data_3N9Y
# 
_entry.id   3N9Y 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3N9Y         
RCSB  RCSB059565   
WWPDB D_1000059565 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3N9Z . unspecified 
PDB 3NA0 . unspecified 
PDB 3NA1 . unspecified 
# 
_pdbx_database_status.entry_id                        3N9Y 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-05-31 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Strushkevich, N.V.'                   1  
'MacKenzie, F.'                        2  
'Tempel, W.'                           3  
'Botchkarev, A.'                       4  
'Arrowsmith, C.H.'                     5  
'Edwards, A.M.'                        6  
'Bountra, C.'                          7  
'Weigelt, J.U.'                        8  
'Park, H.'                             9  
'Structural Genomics Consortium (SGC)' 10 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for pregnenolone biosynthesis by the mitochondrial monooxygenase system.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            108 
_citation.page_first                10139 
_citation.page_last                 10143 
_citation.year                      2011 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21636783 
_citation.pdbx_database_id_DOI      10.1073/pnas.1019441108 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Strushkevich, N.' 1 
primary 'Mackenzie, F.'    2 
primary 'Cherkesova, T.'   3 
primary 'Grabovec, I.'     4 
primary 'Usanov, S.'       5 
primary 'Park, H.W.'       6 
# 
_cell.entry_id           3N9Y 
_cell.length_a           82.999 
_cell.length_b           114.686 
_cell.length_c           86.019 
_cell.angle_alpha        90.00 
_cell.angle_beta         101.96 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3N9Y 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Cholesterol side-chain cleavage enzyme' 56885.066 2   1.14.15.6 ? 'UNP residues 41-521' ? 
2 polymer     man Adrenodoxin                              12571.036 2   ?         ? 'UNP residues 62-175' ? 
3 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE'        616.487   2   ?         ? ?                     ? 
4 non-polymer syn CHOLESTEROL                              386.654   2   ?         ? ?                     ? 
5 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER'             175.820   2   ?         ? ?                     ? 
6 water       nat water                                    18.015    505 ?         ? ?                     ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Cytochrome P450 11A1, CYPXIA1, Cytochrome P450(scc), Cholesterol desmolase' 
2 'Adrenal ferredoxin, Ferredoxin-1, Hepatoredoxin'                            
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;STRSPRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPER
FLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISD
DLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIY
TQNFYWELRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAAR
HQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRW
LSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPFNQEATQ
QHHHHHH
;
;STRSPRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPER
FLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISD
DLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIY
TQNFYWELRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAAR
HQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRW
LSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPFNQEATQ
QHHHHHH
;
A,B ? 
2 'polypeptide(L)' no no 
;SSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLA
YGLTDRSRLGCQICLTKSMDNMTVRVPETVADAR
;
;SSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLA
YGLTDRSRLGCQICLTKSMDNMTVRVPETVADAR
;
C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   THR n 
1 3   ARG n 
1 4   SER n 
1 5   PRO n 
1 6   ARG n 
1 7   PRO n 
1 8   PHE n 
1 9   ASN n 
1 10  GLU n 
1 11  ILE n 
1 12  PRO n 
1 13  SER n 
1 14  PRO n 
1 15  GLY n 
1 16  ASP n 
1 17  ASN n 
1 18  GLY n 
1 19  TRP n 
1 20  LEU n 
1 21  ASN n 
1 22  LEU n 
1 23  TYR n 
1 24  HIS n 
1 25  PHE n 
1 26  TRP n 
1 27  ARG n 
1 28  GLU n 
1 29  THR n 
1 30  GLY n 
1 31  THR n 
1 32  HIS n 
1 33  LYS n 
1 34  VAL n 
1 35  HIS n 
1 36  LEU n 
1 37  HIS n 
1 38  HIS n 
1 39  VAL n 
1 40  GLN n 
1 41  ASN n 
1 42  PHE n 
1 43  GLN n 
1 44  LYS n 
1 45  TYR n 
1 46  GLY n 
1 47  PRO n 
1 48  ILE n 
1 49  TYR n 
1 50  ARG n 
1 51  GLU n 
1 52  LYS n 
1 53  LEU n 
1 54  GLY n 
1 55  ASN n 
1 56  VAL n 
1 57  GLU n 
1 58  SER n 
1 59  VAL n 
1 60  TYR n 
1 61  VAL n 
1 62  ILE n 
1 63  ASP n 
1 64  PRO n 
1 65  GLU n 
1 66  ASP n 
1 67  VAL n 
1 68  ALA n 
1 69  LEU n 
1 70  LEU n 
1 71  PHE n 
1 72  LYS n 
1 73  SER n 
1 74  GLU n 
1 75  GLY n 
1 76  PRO n 
1 77  ASN n 
1 78  PRO n 
1 79  GLU n 
1 80  ARG n 
1 81  PHE n 
1 82  LEU n 
1 83  ILE n 
1 84  PRO n 
1 85  PRO n 
1 86  TRP n 
1 87  VAL n 
1 88  ALA n 
1 89  TYR n 
1 90  HIS n 
1 91  GLN n 
1 92  TYR n 
1 93  TYR n 
1 94  GLN n 
1 95  ARG n 
1 96  PRO n 
1 97  ILE n 
1 98  GLY n 
1 99  VAL n 
1 100 LEU n 
1 101 LEU n 
1 102 LYS n 
1 103 LYS n 
1 104 SER n 
1 105 ALA n 
1 106 ALA n 
1 107 TRP n 
1 108 LYS n 
1 109 LYS n 
1 110 ASP n 
1 111 ARG n 
1 112 VAL n 
1 113 ALA n 
1 114 LEU n 
1 115 ASN n 
1 116 GLN n 
1 117 GLU n 
1 118 VAL n 
1 119 MET n 
1 120 ALA n 
1 121 PRO n 
1 122 GLU n 
1 123 ALA n 
1 124 THR n 
1 125 LYS n 
1 126 ASN n 
1 127 PHE n 
1 128 LEU n 
1 129 PRO n 
1 130 LEU n 
1 131 LEU n 
1 132 ASP n 
1 133 ALA n 
1 134 VAL n 
1 135 SER n 
1 136 ARG n 
1 137 ASP n 
1 138 PHE n 
1 139 VAL n 
1 140 SER n 
1 141 VAL n 
1 142 LEU n 
1 143 HIS n 
1 144 ARG n 
1 145 ARG n 
1 146 ILE n 
1 147 LYS n 
1 148 LYS n 
1 149 ALA n 
1 150 GLY n 
1 151 SER n 
1 152 GLY n 
1 153 ASN n 
1 154 TYR n 
1 155 SER n 
1 156 GLY n 
1 157 ASP n 
1 158 ILE n 
1 159 SER n 
1 160 ASP n 
1 161 ASP n 
1 162 LEU n 
1 163 PHE n 
1 164 ARG n 
1 165 PHE n 
1 166 ALA n 
1 167 PHE n 
1 168 GLU n 
1 169 SER n 
1 170 ILE n 
1 171 THR n 
1 172 ASN n 
1 173 VAL n 
1 174 ILE n 
1 175 PHE n 
1 176 GLY n 
1 177 GLU n 
1 178 ARG n 
1 179 GLN n 
1 180 GLY n 
1 181 MET n 
1 182 LEU n 
1 183 GLU n 
1 184 GLU n 
1 185 VAL n 
1 186 VAL n 
1 187 ASN n 
1 188 PRO n 
1 189 GLU n 
1 190 ALA n 
1 191 GLN n 
1 192 ARG n 
1 193 PHE n 
1 194 ILE n 
1 195 ASP n 
1 196 ALA n 
1 197 ILE n 
1 198 TYR n 
1 199 GLN n 
1 200 MET n 
1 201 PHE n 
1 202 HIS n 
1 203 THR n 
1 204 SER n 
1 205 VAL n 
1 206 PRO n 
1 207 MET n 
1 208 LEU n 
1 209 ASN n 
1 210 LEU n 
1 211 PRO n 
1 212 PRO n 
1 213 ASP n 
1 214 LEU n 
1 215 PHE n 
1 216 ARG n 
1 217 LEU n 
1 218 PHE n 
1 219 ARG n 
1 220 THR n 
1 221 LYS n 
1 222 THR n 
1 223 TRP n 
1 224 LYS n 
1 225 ASP n 
1 226 HIS n 
1 227 VAL n 
1 228 ALA n 
1 229 ALA n 
1 230 TRP n 
1 231 ASP n 
1 232 VAL n 
1 233 ILE n 
1 234 PHE n 
1 235 SER n 
1 236 LYS n 
1 237 ALA n 
1 238 ASP n 
1 239 ILE n 
1 240 TYR n 
1 241 THR n 
1 242 GLN n 
1 243 ASN n 
1 244 PHE n 
1 245 TYR n 
1 246 TRP n 
1 247 GLU n 
1 248 LEU n 
1 249 ARG n 
1 250 GLN n 
1 251 LYS n 
1 252 GLY n 
1 253 SER n 
1 254 VAL n 
1 255 HIS n 
1 256 HIS n 
1 257 ASP n 
1 258 TYR n 
1 259 ARG n 
1 260 GLY n 
1 261 ILE n 
1 262 LEU n 
1 263 TYR n 
1 264 ARG n 
1 265 LEU n 
1 266 LEU n 
1 267 GLY n 
1 268 ASP n 
1 269 SER n 
1 270 LYS n 
1 271 MET n 
1 272 SER n 
1 273 PHE n 
1 274 GLU n 
1 275 ASP n 
1 276 ILE n 
1 277 LYS n 
1 278 ALA n 
1 279 ASN n 
1 280 VAL n 
1 281 THR n 
1 282 GLU n 
1 283 MET n 
1 284 LEU n 
1 285 ALA n 
1 286 GLY n 
1 287 GLY n 
1 288 VAL n 
1 289 ASP n 
1 290 THR n 
1 291 THR n 
1 292 SER n 
1 293 MET n 
1 294 THR n 
1 295 LEU n 
1 296 GLN n 
1 297 TRP n 
1 298 HIS n 
1 299 LEU n 
1 300 TYR n 
1 301 GLU n 
1 302 MET n 
1 303 ALA n 
1 304 ARG n 
1 305 ASN n 
1 306 LEU n 
1 307 LYS n 
1 308 VAL n 
1 309 GLN n 
1 310 ASP n 
1 311 MET n 
1 312 LEU n 
1 313 ARG n 
1 314 ALA n 
1 315 GLU n 
1 316 VAL n 
1 317 LEU n 
1 318 ALA n 
1 319 ALA n 
1 320 ARG n 
1 321 HIS n 
1 322 GLN n 
1 323 ALA n 
1 324 GLN n 
1 325 GLY n 
1 326 ASP n 
1 327 MET n 
1 328 ALA n 
1 329 THR n 
1 330 MET n 
1 331 LEU n 
1 332 GLN n 
1 333 LEU n 
1 334 VAL n 
1 335 PRO n 
1 336 LEU n 
1 337 LEU n 
1 338 LYS n 
1 339 ALA n 
1 340 SER n 
1 341 ILE n 
1 342 LYS n 
1 343 GLU n 
1 344 THR n 
1 345 LEU n 
1 346 ARG n 
1 347 LEU n 
1 348 HIS n 
1 349 PRO n 
1 350 ILE n 
1 351 SER n 
1 352 VAL n 
1 353 THR n 
1 354 LEU n 
1 355 GLN n 
1 356 ARG n 
1 357 TYR n 
1 358 LEU n 
1 359 VAL n 
1 360 ASN n 
1 361 ASP n 
1 362 LEU n 
1 363 VAL n 
1 364 LEU n 
1 365 ARG n 
1 366 ASP n 
1 367 TYR n 
1 368 MET n 
1 369 ILE n 
1 370 PRO n 
1 371 ALA n 
1 372 LYS n 
1 373 THR n 
1 374 LEU n 
1 375 VAL n 
1 376 GLN n 
1 377 VAL n 
1 378 ALA n 
1 379 ILE n 
1 380 TYR n 
1 381 ALA n 
1 382 LEU n 
1 383 GLY n 
1 384 ARG n 
1 385 GLU n 
1 386 PRO n 
1 387 THR n 
1 388 PHE n 
1 389 PHE n 
1 390 PHE n 
1 391 ASP n 
1 392 PRO n 
1 393 GLU n 
1 394 ASN n 
1 395 PHE n 
1 396 ASP n 
1 397 PRO n 
1 398 THR n 
1 399 ARG n 
1 400 TRP n 
1 401 LEU n 
1 402 SER n 
1 403 LYS n 
1 404 ASP n 
1 405 LYS n 
1 406 ASN n 
1 407 ILE n 
1 408 THR n 
1 409 TYR n 
1 410 PHE n 
1 411 ARG n 
1 412 ASN n 
1 413 LEU n 
1 414 GLY n 
1 415 PHE n 
1 416 GLY n 
1 417 TRP n 
1 418 GLY n 
1 419 VAL n 
1 420 ARG n 
1 421 GLN n 
1 422 CYS n 
1 423 LEU n 
1 424 GLY n 
1 425 ARG n 
1 426 ARG n 
1 427 ILE n 
1 428 ALA n 
1 429 GLU n 
1 430 LEU n 
1 431 GLU n 
1 432 MET n 
1 433 THR n 
1 434 ILE n 
1 435 PHE n 
1 436 LEU n 
1 437 ILE n 
1 438 ASN n 
1 439 MET n 
1 440 LEU n 
1 441 GLU n 
1 442 ASN n 
1 443 PHE n 
1 444 ARG n 
1 445 VAL n 
1 446 GLU n 
1 447 ILE n 
1 448 GLN n 
1 449 HIS n 
1 450 LEU n 
1 451 SER n 
1 452 ASP n 
1 453 VAL n 
1 454 GLY n 
1 455 THR n 
1 456 THR n 
1 457 PHE n 
1 458 ASN n 
1 459 LEU n 
1 460 ILE n 
1 461 LEU n 
1 462 MET n 
1 463 PRO n 
1 464 GLU n 
1 465 LYS n 
1 466 PRO n 
1 467 ILE n 
1 468 SER n 
1 469 PHE n 
1 470 THR n 
1 471 PHE n 
1 472 TRP n 
1 473 PRO n 
1 474 PHE n 
1 475 ASN n 
1 476 GLN n 
1 477 GLU n 
1 478 ALA n 
1 479 THR n 
1 480 GLN n 
1 481 GLN n 
1 482 HIS n 
1 483 HIS n 
1 484 HIS n 
1 485 HIS n 
1 486 HIS n 
1 487 HIS n 
2 1   SER n 
2 2   SER n 
2 3   GLU n 
2 4   ASP n 
2 5   LYS n 
2 6   ILE n 
2 7   THR n 
2 8   VAL n 
2 9   HIS n 
2 10  PHE n 
2 11  ILE n 
2 12  ASN n 
2 13  ARG n 
2 14  ASP n 
2 15  GLY n 
2 16  GLU n 
2 17  THR n 
2 18  LEU n 
2 19  THR n 
2 20  THR n 
2 21  LYS n 
2 22  GLY n 
2 23  LYS n 
2 24  VAL n 
2 25  GLY n 
2 26  ASP n 
2 27  SER n 
2 28  LEU n 
2 29  LEU n 
2 30  ASP n 
2 31  VAL n 
2 32  VAL n 
2 33  VAL n 
2 34  GLU n 
2 35  ASN n 
2 36  ASN n 
2 37  LEU n 
2 38  ASP n 
2 39  ILE n 
2 40  ASP n 
2 41  GLY n 
2 42  PHE n 
2 43  GLY n 
2 44  ALA n 
2 45  CYS n 
2 46  GLU n 
2 47  GLY n 
2 48  THR n 
2 49  LEU n 
2 50  ALA n 
2 51  CYS n 
2 52  SER n 
2 53  THR n 
2 54  CYS n 
2 55  HIS n 
2 56  LEU n 
2 57  ILE n 
2 58  PHE n 
2 59  GLU n 
2 60  ASP n 
2 61  HIS n 
2 62  ILE n 
2 63  TYR n 
2 64  GLU n 
2 65  LYS n 
2 66  LEU n 
2 67  ASP n 
2 68  ALA n 
2 69  ILE n 
2 70  THR n 
2 71  ASP n 
2 72  GLU n 
2 73  GLU n 
2 74  ASN n 
2 75  ASP n 
2 76  MET n 
2 77  LEU n 
2 78  ASP n 
2 79  LEU n 
2 80  ALA n 
2 81  TYR n 
2 82  GLY n 
2 83  LEU n 
2 84  THR n 
2 85  ASP n 
2 86  ARG n 
2 87  SER n 
2 88  ARG n 
2 89  LEU n 
2 90  GLY n 
2 91  CYS n 
2 92  GLN n 
2 93  ILE n 
2 94  CYS n 
2 95  LEU n 
2 96  THR n 
2 97  LYS n 
2 98  SER n 
2 99  MET n 
2 100 ASP n 
2 101 ASN n 
2 102 MET n 
2 103 THR n 
2 104 VAL n 
2 105 ARG n 
2 106 VAL n 
2 107 PRO n 
2 108 GLU n 
2 109 THR n 
2 110 VAL n 
2 111 ALA n 
2 112 ASP n 
2 113 ALA n 
2 114 ARG n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'CYP11A, CYP11A1'        ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? JM109 ? ? ? ? ? ? ? plasmid ? ? ? pCW ? ? 
