B 1 291 ? 22.285  -1.921  -19.521 1.00 80.50  ? 551 PRO B O   1 
ATOM   4561 C  CB  . PRO B 1 291 ? 20.410  -4.012  -20.948 1.00 77.84  ? 551 PRO B CB  1 
ATOM   4562 C  CG  . PRO B 1 291 ? 21.608  -4.692  -21.486 1.00 79.62  ? 551 PRO B CG  1 
ATOM   4563 C  CD  . PRO B 1 291 ? 22.341  -3.744  -22.377 1.00 81.59  ? 551 PRO B CD  1 
ATOM   4564 N  N   . VAL B 1 292 ? 20.124  -1.376  -19.090 1.00 74.95  ? 552 VAL B N   1 
ATOM   4565 C  CA  . VAL B 1 292 ? 20.378  -0.696  -17.827 1.00 76.22  ? 552 VAL B CA  1 
ATOM   4566 C  C   . VAL B 1 292 ? 19.609  -1.381  -16.716 1.00 76.28  ? 552 VAL B C   1 
ATOM   4567 O  O   . VAL B 1 292 ? 18.473  -1.826  -16.917 1.00 72.92  ? 552 VAL B O   1 
ATOM   4568 C  CB  . VAL B 1 292 ? 19.944  0.780   -17.905 1.00 76.77  ? 552 VAL B CB  1 
ATOM   4569 C  CG1 . VAL B 1 292 ? 20.002  1.438   -16.548 1.00 75.93  ? 552 VAL B CG1 1 
ATOM   4570 C  CG2 . VAL B 1 292 ? 20.811  1.524   -18.901 1.00 78.75  ? 552 VAL B CG2 1 
ATOM   4571 N  N   . SER B 1 293 ? 20.228  -1.455  -15.541 1.00 77.64  ? 553 SER B N   1 
ATOM   4572 C  CA  . SER B 1 293 ? 19.588  -2.053  -14.374 1.00 75.32  ? 553 SER B CA  1 
ATOM   4573 C  C   . SER B 1 293 ? 19.809  -1.242  -13.103 1.00 76.03  ? 553 SER B C   1 
ATOM   4574 O  O   . SER B 1 293 ? 20.785  -0.492  -12.982 1.00 77.76  ? 553 SER B O   1 
ATOM   4575 C  CB  . SER B 1 293 ? 20.103  -3.480  -14.163 1.00 72.38  ? 553 SER B CB  1 
ATOM   4576 O  OG  . SER B 1 293 ? 21.452  -3.497  -13.734 1.00 75.55  ? 553 SER B OG  1 
ATOM   4577 N  N   . SER B 1 294 ? 18.894  -1.400  -12.155 1.00 72.37  ? 554 SER B N   1 
ATOM   4578 C  CA  . SER B 1 294 ? 19.070  -0.803  -10.842 1.00 75.70  ? 554 SER B CA  1 
ATOM   4579 C  C   . SER B 1 294 ? 18.422  -1.659  -9.779  1.00 76.17  ? 554 SER B C   1 
ATOM   4580 O  O   . SER B 1 294 ? 17.310  -2.160  -9.972  1.00 77.22  ? 554 SER B O   1 
ATOM   4581 C  CB  . SER B 1 294 ? 18.487  0.606   -10.789 1.00 78.46  ? 554 SER B CB  1 
ATOM   4582 O  OG  . SER B 1 294 ? 18.743  1.205   -9.523  1.00 81.30  ? 554 SER B OG  1 
ATOM   4583 N  N   . VAL B 1 295 ? 19.117  -1.826  -8.656  1.00 74.23  ? 555 VAL B N   1 
ATOM   4584 C  CA  . VAL B 1 295 ? 18.577  -2.607  -7.559  1.00 75.31  ? 555 VAL B CA  1 
ATOM   4585 C  C   . VAL B 1 295 ? 18.213  -1.680  -6.414  1.00 73.32  ? 555 VAL B C   1 
ATOM   4586 O  O   . VAL B 1 295 ? 18.965  -0.777  -6.066  1.00 74.60  ? 555 VAL B O   1 
ATOM   4587 C  CB  . VAL B 1 295 ? 19.545  -3.724  -7.097  1.00 77.85  ? 555 VAL B CB  1 
ATOM   4588 C  CG1 . VAL B 1 295 ? 19.040  -4.406  -5.817  1.00 76.33  ? 555 VAL B CG1 1 
ATOM   4589 C  CG2 . VAL B 1 295 ? 19.721  -4.756  -8.205  1.00 74.91  ? 555 VAL B CG2 1 
ATOM   4590 N  N   . PHE B 1 296 ? 17.042  -1.925  -5.843  1.00 72.81  ? 556 PHE B N   1 
ATOM   4591 C  CA  . PHE B 1 296 ? 16.494  -1.110  -4.783  1.00 76.54  ? 556 PHE B CA  1 
ATOM   4592 C  C   . PHE B 1 296 ? 16.157  -1.947  -3.556  1.00 79.51  ? 556 PHE B C   1 
ATOM   4593 O  O   . PHE B 1 296 ? 15.579  -3.021  -3.662  1.00 78.30  ? 556 PHE B O   1 
ATOM   4594 C  CB  . PHE B 1 296 ? 15.210  -0.455  -5.288  1.00 78.54  ? 556 PHE B CB  1 
ATOM   4595 C  CG  . PHE B 1 296 ? 15.425  0.517   -6.415  1.00 78.83  ? 556 PHE B CG  1 
ATOM   4596 C  CD1 . PHE B 1 296 ? 15.793  1.828   -6.153  1.00 76.83  ? 556 PHE B CD1 1 
ATOM   4597 C  CD2 . PHE B 1 296 ? 15.246  0.128   -7.724  1.00 75.76  ? 556 PHE B CD2 1 
ATOM   4598 C  CE1 . PHE B 1 296 ? 15.991  2.724   -7.175  1.00 75.84  ? 556 PHE B CE1 1 
ATOM   4599 C  CE2 . PHE B 1 296 ? 15.442  1.021   -8.752  1.00 76.91  ? 556 PHE B CE2 1 
ATOM   4600 C  CZ  . PHE B 1 296 ? 15.821  2.330   -8.469  1.00 77.88  ? 556 PHE B CZ  1 
ATOM   4601 N  N   . ASP B 1 297 ? 16.536  -1.456  -2.389  1.00 82.61  ? 557 ASP B N   1 
ATOM   4602 C  CA  . ASP B 1 297 ? 15.873  -1.857  -1.154  1.00 82.25  ? 557 ASP B CA  1 
ATOM   4603 C  C   . ASP B 1 297 ? 14.582  -1.037  -1.125  1.00 78.81  ? 557 ASP B C   1 
ATOM   4604 O  O   . ASP B 1 297 ? 14.626  0.183   -1.255  1.00 83.56  ? 557 ASP B O   1 
ATOM   4605 C  CB  . ASP B 1 297 ? 16.742  -1.555  0.081   1.00 86.75  ? 557 ASP B CB  1 
ATOM   4606 C  CG  . ASP B 1 297 ? 17.503  -2.787  0.604   1.00 90.62  ? 557 ASP B CG  1 
ATOM   4607 O  OD1 . ASP B 1 297 ? 17.143  -3.934  0.260   1.00 91.76  ? 557 ASP B OD1 1 
ATOM   4608 O  OD2 . ASP B 1 297 ? 18.459  -2.608  1.395   1.00 93.09  ? 557 ASP B OD2 1 
ATOM   4609 N  N   . ILE B 1 298 ? 13.436  -1.694  -1.009  1.00 71.84  ? 558 ILE B N   1 
ATOM   4610 C  CA  . ILE B 1 298 ? 12.181  -0.984  -0.893  1.00 74.89  ? 558 ILE B CA  1 
ATOM   4611 C  C   . ILE B 1 298 ? 11.453  -1.484  0.332   1.00 78.14  ? 558 ILE B C   1 
ATOM   4612 O  O   . ILE B 1 298 ? 11.097  -2.653  0.410   1.00 76.99  ? 558 ILE B O   1 
ATOM   4613 C  CB  . ILE B 1 298 ? 11.293  -1.185  -2.133  1.00 77.67  ? 558 ILE B CB  1 
ATOM   4614 C  CG1 . ILE B 1 298 ? 11.976  -0.617  -3.388  1.00 75.94  ? 558 ILE B CG1 1 
ATOM   4615 C  CG2 . ILE B 1 298 ? 9.922   -0.535  -1.914  1.00 79.27  ? 558 ILE B CG2 1 
ATOM   4616 C  CD1 . ILE B 1 298 ? 11.007  -0.155  -4.478  1.00 74.20  ? 558 ILE B CD1 1 
ATOM   4617 N  N   . GLY B 1 299 ? 11.251  -0.591  1.294   1.00 82.36  ? 559 GLY B N   1 
ATOM   4618 C  CA  . GLY B 1 299 ? 10.490  -0.902  2.498   1.00 83.84  ? 559 GLY B CA  1 
ATOM   4619 C  C   . GLY B 1 299 ? 9.028   -1.065  2.142   1.00 85.58  ? 559 GLY B C   1 
ATOM   4620 O  O   . GLY B 1 299 ? 8.484   -0.286  1.373   1.00 89.31  ? 559 GLY B O   1 
ATOM   4621 N  N   . VAL B 1 300 ? 8.398   -2.088  2.702   1.00 85.45  ? 560 VAL B N   1 
ATOM   4622 C  CA  . VAL B 1 300 ? 7.026   -2.443  2.377   1.00 83.76  ? 560 VAL B CA  1 
ATOM   4623 C  C   . VAL B 1 300 ? 6.252   -2.607  3.680   1.00 90.05  ? 560 VAL B C   1 
ATOM   4624 O  O   . VAL B 1 300 ? 6.724   -3.281  4.597   1.00 90.18  ? 560 VAL B O   1 
ATOM   4625 C  CB  . VAL B 1 300 ? 7.001   -3.757  1.564   1.00 77.80  ? 560 VAL B CB  1 
ATOM   4626 C  CG1 . VAL B 1 300 ? 5.594   -4.328  1.483   1.00 78.47  ? 560 VAL B CG1 1 
ATOM   4627 C  CG2 . VAL B 1 300 ? 7.579   -3.524  0.180   1.00 62.50  ? 560 VAL B CG2 1 
ATOM   4628 N  N   . ARG B 1 301 ? 5.081   -1.982  3.780   1.00 95.72  ? 561 ARG B N   1 
ATOM   4629 C  CA  . ARG B 1 301 ? 4.261   -2.120  4.991   1.00 104.11 ? 561 ARG B CA  1 
ATOM   4630 C  C   . ARG B 1 301 ? 3.681   -3.542  5.034   1.00 108.39 ? 561 ARG B C   1 
ATOM   4631 O  O   . ARG B 1 301 ? 2.896   -3.925  4.157   1.00 105.42 ? 561 ARG B O   1 
ATOM   4632 C  CB  . ARG B 1 301 ? 3.137   -1.061  5.061   1.00 104.22 ? 561 ARG B CB  1 
ATOM   4633 C  CG  . ARG B 1 301 ? 3.582   0.363   5.441   1.00 102.40 ? 561 ARG B CG  1 
ATOM   4634 N  N   . VAL B 1 302 ? 4.094   -4.309  6.043   1.00 115.45 ? 562 VAL B N   1 
ATOM   4635 C  CA  . VAL B 1 302 ? 3.708   -5.711  6.206   1.00 122.95 ? 562 VAL B CA  1 
ATOM   4636 C  C   . VAL B 1 302 ? 2.814   -5.887  7.451   1.00 141.42 ? 562 VAL B C   1 
ATOM   4637 O  O   . VAL B 1 302 ? 3.066   -5.267  8.499   1.00 140.16 ? 562 VAL B O   1 
ATOM   4638 C  CB  . VAL B 1 302 ? 4.970   -6.597  6.359   1.00 114.37 ? 562 VAL B CB  1 
ATOM   4639 C  CG1 . VAL B 1 302 ? 4.594   -8.078  6.531   1.00 110.35 ? 562 VAL B CG1 1 
ATOM   4640 C  CG2 . VAL B 1 302 ? 5.900   -6.399  5.177   1.00 109.99 ? 562 VAL B CG2 1 
ATOM   4641 N  N   . VAL B 1 303 ? 1.785   -6.737  7.334   1.00 80.59  ? 563 VAL B N   1 
ATOM   4642 C  CA  . VAL B 1 303 ? 0.847   -7.016  8.446   1.00 89.44  ? 563 VAL B CA  1 
ATOM   4643 C  C   . VAL B 1 303 ? 1.097   -8.383  9.071   1.00 92.71  ? 563 VAL B C   1 
ATOM   4644 O  O   . VAL B 1 303 ? 0.459   -8.740  10.054  1.00 93.32  ? 563 VAL B O   1 
ATOM   4645 C  CB  . VAL B 1 303 ? -0.630  -6.964  7.985   1.00 87.78  ? 563 VAL B CB  1 
HETATM 4646 MG MG  . MG  C 2 .   ? -25.539 -4.838  -36.157 1.00 58.95  ? 61  MG  A MG  1 
HETATM 4647 CA CA  . CA  D 3 .   ? -13.578 -15.407 -39.662 1.00 76.65  ? 64  CA  A CA  1 
HETATM 4648 C  C1  . GOL E 4 .   ? -18.434 -20.274 1.499   1.00 89.86  ? 65  GOL A C1  1 
HETATM 4649 O  O1  . GOL E 4 .   ? -17.594 -21.399 1.661   1.00 92.52  ? 65  GOL A O1  1 
HETATM 4650 C  C2  . GOL E 4 .   ? -17.582 -19.142 0.937   1.00 87.98  ? 65  GOL A C2  1 
HETATM 4651 O  O2  . GOL E 4 .   ? -17.960 -17.888 1.472   1.00 90.82  ? 65  GOL A O2  1 
HETATM 4652 C  C3  . GOL E 4 .   ? -17.719 -19.135 -0.576  1.00 81.59  ? 65  GOL A C3  1 
HETATM 4653 O  O3  . GOL E 4 .   ? -16.621 -18.479 -1.154  1.00 76.99  ? 65  GOL A O3  1 
HETATM 4654 MG MG  . MG  F 2 .   ? 15.993  1.901   -32.653 1.00 89.00  ? 62  MG  B MG  1 
HETATM 4655 CA CA  . CA  G 3 .   ? 4.328   11.738  -29.291 1.00 93.07  ? 63  CA  B CA  1 
HETATM 4656 O  O   . HOH H 5 .   ? -32.485 -5.053  -27.439 1.00 54.93  ? 1   HOH A O   1 
HETATM 4657 O  O   . HOH H 5 .   ? -20.995 -10.688 -0.294  1.00 46.42  ? 2   HOH A O   1 
HETATM 4658 O  O   . HOH H 5 .   ? -8.196  -22.502 -26.215 1.00 47.00  ? 3   HOH A O   1 
HETATM 4659 O  O   . HOH H 5 .   ? -30.938 -16.765 -29.725 1.00 59.40  ? 5   HOH A O   1 
HETATM 4660 O  O   . HOH H 5 .   ? -18.504 -7.420  -31.934 1.00 46.81  ? 6   HOH A O   1 
HETATM 4661 O  O   . HOH H 5 .   ? -14.375 -10.600 -41.315 1.00 38.69  ? 7   HOH A O   1 
HETATM 4662 O  O   . HOH H 5 .   ? -23.055 -4.769  -6.221  1.00 56.85  ? 8   HOH A O   1 
HETATM 4663 O  O   . HOH H 5 .   ? -9.740  -5.341  -22.446 1.00 49.42  ? 9   HOH A O   1 
HETATM 4664 O  O   . HOH H 5 .   ? -21.353 1.880   -32.357 1.00 56.45  ? 10  HOH A O   1 
HETATM 4665 O  O   . HOH H 5 .   ? -10.633 -2.520  -22.426 1.00 45.20  ? 11  HOH A O   1 
HETATM 4666 O  O   . HOH H 5 .   ? -15.762 -6.824  -32.555 1.00 46.01  ? 12  HOH A O   1 
HETATM 4667 O  O   . HOH H 5 .   ? -34.022 -21.514 -3.067  1.00 57.05  ? 13  HOH A O   1 
HETATM 4668 O  O   . HOH H 5 .   ? 2.566   -20.993 -18.689 1.00 56.58  ? 14  HOH A O   1 
HETATM 4669 O  O   . HOH H 5 .   ? -22.333 -34.245 -13.659 1.00 58.40  ? 15  HOH A O   1 
HETATM 4670 O  O   . HOH H 5 .   ? -4.243  -16.441 -26.775 1.00 56.08  ? 16  HOH A O   1 
HETATM 4671 O  O   . HOH H 5 .   ? -26.440 -5.938  -34.285 1.00 54.34  ? 17  HOH A O   1 
HETATM 4672 O  O   . HOH H 5 .   ? -25.435 -6.916  -36.414 1.00 49.41  ? 18  HOH A O   1 
HETATM 4673 O  O   . HOH H 5 .   ? -28.347 -23.108 -22.623 1.00 54.44  ? 20  HOH A O   1 
HETATM 4674 O  O   . HOH H 5 .   ? -35.863 -4.984  -30.294 1.00 68.69  ? 22  HOH A O   1 
HETATM 4675 O  O   . HOH H 5 .   ? -9.771  -17.004 -37.948 1.00 62.06  ? 23  HOH A O   1 
HETATM 4676 O  O   . HOH H 5 .   ? -12.058 -17.052 -39.385 1.00 49.12  ? 24  HOH A O   1 
HETATM 4677 O  O   . HOH H 5 .   ? -25.074 -28.690 -10.070 1.00 59.83  ? 25  HOH A O   1 
HETATM 4678 O  O   . HOH H 5 .   ? -10.513 -5.798  -15.400 1.00 37.75  ? 28  HOH A O   1 
HETATM 4679 O  O   . HOH H 5 .   ? -10.202 -25.762 -26.367 1.00 44.81  ? 29  HOH A O   1 
HETATM 4680 O  O   . HOH H 5 .   ? 7.870   -28.074 -14.131 1.00 62.46  ? 32  HOH A O   1 
HETATM 4681 O  O   . HOH H 5 .   ? -3.930  -14.231 -28.443 1.00 62.04  ? 34  HOH A O   1 
HETATM 4682 O  O   . HOH H 5 .   ? -32.678 -17.855 -9.802  1.00 58.74  ? 35  HOH A O   1 
HETATM 4683 O  O   . HOH H 5 .   ? -28.421 -10.810 -27.924 1.00 53.57  ? 36  HOH A O   1 
HETATM 4684 O  O   . HOH H 5 .   ? -25.588 -12.091 -28.024 1.00 55.79  ? 37  HOH A O   1 
HETATM 4685 O  O   . HOH H 5 .   ? -14.843 -17.412 -40.421 1.00 56.93  ? 39  HOH A O   1 
HETATM 4686 O  O   . HOH H 5 .   ? -11.799 2.772   -23.758 1.00 62.10  ? 40  HOH A O   1 
HETATM 4687 O  O   . HOH H 5 .   ? -28.668 -0.822  -15.696 1.00 57.19  ? 43  HOH A O   1 
HETATM 4688 O  O   . HOH H 5 .   ? -16.142 -30.830 -14.958 1.00 53.81  ? 44  HOH A O   1 
HETATM 4689 O  O   . HOH H 5 .   ? -2.210  -16.147 -13.158 1.00 82.14  ? 45  HOH A O   1 
HETATM 4690 O  O   . HOH H 5 .   ? -13.557 -29.060 -9.593  1.00 55.18  ? 46  HOH A O   1 
HETATM 4691 O  O   . HOH H 5 .   ? -25.800 -5.103  -6.601  1.00 50.54  ? 48  HOH A O   1 
HETATM 4692 O  O   . HOH H 5 .   ? -26.859 -3.543  -8.180  1.00 60.76  ? 49  HOH A O   1 
HETATM 4693 O  O   . HOH H 5 .   ? -19.356 -6.772  -36.066 1.00 68.53  ? 51  HOH A O   1 
HETATM 4694 O  O   . HOH H 5 .   ? -21.940 -30.777 -22.046 1.00 79.39  ? 52  HOH A O   1 
HETATM 4695 O  O   . HOH H 5 .   ? -36.053 -6.574  -12.306 1.00 62.85  ? 53  HOH A O   1 
HETATM 4696 O  O   . HOH H 5 .   ? -34.219 -5.111  -9.595  1.00 72.45  ? 54  HOH A O   1 
HETATM 4697 O  O   . HOH H 5 .   ? -9.600  -3.693  -29.255 1.00 51.97  ? 55  HOH A O   1 
HETATM 4698 O  O   . HOH H 5 .   ? -8.551  -2.530  -31.506 1.00 55.94  ? 56  HOH A O   1 
HETATM 4699 O  O   . HOH I 5 .   ? 2.025   12.528  -27.926 1.00 66.77  ? 4   HOH B O   1 
HETATM 4700 O  O   . HOH I 5 .   ? 22.958  -4.575  -26.676 1.00 64.72  ? 19  HOH B O   1 
HETATM 4701 O  O   . HOH I 5 .   ? 14.936  -18.267 -11.376 1.00 57.76  ? 21  HOH B O   1 
HETATM 4702 O  O   . HOH I 5 .   ? 2.249   -12.277 -29.741 1.00 54.73  ? 26  HOH B O   1 
HETATM 4703 O  O   . HOH I 5 .   ? 5.100   -14.249 -28.601 1.00 49.56  ? 27  HOH B O   1 
HETATM 4704 O  O   . HOH I 5 .   ? 18.658  5.770   -11.087 1.00 57.33  ? 30  HOH B O   1 
HETATM 4705 O  O   . HOH I 5 .   ? 0.877   10.878  -12.575 1.00 47.29  ? 31  HOH B O   1 
HETATM 4706 O  O   . HOH I 5 .   ? 6.676   -2.618  -35.154 1.00 59.44  ? 33  HOH B O   1 
HETATM 4707 O  O   . HOH I 5 .   ? 18.617  -15.724 -20.756 1.00 69.57  ? 38  HOH B O   1 
HETATM 4708 O  O   . HOH I 5 .   ? -8.442  -1.502  -20.709 1.00 60.33  ? 41  HOH B O   1 
HETATM 4709 O  O   . HOH I 5 .   ? -5.277  -2.837  -21.104 1.00 82.87  ? 42  HOH B O   1 
HETATM 4710 O  O   . HOH I 5 .   ? 21.592  5.328   -20.526 1.00 66.39  ? 47  HOH B O   1 
HETATM 4711 O  O   . HOH I 5 .   ? -3.248  7.146   -26.492 1.00 69.90  ? 50  HOH B O   1 
HETATM 4712 O  O   . HOH I 5 .   ? 11.629  11.129  -4.684  1.00 66.67  ? 57  HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . MET A 1   ? 1.0382 0.8527 0.9582 -0.0604 0.0043  0.1061  261 MET A N   
2    C CA  . MET A 1   ? 1.0495 0.8856 0.9912 -0.0664 0.0204  0.1265  261 MET A CA  
3    C C   . MET A 1   ? 0.9808 0.8400 0.9457 -0.0701 0.0213  0.1181  261 MET A C   
4    O O   . MET A 1   ? 0.8850 0.7483 0.8371 -0.0610 0.0226  0.1032  261 MET A O   
5    C CB  . MET A 1   ? 1.0476 0.8879 0.9654 -0.0534 0.0401  0.1394  261 MET A CB  
6    N N   . ILE A 2   ? 0.9516 0.8248 0.9508 -0.0837 0.0197  0.1279  262 ILE A N   
7    C CA  . ILE A 2   ? 0.8695 0.7664 0.8923 -0.0870 0.0212  0.1230  262 ILE A CA  
8    C C   . ILE A 2   ? 0.8521 0.7716 0.8777 -0.0809 0.0423  0.1370  262 ILE A C   
9    O O   . ILE A 2   ? 0.8486 0.7765 0.8847 -0.0846 0.0536  0.1581  262 ILE A O   
10   C CB  . ILE A 2   ? 0.8478 0.7523 0.9074 -0.1032 0.0102  0.1282  262 ILE A CB  
11   C CG1 . ILE A 2   ? 0.8739 0.7559 0.9316 -0.1084 -0.0117 0.1140  262 ILE A CG1 
12   C CG2 . ILE A 2   ? 0.8083 0.7376 0.8893 -0.1045 0.0118  0.1229  262 ILE A CG2 
13   C CD1 . ILE A 2   ? 0.9229 0.8023 0.9666 -0.1005 -0.0208 0.0900  262 ILE A CD1 
14   N N   . GLN A 3   ? 0.8382 0.7675 0.8550 -0.0711 0.0476  0.1257  263 GLN A N   
15   C CA  . GLN A 3   ? 0.8294 0.7813 0.8511 -0.0642 0.0657  0.1362  263 GLN A CA  
16   C C   . GLN A 3   ? 0.7812 0.7519 0.8250 -0.0669 0.0626  0.1281  263 GLN A C   
17   O O   . GLN A 3   ? 0.7750 0.7381 0.8116 -0.0651 0.0520  0.1098  263 GLN A O   
18   C CB  . GLN A 3   ? 0.9145 0.8577 0.8994 -0.0464 0.0763  0.1311  263 GLN A CB  
19   C CG  . GLN A 3   ? 1.0682 1.0326 1.0546 -0.0360 0.0923  0.1353  263 GLN A CG  
20   C CD  . GLN A 3   ? 1.2162 1.1716 1.1658 -0.0174 0.1037  0.1334  263 GLN A CD  
21   O OE1 . GLN A 3   ? 1.2953 1.2341 1.2208 -0.0124 0.1047  0.1370  263 GLN A OE1 
22   N NE2 . GLN A 3   ? 1.2078 1.1730 1.1514 -0.0059 0.1117  0.1275  263 GLN A NE2 
23   N N   . ASN A 4   ? 0.7194 0.7157 0.7903 -0.0707 0.0723  0.1427  264 ASN A N   
24   C CA  . ASN A 4   ? 0.6720 0.6883 0.7654 -0.0726 0.0698  0.1373  264 ASN A CA  
25   C C   . ASN A 4   ? 0.6688 0.6915 0.7447 -0.0571 0.0806  0.1303  264 ASN A C   
26   O O   . ASN A 4   ? 0.6909 0.7165 0.7500 -0.0454 0.0961  0.1379  264 ASN A O   
27   C CB  . ASN A 4   ? 0.6885 0.7312 0.8207 -0.0829 0.0743  0.1555  264 ASN A CB  
28   C CG  . ASN A 4   ? 0.8090 0.8450 0.9655 -0.1006 0.0582  0.1589  264 ASN A CG  
29   O OD1 . ASN A 4   ? 0.8813 0.8970 1.0297 -0.1045 0.0411  0.1438  264 ASN A OD1 
30   N ND2 . ASN A 4   ? 0.8351 0.8886 1.0228 -0.1111 0.0633  0.1789  264 ASN A ND2 
31   N N   . PHE A 5   ? 0.6256 0.6487 0.7041 -0.0565 0.0716  0.1154  265 PHE A N   
32   C CA  . PHE A 5   ? 0.6325 0.6616 0.7003 -0.0440 0.0794  0.1089  265 PHE A CA  
33   C C   . PHE A 5   ? 0.6068 0.6575 0.7033 -0.0485 0.0757  0.1094  265 PHE A C   
34   O O   . PHE A 5   ? 0.6494 0.7037 0.7670 -0.0605 0.0626  0.1077  265 PHE A O   
35   C CB  . PHE A 5   ? 0.6639 0.6698 0.7045 -0.0385 0.0714  0.0899  265 PHE A CB  
36   C CG  . PHE A 5   ? 0.7300 0.7150 0.7412 -0.0321 0.0737  0.0874  265 PHE A CG  
37   C CD1 . PHE A 5   ? 0.7554 0.7337 0.7411 -0.0173 0.0840  0.0848  265 PHE A CD1 
38   C CD2 . PHE A 5   ? 0.6982 0.6691 0.7060 -0.0399 0.0645  0.0870  265 PHE A CD2 
39   C CE1 . PHE A 5   ? 0.7530 0.7118 0.7103 -0.0104 0.0846  0.0816  265 PHE A CE1 
40   C CE2 . PHE A 5   ? 0.6938 0.6455 0.6735 -0.0330 0.0660  0.0849  265 PHE A CE2 
41   C CZ  . PHE A 5   ? 0.7083 0.6544 0.6626 -0.0182 0.0758  0.0820  265 PHE A CZ  
42   N N   . ARG A 6   ? 0.5371 0.6014 0.6332 -0.0376 0.0863  0.1112  266 ARG A N   
43   C CA  . ARG A 6   ? 0.5866 0.6719 0.7080 -0.0396 0.0833  0.1122  266 ARG A CA  
44   C C   . ARG A 6   ? 0.5453 0.6195 0.6548 -0.0359 0.0746  0.0959  266 ARG A C   
45   O O   . ARG A 6   ? 0.5138 0.5760 0.5995 -0.0245 0.0804  0.0890  266 ARG A O   
46   C CB  . ARG A 6   ? 0.6661 0.7751 0.7969 -0.0293 0.0998  0.1247  266 ARG A CB  
47   C CG  . ARG A 6   ? 0.7841 0.9186 0.9479 -0.0383 0.1043  0.1427  266 ARG A CG  
48   C CD  . ARG A 6   ? 0.9076 1.0697 1.0828 -0.0268 0.1212  0.1551  266 ARG A CD  
49   N NE  . ARG A 6   ? 1.0214 1.2134 1.2379 -0.0380 0.1225  0.1717  266 ARG A NE  
50   C CZ  . ARG A 6   ? 1.1466 1.3442 1.3753 -0.0470 0.1281  0.1871  266 ARG A CZ  
51   N NH1 . ARG A 6   ? 1.2023 1.3773 1.4021 -0.0446 0.1332  0.1879  266 ARG A NH1 
52   N NH2 . ARG A 6   ? 1.1622 1.3883 1.4327 -0.0585 0.1284  0.2025  266 ARG A NH2 
53   N N   . PHE A 7   ? 0.5185 0.5965 0.6445 -0.0451 0.0604  0.0904  267 PHE A N   
54   C CA  . PHE A 7   ? 0.5044 0.5749 0.6214 -0.0421 0.0523  0.0770  267 PHE A CA  
55   C C   . PHE A 7   ? 0.5145 0.6068 0.6517 -0.0394 0.0518  0.0804  267 PHE A C   
56   O O   . PHE A 7   ? 0.5216 0.6321 0.6860 -0.0469 0.0459  0.0868  267 PHE A O   
57   C CB  . PHE A 7   ? 0.4673 0.5259 0.5841 -0.0518 0.0360  0.0668  267 PHE A CB  
58   C CG  . PHE A 7   ? 0.4892 0.5242 0.5820 -0.0518 0.0340  0.0586  267 PHE A CG  
59   C CD1 . PHE A 7   ? 0.5181 0.5400 0.5950 -0.0495 0.0280  0.0453  267 PHE A CD1 
60   C CD2 . PHE A 7   ? 0.4972 0.5243 0.5842 -0.0540 0.0381  0.0647  267 PHE A CD2 
61   C CE1 . PHE A 7   ? 0.5645 0.5666 0.6214 -0.0493 0.0253  0.0372  267 PHE A CE1 
62   C CE2 . PHE A 7   ? 0.5495 0.5550 0.6139 -0.0530 0.0350  0.0565  267 PHE A CE2 
63   C CZ  . PHE A 7   ? 0.5638 0.5574 0.6140 -0.0507 0.0282  0.0421  267 PHE A CZ  
64   N N   . PHE A 8   ? 0.5284 0.6177 0.6526 -0.0287 0.0567  0.0758  268 PHE A N   
65   C CA  . PHE A 8   ? 0.5122 0.6187 0.6510 -0.0244 0.0548  0.0774  268 PHE A CA  
66   C C   . PHE A 8   ? 0.5096 0.6054 0.6396 -0.0261 0.0430  0.0658  268 PHE A C   
67   O O   . PHE A 8   ? 0.5149 0.5904 0.6218 -0.0230 0.0440  0.0575  268 PHE A O   
68   C CB  . PHE A 8   ? 0.4716 0.5802 0.6002 -0.0098 0.0684  0.0809  268 PHE A CB  
69   C CG  . PHE A 8   ? 0.4945 0.6171 0.6334 -0.0030 0.0666  0.0818  268 PHE A CG  
70   C CD1 . PHE A 8   ? 0.5239 0.6735 0.6863 0.0008  0.0714  0.0922  268 PHE A CD1 
71   C CD2 . PHE A 8   ? 0.4649 0.5746 0.5903 0.0000  0.0606  0.0731  268 PHE A CD2 
72   C CE1 . PHE A 8   ? 0.5194 0.6820 0.6907 0.0083  0.0690  0.0929  268 PHE A CE1 
73   C CE2 . PHE A 8   ? 0.4321 0.5531 0.5647 0.0072  0.0590  0.0748  268 PHE A CE2 
74   C CZ  . PHE A 8   ? 0.4733 0.6204 0.6283 0.0119  0.0626  0.0841  268 PHE A CZ  
75   N N   . ALA A 9   ? 0.4915 0.6015 0.6401 -0.0306 0.0319  0.0653  269 ALA A N   
76   C CA  . ALA A 9   ? 0.5192 0.6239 0.6599 -0.0296 0.0217  0.0560  269 ALA A CA  
77   C C   . ALA A 9   ? 0.5158 0.6371 0.6663 -0.0214 0.0219  0.0598  269 ALA A C   
78   O O   . ALA A 9   ? 0.5416 0.6847 0.7164 -0.0224 0.0203  0.0671  269 ALA A O   
79   C CB  . ALA A 9   ? 0.4785 0.5831 0.6280 -0.0397 0.0060  0.0500  269 ALA A CB  
80   N N   . GLY A 10  ? 0.4906 0.6025 0.6238 -0.0135 0.0238  0.0557  270 GLY A N   
81   C CA  . GLY A 10  ? 0.5025 0.6272 0.6412 -0.0043 0.0232  0.0591  270 GLY A CA  
82   C C   . GLY A 10  ? 0.5597 0.6765 0.6842 -0.0016 0.0159  0.0527  270 GLY A C   
83   O O   . GLY A 10  ? 0.5947 0.6930 0.7006 -0.0034 0.0174  0.0470  270 GLY A O   
84   N N   . THR A 11  ? 0.5307 0.6627 0.6645 0.0033  0.0081  0.0540  271 THR A N   
85   C CA  . THR A 11  ? 0.5005 0.6276 0.6196 0.0085  0.0023  0.0499  271 THR A CA  
86   C C   . THR A 11  ? 0.5025 0.6411 0.6249 0.0204  0.0033  0.0561  271 THR A C   
87   O O   . THR A 11  ? 0.5120 0.6705 0.6553 0.0222  -0.0001 0.0603  271 THR A O   
88   C CB  . THR A 11  ? 0.4617 0.5948 0.5849 0.0030  -0.0135 0.0423  271 THR A CB  
89   O OG1 . THR A 11  ? 0.4575 0.5868 0.5634 0.0099  -0.0172 0.0391  271 THR A OG1 
90   C CG2 . THR A 11  ? 0.4687 0.6239 0.6178 0.0015  -0.0244 0.0441  271 THR A CG2 
91   N N   . TYR A 12  ? 0.4984 0.6246 0.6010 0.0282  0.0077  0.0572  272 TYR A N   
92   C CA  . TYR A 12  ? 0.5424 0.6739 0.6431 0.0411  0.0101  0.0637  272 TYR A CA  
93   C C   . TYR A 12  ? 0.5895 0.7096 0.6689 0.0466  0.0088  0.0636  272 TYR A C   
94   O O   . TYR A 12  ? 0.5874 0.6880 0.6505 0.0436  0.0157  0.0627  272 TYR A O   
95   C CB  . TYR A 12  ? 0.5388 0.6602 0.6359 0.0469  0.0239  0.0693  272 TYR A CB  
96   C CG  . TYR A 12  ? 0.6158 0.7461 0.7166 0.0611  0.0264  0.0765  272 TYR A CG  
97   C CD1 . TYR A 12  ? 0.6161 0.7677 0.7291 0.0670  0.0163  0.0782  272 TYR A CD1 
98   C CD2 . TYR A 12  ? 0.6461 0.7633 0.7384 0.0697  0.0379  0.0806  272 TYR A CD2 
99   C CE1 . TYR A 12  ? 0.5966 0.7574 0.7137 0.0811  0.0182  0.0847  272 TYR A CE1 
100  C CE2 . TYR A 12  ? 0.6382 0.7630 0.7335 0.0842  0.0399  0.0869  272 TYR A CE2 
101  C CZ  . TYR A 12  ? 0.6154 0.7628 0.7236 0.0897  0.0303  0.0891  272 TYR A CZ  
102  O OH  . TYR A 12  ? 0.6097 0.7658 0.7213 0.1050  0.0315  0.0951  272 TYR A OH  
103  N N   . ASN A 13  ? 0.6235 0.7568 0.7037 0.0545  -0.0003 0.0647  273 ASN A N   
104  C CA  . ASN A 13  ? 0.6270 0.7514 0.6859 0.0624  -0.0001 0.0673  273 ASN A CA  
105  C C   . ASN A 13  ? 0.6241 0.7447 0.6787 0.0749  0.0066  0.0765  273 ASN A C   
106  O O   . ASN A 13  ? 0.6660 0.8037 0.7319 0.0836  0.0006  0.0791  273 ASN A O   
107  C CB  . ASN A 13  ? 0.6092 0.7490 0.6675 0.0658  -0.0149 0.0626  273 ASN A CB  
108  C CG  . ASN A 13  ? 0.7011 0.8352 0.7363 0.0768  -0.0143 0.0671  273 ASN A CG  
109  O OD1 . ASN A 13  ? 0.7387 0.8639 0.7646 0.0854  -0.0063 0.0762  273 ASN A OD1 
110  N ND2 . ASN A 13  ? 0.7170 0.8557 0.7417 0.0775  -0.0230 0.0613  273 ASN A ND2 
111  N N   . VAL A 14  ? 0.5886 0.6864 0.6276 0.0760  0.0180  0.0812  274 VAL A N   
112  C CA  . VAL A 14  ? 0.5991 0.6870 0.6335 0.0871  0.0254  0.0892  274 VAL A CA  
113  C C   . VAL A 14  ? 0.6628 0.7438 0.6799 0.0982  0.0248  0.0968  274 VAL A C   
114  O O   . VAL A 14  ? 0.6900 0.7571 0.6990 0.1077  0.0308  0.1042  274 VAL A O   
115  C CB  . VAL A 14  ? 0.5934 0.6568 0.6211 0.0822  0.0369  0.0893  274 VAL A CB  
116  C CG1 . VAL A 14  ? 0.5556 0.6257 0.5979 0.0729  0.0381  0.0826  274 VAL A CG1 
117  C CG2 . VAL A 14  ? 0.5402 0.5833 0.5514 0.0746  0.0406  0.0894  274 VAL A CG2 
118  N N   . ASN A 15  ? 0.6758 0.7652 0.6854 0.0979  0.0175  0.0953  275 ASN A N   
119  C CA  . ASN A 15  ? 0.7359 0.8241 0.7290 0.1103  0.0154  0.1030  275 ASN A CA  
120  C C   . ASN A 15  ? 0.7506 0.8120 0.7266 0.1143  0.0269  0.1136  275 ASN A C   
121  O O   . ASN A 15  ? 0.7371 0.7943 0.7038 0.1274  0.0270  0.1222  275 ASN A O   
122  C CB  . ASN A 15  ? 0.7352 0.8437 0.7385 0.1232  0.0059  0.1041  275 ASN A CB  
123  C CG  . ASN A 15  ? 0.7423 0.8543 0.7279 0.1368  -0.0001 0.1099  275 ASN A CG  
124  O OD1 . ASN A 15  ? 0.7883 0.9048 0.7625 0.1357  -0.0052 0.1071  275 ASN A OD1 
125  N ND2 . ASN A 15  ? 0.6830 0.7929 0.6647 0.1511  0.0004  0.1180  275 ASN A ND2 
126  N N   . GLY A 16  ? 0.7609 0.8033 0.7335 0.1027  0.0356  0.1128  276 GLY A N   
127  C CA  . GLY A 16  ? 0.7575 0.7731 0.7150 0.1033  0.0452  0.1228  276 GLY A CA  
128  C C   . GLY A 16  ? 0.7644 0.7606 0.7226 0.1094  0.0505  0.1269  276 GLY A C   
129  O O   . GLY A 16  ? 0.7750 0.7459 0.7215 0.1107  0.0570  0.1355  276 GLY A O   
130  N N   . GLN A 17  ? 0.7388 0.7466 0.7113 0.1128  0.0478  0.1207  277 GLN A N   
131  C CA  . GLN A 17  ? 0.7680 0.7631 0.7412 0.1230  0.0516  0.1235  277 GLN A CA  
132  C C   . GLN A 17  ? 0.7817 0.7579 0.7570 0.1149  0.0579  0.1179  277 GLN A C   
133  O O   . GLN A 17  ? 0.7822 0.7649 0.7651 0.1026  0.0578  0.1099  277 GLN A O   
134  C CB  . GLN A 17  ? 0.7680 0.7903 0.7572 0.1325  0.0459  0.1205  277 GLN A CB  
135  C CG  . GLN A 17  ? 0.8182 0.8623 0.8078 0.1419  0.0368  0.1240  277 GLN A CG  
136  C CD  . GLN A 17  ? 0.8152 0.8428 0.7861 0.1556  0.0380  0.1353  277 GLN A CD  
137  O OE1 . GLN A 17  ? 0.8411 0.8578 0.8097 0.1678  0.0408  0.1399  277 GLN A OE1 
138  N NE2 . GLN A 17  ? 0.7544 0.7795 0.7108 0.1545  0.0362  0.1401  277 GLN A NE2 
139  N N   . SER A 18  ? 0.7934 0.7455 0.7611 0.1233  0.0625  0.1214  278 SER A N   
140  C CA  . SER A 18  ? 0.7578 0.6936 0.7268 0.1208  0.0671  0.1146  278 SER A CA  
141  C C   . SER A 18  ? 0.7573 0.7169 0.7402 0.1286  0.0667  0.1096  278 SER A C   
142  O O   . SER A 18  ? 0.7756 0.7565 0.7658 0.1398  0.0635  0.1134  278 SER A O   
143  C CB  . SER A 18  ? 0.7503 0.6504 0.7051 0.1289  0.0705  0.1196  278 SER A CB  
144  O OG  . SER A 18  ? 0.7894 0.6690 0.7343 0.1205  0.0714  0.1264  278 SER A OG  
145  N N   . PRO A 19  ? 0.7693 0.7263 0.7564 0.1231  0.0702  0.1018  279 PRO A N   
146  C CA  . PRO A 19  ? 0.7893 0.7688 0.7895 0.1309  0.0721  0.0990  279 PRO A CA  
147  C C   . PRO A 19  ? 0.8767 0.8506 0.8727 0.1508  0.0749  0.1030  279 PRO A C   
148  O O   . PRO A 19  ? 0.8635 0.8053 0.8435 0.1573  0.0777  0.1028  279 PRO A O   
149  C CB  . PRO A 19  ? 0.7239 0.6927 0.7221 0.1226  0.0764  0.0909  279 PRO A CB  
150  C CG  . PRO A 19  ? 0.7363 0.6692 0.7178 0.1167  0.0769  0.0892  279 PRO A CG  
151  C CD  . PRO A 19  ? 0.7399 0.6712 0.7185 0.1118  0.0729  0.0960  279 PRO A CD  
152  N N   . LYS A 20  ? 0.9235 0.9283 0.9347 0.1605  0.0731  0.1064  280 LYS A N   
153  C CA  . LYS A 20  ? 0.9549 0.9619 0.9657 0.1813  0.0756  0.1100  280 LYS A CA  
154  C C   . LYS A 20  ? 0.9956 1.0256 1.0209 0.1868  0.0817  0.1069  280 LYS A C   
155  O O   . LYS A 20  ? 1.0383 1.0631 1.0588 0.2038  0.0869  0.1071  280 LYS A O   
156  C CB  . LYS A 20  ? 0.9435 0.9721 0.9625 0.1905  0.0688  0.1169  280 LYS A CB  
157  C CG  . LYS A 20  ? 1.0597 1.0624 1.0593 0.1955  0.0650  0.1235  280 LYS A CG  
158  C CD  . LYS A 20  ? 1.0532 1.0492 1.0465 0.1783  0.0613  0.1240  280 LYS A CD  
159  C CE  . LYS A 20  ? 1.1214 1.1162 1.1051 0.1850  0.0555  0.1327  280 LYS A CE  
160  N NZ  . LYS A 20  ? 1.1603 1.1907 1.1579 0.1814  0.0469  0.1317  280 LYS A NZ  
161  N N   . GLU A 21  ? 0.9666 1.0219 1.0093 0.1731  0.0812  0.1045  281 GLU A N   
162  C CA  . GLU A 21  ? 0.8947 0.9791 0.9561 0.1767  0.0870  0.1045  281 GLU A CA  
163  C C   . GLU A 21  ? 0.8072 0.8822 0.8635 0.1666  0.0933  0.0989  281 GLU A C   
164  O O   . GLU A 21  ? 0.8003 0.8563 0.8467 0.1518  0.0906  0.0943  281 GLU A O   
165  C CB  . GLU A 21  ? 0.8984 1.0233 0.9884 0.1696  0.0805  0.1081  281 GLU A CB  
166  C CG  . GLU A 21  ? 0.9561 1.0973 1.0543 0.1831  0.0740  0.1136  281 GLU A CG  
167  C CD  . GLU A 21  ? 1.0094 1.1778 1.1275 0.1730  0.0621  0.1146  281 GLU A CD  
168  O OE1 . GLU A 21  ? 1.0448 1.2025 1.1560 0.1577  0.0565  0.1109  281 GLU A OE1 
169  O OE2 . GLU A 21  ? 1.0149 1.2155 1.1554 0.1813  0.0578  0.1185  281 GLU A OE2 
170  N N   . CYS A 22  ? 0.7819 0.8719 0.8448 0.1764  0.1020  0.0998  282 CYS A N   
171  C CA  . CYS A 22  ? 0.7534 0.8438 0.8153 0.1686  0.1085  0.0964  282 CYS A CA  
172  C C   . CYS A 22  ? 0.7511 0.8653 0.8343 0.1488  0.1035  0.0978  282 CYS A C   
173  O O   . CYS A 22  ? 0.7671 0.9130 0.8750 0.1471  0.0994  0.1033  282 CYS A O   
174  C CB  . CYS A 22  ? 0.6769 0.7871 0.7450 0.1851  0.1197  0.0997  282 CYS A CB  
175  S SG  . CYS A 22  ? 0.9008 1.0187 0.9702 0.1761  0.1284  0.0985  282 CYS A SG  
176  N N   . LEU A 23  ? 0.7079 0.8058 0.7817 0.1344  0.1029  0.0924  283 LEU A N   
177  C CA  . LEU A 23  ? 0.6417 0.7555 0.7318 0.1156  0.0970  0.0925  283 LEU A CA  
178  C C   . LEU A 23  ? 0.6462 0.7823 0.7517 0.1114  0.1040  0.0962  283 LEU A C   
179  O O   . LEU A 23  ? 0.6368 0.7862 0.7578 0.0963  0.0990  0.0970  283 LEU A O   
180  C CB  . LEU A 23  ? 0.6062 0.6905 0.6781 0.1022  0.0918  0.0848  283 LEU A CB  
181  C CG  . LEU A 23  ? 0.6221 0.6874 0.6820 0.1019  0.0848  0.0830  283 LEU A CG  
182  C CD1 . LEU A 23  ? 0.6451 0.6856 0.6904 0.0883  0.0813  0.0761  283 LEU A CD1 
183  C CD2 . LEU A 23  ? 0.4968 0.5865 0.5743 0.1002  0.0764  0.0874  283 LEU A CD2 
184  N N   . ARG A 24  ? 0.6730 0.8126 0.7736 0.1254  0.1156  0.0988  284 ARG A N   
185  C CA  . ARG A 24  ? 0.6805 0.8438 0.7959 0.1229  0.1242  0.1049  284 ARG A CA  
186  C C   . ARG A 24  ? 0.6840 0.8854 0.8363 0.1122  0.1195  0.1131  284 ARG A C   
187  O O   . ARG A 24  ? 0.6436 0.8573 0.8095 0.0996  0.1207  0.1168  284 ARG A O   
188  C CB  . ARG A 24  ? 0.7216 0.8927 0.8310 0.1438  0.1378  0.1087  284 ARG A CB  
189  C CG  . ARG A 24  ? 0.8037 0.9377 0.8771 0.1551  0.1423  0.1000  284 ARG A CG  
190  C CD  . ARG A 24  ? 0.8546 0.9786 0.9150 0.1486  0.1476  0.0977  284 ARG A CD  
191  N NE  . ARG A 24  ? 0.9643 1.0742 0.9997 0.1692  0.1578  0.0944  284 ARG A NE  
192  C CZ  . ARG A 24  ? 1.0139 1.0899 1.0188 0.1720  0.1575  0.0846  284 ARG A CZ  
193  N NH1 . ARG A 24  ? 0.9971 1.0510 0.9938 0.1548  0.1485  0.0777  284 ARG A NH1 
194  N NH2 . ARG A 24  ? 1.0415 1.1068 1.0240 0.1934  0.1660  0.0812  284 ARG A NH2 
195  N N   . LEU A 25  ? 0.7022 0.9213 0.8709 0.1175  0.1134  0.1159  285 LEU A N   
196  C CA  . LEU A 25  ? 0.7321 0.9871 0.9377 0.1076  0.1058  0.1224  285 LEU A CA  
197  C C   . LEU A 25  ? 0.7217 0.9693 0.9317 0.0862  0.0945  0.1181  285 LEU A C   
198  O O   . LEU A 25  ? 0.7354 1.0052 0.9717 0.0739  0.0917  0.1233  285 LEU A O   
199  C CB  . LEU A 25  ? 0.7888 1.0559 1.0044 0.1166  0.0969  0.1229  285 LEU A CB  
200  C CG  . LEU A 25  ? 0.8616 1.1523 1.0886 0.1368  0.1051  0.1296  285 LEU A CG  
201  C CD1 . LEU A 25  ? 0.8946 1.1733 1.1081 0.1513  0.0985  0.1265  285 LEU A CD1 
202  C CD2 . LEU A 25  ? 0.8653 1.2026 1.1358 0.1318  0.1040  0.1390  285 LEU A CD2 
203  N N   . TRP A 26  ? 0.6706 0.8866 0.8552 0.0823  0.0878  0.1090  286 TRP A N   
204  C CA  . TRP A 26  ? 0.6115 0.8183 0.7963 0.0648  0.0766  0.1034  286 TRP A CA  
205  C C   . TRP A 26  ? 0.6194 0.8116 0.7940 0.0552  0.0821  0.1016  286 TRP A C   
206  O O   . TRP A 26  ? 0.6160 0.8180 0.8067 0.0413  0.0770  0.1031  286 TRP A O   
207  C CB  . TRP A 26  ? 0.5679 0.7495 0.7299 0.0661  0.0687  0.0956  286 TRP A CB  
208  C CG  . TRP A 26  ? 0.5422 0.7114 0.6987 0.0513  0.0584  0.0886  286 TRP A CG  
209  C CD1 . TRP A 26  ? 0.5280 0.7110 0.7034 0.0379  0.0492  0.0880  286 TRP A CD1 
210  C CD2 . TRP A 26  ? 0.4835 0.6245 0.6147 0.0492  0.0556  0.0813  286 TRP A CD2 
211  N NE1 . TRP A 26  ? 0.5015 0.6661 0.6626 0.0290  0.0410  0.0798  286 TRP A NE1 
212  C CE2 . TRP A 26  ? 0.4582 0.5988 0.5931 0.0356  0.0454  0.0761  286 TRP A CE2 
213  C CE3 . TRP A 26  ? 0.4924 0.6085 0.5994 0.0573  0.0605  0.0791  286 TRP A CE3 
214  C CZ2 . TRP A 26  ? 0.4209 0.5403 0.5365 0.0307  0.0412  0.0690  286 TRP A CZ2 
215  C CZ3 . TRP A 26  ? 0.5096 0.6042 0.5994 0.0506  0.0562  0.0730  286 TRP A CZ3 
216  C CH2 . TRP A 26  ? 0.4768 0.5748 0.5712 0.0378  0.0473  0.0682  286 TRP A CH2 
217  N N   . LEU A 27  ? 0.6334 0.8014 0.7812 0.0632  0.0916  0.0982  287 LEU A N   
218  C CA  . LEU A 27  ? 0.6599 0.8081 0.7915 0.0555  0.0947  0.0940  287 LEU A CA  
219  C C   . LEU A 27  ? 0.6716 0.8306 0.8064 0.0592  0.1075  0.1013  287 LEU A C   
220  O O   . LEU A 27  ? 0.6979 0.8449 0.8230 0.0518  0.1090  0.0995  287 LEU A O   
221  C CB  . LEU A 27  ? 0.6618 0.7747 0.7614 0.0606  0.0950  0.0847  287 LEU A CB  
222  C CG  . LEU A 27  ? 0.6526 0.7508 0.7447 0.0554  0.0842  0.0782  287 LEU A CG  
223  C CD1 . LEU A 27  ? 0.6492 0.7168 0.7149 0.0642  0.0872  0.0726  287 LEU A CD1 
224  C CD2 . LEU A 27  ? 0.5601 0.6528 0.6535 0.0387  0.0746  0.0727  287 LEU A CD2 
225  N N   . SER A 28  ? 0.6914 0.8734 0.8386 0.0717  0.1172  0.1098  288 SER A N   
226  C CA  . SER A 28  ? 0.7236 0.9208 0.8755 0.0763  0.1311  0.1189  288 SER A CA  
227  C C   . SER A 28  ? 0.8283 1.0632 1.0072 0.0865  0.1394  0.1306  288 SER A C   
228  O O   . SER A 28  ? 0.9028 1.1411 1.0714 0.1053  0.1509  0.1327  288 SER A O   
229  C CB  . SER A 28  ? 0.7073 0.8767 0.8235 0.0887  0.1402  0.1129  288 SER A CB  
230  O OG  . SER A 28  ? 0.7252 0.8727 0.8208 0.1009  0.1378  0.1043  288 SER A OG  
231  N N   . ASN A 29  ? 0.8557 1.1188 1.0702 0.0741  0.1322  0.1376  289 ASN A N   
232  C CA  . ASN A 29  ? 0.8766 1.1794 1.1243 0.0805  0.1362  0.1483  289 ASN A CA  
233  C C   . ASN A 29  ? 0.8210 1.1506 1.0987 0.0673  0.1409  0.1610  289 ASN A C   
234  O O   . ASN A 29  ? 0.8236 1.1608 1.1249 0.0490  0.1281  0.1620  289 ASN A O   
235  C CB  . ASN A 29  ? 0.9096 1.2199 1.1739 0.0762  0.1196  0.1438  289 ASN A CB  
236  C CG  . ASN A 29  ? 1.2973 1.6522 1.6022 0.0804  0.1195  0.1542  289 ASN A CG  
237  O OD1 . ASN A 29  ? 1.2874 1.6688 1.6065 0.0912  0.1338  0.1646  289 ASN A OD1 
238  N ND2 . ASN A 29  ? 1.2939 1.6574 1.6170 0.0729  0.1025  0.1507  289 ASN A ND2 
239  N N   . GLY A 30  ? 0.7393 1.0810 1.0143 0.0768  0.1589  0.1707  290 GLY A N   
240  C CA  . GLY A 30  ? 0.7258 1.0926 1.0276 0.0651  0.1666  0.1856  290 GLY A CA  
241  C C   . GLY A 30  ? 0.7201 1.0656 1.0172 0.0445  0.1583  0.1838  290 GLY A C   
242  O O   . GLY A 30  ? 0.7248 1.0900 1.0547 0.0280  0.1549  0.1941  290 GLY A O   
243  N N   . ILE A 31  ? 0.6907 0.9961 0.9489 0.0453  0.1541  0.1706  291 ILE A N   
244  C CA  . ILE A 31  ? 0.6617 0.9453 0.9106 0.0293  0.1480  0.1683  291 ILE A CA  
245  C C   . ILE A 31  ? 0.7037 0.9654 0.9161 0.0392  0.1610  0.1676  291 ILE A C   
246  O O   . ILE A 31  ? 0.7164 0.9680 0.9026 0.0579  0.1696  0.1622  291 ILE A O   
247  C CB  . ILE A 31  ? 0.5805 0.8375 0.8192 0.0185  0.1281  0.1527  291 ILE A CB  
248  C CG1 . ILE A 31  ? 0.5105 0.7372 0.7113 0.0317  0.1274  0.1382  291 ILE A CG1 
249  C CG2 . ILE A 31  ? 0.5322 0.8115 0.8054 0.0102  0.1146  0.1535  291 ILE A CG2 
250  C CD1 . ILE A 31  ? 0.4757 0.6746 0.6622 0.0215  0.1109  0.1239  291 ILE A CD1 
251  N N   . GLN A 32  ? 0.7117 0.9658 0.9223 0.0276  0.1619  0.1730  292 GLN A N   
252  C CA  . GLN A 32  ? 0.7183 0.9470 0.8910 0.0359  0.1705  0.1699  292 GLN A CA  
253  C C   . GLN A 32  ? 0.6964 0.8882 0.8375 0.0380  0.1585  0.1500  292 GLN A C   
254  O O   . GLN A 32  ? 0.6758 0.8599 0.8258 0.0265  0.1429  0.1414  292 GLN A O   
255  C CB  . GLN A 32  ? 0.8107 1.0352 0.9875 0.0215  0.1707  0.1790  292 GLN A CB  
256  C CG  . GLN A 32  ? 0.9289 1.1864 1.1313 0.0201  0.1864  0.2015  292 GLN A CG  
257  C CD  . GLN A 32  ? 1.0580 1.3043 1.2564 0.0080  0.1876  0.2107  292 GLN A CD  
258  O OE1 . GLN A 32  ? 1.0788 1.2923 1.2421 0.0100  0.1838  0.2007  292 GLN A OE1 
259  N NE2 . GLN A 32  ? 1.1096 1.3834 1.3449 -0.0047 0.1927  0.2305  292 GLN A NE2 
260  N N   . ALA A 33  ? 0.6879 0.8577 0.7923 0.0531  0.1657  0.1429  293 ALA A N   
261  C CA  . ALA A 33  ? 0.6383 0.7727 0.7128 0.0555  0.1554  0.1247  293 ALA A CA  
262  C C   . ALA A 33  ? 0.6526 0.7700 0.7277 0.0370  0.1413  0.1186  293 ALA A C   
263  O O   . ALA A 33  ? 0.7179 0.8298 0.7870 0.0317  0.1433  0.1232  293 ALA A O   
264  C CB  . ALA A 33  ? 0.5623 0.6763 0.5993 0.0729  0.1647  0.1195  293 ALA A CB  
265  N N   . PRO A 34  ? 0.6101 0.7195 0.6919 0.0281  0.1271  0.1088  294 PRO A N   
266  C CA  . PRO A 34  ? 0.5642 0.6572 0.6439 0.0129  0.1142  0.1021  294 PRO A CA  
267  C C   . PRO A 34  ? 0.6031 0.6657 0.6490 0.0172  0.1131  0.0914  294 PRO A C   
268  O O   . PRO A 34  ? 0.6357 0.6839 0.6592 0.0302  0.1170  0.0841  294 PRO A O   
269  C CB  . PRO A 34  ? 0.4876 0.5798 0.5780 0.0063  0.1009  0.0934  294 PRO A CB  
270  C CG  . PRO A 34  ? 0.4815 0.5970 0.5896 0.0143  0.1062  0.1000  294 PRO A CG  
271  C CD  . PRO A 34  ? 0.5758 0.6917 0.6677 0.0312  0.1218  0.1043  294 PRO A CD  
272  N N   . ASP A 35  ? 0.5820 0.6340 0.6247 0.0067  0.1066  0.0903  295 ASP A N   
273  C CA  . ASP A 35  ? 0.6162 0.6400 0.6299 0.0088  0.1020  0.0787  295 ASP A CA  
274  C C   . ASP A 35  ? 0.6389 0.6476 0.6471 0.0055  0.0902  0.0638  295 ASP A C   
275  O O   . ASP A 35  ? 0.6644 0.6526 0.6498 0.0123  0.0889  0.0533  295 ASP A O   
276  C CB  . ASP A 35  ? 0.6231 0.6411 0.6375 -0.0017 0.0971  0.0820  295 ASP A CB  
277  C CG  . ASP A 35  ? 0.6500 0.6795 0.6656 0.0020  0.1098  0.0975  295 ASP A CG  
278  O OD1 . ASP A 35  ? 0.7388 0.7599 0.7295 0.0159  0.1195  0.0974  295 ASP A OD1 
279  O OD2 . ASP A 35  ? 0.5626 0.6090 0.6036 -0.0084 0.1102  0.1100  295 ASP A OD2 
280  N N   . VAL A 36  ? 0.6173 0.6366 0.6470 -0.0048 0.0814  0.0633  296 VAL A N   
281  C CA  . VAL A 36  ? 0.5838 0.5925 0.6104 -0.0087 0.0709  0.0514  296 VAL A CA  
282  C C   . VAL A 36  ? 0.5849 0.6100 0.6297 -0.0087 0.0693  0.0540  296 VAL A C   
283  O O   . VAL A 36  ? 0.6205 0.6663 0.6879 -0.0132 0.0687  0.0626  296 VAL A O   
284  C CB  . VAL A 36  ? 0.5758 0.5776 0.6053 -0.0208 0.0586  0.0457  296 VAL A CB  
285  C CG1 . VAL A 36  ? 0.6086 0.6009 0.6331 -0.0234 0.0495  0.0337  296 VAL A CG1 
286  C CG2 . VAL A 36  ? 0.5595 0.5464 0.5722 -0.0205 0.0596  0.0446  296 VAL A CG2 
287  N N   . TYR A 37  ? 0.5570 0.5729 0.5929 -0.0041 0.0678  0.0470  297 TYR A N   
288  C CA  . TYR A 37  ? 0.5522 0.5814 0.6016 -0.0025 0.0659  0.0493  297 TYR A CA  
289  C C   . TYR A 37  ? 0.5381 0.5598 0.5856 -0.0088 0.0554  0.0408  297 TYR A C   
290  O O   . TYR A 37  ? 0.5026 0.5058 0.5341 -0.0085 0.0541  0.0330  297 TYR A O   
291  C CB  . TYR A 37  ? 0.5397 0.5645 0.5794 0.0108  0.0746  0.0506  297 TYR A CB  
292  C CG  . TYR A 37  ? 0.5601 0.6037 0.6101 0.0201  0.0845  0.0609  297 TYR A CG  
293  C CD1 . TYR A 37  ? 0.5370 0.6035 0.6088 0.0205  0.0831  0.0676  297 TYR A CD1 
294  C CD2 . TYR A 37  ? 0.6110 0.6498 0.6478 0.0306  0.0951  0.0634  297 TYR A CD2 
295  C CE1 . TYR A 37  ? 0.5429 0.6293 0.6262 0.0301  0.0926  0.0772  297 TYR A CE1 
296  C CE2 . TYR A 37  ? 0.5983 0.6566 0.6444 0.0411  0.1055  0.0732  297 TYR A CE2 
297  C CZ  . TYR A 37  ? 0.5711 0.6540 0.6416 0.0405  0.1045  0.0802  297 TYR A CZ  
298  O OH  . TYR A 37  ? 0.5367 0.6418 0.6186 0.0515  0.1153  0.0902  297 TYR A OH  
299  N N   . CYS A 38  ? 0.5435 0.5808 0.6077 -0.0141 0.0479  0.0426  298 CYS A N   
300  C CA  . CYS A 38  ? 0.5128 0.5474 0.5755 -0.0183 0.0385  0.0357  298 CYS A CA  
301  C C   . CYS A 38  ? 0.4895 0.5374 0.5610 -0.0128 0.0382  0.0401  298 CYS A C   
302  O O   . CYS A 38  ? 0.5053 0.5718 0.5947 -0.0138 0.0348  0.0452  298 CYS A O   
303  C CB  . CYS A 38  ? 0.5117 0.5524 0.5846 -0.0279 0.0276  0.0328  298 CYS A CB  
304  S SG  . CYS A 38  ? 0.6214 0.6493 0.6874 -0.0340 0.0274  0.0304  298 CYS A SG  
305  N N   . VAL A 39  ? 0.4350 0.4732 0.4948 -0.0070 0.0411  0.0385  299 VAL A N   
306  C CA  . VAL A 39  ? 0.4846 0.5329 0.5496 0.0009  0.0424  0.0440  299 VAL A CA  
307  C C   . VAL A 39  ? 0.4991 0.5439 0.5573 0.0009  0.0373  0.0412  299 VAL A C   
308  O O   . VAL A 39  ? 0.5443 0.5722 0.5888 0.0005  0.0400  0.0380  299 VAL A O   
309  C CB  . VAL A 39  ? 0.5142 0.5534 0.5707 0.0112  0.0529  0.0479  299 VAL A CB  
310  C CG1 . VAL A 39  ? 0.4684 0.5167 0.5292 0.0206  0.0536  0.0536  299 VAL A CG1 
311  C CG2 . VAL A 39  ? 0.4954 0.5404 0.5569 0.0134  0.0597  0.0516  299 VAL A CG2 
312  N N   . GLY A 40  ? 0.4815 0.5427 0.5495 0.0018  0.0298  0.0427  300 GLY A N   
313  C CA  . GLY A 40  ? 0.4851 0.5457 0.5454 0.0024  0.0244  0.0401  300 GLY A CA  
314  C C   . GLY A 40  ? 0.4865 0.5539 0.5461 0.0123  0.0251  0.0464  300 GLY A C   
315  O O   . GLY A 40  ? 0.4845 0.5666 0.5567 0.0172  0.0236  0.0508  300 GLY A O   
316  N N   . PHE A 41  ? 0.5272 0.5847 0.5729 0.0153  0.0273  0.0474  301 PHE A N   
317  C CA  . PHE A 41  ? 0.5476 0.6086 0.5887 0.0253  0.0279  0.0541  301 PHE A CA  
318  C C   . PHE A 41  ? 0.5364 0.6017 0.5688 0.0259  0.0223  0.0527  301 PHE A C   
319  O O   . PHE A 41  ? 0.5146 0.5746 0.5412 0.0191  0.0217  0.0476  301 PHE A O   
320  C CB  . PHE A 41  ? 0.5433 0.5845 0.5733 0.0300  0.0380  0.0595  301 PHE A CB  
321  C CG  . PHE A 41  ? 0.5995 0.6358 0.6342 0.0337  0.0440  0.0611  301 PHE A CG  
322  C CD1 . PHE A 41  ? 0.6143 0.6621 0.6565 0.0438  0.0446  0.0666  301 PHE A CD1 
323  C CD2 . PHE A 41  ? 0.6134 0.6346 0.6442 0.0285  0.0490  0.0569  301 PHE A CD2 
324  C CE1 . PHE A 41  ? 0.6406 0.6860 0.6862 0.0490  0.0511  0.0682  301 PHE A CE1 
325  C CE2 . PHE A 41  ? 0.6291 0.6461 0.6612 0.0341  0.0549  0.0581  301 PHE A CE2 
326  C CZ  . PHE A 41  ? 0.6565 0.6862 0.6960 0.0444  0.0565  0.0639  301 PHE A CZ  
327  N N   . GLN A 42  ? 0.5752 0.6514 0.6062 0.0353  0.0180  0.0572  302 GLN A N   
328  C CA  . GLN A 42  ? 0.5746 0.6532 0.5920 0.0398  0.0152  0.0585  302 GLN A CA  
329  C C   . GLN A 42  ? 0.6065 0.6801 0.6142 0.0509  0.0203  0.0690  302 GLN A C   
330  O O   . GLN A 42  ? 0.6008 0.6740 0.6148 0.0566  0.0226  0.0734  302 GLN A O   
331  C CB  . GLN A 42  ? 0.5099 0.6071 0.5313 0.0418  0.0014  0.0519  302 GLN A CB  
332  C CG  . GLN A 42  ? 0.5050 0.6060 0.5378 0.0314  -0.0055 0.0420  302 GLN A CG  
333  C CD  . GLN A 42  ? 0.5376 0.6448 0.5905 0.0276  -0.0073 0.0422  302 GLN A CD  
334  O OE1 . GLN A 42  ? 0.5900 0.7075 0.6517 0.0343  -0.0090 0.0471  302 GLN A OE1 
335  N NE2 . GLN A 42  ? 0.4966 0.5988 0.5572 0.0174  -0.0064 0.0376  302 GLN A NE2 
336  N N   . GLU A 43  ? 0.6421 0.7124 0.6342 0.0547  0.0226  0.0735  303 GLU A N   
337  C CA  . GLU A 43  ? 0.6556 0.7180 0.6359 0.0648  0.0281  0.0850  303 GLU A CA  
338  C C   . GLU A 43  ? 0.6324 0.6743 0.6145 0.0639  0.0376  0.0907  303 GLU A C   
339  O O   . GLU A 43  ? 0.6318 0.6704 0.6123 0.0741  0.0387  0.0974  303 GLU A O   
340  C CB  . GLU A 43  ? 0.6732 0.7521 0.6534 0.0779  0.0189  0.0871  303 GLU A CB  
341  C CG  . GLU A 43  ? 0.7206 0.8169 0.6955 0.0810  0.0079  0.0808  303 GLU A CG  
342  C CD  . GLU A 43  ? 0.8077 0.9184 0.7787 0.0955  -0.0021 0.0831  303 GLU A CD  
343  O OE1 . GLU A 43  ? 0.8656 0.9731 0.8366 0.1042  0.0005  0.0912  303 GLU A OE1 
344  O OE2 . GLU A 43  ? 0.8355 0.9604 0.8024 0.0996  -0.0137 0.0762  303 GLU A OE2 
345  N N   . LEU A 44  ? 0.6077 0.6353 0.5919 0.0530  0.0435  0.0873  304 LEU A N   
346  C CA  . LEU A 44  ? 0.6094 0.6151 0.5935 0.0525  0.0509  0.0905  304 LEU A CA  
347  C C   . LEU A 44  ? 0.6639 0.6523 0.6356 0.0588  0.0568  0.1023  304 LEU A C   
348  O O   . LEU A 44  ? 0.7071 0.6808 0.6772 0.0654  0.0599  0.1066  304 LEU A O   
349  C CB  . LEU A 44  ? 0.5754 0.5683 0.5627 0.0398  0.0543  0.0836  304 LEU A CB  
350  C CG  . LEU A 44  ? 0.5906 0.5662 0.5802 0.0408  0.0582  0.0817  304 LEU A CG  
351  C CD1 . LEU A 44  ? 0.5391 0.5319 0.5400 0.0436  0.0544  0.0760  304 LEU A CD1 
352  C CD2 . LEU A 44  ? 0.5091 0.4647 0.4973 0.0304  0.0617  0.0770  304 LEU A CD2 
353  N N   . ASP A 45  ? 0.6213 0.6110 0.5840 0.0573  0.0588  0.1083  305 ASP A N   
354  C CA  . ASP A 45  ? 0.6326 0.6063 0.5834 0.0625  0.0650  0.1220  305 ASP A CA  
355  C C   . ASP A 45  ? 0.7358 0.7265 0.6763 0.0672  0.0638  0.1275  305 ASP A C   
356  O O   . ASP A 45  ? 0.7666 0.7695 0.7083 0.0601  0.0631  0.1222  305 ASP A O   
357  C CB  . ASP A 45  ? 0.6394 0.5891 0.5913 0.0509  0.0723  0.1246  305 ASP A CB  
358  C CG  . ASP A 45  ? 0.7979 0.7259 0.7401 0.0543  0.0788  0.1400  305 ASP A CG  
359  O OD1 . ASP A 45  ? 0.8543 0.7899 0.7867 0.0591  0.0814  0.1507  305 ASP A OD1 
360  O OD2 . ASP A 45  ? 0.8182 0.7198 0.7617 0.0524  0.0812  0.1416  305 ASP A OD2 
361  N N   . LEU A 46  ? 0.7336 0.7259 0.6627 0.0807  0.0629  0.1374  306 LEU A N   
362  C CA  . LEU A 46  ? 0.6927 0.7023 0.6085 0.0888  0.0607  0.1423  306 LEU A CA  
363  C C   . LEU A 46  ? 0.7172 0.7141 0.6183 0.0906  0.0707  0.1590  306 LEU A C   
364  O O   . LEU A 46  ? 0.7243 0.7342 0.6110 0.0988  0.0708  0.1651  306 LEU A O   
365  C CB  . LEU A 46  ? 0.6727 0.6969 0.5849 0.1044  0.0508  0.1413  306 LEU A CB  
366  C CG  . LEU A 46  ? 0.6366 0.6813 0.5638 0.1033  0.0392  0.1260  306 LEU A CG  
367  C CD1 . LEU A 46  ? 0.6056 0.6635 0.5329 0.1183  0.0295  0.1265  306 LEU A CD1 
368  C CD2 . LEU A 46  ? 0.5691 0.6306 0.4957 0.0976  0.0341  0.1164  306 LEU A CD2 
369  N N   . SER A 47  ? 0.7251 0.6964 0.6296 0.0829  0.0789  0.1666  307 SER A N   
370  C CA  . SER A 47  ? 0.7085 0.6652 0.6035 0.0811  0.0892  0.1839  307 SER A CA  
371  C C   . SER A 47  ? 0.7465 0.7178 0.6411 0.0724  0.0952  0.1857  307 SER A C   
372  O O   . SER A 47  ? 0.7326 0.7151 0.6384 0.0628  0.0929  0.1728  307 SER A O   
373  C CB  . SER A 47  ? 0.6820 0.6063 0.5851 0.0718  0.0944  0.1885  307 SER A CB  
374  O OG  . SER A 47  ? 0.6834 0.6046 0.6012 0.0550  0.0966  0.1801  307 SER A OG  
375  N N   . LYS A 48  ? 0.8627 0.8334 0.7441 0.0766  0.1038  0.2030  308 LYS A N   
376  C CA  . LYS A 48  ? 0.9030 0.8878 0.7846 0.0691  0.1122  0.2079  308 LYS A CA  
377  C C   . LYS A 48  ? 0.8875 0.8561 0.7889 0.0494  0.1185  0.2082  308 LYS A C   
378  O O   . LYS A 48  ? 0.8667 0.8497 0.7782 0.0395  0.1208  0.2017  308 LYS A O   
379  C CB  . LYS A 48  ? 0.9541 0.9423 0.8163 0.0790  0.1215  0.2289  308 LYS A CB  
380  C CG  . LYS A 48  ? 1.0339 1.0287 0.8740 0.1003  0.1150  0.2324  308 LYS A CG  
381  C CD  . LYS A 48  ? 1.0582 1.0802 0.8933 0.1100  0.1022  0.2140  308 LYS A CD  
382  C CE  . LYS A 48  ? 1.2441 1.2756 1.0555 0.1323  0.0953  0.2187  308 LYS A CE  
383  N NZ  . LYS A 48  ? 1.2204 1.2500 1.0371 0.1400  0.0811  0.2073  308 LYS A NZ  
384  N N   . GLU A 49  ? 0.9088 0.8472 0.8158 0.0447  0.1199  0.2146  309 GLU A N   
385  C CA  . GLU A 49  ? 0.9329 0.8522 0.8589 0.0267  0.1231  0.2132  309 GLU A CA  
386  C C   . GLU A 49  ? 0.9566 0.8859 0.8968 0.0181  0.1160  0.1918  309 GLU A C   
387  O O   . GLU A 49  ? 0.9648 0.8995 0.9185 0.0047  0.1191  0.1888  309 GLU A O   
388  C CB  . GLU A 49  ? 0.9445 0.8274 0.8715 0.0265  0.1217  0.2188  309 GLU A CB  
389  C CG  . GLU A 49  ? 0.9784 0.8375 0.9227 0.0085  0.1255  0.2227  309 GLU A CG  
390  C CD  . GLU A 49  ? 1.0556 0.8760 0.9972 0.0095  0.1259  0.2344  309 GLU A CD  
391  O OE1 . GLU A 49  ? 1.0835 0.8814 1.0395 -0.0052 0.1277  0.2386  309 GLU A OE1 
392  O OE2 . GLU A 49  ? 1.0780 0.8900 1.0038 0.0252  0.1235  0.2392  309 GLU A OE2 
393  N N   . ALA A 50  ? 0.9374 0.8701 0.8750 0.0261  0.1065  0.1778  310 ALA A N   
394  C CA  . ALA A 50  ? 0.8911 0.8327 0.8400 0.0195  0.0995  0.1585  310 ALA A CA  
395  C C   . ALA A 50  ? 0.8778 0.8481 0.8280 0.0169  0.0995  0.1525  310 ALA A C   
396  O O   . ALA A 50  ? 0.8451 0.8194 0.8074 0.0060  0.0984  0.1425  310 ALA A O   
397  C CB  . ALA A 50  ? 0.8903 0.8341 0.8361 0.0298  0.0907  0.1481  310 ALA A CB  
398  N N   . PHE A 51  ? 0.9063 0.8960 0.8427 0.0284  0.1002  0.1582  311 PHE A N   
399  C CA  . PHE A 51  ? 0.9291 0.9460 0.8630 0.0294  0.0997  0.1522  311 PHE A CA  
400  C C   . PHE A 51  ? 0.9395 0.9607 0.8815 0.0184  0.1101  0.1600  311 PHE A C   
401  O O   . PHE A 51  ? 0.9791 1.0213 0.9234 0.0168  0.1102  0.1533  311 PHE A O   
402  C CB  . PHE A 51  ? 0.9629 0.9968 0.8767 0.0464  0.0982  0.1580  311 PHE A CB  
403  C CG  . PHE A 51  ? 0.9965 1.0572 0.9040 0.0506  0.0969  0.1515  311 PHE A CG  
404  C CD1 . PHE A 51  ? 0.9869 1.0603 0.8975 0.0521  0.0850  0.1328  311 PHE A CD1 
405  C CD2 . PHE A 51  ? 1.0617 1.1343 0.9601 0.0537  0.1078  0.1647  311 PHE A CD2 
406  C CE1 . PHE A 51  ? 1.0209 1.1162 0.9245 0.0573  0.0825  0.1255  311 PHE A CE1 
407  C CE2 . PHE A 51  ? 1.0692 1.1669 0.9599 0.0599  0.1068  0.1580  311 PHE A CE2 
408  C CZ  . PHE A 51  ? 1.0747 1.1828 0.9674 0.0621  0.0934  0.1375  311 PHE A CZ  
409  N N   . PHE A 52  ? 0.9342 0.9351 0.8821 0.0108  0.1182  0.1743  312 PHE A N   
410  C CA  . PHE A 52  ? 0.9626 0.9679 0.9188 0.0013  0.1297  0.1873  312 PHE A CA  
411  C C   . PHE A 52  ? 0.8744 0.8665 0.8536 -0.0168 0.1292  0.1811  312 PHE A C   
412  O O   . PHE A 52  ? 0.8131 0.8215 0.8045 -0.0252 0.1329  0.1791  312 PHE A O   
413  C CB  . PHE A 52  ? 1.1132 1.1021 1.0610 0.0045  0.1385  0.2098  312 PHE A CB  
414  C CG  . PHE A 52  ? 1.2129 1.2216 1.1517 0.0094  0.1504  0.2269  312 PHE A CG  
415  C CD1 . PHE A 52  ? 1.2503 1.2869 1.1708 0.0246  0.1492  0.2232  312 PHE A CD1 
416  C CD2 . PHE A 52  ? 1.2753 1.2741 1.2230 -0.0005 0.1626  0.2475  312 PHE A CD2 
417  C CE1 . PHE A 52  ? 1.2945 1.3503 1.2037 0.0312  0.1613  0.2396  312 PHE A CE1 
418  C CE2 . PHE A 52  ? 1.3437 1.3623 1.2826 0.0046  0.1755  0.2657  312 PHE A CE2 
419  C CZ  . PHE A 52  ? 1.3440 1.3920 1.2622 0.0214  0.1754  0.2618  312 PHE A CZ  
420  N N   . PHE A 53  ? 0.9000 0.8628 0.8845 -0.0213 0.1242  0.1780  313 PHE A N   
421  C CA  . PHE A 53  ? 0.9697 0.9153 0.9739 -0.0371 0.1216  0.1710  313 PHE A CA  
422  C C   . PHE A 53  ? 0.9182 0.8550 0.9241 -0.0367 0.1103  0.1506  313 PHE A C   
423  O O   . PHE A 53  ? 0.9233 0.8408 0.9410 -0.0467 0.1065  0.1440  313 PHE A O   
424  C CB  . PHE A 53  ? 1.0846 0.9985 1.0945 -0.0440 0.1254  0.1852  313 PHE A CB  
425  C CG  . PHE A 53  ? 1.1969 1.1143 1.2026 -0.0429 0.1371  0.2087  313 PHE A CG  
426  C CD1 . PHE A 53  ? 1.2453 1.1783 1.2658 -0.0541 0.1464  0.2192  313 PHE A CD1 
427  C CD2 . PHE A 53  ? 1.2602 1.1661 1.2475 -0.0301 0.1393  0.2211  313 PHE A CD2 
428  C CE1 . PHE A 53  ? 1.3102 1.2477 1.3266 -0.0528 0.1587  0.2428  313 PHE A CE1 
429  C CE2 . PHE A 53  ? 1.3149 1.2230 1.2962 -0.0282 0.1505  0.2440  313 PHE A CE2 
430  C CZ  . PHE A 53  ? 1.3378 1.2617 1.3333 -0.0398 0.1609  0.2555  313 PHE A CZ  
431  N N   . HIS A 54  ? 0.9051 0.8553 0.8991 -0.0250 0.1045  0.1411  314 HIS A N   
432  C CA  . HIS A 54  ? 0.9030 0.8510 0.8993 -0.0248 0.0950  0.1227  314 HIS A CA  
433  C C   . HIS A 54  ? 0.8808 0.8008 0.8758 -0.0228 0.0911  0.1198  314 HIS A C   
434  O O   . HIS A 54  ? 0.8749 0.7967 0.8638 -0.0143 0.0857  0.1118  314 HIS A O   
435  C CB  . HIS A 54  ? 0.9071 0.8626 0.9176 -0.0368 0.0925  0.1112  314 HIS A CB  
436  C CG  . HIS A 54  ? 0.9079 0.8571 0.9203 -0.0375 0.0836  0.0941  314 HIS A CG  
437  N ND1 . HIS A 54  ? 0.8775 0.8427 0.8841 -0.0304 0.0777  0.0839  314 HIS A ND1 
438  C CD2 . HIS A 54  ? 0.9095 0.8380 0.9286 -0.0442 0.0795  0.0859  314 HIS A CD2 
439  C CE1 . HIS A 54  ? 0.8550 0.8104 0.8648 -0.0331 0.0717  0.0718  314 HIS A CE1 
440  N NE2 . HIS A 54  ? 0.8855 0.8190 0.9014 -0.0405 0.0727  0.0723  314 HIS A NE2 
441  N N   . ASP A 55  ? 0.8891 0.7835 0.8904 -0.0305 0.0934  0.1258  315 ASP A N   
442  C CA  . ASP A 55  ? 0.9288 0.7934 0.9273 -0.0275 0.0892  0.1221  315 ASP A CA  
443  C C   . ASP A 55  ? 0.8981 0.7583 0.8825 -0.0121 0.0894  0.1285  315 ASP A C   
444  O O   . ASP A 55  ? 0.9350 0.8021 0.9122 -0.0061 0.0942  0.1417  315 ASP A O   
445  C CB  . ASP A 55  ? 1.0290 0.8654 1.0365 -0.0382 0.0907  0.1293  315 ASP A CB  
446  C CG  . ASP A 55  ? 1.1233 0.9600 1.1472 -0.0532 0.0875  0.1196  315 ASP A CG  
447  O OD1 . ASP A 55  ? 1.1601 0.9871 1.1972 -0.0654 0.0904  0.1283  315 ASP A OD1 
448  O OD2 . ASP A 55  ? 1.1339 0.9808 1.1581 -0.0527 0.0819  0.1039  315 ASP A OD2 
449  N N   . THR A 56  ? 0.8588 0.7089 0.8391 -0.0047 0.0843  0.1189  316 THR A N   
450  C CA  . THR A 56  ? 0.8173 0.6656 0.7867 0.0107  0.0839  0.1235  316 THR A CA  
451  C C   . THR A 56  ? 0.7941 0.6256 0.7618 0.0166  0.0796  0.1132  316 THR A C   
452  O O   . THR A 56  ? 0.8137 0.6502 0.7860 0.0125  0.0763  0.1001  316 THR A O   
453  C CB  . THR A 56  ? 0.7865 0.6672 0.7524 0.0188  0.0825  0.1221  316 THR A CB  
454  O OG1 . THR A 56  ? 0.8434 0.7236 0.8028 0.0333  0.0801  0.1229  316 THR A OG1 
455  C CG2 . THR A 56  ? 0.6929 0.5931 0.6665 0.0126  0.0783  0.1078  316 THR A CG2 
456  N N   . PRO A 57  ? 0.7367 0.5479 0.6961 0.0276  0.0799  0.1192  317 PRO A N   
457  C CA  . PRO A 57  ? 0.7203 0.5156 0.6762 0.0357  0.0766  0.1097  317 PRO A CA  
458  C C   . PRO A 57  ? 0.7559 0.5773 0.7119 0.0459  0.0753  0.1031  317 PRO A C   
459  O O   . PRO A 57  ? 0.8555 0.6702 0.8090 0.0539  0.0740  0.0956  317 PRO A O   
460  C CB  . PRO A 57  ? 0.6891 0.4560 0.6358 0.0456  0.0774  0.1196  317 PRO A CB  
461  C CG  . PRO A 57  ? 0.6732 0.4531 0.6168 0.0486  0.0810  0.1341  317 PRO A CG  
462  C CD  . PRO A 57  ? 0.6690 0.4712 0.6205 0.0348  0.0833  0.1352  317 PRO A CD  
463  N N   . LYS A 58  ? 0.7272 0.5784 0.6863 0.0461  0.0755  0.1061  318 LYS A N   
464  C CA  . LYS A 58  ? 0.7290 0.6062 0.6921 0.0534  0.0731  0.1004  318 LYS A CA  
465  C C   . LYS A 58  ? 0.7547 0.6389 0.7248 0.0452  0.0712  0.0875  318 LYS A C   
466  O O   . LYS A 58  ? 0.7852 0.6806 0.7586 0.0512  0.0704  0.0819  318 LYS A O   
467  C CB  . LYS A 58  ? 0.7066 0.6115 0.6711 0.0551  0.0714  0.1057  318 LYS A CB  
468  C CG  . LYS A 58  ? 0.6735 0.5746 0.6291 0.0658  0.0727  0.1186  318 LYS A CG  
469  C CD  . LYS A 58  ? 0.6823 0.5887 0.6374 0.0816  0.0706  0.1195  318 LYS A CD  
470  C CE  . LYS A 58  ? 0.7055 0.6062 0.6500 0.0937  0.0711  0.1326  318 LYS A CE  
471  N NZ  . LYS A 58  ? 0.8247 0.6889 0.7602 0.0938  0.0753  0.1399  318 LYS A NZ  
472  N N   . GLU A 59  ? 0.7255 0.6039 0.6982 0.0317  0.0710  0.0837  319 GLU A N   
473  C CA  . GLU A 59  ? 0.6179 0.5001 0.5955 0.0240  0.0687  0.0718  319 GLU A CA  
474  C C   . GLU A 59  ? 0.6466 0.5107 0.6194 0.0302  0.0687  0.0648  319 GLU A C   
475  O O   . GLU A 59  ? 0.6645 0.5416 0.6393 0.0336  0.0682  0.0590  319 GLU A O   
476  C CB  . GLU A 59  ? 0.5635 0.4401 0.5449 0.0098  0.0680  0.0694  319 GLU A CB  
477  C CG  . GLU A 59  ? 0.5973 0.4739 0.5821 0.0026  0.0648  0.0571  319 GLU A CG  
478  C CD  . GLU A 59  ? 0.7279 0.6076 0.7192 -0.0105 0.0635  0.0548  319 GLU A CD  
479  O OE1 . GLU A 59  ? 0.7673 0.6686 0.7625 -0.0136 0.0638  0.0574  319 GLU A OE1 
480  O OE2 . GLU A 59  ? 0.8172 0.6784 0.8101 -0.0172 0.0617  0.0497  319 GLU A OE2 
481  N N   . GLU A 60  ? 0.6774 0.5112 0.6435 0.0320  0.0689  0.0655  320 GLU A N   
482  C CA  . GLU A 60  ? 0.6759 0.4909 0.6341 0.0404  0.0682  0.0576  320 GLU A CA  
483  C C   . GLU A 60  ? 0.6932 0.5207 0.6488 0.0565  0.0712  0.0607  320 GLU A C   
484  O O   . GLU A 60  ? 0.7027 0.5355 0.6561 0.0632  0.0724  0.0544  320 GLU A O   
485  C CB  . GLU A 60  ? 0.6889 0.4662 0.6399 0.0402  0.0658  0.0567  320 GLU A CB  
486  N N   . GLU A 61  ? 0.7005 0.5354 0.6570 0.0629  0.0726  0.0710  321 GLU A N   
487  C CA  . GLU A 61  ? 0.7094 0.5586 0.6660 0.0787  0.0748  0.0745  321 GLU A CA  
488  C C   . GLU A 61  ? 0.7445 0.6266 0.7116 0.0790  0.0754  0.0711  321 GLU A C   
489  O O   . GLU A 61  ? 0.7924 0.6812 0.7598 0.0899  0.0782  0.0690  321 GLU A O   
490  C CB  . GLU A 61  ? 0.7008 0.5549 0.6572 0.0844  0.0747  0.0860  321 GLU A CB  
491  C CG  . GLU A 61  ? 0.8040 0.6240 0.7492 0.0901  0.0749  0.0911  321 GLU A CG  
492  C CD  . GLU A 61  ? 0.8660 0.6878 0.8084 0.0960  0.0751  0.1039  321 GLU A CD  
493  O OE1 . GLU A 61  ? 0.8217 0.6730 0.7704 0.0963  0.0745  0.1079  321 GLU A OE1 
494  O OE2 . GLU A 61  ? 0.9336 0.7254 0.8668 0.1009  0.0752  0.1098  321 GLU A OE2 