2 1 sample ? ? ? human ? 'adrenodoxin, ADX, FDX1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? JM109 ? ? ? ? ? ? ? plasmid ? ? ? pCW ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP CP11A_HUMAN P05108 1 
;STRSPRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPER
FLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISD
DLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIY
TQNFYWELRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAAR
HQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRW
LSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPFNQEATQ
Q
;
41 ? 
2 UNP ADX_HUMAN   P10109 2 
;SSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLA
YGLTDRSRLGCQICLTKSMDNMTVRVPETVADAR
;
62 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3N9Y A 1 ? 481 ? P05108 41 ? 521 ? 2 482 
2 1 3N9Y B 1 ? 481 ? P05108 41 ? 521 ? 2 482 
3 2 3N9Y C 1 ? 114 ? P10109 62 ? 175 ? 2 115 
4 2 3N9Y D 1 ? 114 ? P10109 62 ? 175 ? 2 115 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3N9Y HIS A 482 ? UNP P05108 ? ? 'EXPRESSION TAG' 483 1  
1 3N9Y HIS A 483 ? UNP P05108 ? ? 'EXPRESSION TAG' 484 2  
1 3N9Y HIS A 484 ? UNP P05108 ? ? 'EXPRESSION TAG' 485 3  
1 3N9Y HIS A 485 ? UNP P05108 ? ? 'EXPRESSION TAG' 486 4  
1 3N9Y HIS A 486 ? UNP P05108 ? ? 'EXPRESSION TAG' 487 5  
1 3N9Y HIS A 487 ? UNP P05108 ? ? 'EXPRESSION TAG' 488 6  
2 3N9Y HIS B 482 ? UNP P05108 ? ? 'EXPRESSION TAG' 483 7  
2 3N9Y HIS B 483 ? UNP P05108 ? ? 'EXPRESSION TAG' 484 8  
2 3N9Y HIS B 484 ? UNP P05108 ? ? 'EXPRESSION TAG' 485 9  
2 3N9Y HIS B 485 ? UNP P05108 ? ? 'EXPRESSION TAG' 486 10 
2 3N9Y HIS B 486 ? UNP P05108 ? ? 'EXPRESSION TAG' 487 11 
2 3N9Y HIS B 487 ? UNP P05108 ? ? 'EXPRESSION TAG' 488 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ?    'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                          ?    'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?    'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?    'C4 H7 N O4'       133.103 
CLR non-polymer         . CHOLESTEROL                       ?    'C27 H46 O'        386.654 
CYS 'L-peptide linking' y CYSTEINE                          ?    'C3 H7 N O2 S'     121.158 
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER'      ?    'Fe2 S2'           175.820 
GLN 'L-peptide linking' y GLUTAMINE                         ?    'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?    'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                           ?    'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                         ?    'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                             ?    'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ?    'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                           ?    'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                            ?    'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                        ?    'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                     ?    'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                           ?    'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                            ?    'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                         ?    'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?    'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                          ?    'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                            ?    'C5 H11 N O2'      117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3N9Y 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.88 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   61.66 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    'PEG 8000, Ca acetate, pH 7.5, vapor diffusion, hanging drop, temperature 291K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2010-03-24 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_wavelength_list        ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
# 
_reflns.entry_id                     3N9Y 
_reflns.d_resolution_high            2.100 
_reflns.d_resolution_low             20.000 
_reflns.number_obs                   92214 
_reflns.pdbx_Rmerge_I_obs            0.084 
_reflns.pdbx_netI_over_sigmaI        9.300 
_reflns.pdbx_chi_squared             1.576 
_reflns.pdbx_redundancy              4.400 
_reflns.percent_possible_obs         99.900 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.10 2.14  ? ? ? 0.522 ? ? 0.954 4.40 ? 4637 100.00 1  1 
2.14 2.17  ? ? ? 0.444 ? ? 0.971 4.40 ? 4584 100.00 2  1 
2.17 2.22  ? ? ? 0.397 ? ? 0.960 4.40 ? 4608 100.00 3  1 
2.22 2.26  ? ? ? 0.359 ? ? 1.187 4.40 ? 4582 99.90  4  1 
2.26 2.31  ? ? ? 0.305 ? ? 1.068 4.40 ? 4601 100.00 5  1 
2.31 2.36  ? ? ? 0.258 ? ? 1.047 4.40 ? 4567 100.00 6  1 
2.36 2.42  ? ? ? 0.230 ? ? 1.098 4.40 ? 4589 100.00 7  1 
2.42 2.49  ? ? ? 0.193 ? ? 1.129 4.50 ? 4622 100.00 8  1 
2.49 2.56  ? ? ? 0.175 ? ? 1.173 4.40 ? 4567 100.00 9  1 
2.56 2.64  ? ? ? 0.156 ? ? 1.223 4.40 ? 4590 100.00 10 1 
2.64 2.74  ? ? ? 0.135 ? ? 1.320 4.40 ? 4634 100.00 11 1 
2.74 2.85  ? ? ? 0.112 ? ? 1.406 4.40 ? 4594 100.00 12 1 
2.85 2.98  ? ? ? 0.097 ? ? 1.518 4.40 ? 4632 100.00 13 1 
2.98 3.13  ? ? ? 0.087 ? ? 1.703 4.40 ? 4587 100.00 14 1 
3.13 3.33  ? ? ? 0.075 ? ? 1.993 4.40 ? 4651 100.00 15 1 
3.33 3.59  ? ? ? 0.069 ? ? 2.481 4.40 ? 4586 100.00 16 1 
3.59 3.94  ? ? ? 0.064 ? ? 3.056 4.30 ? 4641 99.90  17 1 
3.94 4.51  ? ? ? 0.052 ? ? 2.946 4.20 ? 4609 99.90  18 1 
4.51 5.66  ? ? ? 0.042 ? ? 2.403 4.10 ? 4652 99.80  19 1 
5.66 20.00 ? ? ? 0.036 ? ? 2.109 4.30 ? 4681 99.40  20 1 
# 
_refine.entry_id                                 3N9Y 
_refine.ls_d_res_high                            2.100 
_refine.ls_d_res_low                             19.890 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.940 
_refine.ls_number_reflns_obs                     91667 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.207 
_refine.ls_R_factor_R_work                       0.205 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.242 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  4576 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               34.661 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.960 
_refine.aniso_B[2][2]                            -2.090 
_refine.aniso_B[3][3]                            0.830 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            -0.740 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.944 
_refine.correlation_coeff_Fo_to_Fc_free          0.917 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  0.170 
_refine.overall_SU_ML                            0.118 
_refine.overall_SU_B                             4.368 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                92.11 
_refine.B_iso_min                                11.36 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8792 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         150 
_refine_hist.number_atoms_solvent             505 
_refine_hist.number_atoms_total               9447 
_refine_hist.d_res_high                       2.100 
_refine_hist.d_res_low                        19.890 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       9192  0.010  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    12507 1.243  1.987  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 1073  5.346  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 450   33.856 23.600 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 1535  14.931 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 64    16.263 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         1347  0.090  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   7008  0.005  0.021  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            5375  0.666  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           8709  1.286  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            3817  1.830  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           3794  3.066  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.100 
_refine_ls_shell.d_res_low                        2.154 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               100.000 
_refine_ls_shell.number_reflns_R_work             6372 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.246 
_refine_ls_shell.R_factor_R_free                  0.294 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             342 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                6714 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3N9Y 
_struct.title                     'Crystal structure of human CYP11A1 in complex with cholesterol' 
_struct.pdbx_descriptor           
'Cholesterol side-chain cleavage enzyme, mitochondrial (E.C.1.14.15.6), Adrenodoxin, mitochondrial' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3N9Y 
_struct_keywords.text            
;cytochrome P450, cholesterol side chain cleavage, Structural Genomics, Structural Genomics Consortium, SGC, Oxidoreductase, Electron transport
;
_struct_keywords.pdbx_keywords   'Oxidoreductase, Electron transport' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 7   ? ILE A 11  ? PRO A 8   ILE A 12  5 ? 5  
HELX_P HELX_P2  2  ASN A 17  ? THR A 29  ? ASN A 18  THR A 30  1 ? 13 
HELX_P HELX_P3  3  GLY A 30  ? HIS A 32  ? GLY A 31  HIS A 33  5 ? 3  
HELX_P HELX_P4  4  LYS A 33  ? GLY A 46  ? LYS A 34  GLY A 47  1 ? 14 
HELX_P HELX_P5  5  ASP A 63  ? SER A 73  ? ASP A 64  SER A 74  1 ? 11 
HELX_P HELX_P6  6  ILE A 83  ? TYR A 93  ? ILE A 84  TYR A 94  1 ? 11 
HELX_P HELX_P7  7  GLY A 98  ? LYS A 102 ? GLY A 99  LYS A 103 5 ? 5  
HELX_P HELX_P8  8  LYS A 103 ? MET A 119 ? LYS A 104 MET A 120 1 ? 17 
HELX_P HELX_P9  9  ALA A 120 ? LYS A 125 ? ALA A 121 LYS A 126 1 ? 6  
HELX_P HELX_P10 10 ASN A 126 ? GLY A 150 ? ASN A 127 GLY A 151 1 ? 25 
HELX_P HELX_P11 11 ILE A 158 ? GLY A 176 ? ILE A 159 GLY A 177 1 ? 19 
HELX_P HELX_P12 12 ASN A 187 ? VAL A 205 ? ASN A 188 VAL A 206 1 ? 19 
HELX_P HELX_P13 13 PRO A 206 ? LEU A 208 ? PRO A 207 LEU A 209 5 ? 3  
HELX_P HELX_P14 14 PRO A 211 ? ARG A 219 ? PRO A 212 ARG A 220 1 ? 9  
HELX_P HELX_P15 15 ARG A 219 ? GLY A 252 ? ARG A 220 GLY A 253 1 ? 34 
HELX_P HELX_P16 16 GLY A 260 ? ASP A 268 ? GLY A 261 ASP A 269 1 ? 9  
HELX_P HELX_P17 17 SER A 272 ? ASP A 289 ? SER A 273 ASP A 290 1 ? 18 
HELX_P HELX_P18 18 ASP A 289 ? ASN A 305 ? ASP A 290 ASN A 306 1 ? 17 
HELX_P HELX_P19 19 ASN A 305 ? ALA A 323 ? ASN A 306 ALA A 324 1 ? 19 
HELX_P HELX_P20 20 ASP A 326 ? LEU A 331 ? ASP A 327 LEU A 332 1 ? 6  
HELX_P HELX_P21 21 VAL A 334 ? HIS A 348 ? VAL A 335 HIS A 349 1 ? 15 
HELX_P HELX_P22 22 ILE A 379 ? ARG A 384 ? ILE A 380 ARG A 385 1 ? 6  
HELX_P HELX_P23 23 ASP A 396 ? LEU A 401 ? ASP A 397 LEU A 402 5 ? 6  
HELX_P HELX_P24 24 TRP A 417 ? GLN A 421 ? TRP A 418 GLN A 422 5 ? 5  
HELX_P HELX_P25 25 GLY A 424 ? ASN A 442 ? GLY A 425 ASN A 443 1 ? 19 
HELX_P HELX_P26 26 PRO B 7   ? ILE B 11  ? PRO B 8   ILE B 12  5 ? 5  
HELX_P HELX_P27 27 ASN B 17  ? THR B 29  ? ASN B 18  THR B 30  1 ? 13 
HELX_P HELX_P28 28 GLY B 30  ? HIS B 32  ? GLY B 31  HIS B 33  5 ? 3  
HELX_P HELX_P29 29 LYS B 33  ? GLY B 46  ? LYS B 34  GLY B 47  1 ? 14 
HELX_P HELX_P30 30 ASP B 63  ? SER B 73  ? ASP B 64  SER B 74  1 ? 11 
HELX_P HELX_P31 31 ILE B 83  ? TYR B 93  ? ILE B 84  TYR B 94  1 ? 11 
HELX_P HELX_P32 32 GLY B 98  ? LYS B 102 ? GLY B 99  LYS B 103 5 ? 5  
HELX_P HELX_P33 33 LYS B 103 ? MET B 119 ? LYS B 104 MET B 120 1 ? 17 
HELX_P HELX_P34 34 ALA B 120 ? LYS B 125 ? ALA B 121 LYS B 126 1 ? 6  
HELX_P HELX_P35 35 ASN B 126 ? GLY B 150 ? ASN B 127 GLY B 151 1 ? 25 
HELX_P HELX_P36 36 ILE B 158 ? GLY B 176 ? ILE B 159 GLY B 177 1 ? 19 
HELX_P HELX_P37 37 ASN B 187 ? VAL B 205 ? ASN B 188 VAL B 206 1 ? 19 
HELX_P HELX_P38 38 PRO B 206 ? LEU B 208 ? PRO B 207 LEU B 209 5 ? 3  
HELX_P HELX_P39 39 PRO B 211 ? ARG B 219 ? PRO B 212 ARG B 220 1 ? 9  
HELX_P HELX_P40 40 ARG B 219 ? GLY B 252 ? ARG B 220 GLY B 253 1 ? 34 
HELX_P HELX_P41 41 GLY B 260 ? ASP B 268 ? GLY B 261 ASP B 269 1 ? 9  
HELX_P HELX_P42 42 SER B 272 ? ASN B 305 ? SER B 273 ASN B 306 1 ? 34 
HELX_P HELX_P43 43 ASN B 305 ? ALA B 323 ? ASN B 306 ALA B 324 1 ? 19 
HELX_P HELX_P44 44 ASP B 326 ? LEU B 331 ? ASP B 327 LEU B 332 1 ? 6  
HELX_P HELX_P45 45 VAL B 334 ? HIS B 348 ? VAL B 335 HIS B 349 1 ? 15 
HELX_P HELX_P46 46 ALA B 378 ? ARG B 384 ? ALA B 379 ARG B 385 1 ? 7  
HELX_P HELX_P47 47 ASP B 396 ? SER B 402 ? ASP B 397 SER B 403 5 ? 7  
HELX_P HELX_P48 48 TRP B 417 ? GLN B 421 ? TRP B 418 GLN B 422 5 ? 5  
HELX_P HELX_P49 49 GLY B 424 ? ASN B 442 ? GLY B 425 ASN B 443 1 ? 19 
HELX_P HELX_P50 50 SER C 27  ? ASN C 36  ? SER C 28  ASN C 37  1 ? 10 
HELX_P HELX_P51 51 GLU C 59  ? GLU C 64  ? GLU C 60  GLU C 65  1 ? 6  
HELX_P HELX_P52 52 THR C 70  ? LEU C 79  ? THR C 71  LEU C 80  1 ? 10 
HELX_P HELX_P53 53 CYS C 91  ? ILE C 93  ? CYS C 92  ILE C 94  5 ? 3  
HELX_P HELX_P54 54 SER D 27  ? ASN D 36  ? SER D 28  ASN D 37  1 ? 10 
HELX_P HELX_P55 55 ASP D 60  ? LYS D 65  ? ASP D 61  LYS D 66  1 ? 6  
HELX_P HELX_P56 56 THR D 70  ? LEU D 79  ? THR D 71  LEU D 80  1 ? 10 
HELX_P HELX_P57 57 CYS D 91  ? ILE D 93  ? CYS D 92  ILE D 94  5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D CYS 45  SG ? ? ? 1_555 J FES . FE1 ? ? D CYS 46  D FES 151 1_555 ? ? ? ? ? ? ? 2.012 ? 
metalc2  metalc ? ? C CYS 45  SG ? ? ? 1_555 I FES . FE1 ? ? C CYS 46  C FES 150 1_555 ? ? ? ? ? ? ? 2.059 ? 
metalc3  metalc ? ? D CYS 54  SG ? ? ? 1_555 J FES . FE2 ? ? D CYS 55  D FES 151 1_555 ? ? ? ? ? ? ? 2.081 ? 
metalc4  metalc ? ? C CYS 54  SG ? ? ? 1_555 I FES . FE2 ? ? C CYS 55  C FES 150 1_555 ? ? ? ? ? ? ? 2.179 ? 
metalc5  metalc ? ? C CYS 91  SG ? ? ? 1_555 I FES . FE2 ? ? C CYS 92  C FES 150 1_555 ? ? ? ? ? ? ? 2.245 ? 
metalc6  metalc ? ? D CYS 91  SG ? ? ? 1_555 J FES . FE2 ? ? D CYS 92  D FES 151 1_555 ? ? ? ? ? ? ? 2.382 ? 
metalc7  metalc ? ? C CYS 51  SG ? ? ? 1_555 I FES . FE1 ? ? C CYS 52  C FES 150 1_555 ? ? ? ? ? ? ? 2.435 ? 
metalc8  metalc ? ? B CYS 422 SG ? ? ? 1_555 G HEM . FE  ? ? B CYS 423 B HEM 601 1_555 ? ? ? ? ? ? ? 2.467 ? 
metalc9  metalc ? ? A CYS 422 SG ? ? ? 1_555 E HEM . FE  ? ? A CYS 423 A HEM 601 1_555 ? ? ? ? ? ? ? 2.500 ? 
metalc10 metalc ? ? D CYS 51  SG ? ? ? 1_555 J FES . FE1 ? ? D CYS 52  D FES 151 1_555 ? ? ? ? ? ? ? 2.500 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
C ? 2 ? 
D ? 2 ? 
E ? 4 ? 
F ? 3 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 48  ? LEU A 53  ? ILE A 49  LEU A 54  
A 2 VAL A 56  ? VAL A 61  ? VAL A 57  VAL A 62  
A 3 LEU A 374 ? ALA A 378 ? LEU A 375 ALA A 379 
A 4 THR A 353 ? TYR A 357 ? THR A 354 TYR A 358 
B 1 TYR A 154 ? GLY A 156 ? TYR A 155 GLY A 157 
B 2 PHE A 469 ? PRO A 473 ? PHE A 470 PRO A 474 
B 3 PHE A 443 ? GLU A 446 ? PHE A 444 GLU A 447 
C 1 LEU A 362 ? LEU A 364 ? LEU A 363 LEU A 365 
C 2 TYR A 367 ? ILE A 369 ? TYR A 368 ILE A 370 
D 1 THR A 455 ? PHE A 457 ? THR A 456 PHE A 458 
D 2 LEU A 461 ? PRO A 463 ? LEU A 462 PRO A 464 
E 1 ILE B 48  ? LEU B 53  ? ILE B 49  LEU B 54  
E 2 VAL B 56  ? VAL B 61  ? VAL B 57  VAL B 62  
E 3 LEU B 374 ? VAL B 377 ? LEU B 375 VAL B 378 
E 4 LEU B 354 ? TYR B 357 ? LEU B 355 TYR B 358 
F 1 TYR B 154 ? GLY B 156 ? TYR B 155 GLY B 157 
F 2 PHE B 469 ? PRO B 473 ? PHE B 470 PRO B 474 
F 3 PHE B 443 ? ILE B 447 ? PHE B 444 ILE B 448 
G 1 LEU B 362 ? LEU B 364 ? LEU B 363 LEU B 365 
G 2 TYR B 367 ? ILE B 369 ? TYR B 368 ILE B 370 
H 1 THR B 455 ? PHE B 457 ? THR B 456 PHE B 458 
H 2 LEU B 461 ? PRO B 463 ? LEU B 462 PRO B 464 
I 1 HIS C 55  ? ILE C 57  ? HIS C 56  ILE C 58  
I 2 SER C 87  ? LEU C 89  ? SER C 88  LEU C 90  
J 1 HIS D 55  ? ILE D 57  ? HIS D 56  ILE D 58  
J 2 SER D 87  ? LEU D 89  ? SER D 88  LEU D 90  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 49  ? N TYR A 50  O TYR A 60  ? O TYR A 61  
A 2 3 N VAL A 59  ? N VAL A 60  O GLN A 376 ? O GLN A 377 
A 3 4 O VAL A 377 ? O VAL A 378 N LEU A 354 ? N LEU A 355 
B 1 2 N TYR A 154 ? N TYR A 155 O PHE A 471 ? O PHE A 472 
B 2 3 O THR A 470 ? O THR A 471 N GLU A 446 ? N GLU A 447 
C 1 2 N LEU A 362 ? N LEU A 363 O ILE A 369 ? O ILE A 370 
D 1 2 N THR A 456 ? N THR A 457 O MET A 462 ? O MET A 463 
E 1 2 N TYR B 49  ? N TYR B 50  O TYR B 60  ? O TYR B 61  
E 2 3 N VAL B 59  ? N VAL B 60  O GLN B 376 ? O GLN B 377 
E 3 4 O VAL B 377 ? O VAL B 378 N LEU B 354 ? N LEU B 355 
F 1 2 N TYR B 154 ? N TYR B 155 O PHE B 471 ? O PHE B 472 
F 2 3 O TRP B 472 ? O TRP B 473 N ARG B 444 ? N ARG B 445 
G 1 2 N LEU B 362 ? N LEU B 363 O ILE B 369 ? O ILE B 370 
H 1 2 N THR B 456 ? N THR B 457 O MET B 462 ? O MET B 463 
I 1 2 N LEU C 56  ? N LEU C 57  O ARG C 88  ? O ARG C 89  
J 1 2 N LEU D 56  ? N LEU D 57  O ARG D 88  ? O ARG D 89  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE HEM A 601' 
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CLR A 602' 
AC3 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE HEM B 601' 
AC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE CLR B 602' 
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FES C 150' 
AC6 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE FES D 151' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 21 ARG A 80  ? ARG A 81  . ? 1_555 ? 