495  N N   . TRP A 62  ? 0.7098 0.6126 0.6860 0.0676  0.0730  0.0711  322 TRP A N   
496  C CA  . TRP A 62  ? 0.6676 0.5999 0.6556 0.0662  0.0722  0.0685  322 TRP A CA  
497  C C   . TRP A 62  ? 0.6752 0.6034 0.6622 0.0604  0.0733  0.0597  322 TRP A C   
498  O O   . TRP A 62  ? 0.6329 0.5781 0.6267 0.0637  0.0753  0.0584  322 TRP A O   
499  C CB  . TRP A 62  ? 0.6138 0.5670 0.6100 0.0578  0.0674  0.0708  322 TRP A CB  
500  C CG  . TRP A 62  ? 0.6470 0.6134 0.6456 0.0671  0.0657  0.0790  322 TRP A CG  
501  C CD1 . TRP A 62  ? 0.6687 0.6276 0.6598 0.0689  0.0649  0.0858  322 TRP A CD1 
502  C CD2 . TRP A 62  ? 0.6645 0.6547 0.6741 0.0765  0.0643  0.0817  322 TRP A CD2 
503  N NE1 . TRP A 62  ? 0.6447 0.6201 0.6391 0.0799  0.0623  0.0918  322 TRP A NE1 
504  C CE2 . TRP A 62  ? 0.6565 0.6521 0.6638 0.0843  0.0613  0.0889  322 TRP A CE2 
505  C CE3 . TRP A 62  ? 0.6533 0.6623 0.6758 0.0790  0.0654  0.0794  322 TRP A CE3 
506  C CZ2 . TRP A 62  ? 0.6635 0.6822 0.6813 0.0946  0.0581  0.0926  322 TRP A CZ2 
507  C CZ3 . TRP A 62  ? 0.6361 0.6696 0.6716 0.0881  0.0631  0.0841  322 TRP A CZ3 
508  C CH2 . TRP A 62  ? 0.6526 0.6910 0.6861 0.0958  0.0588  0.0899  322 TRP A CH2 
509  N N   . PHE A 63  ? 0.6554 0.5611 0.6345 0.0522  0.0720  0.0542  323 PHE A N   
510  C CA  . PHE A 63  ? 0.6957 0.5936 0.6706 0.0487  0.0721  0.0455  323 PHE A CA  
511  C C   . PHE A 63  ? 0.7191 0.6073 0.6850 0.0634  0.0766  0.0437  323 PHE A C   
512  O O   . PHE A 63  ? 0.7304 0.6308 0.6975 0.0664  0.0795  0.0413  323 PHE A O   
513  C CB  . PHE A 63  ? 0.6925 0.5671 0.6614 0.0382  0.0686  0.0395  323 PHE A CB  
514  C CG  . PHE A 63  ? 0.7617 0.6281 0.7249 0.0355  0.0672  0.0297  323 PHE A CG  
515  C CD1 . PHE A 63  ? 0.7486 0.6342 0.7178 0.0294  0.0663  0.0269  323 PHE A CD1 
516  C CD2 . PHE A 63  ? 0.8184 0.6573 0.7690 0.0406  0.0662  0.0233  323 PHE A CD2 
517  C CE1 . PHE A 63  ? 0.7754 0.6532 0.7375 0.0282  0.0651  0.0188  323 PHE A CE1 
518  C CE2 . PHE A 63  ? 0.8424 0.6738 0.7852 0.0401  0.0643  0.0138  323 PHE A CE2 
519  C CZ  . PHE A 63  ? 0.8193 0.6707 0.7675 0.0340  0.0642  0.0121  323 PHE A CZ  
520  N N   . LYS A 64  ? 0.6760 0.5421 0.6323 0.0730  0.0774  0.0451  324 LYS A N   
521  C CA  . LYS A 64  ? 0.6868 0.5439 0.6329 0.0901  0.0816  0.0431  324 LYS A CA  
522  C C   . LYS A 64  ? 0.6904 0.5807 0.6478 0.0988  0.0868  0.0493  324 LYS A C   
523  O O   . LYS A 64  ? 0.7418 0.6410 0.6972 0.1064  0.0918  0.0470  324 LYS A O   
524  C CB  . LYS A 64  ? 0.7316 0.5600 0.6668 0.1004  0.0804  0.0447  324 LYS A CB  
525  C CG  . LYS A 64  ? 0.7176 0.5069 0.6399 0.0959  0.0750  0.0366  324 LYS A CG  
526  N N   . ALA A 65  ? 0.6070 0.5172 0.5772 0.0971  0.0856  0.0574  325 ALA A N   
527  C CA  . ALA A 65  ? 0.5630 0.5066 0.5483 0.1042  0.0887  0.0636  325 ALA A CA  
528  C C   . ALA A 65  ? 0.6450 0.6129 0.6423 0.0960  0.0902  0.0623  325 ALA A C   
529  O O   . ALA A 65  ? 0.6651 0.6544 0.6715 0.1041  0.0956  0.0659  325 ALA A O   
530  C CB  . ALA A 65  ? 0.5395 0.4974 0.5349 0.1023  0.0843  0.0707  325 ALA A CB  
531  N N   . VAL A 66  ? 0.6305 0.5958 0.6290 0.0802  0.0856  0.0580  326 VAL A N   
532  C CA  . VAL A 66  ? 0.6053 0.5900 0.6143 0.0717  0.0860  0.0572  326 VAL A CA  
533  C C   . VAL A 66  ? 0.6361 0.6097 0.6326 0.0778  0.0922  0.0529  326 VAL A C   
534  O O   . VAL A 66  ? 0.6145 0.6078 0.6189 0.0817  0.0980  0.0568  326 VAL A O   
535  C CB  . VAL A 66  ? 0.5410 0.5258 0.5538 0.0549  0.0785  0.0534  326 VAL A CB  
536  C CG1 . VAL A 66  ? 0.5012 0.4961 0.5196 0.0466  0.0782  0.0510  326 VAL A CG1 
537  C CG2 . VAL A 66  ? 0.5153 0.5178 0.5408 0.0516  0.0729  0.0581  326 VAL A CG2 
538  N N   . SER A 67  ? 0.6730 0.6157 0.6504 0.0797  0.0911  0.0454  327 SER A N   
539  C CA  . SER A 67  ? 0.6352 0.5644 0.5971 0.0859  0.0949  0.0394  327 SER A CA  
540  C C   . SER A 67  ? 0.6971 0.6355 0.6558 0.1047  0.1039  0.0436  327 SER A C   
541  O O   . SER A 67  ? 0.7237 0.6741 0.6809 0.1095  0.1104  0.0449  327 SER A O   
542  C CB  . SER A 67  ? 0.6015 0.4947 0.5450 0.0848  0.0896  0.0297  327 SER A CB  
543  O OG  . SER A 67  ? 0.6301 0.5188 0.5789 0.0677  0.0823  0.0266  327 SER A OG  
544  N N   . GLU A 68  ? 0.7329 0.6671 0.6909 0.1159  0.1047  0.0465  328 GLU A N   
545  C CA  . GLU A 68  ? 0.7613 0.7088 0.7192 0.1351  0.1133  0.0512  328 GLU A CA  
546  C C   . GLU A 68  ? 0.7742 0.7636 0.7564 0.1334  0.1189  0.0612  328 GLU A C   
547  O O   . GLU A 68  ? 0.7784 0.7843 0.7621 0.1467  0.1282  0.0654  328 GLU A O   
548  C CB  . GLU A 68  ? 0.7965 0.7319 0.7508 0.1468  0.1114  0.0530  328 GLU A CB  
549  C CG  . GLU A 68  ? 0.9276 0.8200 0.8574 0.1534  0.1073  0.0437  328 GLU A CG  
550  C CD  . GLU A 68  ? 1.0988 0.9745 1.0255 0.1618  0.1038  0.0466  328 GLU A CD  
551  O OE1 . GLU A 68  ? 1.1949 1.0430 1.1033 0.1769  0.1035  0.0413  328 GLU A OE1 
552  O OE2 . GLU A 68  ? 1.1024 0.9910 1.0433 0.1543  0.1008  0.0540  328 GLU A OE2 
553  N N   . GLY A 69  ? 0.6556 0.6114 0.7209 0.0338  0.1882  0.0458  329 GLY A N   
554  C CA  . GLY A 69  ? 0.6419 0.6216 0.7333 0.0369  0.1839  0.0596  329 GLY A CA  
555  C C   . GLY A 69  ? 0.6733 0.6574 0.7476 0.0301  0.1791  0.0569  329 GLY A C   
556  O O   . GLY A 69  ? 0.6880 0.6887 0.7841 0.0314  0.1791  0.0678  329 GLY A O   
557  N N   . LEU A 70  ? 0.6603 0.6305 0.6977 0.0227  0.1742  0.0437  330 LEU A N   
558  C CA  . LEU A 70  ? 0.6652 0.6386 0.6843 0.0172  0.1676  0.0430  330 LEU A CA  
559  C C   . LEU A 70  ? 0.6890 0.6555 0.7056 0.0211  0.1892  0.0465  330 LEU A C   
560  O O   . LEU A 70  ? 0.7540 0.7085 0.7740 0.0273  0.2093  0.0448  330 LEU A O   
561  C CB  . LEU A 70  ? 0.6469 0.6083 0.6279 0.0096  0.1575  0.0294  330 LEU A CB  
562  C CG  . LEU A 70  ? 0.6325 0.6012 0.6153 0.0055  0.1384  0.0256  330 LEU A CG  
563  C CD1 . LEU A 70  ? 0.6428 0.6028 0.5931 -0.0018 0.1297  0.0129  330 LEU A CD1 
564  C CD2 . LEU A 70  ? 0.5715 0.5598 0.5737 0.0056  0.1225  0.0355  330 LEU A CD2 
565  N N   . HIS A 71  ? 0.6847 0.6567 0.6950 0.0180  0.1869  0.0516  331 HIS A N   
566  C CA  . HIS A 71  ? 0.6990 0.6660 0.7083 0.0215  0.2092  0.0574  331 HIS A CA  
567  C C   . HIS A 71  ? 0.7691 0.7087 0.7401 0.0235  0.2292  0.0454  331 HIS A C   
568  O O   . HIS A 71  ? 0.8109 0.7356 0.7407 0.0178  0.2213  0.0336  331 HIS A O   
569  C CB  . HIS A 71  ? 0.6698 0.6425 0.6707 0.0161  0.2019  0.0640  331 HIS A CB  
570  C CG  . HIS A 71  ? 0.6605 0.6384 0.6801 0.0190  0.2221  0.0763  331 HIS A CG  
571  N ND1 . HIS A 71  ? 0.6886 0.6500 0.6891 0.0239  0.2489  0.0746  331 HIS A ND1 
572  C CD2 . HIS A 71  ? 0.6009 0.5983 0.6566 0.0168  0.2198  0.0905  331 HIS A CD2 
573  C CE1 . HIS A 71  ? 0.6550 0.6274 0.6817 0.0255  0.2640  0.0885  331 HIS A CE1 
574  N NE2 . HIS A 71  ? 0.6260 0.6211 0.6880 0.0204  0.2459  0.0983  331 HIS A NE2 
575  N N   . PRO A 72  ? 0.8036 0.7361 0.7875 0.0318  0.2552  0.0482  332 PRO A N   
576  C CA  . PRO A 72  ? 0.8576 0.7589 0.8016 0.0339  0.2758  0.0343  332 PRO A CA  
577  C C   . PRO A 72  ? 0.8938 0.7783 0.7902 0.0302  0.2842  0.0296  332 PRO A C   
578  O O   . PRO A 72  ? 0.9236 0.7800 0.7758 0.0289  0.2947  0.0148  332 PRO A O   
579  C CB  . PRO A 72  ? 0.8092 0.7092 0.7857 0.0461  0.3038  0.0414  332 PRO A CB  
580  C CG  . PRO A 72  ? 0.7804 0.7133 0.8076 0.0490  0.3011  0.0614  332 PRO A CG  
581  C CD  . PRO A 72  ? 0.7768 0.7292 0.8125 0.0399  0.2675  0.0639  332 PRO A CD  
582  N N   . ASP A 73  ? 0.8601 0.7593 0.7629 0.0281  0.2798  0.0420  333 ASP A N   
583  C CA  . ASP A 73  ? 0.9216 0.8050 0.7798 0.0258  0.2890  0.0412  333 ASP A CA  
584  C C   . ASP A 73  ? 0.9631 0.8377 0.7758 0.0172  0.2651  0.0310  333 ASP A C   
585  O O   . ASP A 73  ? 1.0590 0.9191 0.8286 0.0154  0.2698  0.0302  333 ASP A O   
586  C CB  . ASP A 73  ? 0.9098 0.8100 0.7926 0.0263  0.2948  0.0599  333 ASP A CB  
587  C CG  . ASP A 73  ? 0.9325 0.8398 0.8529 0.0347  0.3244  0.0710  333 ASP A CG  
588  O OD1 . ASP A 73  ? 0.9797 0.8750 0.9018 0.0423  0.3443  0.0642  333 ASP A OD1 
589  O OD2 . ASP A 73  ? 0.9080 0.8332 0.8587 0.0336  0.3283  0.0871  333 ASP A OD2 
590  N N   . ALA A 74  ? 0.8798 0.7644 0.7025 0.0125  0.2397  0.0249  334 ALA A N   
591  C CA  . ALA A 74  ? 0.8341 0.7128 0.6180 0.0049  0.2172  0.0145  334 ALA A CA  
592  C C   . ALA A 74  ? 0.8358 0.7101 0.6185 0.0007  0.2064  -0.0005 334 ALA A C   
593  O O   . ALA A 74  ? 0.8227 0.7032 0.6405 0.0037  0.2102  0.0003  334 ALA A O   
594  C CB  . ALA A 74  ? 0.7484 0.6470 0.5457 0.0023  0.1944  0.0251  334 ALA A CB  
595  N N   . LYS A 75  ? 0.8542 0.7181 0.5967 -0.0068 0.1926  -0.0133 335 LYS A N   
596  C CA  . LYS A 75  ? 0.8173 0.6811 0.5615 -0.0137 0.1777  -0.0264 335 LYS A CA  
597  C C   . LYS A 75  ? 0.7801 0.6693 0.5428 -0.0169 0.1499  -0.0206 335 LYS A C   
598  O O   . LYS A 75  ? 0.7810 0.6780 0.5291 -0.0173 0.1376  -0.0142 335 LYS A O   
599  C CB  . LYS A 75  ? 0.8285 0.6671 0.5235 -0.0218 0.1785  -0.0454 335 LYS A CB  
600  C CG  . LYS A 75  ? 0.9566 0.7809 0.5993 -0.0234 0.1806  -0.0475 335 LYS A CG  
601  C CD  . LYS A 75  ? 1.0219 0.8199 0.6131 -0.0335 0.1788  -0.0689 335 LYS A CD  
602  C CE  . LYS A 75  ? 1.1131 0.8776 0.6831 -0.0302 0.2102  -0.0794 335 LYS A CE  
603  N NZ  . LYS A 75  ? 1.2360 0.9698 0.7365 -0.0371 0.2138  -0.0954 335 LYS A NZ  
604  N N   . TYR A 76  ? 0.7141 0.6146 0.5088 -0.0181 0.1418  -0.0221 336 TYR A N   
605  C CA  . TYR A 76  ? 0.6698 0.5935 0.4865 -0.0192 0.1200  -0.0160 336 TYR A CA  
606  C C   . TYR A 76  ? 0.6982 0.6243 0.5108 -0.0276 0.1059  -0.0280 336 TYR A C   
607  O O   . TYR A 76  ? 0.7647 0.6771 0.5756 -0.0314 0.1145  -0.0382 336 TYR A O   
608  C CB  . TYR A 76  ? 0.5884 0.5257 0.4480 -0.0131 0.1231  -0.0049 336 TYR A CB  
609  C CG  . TYR A 76  ? 0.6130 0.5546 0.4843 -0.0070 0.1322  0.0086  336 TYR A CG  
610  C CD1 . TYR A 76  ? 0.6000 0.5532 0.4747 -0.0064 0.1199  0.0178  336 TYR A CD1 
611  C CD2 . TYR A 76  ? 0.6243 0.5576 0.5048 -0.0020 0.1540  0.0123  336 TYR A CD2 
612  C CE1 . TYR A 76  ? 0.6250 0.5812 0.5119 -0.0030 0.1280  0.0299  336 TYR A CE1 
613  C CE2 . TYR A 76  ? 0.6510 0.5911 0.5469 0.0022  0.1625  0.0255  336 TYR A CE2 
614  C CZ  . TYR A 76  ? 0.6547 0.6058 0.5534 0.0006  0.1490  0.0340  336 TYR A CZ  
615  O OH  . TYR A 76  ? 0.6618 0.6183 0.5768 0.0027  0.1577  0.0469  336 TYR A OH  
616  N N   . ALA A 77  ? 0.6628 0.6059 0.4756 -0.0302 0.0851  -0.0262 337 ALA A N   
617  C CA  . ALA A 77  ? 0.6403 0.5923 0.4577 -0.0383 0.0705  -0.0352 337 ALA A CA  
618  C C   . ALA A 77  ? 0.6568 0.6284 0.5109 -0.0343 0.0633  -0.0268 337 ALA A C   
619  O O   . ALA A 77  ? 0.6553 0.6379 0.5194 -0.0274 0.0584  -0.0156 337 ALA A O   
620  C CB  . ALA A 77  ? 0.6063 0.5662 0.3988 -0.0432 0.0522  -0.0383 337 ALA A CB  
621  N N   . LYS A 78  ? 0.6304 0.6038 0.5021 -0.0389 0.0637  -0.0324 338 LYS A N   
622  C CA  . LYS A 78  ? 0.6192 0.6102 0.5201 -0.0359 0.0568  -0.0257 338 LYS A CA  
623  C C   . LYS A 78  ? 0.6310 0.6411 0.5319 -0.0384 0.0386  -0.0259 338 LYS A C   
624  O O   . LYS A 78  ? 0.6201 0.6329 0.5120 -0.0474 0.0307  -0.0351 338 LYS A O   
625  C CB  . LYS A 78  ? 0.6012 0.5875 0.5188 -0.0403 0.0638  -0.0303 338 LYS A CB  
626  C CG  . LYS A 78  ? 0.7098 0.7133 0.6539 -0.0365 0.0582  -0.0224 338 LYS A CG  
627  C CD  . LYS A 78  ? 0.6832 0.6867 0.6412 -0.0439 0.0606  -0.0276 338 LYS A CD  
628  C CE  . LYS A 78  ? 0.6737 0.6868 0.6276 -0.0551 0.0491  -0.0372 338 LYS A CE  
629  N NZ  . LYS A 78  ? 0.7146 0.7278 0.6859 -0.0632 0.0531  -0.0409 338 LYS A NZ  
630  N N   . VAL A 79  ? 0.5877 0.6112 0.5004 -0.0305 0.0318  -0.0159 339 VAL A N   
631  C CA  . VAL A 79  ? 0.5653 0.6077 0.4825 -0.0296 0.0163  -0.0138 339 VAL A CA  
632  C C   . VAL A 79  ? 0.5810 0.6379 0.5248 -0.0303 0.0142  -0.0137 339 VAL A C   
633  O O   . VAL A 79  ? 0.6013 0.6732 0.5529 -0.0354 0.0049  -0.0176 339 VAL A O   
634  C CB  . VAL A 79  ? 0.5570 0.6022 0.4714 -0.0199 0.0119  -0.0031 339 VAL A CB  
635  C CG1 . VAL A 79  ? 0.5373 0.6023 0.4612 -0.0164 -0.0027 0.0003  339 VAL A CG1 
636  C CG2 . VAL A 79  ? 0.6368 0.6677 0.5233 -0.0194 0.0152  -0.0013 339 VAL A CG2 
637  N N   . LYS A 80  ? 0.5547 0.6081 0.5124 -0.0251 0.0226  -0.0088 340 LYS A N   
638  C CA  . LYS A 80  ? 0.5165 0.5813 0.4954 -0.0248 0.0230  -0.0077 340 LYS A CA  
639  C C   . LYS A 80  ? 0.4995 0.5541 0.4859 -0.0219 0.0342  -0.0040 340 LYS A C   
640  O O   . LYS A 80  ? 0.4743 0.5193 0.4556 -0.0170 0.0381  0.0008  340 LYS A O   
641  C CB  . LYS A 80  ? 0.5387 0.6190 0.5259 -0.0168 0.0142  -0.0018 340 LYS A CB  
642  C CG  . LYS A 80  ? 0.5438 0.6348 0.5501 -0.0139 0.0170  0.0005  340 LYS A CG  
643  C CD  . LYS A 80  ? 0.5443 0.6467 0.5657 -0.0230 0.0181  -0.0046 340 LYS A CD  
644  C CE  . LYS A 80  ? 0.5843 0.7091 0.6165 -0.0248 0.0065  -0.0057 340 LYS A CE  
645  N NZ  . LYS A 80  ? 0.6260 0.7674 0.6841 -0.0301 0.0103  -0.0067 340 LYS A NZ  
646  N N   . LEU A 81  ? 0.4836 0.5409 0.4830 -0.0257 0.0391  -0.0054 341 LEU A N   
647  C CA  . LEU A 81  ? 0.5036 0.5533 0.5098 -0.0222 0.0483  0.0000  341 LEU A CA  
648  C C   . LEU A 81  ? 0.5467 0.6086 0.5643 -0.0194 0.0475  0.0034  341 LEU A C   
649  O O   . LEU A 81  ? 0.6046 0.6788 0.6322 -0.0244 0.0454  -0.0001 341 LEU A O   
650  C CB  . LEU A 81  ? 0.5056 0.5419 0.5139 -0.0289 0.0586  -0.0037 341 LEU A CB  
651  C CG  . LEU A 81  ? 0.4898 0.5180 0.5056 -0.0251 0.0681  0.0036  341 LEU A CG  
652  C CD1 . LEU A 81  ? 0.4241 0.4335 0.4399 -0.0290 0.0797  0.0012  341 LEU A CD1 
653  C CD2 . LEU A 81  ? 0.3998 0.4380 0.4264 -0.0260 0.0694  0.0064  341 LEU A CD2 
654  N N   . ILE A 82  ? 0.4929 0.5523 0.5089 -0.0117 0.0491  0.0101  342 ILE A N   
655  C CA  . ILE A 82  ? 0.5197 0.5872 0.5421 -0.0083 0.0517  0.0130  342 ILE A CA  
656  C C   . ILE A 82  ? 0.5331 0.5902 0.5500 -0.0042 0.0578  0.0197  342 ILE A C   
657  O O   . ILE A 82  ? 0.5403 0.5892 0.5492 -0.0007 0.0547  0.0231  342 ILE A O   
658  C CB  . ILE A 82  ? 0.4821 0.5591 0.5031 -0.0014 0.0446  0.0132  342 ILE A CB  
659  C CG1 . ILE A 82  ? 0.4916 0.5774 0.5202 0.0025  0.0505  0.0152  342 ILE A CG1 
660  C CG2 . ILE A 82  ? 0.4091 0.4755 0.4166 0.0046  0.0398  0.0159  342 ILE A CG2 
661  C CD1 . ILE A 82  ? 0.4206 0.5229 0.4697 -0.0041 0.0544  0.0131  342 ILE A CD1 
662  N N   . ARG A 83  ? 0.5039 0.5626 0.5258 -0.0048 0.0661  0.0227  343 ARG A N   
663  C CA  . ARG A 83  ? 0.5022 0.5506 0.5153 -0.0006 0.0713  0.0306  343 ARG A CA  
664  C C   . ARG A 83  ? 0.5385 0.5906 0.5491 0.0026  0.0784  0.0339  343 ARG A C   
665  O O   . ARG A 83  ? 0.6083 0.6701 0.6326 -0.0014 0.0851  0.0320  343 ARG A O   
666  C CB  . ARG A 83  ? 0.5333 0.5713 0.5520 -0.0050 0.0790  0.0339  343 ARG A CB  
667  C CG  . ARG A 83  ? 0.5893 0.6171 0.5991 0.0007  0.0823  0.0444  343 ARG A CG  
668  C CD  . ARG A 83  ? 0.6052 0.6209 0.6223 -0.0013 0.0896  0.0487  343 ARG A CD  
669  N NE  . ARG A 83  ? 0.6289 0.6408 0.6573 -0.0097 0.1001  0.0448  343 ARG A NE  
670  C CZ  . ARG A 83  ? 0.6293 0.6380 0.6605 -0.0116 0.1102  0.0502  343 ARG A CZ  
671  N NH1 . ARG A 83  ? 0.6135 0.6218 0.6328 -0.0045 0.1117  0.0599  343 ARG A NH1 
672  N NH2 . ARG A 83  ? 0.6107 0.6154 0.6551 -0.0216 0.1192  0.0458  343 ARG A NH2 
673  N N   . LEU A 84  ? 0.5353 0.5799 0.5281 0.0095  0.0772  0.0389  344 LEU A N   
674  C CA  . LEU A 84  ? 0.5220 0.5650 0.5049 0.0136  0.0865  0.0434  344 LEU A CA  
675  C C   . LEU A 84  ? 0.5696 0.5997 0.5379 0.0157  0.0876  0.0528  344 LEU A C   
676  O O   . LEU A 84  ? 0.5462 0.5702 0.4991 0.0195  0.0774  0.0547  344 LEU A O   
677  C CB  . LEU A 84  ? 0.5061 0.5493 0.4743 0.0207  0.0829  0.0394  344 LEU A CB  
678  C CG  . LEU A 84  ? 0.5293 0.5662 0.4782 0.0268  0.0930  0.0429  344 LEU A CG  
679  C CD1 . LEU A 84  ? 0.4888 0.5366 0.4552 0.0251  0.1091  0.0451  344 LEU A CD1 
680  C CD2 . LEU A 84  ? 0.5239 0.5551 0.4546 0.0339  0.0885  0.0367  344 LEU A CD2 
681  N N   . VAL A 85  ? 0.5734 0.6000 0.5489 0.0126  0.0993  0.0592  345 VAL A N   
682  C CA  . VAL A 85  ? 0.5845 0.5986 0.5493 0.0154  0.1017  0.0708  345 VAL A CA  
683  C C   . VAL A 85  ? 0.5817 0.5926 0.5498 0.0164  0.0901  0.0724  345 VAL A C   
684  O O   . VAL A 85  ? 0.5380 0.5478 0.5239 0.0120  0.0927  0.0702  345 VAL A O   
685  C CB  . VAL A 85  ? 0.5235 0.5309 0.4597 0.0224  0.1038  0.0778  345 VAL A CB  
686  C CG1 . VAL A 85  ? 0.5228 0.5184 0.4478 0.0257  0.1057  0.0922  345 VAL A CG1 
687  C CG2 . VAL A 85  ? 0.4659 0.4776 0.4032 0.0218  0.1193  0.0765  345 VAL A CG2 
688  N N   . GLY A 86  ? 0.6062 0.6159 0.5582 0.0215  0.0779  0.0754  346 GLY A N   
689  C CA  . GLY A 86  ? 0.5623 0.5722 0.5214 0.0229  0.0677  0.0795  346 GLY A CA  
690  C C   . GLY A 86  ? 0.5746 0.5916 0.5390 0.0209  0.0564  0.0706  346 GLY A C   
691  O O   . GLY A 86  ? 0.5786 0.5982 0.5512 0.0217  0.0484  0.0742  346 GLY A O   
692  N N   . ILE A 87  ? 0.5766 0.5974 0.5390 0.0186  0.0568  0.0602  347 ILE A N   
693  C CA  . ILE A 87  ? 0.5720 0.5969 0.5355 0.0173  0.0468  0.0524  347 ILE A CA  
694  C C   . ILE A 87  ? 0.5680 0.5981 0.5482 0.0131  0.0510  0.0455  347 ILE A C   
695  O O   . ILE A 87  ? 0.5988 0.6332 0.5820 0.0116  0.0566  0.0404  347 ILE A O   
696  C CB  . ILE A 87  ? 0.5907 0.6135 0.5365 0.0198  0.0439  0.0466  347 ILE A CB  
697  C CG1 . ILE A 87  ? 0.6385 0.6532 0.5602 0.0235  0.0420  0.0519  347 ILE A CG1 
698  C CG2 . ILE A 87  ? 0.5527 0.5753 0.4982 0.0187  0.0334  0.0406  347 ILE A CG2 
699  C CD1 . ILE A 87  ? 0.6691 0.6767 0.5684 0.0266  0.0410  0.0448  347 ILE A CD1 
700  N N   . MET A 88  ? 0.5388 0.5694 0.5295 0.0112  0.0485  0.0456  348 MET A N   
701  C CA  . MET A 88  ? 0.5331 0.5658 0.5336 0.0068  0.0525  0.0391  348 MET A CA  
702  C C   . MET A 88  ? 0.5292 0.5636 0.5299 0.0064  0.0453  0.0363  348 MET A C   
703  O O   . MET A 88  ? 0.5535 0.5870 0.5554 0.0080  0.0401  0.0411  348 MET A O   
704  C CB  . MET A 88  ? 0.5211 0.5477 0.5317 0.0048  0.0615  0.0416  348 MET A CB  
705  C CG  . MET A 88  ? 0.4653 0.4910 0.4805 -0.0015 0.0665  0.0328  348 MET A CG  
706  S SD  . MET A 88  ? 0.6145 0.6260 0.6379 -0.0039 0.0796  0.0341  348 MET A SD  
707  C CE  . MET A 88  ? 0.4324 0.4421 0.4603 0.0028  0.0781  0.0413  348 MET A CE  
708  N N   . LEU A 89  ? 0.5267 0.5645 0.5273 0.0040  0.0447  0.0295  349 LEU A N   
709  C CA  . LEU A 89  ? 0.5264 0.5642 0.5251 0.0035  0.0395  0.0276  349 LEU A CA  
710  C C   . LEU A 89  ? 0.5301 0.5680 0.5298 -0.0007 0.0436  0.0224  349 LEU A C   
711  O O   . LEU A 89  ? 0.5292 0.5715 0.5300 -0.0038 0.0450  0.0175  349 LEU A O   
712  C CB  . LEU A 89  ? 0.5019 0.5418 0.4935 0.0064  0.0324  0.0253  349 LEU A CB  
713  C CG  . LEU A 89  ? 0.4942 0.5310 0.4825 0.0065  0.0272  0.0255  349 LEU A CG  
714  C CD1 . LEU A 89  ? 0.5125 0.5449 0.5043 0.0053  0.0255  0.0306  349 LEU A CD1 
715  C CD2 . LEU A 89  ? 0.4079 0.4432 0.3896 0.0106  0.0219  0.0238  349 LEU A CD2 
716  N N   . LEU A 90  ? 0.5231 0.5562 0.5221 -0.0015 0.0456  0.0234  350 LEU A N   
717  C CA  . LEU A 90  ? 0.5096 0.5387 0.5029 -0.0056 0.0501  0.0178  350 LEU A CA  
718  C C   . LEU A 90  ? 0.4894 0.5185 0.4732 -0.0048 0.0452  0.0182  350 LEU A C   
719  O O   . LEU A 90  ? 0.4475 0.4754 0.4340 -0.0021 0.0436  0.0241  350 LEU A O   
720  C CB  . LEU A 90  ? 0.4932 0.5130 0.4912 -0.0058 0.0612  0.0194  350 LEU A CB  
721  C CG  . LEU A 90  ? 0.5602 0.5767 0.5682 -0.0049 0.0674  0.0222  350 LEU A CG  
722  C CD1 . LEU A 90  ? 0.5759 0.5821 0.5902 -0.0028 0.0793  0.0248  350 LEU A CD1 
723  C CD2 . LEU A 90  ? 0.6021 0.6180 0.6080 -0.0105 0.0688  0.0152  350 LEU A CD2 
724  N N   . LEU A 91  ? 0.4803 0.5110 0.4534 -0.0076 0.0420  0.0128  351 LEU A N   
725  C CA  . LEU A 91  ? 0.4838 0.5122 0.4444 -0.0064 0.0385  0.0147  351 LEU A CA  
726  C C   . LEU A 91  ? 0.5585 0.5791 0.5036 -0.0109 0.0440  0.0093  351 LEU A C   
727  O O   . LEU A 91  ? 0.5730 0.5955 0.5126 -0.0162 0.0417  0.0015  351 LEU A O   
728  C CB  . LEU A 91  ? 0.4750 0.5125 0.4331 -0.0038 0.0274  0.0151  351 LEU A CB  
729  C CG  . LEU A 91  ? 0.5195 0.5542 0.4626 -0.0017 0.0225  0.0185  351 LEU A CG  
730  C CD1 . LEU A 91  ? 0.4595 0.4858 0.4035 0.0020  0.0245  0.0262  351 LEU A CD1 
731  C CD2 . LEU A 91  ? 0.5049 0.5519 0.4485 0.0014  0.0113  0.0183  351 LEU A CD2 
732  N N   . TYR A 92  ? 0.5660 0.5773 0.5043 -0.0096 0.0520  0.0130  352 TYR A N   
733  C CA  . TYR A 92  ? 0.5718 0.5720 0.4890 -0.0127 0.0594  0.0082  352 TYR A CA  
734  C C   . TYR A 92  ? 0.5875 0.5844 0.4885 -0.0102 0.0578  0.0145  352 TYR A C   
735  O O   . TYR A 92  ? 0.5840 0.5830 0.4960 -0.0065 0.0573  0.0236  352 TYR A O   
736  C CB  . TYR A 92  ? 0.5453 0.5344 0.4678 -0.0119 0.0762  0.0082  352 TYR A CB  
737  C CG  . TYR A 92  ? 0.5744 0.5619 0.5137 -0.0123 0.0822  0.0056  352 TYR A CG  
738  C CD1 . TYR A 92  ? 0.5635 0.5379 0.4928 -0.0165 0.0909  -0.0041 352 TYR A CD1 
739  C CD2 . TYR A 92  ? 0.5588 0.5550 0.5222 -0.0084 0.0803  0.0133  352 TYR A CD2 
740  C CE1 . TYR A 92  ? 0.5536 0.5231 0.4986 -0.0162 0.0984  -0.0050 352 TYR A CE1 
741  C CE2 . TYR A 92  ? 0.5288 0.5221 0.5063 -0.0075 0.0867  0.0133  352 TYR A CE2 
742  C CZ  . TYR A 92  ? 0.5591 0.5387 0.5284 -0.0109 0.0964  0.0048  352 TYR A CZ  
743  O OH  . TYR A 92  ? 0.5939 0.5672 0.5768 -0.0095 0.1043  0.0059  352 TYR A OH  
744  N N   . VAL A 93  ? 0.5738 0.5636 0.4474 -0.0130 0.0574  0.0099  353 VAL A N   
745  C CA  . VAL A 93  ? 0.5902 0.5732 0.4429 -0.0106 0.0590  0.0167  353 VAL A CA  
746  C C   . VAL A 93  ? 0.6561 0.6225 0.4809 -0.0135 0.0724  0.0106  353 VAL A C   
747  O O   . VAL A 93  ? 0.6630 0.6239 0.4788 -0.0187 0.0741  -0.0012 353 VAL A O   
748  C CB  . VAL A 93  ? 0.6058 0.5964 0.4437 -0.0095 0.0417  0.0189  353 VAL A CB  
749  C CG1 . VAL A 93  ? 0.5928 0.5967 0.4554 -0.0049 0.0308  0.0246  353 VAL A CG1 
750  C CG2 . VAL A 93  ? 0.6003 0.5939 0.4205 -0.0158 0.0328  0.0076  353 VAL A CG2 
751  N N   . LYS A 94  ? 0.6551 0.6115 0.4651 -0.0106 0.0832  0.0183  354 LYS A N   
752  C CA  . LYS A 94  ? 0.7174 0.6559 0.4941 -0.0125 0.0967  0.0125  354 LYS A CA  
753  C C   . LYS A 94  ? 0.7413 0.6775 0.4841 -0.0181 0.0821  0.0022  354 LYS A C   
754  O O   . LYS A 94  ? 0.6771 0.6253 0.4165 -0.0177 0.0632  0.0063  354 LYS A O   
755  C CB  . LYS A 94  ? 0.7542 0.6836 0.5160 -0.0085 0.1087  0.0244  354 LYS A CB  
756  C CG  . LYS A 94  ? 0.7112 0.6423 0.5043 -0.0048 0.1256  0.0346  354 LYS A CG  
757  C CD  . LYS A 94  ? 0.6745 0.5966 0.4504 -0.0023 0.1367  0.0471  354 LYS A CD  
758  C CE  . LYS A 94  ? 0.6756 0.5998 0.4828 -0.0001 0.1569  0.0568  354 LYS A CE  
759  N NZ  . LYS A 94  ? 0.7283 0.6452 0.5247 0.0011  0.1682  0.0707  354 LYS A NZ  
760  N N   . GLN A 95  ? 0.7795 0.6994 0.4967 -0.0233 0.0908  -0.0110 355 GLN A N   
761  C CA  . GLN A 95  ? 0.8053 0.7233 0.4910 -0.0315 0.0749  -0.0231 355 GLN A CA  
762  C C   . GLN A 95  ? 0.8583 0.7805 0.5140 -0.0297 0.0602  -0.0149 355 GLN A C   
763  O O   . GLN A 95  ? 0.8610 0.7968 0.5109 -0.0337 0.0379  -0.0176 355 GLN A O   
764  C CB  . GLN A 95  ? 0.8664 0.7590 0.5205 -0.0376 0.0895  -0.0390 355 GLN A CB  
765  C CG  . GLN A 95  ? 1.0001 0.8904 0.6261 -0.0496 0.0716  -0.0549 355 GLN A CG  
766  C CD  . GLN A 95  ? 1.0589 0.9696 0.7218 -0.0558 0.0552  -0.0598 355 GLN A CD  
767  O OE1 . GLN A 95  ? 1.0861 0.9911 0.7730 -0.0579 0.0660  -0.0661 355 GLN A OE1 
768  N NE2 . GLN A 95  ? 1.0592 0.9938 0.7276 -0.0581 0.0301  -0.0557 355 GLN A NE2 
769  N N   . GLU A 96  ? 0.9081 0.8196 0.5472 -0.0233 0.0729  -0.0034 356 GLU A N   
770  C CA  . GLU A 96  ? 0.9029 0.8140 0.5094 -0.0204 0.0618  0.0067  356 GLU A CA  
771  C C   . GLU A 96  ? 0.8983 0.8312 0.5317 -0.0151 0.0424  0.0194  356 GLU A C   
772  O O   . GLU A 96  ? 0.9162 0.8522 0.5264 -0.0123 0.0282  0.0274  356 GLU A O   
773  C CB  . GLU A 96  ? 0.9952 0.8875 0.5801 -0.0148 0.0842  0.0176  356 GLU A CB  
774  C CG  . GLU A 96  ? 1.0858 0.9844 0.7137 -0.0084 0.0966  0.0319  356 GLU A CG  
775  C CD  . GLU A 96  ? 1.1834 1.0646 0.8013 -0.0053 0.1254  0.0390  356 GLU A CD  
776  O OE1 . GLU A 96  ? 1.2217 1.1004 0.8369 -0.0010 0.1299  0.0553  356 GLU A OE1 
777  O OE2 . GLU A 96  ? 1.1974 1.0669 0.8117 -0.0067 0.1446  0.0290  356 GLU A OE2 
778  N N   . HIS A 97  ? 0.8457 0.7920 0.5260 -0.0127 0.0423  0.0219  357 HIS A N   
779  C CA  . HIS A 97  ? 0.8004 0.7646 0.5060 -0.0070 0.0259  0.0322  357 HIS A CA  
780  C C   . HIS A 97  ? 0.7841 0.7689 0.5062 -0.0105 0.0060  0.0239  357 HIS A C   
781  O O   . HIS A 97  ? 0.8136 0.8137 0.5506 -0.0049 -0.0086 0.0318  357 HIS A O   
782  C CB  . HIS A 97  ? 0.7797 0.7463 0.5242 -0.0029 0.0356  0.0391  357 HIS A CB  
783  C CG  . HIS A 97  ? 0.7896 0.7411 0.5295 -0.0001 0.0539  0.0496  357 HIS A CG  
784  N ND1 . HIS A 97  ? 0.8258 0.7650 0.5336 0.0029  0.0572  0.0600  357 HIS A ND1 
785  C CD2 . HIS A 97  ? 0.7722 0.7207 0.5381 -0.0001 0.0694  0.0527  357 HIS A CD2 
786  C CE1 . HIS A 97  ? 0.8275 0.7562 0.5432 0.0040  0.0759  0.0687  357 HIS A CE1 
787  N NE2 . HIS A 97  ? 0.8028 0.7385 0.5554 0.0020  0.0827  0.0644  357 HIS A NE2 
788  N N   . ALA A 98  ? 0.7497 0.7341 0.4710 -0.0194 0.0073  0.0086  358 ALA A N   
789  C CA  . ALA A 98  ? 0.6887 0.6929 0.4323 -0.0248 -0.0079 0.0001  358 ALA A CA  
790  C C   . ALA A 98  ? 0.7199 0.7437 0.4587 -0.0231 -0.0315 0.0053  358 ALA A C   
791  O O   . ALA A 98  ? 0.7928 0.8378 0.5638 -0.0201 -0.0421 0.0085  358 ALA A O   
792  C CB  . ALA A 98  ? 0.6403 0.6350 0.3730 -0.0368 -0.0030 -0.0176 358 ALA A CB  
793  N N   . ALA A 99  ? 0.6871 0.7041 0.3860 -0.0238 -0.0392 0.0076  359 ALA A N   
794  C CA  . ALA A 99  ? 0.6788 0.7160 0.3713 -0.0217 -0.0639 0.0139  359 ALA A CA  
795  C C   . ALA A 99  ? 0.7017 0.7510 0.4182 -0.0074 -0.0692 0.0320  359 ALA A C   
796  O O   . ALA A 99  ? 0.7194 0.7909 0.4459 -0.0032 -0.0889 0.0387  359 ALA A O   
797  C CB  . ALA A 99  ? 0.6432 0.6671 0.2809 -0.0247 -0.0704 0.0141  359 ALA A CB  
798  N N   . TYR A 100 ? 0.6523 0.6868 0.3790 -0.0001 -0.0518 0.0400  360 TYR A N   
799  C CA  . TYR A 100 ? 0.6717 0.7101 0.4156 0.0128  -0.0546 0.0562  360 TYR A CA  
800  C C   . TYR A 100 ? 0.7177 0.7666 0.5059 0.0161  -0.0509 0.0545  360 TYR A C   
801  O O   . TYR A 100 ? 0.7410 0.7894 0.5451 0.0265  -0.0509 0.0655  360 TYR A O   
802  C CB  . TYR A 100 ? 0.7035 0.7165 0.4249 0.0178  -0.0395 0.0676  360 TYR A CB  
803  C CG  . TYR A 100 ? 0.7981 0.8004 0.4708 0.0159  -0.0432 0.0708  360 TYR A CG  
804  C CD1 . TYR A 100 ? 0.7972 0.8041 0.4508 0.0241  -0.0588 0.0850  360 TYR A CD1 
805  C CD2 . TYR A 100 ? 0.8662 0.8534 0.5101 0.0064  -0.0314 0.0591  360 TYR A CD2 
806  C CE1 . TYR A 100 ? 0.8887 0.8855 0.4918 0.0220  -0.0637 0.0878  360 TYR A CE1 
807  C CE2 . TYR A 100 ? 0.9606 0.9353 0.5535 0.0041  -0.0340 0.0602  360 TYR A CE2 
808  C CZ  . TYR A 100 ? 0.9974 0.9771 0.5681 0.0114  -0.0509 0.0745  360 TYR A CZ  
809  O OH  . TYR A 100 ? 1.1068 1.0725 0.6208 0.0089  -0.0538 0.0757  360 TYR A OH  
810  N N   . ILE A 101 ? 0.7231 0.7787 0.5285 0.0072  -0.0471 0.0406  361 ILE A N   
811  C CA  . ILE A 101 ? 0.6576 0.7249 0.5016 0.0093  -0.0445 0.0378  361 ILE A CA  
812  C C   . ILE A 101 ? 0.6304 0.7253 0.4947 0.0090  -0.0605 0.0356  361 ILE A C   
813  O O   . ILE A 101 ? 0.6489 0.7539 0.5059 -0.0009 -0.0694 0.0269  361 ILE A O   
814  C CB  . ILE A 101 ? 0.6158 0.6756 0.4690 0.0005  -0.0309 0.0261  361 ILE A CB  
815  C CG1 . ILE A 101 ? 0.6307 0.6676 0.4735 0.0014  -0.0140 0.0292  361 ILE A CG1 
816  C CG2 . ILE A 101 ? 0.5199 0.5930 0.4082 0.0024  -0.0300 0.0238  361 ILE A CG2 
817  C CD1 . ILE A 101 ? 0.5962 0.6282 0.4589 0.0090  -0.0080 0.0377  361 ILE A CD1 
818  N N   . SER A 102 ? 0.5655 0.6726 0.4564 0.0194  -0.0636 0.0432  362 SER A N   
819  C CA  . SER A 102 ? 0.5369 0.6736 0.4540 0.0204  -0.0765 0.0427  362 SER A CA  
820  C C   . SER A 102 ? 0.5445 0.6875 0.4947 0.0286  -0.0685 0.0445  362 SER A C   
821  O O   . SER A 102 ? 0.5436 0.6671 0.4930 0.0334  -0.0557 0.0461  362 SER A O   
822  C CB  . SER A 102 ? 0.5426 0.6935 0.4523 0.0284  -0.0943 0.0543  362 SER A CB  
823  O OG  . SER A 102 ? 0.5633 0.6985 0.4654 0.0425  -0.0902 0.0680  362 SER A OG  
824  N N   . GLU A 103 ? 0.5651 0.7363 0.5441 0.0292  -0.0762 0.0438  363 GLU A N   
825  C CA  . GLU A 103 ? 0.5665 0.7472 0.5769 0.0379  -0.0685 0.0458  363 GLU A CA  
826  C C   . GLU A 103 ? 0.5479 0.7099 0.5583 0.0338  -0.0514 0.0383  363 GLU A C   
827  O O   . GLU A 103 ? 0.5944 0.7440 0.6093 0.0431  -0.0418 0.0413  363 GLU A O   
828  C CB  . GLU A 103 ? 0.6175 0.7936 0.6310 0.0556  -0.0692 0.0586  363 GLU A CB  
829  C CG  . GLU A 103 ? 0.7135 0.9145 0.7366 0.0635  -0.0866 0.0691  363 GLU A CG  
830  C CD  . GLU A 103 ? 0.9523 1.1394 0.9717 0.0819  -0.0851 0.0830  363 GLU A CD  
831  O OE1 . GLU A 103 ? 1.0689 1.2700 1.0884 0.0906  -0.0997 0.0951  363 GLU A OE1 
832  O OE2 . GLU A 103 ? 0.9938 1.1543 1.0088 0.0873  -0.0699 0.0820  363 GLU A OE2 
833  N N   . VAL A 104 ? 0.4957 0.6538 0.4992 0.0198  -0.0481 0.0284  364 VAL A N   
834  C CA  . VAL A 104 ? 0.4922 0.6342 0.4958 0.0155  -0.0333 0.0224  364 VAL A CA  
835  C C   . VAL A 104 ? 0.5036 0.6616 0.5355 0.0170  -0.0278 0.0210  364 VAL A C   
836  O O   . VAL A 104 ? 0.4847 0.6660 0.5356 0.0113  -0.0337 0.0188  364 VAL A O   
837  C CB  . VAL A 104 ? 0.4374 0.5691 0.4258 0.0015  -0.0304 0.0133  364 VAL A CB  
838  C CG1 . VAL A 104 ? 0.3967 0.5149 0.3890 -0.0014 -0.0161 0.0094  364 VAL A CG1 
839  C CG2 . VAL A 104 ? 0.4382 0.5529 0.3964 0.0010  -0.0327 0.0152  364 VAL A CG2 
840  N N   . GLU A 105 ? 0.4699 0.6157 0.5042 0.0241  -0.0166 0.0224  365 GLU A N   
841  C CA  . GLU A 105 ? 0.4340 0.5902 0.4895 0.0262  -0.0075 0.0213  365 GLU A CA  
842  C C   . GLU A 105 ? 0.4229 0.5579 0.4670 0.0249  0.0043  0.0186  365 GLU A C   
843  O O   . GLU A 105 ? 0.4263 0.5413 0.4526 0.0277  0.0051  0.0197  365 GLU A O   
844  C CB  . GLU A 105 ? 0.4101 0.5758 0.4801 0.0409  -0.0068 0.0277  365 GLU A CB  
845  C CG  . GLU A 105 ? 0.4899 0.6814 0.5769 0.0448  -0.0196 0.0333  365 GLU A CG  
846  C CD  . GLU A 105 ? 0.5979 0.8193 0.7107 0.0345  -0.0241 0.0304  365 GLU A CD  
847  O OE1 . GLU A 105 ? 0.5937 0.8157 0.7152 0.0265  -0.0137 0.0252  365 GLU A OE1 
848  O OE2 . GLU A 105 ? 0.6881 0.9325 0.8129 0.0340  -0.0387 0.0341  365 GLU A OE2 
849  N N   . ALA A 106 ? 0.4072 0.5474 0.4625 0.0203  0.0130  0.0159  366 ALA A N   
850  C CA  . ALA A 106 ? 0.4166 0.5383 0.4602 0.0191  0.0228  0.0147  366 ALA A CA  
851  C C   . ALA A 106 ? 0.5057 0.6331 0.5602 0.0236  0.0337  0.0159  366 ALA A C   
852  O O   . ALA A 106 ? 0.5120 0.6592 0.5881 0.0208  0.0368  0.0162  366 ALA A O   
853  C CB  . ALA A 106 ? 0.3966 0.5116 0.4354 0.0071  0.0244  0.0110  366 ALA A CB  
854  N N   . GLU A 107 ? 0.5319 0.6423 0.5712 0.0301  0.0398  0.0167  367 GLU A N   
855  C CA  . GLU A 107 ? 0.5308 0.6425 0.5732 0.0354  0.0518  0.0178  367 GLU A CA  
856  C C   . GLU A 107 ? 0.5457 0.6368 0.5659 0.0349  0.0570  0.0177  367 GLU A C   
857  O O   . GLU A 107 ? 0.5702 0.6470 0.5755 0.0322  0.0501  0.0171  367 GLU A O   
858  C CB  . GLU A 107 ? 0.5814 0.6962 0.6278 0.0483  0.0540  0.0190  367 GLU A CB  
859  C CG  . GLU A 107 ? 0.6589 0.8030 0.7371 0.0504  0.0555  0.0217  367 GLU A CG  
860  C CD  . GLU A 107 ? 0.7685 0.9230 0.8603 0.0505  0.0710  0.0232  367 GLU A CD  
861  O OE1 . GLU A 107 ? 0.7442 0.8852 0.8212 0.0452  0.0788  0.0225  367 GLU A OE1 
862  O OE2 . GLU A 107 ? 0.8776 1.0551 0.9967 0.0561  0.0758  0.0264  367 GLU A OE2 
863  N N   . THR A 108 ? 0.5172 0.6084 0.5363 0.0373  0.0693  0.0193  368 THR A N   
864  C CA  . THR A 108 ? 0.5196 0.5922 0.5147 0.0376  0.0737  0.0205  368 THR A CA  
865  C C   . THR A 108 ? 0.5611 0.6259 0.5419 0.0473  0.0853  0.0201  368 THR A C   
866  O O   . THR A 108 ? 0.5853 0.6629 0.5814 0.0534  0.0952  0.0206  368 THR A O   
867  C CB  . THR A 108 ? 0.5423 0.6162 0.5417 0.0289  0.0783  0.0243  368 THR A CB  
868  O OG1 . THR A 108 ? 0.6065 0.6906 0.6181 0.0288  0.0923  0.0273  368 THR A OG1 
869  C CG2 . THR A 108 ? 0.4916 0.5730 0.5067 0.0198  0.0708  0.0229  368 THR A CG2 
870  N N   . VAL A 109 ? 0.5289 0.5727 0.4796 0.0489  0.0839  0.0192  369 VAL A N   
871  C CA  . VAL A 109 ? 0.5609 0.5912 0.4885 0.0575  0.0945  0.0172  369 VAL A CA  
872  C C   . VAL A 109 ? 0.5957 0.6104 0.4945 0.0542  0.0936  0.0200  369 VAL A C   
873  O O   . VAL A 109 ? 0.5921 0.5969 0.4786 0.0494  0.0795  0.0194  369 VAL A O   
874  C CB  . VAL A 109 ? 0.5606 0.5760 0.4746 0.0648  0.0897  0.0103  369 VAL A CB  
875  C CG1 . VAL A 109 ? 0.6133 0.6059 0.4922 0.0715  0.0983  0.0059  369 VAL A CG1 
876  C CG2 . VAL A 109 ? 0.5761 0.6075 0.5181 0.0719  0.0937  0.0101  369 VAL A CG2 
877  N N   . GLY A 110 ? 0.5836 0.5983 0.4747 0.0565  0.1087  0.0245  370 GLY A N   
878  C CA  . GLY A 110 ? 0.6014 0.6010 0.4616 0.0551  0.1092  0.0292  370 GLY A CA  
879  C C   . GLY A 110 ? 0.6692 0.6464 0.4890 0.0622  0.1114  0.0230  370 GLY A C   
880  O O   . GLY A 110 ? 0.6914 0.6658 0.5081 0.0705  0.1250  0.0184  370 GLY A O   
881  N N   . THR A 111 ? 0.7200 0.6810 0.5094 0.0589  0.0975  0.0225  371 THR A N   
882  C CA  . THR A 111 ? 0.8032 0.7393 0.5486 0.0631  0.0960  0.0146  371 THR A CA  
883  C C   . THR A 111 ? 0.8450 0.7685 0.5531 0.0605  0.0898  0.0205  371 THR A C   
884  O O   . THR A 111 ? 0.9506 0.8549 0.6233 0.0588  0.0771  0.0139  371 THR A O   
885  C CB  . THR A 111 ? 0.7627 0.6884 0.5051 0.0599  0.0784  0.0047  371 THR A CB  
886  O OG1 . THR A 111 ? 0.6965 0.6270 0.4442 0.0504  0.0583  0.0093  371 THR A OG1 
887  C CG2 . THR A 111 ? 0.7418 0.6799 0.5202 0.0629  0.0823  0.0014  371 THR A CG2 
888  N N   . GLY A 112 ? 0.7890 0.7222 0.5039 0.0599  0.0980  0.0331  372 GLY A N   
889  C CA  . GLY A 112 ? 0.8226 0.7452 0.5033 0.0587  0.0915  0.0419  372 GLY A CA  
890  C C   . GLY A 112 ? 0.8826 0.7914 0.5273 0.0658  0.1119  0.0450  372 GLY A C   
891  O O   . GLY A 112 ? 0.8755 0.7658 0.4859 0.0710  0.1181  0.0344  372 GLY A O   
892  N N   . ILE A 113 ? 0.8719 0.7877 0.5239 0.0662  0.1239  0.0595  373 ILE A N   
893  C CA  . ILE A 113 ? 0.9697 0.8729 0.5877 0.0725  0.1452  0.0663  373 ILE A CA  
894  C C   . ILE A 113 ? 1.0088 0.9124 0.6336 0.0793  0.1690  0.0574  373 ILE A C   
895  O O   . ILE A 113 ? 0.9667 0.8902 0.6394 0.0781  0.1751  0.0549  373 ILE A O   
896  C CB  . ILE A 113 ? 0.9782 0.8905 0.6144 0.0707  0.1560  0.0848  373 ILE A CB  
897  C CG1 . ILE A 113 ? 0.9712 0.8794 0.5924 0.0676  0.1345  0.0958  373 ILE A CG1 
898  C CG2 . ILE A 113 ? 1.0080 0.9102 0.6185 0.0769  0.1838  0.0929  373 ILE A CG2 
899  C CD1 . ILE A 113 ? 0.9039 0.8266 0.5683 0.0631  0.1347  0.1086  373 ILE A CD1 
900  N N   . MET A 114 ? 1.0762 0.9577 0.6521 0.0868  0.1819  0.0528  374 MET A N   
901  C CA  . MET A 114 ? 1.0893 0.9678 0.6668 0.0959  0.2063  0.0438  374 MET A CA  
902  C C   . MET A 114 ? 1.0796 0.9628 0.6830 0.0964  0.1957  0.0289  374 MET A C   
903  O O   . MET A 114 ? 1.0886 0.9789 0.7147 0.1039  0.2134  0.0237  374 MET A O   
904  C CB  . MET A 114 ? 1.0799 0.9797 0.6974 0.0980  0.2341  0.0550  374 MET A CB  
905  C CG  . MET A 114 ? 1.1346 1.0258 0.7241 0.0990  0.2510  0.0708  374 MET A CG  
906  S SD  . MET A 114 ? 1.2955 1.2139 0.9413 0.0975  0.2819  0.0848  374 MET A SD  
907  C CE  . MET A 114 ? 1.3727 1.2682 0.9634 0.1042  0.3100  0.0985  374 MET A CE  
908  N N   . GLY A 115 ? 1.0375 0.9175 0.6394 0.0889  0.1672  0.0235  375 GLY A N   
909  C CA  . GLY A 115 ? 0.9846 0.8683 0.6115 0.0882  0.1560  0.0120  375 GLY A CA  
910  C C   . GLY A 115 ? 0.9229 0.8376 0.6125 0.0869  0.1601  0.0166  375 GLY A C   
911  O O   . GLY A 115 ? 0.9320 0.8510 0.6438 0.0893  0.1564  0.0086  375 GLY A O   
912  N N   . ARG A 116 ? 0.8521 0.7869 0.5695 0.0828  0.1669  0.0292  376 ARG A N   
913  C CA  . ARG A 116 ? 0.8410 0.8045 0.6156 0.0801  0.1698  0.0319  376 ARG A CA  
914  C C   . ARG A 116 ? 0.8208 0.8019 0.6264 0.0697  0.1623  0.0419  376 ARG A C   
915  O O   . ARG A 116 ? 0.7881 0.7907 0.6368 0.0655  0.1604  0.0418  376 ARG A O   
916  C CB  . ARG A 116 ? 0.8819 0.8571 0.6758 0.0884  0.1960  0.0330  376 ARG A CB  
917  C CG  . ARG A 116 ? 0.9934 0.9674 0.7754 0.0895  0.2177  0.0436  376 ARG A CG  
918  C CD  . ARG A 116 ? 1.0497 1.0292 0.8398 0.1004  0.2466  0.0434  376 ARG A CD  
919  N NE  . ARG A 116 ? 1.0480 1.0610 0.8998 0.0990  0.2513  0.0454  376 ARG A NE  
920  C CZ  . ARG A 116 ? 1.0790 1.1112 0.9609 0.1041  0.2760  0.0507  376 ARG A CZ  
921  N NH1 . ARG A 116 ? 1.1077 1.1277 0.9630 0.1117  0.3022  0.0552  376 ARG A NH1 
922  N NH2 . ARG A 116 ? 1.0683 1.1337 1.0082 0.1013  0.2742  0.0522  376 ARG A NH2 
923  N N   . MET A 117 ? 0.8111 0.7822 0.5941 0.0658  0.1572  0.0502  377 MET A N   
924  C CA  . MET A 117 ? 0.7729 0.7561 0.5836 0.0574  0.1531  0.0599  377 MET A CA  
925  C C   . MET A 117 ? 0.6941 0.6786 0.5131 0.0518  0.1293  0.0571  377 MET A C   
926  O O   . MET A 117 ? 0.6920 0.6663 0.4900 0.0532  0.1148  0.0501  377 MET A O   
927  C CB  . MET A 117 ? 0.8160 0.7884 0.6031 0.0576  0.1625  0.0735  377 MET A CB  
928  C CG  . MET A 117 ? 0.8702 0.8421 0.6520 0.0624  0.1898  0.0784  377 MET A CG  
929  S SD  . MET A 117 ? 1.0208 0.9802 0.7799 0.0617  0.2032  0.0976  377 MET A SD  
930  C CE  . MET A 117 ? 0.8911 0.8716 0.7120 0.0508  0.2099  0.1033  377 MET A CE  
931  N N   . GLY A 118 ? 0.6515 0.6475 0.5015 0.0449  0.1266  0.0624  378 GLY A N   
932  C CA  . GLY A 118 ? 0.6463 0.6470 0.5123 0.0400  0.1080  0.0591  378 GLY A CA  
933  C C   . GLY A 118 ? 0.7001 0.6925 0.5523 0.0386  0.0942  0.0661  378 GLY A C   
934  O O   . GLY A 118 ? 0.7245 0.7228 0.5969 0.0345  0.0839  0.0659  378 GLY A O   
935  N N   . ASN A 119 ? 0.7267 0.7061 0.5449 0.0426  0.0942  0.0732  379 ASN A N   
936  C CA  . ASN A 119 ? 0.7047 0.6788 0.5086 0.0424  0.0775  0.0809  379 ASN A CA  
937  C C   . ASN A 119 ? 0.7020 0.6761 0.5011 0.0402  0.0571  0.0715  379 ASN A C   
938  O O   . ASN A 119 ? 0.7204 0.6986 0.5271 0.0378  0.0416  0.0762  379 ASN A O   
939  C CB  . ASN A 119 ? 0.7642 0.7247 0.5284 0.0473  0.0807  0.0911  379 ASN A CB  
940  C CG  . ASN A 119 ? 0.8885 0.8358 0.6132 0.0513  0.0847  0.0819  379 ASN A CG  
941  O OD1 . ASN A 119 ? 0.9155 0.8624 0.6417 0.0540  0.1034  0.0769  379 ASN A OD1 
942  N ND2 . ASN A 119 ? 0.9558 0.8921 0.6447 0.0517  0.0675  0.0802  379 ASN A ND2 
943  N N   . LYS A 120 ? 0.7062 0.6754 0.4944 0.0413  0.0586  0.0589  380 LYS A N   
944  C CA  . LYS A 120 ? 0.7414 0.7090 0.5308 0.0383  0.0434  0.0483  380 LYS A CA  
945  C C   . LYS A 120 ? 0.7529 0.7244 0.5598 0.0400  0.0534  0.0382  380 LYS A C   
946  O O   . LYS A 120 ? 0.7648 0.7394 0.5761 0.0441  0.0707  0.0384  380 LYS A O   
947  C CB  . LYS A 120 ? 0.7808 0.7308 0.5275 0.0387  0.0323  0.0433  380 LYS A CB  
948  C CG  . LYS A 120 ? 0.8026 0.7543 0.5443 0.0332  0.0094  0.0483  380 LYS A CG  
949  C CD  . LYS A 120 ? 0.8546 0.8077 0.5830 0.0356  0.0078  0.0632  380 LYS A CD  
950  C CE  . LYS A 120 ? 0.8804 0.8483 0.6337 0.0321  -0.0090 0.0740  380 LYS A CE  
951  N NZ  . LYS A 120 ? 0.9768 0.9454 0.7191 0.0371  -0.0079 0.0914  380 LYS A NZ  
952  N N   . GLY A 121 ? 0.7431 0.7157 0.5621 0.0372  0.0431  0.0307  381 GLY A N   
953  C CA  . GLY A 121 ? 0.7446 0.7211 0.5798 0.0402  0.0509  0.0230  381 GLY A CA  
954  C C   . GLY A 121 ? 0.7180 0.7033 0.5796 0.0355  0.0409  0.0213  381 GLY A C   
955  O O   . GLY A 121 ? 0.7351 0.7188 0.5970 0.0301  0.0274  0.0229  381 GLY A O   
956  N N   . GLY A 122 ? 0.5964 0.5924 0.4805 0.0375  0.0477  0.0190  382 GLY A N   
957  C CA  . GLY A 122 ? 0.5462 0.5480 0.4496 0.0342  0.0396  0.0173  382 GLY A CA  
958  C C   . GLY A 122 ? 0.5453 0.5649 0.4755 0.0333  0.0457  0.0192  382 GLY A C   
959  O O   . GLY A 122 ? 0.5712 0.5992 0.5087 0.0362  0.0566  0.0199  382 GLY A O   
960  N N   . VAL A 123 ? 0.5154 0.5406 0.4599 0.0284  0.0388  0.0201  383 VAL A N   
961  C CA  . VAL A 123 ? 0.5325 0.5719 0.4975 0.0268  0.0413  0.0196  383 VAL A CA  
962  C C   . VAL A 123 ? 0.5087 0.5463 0.4762 0.0268  0.0331  0.0179  383 VAL A C   
963  O O   . VAL A 123 ? 0.5210 0.5475 0.4795 0.0254  0.0265  0.0181  383 VAL A O   
964  C CB  . VAL A 123 ? 0.4803 0.5264 0.4570 0.0200  0.0441  0.0227  383 VAL A CB  
965  C CG1 . VAL A 123 ? 0.4924 0.5376 0.4658 0.0203  0.0535  0.0265  383 VAL A CG1 
966  C CG2 . VAL A 123 ? 0.3782 0.4184 0.3539 0.0162  0.0376  0.0250  383 VAL A CG2 
967  N N   . ALA A 124 ? 0.4660 0.5149 0.4460 0.0281  0.0331  0.0169  384 ALA A N   
968  C CA  . ALA A 124 ? 0.4801 0.5265 0.4601 0.0295  0.0260  0.0170  384 ALA A CA  
969  C C   . ALA A 124 ? 0.5160 0.5774 0.5085 0.0266  0.0235  0.0174  384 ALA A C   
970  O O   . ALA A 124 ? 0.4911 0.5675 0.4962 0.0254  0.0267  0.0165  384 ALA A O   
971  C CB  . ALA A 124 ? 0.4848 0.5238 0.4594 0.0386  0.0263  0.0159  384 ALA A CB  
972  N N   . ILE A 125 ? 0.4870 0.5439 0.4750 0.0244  0.0179  0.0188  385 ILE A N   
973  C CA  . ILE A 125 ? 0.4949 0.5628 0.4871 0.0223  0.0133  0.0191  385 ILE A CA  
974  C C   . ILE A 125 ? 0.4886 0.5504 0.4745 0.0288  0.0078  0.0230  385 ILE A C   
975  O O   . ILE A 125 ? 0.5131 0.5594 0.4894 0.0284  0.0076  0.0251  385 ILE A O   
976  C CB  . ILE A 125 ? 0.4555 0.5200 0.4427 0.0135  0.0142  0.0177  385 ILE A CB  
977  C CG1 . ILE A 125 ? 0.4521 0.5184 0.4457 0.0076  0.0211  0.0147  385 ILE A CG1 
978  C CG2 . ILE A 125 ? 0.4042 0.4771 0.3888 0.0107  0.0085  0.0166  385 ILE A CG2 
979  C CD1 . ILE A 125 ? 0.3992 0.4568 0.3879 0.0014  0.0252  0.0137  385 ILE A CD1 
980  N N   . ARG A 126 ? 0.4637 0.5375 0.4567 0.0348  0.0034  0.0252  386 ARG A N   
981  C CA  . ARG A 126 ? 0.5182 0.5858 0.5044 0.0414  -0.0023 0.0311  386 ARG A CA  
982  C C   . ARG A 126 ? 0.5341 0.6154 0.5191 0.0387  -0.0105 0.0333  386 ARG A C   
983  O O   . ARG A 126 ? 0.5289 0.6284 0.5238 0.0334  -0.0131 0.0296  386 ARG A O   
984  C CB  . ARG A 126 ? 0.4663 0.5326 0.4594 0.0541  -0.0014 0.0342  386 ARG A CB  
985  C CG  . ARG A 126 ? 0.4196 0.5109 0.4333 0.0594  -0.0022 0.0348  386 ARG A CG  
986  C CD  . ARG A 126 ? 0.4680 0.5761 0.4877 0.0624  -0.0132 0.0411  386 ARG A CD  
987  N NE  . ARG A 126 ? 0.5293 0.6231 0.5413 0.0737  -0.0156 0.0490  386 ARG A NE  
988  C CZ  . ARG A 126 ? 0.5476 0.6483 0.5569 0.0781  -0.0257 0.0573  386 ARG A CZ  
989  N NH1 . ARG A 126 ? 0.5572 0.6799 0.5693 0.0714  -0.0361 0.0576  386 ARG A NH1 
990  N NH2 . ARG A 126 ? 0.5521 0.6360 0.5544 0.0889  -0.0258 0.0655  386 ARG A NH2 
991  N N   . PHE A 127 ? 0.5036 0.5751 0.4752 0.0417  -0.0149 0.0396  387 PHE A N   
992  C CA  . PHE A 127 ? 0.5420 0.6232 0.5050 0.0393  -0.0236 0.0423  387 PHE A CA  
993  C C   . PHE A 127 ? 0.5902 0.6597 0.5394 0.0471  -0.0277 0.0526  387 PHE A C   
994  O O   . PHE A 127 ? 0.5689 0.6191 0.5149 0.0521  -0.0222 0.0568  387 PHE A O   
995  C CB  . PHE A 127 ? 0.5164 0.5931 0.4667 0.0270  -0.0204 0.0359  387 PHE A CB  
996  C CG  . PHE A 127 ? 0.5628 0.6179 0.5013 0.0244  -0.0114 0.0372  387 PHE A CG  
997  C CD1 . PHE A 127 ? 0.5922 0.6356 0.5111 0.0235  -0.0109 0.0425  387 PHE A CD1 
998  C CD2 . PHE A 127 ? 0.5670 0.6149 0.5146 0.0224  -0.0036 0.0340  387 PHE A CD2 
999  C CE1 . PHE A 127 ? 0.5887 0.6150 0.5023 0.0205  -0.0013 0.0448  387 PHE A CE1 
1000 C CE2 . PHE A 127 ? 0.5756 0.6080 0.5177 0.0193  0.0031  0.0361  387 PHE A CE2 
1001 C CZ  . PHE A 127 ? 0.5746 0.5971 0.5021 0.0181  0.0049  0.0415  387 PHE A CZ  
1002 N N   . GLN A 128 ? 0.5936 0.6738 0.5337 0.0475  -0.0379 0.0570  388 GLN A N   
1003 C CA  . GLN A 128 ? 0.6775 0.7450 0.5994 0.0540  -0.0414 0.0683  388 GLN A CA  
1004 C C   . GLN A 128 ? 0.6637 0.7201 0.5584 0.0441  -0.0388 0.0668  388 GLN A C   
1005 O O   . GLN A 128 ? 0.6158 0.6827 0.5041 0.0349  -0.0422 0.0585  388 GLN A O   
1006 C CB  . GLN A 128 ? 0.7327 0.8197 0.6607 0.0638  -0.0554 0.0770  388 GLN A CB  
1007 C CG  . GLN A 128 ? 0.8251 0.9003 0.7573 0.0792  -0.0546 0.0896  388 GLN A CG  
1008 C CD  . GLN A 128 ? 0.9505 1.0356 0.8737 0.0881  -0.0684 0.1030  388 GLN A CD  
1009 O OE1 . GLN A 128 ? 0.9868 1.0992 0.9153 0.0860  -0.0821 0.1024  388 GLN A OE1 
1010 N NE2 . GLN A 128 ? 1.0167 1.0795 0.9262 0.0974  -0.0658 0.1159  388 GLN A NE2 
1011 N N   . PHE A 129 ? 0.6392 0.6729 0.5185 0.0458  -0.0314 0.0743  389 PHE A N   
1012 C CA  . PHE A 129 ? 0.6620 0.6833 0.5147 0.0387  -0.0258 0.0753  389 PHE A CA  
1013 C C   . PHE A 129 ? 0.6855 0.6955 0.5175 0.0464  -0.0292 0.0901  389 PHE A C   
1014 O O   . PHE A 129 ? 0.6943 0.6879 0.5307 0.0521  -0.0234 0.0989  389 PHE A O   
1015 C CB  . PHE A 129 ? 0.6500 0.6554 0.5078 0.0324  -0.0105 0.0720  389 PHE A CB  
1016 C CG  . PHE A 129 ? 0.7100 0.7036 0.5451 0.0257  -0.0005 0.0726  389 PHE A CG  
1017 C CD1 . PHE A 129 ? 0.7581 0.7557 0.5685 0.0220  -0.0042 0.0688  389 PHE A CD1 
1018 C CD2 . PHE A 129 ? 0.7003 0.6791 0.5402 0.0225  0.0133  0.0760  389 PHE A CD2 
1019 C CE1 . PHE A 129 ? 0.7440 0.7276 0.5308 0.0167  0.0084  0.0684  389 PHE A CE1 
1020 C CE2 . PHE A 129 ? 0.7180 0.6869 0.5407 0.0174  0.0257  0.0772  389 PHE A CE2 
1021 C CZ  . PHE A 129 ? 0.7378 0.7077 0.5324 0.0153  0.0246  0.0733  389 PHE A CZ  
1022 N N   . HIS A 130 ? 0.6824 0.6995 0.4902 0.0460  -0.0389 0.0928  390 HIS A N   
1023 C CA  . HIS A 130 ? 0.7160 0.7264 0.5031 0.0555  -0.0460 0.1091  390 HIS A CA  
1024 C C   . HIS A 130 ? 0.7283 0.7469 0.5410 0.0688  -0.0541 0.1173  390 HIS A C   
1025 O O   . HIS A 130 ? 0.7545 0.7974 0.5865 0.0711  -0.0655 0.1127  390 HIS A O   
1026 C CB  . HIS A 130 ? 0.7046 0.6867 0.4690 0.0548  -0.0312 0.1189  390 HIS A CB  
1027 C CG  . HIS A 130 ? 0.7162 0.6911 0.4516 0.0446  -0.0226 0.1128  390 HIS A CG  
1028 N ND1 . HIS A 130 ? 0.7893 0.7622 0.4854 0.0445  -0.0292 0.1175  390 HIS A ND1 
1029 C CD2 . HIS A 130 ? 0.7031 0.6718 0.4422 0.0348  -0.0077 0.1020  390 HIS A CD2 
1030 C CE1 . HIS A 130 ? 0.8002 0.7637 0.4752 0.0350  -0.0169 0.1085  390 HIS A CE1 
1031 N NE2 . HIS A 130 ? 0.7921 0.7537 0.4949 0.0297  -0.0033 0.0996  390 HIS A NE2 
1032 N N   . ASN A 131 ? 0.7530 0.7508 0.5680 0.0774  -0.0470 0.1291  391 ASN A N   
1033 C CA  . ASN A 131 ? 0.7830 0.7842 0.6219 0.0913  -0.0518 0.1359  391 ASN A CA  
1034 C C   . ASN A 131 ? 0.8272 0.8113 0.6870 0.0911  -0.0389 0.1301  391 ASN A C   
1035 O O   . ASN A 131 ? 0.9409 0.9100 0.8090 0.1021  -0.0364 0.1385  391 ASN A O   
1036 C CB  . ASN A 131 ? 0.8373 0.8267 0.6602 0.1046  -0.0570 0.1563  391 ASN A CB  
1037 C CG  . ASN A 131 ? 0.9792 0.9951 0.7934 0.1104  -0.0767 0.1632  391 ASN A CG  
1038 O OD1 . ASN A 131 ? 0.9981 1.0339 0.8030 0.1000  -0.0853 0.1531  391 ASN A OD1 
1039 N ND2 . ASN A 131 ? 1.0990 1.1152 0.9171 0.1271  -0.0847 0.1805  391 ASN A ND2 
1040 N N   . THR A 132 ? 0.7656 0.7504 0.6323 0.0788  -0.0311 0.1160  392 THR A N   
1041 C CA  . THR A 132 ? 0.7148 0.6850 0.5983 0.0767  -0.0212 0.1092  392 THR A CA  
1042 C C   . THR A 132 ? 0.6946 0.6844 0.5972 0.0724  -0.0222 0.0946  392 THR A C   
1043 O O   . THR A 132 ? 0.6555 0.6621 0.5558 0.0639  -0.0247 0.0871  392 THR A O   
1044 C CB  . THR A 132 ? 0.7145 0.6632 0.5884 0.0659  -0.0097 0.1096  392 THR A CB  
1045 O OG1 . THR A 132 ? 0.7858 0.7129 0.6449 0.0711  -0.0067 0.1248  392 THR A OG1 
1046 C CG2 . THR A 132 ? 0.6812 0.6189 0.5721 0.0605  -0.0028 0.1006  392 THR A CG2 
1047 N N   . SER A 133 ? 0.6603 0.6454 0.5795 0.0785  -0.0193 0.0908  393 SER A N   
1048 C CA  . SER A 133 ? 0.6242 0.6263 0.5604 0.0768  -0.0189 0.0793  393 SER A CA  
1049 C C   . SER A 133 ? 0.6243 0.6129 0.5604 0.0664  -0.0107 0.0702  393 SER A C   
1050 O O   . SER A 133 ? 0.6684 0.6334 0.6005 0.0659  -0.0059 0.0720  393 SER A O   
1051 C CB  . SER A 133 ? 0.6334 0.6375 0.5851 0.0912  -0.0187 0.0811  393 SER A CB  
1052 O OG  . SER A 133 ? 0.6637 0.6374 0.6107 0.0970  -0.0121 0.0843  393 SER A OG  
1053 N N   . ILE A 134 ? 0.6055 0.6088 0.5468 0.0577  -0.0098 0.0612  394 ILE A N   
1054 C CA  . ILE A 134 ? 0.5991 0.5931 0.5412 0.0480  -0.0037 0.0543  394 ILE A CA  
1055 C C   . ILE A 134 ? 0.5882 0.5955 0.5413 0.0468  -0.0023 0.0453  394 ILE A C   
1056 O O   . ILE A 134 ? 0.5425 0.5700 0.5025 0.0472  -0.0048 0.0431  394 ILE A O   
1057 C CB  . ILE A 134 ? 0.5319 0.5277 0.4667 0.0376  -0.0012 0.0546  394 ILE A CB  
1058 C CG1 . ILE A 134 ? 0.5380 0.5228 0.4585 0.0387  -0.0010 0.0647  394 ILE A CG1 
1059 C CG2 . ILE A 134 ? 0.3971 0.3856 0.3375 0.0292  0.0041  0.0502  394 ILE A CG2 
1060 C CD1 . ILE A 134 ? 0.5019 0.4883 0.4127 0.0304  0.0039  0.0650  394 ILE A CD1 
1061 N N   . CYS A 135 ? 0.5790 0.5744 0.5327 0.0443  0.0014  0.0403  395 CYS A N   
1062 C CA  . CYS A 135 ? 0.5764 0.5812 0.5363 0.0429  0.0040  0.0332  395 CYS A CA  
1063 C C   . CYS A 135 ? 0.5668 0.5632 0.5237 0.0339  0.0054  0.0301  395 CYS A C   
1064 O O   . CYS A 135 ? 0.6238 0.6029 0.5755 0.0316  0.0044  0.0307  395 CYS A O   
1065 C CB  . CYS A 135 ? 0.5553 0.5551 0.5167 0.0530  0.0067  0.0306  395 CYS A CB  
1066 S SG  . CYS A 135 ? 0.6261 0.6354 0.5910 0.0518  0.0126  0.0231  395 CYS A SG  
1067 N N   . VAL A 136 ? 0.4791 0.4881 0.4409 0.0286  0.0073  0.0275  396 VAL A N   
1068 C CA  . VAL A 136 ? 0.4708 0.4767 0.4334 0.0212  0.0079  0.0266  396 VAL A CA  
1069 C C   . VAL A 136 ? 0.5159 0.5267 0.4787 0.0221  0.0101  0.0226  396 VAL A C   
1070 O O   . VAL A 136 ? 0.5288 0.5520 0.4970 0.0232  0.0136  0.0214  396 VAL A O   
1071 C CB  . VAL A 136 ? 0.4620 0.4764 0.4296 0.0155  0.0106  0.0290  396 VAL A CB  
1072 C CG1 . VAL A 136 ? 0.4086 0.4223 0.3820 0.0098  0.0118  0.0302  396 VAL A CG1 
1073 C CG2 . VAL A 136 ? 0.4731 0.4827 0.4362 0.0153  0.0103  0.0337  396 VAL A CG2 
1074 N N   . VAL A 137 ? 0.5721 0.5720 0.5276 0.0208  0.0079  0.0206  397 VAL A N   
1075 C CA  . VAL A 137 ? 0.5989 0.5998 0.5483 0.0224  0.0102  0.0177  397 VAL A CA  
1076 C C   . VAL A 137 ? 0.5886 0.5908 0.5391 0.0158  0.0067  0.0204  397 VAL A C   
1077 O O   . VAL A 137 ? 0.6379 0.6344 0.5900 0.0106  0.0005  0.0222  397 VAL A O   
1078 C CB  . VAL A 137 ? 0.5900 0.5740 0.5232 0.0271  0.0095  0.0125  397 VAL A CB  
1079 C CG1 . VAL A 137 ? 0.5591 0.5438 0.4818 0.0305  0.0149  0.0097  397 VAL A CG1 
1080 C CG2 . VAL A 137 ? 0.5594 0.5382 0.4938 0.0351  0.0121  0.0116  397 VAL A CG2 
1081 N N   . ASN A 138 ? 0.5469 0.5574 0.4990 0.0162  0.0111  0.0218  398 ASN A N   
1082 C CA  . ASN A 138 ? 0.5768 0.5889 0.5290 0.0127  0.0081  0.0260  398 ASN A CA  
1083 C C   . ASN A 138 ? 0.6144 0.6213 0.5493 0.0162  0.0097  0.0245  398 ASN A C   
1084 O O   . ASN A 138 ? 0.6188 0.6294 0.5526 0.0203  0.0187  0.0233  398 ASN A O   
1085 C CB  . ASN A 138 ? 0.5264 0.5494 0.4937 0.0113  0.0143  0.0307  398 ASN A CB  
1086 C CG  . ASN A 138 ? 0.5477 0.5727 0.5163 0.0106  0.0133  0.0370  398 ASN A CG  
1087 O OD1 . ASN A 138 ? 0.6122 0.6336 0.5724 0.0097  0.0047  0.0390  398 ASN A OD1 
1088 N ND2 . ASN A 138 ? 0.4938 0.5238 0.4727 0.0109  0.0214  0.0406  398 ASN A ND2 
1089 N N   . SER A 139 ? 0.5931 0.5919 0.5141 0.0140  0.0010  0.0246  399 SER A N   
1090 C CA  . SER A 139 ? 0.6419 0.6320 0.5391 0.0174  0.0025  0.0225  399 SER A CA  
1091 C C   . SER A 139 ? 0.6480 0.6390 0.5371 0.0143  -0.0063 0.0286  399 SER A C   
1092 O O   . SER A 139 ? 0.6567 0.6526 0.5575 0.0088  -0.0171 0.0323  399 SER A O   
1093 C CB  . SER A 139 ? 0.6432 0.6157 0.5202 0.0189  0.0000  0.0133  399 SER A CB  
1094 O OG  . SER A 139 ? 0.6791 0.6433 0.5519 0.0116  -0.0139 0.0114  399 SER A OG  
1095 N N   . HIS A 140 ? 0.6739 0.6612 0.5439 0.0183  -0.0015 0.0309  400 HIS A N   
1096 C CA  . HIS A 140 ? 0.6724 0.6596 0.5288 0.0171  -0.0104 0.0383  400 HIS A CA  
1097 C C   . HIS A 140 ? 0.7240 0.6940 0.5406 0.0196  -0.0108 0.0325  400 HIS A C   
1098 O O   . HIS A 140 ? 0.7380 0.7036 0.5419 0.0257  0.0038  0.0322  400 HIS A O   
1099 C CB  . HIS A 140 ? 0.6330 0.6302 0.5026 0.0205  -0.0009 0.0494  400 HIS A CB  
1100 C CG  . HIS A 140 ? 0.6984 0.6988 0.5618 0.0207  -0.0107 0.0608  400 HIS A CG  
1101 N ND1 . HIS A 140 ? 0.7067 0.7099 0.5728 0.0252  -0.0020 0.0722  400 HIS A ND1 
1102 C CD2 . HIS A 140 ? 0.7014 0.7033 0.5575 0.0169  -0.0294 0.0637  400 HIS A CD2 
1103 C CE1 . HIS A 140 ? 0.7020 0.7083 0.5620 0.0259  -0.0148 0.0827  400 HIS A CE1 
1104 N NE2 . HIS A 140 ? 0.7073 0.7147 0.5619 0.0205  -0.0324 0.0776  400 HIS A NE2 
1105 N N   . LEU A 141 ? 0.7217 0.6811 0.5186 0.0143  -0.0266 0.0271  401 LEU A N   
1106 C CA  . LEU A 141 ? 0.7886 0.7259 0.5428 0.0159  -0.0266 0.0175  401 LEU A CA  
1107 C C   . LEU A 141 ? 0.7942 0.7277 0.5175 0.0153  -0.0363 0.0238  401 LEU A C   
1108 O O   . LEU A 141 ? 0.8265 0.7752 0.5647 0.0123  -0.0483 0.0354  401 LEU A O   
1109 C CB  . LEU A 141 ? 0.7942 0.7163 0.5404 0.0091  -0.0379 0.0050  401 LEU A CB  
1110 C CG  . LEU A 141 ? 0.7320 0.6570 0.5084 0.0088  -0.0323 0.0010  401 LEU A CG  
1111 C CD1 . LEU A 141 ? 0.7254 0.6302 0.4900 0.0017  -0.0427 -0.0105 401 LEU A CD1 
1112 C CD2 . LEU A 141 ? 0.6823 0.6079 0.4644 0.0192  -0.0114 -0.0007 401 LEU A CD2 
1113 N N   . ALA A 142 ? 0.7975 0.7103 0.4770 0.0191  -0.0305 0.0169  402 ALA A N   
1114 C CA  . ALA A 142 ? 0.7614 0.6662 0.4004 0.0195  -0.0387 0.0224  402 ALA A CA  
1115 C C   . ALA A 142 ? 0.8064 0.7229 0.4511 0.0108  -0.0658 0.0296  402 ALA A C   
1116 O O   . ALA A 142 ? 0.8564 0.7734 0.5131 0.0015  -0.0815 0.0222  402 ALA A O   
1117 C CB  . ALA A 142 ? 0.7130 0.5877 0.2985 0.0209  -0.0351 0.0078  402 ALA A CB  
1118 N N   . ALA A 143 ? 0.8396 0.7656 0.4768 0.0138  -0.0711 0.0450  403 ALA A N   
1119 C CA  . ALA A 143 ? 0.8996 0.8411 0.5451 0.0074  -0.0979 0.0552  403 ALA A CA  
1120 C C   . ALA A 143 ? 0.9664 0.8940 0.5604 0.0015  -0.1202 0.0513  403 ALA A C   
1121 O O   . ALA A 143 ? 1.0077 0.9513 0.6115 -0.0048 -0.1453 0.0597  403 ALA A O   
1122 C CB  . ALA A 143 ? 0.8746 0.8361 0.5466 0.0148  -0.0934 0.0766  403 ALA A CB  
1123 N N   . HIS A 144 ? 0.9623 0.8615 0.5022 0.0035  -0.1123 0.0390  404 HIS A N   
1124 C CA  . HIS A 144 ? 1.0651 0.9488 0.5490 -0.0024 -0.1342 0.0351  404 HIS A CA  
1125 C C   . HIS A 144 ? 1.1073 0.9981 0.6042 -0.0184 -0.1658 0.0274  404 HIS A C   
1126 O O   . HIS A 144 ? 1.1145 0.9989 0.6316 -0.0254 -0.1641 0.0130  404 HIS A O   
1127 C CB  . HIS A 144 ? 1.1376 0.9845 0.5599 0.0012  -0.1185 0.0183  404 HIS A CB  
1128 C CG  . HIS A 144 ? 1.2986 1.1273 0.6535 -0.0013 -0.1348 0.0176  404 HIS A CG  
1129 N ND1 . HIS A 144 ? 1.3376 1.1611 0.6694 -0.0156 -0.1677 0.0088  404 HIS A ND1 
1130 C CD2 . HIS A 144 ? 1.3451 1.1591 0.6489 0.0080  -0.1233 0.0249  404 HIS A CD2 
1131 C CE1 . HIS A 144 ? 1.3562 1.1625 0.6229 -0.0149 -0.1773 0.0100  404 HIS A CE1 
1132 N NE2 . HIS A 144 ? 1.3581 1.1576 0.6055 0.0000  -0.1497 0.0202  404 HIS A NE2 
1133 N N   . ILE A 145 ? 1.1238 1.0289 0.6124 -0.0244 -0.1945 0.0381  405 ILE A N   
1134 C CA  . ILE A 145 ? 1.1665 1.0857 0.6782 -0.0407 -0.2256 0.0339  405 ILE A CA  
1135 C C   . ILE A 145 ? 1.2108 1.0973 0.6829 -0.0542 -0.2342 0.0075  405 ILE A C   
1136 O O   . ILE A 145 ? 1.1811 1.0689 0.6848 -0.0654 -0.2403 -0.0028 405 ILE A O   
1137 C CB  . ILE A 145 ? 0.9224 0.8660 0.4317 -0.0442 -0.2574 0.0517  405 ILE A CB  
1138 N N   . GLU A 146 ? 1.2703 1.1245 0.6717 -0.0525 -0.2325 -0.0035 406 GLU A N   
1139 C CA  . GLU A 146 ? 1.3215 1.1392 0.6758 -0.0652 -0.2417 -0.0294 406 GLU A CA  
1140 C C   . GLU A 146 ? 1.3311 1.1181 0.6788 -0.0585 -0.2095 -0.0471 406 GLU A C   
1141 O O   . GLU A 146 ? 1.3195 1.0841 0.6624 -0.0696 -0.2141 -0.0665 406 GLU A O   
1142 C CB  . GLU A 146 ? 1.3405 1.1346 0.6144 -0.0668 -0.2559 -0.0339 406 GLU A CB  
1143 N N   . GLU A 147 ? 1.3525 1.1393 0.7031 -0.0405 -0.1773 -0.0395 407 GLU A N   
1144 C CA  . GLU A 147 ? 1.3712 1.1261 0.7001 -0.0312 -0.1464 -0.0555 407 GLU A CA  
1145 C C   . GLU A 147 ? 1.2775 1.0459 0.6679 -0.0265 -0.1279 -0.0543 407 GLU A C   
1146 O O   . GLU A 147 ? 1.2172 0.9974 0.6304 -0.0127 -0.1028 -0.0447 407 GLU A O   
1147 C CB  . GLU A 147 ? 1.4153 1.1575 0.7006 -0.0153 -0.1218 -0.0500 407 GLU A CB  
1148 C CG  . GLU A 147 ? 1.5661 1.2772 0.7684 -0.0189 -0.1336 -0.0594 407 GLU A CG  
1149 C CD  . GLU A 147 ? 1.6069 1.2977 0.7612 -0.0026 -0.1024 -0.0574 407 GLU A CD  
1150 O OE1 . GLU A 147 ? 1.6018 1.3039 0.7918 0.0105  -0.0722 -0.0497 407 GLU A OE1 
1151 O OE2 . GLU A 147 ? 1.6254 1.2897 0.7070 -0.0034 -0.1080 -0.0633 407 GLU A OE2 
1152 N N   . TYR A 148 ? 1.2629 1.0285 0.6786 -0.0390 -0.1413 -0.0642 408 TYR A N   
1153 C CA  . TYR A 148 ? 1.1674 0.9424 0.6371 -0.0362 -0.1270 -0.0640 408 TYR A CA  
1154 C C   . TYR A 148 ? 1.2171 0.9664 0.6726 -0.0228 -0.0961 -0.0750 408 TYR A C   
1155 O O   . TYR A 148 ? 1.2460 1.0074 0.7443 -0.0160 -0.0806 -0.0708 408 TYR A O   
1156 C CB  . TYR A 148 ? 1.1390 0.9114 0.6316 -0.0537 -0.1479 -0.0725 408 TYR A CB  
1157 C CG  . TYR A 148 ? 1.2351 0.9649 0.6759 -0.0646 -0.1578 -0.0952 408 TYR A CG  
1158 C CD1 . TYR A 148 ? 1.2443 0.9368 0.6626 -0.0577 -0.1362 -0.1117 408 TYR A CD1 
1159 C CD2 . TYR A 148 ? 1.2975 1.0237 0.7113 -0.0817 -0.1893 -0.1002 408 TYR A CD2 
1160 C CE1 . TYR A 148 ? 1.3416 0.9900 0.7097 -0.0673 -0.1433 -0.1339 408 TYR A CE1 
1161 C CE2 . TYR A 148 ? 1.3766 1.0605 0.7392 -0.0933 -0.1990 -0.1230 408 TYR A CE2 
1162 C CZ  . TYR A 148 ? 1.4221 1.0646 0.7603 -0.0861 -0.1749 -0.1407 408 TYR A CZ  
1163 O OH  . TYR A 148 ? 1.4766 1.0712 0.7608 -0.0973 -0.1823 -0.1652 408 TYR A OH  
1164 N N   . GLU A 149 ? 1.2575 0.9721 0.6535 -0.0184 -0.0871 -0.0886 409 GLU A N   
1165 C CA  . GLU A 149 ? 1.2771 0.9688 0.6609 -0.0034 -0.0557 -0.0976 409 GLU A CA  
1166 C C   . GLU A 149 ? 1.2356 0.9578 0.6588 0.0117  -0.0325 -0.0807 409 GLU A C   
1167 O O   . GLU A 149 ? 1.2104 0.9330 0.6602 0.0219  -0.0114 -0.0821 409 GLU A O   
1168 C CB  . GLU A 149 ? 1.3600 1.0122 0.6697 0.0008  -0.0469 -0.1121 409 GLU A CB  
1169 C CG  . GLU A 149 ? 2.1090 1.7231 1.3691 -0.0152 -0.0693 -0.1331 409 GLU A CG  
1170 C CD  . GLU A 149 ? 1.8739 1.4959 1.1020 -0.0298 -0.1021 -0.1291 409 GLU A CD  
1171 O OE1 . GLU A 149 ? 1.7751 1.4383 1.0412 -0.0327 -0.1168 -0.1092 409 GLU A OE1 
1172 O OE2 . GLU A 149 ? 1.9812 1.5675 1.1457 -0.0383 -0.1137 -0.1462 409 GLU A OE2 
1173 N N   . ARG A 150 ? 1.2151 0.9632 0.6439 0.0124  -0.0378 -0.0642 410 ARG A N   
1174 C CA  . ARG A 150 ? 1.1423 0.9186 0.6080 0.0236  -0.0184 -0.0480 410 ARG A CA  
1175 C C   . ARG A 150 ? 1.0553 0.8593 0.5859 0.0216  -0.0200 -0.0406 410 ARG A C   
1176 O O   . ARG A 150 ? 0.9975 0.8165 0.5595 0.0308  -0.0007 -0.0344 410 ARG A O   
1177 C CB  . ARG A 150 ? 1.1430 0.9358 0.5973 0.0236  -0.0255 -0.0318 410 ARG A CB  
1178 C CG  . ARG A 150 ? 1.2403 1.0085 0.6302 0.0289  -0.0173 -0.0350 410 ARG A CG  
1179 C CD  . ARG A 150 ? 1.3003 1.0854 0.6814 0.0294  -0.0253 -0.0160 410 ARG A CD  
1180 N NE  . ARG A 150 ? 1.4308 1.1906 0.7428 0.0335  -0.0204 -0.0179 410 ARG A NE  
1181 C CZ  . ARG A 150 ? 1.4953 1.2624 0.7850 0.0351  -0.0271 -0.0014 410 ARG A CZ  
1182 N NH1 . ARG A 150 ? 1.4432 1.2417 0.7770 0.0336  -0.0382 0.0179  410 ARG A NH1 
1183 N NH2 . ARG A 150 ? 1.5675 1.3089 0.7892 0.0390  -0.0217 -0.0035 410 ARG A NH2 
1184 N N   . ARG A 151 ? 1.0192 0.8306 0.5698 0.0091  -0.0432 -0.0410 411 ARG A N   
1185 C CA  . ARG A 151 ? 0.9717 0.8045 0.5780 0.0071  -0.0435 -0.0355 411 ARG A CA  
1186 C C   . ARG A 151 ? 0.9640 0.7783 0.5756 0.0115  -0.0305 -0.0474 411 ARG A C   
1187 O O   . ARG A 151 ? 0.9848 0.8128 0.6292 0.0193  -0.0158 -0.0426 411 ARG A O   
1188 C CB  . ARG A 151 ? 0.9514 0.7982 0.5794 -0.0072 -0.0695 -0.0312 411 ARG A CB  
1189 C CG  . ARG A 151 ? 0.9427 0.8130 0.5753 -0.0088 -0.0814 -0.0156 411 ARG A CG  
1190 C CD  . ARG A 151 ? 0.9578 0.8457 0.6177 -0.0216 -0.1060 -0.0101 411 ARG A CD  
1191 N NE  . ARG A 151 ? 1.0738 0.9501 0.6982 -0.0325 -0.1299 -0.0160 411 ARG A NE  
1192 C CZ  . ARG A 151 ? 1.1034 0.9848 0.7008 -0.0315 -0.1411 -0.0078 411 ARG A CZ  
1193 N NH1 . ARG A 151 ? 1.1007 0.9720 0.6652 -0.0429 -0.1660 -0.0142 411 ARG A NH1 
1194 N NH2 . ARG A 151 ? 1.0833 0.9785 0.6849 -0.0195 -0.1280 0.0069  411 ARG A NH2 
1195 N N   . ASN A 152 ? 0.9925 0.7743 0.5701 0.0068  -0.0360 -0.0630 412 ASN A N   
1196 C CA  . ASN A 152 ? 1.0130 0.7719 0.5904 0.0137  -0.0208 -0.0740 412 ASN A CA  
1197 C C   . ASN A 152 ? 0.9839 0.7462 0.5632 0.0316  0.0071  -0.0713 412 ASN A C   
1198 O O   . ASN A 152 ? 0.9613 0.7295 0.5711 0.0398  0.0196  -0.0696 412 ASN A O   
1199 C CB  . ASN A 152 ? 1.0993 0.8154 0.6300 0.0073  -0.0272 -0.0930 412 ASN A CB  
1200 C CG  . ASN A 152 ? 1.1527 0.8665 0.6831 -0.0127 -0.0564 -0.0963 412 ASN A CG  
1201 O OD1 . ASN A 152 ? 1.0681 0.8133 0.6388 -0.0205 -0.0699 -0.0837 412 ASN A OD1 
1202 N ND2 . ASN A 152 ? 1.2427 0.9191 0.7277 -0.0216 -0.0658 -0.1138 412 ASN A ND2 
1203 N N   . GLN A 153 ? 0.9998 0.7600 0.5485 0.0378  0.0169  -0.0696 413 GLN A N   
1204 C CA  . GLN A 153 ? 0.9772 0.7443 0.5337 0.0538  0.0444  -0.0657 413 GLN A CA  
1205 C C   . GLN A 153 ? 0.9873 0.7935 0.5998 0.0561  0.0483  -0.0505 413 GLN A C   
1206 O O   . GLN A 153 ? 1.0194 0.8348 0.6587 0.0662  0.0647  -0.0488 413 GLN A O   
1207 C CB  . GLN A 153 ? 0.9839 0.7425 0.4983 0.0591  0.0558  -0.0646 413 GLN A CB  
1208 C CG  . GLN A 153 ? 1.0663 0.8322 0.5910 0.0753  0.0870  -0.0605 413 GLN A CG  
1209 C CD  . GLN A 153 ? 1.2016 0.9373 0.7059 0.0872  0.1066  -0.0747 413 GLN A CD  
1210 O OE1 . GLN A 153 ? 1.3523 1.0539 0.8015 0.0894  0.1126  -0.0864 413 GLN A OE1 
1211 N NE2 . GLN A 153 ? 1.1336 0.8808 0.6806 0.0957  0.1172  -0.0732 413 GLN A NE2 
1212 N N   . ASP A 154 ? 0.9431 0.7722 0.5736 0.0471  0.0333  -0.0395 414 ASP A N   
1213 C CA  . ASP A 154 ? 0.8775 0.7396 0.5568 0.0483  0.0372  -0.0270 414 ASP A CA  
1214 C C   . ASP A 154 ? 0.8645 0.7308 0.5768 0.0480  0.0346  -0.0296 414 ASP A C   
1215 O O   . ASP A 154 ? 0.8273 0.7099 0.5700 0.0549  0.0463  -0.0253 414 ASP A O   
1216 C CB  . ASP A 154 ? 0.8380 0.7192 0.5292 0.0393  0.0219  -0.0156 414 ASP A CB  
1217 C CG  . ASP A 154 ? 0.9208 0.8026 0.5863 0.0418  0.0272  -0.0081 414 ASP A CG  
1218 O OD1 . ASP A 154 ? 0.9919 0.8640 0.6363 0.0506  0.0460  -0.0102 414 ASP A OD1 
1219 O OD2 . ASP A 154 ? 0.9126 0.8047 0.5794 0.0359  0.0136  0.0013  414 ASP A OD2 
1220 N N   . TYR A 155 ? 0.8408 0.6923 0.5468 0.0394  0.0188  -0.0360 415 TYR A N   
1221 C CA  . TYR A 155 ? 0.8296 0.6820 0.5630 0.0392  0.0171  -0.0370 415 TYR A CA  
1222 C C   . TYR A 155 ? 0.8665 0.7053 0.5986 0.0525  0.0347  -0.0429 415 TYR A C   
1223 O O   . TYR A 155 ? 0.8971 0.7504 0.6608 0.0579  0.0398  -0.0376 415 TYR A O   
1224 C CB  . TYR A 155 ? 0.8330 0.6690 0.5594 0.0268  -0.0010 -0.0429 415 TYR A CB  
1225 C CG  . TYR A 155 ? 0.8058 0.6363 0.5547 0.0279  0.0003  -0.0437 415 TYR A CG  
1226 C CD1 . TYR A 155 ? 0.7677 0.6207 0.5524 0.0236  -0.0049 -0.0338 415 TYR A CD1 
1227 C CD2 . TYR A 155 ? 0.7654 0.5662 0.4980 0.0347  0.0090  -0.0537 415 TYR A CD2 
1228 C CE1 . TYR A 155 ? 0.7716 0.6185 0.5737 0.0253  -0.0030 -0.0329 415 TYR A CE1 
1229 C CE2 . TYR A 155 ? 0.7538 0.5481 0.5064 0.0372  0.0110  -0.0524 415 TYR A CE2 
1230 C CZ  . TYR A 155 ? 0.8102 0.6280 0.5966 0.0322  0.0043  -0.0415 415 TYR A CZ  
1231 O OH  . TYR A 155 ? 0.8452 0.6553 0.6477 0.0348  0.0063  -0.0387 415 TYR A OH  
1232 N N   . LYS A 156 ? 0.8467 0.6579 0.5420 0.0584  0.0438  -0.0534 416 LYS A N   
1233 C CA  . LYS A 156 ? 0.8440 0.6412 0.5394 0.0731  0.0625  -0.0586 416 LYS A CA  
1234 C C   . LYS A 156 ? 0.8270 0.6550 0.5521 0.0843  0.0791  -0.0484 416 LYS A C   
1235 O O   . LYS A 156 ? 0.8326 0.6692 0.5851 0.0943  0.0880  -0.0453 416 LYS A O   
1236 C CB  . LYS A 156 ? 0.8591 0.6168 0.5045 0.0777  0.0716  -0.0732 416 LYS A CB  
1237 N N   . ASP A 157 ? 0.7956 0.6409 0.5176 0.0819  0.0819  -0.0421 417 ASP A N   
1238 C CA  . ASP A 157 ? 0.8046 0.6782 0.5543 0.0899  0.0980  -0.0329 417 ASP A CA  
1239 C C   . ASP A 157 ? 0.8145 0.7213 0.6115 0.0856  0.0901  -0.0227 417 ASP A C   
1240 O O   . ASP A 157 ? 0.7975 0.7261 0.6251 0.0929  0.1009  -0.0173 417 ASP A O   
1241 C CB  . ASP A 157 ? 0.8424 0.7194 0.5706 0.0879  0.1048  -0.0289 417 ASP A CB  
1242 C CG  . ASP A 157 ? 0.9868 0.8343 0.6687 0.0961  0.1201  -0.0378 417 ASP A CG  
1243 O OD1 . ASP A 157 ? 1.0701 0.8936 0.7380 0.1041  0.1270  -0.0482 417 ASP A OD1 
1244 O OD2 . ASP A 157 ? 0.9858 0.8319 0.6428 0.0951  0.1262  -0.0342 417 ASP A OD2 
1245 N N   . ILE A 158 ? 0.7126 0.6242 0.5157 0.0735  0.0717  -0.0200 418 ILE A N   
1246 C CA  . ILE A 158 ? 0.6839 0.6208 0.5247 0.0697  0.0651  -0.0125 418 ILE A CA  
1247 C C   . ILE A 158 ? 0.7207 0.6551 0.5776 0.0777  0.0669  -0.0140 418 ILE A C   
1248 O O   . ILE A 158 ? 0.6886 0.6456 0.5752 0.0827  0.0714  -0.0083 418 ILE A O   
1249 C CB  . ILE A 158 ? 0.5792 0.5182 0.4218 0.0566  0.0473  -0.0097 418 ILE A CB  
1250 C CG1 . ILE A 158 ? 0.5606 0.5071 0.3946 0.0511  0.0463  -0.0046 418 ILE A CG1 
1251 C CG2 . ILE A 158 ? 0.4443 0.4025 0.3193 0.0534  0.0415  -0.0039 418 ILE A CG2 
1252 C CD1 . ILE A 158 ? 0.5716 0.5167 0.4023 0.0399  0.0289  -0.0020 418 ILE A CD1 
1253 N N   . CYS A 159 ? 0.7449 0.6511 0.5818 0.0789  0.0631  -0.0214 419 CYS A N   
1254 C CA  . CYS A 159 ? 0.7110 0.6099 0.5606 0.0876  0.0652  -0.0216 419 CYS A CA  
1255 C C   . CYS A 159 ? 0.7733 0.6795 0.6350 0.1039  0.0830  -0.0204 419 CYS A C   
1256 O O   . CYS A 159 ? 0.7839 0.7068 0.6741 0.1112  0.0840  -0.0137 419 CYS A O   
1257 C CB  . CYS A 159 ? 0.6320 0.4938 0.4557 0.0848  0.0595  -0.0305 419 CYS A CB  
1258 S SG  . CYS A 159 ? 0.7881 0.6496 0.6116 0.0657  0.0384  -0.0289 419 CYS A SG  
1259 N N   . SER A 160 ? 0.7921 0.6876 0.6332 0.1102  0.0974  -0.0257 420 SER A N   
1260 C CA  . SER A 160 ? 0.8003 0.7024 0.6560 0.1272  0.1165  -0.0242 420 SER A CA  
1261 C C   . SER A 160 ? 0.7579 0.7021 0.6507 0.1284  0.1224  -0.0138 420 SER A C   
1262 O O   . SER A 160 ? 0.7755 0.7377 0.6978 0.1407  0.1322  -0.0085 420 SER A O   
1263 C CB  . SER A 160 ? 0.7955 0.6664 0.6139 0.1357  0.1335  -0.0344 420 SER A CB  
1264 O OG  . SER A 160 ? 0.8590 0.7395 0.6650 0.1322  0.1417  -0.0333 420 SER A OG  
1265 N N   . ARG A 161 ? 0.6762 0.6366 0.5706 0.1155  0.1158  -0.0103 421 ARG A N   
1266 C CA  . ARG A 161 ? 0.6810 0.6763 0.6070 0.1148  0.1234  -0.0021 421 ARG A CA  
1267 C C   . ARG A 161 ? 0.6692 0.6919 0.6274 0.1057  0.1084  0.0045  421 ARG A C   
1268 O O   . ARG A 161 ? 0.6877 0.7406 0.6783 0.1054  0.1124  0.0106  421 ARG A O   
1269 C CB  . ARG A 161 ? 0.7210 0.7143 0.6275 0.1081  0.1311  -0.0018 421 ARG A CB  
1270 C CG  . ARG A 161 ? 0.7714 0.7309 0.6314 0.1132  0.1412  -0.0098 421 ARG A CG  
1271 C CD  . ARG A 161 ? 0.8444 0.8084 0.6948 0.1157  0.1602  -0.0064 421 ARG A CD  
1272 N NE  . ARG A 161 ? 0.9094 0.8766 0.7482 0.1031  0.1526  -0.0016 421 ARG A NE  
1273 C CZ  . ARG A 161 ? 0.9758 0.9244 0.7750 0.1018  0.1585  -0.0022 421 ARG A CZ  
1274 N NH1 . ARG A 161 ? 0.9171 0.8400 0.6785 0.1112  0.1727  -0.0092 421 ARG A NH1 
1275 N NH2 . ARG A 161 ? 1.0142 0.9689 0.8099 0.0914  0.1503  0.0048  421 ARG A NH2 
1276 N N   . MET A 162 ? 0.6930 0.7050 0.6421 0.0978  0.0916  0.0031  422 MET A N   
1277 C CA  . MET A 162 ? 0.6620 0.6953 0.6347 0.0892  0.0782  0.0083  422 MET A CA  
1278 C C   . MET A 162 ? 0.6714 0.7178 0.6683 0.0989  0.0759  0.0125  422 MET A C   
1279 O O   . MET A 162 ? 0.6762 0.7038 0.6635 0.1060  0.0733  0.0113  422 MET A O   
1280 C CB  . MET A 162 ? 0.6477 0.6649 0.6026 0.0785  0.0639  0.0064  422 MET A CB  
1281 C CG  . MET A 162 ? 0.5872 0.6220 0.5598 0.0692  0.0524  0.0109  422 MET A CG  
1282 S SD  . MET A 162 ? 0.6679 0.7183 0.6480 0.0570  0.0533  0.0129  422 MET A SD  
1283 C CE  . MET A 162 ? 0.4585 0.4863 0.4105 0.0504  0.0494  0.0109  422 MET A CE  
1284 N N   . GLN A 163 ? 0.6281 0.7070 0.6569 0.0987  0.0768  0.0181  423 GLN A N   
1285 C CA  . GLN A 163 ? 0.5681 0.6669 0.6245 0.1079  0.0729  0.0241  423 GLN A CA  
1286 C C   . GLN A 163 ? 0.6112 0.7387 0.6899 0.0971  0.0594  0.0284  423 GLN A C   
1287 O O   . GLN A 163 ? 0.6295 0.7759 0.7223 0.0878  0.0619  0.0282  423 GLN A O   
1288 C CB  . GLN A 163 ? 0.5293 0.6438 0.6075 0.1206  0.0892  0.0268  423 GLN A CB  
1289 C CG  . GLN A 163 ? 0.7002 0.7835 0.7529 0.1327  0.1046  0.0213  423 GLN A CG  
1290 C CD  . GLN A 163 ? 0.7813 0.8768 0.8585 0.1514  0.1202  0.0256  423 GLN A CD  
1291 O OE1 . GLN A 163 ? 0.7507 0.8790 0.8610 0.1530  0.1287  0.0311  423 GLN A OE1 
1292 N NE2 . GLN A 163 ? 0.8283 0.8977 0.8926 0.1657  0.1244  0.0239  423 GLN A NE2 
1293 N N   . PHE A 164 ? 0.5594 0.6878 0.6389 0.0979  0.0456  0.0320  424 PHE A N   
1294 C CA  . PHE A 164 ? 0.5100 0.6629 0.6051 0.0882  0.0319  0.0351  424 PHE A CA  
1295 C C   . PHE A 164 ? 0.5610 0.7439 0.6883 0.0984  0.0279  0.0429  424 PHE A C   
1296 O O   . PHE A 164 ? 0.6139 0.7903 0.7430 0.1134  0.0283  0.0482  424 PHE A O   
1297 C CB  . PHE A 164 ? 0.4537 0.5897 0.5269 0.0829  0.0195  0.0354  424 PHE A CB  
1298 C CG  . PHE A 164 ? 0.4818 0.5897 0.5277 0.0751  0.0227  0.0295  424 PHE A CG  
1299 C CD1 . PHE A 164 ? 0.4425 0.5524 0.4836 0.0613  0.0217  0.0256  424 PHE A CD1 
1300 C CD2 . PHE A 164 ? 0.4699 0.5495 0.4964 0.0815  0.0264  0.0281  424 PHE A CD2 
1301 C CE1 . PHE A 164 ? 0.4350 0.5231 0.4556 0.0554  0.0236  0.0222  424 PHE A CE1 
1302 C CE2 . PHE A 164 ? 0.4817 0.5396 0.4867 0.0732  0.0269  0.0234  424 PHE A CE2 
1303 C CZ  . PHE A 164 ? 0.4851 0.5490 0.4885 0.0609  0.0251  0.0213  424 PHE A CZ  
1304 N N   . CYS A 165 ? 0.5544 0.7700 0.7089 0.0901  0.0237  0.0440  425 CYS A N   
1305 C CA  . CYS A 165 ? 0.6264 0.8767 0.8165 0.0979  0.0168  0.0524  425 CYS A CA  
1306 C C   . CYS A 165 ? 0.6488 0.9044 0.8325 0.0966  -0.0040 0.0572  425 CYS A C   
1307 O O   . CYS A 165 ? 0.6269 0.8612 0.7800 0.0872  -0.0115 0.0532  425 CYS A O   
1308 C CB  . CYS A 165 ? 0.6330 0.9177 0.8564 0.0867  0.0180  0.0516  425 CYS A CB  
1309 S SG  . CYS A 165 ? 1.1454 1.4313 1.3553 0.0623  0.0027  0.0442  425 CYS A SG  
1310 N N   . GLN A 166 ? 0.6527 0.9378 0.8658 0.1069  -0.0129 0.0671  426 GLN A N   
1311 C CA  . GLN A 166 ? 0.6839 0.9770 0.8908 0.1074  -0.0339 0.0740  426 GLN A CA  
1312 C C   . GLN A 166 ? 0.6870 1.0271 0.9294 0.1003  -0.0503 0.0783  426 GLN A C   
1313 O O   . GLN A 166 ? 0.6564 1.0269 0.9393 0.1033  -0.0439 0.0809  426 GLN A O   
1314 C CB  . GLN A 166 ? 0.6919 0.9701 0.8943 0.1292  -0.0326 0.0846  426 GLN A CB  
1315 C CG  . GLN A 166 ? 0.7259 0.9557 0.8862 0.1304  -0.0249 0.0803  426 GLN A CG  
1316 C CD  . GLN A 166 ? 0.7680 0.9776 0.9226 0.1508  -0.0227 0.0906  426 GLN A CD  
1317 O OE1 . GLN A 166 ? 0.7254 0.9184 0.8575 0.1515  -0.0326 0.0964  426 GLN A OE1 
1318 N NE2 . GLN A 166 ? 0.8107 1.0190 0.9845 0.1675  -0.0078 0.0929  426 GLN A NE2 
1319 N N   . PRO A 167 ? 0.6415 0.9877 0.8683 0.0900  -0.0715 0.0787  427 PRO A N   
1320 C CA  . PRO A 167 ? 0.5885 0.9783 0.8441 0.0822  -0.0922 0.0827  427 PRO A CA  
1321 C C   . PRO A 167 ? 0.5662 0.9923 0.8673 0.1006  -0.0958 0.0972  427 PRO A C   
1322 O O   . PRO A 167 ? 0.5591 1.0271 0.9037 0.0946  -0.1013 0.0989  427 PRO A O   
1323 C CB  . PRO A 167 ? 0.5626 0.9409 0.7807 0.0769  -0.1126 0.0842  427 PRO A CB  
1324 C CG  . PRO A 167 ? 0.5669 0.9000 0.7468 0.0876  -0.1007 0.0858  427 PRO A CG  
1325 C CD  . PRO A 167 ? 0.5886 0.9008 0.7684 0.0852  -0.0773 0.0760  427 PRO A CD  
1326 N N   . ASP A 168 ? 0.5468 0.9572 0.8402 0.1226  -0.0926 0.1084  428 ASP A N   
1327 C CA  . ASP A 168 ? 0.5483 0.9893 0.8857 0.1445  -0.0928 0.1239  428 ASP A CA  
1328 C C   . ASP A 168 ? 0.5598 1.0053 0.9270 0.1501  -0.0665 0.1197  428 ASP A C   
1329 O O   . ASP A 168 ? 0.5774 0.9839 0.9199 0.1553  -0.0451 0.1128  428 ASP A O   
1330 C CB  . ASP A 168 ? 0.5348 0.9492 0.8525 0.1671  -0.0922 0.1362  428 ASP A CB  
1331 C CG  . ASP A 168 ? 0.5849 1.0348 0.9465 0.1895  -0.0998 0.1553  428 ASP A CG  
1332 O OD1 . ASP A 168 ? 0.5675 1.0521 0.9788 0.1963  -0.0915 0.1587  428 ASP A OD1 
1333 O OD2 . ASP A 168 ? 0.6969 1.1404 1.0445 0.2016  -0.1137 0.1685  428 ASP A OD2 
1334 N N   . PRO A 169 ? 0.5976 1.0905 1.0167 0.1474  -0.0682 0.1234  429 PRO A N   
1335 C CA  . PRO A 169 ? 0.6475 1.1446 1.0929 0.1513  -0.0413 0.1197  429 PRO A CA  
1336 C C   . PRO A 169 ? 0.6338 1.1312 1.1035 0.1814  -0.0230 0.1313  429 PRO A C   
1337 O O   . PRO A 169 ? 0.6558 1.1644 1.1547 0.1881  -0.0002 0.1311  429 PRO A O   
1338 C CB  . PRO A 169 ? 0.6231 1.1733 1.1177 0.1349  -0.0513 0.1204  429 PRO A CB  
1339 C CG  . PRO A 169 ? 0.6303 1.2173 1.1472 0.1396  -0.0811 0.1335  429 PRO A CG  
1340 C CD  . PRO A 169 ? 0.6367 1.1824 1.0935 0.1397  -0.0945 0.1314  429 PRO A CD  
1341 N N   . SER A 170 ? 0.5686 1.0524 1.0260 0.1997  -0.0313 0.1418  430 SER A N   
1342 C CA  . SER A 170 ? 0.5382 1.0130 1.0127 0.2291  -0.0123 0.1516  430 SER A CA  
1343 C C   . SER A 170 ? 0.5455 0.9566 0.9651 0.2381  -0.0002 0.1458  430 SER A C   
1344 O O   . SER A 170 ? 0.5959 0.9887 1.0194 0.2621  0.0140  0.1528  430 SER A O   
1345 C CB  . SER A 170 ? 0.5188 1.0344 1.0356 0.2471  -0.0303 0.1721  430 SER A CB  
1346 O OG  . SER A 170 ? 0.5484 1.0439 1.0302 0.2491  -0.0514 0.1784  430 SER A OG  
1347 N N   . LEU A 171 ? 0.4784 0.8556 0.8492 0.2188  -0.0050 0.1330  431 LEU A N   
1348 C CA  . LEU A 171 ? 0.5235 0.8439 0.8462 0.2239  0.0046  0.1272  431 LEU A CA  
1349 C C   . LEU A 171 ? 0.5727 0.8625 0.8721 0.2164  0.0276  0.1112  431 LEU A C   
1350 O O   . LEU A 171 ? 0.5504 0.8576 0.8577 0.2003  0.0303  0.1033  431 LEU A O   
1351 C CB  . LEU A 171 ? 0.5114 0.8141 0.7951 0.2086  -0.0160 0.1255  431 LEU A CB  
1352 C CG  . LEU A 171 ? 0.5507 0.8696 0.8421 0.2190  -0.0375 0.1425  431 LEU A CG  
1353 C CD1 . LEU A 171 ? 0.5225 0.8231 0.7717 0.2023  -0.0550 0.1397  431 LEU A CD1 
1354 C CD2 . LEU A 171 ? 0.5692 0.8634 0.8623 0.2460  -0.0263 0.1537  431 LEU A CD2 
1355 N N   . PRO A 172 ? 0.6172 0.8593 0.8858 0.2273  0.0433  0.1063  432 PRO A N   
1356 C CA  . PRO A 172 ? 0.5707 0.7804 0.8093 0.2188  0.0616  0.0907  432 PRO A CA  
1357 C C   . PRO A 172 ? 0.5764 0.7756 0.7843 0.1938  0.0501  0.0809  432 PRO A C   
1358 O O   . PRO A 172 ? 0.6028 0.8015 0.7989 0.1857  0.0315  0.0843  432 PRO A O   
1359 C CB  . PRO A 172 ? 0.6086 0.7677 0.8165 0.2328  0.0728  0.0881  432 PRO A CB  
1360 C CG  . PRO A 172 ? 0.6624 0.8212 0.8739 0.2418  0.0565  0.1014  432 PRO A CG  
1361 C CD  . PRO A 172 ? 0.6572 0.8711 0.9157 0.2470  0.0443  0.1149  432 PRO A CD  
1362 N N   . PRO A 173 ? 0.5592 0.7484 0.7527 0.1826  0.0621  0.0695  433 PRO A N   
1363 C CA  . PRO A 173 ? 0.5215 0.6966 0.6852 0.1611  0.0529  0.0608  433 PRO A CA  
1364 C C   . PRO A 173 ? 0.5624 0.6929 0.6855 0.1596  0.0501  0.0563  433 PRO A C   
1365 O O   . PRO A 173 ? 0.6670 0.7698 0.7791 0.1737  0.0598  0.0561  433 PRO A O   
1366 C CB  . PRO A 173 ? 0.5099 0.6836 0.6698 0.1539  0.0690  0.0523  433 PRO A CB  
1367 C CG  . PRO A 173 ? 0.4752 0.6458 0.6471 0.1728  0.0897  0.0536  433 PRO A CG  
1368 C CD  . PRO A 173 ? 0.4952 0.6857 0.6986 0.1900  0.0853  0.0653  433 PRO A CD  
1369 N N   . LEU A 174 ? 0.5083 0.6314 0.6111 0.1426  0.0380  0.0526  434 LEU A N   
1370 C CA  . LEU A 174 ? 0.5188 0.6035 0.5876 0.1384  0.0355  0.0487  434 LEU A CA  
1371 C C   . LEU A 174 ? 0.5886 0.6516 0.6344 0.1294  0.0449  0.0373  434 LEU A C   
1372 O O   . LEU A 174 ? 0.5949 0.6736 0.6454 0.1194  0.0471  0.0335  434 LEU A O   
1373 C CB  . LEU A 174 ? 0.4769 0.5652 0.5363 0.1256  0.0194  0.0516  434 LEU A CB  
1374 C CG  . LEU A 174 ? 0.4900 0.6004 0.5648 0.1313  0.0058  0.0632  434 LEU A CG  
1375 C CD1 . LEU A 174 ? 0.4455 0.5560 0.5035 0.1160  -0.0069 0.0630  434 LEU A CD1 
1376 C CD2 . LEU A 174 ? 0.4652 0.5585 0.5396 0.1493  0.0069  0.0727  434 LEU A CD2 
1377 N N   . THR A 175 ? 0.5896 0.6157 0.6101 0.1322  0.0496  0.0323  435 THR A N   
1378 C CA  . THR A 175 ? 0.5862 0.5899 0.5805 0.1220  0.0539  0.0221  435 THR A CA  
1379 C C   . THR A 175 ? 0.6053 0.5954 0.5839 0.1083  0.0415  0.0217  435 THR A C   
1380 O O   . THR A 175 ? 0.6535 0.6471 0.6378 0.1083  0.0329  0.0288  435 THR A O   
1381 C CB  . THR A 175 ? 0.6193 0.5897 0.5942 0.1322  0.0659  0.0153  435 THR A CB  
1382 O OG1 . THR A 175 ? 0.7299 0.6739 0.6954 0.1359  0.0611  0.0173  435 THR A OG1 
1383 C CG2 . THR A 175 ? 0.5154 0.4983 0.5091 0.1495  0.0810  0.0175  435 THR A CG2 
1384 N N   . ILE A 176 ? 0.5678 0.5429 0.5266 0.0971  0.0410  0.0145  436 ILE A N   
1385 C CA  . ILE A 176 ? 0.5486 0.5127 0.4966 0.0841  0.0309  0.0145  436 ILE A CA  
1386 C C   . ILE A 176 ? 0.6386 0.5779 0.5792 0.0871  0.0277  0.0171  436 ILE A C   
1387 O O   . ILE A 176 ? 0.6990 0.6385 0.6413 0.0807  0.0204  0.0227  436 ILE A O   
1388 C CB  . ILE A 176 ? 0.5720 0.5229 0.5011 0.0740  0.0308  0.0068  436 ILE A CB  
1389 C CG1 . ILE A 176 ? 0.6285 0.6028 0.5649 0.0695  0.0336  0.0068  436 ILE A CG1 
1390 C CG2 . ILE A 176 ? 0.5028 0.4414 0.4245 0.0615  0.0210  0.0073  436 ILE A CG2 
1391 C CD1 . ILE A 176 ? 0.5890 0.5515 0.5053 0.0640  0.0354  0.0008  436 ILE A CD1 
1392 N N   . SER A 177 ? 0.6608 0.5764 0.5924 0.0972  0.0349  0.0134  437 SER A N   
1393 C CA  . SER A 177 ? 0.6935 0.5799 0.6168 0.0991  0.0332  0.0154  437 SER A CA  
1394 C C   . SER A 177 ? 0.7111 0.6068 0.6500 0.1094  0.0310  0.0281  437 SER A C   
1395 O O   . SER A 177 ? 0.7592 0.6323 0.6924 0.1099  0.0292  0.0328  437 SER A O   
1396 C CB  . SER A 177 ? 0.7415 0.5941 0.6473 0.1070  0.0428  0.0062  437 SER A CB  
1397 O OG  . SER A 177 ? 0.7858 0.6467 0.7039 0.1254  0.0534  0.0092  437 SER A OG  
1398 N N   . ASN A 178 ? 0.6545 0.5832 0.6132 0.1169  0.0304  0.0344  438 ASN A N   
1399 C CA  . ASN A 178 ? 0.6283 0.5690 0.6013 0.1277  0.0259  0.0474  438 ASN A CA  
1400 C C   . ASN A 178 ? 0.6657 0.6209 0.6379 0.1164  0.0144  0.0542  438 ASN A C   
1401 O O   . ASN A 178 ? 0.7005 0.6851 0.6858 0.1184  0.0076  0.0610  438 ASN A O   
1402 C CB  . ASN A 178 ? 0.5957 0.5674 0.5931 0.1410  0.0292  0.0513  438 ASN A CB  
1403 C CG  . ASN A 178 ? 0.6130 0.5685 0.6122 0.1564  0.0440  0.0468  438 ASN A CG  
1404 O OD1 . ASN A 178 ? 0.5981 0.5649 0.6023 0.1576  0.0527  0.0401  438 ASN A OD1 
1405 N ND2 . ASN A 178 ? 0.6345 0.5620 0.6285 0.1687  0.0483  0.0509  438 ASN A ND2 
1406 N N   . HIS A 179 ? 0.6487 0.5836 0.6053 0.1038  0.0125  0.0520  439 HIS A N   
1407 C CA  . HIS A 179 ? 0.6417 0.5870 0.5950 0.0931  0.0052  0.0575  439 HIS A CA  
1408 C C   . HIS A 179 ? 0.6867 0.6024 0.6274 0.0880  0.0059  0.0621  439 HIS A C   
1409 O O   . HIS A 179 ? 0.7090 0.5980 0.6428 0.0852  0.0102  0.0562  439 HIS A O   
1410 C CB  . HIS A 179 ? 0.6251 0.5867 0.5792 0.0796  0.0042  0.0494  439 HIS A CB  
1411 C CG  . HIS A 179 ? 0.6401 0.6311 0.6081 0.0826  0.0039  0.0465  439 HIS A CG  
1412 N ND1 . HIS A 179 ? 0.6556 0.6490 0.6295 0.0880  0.0106  0.0400  439 HIS A ND1 
1413 C CD2 . HIS A 179 ? 0.6479 0.6660 0.6247 0.0800  -0.0018 0.0492  439 HIS A CD2 
1414 C CE1 . HIS A 179 ? 0.6191 0.6415 0.6085 0.0885  0.0098  0.0400  439 HIS A CE1 
1415 N NE2 . HIS A 179 ? 0.6370 0.6747 0.6289 0.0831  0.0013  0.0449  439 HIS A NE2 
1416 N N   . ASP A 180 ? 0.6486 0.5679 0.5852 0.0866  0.0018  0.0728  440 ASP A N   
1417 C CA  . ASP A 180 ? 0.6523 0.5450 0.5785 0.0813  0.0042  0.0795  440 ASP A CA  
1418 C C   . ASP A 180 ? 0.6533 0.5403 0.5782 0.0643  0.0061  0.0714  440 ASP A C   
1419 O O   . ASP A 180 ? 0.7043 0.5663 0.6258 0.0575  0.0091  0.0721  440 ASP A O   
1420 C CB  . ASP A 180 ? 0.6216 0.5219 0.5402 0.0826  0.0006  0.0930  440 ASP A CB  
1421 C CG  . ASP A 180 ? 0.7212 0.6291 0.6415 0.0996  -0.0042 0.1039  440 ASP A CG  
1422 O OD1 . ASP A 180 ? 0.7646 0.6573 0.6908 0.1121  -0.0010 0.1056  440 ASP A OD1 
1423 O OD2 . ASP A 180 ? 0.7429 0.6713 0.6579 0.1006  -0.0114 0.1110  440 ASP A OD2 
1424 N N   . VAL A 181 ? 0.5909 0.5014 0.5206 0.0574  0.0041  0.0645  441 VAL A N   
1425 C CA  . VAL A 181 ? 0.6340 0.5448 0.5659 0.0430  0.0051  0.0593  441 VAL A CA  
1426 C C   . VAL A 181 ? 0.6316 0.5573 0.5687 0.0404  0.0039  0.0486  441 VAL A C   
1427 O O   . VAL A 181 ? 0.6786 0.6256 0.6194 0.0440  0.0029  0.0473  441 VAL A O   
1428 C CB  . VAL A 181 ? 0.6247 0.5484 0.5554 0.0363  0.0063  0.0656  441 VAL A CB  
1429 C CG1 . VAL A 181 ? 0.5458 0.4783 0.4847 0.0241  0.0078  0.0600  441 VAL A CG1 
1430 C CG2 . VAL A 181 ? 0.6016 0.5075 0.5251 0.0360  0.0096  0.0770  441 VAL A CG2 
1431 N N   . ILE A 182 ? 0.6443 0.5584 0.5809 0.0334  0.0033  0.0415  442 ILE A N   
1432 C CA  . ILE A 182 ? 0.6840 0.6104 0.6221 0.0309  0.0022  0.0331  442 ILE A CA  
1433 C C   . ILE A 182 ? 0.6960 0.6253 0.6393 0.0179  -0.0005 0.0322  442 ILE A C   
1434 O O   . ILE A 182 ? 0.7200 0.6330 0.6631 0.0104  -0.0029 0.0322  442 ILE A O   
1435 C CB  . ILE A 182 ? 0.7065 0.6170 0.6352 0.0362  0.0031  0.0246  442 ILE A CB  
1436 C CG1 . ILE A 182 ? 0.6590 0.5669 0.5870 0.0513  0.0076  0.0264  442 ILE A CG1 
1437 C CG2 . ILE A 182 ? 0.7089 0.6322 0.6359 0.0338  0.0028  0.0177  442 ILE A CG2 
1438 C CD1 . ILE A 182 ? 0.6600 0.5430 0.5764 0.0574  0.0115  0.0188  442 ILE A CD1 
1439 N N   . LEU A 183 ? 0.6626 0.6128 0.6128 0.0152  0.0001  0.0323  443 LEU A N   
1440 C CA  . LEU A 183 ? 0.6748 0.6312 0.6327 0.0056  -0.0025 0.0318  443 LEU A CA  
1441 C C   . LEU A 183 ? 0.6634 0.6262 0.6170 0.0070  -0.0045 0.0257  443 LEU A C   
1442 O O   . LEU A 183 ? 0.6405 0.6147 0.5935 0.0129  -0.0005 0.0245  443 LEU A O   
1443 C CB  . LEU A 183 ? 0.6643 0.6362 0.6331 0.0024  0.0019  0.0378  443 LEU A CB  
1444 C CG  . LEU A 183 ? 0.6902 0.6565 0.6592 0.0016  0.0062  0.0450  443 LEU A CG  
1445 C CD1 . LEU A 183 ? 0.6587 0.6384 0.6343 -0.0009 0.0129  0.0491  443 LEU A CD1 
1446 C CD2 . LEU A 183 ? 0.7211 0.6723 0.6949 -0.0055 0.0039  0.0477  443 LEU A CD2 
1447 N N   . TRP A 184 ? 0.6408 0.5964 0.5910 0.0008  -0.0109 0.0225  444 TRP A N   
1448 C CA  . TRP A 184 ? 0.6616 0.6209 0.6030 0.0020  -0.0132 0.0180  444 TRP A CA  
1449 C C   . TRP A 184 ? 0.6693 0.6391 0.6211 -0.0063 -0.0197 0.0220  444 TRP A C   
1450 O O   . TRP A 184 ? 0.6818 0.6468 0.6398 -0.0149 -0.0272 0.0232  444 TRP A O   
1451 C CB  . TRP A 184 ? 0.6769 0.6148 0.5974 0.0035  -0.0163 0.0095  444 TRP A CB  
1452 C CG  . TRP A 184 ? 0.7094 0.6490 0.6146 0.0076  -0.0151 0.0051  444 TRP A CG  
1453 C CD1 . TRP A 184 ? 0.6953 0.6454 0.5994 0.0037  -0.0198 0.0074  444 TRP A CD1 
1454 C CD2 . TRP A 184 ? 0.6985 0.6282 0.5871 0.0172  -0.0074 -0.0010 444 TRP A CD2 
1455 N NE1 . TRP A 184 ? 0.6916 0.6376 0.5762 0.0097  -0.0153 0.0033  444 TRP A NE1 
1456 C CE2 . TRP A 184 ? 0.6998 0.6339 0.5755 0.0179  -0.0068 -0.0023 444 TRP A CE2 
1457 C CE3 . TRP A 184 ? 0.6116 0.5298 0.4963 0.0265  0.0001  -0.0043 444 TRP A CE3 
1458 C CZ2 . TRP A 184 ? 0.6307 0.5578 0.4891 0.0268  0.0027  -0.0072 444 TRP A CZ2 
1459 C CZ3 . TRP A 184 ? 0.6162 0.5292 0.4870 0.0362  0.0093  -0.0093 444 TRP A CZ3 
1460 C CH2 . TRP A 184 ? 0.6269 0.5443 0.4845 0.0358  0.0112  -0.0110 444 TRP A CH2 
1461 N N   . LEU A 185 ? 0.6799 0.6646 0.6360 -0.0038 -0.0169 0.0249  445 LEU A N   
1462 C CA  . LEU A 185 ? 0.6581 0.6557 0.6278 -0.0088 -0.0219 0.0312  445 LEU A CA  
1463 C C   . LEU A 185 ? 0.6627 0.6642 0.6214 -0.0051 -0.0227 0.0312  445 LEU A C   
1464 O O   . LEU A 185 ? 0.6559 0.6529 0.6004 0.0012  -0.0160 0.0269  445 LEU A O   
1465 C CB  . LEU A 185 ? 0.5626 0.5734 0.5533 -0.0086 -0.0137 0.0381  445 LEU A CB  
1466 C CG  . LEU A 185 ? 0.5402 0.5547 0.5282 -0.0021 -0.0028 0.0366  445 LEU A CG  
1467 C CD1 . LEU A 185 ? 0.5052 0.5278 0.4947 0.0007  0.0004  0.0388  445 LEU A CD1 
1468 C CD2 . LEU A 185 ? 0.5156 0.5338 0.5144 -0.0029 0.0048  0.0399  445 LEU A CD2 
1469 N N   . GLY A 186 ? 0.6388 0.6491 0.6043 -0.0086 -0.0306 0.0371  446 GLY A N   
1470 C CA  . GLY A 186 ? 0.6152 0.6287 0.5693 -0.0043 -0.0307 0.0399  446 GLY A CA  
1471 C C   . GLY A 186 ? 0.6433 0.6612 0.5943 -0.0085 -0.0455 0.0447  446 GLY A C   
1472 O O   . GLY A 186 ? 0.6694 0.6900 0.6307 -0.0164 -0.0573 0.0455  446 GLY A O   
1473 N N   . ASP A 187 ? 0.6628 0.6824 0.6008 -0.0036 -0.0451 0.0492  447 ASP A N   
1474 C CA  . ASP A 187 ? 0.6924 0.7135 0.6170 -0.0064 -0.0610 0.0535  447 ASP A CA  
1475 C C   . ASP A 187 ? 0.7134 0.7136 0.5998 -0.0073 -0.0638 0.0416  447 ASP A C   
1476 O O   . ASP A 187 ? 0.7241 0.7155 0.5881 -0.0004 -0.0535 0.0395  447 ASP A O   
1477 C CB  . ASP A 187 ? 0.7320 0.7612 0.6562 0.0008  -0.0570 0.0651  447 ASP A CB  
1478 C CG  . ASP A 187 ? 0.7964 0.8256 0.6985 -0.0004 -0.0740 0.0703  447 ASP A CG  
1479 O OD1 . ASP A 187 ? 0.8312 0.8527 0.7153 -0.0081 -0.0891 0.0626  447 ASP A OD1 
1480 O OD2 . ASP A 187 ? 0.7970 0.8324 0.6984 0.0060  -0.0725 0.0825  447 ASP A OD2 
1481 N N   . LEU A 188 ? 0.6990 0.6899 0.5791 -0.0159 -0.0759 0.0335  448 LEU A N   
1482 C CA  . LEU A 188 ? 0.7661 0.7320 0.6091 -0.0168 -0.0769 0.0201  448 LEU A CA  
1483 C C   . LEU A 188 ? 0.8194 0.7785 0.6295 -0.0201 -0.0921 0.0193  448 LEU A C   
1484 O O   . LEU A 188 ? 0.8484 0.7851 0.6192 -0.0183 -0.0900 0.0090  448 LEU A O   
1485 C CB  . LEU A 188 ? 0.7819 0.7356 0.6315 -0.0246 -0.0809 0.0109  448 LEU A CB  
1486 C CG  . LEU A 188 ? 0.7246 0.6834 0.6022 -0.0212 -0.0670 0.0126  448 LEU A CG  
1487 C CD1 . LEU A 188 ? 0.7890 0.7328 0.6705 -0.0296 -0.0721 0.0056  448 LEU A CD1 
1488 C CD2 . LEU A 188 ? 0.6423 0.5959 0.5102 -0.0093 -0.0487 0.0097  448 LEU A CD2 
1489 N N   . ASN A 189 ? 0.8384 0.8169 0.6641 -0.0244 -0.1074 0.0306  449 ASN A N   
1490 C CA  . ASN A 189 ? 0.8881 0.8658 0.6841 -0.0257 -0.1230 0.0345  449 ASN A CA  
1491 C C   . ASN A 189 ? 0.9702 0.9304 0.7335 -0.0375 -0.1436 0.0223  449 ASN A C   
1492 O O   . ASN A 189 ? 1.0483 1.0029 0.7761 -0.0385 -0.1565 0.0232  449 ASN A O   
1493 C CB  . ASN A 189 ? 0.8980 0.8660 0.6629 -0.0136 -0.1074 0.0371  449 ASN A CB  
1494 C CG  . ASN A 189 ? 0.8853 0.8735 0.6675 -0.0064 -0.1054 0.0557  449 ASN A CG  
1495 O OD1 . ASN A 189 ? 0.8868 0.8933 0.6869 -0.0098 -0.1227 0.0671  449 ASN A OD1 
1496 N ND2 . ASN A 189 ? 0.8561 0.8410 0.6350 0.0037  -0.0840 0.0595  449 ASN A ND2 
1497 N N   . TYR A 190 ? 0.9836 0.9331 0.7561 -0.0472 -0.1471 0.0110  450 TYR A N   
1498 C CA  . TYR A 190 ? 0.9618 0.8931 0.7066 -0.0614 -0.1682 -0.0017 450 TYR A CA  
1499 C C   . TYR A 190 ? 0.9753 0.9347 0.7456 -0.0721 -0.1941 0.0097  450 TYR A C   
1500 O O   . TYR A 190 ? 0.9507 0.9392 0.7707 -0.0709 -0.1926 0.0237  450 TYR A O   
1501 C CB  . TYR A 190 ? 0.8909 0.8013 0.6423 -0.0690 -0.1633 -0.0157 450 TYR A CB  
1502 C CG  . TYR A 190 ? 0.9170 0.7986 0.6400 -0.0578 -0.1403 -0.0272 450 TYR A CG  
1503 C CD1 . TYR A 190 ? 0.9706 0.8169 0.6435 -0.0593 -0.1409 -0.0439 450 TYR A CD1 
1504 C CD2 . TYR A 190 ? 0.9088 0.7993 0.6556 -0.0452 -0.1179 -0.0211 450 TYR A CD2 
1505 C CE1 . TYR A 190 ? 0.9867 0.8090 0.6384 -0.0471 -0.1180 -0.0529 450 TYR A CE1 
1506 C CE2 . TYR A 190 ? 0.9243 0.7937 0.6513 -0.0345 -0.0980 -0.0297 450 TYR A CE2 
1507 C CZ  . TYR A 190 ? 0.9858 0.8222 0.6674 -0.0346 -0.0973 -0.0448 450 TYR A CZ  
1508 O OH  . TYR A 190 ? 1.0389 0.8571 0.7061 -0.0219 -0.0755 -0.0517 450 TYR A OH  
1509 N N   . ARG A 191 ? 1.0072 0.9585 0.7433 -0.0818 -0.2177 0.0043  451 ARG A N   
1510 C CA  . ARG A 191 ? 0.9678 0.9495 0.7261 -0.0907 -0.2453 0.0171  451 ARG A CA  
1511 C C   . ARG A 191 ? 1.0041 0.9789 0.7614 -0.1126 -0.2707 0.0049  451 ARG A C   
1512 O O   . ARG A 191 ? 1.0105 0.9570 0.7576 -0.1199 -0.2634 -0.0120 451 ARG A O   
1513 C CB  . ARG A 191 ? 0.9322 0.9156 0.6505 -0.0831 -0.2549 0.0252  451 ARG A CB  
1514 C CG  . ARG A 191 ? 0.9145 0.8945 0.6221 -0.0631 -0.2274 0.0335  451 ARG A CG  
1515 C CD  . ARG A 191 ? 0.8701 0.8800 0.6370 -0.0541 -0.2137 0.0509  451 ARG A CD  
1516 N NE  . ARG A 191 ? 0.8637 0.8698 0.6204 -0.0373 -0.1898 0.0588  451 ARG A NE  
1517 C CZ  . ARG A 191 ? 0.9146 0.9288 0.6576 -0.0281 -0.1921 0.0739  451 ARG A CZ  
1518 N NH1 . ARG A 191 ? 0.9909 1.0199 0.7277 -0.0325 -0.2189 0.0842  451 ARG A NH1 
1519 N NH2 . ARG A 191 ? 0.9002 0.9082 0.6370 -0.0146 -0.1676 0.0798  451 ARG A NH2 
1520 N N   . ILE A 192 ? 0.9802 0.9812 0.7512 -0.1231 -0.3007 0.0143  452 ILE A N   
1521 C CA  . ILE A 192 ? 1.0688 1.0654 0.8367 -0.1467 -0.3298 0.0027  452 ILE A CA  
1522 C C   . ILE A 192 ? 1.1949 1.1687 0.8928 -0.1524 -0.3515 -0.0084 452 ILE A C   
1523 O O   . ILE A 192 ? 1.1812 1.1660 0.8557 -0.1410 -0.3566 0.0038  452 ILE A O   
1524 C CB  . ILE A 192 ? 1.0402 1.0847 0.8734 -0.1571 -0.3519 0.0204  452 ILE A CB  
1525 C CG1 . ILE A 192 ? 0.9468 1.0149 0.8456 -0.1485 -0.3276 0.0337  452 ILE A CG1 
1526 C CG2 . ILE A 192 ? 1.0990 1.1391 0.9355 -0.1842 -0.3806 0.0073  452 ILE A CG2 
1527 C CD1 . ILE A 192 ? 0.9180 0.9614 0.8263 -0.1554 -0.3096 0.0197  452 ILE A CD1 
1528 N N   . GLU A 193 ? 1.2573 1.1968 0.9189 -0.1698 -0.3634 -0.0314 453 GLU A N   
1529 C CA  . GLU A 193 ? 1.3533 1.2634 0.9392 -0.1755 -0.3813 -0.0456 453 GLU A CA  
1530 C C   . GLU A 193 ? 1.4354 1.3469 1.0139 -0.2035 -0.4222 -0.0561 453 GLU A C   
1531 O O   . GLU A 193 ? 1.4165 1.3406 1.0444 -0.2210 -0.4325 -0.0582 453 GLU A O   
1532 C CB  . GLU A 193 ? 1.3805 1.2365 0.9077 -0.1670 -0.3539 -0.0672 453 GLU A CB  
1533 C CG  . GLU A 193 ? 1.4513 1.2771 0.9885 -0.1789 -0.3446 -0.0864 453 GLU A CG  
1534 C CD  . GLU A 193 ? 1.5738 1.3428 1.0437 -0.1726 -0.3245 -0.1097 453 GLU A CD  
1535 O OE1 . GLU A 193 ? 1.5885 1.3500 1.0427 -0.1503 -0.2952 -0.1055 453 GLU A OE1 
1536 O OE2 . GLU A 193 ? 1.6575 1.3896 1.0917 -0.1901 -0.3376 -0.1321 453 GLU A OE2 
1537 N N   . GLU A 194 ? 1.5002 1.3991 1.0163 -0.2082 -0.4456 -0.0620 454 GLU A N   
1538 C CA  . GLU A 194 ? 1.5778 1.4806 1.0808 -0.2352 -0.4891 -0.0713 454 GLU A CA  
1539 C C   . GLU A 194 ? 1.5446 1.5114 1.1177 -0.2430 -0.5193 -0.0460 454 GLU A C   
1540 O O   . GLU A 194 ? 1.5955 1.5807 1.1458 -0.2495 -0.5534 -0.0391 454 GLU A O   
1541 C CB  . GLU A 194 ? 1.5964 1.4618 1.0946 -0.2584 -0.4917 -0.0984 454 GLU A CB  
1542 N N   . LEU A 195 ? 1.4345 1.4351 1.0910 -0.2416 -0.5068 -0.0318 455 LEU A N   
1543 C CA  . LEU A 195 ? 1.3655 1.4273 1.0963 -0.2492 -0.5324 -0.0084 455 LEU A CA  
1544 C C   . LEU A 195 ? 1.3687 1.4674 1.1048 -0.2283 -0.5382 0.0191  455 LEU A C   
1545 O O   . LEU A 195 ? 1.3262 1.4167 1.0490 -0.2032 -0.5075 0.0280  455 LEU A O   
1546 C CB  . LEU A 195 ? 1.2643 1.3502 1.0793 -0.2493 -0.5110 0.0011  455 LEU A CB  
1547 C CG  . LEU A 195 ? 1.2364 1.2919 1.0618 -0.2696 -0.5037 -0.0205 455 LEU A CG  
1548 C CD1 . LEU A 195 ? 1.1588 1.2400 1.0646 -0.2650 -0.4782 -0.0065 455 LEU A CD1 
1549 C CD2 . LEU A 195 ? 1.2243 1.2805 1.0457 -0.3022 -0.5450 -0.0336 455 LEU A CD2 
1550 N N   . ASP A 196 ? 1.4068 1.5462 1.1642 -0.2395 -0.5785 0.0329  456 ASP A N   
1551 C CA  . ASP A 196 ? 1.4069 1.5824 1.1690 -0.2214 -0.5904 0.0607  456 ASP A CA  
1552 C C   . ASP A 196 ? 1.3790 1.5943 1.2213 -0.2011 -0.5645 0.0871  456 ASP A C   
1553 O O   . ASP A 196 ? 1.3323 1.5641 1.2402 -0.2079 -0.5525 0.0876  456 ASP A O   
1554 C CB  . ASP A 196 ? 1.4007 1.6130 1.1718 -0.2402 -0.6434 0.0690  456 ASP A CB  
1555 N N   . VAL A 197 ? 1.3863 1.6142 1.2210 -0.1762 -0.5549 0.1089  457 VAL A N   
1556 C CA  . VAL A 197 ? 1.3099 1.5697 1.2132 -0.1550 -0.5283 0.1333  457 VAL A CA  
1557 C C   . VAL A 197 ? 1.2767 1.5953 1.2693 -0.1634 -0.5499 0.1527  457 VAL A C   
1558 O O   . VAL A 197 ? 1.2335 1.5749 1.2935 -0.1541 -0.5258 0.1649  457 VAL A O   
1559 C CB  . VAL A 197 ? 1.0444 1.3034 0.9188 -0.1278 -0.5162 0.1535  457 VAL A CB  
1560 C CG1 . VAL A 197 ? 1.0742 1.3694 0.9501 -0.1268 -0.5557 0.1760  457 VAL A CG1 
1561 C CG2 . VAL A 197 ? 0.9786 1.2509 0.9080 -0.1060 -0.4780 0.1698  457 VAL A CG2 
1562 N N   . GLU A 198 ? 1.2850 1.6278 1.2766 -0.1816 -0.5953 0.1551  458 GLU A N   
1563 C CA  . GLU A 198 ? 1.2176 1.6182 1.2949 -0.1939 -0.6203 0.1716  458 GLU A CA  
1564 C C   . GLU A 198 ? 1.1551 1.5522 1.2779 -0.2145 -0.6087 0.1549  458 GLU A C   
1565 O O   . GLU A 198 ? 1.0900 1.5212 1.2930 -0.2097 -0.5920 0.1699  458 GLU A O   
1566 C CB  . GLU A 198 ? 1.2634 1.6881 1.3218 -0.2114 -0.6751 0.1753  458 GLU A CB  
1567 N N   . LYS A 199 ? 1.1616 1.5150 1.2318 -0.2363 -0.6153 0.1246  459 LYS A N   
1568 C CA  . LYS A 199 ? 1.1300 1.4747 1.2375 -0.2574 -0.6058 0.1085  459 LYS A CA  
1569 C C   . LYS A 199 ? 1.1345 1.4651 1.2693 -0.2395 -0.5556 0.1101  459 LYS A C   
1570 O O   . LYS A 199 ? 1.0919 1.4416 1.2926 -0.2471 -0.5428 0.1141  459 LYS A O   
1571 C CB  . LYS A 199 ? 1.1385 1.4295 1.1746 -0.2810 -0.6186 0.0746  459 LYS A CB  
1572 N N   . VAL A 200 ? 1.1736 1.4710 1.2567 -0.2162 -0.5274 0.1075  460 VAL A N   
1573 C CA  . VAL A 200 ? 1.1136 1.3917 1.2096 -0.1998 -0.4817 0.1059  460 VAL A CA  
1574 C C   . VAL A 200 ? 1.1050 1.4290 1.2792 -0.1836 -0.4650 0.1329  460 VAL A C   
1575 O O   . VAL A 200 ? 1.1278 1.4500 1.3392 -0.1804 -0.4356 0.1326  460 VAL A O   
1576 C CB  . VAL A 200 ? 1.0838 1.3187 1.1072 -0.1798 -0.4582 0.0974  460 VAL A CB  
1577 C CG1 . VAL A 200 ? 1.0282 1.2541 1.0737 -0.1604 -0.4138 0.1014  460 VAL A CG1 
1578 C CG2 . VAL A 200 ? 1.0996 1.2826 1.0488 -0.1942 -0.4646 0.0679  460 VAL A CG2 
1579 N N   . LYS A 201 ? 1.0743 1.4372 1.2712 -0.1725 -0.4825 0.1564  461 LYS A N   
1580 C CA  . LYS A 201 ? 0.9902 1.3972 1.2640 -0.1565 -0.4673 0.1827  461 LYS A CA  
1581 C C   . LYS A 201 ? 1.0013 1.4486 1.3523 -0.1759 -0.4805 0.1886  461 LYS A C   
1582 O O   . LYS A 201 ? 0.9840 1.4458 1.3914 -0.1701 -0.4528 0.1965  461 LYS A O   
1583 C CB  . LYS A 201 ? 0.9477 1.3845 1.2259 -0.1381 -0.4829 0.2078  461 LYS A CB  
1584 C CG  . LYS A 201 ? 0.9333 1.3391 1.1585 -0.1128 -0.4586 0.2106  461 LYS A CG  
1585 C CD  . LYS A 201 ? 0.9589 1.3960 1.1916 -0.0967 -0.4787 0.2380  461 LYS A CD  
1586 C CE  . LYS A 201 ? 0.9576 1.3700 1.1524 -0.0700 -0.4523 0.2470  461 LYS A CE  
1587 N NZ  . LYS A 201 ? 0.9575 1.4082 1.1869 -0.0514 -0.4648 0.2797  461 LYS A NZ  
1588 N N   . LYS A 202 ? 1.0224 1.4868 1.3745 -0.1997 -0.5224 0.1845  462 LYS A N   
1589 C CA  . LYS A 202 ? 0.9777 1.4845 1.4065 -0.2217 -0.5400 0.1910  462 LYS A CA  
1590 C C   . LYS A 202 ? 0.9891 1.4694 1.4313 -0.2360 -0.5140 0.1734  462 LYS A C   
1591 O O   . LYS A 202 ? 0.9538 1.4646 1.4699 -0.2383 -0.4988 0.1854  462 LYS A O   
1592 C CB  . LYS A 202 ? 0.9465 1.4706 1.3637 -0.2478 -0.5929 0.1859  462 LYS A CB  
1593 N N   . LEU A 203 ? 1.0365 1.4592 1.4073 -0.2444 -0.5072 0.1461  463 LEU A N   
1594 C CA  . LEU A 203 ? 1.0641 1.4560 1.4409 -0.2539 -0.4795 0.1308  463 LEU A CA  
1595 C C   . LEU A 203 ? 1.0250 1.4256 1.4413 -0.2304 -0.4360 0.1453  463 LEU A C   
1596 O O   . LEU A 203 ? 1.0157 1.4255 1.4822 -0.2379 -0.4179 0.1482  463 LEU A O   
1597 C CB  . LEU A 203 ? 1.1024 1.4284 1.3921 -0.2582 -0.4729 0.1018  463 LEU A CB  
1598 C CG  . LEU A 203 ? 1.1517 1.4544 1.4026 -0.2878 -0.5076 0.0798  463 LEU A CG  
1599 C CD1 . LEU A 203 ? 1.1829 1.4197 1.3430 -0.2843 -0.4961 0.0536  463 LEU A CD1 
1600 C CD2 . LEU A 203 ? 1.1473 1.4579 1.4519 -0.3156 -0.5121 0.0748  463 LEU A CD2 
1601 N N   . ILE A 204 ? 1.0018 1.3985 1.3944 -0.2029 -0.4192 0.1545  464 ILE A N   
1602 C CA  . ILE A 204 ? 0.9874 1.3898 1.4116 -0.1802 -0.3792 0.1670  464 ILE A CA  
1603 C C   . ILE A 204 ? 0.9759 1.4356 1.4891 -0.1766 -0.3777 0.1927  464 ILE A C   
1604 O O   . ILE A 204 ? 0.9422 1.4074 1.4950 -0.1693 -0.3461 0.1991  464 ILE A O   
1605 C CB  . ILE A 204 ? 0.9547 1.3368 1.3314 -0.1532 -0.3623 0.1698  464 ILE A CB  
1606 C CG1 . ILE A 204 ? 0.9689 1.2942 1.2655 -0.1543 -0.3536 0.1450  464 ILE A CG1 
1607 C CG2 . ILE A 204 ? 0.8899 1.2804 1.3023 -0.1314 -0.3241 0.1831  464 ILE A CG2 
1608 C CD1 . ILE A 204 ? 0.9583 1.2646 1.2034 -0.1328 -0.3447 0.1467  464 ILE A CD1 
1609 N N   . GLU A 205 ? 1.0001 1.5029 1.5451 -0.1809 -0.4112 0.2081  465 GLU A N   
1610 C CA  . GLU A 205 ? 0.9867 1.5482 1.6239 -0.1794 -0.4119 0.2329  465 GLU A CA  
1611 C C   . GLU A 205 ? 0.9712 1.5391 1.6568 -0.2002 -0.4006 0.2279  465 GLU A C   
1612 O O   . GLU A 205 ? 0.9484 1.5254 1.6770 -0.1892 -0.3659 0.2376  465 GLU A O   
1613 C CB  . GLU A 205 ? 0.9973 1.6069 1.6640 -0.1865 -0.4568 0.2488  465 GLU A CB  
1614 C CG  . GLU A 205 ? 0.9892 1.6183 1.6551 -0.1581 -0.4584 0.2704  465 GLU A CG  
1615 N N   . GLU A 206 ? 0.9896 1.5484 1.6636 -0.2302 -0.4280 0.2120  466 GLU A N   
1616 C CA  . GLU A 206 ? 0.9965 1.5635 1.7209 -0.2534 -0.4211 0.2090  466 GLU A CA  
1617 C C   . GLU A 206 ? 0.9614 1.4744 1.6481 -0.2532 -0.3847 0.1912  466 GLU A C   
1618 O O   . GLU A 206 ? 0.9505 1.4563 1.6610 -0.2740 -0.3792 0.1847  466 GLU A O   
1619 C CB  . GLU A 206 ? 1.0530 1.6323 1.7852 -0.2880 -0.4660 0.1996  466 GLU A CB  
1620 N N   . LYS A 207 ? 0.9280 1.4041 1.5577 -0.2297 -0.3603 0.1845  467 LYS A N   
1621 C CA  . LYS A 207 ? 0.8612 1.2929 1.4609 -0.2235 -0.3232 0.1724  467 LYS A CA  
1622 C C   . LYS A 207 ? 0.9074 1.2924 1.4625 -0.2461 -0.3299 0.1480  467 LYS A C   
1623 O O   . LYS A 207 ? 0.8673 1.2227 1.4140 -0.2461 -0.3021 0.1411  467 LYS A O   
1624 C CB  . LYS A 207 ? 0.7633 1.2201 1.4290 -0.2166 -0.2901 0.1893  467 LYS A CB  
1625 C CG  . LYS A 207 ? 0.6972 1.1787 1.3862 -0.1869 -0.2687 0.2084  467 LYS A CG  
1626 C CD  . LYS A 207 ? 0.6670 1.1667 1.4128 -0.1788 -0.2318 0.2228  467 LYS A CD  
1627 C CE  . LYS A 207 ? 1.1255 1.5786 1.8342 -0.1769 -0.1978 0.2096  467 LYS A CE  
1628 N NZ  . LYS A 207 ? 1.1082 1.5199 1.7483 -0.1560 -0.1804 0.1981  467 LYS A NZ  
1629 N N   . ASP A 208 ? 0.9989 1.3741 1.5214 -0.2639 -0.3659 0.1347  468 ASP A N   
1630 C CA  . ASP A 208 ? 1.0731 1.4001 1.5505 -0.2852 -0.3731 0.1101  468 ASP A CA  
1631 C C   . ASP A 208 ? 1.0576 1.3309 1.4509 -0.2690 -0.3597 0.0923  468 ASP A C   
1632 O O   . ASP A 208 ? 1.0889 1.3396 1.4260 -0.2733 -0.3820 0.0778  468 ASP A O   
1633 C CB  . ASP A 208 ? 1.1598 1.4981 1.6395 -0.3142 -0.4179 0.1019  468 ASP A CB  
1634 C CG  . ASP A 208 ? 1.2589 1.5527 1.7145 -0.3414 -0.4230 0.0791  468 ASP A CG  
1635 O OD1 . ASP A 208 ? 1.2785 1.5202 1.6858 -0.3343 -0.3982 0.0643  468 ASP A OD1 
1636 O OD2 . ASP A 208 ? 1.3244 1.6353 1.8111 -0.3705 -0.4524 0.0763  468 ASP A OD2 
1637 N N   . PHE A 209 ? 1.0129 1.2664 1.3980 -0.2507 -0.3226 0.0937  469 PHE A N   
1638 C CA  . PHE A 209 ? 1.0083 1.2177 1.3240 -0.2332 -0.3068 0.0800  469 PHE A CA  
1639 C C   . PHE A 209 ? 1.0581 1.2140 1.3251 -0.2464 -0.3063 0.0566  469 PHE A C   
1640 O O   . PHE A 209 ? 1.0959 1.2143 1.3047 -0.2334 -0.2950 0.0439  469 PHE A O   
1641 C CB  . PHE A 209 ? 0.9561 1.1660 1.2821 -0.2094 -0.2694 0.0902  469 PHE A CB  
1642 C CG  . PHE A 209 ? 0.9227 1.1780 1.2926 -0.1936 -0.2647 0.1121  469 PHE A CG  
1643 C CD1 . PHE A 209 ? 0.9171 1.1878 1.2704 -0.1830 -0.2816 0.1175  469 PHE A CD1 
1644 C CD2 . PHE A 209 ? 0.8878 1.1682 1.3136 -0.1884 -0.2417 0.1278  469 PHE A CD2 
1645 C CE1 . PHE A 209 ? 0.8955 1.2052 1.2898 -0.1669 -0.2761 0.1385  469 PHE A CE1 
1646 C CE2 . PHE A 209 ? 0.8854 1.2047 1.3516 -0.1723 -0.2351 0.1475  469 PHE A CE2 
1647 C CZ  . PHE A 209 ? 0.8780 1.2118 1.3296 -0.1613 -0.2526 0.1531  469 PHE A CZ  
1648 N N   . GLN A 210 ? 1.0602 1.2117 1.3527 -0.2717 -0.3164 0.0514  470 GLN A N   
1649 C CA  . GLN A 210 ? 1.1061 1.2034 1.3549 -0.2846 -0.3149 0.0295  470 GLN A CA  
1650 C C   . GLN A 210 ? 1.1518 1.2241 1.3418 -0.2937 -0.3436 0.0101  470 GLN A C   
1651 O O   . GLN A 210 ? 1.1699 1.1952 1.2980 -0.2857 -0.3346 -0.0071 470 GLN A O   
1652 C CB  . GLN A 210 ? 1.1626 1.2597 1.4577 -0.3098 -0.3152 0.0305  470 GLN A CB  
1653 C CG  . GLN A 210 ? 1.1769 1.2792 1.5098 -0.2992 -0.2793 0.0453  470 GLN A CG  
1654 C CD  . GLN A 210 ? 1.2336 1.3187 1.5961 -0.3226 -0.2734 0.0435  470 GLN A CD  
1655 O OE1 . GLN A 210 ? 1.2933 1.3784 1.6709 -0.3504 -0.2987 0.0359  470 GLN A OE1 
1656 N NE2 . GLN A 210 ? 1.1783 1.2481 1.5484 -0.3120 -0.2403 0.0510  470 GLN A NE2 
1657 N N   . MET A 211 ? 1.1585 1.2635 1.3676 -0.3093 -0.3778 0.0137  471 MET A N   
1658 C CA  . MET A 211 ? 1.2135 1.2972 1.3652 -0.3202 -0.4085 -0.0041 471 MET A CA  
1659 C C   . MET A 211 ? 1.2058 1.2751 1.2980 -0.2943 -0.4007 -0.0066 471 MET A C   
1660 O O   . MET A 211 ? 1.2669 1.2927 1.2908 -0.2953 -0.4061 -0.0269 471 MET A O   
1661 C CB  . MET A 211 ? 1.2518 1.3829 1.4415 -0.3396 -0.4482 0.0049  471 MET A CB  
1662 C CG  . MET A 211 ? 1.3057 1.4181 1.4338 -0.3525 -0.4843 -0.0127 471 MET A CG  
1663 S SD  . MET A 211 ? 1.5890 1.6296 1.6558 -0.3789 -0.4926 -0.0483 471 MET A SD  
1664 C CE  . MET A 211 ? 1.9831 2.0372 2.0229 -0.4052 -0.5485 -0.0584 471 MET A CE  
1665 N N   . LEU A 212 ? 1.1455 1.2500 1.2641 -0.2713 -0.3866 0.0141  472 LEU A N   
1666 C CA  . LEU A 212 ? 1.1333 1.2291 1.2035 -0.2469 -0.3780 0.0152  472 LEU A CA  
1667 C C   . LEU A 212 ? 1.1161 1.1610 1.1355 -0.2334 -0.3484 -0.0003 472 LEU A C   
1668 O O   . LEU A 212 ? 1.1103 1.1265 1.0678 -0.2241 -0.3481 -0.0119 472 LEU A O   
1669 C CB  . LEU A 212 ? 1.0773 1.2190 1.1940 -0.2263 -0.3656 0.0410  472 LEU A CB  
1670 C CG  . LEU A 212 ? 1.1163 1.2706 1.2037 -0.2081 -0.3730 0.0501  472 LEU A CG  
1671 C CD1 . LEU A 212 ? 1.1890 1.3569 1.2591 -0.2230 -0.4138 0.0487  472 LEU A CD1 
1672 C CD2 . LEU A 212 ? 1.0770 1.2733 1.2188 -0.1895 -0.3577 0.0753  472 LEU A CD2 
1673 N N   . TYR A 213 ? 1.1248 1.1594 1.1714 -0.2323 -0.3235 0.0004  473 TYR A N   
1674 C CA  . TYR A 213 ? 1.1361 1.1276 1.1444 -0.2188 -0.2953 -0.0113 473 TYR A CA  
1675 C C   . TYR A 213 ? 1.1858 1.1272 1.1303 -0.2282 -0.3050 -0.0361 473 TYR A C   
1676 O O   . TYR A 213 ? 1.1914 1.1032 1.0859 -0.2123 -0.2906 -0.0456 473 TYR A O   
1677 C CB  . TYR A 213 ? 1.1230 1.1117 1.1721 -0.2205 -0.2725 -0.0058 473 TYR A CB  
1678 C CG  . TYR A 213 ? 1.1759 1.1293 1.1951 -0.2028 -0.2422 -0.0123 473 TYR A CG  
1679 C CD1 . TYR A 213 ? 1.1548 1.1064 1.1451 -0.1794 -0.2272 -0.0106 473 TYR A CD1 
1680 C CD2 . TYR A 213 ? 1.1888 1.1121 1.2120 -0.2097 -0.2286 -0.0187 473 TYR A CD2 
1681 C CE1 . TYR A 213 ? 1.1065 1.0307 1.0749 -0.1640 -0.2017 -0.0156 473 TYR A CE1 
1682 C CE2 . TYR A 213 ? 1.1598 1.0541 1.1585 -0.1925 -0.2027 -0.0226 473 TYR A CE2 
1683 C CZ  . TYR A 213 ? 1.1408 1.0374 1.1134 -0.1702 -0.1904 -0.0213 473 TYR A CZ  
1684 O OH  . TYR A 213 ? 1.1867 1.0587 1.1396 -0.1541 -0.1670 -0.0245 473 TYR A OH  
1685 N N   . ALA A 214 ? 1.2287 1.1607 1.1744 -0.2543 -0.3297 -0.0470 474 ALA A N   
1686 C CA  . ALA A 214 ? 1.2643 1.1446 1.1463 -0.2650 -0.3397 -0.0726 474 ALA A CA  
1687 C C   . ALA A 214 ? 1.2744 1.1423 1.0924 -0.2517 -0.3458 -0.0801 474 ALA A C   
1688 O O   . ALA A 214 ? 1.3089 1.1281 1.0660 -0.2523 -0.3431 -0.1014 474 ALA A O   
1689 C CB  . ALA A 214 ? 1.2697 1.1485 1.1650 -0.2980 -0.3713 -0.0823 474 ALA A CB  
1690 N N   . TYR A 215 ? 1.2426 1.1522 1.0736 -0.2393 -0.3523 -0.0622 475 TYR A N   
1691 C CA  . TYR A 215 ? 1.2753 1.1764 1.0483 -0.2254 -0.3562 -0.0652 475 TYR A CA  
1692 C C   . TYR A 215 ? 1.2600 1.1698 1.0331 -0.1960 -0.3255 -0.0523 475 TYR A C   
1693 O O   . TYR A 215 ? 1.2620 1.1694 0.9947 -0.1825 -0.3245 -0.0505 475 TYR A O   
1694 C CB  . TYR A 215 ? 1.3019 1.2404 1.0814 -0.2351 -0.3918 -0.0547 475 TYR A CB  
1695 C CG  . TYR A 215 ? 1.3753 1.3052 1.1455 -0.2655 -0.4271 -0.0691 475 TYR A CG  
1696 C CD1 . TYR A 215 ? 1.4707 1.3589 1.1649 -0.2746 -0.4430 -0.0916 475 TYR A CD1 
1697 C CD2 . TYR A 215 ? 1.3623 1.3257 1.1994 -0.2862 -0.4447 -0.0606 475 TYR A CD2 
1698 C CE1 . TYR A 215 ? 1.5330 1.4109 1.2152 -0.3047 -0.4775 -0.1069 475 TYR A CE1 
1699 C CE2 . TYR A 215 ? 1.4278 1.3846 1.2591 -0.3168 -0.4791 -0.0745 475 TYR A CE2 
1700 C CZ  . TYR A 215 ? 1.5087 1.4217 1.2611 -0.3266 -0.4965 -0.0984 475 TYR A CZ  
1701 O OH  . TYR A 215 ? 1.5456 1.4495 1.2886 -0.3587 -0.5321 -0.1140 475 TYR A OH  
1702 N N   . ASP A 216 ? 1.2180 1.1370 1.0347 -0.1870 -0.3005 -0.0434 476 ASP A N   
1703 C CA  . ASP A 216 ? 1.1382 1.0645 0.9571 -0.1618 -0.2723 -0.0328 476 ASP A CA  
1704 C C   . ASP A 216 ? 1.1200 1.0012 0.8832 -0.1504 -0.2524 -0.0495 476 ASP A C   
1705 O O   . ASP A 216 ? 1.1075 0.9554 0.8607 -0.1560 -0.2436 -0.0636 476 ASP A O   
1706 C CB  . ASP A 216 ? 1.0956 1.0431 0.9731 -0.1568 -0.2528 -0.0197 476 ASP A CB  
1707 C CG  . ASP A 216 ? 1.0681 1.0139 0.9416 -0.1333 -0.2228 -0.0138 476 ASP A CG  
1708 O OD1 . ASP A 216 ? 1.0642 1.0309 0.9378 -0.1199 -0.2195 -0.0022 476 ASP A OD1 
1709 O OD2 . ASP A 216 ? 1.0446 0.9682 0.9165 -0.1286 -0.2030 -0.0202 476 ASP A OD2 
1710 N N   . GLN A 217 ? 1.1065 0.9868 0.8360 -0.1340 -0.2442 -0.0466 477 GLN A N   
1711 C CA  . GLN A 217 ? 1.1032 0.9445 0.7797 -0.1216 -0.2246 -0.0609 477 GLN A CA  
1712 C C   . GLN A 217 ? 1.0685 0.8956 0.7631 -0.1114 -0.1965 -0.0634 477 GLN A C   
1713 O O   . GLN A 217 ? 1.1095 0.8983 0.7699 -0.1077 -0.1840 -0.0790 477 GLN A O   
1714 C CB  . GLN A 217 ? 1.0772 0.9282 0.7277 -0.1043 -0.2160 -0.0520 477 GLN A CB  
1715 C CG  . GLN A 217 ? 1.1499 0.9961 0.7533 -0.1098 -0.2382 -0.0548 477 GLN A CG  
1716 C CD  . GLN A 217 ? 1.1838 1.0376 0.7629 -0.0914 -0.2254 -0.0437 477 GLN A CD  
1717 O OE1 . GLN A 217 ? 1.0836 0.9546 0.6920 -0.0767 -0.2038 -0.0313 477 GLN A OE1 
1718 N NE2 . GLN A 217 ? 1.2721 1.1119 0.7960 -0.0933 -0.2390 -0.0482 477 GLN A NE2 
1719 N N   . LEU A 218 ? 0.9747 0.8317 0.7213 -0.1059 -0.1863 -0.0479 478 LEU A N   
1720 C CA  . LEU A 218 ? 0.9679 0.8136 0.7301 -0.0960 -0.1619 -0.0488 478 LEU A CA  
1721 C C   . LEU A 218 ? 0.9867 0.8059 0.7537 -0.1096 -0.1650 -0.0597 478 LEU A C   
1722 O O   . LEU A 218 ? 1.0301 0.8185 0.7796 -0.1023 -0.1486 -0.0692 478 LEU A O   
1723 C CB  . LEU A 218 ? 0.9350 0.8162 0.7458 -0.0874 -0.1503 -0.0306 478 LEU A CB  
1724 C CG  . LEU A 218 ? 0.8854 0.7580 0.7120 -0.0779 -0.1278 -0.0300 478 LEU A CG  
1725 C CD1 . LEU A 218 ? 0.8830 0.7282 0.6725 -0.0641 -0.1113 -0.0404 478 LEU A CD1 
1726 C CD2 . LEU A 218 ? 0.8651 0.7715 0.7304 -0.0692 -0.1173 -0.0134 478 LEU A CD2 
1727 N N   . LYS A 219 ? 0.9583 0.7894 0.7509 -0.1290 -0.1853 -0.0576 479 LYS A N   
1728 C CA  . LYS A 219 ? 1.0126 0.8167 0.8108 -0.1445 -0.1888 -0.0677 479 LYS A CA  
1729 C C   . LYS A 219 ? 1.1160 0.8707 0.8571 -0.1465 -0.1892 -0.0897 479 LYS A C   
1730 O O   . LYS A 219 ? 1.1706 0.8909 0.9010 -0.1418 -0.1728 -0.0984 479 LYS A O   
1731 C CB  . LYS A 219 ? 1.0724 0.8973 0.9037 -0.1679 -0.2138 -0.0635 479 LYS A CB  
1732 C CG  . LYS A 219 ? 1.1372 0.9344 0.9806 -0.1857 -0.2154 -0.0723 479 LYS A CG  
1733 C CD  . LYS A 219 ? 1.1954 1.0018 1.0544 -0.2131 -0.2453 -0.0759 479 LYS A CD  
1734 C CE  . LYS A 219 ? 1.2385 1.0173 1.1149 -0.2323 -0.2448 -0.0831 479 LYS A CE  
1735 N NZ  . LYS A 219 ? 1.3040 1.0249 1.1261 -0.2404 -0.2479 -0.1080 479 LYS A NZ  
1736 N N   . ILE A 220 ? 1.1120 0.8621 0.8148 -0.1522 -0.2071 -0.0982 480 ILE A N   
1737 C CA  . ILE A 220 ? 1.1731 0.8738 0.8150 -0.1553 -0.2085 -0.1209 480 ILE A CA  
1738 C C   . ILE A 220 ? 1.2017 0.8727 0.8162 -0.1328 -0.1778 -0.1273 480 ILE A C   
1739 O O   . ILE A 220 ? 1.2551 0.8817 0.8470 -0.1340 -0.1683 -0.1428 480 ILE A O   
1740 C CB  . ILE A 220 ? 1.1787 0.8830 0.7784 -0.1611 -0.2304 -0.1262 480 ILE A CB  
1741 C CG1 . ILE A 220 ? 1.1300 0.8540 0.7515 -0.1874 -0.2647 -0.1250 480 ILE A CG1 
1742 C CG2 . ILE A 220 ? 1.2392 0.8903 0.7678 -0.1590 -0.2251 -0.1496 480 ILE A CG2 
1743 C CD1 . ILE A 220 ? 1.1246 0.8710 0.7225 -0.1911 -0.2893 -0.1207 480 ILE A CD1 
1744 N N   . GLN A 221 ? 1.1552 0.8512 0.7757 -0.1126 -0.1621 -0.1147 481 GLN A N   
1745 C CA  . GLN A 221 ? 1.1679 0.8436 0.7664 -0.0905 -0.1339 -0.1187 481 GLN A CA  
1746 C C   . GLN A 221 ? 1.1614 0.8274 0.7901 -0.0829 -0.1151 -0.1158 481 GLN A C   
1747 O O   . GLN A 221 ? 1.1836 0.8159 0.7891 -0.0712 -0.0968 -0.1259 481 GLN A O   
1748 C CB  . GLN A 221 ? 1.1163 0.8248 0.7195 -0.0734 -0.1230 -0.1047 481 GLN A CB  
1749 C CG  . GLN A 221 ? 1.1433 0.8555 0.7066 -0.0747 -0.1352 -0.1063 481 GLN A CG  
1750 C CD  . GLN A 221 ? 1.2441 0.9094 0.7435 -0.0787 -0.1375 -0.1280 481 GLN A CD  
1751 O OE1 . GLN A 221 ? 1.2661 0.8985 0.7417 -0.0669 -0.1156 -0.1392 481 GLN A OE1 
1752 N NE2 . GLN A 221 ? 1.2466 0.9082 0.7173 -0.0953 -0.1645 -0.1342 481 GLN A NE2 
1753 N N   . VAL A 222 ? 1.1204 0.8157 0.7998 -0.0883 -0.1187 -0.1012 482 VAL A N   
1754 C CA  . VAL A 222 ? 1.1281 0.8138 0.8348 -0.0834 -0.1038 -0.0968 482 VAL A CA  
1755 C C   . VAL A 222 ? 1.2009 0.8388 0.8892 -0.0953 -0.1065 -0.1126 482 VAL A C   
1756 O O   . VAL A 222 ? 1.2660 0.8741 0.9462 -0.0840 -0.0888 -0.1170 482 VAL A O   
1757 C CB  . VAL A 222 ? 1.0348 0.7597 0.7952 -0.0886 -0.1074 -0.0783 482 VAL A CB  
1758 C CG1 . VAL A 222 ? 0.9559 0.6666 0.7389 -0.0859 -0.0941 -0.0737 482 VAL A CG1 
1759 C CG2 . VAL A 222 ? 0.9677 0.7325 0.7444 -0.0747 -0.1004 -0.0642 482 VAL A CG2 
1760 N N   . ALA A 223 ? 1.1773 0.8070 0.8592 -0.1181 -0.1288 -0.1209 483 ALA A N   
1761 C CA  . ALA A 223 ? 1.1942 0.7739 0.8535 -0.1320 -0.1326 -0.1386 483 ALA A CA  
1762 C C   . ALA A 223 ? 1.2609 0.7939 0.8621 -0.1206 -0.1206 -0.1581 483 ALA A C   
1763 O O   . ALA A 223 ? 1.3227 0.8082 0.9066 -0.1210 -0.1107 -0.1708 483 ALA A O   
1764 C CB  . ALA A 223 ? 1.1943 0.7784 0.8571 -0.1604 -0.1619 -0.1445 483 ALA A CB  
1765 N N   . ALA A 224 ? 1.2753 0.8200 0.8462 -0.1100 -0.1199 -0.1601 484 ALA A N   
1766 C CA  . ALA A 224 ? 1.3414 0.8449 0.8557 -0.0971 -0.1052 -0.1775 484 ALA A CA  
1767 C C   . ALA A 224 ? 1.3581 0.8582 0.8806 -0.0694 -0.0741 -0.1711 484 ALA A C   
1768 O O   . ALA A 224 ? 1.3894 0.8564 0.8725 -0.0553 -0.0566 -0.1834 484 ALA A O   
1769 C CB  . ALA A 224 ? 1.3079 0.8254 0.7851 -0.0969 -0.1158 -0.1804 484 ALA A CB  
1770 N N   . LYS A 225 ? 1.3047 0.8407 0.8786 -0.0619 -0.0677 -0.1514 485 LYS A N   
1771 C CA  . LYS A 225 ? 1.2786 0.8194 0.8701 -0.0377 -0.0424 -0.1422 485 LYS A CA  
1772 C C   . LYS A 225 ? 1.2588 0.8160 0.8335 -0.0183 -0.0277 -0.1399 485 LYS A C   
1773 O O   . LYS A 225 ? 1.2956 0.8437 0.8701 0.0020  -0.0053 -0.1391 485 LYS A O   
1774 C CB  . LYS A 225 ? 1.3281 0.8190 0.9089 -0.0319 -0.0280 -0.1522 485 LYS A CB  
1775 C CG  . LYS A 225 ? 1.3740 0.8432 0.9675 -0.0543 -0.0426 -0.1558 485 LYS A CG  
1776 C CD  . LYS A 225 ? 1.4087 0.8519 1.0227 -0.0457 -0.0270 -0.1506 485 LYS A CD  
1777 C CE  . LYS A 225 ? 1.3948 0.8794 1.0617 -0.0453 -0.0284 -0.1272 485 LYS A CE  
1778 N NZ  . LYS A 225 ? 1.3845 0.8775 1.0743 -0.0717 -0.0479 -0.1237 485 LYS A NZ  
1779 N N   . THR A 226 ? 1.1770 0.7610 0.7422 -0.0245 -0.0401 -0.1368 486 THR A N   
1780 C CA  . THR A 226 ? 1.1872 0.7911 0.7407 -0.0086 -0.0270 -0.1318 486 THR A CA  
1781 C C   . THR A 226 ? 1.1853 0.8402 0.7866 -0.0011 -0.0236 -0.1108 486 THR A C   
1782 O O   . THR A 226 ? 1.1809 0.8548 0.7811 0.0121  -0.0107 -0.1046 486 THR A O   
1783 C CB  . THR A 226 ? 1.2970 0.8973 0.8063 -0.0177 -0.0407 -0.1394 486 THR A CB  
1784 O OG1 . THR A 226 ? 1.3015 0.9297 0.8303 -0.0361 -0.0671 -0.1314 486 THR A OG1 
1785 C CG2 . THR A 226 ? 1.3547 0.9008 0.8078 -0.0234 -0.0414 -0.1625 486 THR A CG2 
1786 N N   . VAL A 227 ? 1.1321 0.8075 0.7741 -0.0102 -0.0340 -0.1004 487 VAL A N   
1787 C CA  . VAL A 227 ? 1.0952 0.8139 0.7800 -0.0040 -0.0303 -0.0824 487 VAL A CA  
1788 C C   . VAL A 227 ? 1.1011 0.8286 0.8239 -0.0111 -0.0355 -0.0738 487 VAL A C   
1789 O O   . VAL A 227 ? 1.1704 0.8795 0.8923 -0.0256 -0.0472 -0.0791 487 VAL A O   
1790 C CB  . VAL A 227 ? 1.0520 0.8036 0.7417 -0.0104 -0.0422 -0.0739 487 VAL A CB  
1791 C CG1 . VAL A 227 ? 1.0881 0.8408 0.7490 0.0008  -0.0315 -0.0758 487 VAL A CG1 
1792 C CG2 . VAL A 227 ? 1.0492 0.7968 0.7313 -0.0304 -0.0661 -0.0779 487 VAL A CG2 
1793 N N   . PHE A 228 ? 0.9725 0.7274 0.7275 -0.0015 -0.0264 -0.0606 488 PHE A N   
1794 C CA  . PHE A 228 ? 0.9141 0.6811 0.7029 -0.0069 -0.0298 -0.0502 488 PHE A CA  
1795 C C   . PHE A 228 ? 0.9175 0.6498 0.7034 -0.0096 -0.0276 -0.0552 488 PHE A C   
1796 O O   . PHE A 228 ? 0.9161 0.6456 0.7178 -0.0234 -0.0366 -0.0519 488 PHE A O   
1797 C CB  . PHE A 228 ? 0.8996 0.6912 0.7065 -0.0228 -0.0459 -0.0436 488 PHE A CB  
1798 C CG  . PHE A 228 ? 0.9209 0.7478 0.7399 -0.0178 -0.0447 -0.0344 488 PHE A CG  
1799 C CD1 . PHE A 228 ? 0.9057 0.7579 0.7535 -0.0120 -0.0375 -0.0225 488 PHE A CD1 
1800 C CD2 . PHE A 228 ? 0.9586 0.7903 0.7567 -0.0183 -0.0499 -0.0377 488 PHE A CD2 
1801 C CE1 . PHE A 228 ? 0.8623 0.7430 0.7203 -0.0077 -0.0351 -0.0151 488 PHE A CE1 
1802 C CE2 . PHE A 228 ? 0.9555 0.8164 0.7647 -0.0132 -0.0472 -0.0284 488 PHE A CE2 
1803 C CZ  . PHE A 228 ? 0.8978 0.7825 0.7382 -0.0082 -0.0394 -0.0176 488 PHE A CZ  
1804 N N   . GLU A 229 ? 0.9112 0.6169 0.6796 0.0044  -0.0140 -0.0620 489 GLU A N   
1805 C CA  . GLU A 229 ? 0.9145 0.5829 0.6794 0.0045  -0.0094 -0.0660 489 GLU A CA  