2  AC1 21 VAL A 99  ? VAL A 100 . ? 1_555 ? 
3  AC1 21 TRP A 107 ? TRP A 108 . ? 1_555 ? 
4  AC1 21 ARG A 111 ? ARG A 112 . ? 1_555 ? 
5  AC1 21 MET A 283 ? MET A 284 . ? 1_555 ? 
6  AC1 21 GLY A 286 ? GLY A 287 . ? 1_555 ? 
7  AC1 21 GLY A 287 ? GLY A 288 . ? 1_555 ? 
8  AC1 21 THR A 290 ? THR A 291 . ? 1_555 ? 
9  AC1 21 THR A 294 ? THR A 295 . ? 1_555 ? 
10 AC1 21 ILE A 350 ? ILE A 351 . ? 1_555 ? 
11 AC1 21 SER A 351 ? SER A 352 . ? 1_555 ? 
12 AC1 21 ARG A 356 ? ARG A 357 . ? 1_555 ? 
13 AC1 21 GLY A 414 ? GLY A 415 . ? 1_555 ? 
14 AC1 21 PHE A 415 ? PHE A 416 . ? 1_555 ? 
15 AC1 21 GLY A 416 ? GLY A 417 . ? 1_555 ? 
16 AC1 21 TRP A 417 ? TRP A 418 . ? 1_555 ? 
17 AC1 21 ARG A 420 ? ARG A 421 . ? 1_555 ? 
18 AC1 21 GLN A 421 ? GLN A 422 . ? 1_555 ? 
19 AC1 21 CYS A 422 ? CYS A 423 . ? 1_555 ? 
20 AC1 21 GLY A 424 ? GLY A 425 . ? 1_555 ? 
21 AC1 21 HOH K .   ? HOH A 499 . ? 1_555 ? 
22 AC2 6  PHE A 81  ? PHE A 82  . ? 1_555 ? 
23 AC2 6  SER A 351 ? SER A 352 . ? 1_555 ? 
24 AC2 6  THR A 353 ? THR A 354 . ? 1_555 ? 
25 AC2 6  GLN A 355 ? GLN A 356 . ? 1_555 ? 
26 AC2 6  HOH K .   ? HOH A 538 . ? 1_555 ? 
27 AC2 6  HOH K .   ? HOH A 573 . ? 1_555 ? 
28 AC3 23 ARG B 80  ? ARG B 81  . ? 1_555 ? 
29 AC3 23 VAL B 99  ? VAL B 100 . ? 1_555 ? 
30 AC3 23 TRP B 107 ? TRP B 108 . ? 1_555 ? 
31 AC3 23 ARG B 111 ? ARG B 112 . ? 1_555 ? 
32 AC3 23 MET B 283 ? MET B 284 . ? 1_555 ? 
33 AC3 23 GLY B 286 ? GLY B 287 . ? 1_555 ? 
34 AC3 23 GLY B 287 ? GLY B 288 . ? 1_555 ? 
35 AC3 23 THR B 290 ? THR B 291 . ? 1_555 ? 
36 AC3 23 THR B 294 ? THR B 295 . ? 1_555 ? 
37 AC3 23 LEU B 345 ? LEU B 346 . ? 1_555 ? 
38 AC3 23 ILE B 350 ? ILE B 351 . ? 1_555 ? 
39 AC3 23 SER B 351 ? SER B 352 . ? 1_555 ? 
40 AC3 23 LEU B 354 ? LEU B 355 . ? 1_555 ? 
41 AC3 23 ARG B 356 ? ARG B 357 . ? 1_555 ? 
42 AC3 23 GLY B 414 ? GLY B 415 . ? 1_555 ? 
43 AC3 23 PHE B 415 ? PHE B 416 . ? 1_555 ? 
44 AC3 23 GLY B 416 ? GLY B 417 . ? 1_555 ? 
45 AC3 23 TRP B 417 ? TRP B 418 . ? 1_555 ? 
46 AC3 23 ARG B 420 ? ARG B 421 . ? 1_555 ? 
47 AC3 23 GLN B 421 ? GLN B 422 . ? 1_555 ? 
48 AC3 23 CYS B 422 ? CYS B 423 . ? 1_555 ? 
49 AC3 23 GLY B 424 ? GLY B 425 . ? 1_555 ? 
50 AC3 23 HOH L .   ? HOH B 499 . ? 1_555 ? 
51 AC4 8  PHE B 81  ? PHE B 82  . ? 1_555 ? 
52 AC4 8  MET B 200 ? MET B 201 . ? 1_555 ? 
53 AC4 8  GLU B 282 ? GLU B 283 . ? 1_555 ? 
54 AC4 8  SER B 351 ? SER B 352 . ? 1_555 ? 
55 AC4 8  THR B 353 ? THR B 354 . ? 1_555 ? 
56 AC4 8  GLN B 355 ? GLN B 356 . ? 1_555 ? 
57 AC4 8  HOH L .   ? HOH B 559 . ? 1_555 ? 
58 AC4 8  HOH L .   ? HOH B 590 . ? 1_555 ? 
59 AC5 6  GLY C 43  ? GLY C 44  . ? 1_555 ? 
60 AC5 6  CYS C 45  ? CYS C 46  . ? 1_555 ? 
61 AC5 6  GLY C 47  ? GLY C 48  . ? 1_555 ? 
62 AC5 6  CYS C 51  ? CYS C 52  . ? 1_555 ? 
63 AC5 6  CYS C 54  ? CYS C 55  . ? 1_555 ? 
64 AC5 6  CYS C 91  ? CYS C 92  . ? 1_555 ? 
65 AC6 8  LEU D 29  ? LEU D 30  . ? 1_555 ? 
66 AC6 8  GLY D 43  ? GLY D 44  . ? 1_555 ? 
67 AC6 8  CYS D 45  ? CYS D 46  . ? 1_555 ? 
68 AC6 8  GLY D 47  ? GLY D 48  . ? 1_555 ? 
69 AC6 8  LEU D 49  ? LEU D 50  . ? 1_555 ? 
70 AC6 8  CYS D 51  ? CYS D 52  . ? 1_555 ? 
71 AC6 8  CYS D 54  ? CYS D 55  . ? 1_555 ? 
72 AC6 8  CYS D 91  ? CYS D 92  . ? 1_555 ? 
# 
_atom_sites.entry_id                    3N9Y 
_atom_sites.fract_transf_matrix[1][1]   0.012048 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002552 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008719 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011883 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 4   ? -20.804 -14.909 18.121  1.00 52.41 ? 5   SER A N   1 
ATOM   2    C  CA  . SER A 1 4   ? -20.580 -15.663 16.843  1.00 52.36 ? 5   SER A CA  1 
ATOM   3    C  C   . SER A 1 4   ? -19.168 -15.576 16.220  1.00 51.72 ? 5   SER A C   1 
ATOM   4    O  O   . SER A 1 4   ? -18.978 -16.023 15.085  1.00 52.19 ? 5   SER A O   1 
ATOM   5    C  CB  . SER A 1 4   ? -21.644 -15.279 15.807  1.00 52.52 ? 5   SER A CB  1 
ATOM   6    O  OG  . SER A 1 4   ? -21.906 -13.888 15.851  1.00 53.90 ? 5   SER A OG  1 
ATOM   7    N  N   . PRO A 1 5   ? -18.174 -15.010 16.943  1.00 51.10 ? 6   PRO A N   1 
ATOM   8    C  CA  . PRO A 1 5   ? -16.821 -15.068 16.376  1.00 50.40 ? 6   PRO A CA  1 
ATOM   9    C  C   . PRO A 1 5   ? -16.205 -16.457 16.568  1.00 49.54 ? 6   PRO A C   1 
ATOM   10   O  O   . PRO A 1 5   ? -16.387 -17.067 17.627  1.00 49.42 ? 6   PRO A O   1 
ATOM   11   C  CB  . PRO A 1 5   ? -16.040 -14.019 17.189  1.00 50.37 ? 6   PRO A CB  1 
ATOM   12   C  CG  . PRO A 1 5   ? -17.055 -13.320 18.061  1.00 50.98 ? 6   PRO A CG  1 
ATOM   13   C  CD  . PRO A 1 5   ? -18.185 -14.284 18.225  1.00 51.08 ? 6   PRO A CD  1 
ATOM   14   N  N   . ARG A 1 6   ? -15.496 -16.950 15.549  1.00 48.51 ? 7   ARG A N   1 
ATOM   15   C  CA  . ARG A 1 6   ? -14.868 -18.274 15.606  1.00 47.43 ? 7   ARG A CA  1 
ATOM   16   C  C   . ARG A 1 6   ? -13.805 -18.345 16.709  1.00 46.52 ? 7   ARG A C   1 
ATOM   17   O  O   . ARG A 1 6   ? -13.193 -17.322 17.054  1.00 46.32 ? 7   ARG A O   1 
ATOM   18   C  CB  . ARG A 1 6   ? -14.231 -18.662 14.270  1.00 47.63 ? 7   ARG A CB  1 
ATOM   19   C  CG  . ARG A 1 6   ? -15.153 -18.690 13.055  1.00 48.70 ? 7   ARG A CG  1 
ATOM   20   C  CD  . ARG A 1 6   ? -14.809 -17.545 12.109  1.00 50.52 ? 7   ARG A CD  1 
ATOM   21   N  NE  . ARG A 1 6   ? -14.600 -17.999 10.733  1.00 51.73 ? 7   ARG A NE  1 
ATOM   22   C  CZ  . ARG A 1 6   ? -14.063 -17.257 9.764   1.00 51.85 ? 7   ARG A CZ  1 
ATOM   23   N  NH1 . ARG A 1 6   ? -13.668 -16.012 10.004  1.00 51.55 ? 7   ARG A NH1 1 
ATOM   24   N  NH2 . ARG A 1 6   ? -13.915 -17.763 8.546   1.00 52.08 ? 7   ARG A NH2 1 
ATOM   25   N  N   . PRO A 1 7   ? -13.589 -19.550 17.277  1.00 45.35 ? 8   PRO A N   1 
ATOM   26   C  CA  . PRO A 1 7   ? -12.545 -19.682 18.285  1.00 44.44 ? 8   PRO A CA  1 
ATOM   27   C  C   . PRO A 1 7   ? -11.139 -19.581 17.678  1.00 43.43 ? 8   PRO A C   1 
ATOM   28   O  O   . PRO A 1 7   ? -10.959 -19.771 16.465  1.00 42.71 ? 8   PRO A O   1 
ATOM   29   C  CB  . PRO A 1 7   ? -12.782 -21.087 18.859  1.00 44.52 ? 8   PRO A CB  1 
ATOM   30   C  CG  . PRO A 1 7   ? -13.488 -21.829 17.784  1.00 44.77 ? 8   PRO A CG  1 
ATOM   31   C  CD  . PRO A 1 7   ? -14.336 -20.811 17.086  1.00 45.47 ? 8   PRO A CD  1 
ATOM   32   N  N   . PHE A 1 8   ? -10.171 -19.280 18.541  1.00 42.14 ? 9   PHE A N   1 
ATOM   33   C  CA  . PHE A 1 8   ? -8.755  -19.182 18.183  1.00 40.91 ? 9   PHE A CA  1 
ATOM   34   C  C   . PHE A 1 8   ? -8.243  -20.332 17.308  1.00 40.11 ? 9   PHE A C   1 
ATOM   35   O  O   . PHE A 1 8   ? -7.559  -20.089 16.309  1.00 39.46 ? 9   PHE A O   1 
ATOM   36   C  CB  . PHE A 1 8   ? -7.917  -19.056 19.458  1.00 40.95 ? 9   PHE A CB  1 
ATOM   37   C  CG  . PHE A 1 8   ? -6.443  -18.925 19.214  1.00 41.10 ? 9   PHE A CG  1 
ATOM   38   C  CD1 . PHE A 1 8   ? -5.899  -17.714 18.791  1.00 41.08 ? 9   PHE A CD1 1 
ATOM   39   C  CD2 . PHE A 1 8   ? -5.592  -20.007 19.433  1.00 41.97 ? 9   PHE A CD2 1 
ATOM   40   C  CE1 . PHE A 1 8   ? -4.532  -17.583 18.576  1.00 41.01 ? 9   PHE A CE1 1 
ATOM   41   C  CE2 . PHE A 1 8   ? -4.217  -19.889 19.223  1.00 42.62 ? 9   PHE A CE2 1 
ATOM   42   C  CZ  . PHE A 1 8   ? -3.687  -18.669 18.788  1.00 41.61 ? 9   PHE A CZ  1 
ATOM   43   N  N   . ASN A 1 9   ? -8.587  -21.571 17.669  1.00 39.27 ? 10  ASN A N   1 
ATOM   44   C  CA  . ASN A 1 9   ? -8.074  -22.757 16.965  1.00 38.56 ? 10  ASN A CA  1 
ATOM   45   C  C   . ASN A 1 9   ? -8.517  -22.899 15.507  1.00 37.54 ? 10  ASN A C   1 
ATOM   46   O  O   . ASN A 1 9   ? -7.928  -23.679 14.751  1.00 37.41 ? 10  ASN A O   1 
ATOM   47   C  CB  . ASN A 1 9   ? -8.377  -24.046 17.737  1.00 39.31 ? 10  ASN A CB  1 
ATOM   48   C  CG  . ASN A 1 9   ? -9.858  -24.355 17.790  1.00 40.82 ? 10  ASN A CG  1 
ATOM   49   O  OD1 . ASN A 1 9   ? -10.581 -23.843 18.642  1.00 41.35 ? 10  ASN A OD1 1 
ATOM   50   N  ND2 . ASN A 1 9   ? -10.321 -25.189 16.861  1.00 43.59 ? 10  ASN A ND2 1 
ATOM   51   N  N   . GLU A 1 10  ? -9.536  -22.141 15.109  1.00 36.34 ? 11  GLU A N   1 
ATOM   52   C  CA  . GLU A 1 10  ? -10.005 -22.173 13.719  1.00 35.42 ? 11  GLU A CA  1 
ATOM   53   C  C   . GLU A 1 10  ? -9.223  -21.241 12.780  1.00 34.09 ? 11  GLU A C   1 
ATOM   54   O  O   . GLU A 1 10  ? -9.363  -21.315 11.559  1.00 33.50 ? 11  GLU A O   1 
ATOM   55   C  CB  . GLU A 1 10  ? -11.519 -21.937 13.644  1.00 36.01 ? 11  GLU A CB  1 
ATOM   56   C  CG  . GLU A 1 10  ? -12.307 -22.980 14.450  1.00 38.16 ? 11  GLU A CG  1 
ATOM   57   C  CD  . GLU A 1 10  ? -13.805 -22.946 14.215  1.00 41.74 ? 11  GLU A CD  1 
ATOM   58   O  OE1 . GLU A 1 10  ? -14.277 -22.097 13.424  1.00 43.19 ? 11  GLU A OE1 1 
ATOM   59   O  OE2 . GLU A 1 10  ? -14.512 -23.779 14.834  1.00 43.27 ? 11  GLU A OE2 1 
ATOM   60   N  N   . ILE A 1 11  ? -8.388  -20.373 13.348  1.00 32.68 ? 12  ILE A N   1 
ATOM   61   C  CA  . ILE A 1 11  ? -7.476  -19.567 12.536  1.00 31.11 ? 12  ILE A CA  1 
ATOM   62   C  C   . ILE A 1 11  ? -6.582  -20.525 11.758  1.00 30.23 ? 12  ILE A C   1 
ATOM   63   O  O   . ILE A 1 11  ? -6.008  -21.425 12.353  1.00 30.38 ? 12  ILE A O   1 
ATOM   64   C  CB  . ILE A 1 11  ? -6.634  -18.602 13.406  1.00 31.05 ? 12  ILE A CB  1 
ATOM   65   C  CG1 . ILE A 1 11  ? -7.545  -17.583 14.083  1.00 29.83 ? 12  ILE A CG1 1 
ATOM   66   C  CG2 . ILE A 1 11  ? -5.580  -17.865 12.551  1.00 30.04 ? 12  ILE A CG2 1 
ATOM   67   C  CD1 . ILE A 1 11  ? -6.920  -16.872 15.254  1.00 30.96 ? 12  ILE A CD1 1 
ATOM   68   N  N   . PRO A 1 12  ? -6.481  -20.351 10.422  1.00 29.86 ? 13  PRO A N   1 
ATOM   69   C  CA  . PRO A 1 12  ? -5.628  -21.221 9.621   1.00 29.49 ? 13  PRO A CA  1 
ATOM   70   C  C   . PRO A 1 12  ? -4.191  -21.264 10.158  1.00 29.45 ? 13  PRO A C   1 
ATOM   71   O  O   . PRO A 1 12  ? -3.696  -20.266 10.699  1.00 28.72 ? 13  PRO A O   1 