1806 C C   . GLU A 229 ? 0.8803 0.5662 0.6790 0.0074  -0.0066 -0.0497 489 GLU A C   
1807 O O   . GLU A 229 ? 0.8830 0.5957 0.6979 0.0209  0.0010  -0.0393 489 GLU A O   
1808 C CB  . GLU A 229 ? 0.9033 0.5401 0.6449 0.0224  0.0074  -0.0750 489 GLU A CB  
1809 C CG  . GLU A 229 ? 1.3008 0.9242 1.0049 0.0249  0.0104  -0.0899 489 GLU A CG  
1810 C CD  . GLU A 229 ? 1.4551 1.0298 1.1278 0.0365  0.0257  -0.1043 489 GLU A CD  
1811 O OE1 . GLU A 229 ? 1.4523 1.0146 1.0916 0.0414  0.0320  -0.1160 489 GLU A OE1 
1812 O OE2 . GLU A 229 ? 1.4850 1.0314 1.1643 0.0413  0.0326  -0.1038 489 GLU A OE2 
1813 N N   . GLY A 230 ? 0.8366 0.5076 0.6452 -0.0066 -0.0133 -0.0474 490 GLY A N   
1814 C CA  . GLY A 230 ? 0.8085 0.4904 0.6439 -0.0051 -0.0098 -0.0318 490 GLY A CA  
1815 C C   . GLY A 230 ? 0.8306 0.5528 0.6913 -0.0143 -0.0173 -0.0203 490 GLY A C   
1816 O O   . GLY A 230 ? 0.8392 0.5701 0.7191 -0.0144 -0.0140 -0.0075 490 GLY A O   
1817 N N   . PHE A 231 ? 0.8130 0.5582 0.6727 -0.0214 -0.0262 -0.0242 491 PHE A N   
1818 C CA  . PHE A 231 ? 0.8121 0.5936 0.6968 -0.0289 -0.0317 -0.0134 491 PHE A CA  
1819 C C   . PHE A 231 ? 0.8457 0.6266 0.7453 -0.0496 -0.0433 -0.0124 491 PHE A C   
1820 O O   . PHE A 231 ? 0.8950 0.6520 0.7820 -0.0614 -0.0520 -0.0230 491 PHE A O   
1821 C CB  . PHE A 231 ? 0.8121 0.6210 0.6930 -0.0250 -0.0347 -0.0150 491 PHE A CB  
1822 C CG  . PHE A 231 ? 0.7946 0.6162 0.6728 -0.0072 -0.0234 -0.0121 491 PHE A CG  
1823 C CD1 . PHE A 231 ? 0.7494 0.6024 0.6463 -0.0033 -0.0203 -0.0021 491 PHE A CD1 
1824 C CD2 . PHE A 231 ? 0.7727 0.5748 0.6306 0.0051  -0.0155 -0.0200 491 PHE A CD2 
1825 C CE1 . PHE A 231 ? 0.7086 0.5746 0.6052 0.0105  -0.0117 -0.0001 491 PHE A CE1 
1826 C CE2 . PHE A 231 ? 0.7446 0.5624 0.6056 0.0203  -0.0056 -0.0165 491 PHE A CE2 
1827 C CZ  . PHE A 231 ? 0.7352 0.5858 0.6162 0.0221  -0.0048 -0.0066 491 PHE A CZ  
1828 N N   . THR A 232 ? 0.7995 0.6080 0.7269 -0.0543 -0.0429 0.0002  492 THR A N   
1829 C CA  . THR A 232 ? 0.7570 0.5739 0.7072 -0.0727 -0.0520 0.0042  492 THR A CA  
1830 C C   . THR A 232 ? 0.7632 0.6182 0.7303 -0.0746 -0.0580 0.0097  492 THR A C   
1831 O O   . THR A 232 ? 0.7942 0.6683 0.7610 -0.0619 -0.0508 0.0142  492 THR A O   
1832 C CB  . THR A 232 ? 0.7202 0.5345 0.6914 -0.0759 -0.0425 0.0168  492 THR A CB  
1833 O OG1 . THR A 232 ? 0.7393 0.5175 0.6939 -0.0702 -0.0349 0.0142  492 THR A OG1 
1834 C CG2 . THR A 232 ? 0.7202 0.5411 0.7184 -0.0963 -0.0505 0.0207  492 THR A CG2 
1835 N N   . GLU A 233 ? 0.7509 0.6163 0.7334 -0.0905 -0.0719 0.0093  493 GLU A N   
1836 C CA  . GLU A 233 ? 0.7283 0.6309 0.7357 -0.0927 -0.0768 0.0182  493 GLU A CA  
1837 C C   . GLU A 233 ? 0.7591 0.6721 0.8023 -0.1081 -0.0793 0.0271  493 GLU A C   
1838 O O   . GLU A 233 ? 0.8323 0.7251 0.8764 -0.1224 -0.0869 0.0218  493 GLU A O   
1839 C CB  . GLU A 233 ? 0.6853 0.5961 0.6797 -0.0963 -0.0934 0.0113  493 GLU A CB  
1840 C CG  . GLU A 233 ? 0.7227 0.6718 0.7425 -0.0939 -0.0961 0.0227  493 GLU A CG  
1841 C CD  . GLU A 233 ? 0.7957 0.7560 0.8048 -0.0972 -0.1141 0.0195  493 GLU A CD  
1842 O OE1 . GLU A 233 ? 0.7344 0.7213 0.7568 -0.0896 -0.1127 0.0288  493 GLU A OE1 
1843 O OE2 . GLU A 233 ? 0.8820 0.8242 0.8689 -0.1074 -0.1295 0.0084  493 GLU A OE2 
1844 N N   . GLY A 234 ? 0.7208 0.6635 0.7941 -0.1055 -0.0715 0.0404  494 GLY A N   
1845 C CA  . GLY A 234 ? 0.7024 0.6605 0.8152 -0.1195 -0.0719 0.0507  494 GLY A CA  
1846 C C   . GLY A 234 ? 0.7525 0.7275 0.8824 -0.1340 -0.0935 0.0486  494 GLY A C   
1847 O O   . GLY A 234 ? 0.7907 0.7709 0.9023 -0.1298 -0.1054 0.0424  494 GLY A O   
1848 N N   . GLU A 235 ? 0.7759 0.7605 0.9413 -0.1514 -0.0989 0.0547  495 GLU A N   
1849 C CA  . GLU A 235 ? 0.8203 0.8275 1.0086 -0.1665 -0.1221 0.0547  495 GLU A CA  
1850 C C   . GLU A 235 ? 0.7906 0.8355 0.9950 -0.1550 -0.1244 0.0641  495 GLU A C   
1851 O O   . GLU A 235 ? 0.7455 0.8081 0.9684 -0.1426 -0.1058 0.0756  495 GLU A O   
1852 C CB  . GLU A 235 ? 0.8737 0.8925 1.1086 -0.1868 -0.1245 0.0630  495 GLU A CB  
1853 C CG  . GLU A 235 ? 0.9459 0.9831 1.2034 -0.2074 -0.1530 0.0605  495 GLU A CG  
1854 C CD  . GLU A 235 ? 1.0036 1.0632 1.3197 -0.2267 -0.1530 0.0726  495 GLU A CD  
1855 O OE1 . GLU A 235 ? 1.0191 1.0696 1.3494 -0.2255 -0.1299 0.0807  495 GLU A OE1 
1856 O OE2 . GLU A 235 ? 1.0286 1.1158 1.3769 -0.2432 -0.1761 0.0750  495 GLU A OE2 
1857 N N   . LEU A 236 ? 0.7791 0.8328 0.9724 -0.1585 -0.1468 0.0588  496 LEU A N   
1858 C CA  . LEU A 236 ? 0.7530 0.8409 0.9616 -0.1484 -0.1520 0.0689  496 LEU A CA  
1859 C C   . LEU A 236 ? 0.8225 0.9490 1.0898 -0.1603 -0.1612 0.0832  496 LEU A C   
1860 O O   . LEU A 236 ? 0.9068 1.0425 1.1858 -0.1778 -0.1863 0.0807  496 LEU A O   
1861 C CB  . LEU A 236 ? 0.7276 0.8081 0.8975 -0.1472 -0.1727 0.0591  496 LEU A CB  
1862 C CG  . LEU A 236 ? 0.7132 0.7636 0.8301 -0.1316 -0.1613 0.0480  496 LEU A CG  
1863 C CD1 . LEU A 236 ? 0.6841 0.7173 0.7571 -0.1358 -0.1816 0.0350  496 LEU A CD1 
1864 C CD2 . LEU A 236 ? 0.6145 0.6820 0.7369 -0.1114 -0.1437 0.0583  496 LEU A CD2 
1865 N N   . THR A 237 ? 0.7757 0.9249 1.0804 -0.1515 -0.1408 0.0980  497 THR A N   
1866 C CA  . THR A 237 ? 0.7315 0.9207 1.0989 -0.1602 -0.1442 0.1139  497 THR A CA  
1867 C C   . THR A 237 ? 0.6943 0.9190 1.0858 -0.1451 -0.1446 0.1277  497 THR A C   
1868 O O   . THR A 237 ? 0.7362 0.9977 1.1830 -0.1479 -0.1448 0.1430  497 THR A O   
1869 C CB  . THR A 237 ? 0.7030 0.8923 1.1000 -0.1616 -0.1178 0.1225  497 THR A CB  
1870 O OG1 . THR A 237 ? 0.7206 0.9099 1.1098 -0.1404 -0.0915 0.1282  497 THR A OG1 
1871 C CG2 . THR A 237 ? 0.6618 0.8105 1.0292 -0.1723 -0.1136 0.1104  497 THR A CG2 
1872 N N   . PHE A 238 ? 0.6412 0.8542 0.9929 -0.1291 -0.1437 0.1228  498 PHE A N   
1873 C CA  . PHE A 238 ? 0.6266 0.8663 0.9938 -0.1138 -0.1444 0.1351  498 PHE A CA  
1874 C C   . PHE A 238 ? 0.6447 0.8852 0.9842 -0.1156 -0.1727 0.1308  498 PHE A C   
1875 O O   . PHE A 238 ? 0.6243 0.8351 0.9172 -0.1227 -0.1837 0.1149  498 PHE A O   
1876 C CB  . PHE A 238 ? 0.6263 0.8505 0.9701 -0.0932 -0.1174 0.1346  498 PHE A CB  
1877 C CG  . PHE A 238 ? 0.6625 0.8477 0.9465 -0.0898 -0.1141 0.1176  498 PHE A CG  
1878 C CD1 . PHE A 238 ? 0.7269 0.9023 0.9735 -0.0835 -0.1259 0.1118  498 PHE A CD1 
1879 C CD2 . PHE A 238 ? 0.6567 0.8162 0.9232 -0.0921 -0.0984 0.1090  498 PHE A CD2 
1880 C CE1 . PHE A 238 ? 0.7607 0.9029 0.9568 -0.0796 -0.1208 0.0971  498 PHE A CE1 
1881 C CE2 . PHE A 238 ? 0.6931 0.8202 0.9098 -0.0876 -0.0953 0.0949  498 PHE A CE2 
1882 C CZ  . PHE A 238 ? 0.7494 0.8688 0.9328 -0.0814 -0.1059 0.0888  498 PHE A CZ  
1883 N N   . GLN A 239 ? 0.6850 0.9577 1.0512 -0.1079 -0.1831 0.1456  499 GLN A N   
1884 C CA  . GLN A 239 ? 0.7198 0.9960 1.0594 -0.1091 -0.2115 0.1446  499 GLN A CA  
1885 C C   . GLN A 239 ? 0.7219 0.9673 1.0024 -0.0943 -0.2025 0.1357  499 GLN A C   
1886 O O   . GLN A 239 ? 0.6767 0.9104 0.9507 -0.0795 -0.1756 0.1363  499 GLN A O   
1887 C CB  . GLN A 239 ? 0.7257 1.0472 1.1133 -0.1040 -0.2264 0.1659  499 GLN A CB  
1888 C CG  . GLN A 239 ? 0.7214 1.0510 1.1159 -0.0794 -0.2071 0.1795  499 GLN A CG  
1889 C CD  . GLN A 239 ? 0.7099 1.0857 1.1607 -0.0720 -0.2183 0.2033  499 GLN A CD  
1890 O OE1 . GLN A 239 ? 0.6936 1.1035 1.1981 -0.0833 -0.2305 0.2129  499 GLN A OE1 
1891 N NE2 . GLN A 239 ? 0.7018 1.0792 1.1431 -0.0522 -0.2129 0.2141  499 GLN A NE2 
1892 N N   . PRO A 240 ? 0.7586 0.9909 0.9955 -0.0990 -0.2250 0.1274  500 PRO A N   
1893 C CA  . PRO A 240 ? 0.7533 0.9578 0.9352 -0.0861 -0.2168 0.1199  500 PRO A CA  
1894 C C   . PRO A 240 ? 0.7150 0.9304 0.9090 -0.0653 -0.1983 0.1343  500 PRO A C   
1895 O O   . PRO A 240 ? 0.6682 0.9158 0.9047 -0.0593 -0.2026 0.1526  500 PRO A O   
1896 C CB  . PRO A 240 ? 0.7947 0.9962 0.9412 -0.0944 -0.2477 0.1157  500 PRO A CB  
1897 C CG  . PRO A 240 ? 0.7891 0.9954 0.9519 -0.1168 -0.2680 0.1083  500 PRO A CG  
1898 C CD  . PRO A 240 ? 0.7685 1.0082 1.0017 -0.1184 -0.2589 0.1229  500 PRO A CD  
1899 N N   . THR A 241 ? 0.7356 0.9232 0.8930 -0.0546 -0.1778 0.1258  501 THR A N   
1900 C CA  . THR A 241 ? 0.6984 0.8873 0.8659 -0.0372 -0.1534 0.1345  501 THR A CA  
1901 C C   . THR A 241 ? 0.7585 0.9422 0.8972 -0.0253 -0.1562 0.1410  501 THR A C   
1902 O O   . THR A 241 ? 0.7755 0.9538 0.9153 -0.0118 -0.1357 0.1462  501 THR A O   
1903 C CB  . THR A 241 ? 0.5992 0.7617 0.7478 -0.0347 -0.1289 0.1211  501 THR A CB  
1904 O OG1 . THR A 241 ? 0.5964 0.7312 0.6935 -0.0367 -0.1323 0.1065  501 THR A OG1 
1905 C CG2 . THR A 241 ? 0.5918 0.7560 0.7648 -0.0457 -0.1246 0.1161  501 THR A CG2 
1906 N N   . TYR A 242 ? 0.7594 0.9431 0.8708 -0.0312 -0.1813 0.1405  502 TYR A N   
1907 C CA  . TYR A 242 ? 0.7840 0.9598 0.8598 -0.0213 -0.1859 0.1466  502 TYR A CA  
1908 C C   . TYR A 242 ? 0.8698 1.0623 0.9394 -0.0295 -0.2198 0.1533  502 TYR A C   
1909 O O   . TYR A 242 ? 0.8705 1.0634 0.9376 -0.0459 -0.2379 0.1426  502 TYR A O   
1910 C CB  . TYR A 242 ? 0.7597 0.9000 0.7803 -0.0215 -0.1754 0.1290  502 TYR A CB  
1911 C CG  . TYR A 242 ? 0.8114 0.9377 0.7873 -0.0124 -0.1761 0.1330  502 TYR A CG  
1912 C CD1 . TYR A 242 ? 0.8030 0.9263 0.7816 0.0022  -0.1559 0.1435  502 TYR A CD1 
1913 C CD2 . TYR A 242 ? 0.8253 0.9371 0.7528 -0.0192 -0.1943 0.1248  502 TYR A CD2 
1914 C CE1 . TYR A 242 ? 0.8378 0.9461 0.7752 0.0099  -0.1538 0.1478  502 TYR A CE1 
1915 C CE2 . TYR A 242 ? 0.8713 0.9678 0.7544 -0.0106 -0.1918 0.1285  502 TYR A CE2 
1916 C CZ  . TYR A 242 ? 0.9032 0.9990 0.7930 0.0039  -0.1712 0.1410  502 TYR A CZ  
1917 O OH  . TYR A 242 ? 0.9591 1.0393 0.8059 0.0120  -0.1670 0.1464  502 TYR A OH  
1918 N N   . LYS A 243 ? 0.8852 1.0905 0.9515 -0.0192 -0.2300 0.1708  503 LYS A N   
1919 C CA  . LYS A 243 ? 0.8402 1.0424 0.9090 -0.0001 -0.2093 0.1849  503 LYS A CA  
1920 C C   . LYS A 243 ? 0.8595 1.0972 0.9842 0.0089  -0.2153 0.2089  503 LYS A C   
1921 O O   . LYS A 243 ? 0.8921 1.1547 1.0291 0.0043  -0.2439 0.2198  503 LYS A O   
1922 C CB  . LYS A 243 ? 0.8475 1.0305 0.8588 0.0054  -0.2160 0.1868  503 LYS A CB  
1923 C CG  . LYS A 243 ? 0.8279 1.0082 0.8397 0.0240  -0.1999 0.2051  503 LYS A CG  
1924 C CD  . LYS A 243 ? 0.8518 1.0043 0.7998 0.0282  -0.1975 0.2027  503 LYS A CD  
1925 C CE  . LYS A 243 ? 0.8886 1.0356 0.8384 0.0458  -0.1794 0.2219  503 LYS A CE  
1926 N NZ  . LYS A 243 ? 0.9288 1.0438 0.8249 0.0492  -0.1630 0.2152  503 LYS A NZ  
1927 N N   . TYR A 244 ? 0.8406 1.0803 0.9988 0.0219  -0.1885 0.2171  504 TYR A N   
1928 C CA  . TYR A 244 ? 0.8012 1.0725 1.0170 0.0331  -0.1882 0.2398  504 TYR A CA  
1929 C C   . TYR A 244 ? 0.8595 1.1245 1.0706 0.0528  -0.1769 0.2581  504 TYR A C   
1930 O O   . TYR A 244 ? 0.8551 1.0895 1.0279 0.0581  -0.1592 0.2515  504 TYR A O   
1931 C CB  . TYR A 244 ? 0.7211 0.9979 0.9819 0.0339  -0.1636 0.2359  504 TYR A CB  
1932 C CG  . TYR A 244 ? 0.7040 0.9913 0.9818 0.0160  -0.1727 0.2233  504 TYR A CG  
1933 C CD1 . TYR A 244 ? 0.6881 1.0132 1.0177 0.0102  -0.1899 0.2353  504 TYR A CD1 
1934 C CD2 . TYR A 244 ? 0.6627 0.9228 0.9078 0.0050  -0.1637 0.2007  504 TYR A CD2 
1935 C CE1 . TYR A 244 ? 0.6394 0.9727 0.9865 -0.0078 -0.1971 0.2244  504 TYR A CE1 
1936 C CE2 . TYR A 244 ? 0.5946 0.8611 0.8548 -0.0113 -0.1709 0.1904  504 TYR A CE2 
1937 C CZ  . TYR A 244 ? 0.6143 0.9164 0.9250 -0.0183 -0.1872 0.2020  504 TYR A CZ  
1938 O OH  . TYR A 244 ? 0.6733 0.9799 1.0003 -0.0357 -0.1930 0.1923  504 TYR A OH  
1939 N N   . ASP A 245 ? 0.9174 1.2123 1.1709 0.0638  -0.1866 0.2822  505 ASP A N   
1940 C CA  . ASP A 245 ? 0.9542 1.2435 1.2160 0.0847  -0.1711 0.3021  505 ASP A CA  
1941 C C   . ASP A 245 ? 0.8944 1.1655 1.1765 0.0922  -0.1331 0.2951  505 ASP A C   
1942 O O   . ASP A 245 ? 0.8234 1.1099 1.1483 0.0898  -0.1235 0.2921  505 ASP A O   
1943 C CB  . ASP A 245 ? 0.9935 1.3225 1.3074 0.0965  -0.1881 0.3307  505 ASP A CB  
1944 C CG  . ASP A 245 ? 1.0350 1.3708 1.3198 0.1022  -0.2160 0.3488  505 ASP A CG  
1945 O OD1 . ASP A 245 ? 1.0678 1.4406 1.3945 0.1098  -0.2362 0.3722  505 ASP A OD1 
1946 O OD2 . ASP A 245 ? 1.0471 1.3530 1.2696 0.0998  -0.2174 0.3412  505 ASP A OD2 
1947 N N   . THR A 246 ? 0.9145 1.1530 1.1659 0.1007  -0.1114 0.2929  506 THR A N   
1948 C CA  . THR A 246 ? 0.8838 1.1015 1.1493 0.1069  -0.0765 0.2854  506 THR A CA  
1949 C C   . THR A 246 ? 0.8687 1.1086 1.1939 0.1208  -0.0670 0.3034  506 THR A C   
1950 O O   . THR A 246 ? 0.8930 1.1518 1.2395 0.1333  -0.0793 0.3271  506 THR A O   
1951 C CB  . THR A 246 ? 0.8769 1.0594 1.1080 0.1153  -0.0567 0.2859  506 THR A CB  
1952 O OG1 . THR A 246 ? 0.9123 1.0804 1.0898 0.1063  -0.0697 0.2774  506 THR A OG1 
1953 C CG2 . THR A 246 ? 0.8253 0.9822 1.0574 0.1138  -0.0249 0.2688  506 THR A CG2 
1954 N N   . GLY A 247 ? 0.7921 1.0300 1.1436 0.1193  -0.0452 0.2929  507 GLY A N   
1955 C CA  . GLY A 247 ? 0.7139 0.9692 1.1219 0.1336  -0.0297 0.3080  507 GLY A CA  
1956 C C   . GLY A 247 ? 0.6655 0.9666 1.1222 0.1309  -0.0509 0.3205  507 GLY A C   
1957 O O   . GLY A 247 ? 0.6623 0.9849 1.1712 0.1452  -0.0422 0.3387  507 GLY A O   
1958 N N   . SER A 248 ? 0.6865 1.0019 1.1282 0.1123  -0.0775 0.3106  508 SER A N   
1959 C CA  . SER A 248 ? 0.7685 1.1279 1.2574 0.1050  -0.0994 0.3199  508 SER A CA  
1960 C C   . SER A 248 ? 0.7920 1.1534 1.2587 0.0807  -0.1184 0.3000  508 SER A C   
1961 O O   . SER A 248 ? 0.8165 1.1452 1.2326 0.0712  -0.1124 0.2789  508 SER A O   
1962 C CB  . SER A 248 ? 0.8086 1.1990 1.3170 0.1135  -0.1284 0.3454  508 SER A CB  
1963 O OG  . SER A 248 ? 0.8408 1.2245 1.2981 0.1007  -0.1582 0.3384  508 SER A OG  
1964 N N   . ASP A 249 ? 0.7757 1.1759 1.2832 0.0710  -0.1413 0.3078  509 ASP A N   
1965 C CA  . ASP A 249 ? 0.7832 1.1872 1.2758 0.0470  -0.1623 0.2913  509 ASP A CA  
1966 C C   . ASP A 249 ? 0.8118 1.2356 1.2908 0.0366  -0.2048 0.2971  509 ASP A C   
1967 O O   . ASP A 249 ? 0.8153 1.2479 1.2920 0.0161  -0.2260 0.2862  509 ASP A O   
1968 C CB  . ASP A 249 ? 0.7915 1.2219 1.3416 0.0393  -0.1537 0.2924  509 ASP A CB  
1969 C CG  . ASP A 249 ? 0.8032 1.2113 1.3587 0.0472  -0.1128 0.2842  509 ASP A CG  
1970 O OD1 . ASP A 249 ? 0.7954 1.1636 1.3006 0.0495  -0.0959 0.2686  509 ASP A OD1 
1971 O OD2 . ASP A 249 ? 0.8188 1.2500 1.4288 0.0505  -0.0975 0.2932  509 ASP A OD2 
1972 N N   . ASP A 250 ? 0.8221 1.2505 1.2895 0.0502  -0.2173 0.3140  510 ASP A N   
1973 C CA  . ASP A 250 ? 0.8510 1.2935 1.2941 0.0415  -0.2579 0.3194  510 ASP A CA  
1974 C C   . ASP A 250 ? 0.8730 1.2728 1.2345 0.0333  -0.2619 0.2988  510 ASP A C   
1975 O O   . ASP A 250 ? 0.8690 1.2329 1.1975 0.0409  -0.2338 0.2887  510 ASP A O   
1976 C CB  . ASP A 250 ? 0.8810 1.3463 1.3444 0.0615  -0.2692 0.3489  510 ASP A CB  
1977 C CG  . ASP A 250 ? 0.8697 1.3802 1.4180 0.0724  -0.2654 0.3719  510 ASP A CG  
1978 O OD1 . ASP A 250 ? 0.8219 1.3529 1.4139 0.0604  -0.2618 0.3657  510 ASP A OD1 
1979 O OD2 . ASP A 250 ? 0.8787 1.4037 1.4509 0.0937  -0.2645 0.3972  510 ASP A OD2 
1980 N N   . TRP A 251 ? 0.8867 1.2908 1.2163 0.0177  -0.2965 0.2928  511 TRP A N   
1981 C CA  . TRP A 251 ? 0.9420 1.3061 1.1934 0.0095  -0.3007 0.2728  511 TRP A CA  
1982 C C   . TRP A 251 ? 1.0362 1.3851 1.2420 0.0247  -0.3040 0.2855  511 TRP A C   
1983 O O   . TRP A 251 ? 1.1098 1.4843 1.3396 0.0374  -0.3173 0.3109  511 TRP A O   
1984 C CB  . TRP A 251 ? 0.9809 1.3502 1.2101 -0.0142 -0.3357 0.2590  511 TRP A CB  
1985 C CG  . TRP A 251 ? 0.9797 1.3649 1.2520 -0.0326 -0.3386 0.2479  511 TRP A CG  
1986 C CD1 . TRP A 251 ? 0.9801 1.4079 1.3063 -0.0443 -0.3646 0.2581  511 TRP A CD1 
1987 C CD2 . TRP A 251 ? 0.9554 1.3140 1.2197 -0.0422 -0.3157 0.2256  511 TRP A CD2 
1988 N NE1 . TRP A 251 ? 0.9547 1.3824 1.3074 -0.0609 -0.3571 0.2436  511 TRP A NE1 
1989 C CE2 . TRP A 251 ? 0.9413 1.3260 1.2552 -0.0593 -0.3273 0.2239  511 TRP A CE2 
1990 C CE3 . TRP A 251 ? 0.9388 1.2557 1.1614 -0.0378 -0.2867 0.2083  511 TRP A CE3 
1991 C CZ2 . TRP A 251 ? 0.9319 1.2993 1.2513 -0.0712 -0.3100 0.2063  511 TRP A CZ2 
1992 C CZ3 . TRP A 251 ? 0.9452 1.2473 1.1743 -0.0489 -0.2712 0.1908  511 TRP A CZ3 
1993 C CH2 . TRP A 251 ? 0.9415 1.2673 1.2168 -0.0651 -0.2825 0.1902  511 TRP A CH2 
1994 N N   . ASP A 252 ? 1.0548 1.3622 1.1958 0.0235  -0.2915 0.2689  512 ASP A N   
1995 C CA  . ASP A 252 ? 1.1600 1.4482 1.2454 0.0334  -0.2965 0.2773  512 ASP A CA  
1996 C C   . ASP A 252 ? 1.2525 1.5090 1.2662 0.0188  -0.3059 0.2537  512 ASP A C   
1997 O O   . ASP A 252 ? 1.2588 1.4921 1.2586 0.0103  -0.2884 0.2308  512 ASP A O   
1998 C CB  . ASP A 252 ? 1.1640 1.4297 1.2470 0.0524  -0.2604 0.2849  512 ASP A CB  
1999 C CG  . ASP A 252 ? 1.2519 1.5037 1.2901 0.0653  -0.2646 0.3016  512 ASP A CG  
2000 O OD1 . ASP A 252 ? 1.2790 1.5548 1.3227 0.0707  -0.2918 0.3232  512 ASP A OD1 
2001 O OD2 . ASP A 252 ? 1.2765 1.4937 1.2750 0.0702  -0.2401 0.2940  512 ASP A OD2 
2002 N N   . THR A 253 ? 1.3378 1.5923 1.3046 0.0168  -0.3330 0.2593  513 THR A N   
2003 C CA  . THR A 253 ? 1.3889 1.6145 1.2874 0.0017  -0.3451 0.2361  513 THR A CA  
2004 C C   . THR A 253 ? 1.4625 1.6648 1.2896 0.0098  -0.3504 0.2426  513 THR A C   
2005 O O   . THR A 253 ? 1.5132 1.7290 1.3175 0.0073  -0.3832 0.2539  513 THR A O   
2006 C CB  . THR A 253 ? 1.2696 1.5162 1.1784 -0.0199 -0.3824 0.2268  513 THR A CB  
2007 O OG1 . THR A 253 ? 1.2895 1.5727 1.2184 -0.0174 -0.4159 0.2507  513 THR A OG1 
2008 C CG2 . THR A 253 ? 1.2079 1.4706 1.1799 -0.0299 -0.3728 0.2172  513 THR A CG2 
2009 N N   . SER A 254 ? 1.4657 1.6336 1.2573 0.0187  -0.3179 0.2356  514 SER A N   
2010 C CA  . SER A 254 ? 1.5166 1.6569 1.2376 0.0265  -0.3147 0.2402  514 SER A CA  
2011 C C   . SER A 254 ? 1.5366 1.6456 1.1898 0.0125  -0.3207 0.2134  514 SER A C   
2012 O O   . SER A 254 ? 1.5105 1.5946 1.1523 0.0092  -0.2954 0.1924  514 SER A O   
2013 C CB  . SER A 254 ? 1.5104 1.6302 1.2322 0.0425  -0.2743 0.2468  514 SER A CB  
2014 O OG  . SER A 254 ? 1.4663 1.5750 1.2128 0.0382  -0.2468 0.2270  514 SER A OG  
2015 N N   . ARG A 258 ? 1.2723 1.3746 0.9341 -0.0686 -0.3911 0.1251  518 ARG A N   
2016 C CA  . ARG A 258 ? 1.2333 1.3436 0.9528 -0.0598 -0.3589 0.1280  518 ARG A CA  
2017 C C   . ARG A 258 ? 1.2764 1.4263 1.0710 -0.0696 -0.3748 0.1359  518 ARG A C   
2018 O O   . ARG A 258 ? 1.3110 1.4964 1.1553 -0.0600 -0.3791 0.1599  518 ARG A O   
2019 C CB  . ARG A 258 ? 1.1993 1.3142 0.9284 -0.0369 -0.3338 0.1492  518 ARG A CB  
2020 C CG  . ARG A 258 ? 1.3713 1.4975 1.1627 -0.0279 -0.3032 0.1540  518 ARG A CG  
2021 C CD  . ARG A 258 ? 1.3503 1.4457 1.1162 -0.0171 -0.2664 0.1455  518 ARG A CD  
2022 N NE  . ARG A 258 ? 1.3943 1.4801 1.1255 -0.0022 -0.2577 0.1606  518 ARG A NE  
2023 C CZ  . ARG A 258 ? 1.3656 1.4263 1.0707 0.0075  -0.2277 0.1568  518 ARG A CZ  
2024 N NH1 . ARG A 258 ? 1.3306 1.3747 1.0400 0.0047  -0.2049 0.1382  518 ARG A NH1 
2025 N NH2 . ARG A 258 ? 1.3255 1.3782 1.0012 0.0199  -0.2206 0.1727  518 ARG A NH2 
2026 N N   . ALA A 259 ? 1.2663 1.4087 1.0692 -0.0885 -0.3825 0.1160  519 ALA A N   
2027 C CA  . ALA A 259 ? 1.1893 1.3643 1.0663 -0.0984 -0.3886 0.1208  519 ALA A CA  
2028 C C   . ALA A 259 ? 1.1123 1.2858 1.0297 -0.0865 -0.3504 0.1225  519 ALA A C   
2029 O O   . ALA A 259 ? 1.0592 1.2023 0.9434 -0.0757 -0.3228 0.1140  519 ALA A O   
2030 C CB  . ALA A 259 ? 1.1953 1.3578 1.0640 -0.1237 -0.4079 0.0988  519 ALA A CB  
2031 N N   . PRO A 260 ? 1.0712 1.2783 1.0602 -0.0885 -0.3486 0.1340  520 PRO A N   
2032 C CA  . PRO A 260 ? 1.0203 1.2236 1.0448 -0.0818 -0.3153 0.1318  520 PRO A CA  
2033 C C   . PRO A 260 ? 0.9787 1.1426 0.9686 -0.0902 -0.3005 0.1067  520 PRO A C   
2034 O O   . PRO A 260 ? 1.0093 1.1525 0.9602 -0.1050 -0.3184 0.0902  520 PRO A O   
2035 C CB  . PRO A 260 ? 1.0086 1.2516 1.1062 -0.0905 -0.3249 0.1434  520 PRO A CB  
2036 C CG  . PRO A 260 ? 1.0015 1.2791 1.1155 -0.0879 -0.3533 0.1636  520 PRO A CG  
2037 C CD  . PRO A 260 ? 1.0593 1.3128 1.1016 -0.0943 -0.3762 0.1528  520 PRO A CD  
2038 N N   . ALA A 261 ? 0.8909 1.0433 0.8934 -0.0805 -0.2685 0.1038  521 ALA A N   
2039 C CA  . ALA A 261 ? 0.8424 0.9576 0.8109 -0.0839 -0.2522 0.0827  521 ALA A CA  
2040 C C   . ALA A 261 ? 0.8456 0.9609 0.8492 -0.0786 -0.2243 0.0827  521 ALA A C   
2041 O O   . ALA A 261 ? 0.8594 0.9937 0.8959 -0.0665 -0.2096 0.0970  521 ALA A O   
2042 C CB  . ALA A 261 ? 0.7802 0.8669 0.6895 -0.0728 -0.2421 0.0759  521 ALA A CB  
2043 N N   . TRP A 262 ? 0.8626 0.9548 0.8572 -0.0875 -0.2172 0.0668  522 TRP A N   
2044 C CA  . TRP A 262 ? 0.8248 0.9112 0.8404 -0.0816 -0.1907 0.0653  522 TRP A CA  
2045 C C   . TRP A 262 ? 0.8480 0.9097 0.8247 -0.0679 -0.1705 0.0579  522 TRP A C   
2046 O O   . TRP A 262 ? 0.8816 0.9163 0.8338 -0.0691 -0.1611 0.0438  522 TRP A O   
2047 C CB  . TRP A 262 ? 0.8383 0.9103 0.8618 -0.0963 -0.1919 0.0539  522 TRP A CB  
2048 C CG  . TRP A 262 ? 0.8699 0.9703 0.9471 -0.1088 -0.2023 0.0640  522 TRP A CG  
2049 C CD1 . TRP A 262 ? 0.8365 0.9646 0.9634 -0.1031 -0.1895 0.0792  522 TRP A CD1 
2050 C CD2 . TRP A 262 ? 0.8890 0.9923 0.9765 -0.1296 -0.2262 0.0591  522 TRP A CD2 
2051 N NE1 . TRP A 262 ? 0.8367 0.9873 1.0070 -0.1180 -0.2028 0.0856  522 TRP A NE1 
2052 C CE2 . TRP A 262 ? 0.8599 0.9967 1.0086 -0.1355 -0.2263 0.0735  522 TRP A CE2 
2053 C CE3 . TRP A 262 ? 0.9254 1.0048 0.9758 -0.1444 -0.2467 0.0432  522 TRP A CE3 
2054 C CZ2 . TRP A 262 ? 0.8812 1.0318 1.0596 -0.1565 -0.2471 0.0737  522 TRP A CZ2 
2055 C CZ3 . TRP A 262 ? 0.9668 1.0569 1.0430 -0.1663 -0.2689 0.0417  522 TRP A CZ3 
2056 C CH2 . TRP A 262 ? 0.9480 1.0751 1.0900 -0.1727 -0.2695 0.0575  522 TRP A CH2 
2057 N N   . CYS A 263 ? 0.8240 0.8951 0.7970 -0.0546 -0.1634 0.0683  523 CYS A N   
2058 C CA  . CYS A 263 ? 0.8312 0.8821 0.7718 -0.0428 -0.1443 0.0626  523 CYS A CA  
2059 C C   . CYS A 263 ? 0.8178 0.8612 0.7725 -0.0384 -0.1215 0.0576  523 CYS A C   
2060 O O   . CYS A 263 ? 0.8073 0.8291 0.7347 -0.0345 -0.1101 0.0466  523 CYS A O   
2061 C CB  . CYS A 263 ? 0.8077 0.8707 0.7482 -0.0304 -0.1394 0.0766  523 CYS A CB  
2062 S SG  . CYS A 263 ? 0.8811 0.9400 0.7794 -0.0310 -0.1610 0.0797  523 CYS A SG  
2063 N N   . ASP A 264 ? 0.7814 0.8433 0.7785 -0.0388 -0.1153 0.0662  524 ASP A N   
2064 C CA  . ASP A 264 ? 0.7143 0.7732 0.7246 -0.0323 -0.0932 0.0652  524 ASP A CA  
2065 C C   . ASP A 264 ? 0.7063 0.7589 0.7297 -0.0408 -0.0910 0.0593  524 ASP A C   
2066 O O   . ASP A 264 ? 0.7227 0.7895 0.7760 -0.0489 -0.0981 0.0653  524 ASP A O   
2067 C CB  . ASP A 264 ? 0.6817 0.7614 0.7240 -0.0245 -0.0837 0.0793  524 ASP A CB  
2068 C CG  . ASP A 264 ? 0.7391 0.8246 0.7708 -0.0169 -0.0880 0.0879  524 ASP A CG  
2069 O OD1 . ASP A 264 ? 0.7770 0.8484 0.7817 -0.0101 -0.0783 0.0838  524 ASP A OD1 
2070 O OD2 . ASP A 264 ? 0.7340 0.8381 0.7843 -0.0177 -0.1017 0.0996  524 ASP A OD2 
2071 N N   . ARG A 265 ? 0.7061 0.7379 0.7086 -0.0381 -0.0802 0.0489  525 ARG A N   
2072 C CA  . ARG A 265 ? 0.7064 0.7242 0.7105 -0.0457 -0.0797 0.0422  525 ARG A CA  
2073 C C   . ARG A 265 ? 0.6816 0.6906 0.6840 -0.0383 -0.0614 0.0399  525 ARG A C   
2074 O O   . ARG A 265 ? 0.6681 0.6770 0.6598 -0.0283 -0.0509 0.0392  525 ARG A O   
2075 C CB  . ARG A 265 ? 0.7047 0.6984 0.6756 -0.0514 -0.0907 0.0295  525 ARG A CB  
2076 C CG  . ARG A 265 ? 0.6591 0.6567 0.6164 -0.0573 -0.1101 0.0290  525 ARG A CG  
2077 C CD  . ARG A 265 ? 0.6558 0.6709 0.6433 -0.0707 -0.1267 0.0355  525 ARG A CD  
2078 N NE  . ARG A 265 ? 0.7794 0.7741 0.7579 -0.0846 -0.1367 0.0246  525 ARG A NE  
2079 C CZ  . ARG A 265 ? 0.7833 0.7621 0.7331 -0.0942 -0.1546 0.0141  525 ARG A CZ  
2080 N NH1 . ARG A 265 ? 0.7399 0.7225 0.6645 -0.0912 -0.1660 0.0142  525 ARG A NH1 
2081 N NH2 . ARG A 265 ? 0.7632 0.7199 0.7074 -0.1076 -0.1611 0.0036  525 ARG A NH2 
2082 N N   . ILE A 266 ? 0.6654 0.6676 0.6790 -0.0440 -0.0586 0.0397  526 ILE A N   
2083 C CA  . ILE A 266 ? 0.5965 0.5884 0.6052 -0.0379 -0.0444 0.0381  526 ILE A CA  
2084 C C   . ILE A 266 ? 0.6518 0.6202 0.6498 -0.0436 -0.0474 0.0318  526 ILE A C   
2085 O O   . ILE A 266 ? 0.6719 0.6388 0.6853 -0.0550 -0.0537 0.0342  526 ILE A O   
2086 C CB  . ILE A 266 ? 0.5742 0.5806 0.6088 -0.0374 -0.0334 0.0478  526 ILE A CB  
2087 C CG1 . ILE A 266 ? 0.5628 0.5893 0.6102 -0.0317 -0.0289 0.0541  526 ILE A CG1 
2088 C CG2 . ILE A 266 ? 0.4795 0.4742 0.5031 -0.0311 -0.0210 0.0464  526 ILE A CG2 
2089 C CD1 . ILE A 266 ? 0.5371 0.5750 0.6066 -0.0300 -0.0153 0.0624  526 ILE A CD1 
2090 N N   . LEU A 267 ? 0.6762 0.6261 0.6501 -0.0359 -0.0425 0.0244  527 LEU A N   
2091 C CA  . LEU A 267 ? 0.6980 0.6217 0.6609 -0.0385 -0.0425 0.0190  527 LEU A CA  
2092 C C   . LEU A 267 ? 0.6884 0.6069 0.6482 -0.0277 -0.0296 0.0220  527 LEU A C   
2093 O O   . LEU A 267 ? 0.6352 0.5692 0.5966 -0.0190 -0.0227 0.0250  527 LEU A O   
2094 C CB  . LEU A 267 ? 0.7037 0.6058 0.6381 -0.0380 -0.0489 0.0067  527 LEU A CB  
2095 C CG  . LEU A 267 ? 0.7048 0.6075 0.6325 -0.0488 -0.0646 0.0018  527 LEU A CG  
2096 C CD1 . LEU A 267 ? 0.7264 0.6460 0.6446 -0.0423 -0.0663 0.0027  527 LEU A CD1 
2097 C CD2 . LEU A 267 ? 0.6837 0.5523 0.5836 -0.0539 -0.0705 -0.0116 527 LEU A CD2 
2098 N N   . TRP A 268 ? 0.7106 0.6067 0.6659 -0.0287 -0.0273 0.0214  528 TRP A N   
2099 C CA  . TRP A 268 ? 0.7219 0.6128 0.6748 -0.0187 -0.0172 0.0268  528 TRP A CA  
2100 C C   . TRP A 268 ? 0.7240 0.5835 0.6637 -0.0155 -0.0152 0.0236  528 TRP A C   
2101 O O   . TRP A 268 ? 0.7605 0.5990 0.6975 -0.0255 -0.0204 0.0188  528 TRP A O   
2102 C CB  . TRP A 268 ? 0.7401 0.6426 0.7109 -0.0229 -0.0117 0.0383  528 TRP A CB  
2103 C CG  . TRP A 268 ? 0.8204 0.7065 0.8006 -0.0340 -0.0120 0.0428  528 TRP A CG  
2104 C CD1 . TRP A 268 ? 0.8579 0.7204 0.8316 -0.0319 -0.0067 0.0469  528 TRP A CD1 
2105 C CD2 . TRP A 268 ? 0.8069 0.7000 0.8075 -0.0489 -0.0173 0.0451  528 TRP A CD2 
2106 N NE1 . TRP A 268 ? 0.8247 0.6768 0.8126 -0.0459 -0.0075 0.0509  528 TRP A NE1 
2107 C CE2 . TRP A 268 ? 0.8356 0.7082 0.8418 -0.0570 -0.0145 0.0497  528 TRP A CE2 
2108 C CE3 . TRP A 268 ? 0.8114 0.7270 0.8281 -0.0561 -0.0245 0.0449  528 TRP A CE3 
2109 C CZ2 . TRP A 268 ? 0.8821 0.7580 0.9116 -0.0734 -0.0187 0.0532  528 TRP A CZ2 
2110 C CZ3 . TRP A 268 ? 0.8527 0.7736 0.8931 -0.0709 -0.0299 0.0489  528 TRP A CZ3 
2111 C CH2 . TRP A 268 ? 0.8899 0.7921 0.9379 -0.0803 -0.0270 0.0527  528 TRP A CH2 
2112 N N   . LYS A 269 ? 0.6730 0.5291 0.6058 -0.0018 -0.0080 0.0266  529 LYS A N   
2113 C CA  . LYS A 269 ? 0.7555 0.5830 0.6806 0.0032  -0.0040 0.0283  529 LYS A CA  
2114 C C   . LYS A 269 ? 0.8087 0.6420 0.7353 0.0154  0.0024  0.0394  529 LYS A C   
2115 O O   . LYS A 269 ? 0.8517 0.7081 0.7797 0.0240  0.0034  0.0410  529 LYS A O   
2116 C CB  . LYS A 269 ? 0.8090 0.6115 0.7163 0.0089  -0.0039 0.0165  529 LYS A CB  
2117 C CG  . LYS A 269 ? 0.8402 0.6477 0.7406 0.0269  0.0024  0.0151  529 LYS A CG  
2118 C CD  . LYS A 269 ? 0.9402 0.7178 0.8213 0.0320  0.0054  0.0026  529 LYS A CD  
2119 C CE  . LYS A 269 ? 1.0147 0.7644 0.8917 0.0448  0.0136  0.0059  529 LYS A CE  
2120 N NZ  . LYS A 269 ? 1.0779 0.8005 0.9352 0.0527  0.0197  -0.0074 529 LYS A NZ  
2121 N N   . GLY A 270 ? 0.8052 0.6169 0.7313 0.0149  0.0060  0.0474  530 GLY A N   
2122 C CA  . GLY A 270 ? 0.7804 0.5949 0.7052 0.0253  0.0108  0.0604  530 GLY A CA  
2123 C C   . GLY A 270 ? 0.7794 0.5734 0.7062 0.0178  0.0150  0.0709  530 GLY A C   
2124 O O   . GLY A 270 ? 0.7832 0.5726 0.7190 0.0022  0.0143  0.0694  530 GLY A O   
2125 N N   . LYS A 271 ? 0.7972 0.5794 0.7169 0.0290  0.0195  0.0828  531 LYS A N   
2126 C CA  . LYS A 271 ? 0.8441 0.6106 0.7636 0.0237  0.0256  0.0967  531 LYS A CA  
2127 C C   . LYS A 271 ? 0.8901 0.6837 0.8131 0.0174  0.0278  0.1036  531 LYS A C   
2128 O O   . LYS A 271 ? 0.8811 0.7027 0.8033 0.0211  0.0242  0.0994  531 LYS A O   
2129 C CB  . LYS A 271 ? 0.8422 0.5919 0.7502 0.0401  0.0291  0.1097  531 LYS A CB  
2130 C CG  . LYS A 271 ? 0.8921 0.6095 0.7964 0.0492  0.0307  0.1057  531 LYS A CG  
2131 C CD  . LYS A 271 ? 0.9530 0.6651 0.8493 0.0701  0.0325  0.1206  531 LYS A CD  
2132 C CE  . LYS A 271 ? 0.9780 0.6500 0.8709 0.0808  0.0380  0.1217  531 LYS A CE  
2133 N NZ  . LYS A 271 ? 1.0188 0.6749 0.9132 0.0750  0.0383  0.1020  531 LYS A NZ  
2134 N N   . ASN A 272 ? 0.9344 0.7173 0.8609 0.0079  0.0353  0.1142  532 ASN A N   
2135 C CA  . ASN A 272 ? 0.9212 0.7239 0.8479 0.0034  0.0415  0.1224  532 ASN A CA  
2136 C C   . ASN A 272 ? 0.9223 0.7543 0.8616 -0.0038 0.0386  0.1122  532 ASN A C   
2137 O O   . ASN A 272 ? 0.9435 0.7960 0.8758 0.0002  0.0406  0.1135  532 ASN A O   
2138 C CB  . ASN A 272 ? 0.9235 0.7331 0.8289 0.0178  0.0421  0.1322  532 ASN A CB  
2139 C CG  . ASN A 272 ? 0.9603 0.7420 0.8529 0.0259  0.0461  0.1468  532 ASN A CG  
2140 O OD1 . ASN A 272 ? 0.9907 0.7488 0.8887 0.0176  0.0540  0.1542  532 ASN A OD1 
2141 N ND2 . ASN A 272 ? 0.9698 0.7545 0.8473 0.0420  0.0405  0.1522  532 ASN A ND2 
2142 N N   . ILE A 273 ? 0.8905 0.7231 0.8467 -0.0143 0.0336  0.1020  533 ILE A N   
2143 C CA  . ILE A 273 ? 0.8201 0.6791 0.7911 -0.0214 0.0308  0.0946  533 ILE A CA  
2144 C C   . ILE A 273 ? 0.8648 0.7224 0.8595 -0.0378 0.0330  0.0973  533 ILE A C   
2145 O O   . ILE A 273 ? 0.9251 0.7637 0.9255 -0.0458 0.0278  0.0935  533 ILE A O   
2146 C CB  . ILE A 273 ? 0.7310 0.5960 0.7009 -0.0186 0.0200  0.0805  533 ILE A CB  
2147 C CG1 . ILE A 273 ? 0.6532 0.5232 0.6060 -0.0032 0.0180  0.0779  533 ILE A CG1 
2148 C CG2 . ILE A 273 ? 0.7184 0.6080 0.7042 -0.0260 0.0169  0.0752  533 ILE A CG2 
2149 C CD1 . ILE A 273 ? 0.6581 0.5357 0.6100 0.0000  0.0104  0.0649  533 ILE A CD1 
2150 N N   . THR A 274 ? 0.7941 0.6714 0.8036 -0.0431 0.0409  0.1035  534 THR A N   
2151 C CA  . THR A 274 ? 0.7517 0.6348 0.7909 -0.0586 0.0431  0.1075  534 THR A CA  
2152 C C   . THR A 274 ? 0.7351 0.6486 0.7926 -0.0605 0.0399  0.1028  534 THR A C   
2153 O O   . THR A 274 ? 0.7920 0.7196 0.8407 -0.0514 0.0458  0.1031  534 THR A O   
2154 C CB  . THR A 274 ? 0.7204 0.5976 0.7645 -0.0620 0.0599  0.1230  534 THR A CB  
2155 O OG1 . THR A 274 ? 0.7337 0.5810 0.7562 -0.0571 0.0629  0.1289  534 THR A OG1 
2156 C CG2 . THR A 274 ? 0.6851 0.5686 0.7654 -0.0792 0.0628  0.1284  534 THR A CG2 
2157 N N   . GLN A 275 ? 0.6980 0.6206 0.7793 -0.0720 0.0294  0.0982  535 GLN A N   
2158 C CA  . GLN A 275 ? 0.6651 0.6168 0.7645 -0.0723 0.0250  0.0956  535 GLN A CA  
2159 C C   . GLN A 275 ? 0.6652 0.6359 0.7986 -0.0800 0.0358  0.1072  535 GLN A C   
2160 O O   . GLN A 275 ? 0.7052 0.6728 0.8614 -0.0934 0.0348  0.1123  535 GLN A O   
2161 C CB  . GLN A 275 ? 0.6314 0.5858 0.7361 -0.0791 0.0059  0.0851  535 GLN A CB  
2162 C CG  . GLN A 275 ? 0.6512 0.6335 0.7683 -0.0758 0.0005  0.0834  535 GLN A CG  
2163 C CD  . GLN A 275 ? 0.7325 0.7138 0.8417 -0.0791 -0.0185 0.0726  535 GLN A CD  
2164 O OE1 . GLN A 275 ? 0.8079 0.7796 0.9224 -0.0915 -0.0304 0.0688  535 GLN A OE1 
2165 N NE2 . GLN A 275 ? 0.7221 0.7116 0.8167 -0.0687 -0.0210 0.0675  535 GLN A NE2 
2166 N N   . LEU A 276 ? 0.6023 0.5914 0.7404 -0.0719 0.0475  0.1114  536 LEU A N   
2167 C CA  . LEU A 276 ? 0.5973 0.6042 0.7681 -0.0766 0.0626  0.1237  536 LEU A CA  
2168 C C   . LEU A 276 ? 0.6563 0.6924 0.8656 -0.0819 0.0539  0.1248  536 LEU A C   
2169 O O   . LEU A 276 ? 0.6758 0.7293 0.9238 -0.0901 0.0606  0.1351  536 LEU A O   
2170 C CB  . LEU A 276 ? 0.5693 0.5765 0.7229 -0.0648 0.0832  0.1282  536 LEU A CB  
2171 C CG  . LEU A 276 ? 0.6142 0.5956 0.7301 -0.0594 0.0921  0.1303  536 LEU A CG  
2172 C CD1 . LEU A 276 ? 0.5960 0.5785 0.6951 -0.0502 0.1128  0.1351  536 LEU A CD1 
2173 C CD2 . LEU A 276 ? 0.6163 0.5807 0.7396 -0.0697 0.0948  0.1390  536 LEU A CD2 
2174 N N   . SER A 277 ? 0.6744 0.7166 0.8741 -0.0770 0.0389  0.1153  537 SER A N   
2175 C CA  . SER A 277 ? 0.6827 0.7523 0.9135 -0.0791 0.0291  0.1173  537 SER A CA  
2176 C C   . SER A 277 ? 0.7147 0.7816 0.9243 -0.0757 0.0095  0.1059  537 SER A C   
2177 O O   . SER A 277 ? 0.7774 0.8262 0.9499 -0.0672 0.0097  0.0970  537 SER A O   
2178 C CB  . SER A 277 ? 0.6787 0.7662 0.9242 -0.0683 0.0475  0.1248  537 SER A CB  
2179 O OG  . SER A 277 ? 0.7116 0.7869 0.9211 -0.0553 0.0536  0.1171  537 SER A OG  
2180 N N   . TYR A 278 ? 0.6621 0.7481 0.8956 -0.0824 -0.0071 0.1071  538 TYR A N   
2181 C CA  . TYR A 278 ? 0.6012 0.6875 0.8157 -0.0787 -0.0245 0.0987  538 TYR A CA  
2182 C C   . TYR A 278 ? 0.6035 0.7213 0.8530 -0.0792 -0.0330 0.1076  538 TYR A C   
2183 O O   . TYR A 278 ? 0.6323 0.7654 0.9119 -0.0918 -0.0459 0.1124  538 TYR A O   
2184 C CB  . TYR A 278 ? 0.6134 0.6794 0.8072 -0.0895 -0.0427 0.0881  538 TYR A CB  
2185 C CG  . TYR A 278 ? 0.6454 0.7020 0.8061 -0.0847 -0.0570 0.0770  538 TYR A CG  
2186 C CD1 . TYR A 278 ? 0.6462 0.7035 0.7871 -0.0700 -0.0498 0.0751  538 TYR A CD1 
2187 C CD2 . TYR A 278 ? 0.6387 0.6815 0.7844 -0.0955 -0.0760 0.0677  538 TYR A CD2 
2188 C CE1 . TYR A 278 ? 0.6313 0.6793 0.7424 -0.0659 -0.0601 0.0662  538 TYR A CE1 
2189 C CE2 . TYR A 278 ? 0.6476 0.6791 0.7589 -0.0904 -0.0862 0.0576  538 TYR A CE2 
2190 C CZ  . TYR A 278 ? 0.6366 0.6717 0.7318 -0.0753 -0.0775 0.0578  538 TYR A CZ  
2191 O OH  . TYR A 278 ? 0.6136 0.6380 0.6759 -0.0703 -0.0852 0.0492  538 TYR A OH  
2192 N N   . GLN A 279 ? 0.6458 0.7733 0.8931 -0.0657 -0.0262 0.1103  539 GLN A N   
2193 C CA  . GLN A 279 ? 0.7154 0.8738 1.0001 -0.0621 -0.0297 0.1222  539 GLN A CA  
2194 C C   . GLN A 279 ? 0.7041 0.8638 0.9699 -0.0519 -0.0381 0.1201  539 GLN A C   
2195 O O   . GLN A 279 ? 0.7381 0.8767 0.9656 -0.0447 -0.0331 0.1106  539 GLN A O   
2196 C CB  . GLN A 279 ? 0.7657 0.9356 1.0764 -0.0529 -0.0040 0.1324  539 GLN A CB  
2197 C CG  . GLN A 279 ? 0.8826 1.0458 1.2029 -0.0591 0.0126  0.1351  539 GLN A CG  
2198 C CD  . GLN A 279 ? 1.0135 1.1605 1.3114 -0.0475 0.0386  0.1331  539 GLN A CD  
2199 O OE1 . GLN A 279 ? 1.0519 1.1763 1.3074 -0.0420 0.0395  0.1222  539 GLN A OE1 
2200 N NE2 . GLN A 279 ? 1.0434 1.2023 1.3696 -0.0439 0.0600  0.1435  539 GLN A NE2 
2201 N N   . SER A 280 ? 0.6606 0.8463 0.9555 -0.0509 -0.0501 0.1306  540 SER A N   
2202 C CA  . SER A 280 ? 0.6431 0.8337 0.9311 -0.0374 -0.0498 0.1349  540 SER A CA  
2203 C C   . SER A 280 ? 0.6400 0.8497 0.9670 -0.0264 -0.0306 0.1486  540 SER A C   
2204 O O   . SER A 280 ? 0.6772 0.8986 1.0362 -0.0297 -0.0191 0.1548  540 SER A O   
2205 C CB  . SER A 280 ? 0.6359 0.8391 0.9222 -0.0412 -0.0771 0.1381  540 SER A CB  
2206 O OG  . SER A 280 ? 0.6822 0.9178 1.0163 -0.0472 -0.0894 0.1515  540 SER A OG  
2207 N N   . HIS A 281 ? 0.6186 0.8292 0.9421 -0.0127 -0.0250 0.1534  541 HIS A N   
2208 C CA  . HIS A 281 ? 0.5759 0.7981 0.9312 0.0001  -0.0039 0.1649  541 HIS A CA  
2209 C C   . HIS A 281 ? 0.6323 0.8731 1.0067 0.0097  -0.0149 0.1784  541 HIS A C   
2210 O O   . HIS A 281 ? 0.6651 0.8917 1.0162 0.0196  -0.0110 0.1773  541 HIS A O   
2211 C CB  . HIS A 281 ? 0.5654 0.7598 0.8898 0.0087  0.0203  0.1551  541 HIS A CB  
2212 C CG  . HIS A 281 ? 0.6349 0.8108 0.9364 0.0007  0.0293  0.1431  541 HIS A CG  
2213 N ND1 . HIS A 281 ? 0.6324 0.8078 0.9485 0.0017  0.0508  0.1452  541 HIS A ND1 
2214 C CD2 . HIS A 281 ? 0.6553 0.8121 0.9199 -0.0075 0.0202  0.1300  541 HIS A CD2 
2215 C CE1 . HIS A 281 ? 0.6061 0.7629 0.8937 -0.0057 0.0533  0.1348  541 HIS A CE1 
2216 N NE2 . HIS A 281 ? 0.6232 0.7689 0.8811 -0.0109 0.0349  0.1256  541 HIS A NE2 
2217 N N   . MET A 282 ? 0.6568 0.9305 1.0756 0.0062  -0.0293 0.1923  542 MET A N   
2218 C CA  . MET A 282 ? 0.6160 0.9121 1.0554 0.0141  -0.0457 0.2077  542 MET A CA  
2219 C C   . MET A 282 ? 0.6086 0.9032 1.0633 0.0343  -0.0231 0.2183  542 MET A C   
2220 O O   . MET A 282 ? 0.6552 0.9490 1.1009 0.0440  -0.0307 0.2258  542 MET A O   
2221 C CB  . MET A 282 ? 0.5532 0.8895 1.0455 0.0058  -0.0646 0.2216  542 MET A CB  
2222 C CG  . MET A 282 ? 0.5029 0.8398 0.9809 -0.0157 -0.0908 0.2113  542 MET A CG  
2223 S SD  . MET A 282 ? 0.8626 1.2003 1.3061 -0.0203 -0.1284 0.2105  542 MET A SD  
2224 C CE  . MET A 282 ? 0.8719 1.1656 1.2487 -0.0335 -0.1295 0.1838  542 MET A CE  
2225 N N   . ALA A 283 ? 0.5948 0.8858 1.0694 0.0407  0.0060  0.2188  543 ALA A N   
2226 C CA  . ALA A 283 ? 0.5723 0.8623 1.0680 0.0602  0.0294  0.2296  543 ALA A CA  
2227 C C   . ALA A 283 ? 0.5933 0.8503 1.0457 0.0697  0.0377  0.2225  543 ALA A C   
2228 O O   . ALA A 283 ? 0.6580 0.9136 1.1261 0.0857  0.0502  0.2335  543 ALA A O   
2229 C CB  . ALA A 283 ? 0.5176 0.8052 1.0357 0.0644  0.0610  0.2289  543 ALA A CB  
2230 N N   . LEU A 284 ? 0.5603 0.7912 0.9616 0.0601  0.0316  0.2050  544 LEU A N   
2231 C CA  . LEU A 284 ? 0.5822 0.7852 0.9454 0.0666  0.0371  0.1990  544 LEU A CA  
2232 C C   . LEU A 284 ? 0.5789 0.7915 0.9344 0.0682  0.0121  0.2089  544 LEU A C   
2233 O O   . LEU A 284 ? 0.5799 0.8005 0.9204 0.0564  -0.0121 0.2050  544 LEU A O   
2234 C CB  . LEU A 284 ? 0.6047 0.7792 0.9205 0.0564  0.0416  0.1775  544 LEU A CB  
2235 C CG  . LEU A 284 ? 0.6357 0.7961 0.9503 0.0560  0.0669  0.1676  544 LEU A CG  
2236 C CD1 . LEU A 284 ? 0.6320 0.7719 0.9049 0.0449  0.0651  0.1491  544 LEU A CD1 
2237 C CD2 . LEU A 284 ? 0.6743 0.8172 0.9915 0.0695  0.0920  0.1694  544 LEU A CD2 
2238 N N   . LYS A 285 ? 0.5727 0.7819 0.9359 0.0829  0.0187  0.2217  545 LYS A N   
2239 C CA  . LYS A 285 ? 0.6108 0.8314 0.9705 0.0873  -0.0037 0.2360  545 LYS A CA  
2240 C C   . LYS A 285 ? 0.6394 0.8299 0.9621 0.0942  0.0050  0.2343  545 LYS A C   
2241 O O   . LYS A 285 ? 0.6712 0.8657 0.9945 0.1037  -0.0040 0.2503  545 LYS A O   
2242 C CB  . LYS A 285 ? 0.6205 0.8722 1.0339 0.1008  -0.0070 0.2606  545 LYS A CB  
2243 C CG  . LYS A 285 ? 0.6328 0.9190 1.0944 0.0951  -0.0127 0.2660  545 LYS A CG  
2244 C CD  . LYS A 285 ? 0.6521 0.9662 1.1731 0.1127  -0.0055 0.2904  545 LYS A CD  
2245 C CE  . LYS A 285 ? 0.6576 1.0096 1.2336 0.1074  -0.0087 0.2977  545 LYS A CE  
2246 N NZ  . LYS A 285 ? 0.6963 1.0329 1.2727 0.1027  0.0199  0.2826  545 LYS A NZ  
2247 N N   . THR A 286 ? 0.6132 0.7742 0.9045 0.0891  0.0221  0.2159  546 THR A N   
2248 C CA  . THR A 286 ? 0.6696 0.8026 0.9299 0.0937  0.0319  0.2138  546 THR A CA  
2249 C C   . THR A 286 ? 0.7042 0.8351 0.9274 0.0869  0.0107  0.2124  546 THR A C   
2250 O O   . THR A 286 ? 0.7434 0.8614 0.9492 0.0937  0.0120  0.2209  546 THR A O   
2251 C CB  . THR A 286 ? 0.6903 0.7946 0.9320 0.0896  0.0562  0.1948  546 THR A CB  
2252 O OG1 . THR A 286 ? 0.7221 0.8176 0.9896 0.1013  0.0800  0.2005  546 THR A OG1 
2253 C CG2 . THR A 286 ? 0.6950 0.7745 0.8985 0.0863  0.0593  0.1873  546 THR A CG2 
2254 N N   . SER A 287 ? 0.6828 0.8253 0.8945 0.0743  -0.0079 0.2029  547 SER A N   
2255 C CA  . SER A 287 ? 0.6861 0.8231 0.8580 0.0668  -0.0260 0.1976  547 SER A CA  
2256 C C   . SER A 287 ? 0.7041 0.8655 0.8805 0.0622  -0.0557 0.2061  547 SER A C   
2257 O O   . SER A 287 ? 0.7200 0.9069 0.9354 0.0626  -0.0641 0.2153  547 SER A O   
2258 C CB  . SER A 287 ? 0.6637 0.7859 0.8099 0.0548  -0.0212 0.1753  547 SER A CB  
2259 O OG  . SER A 287 ? 0.7044 0.8180 0.8113 0.0488  -0.0343 0.1687  547 SER A OG  
2260 N N   . ASP A 288 ? 0.6823 0.8354 0.8180 0.0574  -0.0712 0.2027  548 ASP A N   
2261 C CA  . ASP A 288 ? 0.6988 0.8694 0.8268 0.0495  -0.1016 0.2056  548 ASP A CA  
2262 C C   . ASP A 288 ? 0.6880 0.8591 0.8115 0.0336  -0.1096 0.1867  548 ASP A C   
2263 O O   . ASP A 288 ? 0.6776 0.8634 0.8019 0.0240  -0.1343 0.1866  548 ASP A O   
2264 C CB  . ASP A 288 ? 0.4876 0.6465 0.5688 0.0516  -0.1148 0.2104  548 ASP A CB  
2265 C CG  . ASP A 288 ? 0.7051 0.8324 0.7397 0.0493  -0.0990 0.1946  548 ASP A CG  
2266 O OD1 . ASP A 288 ? 0.6810 0.7969 0.7208 0.0463  -0.0799 0.1807  548 ASP A OD1 
2267 O OD2 . ASP A 288 ? 0.6890 0.8038 0.6817 0.0506  -0.1054 0.1966  548 ASP A OD2 
2268 N N   . HIS A 289 ? 0.6708 0.8253 0.7899 0.0304  -0.0895 0.1713  549 HIS A N   
2269 C CA  . HIS A 289 ? 0.6411 0.7967 0.7659 0.0177  -0.0927 0.1569  549 HIS A CA  
2270 C C   . HIS A 289 ? 0.5850 0.7532 0.7547 0.0199  -0.0774 0.1608  549 HIS A C   
2271 O O   . HIS A 289 ? 0.5343 0.7008 0.7201 0.0309  -0.0587 0.1680  549 HIS A O   
2272 C CB  . HIS A 289 ? 0.5804 0.7096 0.6695 0.0132  -0.0810 0.1378  549 HIS A CB  
2273 C CG  . HIS A 289 ? 0.6386 0.7514 0.6808 0.0109  -0.0908 0.1308  549 HIS A CG  
2274 N ND1 . HIS A 289 ? 0.6880 0.7899 0.7048 0.0004  -0.1014 0.1162  549 HIS A ND1 
2275 C CD2 . HIS A 289 ? 0.7002 0.8025 0.7144 0.0183  -0.0880 0.1358  549 HIS A CD2 
2276 C CE1 . HIS A 289 ? 0.7334 0.8193 0.7079 0.0021  -0.1048 0.1121  549 HIS A CE1 
2277 N NE2 . HIS A 289 ? 0.7474 0.8341 0.7195 0.0126  -0.0968 0.1244  549 HIS A NE2 
2278 N N   . LYS A 290 ? 0.5900 0.7678 0.7772 0.0090  -0.0837 0.1552  550 LYS A N   
2279 C CA  . LYS A 290 ? 0.6227 0.8051 0.8414 0.0095  -0.0647 0.1546  550 LYS A CA  
2280 C C   . LYS A 290 ? 0.6382 0.7960 0.8291 0.0043  -0.0514 0.1368  550 LYS A C   
2281 O O   . LYS A 290 ? 0.6374 0.7809 0.7955 -0.0029 -0.0613 0.1252  550 LYS A O   
2282 C CB  . LYS A 290 ? 0.5919 0.8007 0.8516 0.0010  -0.0764 0.1617  550 LYS A CB  
2283 C CG  . LYS A 290 ? 0.6005 0.8395 0.8934 0.0055  -0.0932 0.1808  550 LYS A CG  
2284 C CD  . LYS A 290 ? 0.5927 0.8388 0.9117 0.0233  -0.0747 0.1955  550 LYS A CD  
2285 C CE  . LYS A 290 ? 0.5980 0.8793 0.9599 0.0284  -0.0914 0.2169  550 LYS A CE  
2286 N NZ  . LYS A 290 ? 0.6236 0.9078 1.0076 0.0480  -0.0735 0.2323  550 LYS A NZ  
2287 N N   . PRO A 291 ? 0.6415 0.7934 0.8438 0.0088  -0.0287 0.1348  551 PRO A N   
2288 C CA  . PRO A 291 ? 0.6117 0.7435 0.7887 0.0038  -0.0193 0.1197  551 PRO A CA  
2289 C C   . PRO A 291 ? 0.6201 0.7565 0.8077 -0.0075 -0.0258 0.1162  551 PRO A C   
2290 O O   . PRO A 291 ? 0.6498 0.8070 0.8714 -0.0116 -0.0328 0.1258  551 PRO A O   
2291 C CB  . PRO A 291 ? 0.5616 0.6854 0.7447 0.0119  0.0054  0.1192  551 PRO A CB  
2292 C CG  . PRO A 291 ? 0.5769 0.7175 0.7957 0.0201  0.0114  0.1339  551 PRO A CG  
2293 C CD  . PRO A 291 ? 0.6201 0.7818 0.8559 0.0186  -0.0108 0.1454  551 PRO A CD  
2294 N N   . VAL A 292 ? 0.5923 0.7097 0.7527 -0.0123 -0.0230 0.1035  552 VAL A N   
2295 C CA  . VAL A 292 ? 0.6082 0.7227 0.7715 -0.0230 -0.0282 0.0991  552 VAL A CA  
2296 C C   . VAL A 292 ? 0.6396 0.7388 0.7901 -0.0209 -0.0101 0.0926  552 VAL A C   
2297 O O   . VAL A 292 ? 0.6864 0.7738 0.8151 -0.0140 -0.0008 0.0868  552 VAL A O   
2298 C CB  . VAL A 292 ? 0.5327 0.6355 0.6688 -0.0308 -0.0473 0.0901  552 VAL A CB  
2299 C CG1 . VAL A 292 ? 0.5306 0.6219 0.6635 -0.0409 -0.0494 0.0836  552 VAL A CG1 
2300 C CG2 . VAL A 292 ? 0.5375 0.6564 0.6841 -0.0344 -0.0675 0.0969  552 VAL A CG2 
2301 N N   . SER A 293 ? 0.6270 0.7269 0.7915 -0.0272 -0.0053 0.0944  553 SER A N   
2302 C CA  . SER A 293 ? 0.6199 0.7057 0.7704 -0.0250 0.0109  0.0902  553 SER A CA  
2303 C C   . SER A 293 ? 0.6475 0.7255 0.7986 -0.0346 0.0077  0.0893  553 SER A C   
2304 O O   . SER A 293 ? 0.6599 0.7476 0.8332 -0.0439 -0.0030 0.0939  553 SER A O   
2305 C CB  . SER A 293 ? 0.5908 0.6847 0.7604 -0.0187 0.0306  0.0973  553 SER A CB  
2306 O OG  . SER A 293 ? 0.6213 0.7306 0.8259 -0.0238 0.0338  0.1076  553 SER A OG  
2307 N N   . SER A 294 ? 0.5964 0.6568 0.7238 -0.0328 0.0162  0.0839  554 SER A N   
2308 C CA  . SER A 294 ? 0.5728 0.6223 0.6994 -0.0400 0.0175  0.0852  554 SER A CA  
2309 C C   . SER A 294 ? 0.6756 0.7134 0.7841 -0.0344 0.0339  0.0853  554 SER A C   
2310 O O   . SER A 294 ? 0.6848 0.7165 0.7700 -0.0266 0.0370  0.0790  554 SER A O   
2311 C CB  . SER A 294 ? 0.5341 0.5671 0.6403 -0.0444 0.0029  0.0768  554 SER A CB  
2312 O OG  . SER A 294 ? 0.5990 0.6173 0.7032 -0.0504 0.0058  0.0786  554 SER A OG  
2313 N N   . VAL A 295 ? 0.6777 0.7130 0.7967 -0.0389 0.0440  0.0929  555 VAL A N   
2314 C CA  . VAL A 295 ? 0.6426 0.6641 0.7391 -0.0345 0.0578  0.0940  555 VAL A CA  
2315 C C   . VAL A 295 ? 0.6334 0.6366 0.7180 -0.0395 0.0532  0.0951  555 VAL A C   
2316 O O   . VAL A 295 ? 0.6264 0.6292 0.7311 -0.0493 0.0486  0.0994  555 VAL A O   
2317 C CB  . VAL A 295 ? 0.6156 0.6449 0.7272 -0.0334 0.0778  0.1030  555 VAL A CB  
2318 C CG1 . VAL A 295 ? 0.6013 0.6138 0.6829 -0.0294 0.0909  0.1044  555 VAL A CG1 
2319 C CG2 . VAL A 295 ? 0.5808 0.6234 0.7018 -0.0266 0.0835  0.1013  555 VAL A CG2 
2320 N N   . PHE A 296 ? 0.6317 0.6198 0.6848 -0.0328 0.0540  0.0914  556 PHE A N   
2321 C CA  . PHE A 296 ? 0.6534 0.6212 0.6918 -0.0342 0.0513  0.0937  556 PHE A CA  
2322 C C   . PHE A 296 ? 0.6934 0.6516 0.7110 -0.0292 0.0645  0.1006  556 PHE A C   
2323 O O   . PHE A 296 ? 0.7338 0.6968 0.7346 -0.0223 0.0694  0.0977  556 PHE A O   
2324 C CB  . PHE A 296 ? 0.6636 0.6218 0.6814 -0.0283 0.0387  0.0845  556 PHE A CB  
2325 C CG  . PHE A 296 ? 0.6691 0.6318 0.6967 -0.0318 0.0255  0.0763  556 PHE A CG  
2326 C CD1 . PHE A 296 ? 0.6593 0.6090 0.6925 -0.0395 0.0172  0.0748  556 PHE A CD1 
2327 C CD2 . PHE A 296 ? 0.6418 0.6187 0.6691 -0.0275 0.0215  0.0699  556 PHE A CD2 
2328 C CE1 . PHE A 296 ? 0.6632 0.6145 0.6988 -0.0430 0.0044  0.0664  556 PHE A CE1 
2329 C CE2 . PHE A 296 ? 0.6593 0.6386 0.6904 -0.0302 0.0096  0.0633  556 PHE A CE2 
2330 C CZ  . PHE A 296 ? 0.6425 0.6089 0.6757 -0.0378 0.0006  0.0612  556 PHE A CZ  
2331 N N   . ASP A 297 ? 0.7000 0.6429 0.7167 -0.0333 0.0695  0.1096  557 ASP A N   
2332 C CA  . ASP A 297 ? 0.7289 0.6565 0.7175 -0.0273 0.0778  0.1170  557 ASP A CA  
2333 C C   . ASP A 297 ? 0.7260 0.6391 0.6965 -0.0212 0.0647  0.1130  557 ASP A C   
2334 O O   . ASP A 297 ? 0.7635 0.6629 0.7429 -0.0258 0.0590  0.1135  557 ASP A O   
2335 C CB  . ASP A 297 ? 0.7979 0.7140 0.7955 -0.0344 0.0916  0.1311  557 ASP A CB  
2336 C CG  . ASP A 297 ? 0.8895 0.8106 0.8798 -0.0326 0.1117  0.1393  557 ASP A CG  
2337 O OD1 . ASP A 297 ? 0.9114 0.8422 0.8873 -0.0261 0.1150  0.1332  557 ASP A OD1 
2338 O OD2 . ASP A 297 ? 0.9700 0.8828 0.9676 -0.0381 0.1258  0.1519  557 ASP A OD2 
2339 N N   . ILE A 298 ? 0.6929 0.6088 0.6397 -0.0111 0.0601  0.1088  558 ILE A N   
2340 C CA  . ILE A 298 ? 0.7046 0.6099 0.6369 -0.0029 0.0493  0.1069  558 ILE A CA  
2341 C C   . ILE A 298 ? 0.7361 0.6303 0.6416 0.0053  0.0520  0.1172  558 ILE A C   
2342 O O   . ILE A 298 ? 0.7777 0.6797 0.6658 0.0081  0.0561  0.1187  558 ILE A O   
2343 C CB  . ILE A 298 ? 0.6679 0.5884 0.5991 0.0025  0.0390  0.0947  558 ILE A CB  
2344 C CG1 . ILE A 298 ? 0.6488 0.5767 0.6024 -0.0045 0.0346  0.0859  558 ILE A CG1 
2345 C CG2 . ILE A 298 ? 0.6363 0.5492 0.5545 0.0130  0.0302  0.0947  558 ILE A CG2 
2346 C CD1 . ILE A 298 ? 0.6191 0.5610 0.5727 -0.0001 0.0268  0.0750  558 ILE A CD1 
2347 N N   . GLY A 299 ? 0.7370 0.6114 0.6375 0.0093  0.0496  0.1245  559 GLY A N   
2348 C CA  . GLY A 299 ? 0.8025 0.6660 0.6775 0.0188  0.0504  0.1366  559 GLY A CA  
2349 C C   . GLY A 299 ? 0.8056 0.6811 0.6694 0.0305  0.0374  0.1317  559 GLY A C   
2350 O O   . GLY A 299 ? 0.8444 0.7194 0.7195 0.0350  0.0295  0.1253  559 GLY A O   
2351 N N   . VAL A 300 ? 0.7423 0.6288 0.5841 0.0347  0.0357  0.1344  560 VAL A N   
2352 C CA  . VAL A 300 ? 0.7454 0.6476 0.5785 0.0441  0.0221  0.1308  560 VAL A CA  
2353 C C   . VAL A 300 ? 0.8073 0.7004 0.6150 0.0541  0.0182  0.1466  560 VAL A C   
2354 O O   . VAL A 300 ? 0.7870 0.6694 0.5728 0.0517  0.0266  0.1564  560 VAL A O   
2355 C CB  . VAL A 300 ? 0.7460 0.6695 0.5724 0.0391  0.0202  0.1197  560 VAL A CB  
2356 C CG1 . VAL A 300 ? 0.7664 0.7070 0.5824 0.0469  0.0051  0.1181  560 VAL A CG1 
2357 C CG2 . VAL A 300 ? 0.6828 0.6168 0.5341 0.0311  0.0230  0.1055  560 VAL A CG2 
2358 N N   . ARG A 301 ? 0.8525 0.7502 0.6632 0.0662  0.0061  0.1501  561 ARG A N   
2359 C CA  . ARG A 301 ? 0.9248 0.8161 0.7138 0.0779  -0.0002 0.1670  561 ARG A CA  
2360 C C   . ARG A 301 ? 0.9228 0.8364 0.6896 0.0781  -0.0111 0.1651  561 ARG A C   
2361 O O   . ARG A 301 ? 0.8810 0.8194 0.6594 0.0783  -0.0224 0.1540  561 ARG A O   
2362 C CB  . ARG A 301 ? 0.9742 0.8622 0.7786 0.0926  -0.0083 0.1732  561 ARG A CB  
2363 C CG  . ARG A 301 ? 1.0602 0.9296 0.8893 0.0913  -0.0002 0.1670  561 ARG A CG  
2364 C CD  . ARG A 301 ? 1.1822 1.0304 1.0160 0.1066  -0.0008 0.1794  561 ARG A CD  
2365 N NE  . ARG A 301 ? 1.3550 1.1704 1.1747 0.1049  0.0099  0.1945  561 ARG A NE  
2366 C CZ  . ARG A 301 ? 1.4543 1.2567 1.2551 0.1163  0.0087  0.2151  561 ARG A CZ  
2367 N NH1 . ARG A 301 ? 1.4637 1.2841 1.2584 0.1319  -0.0051 0.2242  561 ARG A NH1 
2368 N NH2 . ARG A 301 ? 1.4817 1.2526 1.2710 0.1122  0.0212  0.2281  561 ARG A NH2 
2369 N N   . VAL A 302 ? 0.9683 0.8713 0.7018 0.0769  -0.0069 0.1759  562 VAL A N   
2370 C CA  . VAL A 302 ? 0.9703 0.8881 0.6736 0.0748  -0.0160 0.1735  562 VAL A CA  
2371 C C   . VAL A 302 ? 1.0816 0.9972 0.7601 0.0877  -0.0287 0.1924  562 VAL A C   
2372 O O   . VAL A 302 ? 1.1508 1.0420 0.8144 0.0933  -0.0200 0.2101  562 VAL A O   
2373 C CB  . VAL A 302 ? 0.9130 0.8176 0.5912 0.0640  0.0008  0.1713  562 VAL A CB  
2374 C CG1 . VAL A 302 ? 0.9332 0.8475 0.5722 0.0615  -0.0080 0.1675  562 VAL A CG1 
2375 C CG2 . VAL A 302 ? 0.8168 0.7248 0.5234 0.0531  0.0128  0.1553  562 VAL A CG2 
2376 N N   . VAL A 303 ? 1.1010 1.0426 0.7770 0.0923  -0.0495 0.1898  563 VAL A N   
2377 C CA  . VAL A 303 ? 1.1496 1.0956 0.8054 0.1058  -0.0662 0.2087  563 VAL A CA  
2378 C C   . VAL A 303 ? 1.1225 1.0849 0.7413 0.1001  -0.0814 0.2047  563 VAL A C   
2379 O O   . VAL A 303 ? 1.1469 1.1009 0.7269 0.1058  -0.0878 0.2206  563 VAL A O   
2380 C CB  . VAL A 303 ? 1.2259 1.1913 0.9197 0.1201  -0.0809 0.2135  563 VAL A CB  
2381 N N   . MET B 1   ? 1.5875 1.3060 0.9212 0.1735  -0.1217 -0.1478 261 MET B N   
2382 C CA  . MET B 1   ? 1.6070 1.3332 0.9649 0.1767  -0.1096 -0.1578 261 MET B CA  
2383 C C   . MET B 1   ? 1.5748 1.2988 0.9888 0.1609  -0.1160 -0.1583 261 MET B C   
2384 O O   . MET B 1   ? 1.5597 1.3000 1.0033 0.1532  -0.0995 -0.1474 261 MET B O   
2385 C CB  . MET B 1   ? 1.6354 1.3453 0.9650 0.1957  -0.1195 -0.1845 261 MET B CB  
2386 N N   . ILE B 2   ? 1.5458 1.2515 0.9737 0.1562  -0.1401 -0.1706 262 ILE B N   
2387 C CA  . ILE B 2   ? 1.4417 1.1452 0.9209 0.1418  -0.1474 -0.1724 262 ILE B CA  
2388 C C   . ILE B 2   ? 1.4299 1.1303 0.9244 0.1309  -0.1639 -0.1665 262 ILE B C   
2389 O O   . ILE B 2   ? 1.4196 1.1068 0.9029 0.1346  -0.1856 -0.1792 262 ILE B O   
2390 C CB  . ILE B 2   ? 1.4286 1.1137 0.9183 0.1459  -0.1618 -0.1962 262 ILE B CB  
2391 C CG1 . ILE B 2   ? 1.4579 1.1420 0.9319 0.1599  -0.1476 -0.2049 262 ILE B CG1 
2392 C CG2 . ILE B 2   ? 1.3524 1.0366 0.8943 0.1295  -0.1684 -0.1955 262 ILE B CG2 
2393 C CD1 . ILE B 2   ? 1.4108 1.1129 0.9139 0.1546  -0.1259 -0.1914 262 ILE B CD1 
2394 N N   . GLN B 3   ? 1.4365 1.1493 0.9571 0.1185  -0.1546 -0.1482 263 GLN B N   
2395 C CA  . GLN B 3   ? 1.4131 1.1244 0.9535 0.1093  -0.1685 -0.1425 263 GLN B CA  
2396 C C   . GLN B 3   ? 1.3510 1.0674 0.9422 0.0972  -0.1696 -0.1452 263 GLN B C   
2397 O O   . GLN B 3   ? 1.3324 1.0564 0.9416 0.0932  -0.1542 -0.1415 263 GLN B O   
2398 C CB  . GLN B 3   ? 1.4518 1.1699 0.9809 0.1050  -0.1576 -0.1203 263 GLN B CB  
2399 C CG  . GLN B 3   ? 1.5328 1.2458 1.0714 0.1003  -0.1730 -0.1141 263 GLN B CG  
2400 C CD  . GLN B 3   ? 1.6018 1.3164 1.1306 0.0948  -0.1617 -0.0914 263 GLN B CD  
2401 O OE1 . GLN B 3   ? 1.6540 1.3660 1.1448 0.0995  -0.1539 -0.0810 263 GLN B OE1 
2402 N NE2 . GLN B 3   ? 1.5756 1.2938 1.1379 0.0845  -0.1608 -0.0837 263 GLN B NE2 
2403 N N   . ASN B 4   ? 1.3328 1.0469 0.9468 0.0920  -0.1877 -0.1511 264 ASN B N   
2404 C CA  . ASN B 4   ? 1.3413 1.0624 1.0030 0.0802  -0.1885 -0.1527 264 ASN B CA  
2405 C C   . ASN B 4   ? 1.3417 1.0747 1.0253 0.0720  -0.1811 -0.1366 264 ASN B C   
2406 O O   . ASN B 4   ? 1.3557 1.0875 1.0264 0.0745  -0.1875 -0.1293 264 ASN B O   
2407 C CB  . ASN B 4   ? 1.3796 1.0965 1.0600 0.0780  -0.2114 -0.1684 264 ASN B CB  
2408 C CG  . ASN B 4   ? 1.4607 1.1622 1.1243 0.0842  -0.2215 -0.1872 264 ASN B CG  
2409 O OD1 . ASN B 4   ? 1.4480 1.1434 1.1112 0.0851  -0.2108 -0.1910 264 ASN B OD1 
2410 N ND2 . ASN B 4   ? 1.5257 1.2198 1.1753 0.0893  -0.2436 -0.1998 264 ASN B ND2 
2411 N N   . PHE B 5   ? 1.2635 1.0056 0.9782 0.0631  -0.1689 -0.1317 265 PHE B N   
2412 C CA  . PHE B 5   ? 1.1544 0.9068 0.8915 0.0556  -0.1624 -0.1193 265 PHE B CA  
2413 C C   . PHE B 5   ? 1.1240 0.8853 0.9028 0.0472  -0.1654 -0.1239 265 PHE B C   
2414 O O   . PHE B 5   ? 1.1020 0.8617 0.8945 0.0441  -0.1643 -0.1315 265 PHE B O   
2415 C CB  . PHE B 5   ? 1.1198 0.8779 0.8522 0.0526  -0.1423 -0.1062 265 PHE B CB  
2416 C CG  . PHE B 5   ? 1.1738 0.9279 0.8692 0.0581  -0.1361 -0.0976 265 PHE B CG  
2417 C CD1 . PHE B 5   ? 1.1678 0.9209 0.8544 0.0550  -0.1338 -0.0837 265 PHE B CD1 
2418 C CD2 . PHE B 5   ? 1.2084 0.9591 0.8770 0.0665  -0.1322 -0.1031 265 PHE B CD2 
2419 C CE1 . PHE B 5   ? 1.1630 0.9127 0.8161 0.0580  -0.1270 -0.0733 265 PHE B CE1 
2420 C CE2 . PHE B 5   ? 1.2182 0.9688 0.8525 0.0713  -0.1243 -0.0937 265 PHE B CE2 
2421 C CZ  . PHE B 5   ? 1.1913 0.9419 0.8185 0.0659  -0.1214 -0.0777 265 PHE B CZ  
2422 N N   . ARG B 6   ? 1.1251 0.8949 0.9229 0.0440  -0.1685 -0.1187 266 ARG B N   
2423 C CA  . ARG B 6   ? 1.0964 0.8794 0.9339 0.0364  -0.1691 -0.1211 266 ARG B CA  
2424 C C   . ARG B 6   ? 1.0169 0.8062 0.8670 0.0302  -0.1512 -0.1119 266 ARG B C   
2425 O O   . ARG B 6   ? 0.9870 0.7771 0.8281 0.0305  -0.1429 -0.1018 266 ARG B O   
2426 C CB  . ARG B 6   ? 1.1219 0.9140 0.9737 0.0384  -0.1790 -0.1202 266 ARG B CB  
2427 C CG  . ARG B 6   ? 1.1862 0.9769 1.0338 0.0446  -0.1998 -0.1301 266 ARG B CG  
2428 C CD  . ARG B 6   ? 1.2572 1.0577 1.1353 0.0380  -0.2088 -0.1420 266 ARG B CD  
2429 N NE  . ARG B 6   ? 1.3370 1.1327 1.2051 0.0432  -0.2298 -0.1539 266 ARG B NE  
2430 C CZ  . ARG B 6   ? 1.3933 1.1984 1.2692 0.0489  -0.2464 -0.1576 266 ARG B CZ  
2431 N NH1 . ARG B 6   ? 1.3805 1.1993 1.2738 0.0514  -0.2440 -0.1508 266 ARG B NH1 
2432 N NH2 . ARG B 6   ? 1.4434 1.2439 1.3084 0.0537  -0.2667 -0.1692 266 ARG B NH2 
2433 N N   . PHE B 7   ? 0.9940 0.7861 0.8639 0.0242  -0.1464 -0.1152 267 PHE B N   
2434 C CA  . PHE B 7   ? 0.9830 0.7818 0.8664 0.0187  -0.1311 -0.1068 267 PHE B CA  
2435 C C   . PHE B 7   ? 0.9983 0.8106 0.9160 0.0114  -0.1314 -0.1070 267 PHE B C   
2436 O O   . PHE B 7   ? 1.0209 0.8338 0.9562 0.0066  -0.1381 -0.1139 267 PHE B O   
2437 C CB  . PHE B 7   ? 0.9834 0.7733 0.8600 0.0190  -0.1239 -0.1083 267 PHE B CB  
2438 C CG  . PHE B 7   ? 1.0089 0.7937 0.8562 0.0260  -0.1163 -0.1043 267 PHE B CG  
2439 C CD1 . PHE B 7   ? 0.9507 0.7412 0.7983 0.0252  -0.1022 -0.0957 267 PHE B CD1 
2440 C CD2 . PHE B 7   ? 1.0649 0.8414 0.8846 0.0334  -0.1231 -0.1089 267 PHE B CD2 
2441 C CE1 . PHE B 7   ? 0.9650 0.7562 0.7900 0.0309  -0.0943 -0.0915 267 PHE B CE1 
2442 C CE2 . PHE B 7   ? 1.0667 0.8424 0.8603 0.0393  -0.1139 -0.1038 267 PHE B CE2 
2443 C CZ  . PHE B 7   ? 1.0240 0.8087 0.8224 0.0376  -0.0991 -0.0951 267 PHE B CZ  
2444 N N   . PHE B 8   ? 0.9977 0.8213 0.9245 0.0103  -0.1240 -0.0995 268 PHE B N   
2445 C CA  . PHE B 8   ? 0.9461 0.7855 0.9028 0.0042  -0.1194 -0.0976 268 PHE B CA  
2446 C C   . PHE B 8   ? 0.8680 0.7067 0.8278 -0.0007 -0.1058 -0.0905 268 PHE B C   
2447 O O   . PHE B 8   ? 0.8199 0.6545 0.7633 0.0019  -0.0979 -0.0845 268 PHE B O   
2448 C CB  . PHE B 8   ? 0.9219 0.7727 0.8835 0.0079  -0.1184 -0.0944 268 PHE B CB  
2449 C CG  . PHE B 8   ? 0.9292 0.7998 0.9196 0.0036  -0.1121 -0.0928 268 PHE B CG  
2450 C CD1 . PHE B 8   ? 0.9617 0.8493 0.9758 0.0042  -0.1197 -0.0983 268 PHE B CD1 
2451 C CD2 . PHE B 8   ? 0.9073 0.7822 0.9012 -0.0005 -0.0984 -0.0853 268 PHE B CD2 
2452 C CE1 . PHE B 8   ? 0.9552 0.8654 0.9965 0.0006  -0.1117 -0.0959 268 PHE B CE1 
2453 C CE2 . PHE B 8   ? 0.9022 0.7966 0.9196 -0.0039 -0.0911 -0.0828 268 PHE B CE2 
2454 C CZ  . PHE B 8   ? 0.9181 0.8310 0.9593 -0.0035 -0.0967 -0.0878 268 PHE B CZ  
2455 N N   . ALA B 9   ? 0.8666 0.7096 0.8481 -0.0081 -0.1038 -0.0907 269 ALA B N   
2456 C CA  . ALA B 9   ? 0.8872 0.7309 0.8744 -0.0125 -0.0913 -0.0822 269 ALA B CA  
2457 C C   . ALA B 9   ? 0.8924 0.7556 0.9053 -0.0186 -0.0855 -0.0777 269 ALA B C   
2458 O O   . ALA B 9   ? 0.8905 0.7644 0.9253 -0.0234 -0.0916 -0.0819 269 ALA B O   
2459 C CB  . ALA B 9   ? 0.8812 0.7080 0.8675 -0.0158 -0.0926 -0.0842 269 ALA B CB  
2460 N N   . GLY B 10  ? 0.8700 0.7399 0.8800 -0.0180 -0.0739 -0.0692 270 GLY B N   
2461 C CA  . GLY B 10  ? 0.8175 0.7069 0.8471 -0.0222 -0.0656 -0.0638 270 GLY B CA  