ATOM   72   C  CB  . PRO A 1 12  ? -5.672  -20.568 8.239   1.00 29.50 ? 13  PRO A CB  1 
ATOM   73   C  CG  . PRO A 1 12  ? -7.000  -19.884 8.207   1.00 29.68 ? 13  PRO A CG  1 
ATOM   74   C  CD  . PRO A 1 12  ? -7.210  -19.377 9.581   1.00 29.38 ? 13  PRO A CD  1 
ATOM   75   N  N   . SER A 1 13  ? -3.549  -22.420 9.994   1.00 29.35 ? 14  SER A N   1 
ATOM   76   C  CA  . SER A 1 13  ? -2.291  -22.752 10.658  1.00 29.85 ? 14  SER A CA  1 
ATOM   77   C  C   . SER A 1 13  ? -1.664  -23.966 9.976   1.00 30.17 ? 14  SER A C   1 
ATOM   78   O  O   . SER A 1 13  ? -2.396  -24.851 9.534   1.00 29.56 ? 14  SER A O   1 
ATOM   79   C  CB  . SER A 1 13  ? -2.579  -23.087 12.126  1.00 29.70 ? 14  SER A CB  1 
ATOM   80   O  OG  . SER A 1 13  ? -1.387  -23.405 12.833  1.00 31.04 ? 14  SER A OG  1 
ATOM   81   N  N   . PRO A 1 14  ? -0.314  -24.029 9.894   1.00 30.96 ? 15  PRO A N   1 
ATOM   82   C  CA  . PRO A 1 14  ? 0.327   -25.268 9.403   1.00 31.31 ? 15  PRO A CA  1 
ATOM   83   C  C   . PRO A 1 14  ? 0.182   -26.459 10.354  1.00 31.77 ? 15  PRO A C   1 
ATOM   84   O  O   . PRO A 1 14  ? 0.490   -27.588 9.969   1.00 32.88 ? 15  PRO A O   1 
ATOM   85   C  CB  . PRO A 1 14  ? 1.809   -24.882 9.270   1.00 31.53 ? 15  PRO A CB  1 
ATOM   86   C  CG  . PRO A 1 14  ? 1.986   -23.727 10.224  1.00 31.56 ? 15  PRO A CG  1 
ATOM   87   C  CD  . PRO A 1 14  ? 0.682   -22.972 10.169  1.00 31.27 ? 15  PRO A CD  1 
ATOM   88   N  N   . GLY A 1 15  ? -0.292  -26.216 11.574  1.00 31.72 ? 16  GLY A N   1 
ATOM   89   C  CA  . GLY A 1 15  ? -0.413  -27.268 12.588  1.00 31.55 ? 16  GLY A CA  1 
ATOM   90   C  C   . GLY A 1 15  ? 0.097   -26.810 13.943  1.00 31.18 ? 16  GLY A C   1 
ATOM   91   O  O   . GLY A 1 15  ? 0.701   -25.740 14.055  1.00 30.80 ? 16  GLY A O   1 
ATOM   92   N  N   . ASP A 1 16  ? -0.125  -27.627 14.969  1.00 30.90 ? 17  ASP A N   1 
ATOM   93   C  CA  . ASP A 1 16  ? 0.181   -27.232 16.347  1.00 30.99 ? 17  ASP A CA  1 
ATOM   94   C  C   . ASP A 1 16  ? 1.549   -27.642 16.858  1.00 29.91 ? 17  ASP A C   1 
ATOM   95   O  O   . ASP A 1 16  ? 1.941   -27.264 17.956  1.00 30.21 ? 17  ASP A O   1 
ATOM   96   C  CB  . ASP A 1 16  ? -0.895  -27.734 17.298  1.00 31.98 ? 17  ASP A CB  1 
ATOM   97   C  CG  . ASP A 1 16  ? -2.233  -27.093 17.027  1.00 35.41 ? 17  ASP A CG  1 
ATOM   98   O  OD1 . ASP A 1 16  ? -2.348  -25.853 17.185  1.00 38.76 ? 17  ASP A OD1 1 
ATOM   99   O  OD2 . ASP A 1 16  ? -3.164  -27.827 16.633  1.00 39.49 ? 17  ASP A OD2 1 
ATOM   100  N  N   . ASN A 1 17  ? 2.273   -28.413 16.065  1.00 28.86 ? 18  ASN A N   1 
ATOM   101  C  CA  . ASN A 1 17  ? 3.602   -28.831 16.459  1.00 28.15 ? 18  ASN A CA  1 
ATOM   102  C  C   . ASN A 1 17  ? 4.647   -27.803 16.019  1.00 27.30 ? 18  ASN A C   1 
ATOM   103  O  O   . ASN A 1 17  ? 5.060   -27.764 14.850  1.00 26.62 ? 18  ASN A O   1 
ATOM   104  C  CB  . ASN A 1 17  ? 3.908   -30.245 15.943  1.00 27.73 ? 18  ASN A CB  1 
ATOM   105  C  CG  . ASN A 1 17  ? 5.231   -30.778 16.459  1.00 29.04 ? 18  ASN A CG  1 
ATOM   106  O  OD1 . ASN A 1 17  ? 6.175   -30.019 16.692  1.00 27.18 ? 18  ASN A OD1 1 
ATOM   107  N  ND2 . ASN A 1 17  ? 5.309   -32.094 16.639  1.00 29.41 ? 18  ASN A ND2 1 
ATOM   108  N  N   . GLY A 1 18  ? 5.050   -26.971 16.981  1.00 26.83 ? 19  GLY A N   1 
ATOM   109  C  CA  . GLY A 1 18  ? 6.064   -25.936 16.784  1.00 26.51 ? 19  GLY A CA  1 
ATOM   110  C  C   . GLY A 1 18  ? 7.402   -26.420 16.248  1.00 26.62 ? 19  GLY A C   1 
ATOM   111  O  O   . GLY A 1 18  ? 8.034   -25.733 15.440  1.00 26.19 ? 19  GLY A O   1 
ATOM   112  N  N   . TRP A 1 19  ? 7.847   -27.597 16.693  1.00 25.79 ? 20  TRP A N   1 
ATOM   113  C  CA  . TRP A 1 19  ? 9.150   -28.114 16.258  1.00 25.71 ? 20  TRP A CA  1 
ATOM   114  C  C   . TRP A 1 19  ? 9.049   -28.614 14.835  1.00 24.97 ? 20  TRP A C   1 
ATOM   115  O  O   . TRP A 1 19  ? 9.944   -28.374 14.029  1.00 24.78 ? 20  TRP A O   1 
ATOM   116  C  CB  . TRP A 1 19  ? 9.673   -29.197 17.221  1.00 25.80 ? 20  TRP A CB  1 
ATOM   117  C  CG  . TRP A 1 19  ? 9.652   -28.690 18.628  1.00 27.66 ? 20  TRP A CG  1 
ATOM   118  C  CD1 . TRP A 1 19  ? 8.818   -29.092 19.639  1.00 28.21 ? 20  TRP A CD1 1 
ATOM   119  C  CD2 . TRP A 1 19  ? 10.451  -27.625 19.164  1.00 28.91 ? 20  TRP A CD2 1 
ATOM   120  N  NE1 . TRP A 1 19  ? 9.072   -28.360 20.773  1.00 29.77 ? 20  TRP A NE1 1 
ATOM   121  C  CE2 . TRP A 1 19  ? 10.071  -27.456 20.511  1.00 29.12 ? 20  TRP A CE2 1 
ATOM   122  C  CE3 . TRP A 1 19  ? 11.461  -26.806 18.636  1.00 29.70 ? 20  TRP A CE3 1 
ATOM   123  C  CZ2 . TRP A 1 19  ? 10.663  -26.501 21.343  1.00 31.48 ? 20  TRP A CZ2 1 
ATOM   124  C  CZ3 . TRP A 1 19  ? 12.053  -25.852 19.466  1.00 30.36 ? 20  TRP A CZ3 1 
ATOM   125  C  CH2 . TRP A 1 19  ? 11.643  -25.704 20.801  1.00 30.15 ? 20  TRP A CH2 1 
ATOM   126  N  N   . LEU A 1 20  ? 7.939   -29.286 14.528  1.00 24.34 ? 21  LEU A N   1 
ATOM   127  C  CA  . LEU A 1 20  ? 7.654   -29.697 13.160  1.00 23.90 ? 21  LEU A CA  1 
ATOM   128  C  C   . LEU A 1 20  ? 7.536   -28.482 12.233  1.00 22.57 ? 21  LEU A C   1 
ATOM   129  O  O   . LEU A 1 20  ? 8.076   -28.479 11.126  1.00 22.48 ? 21  LEU A O   1 
ATOM   130  C  CB  . LEU A 1 20  ? 6.371   -30.549 13.084  1.00 23.76 ? 21  LEU A CB  1 
ATOM   131  C  CG  . LEU A 1 20  ? 6.144   -31.251 11.727  1.00 26.09 ? 21  LEU A CG  1 
ATOM   132  C  CD1 . LEU A 1 20  ? 7.362   -32.117 11.279  1.00 26.47 ? 21  LEU A CD1 1 
ATOM   133  C  CD2 . LEU A 1 20  ? 4.884   -32.107 11.754  1.00 29.22 ? 21  LEU A CD2 1 
ATOM   134  N  N   . ASN A 1 21  ? 6.820   -27.456 12.677  1.00 21.64 ? 22  ASN A N   1 
ATOM   135  C  CA  . ASN A 1 21  ? 6.705   -26.228 11.877  1.00 21.33 ? 22  ASN A CA  1 
ATOM   136  C  C   . ASN A 1 21  ? 8.065   -25.593 11.614  1.00 21.27 ? 22  ASN A C   1 
ATOM   137  O  O   . ASN A 1 21  ? 8.331   -25.108 10.521  1.00 20.44 ? 22  ASN A O   1 
ATOM   138  C  CB  . ASN A 1 21  ? 5.763   -25.229 12.549  1.00 21.03 ? 22  ASN A CB  1 
ATOM   139  C  CG  . ASN A 1 21  ? 4.339   -25.712 12.561  1.00 21.36 ? 22  ASN A CG  1 
ATOM   140  O  OD1 . ASN A 1 21  ? 3.966   -26.558 11.755  1.00 22.33 ? 22  ASN A OD1 1 
ATOM   141  N  ND2 . ASN A 1 21  ? 3.536   -25.197 13.486  1.00 22.21 ? 22  ASN A ND2 1 
ATOM   142  N  N   . LEU A 1 22  ? 8.930   -25.616 12.631  1.00 21.37 ? 23  LEU A N   1 
ATOM   143  C  CA  . LEU A 1 22  ? 10.274  -25.054 12.513  1.00 22.01 ? 23  LEU A CA  1 
ATOM   144  C  C   . LEU A 1 22  ? 11.105  -25.851 11.513  1.00 22.32 ? 23  LEU A C   1 
ATOM   145  O  O   . LEU A 1 22  ? 11.821  -25.284 10.677  1.00 22.60 ? 23  LEU A O   1 
ATOM   146  C  CB  . LEU A 1 22  ? 10.956  -25.022 13.885  1.00 21.53 ? 23  LEU A CB  1 
ATOM   147  C  CG  . LEU A 1 22  ? 12.158  -24.101 14.127  1.00 21.98 ? 23  LEU A CG  1 
ATOM   148  C  CD1 . LEU A 1 22  ? 11.923  -22.673 13.620  1.00 19.91 ? 23  LEU A CD1 1 
ATOM   149  C  CD2 . LEU A 1 22  ? 12.484  -24.099 15.636  1.00 21.30 ? 23  LEU A CD2 1 
ATOM   150  N  N   . TYR A 1 23  ? 10.991  -27.174 11.598  1.00 22.78 ? 24  TYR A N   1 
ATOM   151  C  CA  . TYR A 1 23  ? 11.652  -28.064 10.667  1.00 23.25 ? 24  TYR A CA  1 
ATOM   152  C  C   . TYR A 1 23  ? 11.313  -27.731 9.213   1.00 22.78 ? 24  TYR A C   1 
ATOM   153  O  O   . TYR A 1 23  ? 12.204  -27.631 8.371   1.00 23.07 ? 24  TYR A O   1 
ATOM   154  C  CB  . TYR A 1 23  ? 11.307  -29.525 10.993  1.00 23.36 ? 24  TYR A CB  1 
ATOM   155  C  CG  . TYR A 1 23  ? 11.762  -30.473 9.931   1.00 26.68 ? 24  TYR A CG  1 
ATOM   156  C  CD1 . TYR A 1 23  ? 13.120  -30.734 9.736   1.00 30.20 ? 24  TYR A CD1 1 
ATOM   157  C  CD2 . TYR A 1 23  ? 10.843  -31.089 9.090   1.00 29.88 ? 24  TYR A CD2 1 
ATOM   158  C  CE1 . TYR A 1 23  ? 13.547  -31.600 8.733   1.00 32.14 ? 24  TYR A CE1 1 
ATOM   159  C  CE2 . TYR A 1 23  ? 11.263  -31.954 8.081   1.00 32.64 ? 24  TYR A CE2 1 
ATOM   160  C  CZ  . TYR A 1 23  ? 12.612  -32.206 7.919   1.00 32.62 ? 24  TYR A CZ  1 
ATOM   161  O  OH  . TYR A 1 23  ? 13.022  -33.056 6.928   1.00 36.13 ? 24  TYR A OH  1 
ATOM   162  N  N   . HIS A 1 24  ? 10.025  -27.570 8.920   1.00 22.78 ? 25  HIS A N   1 
ATOM   163  C  CA  . HIS A 1 24  ? 9.598   -27.289 7.555   1.00 22.72 ? 25  HIS A CA  1 
ATOM   164  C  C   . HIS A 1 24  ? 9.999   -25.881 7.099   1.00 21.98 ? 25  HIS A C   1 
ATOM   165  O  O   . HIS A 1 24  ? 10.365  -25.700 5.955   1.00 21.77 ? 25  HIS A O   1 
ATOM   166  C  CB  . HIS A 1 24  ? 8.093   -27.508 7.391   1.00 23.02 ? 25  HIS A CB  1 
ATOM   167  C  CG  . HIS A 1 24  ? 7.698   -28.951 7.380   1.00 25.69 ? 25  HIS A CG  1 
ATOM   168  N  ND1 . HIS A 1 24  ? 8.252   -29.869 6.513   1.00 28.50 ? 25  HIS A ND1 1 
ATOM   169  C  CD2 . HIS A 1 24  ? 6.797   -29.635 8.124   1.00 28.21 ? 25  HIS A CD2 1 
ATOM   170  C  CE1 . HIS A 1 24  ? 7.715   -31.057 6.725   1.00 28.68 ? 25  HIS A CE1 1 
ATOM   171  N  NE2 . HIS A 1 24  ? 6.833   -30.944 7.702   1.00 28.80 ? 25  HIS A NE2 1 
ATOM   172  N  N   . PHE A 1 25  ? 9.942   -24.902 7.997   1.00 21.54 ? 26  PHE A N   1 
ATOM   173  C  CA  . PHE A 1 25  ? 10.411  -23.549 7.685   1.00 21.87 ? 26  PHE A CA  1 
ATOM   174  C  C   . PHE A 1 25  ? 11.899  -23.566 7.280   1.00 22.51 ? 26  PHE A C   1 
ATOM   175  O  O   . PHE A 1 25  ? 12.244  -23.053 6.220   1.00 22.80 ? 26  PHE A O   1 
ATOM   176  C  CB  . PHE A 1 25  ? 10.111  -22.583 8.851   1.00 21.36 ? 26  PHE A CB  1 
ATOM   177  C  CG  . PHE A 1 25  ? 10.869  -21.276 8.804   1.00 21.59 ? 26  PHE A CG  1 
ATOM   178  C  CD1 . PHE A 1 25  ? 10.946  -20.515 7.637   1.00 21.78 ? 26  PHE A CD1 1 
ATOM   179  C  CD2 . PHE A 1 25  ? 11.467  -20.773 9.964   1.00 24.17 ? 26  PHE A CD2 1 
ATOM   180  C  CE1 . PHE A 1 25  ? 11.640  -19.305 7.615   1.00 21.25 ? 26  PHE A CE1 1 
ATOM   181  C  CE2 . PHE A 1 25  ? 12.163  -19.555 9.958   1.00 23.02 ? 26  PHE A CE2 1 
ATOM   182  C  CZ  . PHE A 1 25  ? 12.248  -18.822 8.791   1.00 23.09 ? 26  PHE A CZ  1 
ATOM   183  N  N   . TRP A 1 26  ? 12.758  -24.186 8.088   1.00 23.16 ? 27  TRP A N   1 
ATOM   184  C  CA  . TRP A 1 26  ? 14.189  -24.270 7.755   1.00 24.50 ? 27  TRP A CA  1 
ATOM   185  C  C   . TRP A 1 26  ? 14.488  -25.031 6.473   1.00 25.36 ? 27  TRP A C   1 
ATOM   186  O  O   . TRP A 1 26  ? 15.364  -24.631 5.709   1.00 25.28 ? 27  TRP A O   1 
ATOM   187  C  CB  . TRP A 1 26  ? 15.003  -24.890 8.885   1.00 24.46 ? 27  TRP A CB  1 
ATOM   188  C  CG  . TRP A 1 26  ? 15.035  -24.093 10.147  1.00 25.53 ? 27  TRP A CG  1 
ATOM   189  C  CD1 . TRP A 1 26  ? 14.570  -22.826 10.336  1.00 25.26 ? 27  TRP A CD1 1 
ATOM   190  C  CD2 . TRP A 1 26  ? 15.573  -24.516 11.395  1.00 27.00 ? 27  TRP A CD2 1 
ATOM   191  N  NE1 . TRP A 1 26  ? 14.773  -22.438 11.633  1.00 26.94 ? 27  TRP A NE1 1 
ATOM   192  C  CE2 . TRP A 1 26  ? 15.395  -23.455 12.306  1.00 27.18 ? 27  TRP A CE2 1 
ATOM   193  C  CE3 . TRP A 1 26  ? 16.192  -25.697 11.837  1.00 28.20 ? 27  TRP A CE3 1 
ATOM   194  C  CZ2 . TRP A 1 26  ? 15.819  -23.529 13.637  1.00 28.17 ? 27  TRP A CZ2 1 
ATOM   195  C  CZ3 . TRP A 1 26  ? 16.606  -25.776 13.154  1.00 27.85 ? 27  TRP A CZ3 1 
ATOM   196  C  CH2 . TRP A 1 26  ? 16.415  -24.696 14.043  1.00 28.25 ? 27  TRP A CH2 1 
ATOM   197  N  N   . ARG A 1 27  ? 13.768  -26.130 6.260   1.00 26.92 ? 28  ARG A N   1 
ATOM   198  C  CA  . ARG A 1 27  ? 13.966  -27.000 5.095   1.00 28.94 ? 28  ARG A CA  1 
ATOM   199  C  C   . ARG A 1 27  ? 13.561  -26.305 3.793   1.00 28.68 ? 28  ARG A C   1 
ATOM   200  O  O   . ARG A 1 27  ? 14.300  -26.344 2.824   1.00 28.76 ? 28  ARG A O   1 
ATOM   201  C  CB  . ARG A 1 27  ? 13.167  -28.312 5.263   1.00 29.45 ? 28  ARG A CB  1 
ATOM   202  C  CG  . ARG A 1 27  ? 13.550  -29.434 4.274   1.00 33.59 ? 28  ARG A CG  1 
ATOM   203  C  CD  . ARG A 1 27  ? 12.550  -30.599 4.315   1.00 38.84 ? 28  ARG A CD  1 
ATOM   204  N  NE  . ARG A 1 27  ? 11.221  -30.145 3.897   1.00 44.29 ? 28  ARG A NE  1 
ATOM   205  C  CZ  . ARG A 1 27  ? 10.102  -30.869 3.929   1.00 46.63 ? 28  ARG A CZ  1 
ATOM   206  N  NH1 . ARG A 1 27  ? 10.103  -32.130 4.362   1.00 47.89 ? 28  ARG A NH1 1 
ATOM   207  N  NH2 . ARG A 1 27  ? 8.968   -30.318 3.513   1.00 48.42 ? 28  ARG A NH2 1 
ATOM   208  N  N   . GLU A 1 28  ? 12.385  -25.679 3.791   1.00 29.20 ? 29  GLU A N   1 
ATOM   209  C  CA  . GLU A 1 28  ? 11.759  -25.169 2.563   1.00 30.12 ? 29  GLU A CA  1 
ATOM   210  C  C   . GLU A 1 28  ? 12.172  -23.743 2.211   1.00 29.58 ? 29  GLU A C   1 
ATOM   211  O  O   . GLU A 1 28  ? 12.310  -23.403 1.033   1.00 29.94 ? 29  GLU A O   1 
ATOM   212  C  CB  . GLU A 1 28  ? 10.229  -25.247 2.667   1.00 30.46 ? 29  GLU A CB  1 
ATOM   213  C  CG  . GLU A 1 28  ? 9.688   -26.700 2.684   1.00 35.15 ? 29  GLU A CG  1 
ATOM   214  C  CD  . GLU A 1 28  ? 8.166   -26.815 2.875   1.00 40.53 ? 29  GLU A CD  1 
ATOM   215  O  OE1 . GLU A 1 28  ? 7.438   -25.795 2.801   1.00 41.87 ? 29  GLU A OE1 1 
ATOM   216  O  OE2 . GLU A 1 28  ? 7.690   -27.955 3.105   1.00 44.24 ? 29  GLU A OE2 1 
ATOM   217  N  N   . THR A 1 29  ? 12.349  -22.909 3.231   1.00 28.81 ? 30  THR A N   1 
ATOM   218  C  CA  . THR A 1 29  ? 12.582  -21.491 3.012   1.00 28.57 ? 30  THR A CA  1 
ATOM   219  C  C   . THR A 1 29  ? 13.935  -21.036 3.577   1.00 28.15 ? 30  THR A C   1 
ATOM   220  O  O   . THR A 1 29  ? 14.697  -20.386 2.876   1.00 28.38 ? 30  THR A O   1 
ATOM   221  C  CB  . THR A 1 29  ? 11.408  -20.658 3.552   1.00 28.31 ? 30  THR A CB  1 
ATOM   222  O  OG1 . THR A 1 29  ? 10.195  -21.164 2.979   1.00 29.30 ? 30  THR A OG1 1 
ATOM   223  C  CG2 . THR A 1 29  ? 11.546  -19.184 3.164   1.00 28.94 ? 30  THR A CG2 1 
ATOM   224  N  N   . GLY A 1 30  ? 14.233  -21.392 4.826   1.00 27.43 ? 31  GLY A N   1 
ATOM   225  C  CA  . GLY A 1 30  ? 15.505  -21.015 5.441   1.00 26.99 ? 31  GLY A CA  1 
ATOM   226  C  C   . GLY A 1 30  ? 15.383  -19.845 6.403   1.00 26.49 ? 31  GLY A C   1 
ATOM   227  O  O   . GLY A 1 30  ? 14.598  -18.916 6.165   1.00 25.66 ? 31  GLY A O   1 
ATOM   228  N  N   . THR A 1 31  ? 16.179  -19.885 7.476   1.00 25.88 ? 32  THR A N   1 
ATOM   229  C  CA  . THR A 1 31  ? 16.165  -18.844 8.521   1.00 26.30 ? 32  THR A CA  1 
ATOM   230  C  C   . THR A 1 31  ? 16.386  -17.431 7.956   1.00 25.54 ? 32  THR A C   1 
ATOM   231  O  O   . THR A 1 31  ? 15.808  -16.451 8.449   1.00 25.13 ? 32  THR A O   1 
ATOM   232  C  CB  . THR A 1 31  ? 17.253  -19.097 9.610   1.00 26.82 ? 32  THR A CB  1 
ATOM   233  O  OG1 . THR A 1 31  ? 18.497  -19.369 8.971   1.00 27.92 ? 32  THR A OG1 1 
ATOM   234  C  CG2 . THR A 1 31  ? 16.909  -20.291 10.480  1.00 27.68 ? 32  THR A CG2 1 
ATOM   235  N  N   . HIS A 1 32  ? 17.206  -17.336 6.912   1.00 23.75 ? 33  HIS A N   1 
ATOM   236  C  CA  . HIS A 1 32  ? 17.592  -16.035 6.383   1.00 23.49 ? 33  HIS A CA  1 
ATOM   237  C  C   . HIS A 1 32  ? 16.576  -15.466 5.373   1.00 22.25 ? 33  HIS A C   1 
ATOM   238  O  O   . HIS A 1 32  ? 16.788  -14.403 4.792   1.00 22.02 ? 33  HIS A O   1 
ATOM   239  C  CB  . HIS A 1 32  ? 19.023  -16.094 5.824   1.00 23.75 ? 33  HIS A CB  1 
ATOM   240  C  CG  . HIS A 1 32  ? 20.063  -16.332 6.881   1.00 27.40 ? 33  HIS A CG  1 
ATOM   241  N  ND1 . HIS A 1 32  ? 20.612  -15.311 7.633   1.00 29.51 ? 33  HIS A ND1 1 
ATOM   242  C  CD2 . HIS A 1 32  ? 20.623  -17.479 7.342   1.00 29.07 ? 33  HIS A CD2 1 
ATOM   243  C  CE1 . HIS A 1 32  ? 21.487  -15.816 8.487   1.00 29.93 ? 33  HIS A CE1 1 
ATOM   244  N  NE2 . HIS A 1 32  ? 21.504  -17.129 8.339   1.00 30.45 ? 33  HIS A NE2 1 
ATOM   245  N  N   . LYS A 1 33  ? 15.456  -16.171 5.216   1.00 21.19 ? 34  LYS A N   1 
ATOM   246  C  CA  . LYS A 1 33  ? 14.398  -15.785 4.303   1.00 20.20 ? 34  LYS A CA  1 
ATOM   247  C  C   . LYS A 1 33  ? 13.047  -15.746 5.011   1.00 19.49 ? 34  LYS A C   1 
ATOM   248  O  O   . LYS A 1 33  ? 12.018  -16.042 4.412   1.00 18.01 ? 34  LYS A O   1 
ATOM   249  C  CB  . LYS A 1 33  ? 14.330  -16.769 3.120   1.00 20.39 ? 34  LYS A CB  1 
ATOM   250  C  CG  . LYS A 1 33  ? 15.549  -16.786 2.196   1.00 22.23 ? 34  LYS A CG  1 
ATOM   251  C  CD  . LYS A 1 33  ? 15.779  -15.426 1.523   1.00 25.03 ? 34  LYS A CD  1 
ATOM   252  C  CE  . LYS A 1 33  ? 17.094  -15.418 0.733   1.00 28.17 ? 34  LYS A CE  1 
ATOM   253  N  NZ  . LYS A 1 33  ? 17.241  -14.178 -0.075  1.00 29.22 ? 34  LYS A NZ  1 
ATOM   254  N  N   . VAL A 1 34  ? 13.022  -15.356 6.279   1.00 19.66 ? 35  VAL A N   1 
ATOM   255  C  CA  . VAL A 1 34  ? 11.744  -15.357 6.991   1.00 20.29 ? 35  VAL A CA  1 
ATOM   256  C  C   . VAL A 1 34  ? 10.697  -14.419 6.348   1.00 20.12 ? 35  VAL A C   1 
ATOM   257  O  O   . VAL A 1 34  ? 9.501   -14.677 6.442   1.00 20.04 ? 35  VAL A O   1 
ATOM   258  C  CB  . VAL A 1 34  ? 11.891  -15.071 8.500   1.00 21.23 ? 35  VAL A CB  1 
ATOM   259  C  CG1 . VAL A 1 34  ? 12.156  -13.613 8.754   1.00 20.81 ? 35  VAL A CG1 1 
ATOM   260  C  CG2 . VAL A 1 34  ? 10.613  -15.508 9.240   1.00 22.55 ? 35  VAL A CG2 1 
ATOM   261  N  N   . HIS A 1 35  ? 11.151  -13.337 5.708   1.00 19.53 ? 36  HIS A N   1 
ATOM   262  C  CA  . HIS A 1 35  ? 10.245  -12.437 4.994   1.00 20.03 ? 36  HIS A CA  1 
ATOM   263  C  C   . HIS A 1 35  ? 9.469   -13.175 3.889   1.00 20.45 ? 36  HIS A C   1 
ATOM   264  O  O   . HIS A 1 35  ? 8.272   -12.946 3.733   1.00 20.21 ? 36  HIS A O   1 
ATOM   265  C  CB  . HIS A 1 35  ? 10.991  -11.210 4.439   1.00 19.57 ? 36  HIS A CB  1 
ATOM   266  C  CG  . HIS A 1 35  ? 12.207  -11.553 3.628   1.00 19.69 ? 36  HIS A CG  1 
ATOM   267  N  ND1 . HIS A 1 35  ? 13.291  -12.214 4.162   1.00 18.01 ? 36  HIS A ND1 1 
ATOM   268  C  CD2 . HIS A 1 35  ? 12.513  -11.318 2.331   1.00 19.60 ? 36  HIS A CD2 1 
ATOM   269  C  CE1 . HIS A 1 35  ? 14.219  -12.361 3.233   1.00 19.02 ? 36  HIS A CE1 1 
ATOM   270  N  NE2 . HIS A 1 35  ? 13.772  -11.831 2.112   1.00 19.68 ? 36  HIS A NE2 1 
ATOM   271  N  N   . LEU A 1 36  ? 10.154  -14.062 3.153   1.00 20.82 ? 37  LEU A N   1 
ATOM   272  C  CA  . LEU A 1 36  ? 9.524   -14.869 2.108   1.00 21.89 ? 37  LEU A CA  1 
ATOM   273  C  C   . LEU A 1 36  ? 8.554   -15.880 2.683   1.00 21.83 ? 37  LEU A C   1 
ATOM   274  O  O   . LEU A 1 36  ? 7.472   -16.079 2.150   1.00 21.67 ? 37  LEU A O   1 
ATOM   275  C  CB  . LEU A 1 36  ? 10.565  -15.569 1.229   1.00 21.78 ? 37  LEU A CB  1 
ATOM   276  C  CG  . LEU A 1 36  ? 11.549  -14.641 0.518   1.00 22.78 ? 37  LEU A CG  1 
ATOM   277  C  CD1 . LEU A 1 36  ? 12.413  -15.430 -0.476  1.00 23.32 ? 37  LEU A CD1 1 
ATOM   278  C  CD2 . LEU A 1 36  ? 10.839  -13.427 -0.175  1.00 23.81 ? 37  LEU A CD2 1 
ATOM   279  N  N   . HIS A 1 37  ? 8.941   -16.494 3.792   1.00 22.08 ? 38  HIS A N   1 
ATOM   280  C  CA  . HIS A 1 37  ? 8.052   -17.358 4.571   1.00 21.90 ? 38  HIS A CA  1 
ATOM   281  C  C   . HIS A 1 37  ? 6.720   -16.664 4.817   1.00 22.01 ? 38  HIS A C   1 
ATOM   282  O  O   . HIS A 1 37  ? 5.668   -17.262 4.579   1.00 22.05 ? 38  HIS A O   1 
ATOM   283  C  CB  . HIS A 1 37  ? 8.722   -17.729 5.895   1.00 22.03 ? 38  HIS A CB  1 
ATOM   284  C  CG  . HIS A 1 37  ? 7.938   -18.677 6.744   1.00 21.74 ? 38  HIS A CG  1 
ATOM   285  N  ND1 . HIS A 1 37  ? 7.668   -19.973 6.359   1.00 23.23 ? 38  HIS A ND1 1 
ATOM   286  C  CD2 . HIS A 1 37  ? 7.434   -18.544 7.994   1.00 23.95 ? 38  HIS A CD2 1 
ATOM   287  C  CE1 . HIS A 1 37  ? 6.988   -20.583 7.315   1.00 23.58 ? 38  HIS A CE1 1 
ATOM   288  N  NE2 . HIS A 1 37  ? 6.835   -19.739 8.321   1.00 23.86 ? 38  HIS A NE2 1 
ATOM   289  N  N   . HIS A 1 38  ? 6.763   -15.412 5.275   1.00 21.66 ? 39  HIS A N   1 
ATOM   290  C  CA  . HIS A 1 38  ? 5.541   -14.646 5.537   1.00 21.98 ? 39  HIS A CA  1 
ATOM   291  C  C   . HIS A 1 38  ? 4.688   -14.450 4.291   1.00 21.87 ? 39  HIS A C   1 
ATOM   292  O  O   . HIS A 1 38  ? 3.490   -14.696 4.322   1.00 21.73 ? 39  HIS A O   1 