2462 C C   . GLY B 10  ? 0.8062 0.6934 0.8324 -0.0253 -0.0537 -0.0532 270 GLY B C   
2463 O O   . GLY B 10  ? 0.8110 0.6855 0.8179 -0.0213 -0.0515 -0.0502 270 GLY B O   
2464 N N   . THR B 11  ? 0.7841 0.6852 0.8295 -0.0323 -0.0461 -0.0468 271 THR B N   
2465 C CA  . THR B 11  ? 0.7998 0.7012 0.8409 -0.0346 -0.0343 -0.0351 271 THR B CA  
2466 C C   . THR B 11  ? 0.8448 0.7720 0.9016 -0.0372 -0.0245 -0.0300 271 THR B C   
2467 O O   . THR B 11  ? 0.8779 0.8207 0.9590 -0.0431 -0.0256 -0.0323 271 THR B O   
2468 C CB  . THR B 11  ? 0.8030 0.6855 0.8477 -0.0424 -0.0340 -0.0290 271 THR B CB  
2469 O OG1 . THR B 11  ? 0.8474 0.7326 0.8897 -0.0449 -0.0223 -0.0156 271 THR B OG1 
2470 C CG2 . THR B 11  ? 0.7769 0.6607 0.8470 -0.0534 -0.0401 -0.0324 271 THR B CG2 
2471 N N   . TYR B 12  ? 0.8366 0.7703 0.8796 -0.0322 -0.0150 -0.0235 272 TYR B N   
2472 C CA  . TYR B 12  ? 0.8234 0.7832 0.8759 -0.0315 -0.0043 -0.0197 272 TYR B CA  
2473 C C   . TYR B 12  ? 0.8725 0.8318 0.9073 -0.0295 0.0065  -0.0086 272 TYR B C   
2474 O O   . TYR B 12  ? 0.8528 0.8021 0.8644 -0.0218 0.0043  -0.0099 272 TYR B O   
2475 C CB  . TYR B 12  ? 0.8062 0.7780 0.8551 -0.0207 -0.0085 -0.0309 272 TYR B CB  
2476 C CG  . TYR B 12  ? 0.8211 0.8227 0.8836 -0.0168 0.0006  -0.0315 272 TYR B CG  
2477 C CD1 . TYR B 12  ? 0.8143 0.8370 0.8977 -0.0254 0.0124  -0.0221 272 TYR B CD1 
2478 C CD2 . TYR B 12  ? 0.7944 0.8034 0.8497 -0.0042 -0.0029 -0.0418 272 TYR B CD2 
2479 C CE1 . TYR B 12  ? 0.7891 0.8443 0.8860 -0.0203 0.0222  -0.0231 272 TYR B CE1 
2480 C CE2 . TYR B 12  ? 0.7656 0.8031 0.8329 0.0025  0.0052  -0.0444 272 TYR B CE2 
2481 C CZ  . TYR B 12  ? 0.7463 0.8093 0.8348 -0.0050 0.0184  -0.0353 272 TYR B CZ  
2482 O OH  . TYR B 12  ? 0.6962 0.7915 0.7966 0.0032  0.0281  -0.0381 272 TYR B OH  
2483 N N   . ASN B 13  ? 0.9191 0.8890 0.9651 -0.0373 0.0176  0.0032  273 ASN B N   
2484 C CA  . ASN B 13  ? 0.8991 0.8704 0.9272 -0.0351 0.0284  0.0153  273 ASN B CA  
2485 C C   . ASN B 13  ? 0.8691 0.8685 0.8959 -0.0278 0.0378  0.0130  273 ASN B C   
2486 O O   . ASN B 13  ? 0.8552 0.8782 0.9031 -0.0329 0.0468  0.0165  273 ASN B O   
2487 C CB  . ASN B 13  ? 0.9055 0.8709 0.9438 -0.0476 0.0360  0.0312  273 ASN B CB  
2488 C CG  . ASN B 13  ? 0.9224 0.8893 0.9400 -0.0449 0.0474  0.0457  273 ASN B CG  
2489 O OD1 . ASN B 13  ? 0.9557 0.9413 0.9602 -0.0361 0.0545  0.0445  273 ASN B OD1 
2490 N ND2 . ASN B 13  ? 0.8984 0.8439 0.9109 -0.0513 0.0484  0.0591  273 ASN B ND2 
2491 N N   . VAL B 14  ? 0.8665 0.8637 0.8688 -0.0157 0.0353  0.0064  274 VAL B N   
2492 C CA  . VAL B 14  ? 0.9026 0.9217 0.8996 -0.0054 0.0412  -0.0003 274 VAL B CA  
2493 C C   . VAL B 14  ? 0.9939 1.0271 0.9756 -0.0026 0.0560  0.0108  274 VAL B C   
2494 O O   . VAL B 14  ? 1.0421 1.0942 1.0157 0.0077  0.0624  0.0051  274 VAL B O   
2495 C CB  . VAL B 14  ? 0.8134 0.8208 0.7915 0.0060  0.0294  -0.0148 274 VAL B CB  
2496 C CG1 . VAL B 14  ? 0.8054 0.8005 0.7965 0.0037  0.0161  -0.0242 274 VAL B CG1 
2497 C CG2 . VAL B 14  ? 0.8362 0.8261 0.7871 0.0086  0.0257  -0.0113 274 VAL B CG2 
2498 N N   . ASN B 15  ? 1.0076 1.0309 0.9834 -0.0104 0.0613  0.0266  275 ASN B N   
2499 C CA  . ASN B 15  ? 1.0284 1.0648 0.9885 -0.0086 0.0761  0.0399  275 ASN B CA  
2500 C C   . ASN B 15  ? 1.0209 1.0620 0.9497 0.0070  0.0756  0.0315  275 ASN B C   
2501 O O   . ASN B 15  ? 0.9993 1.0630 0.9196 0.0140  0.0878  0.0325  275 ASN B O   
2502 C CB  . ASN B 15  ? 1.0307 1.0973 1.0157 -0.0155 0.0916  0.0472  275 ASN B CB  
2503 C CG  . ASN B 15  ? 1.0610 1.1354 1.0357 -0.0211 0.1082  0.0685  275 ASN B CG  
2504 O OD1 . ASN B 15  ? 1.0890 1.1400 1.0548 -0.0286 0.1067  0.0825  275 ASN B OD1 
2505 N ND2 . ASN B 15  ? 1.0429 1.1502 1.0183 -0.0167 0.1244  0.0714  275 ASN B ND2 
2506 N N   . GLY B 16  ? 1.0186 1.0390 0.9311 0.0124  0.0611  0.0223  276 GLY B N   
2507 C CA  . GLY B 16  ? 1.0275 1.0467 0.9095 0.0250  0.0570  0.0142  276 GLY B CA  
2508 C C   . GLY B 16  ? 1.0252 1.0584 0.9047 0.0362  0.0573  -0.0019 276 GLY B C   
2509 O O   . GLY B 16  ? 1.0404 1.0757 0.8932 0.0474  0.0568  -0.0084 276 GLY B O   
2510 N N   . GLN B 17  ? 1.0090 1.0503 0.9150 0.0342  0.0566  -0.0094 277 GLN B N   
2511 C CA  . GLN B 17  ? 1.0134 1.0689 0.9207 0.0465  0.0572  -0.0244 277 GLN B CA  
2512 C C   . GLN B 17  ? 1.0458 1.0789 0.9461 0.0517  0.0392  -0.0404 277 GLN B C   
2513 O O   . GLN B 17  ? 1.0599 1.0728 0.9658 0.0433  0.0280  -0.0395 277 GLN B O   
2514 C CB  . GLN B 17  ? 0.9881 1.0681 0.9301 0.0427  0.0657  -0.0234 277 GLN B CB  
2515 C CG  . GLN B 17  ? 1.0494 1.1559 1.0018 0.0364  0.0852  -0.0073 277 GLN B CG  
2516 C CD  . GLN B 17  ? 1.1146 1.2451 1.0479 0.0508  0.0989  -0.0098 277 GLN B CD  
2517 O OE1 . GLN B 17  ? 1.1404 1.2641 1.0418 0.0554  0.1023  -0.0048 277 GLN B OE1 
2518 N NE2 . GLN B 17  ? 1.1192 1.2785 1.0706 0.0597  0.1061  -0.0188 277 GLN B NE2 
2519 N N   . SER B 18  ? 1.0374 1.0732 0.9243 0.0659  0.0367  -0.0548 278 SER B N   
2520 C CA  . SER B 18  ? 1.0128 1.0278 0.8968 0.0708  0.0206  -0.0695 278 SER B CA  
2521 C C   . SER B 18  ? 0.9842 1.0101 0.8984 0.0708  0.0203  -0.0732 278 SER B C   
2522 O O   . SER B 18  ? 0.9589 1.0138 0.8920 0.0726  0.0335  -0.0696 278 SER B O   
2523 C CB  . SER B 18  ? 1.0236 1.0333 0.8808 0.0869  0.0166  -0.0844 278 SER B CB  
2524 O OG  . SER B 18  ? 1.0433 1.0388 0.8722 0.0859  0.0115  -0.0832 278 SER B OG  
2525 N N   . PRO B 19  ? 0.9391 0.9436 0.8583 0.0687  0.0054  -0.0799 279 PRO B N   
2526 C CA  . PRO B 19  ? 0.9107 0.9232 0.8548 0.0713  0.0018  -0.0852 279 PRO B CA  
2527 C C   . PRO B 19  ? 0.9515 0.9808 0.8966 0.0894  0.0052  -0.0975 279 PRO B C   
2528 O O   . PRO B 19  ? 0.9162 0.9268 0.8407 0.1013  -0.0040 -0.1097 279 PRO B O   
2529 C CB  . PRO B 19  ? 0.8264 0.8071 0.7634 0.0677  -0.0156 -0.0898 279 PRO B CB  
2530 C CG  . PRO B 19  ? 0.8459 0.8058 0.7545 0.0688  -0.0212 -0.0924 279 PRO B CG  
2531 C CD  . PRO B 19  ? 0.8678 0.8410 0.7675 0.0656  -0.0093 -0.0836 279 PRO B CD  
2532 N N   . LYS B 20  ? 0.9961 1.0609 0.9658 0.0912  0.0187  -0.0940 280 LYS B N   
2533 C CA  . LYS B 20  ? 0.9904 1.0806 0.9670 0.1097  0.0251  -0.1049 280 LYS B CA  
2534 C C   . LYS B 20  ? 1.0187 1.1180 1.0239 0.1151  0.0164  -0.1121 280 LYS B C   
2535 O O   . LYS B 20  ? 1.0535 1.1684 1.0638 0.1335  0.0172  -0.1238 280 LYS B O   
2536 C CB  . LYS B 20  ? 0.9572 1.0877 0.9443 0.1092  0.0473  -0.0956 280 LYS B CB  
2537 C CG  . LYS B 20  ? 1.4079 1.5388 1.3601 0.1194  0.0569  -0.0973 280 LYS B CG  
2538 C CD  . LYS B 20  ? 0.8857 1.0067 0.8208 0.1043  0.0626  -0.0813 280 LYS B CD  
2539 C CE  . LYS B 20  ? 0.8704 1.0263 0.8072 0.1032  0.0854  -0.0684 280 LYS B CE  
2540 N N   . GLU B 21  ? 1.0240 1.1131 1.0462 0.1006  0.0074  -0.1060 281 GLU B N   
2541 C CA  . GLU B 21  ? 1.0544 1.1542 1.1047 0.1038  -0.0017 -0.1112 281 GLU B CA  
2542 C C   . GLU B 21  ? 1.0386 1.1000 1.0780 0.0992  -0.0214 -0.1136 281 GLU B C   
2543 O O   . GLU B 21  ? 1.0390 1.0744 1.0614 0.0865  -0.0248 -0.1067 281 GLU B O   
2544 C CB  . GLU B 21  ? 1.0616 1.1941 1.1493 0.0889  0.0071  -0.1007 281 GLU B CB  
2545 C CG  . GLU B 21  ? 1.1008 1.2755 1.2043 0.0884  0.0289  -0.0938 281 GLU B CG  
2546 C CD  . GLU B 21  ? 1.1378 1.3307 1.2701 0.0659  0.0372  -0.0785 281 GLU B CD  
2547 O OE1 . GLU B 21  ? 1.1814 1.3464 1.3041 0.0504  0.0319  -0.0703 281 GLU B OE1 
2548 O OE2 . GLU B 21  ? 1.1195 1.3549 1.2848 0.0636  0.0490  -0.0747 281 GLU B OE2 
2549 N N   . CYS B 22  ? 0.9875 1.0478 1.0375 0.1102  -0.0337 -0.1226 282 CYS B N   
2550 C CA  . CYS B 22  ? 0.9331 0.9628 0.9767 0.1055  -0.0515 -0.1229 282 CYS B CA  
2551 C C   . CYS B 22  ? 0.9213 0.9541 0.9807 0.0855  -0.0516 -0.1126 282 CYS B C   
2552 O O   . CYS B 22  ? 0.9377 1.0025 1.0271 0.0791  -0.0440 -0.1090 282 CYS B O   
2553 C CB  . CYS B 22  ? 0.8621 0.8972 0.9185 0.1220  -0.0637 -0.1331 282 CYS B CB  
2554 S SG  . CYS B 22  ? 1.0857 1.0860 1.1324 0.1170  -0.0848 -0.1319 282 CYS B SG  
2555 N N   . LEU B 23  ? 0.8482 0.8482 0.8878 0.0758  -0.0601 -0.1084 283 LEU B N   
2556 C CA  . LEU B 23  ? 0.8622 0.8608 0.9111 0.0587  -0.0597 -0.0999 283 LEU B CA  
2557 C C   . LEU B 23  ? 0.9057 0.8981 0.9643 0.0574  -0.0744 -0.1029 283 LEU B C   
2558 O O   . LEU B 23  ? 0.8880 0.8746 0.9506 0.0449  -0.0766 -0.0982 283 LEU B O   
2559 C CB  . LEU B 23  ? 0.8689 0.8404 0.8915 0.0492  -0.0580 -0.0930 283 LEU B CB  
2560 C CG  . LEU B 23  ? 0.8629 0.8384 0.8739 0.0473  -0.0448 -0.0880 283 LEU B CG  
2561 C CD1 . LEU B 23  ? 0.8533 0.8058 0.8446 0.0372  -0.0456 -0.0808 283 LEU B CD1 
2562 C CD2 . LEU B 23  ? 0.8460 0.8525 0.8800 0.0423  -0.0308 -0.0822 283 LEU B CD2 
2563 N N   . ARG B 24  ? 0.9675 0.9599 1.0282 0.0715  -0.0854 -0.1112 284 ARG B N   
2564 C CA  . ARG B 24  ? 0.9816 0.9689 1.0491 0.0727  -0.1012 -0.1145 284 ARG B CA  
2565 C C   . ARG B 24  ? 0.9409 0.9571 1.0423 0.0621  -0.0997 -0.1133 284 ARG B C   
2566 O O   . ARG B 24  ? 0.9073 0.9141 1.0098 0.0546  -0.1097 -0.1131 284 ARG B O   
2567 C CB  . ARG B 24  ? 1.0416 1.0312 1.1111 0.0922  -0.1123 -0.1236 284 ARG B CB  
2568 C CG  . ARG B 24  ? 1.1300 1.0860 1.1664 0.1037  -0.1177 -0.1260 284 ARG B CG  
2569 C CD  . ARG B 24  ? 1.2285 1.1463 1.2376 0.1014  -0.1320 -0.1228 284 ARG B CD  
2570 N NE  . ARG B 24  ? 1.3298 1.2532 1.3503 0.1012  -0.1446 -0.1238 284 ARG B NE  
2571 C CZ  . ARG B 24  ? 1.3542 1.2825 1.3829 0.1162  -0.1585 -0.1302 284 ARG B CZ  
2572 N NH1 . ARG B 24  ? 1.4016 1.3294 1.4294 0.1342  -0.1613 -0.1365 284 ARG B NH1 
2573 N NH2 . ARG B 24  ? 1.2804 1.2133 1.3171 0.1144  -0.1709 -0.1309 284 ARG B NH2 
2574 N N   . LEU B 25  ? 0.9771 1.0283 1.1056 0.0611  -0.0870 -0.1125 285 LEU B N   
2575 C CA  . LEU B 25  ? 1.0011 1.0836 1.1673 0.0496  -0.0851 -0.1108 285 LEU B CA  
2576 C C   . LEU B 25  ? 0.9862 1.0521 1.1488 0.0301  -0.0838 -0.1033 285 LEU B C   
2577 O O   . LEU B 25  ? 0.9965 1.0745 1.1838 0.0192  -0.0895 -0.1036 285 LEU B O   
2578 C CB  . LEU B 25  ? 1.0448 1.1679 1.2375 0.0504  -0.0676 -0.1082 285 LEU B CB  
2579 C CG  . LEU B 25  ? 1.0983 1.2539 1.3102 0.0695  -0.0674 -0.1169 285 LEU B CG  
2580 C CD1 . LEU B 25  ? 1.1337 1.2633 1.3193 0.0902  -0.0816 -0.1265 285 LEU B CD1 
2581 C CD2 . LEU B 25  ? 1.0886 1.2722 1.3067 0.0727  -0.0455 -0.1130 285 LEU B CD2 
2582 N N   . TRP B 26  ? 0.9814 1.0201 1.1141 0.0264  -0.0772 -0.0974 286 TRP B N   
2583 C CA  . TRP B 26  ? 0.9593 0.9788 1.0839 0.0116  -0.0755 -0.0907 286 TRP B CA  
2584 C C   . TRP B 26  ? 0.9820 0.9678 1.0790 0.0133  -0.0887 -0.0937 286 TRP B C   
2585 O O   . TRP B 26  ? 0.9679 0.9424 1.0656 0.0047  -0.0952 -0.0939 286 TRP B O   
2586 C CB  . TRP B 26  ? 0.9078 0.9233 1.0187 0.0078  -0.0592 -0.0816 286 TRP B CB  
2587 C CG  . TRP B 26  ? 0.8786 0.8702 0.9743 -0.0027 -0.0574 -0.0748 286 TRP B CG  
2588 C CD1 . TRP B 26  ? 0.8460 0.8286 0.9506 -0.0136 -0.0631 -0.0740 286 TRP B CD1 
2589 C CD2 . TRP B 26  ? 0.8661 0.8404 0.9358 -0.0024 -0.0498 -0.0686 286 TRP B CD2 
2590 N NE1 . TRP B 26  ? 0.8334 0.7934 0.9183 -0.0183 -0.0589 -0.0677 286 TRP B NE1 
2591 C CE2 . TRP B 26  ? 0.8577 0.8142 0.9223 -0.0118 -0.0508 -0.0639 286 TRP B CE2 
2592 C CE3 . TRP B 26  ? 0.8418 0.8137 0.8919 0.0056  -0.0438 -0.0676 286 TRP B CE3 
2593 C CZ2 . TRP B 26  ? 0.8459 0.7856 0.8887 -0.0126 -0.0454 -0.0574 286 TRP B CZ2 
2594 C CZ3 . TRP B 26  ? 0.8314 0.7867 0.8602 0.0029  -0.0393 -0.0612 286 TRP B CZ3 
2595 C CH2 . TRP B 26  ? 0.8382 0.7793 0.8645 -0.0057 -0.0398 -0.0559 286 TRP B CH2 
2596 N N   . LEU B 27  ? 1.0059 0.9755 1.0779 0.0247  -0.0927 -0.0961 287 LEU B N   
2597 C CA  . LEU B 27  ? 0.9782 0.9165 1.0199 0.0255  -0.1008 -0.0956 287 LEU B CA  
2598 C C   . LEU B 27  ? 0.9588 0.8888 0.9955 0.0331  -0.1177 -0.1021 287 LEU B C   
2599 O O   . LEU B 27  ? 0.9558 0.8641 0.9714 0.0314  -0.1246 -0.1013 287 LEU B O   
2600 C CB  . LEU B 27  ? 0.9473 0.8702 0.9638 0.0308  -0.0956 -0.0926 287 LEU B CB  
2601 C CG  . LEU B 27  ? 0.8965 0.8219 0.9092 0.0245  -0.0810 -0.0857 287 LEU B CG  
2602 C CD1 . LEU B 27  ? 0.8938 0.8095 0.8870 0.0318  -0.0790 -0.0862 287 LEU B CD1 
2603 C CD2 . LEU B 27  ? 0.8675 0.7780 0.8692 0.0147  -0.0789 -0.0798 287 LEU B CD2 
2604 N N   . SER B 28  ? 0.9505 0.8984 1.0047 0.0427  -0.1243 -0.1082 288 SER B N   
2605 C CA  . SER B 28  ? 1.0191 0.9597 1.0682 0.0515  -0.1421 -0.1140 288 SER B CA  
2606 C C   . SER B 28  ? 1.0917 1.0641 1.1746 0.0591  -0.1492 -0.1213 288 SER B C   
2607 O O   . SER B 28  ? 1.1117 1.0861 1.1932 0.0744  -0.1565 -0.1256 288 SER B O   
2608 C CB  . SER B 28  ? 0.9985 0.9105 1.0144 0.0617  -0.1473 -0.1123 288 SER B CB  
2609 O OG  . SER B 28  ? 1.0137 0.9292 1.0295 0.0691  -0.1394 -0.1125 288 SER B OG  
2610 N N   . ASN B 29  ? 1.1147 1.1119 1.2288 0.0482  -0.1477 -0.1226 289 ASN B N   
2611 C CA  . ASN B 29  ? 1.1207 1.1559 1.2746 0.0520  -0.1532 -0.1288 289 ASN B CA  
2612 C C   . ASN B 29  ? 1.1577 1.1947 1.3214 0.0498  -0.1731 -0.1353 289 ASN B C   
2613 O O   . ASN B 29  ? 1.1825 1.2283 1.3654 0.0346  -0.1741 -0.1357 289 ASN B O   
2614 C CB  . ASN B 29  ? 1.0653 1.1323 1.2529 0.0392  -0.1368 -0.1244 289 ASN B CB  
2615 N N   . GLY B 30  ? 1.1468 1.1732 1.2956 0.0650  -0.1899 -0.1405 290 GLY B N   
2616 C CA  . GLY B 30  ? 1.1785 1.2070 1.3332 0.0660  -0.2115 -0.1477 290 GLY B CA  
2617 C C   . GLY B 30  ? 1.2120 1.2098 1.3392 0.0555  -0.2177 -0.1473 290 GLY B C   
2618 O O   . GLY B 30  ? 1.2320 1.2371 1.3730 0.0488  -0.2314 -0.1539 290 GLY B O   
2619 N N   . ILE B 31  ? 1.1963 1.1612 1.2853 0.0547  -0.2082 -0.1403 291 ILE B N   
2620 C CA  . ILE B 31  ? 1.1867 1.1213 1.2435 0.0484  -0.2118 -0.1394 291 ILE B CA  
2621 C C   . ILE B 31  ? 1.1803 1.0853 1.1943 0.0607  -0.2178 -0.1356 291 ILE B C   
2622 O O   . ILE B 31  ? 1.1929 1.0942 1.2000 0.0699  -0.2139 -0.1314 291 ILE B O   
2623 C CB  . ILE B 31  ? 1.0103 0.9349 1.0616 0.0349  -0.1929 -0.1327 291 ILE B CB  
2624 C CG1 . ILE B 31  ? 1.0213 0.9341 1.0528 0.0390  -0.1776 -0.1237 291 ILE B CG1 
2625 C CG2 . ILE B 31  ? 0.9389 0.8898 1.0309 0.0218  -0.1856 -0.1336 291 ILE B CG2 
2626 C CD1 . ILE B 31  ? 0.9705 0.8808 1.0027 0.0278  -0.1591 -0.1169 291 ILE B CD1 
2627 N N   . GLN B 32  ? 1.1890 1.0716 1.1729 0.0607  -0.2270 -0.1367 292 GLN B N   
2628 C CA  . GLN B 32  ? 1.1956 1.0486 1.1359 0.0693  -0.2289 -0.1297 292 GLN B CA  
2629 C C   . GLN B 32  ? 1.1705 1.0107 1.0965 0.0626  -0.2087 -0.1198 292 GLN B C   
2630 O O   . GLN B 32  ? 1.1726 1.0205 1.1125 0.0519  -0.1959 -0.1193 292 GLN B O   
2631 C CB  . GLN B 32  ? 1.2088 1.0438 1.1184 0.0706  -0.2406 -0.1327 292 GLN B CB  
2632 C CG  . GLN B 32  ? 1.2548 1.1011 1.1753 0.0774  -0.2635 -0.1434 292 GLN B CG  
2633 C CD  . GLN B 32  ? 1.3139 1.1393 1.1961 0.0815  -0.2761 -0.1465 292 GLN B CD  
2634 O OE1 . GLN B 32  ? 1.3199 1.1477 1.2063 0.0755  -0.2828 -0.1561 292 GLN B OE1 
2635 N NE2 . GLN B 32  ? 1.3504 1.1534 1.1931 0.0916  -0.2795 -0.1382 292 GLN B NE2 
2636 N N   . ALA B 33  ? 1.1299 0.9501 1.0290 0.0686  -0.2066 -0.1116 293 ALA B N   
2637 C CA  . ALA B 33  ? 1.0982 0.9072 0.9846 0.0614  -0.1894 -0.1024 293 ALA B CA  
2638 C C   . ALA B 33  ? 1.1166 0.9193 0.9887 0.0522  -0.1808 -0.1002 293 ALA B C   
2639 O O   . ALA B 33  ? 1.1458 0.9348 0.9914 0.0547  -0.1871 -0.0996 293 ALA B O   
2640 C CB  . ALA B 33  ? 1.0553 0.8403 0.9132 0.0675  -0.1917 -0.0937 293 ALA B CB  
2641 N N   . PRO B 34  ? 1.0730 0.8858 0.9613 0.0430  -0.1666 -0.0994 294 PRO B N   
2642 C CA  . PRO B 34  ? 1.0391 0.8455 0.9143 0.0367  -0.1582 -0.0975 294 PRO B CA  
2643 C C   . PRO B 34  ? 1.0748 0.8645 0.9173 0.0370  -0.1521 -0.0880 294 PRO B C   
2644 O O   . PRO B 34  ? 1.0597 0.8418 0.8934 0.0381  -0.1507 -0.0808 294 PRO B O   
2645 C CB  . PRO B 34  ? 0.9387 0.7581 0.8374 0.0288  -0.1444 -0.0959 294 PRO B CB  
2646 C CG  . PRO B 34  ? 0.9239 0.7611 0.8526 0.0297  -0.1485 -0.1007 294 PRO B CG  
2647 C CD  . PRO B 34  ? 0.9915 0.8239 0.9115 0.0394  -0.1587 -0.1008 294 PRO B CD  
2648 N N   . ASP B 35  ? 1.0778 0.8619 0.9030 0.0359  -0.1484 -0.0883 295 ASP B N   
2649 C CA  . ASP B 35  ? 1.0763 0.8509 0.8740 0.0349  -0.1396 -0.0786 295 ASP B CA  
2650 C C   . ASP B 35  ? 1.0603 0.8433 0.8694 0.0276  -0.1241 -0.0731 295 ASP B C   
2651 O O   . ASP B 35  ? 1.0786 0.8587 0.8771 0.0240  -0.1167 -0.0632 295 ASP B O   
2652 C CB  . ASP B 35  ? 1.0838 0.8522 0.8572 0.0393  -0.1416 -0.0823 295 ASP B CB  
2653 C CG  . ASP B 35  ? 1.1457 0.9047 0.9021 0.0474  -0.1584 -0.0873 295 ASP B CG  
2654 O OD1 . ASP B 35  ? 1.1693 0.9188 0.9104 0.0503  -0.1634 -0.0795 295 ASP B OD1 
2655 O OD2 . ASP B 35  ? 1.1524 0.9120 0.9104 0.0509  -0.1679 -0.0991 295 ASP B OD2 
2656 N N   . VAL B 36  ? 1.0485 0.8413 0.8793 0.0249  -0.1201 -0.0789 296 VAL B N   
2657 C CA  . VAL B 36  ? 1.0040 0.8052 0.8458 0.0194  -0.1066 -0.0738 296 VAL B CA  
2658 C C   . VAL B 36  ? 0.9319 0.7435 0.8027 0.0159  -0.1054 -0.0769 296 VAL B C   
2659 O O   . VAL B 36  ? 0.9168 0.7313 0.8022 0.0159  -0.1115 -0.0843 296 VAL B O   
2660 C CB  . VAL B 36  ? 0.9540 0.7552 0.7874 0.0208  -0.0997 -0.0753 296 VAL B CB  
2661 C CG1 . VAL B 36  ? 0.8998 0.7104 0.7432 0.0167  -0.0870 -0.0688 296 VAL B CG1 
2662 C CG2 . VAL B 36  ? 0.9395 0.7337 0.7429 0.0255  -0.0997 -0.0728 296 VAL B CG2 
2663 N N   . TYR B 37  ? 0.8788 0.6965 0.7571 0.0123  -0.0978 -0.0708 297 TYR B N   
2664 C CA  . TYR B 37  ? 0.8670 0.6961 0.7689 0.0096  -0.0941 -0.0719 297 TYR B CA  
2665 C C   . TYR B 37  ? 0.8410 0.6752 0.7467 0.0058  -0.0829 -0.0668 297 TYR B C   
2666 O O   . TYR B 37  ? 0.8592 0.6935 0.7549 0.0046  -0.0774 -0.0607 297 TYR B O   
2667 C CB  . TYR B 37  ? 0.8607 0.6923 0.7655 0.0109  -0.0952 -0.0702 297 TYR B CB  
2668 C CG  . TYR B 37  ? 0.8504 0.6856 0.7662 0.0160  -0.1048 -0.0766 297 TYR B CG  
2669 C CD1 . TYR B 37  ? 0.8415 0.6926 0.7825 0.0150  -0.1039 -0.0809 297 TYR B CD1 
2670 C CD2 . TYR B 37  ? 0.8145 0.6384 0.7165 0.0218  -0.1145 -0.0773 297 TYR B CD2 
2671 C CE1 . TYR B 37  ? 0.8406 0.7008 0.7958 0.0204  -0.1122 -0.0869 297 TYR B CE1 
2672 C CE2 . TYR B 37  ? 0.7913 0.6204 0.7047 0.0287  -0.1241 -0.0834 297 TYR B CE2 
2673 C CZ  . TYR B 37  ? 0.8419 0.6913 0.7832 0.0283  -0.1228 -0.0887 297 TYR B CZ  
2674 O OH  . TYR B 37  ? 0.8688 0.7288 0.8253 0.0357  -0.1320 -0.0950 297 TYR B OH  
2675 N N   . CYS B 38  ? 0.8073 0.6455 0.7282 0.0037  -0.0805 -0.0689 298 CYS B N   
2676 C CA  . CYS B 38  ? 0.8368 0.6788 0.7628 0.0013  -0.0710 -0.0635 298 CYS B CA  
2677 C C   . CYS B 38  ? 0.8627 0.7150 0.8088 -0.0024 -0.0675 -0.0619 298 CYS B C   
2678 O O   . CYS B 38  ? 0.9190 0.7729 0.8803 -0.0054 -0.0705 -0.0654 298 CYS B O   
2679 C CB  . CYS B 38  ? 0.8526 0.6854 0.7755 0.0027  -0.0709 -0.0660 298 CYS B CB  
2680 S SG  . CYS B 38  ? 0.9543 0.7757 0.8551 0.0088  -0.0776 -0.0724 298 CYS B SG  
2681 N N   . VAL B 39  ? 0.8329 0.6933 0.7791 -0.0027 -0.0614 -0.0569 299 VAL B N   
2682 C CA  . VAL B 39  ? 0.7629 0.6358 0.7249 -0.0048 -0.0568 -0.0553 299 VAL B CA  
2683 C C   . VAL B 39  ? 0.7776 0.6546 0.7388 -0.0063 -0.0474 -0.0472 299 VAL B C   
2684 O O   . VAL B 39  ? 0.7747 0.6515 0.7232 -0.0043 -0.0453 -0.0440 299 VAL B O   
2685 C CB  . VAL B 39  ? 0.7449 0.6247 0.7059 -0.0009 -0.0589 -0.0583 299 VAL B CB  
2686 C CG1 . VAL B 39  ? 0.7376 0.6341 0.7154 -0.0013 -0.0529 -0.0576 299 VAL B CG1 
2687 C CG2 . VAL B 39  ? 0.7344 0.6077 0.6923 0.0025  -0.0695 -0.0650 299 VAL B CG2 
2688 N N   . GLY B 40  ? 0.7676 0.6487 0.7427 -0.0105 -0.0426 -0.0434 300 GLY B N   
2689 C CA  . GLY B 40  ? 0.7213 0.6030 0.6941 -0.0117 -0.0345 -0.0343 300 GLY B CA  
2690 C C   . GLY B 40  ? 0.7785 0.6750 0.7601 -0.0138 -0.0265 -0.0291 300 GLY B C   
2691 O O   . GLY B 40  ? 0.7966 0.7031 0.7953 -0.0177 -0.0254 -0.0307 300 GLY B O   
2692 N N   . PHE B 41  ? 0.7809 0.6808 0.7507 -0.0111 -0.0207 -0.0225 301 PHE B N   
2693 C CA  . PHE B 41  ? 0.7731 0.6871 0.7454 -0.0116 -0.0115 -0.0163 301 PHE B CA  
2694 C C   . PHE B 41  ? 0.8204 0.7287 0.7870 -0.0133 -0.0055 -0.0043 301 PHE B C   
2695 O O   . PHE B 41  ? 0.8585 0.7536 0.8164 -0.0112 -0.0092 -0.0021 301 PHE B O   
2696 C CB  . PHE B 41  ? 0.7602 0.6830 0.7184 -0.0046 -0.0114 -0.0206 301 PHE B CB  
2697 C CG  . PHE B 41  ? 0.7649 0.6910 0.7271 -0.0013 -0.0174 -0.0317 301 PHE B CG  
2698 C CD1 . PHE B 41  ? 0.7988 0.7406 0.7750 -0.0001 -0.0136 -0.0349 301 PHE B CD1 
2699 C CD2 . PHE B 41  ? 0.7319 0.6462 0.6848 0.0007  -0.0268 -0.0379 301 PHE B CD2 
2700 C CE1 . PHE B 41  ? 0.8269 0.7706 0.8066 0.0051  -0.0204 -0.0451 301 PHE B CE1 
2701 C CE2 . PHE B 41  ? 0.7619 0.6754 0.7163 0.0044  -0.0333 -0.0468 301 PHE B CE2 
2702 C CZ  . PHE B 41  ? 0.8008 0.7280 0.7683 0.0075  -0.0309 -0.0508 301 PHE B CZ  
2703 N N   . GLN B 42  ? 0.8414 0.7604 0.8125 -0.0162 0.0041  0.0042  302 GLN B N   
2704 C CA  . GLN B 42  ? 0.8383 0.7530 0.7981 -0.0159 0.0104  0.0173  302 GLN B CA  
2705 C C   . GLN B 42  ? 0.8639 0.7977 0.8156 -0.0129 0.0200  0.0216  302 GLN B C   
2706 O O   . GLN B 42  ? 0.8028 0.7535 0.7655 -0.0136 0.0243  0.0166  302 GLN B O   
2707 C CB  . GLN B 42  ? 0.8259 0.7284 0.7986 -0.0249 0.0134  0.0272  302 GLN B CB  
2708 C CG  . GLN B 42  ? 0.8499 0.7323 0.8301 -0.0271 0.0037  0.0208  302 GLN B CG  
2709 C CD  . GLN B 42  ? 0.8682 0.7562 0.8681 -0.0328 -0.0010 0.0103  302 GLN B CD  
2710 O OE1 . GLN B 42  ? 0.8962 0.8018 0.9120 -0.0386 0.0044  0.0113  302 GLN B OE1 
2711 N NE2 . GLN B 42  ? 0.8257 0.7005 0.8245 -0.0304 -0.0110 0.0003  302 GLN B NE2 
2712 N N   . GLU B 43  ? 0.9162 0.8480 0.8477 -0.0081 0.0229  0.0303  303 GLU B N   
2713 C CA  . GLU B 43  ? 0.9064 0.8548 0.8228 -0.0029 0.0315  0.0341  303 GLU B CA  
2714 C C   . GLU B 43  ? 0.8780 0.8378 0.7887 0.0045  0.0274  0.0187  303 GLU B C   
2715 O O   . GLU B 43  ? 0.8820 0.8592 0.7922 0.0078  0.0353  0.0162  303 GLU B O   
2716 C CB  . GLU B 43  ? 0.9075 0.8688 0.8356 -0.0099 0.0457  0.0456  303 GLU B CB  
2717 C CG  . GLU B 43  ? 0.9565 0.9009 0.8928 -0.0194 0.0479  0.0605  303 GLU B CG  
2718 C CD  . GLU B 43  ? 1.0295 0.9847 0.9714 -0.0274 0.0630  0.0769  303 GLU B CD  
2719 O OE1 . GLU B 43  ? 1.0649 1.0455 1.0192 -0.0296 0.0725  0.0748  303 GLU B OE1 
2720 O OE2 . GLU B 43  ? 1.0757 1.0140 1.0101 -0.0315 0.0655  0.0928  303 GLU B OE2 
2721 N N   . LEU B 44  ? 0.8343 0.7835 0.7403 0.0072  0.0153  0.0088  304 LEU B N   
2722 C CA  . LEU B 44  ? 0.8504 0.8034 0.7488 0.0134  0.0091  -0.0051 304 LEU B CA  
2723 C C   . LEU B 44  ? 0.9401 0.9022 0.8154 0.0216  0.0124  -0.0060 304 LEU B C   
2724 O O   . LEU B 44  ? 0.9622 0.9324 0.8328 0.0280  0.0133  -0.0161 304 LEU B O   
2725 C CB  . LEU B 44  ? 0.7852 0.7244 0.6805 0.0128  -0.0036 -0.0117 304 LEU B CB  
2726 C CG  . LEU B 44  ? 0.7948 0.7315 0.6928 0.0147  -0.0106 -0.0251 304 LEU B CG  
2727 C CD1 . LEU B 44  ? 0.8250 0.7620 0.7445 0.0106  -0.0097 -0.0271 304 LEU B CD1 
2728 C CD2 . LEU B 44  ? 0.7781 0.7033 0.6679 0.0136  -0.0221 -0.0299 304 LEU B CD2 
2729 N N   . ASP B 45  ? 0.9083 0.8680 0.7676 0.0230  0.0132  0.0039  305 ASP B N   
2730 C CA  . ASP B 45  ? 0.8916 0.8595 0.7254 0.0312  0.0159  0.0045  305 ASP B CA  
2731 C C   . ASP B 45  ? 0.9240 0.8929 0.7467 0.0310  0.0233  0.0222  305 ASP B C   
2732 O O   . ASP B 45  ? 0.9198 0.8778 0.7419 0.0291  0.0174  0.0296  305 ASP B O   
2733 C CB  . ASP B 45  ? 0.8468 0.8075 0.6647 0.0355  0.0014  -0.0068 305 ASP B CB  
2734 C CG  . ASP B 45  ? 0.8932 0.8605 0.6822 0.0449  0.0012  -0.0101 305 ASP B CG  
2735 O OD1 . ASP B 45  ? 0.8784 0.8543 0.6548 0.0483  0.0113  0.0013  305 ASP B OD1 
2736 O OD2 . ASP B 45  ? 0.9219 0.8843 0.6990 0.0489  -0.0097 -0.0239 305 ASP B OD2 
2737 N N   . LEU B 46  ? 0.9223 0.9047 0.7359 0.0338  0.0368  0.0295  306 LEU B N   
2738 C CA  . LEU B 46  ? 0.9300 0.9123 0.7316 0.0329  0.0458  0.0488  306 LEU B CA  
2739 C C   . LEU B 46  ? 0.9789 0.9644 0.7450 0.0436  0.0432  0.0506  306 LEU B C   
2740 O O   . LEU B 46  ? 0.9742 0.9583 0.7245 0.0449  0.0491  0.0673  306 LEU B O   
2741 C CB  . LEU B 46  ? 0.9111 0.9080 0.7246 0.0275  0.0639  0.0592  306 LEU B CB  
2742 C CG  . LEU B 46  ? 0.9017 0.8940 0.7506 0.0149  0.0658  0.0616  306 LEU B CG  
2743 C CD1 . LEU B 46  ? 0.9069 0.9216 0.7727 0.0094  0.0824  0.0671  306 LEU B CD1 
2744 C CD2 . LEU B 46  ? 0.8537 0.8237 0.7062 0.0079  0.0620  0.0760  306 LEU B CD2 
2745 N N   . SER B 47  ? 0.9967 0.9845 0.7491 0.0512  0.0331  0.0335  307 SER B N   
2746 C CA  . SER B 47  ? 1.0273 1.0170 0.7454 0.0614  0.0271  0.0322  307 SER B CA  
2747 C C   . SER B 47  ? 1.0486 1.0274 0.7608 0.0608  0.0163  0.0422  307 SER B C   
2748 O O   . SER B 47  ? 1.0391 1.0081 0.7733 0.0543  0.0089  0.0426  307 SER B O   
2749 C CB  . SER B 47  ? 1.0137 1.0030 0.7208 0.0678  0.0149  0.0100  307 SER B CB  
2750 O OG  . SER B 47  ? 1.0345 1.0117 0.7561 0.0621  -0.0014 0.0017  307 SER B OG  
2751 N N   . LYS B 48  ? 1.0873 1.0691 0.7687 0.0692  0.0154  0.0500  308 LYS B N   
2752 C CA  . LYS B 48  ? 1.1006 1.0748 0.7734 0.0718  0.0040  0.0596  308 LYS B CA  
2753 C C   . LYS B 48  ? 1.0832 1.0561 0.7608 0.0723  -0.0161 0.0432  308 LYS B C   
2754 O O   . LYS B 48  ? 1.0684 1.0365 0.7607 0.0698  -0.0256 0.0466  308 LYS B O   
2755 C CB  . LYS B 48  ? 1.1514 1.1300 0.7862 0.0820  0.0067  0.0714  308 LYS B CB  
2756 C CG  . LYS B 48  ? 1.1805 1.1636 0.8054 0.0813  0.0285  0.0890  308 LYS B CG  
2757 C CD  . LYS B 48  ? 1.2180 1.1884 0.8661 0.0715  0.0367  0.1083  308 LYS B CD  
2758 C CE  . LYS B 48  ? 1.3074 1.2788 0.9374 0.0710  0.0544  0.1319  308 LYS B CE  
2759 N NZ  . LYS B 48  ? 1.3532 1.3445 0.9802 0.0698  0.0726  0.1291  308 LYS B NZ  
2760 N N   . GLU B 49  ? 1.1095 1.0869 0.7756 0.0753  -0.0220 0.0254  309 GLU B N   
2761 C CA  . GLU B 49  ? 1.0837 1.0589 0.7554 0.0730  -0.0409 0.0093  309 GLU B CA  
2762 C C   . GLU B 49  ? 1.0671 1.0368 0.7745 0.0624  -0.0438 0.0079  309 GLU B C   
2763 O O   . GLU B 49  ? 1.1009 1.0716 0.8186 0.0596  -0.0564 0.0073  309 GLU B O   
2764 C CB  . GLU B 49  ? 1.0720 1.0467 0.7294 0.0765  -0.0441 -0.0099 309 GLU B CB  
2765 C CG  . GLU B 49  ? 1.1326 1.1020 0.7922 0.0727  -0.0648 -0.0265 309 GLU B CG  
2766 C CD  . GLU B 49  ? 1.2561 1.2209 0.8903 0.0797  -0.0708 -0.0453 309 GLU B CD  
2767 O OE1 . GLU B 49  ? 1.2761 1.2313 0.9150 0.0746  -0.0860 -0.0608 309 GLU B OE1 
2768 O OE2 . GLU B 49  ? 1.3090 1.2793 0.9177 0.0906  -0.0600 -0.0442 309 GLU B OE2 
2769 N N   . ALA B 50  ? 1.0256 0.9916 0.7515 0.0571  -0.0321 0.0075  310 ALA B N   
2770 C CA  . ALA B 50  ? 0.9882 0.9483 0.7443 0.0481  -0.0337 0.0065  310 ALA B CA  
2771 C C   . ALA B 50  ? 1.0055 0.9633 0.7723 0.0473  -0.0327 0.0214  310 ALA B C   
2772 O O   . ALA B 50  ? 0.9693 0.9257 0.7536 0.0435  -0.0400 0.0197  310 ALA B O   
2773 C CB  . ALA B 50  ? 0.9547 0.9123 0.7264 0.0440  -0.0219 0.0036  310 ALA B CB  
2774 N N   . PHE B 51  ? 1.0131 0.9698 0.7689 0.0514  -0.0232 0.0364  311 PHE B N   
2775 C CA  . PHE B 51  ? 1.0187 0.9685 0.7816 0.0526  -0.0231 0.0508  311 PHE B CA  
2776 C C   . PHE B 51  ? 1.0246 0.9804 0.7814 0.0586  -0.0383 0.0500  311 PHE B C   
2777 O O   . PHE B 51  ? 1.0163 0.9701 0.7883 0.0595  -0.0434 0.0537  311 PHE B O   
2778 C CB  . PHE B 51  ? 1.0337 0.9784 0.7822 0.0555  -0.0112 0.0686  311 PHE B CB  
2779 C CG  . PHE B 51  ? 1.0729 1.0048 0.8263 0.0580  -0.0126 0.0836  311 PHE B CG  
2780 C CD1 . PHE B 51  ? 1.0418 0.9613 0.8202 0.0520  -0.0099 0.0849  311 PHE B CD1 
2781 C CD2 . PHE B 51  ? 1.1419 1.0727 0.8734 0.0679  -0.0180 0.0956  311 PHE B CD2 
2782 C CE1 . PHE B 51  ? 1.0694 0.9737 0.8510 0.0561  -0.0121 0.0970  311 PHE B CE1 
2783 C CE2 . PHE B 51  ? 1.1424 1.0588 0.8778 0.0723  -0.0204 0.1092  311 PHE B CE2 
2784 C CZ  . PHE B 51  ? 1.1224 1.0247 0.8830 0.0667  -0.0173 0.1093  311 PHE B CZ  
2785 N N   . PHE B 52  ? 1.0285 0.9932 0.7637 0.0635  -0.0462 0.0439  312 PHE B N   
2786 C CA  . PHE B 52  ? 1.0546 1.0282 0.7828 0.0694  -0.0617 0.0438  312 PHE B CA  
2787 C C   . PHE B 52  ? 1.0266 1.0089 0.7743 0.0629  -0.0748 0.0297  312 PHE B C   
2788 O O   . PHE B 52  ? 0.9967 0.9872 0.7583 0.0644  -0.0835 0.0324  312 PHE B O   
2789 C CB  . PHE B 52  ? 1.0712 1.0500 0.7648 0.0775  -0.0658 0.0433  312 PHE B CB  
2790 C CG  . PHE B 52  ? 1.0976 1.0836 0.7781 0.0867  -0.0787 0.0506  312 PHE B CG  
2791 C CD1 . PHE B 52  ? 1.1471 1.1264 0.8220 0.0940  -0.0738 0.0697  312 PHE B CD1 
2792 C CD2 . PHE B 52  ? 1.1352 1.1335 0.8090 0.0882  -0.0970 0.0388  312 PHE B CD2 
2793 C CE1 . PHE B 52  ? 1.1765 1.1626 0.8385 0.1048  -0.0872 0.0771  312 PHE B CE1 
2794 C CE2 . PHE B 52  ? 1.1886 1.1966 0.8517 0.0975  -0.1107 0.0451  312 PHE B CE2 
2795 C CZ  . PHE B 52  ? 1.1884 1.1908 0.8450 0.1070  -0.1058 0.0646  312 PHE B CZ  
2796 N N   . PHE B 53  ? 1.0633 1.0436 0.8124 0.0560  -0.0757 0.0154  313 PHE B N   
2797 C CA  . PHE B 53  ? 1.0974 1.0838 0.8599 0.0482  -0.0893 0.0023  313 PHE B CA  
2798 C C   . PHE B 53  ? 1.0591 1.0400 0.8477 0.0383  -0.0845 -0.0020 313 PHE B C   
2799 O O   . PHE B 53  ? 1.0099 0.9946 0.8105 0.0302  -0.0941 -0.0105 313 PHE B O   
2800 C CB  . PHE B 53  ? 1.1168 1.1008 0.8584 0.0479  -0.0979 -0.0120 313 PHE B CB  
2801 C CG  . PHE B 53  ? 1.1572 1.1486 0.8720 0.0569  -0.1080 -0.0114 313 PHE B CG  
2802 C CD1 . PHE B 53  ? 1.1623 1.1673 0.8823 0.0560  -0.1254 -0.0128 313 PHE B CD1 
2803 C CD2 . PHE B 53  ? 1.1831 1.1703 0.8671 0.0664  -0.1006 -0.0098 313 PHE B CD2 
2804 C CE1 . PHE B 53  ? 1.1581 1.1704 0.8518 0.0650  -0.1372 -0.0132 313 PHE B CE1 
2805 C CE2 . PHE B 53  ? 1.1974 1.1910 0.8522 0.0758  -0.1106 -0.0094 313 PHE B CE2 
2806 C CZ  . PHE B 53  ? 1.1989 1.2040 0.8580 0.0753  -0.1299 -0.0115 313 PHE B CZ  
2807 N N   . HIS B 54  ? 1.0918 1.0634 0.8883 0.0383  -0.0703 0.0043  314 HIS B N   
2808 C CA  . HIS B 54  ? 1.0858 1.0502 0.9030 0.0304  -0.0649 0.0003  314 HIS B CA  
2809 C C   . HIS B 54  ? 1.0741 1.0305 0.8873 0.0257  -0.0652 -0.0122 314 HIS B C   
2810 O O   . HIS B 54  ? 1.0615 1.0102 0.8800 0.0246  -0.0557 -0.0130 314 HIS B O   
2811 C CB  . HIS B 54  ? 1.1009 1.0732 0.9387 0.0255  -0.0714 0.0001  314 HIS B CB  
2812 C CG  . HIS B 54  ? 1.1310 1.0958 0.9851 0.0180  -0.0667 -0.0042 314 HIS B CG  
2813 N ND1 . HIS B 54  ? 1.1508 1.1085 1.0154 0.0193  -0.0571 0.0011  314 HIS B ND1 
2814 C CD2 . HIS B 54  ? 1.0870 1.0484 0.9466 0.0093  -0.0715 -0.0130 314 HIS B CD2 
2815 C CE1 . HIS B 54  ? 1.1166 1.0688 0.9914 0.0126  -0.0562 -0.0047 314 HIS B CE1 
2816 N NE2 . HIS B 54  ? 1.0924 1.0465 0.9643 0.0064  -0.0643 -0.0124 314 HIS B NE2 
2817 N N   . ASP B 55  ? 1.1245 1.0821 0.9293 0.0231  -0.0773 -0.0222 315 ASP B N   
2818 C CA  . ASP B 55  ? 1.1518 1.0978 0.9504 0.0202  -0.0801 -0.0351 315 ASP B CA  
2819 C C   . ASP B 55  ? 1.1009 1.0422 0.8873 0.0278  -0.0686 -0.0368 315 ASP B C   
2820 O O   . ASP B 55  ? 1.1548 1.1025 0.9259 0.0356  -0.0626 -0.0310 315 ASP B O   
2821 C CB  . ASP B 55  ? 1.2312 1.1765 1.0158 0.0184  -0.0961 -0.0456 315 ASP B CB  
2822 C CG  . ASP B 55  ? 1.2695 1.2172 1.0718 0.0063  -0.1076 -0.0476 315 ASP B CG  
2823 O OD1 . ASP B 55  ? 1.3647 1.3158 1.1610 0.0025  -0.1223 -0.0537 315 ASP B OD1 
2824 O OD2 . ASP B 55  ? 1.1899 1.1366 1.0119 0.0001  -0.1021 -0.0430 315 ASP B OD2 
2825 N N   . THR B 56  ? 1.0054 0.9370 0.7991 0.0256  -0.0654 -0.0439 316 THR B N   
2826 C CA  . THR B 56  ? 0.9787 0.9095 0.7650 0.0329  -0.0552 -0.0476 316 THR B CA  
2827 C C   . THR B 56  ? 0.9627 0.8807 0.7542 0.0315  -0.0593 -0.0596 316 THR B C   
2828 O O   . THR B 56  ? 0.9494 0.8604 0.7574 0.0237  -0.0626 -0.0588 316 THR B O   
2829 C CB  . THR B 56  ? 0.9906 0.9289 0.7902 0.0334  -0.0397 -0.0353 316 THR B CB  
2830 O OG1 . THR B 56  ? 1.0465 0.9874 0.8463 0.0385  -0.0305 -0.0403 316 THR B OG1 
2831 C CG2 . THR B 56  ? 0.8836 0.8176 0.7069 0.0252  -0.0395 -0.0300 316 THR B CG2 
2832 N N   . PRO B 57  ? 0.9513 0.8659 0.7272 0.0404  -0.0592 -0.0707 317 PRO B N   
2833 C CA  . PRO B 57  ? 0.9388 0.8389 0.7184 0.0416  -0.0637 -0.0823 317 PRO B CA  
2834 C C   . PRO B 57  ? 0.9492 0.8545 0.7491 0.0423  -0.0528 -0.0783 317 PRO B C   
2835 O O   . PRO B 57  ? 0.9939 0.8874 0.7996 0.0433  -0.0573 -0.0860 317 PRO B O   
2836 C CB  . PRO B 57  ? 0.9134 0.8100 0.6684 0.0544  -0.0659 -0.0958 317 PRO B CB  
2837 C CG  . PRO B 57  ? 0.9091 0.8248 0.6513 0.0611  -0.0551 -0.0884 317 PRO B CG  
2838 C CD  . PRO B 57  ? 0.9012 0.8247 0.6534 0.0514  -0.0544 -0.0730 317 PRO B CD  
2839 N N   . LYS B 58  ? 0.9291 0.8504 0.7393 0.0414  -0.0399 -0.0662 318 LYS B N   
2840 C CA  . LYS B 58  ? 0.9190 0.8466 0.7509 0.0401  -0.0309 -0.0623 318 LYS B CA  
2841 C C   . LYS B 58  ? 0.8843 0.8019 0.7331 0.0305  -0.0366 -0.0590 318 LYS B C   
2842 O O   . LYS B 58  ? 0.9352 0.8529 0.7992 0.0300  -0.0344 -0.0602 318 LYS B O   
2843 C CB  . LYS B 58  ? 0.8964 0.8423 0.7342 0.0406  -0.0158 -0.0502 318 LYS B CB  
2844 C CG  . LYS B 58  ? 0.9020 0.8633 0.7344 0.0509  -0.0052 -0.0546 318 LYS B CG  
2845 C CD  . LYS B 58  ? 0.9077 0.8850 0.7311 0.0527  0.0079  -0.0428 318 LYS B CD  
2846 C CE  . LYS B 58  ? 0.9553 0.9511 0.7713 0.0643  0.0195  -0.0482 318 LYS B CE  
2847 N NZ  . LYS B 58  ? 0.9718 0.9625 0.7580 0.0769  0.0131  -0.0619 318 LYS B NZ  
2848 N N   . GLU B 59  ? 0.8319 0.7430 0.6780 0.0236  -0.0440 -0.0551 319 GLU B N   
2849 C CA  . GLU B 59  ? 0.8304 0.7334 0.6894 0.0155  -0.0486 -0.0524 319 GLU B CA  
2850 C C   . GLU B 59  ? 0.8569 0.7453 0.7160 0.0156  -0.0563 -0.0616 319 GLU B C   
2851 O O   . GLU B 59  ? 0.8276 0.7128 0.6983 0.0145  -0.0553 -0.0614 319 GLU B O   
2852 C CB  . GLU B 59  ? 0.8043 0.7073 0.6606 0.0091  -0.0549 -0.0475 319 GLU B CB  
2853 C CG  . GLU B 59  ? 0.8332 0.7286 0.6990 0.0013  -0.0601 -0.0462 319 GLU B CG  
2854 C CD  . GLU B 59  ? 0.8951 0.7981 0.7637 -0.0043 -0.0634 -0.0399 319 GLU B CD  
2855 O OE1 . GLU B 59  ? 0.8911 0.8044 0.7642 -0.0020 -0.0580 -0.0324 319 GLU B OE1 
2856 O OE2 . GLU B 59  ? 0.9630 0.8618 0.8305 -0.0112 -0.0718 -0.0420 319 GLU B OE2 
2857 N N   . GLU B 60  ? 0.8824 0.7600 0.7269 0.0174  -0.0652 -0.0700 320 GLU B N   
2858 C CA  . GLU B 60  ? 0.8830 0.7417 0.7243 0.0182  -0.0741 -0.0784 320 GLU B CA  
2859 C C   . GLU B 60  ? 0.9228 0.7840 0.7679 0.0295  -0.0694 -0.0850 320 GLU B C   
2860 O O   . GLU B 60  ? 0.9474 0.7974 0.7979 0.0307  -0.0739 -0.0880 320 GLU B O   
2861 C CB  . GLU B 60  ? 0.9271 0.7702 0.7515 0.0165  -0.0862 -0.0861 320 GLU B CB  
2862 C CG  . GLU B 60  ? 1.0627 0.8848 0.8765 0.0242  -0.0943 -0.0985 320 GLU B CG  
2863 C CD  . GLU B 60  ? 1.2052 1.0017 1.0140 0.0142  -0.1081 -0.0997 320 GLU B CD  
2864 O OE1 . GLU B 60  ? 1.2519 1.0331 1.0460 0.0124  -0.1191 -0.1075 320 GLU B OE1 
2865 O OE2 . GLU B 60  ? 1.2338 1.0251 1.0528 0.0075  -0.1081 -0.0925 320 GLU B OE2 
2866 N N   . GLU B 61  ? 0.9208 0.7985 0.7636 0.0381  -0.0601 -0.0866 321 GLU B N   
2867 C CA  . GLU B 61  ? 0.9300 0.8173 0.7804 0.0490  -0.0539 -0.0924 321 GLU B CA  
2868 C C   . GLU B 61  ? 0.9353 0.8294 0.8085 0.0450  -0.0504 -0.0867 321 GLU B C   
2869 O O   . GLU B 61  ? 0.9577 0.8467 0.8375 0.0507  -0.0548 -0.0930 321 GLU B O   
2870 C CB  . GLU B 61  ? 0.9458 0.8556 0.7924 0.0566  -0.0411 -0.0913 321 GLU B CB  
2871 C CG  . GLU B 61  ? 1.0106 0.9146 0.8321 0.0666  -0.0448 -0.1019 321 GLU B CG  
2872 C CD  . GLU B 61  ? 1.0568 0.9838 0.8696 0.0734  -0.0311 -0.0984 321 GLU B CD  
2873 O OE1 . GLU B 61  ? 1.0507 0.9988 0.8798 0.0705  -0.0177 -0.0875 321 GLU B OE1 
2874 O OE2 . GLU B 61  ? 1.0802 1.0027 0.8683 0.0812  -0.0345 -0.1064 321 GLU B OE2 
2875 N N   . TRP B 62  ? 0.8998 0.8039 0.7838 0.0361  -0.0438 -0.0756 322 TRP B N   
2876 C CA  . TRP B 62  ? 0.9217 0.8318 0.8265 0.0319  -0.0411 -0.0712 322 TRP B CA  
2877 C C   . TRP B 62  ? 0.9327 0.8246 0.8377 0.0265  -0.0515 -0.0715 322 TRP B C   
2878 O O   . TRP B 62  ? 0.9377 0.8290 0.8540 0.0277  -0.0544 -0.0736 322 TRP B O   
2879 C CB  . TRP B 62  ? 0.9045 0.8273 0.8191 0.0249  -0.0313 -0.0600 322 TRP B CB  
2880 C CG  . TRP B 62  ? 0.8743 0.8179 0.7944 0.0289  -0.0191 -0.0573 322 TRP B CG  
2881 C CD1 . TRP B 62  ? 0.8476 0.7986 0.7541 0.0313  -0.0121 -0.0530 322 TRP B CD1 
2882 C CD2 . TRP B 62  ? 0.8655 0.8273 0.8064 0.0306  -0.0122 -0.0577 322 TRP B CD2 
2883 N NE1 . TRP B 62  ? 0.8889 0.8612 0.8047 0.0342  0.0004  -0.0497 322 TRP B NE1 
2884 C CE2 . TRP B 62  ? 0.8981 0.8790 0.8373 0.0332  0.0008  -0.0525 322 TRP B CE2 
2885 C CE3 . TRP B 62  ? 0.8287 0.7943 0.7899 0.0300  -0.0162 -0.0618 322 TRP B CE3 
2886 C CZ2 . TRP B 62  ? 0.8660 0.8719 0.8259 0.0340  0.0115  -0.0504 322 TRP B CZ2 
2887 C CZ3 . TRP B 62  ? 0.8221 0.8126 0.8053 0.0310  -0.0076 -0.0609 322 TRP B CZ3 
2888 C CH2 . TRP B 62  ? 0.8181 0.8296 0.8018 0.0324  0.0069  -0.0549 322 TRP B CH2 
2889 N N   . PHE B 63  ? 0.8993 0.7782 0.7918 0.0206  -0.0570 -0.0689 323 PHE B N   
2890 C CA  . PHE B 63  ? 0.8936 0.7560 0.7831 0.0153  -0.0655 -0.0681 323 PHE B CA  
2891 C C   . PHE B 63  ? 0.8838 0.7312 0.7684 0.0217  -0.0744 -0.0761 323 PHE B C   
2892 O O   . PHE B 63  ? 0.8486 0.6881 0.7366 0.0213  -0.0791 -0.0755 323 PHE B O   
2893 C CB  . PHE B 63  ? 0.9458 0.8006 0.8241 0.0077  -0.0696 -0.0643 323 PHE B CB  
2894 C CG  . PHE B 63  ? 1.0240 0.8636 0.8984 0.0012  -0.0768 -0.0619 323 PHE B CG  
2895 C CD1 . PHE B 63  ? 0.9894 0.8321 0.8703 -0.0027 -0.0739 -0.0559 323 PHE B CD1 
2896 C CD2 . PHE B 63  ? 1.1098 0.9301 0.9723 -0.0007 -0.0865 -0.0655 323 PHE B CD2 
2897 C CE1 . PHE B 63  ? 1.0451 0.8756 0.9200 -0.0082 -0.0790 -0.0526 323 PHE B CE1 
2898 C CE2 . PHE B 63  ? 1.1350 0.9406 0.9929 -0.0080 -0.0922 -0.0609 323 PHE B CE2 
2899 C CZ  . PHE B 63  ? 1.1066 0.9191 0.9703 -0.0115 -0.0875 -0.0539 323 PHE B CZ  
2900 N N   . LYS B 64  ? 0.8714 0.7131 0.7459 0.0289  -0.0775 -0.0839 324 LYS B N   
2901 C CA  . LYS B 64  ? 0.8828 0.7090 0.7522 0.0382  -0.0861 -0.0925 324 LYS B CA  
2902 C C   . LYS B 64  ? 0.8750 0.7180 0.7615 0.0477  -0.0819 -0.0958 324 LYS B C   
2903 O O   . LYS B 64  ? 0.9716 0.8043 0.8600 0.0528  -0.0897 -0.0989 324 LYS B O   
2904 C CB  . LYS B 64  ? 0.9572 0.7725 0.8104 0.0458  -0.0906 -0.1021 324 LYS B CB  
2905 C CG  . LYS B 64  ? 1.1024 0.8902 0.9381 0.0371  -0.1021 -0.1023 324 LYS B CG  
2906 N N   . ALA B 65  ? 0.8089 0.6783 0.7085 0.0495  -0.0701 -0.0944 325 ALA B N   
2907 C CA  . ALA B 65  ? 0.7921 0.6821 0.7125 0.0566  -0.0659 -0.0971 325 ALA B CA  
2908 C C   . ALA B 65  ? 0.8286 0.7163 0.7612 0.0499  -0.0707 -0.0926 325 ALA B C   
2909 O O   . ALA B 65  ? 0.8618 0.7511 0.8041 0.0567  -0.0771 -0.0973 325 ALA B O   
2910 C CB  . ALA B 65  ? 0.7685 0.6868 0.7012 0.0558  -0.0514 -0.0932 325 ALA B CB  
2911 N N   . VAL B 66  ? 0.8062 0.6905 0.7372 0.0379  -0.0681 -0.0841 326 VAL B N   
2912 C CA  . VAL B 66  ? 0.7982 0.6789 0.7364 0.0318  -0.0722 -0.0805 326 VAL B CA  
2913 C C   . VAL B 66  ? 0.8347 0.6929 0.7596 0.0346  -0.0846 -0.0829 326 VAL B C   
2914 O O   . VAL B 66  ? 0.8806 0.7385 0.8124 0.0380  -0.0912 -0.0853 326 VAL B O   
2915 C CB  . VAL B 66  ? 0.8003 0.6788 0.7347 0.0211  -0.0671 -0.0721 326 VAL B CB  
2916 C CG1 . VAL B 66  ? 0.7898 0.6586 0.7232 0.0168  -0.0729 -0.0701 326 VAL B CG1 
2917 C CG2 . VAL B 66  ? 0.8233 0.7208 0.7719 0.0179  -0.0561 -0.0679 326 VAL B CG2 
2918 N N   . SER B 67  ? 0.8035 0.6424 0.7092 0.0326  -0.0885 -0.0816 327 SER B N   
2919 C CA  . SER B 67  ? 0.8182 0.6325 0.7091 0.0331  -0.0997 -0.0812 327 SER B CA  
2920 C C   . SER B 67  ? 0.8209 0.6306 0.7148 0.0462  -0.1083 -0.0888 327 SER B C   
2921 O O   . SER B 67  ? 0.8002 0.5997 0.6909 0.0485  -0.1168 -0.0878 327 SER B O   
2922 C CB  . SER B 67  ? 0.8104 0.6055 0.6833 0.0276  -0.1027 -0.0789 327 SER B CB  
2923 O OG  . SER B 67  ? 0.8328 0.6320 0.7037 0.0155  -0.0973 -0.0705 327 SER B OG  
2924 N N   . GLU B 68  ? 0.8518 0.6711 0.7514 0.0560  -0.1057 -0.0965 328 GLU B N   
2925 C CA  . GLU B 68  ? 0.8963 0.7150 0.8005 0.0718  -0.1130 -0.1054 328 GLU B CA  
2926 C C   . GLU B 68  ? 0.9309 0.7748 0.8593 0.0759  -0.1124 -0.1070 328 GLU B C   
2927 O O   . GLU B 68  ? 0.9532 0.7967 0.8870 0.0884  -0.1214 -0.1129 328 GLU B O   
2928 C CB  . GLU B 68  ? 0.9023 0.7281 0.8053 0.0824  -0.1084 -0.1140 328 GLU B CB  
2929 C CG  . GLU B 68  ? 0.9668 0.7635 0.8449 0.0802  -0.1134 -0.1155 328 GLU B CG  
2930 C CD  . GLU B 68  ? 1.0571 0.8628 0.9306 0.0897  -0.1074 -0.1247 328 GLU B CD  
2931 O OE1 . GLU B 68  ? 1.0352 0.8734 0.9243 0.0936  -0.0950 -0.1258 328 GLU B OE1 
2932 O OE2 . GLU B 68  ? 1.1460 0.9249 0.9989 0.0931  -0.1154 -0.1306 328 GLU B OE2 
2933 N N   . GLY B 69  ? 0.9083 0.7729 0.8517 0.0655  -0.1032 -0.1020 329 GLY B N   
2934 C CA  . GLY B 69  ? 0.8751 0.7632 0.8435 0.0656  -0.1034 -0.1032 329 GLY B CA  
2935 C C   . GLY B 69  ? 0.9082 0.7853 0.8730 0.0589  -0.1119 -0.0996 329 GLY B C   
2936 O O   . GLY B 69  ? 0.9297 0.8225 0.9134 0.0601  -0.1165 -0.1026 329 GLY B O   
2937 N N   . LEU B 70  ? 0.9065 0.7588 0.8478 0.0521  -0.1143 -0.0936 330 LEU B N   
2938 C CA  . LEU B 70  ? 0.9070 0.7482 0.8397 0.0478  -0.1217 -0.0905 330 LEU B CA  
2939 C C   . LEU B 70  ? 0.9883 0.8225 0.9191 0.0591  -0.1365 -0.0952 330 LEU B C   
2940 O O   . LEU B 70  ? 1.0505 0.8780 0.9784 0.0702  -0.1420 -0.0991 330 LEU B O   
2941 C CB  . LEU B 70  ? 0.8501 0.6684 0.7571 0.0400  -0.1204 -0.0826 330 LEU B CB  
2942 C CG  . LEU B 70  ? 0.8398 0.6635 0.7462 0.0298  -0.1080 -0.0773 330 LEU B CG  
2943 C CD1 . LEU B 70  ? 0.8568 0.6617 0.7407 0.0228  -0.1082 -0.0695 330 LEU B CD1 
2944 C CD2 . LEU B 70  ? 0.7935 0.6349 0.7164 0.0245  -0.1012 -0.0772 330 LEU B CD2 
2945 N N   . HIS B 71  ? 0.9386 0.7731 0.8696 0.0575  -0.1439 -0.0954 331 HIS B N   
2946 C CA  . HIS B 71  ? 0.9245 0.7559 0.8551 0.0686  -0.1594 -0.1000 331 HIS B CA  
2947 C C   . HIS B 71  ? 0.9469 0.7475 0.8494 0.0762  -0.1681 -0.0960 331 HIS B C   
2948 O O   . HIS B 71  ? 0.9444 0.7223 0.8212 0.0690  -0.1665 -0.0877 331 HIS B O   
2949 C CB  . HIS B 71  ? 0.9341 0.7665 0.8625 0.0646  -0.1668 -0.1007 331 HIS B CB  
2950 C CG  . HIS B 71  ? 0.9500 0.7889 0.8867 0.0758  -0.1835 -0.1074 331 HIS B CG  
2951 N ND1 . HIS B 71  ? 0.9751 0.7940 0.8917 0.0878  -0.1964 -0.1061 331 HIS B ND1 
2952 C CD2 . HIS B 71  ? 0.9432 0.8070 0.9074 0.0766  -0.1904 -0.1151 331 HIS B CD2 
2953 C CE1 . HIS B 71  ? 0.9770 0.8093 0.9078 0.0974  -0.2110 -0.1132 331 HIS B CE1 
2954 N NE2 . HIS B 71  ? 0.9785 0.8395 0.9393 0.0901  -0.2078 -0.1191 331 HIS B NE2 
2955 N N   . PRO B 72  ? 0.9384 0.7385 0.8465 0.0909  -0.1776 -0.1017 332 PRO B N   
2956 C CA  . PRO B 72  ? 0.9700 0.7375 0.8530 0.0989  -0.1858 -0.0984 332 PRO B CA  
2957 C C   . PRO B 72  ? 1.0365 0.7759 0.8912 0.1007  -0.1987 -0.0912 332 PRO B C   
2958 O O   . PRO B 72  ? 1.0670 0.7742 0.8977 0.1043  -0.2050 -0.0856 332 PRO B O   
2959 C CB  . PRO B 72  ? 0.9317 0.7116 0.8331 0.1171  -0.1922 -0.1086 332 PRO B CB  
2960 C CG  . PRO B 72  ? 0.9061 0.7236 0.8391 0.1192  -0.1931 -0.1152 332 PRO B CG  
2961 C CD  . PRO B 72  ? 0.9000 0.7315 0.8405 0.1010  -0.1808 -0.1114 332 PRO B CD  
2962 N N   . ASP B 73  ? 1.0843 0.8341 0.9401 0.0982  -0.2031 -0.0911 333 ASP B N   
2963 C CA  . ASP B 73  ? 1.1407 0.8662 0.9666 0.1010  -0.2151 -0.0841 333 ASP B CA  
2964 C C   . ASP B 73  ? 1.1479 0.8501 0.9437 0.0877  -0.2069 -0.0713 333 ASP B C   
2965 O O   . ASP B 73  ? 1.2107 0.8874 0.9769 0.0898  -0.2150 -0.0626 333 ASP B O   
2966 C CB  . ASP B 73  ? 1.1208 0.8647 0.9549 0.1034  -0.2238 -0.0898 333 ASP B CB  
2967 C CG  . ASP B 73  ? 1.1525 0.9086 1.0035 0.1203  -0.2406 -0.0987 333 ASP B CG  
2968 O OD1 . ASP B 73  ? 1.1947 0.9455 1.0510 0.1324  -0.2451 -0.1008 333 ASP B OD1 
2969 O OD2 . ASP B 73  ? 1.1492 0.9211 1.0088 0.1222  -0.2503 -0.1045 333 ASP B OD2 
2970 N N   . ALA B 74  ? 1.0984 0.8106 0.9017 0.0743  -0.1908 -0.0694 334 ALA B N   
2971 C CA  . ALA B 74  ? 1.0759 0.7725 0.8558 0.0614  -0.1818 -0.0574 334 ALA B CA  
2972 C C   . ALA B 74  ? 1.0652 0.7585 0.8505 0.0527  -0.1714 -0.0547 334 ALA B C   
2973 O O   . ALA B 74  ? 1.0375 0.7451 0.8447 0.0556  -0.1681 -0.0629 334 ALA B O   
2974 C CB  . ALA B 74  ? 1.0258 0.7387 0.8056 0.0539  -0.1737 -0.0573 334 ALA B CB  
2975 N N   . LYS B 75  ? 1.1027 0.7778 0.8671 0.0420  -0.1669 -0.0427 335 LYS B N   
2976 C CA  . LYS B 75  ? 1.0947 0.7684 0.8631 0.0306  -0.1574 -0.0392 335 LYS B CA  
2977 C C   . LYS B 75  ? 1.0902 0.7874 0.8659 0.0204  -0.1435 -0.0369 335 LYS B C   
2978 O O   . LYS B 75  ? 1.1117 0.8084 0.8723 0.0164  -0.1404 -0.0296 335 LYS B O   
2979 C CB  . LYS B 75  ? 1.1503 0.7923 0.8942 0.0228  -0.1613 -0.0264 335 LYS B CB  
2980 C CG  . LYS B 75  ? 1.1991 0.8366 0.9471 0.0100  -0.1551 -0.0232 335 LYS B CG  
2981 C CD  . LYS B 75  ? 2.7438 2.3447 2.4688 0.0017  -0.1622 -0.0106 335 LYS B CD  
2982 C CE  . LYS B 75  ? 2.0284 1.6236 1.7587 -0.0129 -0.1586 -0.0084 335 LYS B CE  
2983 N NZ  . LYS B 75  ? 2.0600 1.6132 1.7719 -0.0186 -0.1700 -0.0007 335 LYS B NZ  
2984 N N   . TYR B 76  ? 1.0184 0.7359 0.8156 0.0180  -0.1353 -0.0433 336 TYR B N   
2985 C CA  . TYR B 76  ? 0.9604 0.6989 0.7658 0.0102  -0.1228 -0.0416 336 TYR B CA  
2986 C C   . TYR B 76  ? 0.9636 0.7013 0.7672 -0.0017 -0.1154 -0.0343 336 TYR B C   
2987 O O   . TYR B 76  ? 0.9970 0.7227 0.8004 -0.0035 -0.1194 -0.0349 336 TYR B O   
2988 C CB  . TYR B 76  ? 0.9244 0.6852 0.7539 0.0146  -0.1187 -0.0516 336 TYR B CB  
2989 C CG  . TYR B 76  ? 0.9316 0.6979 0.7669 0.0232  -0.1257 -0.0585 336 TYR B CG  
2990 C CD1 . TYR B 76  ? 0.9308 0.7034 0.7626 0.0223  -0.1241 -0.0589 336 TYR B CD1 
2991 C CD2 . TYR B 76  ? 0.9303 0.6958 0.7744 0.0329  -0.1351 -0.0654 336 TYR B CD2 
2992 C CE1 . TYR B 76  ? 0.9209 0.6975 0.7578 0.0291  -0.1327 -0.0662 336 TYR B CE1 
2993 C CE2 . TYR B 76  ? 0.9435 0.7168 0.7957 0.0400  -0.1431 -0.0719 336 TYR B CE2 
2994 C CZ  . TYR B 76  ? 0.9554 0.7336 0.8040 0.0372  -0.1426 -0.0724 336 TYR B CZ  
2995 O OH  . TYR B 76  ? 0.9893 0.7751 0.8468 0.0435  -0.1529 -0.0802 336 TYR B OH  
2996 N N   . ALA B 77  ? 0.9359 0.6869 0.7384 -0.0089 -0.1057 -0.0284 337 ALA B N   
2997 C CA  . ALA B 77  ? 0.9296 0.6881 0.7359 -0.0203 -0.0982 -0.0219 337 ALA B CA  
2998 C C   . ALA B 77  ? 0.9293 0.7125 0.7537 -0.0191 -0.0894 -0.0268 337 ALA B C   
2999 O O   . ALA B 77  ? 0.9323 0.7258 0.7606 -0.0134 -0.0859 -0.0306 337 ALA B O   
3000 C CB  . ALA B 77  ? 0.9426 0.7002 0.7346 -0.0288 -0.0933 -0.0097 337 ALA B CB  
3001 N N   . LYS B 78  ? 0.9015 0.6917 0.7357 -0.0244 -0.0870 -0.0270 338 LYS B N   
3002 C CA  . LYS B 78  ? 0.8762 0.6873 0.7252 -0.0230 -0.0795 -0.0299 338 LYS B CA  
3003 C C   . LYS B 78  ? 0.8835 0.7099 0.7332 -0.0286 -0.0713 -0.0225 338 LYS B C   
3004 O O   . LYS B 78  ? 0.9121 0.7412 0.7611 -0.0381 -0.0707 -0.0159 338 LYS B O   
3005 C CB  . LYS B 78  ? 0.9386 0.7513 0.7944 -0.0247 -0.0814 -0.0333 338 LYS B CB  
3006 C CG  . LYS B 78  ? 0.9610 0.7941 0.8298 -0.0225 -0.0740 -0.0349 338 LYS B CG  
3007 C CD  . LYS B 78  ? 1.0054 0.8444 0.8764 -0.0282 -0.0750 -0.0337 338 LYS B CD  
3008 C CE  . LYS B 78  ? 1.0210 0.8672 0.8917 -0.0386 -0.0737 -0.0253 338 LYS B CE  
3009 N NZ  . LYS B 78  ? 1.0308 0.8859 0.9064 -0.0440 -0.0762 -0.0253 338 LYS B NZ  
3010 N N   . VAL B 79  ? 0.8404 0.6773 0.6927 -0.0226 -0.0654 -0.0242 339 VAL B N   
3011 C CA  . VAL B 79  ? 0.7903 0.6437 0.6433 -0.0240 -0.0568 -0.0187 339 VAL B CA  
3012 C C   . VAL B 79  ? 0.8079 0.6795 0.6757 -0.0247 -0.0521 -0.0181 339 VAL B C   
3013 O O   . VAL B 79  ? 0.8030 0.6902 0.6749 -0.0300 -0.0476 -0.0117 339 VAL B O   
3014 C CB  . VAL B 79  ? 0.7791 0.6330 0.6260 -0.0150 -0.0537 -0.0226 339 VAL B CB  
3015 C CG1 . VAL B 79  ? 0.7345 0.6061 0.5804 -0.0139 -0.0441 -0.0179 339 VAL B CG1 
3016 C CG2 . VAL B 79  ? 0.8228 0.6595 0.6532 -0.0132 -0.0600 -0.0234 339 VAL B CG2 
3017 N N   . LYS B 80  ? 0.8052 0.6763 0.6815 -0.0193 -0.0531 -0.0240 340 LYS B N   
3018 C CA  . LYS B 80  ? 0.8024 0.6884 0.6899 -0.0181 -0.0494 -0.0229 340 LYS B CA  
3019 C C   . LYS B 80  ? 0.7966 0.6786 0.6896 -0.0146 -0.0513 -0.0274 340 LYS B C   
3020 O O   . LYS B 80  ? 0.8278 0.7004 0.7211 -0.0109 -0.0528 -0.0322 340 LYS B O   
3021 C CB  . LYS B 80  ? 0.8281 0.7257 0.7187 -0.0114 -0.0424 -0.0217 340 LYS B CB  
3022 C CG  . LYS B 80  ? 0.8801 0.7917 0.7811 -0.0075 -0.0393 -0.0197 340 LYS B CG  
3023 C CD  . LYS B 80  ? 0.9284 0.8562 0.8354 -0.0141 -0.0405 -0.0145 340 LYS B CD  
3024 C CE  . LYS B 80  ? 0.9599 0.9060 0.8699 -0.0170 -0.0360 -0.0090 340 LYS B CE  
3025 N NZ  . LYS B 80  ? 0.9624 0.9307 0.8849 -0.0193 -0.0369 -0.0049 340 LYS B NZ  
3026 N N   . LEU B 81  ? 0.7763 0.6675 0.6738 -0.0162 -0.0514 -0.0255 341 LEU B N   
3027 C CA  . LEU B 81  ? 0.8033 0.6951 0.7042 -0.0123 -0.0507 -0.0277 341 LEU B CA  
3028 C C   . LEU B 81  ? 0.8262 0.7319 0.7323 -0.0092 -0.0469 -0.0228 341 LEU B C   
3029 O O   . LEU B 81  ? 0.8461 0.7638 0.7538 -0.0122 -0.0483 -0.0194 341 LEU B O   
3030 C CB  . LEU B 81  ? 0.7816 0.6688 0.6776 -0.0152 -0.0563 -0.0309 341 LEU B CB  
3031 C CG  . LEU B 81  ? 0.7636 0.6541 0.6590 -0.0109 -0.0550 -0.0329 341 LEU B CG  
3032 C CD1 . LEU B 81  ? 0.7615 0.6436 0.6484 -0.0119 -0.0615 -0.0391 341 LEU B CD1 
3033 C CD2 . LEU B 81  ? 0.7292 0.6330 0.6258 -0.0094 -0.0529 -0.0278 341 LEU B CD2 
3034 N N   . ILE B 82  ? 0.8106 0.7147 0.7201 -0.0034 -0.0429 -0.0220 342 ILE B N   
3035 C CA  . ILE B 82  ? 0.8052 0.7182 0.7174 0.0014  -0.0403 -0.0167 342 ILE B CA  
3036 C C   . ILE B 82  ? 0.8146 0.7237 0.7256 0.0036  -0.0382 -0.0151 342 ILE B C   
3037 O O   . ILE B 82  ? 0.8237 0.7239 0.7372 0.0030  -0.0360 -0.0174 342 ILE B O   
3038 C CB  . ILE B 82  ? 0.7506 0.6630 0.6666 0.0077  -0.0366 -0.0149 342 ILE B CB  
3039 C CG1 . ILE B 82  ? 0.6877 0.6107 0.6062 0.0141  -0.0356 -0.0089 342 ILE B CG1 
3040 C CG2 . ILE B 82  ? 0.7709 0.6671 0.6883 0.0096  -0.0346 -0.0177 342 ILE B CG2 
3041 C CD1 . ILE B 82  ? 0.6438 0.5870 0.5653 0.0123  -0.0385 -0.0067 342 ILE B CD1 
3042 N N   . ARG B 83  ? 0.8059 0.7236 0.7133 0.0060  -0.0388 -0.0106 343 ARG B N   
3043 C CA  . ARG B 83  ? 0.8550 0.7709 0.7580 0.0084  -0.0355 -0.0071 343 ARG B CA  
3044 C C   . ARG B 83  ? 0.9035 0.8256 0.8031 0.0145  -0.0353 0.0011  343 ARG B C   
3045 O O   . ARG B 83  ? 0.8995 0.8331 0.7989 0.0160  -0.0403 0.0019  343 ARG B O   
3046 C CB  . ARG B 83  ? 0.8595 0.7777 0.7544 0.0061  -0.0380 -0.0121 343 ARG B CB  
3047 C CG  . ARG B 83  ? 0.8684 0.7888 0.7554 0.0096  -0.0332 -0.0082 343 ARG B CG  
3048 C CD  . ARG B 83  ? 0.8276 0.7489 0.7068 0.0095  -0.0345 -0.0161 343 ARG B CD  
3049 N NE  . ARG B 83  ? 0.8264 0.7506 0.6953 0.0091  -0.0433 -0.0209 343 ARG B NE  
3050 C CZ  . ARG B 83  ? 0.8859 0.8173 0.7430 0.0126  -0.0460 -0.0180 343 ARG B CZ  
3051 N NH1 . ARG B 83  ? 0.8981 0.8335 0.7502 0.0176  -0.0395 -0.0090 343 ARG B NH1 
3052 N NH2 . ARG B 83  ? 0.8947 0.8282 0.7440 0.0107  -0.0563 -0.0238 343 ARG B NH2 
3053 N N   . LEU B 84  ? 0.8792 0.7937 0.7772 0.0176  -0.0300 0.0080  344 LEU B N   
3054 C CA  . LEU B 84  ? 0.8320 0.7487 0.7228 0.0242  -0.0299 0.0175  344 LEU B CA  
3055 C C   . LEU B 84  ? 0.8599 0.7747 0.7411 0.0232  -0.0245 0.0225  344 LEU B C   
3056 O O   . LEU B 84  ? 0.8503 0.7552 0.7361 0.0203  -0.0178 0.0265  344 LEU B O   
3057 C CB  . LEU B 84  ? 0.7824 0.6875 0.6788 0.0295  -0.0281 0.0232  344 LEU B CB  
3058 C CG  . LEU B 84  ? 0.8051 0.7076 0.6933 0.0381  -0.0286 0.0346  344 LEU B CG  
3059 C CD1 . LEU B 84  ? 0.7603 0.6819 0.6454 0.0445  -0.0362 0.0347  344 LEU B CD1 
3060 C CD2 . LEU B 84  ? 0.7921 0.6755 0.6855 0.0433  -0.0270 0.0389  344 LEU B CD2 
3061 N N   . VAL B 85  ? 0.8676 0.7928 0.7355 0.0254  -0.0276 0.0221  345 VAL B N   
3062 C CA  . VAL B 85  ? 0.9008 0.8280 0.7563 0.0257  -0.0217 0.0249  345 VAL B CA  
3063 C C   . VAL B 85  ? 0.9088 0.8341 0.7735 0.0198  -0.0159 0.0179  345 VAL B C   
3064 O O   . VAL B 85  ? 0.9131 0.8412 0.7793 0.0178  -0.0206 0.0067  345 VAL B O   
3065 C CB  . VAL B 85  ? 1.0453 0.9668 0.8921 0.0297  -0.0155 0.0401  345 VAL B CB  
3066 C CG1 . VAL B 85  ? 1.0683 0.9956 0.9009 0.0300  -0.0073 0.0440  345 VAL B CG1 
3067 C CG2 . VAL B 85  ? 1.0271 0.9519 0.8644 0.0379  -0.0235 0.0460  345 VAL B CG2 
3068 N N   . GLY B 86  ? 0.8850 0.8051 0.7576 0.0166  -0.0069 0.0246  346 GLY B N   
3069 C CA  . GLY B 86  ? 0.8952 0.8182 0.7796 0.0116  -0.0018 0.0183  346 GLY B CA  
3070 C C   . GLY B 86  ? 0.9077 0.8211 0.8117 0.0059  -0.0032 0.0151  346 GLY B C   
3071 O O   . GLY B 86  ? 0.9092 0.8257 0.8259 0.0014  0.0004  0.0114  346 GLY B O   
3072 N N   . ILE B 87  ? 0.8609 0.7641 0.7668 0.0070  -0.0087 0.0159  347 ILE B N   
3073 C CA  . ILE B 87  ? 0.7889 0.6811 0.7085 0.0035  -0.0111 0.0117  347 ILE B CA  
3074 C C   . ILE B 87  ? 0.8151 0.7101 0.7342 0.0045  -0.0184 0.0010  347 ILE B C   
3075 O O   . ILE B 87  ? 0.8390 0.7352 0.7528 0.0081  -0.0225 0.0011  347 ILE B O   
3076 C CB  . ILE B 87  ? 0.7820 0.6599 0.7020 0.0062  -0.0117 0.0193  347 ILE B CB  
3077 C CG1 . ILE B 87  ? 0.8075 0.6790 0.7262 0.0038  -0.0047 0.0324  347 ILE B CG1 
3078 C CG2 . ILE B 87  ? 0.7383 0.6031 0.6690 0.0040  -0.0153 0.0128  347 ILE B CG2 
3079 C CD1 . ILE B 87  ? 0.7782 0.6331 0.6916 0.0092  -0.0063 0.0419  347 ILE B CD1 
3080 N N   . MET B 88  ? 0.7857 0.6828 0.7105 0.0013  -0.0198 -0.0072 348 MET B N   
3081 C CA  . MET B 88  ? 0.7830 0.6798 0.7051 0.0013  -0.0265 -0.0157 348 MET B CA  
3082 C C   . MET B 88  ? 0.8363 0.7251 0.7674 -0.0010 -0.0294 -0.0214 348 MET B C   
3083 O O   . MET B 88  ? 0.8623 0.7503 0.8039 -0.0037 -0.0276 -0.0228 348 MET B O   
3084 C CB  . MET B 88  ? 0.7571 0.6605 0.6730 0.0019  -0.0283 -0.0213 348 MET B CB  
3085 C CG  . MET B 88  ? 0.6833 0.5822 0.5952 0.0007  -0.0360 -0.0285 348 MET B CG  
3086 S SD  . MET B 88  ? 0.9342 0.8346 0.8349 0.0027  -0.0402 -0.0353 348 MET B SD  
3087 C CE  . MET B 88  ? 0.8317 0.7335 0.7410 0.0059  -0.0376 -0.0414 348 MET B CE  
3088 N N   . LEU B 89  ? 0.7970 0.6817 0.7238 -0.0002 -0.0339 -0.0245 349 LEU B N   
3089 C CA  . LEU B 89  ? 0.7804 0.6571 0.7098 -0.0011 -0.0379 -0.0305 349 LEU B CA  
3090 C C   . LEU B 89  ? 0.8288 0.7058 0.7496 -0.0018 -0.0427 -0.0341 349 LEU B C   
3091 O O   . LEU B 89  ? 0.8400 0.7219 0.7547 -0.0020 -0.0428 -0.0311 349 LEU B O   
3092 C CB  . LEU B 89  ? 0.7713 0.6403 0.7005 0.0018  -0.0374 -0.0295 349 LEU B CB  
3093 C CG  . LEU B 89  ? 0.7613 0.6203 0.6902 0.0021  -0.0420 -0.0366 349 LEU B CG  
3094 C CD1 . LEU B 89  ? 0.7653 0.6212 0.7060 -0.0021 -0.0444 -0.0403 349 LEU B CD1 
3095 C CD2 . LEU B 89  ? 0.7220 0.5721 0.6471 0.0074  -0.0415 -0.0375 349 LEU B CD2 
3096 N N   . LEU B 90  ? 0.8196 0.6916 0.7411 -0.0025 -0.0473 -0.0398 350 LEU B N   
3097 C CA  . LEU B 90  ? 0.8333 0.7005 0.7451 -0.0035 -0.0527 -0.0420 350 LEU B CA  
3098 C C   . LEU B 90  ? 0.8418 0.7008 0.7497 -0.0024 -0.0562 -0.0449 350 LEU B C   
3099 O O   . LEU B 90  ? 0.8364 0.6925 0.7514 -0.0010 -0.0576 -0.0488 350 LEU B O   
3100 C CB  . LEU B 90  ? 0.8058 0.6710 0.7181 -0.0026 -0.0568 -0.0465 350 LEU B CB  
3101 C CG  . LEU B 90  ? 0.7867 0.6596 0.7006 -0.0015 -0.0536 -0.0462 350 LEU B CG  
3102 C CD1 . LEU B 90  ? 0.7886 0.6614 0.7057 0.0026  -0.0565 -0.0526 350 LEU B CD1 
3103 C CD2 . LEU B 90  ? 0.8134 0.6857 0.7169 -0.0042 -0.0553 -0.0437 350 LEU B CD2 
3104 N N   . LEU B 91  ? 0.8307 0.6865 0.7270 -0.0036 -0.0578 -0.0429 351 LEU B N   
3105 C CA  . LEU B 91  ? 0.8342 0.6819 0.7216 -0.0015 -0.0612 -0.0454 351 LEU B CA  
3106 C C   . LEU B 91  ? 0.8395 0.6790 0.7155 -0.0037 -0.0669 -0.0441 351 LEU B C   
3107 O O   . LEU B 91  ? 0.8233 0.6643 0.6939 -0.0086 -0.0653 -0.0384 351 LEU B O   
3108 C CB  . LEU B 91  ? 0.8106 0.6626 0.6914 0.0004  -0.0558 -0.0426 351 LEU B CB  
3109 C CG  . LEU B 91  ? 0.8228 0.6671 0.6894 0.0041  -0.0585 -0.0455 351 LEU B CG  
3110 C CD1 . LEU B 91  ? 0.8174 0.6529 0.6884 0.0082  -0.0641 -0.0542 351 LEU B CD1 
3111 C CD2 . LEU B 91  ? 0.7906 0.6430 0.6488 0.0071  -0.0512 -0.0422 351 LEU B CD2 
3112 N N   . TYR B 92  ? 0.8302 0.6604 0.7034 -0.0004 -0.0744 -0.0490 352 TYR B N   
3113 C CA  . TYR B 92  ? 0.8502 0.6676 0.7092 -0.0007 -0.0813 -0.0472 352 TYR B CA  
3114 C C   . TYR B 92  ? 0.9267 0.7365 0.7718 0.0032  -0.0857 -0.0485 352 TYR B C   
3115 O O   . TYR B 92  ? 0.8848 0.6972 0.7351 0.0074  -0.0873 -0.0550 352 TYR B O   
3116 C CB  . TYR B 92  ? 0.8147 0.6268 0.6801 0.0031  -0.0889 -0.0524 352 TYR B CB  