ATOM   293  C  CB  . HIS A 1 38  ? 5.861   -13.279 6.146   1.00 21.71 ? 39  HIS A CB  1 
ATOM   294  C  CG  . HIS A 1 38  ? 6.478   -13.357 7.503   1.00 21.50 ? 39  HIS A CG  1 
ATOM   295  N  ND1 . HIS A 1 38  ? 7.172   -12.306 8.067   1.00 19.59 ? 39  HIS A ND1 1 
ATOM   296  C  CD2 . HIS A 1 38  ? 6.512   -14.365 8.410   1.00 20.82 ? 39  HIS A CD2 1 
ATOM   297  C  CE1 . HIS A 1 38  ? 7.591   -12.660 9.270   1.00 20.68 ? 39  HIS A CE1 1 
ATOM   298  N  NE2 . HIS A 1 38  ? 7.209   -13.905 9.500   1.00 20.77 ? 39  HIS A NE2 1 
ATOM   299  N  N   . VAL A 1 39  ? 5.322   -14.024 3.200   1.00 22.63 ? 40  VAL A N   1 
ATOM   300  C  CA  . VAL A 1 39  ? 4.632   -13.806 1.924   1.00 23.03 ? 40  VAL A CA  1 
ATOM   301  C  C   . VAL A 1 39  ? 3.914   -15.098 1.509   1.00 23.63 ? 40  VAL A C   1 
ATOM   302  O  O   . VAL A 1 39  ? 2.728   -15.084 1.173   1.00 23.09 ? 40  VAL A O   1 
ATOM   303  C  CB  . VAL A 1 39  ? 5.610   -13.330 0.814   1.00 23.05 ? 40  VAL A CB  1 
ATOM   304  C  CG1 . VAL A 1 39  ? 4.939   -13.333 -0.569  1.00 23.25 ? 40  VAL A CG1 1 
ATOM   305  C  CG2 . VAL A 1 39  ? 6.140   -11.930 1.131   1.00 22.57 ? 40  VAL A CG2 1 
ATOM   306  N  N   . GLN A 1 40  ? 4.639   -16.211 1.570   1.00 24.06 ? 41  GLN A N   1 
ATOM   307  C  CA  . GLN A 1 40  ? 4.116   -17.497 1.119   1.00 24.99 ? 41  GLN A CA  1 
ATOM   308  C  C   . GLN A 1 40  ? 2.952   -17.974 1.982   1.00 24.56 ? 41  GLN A C   1 
ATOM   309  O  O   . GLN A 1 40  ? 2.009   -18.567 1.470   1.00 24.28 ? 41  GLN A O   1 
ATOM   310  C  CB  . GLN A 1 40  ? 5.224   -18.550 1.083   1.00 24.81 ? 41  GLN A CB  1 
ATOM   311  C  CG  . GLN A 1 40  ? 6.313   -18.279 0.042   1.00 28.73 ? 41  GLN A CG  1 
ATOM   312  C  CD  . GLN A 1 40  ? 7.579   -19.114 0.273   1.00 33.74 ? 41  GLN A CD  1 
ATOM   313  O  OE1 . GLN A 1 40  ? 7.771   -19.709 1.345   1.00 36.39 ? 41  GLN A OE1 1 
ATOM   314  N  NE2 . GLN A 1 40  ? 8.440   -19.166 -0.732  1.00 33.79 ? 41  GLN A NE2 1 
ATOM   315  N  N   . ASN A 1 41  ? 3.027   -17.709 3.280   1.00 24.08 ? 42  ASN A N   1 
ATOM   316  C  CA  . ASN A 1 41  ? 1.980   -18.103 4.199   1.00 24.42 ? 42  ASN A CA  1 
ATOM   317  C  C   . ASN A 1 41  ? 0.657   -17.368 3.967   1.00 24.60 ? 42  ASN A C   1 
ATOM   318  O  O   . ASN A 1 41  ? -0.395  -17.982 4.032   1.00 23.70 ? 42  ASN A O   1 
ATOM   319  C  CB  . ASN A 1 41  ? 2.435   -17.934 5.648   1.00 24.49 ? 42  ASN A CB  1 
ATOM   320  C  CG  . ASN A 1 41  ? 3.371   -19.054 6.106   1.00 25.58 ? 42  ASN A CG  1 
ATOM   321  O  OD1 . ASN A 1 41  ? 3.541   -20.056 5.414   1.00 27.79 ? 42  ASN A OD1 1 
ATOM   322  N  ND2 . ASN A 1 41  ? 3.980   -18.875 7.264   1.00 23.72 ? 42  ASN A ND2 1 
ATOM   323  N  N   . PHE A 1 42  ? 0.706   -16.059 3.712   1.00 24.45 ? 43  PHE A N   1 
ATOM   324  C  CA  . PHE A 1 42  ? -0.528  -15.333 3.376   1.00 24.92 ? 43  PHE A CA  1 
ATOM   325  C  C   . PHE A 1 42  ? -1.121  -15.838 2.062   1.00 25.64 ? 43  PHE A C   1 
ATOM   326  O  O   . PHE A 1 42  ? -2.338  -15.942 1.941   1.00 25.85 ? 43  PHE A O   1 
ATOM   327  C  CB  . PHE A 1 42  ? -0.324  -13.811 3.353   1.00 24.27 ? 43  PHE A CB  1 
ATOM   328  C  CG  . PHE A 1 42  ? 0.011   -13.232 4.696   1.00 22.62 ? 43  PHE A CG  1 
ATOM   329  C  CD1 . PHE A 1 42  ? 1.274   -12.708 4.940   1.00 19.33 ? 43  PHE A CD1 1 
ATOM   330  C  CD2 . PHE A 1 42  ? -0.932  -13.229 5.724   1.00 21.39 ? 43  PHE A CD2 1 
ATOM   331  C  CE1 . PHE A 1 42  ? 1.591   -12.177 6.192   1.00 21.72 ? 43  PHE A CE1 1 
ATOM   332  C  CE2 . PHE A 1 42  ? -0.631  -12.701 6.977   1.00 20.99 ? 43  PHE A CE2 1 
ATOM   333  C  CZ  . PHE A 1 42  ? 0.634   -12.171 7.216   1.00 20.78 ? 43  PHE A CZ  1 
ATOM   334  N  N   . GLN A 1 43  ? -0.259  -16.176 1.099   1.00 26.74 ? 44  GLN A N   1 
ATOM   335  C  CA  . GLN A 1 43  ? -0.693  -16.807 -0.143  1.00 28.10 ? 44  GLN A CA  1 
ATOM   336  C  C   . GLN A 1 43  ? -1.391  -18.142 0.164   1.00 28.86 ? 44  GLN A C   1 
ATOM   337  O  O   . GLN A 1 43  ? -2.443  -18.455 -0.410  1.00 29.02 ? 44  GLN A O   1 
ATOM   338  C  CB  . GLN A 1 43  ? 0.494   -17.012 -1.101  1.00 28.18 ? 44  GLN A CB  1 
ATOM   339  C  CG  . GLN A 1 43  ? 1.008   -15.729 -1.778  1.00 31.65 ? 44  GLN A CG  1 
ATOM   340  C  CD  . GLN A 1 43  ? 2.318   -15.929 -2.563  1.00 37.98 ? 44  GLN A CD  1 
ATOM   341  O  OE1 . GLN A 1 43  ? 3.056   -16.909 -2.358  1.00 41.66 ? 44  GLN A OE1 1 
ATOM   342  N  NE2 . GLN A 1 43  ? 2.618   -14.987 -3.456  1.00 39.44 ? 44  GLN A NE2 1 
ATOM   343  N  N   . LYS A 1 44  ? -0.820  -18.908 1.092   1.00 28.96 ? 45  LYS A N   1 
ATOM   344  C  CA  . LYS A 1 44  ? -1.371  -20.212 1.474   1.00 29.55 ? 45  LYS A CA  1 
ATOM   345  C  C   . LYS A 1 44  ? -2.652  -20.163 2.298   1.00 28.62 ? 45  LYS A C   1 
ATOM   346  O  O   . LYS A 1 44  ? -3.561  -20.943 2.049   1.00 28.40 ? 45  LYS A O   1 
ATOM   347  C  CB  . LYS A 1 44  ? -0.339  -21.037 2.249   1.00 30.11 ? 45  LYS A CB  1 
ATOM   348  C  CG  . LYS A 1 44  ? 0.469   -21.967 1.395   1.00 33.80 ? 45  LYS A CG  1 
ATOM   349  C  CD  . LYS A 1 44  ? 1.040   -23.113 2.229   1.00 38.74 ? 45  LYS A CD  1 
ATOM   350  C  CE  . LYS A 1 44  ? 2.319   -22.711 2.952   1.00 41.09 ? 45  LYS A CE  1 
ATOM   351  N  NZ  . LYS A 1 44  ? 3.462   -22.417 2.013   1.00 44.32 ? 45  LYS A NZ  1 
ATOM   352  N  N   . TYR A 1 45  ? -2.710  -19.263 3.276   1.00 27.81 ? 46  TYR A N   1 
ATOM   353  C  CA  . TYR A 1 45  ? -3.751  -19.301 4.315   1.00 27.62 ? 46  TYR A CA  1 
ATOM   354  C  C   . TYR A 1 45  ? -4.754  -18.160 4.243   1.00 27.01 ? 46  TYR A C   1 
ATOM   355  O  O   . TYR A 1 45  ? -5.796  -18.200 4.900   1.00 26.43 ? 46  TYR A O   1 
ATOM   356  C  CB  . TYR A 1 45  ? -3.122  -19.337 5.718   1.00 27.49 ? 46  TYR A CB  1 
ATOM   357  C  CG  . TYR A 1 45  ? -2.175  -20.501 5.934   1.00 30.41 ? 46  TYR A CG  1 
ATOM   358  C  CD1 . TYR A 1 45  ? -0.847  -20.279 6.298   1.00 32.13 ? 46  TYR A CD1 1 
ATOM   359  C  CD2 . TYR A 1 45  ? -2.599  -21.826 5.747   1.00 32.26 ? 46  TYR A CD2 1 
ATOM   360  C  CE1 . TYR A 1 45  ? 0.033   -21.337 6.489   1.00 34.40 ? 46  TYR A CE1 1 
ATOM   361  C  CE2 . TYR A 1 45  ? -1.721  -22.894 5.935   1.00 33.27 ? 46  TYR A CE2 1 
ATOM   362  C  CZ  . TYR A 1 45  ? -0.410  -22.639 6.303   1.00 33.90 ? 46  TYR A CZ  1 
ATOM   363  O  OH  . TYR A 1 45  ? 0.468   -23.675 6.486   1.00 35.29 ? 46  TYR A OH  1 
ATOM   364  N  N   . GLY A 1 46  ? -4.442  -17.147 3.442   1.00 26.33 ? 47  GLY A N   1 
ATOM   365  C  CA  . GLY A 1 46  ? -5.235  -15.923 3.449   1.00 26.23 ? 47  GLY A CA  1 
ATOM   366  C  C   . GLY A 1 46  ? -4.670  -14.884 4.402   1.00 25.74 ? 47  GLY A C   1 
ATOM   367  O  O   . GLY A 1 46  ? -3.538  -15.022 4.877   1.00 26.25 ? 47  GLY A O   1 
ATOM   368  N  N   . PRO A 1 47  ? -5.471  -13.855 4.719   1.00 25.31 ? 48  PRO A N   1 
ATOM   369  C  CA  . PRO A 1 47  ? -5.008  -12.611 5.353   1.00 24.88 ? 48  PRO A CA  1 
ATOM   370  C  C   . PRO A 1 47  ? -4.737  -12.680 6.855   1.00 24.43 ? 48  PRO A C   1 
ATOM   371  O  O   . PRO A 1 47  ? -4.284  -11.693 7.453   1.00 24.44 ? 48  PRO A O   1 
ATOM   372  C  CB  . PRO A 1 47  ? -6.149  -11.637 5.055   1.00 25.38 ? 48  PRO A CB  1 
ATOM   373  C  CG  . PRO A 1 47  ? -7.364  -12.501 4.938   1.00 25.58 ? 48  PRO A CG  1 
ATOM   374  C  CD  . PRO A 1 47  ? -6.921  -13.836 4.445   1.00 25.16 ? 48  PRO A CD  1 
ATOM   375  N  N   . ILE A 1 48  ? -5.004  -13.836 7.457   1.00 23.90 ? 49  ILE A N   1 
ATOM   376  C  CA  . ILE A 1 48  ? -4.722  -14.068 8.873   1.00 23.27 ? 49  ILE A CA  1 
ATOM   377  C  C   . ILE A 1 48  ? -4.377  -15.536 9.098   1.00 22.98 ? 49  ILE A C   1 
ATOM   378  O  O   . ILE A 1 48  ? -5.005  -16.437 8.535   1.00 22.74 ? 49  ILE A O   1 
ATOM   379  C  CB  . ILE A 1 48  ? -5.896  -13.643 9.789   1.00 23.75 ? 49  ILE A CB  1 
ATOM   380  C  CG1 . ILE A 1 48  ? -5.497  -13.726 11.267  1.00 23.26 ? 49  ILE A CG1 1 
ATOM   381  C  CG2 . ILE A 1 48  ? -7.150  -14.490 9.513   1.00 23.82 ? 49  ILE A CG2 1 
ATOM   382  C  CD1 . ILE A 1 48  ? -6.378  -12.908 12.183  1.00 25.67 ? 49  ILE A CD1 1 
ATOM   383  N  N   . TYR A 1 49  ? -3.350  -15.776 9.895   1.00 22.69 ? 50  TYR A N   1 
ATOM   384  C  CA  . TYR A 1 49  ? -2.961  -17.149 10.203  1.00 22.82 ? 50  TYR A CA  1 
ATOM   385  C  C   . TYR A 1 49  ? -2.262  -17.198 11.539  1.00 22.68 ? 50  TYR A C   1 
ATOM   386  O  O   . TYR A 1 49  ? -1.888  -16.167 12.088  1.00 22.49 ? 50  TYR A O   1 
ATOM   387  C  CB  . TYR A 1 49  ? -2.112  -17.776 9.077   1.00 22.04 ? 50  TYR A CB  1 
ATOM   388  C  CG  . TYR A 1 49  ? -0.683  -17.259 8.949   1.00 24.52 ? 50  TYR A CG  1 
ATOM   389  C  CD1 . TYR A 1 49  ? 0.364   -17.850 9.674   1.00 25.47 ? 50  TYR A CD1 1 
ATOM   390  C  CD2 . TYR A 1 49  ? -0.366  -16.203 8.077   1.00 23.39 ? 50  TYR A CD2 1 
ATOM   391  C  CE1 . TYR A 1 49  ? 1.691   -17.389 9.554   1.00 23.94 ? 50  TYR A CE1 1 
ATOM   392  C  CE2 . TYR A 1 49  ? 0.957   -15.738 7.958   1.00 24.14 ? 50  TYR A CE2 1 
ATOM   393  C  CZ  . TYR A 1 49  ? 1.973   -16.335 8.699   1.00 24.71 ? 50  TYR A CZ  1 
ATOM   394  O  OH  . TYR A 1 49  ? 3.280   -15.905 8.582   1.00 26.22 ? 50  TYR A OH  1 
ATOM   395  N  N   . ARG A 1 50  ? -2.127  -18.400 12.080  1.00 23.82 ? 51  ARG A N   1 
ATOM   396  C  CA  . ARG A 1 50  ? -1.359  -18.590 13.301  1.00 25.22 ? 51  ARG A CA  1 
ATOM   397  C  C   . ARG A 1 50  ? -0.283  -19.630 13.039  1.00 25.35 ? 51  ARG A C   1 
ATOM   398  O  O   . ARG A 1 50  ? -0.486  -20.579 12.274  1.00 25.31 ? 51  ARG A O   1 
ATOM   399  C  CB  . ARG A 1 50  ? -2.252  -18.971 14.492  1.00 25.46 ? 51  ARG A CB  1 
ATOM   400  C  CG  . ARG A 1 50  ? -3.081  -20.224 14.272  1.00 27.97 ? 51  ARG A CG  1 
ATOM   401  C  CD  . ARG A 1 50  ? -3.871  -20.620 15.512  1.00 31.40 ? 51  ARG A CD  1 
ATOM   402  N  NE  . ARG A 1 50  ? -4.702  -21.788 15.209  1.00 34.69 ? 51  ARG A NE  1 
ATOM   403  C  CZ  . ARG A 1 50  ? -4.353  -23.051 15.449  1.00 36.47 ? 51  ARG A CZ  1 