3117 C CG  . TYR B 92  ? 0.8818 0.7002 0.7585 0.0024  -0.0863 -0.0539 352 TYR B CG  
3118 C CD1 . TYR B 92  ? 0.9043 0.7123 0.7730 0.0011  -0.0900 -0.0526 352 TYR B CD1 
3119 C CD2 . TYR B 92  ? 0.8518 0.6844 0.7452 0.0037  -0.0809 -0.0571 352 TYR B CD2 
3120 C CE1 . TYR B 92  ? 0.8914 0.7042 0.7668 0.0025  -0.0884 -0.0560 352 TYR B CE1 
3121 C CE2 . TYR B 92  ? 0.8342 0.6734 0.7342 0.0046  -0.0779 -0.0585 352 TYR B CE2 
3122 C CZ  . TYR B 92  ? 0.8730 0.7028 0.7632 0.0048  -0.0818 -0.0588 352 TYR B CZ  
3123 O OH  . TYR B 92  ? 0.8962 0.7322 0.7900 0.0073  -0.0792 -0.0618 352 TYR B OH  
3124 N N   . VAL B 93  ? 0.9437 0.7428 0.7700 0.0016  -0.0883 -0.0423 353 VAL B N   
3125 C CA  . VAL B 93  ? 0.9391 0.7282 0.7472 0.0066  -0.0944 -0.0431 353 VAL B CA  
3126 C C   . VAL B 93  ? 0.9341 0.7054 0.7281 0.0070  -0.1036 -0.0386 353 VAL B C   
3127 O O   . VAL B 93  ? 0.8829 0.6476 0.6749 0.0007  -0.1024 -0.0318 353 VAL B O   
3128 C CB  . VAL B 93  ? 0.9592 0.7531 0.7511 0.0058  -0.0861 -0.0377 353 VAL B CB  
3129 C CG1 . VAL B 93  ? 0.9719 0.7799 0.7763 0.0078  -0.0784 -0.0428 353 VAL B CG1 
3130 C CG2 . VAL B 93  ? 0.9463 0.7411 0.7302 -0.0029 -0.0795 -0.0254 353 VAL B CG2 
3131 N N   . LYS B 94  ? 0.9668 0.7284 0.7506 0.0147  -0.1142 -0.0427 354 LYS B N   
3132 C CA  . LYS B 94  ? 1.0413 0.7825 0.8063 0.0170  -0.1239 -0.0369 354 LYS B CA  
3133 C C   . LYS B 94  ? 1.1113 0.8447 0.8572 0.0079  -0.1165 -0.0229 354 LYS B C   
3134 O O   . LYS B 94  ? 1.1267 0.8709 0.8649 0.0048  -0.1066 -0.0188 354 LYS B O   
3135 C CB  . LYS B 94  ? 1.0671 0.8007 0.8153 0.0263  -0.1347 -0.0404 354 LYS B CB  
3136 C CG  . LYS B 94  ? 1.0663 0.8066 0.8326 0.0350  -0.1459 -0.0534 354 LYS B CG  
3137 C CD  . LYS B 94  ? 1.0632 0.7907 0.8084 0.0445  -0.1606 -0.0545 354 LYS B CD  
3138 C CE  . LYS B 94  ? 1.0946 0.8335 0.8597 0.0524  -0.1729 -0.0681 354 LYS B CE  
3139 N NZ  . LYS B 94  ? 1.1644 0.8950 0.9068 0.0610  -0.1868 -0.0710 354 LYS B NZ  
3140 N N   . GLN B 95  ? 1.1081 0.8229 0.8466 0.0039  -0.1214 -0.0155 355 GLN B N   
3141 C CA  . GLN B 95  ? 1.1685 0.8760 0.8921 -0.0079 -0.1147 -0.0007 355 GLN B CA  
3142 C C   . GLN B 95  ? 1.1898 0.8986 0.8886 -0.0076 -0.1096 0.0078  355 GLN B C   
3143 O O   . GLN B 95  ? 1.1628 0.8847 0.8585 -0.0164 -0.0970 0.0167  355 GLN B O   
3144 C CB  . GLN B 95  ? 1.2628 0.9417 0.9772 -0.0115 -0.1243 0.0060  355 GLN B CB  
3145 C CG  . GLN B 95  ? 1.3864 1.0604 1.0959 -0.0282 -0.1172 0.0201  355 GLN B CG  
3146 C CD  . GLN B 95  ? 1.5284 1.1690 1.2294 -0.0326 -0.1284 0.0255  355 GLN B CD  
3147 O OE1 . GLN B 95  ? 1.5683 1.2016 1.2825 -0.0284 -0.1356 0.0154  355 GLN B OE1 
3148 N NE2 . GLN B 95  ? 1.5761 1.1950 1.2537 -0.0411 -0.1298 0.0419  355 GLN B NE2 
3149 N N   . GLU B 96  ? 1.2174 0.9157 0.8987 0.0035  -0.1192 0.0046  356 GLU B N   
3150 C CA  . GLU B 96  ? 1.2757 0.9736 0.9279 0.0057  -0.1151 0.0121  356 GLU B CA  
3151 C C   . GLU B 96  ? 1.2817 1.0057 0.9374 0.0064  -0.1014 0.0078  356 GLU B C   
3152 O O   . GLU B 96  ? 1.3124 1.0405 0.9446 0.0061  -0.0931 0.0162  356 GLU B O   
3153 C CB  . GLU B 96  ? 1.3071 0.9896 0.9391 0.0192  -0.1304 0.0072  356 GLU B CB  
3154 C CG  . GLU B 96  ? 1.3222 1.0170 0.9718 0.0303  -0.1384 -0.0117 356 GLU B CG  
3155 C CD  . GLU B 96  ? 1.3774 1.0579 1.0099 0.0430  -0.1564 -0.0164 356 GLU B CD  
3156 O OE1 . GLU B 96  ? 1.4663 1.1405 1.0670 0.0479  -0.1581 -0.0120 356 GLU B OE1 
3157 O OE2 . GLU B 96  ? 1.3532 1.0303 1.0035 0.0491  -0.1690 -0.0245 356 GLU B OE2 
3158 N N   . HIS B 97  ? 1.2134 0.9540 0.8966 0.0083  -0.0988 -0.0049 357 HIS B N   
3159 C CA  . HIS B 97  ? 1.1107 0.8729 0.7993 0.0107  -0.0873 -0.0104 357 HIS B CA  
3160 C C   . HIS B 97  ? 1.0542 0.8348 0.7590 0.0006  -0.0729 -0.0033 357 HIS B C   
3161 O O   . HIS B 97  ? 1.0268 0.8257 0.7345 0.0035  -0.0624 -0.0058 357 HIS B O   
3162 C CB  . HIS B 97  ? 1.0622 0.8301 0.7715 0.0179  -0.0931 -0.0270 357 HIS B CB  
3163 C CG  . HIS B 97  ? 1.1379 0.8930 0.8393 0.0271  -0.1087 -0.0363 357 HIS B CG  
3164 N ND1 . HIS B 97  ? 1.2030 0.9486 0.8737 0.0345  -0.1143 -0.0357 357 HIS B ND1 
3165 C CD2 . HIS B 97  ? 1.1505 0.9037 0.8717 0.0305  -0.1201 -0.0467 357 HIS B CD2 
3166 C CE1 . HIS B 97  ? 1.2092 0.9468 0.8818 0.0419  -0.1303 -0.0458 357 HIS B CE1 
3167 N NE2 . HIS B 97  ? 1.1941 0.9377 0.8990 0.0393  -0.1336 -0.0525 357 HIS B NE2 
3168 N N   . ALA B 98  ? 1.0327 0.8081 0.7483 -0.0102 -0.0738 0.0045  358 ALA B N   
3169 C CA  . ALA B 98  ? 1.0183 0.8123 0.7529 -0.0205 -0.0631 0.0100  358 ALA B CA  
3170 C C   . ALA B 98  ? 1.1128 0.9249 0.8372 -0.0253 -0.0489 0.0215  358 ALA B C   
3171 O O   . ALA B 98  ? 1.1473 0.9840 0.8877 -0.0268 -0.0386 0.0210  358 ALA B O   
3172 C CB  . ALA B 98  ? 0.8929 0.6741 0.6373 -0.0315 -0.0692 0.0152  358 ALA B CB  
3173 N N   . ALA B 99  ? 1.1288 0.9305 0.8265 -0.0271 -0.0481 0.0322  359 ALA B N   
3174 C CA  . ALA B 99  ? 1.1618 0.9838 0.8486 -0.0317 -0.0327 0.0446  359 ALA B CA  
3175 C C   . ALA B 99  ? 1.1970 1.0417 0.8810 -0.0178 -0.0228 0.0351  359 ALA B C   
3176 O O   . ALA B 99  ? 1.1980 1.0680 0.8807 -0.0195 -0.0077 0.0427  359 ALA B O   
3177 C CB  . ALA B 99  ? 1.1690 0.9725 0.8232 -0.0352 -0.0339 0.0588  359 ALA B CB  
3178 N N   . TYR B 100 ? 1.2000 1.0356 0.8837 -0.0042 -0.0314 0.0184  360 TYR B N   
3179 C CA  . TYR B 100 ? 1.2194 1.0675 0.8959 0.0104  -0.0255 0.0072  360 TYR B CA  
3180 C C   . TYR B 100 ? 1.2019 1.0609 0.9071 0.0148  -0.0250 -0.0050 360 TYR B C   
3181 O O   . TYR B 100 ? 1.1968 1.0602 0.8987 0.0275  -0.0229 -0.0165 360 TYR B O   
3182 C CB  . TYR B 100 ? 1.2592 1.0859 0.9089 0.0223  -0.0371 -0.0022 360 TYR B CB  
3183 C CG  . TYR B 100 ? 1.3179 1.1302 0.9361 0.0192  -0.0395 0.0109  360 TYR B CG  
3184 C CD1 . TYR B 100 ? 1.3449 1.1699 0.9378 0.0200  -0.0257 0.0223  360 TYR B CD1 
3185 C CD2 . TYR B 100 ? 1.3090 1.0954 0.9223 0.0161  -0.0552 0.0129  360 TYR B CD2 
3186 C CE1 . TYR B 100 ? 1.3745 1.1846 0.9360 0.0164  -0.0274 0.0368  360 TYR B CE1 
3187 C CE2 . TYR B 100 ? 1.3606 1.1304 0.9435 0.0140  -0.0585 0.0262  360 TYR B CE2 
3188 C CZ  . TYR B 100 ? 1.3911 1.1716 0.9469 0.0135  -0.0446 0.0389  360 TYR B CZ  
3189 O OH  . TYR B 100 ? 1.3987 1.1608 0.9216 0.0109  -0.0475 0.0543  360 TYR B OH  
3190 N N   . ILE B 101 ? 1.1491 1.0104 0.8803 0.0045  -0.0273 -0.0021 361 ILE B N   
3191 C CA  . ILE B 101 ? 1.0738 0.9476 0.8313 0.0067  -0.0251 -0.0092 361 ILE B CA  
3192 C C   . ILE B 101 ? 1.0413 0.9445 0.8109 0.0019  -0.0114 0.0001  361 ILE B C   
3193 O O   . ILE B 101 ? 1.0389 0.9487 0.8115 -0.0114 -0.0084 0.0128  361 ILE B O   
3194 C CB  . ILE B 101 ? 1.0010 0.8635 0.7779 -0.0010 -0.0349 -0.0110 361 ILE B CB  
3195 C CG1 . ILE B 101 ? 1.0053 0.8449 0.7765 0.0046  -0.0480 -0.0210 361 ILE B CG1 
3196 C CG2 . ILE B 101 ? 0.9066 0.7842 0.7083 -0.0004 -0.0311 -0.0145 361 ILE B CG2 
3197 C CD1 . ILE B 101 ? 0.9857 0.8241 0.7617 0.0154  -0.0502 -0.0343 361 ILE B CD1 
3198 N N   . SER B 102 ? 0.9929 0.9135 0.7702 0.0127  -0.0039 -0.0062 362 SER B N   
3199 C CA  . SER B 102 ? 0.9550 0.9084 0.7485 0.0108  0.0085  0.0011  362 SER B CA  
3200 C C   . SER B 102 ? 0.9907 0.9529 0.8016 0.0224  0.0094  -0.0084 362 SER B C   
3201 O O   . SER B 102 ? 1.0185 0.9598 0.8273 0.0304  0.0013  -0.0198 362 SER B O   
3202 C CB  . SER B 102 ? 0.9729 0.9458 0.7492 0.0154  0.0219  0.0074  362 SER B CB  
3203 O OG  . SER B 102 ? 0.9775 0.9449 0.7360 0.0343  0.0237  -0.0050 362 SER B OG  
3204 N N   . GLU B 103 ? 0.9774 0.9707 0.8065 0.0225  0.0184  -0.0029 363 GLU B N   
3205 C CA  . GLU B 103 ? 0.9829 0.9862 0.8284 0.0345  0.0193  -0.0098 363 GLU B CA  
3206 C C   . GLU B 103 ? 0.9433 0.9245 0.7995 0.0322  0.0075  -0.0153 363 GLU B C   
3207 O O   . GLU B 103 ? 0.9061 0.8768 0.7639 0.0443  0.0050  -0.0241 363 GLU B O   
3208 C CB  . GLU B 103 ? 1.0659 1.0664 0.8961 0.0550  0.0243  -0.0207 363 GLU B CB  
3209 C CG  . GLU B 103 ? 1.1392 1.1673 0.9587 0.0621  0.0387  -0.0166 363 GLU B CG  
3210 C CD  . GLU B 103 ? 1.2027 1.2298 1.0092 0.0862  0.0434  -0.0298 363 GLU B CD  
3211 O OE1 . GLU B 103 ? 1.2365 1.2954 1.0424 0.0963  0.0572  -0.0274 363 GLU B OE1 
3212 O OE2 . GLU B 103 ? 1.1903 1.1855 0.9880 0.0950  0.0333  -0.0426 363 GLU B OE2 
3213 N N   . VAL B 104 ? 0.9277 0.9015 0.7905 0.0171  0.0007  -0.0099 364 VAL B N   
3214 C CA  . VAL B 104 ? 0.9302 0.8867 0.8022 0.0151  -0.0087 -0.0143 364 VAL B CA  
3215 C C   . VAL B 104 ? 0.8899 0.8640 0.7812 0.0185  -0.0076 -0.0127 364 VAL B C   
3216 O O   . VAL B 104 ? 0.8742 0.8739 0.7777 0.0135  -0.0039 -0.0056 364 VAL B O   
3217 C CB  . VAL B 104 ? 0.9317 0.8742 0.8027 0.0006  -0.0166 -0.0108 364 VAL B CB  
3218 C CG1 . VAL B 104 ? 0.9322 0.8591 0.8104 0.0009  -0.0244 -0.0162 364 VAL B CG1 
3219 C CG2 . VAL B 104 ? 0.9304 0.8553 0.7814 -0.0012 -0.0189 -0.0113 364 VAL B CG2 
3220 N N   . GLU B 105 ? 0.8744 0.8348 0.7686 0.0270  -0.0113 -0.0187 365 GLU B N   
3221 C CA  . GLU B 105 ? 0.9107 0.8835 0.8194 0.0323  -0.0113 -0.0166 365 GLU B CA  
3222 C C   . GLU B 105 ? 0.8976 0.8479 0.8074 0.0328  -0.0179 -0.0196 365 GLU B C   
3223 O O   . GLU B 105 ? 0.9089 0.8359 0.8106 0.0355  -0.0204 -0.0258 365 GLU B O   
3224 C CB  . GLU B 105 ? 0.9834 0.9682 0.8935 0.0491  -0.0049 -0.0193 365 GLU B CB  
3225 C CG  . GLU B 105 ? 1.0478 1.0625 0.9592 0.0518  0.0045  -0.0159 365 GLU B CG  
3226 C CD  . GLU B 105 ? 1.0874 1.1346 1.0167 0.0406  0.0061  -0.0061 365 GLU B CD  
3227 O OE1 . GLU B 105 ? 1.0424 1.0918 0.9832 0.0348  -0.0006 -0.0031 365 GLU B OE1 
3228 O OE2 . GLU B 105 ? 1.1589 1.2303 1.0901 0.0372  0.0140  -0.0012 365 GLU B OE2 
3229 N N   . ALA B 106 ? 0.8481 0.8067 0.7678 0.0298  -0.0207 -0.0150 366 ALA B N   
3230 C CA  . ALA B 106 ? 0.8351 0.7765 0.7552 0.0295  -0.0251 -0.0155 366 ALA B CA  
3231 C C   . ALA B 106 ? 0.9048 0.8560 0.8321 0.0382  -0.0251 -0.0111 366 ALA B C   
3232 O O   . ALA B 106 ? 0.9568 0.9320 0.8921 0.0380  -0.0252 -0.0067 366 ALA B O   
3233 C CB  . ALA B 106 ? 0.7720 0.7105 0.6916 0.0171  -0.0298 -0.0142 366 ALA B CB  
3234 N N   . GLU B 107 ? 0.9215 0.8542 0.8465 0.0455  -0.0258 -0.0116 367 GLU B N   
3235 C CA  . GLU B 107 ? 0.9428 0.8797 0.8717 0.0533  -0.0273 -0.0056 367 GLU B CA  
3236 C C   . GLU B 107 ? 0.9307 0.8475 0.8555 0.0496  -0.0294 -0.0023 367 GLU B C   
3237 O O   . GLU B 107 ? 0.9220 0.8225 0.8439 0.0420  -0.0292 -0.0058 367 GLU B O   
3238 C CB  . GLU B 107 ? 0.9631 0.9000 0.8933 0.0698  -0.0251 -0.0068 367 GLU B CB  
3239 C CG  . GLU B 107 ? 1.0034 0.9749 0.9433 0.0764  -0.0230 -0.0049 367 GLU B CG  
3240 C CD  . GLU B 107 ? 1.3305 1.3223 1.2788 0.0772  -0.0277 0.0028  367 GLU B CD  
3241 O OE1 . GLU B 107 ? 1.3149 1.2975 1.2589 0.0693  -0.0322 0.0066  367 GLU B OE1 
3242 O OE2 . GLU B 107 ? 1.3227 1.3421 1.2820 0.0866  -0.0271 0.0046  367 GLU B OE2 
3243 N N   . THR B 108 ? 0.8829 0.8038 0.8079 0.0549  -0.0313 0.0050  368 THR B N   
3244 C CA  . THR B 108 ? 0.8602 0.7637 0.7798 0.0529  -0.0316 0.0108  368 THR B CA  
3245 C C   . THR B 108 ? 0.8843 0.7784 0.8017 0.0661  -0.0327 0.0178  368 THR B C   
3246 O O   . THR B 108 ? 0.8925 0.8029 0.8132 0.0767  -0.0349 0.0196  368 THR B O   
3247 C CB  . THR B 108 ? 0.7251 0.6407 0.6410 0.0451  -0.0335 0.0143  368 THR B CB  
3248 O OG1 . THR B 108 ? 0.7744 0.7110 0.6915 0.0506  -0.0377 0.0180  368 THR B OG1 
3249 C CG2 . THR B 108 ? 0.6434 0.5646 0.5603 0.0340  -0.0337 0.0073  368 THR B CG2 
3250 N N   . VAL B 109 ? 0.8526 0.7202 0.7656 0.0652  -0.0314 0.0220  369 VAL B N   
3251 C CA  . VAL B 109 ? 0.8632 0.7145 0.7712 0.0759  -0.0330 0.0310  369 VAL B CA  
3252 C C   . VAL B 109 ? 0.8495 0.6870 0.7505 0.0677  -0.0308 0.0416  369 VAL B C   
3253 O O   . VAL B 109 ? 0.8632 0.6862 0.7666 0.0567  -0.0276 0.0405  369 VAL B O   
3254 C CB  . VAL B 109 ? 0.8755 0.7003 0.7841 0.0837  -0.0336 0.0261  369 VAL B CB  
3255 C CG1 . VAL B 109 ? 0.8614 0.6590 0.7631 0.0919  -0.0359 0.0368  369 VAL B CG1 
3256 C CG2 . VAL B 109 ? 0.8196 0.6607 0.7326 0.0959  -0.0342 0.0166  369 VAL B CG2 
3257 N N   . GLY B 110 ? 0.8299 0.6749 0.7226 0.0730  -0.0326 0.0520  370 GLY B N   
3258 C CA  . GLY B 110 ? 0.8541 0.6867 0.7367 0.0675  -0.0293 0.0644  370 GLY B CA  
3259 C C   . GLY B 110 ? 0.9144 0.7154 0.7915 0.0739  -0.0299 0.0753  370 GLY B C   
3260 O O   . GLY B 110 ? 0.9213 0.7155 0.7970 0.0887  -0.0352 0.0765  370 GLY B O   
3261 N N   . THR B 111 ? 0.9506 0.7323 0.8255 0.0628  -0.0244 0.0837  371 THR B N   
3262 C CA  . THR B 111 ? 0.9994 0.7454 0.8703 0.0649  -0.0250 0.0946  371 THR B CA  
3263 C C   . THR B 111 ? 1.0318 0.7685 0.8926 0.0557  -0.0185 0.1126  371 THR B C   
3264 O O   . THR B 111 ? 1.1198 0.8251 0.9800 0.0504  -0.0170 0.1230  371 THR B O   
3265 C CB  . THR B 111 ? 1.0329 0.7568 0.9170 0.0565  -0.0252 0.0850  371 THR B CB  
3266 O OG1 . THR B 111 ? 1.0562 0.7914 0.9495 0.0387  -0.0188 0.0824  371 THR B OG1 
3267 C CG2 . THR B 111 ? 0.9653 0.6955 0.8562 0.0664  -0.0304 0.0675  371 THR B CG2 
3268 N N   . GLY B 112 ? 0.9793 0.7422 0.8312 0.0534  -0.0145 0.1165  372 GLY B N   
3269 C CA  . GLY B 112 ? 0.9835 0.7436 0.8250 0.0440  -0.0056 0.1325  372 GLY B CA  
3270 C C   . GLY B 112 ? 1.0345 0.7825 0.8538 0.0550  -0.0079 0.1509  372 GLY B C   
3271 O O   . GLY B 112 ? 1.0766 0.7937 0.8927 0.0613  -0.0123 0.1598  372 GLY B O   
3272 N N   . ILE B 113 ? 1.0275 0.7983 0.8297 0.0586  -0.0061 0.1559  373 ILE B N   
3273 C CA  . ILE B 113 ? 1.0981 0.8625 0.8752 0.0707  -0.0096 0.1729  373 ILE B CA  
3274 C C   . ILE B 113 ? 1.1240 0.8777 0.9008 0.0889  -0.0228 0.1714  373 ILE B C   
3275 O O   . ILE B 113 ? 1.0933 0.8655 0.8832 0.0955  -0.0299 0.1549  373 ILE B O   
3276 C CB  . ILE B 113 ? 1.1149 0.9117 0.8742 0.0742  -0.0094 0.1709  373 ILE B CB  
3277 C CG1 . ILE B 113 ? 1.0600 0.8661 0.8136 0.0602  0.0053  0.1764  373 ILE B CG1 
3278 C CG2 . ILE B 113 ? 1.1290 0.9235 0.8626 0.0906  -0.0179 0.1842  373 ILE B CG2 
3279 C CD1 . ILE B 113 ? 0.9867 0.8254 0.7301 0.0617  0.0057  0.1650  373 ILE B CD1 
3280 N N   . MET B 114 ? 1.1959 0.9200 0.9578 0.0974  -0.0257 0.1896  374 MET B N   
3281 C CA  . MET B 114 ? 1.1875 0.8971 0.9493 0.1171  -0.0381 0.1894  374 MET B CA  
3282 C C   . MET B 114 ? 1.1629 0.8685 0.9500 0.1184  -0.0414 0.1704  374 MET B C   
3283 O O   . MET B 114 ? 1.1068 0.8204 0.9003 0.1351  -0.0505 0.1615  374 MET B O   
3284 C CB  . MET B 114 ? 1.1370 0.8762 0.8868 0.1337  -0.0482 0.1885  374 MET B CB  
3285 C CG  . MET B 114 ? 1.1955 0.9302 0.9139 0.1380  -0.0481 0.2096  374 MET B CG  
3286 S SD  . MET B 114 ? 1.5001 1.1816 1.1978 0.1464  -0.0497 0.2372  374 MET B SD  
3287 C CE  . MET B 114 ? 2.0645 1.7288 1.7608 0.1187  -0.0304 0.2490  374 MET B CE  
3288 N N   . GLY B 115 ? 1.1712 0.8658 0.9721 0.1009  -0.0335 0.1644  375 GLY B N   
3289 C CA  . GLY B 115 ? 1.1366 0.8258 0.9577 0.1002  -0.0357 0.1464  375 GLY B CA  
3290 C C   . GLY B 115 ? 1.1331 0.8595 0.9656 0.1072  -0.0395 0.1280  375 GLY B C   
3291 O O   . GLY B 115 ? 1.1768 0.8995 1.0200 0.1163  -0.0439 0.1158  375 GLY B O   
3292 N N   . ARG B 116 ? 1.1049 0.8662 0.9345 0.1032  -0.0379 0.1256  376 ARG B N   
3293 C CA  . ARG B 116 ? 1.0696 0.8655 0.9114 0.1067  -0.0417 0.1090  376 ARG B CA  
3294 C C   . ARG B 116 ? 0.9931 0.8200 0.8346 0.0957  -0.0390 0.1028  376 ARG B C   
3295 O O   . ARG B 116 ? 0.9146 0.7650 0.7683 0.0939  -0.0410 0.0890  376 ARG B O   
3296 C CB  . ARG B 116 ? 1.0769 0.8854 0.9187 0.1272  -0.0515 0.1090  376 ARG B CB  
3297 C CG  . ARG B 116 ? 1.1217 0.9344 0.9454 0.1371  -0.0573 0.1234  376 ARG B CG  
3298 C CD  . ARG B 116 ? 1.1551 0.9736 0.9817 0.1601  -0.0680 0.1244  376 ARG B CD  
3299 N NE  . ARG B 116 ? 1.1403 1.0002 0.9849 0.1639  -0.0725 0.1102  376 ARG B NE  
3300 C CZ  . ARG B 116 ? 1.1342 1.0191 0.9837 0.1806  -0.0825 0.1104  376 ARG B CZ  
3301 N NH1 . ARG B 116 ? 1.1476 1.0197 0.9834 0.1976  -0.0903 0.1236  376 ARG B NH1 
3302 N NH2 . ARG B 116 ? 1.0798 1.0041 0.9489 0.1798  -0.0851 0.0980  376 ARG B NH2 
3303 N N   . MET B 117 ? 0.9976 0.8241 0.8248 0.0882  -0.0340 0.1125  377 MET B N   
3304 C CA  . MET B 117 ? 0.9816 0.8341 0.8073 0.0793  -0.0318 0.1044  377 MET B CA  
3305 C C   . MET B 117 ? 0.9111 0.7614 0.7501 0.0642  -0.0236 0.0952  377 MET B C   
3306 O O   . MET B 117 ? 0.8530 0.6816 0.6984 0.0576  -0.0180 0.0992  377 MET B O   
3307 C CB  . MET B 117 ? 1.0346 0.8920 0.8367 0.0804  -0.0300 0.1164  377 MET B CB  
3308 C CG  . MET B 117 ? 1.0554 0.9240 0.8440 0.0956  -0.0413 0.1217  377 MET B CG  
3309 S SD  . MET B 117 ? 1.1500 1.0240 0.9048 0.0987  -0.0404 0.1352  377 MET B SD  
3310 C CE  . MET B 117 ? 1.1209 1.0274 0.8751 0.1084  -0.0571 0.1232  377 MET B CE  
3311 N N   . GLY B 118 ? 0.9149 0.7874 0.7580 0.0588  -0.0245 0.0828  378 GLY B N   
3312 C CA  . GLY B 118 ? 0.9104 0.7839 0.7672 0.0472  -0.0195 0.0718  378 GLY B CA  
3313 C C   . GLY B 118 ? 0.9038 0.7748 0.7592 0.0367  -0.0096 0.0753  378 GLY B C   
3314 O O   . GLY B 118 ? 0.8749 0.7524 0.7410 0.0290  -0.0072 0.0648  378 GLY B O   
3315 N N   . ASN B 119 ? 0.9138 0.7766 0.7566 0.0368  -0.0036 0.0905  379 ASN B N   
3316 C CA  . ASN B 119 ? 0.9303 0.7937 0.7752 0.0263  0.0079  0.0957  379 ASN B CA  
3317 C C   . ASN B 119 ? 0.9341 0.7808 0.8003 0.0161  0.0111  0.0948  379 ASN B C   
3318 O O   . ASN B 119 ? 0.8915 0.7438 0.7684 0.0055  0.0192  0.0947  379 ASN B O   
3319 C CB  . ASN B 119 ? 0.9824 0.8420 0.8070 0.0282  0.0147  0.1144  379 ASN B CB  
3320 C CG  . ASN B 119 ? 1.0593 0.8926 0.8790 0.0328  0.0117  0.1293  379 ASN B CG  
3321 O OD1 . ASN B 119 ? 1.0874 0.9141 0.9071 0.0429  0.0014  0.1257  379 ASN B OD1 
3322 N ND2 . ASN B 119 ? 1.1060 0.9245 0.9217 0.0256  0.0209  0.1466  379 ASN B ND2 
3323 N N   . LYS B 120 ? 0.9572 0.7841 0.8292 0.0203  0.0041  0.0940  380 LYS B N   
3324 C CA  . LYS B 120 ? 0.9557 0.7654 0.8462 0.0132  0.0028  0.0879  380 LYS B CA  
3325 C C   . LYS B 120 ? 0.9536 0.7573 0.8460 0.0237  -0.0069 0.0774  380 LYS B C   
3326 O O   . LYS B 120 ? 0.8817 0.6934 0.7638 0.0354  -0.0117 0.0782  380 LYS B O   
3327 C CB  . LYS B 120 ? 0.9816 0.7638 0.8741 0.0063  0.0065  0.1029  380 LYS B CB  
3328 C CG  . LYS B 120 ? 1.0070 0.7941 0.9132 -0.0106 0.0162  0.1078  380 LYS B CG  
3329 C CD  . LYS B 120 ? 1.0904 0.8911 0.9829 -0.0129 0.0273  0.1239  380 LYS B CD  
3330 C CE  . LYS B 120 ? 1.1069 0.9349 1.0122 -0.0237 0.0375  0.1204  380 LYS B CE  
3331 N NZ  . LYS B 120 ? 1.1291 0.9767 1.0147 -0.0204 0.0480  0.1318  380 LYS B NZ  
3332 N N   . GLY B 121 ? 0.9815 0.7732 0.8875 0.0196  -0.0097 0.0674  381 GLY B N   
3333 C CA  . GLY B 121 ? 0.9549 0.7443 0.8629 0.0293  -0.0169 0.0556  381 GLY B CA  
3334 C C   . GLY B 121 ? 0.9413 0.7372 0.8609 0.0225  -0.0182 0.0407  381 GLY B C   
3335 O O   . GLY B 121 ? 0.9446 0.7385 0.8739 0.0105  -0.0154 0.0394  381 GLY B O   
3336 N N   . GLY B 122 ? 0.9200 0.7252 0.8389 0.0303  -0.0224 0.0302  382 GLY B N   
3337 C CA  . GLY B 122 ? 0.8799 0.6909 0.8056 0.0258  -0.0244 0.0168  382 GLY B CA  
3338 C C   . GLY B 122 ? 0.8769 0.7099 0.7993 0.0309  -0.0259 0.0104  382 GLY B C   
3339 O O   . GLY B 122 ? 0.9119 0.7545 0.8298 0.0401  -0.0269 0.0138  382 GLY B O   
3340 N N   . VAL B 123 ? 0.8765 0.7184 0.8023 0.0244  -0.0266 0.0020  383 VAL B N   
3341 C CA  . VAL B 123 ? 0.8599 0.7188 0.7832 0.0267  -0.0282 -0.0039 383 VAL B CA  
3342 C C   . VAL B 123 ? 0.8182 0.6681 0.7422 0.0269  -0.0304 -0.0136 383 VAL B C   
3343 O O   . VAL B 123 ? 0.7970 0.6307 0.7246 0.0229  -0.0319 -0.0169 383 VAL B O   
3344 C CB  . VAL B 123 ? 0.6916 0.5659 0.6141 0.0193  -0.0282 -0.0047 383 VAL B CB  
3345 C CG1 . VAL B 123 ? 0.6713 0.5535 0.5896 0.0199  -0.0267 0.0034  383 VAL B CG1 
3346 C CG2 . VAL B 123 ? 0.7215 0.5897 0.6489 0.0115  -0.0283 -0.0098 383 VAL B CG2 
3347 N N   . ALA B 124 ? 0.8093 0.6704 0.7296 0.0309  -0.0307 -0.0179 384 ALA B N   
3348 C CA  . ALA B 124 ? 0.8737 0.7271 0.7901 0.0322  -0.0325 -0.0268 384 ALA B CA  
3349 C C   . ALA B 124 ? 0.8851 0.7557 0.7968 0.0319  -0.0314 -0.0288 384 ALA B C   
3350 O O   . ALA B 124 ? 0.8666 0.7556 0.7800 0.0342  -0.0289 -0.0240 384 ALA B O   
3351 C CB  . ALA B 124 ? 0.8800 0.7174 0.7932 0.0426  -0.0331 -0.0304 384 ALA B CB  
3352 N N   . ILE B 125 ? 0.8595 0.7247 0.7658 0.0284  -0.0338 -0.0350 385 ILE B N   
3353 C CA  . ILE B 125 ? 0.8333 0.7110 0.7325 0.0271  -0.0323 -0.0353 385 ILE B CA  
3354 C C   . ILE B 125 ? 0.9085 0.7773 0.7970 0.0344  -0.0325 -0.0426 385 ILE B C   
3355 O O   . ILE B 125 ? 0.9287 0.7800 0.8140 0.0336  -0.0377 -0.0494 385 ILE B O   
3356 C CB  . ILE B 125 ? 0.7576 0.6349 0.6552 0.0170  -0.0361 -0.0351 385 ILE B CB  
3357 C CG1 . ILE B 125 ? 0.7118 0.5954 0.6171 0.0110  -0.0368 -0.0303 385 ILE B CG1 
3358 C CG2 . ILE B 125 ? 0.7744 0.6617 0.6637 0.0145  -0.0344 -0.0329 385 ILE B CG2 
3359 C CD1 . ILE B 125 ? 0.6825 0.5598 0.5868 0.0043  -0.0414 -0.0327 385 ILE B CD1 
3360 N N   . ARG B 126 ? 0.9344 0.8167 0.8174 0.0417  -0.0269 -0.0418 386 ARG B N   
3361 C CA  . ARG B 126 ? 0.9503 0.8265 0.8184 0.0498  -0.0260 -0.0492 386 ARG B CA  
3362 C C   . ARG B 126 ? 0.9811 0.8736 0.8405 0.0456  -0.0216 -0.0448 386 ARG B C   
3363 O O   . ARG B 126 ? 0.9981 0.9086 0.8656 0.0377  -0.0186 -0.0361 386 ARG B O   
3364 C CB  . ARG B 126 ? 0.9279 0.8042 0.7941 0.0653  -0.0221 -0.0533 386 ARG B CB  
3365 C CG  . ARG B 126 ? 0.9358 0.8409 0.8094 0.0711  -0.0137 -0.0465 386 ARG B CG  
3366 C CD  . ARG B 126 ? 0.9801 0.9062 0.8441 0.0731  -0.0060 -0.0453 386 ARG B CD  
3367 N NE  . ARG B 126 ? 1.0216 0.9381 0.8682 0.0879  -0.0040 -0.0556 386 ARG B NE  
3368 C CZ  . ARG B 126 ? 0.9951 0.9215 0.8254 0.0910  0.0019  -0.0570 386 ARG B CZ  
3369 N NH1 . ARG B 126 ? 0.9410 0.8861 0.7714 0.0788  0.0065  -0.0471 386 ARG B NH1 
3370 N NH2 . ARG B 126 ? 1.0219 0.9376 0.8338 0.1066  0.0030  -0.0682 386 ARG B NH2 
3371 N N   . PHE B 127 ? 0.9766 0.8615 0.8182 0.0504  -0.0220 -0.0507 387 PHE B N   
3372 C CA  . PHE B 127 ? 0.9826 0.8790 0.8119 0.0458  -0.0179 -0.0451 387 PHE B CA  
3373 C C   . PHE B 127 ? 1.0114 0.8977 0.8167 0.0554  -0.0182 -0.0531 387 PHE B C   
3374 O O   . PHE B 127 ? 0.9723 0.8389 0.7716 0.0632  -0.0247 -0.0645 387 PHE B O   
3375 C CB  . PHE B 127 ? 0.9313 0.8210 0.7631 0.0313  -0.0242 -0.0395 387 PHE B CB  
3376 C CG  . PHE B 127 ? 0.9125 0.7785 0.7410 0.0302  -0.0352 -0.0473 387 PHE B CG  
3377 C CD1 . PHE B 127 ? 0.9210 0.7757 0.7322 0.0294  -0.0407 -0.0493 387 PHE B CD1 
3378 C CD2 . PHE B 127 ? 0.8879 0.7447 0.7313 0.0298  -0.0400 -0.0518 387 PHE B CD2 
3379 C CE1 . PHE B 127 ? 0.9252 0.7622 0.7368 0.0288  -0.0520 -0.0569 387 PHE B CE1 
3380 C CE2 . PHE B 127 ? 0.8852 0.7253 0.7300 0.0276  -0.0496 -0.0585 387 PHE B CE2 
3381 C CZ  . PHE B 127 ? 0.9193 0.7508 0.7498 0.0274  -0.0560 -0.0616 387 PHE B CZ  
3382 N N   . GLN B 128 ? 1.0468 0.9464 0.8377 0.0543  -0.0113 -0.0469 388 GLN B N   
3383 C CA  . GLN B 128 ? 1.1450 1.0357 0.9085 0.0632  -0.0116 -0.0533 388 GLN B CA  
3384 C C   . GLN B 128 ? 1.1537 1.0321 0.9047 0.0528  -0.0187 -0.0483 388 GLN B C   
3385 O O   . GLN B 128 ? 1.1593 1.0468 0.9159 0.0406  -0.0159 -0.0358 388 GLN B O   
3386 C CB  . GLN B 128 ? 1.2225 1.1387 0.9751 0.0719  0.0032  -0.0492 388 GLN B CB  
3387 C CG  . GLN B 128 ? 1.2786 1.1862 0.9999 0.0872  0.0043  -0.0595 388 GLN B CG  
3388 C CD  . GLN B 128 ? 1.3465 1.2842 1.0585 0.0982  0.0214  -0.0558 388 GLN B CD  
3389 O OE1 . GLN B 128 ? 1.3460 1.3113 1.0797 0.0974  0.0314  -0.0485 388 GLN B OE1 
3390 N NE2 . GLN B 128 ? 1.4067 1.3411 1.0862 0.1093  0.0247  -0.0611 388 GLN B NE2 
3391 N N   . PHE B 129 ? 1.1359 0.9920 0.8706 0.0580  -0.0296 -0.0585 389 PHE B N   
3392 C CA  . PHE B 129 ? 1.1219 0.9650 0.8408 0.0522  -0.0381 -0.0552 389 PHE B CA  
3393 C C   . PHE B 129 ? 1.1734 1.0125 0.8579 0.0638  -0.0369 -0.0600 389 PHE B C   
3394 O O   . PHE B 129 ? 1.1298 0.9575 0.8040 0.0754  -0.0426 -0.0746 389 PHE B O   
3395 C CB  . PHE B 129 ? 1.0664 0.8902 0.7981 0.0485  -0.0536 -0.0633 389 PHE B CB  
3396 C CG  . PHE B 129 ? 1.0922 0.9031 0.8114 0.0442  -0.0643 -0.0604 389 PHE B CG  
3397 C CD1 . PHE B 129 ? 1.1183 0.9322 0.8273 0.0370  -0.0603 -0.0463 389 PHE B CD1 
3398 C CD2 . PHE B 129 ? 1.0962 0.8912 0.8156 0.0471  -0.0795 -0.0714 389 PHE B CD2 
3399 C CE1 . PHE B 129 ? 1.1160 0.9144 0.8121 0.0349  -0.0714 -0.0434 389 PHE B CE1 
3400 C CE2 . PHE B 129 ? 1.0977 0.8820 0.8068 0.0453  -0.0906 -0.0691 389 PHE B CE2 
3401 C CZ  . PHE B 129 ? 1.1114 0.8959 0.8077 0.0402  -0.0867 -0.0551 389 PHE B CZ  
3402 N N   . HIS B 130 ? 1.2218 1.0694 0.8877 0.0601  -0.0295 -0.0472 390 HIS B N   
3403 C CA  . HIS B 130 ? 1.2375 1.0886 0.8683 0.0709  -0.0232 -0.0477 390 HIS B CA  
3404 C C   . HIS B 130 ? 1.2709 1.1382 0.9020 0.0847  -0.0116 -0.0561 390 HIS B C   
3405 O O   . HIS B 130 ? 1.2416 1.1336 0.8917 0.0816  0.0018  -0.0479 390 HIS B O   
3406 C CB  . HIS B 130 ? 1.2288 1.0547 0.8330 0.0777  -0.0392 -0.0576 390 HIS B CB  
3407 C CG  . HIS B 130 ? 1.2386 1.0507 0.8393 0.0670  -0.0496 -0.0477 390 HIS B CG  
3408 N ND1 . HIS B 130 ? 1.2570 1.0681 0.8300 0.0643  -0.0457 -0.0333 390 HIS B ND1 
3409 C CD2 . HIS B 130 ? 1.2242 1.0225 0.8451 0.0596  -0.0636 -0.0498 390 HIS B CD2 
3410 C CE1 . HIS B 130 ? 1.2387 1.0329 0.8143 0.0563  -0.0582 -0.0275 390 HIS B CE1 
3411 N NE2 . HIS B 130 ? 1.2207 1.0085 0.8257 0.0542  -0.0690 -0.0381 390 HIS B NE2 
3412 N N   . ASN B 131 ? 1.3317 1.1854 0.9435 0.1005  -0.0175 -0.0732 391 ASN B N   
3413 C CA  . ASN B 131 ? 1.3522 1.2173 0.9642 0.1160  -0.0078 -0.0832 391 ASN B CA  
3414 C C   . ASN B 131 ? 1.3257 1.1704 0.9555 0.1211  -0.0197 -0.0995 391 ASN B C   
3415 O O   . ASN B 131 ? 1.3695 1.2078 0.9883 0.1375  -0.0193 -0.1139 391 ASN B O   
3416 C CB  . ASN B 131 ? 1.3994 1.2679 0.9708 0.1328  -0.0011 -0.0893 391 ASN B CB  
3417 C CG  . ASN B 131 ? 1.4580 1.3496 1.0128 0.1265  0.0136  -0.0700 391 ASN B CG  
3418 O OD1 . ASN B 131 ? 1.4139 1.3257 0.9926 0.1118  0.0229  -0.0529 391 ASN B OD1 
3419 N ND2 . ASN B 131 ? 1.5639 1.4515 1.0768 0.1369  0.0153  -0.0721 391 ASN B ND2 
3420 N N   . THR B 132 ? 1.2374 1.0722 0.8947 0.1068  -0.0296 -0.0964 392 THR B N   
3421 C CA  . THR B 132 ? 1.1882 1.0039 0.8655 0.1072  -0.0405 -0.1080 392 THR B CA  
3422 C C   . THR B 132 ? 1.1415 0.9705 0.8532 0.0981  -0.0343 -0.0980 392 THR B C   
3423 O O   . THR B 132 ? 1.1401 0.9816 0.8646 0.0848  -0.0313 -0.0845 392 THR B O   
3424 C CB  . THR B 132 ? 1.1440 0.9365 0.8232 0.0988  -0.0592 -0.1144 392 THR B CB  
3425 O OG1 . THR B 132 ? 1.2294 1.0092 0.8753 0.1079  -0.0673 -0.1245 392 THR B OG1 
3426 C CG2 . THR B 132 ? 1.0739 0.8485 0.7758 0.0968  -0.0692 -0.1246 392 THR B CG2 
3427 N N   . SER B 133 ? 1.1040 0.9278 0.8280 0.1059  -0.0337 -0.1051 393 SER B N   
3428 C CA  . SER B 133 ? 1.1154 0.9492 0.8689 0.0996  -0.0294 -0.0967 393 SER B CA  
3429 C C   . SER B 133 ? 1.1349 0.9462 0.9063 0.0902  -0.0422 -0.1005 393 SER B C   
3430 O O   . SER B 133 ? 1.1762 0.9635 0.9435 0.0955  -0.0516 -0.1130 393 SER B O   
3431 C CB  . SER B 133 ? 1.1312 0.9742 0.8869 0.1154  -0.0205 -0.1001 393 SER B CB  
3432 O OG  . SER B 133 ? 1.2000 1.0158 0.9435 0.1286  -0.0284 -0.1165 393 SER B OG  
3433 N N   . ILE B 134 ? 1.0771 0.8965 0.8682 0.0760  -0.0424 -0.0898 394 ILE B N   
3434 C CA  . ILE B 134 ? 1.0184 0.8228 0.8278 0.0661  -0.0519 -0.0911 394 ILE B CA  
3435 C C   . ILE B 134 ? 0.9590 0.7745 0.7894 0.0620  -0.0457 -0.0814 394 ILE B C   
3436 O O   . ILE B 134 ? 0.9476 0.7846 0.7816 0.0596  -0.0375 -0.0716 394 ILE B O   
3437 C CB  . ILE B 134 ? 0.9984 0.8030 0.8095 0.0544  -0.0587 -0.0879 394 ILE B CB  
3438 C CG1 . ILE B 134 ? 1.0021 0.7972 0.7889 0.0593  -0.0659 -0.0960 394 ILE B CG1 
3439 C CG2 . ILE B 134 ? 0.9434 0.7386 0.7764 0.0449  -0.0664 -0.0888 394 ILE B CG2 
3440 C CD1 . ILE B 134 ? 0.9791 0.7796 0.7598 0.0519  -0.0688 -0.0891 394 ILE B CD1 
3441 N N   . CYS B 135 ? 0.9462 0.7467 0.7898 0.0608  -0.0500 -0.0837 395 CYS B N   
3442 C CA  . CYS B 135 ? 0.9580 0.7661 0.8198 0.0566  -0.0456 -0.0738 395 CYS B CA  
3443 C C   . CYS B 135 ? 0.9521 0.7485 0.8286 0.0452  -0.0519 -0.0728 395 CYS B C   
3444 O O   . CYS B 135 ? 0.9736 0.7497 0.8513 0.0442  -0.0595 -0.0806 395 CYS B O   
3445 C CB  . CYS B 135 ? 0.9451 0.7477 0.8074 0.0689  -0.0421 -0.0746 395 CYS B CB  
3446 S SG  . CYS B 135 ? 1.0629 0.8707 0.9444 0.0644  -0.0390 -0.0619 395 CYS B SG  
3447 N N   . VAL B 136 ? 0.8683 0.6785 0.7566 0.0365  -0.0488 -0.0634 396 VAL B N   
3448 C CA  . VAL B 136 ? 0.8659 0.6719 0.7685 0.0260  -0.0524 -0.0613 396 VAL B CA  
3449 C C   . VAL B 136 ? 0.8986 0.7093 0.8118 0.0241  -0.0470 -0.0513 396 VAL B C   
3450 O O   . VAL B 136 ? 0.9213 0.7484 0.8339 0.0249  -0.0418 -0.0444 396 VAL B O   
3451 C CB  . VAL B 136 ? 0.8733 0.6912 0.7771 0.0188  -0.0542 -0.0602 396 VAL B CB  
3452 C CG1 . VAL B 136 ? 0.8784 0.6975 0.7990 0.0100  -0.0558 -0.0577 396 VAL B CG1 
3453 C CG2 . VAL B 136 ? 0.8224 0.6347 0.7135 0.0209  -0.0608 -0.0685 396 VAL B CG2 
3454 N N   . VAL B 137 ? 0.8870 0.6829 0.8094 0.0208  -0.0488 -0.0502 397 VAL B N   
3455 C CA  . VAL B 137 ? 0.8798 0.6768 0.8089 0.0196  -0.0438 -0.0395 397 VAL B CA  
3456 C C   . VAL B 137 ? 0.8940 0.6946 0.8363 0.0079  -0.0429 -0.0346 397 VAL B C   
3457 O O   . VAL B 137 ? 0.9251 0.7182 0.8764 0.0009  -0.0476 -0.0395 397 VAL B O   
3458 C CB  . VAL B 137 ? 0.8785 0.6525 0.8064 0.0252  -0.0453 -0.0389 397 VAL B CB  
3459 C CG1 . VAL B 137 ? 0.8638 0.6394 0.7954 0.0250  -0.0402 -0.0258 397 VAL B CG1 
3460 C CG2 . VAL B 137 ? 0.8563 0.6257 0.7710 0.0397  -0.0461 -0.0462 397 VAL B CG2 
3461 N N   . ASN B 138 ? 0.8785 0.6926 0.8222 0.0066  -0.0370 -0.0250 398 ASN B N   
3462 C CA  . ASN B 138 ? 0.8490 0.6695 0.8033 -0.0023 -0.0333 -0.0184 398 ASN B CA  
3463 C C   . ASN B 138 ? 0.8529 0.6676 0.8049 -0.0006 -0.0283 -0.0063 398 ASN B C   
3464 O O   . ASN B 138 ? 0.8510 0.6727 0.7933 0.0067  -0.0263 -0.0018 398 ASN B O   
3465 C CB  . ASN B 138 ? 0.8047 0.6461 0.7570 -0.0034 -0.0311 -0.0188 398 ASN B CB  
3466 C CG  . ASN B 138 ? 0.8268 0.6787 0.7877 -0.0096 -0.0257 -0.0129 398 ASN B CG  
3467 O OD1 . ASN B 138 ? 0.8649 0.7118 0.8378 -0.0163 -0.0238 -0.0095 398 ASN B OD1 
3468 N ND2 . ASN B 138 ? 0.8227 0.6898 0.7774 -0.0077 -0.0232 -0.0120 398 ASN B ND2 
3469 N N   . SER B 139 ? 0.8673 0.6692 0.8283 -0.0079 -0.0269 -0.0004 399 SER B N   
3470 C CA  . SER B 139 ? 0.9209 0.7130 0.8775 -0.0064 -0.0224 0.0131  399 SER B CA  
3471 C C   . SER B 139 ? 0.9399 0.7395 0.9057 -0.0175 -0.0152 0.0236  399 SER B C   
3472 O O   . SER B 139 ? 0.9857 0.7886 0.9671 -0.0280 -0.0153 0.0203  399 SER B O   
3473 C CB  . SER B 139 ? 0.9347 0.6963 0.8897 -0.0031 -0.0275 0.0131  399 SER B CB  
3474 O OG  . SER B 139 ? 0.9550 0.7015 0.9238 -0.0149 -0.0309 0.0102  399 SER B OG  
3475 N N   . HIS B 140 ? 0.9261 0.7309 0.8819 -0.0145 -0.0090 0.0362  400 HIS B N   
3476 C CA  . HIS B 140 ? 0.9494 0.7602 0.9100 -0.0238 0.0000  0.0492  400 HIS B CA  
3477 C C   . HIS B 140 ? 0.9634 0.7490 0.9162 -0.0227 0.0008  0.0636  400 HIS B C   
3478 O O   . HIS B 140 ? 0.9992 0.7819 0.9351 -0.0114 -0.0001 0.0691  400 HIS B O   
3479 C CB  . HIS B 140 ? 0.9470 0.7843 0.8972 -0.0196 0.0063  0.0516  400 HIS B CB  
3480 C CG  . HIS B 140 ? 0.9731 0.8234 0.9278 -0.0279 0.0175  0.0628  400 HIS B CG  
3481 N ND1 . HIS B 140 ? 0.9602 0.8314 0.9017 -0.0232 0.0243  0.0665  400 HIS B ND1 
3482 C CD2 . HIS B 140 ? 0.9814 0.8283 0.9523 -0.0409 0.0234  0.0713  400 HIS B CD2 
3483 C CE1 . HIS B 140 ? 0.9450 0.8268 0.8931 -0.0315 0.0354  0.0769  400 HIS B CE1 
3484 N NE2 . HIS B 140 ? 0.9776 0.8463 0.9453 -0.0433 0.0354  0.0809  400 HIS B NE2 
3485 N N   . LEU B 141 ? 0.9395 0.7053 0.9049 -0.0342 0.0009  0.0693  401 LEU B N   
3486 C CA  . LEU B 141 ? 1.0084 0.7417 0.9662 -0.0333 -0.0006 0.0823  401 LEU B CA  
3487 C C   . LEU B 141 ? 1.0428 0.7787 0.9976 -0.0421 0.0104  0.1033  401 LEU B C   
3488 O O   . LEU B 141 ? 1.0677 0.8312 1.0305 -0.0503 0.0197  0.1061  401 LEU B O   
3489 C CB  . LEU B 141 ? 1.0310 0.7338 1.0021 -0.0411 -0.0091 0.0758  401 LEU B CB  
3490 C CG  . LEU B 141 ? 1.0169 0.7161 0.9885 -0.0323 -0.0196 0.0548  401 LEU B CG  
3491 C CD1 . LEU B 141 ? 1.0419 0.7078 1.0231 -0.0395 -0.0291 0.0480  401 LEU B CD1 
3492 C CD2 . LEU B 141 ? 1.0020 0.6999 0.9543 -0.0123 -0.0226 0.0515  401 LEU B CD2 
3493 N N   . ALA B 142 ? 1.0506 0.7575 0.9931 -0.0393 0.0096  0.1184  402 ALA B N   
3494 C CA  . ALA B 142 ? 1.0603 0.7663 0.9943 -0.0462 0.0203  0.1414  402 ALA B CA  
3495 C C   . ALA B 142 ? 1.1315 0.8488 1.0877 -0.0683 0.0303  0.1492  402 ALA B C   
3496 O O   . ALA B 142 ? 1.1538 0.8617 1.1329 -0.0805 0.0252  0.1409  402 ALA B O   
3497 C CB  . ALA B 142 ? 1.0613 0.7263 0.9808 -0.0407 0.0152  0.1555  402 ALA B CB  
3498 N N   . ALA B 143 ? 1.1820 0.9208 1.1311 -0.0728 0.0443  0.1654  403 ALA B N   
3499 C CA  . ALA B 143 ? 1.2161 0.9800 1.1872 -0.0915 0.0571  0.1725  403 ALA B CA  
3500 C C   . ALA B 143 ? 1.2839 1.0310 1.2588 -0.1089 0.0669  0.1987  403 ALA B C   
3501 O O   . ALA B 143 ? 1.2500 1.0238 1.2432 -0.1243 0.0801  0.2071  403 ALA B O   
3502 C CB  . ALA B 143 ? 1.1928 1.0004 1.1550 -0.0841 0.0683  0.1698  403 ALA B CB  
3503 N N   . HIS B 144 ? 1.3690 1.0732 1.3273 -0.1064 0.0610  0.2123  404 HIS B N   
3504 C CA  . HIS B 144 ? 1.4483 1.1306 1.4063 -0.1230 0.0698  0.2400  404 HIS B CA  
3505 C C   . HIS B 144 ? 1.4954 1.1756 1.4918 -0.1487 0.0700  0.2388  404 HIS B C   
3506 O O   . HIS B 144 ? 1.4914 1.1622 1.5062 -0.1499 0.0564  0.2178  404 HIS B O   
3507 C CB  . HIS B 144 ? 1.5175 1.1465 1.4518 -0.1135 0.0590  0.2512  404 HIS B CB  
3508 C CG  . HIS B 144 ? 1.5852 1.1908 1.5063 -0.1249 0.0688  0.2837  404 HIS B CG  
3509 N ND1 . HIS B 144 ? 1.6044 1.1996 1.5489 -0.1523 0.0760  0.2996  404 HIS B ND1 
3510 C CD2 . HIS B 144 ? 1.6081 1.1973 1.4947 -0.1128 0.0717  0.3042  404 HIS B CD2 
3511 C CE1 . HIS B 144 ? 1.6474 1.2203 1.5715 -0.1574 0.0843  0.3296  404 HIS B CE1 
3512 N NE2 . HIS B 144 ? 1.6521 1.2204 1.5394 -0.1328 0.0816  0.3330  404 HIS B NE2 
3513 N N   . ILE B 145 ? 1.3779 1.0790 1.4442 -0.3423 -0.0509 0.1678  405 ILE B N   
3514 C CA  . ILE B 145 ? 1.4305 1.1341 1.5019 -0.3781 -0.0659 0.1715  405 ILE B CA  
3515 C C   . ILE B 145 ? 1.4863 1.1003 1.5179 -0.3873 -0.0880 0.1650  405 ILE B C   
3516 O O   . ILE B 145 ? 1.4911 1.0908 1.5176 -0.3910 -0.0995 0.1508  405 ILE B O   
3517 C CB  . ILE B 145 ? 1.1628 0.9093 1.2542 -0.4148 -0.0647 0.1975  405 ILE B CB  
3518 N N   . GLU B 146 ? 1.5248 1.0772 1.5268 -0.3894 -0.0953 0.1748  406 GLU B N   
3519 C CA  . GLU B 146 ? 1.5775 1.0402 1.5392 -0.4001 -0.1199 0.1710  406 GLU B CA  
3520 C C   . GLU B 146 ? 1.6085 1.0103 1.5367 -0.3597 -0.1217 0.1483  406 GLU B C   
3521 O O   . GLU B 146 ? 1.6840 1.0232 1.5815 -0.3592 -0.1409 0.1347  406 GLU B O   
3522 C CB  . GLU B 146 ? 1.6074 1.0323 1.5533 -0.4293 -0.1315 0.1961  406 GLU B CB  
3523 N N   . GLU B 147 ? 1.5377 0.9577 1.4711 -0.3256 -0.1029 0.1439  407 GLU B N   
3524 C CA  . GLU B 147 ? 1.5903 0.9545 1.4928 -0.2877 -0.1041 0.1252  407 GLU B CA  
3525 C C   . GLU B 147 ? 1.5530 0.9334 1.4576 -0.2624 -0.0982 0.1011  407 GLU B C   
3526 O O   . GLU B 147 ? 1.4907 0.9074 1.4097 -0.2319 -0.0801 0.0927  407 GLU B O   
3527 C CB  . GLU B 147 ? 1.5994 0.9688 1.5040 -0.2623 -0.0893 0.1314  407 GLU B CB  
3528 C CG  . GLU B 147 ? 1.6282 0.9527 1.5140 -0.2814 -0.1004 0.1520  407 GLU B CG  
3529 C CD  . GLU B 147 ? 1.6483 0.9157 1.5058 -0.2491 -0.1022 0.1457  407 GLU B CD  
3530 O OE1 . GLU B 147 ? 1.5924 0.8884 1.4624 -0.2149 -0.0847 0.1370  407 GLU B OE1 
3531 O OE2 . GLU B 147 ? 1.7280 0.9210 1.5511 -0.2582 -0.1228 0.1499  407 GLU B OE2 
3532 N N   . TYR B 148 ? 1.5857 0.9363 1.4741 -0.2765 -0.1153 0.0910  408 TYR B N   
3533 C CA  . TYR B 148 ? 1.5392 0.8914 1.4198 -0.2540 -0.1135 0.0677  408 TYR B CA  
3534 C C   . TYR B 148 ? 1.5553 0.8620 1.4047 -0.2126 -0.1103 0.0501  408 TYR B C   
3535 O O   . TYR B 148 ? 1.5239 0.8494 1.3730 -0.1872 -0.1007 0.0335  408 TYR B O   
3536 C CB  . TYR B 148 ? 1.5629 0.8852 1.4282 -0.2789 -0.1357 0.0609  408 TYR B CB  
3537 C CG  . TYR B 148 ? 1.6435 0.8766 1.4669 -0.2923 -0.1627 0.0610  408 TYR B CG  
3538 C CD1 . TYR B 148 ? 1.6889 0.8532 1.4686 -0.2630 -0.1728 0.0406  408 TYR B CD1 
3539 C CD2 . TYR B 148 ? 1.6782 0.8962 1.5051 -0.3346 -0.1797 0.0815  408 TYR B CD2 
3540 C CE1 . TYR B 148 ? 1.7782 0.8550 1.5166 -0.2735 -0.2013 0.0390  408 TYR B CE1 
3541 C CE2 . TYR B 148 ? 1.7610 0.8923 1.5482 -0.3486 -0.2083 0.0827  408 TYR B CE2 
3542 C CZ  . TYR B 148 ? 1.8033 0.8615 1.5453 -0.3170 -0.2201 0.0605  408 TYR B CZ  
3543 O OH  . TYR B 148 ? 1.8538 0.8211 1.5538 -0.3285 -0.2516 0.0599  408 TYR B OH  
3544 N N   . GLU B 149 ? 1.6039 0.8529 1.4273 -0.2057 -0.1186 0.0540  409 GLU B N   
3545 C CA  . GLU B 149 ? 1.6127 0.8250 1.4102 -0.1640 -0.1144 0.0377  409 GLU B CA  
3546 C C   . GLU B 149 ? 1.4931 0.7683 1.3197 -0.1344 -0.0875 0.0360  409 GLU B C   
3547 O O   . GLU B 149 ? 1.4841 0.7535 1.2983 -0.1001 -0.0800 0.0192  409 GLU B O   
3548 C CB  . GLU B 149 ? 1.7286 0.8731 1.4978 -0.1619 -0.1283 0.0444  409 GLU B CB  
3549 C CG  . GLU B 149 ? 1.8889 0.9514 1.6183 -0.1826 -0.1599 0.0418  409 GLU B CG  
3550 C CD  . GLU B 149 ? 1.9607 1.0090 1.6954 -0.2261 -0.1740 0.0684  409 GLU B CD  
3551 O OE1 . GLU B 149 ? 1.9073 1.0170 1.6782 -0.2412 -0.1572 0.0882  409 GLU B OE1 
3552 O OE2 . GLU B 149 ? 2.0323 1.0077 1.7338 -0.2449 -0.2027 0.0694  409 GLU B OE2 
3553 N N   . ARG B 150 ? 1.4283 0.7638 1.2929 -0.1473 -0.0739 0.0536  410 ARG B N   
3554 C CA  . ARG B 150 ? 1.4147 0.8087 1.3080 -0.1213 -0.0515 0.0532  410 ARG B CA  
3555 C C   . ARG B 150 ? 1.3459 0.7827 1.2522 -0.1111 -0.0431 0.0398  410 ARG B C   
3556 O O   . ARG B 150 ? 1.2897 0.7450 1.1998 -0.0807 -0.0306 0.0305  410 ARG B O   
3557 C CB  . ARG B 150 ? 1.4176 0.8634 1.3454 -0.1364 -0.0413 0.0741  410 ARG B CB  
3558 C CG  . ARG B 150 ? 1.5037 0.9136 1.4192 -0.1346 -0.0441 0.0868  410 ARG B CG  
3559 C CD  . ARG B 150 ? 1.5428 1.0052 1.4892 -0.1457 -0.0329 0.1067  410 ARG B CD  
3560 N NE  . ARG B 150 ? 1.6653 1.0846 1.5938 -0.1510 -0.0396 0.1206  410 ARG B NE  
3561 C CZ  . ARG B 150 ? 1.6544 1.1016 1.5983 -0.1613 -0.0330 0.1396  410 ARG B CZ  
3562 N NH1 . ARG B 150 ? 1.5693 1.0905 1.5484 -0.1658 -0.0192 0.1464  410 ARG B NH1 
3563 N NH2 . ARG B 150 ? 1.6944 1.0931 1.6159 -0.1660 -0.0416 0.1515  410 ARG B NH2 
3564 N N   . ARG B 151 ? 1.3140 0.7664 1.2272 -0.1373 -0.0511 0.0397  411 ARG B N   
3565 C CA  . ARG B 151 ? 1.2579 0.7413 1.1774 -0.1302 -0.0472 0.0265  411 ARG B CA  
3566 C C   . ARG B 151 ? 1.2844 0.7199 1.1657 -0.1050 -0.0515 0.0065  411 ARG B C   
3567 O O   . ARG B 151 ? 1.2567 0.7179 1.1411 -0.0803 -0.0395 -0.0032 411 ARG B O   
3568 C CB  . ARG B 151 ? 1.2605 0.7612 1.1909 -0.1642 -0.0586 0.0295  411 ARG B CB  
3569 C CG  . ARG B 151 ? 1.2414 0.8021 1.2122 -0.1858 -0.0523 0.0473  411 ARG B CG  
3570 C CD  . ARG B 151 ? 1.2878 0.8718 1.2727 -0.2179 -0.0634 0.0494  411 ARG B CD  
3571 N NE  . ARG B 151 ? 1.3655 0.9191 1.3425 -0.2502 -0.0778 0.0621  411 ARG B NE  
3572 C CZ  . ARG B 151 ? 1.3504 0.9236 1.3444 -0.2662 -0.0736 0.0814  411 ARG B CZ  
3573 N NH1 . ARG B 151 ? 1.3656 0.9093 1.3505 -0.2983 -0.0884 0.0942  411 ARG B NH1 
3574 N NH2 . ARG B 151 ? 1.2957 0.9166 1.3143 -0.2505 -0.0558 0.0887  411 ARG B NH2 
3575 N N   . ASN B 152 ? 1.3446 0.7106 1.1891 -0.1109 -0.0695 0.0006  412 ASN B N   
3576 C CA  . ASN B 152 ? 1.3962 0.7122 1.2001 -0.0839 -0.0753 -0.0201 412 ASN B CA  
3577 C C   . ASN B 152 ? 1.3619 0.6893 1.1664 -0.0448 -0.0578 -0.0253 412 ASN B C   
3578 O O   . ASN B 152 ? 1.3534 0.6910 1.1471 -0.0189 -0.0493 -0.0400 412 ASN B O   
3579 C CB  . ASN B 152 ? 1.4891 0.7216 1.2526 -0.0944 -0.1002 -0.0240 412 ASN B CB  
3580 C CG  . ASN B 152 ? 1.5269 0.7424 1.2849 -0.1314 -0.1205 -0.0220 412 ASN B CG  
3581 O OD1 . ASN B 152 ? 1.5230 0.7885 1.3054 -0.1464 -0.1156 -0.0202 412 ASN B OD1 
3582 N ND2 . ASN B 152 ? 1.5784 0.7221 1.3045 -0.1463 -0.1453 -0.0219 412 ASN B ND2 
3583 N N   . GLN B 153 ? 1.3323 0.6614 1.1506 -0.0414 -0.0524 -0.0123 413 GLN B N   
3584 C CA  . GLN B 153 ? 1.3229 0.6640 1.1455 -0.0057 -0.0372 -0.0155 413 GLN B CA  
3585 C C   . GLN B 153 ? 1.2573 0.6730 1.1141 0.0063  -0.0167 -0.0139 413 GLN B C   
3586 O O   . GLN B 153 ? 1.2332 0.6612 1.0859 0.0369  -0.0055 -0.0238 413 GLN B O   
3587 C CB  . GLN B 153 ? 1.3318 0.6604 1.1636 -0.0080 -0.0374 -0.0002 413 GLN B CB  
3588 C CG  . GLN B 153 ? 1.3439 0.6701 1.1744 0.0297  -0.0268 -0.0050 413 GLN B CG  
3589 C CD  . GLN B 153 ? 1.4130 0.6801 1.2008 0.0575  -0.0360 -0.0258 413 GLN B CD  
3590 O OE1 . GLN B 153 ? 1.4831 0.6836 1.2403 0.0550  -0.0542 -0.0281 413 GLN B OE1 
3591 N NE2 . GLN B 153 ? 1.3871 0.6787 1.1716 0.0846  -0.0244 -0.0408 413 GLN B NE2 
3592 N N   . ASP B 154 ? 1.2407 0.7065 1.1309 -0.0177 -0.0130 -0.0012 414 ASP B N   
3593 C CA  . ASP B 154 ? 1.2013 0.7346 1.1235 -0.0091 0.0022  0.0013  414 ASP B CA  
3594 C C   . ASP B 154 ? 1.1421 0.6814 1.0485 0.0020  0.0039  -0.0142 414 ASP B C   
3595 O O   . ASP B 154 ? 1.1028 0.6751 1.0184 0.0245  0.0171  -0.0170 414 ASP B O   
3596 C CB  . ASP B 154 ? 1.2034 0.7849 1.1606 -0.0367 0.0021  0.0151  414 ASP B CB  
3597 C CG  . ASP B 154 ? 1.2098 0.8113 1.1917 -0.0389 0.0078  0.0314  414 ASP B CG  
3598 O OD1 . ASP B 154 ? 1.2174 0.8052 1.1958 -0.0168 0.0139  0.0328  414 ASP B OD1 
3599 O OD2 . ASP B 154 ? 1.1975 0.8307 1.2025 -0.0620 0.0059  0.0425  414 ASP B OD2 
3600 N N   . TYR B 155 ? 1.1230 0.6316 1.0056 -0.0147 -0.0100 -0.0231 415 TYR B N   
3601 C CA  . TYR B 155 ? 1.1385 0.6477 1.0004 -0.0042 -0.0098 -0.0384 415 TYR B CA  
3602 C C   . TYR B 155 ? 1.1594 0.6414 0.9912 0.0315  -0.0034 -0.0525 415 TYR B C   
3603 O O   . TYR B 155 ? 1.1175 0.6321 0.9507 0.0512  0.0092  -0.0577 415 TYR B O   
3604 C CB  . TYR B 155 ? 1.2191 0.6928 1.0580 -0.0286 -0.0288 -0.0459 415 TYR B CB  
3605 C CG  . TYR B 155 ? 1.2972 0.7576 1.1047 -0.0160 -0.0315 -0.0639 415 TYR B CG  
3606 C CD1 . TYR B 155 ? 1.2835 0.7851 1.1036 -0.0255 -0.0297 -0.0646 415 TYR B CD1 
3607 C CD2 . TYR B 155 ? 1.3892 0.7941 1.1519 0.0064  -0.0374 -0.0808 415 TYR B CD2 
3608 C CE1 . TYR B 155 ? 1.3372 0.8257 1.1250 -0.0141 -0.0323 -0.0806 415 TYR B CE1 
3609 C CE2 . TYR B 155 ? 1.4575 0.8507 1.1876 0.0199  -0.0395 -0.0981 415 TYR B CE2 
3610 C CZ  . TYR B 155 ? 1.4304 0.8656 1.1727 0.0088  -0.0365 -0.0973 415 TYR B CZ  
3611 O OH  . TYR B 155 ? 1.4729 0.8949 1.1796 0.0222  -0.0389 -0.1139 415 TYR B OH  
3612 N N   . LYS B 156 ? 1.2182 0.6417 1.0228 0.0399  -0.0128 -0.0580 416 LYS B N   
3613 C CA  . LYS B 156 ? 1.2453 0.6408 1.0203 0.0767  -0.0083 -0.0731 416 LYS B CA  
3614 C C   . LYS B 156 ? 1.2654 0.7152 1.0689 0.1022  0.0137  -0.0670 416 LYS B C   
3615 O O   . LYS B 156 ? 1.2952 0.7632 1.0879 0.1282  0.0247  -0.0776 416 LYS B O   
3616 C CB  . LYS B 156 ? 1.2675 0.5919 1.0141 0.0807  -0.0242 -0.0773 416 LYS B CB  
3617 N N   . ASP B 157 ? 1.2423 0.7197 1.0819 0.0939  0.0195  -0.0493 417 ASP B N   
3618 C CA  . ASP B 157 ? 1.1853 0.7111 1.0547 0.1159  0.0373  -0.0415 417 ASP B CA  
3619 C C   . ASP B 157 ? 1.1132 0.7046 1.0080 0.1151  0.0500  -0.0368 417 ASP B C   
3620 O O   . ASP B 157 ? 1.0851 0.7094 0.9885 0.1390  0.0638  -0.0376 417 ASP B O   
3621 C CB  . ASP B 157 ? 1.1949 0.7311 1.0946 0.1048  0.0375  -0.0236 417 ASP B CB  
3622 C CG  . ASP B 157 ? 1.3265 0.8025 1.2044 0.1094  0.0267  -0.0250 417 ASP B CG  
3623 O OD1 . ASP B 157 ? 1.4107 0.8371 1.2520 0.1278  0.0196  -0.0407 417 ASP B OD1 
3624 O OD2 . ASP B 157 ? 1.3516 0.8299 1.2485 0.0949  0.0243  -0.0099 417 ASP B OD2 
3625 N N   . ILE B 158 ? 1.0608 0.6727 0.9691 0.0871  0.0444  -0.0307 418 ILE B N   
3626 C CA  . ILE B 158 ? 1.0373 0.7024 0.9631 0.0852  0.0522  -0.0277 418 ILE B CA  
3627 C C   . ILE B 158 ? 1.0781 0.7340 0.9705 0.1055  0.0570  -0.0435 418 ILE B C   
3628 O O   . ILE B 158 ? 1.0594 0.7554 0.9616 0.1233  0.0706  -0.0414 418 ILE B O   
3629 C CB  . ILE B 158 ? 0.9988 0.6797 0.9380 0.0532  0.0421  -0.0225 418 ILE B CB  
3630 C CG1 . ILE B 158 ? 0.9411 0.6463 0.9173 0.0376  0.0408  -0.0062 418 ILE B CG1 
3631 C CG2 . ILE B 158 ? 0.9224 0.6466 0.8691 0.0525  0.0466  -0.0227 418 ILE B CG2 
3632 C CD1 . ILE B 158 ? 0.8933 0.6098 0.8826 0.0061  0.0293  -0.0018 418 ILE B CD1 
3633 N N   . CYS B 159 ? 1.1068 0.7101 0.9589 0.1036  0.0454  -0.0590 419 CYS B N   
3634 C CA  . CYS B 159 ? 1.1794 0.7720 0.9950 0.1241  0.0489  -0.0759 419 CYS B CA  
3635 C C   . CYS B 159 ? 1.1858 0.7871 0.9949 0.1611  0.0636  -0.0814 419 CYS B C   
3636 O O   . CYS B 159 ? 1.1811 0.8169 0.9848 0.1784  0.0765  -0.0852 419 CYS B O   
3637 C CB  . CYS B 159 ? 1.2619 0.7884 1.0325 0.1175  0.0305  -0.0928 419 CYS B CB  
3638 S SG  . CYS B 159 ? 1.1668 0.6928 0.9411 0.0775  0.0144  -0.0896 419 CYS B SG  
3639 N N   . SER B 160 ? 1.1645 0.7379 0.9752 0.1729  0.0618  -0.0810 420 SER B N   
3640 C CA  . SER B 160 ? 1.1976 0.7758 1.0013 0.2101  0.0738  -0.0883 420 SER B CA  
3641 C C   . SER B 160 ? 1.1498 0.7961 0.9982 0.2190  0.0919  -0.0718 420 SER B C   
3642 O O   . SER B 160 ? 1.1566 0.8357 1.0040 0.2452  0.1065  -0.0758 420 SER B O   
3643 C CB  . SER B 160 ? 1.2729 0.7900 1.0578 0.2216  0.0622  -0.0956 420 SER B CB  
3644 O OG  . SER B 160 ? 1.3168 0.8416 1.1361 0.2083  0.0613  -0.0779 420 SER B OG  
3645 N N   . ARG B 161 ? 1.1015 0.7707 0.9887 0.1974  0.0904  -0.0531 421 ARG B N   
3646 C CA  . ARG B 161 ? 1.0484 0.7761 0.9790 0.2045  0.1034  -0.0365 421 ARG B CA  
3647 C C   . ARG B 161 ? 1.0254 0.8131 0.9765 0.1954  0.1118  -0.0268 421 ARG B C   
3648 O O   . ARG B 161 ? 0.9967 0.8324 0.9725 0.2089  0.1242  -0.0174 421 ARG B O   
3649 C CB  . ARG B 161 ? 0.9999 0.7254 0.9611 0.1879  0.0968  -0.0213 421 ARG B CB  
3650 C CG  . ARG B 161 ? 1.0997 0.7667 1.0428 0.1932  0.0872  -0.0267 421 ARG B CG  
3651 C CD  . ARG B 161 ? 1.1314 0.8110 1.1047 0.2018  0.0904  -0.0136 421 ARG B CD  
3652 N NE  . ARG B 161 ? 1.1351 0.8189 1.1314 0.1750  0.0830  0.0015  421 ARG B NE  
3653 C CZ  . ARG B 161 ? 1.1603 0.8014 1.1475 0.1640  0.0724  0.0044  421 ARG B CZ  
3654 N NH1 . ARG B 161 ? 1.1870 0.7704 1.1415 0.1760  0.0649  -0.0065 421 ARG B NH1 
3655 N NH2 . ARG B 161 ? 1.1371 0.7939 1.1473 0.1408  0.0682  0.0188  421 ARG B NH2 
3656 N N   . MET B 162 ? 1.0357 0.8205 0.9778 0.1713  0.1035  -0.0280 422 MET B N   
3657 C CA  . MET B 162 ? 1.0061 0.8411 0.9648 0.1598  0.1076  -0.0186 422 MET B CA  
3658 C C   . MET B 162 ? 1.0837 0.9396 1.0214 0.1821  0.1208  -0.0261 422 MET B C   
3659 O O   . MET B 162 ? 1.1827 1.0067 1.0791 0.1901  0.1191  -0.0435 422 MET B O   
3660 C CB  . MET B 162 ? 1.0133 0.8323 0.9613 0.1313  0.0936  -0.0216 422 MET B CB  
3661 C CG  . MET B 162 ? 0.9735 0.8370 0.9359 0.1164  0.0931  -0.0126 422 MET B CG  
3662 S SD  . MET B 162 ? 1.0659 0.9745 1.0817 0.0981  0.0878  0.0091  422 MET B SD  
3663 C CE  . MET B 162 ? 0.7421 0.6142 0.7618 0.0758  0.0726  0.0066  422 MET B CE  
3664 N N   . GLN B 163 ? 1.0690 0.9791 1.0349 0.1925  0.1335  -0.0127 423 GLN B N   
3665 C CA  . GLN B 163 ? 1.1216 1.0656 1.0739 0.2125  0.1487  -0.0156 423 GLN B CA  
3666 C C   . GLN B 163 ? 1.0735 1.0777 1.0551 0.1981  0.1527  0.0044  423 GLN B C   
3667 O O   . GLN B 163 ? 1.0445 1.0787 1.0675 0.1913  0.1516  0.0221  423 GLN B O   
3668 C CB  . GLN B 163 ? 1.1400 1.0956 1.0996 0.2441  0.1618  -0.0176 423 GLN B CB  
3669 C CG  . GLN B 163 ? 1.2403 1.1476 1.1575 0.2702  0.1626  -0.0415 423 GLN B CG  
3670 C CD  . GLN B 163 ? 1.3264 1.2587 1.2529 0.3046  0.1773  -0.0435 423 GLN B CD  
3671 O OE1 . GLN B 163 ? 1.3029 1.2794 1.2718 0.3058  0.1841  -0.0258 423 GLN B OE1 
3672 N NE2 . GLN B 163 ? 1.4077 1.3126 1.2948 0.3336  0.1810  -0.0654 423 GLN B NE2 
3673 N N   . PHE B 164 ? 1.0511 1.0705 1.0098 0.1935  0.1555  0.0019  424 PHE B N   
3674 C CA  . PHE B 164 ? 1.0077 1.0837 0.9891 0.1814  0.1592  0.0215  424 PHE B CA  
3675 C C   . PHE B 164 ? 1.1149 1.2330 1.0903 0.2062  0.1796  0.0234  424 PHE B C   
3676 O O   . PHE B 164 ? 1.2184 1.3181 1.1555 0.2283  0.1886  0.0046  424 PHE B O   
3677 C CB  . PHE B 164 ? 0.9698 1.0388 0.9297 0.1590  0.1486  0.0196  424 PHE B CB  
3678 C CG  . PHE B 164 ? 0.9714 0.9971 0.9297 0.1375  0.1294  0.0129  424 PHE B CG  
3679 C CD1 . PHE B 164 ? 0.9318 0.9717 0.9266 0.1155  0.1165  0.0275  424 PHE B CD1 
3680 C CD2 . PHE B 164 ? 1.0174 0.9894 0.9375 0.1392  0.1230  -0.0081 424 PHE B CD2 
3681 C CE1 . PHE B 164 ? 0.9276 0.9344 0.9227 0.0964  0.1000  0.0214  424 PHE B CE1 
3682 C CE2 . PHE B 164 ? 1.0264 0.9635 0.9476 0.1173  0.1055  -0.0126 424 PHE B CE2 
3683 C CZ  . PHE B 164 ? 0.9843 0.9419 0.9441 0.0962  0.0951  0.0023  424 PHE B CZ  
3684 N N   . CYS B 165 ? 1.0942 1.2697 1.1069 0.2027  0.1861  0.0461  425 CYS B N   
3685 C CA  . CYS B 165 ? 1.1547 1.3819 1.1701 0.2245  0.2067  0.0522  425 CYS B CA  
3686 C C   . CYS B 165 ? 1.1758 1.4253 1.1561 0.2245  0.2157  0.0498  425 CYS B C   
3687 O O   . CYS B 165 ? 1.1571 1.4055 1.1297 0.1998  0.2050  0.0565  425 CYS B O   
3688 C CB  . CYS B 165 ? 1.1270 1.4095 1.1955 0.2167  0.2081  0.0799  425 CYS B CB  
3689 S SG  . CYS B 165 ? 1.3108 1.6104 1.4036 0.1773  0.1886  0.1032  425 CYS B SG  
3690 N N   . LEU B 174 ? 1.0308 1.0530 0.8652 0.2664  0.1923  -0.0452 434 LEU B N   
3691 C CA  . LEU B 174 ? 1.0841 1.0555 0.8853 0.2474  0.1750  -0.0576 434 LEU B CA  
3692 C C   . LEU B 174 ? 1.0852 1.0027 0.8977 0.2309  0.1562  -0.0610 434 LEU B C   
3693 O O   . LEU B 174 ? 0.9982 0.9314 0.8540 0.2160  0.1527  -0.0443 434 LEU B O   
3694 C CB  . LEU B 174 ? 1.0579 1.0609 0.8668 0.2189  0.1706  -0.0423 434 LEU B CB  
3695 C CG  . LEU B 174 ? 1.0633 1.1350 0.8805 0.2215  0.1869  -0.0256 434 LEU B CG  
3696 C CD1 . LEU B 174 ? 1.0434 1.1269 0.8623 0.1900  0.1752  -0.0131 434 LEU B CD1 
3697 C CD2 . LEU B 174 ? 1.1088 1.1935 0.8835 0.2528  0.2045  -0.0404 434 LEU B CD2 
3698 N N   . THR B 175 ? 1.1619 1.0163 0.9339 0.2335  0.1436  -0.0822 435 THR B N   
3699 C CA  . THR B 175 ? 1.1711 0.9742 0.9482 0.2120  0.1241  -0.0845 435 THR B CA  
3700 C C   . THR B 175 ? 1.1570 0.9554 0.9319 0.1797  0.1100  -0.0808 435 THR B C   
3701 O O   . THR B 175 ? 1.1880 1.0098 0.9472 0.1769  0.1135  -0.0807 435 THR B O   
3702 C CB  . THR B 175 ? 1.2249 0.9570 0.9593 0.2281  0.1134  -0.1081 435 THR B CB  
3703 O OG1 . THR B 175 ? 1.2989 1.0083 0.9831 0.2372  0.1101  -0.1267 435 THR B OG1 
3704 C CG2 . THR B 175 ? 1.1779 0.9082 0.9144 0.2615  0.1240  -0.1136 435 THR B CG2 
3705 N N   . ILE B 176 ? 1.1163 0.8858 0.9068 0.1557  0.0941  -0.0776 436 ILE B N   
3706 C CA  . ILE B 176 ? 1.1181 0.8763 0.9058 0.1258  0.0780  -0.0771 436 ILE B CA  
3707 C C   . ILE B 176 ? 1.2441 0.9679 0.9793 0.1310  0.0712  -0.0964 436 ILE B C   
3708 O O   . ILE B 176 ? 1.2841 1.0250 1.0103 0.1189  0.0678  -0.0951 436 ILE B O   
3709 C CB  . ILE B 176 ? 1.0975 0.8194 0.8998 0.1044  0.0618  -0.0758 436 ILE B CB  
3710 C CG1 . ILE B 176 ? 1.0254 0.7822 0.8784 0.0974  0.0667  -0.0566 436 ILE B CG1 
3711 C CG2 . ILE B 176 ? 1.1137 0.8201 0.9086 0.0758  0.0440  -0.0788 436 ILE B CG2 
3712 C CD1 . ILE B 176 ? 0.9858 0.7192 0.8565 0.0740  0.0527  -0.0523 436 ILE B CD1 
3713 N N   . SER B 177 ? 1.2855 0.9583 0.9844 0.1501  0.0676  -0.1148 437 SER B N   
3714 C CA  . SER B 177 ? 1.3029 0.9330 0.9468 0.1585  0.0582  -0.1361 437 SER B CA  
3715 C C   . SER B 177 ? 1.2517 0.9179 0.8715 0.1750  0.0721  -0.1397 437 SER B C   
3716 O O   . SER B 177 ? 1.2579 0.9005 0.8395 0.1718  0.0624  -0.1522 437 SER B O   
3717 C CB  . SER B 177 ? 1.3367 0.9076 0.9459 0.1825  0.0523  -0.1553 437 SER B CB  
3718 O OG  . SER B 177 ? 1.3532 0.8802 0.9745 0.1623  0.0348  -0.1530 437 SER B OG  
3719 N N   . ASN B 178 ? 1.1749 0.8986 0.8167 0.1913  0.0939  -0.1278 438 ASN B N   
3720 C CA  . ASN B 178 ? 1.1937 0.9573 0.8129 0.2080  0.1095  -0.1290 438 ASN B CA  
3721 C C   . ASN B 178 ? 1.1657 0.9696 0.8019 0.1806  0.1075  -0.1120 438 ASN B C   
3722 O O   . ASN B 178 ? 1.1302 0.9942 0.7905 0.1810  0.1224  -0.0942 438 ASN B O   
3723 C CB  . ASN B 178 ? 1.1909 1.0010 0.8276 0.2370  0.1332  -0.1226 438 ASN B CB  
3724 C CG  . ASN B 178 ? 1.2723 1.1106 0.8713 0.2652  0.1502  -0.1320 438 ASN B CG  
3725 O OD1 . ASN B 178 ? 1.3010 1.1198 0.8562 0.2653  0.1442  -0.1447 438 ASN B OD1 
3726 N ND2 . ASN B 178 ? 1.2889 1.1757 0.9052 0.2898  0.1717  -0.1255 438 ASN B ND2 
3727 N N   . HIS B 179 ? 1.1696 0.9388 0.7926 0.1563  0.0870  -0.1175 439 HIS B N   
3728 C CA  . HIS B 179 ? 1.1468 0.9452 0.7847 0.1292  0.0799  -0.1036 439 HIS B CA  
3729 C C   . HIS B 179 ? 1.1679 0.9229 0.7640 0.1172  0.0609  -0.1192 439 HIS B C   
3730 O O   . HIS B 179 ? 1.1807 0.8801 0.7611 0.1122  0.0444  -0.1339 439 HIS B O   
3731 C CB  . HIS B 179 ? 1.1430 0.9563 0.8362 0.1030  0.0710  -0.0861 439 HIS B CB  
3732 C CG  . HIS B 179 ? 1.0841 0.9468 0.8211 0.1103  0.0870  -0.0672 439 HIS B CG  
3733 N ND1 . HIS B 179 ? 1.0638 0.9180 0.8163 0.1264  0.0949  -0.0684 439 HIS B ND1 
3734 C CD2 . HIS B 179 ? 0.9954 0.9144 0.7628 0.1035  0.0946  -0.0463 439 HIS B CD2 
3735 C CE1 . HIS B 179 ? 1.0237 0.9282 0.8152 0.1296  0.1073  -0.0496 439 HIS B CE1 
3736 N NE2 . HIS B 179 ? 0.9759 0.9201 0.7774 0.1155  0.1069  -0.0356 439 HIS B NE2 
3737 N N   . ASP B 180 ? 1.1624 0.9421 0.7408 0.1113  0.0617  -0.1150 440 ASP B N   
3738 C CA  . ASP B 180 ? 1.2393 0.9819 0.7802 0.0980  0.0421  -0.1280 440 ASP B CA  
3739 C C   . ASP B 180 ? 1.2721 0.9849 0.8392 0.0681  0.0184  -0.1275 440 ASP B C   
3740 O O   . ASP B 180 ? 1.3308 0.9903 0.8701 0.0630  0.0007  -0.1444 440 ASP B O   
3741 C CB  . ASP B 180 ? 1.2560 1.0373 0.7869 0.0889  0.0445  -0.1169 440 ASP B CB  
3742 C CG  . ASP B 180 ? 1.3385 1.1558 0.8419 0.1157  0.0685  -0.1154 440 ASP B CG  
3743 O OD1 . ASP B 180 ? 1.4239 1.2239 0.8997 0.1452  0.0798  -0.1311 440 ASP B OD1 
3744 O OD2 . ASP B 180 ? 1.3103 1.1741 0.8190 0.1075  0.0752  -0.0983 440 ASP B OD2 
3745 N N   . VAL B 181 ? 1.2505 0.9998 0.8712 0.0489  0.0176  -0.1080 441 VAL B N   
3746 C CA  . VAL B 181 ? 1.2403 0.9744 0.8924 0.0212  -0.0025 -0.1053 441 VAL B CA  
3747 C C   . VAL B 181 ? 1.1606 0.9081 0.8591 0.0201  0.0040  -0.0945 441 VAL B C   
3748 O O   . VAL B 181 ? 1.1185 0.9087 0.8451 0.0281  0.0191  -0.0797 441 VAL B O   
3749 C CB  . VAL B 181 ? 1.0968 0.8621 0.7686 -0.0022 -0.0144 -0.0934 441 VAL B CB  
3750 C CG1 . VAL B 181 ? 1.0126 0.7791 0.7275 -0.0271 -0.0308 -0.0878 441 VAL B CG1 
3751 C CG2 . VAL B 181 ? 1.1799 0.9216 0.8041 -0.0052 -0.0262 -0.1058 441 VAL B CG2 
3752 N N   . ILE B 182 ? 1.1620 0.8721 0.8669 0.0097  -0.0083 -0.1014 442 ILE B N   
3753 C CA  . ILE B 182 ? 1.1276 0.8492 0.8766 0.0034  -0.0056 -0.0903 442 ILE B CA  
3754 C C   . ILE B 182 ? 1.1037 0.8213 0.8782 -0.0263 -0.0252 -0.0875 442 ILE B C   
3755 O O   . ILE B 182 ? 1.0941 0.7717 0.8473 -0.0383 -0.0414 -0.0993 442 ILE B O   
3756 C CB  . ILE B 182 ? 1.1236 0.8041 0.8586 0.0184  -0.0016 -0.0992 442 ILE B CB  
3757 C CG1 . ILE B 182 ? 1.1734 0.8520 0.8771 0.0516  0.0160  -0.1069 442 ILE B CG1 
3758 C CG2 . ILE B 182 ? 1.0426 0.7395 0.8231 0.0119  0.0023  -0.0855 442 ILE B CG2 
3759 C CD1 . ILE B 182 ? 1.2326 0.8527 0.9013 0.0674  0.0117  -0.1241 442 ILE B CD1 
3760 N N   . LEU B 183 ? 1.0344 0.7952 0.8547 -0.0375 -0.0245 -0.0720 443 LEU B N   
3761 C CA  . LEU B 183 ? 0.9747 0.7390 0.8259 -0.0617 -0.0395 -0.0684 443 LEU B CA  
3762 C C   . LEU B 183 ? 0.9523 0.7216 0.8323 -0.0584 -0.0308 -0.0599 443 LEU B C   
3763 O O   . LEU B 183 ? 0.9524 0.7489 0.8495 -0.0434 -0.0161 -0.0501 443 LEU B O   
3764 C CB  . LEU B 183 ? 0.9356 0.7442 0.8158 -0.0746 -0.0475 -0.0590 443 LEU B CB  
3765 C CG  . LEU B 183 ? 0.9917 0.7990 0.8430 -0.0768 -0.0556 -0.0648 443 LEU B CG  
3766 C CD1 . LEU B 183 ? 0.9020 0.7482 0.7844 -0.0914 -0.0681 -0.0557 443 LEU B CD1 
3767 C CD2 . LEU B 183 ? 1.0675 0.8265 0.8816 -0.0852 -0.0698 -0.0818 443 LEU B CD2 
3768 N N   . TRP B 184 ? 0.9800 0.7220 0.8636 -0.0727 -0.0403 -0.0630 444 TRP B N   
3769 C CA  . TRP B 184 ? 0.9929 0.7392 0.9033 -0.0731 -0.0340 -0.0537 444 TRP B CA  
3770 C C   . TRP B 184 ? 0.9699 0.7364 0.9138 -0.0987 -0.0465 -0.0475 444 TRP B C   
3771 O O   . TRP B 184 ? 0.9915 0.7368 0.9261 -0.1177 -0.0617 -0.0541 444 TRP B O   
3772 C CB  . TRP B 184 ? 1.0333 0.7257 0.9142 -0.0653 -0.0331 -0.0616 444 TRP B CB  
3773 C CG  . TRP B 184 ? 1.0180 0.7133 0.9206 -0.0595 -0.0236 -0.0514 444 TRP B CG  
3774 C CD1 . TRP B 184 ? 0.9569 0.6738 0.8952 -0.0758 -0.0260 -0.0395 444 TRP B CD1 
3775 C CD2 . TRP B 184 ? 1.0696 0.7460 0.9580 -0.0348 -0.0108 -0.0528 444 TRP B CD2 
3776 N NE1 . TRP B 184 ? 0.9602 0.6701 0.9056 -0.0636 -0.0158 -0.0327 444 TRP B NE1 
3777 C CE2 . TRP B 184 ? 1.0253 0.7100 0.9416 -0.0384 -0.0070 -0.0408 444 TRP B CE2 
3778 C CE3 . TRP B 184 ? 1.1203 0.7756 0.9748 -0.0085 -0.0023 -0.0634 444 TRP B CE3 
3779 C CZ2 . TRP B 184 ? 1.0277 0.6974 0.9395 -0.0175 0.0037  -0.0390 444 TRP B CZ2 
3780 C CZ3 . TRP B 184 ? 1.1232 0.7662 0.9749 0.0133  0.0088  -0.0624 444 TRP B CZ3 
3781 C CH2 . TRP B 184 ? 1.0703 0.7190 0.9507 0.0082  0.0110  -0.0502 444 TRP B CH2 
3782 N N   . LEU B 185 ? 0.8879 0.6966 0.8707 -0.0985 -0.0405 -0.0350 445 LEU B N   
3783 C CA  . LEU B 185 ? 0.8870 0.7234 0.9035 -0.1191 -0.0505 -0.0293 445 LEU B CA  
3784 C C   . LEU B 185 ? 0.9028 0.7519 0.9444 -0.1168 -0.0415 -0.0183 445 LEU B C   
3785 O O   . LEU B 185 ? 0.9136 0.7524 0.9488 -0.0985 -0.0285 -0.0148 445 LEU B O   
3786 C CB  . LEU B 185 ? 0.8569 0.7385 0.8962 -0.1214 -0.0571 -0.0268 445 LEU B CB  
3787 C CG  . LEU B 185 ? 0.8337 0.7496 0.8900 -0.1035 -0.0477 -0.0178 445 LEU B CG  
3788 C CD1 . LEU B 185 ? 0.7861 0.7409 0.8841 -0.1055 -0.0480 -0.0077 445 LEU B CD1 
3789 C CD2 . LEU B 185 ? 0.7547 0.6862 0.8037 -0.1023 -0.0554 -0.0200 445 LEU B CD2 
3790 N N   . GLY B 186 ? 0.8870 0.7584 0.9558 -0.1350 -0.0485 -0.0130 446 GLY B N   
3791 C CA  . GLY B 186 ? 0.8416 0.7357 0.9373 -0.1322 -0.0401 -0.0013 446 GLY B CA  
3792 C C   . GLY B 186 ? 0.8201 0.7158 0.9290 -0.1536 -0.0449 0.0040  446 GLY B C   
3793 O O   . GLY B 186 ? 0.8343 0.7196 0.9379 -0.1743 -0.0570 -0.0005 446 GLY B O   
3794 N N   . ASP B 187 ? 0.8302 0.7411 0.9569 -0.1488 -0.0358 0.0148  447 ASP B N   
3795 C CA  . ASP B 187 ? 0.9012 0.8124 1.0376 -0.1679 -0.0371 0.0233  447 ASP B CA  
3796 C C   . ASP B 187 ? 0.9172 0.7706 1.0232 -0.1671 -0.0339 0.0249  447 ASP B C   
3797 O O   . ASP B 187 ? 0.9230 0.7696 1.0297 -0.1559 -0.0242 0.0327  447 ASP B O   
3798 C CB  . ASP B 187 ? 0.8979 0.8571 1.0671 -0.1621 -0.0296 0.0340  447 ASP B CB  
3799 C CG  . ASP B 187 ? 0.9998 0.9723 1.1824 -0.1839 -0.0307 0.0440  447 ASP B CG  
3800 O OD1 . ASP B 187 ? 1.0619 0.9975 1.2262 -0.2030 -0.0360 0.0456  447 ASP B OD1 
3801 O OD2 . ASP B 187 ? 1.0105 1.0315 1.2214 -0.1822 -0.0270 0.0507  447 ASP B OD2 
3802 N N   . LEU B 188 ? 0.9517 0.7610 1.0295 -0.1781 -0.0441 0.0166  448 LEU B N   
3803 C CA  . LEU B 188 ? 1.0243 0.7712 1.0680 -0.1758 -0.0454 0.0151  448 LEU B CA  
3804 C C   . LEU B 188 ? 1.0571 0.7928 1.1063 -0.1973 -0.0489 0.0283  448 LEU B C   
3805 O O   . LEU B 188 ? 1.0705 0.7561 1.0949 -0.1944 -0.0501 0.0301  448 LEU B O   
3806 C CB  . LEU B 188 ? 1.0560 0.7573 1.0658 -0.1813 -0.0587 0.0011  448 LEU B CB  
3807 C CG  . LEU B 188 ? 1.0261 0.7384 1.0267 -0.1647 -0.0573 -0.0115 448 LEU B CG  
3808 C CD1 . LEU B 188 ? 1.1102 0.7657 1.0675 -0.1641 -0.0688 -0.0261 448 LEU B CD1 
3809 C CD2 . LEU B 188 ? 0.9660 0.6955 0.9704 -0.1349 -0.0404 -0.0102 448 LEU B CD2 
3810 N N   . ASN B 189 ? 1.0496 0.8321 1.1302 -0.2189 -0.0514 0.0373  449 ASN B N   
3811 C CA  . ASN B 189 ? 1.0851 0.8751 1.1782 -0.2388 -0.0509 0.0536  449 ASN B CA  
3812 C C   . ASN B 189 ? 1.1925 0.9276 1.2611 -0.2644 -0.0649 0.0585  449 ASN B C   
3813 O O   . ASN B 189 ? 1.2032 0.9333 1.2748 -0.2793 -0.0642 0.0738  449 ASN B O   
3814 C CB  . ASN B 189 ? 1.0599 0.8575 1.1586 -0.2183 -0.0359 0.0625  449 ASN B CB  
3815 C CG  . ASN B 189 ? 1.0180 0.8838 1.1546 -0.2210 -0.0276 0.0729  449 ASN B CG  
3816 O OD1 . ASN B 189 ? 1.0075 0.9032 1.1620 -0.2461 -0.0319 0.0814  449 ASN B OD1 
3817 N ND2 . ASN B 189 ? 1.0153 0.9073 1.1646 -0.1949 -0.0165 0.0724  449 ASN B ND2 
3818 N N   . TYR B 190 ? 1.2497 0.9426 1.2930 -0.2703 -0.0792 0.0463  450 TYR B N   
3819 C CA  . TYR B 190 ? 1.2999 0.9383 1.3199 -0.2964 -0.0971 0.0503  450 TYR B CA  
3820 C C   . TYR B 190 ? 1.3351 1.0144 1.3846 -0.3334 -0.1062 0.0618  450 TYR B C   
3821 O O   . TYR B 190 ? 1.3083 1.0449 1.3867 -0.3361 -0.1040 0.0582  450 TYR B O   
3822 C CB  . TYR B 190 ? 1.2803 0.8579 1.2608 -0.2881 -0.1112 0.0318  450 TYR B CB  
3823 C CG  . TYR B 190 ? 1.2433 0.7729 1.1894 -0.2538 -0.1047 0.0206  450 TYR B CG  
3824 C CD1 . TYR B 190 ? 1.2858 0.7490 1.1998 -0.2525 -0.1133 0.0224  450 TYR B CD1 
3825 C CD2 . TYR B 190 ? 1.1942 0.7449 1.1396 -0.2229 -0.0914 0.0083  450 TYR B CD2 
3826 C CE1 . TYR B 190 ? 1.3009 0.7228 1.1842 -0.2187 -0.1078 0.0106  450 TYR B CE1 
3827 C CE2 . TYR B 190 ? 1.2245 0.7374 1.1405 -0.1913 -0.0847 -0.0017 450 TYR B CE2 
3828 C CZ  . TYR B 190 ? 1.2698 0.7195 1.1553 -0.1881 -0.0926 -0.0015 450 TYR B CZ  
3829 O OH  . TYR B 190 ? 1.2797 0.6952 1.1373 -0.1545 -0.0863 -0.0128 450 TYR B OH  
3830 N N   . ARG B 191 ? 1.3844 1.0345 1.4266 -0.3620 -0.1176 0.0761  451 ARG B N   
3831 C CA  . ARG B 191 ? 1.3540 1.0511 1.4283 -0.3984 -0.1228 0.0923  451 ARG B CA  
3832 C C   . ARG B 191 ? 1.4092 1.0623 1.4680 -0.4317 -0.1482 0.0942  451 ARG B C   
3833 O O   . ARG B 191 ? 1.4669 1.0513 1.4882 -0.4247 -0.1631 0.0804  451 ARG B O   
3834 C CB  . ARG B 191 ? 1.3239 1.0412 1.4110 -0.4080 -0.1117 0.1145  451 ARG B CB  
3835 C CG  . ARG B 191 ? 1.2597 1.0121 1.3586 -0.3751 -0.0888 0.1140  451 ARG B CG  
3836 C CD  . ARG B 191 ? 1.1808 1.0104 1.3157 -0.3614 -0.0777 0.1059  451 ARG B CD  
3837 N NE  . ARG B 191 ? 1.1497 1.0015 1.2909 -0.3275 -0.0599 0.1028  451 ARG B NE  
3838 C CZ  . ARG B 191 ? 1.1171 1.0058 1.2754 -0.3234 -0.0466 0.1162  451 ARG B CZ  
3839 N NH1 . ARG B 191 ? 1.1497 1.0616 1.3207 -0.3511 -0.0468 0.1347  451 ARG B NH1 
3840 N NH2 . ARG B 191 ? 1.0526 0.9556 1.2149 -0.2915 -0.0334 0.1117  451 ARG B NH2 
3841 N N   . ILE B 192 ? 1.4103 1.1063 1.4991 -0.4675 -0.1536 0.1112  452 ILE B N   
3842 C CA  . ILE B 192 ? 1.4917 1.1497 1.5707 -0.5054 -0.1786 0.1194  452 ILE B CA  
3843 C C   . ILE B 192 ? 1.5600 1.1824 1.6252 -0.5248 -0.1820 0.1416  452 ILE B C   
3844 O O   . ILE B 192 ? 1.5090 1.1767 1.5947 -0.5247 -0.1640 0.1574  452 ILE B O   
3845 C CB  . ILE B 192 ? 1.4645 1.1951 1.5875 -0.5359 -0.1835 0.1270  452 ILE B CB  
3846 C CG1 . ILE B 192 ? 1.3720 1.1546 1.5159 -0.5126 -0.1754 0.1073  452 ILE B CG1 
3847 C CG2 . ILE B 192 ? 1.5490 1.2348 1.6601 -0.5732 -0.2133 0.1316  452 ILE B CG2 
3848 C CD1 . ILE B 192 ? 1.3708 1.0944 1.4790 -0.4911 -0.1869 0.0830  452 ILE B CD1 
3849 N N   . GLU B 193 ? 1.6847 1.2231 1.7127 -0.5405 -0.2068 0.1423  453 GLU B N   
3850 C CA  . GLU B 193 ? 1.7570 1.2462 1.7651 -0.5611 -0.2164 0.1632  453 GLU B CA  
3851 C C   . GLU B 193 ? 1.7728 1.2520 1.7885 -0.6131 -0.2421 0.1822  453 GLU B C   
3852 O O   . GLU B 193 ? 1.7388 1.2417 1.7719 -0.6295 -0.2535 0.1762  453 GLU B O   
3853 C CB  . GLU B 193 ? 1.8417 1.2318 1.7954 -0.5337 -0.2273 0.1482  453 GLU B CB  
3854 C CG  . GLU B 193 ? 1.9267 1.2429 1.8450 -0.5368 -0.2567 0.1300  453 GLU B CG  
3855 C CD  . GLU B 193 ? 1.9881 1.2247 1.8561 -0.4963 -0.2611 0.1071  453 GLU B CD  
3856 O OE1 . GLU B 193 ? 1.9526 1.2147 1.8220 -0.4566 -0.2391 0.0901  453 GLU B OE1 
3857 O OE2 . GLU B 193 ? 2.0683 1.2171 1.8952 -0.5040 -0.2881 0.1057  453 GLU B OE2 
3858 N N   . GLU B 194 ? 1.8150 1.2593 1.8182 -0.6396 -0.2522 0.2061  454 GLU B N   
3859 C CA  . GLU B 194 ? 1.8533 1.2863 1.8636 -0.6926 -0.2777 0.2289  454 GLU B CA  
3860 C C   . GLU B 194 ? 1.8167 1.3581 1.8848 -0.7224 -0.2659 0.2455  454 GLU B C   
3861 O O   . GLU B 194 ? 1.8104 1.3958 1.9004 -0.7500 -0.2579 0.2738  454 GLU B O   
3862 C CB  . GLU B 194 ? 1.8948 1.2477 1.8728 -0.7005 -0.3121 0.2128  454 GLU B CB  
3863 N N   . LEU B 195 ? 1.8005 1.3859 1.8921 -0.7153 -0.2648 0.2276  455 LEU B N   
3864 C CA  . LEU B 195 ? 1.7809 1.4643 1.9268 -0.7437 -0.2595 0.2396  455 LEU B CA  
3865 C C   . LEU B 195 ? 1.7679 1.5467 1.9528 -0.7452 -0.2295 0.2586  455 LEU B C   
3866 O O   . LEU B 195 ? 1.7633 1.5507 1.9408 -0.7110 -0.2066 0.2532  455 LEU B O   
3867 C CB  . LEU B 195 ? 1.7211 1.4381 1.8833 -0.7220 -0.2579 0.2123  455 LEU B CB  
3868 C CG  . LEU B 195 ? 1.7678 1.4058 1.8965 -0.7211 -0.2873 0.1917  455 LEU B CG  
3869 C CD1 . LEU B 195 ? 1.7067 1.3982 1.8624 -0.7111 -0.2863 0.1722  455 LEU B CD1 
3870 C CD2 . LEU B 195 ? 1.8588 1.4431 1.9756 -0.7691 -0.3211 0.2102  455 LEU B CD2 
3871 N N   . ASP B 196 ? 1.7744 1.6273 2.0016 -0.7843 -0.2302 0.2804  456 ASP B N   
3872 C CA  . ASP B 196 ? 1.7503 1.6980 2.0142 -0.7906 -0.2036 0.3011  456 ASP B CA  
3873 C C   . ASP B 196 ? 1.7121 1.7435 2.0075 -0.7518 -0.1776 0.2809  456 ASP B C   
3874 O O   . ASP B 196 ? 1.6845 1.7046 1.9769 -0.7255 -0.1815 0.2534  456 ASP B O   
3875 C CB  . ASP B 196 ? 1.7371 1.7433 2.0377 -0.8453 -0.2129 0.3309  456 ASP B CB  
3876 N N   . VAL B 197 ? 1.6994 1.8122 2.0224 -0.7480 -0.1524 0.2950  457 VAL B N   
3877 C CA  . VAL B 197 ? 1.6379 1.8337 1.9918 -0.7121 -0.1294 0.2779  457 VAL B CA  
3878 C C   . VAL B 197 ? 1.6226 1.9014 2.0238 -0.7285 -0.1339 0.2742  457 VAL B C   
3879 O O   . VAL B 197 ? 1.6011 1.8969 2.0129 -0.7022 -0.1347 0.2485  457 VAL B O   
3880 C CB  . VAL B 197 ? 1.8411 2.0944 2.2055 -0.6995 -0.1021 0.2927  457 VAL B CB  
3881 C CG1 . VAL B 197 ? 1.7713 2.1409 2.1838 -0.6849 -0.0839 0.2862  457 VAL B CG1 
3882 C CG2 . VAL B 197 ? 1.8284 2.0198 2.1549 -0.6581 -0.0920 0.2801  457 VAL B CG2 
3883 N N   . GLU B 198 ? 1.6223 1.9529 2.0519 -0.7725 -0.1377 0.3006  458 GLU B N   
3884 C CA  . GLU B 198 ? 1.5656 1.9814 2.0442 -0.7919 -0.1427 0.3001  458 GLU B CA  
3885 C C   . GLU B 198 ? 1.5708 1.9354 2.0423 -0.7978 -0.1701 0.2809  458 GLU B C   
3886 O O   . GLU B 198 ? 1.5146 1.9349 2.0176 -0.7884 -0.1722 0.2642  458 GLU B O   
3887 C CB  . GLU B 198 ? 1.5785 2.0503 2.0852 -0.8431 -0.1437 0.3360  458 GLU B CB  
3888 N N   . LYS B 199 ? 1.6362 1.8931 2.0641 -0.8113 -0.1920 0.2823  459 LYS B N   
3889 C CA  . LYS B 199 ? 1.6702 1.8697 2.0859 -0.8228 -0.2216 0.2676  459 LYS B CA  
3890 C C   . LYS B 199 ? 1.6584 1.8303 2.0574 -0.7777 -0.2214 0.2316  459 LYS B C   
3891 O O   . LYS B 199 ? 1.6332 1.8138 2.0455 -0.7808 -0.2372 0.2166  459 LYS B O   
3892 C CB  . LYS B 199 ? 1.7356 1.8239 2.1051 -0.8485 -0.2467 0.2793  459 LYS B CB  
3893 N N   . VAL B 200 ? 1.6670 1.8057 2.0369 -0.7370 -0.2043 0.2190  460 VAL B N   
3894 C CA  . VAL B 200 ? 1.6302 1.7414 1.9815 -0.6940 -0.2025 0.1875  460 VAL B CA  
3895 C C   . VAL B 200 ? 1.5572 1.7608 1.9523 -0.6778 -0.1934 0.1738  460 VAL B C   
3896 O O   . VAL B 200 ? 1.5591 1.7495 1.9503 -0.6627 -0.2045 0.1515  460 VAL B O   
3897 C CB  . VAL B 200 ? 1.7197 1.7894 2.0375 -0.6548 -0.1838 0.1802  460 VAL B CB  
3898 C CG1 . VAL B 200 ? 1.6761 1.7372 1.9830 -0.6112 -0.1786 0.1506  460 VAL B CG1 
3899 C CG2 . VAL B 200 ? 1.7870 1.7541 2.0561 -0.6643 -0.1968 0.1876  460 VAL B CG2 
3900 N N   . LYS B 201 ? 1.4898 1.7857 1.9248 -0.6804 -0.1743 0.1869  461 LYS B N   
3901 C CA  . LYS B 201 ? 1.3994 1.7877 1.8770 -0.6626 -0.1658 0.1739  461 LYS B CA  
3902 C C   . LYS B 201 ? 1.4196 1.8426 1.9283 -0.6896 -0.1868 0.1709  461 LYS B C   
3903 O O   . LYS B 201 ? 1.3651 1.8206 1.8909 -0.6696 -0.1912 0.1499  461 LYS B O   
3904 C CB  . LYS B 201 ? 1.3224 1.8012 1.8328 -0.6590 -0.1413 0.1892  461 LYS B CB  
3905 C CG  . LYS B 201 ? 1.2816 1.7355 1.7654 -0.6271 -0.1205 0.1894  461 LYS B CG  
3906 C CD  . LYS B 201 ? 1.2368 1.7757 1.7487 -0.6274 -0.0981 0.2067  461 LYS B CD  
3907 C CE  . LYS B 201 ? 1.2182 1.7205 1.6995 -0.6030 -0.0808 0.2113  461 LYS B CE  
3908 N NZ  . LYS B 201 ? 1.2044 1.7883 1.7096 -0.6021 -0.0594 0.2276  461 LYS B NZ  
3909 N N   . LYS B 202 ? 1.4923 1.9063 2.0077 -0.7354 -0.2014 0.1925  462 LYS B N   
3910 C CA  . LYS B 202 ? 1.5118 1.9538 2.0569 -0.7662 -0.2242 0.1924  462 LYS B CA  
3911 C C   . LYS B 202 ? 1.5308 1.8857 2.0418 -0.7614 -0.2504 0.1710  462 LYS B C   
3912 O O   . LYS B 202 ? 1.5434 1.9194 2.0764 -0.7755 -0.2696 0.1630  462 LYS B O   
3913 C CB  . LYS B 202 ? 1.5523 2.0109 2.1155 -0.8197 -0.2333 0.2249  462 LYS B CB  
3914 N N   . LEU B 203 ? 1.5239 1.7826 1.9808 -0.7410 -0.2513 0.1618  463 LEU B N   
3915 C CA  . LEU B 203 ? 1.5087 1.6856 1.9271 -0.7275 -0.2718 0.1386  463 LEU B CA  
3916 C C   . LEU B 203 ? 1.4475 1.6513 1.8695 -0.6846 -0.2621 0.1121  463 LEU B C   
3917 O O   . LEU B 203 ? 1.4173 1.6041 1.8343 -0.6800 -0.2799 0.0939  463 LEU B O   
3918 C CB  . LEU B 203 ? 1.5028 1.5714 1.8621 -0.7197 -0.2756 0.1385  463 LEU B CB  
3919 C CG  . LEU B 203 ? 1.5129 1.5302 1.8579 -0.7624 -0.2943 0.1617  463 LEU B CG  
3920 C CD1 . LEU B 203 ? 1.5254 1.4537 1.8181 -0.7486 -0.2909 0.1640  463 LEU B CD1 
3921 C CD2 . LEU B 203 ? 1.5442 1.5181 1.8815 -0.7888 -0.3290 0.1556  463 LEU B CD2 
3922 N N   . ILE B 204 ? 1.4324 1.6752 1.8613 -0.6539 -0.2356 0.1106  464 ILE B N   
3923 C CA  . ILE B 204 ? 1.4066 1.6847 1.8445 -0.6152 -0.2268 0.0887  464 ILE B CA  
3924 C C   . ILE B 204 ? 1.3972 1.7635 1.8865 -0.6247 -0.2343 0.0845  464 ILE B C   
3925 O O   . ILE B 204 ? 1.3826 1.7572 1.8749 -0.6048 -0.2430 0.0638  464 ILE B O   
3926 C CB  . ILE B 204 ? 1.3432 1.6492 1.7817 -0.5833 -0.1988 0.0906  464 ILE B CB  
3927 N N   . GLU B 205 ? 1.3849 1.8176 1.9141 -0.6552 -0.2318 0.1046  465 GLU B N   
3928 C CA  . GLU B 205 ? 1.3476 1.8663 1.9284 -0.6688 -0.2409 0.1025  465 GLU B CA  
3929 C C   . GLU B 205 ? 1.3994 1.8753 1.9728 -0.6891 -0.2717 0.0928  465 GLU B C   
3930 O O   . GLU B 205 ? 1.3836 1.8781 1.9678 -0.6727 -0.2826 0.0725  465 GLU B O   
3931 C CB  . GLU B 205 ? 1.3293 1.9266 1.9525 -0.7015 -0.2316 0.1292  465 GLU B CB  
3932 C CG  . GLU B 205 ? 1.2800 1.9537 1.9254 -0.6784 -0.2026 0.1347  465 GLU B CG  
3933 N N   . GLU B 206 ? 1.4558 1.8706 2.0088 -0.7242 -0.2875 0.1072  466 GLU B N   
3934 C CA  . GLU B 206 ? 1.4930 1.8574 2.0342 -0.7454 -0.3196 0.0989  466 GLU B CA  
3935 C C   . GLU B 206 ? 1.5131 1.7856 1.9994 -0.7157 -0.3292 0.0741  466 GLU B C   
3936 O O   . GLU B 206 ? 1.5609 1.7859 2.0305 -0.7267 -0.3556 0.0635  466 GLU B O   
3937 C CB  . GLU B 206 ? 1.5486 1.8732 2.0836 -0.7928 -0.3363 0.1228  466 GLU B CB  
3938 N N   . LYS B 207 ? 1.4633 1.7124 1.9217 -0.6788 -0.3079 0.0659  467 LYS B N   
3939 C CA  . LYS B 207 ? 1.4082 1.5922 1.8215 -0.6447 -0.3110 0.0423  467 LYS B CA  
3940 C C   . LYS B 207 ? 1.4655 1.5402 1.8229 -0.6526 -0.3302 0.0374  467 LYS B C   
3941 O O   . LYS B 207 ? 1.4366 1.4637 1.7620 -0.6347 -0.3420 0.0173  467 LYS B O   
3942 C CB  . LYS B 207 ? 1.3303 1.5566 1.7648 -0.6295 -0.3214 0.0224  467 LYS B CB  
3943 C CG  . LYS B 207 ? 1.2538 1.5757 1.7325 -0.6083 -0.3023 0.0208  467 LYS B CG  
3944 N N   . ASP B 208 ? 1.5518 1.5859 1.8950 -0.6779 -0.3335 0.0557  468 ASP B N   
3945 C CA  . ASP B 208 ? 1.6461 1.5729 1.9342 -0.6845 -0.3532 0.0514  468 ASP B CA  
3946 C C   . ASP B 208 ? 1.6541 1.5250 1.8972 -0.6513 -0.3341 0.0463  468 ASP B C   
3947 O O   . ASP B 208 ? 1.6888 1.5321 1.9194 -0.6602 -0.3274 0.0621  468 ASP B O   
3948 C CB  . ASP B 208 ? 1.7105 1.6187 2.0066 -0.7314 -0.3719 0.0744  468 ASP B CB  
3949 C CG  . ASP B 208 ? 1.8238 1.6284 2.0712 -0.7446 -0.4045 0.0666  468 ASP B CG  
3950 O OD1 . ASP B 208 ? 1.8509 1.5773 2.0440 -0.7165 -0.4042 0.0512  468 ASP B OD1 
3951 O OD2 . ASP B 208 ? 1.8886 1.6911 2.1523 -0.7831 -0.4313 0.0761  468 ASP B OD2 
3952 N N   . PHE B 209 ? 1.6054 1.4612 1.8250 -0.6136 -0.3261 0.0249  469 PHE B N   
3953 C CA  . PHE B 209 ? 1.5587 1.3749 1.7419 -0.5788 -0.3058 0.0191  469 PHE B CA  
3954 C C   . PHE B 209 ? 1.6280 1.3391 1.7506 -0.5741 -0.3200 0.0113  469 PHE B C   
3955 O O   . PHE B 209 ? 1.6408 1.3142 1.7349 -0.5537 -0.3057 0.0120  469 PHE B O   
3956 C CB  . PHE B 209 ? 1.4611 1.3080 1.6453 -0.5413 -0.2912 0.0016  469 PHE B CB  
3957 C CG  . PHE B 209 ? 1.3711 1.3170 1.6106 -0.5388 -0.2775 0.0066  469 PHE B CG  
3958 C CD1 . PHE B 209 ? 1.3180 1.3139 1.5866 -0.5412 -0.2570 0.0238  469 PHE B CD1 
3959 C CD2 . PHE B 209 ? 1.3375 1.3249 1.5976 -0.5323 -0.2861 -0.0067 469 PHE B CD2 
3960 C CE1 . PHE B 209 ? 1.2600 1.3470 1.5771 -0.5360 -0.2454 0.0266  469 PHE B CE1 
3961 C CE2 . PHE B 209 ? 1.2634 1.3404 1.5730 -0.5272 -0.2757 -0.0040 469 PHE B CE2 
3962 C CZ  . PHE B 209 ? 1.2262 1.3534 1.5639 -0.5282 -0.2552 0.0121  469 PHE B CZ  
3963 N N   . GLN B 210 ? 1.6463 1.3101 1.7487 -0.5914 -0.3493 0.0028  470 GLN B N   
3964 C CA  . GLN B 210 ? 1.6796 1.2412 1.7214 -0.5852 -0.3667 -0.0076 470 GLN B CA  
3965 C C   . GLN B 210 ? 1.7379 1.2562 1.7680 -0.6058 -0.3718 0.0109  470 GLN B C   
3966 O O   . GLN B 210 ? 1.7800 1.2236 1.7619 -0.5882 -0.3737 0.0043  470 GLN B O   
3967 C CB  . GLN B 210 ? 1.6998 1.2231 1.7246 -0.6011 -0.3998 -0.0203 470 GLN B CB  
3968 N N   . MET B 211 ? 1.7333 1.3008 1.8078 -0.6426 -0.3743 0.0342  471 MET B N   
3969 C CA  . MET B 211 ? 1.7601 1.2924 1.8277 -0.6686 -0.3813 0.0559  471 MET B CA  
3970 C C   . MET B 211 ? 1.7232 1.2846 1.7995 -0.6513 -0.3496 0.0680  471 MET B C   
3971 O O   . MET B 211 ? 1.7651 1.2765 1.8183 -0.6586 -0.3526 0.0803  471 MET B O   
3972 C CB  . MET B 211 ? 1.7477 1.3211 1.8585 -0.7197 -0.3993 0.0783  471 MET B CB  
3973 N N   . LEU B 212 ? 1.6606 1.2993 1.7687 -0.6281 -0.3216 0.0645  472 LEU B N   
3974 C CA  . LEU B 212 ? 1.6459 1.3116 1.7606 -0.6075 -0.2920 0.0735  472 LEU B CA  
3975 C C   . LEU B 212 ? 1.6879 1.2858 1.7521 -0.5673 -0.2838 0.0567  472 LEU B C   
3976 O O   . LEU B 212 ? 1.7258 1.2979 1.7744 -0.5582 -0.2727 0.0655  472 LEU B O   
3977 C CB  . LEU B 212 ? 1.5374 1.3050 1.7010 -0.5945 -0.2679 0.0740  472 LEU B CB  
3978 C CG  . LEU B 212 ? 1.4746 1.2835 1.6551 -0.5830 -0.2402 0.0888  472 LEU B CG  
3979 N N   . TYR B 213 ? 1.6850 1.2558 1.7240 -0.5441 -0.2900 0.0331  473 TYR B N   
3980 C CA  . TYR B 213 ? 1.7112 1.2250 1.7029 -0.5044 -0.2822 0.0151  473 TYR B CA  
3981 C C   . TYR B 213 ? 1.8160 1.2332 1.7577 -0.5063 -0.2995 0.0143  473 TYR B C   
3982 O O   . TYR B 213 ? 1.8139 1.1912 1.7231 -0.4757 -0.2885 0.0065  473 TYR B O   
3983 C CB  . TYR B 213 ? 1.6869 1.1979 1.6636 -0.4849 -0.2878 -0.0081 473 TYR B CB  
3984 C CG  . TYR B 213 ? 1.6806 1.1437 1.6106 -0.4436 -0.2786 -0.0273 473 TYR B CG  
3985 C CD1 . TYR B 213 ? 1.6078 1.1025 1.5445 -0.4128 -0.2501 -0.0273 473 TYR B CD1 
3986 C CD2 . TYR B 213 ? 1.7256 1.1144 1.6049 -0.4353 -0.2989 -0.0454 473 TYR B CD2 
3987 C CE1 . TYR B 213 ? 1.6211 1.0786 1.5181 -0.3760 -0.2409 -0.0435 473 TYR B CE1 
3988 C CE2 . TYR B 213 ? 1.7260 1.0775 1.5628 -0.3965 -0.2891 -0.0630 473 TYR B CE2 
3989 C CZ  . TYR B 213 ? 1.6896 1.0778 1.5369 -0.3678 -0.2595 -0.0612 473 TYR B CZ  
3990 O OH  . TYR B 213 ? 1.7073 1.0647 1.5155 -0.3305 -0.2490 -0.0770 473 TYR B OH  
3991 N N   . ALA B 214 ? 1.9198 1.2989 1.8554 -0.5420 -0.3282 0.0222  474 ALA B N   
3992 C CA  . ALA B 214 ? 2.0343 1.3216 1.9253 -0.5479 -0.3484 0.0245  474 ALA B CA  
3993 C C   . ALA B 214 ? 2.0481 1.3369 1.9417 -0.5412 -0.3296 0.0406  474 ALA B C   
3994 O O   . ALA B 214 ? 2.0950 1.3172 1.9460 -0.5176 -0.3311 0.0324  474 ALA B O   
3995 C CB  . ALA B 214 ? 2.0772 1.3362 1.9725 -0.5951 -0.3823 0.0375  474 ALA B CB  
3996 N N   . TYR B 215 ? 1.9909 1.3575 1.9341 -0.5602 -0.3121 0.0624  475 TYR B N   
3997 C CA  . TYR B 215 ? 1.9897 1.3638 1.9389 -0.5592 -0.2954 0.0809  475 TYR B CA  
3998 C C   . TYR B 215 ? 1.8901 1.3176 1.8544 -0.5204 -0.2603 0.0749  475 TYR B C   
3999 O O   . TYR B 215 ? 1.8652 1.3304 1.8510 -0.5221 -0.2421 0.0921  475 TYR B O   
4000 C CB  . TYR B 215 ? 2.0159 1.4408 2.0069 -0.6054 -0.2985 0.1108  475 TYR B CB  
4001 C CG  . TYR B 215 ? 2.1296 1.4903 2.1018 -0.6462 -0.3328 0.1246  475 TYR B CG  
4002 C CD1 . TYR B 215 ? 2.2223 1.5022 2.1548 -0.6480 -0.3456 0.1323  475 TYR B CD1 
4003 C CD2 . TYR B 215 ? 2.1607 1.5410 2.1556 -0.6838 -0.3545 0.1309  475 TYR B CD2 
4004 C CE1 . TYR B 215 ? 2.3300 1.5460 2.2437 -0.6868 -0.3807 0.1461  475 TYR B CE1 
4005 C CE2 . TYR B 215 ? 2.2616 1.5815 2.2402 -0.7238 -0.3888 0.1454  475 TYR B CE2 
4006 C CZ  . TYR B 215 ? 2.3464 1.5825 2.2834 -0.7255 -0.4023 0.1533  475 TYR B CZ  
4007 O OH  . TYR B 215 ? 2.4243 1.5958 2.3435 -0.7658 -0.4393 0.1684  475 TYR B OH  
4008 N N   . ASP B 216 ? 1.8158 1.2443 1.7671 -0.4859 -0.2520 0.0516  476 ASP B N   
4009 C CA  . ASP B 216 ? 1.6744 1.1529 1.6408 -0.4506 -0.2218 0.0461  476 ASP B CA  
4010 C C   . ASP B 216 ? 1.6492 1.0692 1.5744 -0.4150 -0.2143 0.0355  476 ASP B C   
4011 O O   . ASP B 216 ? 1.7013 1.0608 1.5853 -0.3981 -0.2264 0.0169  476 ASP B O   
4012 C CB  . ASP B 216 ? 1.6209 1.1432 1.6013 -0.4356 -0.2167 0.0294  476 ASP B CB  
4013 C CG  . ASP B 216 ? 1.5450 1.1066 1.5342 -0.3981 -0.1899 0.0224  476 ASP B CG  
4014 O OD1 . ASP B 216 ? 1.5068 1.1333 1.5338 -0.3983 -0.1722 0.0347  476 ASP B OD1 
4015 O OD2 . ASP B 216 ? 1.5144 1.0425 1.4720 -0.3682 -0.1870 0.0048  476 ASP B OD2 
4016 N N   . GLN B 217 ? 1.5777 1.0189 1.5142 -0.4017 -0.1941 0.0464  477 GLN B N   
4017 C CA  . GLN B 217 ? 1.5796 0.9675 1.4808 -0.3698 -0.1875 0.0391  477 GLN B CA  
4018 C C   . GLN B 217 ? 1.5619 0.9262 1.4339 -0.3314 -0.1829 0.0140  477 GLN B C   
4019 O O   . GLN B 217 ? 1.6399 0.9362 1.4693 -0.3117 -0.1906 0.0025  477 GLN B O   
4020 C CB  . GLN B 217 ? 1.5140 0.9451 1.4394 -0.3573 -0.1632 0.0530  477 GLN B CB  
4021 C CG  . GLN B 217 ? 1.5267 0.9432 1.4556 -0.3832 -0.1683 0.0762  477 GLN B CG  
4022 C CD  . GLN B 217 ? 1.4876 0.9528 1.4412 -0.3700 -0.1440 0.0891  477 GLN B CD  
4023 O OE1 . GLN B 217 ? 1.4107 0.9395 1.3925 -0.3521 -0.1248 0.0850  477 GLN B OE1 
4024 N NE2 . GLN B 217 ? 1.5500 0.9833 1.4920 -0.3790 -0.1467 0.1050  477 GLN B NE2 
4025 N N   . LEU B 218 ? 1.4498 0.8701 1.3432 -0.3201 -0.1709 0.0056  478 LEU B N   
4026 C CA  . LEU B 218 ? 1.4252 0.8299 1.2920 -0.2859 -0.1652 -0.0157 478 LEU B CA  
4027 C C   . LEU B 218 ? 1.5200 0.8596 1.3440 -0.2885 -0.1892 -0.0325 478 LEU B C   
4028 O O   . LEU B 218 ? 1.5775 0.8724 1.3618 -0.2591 -0.1890 -0.0492 478 LEU B O   
4029 C CB  . LEU B 218 ? 1.3452 0.8230 1.2441 -0.2768 -0.1500 -0.0188 478 LEU B CB  
4030 C CG  . LEU B 218 ? 1.3333 0.8085 1.2102 -0.2413 -0.1396 -0.0364 478 LEU B CG  
4031 C CD1 . LEU B 218 ? 1.3433 0.7864 1.1957 -0.2096 -0.1269 -0.0401 478 LEU B CD1 
4032 C CD2 . LEU B 218 ? 1.2726 0.8223 1.1860 -0.2348 -0.1251 -0.0344 478 LEU B CD2 
4033 N N   . LYS B 219 ? 1.5214 0.8573 1.3535 -0.3229 -0.2101 -0.0283 479 LYS B N   
4034 C CA  . LYS B 219 ? 1.5852 0.8602 1.3783 -0.3283 -0.2362 -0.0441 479 LYS B CA  
4035 C C   . LYS B 219 ? 1.6878 0.8733 1.4350 -0.3260 -0.2554 -0.0479 479 LYS B C   
4036 O O   . LYS B 219 ? 1.7383 0.8625 1.4405 -0.3146 -0.2737 -0.0667 479 LYS B O   
4037 C CB  . LYS B 219 ? 1.5832 0.8810 1.4019 -0.3681 -0.2550 -0.0366 479 LYS B CB  
4038 N N   . ILE B 220 ? 1.7044 0.8818 1.4615 -0.3364 -0.2527 -0.0304 480 ILE B N   
4039 C CA  . ILE B 220 ? 1.7870 0.8788 1.5028 -0.3356 -0.2724 -0.0312 480 ILE B CA  
4040 C C   . ILE B 220 ? 1.8171 0.8808 1.5018 -0.2891 -0.2579 -0.0463 480 ILE B C   
4041 O O   . ILE B 220 ? 1.9179 0.9050 1.5534 -0.2713 -0.2753 -0.0620 480 ILE B O   
4042 C CB  . ILE B 220 ? 1.7523 0.8477 1.4910 -0.3668 -0.2756 -0.0039 480 ILE B CB  
4043 C CG1 . ILE B 220 ? 1.7149 0.8515 1.4915 -0.4144 -0.2867 0.0143  480 ILE B CG1 
4044 C CG2 . ILE B 220 ? 1.8359 0.8351 1.5284 -0.3670 -0.3006 -0.0049 480 ILE B CG2 
4045 C CD1 . ILE B 220 ? 1.7178 0.8666 1.5180 -0.4472 -0.2880 0.0432  480 ILE B CD1 
4046 N N   . GLN B 221 ? 1.7168 0.8437 1.4309 -0.2690 -0.2270 -0.0415 481 GLN B N   
4047 C CA  . GLN B 221 ? 1.7075 0.8203 1.4007 -0.2260 -0.2104 -0.0528 481 GLN B CA  
4048 C C   . GLN B 221 ? 1.7386 0.8362 1.3984 -0.1931 -0.2085 -0.0787 481 GLN B C   
4049 O O   . GLN B 221 ? 1.7883 0.8363 1.4083 -0.1611 -0.2106 -0.0943 481 GLN B O   
4050 C CB  . GLN B 221 ? 1.5924 0.7787 1.3291 -0.2166 -0.1800 -0.0388 481 GLN B CB  
4051 C CG  . GLN B 221 ? 1.5581 0.7458 1.3149 -0.2390 -0.1806 -0.0156 481 GLN B CG  
4052 C CD  . GLN B 221 ? 1.6640 0.7650 1.3793 -0.2372 -0.2016 -0.0174 481 GLN B CD  
4053 O OE1 . GLN B 221 ? 1.6946 0.7563 1.3782 -0.2016 -0.1993 -0.0326 481 GLN B OE1 
4054 N NE2 . GLN B 221 ? 1.7167 0.7864 1.4309 -0.2757 -0.2239 -0.0020 481 GLN B NE2 
4055 N N   . VAL B 222 ? 1.6994 0.8390 1.3735 -0.2003 -0.2055 -0.0835 482 VAL B N   
4056 C CA  . VAL B 222 ? 1.7082 0.8313 1.3470 -0.1736 -0.2064 -0.1069 482 VAL B CA  
4057 C C   . VAL B 222 ? 1.7993 0.8325 1.3844 -0.1738 -0.2375 -0.1225 482 VAL B C   
4058 O O   . VAL B 222 ? 1.8453 0.8343 1.3867 -0.1392 -0.2387 -0.1416 482 VAL B O   
4059 C CB  . VAL B 222 ? 1.6357 0.8144 1.2980 -0.1864 -0.2024 -0.1077 482 VAL B CB  
4060 C CG1 . VAL B 222 ? 1.6332 0.7837 1.2513 -0.1635 -0.2087 -0.1314 482 VAL B CG1 
4061 C CG2 . VAL B 222 ? 1.4230 0.6869 1.1333 -0.1794 -0.1728 -0.0952 482 VAL B CG2 
4062 N N   . ALA B 223 ? 1.8220 0.8289 1.4110 -0.2123 -0.2635 -0.1141 483 ALA B N   
4063 C CA  . ALA B 223 ? 1.9183 0.8352 1.4580 -0.2180 -0.2984 -0.1267 483 ALA B CA  
4064 C C   . ALA B 223 ? 1.9882 0.8364 1.4899 -0.1940 -0.3061 -0.1333 483 ALA B C   
4065 O O   . ALA B 223 ? 2.0575 0.8325 1.5054 -0.1741 -0.3273 -0.1544 483 ALA B O   
4066 C CB  . ALA B 223 ? 1.9163 0.8233 1.4766 -0.2687 -0.3241 -0.1096 483 ALA B CB  
4067 N N   . ALA B 224 ? 1.9393 0.8103 1.4676 -0.1943 -0.2901 -0.1161 484 ALA B N   
4068 C CA  . ALA B 224 ? 1.9455 0.7575 1.4424 -0.1700 -0.2956 -0.1210 484 ALA B CA  
4069 C C   . ALA B 224 ? 1.9472 0.7764 1.4286 -0.1175 -0.2701 -0.1392 484 ALA B C   
4070 O O   . ALA B 224 ? 1.9562 0.7503 1.4180 -0.0921 -0.2693 -0.1437 484 ALA B O   
4071 C CB  . ALA B 224 ? 1.8681 0.6952 1.3987 -0.1944 -0.2911 -0.0938 484 ALA B CB  
4072 N N   . LYS B 225 ? 1.9426 0.8272 1.4334 -0.1022 -0.2500 -0.1486 485 LYS B N   
4073 C CA  . LYS B 225 ? 1.9312 0.8420 1.4104 -0.0554 -0.2246 -0.1639 485 LYS B CA  
4074 C C   . LYS B 225 ? 1.8775 0.8291 1.3881 -0.0396 -0.1987 -0.1508 485 LYS B C   
4075 O O   . LYS B 225 ? 1.8645 0.8249 1.3619 0.0004  -0.1818 -0.1629 485 LYS B O   
4076 C CB  . LYS B 225 ? 1.9846 0.8198 1.3995 -0.0205 -0.2421 -0.1919 485 LYS B CB  
4077 N N   . THR B 226 ? 1.8372 0.8174 1.3899 -0.0707 -0.1952 -0.1259 486 THR B N   
4078 C CA  . THR B 226 ? 1.7946 0.8061 1.3752 -0.0588 -0.1747 -0.1124 486 THR B CA  
4079 C C   . THR B 226 ? 1.7561 0.8556 1.3762 -0.0458 -0.1424 -0.1071 486 THR B C   
4080 O O   . THR B 226 ? 1.7415 0.8649 1.3733 -0.0198 -0.1232 -0.1051 486 THR B O   
4081 C CB  . THR B 226 ? 1.7412 0.7514 1.3498 -0.0967 -0.1830 -0.0869 486 THR B CB  
4082 O OG1 . THR B 226 ? 1.6459 0.7162 1.2957 -0.1309 -0.1775 -0.0718 486 THR B OG1 
4083 C CG2 . THR B 226 ? 1.8243 0.7450 1.3951 -0.1144 -0.2178 -0.0882 486 THR B CG2 
4084 N N   . VAL B 227 ? 1.7394 0.8855 1.3810 -0.0649 -0.1386 -0.1042 487 VAL B N   
4085 C CA  . VAL B 227 ? 1.6749 0.9005 1.3505 -0.0542 -0.1123 -0.1001 487 VAL B CA  
4086 C C   . VAL B 227 ? 1.6781 0.9214 1.3459 -0.0601 -0.1160 -0.1104 487 VAL B C   
4087 O O   . VAL B 227 ? 1.7533 0.9603 1.4030 -0.0818 -0.1383 -0.1154 487 VAL B O   
4088 C CB  . VAL B 227 ? 1.5407 0.8271 1.2709 -0.0781 -0.1006 -0.0764 487 VAL B CB  
4089 C CG1 . VAL B 227 ? 1.5567 0.8365 1.2977 -0.0688 -0.0927 -0.0651 487 VAL B CG1 
4090 C CG2 . VAL B 227 ? 1.5270 0.8116 1.2716 -0.1204 -0.1183 -0.0661 487 VAL B CG2 
4091 N N   . PHE B 228 ? 1.6009 0.8997 1.2827 -0.0419 -0.0953 -0.1123 488 PHE B N   
4092 C CA  . PHE B 228 ? 1.5731 0.8979 1.2516 -0.0473 -0.0963 -0.1193 488 PHE B CA  
4093 C C   . PHE B 228 ? 1.6355 0.9032 1.2593 -0.0367 -0.1132 -0.1414 488 PHE B C   
4094 O O   . PHE B 228 ? 1.5668 0.8322 1.1835 -0.0548 -0.1265 -0.1460 488 PHE B O   
4095 C CB  . PHE B 228 ? 1.5303 0.8887 1.2462 -0.0859 -0.1048 -0.1055 488 PHE B CB  
4096 C CG  . PHE B 228 ? 1.4511 0.8788 1.2192 -0.0916 -0.0868 -0.0873 488 PHE B CG  
4097 C CD1 . PHE B 228 ? 1.3881 0.8722 1.1748 -0.0813 -0.0721 -0.0859 488 PHE B CD1 
4098 C CD2 . PHE B 228 ? 1.4183 0.8535 1.2150 -0.1074 -0.0861 -0.0713 488 PHE B CD2 
4099 C CE1 . PHE B 228 ? 1.2828 0.8270 1.1159 -0.0852 -0.0586 -0.0701 488 PHE B CE1 
4100 C CE2 . PHE B 228 ? 1.3346 0.8323 1.1767 -0.1102 -0.0707 -0.0559 488 PHE B CE2 
4101 C CZ  . PHE B 228 ? 1.2617 0.8127 1.1221 -0.0985 -0.0577 -0.0560 488 PHE B CZ  
4102 N N   . GLU B 229 ? 1.7378 0.9602 1.3222 -0.0056 -0.1134 -0.1560 489 GLU B N   
4103 C CA  . GLU B 229 ? 1.8256 0.9931 1.3531 0.0111  -0.1287 -0.1797 489 GLU B CA  
4104 C C   . GLU B 229 ? 1.7950 1.0053 1.3169 0.0191  -0.1178 -0.1862 489 GLU B C   
4105 O O   . GLU B 229 ? 1.7142 0.9839 1.2571 0.0353  -0.0927 -0.1801 489 GLU B O   
4106 C CB  . GLU B 229 ? 1.8907 1.0157 1.3796 0.0510  -0.1261 -0.1955 489 GLU B CB  
4107 C CG  . GLU B 229 ? 1.9468 1.0337 1.4425 0.0480  -0.1341 -0.1876 489 GLU B CG  
4108 C CD  . GLU B 229 ? 2.0535 1.0800 1.5010 0.0867  -0.1412 -0.2081 489 GLU B CD  
4109 O OE1 . GLU B 229 ? 2.0306 1.0740 1.4902 0.1109  -0.1246 -0.2050 489 GLU B OE1 
4110 O OE2 . GLU B 229 ? 2.1290 1.0904 1.5264 0.0939  -0.1648 -0.2278 489 GLU B OE2 
4111 N N   . GLY B 230 ? 1.8385 1.0183 1.3330 0.0053  -0.1383 -0.1971 490 GLY B N   
4112 C CA  . GLY B 230 ? 1.8256 1.0353 1.3062 0.0118  -0.1323 -0.2048 490 GLY B CA  
4113 C C   . GLY B 230 ? 1.7410 1.0136 1.2668 -0.0157 -0.1267 -0.1886 490 GLY B C   
4114 O O   . GLY B 230 ? 1.7379 1.0300 1.2503 -0.0137 -0.1257 -0.1943 490 GLY B O   
4115 N N   . PHE B 231 ? 1.6527 0.9568 1.2296 -0.0401 -0.1240 -0.1690 491 PHE B N   
4116 C CA  . PHE B 231 ? 1.5493 0.9135 1.1706 -0.0644 -0.1205 -0.1547 491 PHE B CA  
4117 C C   . PHE B 231 ? 1.5814 0.9257 1.2047 -0.0978 -0.1466 -0.1560 491 PHE B C   
4118 O O   . PHE B 231 ? 1.6766 0.9638 1.2781 -0.1089 -0.1673 -0.1622 491 PHE B O   
4119 C CB  . PHE B 231 ? 1.4282 0.8394 1.1037 -0.0737 -0.1063 -0.1342 491 PHE B CB  
4120 C CG  . PHE B 231 ? 1.3682 0.8171 1.0547 -0.0456 -0.0803 -0.1290 491 PHE B CG  
4121 C CD1 . PHE B 231 ? 1.3199 0.8342 1.0412 -0.0463 -0.0659 -0.1173 491 PHE B CD1 
4122 C CD2 . PHE B 231 ? 1.3758 0.7944 1.0390 -0.0185 -0.0721 -0.1357 491 PHE B CD2 
4123 C CE1 . PHE B 231 ? 1.2821 0.8318 1.0160 -0.0226 -0.0437 -0.1107 491 PHE B CE1 
4124 C CE2 . PHE B 231 ? 1.3467 0.8034 1.0233 0.0069  -0.0486 -0.1302 491 PHE B CE2 
4125 C CZ  . PHE B 231 ? 1.3059 0.8287 1.0185 0.0039  -0.0342 -0.1170 491 PHE B CZ  
4126 N N   . THR B 232 ? 1.5094 0.9009 1.1599 -0.1142 -0.1470 -0.1496 492 THR B N   
4127 C CA  . THR B 232 ? 1.4603 0.8457 1.1224 -0.1469 -0.1705 -0.1489 492 THR B CA  
4128 C C   . THR B 232 ? 1.4021 0.8518 1.1248 -0.1685 -0.1648 -0.1307 492 THR B C   
4129 O O   . THR B 232 ? 1.3540 0.8562 1.1002 -0.1579 -0.1474 -0.1235 492 THR B O   
4130 C CB  . THR B 232 ? 1.4273 0.8070 1.0601 -0.1449 -0.1812 -0.1619 492 THR B CB  
4131 O OG1 . THR B 232 ? 1.4987 0.8229 1.0717 -0.1202 -0.1849 -0.1804 492 THR B OG1 
4132 C CG2 . THR B 232 ? 1.3860 0.7576 1.0313 -0.1786 -0.2077 -0.1621 492 THR B CG2 
4133 N N   . GLU B 233 ? 1.4052 0.8510 1.1523 -0.1984 -0.1801 -0.1231 493 GLU B N   
4134 C CA  . GLU B 233 ? 1.3634 0.8704 1.1650 -0.2205 -0.1791 -0.1090 493 GLU B CA  
4135 C C   . GLU B 233 ? 1.4283 0.9329 1.2307 -0.2440 -0.2027 -0.1151 493 GLU B C   
4136 O O   . GLU B 233 ? 1.5286 0.9779 1.2951 -0.2507 -0.2222 -0.1262 493 GLU B O   
4137 C CB  . GLU B 233 ? 1.3203 0.8341 1.1530 -0.2378 -0.1774 -0.0940 493 GLU B CB  
4138 C CG  . GLU B 233 ? 1.2863 0.8696 1.1759 -0.2563 -0.1735 -0.0797 493 GLU B CG  
4139 C CD  . GLU B 233 ? 1.3434 0.9358 1.2606 -0.2728 -0.1701 -0.0639 493 GLU B CD  
4140 O OE1 . GLU B 233 ? 1.2692 0.9177 1.2259 -0.2716 -0.1557 -0.0521 493 GLU B OE1 
4141 O OE2 . GLU B 233 ? 1.4372 0.9792 1.3347 -0.2870 -0.1830 -0.0631 493 GLU B OE2 
4142 N N   . GLY B 234 ? 1.3843 0.9476 1.2272 -0.2557 -0.2028 -0.1085 494 GLY B N   
4143 C CA  . GLY B 234 ? 1.3734 0.9425 1.2264 -0.2803 -0.2259 -0.1125 494 GLY B CA  
4144 C C   . GLY B 234 ? 1.3932 0.9616 1.2732 -0.3115 -0.2394 -0.1031 494 GLY B C   
4145 O O   . GLY B 234 ? 1.3626 0.9334 1.2578 -0.3152 -0.2293 -0.0915 494 GLY B O   
4146 N N   . GLU B 235 ? 1.4708 1.0368 1.3567 -0.3350 -0.2628 -0.1073 495 GLU B N   
4147 C CA  . GLU B 235 ? 1.5243 1.1018 1.4428 -0.3684 -0.2764 -0.0963 495 GLU B CA  
4148 C C   . GLU B 235 ? 1.4550 1.1125 1.4313 -0.3730 -0.2605 -0.0819 495 GLU B C   
4149 O O   . GLU B 235 ? 1.4122 1.1168 1.4075 -0.3605 -0.2535 -0.0847 495 GLU B O   
4150 C CB  . GLU B 235 ? 1.5605 1.1254 1.4767 -0.3915 -0.3055 -0.1043 495 GLU B CB  
4151 C CG  . GLU B 235 ? 1.6067 1.1590 1.5407 -0.4276 -0.3247 -0.0940 495 GLU B CG  
4152 C CD  . GLU B 235 ? 1.6558 1.2172 1.6040 -0.4529 -0.3521 -0.0988 495 GLU B CD  
4153 O OE1 . GLU B 235 ? 1.6528 1.2202 1.5900 -0.4413 -0.3584 -0.1121 495 GLU B OE1 
4154 O OE2 . GLU B 235 ? 1.7007 1.2640 1.6716 -0.4854 -0.3682 -0.0884 495 GLU B OE2 
4155 N N   . LEU B 236 ? 1.4306 1.1009 1.4318 -0.3894 -0.2553 -0.0666 496 LEU B N   
4156 C CA  . LEU B 236 ? 1.3513 1.0977 1.4063 -0.3953 -0.2417 -0.0530 496 LEU B CA  
4157 C C   . LEU B 236 ? 1.3700 1.1607 1.4635 -0.4243 -0.2595 -0.0502 496 LEU B C   
4158 O O   . LEU B 236 ? 1.4053 1.2018 1.5180 -0.4530 -0.2679 -0.0383 496 LEU B O   
4159 C CB  . LEU B 236 ? 1.3200 1.0634 1.3829 -0.3998 -0.2278 -0.0371 496 LEU B CB  
4160 C CG  . LEU B 236 ? 1.3167 1.0304 1.3510 -0.3684 -0.2079 -0.0390 496 LEU B CG  
4161 C CD1 . LEU B 236 ? 1.3522 1.0141 1.3650 -0.3752 -0.2074 -0.0304 496 LEU B CD1 
4162 C CD2 . LEU B 236 ? 1.2726 1.0496 1.3400 -0.3498 -0.1858 -0.0325 496 LEU B CD2 
4163 N N   . THR B 237 ? 1.3412 1.1624 1.4449 -0.4169 -0.2663 -0.0608 497 THR B N   
4164 C CA  . THR B 237 ? 1.3024 1.1745 1.4461 -0.4385 -0.2825 -0.0607 497 THR B CA  
4165 C C   . THR B 237 ? 1.2030 1.1579 1.4019 -0.4412 -0.2687 -0.0486 497 THR B C   
4166 O O   . THR B 237 ? 1.1681 1.1710 1.4063 -0.4639 -0.2791 -0.0436 497 THR B O   
4167 C CB  . THR B 237 ? 1.3111 1.1885 1.4459 -0.4251 -0.2941 -0.0767 497 THR B CB  
4168 O OG1 . THR B 237 ? 1.3048 1.2005 1.4356 -0.3942 -0.2753 -0.0791 497 THR B OG1 
4169 C CG2 . THR B 237 ? 1.3250 1.1274 1.4075 -0.4260 -0.3119 -0.0897 497 THR B CG2 
4170 N N   . PHE B 238 ? 1.1680 1.1407 1.3694 -0.4169 -0.2459 -0.0445 498 PHE B N   
4171 C CA  . PHE B 238 ? 1.1114 1.1607 1.3598 -0.4123 -0.2320 -0.0355 498 PHE B CA  
4172 C C   . PHE B 238 ? 1.1168 1.1760 1.3785 -0.4254 -0.2180 -0.0176 498 PHE B C   
4173 O O   . PHE B 238 ? 1.1454 1.1472 1.3750 -0.4270 -0.2133 -0.0124 498 PHE B O   
4174 C CB  . PHE B 238 ? 1.0576 1.1239 1.3033 -0.3782 -0.2180 -0.0411 498 PHE B CB  
4175 C CG  . PHE B 238 ? 1.0763 1.0904 1.2835 -0.3582 -0.2021 -0.0397 498 PHE B CG  
4176 C CD1 . PHE B 238 ? 1.0385 1.0579 1.2517 -0.3532 -0.1833 -0.0271 498 PHE B CD1 
4177 C CD2 . PHE B 238 ? 1.1144 1.0775 1.2798 -0.3430 -0.2058 -0.0511 498 PHE B CD2 
4178 C CE1 . PHE B 238 ? 1.0343 1.0085 1.2145 -0.3333 -0.1695 -0.0265 498 PHE B CE1 
4179 C CE2 . PHE B 238 ? 1.1145 1.0361 1.2471 -0.3230 -0.1905 -0.0503 498 PHE B CE2 
4180 C CZ  . PHE B 238 ? 1.0863 1.0133 1.2274 -0.3181 -0.1729 -0.0383 498 PHE B CZ  
4181 N N   . GLN B 239 ? 1.0874 1.2202 1.3953 -0.4332 -0.2119 -0.0084 499 GLN B N   
4182 C CA  . GLN B 239 ? 1.1295 1.2797 1.4523 -0.4484 -0.1991 0.0104  499 GLN B CA  
4183 C C   . GLN B 239 ? 1.1586 1.2970 1.4670 -0.4228 -0.1767 0.0155  499 GLN B C   
4184 O O   . GLN B 239 ? 1.1352 1.2768 1.4368 -0.3932 -0.1698 0.0056  499 GLN B O   
4185 C CB  . GLN B 239 ? 1.1061 1.3446 1.4825 -0.4644 -0.1988 0.0187  499 GLN B CB  
4186 C CG  . GLN B 239 ? 1.0298 1.3386 1.4366 -0.4376 -0.1857 0.0148  499 GLN B CG  
4187 C CD  . GLN B 239 ? 0.9766 1.3705 1.4316 -0.4528 -0.1802 0.0264  499 GLN B CD  
4188 O OE1 . GLN B 239 ? 0.9611 1.3884 1.4419 -0.4784 -0.1935 0.0284  499 GLN B OE1 
4189 N NE2 . GLN B 239 ? 0.9276 1.3587 1.3946 -0.4368 -0.1604 0.0343  499 GLN B NE2 
4190 N N   . PRO B 240 ? 1.1969 1.3202 1.5003 -0.4352 -0.1668 0.0319  500 PRO B N   
4191 C CA  . PRO B 240 ? 1.1747 1.2849 1.4650 -0.4138 -0.1467 0.0385  500 PRO B CA  
4192 C C   . PRO B 240 ? 1.1301 1.3004 1.4458 -0.3865 -0.1327 0.0355  500 PRO B C   
4193 O O   . PRO B 240 ? 1.1083 1.3481 1.4620 -0.3902 -0.1344 0.0353  500 PRO B O   
4194 C CB  . PRO B 240 ? 1.1944 1.3084 1.4925 -0.4404 -0.1423 0.0593  500 PRO B CB  
4195 C CG  . PRO B 240 ? 1.2312 1.3069 1.5180 -0.4718 -0.1630 0.0607  500 PRO B CG  
4196 C CD  . PRO B 240 ? 1.2317 1.3372 1.5357 -0.4724 -0.1775 0.0456  500 PRO B CD  
4197 N N   . THR B 241 ? 1.1204 1.2637 1.4154 -0.3588 -0.1201 0.0331  501 THR B N   
4198 C CA  . THR B 241 ? 1.0607 1.2470 1.3729 -0.3298 -0.1105 0.0283  501 THR B CA  
4199 C C   . THR B 241 ? 1.0213 1.2307 1.3435 -0.3196 -0.0925 0.0412  501 THR B C   
4200 O O   . THR B 241 ? 0.9630 1.1924 1.2914 -0.2931 -0.0846 0.0379  501 THR B O   
4201 C CB  . THR B 241 ? 1.0698 1.2133 1.3532 -0.3043 -0.1108 0.0161  501 THR B CB  
4202 O OG1 . THR B 241 ? 1.0895 1.1708 1.3381 -0.2996 -0.1026 0.0205  501 THR B OG1 
4203 C CG2 . THR B 241 ? 1.0778 1.2045 1.3511 -0.3115 -0.1288 0.0027  501 THR B CG2 
4204 N N   . TYR B 242 ? 1.0633 1.2688 1.3861 -0.3414 -0.0875 0.0565  502 TYR B N   
4205 C CA  . TYR B 242 ? 1.0697 1.2922 1.3976 -0.3339 -0.0708 0.0702  502 TYR B CA  
4206 C C   . TYR B 242 ? 1.1263 1.3557 1.4607 -0.3678 -0.0710 0.0877  502 TYR B C   
4207 O O   . TYR B 242 ? 1.1910 1.3770 1.5091 -0.3916 -0.0832 0.0894  502 TYR B O   
4208 C CB  . TYR B 242 ? 1.0692 1.2284 1.3626 -0.3141 -0.0628 0.0702  502 TYR B CB  
4209 C CG  . TYR B 242 ? 1.0570 1.2214 1.3498 -0.3051 -0.0473 0.0838  502 TYR B CG  
4210 C CD1 . TYR B 242 ? 1.0057 1.2134 1.3161 -0.2793 -0.0374 0.0826  502 TYR B CD1 
4211 C CD2 . TYR B 242 ? 1.0870 1.2076 1.3589 -0.3215 -0.0447 0.0976  502 TYR B CD2 
4212 C CE1 . TYR B 242 ? 1.0103 1.2198 1.3179 -0.2701 -0.0243 0.0946  502 TYR B CE1 
4213 C CE2 . TYR B 242 ? 1.0801 1.2022 1.3491 -0.3131 -0.0316 0.1103  502 TYR B CE2 
4214 C CZ  . TYR B 242 ? 1.0591 1.2263 1.3459 -0.2872 -0.0209 0.1085  502 TYR B CZ  
4215 O OH  . TYR B 242 ? 1.0640 1.2314 1.3464 -0.2783 -0.0090 0.1207  502 TYR B OH  
4216 N N   . LYS B 243 ? 1.0879 1.3702 1.4443 -0.3717 -0.0591 0.1015  503 LYS B N   
4217 C CA  . LYS B 243 ? 1.0072 1.3418 1.3820 -0.3434 -0.0465 0.0993  503 LYS B CA  
4218 C C   . LYS B 243 ? 1.0257 1.4475 1.4415 -0.3479 -0.0485 0.0968  503 LYS B C   
4219 O O   . LYS B 243 ? 1.0484 1.5040 1.4819 -0.3774 -0.0503 0.1079  503 LYS B O   
4220 C CB  . LYS B 243 ? 0.9417 1.2702 1.3069 -0.3422 -0.0315 0.1166  503 LYS B CB  
4221 C CG  . LYS B 243 ? 0.8489 1.2316 1.2317 -0.3146 -0.0193 0.1158  503 LYS B CG  
4222 C CD  . LYS B 243 ? 0.8472 1.2080 1.2125 -0.3091 -0.0058 0.1309  503 LYS B CD  
4223 C CE  . LYS B 243 ? 0.8060 1.2205 1.1874 -0.2804 0.0045  0.1292  503 LYS B CE  
4224 N NZ  . LYS B 243 ? 0.8021 1.1802 1.1615 -0.2641 0.0145  0.1375  503 LYS B NZ  
4225 N N   . TYR B 244 ? 1.0370 1.4959 1.4679 -0.3182 -0.0488 0.0827  504 TYR B N   
4226 C CA  . TYR B 244 ? 1.0518 1.5931 1.5206 -0.3152 -0.0527 0.0761  504 TYR B CA  
4227 C C   . TYR B 244 ? 1.0398 1.6382 1.5248 -0.2921 -0.0401 0.0789  504 TYR B C   
4228 O O   . TYR B 244 ? 1.0141 1.5860 1.4820 -0.2689 -0.0323 0.0795  504 TYR B O   
4229 C CB  . TYR B 244 ? 1.0486 1.5898 1.5227 -0.2987 -0.0687 0.0552  504 TYR B CB  
4230 C CG  . TYR B 244 ? 1.0843 1.5905 1.5505 -0.3222 -0.0838 0.0502  504 TYR B CG  
4231 C CD1 . TYR B 244 ? 1.0987 1.6522 1.5928 -0.3446 -0.0938 0.0493  504 TYR B CD1 
4232 C CD2 . TYR B 244 ? 1.1181 1.5456 1.5486 -0.3211 -0.0885 0.0460  504 TYR B CD2 
4233 C CE1 . TYR B 244 ? 1.1556 1.6743 1.6414 -0.3661 -0.1098 0.0443  504 TYR B CE1 
4234 C CE2 . TYR B 244 ? 1.1685 1.5614 1.5881 -0.3407 -0.1035 0.0402  504 TYR B CE2 
4235 C CZ  . TYR B 244 ? 1.1978 1.6340 1.6445 -0.3635 -0.1149 0.0395  504 TYR B CZ  
4236 O OH  . TYR B 244 ? 1.2517 1.6501 1.6862 -0.3829 -0.1316 0.0336  504 TYR B OH  
4237 N N   . ASP B 245 ? 1.0594 1.7378 1.5775 -0.2979 -0.0387 0.0801  505 ASP B N   
4238 C CA  . ASP B 245 ? 1.0643 1.8058 1.6001 -0.2702 -0.0309 0.0764  505 ASP B CA  
4239 C C   . ASP B 245 ? 1.0230 1.7614 1.5608 -0.2355 -0.0442 0.0544  505 ASP B C   
4240 O O   . ASP B 245 ? 0.9859 1.7129 1.5281 -0.2383 -0.0601 0.0416  505 ASP B O   
4241 C CB  . ASP B 245 ? 1.0718 1.9053 1.6437 -0.2834 -0.0273 0.0809  505 ASP B CB  
4242 C CG  . ASP B 245 ? 1.1073 1.9518 1.6778 -0.3171 -0.0127 0.1065  505 ASP B CG  
4243 O OD1 . ASP B 245 ? 1.1021 2.0241 1.7021 -0.3317 -0.0077 0.1136  505 ASP B OD1 
4244 O OD2 . ASP B 245 ? 1.1290 1.9060 1.6693 -0.3292 -0.0070 0.1199  505 ASP B OD2 
4245 N N   . THR B 246 ? 1.0114 1.7566 1.5444 -0.2039 -0.0395 0.0509  506 THR B N   
4246 C CA  . THR B 246 ? 0.9910 1.7227 1.5217 -0.1721 -0.0536 0.0330  506 THR B CA  
4247 C C   . THR B 246 ? 0.9640 1.7647 1.5257 -0.1589 -0.0676 0.0166  506 THR B C   
4248 O O   . THR B 246 ? 0.9670 1.8376 1.5508 -0.1556 -0.0612 0.0178  506 THR B O   
4249 C CB  . THR B 246 ? 0.9423 1.6566 1.4582 -0.1429 -0.0469 0.0351  506 THR B CB  
4250 O OG1 . THR B 246 ? 0.9787 1.6554 1.4735 -0.1569 -0.0298 0.0534  506 THR B OG1 
4251 C CG2 . THR B 246 ? 0.9028 1.5677 1.4044 -0.1215 -0.0606 0.0239  506 THR B CG2 
4252 N N   . GLY B 247 ? 0.9191 1.7004 1.4814 -0.1514 -0.0869 0.0014  507 GLY B N   
4253 C CA  . GLY B 247 ? 0.8485 1.6862 1.4381 -0.1382 -0.1045 -0.0161 507 GLY B CA  
4254 C C   . GLY B 247 ? 0.8168 1.6921 1.4285 -0.1667 -0.1074 -0.0158 507 GLY B C   
4255 O O   . GLY B 247 ? 0.7913 1.7320 1.4320 -0.1579 -0.1172 -0.0276 507 GLY B O   
4256 N N   . SER B 248 ? 0.8260 1.6599 1.4247 -0.2001 -0.1009 -0.0029 508 SER B N   
4257 C CA  . SER B 248 ? 0.8363 1.7018 1.4558 -0.2313 -0.1046 0.0001  508 SER B CA  
4258 C C   . SER B 248 ? 0.8676 1.6633 1.4637 -0.2632 -0.1059 0.0092  508 SER B C   
4259 O O   . SER B 248 ? 0.8838 1.6083 1.4469 -0.2600 -0.1022 0.0130  508 SER B O   
4260 C CB  . SER B 248 ? 0.8468 1.7830 1.4897 -0.2438 -0.0876 0.0139  508 SER B CB  
4261 O OG  . SER B 248 ? 0.8902 1.7909 1.5103 -0.2553 -0.0686 0.0336  508 SER B OG  
4262 N N   . ASP B 249 ? 0.8871 1.7062 1.5015 -0.2928 -0.1125 0.0121  509 ASP B N   
4263 C CA  . ASP B 249 ? 0.9261 1.6851 1.5209 -0.3259 -0.1167 0.0206  509 ASP B CA  
4264 C C   . ASP B 249 ? 1.0025 1.7780 1.6045 -0.3604 -0.1038 0.0432  509 ASP B C   
4265 O O   . ASP B 249 ? 1.0111 1.7648 1.6120 -0.3929 -0.1121 0.0500  509 ASP B O   
4266 C CB  . ASP B 249 ? 0.9517 1.7161 1.5596 -0.3361 -0.1392 0.0068  509 ASP B CB  
4267 C CG  . ASP B 249 ? 0.9577 1.7048 1.5576 -0.3053 -0.1547 -0.0140 509 ASP B CG  
4268 O OD1 . ASP B 249 ? 0.9643 1.6553 1.5332 -0.2872 -0.1511 -0.0157 509 ASP B OD1 
4269 O OD2 . ASP B 249 ? 0.9381 1.7282 1.5629 -0.3001 -0.1714 -0.0281 509 ASP B OD2 
4270 N N   . ASP B 250 ? 1.0035 1.8158 1.6116 -0.3537 -0.0851 0.0555  510 ASP B N   
4271 C CA  . ASP B 250 ? 1.0256 1.8521 1.6370 -0.3857 -0.0717 0.0798  510 ASP B CA  
4272 C C   . ASP B 250 ? 1.0639 1.8077 1.6339 -0.3900 -0.0623 0.0927  510 ASP B C   
4273 O O   . ASP B 250 ? 1.0842 1.7769 1.6286 -0.3635 -0.0620 0.0830  510 ASP B O   
4274 C CB  . ASP B 250 ? 1.0098 1.9293 1.6506 -0.3762 -0.0563 0.0865  510 ASP B CB  
4275 C CG  . ASP B 250 ? 0.9972 2.0080 1.6831 -0.3793 -0.0643 0.0777  510 ASP B CG  
4276 O OD1 . ASP B 250 ? 1.0142 2.0349 1.7162 -0.4127 -0.0739 0.0838  510 ASP B OD1 
4277 O OD2 . ASP B 250 ? 0.9564 2.0297 1.6617 -0.3475 -0.0622 0.0645  510 ASP B OD2 
4278 N N   . TRP B 251 ? 1.0892 1.8215 1.6534 -0.4233 -0.0555 0.1152  511 TRP B N   
4279 C CA  . TRP B 251 ? 1.1245 1.7722 1.6482 -0.4312 -0.0504 0.1276  511 TRP B CA  
4280 C C   . TRP B 251 ? 1.1448 1.8038 1.6595 -0.4212 -0.0306 0.1426  511 TRP B C   
4281 O O   . TRP B 251 ? 1.1280 1.8651 1.6685 -0.4208 -0.0191 0.1507  511 TRP B O   
4282 C CB  . TRP B 251 ? 1.1769 1.7891 1.6932 -0.4761 -0.0598 0.1441  511 TRP B CB  
4283 C CG  . TRP B 251 ? 1.1988 1.7858 1.7174 -0.4911 -0.0814 0.1319  511 TRP B CG  
4284 C CD1 . TRP B 251 ? 1.1914 1.8263 1.7414 -0.5199 -0.0927 0.1355  511 TRP B CD1 
4285 C CD2 . TRP B 251 ? 1.2204 1.7289 1.7076 -0.4786 -0.0945 0.1150  511 TRP B CD2 
4286 N NE1 . TRP B 251 ? 1.2124 1.8002 1.7516 -0.5254 -0.1132 0.1211  511 TRP B NE1 
4287 C CE2 . TRP B 251 ? 1.2314 1.7418 1.7309 -0.5002 -0.1141 0.1083  511 TRP B CE2 
4288 C CE3 . TRP B 251 ? 1.1993 1.6395 1.6498 -0.4510 -0.0913 0.1051  511 TRP B CE3 
4289 C CZ2 . TRP B 251 ? 1.2322 1.6766 1.7053 -0.4942 -0.1304 0.0918  511 TRP B CZ2 
4290 C CZ3 . TRP B 251 ? 1.1970 1.5762 1.6231 -0.4454 -0.1060 0.0894  511 TRP B CZ3 
4291 C CH2 . TRP B 251 ? 1.2218 1.6026 1.6578 -0.4665 -0.1252 0.0827  511 TRP B CH2 
4292 N N   . ASP B 252 ? 1.1909 1.7717 1.6681 -0.4126 -0.0270 0.1460  512 ASP B N   
4293 C CA  . ASP B 252 ? 1.2093 1.7815 1.6707 -0.4104 -0.0111 0.1636  512 ASP B CA  
4294 C C   . ASP B 252 ? 1.2716 1.7569 1.6970 -0.4336 -0.0149 0.1779  512 ASP B C   
4295 O O   . ASP B 252 ? 1.2802 1.7686 1.7036 -0.4643 -0.0117 0.2006  512 ASP B O   
4296 C CB  . ASP B 252 ? 1.1382 1.7069 1.5904 -0.3669 -0.0023 0.1518  512 ASP B CB  
4297 C CG  . ASP B 252 ? 1.1287 1.7182 1.5752 -0.3606 0.0148  0.1681  512 ASP B CG  
4298 O OD1 . ASP B 252 ? 1.1681 1.7644 1.6122 -0.3907 0.0207  0.1903  512 ASP B OD1 
4299 O OD2 . ASP B 252 ? 1.0834 1.6815 1.5270 -0.3256 0.0211  0.1592  512 ASP B OD2 
4300 N N   . ALA B 259 ? 1.3702 1.5577 1.6807 -0.5099 -0.0583 0.2032  519 ALA B N   
4301 C CA  . ALA B 259 ? 1.4442 1.5566 1.7291 -0.5217 -0.0792 0.1940  519 ALA B CA  
4302 C C   . ALA B 259 ? 1.4500 1.5535 1.7324 -0.4905 -0.0825 0.1658  519 ALA B C   
4303 O O   . ALA B 259 ? 1.4454 1.5137 1.7063 -0.4571 -0.0753 0.1538  519 ALA B O   
4304 C CB  . ALA B 259 ? 1.4957 1.5160 1.7361 -0.5229 -0.0848 0.2013  519 ALA B CB  
4305 N N   . PRO B 260 ? 1.4329 1.5694 1.7375 -0.5020 -0.0938 0.1562  520 PRO B N   
4306 C CA  . PRO B 260 ? 1.3795 1.5105 1.6817 -0.4752 -0.0984 0.1310  520 PRO B CA  
4307 C C   . PRO B 260 ? 1.4022 1.4408 1.6596 -0.4633 -0.1091 0.1178  520 PRO B C   
4308 O O   . PRO B 260 ? 1.4380 1.4120 1.6665 -0.4801 -0.1185 0.1261  520 PRO B O   
4309 C CB  . PRO B 260 ? 1.3523 1.5316 1.6856 -0.4982 -0.1118 0.1277  520 PRO B CB  
4310 C CG  . PRO B 260 ? 1.3608 1.6024 1.7252 -0.5265 -0.1061 0.1496  520 PRO B CG  
4311 C CD  . PRO B 260 ? 1.4242 1.6156 1.7616 -0.5394 -0.1018 0.1691  520 PRO B CD  
4312 N N   . ALA B 261 ? 1.3729 1.4063 1.6239 -0.4341 -0.1084 0.0973  521 ALA B N   
4313 C CA  . ALA B 261 ? 1.3930 1.3482 1.6014 -0.4155 -0.1138 0.0836  521 ALA B CA  
4314 C C   . ALA B 261 ? 1.3468 1.3110 1.5544 -0.3905 -0.1154 0.0629  521 ALA B C   
4315 O O   . ALA B 261 ? 1.3041 1.3309 1.5416 -0.3777 -0.1083 0.0591  521 ALA B O   
4316 C CB  . ALA B 261 ? 1.3857 1.3072 1.5723 -0.3942 -0.0995 0.0891  521 ALA B CB  
4317 N N   . TRP B 262 ? 1.3499 1.2502 1.5214 -0.3842 -0.1263 0.0497  522 TRP B N   
4318 C CA  . TRP B 262 ? 1.3115 1.2070 1.4715 -0.3566 -0.1250 0.0319  522 TRP B CA  
4319 C C   . TRP B 262 ? 1.2618 1.1299 1.4007 -0.3264 -0.1091 0.0311  522 TRP B C   
4320 O O   . TRP B 262 ? 1.2837 1.0887 1.3844 -0.3160 -0.1116 0.0242  522 TRP B O   
4321 C CB  . TRP B 262 ? 1.3853 1.2267 1.5135 -0.3626 -0.1437 0.0178  522 TRP B CB  
4322 C CG  . TRP B 262 ? 1.4054 1.2734 1.5535 -0.3875 -0.1616 0.0144  522 TRP B CG  
4323 C CD1 . TRP B 262 ? 1.3629 1.2898 1.5413 -0.3843 -0.1636 0.0081  522 TRP B CD1 
4324 C CD2 . TRP B 262 ? 1.4704 1.3029 1.6076 -0.4181 -0.1826 0.0163  522 TRP B CD2 
4325 N NE1 . TRP B 262 ? 1.3797 1.3133 1.5688 -0.4109 -0.1833 0.0058  522 TRP B NE1 
4326 C CE2 . TRP B 262 ? 1.4477 1.3243 1.6125 -0.4328 -0.1953 0.0113  522 TRP B CE2 
4327 C CE3 . TRP B 262 ? 1.5215 1.2872 1.6283 -0.4348 -0.1942 0.0217  522 TRP B CE3 
4328 C CZ2 . TRP B 262 ? 1.4921 1.3509 1.6569 -0.4643 -0.2181 0.0124  522 TRP B CZ2 
4329 C CZ3 . TRP B 262 ? 1.5486 1.2933 1.6537 -0.4667 -0.2181 0.0231  522 TRP B CZ3 
4330 C CH2 . TRP B 262 ? 1.5405 1.3329 1.6754 -0.4816 -0.2294 0.0188  522 TRP B CH2 
4331 N N   . CYS B 263 ? 1.2110 1.1268 1.3748 -0.3115 -0.0934 0.0379  523 CYS B N   
4332 C CA  . CYS B 263 ? 1.2005 1.0972 1.3495 -0.2824 -0.0788 0.0376  523 CYS B CA  
4333 C C   . CYS B 263 ? 1.1429 1.0303 1.2776 -0.2573 -0.0779 0.0226  523 CYS B C   
4334 O O   . CYS B 263 ? 1.1750 1.0236 1.2833 -0.2366 -0.0711 0.0184  523 CYS B O   
4335 C CB  . CYS B 263 ? 1.1672 1.1193 1.3474 -0.2735 -0.0645 0.0487  523 CYS B CB  
4336 S SG  . CYS B 263 ? 1.2048 1.1632 1.3944 -0.2982 -0.0606 0.0696  523 CYS B SG  
4337 N N   . ASP B 264 ? 1.0718 0.9956 1.2236 -0.2600 -0.0856 0.0151  524 ASP B N   
4338 C CA  . ASP B 264 ? 1.0220 0.9538 1.1690 -0.2373 -0.0840 0.0047  524 ASP B CA  
4339 C C   . ASP B 264 ? 1.0205 0.9138 1.1377 -0.2409 -0.0969 -0.0088 524 ASP B C   
4340 O O   . ASP B 264 ? 1.0013 0.9045 1.1260 -0.2601 -0.1117 -0.0133 524 ASP B O   
4341 C CB  . ASP B 264 ? 0.9809 0.9801 1.1669 -0.2347 -0.0851 0.0058  524 ASP B CB  
4342 C CG  . ASP B 264 ? 0.9962 1.0332 1.2088 -0.2310 -0.0735 0.0181  524 ASP B CG  
4343 O OD1 . ASP B 264 ? 1.0061 1.0376 1.2144 -0.2096 -0.0615 0.0219  524 ASP B OD1 
4344 O OD2 . ASP B 264 ? 0.9995 1.0731 1.2371 -0.2491 -0.0763 0.0244  524 ASP B OD2 
4345 N N   . ARG B 265 ? 0.9987 0.8509 1.0823 -0.2211 -0.0912 -0.0155 525 ARG B N   
4346 C CA  . ARG B 265 ? 1.0210 0.8252 1.0665 -0.2215 -0.1016 -0.0283 525 ARG B CA  
4347 C C   . ARG B 265 ? 1.0551 0.8562 1.0812 -0.1966 -0.0950 -0.0364 525 ARG B C   
4348 O O   . ARG B 265 ? 1.0630 0.8795 1.0954 -0.1761 -0.0800 -0.0312 525 ARG B O   
4349 C CB  . ARG B 265 ? 1.0736 0.8154 1.0854 -0.2230 -0.1025 -0.0293 525 ARG B CB  
4350 C CG  . ARG B 265 ? 1.1078 0.8464 1.1346 -0.2448 -0.1052 -0.0169 525 ARG B CG  
4351 C CD  . ARG B 265 ? 1.1557 0.9078 1.1990 -0.2770 -0.1227 -0.0150 525 ARG B CD  
4352 N NE  . ARG B 265 ? 1.2309 0.9555 1.2713 -0.2989 -0.1286 -0.0043 525 ARG B NE  
4353 C CZ  . ARG B 265 ? 1.2848 0.9477 1.2931 -0.3123 -0.1446 -0.0082 525 ARG B CZ  
4354 N NH1 . ARG B 265 ? 1.3031 0.9240 1.2772 -0.3050 -0.1563 -0.0245 525 ARG B NH1 
4355 N NH2 . ARG B 265 ? 1.3318 0.9736 1.3407 -0.3334 -0.1501 0.0048  525 ARG B NH2 
4356 N N   . ILE B 266 ? 1.0728 0.8534 1.0744 -0.1995 -0.1069 -0.0481 526 ILE B N   
4357 C CA  . ILE B 266 ? 1.0636 0.8326 1.0370 -0.1783 -0.1017 -0.0561 526 ILE B CA  
4358 C C   . ILE B 266 ? 1.1290 0.8368 1.0545 -0.1777 -0.1102 -0.0691 526 ILE B C   
4359 O O   . ILE B 266 ? 1.1730 0.8604 1.0904 -0.1977 -0.1282 -0.0751 526 ILE B O   
4360 C CB  . ILE B 266 ? 1.0325 0.8377 1.0185 -0.1808 -0.1103 -0.0588 526 ILE B CB  
4361 C CG1 . ILE B 266 ? 0.9816 0.8455 1.0155 -0.1829 -0.1078 -0.0482 526 ILE B CG1 
4362 C CG2 . ILE B 266 ? 1.0111 0.8081 0.9679 -0.1599 -0.1031 -0.0636 526 ILE B CG2 
4363 C CD1 . ILE B 266 ? 0.9557 0.8532 1.0041 -0.1867 -0.1206 -0.0511 526 ILE B CD1 
4364 N N   . LEU B 267 ? 1.1184 0.7978 1.0125 -0.1540 -0.0981 -0.0737 527 LEU B N   
4365 C CA  . LEU B 267 ? 1.1463 0.7677 0.9897 -0.1465 -0.1054 -0.0885 527 LEU B CA  
4366 C C   . LEU B 267 ? 1.1545 0.7825 0.9726 -0.1207 -0.0935 -0.0947 527 LEU B C   
4367 O O   . LEU B 267 ? 1.1084 0.7822 0.9502 -0.1112 -0.0804 -0.0855 527 LEU B O   
4368 C CB  . LEU B 267 ? 1.1860 0.7603 1.0111 -0.1409 -0.1035 -0.0895 527 LEU B CB  
4369 C CG  . LEU B 267 ? 1.1801 0.7447 1.0270 -0.1677 -0.1146 -0.0805 527 LEU B CG  
4370 C CD1 . LEU B 267 ? 1.1481 0.7542 1.0356 -0.1667 -0.0992 -0.0641 527 LEU B CD1 
4371 C CD2 . LEU B 267 ? 1.1802 0.6744 0.9894 -0.1690 -0.1266 -0.0879 527 LEU B CD2 
4372 N N   . TRP B 268 ? 1.2418 0.8249 1.0113 -0.1096 -0.0988 -0.1097 528 TRP B N   
4373 C CA  . TRP B 268 ? 1.2595 0.8512 1.0016 -0.0851 -0.0864 -0.1153 528 TRP B CA  
4374 C C   . TRP B 268 ? 1.3078 0.8444 0.9949 -0.0652 -0.0876 -0.1322 528 TRP B C   
4375 O O   . TRP B 268 ? 1.3663 0.8518 1.0326 -0.0739 -0.1039 -0.1414 528 TRP B O   
4376 C CB  . TRP B 268 ? 1.2642 0.8808 1.0059 -0.0953 -0.0954 -0.1163 528 TRP B CB  
4377 C CG  . TRP B 268 ? 1.3224 0.8985 1.0341 -0.1098 -0.1182 -0.1300 528 TRP B CG  
4378 C CD1 . TRP B 268 ? 1.4110 0.9507 1.0705 -0.0976 -0.1238 -0.1454 528 TRP B CD1 
4379 C CD2 . TRP B 268 ? 1.3125 0.8816 1.0446 -0.1389 -0.1393 -0.1296 528 TRP B CD2 
4380 N NE1 . TRP B 268 ? 1.4308 0.9369 1.0760 -0.1176 -0.1487 -0.1549 528 TRP B NE1 
4381 C CE2 . TRP B 268 ? 1.3904 0.9156 1.0815 -0.1440 -0.1585 -0.1448 528 TRP B CE2 
4382 C CE3 . TRP B 268 ? 1.2608 0.8593 1.0419 -0.1607 -0.1438 -0.1177 528 TRP B CE3 
4383 C CZ2 . TRP B 268 ? 1.4028 0.9124 1.1030 -0.1716 -0.1828 -0.1477 528 TRP B CZ2 
4384 C CZ3 . TRP B 268 ? 1.2835 0.8709 1.0741 -0.1875 -0.1660 -0.1205 528 TRP B CZ3 
4385 C CH2 . TRP B 268 ? 1.3522 0.8953 1.1039 -0.1936 -0.1857 -0.1349 528 TRP B CH2 
4386 N N   . LYS B 269 ? 1.2746 0.8229 0.9382 -0.0383 -0.0712 -0.1361 529 LYS B N   
4387 C CA  . LYS B 269 ? 1.3243 0.8276 0.9295 -0.0169 -0.0735 -0.1552 529 LYS B CA  
4388 C C   . LYS B 269 ? 1.3708 0.9072 0.9558 0.0044  -0.0570 -0.1562 529 LYS B C   
4389 O O   . LYS B 269 ? 1.3416 0.9276 0.9532 0.0143  -0.0371 -0.1427 529 LYS B O   
4390 C CB  . LYS B 269 ? 1.3661 0.8235 0.9500 0.0020  -0.0713 -0.1641 529 LYS B CB  
4391 C CG  . LYS B 269 ? 1.3938 0.8784 0.9854 0.0311  -0.0461 -0.1592 529 LYS B CG  
4392 C CD  . LYS B 269 ? 1.4810 0.9100 1.0355 0.0555  -0.0482 -0.1748 529 LYS B CD  
4393 C CE  . LYS B 269 ? 1.5803 0.9888 1.0784 0.0842  -0.0456 -0.1946 529 LYS B CE  
4394 N NZ  . LYS B 269 ? 1.6883 1.0334 1.1445 0.1078  -0.0541 -0.2136 529 LYS B NZ  
4395 N N   . GLY B 270 ? 1.4437 0.9516 0.9804 0.0104  -0.0665 -0.1716 530 GLY B N   
4396 C CA  . GLY B 270 ? 1.4454 0.9831 0.9572 0.0265  -0.0537 -0.1725 530 GLY B CA  
4397 C C   . GLY B 270 ? 1.5183 1.0283 0.9930 0.0156  -0.0736 -0.1845 530 GLY B C   
4398 O O   . GLY B 270 ? 1.5070 0.9910 0.9909 -0.0096 -0.0965 -0.1870 530 GLY B O   
4399 N N   . LYS B 271 ? 1.5945 1.1111 1.0266 0.0346  -0.0653 -0.1917 531 LYS B N   
4400 C CA  . LYS B 271 ? 1.6702 1.1605 1.0619 0.0266  -0.0839 -0.2034 531 LYS B CA  
4401 C C   . LYS B 271 ? 1.6375 1.1746 1.0584 0.0035  -0.0871 -0.1867 531 LYS B C   
4402 O O   . LYS B 271 ? 1.5933 1.1851 1.0501 0.0031  -0.0701 -0.1680 531 LYS B O   
4403 C CB  . LYS B 271 ? 1.7105 1.1842 1.0376 0.0588  -0.0745 -0.2200 531 LYS B CB  
4404 N N   . ASN B 272 ? 1.6494 1.1617 1.0549 -0.0156 -0.1115 -0.1938 532 ASN B N   
4405 C CA  . ASN B 272 ? 1.5851 1.1313 1.0107 -0.0374 -0.1209 -0.1817 532 ASN B CA  
4406 C C   . ASN B 272 ? 1.4702 1.0462 0.9617 -0.0634 -0.1287 -0.1664 532 ASN B C   
4407 O O   . ASN B 272 ? 1.4561 1.0678 0.9711 -0.0776 -0.1339 -0.1543 532 ASN B O   
4408 C CB  . ASN B 272 ? 1.5757 1.1679 0.9887 -0.0242 -0.1011 -0.1700 532 ASN B CB  
4409 C CG  . ASN B 272 ? 1.6227 1.1927 0.9693 0.0023  -0.0924 -0.1849 532 ASN B CG  
4410 O OD1 . ASN B 272 ? 1.6213 1.2143 0.9572 0.0269  -0.0674 -0.1823 532 ASN B OD1 
4411 N ND2 . ASN B 272 ? 1.6611 1.1869 0.9621 -0.0012 -0.1133 -0.2016 532 ASN B ND2 
4412 N N   . ILE B 273 ? 1.4182 0.9777 0.9366 -0.0691 -0.1312 -0.1677 533 ILE B N   
4413 C CA  . ILE B 273 ? 1.3328 0.9196 0.9114 -0.0921 -0.1381 -0.1550 533 ILE B CA  
4414 C C   . ILE B 273 ? 1.3567 0.9124 0.9372 -0.1165 -0.1668 -0.1641 533 ILE B C   
4415 O O   . ILE B 273 ? 1.4205 0.9260 0.9757 -0.1171 -0.1777 -0.1772 533 ILE B O   
4416 C CB  . ILE B 273 ? 1.2972 0.8868 0.9048 -0.0856 -0.1238 -0.1491 533 ILE B CB  
4417 C CG1 . ILE B 273 ? 1.2368 0.8548 0.8417 -0.0598 -0.0961 -0.1413 533 ILE B CG1 
4418 C CG2 . ILE B 273 ? 1.2567 0.8798 0.9251 -0.1076 -0.1292 -0.1355 533 ILE B CG2 
4419 C CD1 . ILE B 273 ? 1.2316 0.8411 0.8521 -0.0485 -0.0832 -0.1395 533 ILE B CD1 
4420 N N   . THR B 274 ? 1.3067 0.8918 0.9168 -0.1364 -0.1806 -0.1572 534 THR B N   
4421 C CA  . THR B 274 ? 1.3354 0.9041 0.9598 -0.1616 -0.2073 -0.1632 534 THR B CA  
4422 C C   . THR B 274 ? 1.3034 0.9199 0.9932 -0.1779 -0.2076 -0.1490 534 THR B C   
4423 O O   . THR B 274 ? 1.2786 0.9399 0.9939 -0.1771 -0.2026 -0.1381 534 THR B O   
4424 C CB  . THR B 274 ? 1.3577 0.9192 0.9558 -0.1688 -0.2267 -0.1703 534 THR B CB  
4425 O OG1 . THR B 274 ? 1.3900 0.9206 0.9267 -0.1482 -0.2202 -0.1805 534 THR B OG1 
4426 C CG2 . THR B 274 ? 1.3491 0.8835 0.9529 -0.1928 -0.2564 -0.1799 534 THR B CG2 
4427 N N   . GLN B 275 ? 1.3110 0.9181 1.0264 -0.1920 -0.2135 -0.1487 535 GLN B N   
4428 C CA  . GLN B 275 ? 1.2425 0.8959 1.0178 -0.2072 -0.2143 -0.1366 535 GLN B CA  
4429 C C   . GLN B 275 ? 1.2812 0.9487 1.0741 -0.2281 -0.2392 -0.1402 535 GLN B C   
4430 O O   . GLN B 275 ? 1.3349 0.9673 1.1098 -0.2418 -0.2588 -0.1505 535 GLN B O   
4431 C CB  . GLN B 275 ? 1.1940 0.8342 0.9882 -0.2160 -0.2113 -0.1335 535 GLN B CB  
4432 C CG  . GLN B 275 ? 1.1569 0.8498 1.0108 -0.2277 -0.2075 -0.1202 535 GLN B CG  
4433 C CD  . GLN B 275 ? 1.1728 0.8542 1.0421 -0.2349 -0.2011 -0.1144 535 GLN B CD  
4434 O OE1 . GLN B 275 ? 1.2314 0.8766 1.0892 -0.2507 -0.2154 -0.1195 535 GLN B OE1 
4435 N NE2 . GLN B 275 ? 1.1250 0.8352 1.0193 -0.2240 -0.1811 -0.1029 535 GLN B NE2 
4436 N N   . LEU B 276 ? 1.2222 0.9391 1.0495 -0.2299 -0.2406 -0.1322 536 LEU B N   
4437 C CA  . LEU B 276 ? 1.1874 0.9227 1.0345 -0.2472 -0.2652 -0.1360 536 LEU B CA  
4438 C C   . LEU B 276 ? 1.1908 0.9621 1.0933 -0.2645 -0.2713 -0.1309 536 LEU B C   
4439 O O   . LEU B 276 ? 1.2021 0.9851 1.1233 -0.2814 -0.2928 -0.1358 536 LEU B O   
4440 C CB  . LEU B 276 ? 1.1093 0.8757 0.9604 -0.2392 -0.2679 -0.1315 536 LEU B CB  
4441 C CG  . LEU B 276 ? 1.1705 0.9093 0.9680 -0.2273 -0.2681 -0.1359 536 LEU B CG  
4442 C CD1 . LEU B 276 ? 1.1598 0.9354 0.9707 -0.2230 -0.2719 -0.1270 536 LEU B CD1 
4443 C CD2 . LEU B 276 ? 1.1887 0.8838 0.9486 -0.2375 -0.2903 -0.1509 536 LEU B CD2 
4444 N N   . SER B 277 ? 1.1677 0.9591 1.0964 -0.2598 -0.2524 -0.1208 537 SER B N   
4445 C CA  . SER B 277 ? 1.1361 0.9679 1.1169 -0.2745 -0.2552 -0.1145 537 SER B CA  
4446 C C   . SER B 277 ? 1.1569 0.9942 1.1515 -0.2681 -0.2328 -0.1042 537 SER B C   
4447 O O   . SER B 277 ? 1.2095 1.0316 1.1824 -0.2493 -0.2147 -0.1010 537 SER B O   
4448 C CB  . SER B 277 ? 1.0737 0.9611 1.0928 -0.2727 -0.2629 -0.1115 537 SER B CB  
4449 O OG  . SER B 277 ? 1.0591 0.9642 1.0786 -0.2523 -0.2474 -0.1038 537 SER B OG  
4450 N N   . TYR B 278 ? 1.1174 0.9787 1.1486 -0.2842 -0.2345 -0.0985 538 TYR B N   
4451 C CA  . TYR B 278 ? 1.0863 0.9536 1.1322 -0.2815 -0.2157 -0.0878 538 TYR B CA  
4452 C C   . TYR B 278 ? 1.0701 0.9892 1.1673 -0.2988 -0.2204 -0.0809 538 TYR B C   
4453 O O   . TYR B 278 ? 1.1285 1.0427 1.2343 -0.3218 -0.2337 -0.0817 538 TYR B O   
4454 C CB  . TYR B 278 ? 1.1157 0.9219 1.1244 -0.2858 -0.2142 -0.0904 538 TYR B CB  
4455 C CG  . TYR B 278 ? 1.1478 0.9452 1.1594 -0.2799 -0.1953 -0.0804 538 TYR B CG  
4456 C CD1 . TYR B 278 ? 1.0844 0.9128 1.1130 -0.2610 -0.1752 -0.0718 538 TYR B CD1 
4457 C CD2 . TYR B 278 ? 1.1811 0.9344 1.1757 -0.2931 -0.1997 -0.0796 538 TYR B CD2 
4458 C CE1 . TYR B 278 ? 1.0512 0.8685 1.0806 -0.2553 -0.1595 -0.0631 538 TYR B CE1 
4459 C CE2 . TYR B 278 ? 1.1782 0.9193 1.1729 -0.2879 -0.1846 -0.0704 538 TYR B CE2 
4460 C CZ  . TYR B 278 ? 1.0928 0.8663 1.1048 -0.2686 -0.1641 -0.0625 538 TYR B CZ  
4461 O OH  . TYR B 278 ? 1.0631 0.8216 1.0735 -0.2633 -0.1506 -0.0538 538 TYR B OH  
4462 N N   . GLN B 279 ? 0.9940 0.9644 1.1248 -0.2874 -0.2108 -0.0743 539 GLN B N   
4463 C CA  . GLN B 279 ? 0.9516 0.9823 1.1319 -0.2982 -0.2161 -0.0702 539 GLN B CA  
4464 C C   . GLN B 279 ? 0.9210 0.9843 1.1265 -0.2888 -0.1967 -0.0585 539 GLN B C   
4465 O O   . GLN B 279 ? 0.9132 0.9616 1.1035 -0.2698 -0.1817 -0.0546 539 GLN B O   
4466 C CB  . GLN B 279 ? 0.8996 0.9682 1.0981 -0.2904 -0.2306 -0.0775 539 GLN B CB  
4467 C CG  . GLN B 279 ? 1.4018 1.4391 1.5714 -0.2940 -0.2503 -0.0895 539 GLN B CG  
4468 C CD  . GLN B 279 ? 1.4170 1.4391 1.5599 -0.2727 -0.2484 -0.0918 539 GLN B CD  
4469 O OE1 . GLN B 279 ? 1.4158 1.4284 1.5464 -0.2563 -0.2298 -0.0849 539 GLN B OE1 
4470 N NE2 . GLN B 279 ? 1.4161 1.4365 1.5501 -0.2741 -0.2686 -0.1007 539 GLN B NE2 
4471 N N   . SER B 280 ? 0.9286 1.0387 1.1729 -0.3018 -0.1972 -0.0527 540 SER B N   
4472 C CA  . SER B 280 ? 0.9432 1.0981 1.2167 -0.2905 -0.1820 -0.0433 540 SER B CA  
4473 C C   . SER B 280 ? 0.9437 1.1609 1.2542 -0.2843 -0.1930 -0.0488 540 SER B C   
4474 O O   . SER B 280 ? 0.9771 1.2047 1.2948 -0.2940 -0.2117 -0.0579 540 SER B O   
4475 C CB  . SER B 280 ? 0.9972 1.1616 1.2850 -0.3087 -0.1724 -0.0313 540 SER B CB  
4476 O OG  . SER B 280 ? 1.0173 1.2375 1.3439 -0.3261 -0.1813 -0.0300 540 SER B OG  
4477 N N   . HIS B 281 ? 0.9016 1.1593 1.2351 -0.2672 -0.1831 -0.0441 541 HIS B N   
4478 C CA  . HIS B 281 ? 0.8676 1.1813 1.2330 -0.2555 -0.1951 -0.0512 541 HIS B CA  
4479 C C   . HIS B 281 ? 0.8471 1.2239 1.2515 -0.2556 -0.1878 -0.0458 541 HIS B C   
4480 O O   . HIS B 281 ? 0.7863 1.1844 1.2001 -0.2365 -0.1773 -0.0414 541 HIS B O   
4481 C CB  . HIS B 281 ? 0.8370 1.1397 1.1900 -0.2298 -0.1967 -0.0540 541 HIS B CB  
4482 C CG  . HIS B 281 ? 0.8596 1.1092 1.1754 -0.2298 -0.2038 -0.0588 541 HIS B CG  
4483 N ND1 . HIS B 281 ? 0.8739 1.1243 1.1863 -0.2286 -0.2249 -0.0690 541 HIS B ND1 
4484 C CD2 . HIS B 281 ? 0.8828 1.0778 1.1614 -0.2306 -0.1929 -0.0552 541 HIS B CD2 
4485 C CE1 . HIS B 281 ? 0.8949 1.0945 1.1688 -0.2292 -0.2256 -0.0704 541 HIS B CE1 
4486 N NE2 . HIS B 281 ? 0.8927 1.0595 1.1459 -0.2294 -0.2059 -0.0628 541 HIS B NE2 
4487 N N   . MET B 282 ? 0.8722 1.2808 1.2994 -0.2773 -0.1946 -0.0462 542 MET B N   
4488 C CA  . MET B 282 ? 0.8922 1.3646 1.3558 -0.2824 -0.1862 -0.0394 542 MET B CA  
4489 C C   . MET B 282 ? 0.8873 1.4172 1.3779 -0.2556 -0.1890 -0.0462 542 MET B C   
4490 O O   . MET B 282 ? 0.9042 1.4678 1.4090 -0.2465 -0.1745 -0.0389 542 MET B O   
4491 C CB  . MET B 282 ? 0.9192 1.4218 1.4058 -0.3106 -0.1969 -0.0399 542 MET B CB  
4492 C CG  . MET B 282 ? 0.9735 1.4240 1.4372 -0.3401 -0.1946 -0.0304 542 MET B CG  
4493 S SD  . MET B 282 ? 1.1195 1.5699 1.5828 -0.3538 -0.1708 -0.0090 542 MET B SD  
4494 C CE  . MET B 282 ? 1.0946 1.4424 1.5018 -0.3534 -0.1662 -0.0067 542 MET B CE  
4495 N N   . ALA B 283 ? 0.8675 1.4045 1.3620 -0.2424 -0.2091 -0.0605 543 ALA B N   
4496 C CA  . ALA B 283 ? 0.8172 1.4076 1.3377 -0.2167 -0.2188 -0.0702 543 ALA B CA  
4497 C C   . ALA B 283 ? 0.7971 1.3925 1.3150 -0.1915 -0.2057 -0.0649 543 ALA B C   
4498 O O   . ALA B 283 ? 0.7727 1.4248 1.3171 -0.1749 -0.2066 -0.0689 543 ALA B O   
4499 C CB  . ALA B 283 ? 0.8100 1.3853 1.3236 -0.2062 -0.2444 -0.0847 543 ALA B CB  
4500 N N   . LEU B 284 ? 0.8192 1.3573 1.3054 -0.1878 -0.1945 -0.0566 544 LEU B N   
4501 C CA  . LEU B 284 ? 0.8272 1.3629 1.3088 -0.1647 -0.1835 -0.0508 544 LEU B CA  
4502 C C   . LEU B 284 ? 0.8252 1.3785 1.3133 -0.1707 -0.1605 -0.0378 544 LEU B C   
4503 O O   . LEU B 284 ? 0.8691 1.3852 1.3388 -0.1888 -0.1464 -0.0271 544 LEU B O   
4504 C CB  . LEU B 284 ? 0.8683 1.3391 1.3153 -0.1587 -0.1807 -0.0464 544 LEU B CB  
4505 C CG  . LEU B 284 ? 0.8860 1.3352 1.3213 -0.1492 -0.2019 -0.0556 544 LEU B CG  
4506 C CD1 . LEU B 284 ? 0.9014 1.2915 1.3024 -0.1475 -0.1935 -0.0480 544 LEU B CD1 
4507 C CD2 . LEU B 284 ? 0.8858 1.3708 1.3406 -0.1239 -0.2181 -0.0631 544 LEU B CD2 
4508 N N   . LYS B 285 ? 0.7825 1.3898 1.2942 -0.1541 -0.1577 -0.0389 545 LYS B N   
4509 C CA  . LYS B 285 ? 0.7798 1.4150 1.3005 -0.1610 -0.1371 -0.0266 545 LYS B CA  
4510 C C   . LYS B 285 ? 0.7844 1.4139 1.2971 -0.1373 -0.1259 -0.0205 545 LYS B C   
4511 O O   . LYS B 285 ? 0.8046 1.4692 1.3277 -0.1357 -0.1119 -0.0128 545 LYS B O   
4512 C CB  . LYS B 285 ? 0.7144 1.4286 1.2709 -0.1637 -0.1403 -0.0317 545 LYS B CB  
4513 C CG  . LYS B 285 ? 0.7146 1.4454 1.2859 -0.1861 -0.1537 -0.0386 545 LYS B CG  
4514 C CD  . LYS B 285 ? 0.6789 1.4862 1.2860 -0.1718 -0.1679 -0.0530 545 LYS B CD  
4515 C CE  . LYS B 285 ? 0.6931 1.5400 1.3248 -0.1992 -0.1728 -0.0537 545 LYS B CE  
4516 N NZ  . LYS B 285 ? 0.7428 1.5314 1.3557 -0.2229 -0.1834 -0.0540 545 LYS B NZ  
4517 N N   . THR B 286 ? 0.7516 1.3384 1.2459 -0.1198 -0.1324 -0.0230 546 THR B N   
4518 C CA  . THR B 286 ? 0.7435 1.3224 1.2310 -0.0967 -0.1250 -0.0175 546 THR B CA  
4519 C C   . THR B 286 ? 0.7906 1.3409 1.2618 -0.1076 -0.1017 -0.0013 546 THR B C   
4520 O O   . THR B 286 ? 0.8052 1.3708 1.2787 -0.0940 -0.0916 0.0050  546 THR B O   
4521 C CB  . THR B 286 ? 0.6076 1.1456 1.0799 -0.0791 -0.1384 -0.0215 546 THR B CB  
4522 O OG1 . THR B 286 ? 0.6085 1.1787 1.0973 -0.0599 -0.1614 -0.0352 546 THR B OG1 
4523 C CG2 . THR B 286 ? 0.5761 1.0883 1.0355 -0.0636 -0.1270 -0.0113 546 THR B CG2 
4524 N N   . SER B 287 ? 0.7905 1.2973 1.2435 -0.1311 -0.0951 0.0047  547 SER B N   
4525 C CA  . SER B 287 ? 0.7623 1.2320 1.1959 -0.1427 -0.0764 0.0191  547 SER B CA  
4526 C C   . SER B 287 ? 0.7870 1.2697 1.2256 -0.1725 -0.0688 0.0269  547 SER B C   
4527 O O   . SER B 287 ? 0.7892 1.3084 1.2466 -0.1856 -0.0777 0.0210  547 SER B O   
4528 C CB  . SER B 287 ? 0.7317 1.1348 1.1363 -0.1440 -0.0761 0.0198  547 SER B CB  
4529 O OG  . SER B 287 ? 0.7199 1.0838 1.1046 -0.1553 -0.0609 0.0315  547 SER B OG  
4530 N N   . ASP B 288 ? 0.7963 1.2487 1.2183 -0.1834 -0.0538 0.0408  548 ASP B N   
4531 C CA  . ASP B 288 ? 0.7824 1.2323 1.2030 -0.2152 -0.0482 0.0515  548 ASP B CA  
4532 C C   . ASP B 288 ? 0.8239 1.2130 1.2208 -0.2336 -0.0549 0.0493  548 ASP B C   
4533 O O   . ASP B 288 ? 0.8389 1.2153 1.2315 -0.2617 -0.0547 0.0573  548 ASP B O   
4534 C CB  . ASP B 288 ? 0.7717 1.2152 1.1837 -0.2192 -0.0317 0.0682  548 ASP B CB  
4535 C CG  . ASP B 288 ? 0.8222 1.2003 1.2041 -0.2066 -0.0251 0.0722  548 ASP B CG  
4536 O OD1 . ASP B 288 ? 0.8334 1.1705 1.2002 -0.1977 -0.0317 0.0631  548 ASP B OD1 
4537 O OD2 . ASP B 288 ? 0.8512 1.2206 1.2245 -0.2053 -0.0131 0.0847  548 ASP B OD2 
4538 N N   . HIS B 289 ? 0.8216 1.1730 1.2019 -0.2176 -0.0613 0.0393  549 HIS B N   
4539 C CA  . HIS B 289 ? 0.8283 1.1297 1.1863 -0.2299 -0.0702 0.0330  549 HIS B CA  
4540 C C   . HIS B 289 ? 0.8106 1.1355 1.1814 -0.2257 -0.0868 0.0186  549 HIS B C   
4541 O O   . HIS B 289 ? 0.7479 1.1085 1.1357 -0.2053 -0.0914 0.0124  549 HIS B O   
4542 C CB  . HIS B 289 ? 0.8352 1.0762 1.1614 -0.2143 -0.0646 0.0324  549 HIS B CB  
4543 C CG  . HIS B 289 ? 0.8644 1.0652 1.1702 -0.2190 -0.0519 0.0442  549 HIS B CG  
4544 N ND1 . HIS B 289 ? 0.9048 1.0489 1.1824 -0.2343 -0.0536 0.0452  549 HIS B ND1 
4545 C CD2 . HIS B 289 ? 0.8466 1.0509 1.1535 -0.2082 -0.0392 0.0544  549 HIS B CD2 
4546 C CE1 . HIS B 289 ? 0.9109 1.0257 1.1738 -0.2331 -0.0430 0.0556  549 HIS B CE1 
4547 N NE2 . HIS B 289 ? 0.8800 1.0307 1.1604 -0.2178 -0.0337 0.0618  549 HIS B NE2 
4548 N N   . LYS B 290 ? 0.8860 1.1865 1.2463 -0.2445 -0.0977 0.0130  550 LYS B N   
4549 C CA  . LYS B 290 ? 0.8923 1.1983 1.2551 -0.2405 -0.1147 -0.0009 550 LYS B CA  
4550 C C   . LYS B 290 ? 0.8794 1.1266 1.2072 -0.2293 -0.1154 -0.0056 550 LYS B C   
4551 O O   . LYS B 290 ? 0.9079 1.1048 1.2079 -0.2346 -0.1073 -0.0010 550 LYS B O   
4552 C CB  . LYS B 290 ? 0.9377 1.2526 1.3091 -0.2674 -0.1279 -0.0048 550 LYS B CB  
4553 C CG  . LYS B 290 ? 0.9611 1.3413 1.3698 -0.2817 -0.1275 0.0005  550 LYS B CG  
4554 C CD  . LYS B 290 ? 0.9450 1.3912 1.3857 -0.2610 -0.1324 -0.0073 550 LYS B CD  
4555 C CE  . LYS B 290 ? 0.9630 1.4794 1.4407 -0.2750 -0.1314 -0.0032 550 LYS B CE  
4556 N NZ  . LYS B 290 ? 0.9556 1.5333 1.4589 -0.2498 -0.1281 -0.0067 550 LYS B NZ  
4557 N N   . PRO B 291 ? 0.8319 1.0859 1.1601 -0.2131 -0.1257 -0.0145 551 PRO B N   
4558 C CA  . PRO B 291 ? 0.8239 1.0296 1.1199 -0.2029 -0.1256 -0.0176 551 PRO B CA  
4559 C C   . PRO B 291 ? 0.8384 1.0078 1.1109 -0.2194 -0.1359 -0.0251 551 PRO B C   
4560 O O   . PRO B 291 ? 0.8608 1.0504 1.1476 -0.2355 -0.1495 -0.0307 551 PRO B O   
4561 C CB  . PRO B 291 ? 0.8062 1.0374 1.1140 -0.1838 -0.1363 -0.0228 551 PRO B CB  
4562 C CG  . PRO B 291 ? 0.7985 1.0856 1.1412 -0.1864 -0.1479 -0.0276 551 PRO B CG  
4563 C CD  . PRO B 291 ? 0.8114 1.1191 1.1695 -0.2026 -0.1383 -0.0214 551 PRO B CD  
4564 N N   . VAL B 292 ? 0.8312 0.9488 1.0679 -0.2142 -0.1299 -0.0256 552 VAL B N   
4565 C CA  . VAL B 292 ? 0.8717 0.9462 1.0781 -0.2266 -0.1389 -0.0335 552 VAL B CA  
4566 C C   . VAL B 292 ? 0.8874 0.9417 1.0690 -0.2118 -0.1424 -0.0394 552 VAL B C   
4567 O O   . VAL B 292 ? 0.8472 0.9000 1.0233 -0.1929 -0.1313 -0.0344 552 VAL B O   
4568 C CB  . VAL B 292 ? 0.9039 0.9294 1.0835 -0.2339 -0.1289 -0.0297 552 VAL B CB  
4569 C CG1 . VAL B 292 ? 0.9228 0.8975 1.0646 -0.2411 -0.1387 -0.0395 552 VAL B CG1 
4570 C CG2 . VAL B 292 ? 0.9158 0.9588 1.1176 -0.2539 -0.1279 -0.0218 552 VAL B CG2 
4571 N N   . SER B 293 ? 0.9147 0.9542 1.0810 -0.2214 -0.1583 -0.0490 553 SER B N   
4572 C CA  . SER B 293 ? 0.9014 0.9206 1.0399 -0.2102 -0.1627 -0.0540 553 SER B CA  
4573 C C   . SER B 293 ? 0.9391 0.9108 1.0388 -0.2199 -0.1707 -0.0634 553 SER B C   
4574 O O   . SER B 293 ? 0.9644 0.9250 1.0650 -0.2387 -0.1809 -0.0680 553 SER B O   
4575 C CB  . SER B 293 ? 0.8441 0.9016 1.0045 -0.2071 -0.1790 -0.0569 553 SER B CB  
4576 O OG  . SER B 293 ? 0.8772 0.9452 1.0482 -0.2241 -0.1983 -0.0655 553 SER B OG  
4577 N N   . SER B 294 ? 0.9134 0.8581 0.9783 -0.2070 -0.1667 -0.0659 554 SER B N   
4578 C CA  . SER B 294 ? 0.9838 0.8848 1.0078 -0.2126 -0.1759 -0.0764 554 SER B CA  
4579 C C   . SER B 294 ? 0.9993 0.8965 0.9982 -0.2002 -0.1778 -0.0781 554 SER B C   
4580 O O   . SER B 294 ? 1.0094 0.9176 1.0069 -0.1837 -0.1636 -0.0700 554 SER B O   
4581 C CB  . SER B 294 ? 1.0454 0.8985 1.0373 -0.2098 -0.1645 -0.0786 554 SER B CB  
4582 O OG  . SER B 294 ? 1.1098 0.9187 1.0603 -0.2144 -0.1761 -0.0906 554 SER B OG  
4583 N N   . VAL B 295 ? 0.9864 0.8685 0.9654 -0.2092 -0.1962 -0.0875 555 VAL B N   
4584 C CA  . VAL B 295 ? 1.0113 0.8879 0.9623 -0.2000 -0.1996 -0.0883 555 VAL B CA  
4585 C C   . VAL B 295 ? 1.0207 0.8471 0.9179 -0.1964 -0.1973 -0.0976 555 VAL B C   
4586 O O   . VAL B 295 ? 1.0522 0.8477 0.9346 -0.2080 -0.2082 -0.1078 555 VAL B O   
4587 C CB  . VAL B 295 ? 1.0307 0.9302 0.9970 -0.2098 -0.2238 -0.0913 555 VAL B CB  
4588 C CG1 . VAL B 295 ? 1.0283 0.9142 0.9577 -0.2033 -0.2294 -0.0917 555 VAL B CG1 
4589 C CG2 . VAL B 295 ? 0.9604 0.9098 0.9760 -0.2074 -0.2260 -0.0829 555 VAL B CG2 
4590 N N   . PHE B 296 ? 1.0259 0.8463 0.8942 -0.1797 -0.1835 -0.0939 556 PHE B N   
4591 C CA  . PHE B 296 ? 1.1053 0.8831 0.9199 -0.1703 -0.1778 -0.1028 556 PHE B CA  
4592 C C   . PHE B 296 ? 1.1526 0.9323 0.9362 -0.1651 -0.1824 -0.1022 556 PHE B C   
4593 O O   . PHE B 296 ? 1.1214 0.9343 0.9194 -0.1599 -0.1773 -0.0898 556 PHE B O   
4594 C CB  . PHE B 296 ? 1.1357 0.9071 0.9414 -0.1514 -0.1521 -0.0983 556 PHE B CB  
4595 C CG  . PHE B 296 ? 1.1356 0.8967 0.9628 -0.1555 -0.1472 -0.0986 556 PHE B CG  
4596 C CD1 . PHE B 296 ? 1.1354 0.8488 0.9350 -0.1596 -0.1532 -0.1106 556 PHE B CD1 
4597 C CD2 . PHE B 296 ? 1.0699 0.8665 0.9420 -0.1554 -0.1382 -0.0866 556 PHE B CD2 
4598 C CE1 . PHE B 296 ? 1.1208 0.8225 0.9383 -0.1656 -0.1504 -0.1089 556 PHE B CE1 
4599 C CE2 . PHE B 296 ? 1.0819 0.8690 0.9712 -0.1602 -0.1337 -0.0855 556 PHE B CE2 
4600 C CZ  . PHE B 296 ? 1.1193 0.8586 0.9811 -0.1663 -0.1400 -0.0960 556 PHE B CZ  
4601 N N   . ASP B 297 ? 1.2190 0.9614 0.9586 -0.1675 -0.1937 -0.1151 557 ASP B N   
4602 C CA  . ASP B 297 ? 1.2318 0.9668 0.9266 -0.1570 -0.1903 -0.1152 557 ASP B CA  
4603 C C   . ASP B 297 ? 1.2020 0.9237 0.8685 -0.1349 -0.1643 -0.1158 557 ASP B C   
4604 O O   . ASP B 297 ? 1.2795 0.9659 0.9294 -0.1303 -0.1617 -0.1272 557 ASP B O   
4605 C CB  . ASP B 297 ? 1.3148 1.0120 0.9691 -0.1656 -0.2123 -0.1302 557 ASP B CB  
4606 C CG  . ASP B 297 ? 1.3544 1.0703 1.0183 -0.1794 -0.2346 -0.1265 557 ASP B CG  
4607 O OD1 . ASP B 297 ? 1.3471 1.1019 1.0374 -0.1791 -0.2318 -0.1120 557 ASP B OD1 
4608 O OD2 . ASP B 297 ? 1.4016 1.0905 1.0447 -0.1903 -0.2571 -0.1386 557 ASP B OD2 
4609 N N   . ILE B 298 ? 1.1053 0.8559 0.7683 -0.1215 -0.1462 -0.1032 558 ILE B N   
4610 C CA  . ILE B 298 ? 1.1552 0.8991 0.7913 -0.0987 -0.1214 -0.1042 558 ILE B CA  
4611 C C   . ILE B 298 ? 1.2072 0.9599 0.8018 -0.0883 -0.1139 -0.1008 558 ILE B C   
4612 O O   . ILE B 298 ? 1.1751 0.9653 0.7851 -0.0927 -0.1124 -0.0843 558 ILE B O   
4613 C CB  . ILE B 298 ? 1.1649 0.9433 0.8429 -0.0902 -0.1017 -0.0898 558 ILE B CB  
4614 C CG1 . ILE B 298 ? 1.1331 0.9031 0.8493 -0.0998 -0.1074 -0.0925 558 ILE B CG1 
4615 C CG2 . ILE B 298 ? 1.1951 0.9716 0.8451 -0.0646 -0.0761 -0.0907 558 ILE B CG2 
4616 C CD1 . ILE B 298 ? 1.1001 0.8815 0.8378 -0.0853 -0.0860 -0.0857 558 ILE B CD1 
4617 N N   . GLY B 299 ? 1.2907 1.0078 0.8307 -0.0748 -0.1107 -0.1162 559 GLY B N   
4618 C CA  . GLY B 299 ? 1.3219 1.0477 0.8157 -0.0619 -0.1003 -0.1142 559 GLY B CA  
4619 C C   . GLY B 299 ? 1.3276 1.0928 0.8310 -0.0430 -0.0709 -0.1005 559 GLY B C   
4620 O O   . GLY B 299 ? 1.3721 1.1332 0.8881 -0.0292 -0.0566 -0.1042 559 GLY B O   
4621 N N   . VAL B 300 ? 1.3150 1.1186 0.8129 -0.0436 -0.0632 -0.0838 560 VAL B N   
4622 C CA  . VAL B 300 ? 1.2731 1.1229 0.7865 -0.0298 -0.0370 -0.0665 560 VAL B CA  
4623 C C   . VAL B 300 ? 1.3644 1.2298 0.8273 -0.0173 -0.0234 -0.0635 560 VAL B C   
4624 O O   . VAL B 300 ? 1.3747 1.2384 0.8133 -0.0302 -0.0372 -0.0596 560 VAL B O   
4625 C CB  . VAL B 300 ? 1.1651 1.0566 0.7343 -0.0479 -0.0428 -0.0424 560 VAL B CB  
4626 C CG1 . VAL B 300 ? 1.1528 1.0950 0.7338 -0.0377 -0.0194 -0.0211 560 VAL B CG1 
4627 C CG2 . VAL B 300 ? 0.9575 0.8409 0.5764 -0.0552 -0.0508 -0.0452 560 VAL B CG2 
4628 N N   . ARG B 301 ? 1.4367 1.3179 0.8823 0.0085  0.0032  -0.0655 561 ARG B N   
4629 C CA  . ARG B 301 ? 1.5510 1.4555 0.9491 0.0227  0.0196  -0.0618 561 ARG B CA  
4630 C C   . ARG B 301 ? 1.5771 1.5394 1.0016 0.0072  0.0248  -0.0302 561 ARG B C   
4631 O O   . ARG B 301 ? 1.5114 1.5131 0.9810 0.0082  0.0380  -0.0128 561 ARG B O   
4632 C CB  . ARG B 301 ? 1.5581 1.4690 0.9325 0.0572  0.0471  -0.0734 561 ARG B CB  
4633 C CG  . ARG B 301 ? 1.5711 1.4207 0.8988 0.0767  0.0409  -0.1060 561 ARG B CG  
4634 N N   . VAL B 302 ? 1.6756 1.6395 1.0714 -0.0080 0.0119  -0.0226 562 VAL B N   
4635 C CA  . VAL B 302 ? 1.7487 1.7589 1.1638 -0.0271 0.0101  0.0080  562 VAL B CA  
4636 C C   . VAL B 302 ? 1.9881 2.0310 1.3544 -0.0172 0.0294  0.0180  562 VAL B C   
4637 O O   . VAL B 302 ? 2.0006 2.0166 1.3081 -0.0054 0.0299  -0.0001 562 VAL B O   
4638 C CB  . VAL B 302 ? 1.6455 1.6319 1.0682 -0.0559 -0.0245 0.0115  562 VAL B CB  
4639 C CG1 . VAL B 302 ? 1.5746 1.6029 1.0152 -0.0767 -0.0309 0.0437  562 VAL B CG1 
4640 C CG2 . VAL B 302 ? 1.5837 1.5428 1.0527 -0.0647 -0.0425 0.0007  562 VAL B CG2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   261 261 MET MET A . n 
A 1 2   ILE 2   262 262 ILE ILE A . n 
A 1 3   GLN 3   263 263 GLN GLN A . n 
A 1 4   ASN 4   264 264 ASN ASN A . n 
A 1 5   PHE 5   265 265 PHE PHE A . n 
A 1 6   ARG 6   266 266 ARG ARG A . n 
A 1 7   PHE 7   267 267 PHE PHE A . n 
A 1 8   PHE 8   268 268 PHE PHE A . n 
A 1 9   ALA 9   269 269 ALA ALA A . n 
A 1 10  GLY 10  270 270 GLY GLY A . n 
A 1 11  THR 11  271 271 THR THR A . n 
A 1 12  TYR 12  272 272 TYR TYR A . n 
A 1 13  ASN 13  273 273 ASN ASN A . n 
A 1 14  VAL 14  274 274 VAL VAL A . n 
A 1 15  ASN 15  275 275 ASN ASN A . n 
A 1 16  GLY 16  276 276 GLY GLY A . n 
A 1 17  GLN 17  277 277 GLN GLN A . n 
A 1 18  SER 18  278 278 SER SER A . n 
A 1 19  PRO 19  279 279 PRO PRO A . n 
A 1 20  LYS 20  280 280 LYS LYS A . n 
A 1 21  GLU 21  281 281 GLU GLU A . n 
A 1 22  CYS 22  282 282 CYS CYS A . n 
A 1 23  LEU 23  283 283 LEU LEU A . n 
A 1 24  ARG 24  284 284 ARG ARG A . n 
A 1 25  LEU 25  285 285 LEU LEU A . n 
A 1 26  TRP 26  286 286 TRP TRP A . n 
A 1 27  LEU 27  287 287 LEU LEU A . n 
A 1 28  SER 28  288 288 SER SER A . n 
A 1 29  ASN 29  289 289 ASN ASN A . n 
A 1 30  GLY 30  290 290 GLY GLY A . n 
A 1 31  ILE 31  291 291 ILE ILE A . n 
A 1 32  GLN 32  292 292 GLN GLN A . n 
A 1 33  ALA 33  293 293 ALA ALA A . n 
A 1 34  PRO 34  294 294 PRO PRO A . n 
A 1 35  ASP 35  295 295 ASP ASP A . n 
A 1 36  VAL 36  296 296 VAL VAL A . n 
A 1 37  TYR 37  297 297 TYR TYR A . n 
A 1 38  CYS 38  298 298 CYS CYS A . n 
A 1 39  VAL 39  299 299 VAL VAL A . n 
A 1 40  GLY 40  300 300 GLY GLY A . n 
A 1 41  PHE 41  301 301 PHE PHE A . n 
A 1 42  GLN 42  302 302 GLN GLN A . n 
A 1 43  GLU 43  303 303 GLU GLU A . n 
A 1 44  LEU 44  304 304 LEU LEU A . n 
A 1 45  ASP 45  305 305 ASP ASP A . n 
A 1 46  LEU 46  306 306 LEU LEU A . n 
A 1 47  SER 47  307 307 SER SER A . n 
A 1 48  LYS 48  308 308 LYS LYS A . n 
A 1 49  GLU 49  309 309 GLU GLU A . n 
A 1 50  ALA 50  310 310 ALA ALA A . n 
A 1 51  PHE 51  311 311 PHE PHE A . n 
A 1 52  PHE 52  312 312 PHE PHE A . n 
A 1 53  PHE 53  313 313 PHE PHE A . n 
A 1 54  HIS 54  314 314 HIS HIS A . n 
A 1 55  ASP 55  315 315 ASP ASP A . n 
A 1 56  THR 56  316 316 THR THR A . n 
A 1 57  PRO 57  317 317 PRO PRO A . n 
A 1 58  LYS 58  318 318 LYS LYS A . n 
A 1 59  GLU 59  319 319 GLU GLU A . n 
A 1 60  GLU 60  320 320 GLU GLU A . n 
A 1 61  GLU 61  321 321 GLU GLU A . n 
A 1 62  TRP 62  322 322 TRP TRP A . n 
A 1 63  PHE 63  323 323 PHE PHE A . n 
A 1 64  LYS 64  324 324 LYS LYS A . n 
A 1 65  ALA 65  325 325 ALA ALA A . n 
A 1 66  VAL 66  326 326 VAL VAL A . n 
A 1 67  SER 67  327 327 SER SER A . n 
A 1 68  GLU 68  328 328 GLU GLU A . n 
A 1 69  GLY 69  329 329 GLY GLY A . n 
A 1 70  LEU 70  330 330 LEU LEU A . n 
A 1 71  HIS 71  331 331 HIS HIS A . n 
A 1 72  PRO 72  332 332 PRO PRO A . n 
A 1 73  ASP 73  333 333 ASP ASP A . n 
A 1 74  ALA 74  334 334 ALA ALA A . n 
A 1 75  LYS 75  335 335 LYS LYS A . n 
A 1 76  TYR 76  336 336 TYR TYR A . n 
A 1 77  ALA 77  337 337 ALA ALA A . n 
A 1 78  LYS 78  338 338 LYS LYS A . n 
A 1 79  VAL 79  339 339 VAL VAL A . n 
A 1 80  LYS 80  340 340 LYS LYS A . n 
A 1 81  LEU 81  341 341 LEU LEU A . n 
A 1 82  ILE 82  342 342 ILE ILE A . n 
A 1 83  ARG 83  343 343 ARG ARG A . n 
A 1 84  LEU 84  344 344 LEU LEU A . n 
A 1 85  VAL 85  345 345 VAL VAL A . n 
A 1 86  GLY 86  346 346 GLY GLY A . n 
A 1 87  ILE 87  347 347 ILE ILE A . n 
A 1 88  MET 88  348 348 MET MET A . n 
A 1 89  LEU 89  349 349 LEU LEU A . n 
A 1 90  LEU 90  350 350 LEU LEU A . n 
A 1 91  LEU 91  351 351 LEU LEU A . n 
A 1 92  TYR 92  352 352 TYR TYR A . n 
A 1 93  VAL 93  353 353 VAL VAL A . n 
A 1 94  LYS 94  354 354 LYS LYS A . n 
A 1 95  GLN 95  355 355 GLN GLN A . n 
A 1 96  GLU 96  356 356 GLU GLU A . n 
A 1 97  HIS 97  357 357 HIS HIS A . n 
A 1 98  ALA 98  358 358 ALA ALA A . n 
A 1 99  ALA 99  359 359 ALA ALA A . n 
A 1 100 TYR 100 360 360 TYR TYR A . n 
A 1 101 ILE 101 361 361 ILE ILE A . n 
A 1 102 SER 102 362 362 SER SER A . n 
A 1 103 GLU 103 363 363 GLU GLU A . n 
A 1 104 VAL 104 364 364 VAL VAL A . n 
A 1 105 GLU 105 365 365 GLU GLU A . n 
A 1 106 ALA 106 366 366 ALA ALA A . n 
A 1 107 GLU 107 367 367 GLU GLU A . n 
A 1 108 THR 108 368 368 THR THR A . n 
A 1 109 VAL 109 369 369 VAL VAL A . n 
A 1 110 GLY 110 370 370 GLY GLY A . n 
A 1 111 THR 111 371 371 THR THR A . n 
A 1 112 GLY 112 372 372 GLY GLY A . n 
A 1 113 ILE 113 373 373 ILE ILE A . n 
A 1 114 MET 114 374 374 MET MET A . n 
A 1 115 GLY 115 375 375 GLY GLY A . n 
A 1 116 ARG 116 376 376 ARG ARG A . n 
A 1 117 MET 117 377 377 MET MET A . n 
A 1 118 GLY 118 378 378 GLY GLY A . n 
A 1 119 ASN 119 379 379 ASN ASN A . n 
A 1 120 LYS 120 380 380 LYS LYS A . n 
A 1 121 GLY 121 381 381 GLY GLY A . n 
A 1 122 GLY 122 382 382 GLY GLY A . n 
A 1 123 VAL 123 383 383 VAL VAL A . n 
A 1 124 ALA 124 384 384 ALA ALA A . n 
A 1 125 ILE 125 385 385 ILE ILE A . n 
A 1 126 ARG 126 386 386 ARG ARG A . n 
A 1 127 PHE 127 387 387 PHE PHE A . n 
A 1 128 GLN 128 388 388 GLN GLN A . n 
A 1 129 PHE 129 389 389 PHE PHE A . n 
A 1 130 HIS 130 390 390 HIS HIS A . n 
A 1 131 ASN 131 391 391 ASN ASN A . n 
A 1 132 THR 132 392 392 THR THR A . n 
A 1 133 SER 133 393 393 SER SER A . n 
A 1 134 ILE 134 394 394 ILE ILE A . n 
A 1 135 CYS 135 395 395 CYS CYS A . n 
A 1 136 VAL 136 396 396 VAL VAL A . n 
A 1 137 VAL 137 397 397 VAL VAL A . n 
A 1 138 ASN 138 398 398 ASN ASN A . n 
A 1 139 SER 139 399 399 SER SER A . n 
A 1 140 HIS 140 400 400 HIS HIS A . n 
A 1 141 LEU 141 401 401 LEU LEU A . n 
A 1 142 ALA 142 402 402 ALA ALA A . n 
A 1 143 ALA 143 403 403 ALA ALA A . n 
A 1 144 HIS 144 404 404 HIS HIS A . n 
A 1 145 ILE 145 405 405 ILE ILE A . n 
A 1 146 GLU 146 406 406 GLU GLU A . n 
A 1 147 GLU 147 407 407 GLU GLU A . n 
A 1 148 TYR 148 408 408 TYR TYR A . n 
A 1 149 GLU 149 409 409 GLU GLU A . n 
A 1 150 ARG 150 410 410 ARG ARG A . n 
A 1 151 ARG 151 411 411 ARG ARG A . n 
A 1 152 ASN 152 412 412 ASN ASN A . n 
A 1 153 GLN 153 413 413 GLN GLN A . n 
A 1 154 ASP 154 414 414 ASP ASP A . n 
A 1 155 TYR 155 415 415 TYR TYR A . n 
A 1 156 LYS 156 416 416 LYS LYS A . n 
A 1 157 ASP 157 417 417 ASP ASP A . n 
A 1 158 ILE 158 418 418 ILE ILE A . n 
A 1 159 CYS 159 419 419 CYS CYS A . n 
A 1 160 SER 160 420 420 SER SER A . n 
A 1 161 ARG 161 421 421 ARG ARG A . n 
A 1 162 MET 162 422 422 MET MET A . n 
A 1 163 GLN 163 423 423 GLN GLN A . n 
A 1 164 PHE 164 424 424 PHE PHE A . n 
A 1 165 CYS 165 425 425 CYS CYS A . n 
A 1 166 GLN 166 426 426 GLN GLN A . n 
A 1 167 PRO 167 427 427 PRO PRO A . n 
A 1 168 ASP 168 428 428 ASP ASP A . n 
A 1 169 PRO 169 429 429 PRO PRO A . n 
A 1 170 SER 170 430 430 SER SER A . n 
A 1 171 LEU 171 431 431 LEU LEU A . n 
A 1 172 PRO 172 432 432 PRO PRO A . n 
A 1 173 PRO 173 433 433 PRO PRO A . n 
A 1 174 LEU 174 434 434 LEU LEU A . n 
A 1 175 THR 175 435 435 THR THR A . n 
A 1 176 ILE 176 436 436 ILE ILE A . n 
A 1 177 SER 177 437 437 SER SER A . n 
A 1 178 ASN 178 438 438 ASN ASN A . n 
A 1 179 HIS 179 439 439 HIS HIS A . n 
A 1 180 ASP 180 440 440 ASP ASP A . n 
A 1 181 VAL 181 441 441 VAL VAL A . n 
A 1 182 ILE 182 442 442 ILE ILE A . n 
A 1 183 LEU 183 443 443 LEU LEU A . n 
A 1 184 TRP 184 444 444 TRP TRP A . n 
A 1 185 LEU 185 445 445 LEU LEU A . n 
A 1 186 GLY 186 446 446 GLY GLY A . n 
A 1 187 ASP 187 447 447 ASP ASP A . n 
A 1 188 LEU 188 448 448 LEU LEU A . n 
A 1 189 ASN 189 449 449 ASN ASN A . n 
A 1 190 TYR 190 450 450 TYR TYR A . n 
A 1 191 ARG 191 451 451 ARG ARG A . n 
A 1 192 ILE 192 452 452 ILE ILE A . n 
A 1 193 GLU 193 453 453 GLU GLU A . n 
A 1 194 GLU 194 454 454 GLU GLU A . n 
A 1 195 LEU 195 455 455 LEU LEU A . n 
A 1 196 ASP 196 456 456 ASP ASP A . n 
A 1 197 VAL 197 457 457 VAL VAL A . n 
A 1 198 GLU 198 458 458 GLU GLU A . n 
A 1 199 LYS 199 459 459 LYS LYS A . n 
A 1 200 VAL 200 460 460 VAL VAL A . n 
A 1 201 LYS 201 461 461 LYS LYS A . n 
A 1 202 LYS 202 462 462 LYS LYS A . n 
A 1 203 LEU 203 463 463 LEU LEU A . n 
A 1 204 ILE 204 464 464 ILE ILE A . n 
A 1 205 GLU 205 465 465 GLU GLU A . n 
A 1 206 GLU 206 466 466 GLU GLU A . n 
A 1 207 LYS 207 467 467 LYS LYS A . n 
A 1 208 ASP 208 468 468 ASP ASP A . n 
A 1 209 PHE 209 469 469 PHE PHE A . n 
A 1 210 GLN 210 470 470 GLN GLN A . n 
A 1 211 MET 211 471 471 MET MET A . n 
A 1 212 LEU 212 472 472 LEU LEU A . n 
A 1 213 TYR 213 473 473 TYR TYR A . n 
A 1 214 ALA 214 474 474 ALA ALA A . n 
A 1 215 TYR 215 475 475 TYR TYR A . n 
A 1 216 ASP 216 476 476 ASP ASP A . n 
A 1 217 GLN 217 477 477 GLN GLN A . n 
A 1 218 LEU 218 478 478 LEU LEU A . n 
A 1 219 LYS 219 479 479 LYS LYS A . n 
A 1 220 ILE 220 480 480 ILE ILE A . n 
A 1 221 GLN 221 481 481 GLN GLN A . n 
A 1 222 VAL 222 482 482 VAL VAL A . n 
A 1 223 ALA 223 483 483 ALA ALA A . n 
A 1 224 ALA 224 484 484 ALA ALA A . n 
A 1 225 LYS 225 485 485 LYS LYS A . n 
A 1 226 THR 226 486 486 THR THR A . n 
A 1 227 VAL 227 487 487 VAL VAL A . n 
A 1 228 PHE 228 488 488 PHE PHE A . n 
A 1 229 GLU 229 489 489 GLU GLU A . n 
A 1 230 GLY 230 490 490 GLY GLY A . n 
A 1 231 PHE 231 491 491 PHE PHE A . n 
A 1 232 THR 232 492 492 THR THR A . n 
A 1 233 GLU 233 493 493 GLU GLU A . n 
A 1 234 GLY 234 494 494 GLY GLY A . n 
A 1 235 GLU 235 495 495 GLU GLU A . n 
A 1 236 LEU 236 496 496 LEU LEU A . n 
A 1 237 THR 237 497 497 THR THR A . n 
A 1 238 PHE 238 498 498 PHE PHE A . n 
A 1 239 GLN 239 499 499 GLN GLN A . n 
A 1 240 PRO 240 500 500 PRO PRO A . n 
A 1 241 THR 241 501 501 THR THR A . n 
A 1 242 TYR 242 502 502 TYR TYR A . n 
A 1 243 LYS 243 503 503 LYS LYS A . n 
A 1 244 TYR 244 504 504 TYR TYR A . n 
A 1 245 ASP 245 505 505 ASP ASP A . n 
A 1 246 THR 246 506 506 THR THR A . n 
A 1 247 GLY 247 507 507 GLY GLY A . n 
A 1 248 SER 248 508 508 SER SER A . n 
A 1 249 ASP 249 509 509 ASP ASP A . n 
A 1 250 ASP 250 510 510 ASP ASP A . n 
A 1 251 TRP 251 511 511 TRP TRP A . n 
A 1 252 ASP 252 512 512 ASP ASP A . n 
A 1 253 THR 253 513 513 THR THR A . n 
A 1 254 SER 254 514 514 SER SER A . n 
A 1 255 GLU 255 515 ?   ?   ?   A . n 
A 1 256 LYS 256 516 ?   ?   ?   A . n 
A 1 257 CYS 257 517 ?   ?   ?   A . n 
A 1 258 ARG 258 518 518 ARG ARG A . n 
A 1 259 ALA 259 519 519 ALA ALA A . n 
A 1 260 PRO 260 520 520 PRO PRO A . n 
A 1 261 ALA 261 521 521 ALA ALA A . n 
A 1 262 TRP 262 522 522 TRP TRP A . n 
A 1 263 CYS 263 523 523 CYS CYS A . n 
A 1 264 ASP 264 524 524 ASP ASP A . n 
A 1 265 ARG 265 525 525 ARG ARG A . n 
A 1 266 ILE 266 526 526 ILE ILE A . n 
A 1 267 LEU 267 527 527 LEU LEU A . n 
A 1 268 TRP 268 528 528 TRP TRP A . n 
A 1 269 LYS 269 529 529 LYS LYS A . n 
A 1 270 GLY 270 530 530 GLY GLY A . n 
A 1 271 LYS 271 531 531 LYS LYS A . n 
A 1 272 ASN 272 532 532 ASN ASN A . n 
A 1 273 ILE 273 533 533 ILE ILE A . n 
A 1 274 THR 274 534 534 THR THR A . n 
A 1 275 GLN 275 535 535 GLN GLN A . n 
A 1 276 LEU 276 536 536 LEU LEU A . n 
A 1 277 SER 277 537 537 SER SER A . n 
A 1 278 TYR 278 538 538 TYR TYR A . n 
A 1 279 GLN 279 539 539 GLN GLN A . n 
A 1 280 SER 280 540 540 SER SER A . n 
A 1 281 HIS 281 541 541 HIS HIS A . n 
A 1 282 MET 282 542 542 MET MET A . n 
A 1 283 ALA 283 543 543 ALA ALA A . n 
A 1 284 LEU 284 544 544 LEU LEU A . n 
A 1 285 LYS 285 545 545 LYS LYS A . n 
A 1 286 THR 286 546 546 THR THR A . n 
A 1 287 SER 287 547 547 SER SER A . n 
A 1 288 ASP 288 548 548 ASP ASP A . n 
A 1 289 HIS 289 549 549 HIS HIS A . n 
A 1 290 LYS 290 550 550 LYS LYS A . n 
A 1 291 PRO 291 551 551 PRO PRO A . n 
A 1 292 VAL 292 552 552 VAL VAL A . n 
A 1 293 SER 293 553 553 SER SER A . n 
A 1 294 SER 294 554 554 SER SER A . n 
A 1 295 VAL 295 555 555 VAL VAL A . n 
A 1 296 PHE 296 556 556 PHE PHE A . n 
A 1 297 ASP 297 557 557 ASP ASP A . n 
A 1 298 ILE 298 558 558 ILE ILE A . n 
A 1 299 GLY 299 559 559 GLY GLY A . n 
A 1 300 VAL 300 560 560 VAL VAL A . n 
A 1 301 ARG 301 561 561 ARG ARG A . n 
A 1 302 VAL 302 562 562 VAL VAL A . n 
A 1 303 VAL 303 563 563 VAL VAL A . n 
A 1 304 ASN 304 564 ?   ?   ?   A . n 
A 1 305 ASP 305 565 ?   ?   ?   A . n 
A 1 306 GLU 306 566 ?   ?   ?   A . n 
A 1 307 ALA 307 567 ?   ?   ?   A . n 
A 1 308 HIS 308 568 ?   ?   ?   A . n 
A 1 309 HIS 309 569 ?   ?   ?   A . n 
A 1 310 HIS 310 570 ?   ?   ?   A . n 
A 1 311 HIS 311 571 ?   ?   ?   A . n 
A 1 312 HIS 312 572 ?   ?   ?   A . n 
A 1 313 HIS 313 573 ?   ?   ?   A . n 
B 1 1   MET 1   261 261 MET MET B . n 
B 1 2   ILE 2   262 262 ILE ILE B . n 
B 1 3   GLN 3   263 263 GLN GLN B . n 
B 1 4   ASN 4   264 264 ASN ASN B . n 
B 1 5   PHE 5   265 265 PHE PHE B . n 
B 1 6   ARG 6   266 266 ARG ARG B . n 
B 1 7   PHE 7   267 267 PHE PHE B . n 
B 1 8   PHE 8   268 268 PHE PHE B . n 
B 1 9   ALA 9   269 269 ALA ALA B . n 
B 1 10  GLY 10  270 270 GLY GLY B . n 
B 1 11  THR 11  271 271 THR THR B . n 
B 1 12  TYR 12  272 272 TYR TYR B . n 
B 1 13  ASN 13  273 273 ASN ASN B . n 
B 1 14  VAL 14  274 274 VAL VAL B . n 
B 1 15  ASN 15  275 275 ASN ASN B . n 
B 1 16  GLY 16  276 276 GLY GLY B . n 
B 1 17  GLN 17  277 277 GLN GLN B . n 
B 1 18  SER 18  278 278 SER SER B . n 
B 1 19  PRO 19  279 279 PRO PRO B . n 
B 1 20  LYS 20  280 280 LYS LYS B . n 
B 1 21  GLU 21  281 281 GLU GLU B . n 
B 1 22  CYS 22  282 282 CYS CYS B . n 
B 1 23  LEU 23  283 283 LEU LEU B . n 
B 1 24  ARG 24  284 284 ARG ARG B . n 
B 1 25  LEU 25  285 285 LEU LEU B . n 
B 1 26  TRP 26  286 286 TRP TRP B . n 
B 1 27  LEU 27  287 287 LEU LEU B . n 
B 1 28  SER 28  288 288 SER SER B . n 
B 1 29  ASN 29  289 289 ASN ASN B . n 
B 1 30  GLY 30  290 290 GLY GLY B . n 
B 1 31  ILE 31  291 291 ILE ILE B . n 
B 1 32  GLN 32  292 292 GLN GLN B . n 
B 1 33  ALA 33  293 293 ALA ALA B . n 
B 1 34  PRO 34  294 294 PRO PRO B . n 
B 1 35  ASP 35  295 295 ASP ASP B . n 
B 1 36  VAL 36  296 296 VAL VAL B . n 
B 1 37  TYR 37  297 297 TYR TYR B . n 
B 1 38  CYS 38  298 298 CYS CYS B . n 
B 1 39  VAL 39  299 299 VAL VAL B . n 
B 1 40  GLY 40  300 300 GLY GLY B . n 
B 1 41  PHE 41  301 301 PHE PHE B . n 
B 1 42  GLN 42  302 302 GLN GLN B . n 
B 1 43  GLU 43  303 303 GLU GLU B . n 
B 1 44  LEU 44  304 304 LEU LEU B . n 
B 1 45  ASP 45  305 305 ASP ASP B . n 
B 1 46  LEU 46  306 306 LEU LEU B . n 
B 1 47  SER 47  307 307 SER SER B . n 
B 1 48  LYS 48  308 308 LYS LYS B . n 
B 1 49  GLU 49  309 309 GLU GLU B . n 
B 1 50  ALA 50  310 310 ALA ALA B . n 
B 1 51  PHE 51  311 311 PHE PHE B . n 
B 1 52  PHE 52  312 312 PHE PHE B . n 
B 1 53  PHE 53  313 313 PHE PHE B . n 
B 1 54  HIS 54  314 314 HIS HIS B . n 
B 1 55  ASP 55  315 315 ASP ASP B . n 
B 1 56  THR 56  316 316 THR THR B . n 
B 1 57  PRO 57  317 317 PRO PRO B . n 
B 1 58  LYS 58  318 318 LYS LYS B . n 
B 1 59  GLU 59  319 319 GLU GLU B . n 
B 1 60  GLU 60  320 320 GLU GLU B . n 
B 1 61  GLU 61  321 321 GLU GLU B . n 
B 1 62  TRP 62  322 322 TRP TRP B . n 
B 1 63  PHE 63  323 323 PHE PHE B . n 
B 1 64  LYS 64  324 324 LYS LYS B . n 
B 1 65  ALA 65  325 325 ALA ALA B . n 
B 1 66  VAL 66  326 326 VAL VAL B . n 
B 1 67  SER 67  327 327 SER SER B . n 
B 1 68  GLU 68  328 328 GLU GLU B . n 
B 1 69  GLY 69  329 329 GLY GLY B . n 
B 1 70  LEU 70  330 330 LEU LEU B . n 
B 1 71  HIS 71  331 331 HIS HIS B . n 
B 1 72  PRO 72  332 332 PRO PRO B . n 
B 1 73  ASP 73  333 333 ASP ASP B . n 
B 1 74  ALA 74  334 334 ALA ALA B . n 
B 1 75  LYS 75  335 335 LYS LYS B . n 
B 1 76  TYR 76  336 336 TYR TYR B . n 
B 1 77  ALA 77  337 337 ALA ALA B . n 
B 1 78  LYS 78  338 338 LYS LYS B . n 
B 1 79  VAL 79  339 339 VAL VAL B . n 
B 1 80  LYS 80  340 340 LYS LYS B . n 
B 1 81  LEU 81  341 341 LEU LEU B . n 
B 1 82  ILE 82  342 342 ILE ILE B . n 
B 1 83  ARG 83  343 343 ARG ARG B . n 
B 1 84  LEU 84  344 344 LEU LEU B . n 
B 1 85  VAL 85  345 345 VAL VAL B . n 
B 1 86  GLY 86  346 346 GLY GLY B . n 
B 1 87  ILE 87  347 347 ILE ILE B . n 
B 1 88  MET 88  348 348 MET MET B . n 
B 1 89  LEU 89  349 349 LEU LEU B . n 
B 1 90  LEU 90  350 350 LEU LEU B . n 
B 1 91  LEU 91  351 351 LEU LEU B . n 
B 1 92  TYR 92  352 352 TYR TYR B . n 
B 1 93  VAL 93  353 353 VAL VAL B . n 
B 1 94  LYS 94  354 354 LYS LYS B . n 
B 1 95  GLN 95  355 355 GLN GLN B . n 
B 1 96  GLU 96  356 356 GLU GLU B . n 
B 1 97  HIS 97  357 357 HIS HIS B . n 
B 1 98  ALA 98  358 358 ALA ALA B . n 
B 1 99  ALA 99  359 359 ALA ALA B . n 
B 1 100 TYR 100 360 360 TYR TYR B . n 
B 1 101 ILE 101 361 361 ILE ILE B . n 
B 1 102 SER 102 362 362 SER SER B . n 
B 1 103 GLU 103 363 363 GLU GLU B . n 
B 1 104 VAL 104 364 364 VAL VAL B . n 
B 1 105 GLU 105 365 365 GLU GLU B . n 
B 1 106 ALA 106 366 366 ALA ALA B . n 
B 1 107 GLU 107 367 367 GLU GLU B . n 
B 1 108 THR 108 368 368 THR THR B . n 
B 1 109 VAL 109 369 369 VAL VAL B . n 
B 1 110 GLY 110 370 370 GLY GLY B . n 
B 1 111 THR 111 371 371 THR THR B . n 
B 1 112 GLY 112 372 372 GLY GLY B . n 
B 1 113 ILE 113 373 373 ILE ILE B . n 
B 1 114 MET 114 374 374 MET MET B . n 
B 1 115 GLY 115 375 375 GLY GLY B . n 
B 1 116 ARG 116 376 376 ARG ARG B . n 
B 1 117 MET 117 377 377 MET MET B . n 
B 1 118 GLY 118 378 378 GLY GLY B . n 
B 1 119 ASN 119 379 379 ASN ASN B . n 
B 1 120 LYS 120 380 380 LYS LYS B . n 
B 1 121 GLY 121 381 381 GLY GLY B . n 
B 1 122 GLY 122 382 382 GLY GLY B . n 
B 1 123 VAL 123 383 383 VAL VAL B . n 
B 1 124 ALA 124 384 384 ALA ALA B . n 
B 1 125 ILE 125 385 385 ILE ILE B . n 
B 1 126 ARG 126 386 386 ARG ARG B . n 
B 1 127 PHE 127 387 387 PHE PHE B . n 
B 1 128 GLN 128 388 388 GLN GLN B . n 
B 1 129 PHE 129 389 389 PHE PHE B . n 
B 1 130 HIS 130 390 390 HIS HIS B . n 
B 1 131 ASN 131 391 391 ASN ASN B . n 
B 1 132 THR 132 392 392 THR THR B . n 
B 1 133 SER 133 393 393 SER SER B . n 
B 1 134 ILE 134 394 394 ILE ILE B . n 
B 1 135 CYS 135 395 395 CYS CYS B . n 
B 1 136 VAL 136 396 396 VAL VAL B . n 
B 1 137 VAL 137 397 397 VAL VAL B . n 
B 1 138 ASN 138 398 398 ASN ASN B . n 
B 1 139 SER 139 399 399 SER SER B . n 
B 1 140 HIS 140 400 400 HIS HIS B . n 
B 1 141 LEU 141 401 401 LEU LEU B . n 
B 1 142 ALA 142 402 402 ALA ALA B . n 
B 1 143 ALA 143 403 403 ALA ALA B . n 
B 1 144 HIS 144 404 404 HIS HIS B . n 
B 1 145 ILE 145 405 405 ILE ILE B . n 
B 1 146 GLU 146 406 406 GLU GLU B . n 
B 1 147 GLU 147 407 407 GLU GLU B . n 
B 1 148 TYR 148 408 408 TYR TYR B . n 
B 1 149 GLU 149 409 409 GLU GLU B . n 
B 1 150 ARG 150 410 410 ARG ARG B . n 
B 1 151 ARG 151 411 411 ARG ARG B . n 
B 1 152 ASN 152 412 412 ASN ASN B . n 
B 1 153 GLN 153 413 413 GLN GLN B . n 
B 1 154 ASP 154 414 414 ASP ASP B . n 
B 1 155 TYR 155 415 415 TYR TYR B . n 
B 1 156 LYS 156 416 416 LYS LYS B . n 
B 1 157 ASP 157 417 417 ASP ASP B . n 
B 1 158 ILE 158 418 418 ILE ILE B . n 
B 1 159 CYS 159 419 419 CYS CYS B . n 
B 1 160 SER 160 420 420 SER SER B . n 
B 1 161 ARG 161 421 421 ARG ARG B . n 
B 1 162 MET 162 422 422 MET MET B . n 
B 1 163 GLN 163 423 423 GLN GLN B . n 
B 1 164 PHE 164 424 424 PHE PHE B . n 
B 1 165 CYS 165 425 425 CYS CYS B . n 
B 1 166 GLN 166 426 ?   ?   ?   B . n 
B 1 167 PRO 167 427 ?   ?   ?   B . n 
B 1 168 ASP 168 428 ?   ?   ?   B . n 
B 1 169 PRO 169 429 ?   ?   ?   B . n 
B 1 170 SER 170 430 ?   ?   ?   B . n 
B 1 171 LEU 171 431 ?   ?   ?   B . n 
B 1 172 PRO 172 432 ?   ?   ?   B . n 
B 1 173 PRO 173 433 ?   ?   ?   B . n 
B 1 174 LEU 174 434 434 LEU LEU B . n 
B 1 175 THR 175 435 435 THR THR B . n 
B 1 176 ILE 176 436 436 ILE ILE B . n 
B 1 177 SER 177 437 437 SER SER B . n 
B 1 178 ASN 178 438 438 ASN ASN B . n 
B 1 179 HIS 179 439 439 HIS HIS B . n 
B 1 180 ASP 180 440 440 ASP ASP B . n 
B 1 181 VAL 181 441 441 VAL VAL B . n 
B 1 182 ILE 182 442 442 ILE ILE B . n 
B 1 183 LEU 183 443 443 LEU LEU B . n 
B 1 184 TRP 184 444 444 TRP TRP B . n 
B 1 185 LEU 185 445 445 LEU LEU B . n 
B 1 186 GLY 186 446 446 GLY GLY B . n 
B 1 187 ASP 187 447 447 ASP ASP B . n 
B 1 188 LEU 188 448 448 LEU LEU B . n 
B 1 189 ASN 189 449 449 ASN ASN B . n 
B 1 190 TYR 190 450 450 TYR TYR B . n 
B 1 191 ARG 191 451 451 ARG ARG B . n 
B 1 192 ILE 192 452 452 ILE ILE B . n 
B 1 193 GLU 193 453 453 GLU GLU B . n 
B 1 194 GLU 194 454 454 GLU GLU B . n 
B 1 195 LEU 195 455 455 LEU LEU B . n 
B 1 196 ASP 196 456 456 ASP ASP B . n 
B 1 197 VAL 197 457 457 VAL VAL B . n 
B 1 198 GLU 198 458 458 GLU GLU B . n 
B 1 199 LYS 199 459 459 LYS LYS B . n 
B 1 200 VAL 200 460 460 VAL VAL B . n 
B 1 201 LYS 201 461 461 LYS LYS B . n 
B 1 202 LYS 202 462 462 LYS LYS B . n 
B 1 203 LEU 203 463 463 LEU LEU B . n 
B 1 204 ILE 204 464 464 ILE ILE B . n 
B 1 205 GLU 205 465 465 GLU GLU B . n 
B 1 206 GLU 206 466 466 GLU GLU B . n 
B 1 207 LYS 207 467 467 LYS LYS B . n 
B 1 208 ASP 208 468 468 ASP ASP B . n 
B 1 209 PHE 209 469 469 PHE PHE B . n 
B 1 210 GLN 210 470 470 GLN GLN B . n 
B 1 211 MET 211 471 471 MET MET B . n 
B 1 212 LEU 212 472 472 LEU LEU B . n 
B 1 213 TYR 213 473 473 TYR TYR B . n 
B 1 214 ALA 214 474 474 ALA ALA B . n 
B 1 215 TYR 215 475 475 TYR TYR B . n 
B 1 216 ASP 216 476 476 ASP ASP B . n 
B 1 217 GLN 217 477 477 GLN GLN B . n 
B 1 218 LEU 218 478 478 LEU LEU B . n 
B 1 219 LYS 219 479 479 LYS LYS B . n 
B 1 220 ILE 220 480 480 ILE ILE B . n 
B 1 221 GLN 221 481 481 GLN GLN B . n 
B 1 222 VAL 222 482 482 VAL VAL B . n 
B 1 223 ALA 223 483 483 ALA ALA B . n 
B 1 224 ALA 224 484 484 ALA ALA B . n 
B 1 225 LYS 225 485 485 LYS LYS B . n 
B 1 226 THR 226 486 486 THR THR B . n 
B 1 227 VAL 227 487 487 VAL VAL B . n 
B 1 228 PHE 228 488 488 PHE PHE B . n 
B 1 229 GLU 229 489 489 GLU GLU B . n 
B 1 230 GLY 230 490 490 GLY GLY B . n 
B 1 231 PHE 231 491 491 PHE PHE B . n 
B 1 232 THR 232 492 492 THR THR B . n 
B 1 233 GLU 233 493 493 GLU GLU B . n 
B 1 234 GLY 234 494 494 GLY GLY B . n 
B 1 235 GLU 235 495 495 GLU GLU B . n 
B 1 236 LEU 236 496 496 LEU LEU B . n 
B 1 237 THR 237 497 497 THR THR B . n 
B 1 238 PHE 238 498 498 PHE PHE B . n 
B 1 239 GLN 239 499 499 GLN GLN B . n 
B 1 240 PRO 240 500 500 PRO PRO B . n 
B 1 241 THR 241 501 501 THR THR B . n 
B 1 242 TYR 242 502 502 TYR TYR B . n 
B 1 243 LYS 243 503 503 LYS LYS B . n 
B 1 244 TYR 244 504 504 TYR TYR B . n 
B 1 245 ASP 245 505 505 ASP ASP B . n 
B 1 246 THR 246 506 506 THR THR B . n 
B 1 247 GLY 247 507 507 GLY GLY B . n 
B 1 248 SER 248 508 508 SER SER B . n 
B 1 249 ASP 249 509 509 ASP ASP B . n 
B 1 250 ASP 250 510 510 ASP ASP B . n 
B 1 251 TRP 251 511 511 TRP TRP B . n 
B 1 252 ASP 252 512 512 ASP ASP B . n 
B 1 253 THR 253 513 ?   ?   ?   B . n 
B 1 254 SER 254 514 ?   ?   ?   B . n 
B 1 255 GLU 255 515 ?   ?   ?   B . n 
B 1 256 LYS 256 516 ?   ?   ?   B . n 
B 1 257 CYS 257 517 ?   ?   ?   B . n 
B 1 258 ARG 258 518 ?   ?   ?   B . n 
B 1 259 ALA 259 519 519 ALA ALA B . n 
B 1 260 PRO 260 520 520 PRO PRO B . n 
B 1 261 ALA 261 521 521 ALA ALA B . n 
B 1 262 TRP 262 522 522 TRP TRP B . n 
B 1 263 CYS 263 523 523 CYS CYS B . n 
B 1 264 ASP 264 524 524 ASP ASP B . n 
B 1 265 ARG 265 525 525 ARG ARG B . n 
B 1 266 ILE 266 526 526 ILE ILE B . n 
B 1 267 LEU 267 527 527 LEU LEU B . n 
B 1 268 TRP 268 528 528 TRP TRP B . n 
B 1 269 LYS 269 529 529 LYS LYS B . n 
B 1 270 GLY 270 530 530 GLY GLY B . n 
B 1 271 LYS 271 531 531 LYS LYS B . n 
B 1 272 ASN 272 532 532 ASN ASN B . n 
B 1 273 ILE 273 533 533 ILE ILE B . n 
B 1 274 THR 274 534 534 THR THR B . n 
B 1 275 GLN 275 535 535 GLN GLN B . n 
B 1 276 LEU 276 536 536 LEU LEU B . n 
B 1 277 SER 277 537 537 SER SER B . n 
B 1 278 TYR 278 538 538 TYR TYR B . n 
B 1 279 GLN 279 539 539 GLN GLN B . n 
B 1 280 SER 280 540 540 SER SER B . n 
B 1 281 HIS 281 541 541 HIS HIS B . n 
B 1 282 MET 282 542 542 MET MET B . n 
B 1 283 ALA 283 543 543 ALA ALA B . n 
B 1 284 LEU 284 544 544 LEU LEU B . n 
B 1 285 LYS 285 545 545 LYS LYS B . n 
B 1 286 THR 286 546 546 THR THR B . n 
B 1 287 SER 287 547 547 SER SER B . n 
B 1 288 ASP 288 548 548 ASP ASP B . n 
B 1 289 HIS 289 549 549 HIS HIS B . n 
B 1 290 LYS 290 550 550 LYS LYS B . n 
B 1 291 PRO 291 551 551 PRO PRO B . n 
B 1 292 VAL 292 552 552 VAL VAL B . n 
B 1 293 SER 293 553 553 SER SER B . n 
B 1 294 SER 294 554 554 SER SER B . n 
B 1 295 VAL 295 555 555 VAL VAL B . n 
B 1 296 PHE 296 556 556 PHE PHE B . n 
B 1 297 ASP 297 557 557 ASP ASP B . n 
B 1 298 ILE 298 558 558 ILE ILE B . n 
B 1 299 GLY 299 559 559 GLY GLY B . n 
B 1 300 VAL 300 560 560 VAL VAL B . n 
B 1 301 ARG 301 561 561 ARG ARG B . n 
B 1 302 VAL 302 562 562 VAL VAL B . n 
B 1 303 VAL 303 563 563 VAL VAL B . n 
B 1 304 ASN 304 564 ?   ?   ?   B . n 
B 1 305 ASP 305 565 ?   ?   ?   B . n 
B 1 306 GLU 306 566 ?   ?   ?   B . n 
B 1 307 ALA 307 567 ?   ?   ?   B . n 
B 1 308 HIS 308 568 ?   ?   ?   B . n 
B 1 309 HIS 309 569 ?   ?   ?   B . n 
B 1 310 HIS 310 570 ?   ?   ?   B . n 
B 1 311 HIS 311 571 ?   ?   ?   B . n 
B 1 312 HIS 312 572 ?   ?   ?   B . n 
B 1 313 HIS 313 573 ?   ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,H 
2 1 B,F,G,I   
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A THR 111 ? A THR 371 ? 1_555 CA ? D CA . ? A CA 64 ? 1_555 O   ? H HOH .   ? A HOH 24  ? 1_555 84.8  ? 
2  O   ? A THR 111 ? A THR 371 ? 1_555 CA ? D CA . ? A CA 64 ? 1_555 OD1 ? A ASP 154 ? A ASP 414 ? 1_555 79.1  ? 
3  O   ? H HOH .   ? A HOH 24  ? 1_555 CA ? D CA . ? A CA 64 ? 1_555 OD1 ? A ASP 154 ? A ASP 414 ? 1_555 62.3  ? 
4  O   ? A THR 111 ? A THR 371 ? 1_555 CA ? D CA . ? A CA 64 ? 1_555 O   ? H HOH .   ? A HOH 39  ? 1_555 147.3 ? 
5  O   ? H HOH .   ? A HOH 24  ? 1_555 CA ? D CA . ? A CA 64 ? 1_555 O   ? H HOH .   ? A HOH 39  ? 1_555 78.0  ? 
6  OD1 ? A ASP 154 ? A ASP 414 ? 1_555 CA ? D CA . ? A CA 64 ? 1_555 O   ? H HOH .   ? A HOH 39  ? 1_555 68.3  ? 
7  O   ? H HOH .   ? A HOH 18  ? 1_555 MG ? C MG . ? A MG 61 ? 1_555 OD1 ? A ASN 15  ? A ASN 275 ? 1_555 139.4 ? 
8  O   ? H HOH .   ? A HOH 18  ? 1_555 MG ? C MG . ? A MG 61 ? 1_555 O   ? H HOH .   ? A HOH 17  ? 1_555 69.7  ? 
9  OD1 ? A ASN 15  ? A ASN 275 ? 1_555 MG ? C MG . ? A MG 61 ? 1_555 O   ? H HOH .   ? A HOH 17  ? 1_555 72.5  ? 
10 O   ? H HOH .   ? A HOH 18  ? 1_555 MG ? C MG . ? A MG 61 ? 1_555 OE1 ? A GLU 43  ? A GLU 303 ? 1_555 84.4  ? 
11 OD1 ? A ASN 15  ? A ASN 275 ? 1_555 MG ? C MG . ? A MG 61 ? 1_555 OE1 ? A GLU 43  ? A GLU 303 ? 1_555 93.7  ? 
12 O   ? H HOH .   ? A HOH 17  ? 1_555 MG ? C MG . ? A MG 61 ? 1_555 OE1 ? A GLU 43  ? A GLU 303 ? 1_555 66.4  ? 
13 O   ? B THR 111 ? B THR 371 ? 1_555 CA ? G CA . ? B CA 63 ? 1_555 OD1 ? B ASP 154 ? B ASP 414 ? 1_555 77.9  ? 
14 O   ? B THR 111 ? B THR 371 ? 1_555 CA ? G CA . ? B CA 63 ? 1_555 O   ? I HOH .   ? B HOH 4   ? 1_555 68.3  ? 
15 OD1 ? B ASP 154 ? B ASP 414 ? 1_555 CA ? G CA . ? B CA 63 ? 1_555 O   ? I HOH .   ? B HOH 4   ? 1_555 70.3  ? 
16 OE1 ? B GLU 43  ? B GLU 303 ? 1_555 MG ? F MG . ? B MG 62 ? 1_555 OD1 ? B ASN 15  ? B ASN 275 ? 1_555 82.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-07-28 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2014-05-28 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -22.8689 -6.3470  -20.3111 0.4229 0.4487 0.4631 0.0352  0.0573  0.0578  1.6127 1.6215 1.6476 
-1.0010 0.6176  -0.1828 0.0723  0.1184  0.0965  0.0560  0.0792 0.2434  -0.3385 -0.3772 -0.0000 
'X-RAY DIFFRACTION' 2 ? refined -21.9970 -17.7784 -25.6651 0.3273 0.3204 0.2865 -0.0105 -0.0287 0.0289  2.0760 3.0809 2.1862 
-0.0259 -0.6768 -0.6535 0.0584  0.2461  -0.1377 -0.3570 0.0850 0.3283  0.3266  -0.1548 0.0000  
'X-RAY DIFFRACTION' 3 ? refined 8.7149   -6.2028  -18.1540 0.6137 0.4865 0.5466 -0.0028 -0.0462 -0.0418 2.0871 2.0725 2.7175 
-0.5897 0.6803  -0.0405 0.0475  0.1194  0.1698  0.0558  0.0594 -0.2166 -0.0249 0.0267  -0.0000 
'X-RAY DIFFRACTION' 4 ? refined 17.0555  7.8626   -18.2630 0.8021 0.5351 0.8209 -0.2399 -0.1063 -0.0216 1.6045 1.5881 2.5961 
-0.3848 1.8705  -0.2000 -0.1664 -0.0020 0.6096  0.5960  0.0289 -0.4107 -1.1858 0.4034  0.0000  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '(chain A and resid 261:328)' 
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '(chain A and resid 329:563)' 
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? '(chain B and resid 261:404)' 
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? '(chain B and resid 405:562)' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC    'data collection' Quantum                    ? 1 
PHASER  phasing           .                          ? 2 
PHENIX  refinement        '(phenix.refine: 1.6_289)' ? 3 
iMOSFLM 'data reduction'  .                          ? 4 
SCALA   'data scaling'    .                          ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 288 ? ? -160.74 72.80   
2  1 HIS A 314 ? ? 71.74   -49.74  
3  1 VAL A 345 ? ? 52.56   -100.04 
4  1 MET A 374 ? ? 57.90   19.53   
5  1 ARG A 376 ? ? -143.21 -7.15   
6  1 HIS A 390 ? ? 55.98   -115.37 
7  1 ALA A 402 ? ? -35.87  137.06  
8  1 GLU A 407 ? ? -100.43 75.19   
9  1 ARG A 451 ? ? -119.87 -169.80 
10 1 GLU A 454 ? ? 70.41   -54.04  
11 1 PRO A 520 ? ? -49.64  160.00  
12 1 SER B 288 ? ? -155.31 64.96   
13 1 HIS B 314 ? ? 72.51   -54.99  
14 1 VAL B 345 ? ? 52.65   -104.82 
15 1 ARG B 376 ? ? -157.85 -13.25  
16 1 HIS B 390 ? ? 53.70   -114.58 
17 1 GLU B 454 ? ? 62.71   -70.70  
18 1 LEU B 455 ? ? -49.98  150.27  
19 1 LYS B 485 ? ? 56.78   19.27   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A MET 261 ? CG  ? A MET 1   CG  
2   1 Y 1 A MET 261 ? SD  ? A MET 1   SD  
3   1 Y 1 A MET 261 ? CE  ? A MET 1   CE  
4   1 Y 1 A GLU 320 ? CG  ? A GLU 60  CG  
5   1 Y 1 A GLU 320 ? CD  ? A GLU 60  CD  
6   1 Y 1 A GLU 320 ? OE1 ? A GLU 60  OE1 
7   1 Y 1 A GLU 320 ? OE2 ? A GLU 60  OE2 
8   1 Y 1 A LYS 324 ? CD  ? A LYS 64  CD  
9   1 Y 1 A LYS 324 ? CE  ? A LYS 64  CE  
10  1 Y 1 A LYS 324 ? NZ  ? A LYS 64  NZ  
11  1 Y 1 A ILE 405 ? CG1 ? A ILE 145 CG1 
12  1 Y 1 A ILE 405 ? CG2 ? A ILE 145 CG2 
13  1 Y 1 A ILE 405 ? CD1 ? A ILE 145 CD1 
14  1 Y 1 A GLU 406 ? CG  ? A GLU 146 CG  
15  1 Y 1 A GLU 406 ? CD  ? A GLU 146 CD  
16  1 Y 1 A GLU 406 ? OE1 ? A GLU 146 OE1 
17  1 Y 1 A GLU 406 ? OE2 ? A GLU 146 OE2 
18  1 Y 1 A LYS 416 ? CG  ? A LYS 156 CG  
19  1 Y 1 A LYS 416 ? CD  ? A LYS 156 CD  
20  1 Y 1 A LYS 416 ? CE  ? A LYS 156 CE  
21  1 Y 1 A LYS 416 ? NZ  ? A LYS 156 NZ  
22  1 Y 1 A GLU 454 ? CG  ? A GLU 194 CG  
23  1 Y 1 A GLU 454 ? CD  ? A GLU 194 CD  
24  1 Y 1 A GLU 454 ? OE1 ? A GLU 194 OE1 
25  1 Y 1 A GLU 454 ? OE2 ? A GLU 194 OE2 
26  1 Y 1 A ASP 456 ? CG  ? A ASP 196 CG  
27  1 Y 1 A ASP 456 ? OD1 ? A ASP 196 OD1 
28  1 Y 1 A ASP 456 ? OD2 ? A ASP 196 OD2 
29  1 Y 1 A GLU 458 ? CG  ? A GLU 198 CG  
30  1 Y 1 A GLU 458 ? CD  ? A GLU 198 CD  
31  1 Y 1 A GLU 458 ? OE1 ? A GLU 198 OE1 
32  1 Y 1 A GLU 458 ? OE2 ? A GLU 198 OE2 
33  1 Y 1 A LYS 459 ? CG  ? A LYS 199 CG  
34  1 Y 1 A LYS 459 ? CD  ? A LYS 199 CD  
35  1 Y 1 A LYS 459 ? CE  ? A LYS 199 CE  
36  1 Y 1 A LYS 459 ? NZ  ? A LYS 199 NZ  
37  1 Y 1 A LYS 462 ? CG  ? A LYS 202 CG  
38  1 Y 1 A LYS 462 ? CD  ? A LYS 202 CD  
39  1 Y 1 A LYS 462 ? CE  ? A LYS 202 CE  
40  1 Y 1 A LYS 462 ? NZ  ? A LYS 202 NZ  
41  1 Y 1 A GLU 465 ? CD  ? A GLU 205 CD  
42  1 Y 1 A GLU 465 ? OE1 ? A GLU 205 OE1 
43  1 Y 1 A GLU 465 ? OE2 ? A GLU 205 OE2 
44  1 Y 1 A GLU 466 ? CG  ? A GLU 206 CG  
45  1 Y 1 A GLU 466 ? CD  ? A GLU 206 CD  
46  1 Y 1 A GLU 466 ? OE1 ? A GLU 206 OE1 
47  1 Y 1 A GLU 466 ? OE2 ? A GLU 206 OE2 
48  1 Y 1 A VAL 563 ? CG1 ? A VAL 303 CG1 
49  1 Y 1 A VAL 563 ? CG2 ? A VAL 303 CG2 
50  1 Y 1 B MET 261 ? CG  ? B MET 1   CG  
51  1 Y 1 B MET 261 ? SD  ? B MET 1   SD  
52  1 Y 1 B MET 261 ? CE  ? B MET 1   CE  
53  1 Y 1 B LYS 280 ? NZ  ? B LYS 20  NZ  
54  1 Y 1 B ASN 289 ? CG  ? B ASN 29  CG  
55  1 Y 1 B ASN 289 ? OD1 ? B ASN 29  OD1 
56  1 Y 1 B ASN 289 ? ND2 ? B ASN 29  ND2 
57  1 Y 1 B LYS 324 ? CD  ? B LYS 64  CD  
58  1 Y 1 B LYS 324 ? CE  ? B LYS 64  CE  
59  1 Y 1 B LYS 324 ? NZ  ? B LYS 64  NZ  
60  1 Y 1 B ILE 405 ? CG1 ? B ILE 145 CG1 
61  1 Y 1 B ILE 405 ? CG2 ? B ILE 145 CG2 
62  1 Y 1 B ILE 405 ? CD1 ? B ILE 145 CD1 
63  1 Y 1 B GLU 406 ? CG  ? B GLU 146 CG  
64  1 Y 1 B GLU 406 ? CD  ? B GLU 146 CD  
65  1 Y 1 B GLU 406 ? OE1 ? B GLU 146 OE1 
66  1 Y 1 B GLU 406 ? OE2 ? B GLU 146 OE2 
67  1 Y 1 B LYS 416 ? CG  ? B LYS 156 CG  
68  1 Y 1 B LYS 416 ? CD  ? B LYS 156 CD  
69  1 Y 1 B LYS 416 ? CE  ? B LYS 156 CE  
70  1 Y 1 B LYS 416 ? NZ  ? B LYS 156 NZ  
71  1 Y 1 B GLU 454 ? CG  ? B GLU 194 CG  
72  1 Y 1 B GLU 454 ? CD  ? B GLU 194 CD  
73  1 Y 1 B GLU 454 ? OE1 ? B GLU 194 OE1 
74  1 Y 1 B GLU 454 ? OE2 ? B GLU 194 OE2 
75  1 Y 1 B ASP 456 ? CG  ? B ASP 196 CG  
76  1 Y 1 B ASP 456 ? OD1 ? B ASP 196 OD1 
77  1 Y 1 B ASP 456 ? OD2 ? B ASP 196 OD2 
78  1 Y 1 B GLU 458 ? CG  ? B GLU 198 CG  
79  1 Y 1 B GLU 458 ? CD  ? B GLU 198 CD  
80  1 Y 1 B GLU 458 ? OE1 ? B GLU 198 OE1 
81  1 Y 1 B GLU 458 ? OE2 ? B GLU 198 OE2 
82  1 Y 1 B LYS 459 ? CG  ? B LYS 199 CG  
83  1 Y 1 B LYS 459 ? CD  ? B LYS 199 CD  
84  1 Y 1 B LYS 459 ? CE  ? B LYS 199 CE  
85  1 Y 1 B LYS 459 ? NZ  ? B LYS 199 NZ  
86  1 Y 1 B LYS 462 ? CG  ? B LYS 202 CG  
87  1 Y 1 B LYS 462 ? CD  ? B LYS 202 CD  
88  1 Y 1 B LYS 462 ? CE  ? B LYS 202 CE  
89  1 Y 1 B LYS 462 ? NZ  ? B LYS 202 NZ  
90  1 Y 1 B ILE 464 ? CG1 ? B ILE 204 CG1 
91  1 Y 1 B ILE 464 ? CG2 ? B ILE 204 CG2 
92  1 Y 1 B ILE 464 ? CD1 ? B ILE 204 CD1 
93  1 Y 1 B GLU 465 ? CD  ? B GLU 205 CD  
94  1 Y 1 B GLU 465 ? OE1 ? B GLU 205 OE1 
95  1 Y 1 B GLU 465 ? OE2 ? B GLU 205 OE2 
96  1 Y 1 B GLU 466 ? CG  ? B GLU 206 CG  
97  1 Y 1 B GLU 466 ? CD  ? B GLU 206 CD  
98  1 Y 1 B GLU 466 ? OE1 ? B GLU 206 OE1 
99  1 Y 1 B GLU 466 ? OE2 ? B GLU 206 OE2 
100 1 Y 1 B LYS 467 ? CD  ? B LYS 207 CD  
101 1 Y 1 B LYS 467 ? CE  ? B LYS 207 CE  
102 1 Y 1 B LYS 467 ? NZ  ? B LYS 207 NZ  
103 1 Y 1 B GLN 470 ? CG  ? B GLN 210 CG  
104 1 Y 1 B GLN 470 ? CD  ? B GLN 210 CD  
105 1 Y 1 B GLN 470 ? OE1 ? B GLN 210 OE1 
106 1 Y 1 B GLN 470 ? NE2 ? B GLN 210 NE2 
107 1 Y 1 B MET 471 ? CG  ? B MET 211 CG  
108 1 Y 1 B MET 471 ? SD  ? B MET 211 SD  
109 1 Y 1 B MET 471 ? CE  ? B MET 211 CE  
110 1 Y 1 B LEU 472 ? CD1 ? B LEU 212 CD1 
111 1 Y 1 B LEU 472 ? CD2 ? B LEU 212 CD2 
112 1 Y 1 B LYS 479 ? CG  ? B LYS 219 CG  
113 1 Y 1 B LYS 479 ? CD  ? B LYS 219 CD  
114 1 Y 1 B LYS 479 ? CE  ? B LYS 219 CE  
115 1 Y 1 B LYS 479 ? NZ  ? B LYS 219 NZ  
116 1 Y 1 B LYS 485 ? CG  ? B LYS 225 CG  
117 1 Y 1 B LYS 485 ? CD  ? B LYS 225 CD  
118 1 Y 1 B LYS 485 ? CE  ? B LYS 225 CE  
119 1 Y 1 B LYS 485 ? NZ  ? B LYS 225 NZ  
120 1 Y 1 B LYS 531 ? CG  ? B LYS 271 CG  
121 1 Y 1 B LYS 531 ? CD  ? B LYS 271 CD  
122 1 Y 1 B LYS 531 ? CE  ? B LYS 271 CE  
123 1 Y 1 B LYS 531 ? NZ  ? B LYS 271 NZ  
124 1 Y 1 B ARG 561 ? CD  ? B ARG 301 CD  
125 1 Y 1 B ARG 561 ? NE  ? B ARG 301 NE  
126 1 Y 1 B ARG 561 ? CZ  ? B ARG 301 CZ  
127 1 Y 1 B ARG 561 ? NH1 ? B ARG 301 NH1 
128 1 Y 1 B ARG 561 ? NH2 ? B ARG 301 NH2 
129 1 Y 1 B VAL 563 ? CG1 ? B VAL 303 CG1 
130 1 Y 1 B VAL 563 ? CG2 ? B VAL 303 CG2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU 515 ? A GLU 255 
2  1 Y 1 A LYS 516 ? A LYS 256 
3  1 Y 1 A CYS 517 ? A CYS 257 
4  1 Y 1 A ASN 564 ? A ASN 304 
5  1 Y 1 A ASP 565 ? A ASP 305 
6  1 Y 1 A GLU 566 ? A GLU 306 
7  1 Y 1 A ALA 567 ? A ALA 307 
8  1 Y 1 A HIS 568 ? A HIS 308 
9  1 Y 1 A HIS 569 ? A HIS 309 
10 1 Y 1 A HIS 570 ? A HIS 310 
11 1 Y 1 A HIS 571 ? A HIS 311 
12 1 Y 1 A HIS 572 ? A HIS 312 
13 1 Y 1 A HIS 573 ? A HIS 313 
14 1 Y 1 B GLN 426 ? B GLN 166 
15 1 Y 1 B PRO 427 ? B PRO 167 
16 1 Y 1 B ASP 428 ? B ASP 168 
17 1 Y 1 B PRO 429 ? B PRO 169 
18 1 Y 1 B SER 430 ? B SER 170 
19 1 Y 1 B LEU 431 ? B LEU 171 
20 1 Y 1 B PRO 432 ? B PRO 172 
21 1 Y 1 B PRO 433 ? B PRO 173 
22 1 Y 1 B THR 513 ? B THR 253 
23 1 Y 1 B SER 514 ? B SER 254 
24 1 Y 1 B GLU 515 ? B GLU 255 
25 1 Y 1 B LYS 516 ? B LYS 256 
26 1 Y 1 B CYS 517 ? B CYS 257 
27 1 Y 1 B ARG 518 ? B ARG 258 
28 1 Y 1 B ASN 564 ? B ASN 304 
29 1 Y 1 B ASP 565 ? B ASP 305 
30 1 Y 1 B GLU 566 ? B GLU 306 
31 1 Y 1 B ALA 567 ? B ALA 307 
32 1 Y 1 B HIS 568 ? B HIS 308 
33 1 Y 1 B HIS 569 ? B HIS 309 
34 1 Y 1 B HIS 570 ? B HIS 310 
35 1 Y 1 B HIS 571 ? B HIS 311 
36 1 Y 1 B HIS 572 ? B HIS 312 
37 1 Y 1 B HIS 573 ? B HIS 313 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION' MG  
3 'CALCIUM ION'   CA  
4 GLYCEROL        GOL 
5 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 MG  1  61 61 MG  MG  A . 
D 3 CA  1  64 64 CA  CA  A . 
E 4 GOL 1  65 65 GOL GOL A . 
F 2 MG  1  62 62 MG  MG  B . 
G 3 CA  1  63 63 CA  CA  B . 
H 5 HOH 1  1  1  HOH HOH A . 
H 5 HOH 2  2  2  HOH HOH A . 
H 5 HOH 3  3  3  HOH HOH A . 
H 5 HOH 4  5  5  HOH HOH A . 
H 5 HOH 5  6  6  HOH HOH A . 
H 5 HOH 6  7  7  HOH HOH A . 
H 5 HOH 7  8  8  HOH HOH A . 
H 5 HOH 8  9  9  HOH HOH A . 
H 5 HOH 9  10 10 HOH HOH A . 
H 5 HOH 10 11 11 HOH HOH A . 
H 5 HOH 11 12 12 HOH HOH A . 
H 5 HOH 12 13 13 HOH HOH A . 
H 5 HOH 13 14 14 HOH HOH A . 
H 5 HOH 14 15 15 HOH HOH A . 
H 5 HOH 15 16 16 HOH HOH A . 
H 5 HOH 16 17 17 HOH HOH A . 
H 5 HOH 17 18 18 HOH HOH A . 
H 5 HOH 18 20 20 HOH HOH A . 
H 5 HOH 19 22 22 HOH HOH A . 
H 5 HOH 20 23 23 HOH HOH A . 
H 5 HOH 21 24 24 HOH HOH A . 
H 5 HOH 22 25 25 HOH HOH A . 
H 5 HOH 23 28 28 HOH HOH A . 
H 5 HOH 24 29 29 HOH HOH A . 
H 5 HOH 25 32 32 HOH HOH A . 
H 5 HOH 26 34 34 HOH HOH A . 
H 5 HOH 27 35 35 HOH HOH A . 
H 5 HOH 28 36 36 HOH HOH A . 
H 5 HOH 29 37 37 HOH HOH A . 
H 5 HOH 30 39 39 HOH HOH A . 
H 5 HOH 31 40 40 HOH HOH A . 
H 5 HOH 32 43 43 HOH HOH A . 
H 5 HOH 33 44 44 HOH HOH A . 
H 5 HOH 34 45 45 HOH HOH A . 
H 5 HOH 35 46 46 HOH HOH A . 
H 5 HOH 36 48 48 HOH HOH A . 
H 5 HOH 37 49 49 HOH HOH A . 
H 5 HOH 38 51 51 HOH HOH A . 
H 5 HOH 39 52 52 HOH HOH A . 
H 5 HOH 40 53 53 HOH HOH A . 
H 5 HOH 41 54 54 HOH HOH A . 
H 5 HOH 42 55 55 HOH HOH A . 
H 5 HOH 43 56 56 HOH HOH A . 
I 5 HOH 1  4  4  HOH HOH B . 
I 5 HOH 2  19 19 HOH HOH B . 
I 5 HOH 3  21 21 HOH HOH B . 
I 5 HOH 4  26 26 HOH HOH B . 
I 5 HOH 5  27 27 HOH HOH B . 
I 5 HOH 6  30 30 HOH HOH B . 
I 5 HOH 7  31 31 HOH HOH B . 
I 5 HOH 8  33 33 HOH HOH B . 
I 5 HOH 9  38 38 HOH HOH B . 
I 5 HOH 10 41 41 HOH HOH B . 
I 5 HOH 11 42 42 HOH HOH B . 
I 5 HOH 12 47 47 HOH HOH B . 
I 5 HOH 13 50 50 HOH HOH B . 
I 5 HOH 14 57 57 HOH HOH B . 
#