ATOM   404  N  NH1 . ARG A 1 50  ? -3.187  -23.331 16.025  1.00 37.12 ? 51  ARG A NH1 1 
ATOM   405  N  NH2 . ARG A 1 50  ? -5.182  -24.042 15.122  1.00 36.94 ? 51  ARG A NH2 1 
ATOM   406  N  N   . GLU A 1 51  ? 0.878   -19.427 13.642  1.00 25.50 ? 52  GLU A N   1 
ATOM   407  C  CA  . GLU A 1 51  ? 1.971   -20.364 13.472  1.00 26.43 ? 52  GLU A CA  1 
ATOM   408  C  C   . GLU A 1 51  ? 2.816   -20.374 14.717  1.00 26.13 ? 52  GLU A C   1 
ATOM   409  O  O   . GLU A 1 51  ? 3.370   -19.343 15.127  1.00 26.08 ? 52  GLU A O   1 
ATOM   410  C  CB  . GLU A 1 51  ? 2.837   -20.048 12.234  1.00 26.85 ? 52  GLU A CB  1 
ATOM   411  C  CG  . GLU A 1 51  ? 3.906   -21.133 11.958  1.00 29.69 ? 52  GLU A CG  1 
ATOM   412  C  CD  . GLU A 1 51  ? 4.812   -20.828 10.756  1.00 34.50 ? 52  GLU A CD  1 
ATOM   413  O  OE1 . GLU A 1 51  ? 5.402   -19.727 10.700  1.00 36.88 ? 52  GLU A OE1 1 
ATOM   414  O  OE2 . GLU A 1 51  ? 4.964   -21.712 9.880   1.00 36.79 ? 52  GLU A OE2 1 
ATOM   415  N  N   . LYS A 1 52  ? 2.884   -21.550 15.328  1.00 25.70 ? 53  LYS A N   1 
ATOM   416  C  CA  . LYS A 1 52  ? 3.821   -21.793 16.394  1.00 26.03 ? 53  LYS A CA  1 
ATOM   417  C  C   . LYS A 1 52  ? 5.159   -22.186 15.759  1.00 25.70 ? 53  LYS A C   1 
ATOM   418  O  O   . LYS A 1 52  ? 5.222   -23.132 14.972  1.00 24.89 ? 53  LYS A O   1 
ATOM   419  C  CB  . LYS A 1 52  ? 3.308   -22.902 17.316  1.00 25.96 ? 53  LYS A CB  1 
ATOM   420  C  CG  . LYS A 1 52  ? 4.148   -23.095 18.547  1.00 27.46 ? 53  LYS A CG  1 
ATOM   421  C  CD  . LYS A 1 52  ? 3.410   -23.980 19.556  1.00 32.91 ? 53  LYS A CD  1 
ATOM   422  C  CE  . LYS A 1 52  ? 4.116   -23.970 20.905  1.00 36.03 ? 53  LYS A CE  1 
ATOM   423  N  NZ  . LYS A 1 52  ? 3.587   -25.058 21.810  1.00 38.64 ? 53  LYS A NZ  1 
ATOM   424  N  N   . LEU A 1 53  ? 6.194   -21.421 16.069  1.00 26.07 ? 54  LEU A N   1 
ATOM   425  C  CA  . LEU A 1 53  ? 7.550   -21.728 15.632  1.00 27.70 ? 54  LEU A CA  1 
ATOM   426  C  C   . LEU A 1 53  ? 8.391   -22.016 16.848  1.00 28.58 ? 54  LEU A C   1 
ATOM   427  O  O   . LEU A 1 53  ? 8.621   -21.135 17.685  1.00 28.89 ? 54  LEU A O   1 
ATOM   428  C  CB  . LEU A 1 53  ? 8.169   -20.595 14.812  1.00 27.31 ? 54  LEU A CB  1 
ATOM   429  C  CG  . LEU A 1 53  ? 7.793   -20.541 13.341  1.00 26.88 ? 54  LEU A CG  1 
ATOM   430  C  CD1 . LEU A 1 53  ? 8.544   -19.410 12.637  1.00 27.17 ? 54  LEU A CD1 1 
ATOM   431  C  CD2 . LEU A 1 53  ? 8.056   -21.869 12.644  1.00 25.86 ? 54  LEU A CD2 1 
ATOM   432  N  N   . GLY A 1 54  ? 8.822   -23.271 16.955  1.00 29.51 ? 55  GLY A N   1 
ATOM   433  C  CA  . GLY A 1 54  ? 9.514   -23.727 18.144  1.00 30.60 ? 55  GLY A CA  1 
ATOM   434  C  C   . GLY A 1 54  ? 8.594   -23.545 19.332  1.00 31.69 ? 55  GLY A C   1 
ATOM   435  O  O   . GLY A 1 54  ? 7.560   -24.200 19.423  1.00 31.59 ? 55  GLY A O   1 
ATOM   436  N  N   . ASN A 1 55  ? 8.966   -22.633 20.226  1.00 32.80 ? 56  ASN A N   1 
ATOM   437  C  CA  . ASN A 1 55  ? 8.215   -22.410 21.460  1.00 34.21 ? 56  ASN A CA  1 
ATOM   438  C  C   . ASN A 1 55  ? 7.149   -21.313 21.382  1.00 34.39 ? 56  ASN A C   1 
ATOM   439  O  O   . ASN A 1 55  ? 6.163   -21.348 22.144  1.00 35.31 ? 56  ASN A O   1 
ATOM   440  C  CB  . ASN A 1 55  ? 9.164   -22.159 22.645  1.00 34.70 ? 56  ASN A CB  1 
ATOM   441  C  CG  . ASN A 1 55  ? 10.374  -21.274 22.283  1.00 36.43 ? 56  ASN A CG  1 
ATOM   442  O  OD1 . ASN A 1 55  ? 10.864  -21.266 21.138  1.00 37.19 ? 56  ASN A OD1 1 
ATOM   443  N  ND2 . ASN A 1 55  ? 10.871  -20.539 23.282  1.00 36.20 ? 56  ASN A ND2 1 
ATOM   444  N  N   . VAL A 1 56  ? 7.337   -20.370 20.453  1.00 33.72 ? 57  VAL A N   1 
ATOM   445  C  CA  . VAL A 1 56  ? 6.477   -19.178 20.324  1.00 32.54 ? 57  VAL A CA  1 
ATOM   446  C  C   . VAL A 1 56  ? 5.383   -19.295 19.245  1.00 31.31 ? 57  VAL A C   1 
ATOM   447  O  O   . VAL A 1 56  ? 5.664   -19.553 18.064  1.00 30.53 ? 57  VAL A O   1 
ATOM   448  C  CB  . VAL A 1 56  ? 7.333   -17.880 20.120  1.00 32.75 ? 57  VAL A CB  1 
ATOM   449  C  CG1 . VAL A 1 56  ? 8.270   -17.990 18.903  1.00 34.11 ? 57  VAL A CG1 1 
ATOM   450  C  CG2 . VAL A 1 56  ? 6.456   -16.628 20.026  1.00 33.60 ? 57  VAL A CG2 1 
ATOM   451  N  N   . GLU A 1 57  ? 4.136   -19.103 19.666  1.00 29.77 ? 58  GLU A N   1 
ATOM   452  C  CA  . GLU A 1 57  ? 3.026   -18.973 18.732  1.00 29.31 ? 58  GLU A CA  1 
ATOM   453  C  C   . GLU A 1 57  ? 2.682   -17.497 18.523  1.00 27.97 ? 58  GLU A C   1 
ATOM   454  O  O   . GLU A 1 57  ? 2.743   -16.679 19.456  1.00 27.69 ? 58  GLU A O   1 
ATOM   455  C  CB  . GLU A 1 57  ? 1.771   -19.754 19.188  1.00 29.50 ? 58  GLU A CB  1 
ATOM   456  C  CG  . GLU A 1 57  ? 0.703   -19.878 18.066  1.00 32.39 ? 58  GLU A CG  1 
ATOM   457  C  CD  . GLU A 1 57  ? -0.292  -21.044 18.242  1.00 36.45 ? 58  GLU A CD  1 
ATOM   458  O  OE1 . GLU A 1 57  ? -0.638  -21.362 19.398  1.00 37.36 ? 58  GLU A OE1 1 
ATOM   459  O  OE2 . GLU A 1 57  ? -0.734  -21.631 17.213  1.00 37.53 ? 58  GLU A OE2 1 
ATOM   460  N  N   . SER A 1 58  ? 2.333   -17.169 17.289  1.00 26.30 ? 59  SER A N   1 
ATOM   461  C  CA  . SER A 1 58  ? 1.877   -15.829 16.959  1.00 25.27 ? 59  SER A CA  1 
ATOM   462  C  C   . SER A 1 58  ? 0.713   -15.932 16.007  1.00 24.08 ? 59  SER A C   1 
ATOM   463  O  O   . SER A 1 58  ? 0.591   -16.891 15.260  1.00 23.15 ? 59  SER A O   1 
ATOM   464  C  CB  . SER A 1 58  ? 2.983   -15.011 16.278  1.00 25.16 ? 59  SER A CB  1 
ATOM   465  O  OG  . SER A 1 58  ? 4.146   -14.923 17.069  1.00 26.70 ? 59  SER A OG  1 
ATOM   466  N  N   . VAL A 1 59  ? -0.136  -14.921 16.045  1.00 24.08 ? 60  VAL A N   1 
ATOM   467  C  CA  . VAL A 1 59  ? -1.112  -14.694 15.004  1.00 24.33 ? 60  VAL A CA  1 
ATOM   468  C  C   . VAL A 1 59  ? -0.496  -13.635 14.098  1.00 24.26 ? 60  VAL A C   1 
ATOM   469  O  O   . VAL A 1 59  ? 0.053   -12.644 14.574  1.00 24.89 ? 60  VAL A O   1 
ATOM   470  C  CB  . VAL A 1 59  ? -2.445  -14.193 15.610  1.00 24.75 ? 60  VAL A CB  1 
ATOM   471  C  CG1 . VAL A 1 59  ? -3.390  -13.684 14.529  1.00 24.27 ? 60  VAL A CG1 1 
ATOM   472  C  CG2 . VAL A 1 59  ? -3.086  -15.314 16.418  1.00 24.41 ? 60  VAL A CG2 1 
ATOM   473  N  N   . TYR A 1 60  ? -0.563  -13.867 12.800  1.00 24.02 ? 61  TYR A N   1 
ATOM   474  C  CA  . TYR A 1 60  ? -0.004  -12.951 11.823  1.00 24.04 ? 61  TYR A CA  1 
ATOM   475  C  C   . TYR A 1 60  ? -1.117  -12.295 11.015  1.00 23.94 ? 61  TYR A C   1 
ATOM   476  O  O   . TYR A 1 60  ? -2.056  -12.978 10.574  1.00 23.11 ? 61  TYR A O   1 
ATOM   477  C  CB  . TYR A 1 60  ? 0.899   -13.721 10.871  1.00 23.78 ? 61  TYR A CB  1 
ATOM   478  C  CG  . TYR A 1 60  ? 2.170   -14.255 11.511  1.00 24.54 ? 61  TYR A CG  1 
ATOM   479  C  CD1 . TYR A 1 60  ? 2.170   -15.487 12.172  1.00 23.67 ? 61  TYR A CD1 1 
ATOM   480  C  CD2 . TYR A 1 60  ? 3.367   -13.525 11.457  1.00 22.97 ? 61  TYR A CD2 1 
ATOM   481  C  CE1 . TYR A 1 60  ? 3.332   -15.993 12.754  1.00 26.25 ? 61  TYR A CE1 1 
ATOM   482  C  CE2 . TYR A 1 60  ? 4.546   -14.024 12.039  1.00 24.76 ? 61  TYR A CE2 1 
ATOM   483  C  CZ  . TYR A 1 60  ? 4.516   -15.256 12.683  1.00 26.28 ? 61  TYR A CZ  1 
ATOM   484  O  OH  . TYR A 1 60  ? 5.647   -15.767 13.268  1.00 27.86 ? 61  TYR A OH  1 
ATOM   485  N  N   . VAL A 1 61  ? -0.999  -10.978 10.834  1.00 23.80 ? 62  VAL A N   1 
ATOM   486  C  CA  . VAL A 1 61  ? -1.918  -10.190 9.992   1.00 24.09 ? 62  VAL A CA  1 
ATOM   487  C  C   . VAL A 1 61  ? -1.160  -9.351  8.956   1.00 24.57 ? 62  VAL A C   1 
ATOM   488  O  O   . VAL A 1 61  ? 0.020   -9.022  9.134   1.00 23.53 ? 62  VAL A O   1 
ATOM   489  C  CB  . VAL A 1 61  ? -2.842  -9.256  10.821  1.00 24.22 ? 62  VAL A CB  1 
ATOM   490  C  CG1 . VAL A 1 61  ? -3.785  -10.062 11.717  1.00 24.62 ? 62  VAL A CG1 1 
ATOM   491  C  CG2 . VAL A 1 61  ? -2.026  -8.254  11.660  1.00 24.41 ? 62  VAL A CG2 1 
ATOM   492  N  N   . ILE A 1 62  ? -1.860  -9.011  7.876   1.00 25.11 ? 63  ILE A N   1 
ATOM   493  C  CA  . ILE A 1 62  ? -1.300  -8.234  6.774   1.00 25.35 ? 63  ILE A CA  1 
ATOM   494  C  C   . ILE A 1 62  ? -2.178  -7.023  6.398   1.00 26.45 ? 63  ILE A C   1 
ATOM   495  O  O   . ILE A 1 62  ? -1.665  -5.988  5.976   1.00 26.59 ? 63  ILE A O   1 
ATOM   496  C  CB  . ILE A 1 62  ? -1.049  -9.149  5.545   1.00 25.13 ? 63  ILE A CB  1 
ATOM   497  C  CG1 . ILE A 1 62  ? -0.171  -8.441  4.505   1.00 23.05 ? 63  ILE A CG1 1 
ATOM   498  C  CG2 . ILE A 1 62  ? -2.388  -9.695  4.960   1.00 24.08 ? 63  ILE A CG2 1 
ATOM   499  C  CD1 . ILE A 1 62  ? 0.169   -9.308  3.319   1.00 23.34 ? 63  ILE A CD1 1 
ATOM   500  N  N   . ASP A 1 63  ? -3.496  -7.168  6.561   1.00 27.57 ? 64  ASP A N   1 
ATOM   501  C  CA  . ASP A 1 63  ? -4.490  -6.139  6.196   1.00 28.48 ? 64  ASP A CA  1 
ATOM   502  C  C   . ASP A 1 63  ? -4.441  -4.907  7.100   1.00 28.28 ? 64  ASP A C   1 
ATOM   503  O  O   . ASP A 1 63  ? -4.656  -5.018  8.297   1.00 28.66 ? 64  ASP A O   1 
ATOM   504  C  CB  . ASP A 1 63  ? -5.909  -6.755  6.200   1.00 29.06 ? 64  ASP A CB  1 
ATOM   505  C  CG  . ASP A 1 63  ? -6.974  -5.852  5.548   1.00 31.60 ? 64  ASP A CG  1 
ATOM   506  O  OD1 . ASP A 1 63  ? -6.864  -4.609  5.586   1.00 34.26 ? 64  ASP A OD1 1 
ATOM   507  O  OD2 . ASP A 1 63  ? -7.953  -6.406  5.006   1.00 36.17 ? 64  ASP A OD2 1 
ATOM   508  N  N   . PRO A 1 64  ? -4.184  -3.712  6.521   1.00 29.00 ? 65  PRO A N   1 
ATOM   509  C  CA  . PRO A 1 64  ? -4.166  -2.472  7.307   1.00 29.37 ? 65  PRO A CA  1 
ATOM   510  C  C   . PRO A 1 64  ? -5.391  -2.255  8.194   1.00 29.98 ? 65  PRO A C   1 
ATOM   511  O  O   . PRO A 1 64  ? -5.255  -1.677  9.264   1.00 30.25 ? 65  PRO A O   1 
ATOM   512  C  CB  . PRO A 1 64  ? -4.071  -1.381  6.238   1.00 29.15 ? 65  PRO A CB  1 
ATOM   513  C  CG  . PRO A 1 64  ? -3.270  -2.019  5.152   1.00 29.77 ? 65  PRO A CG  1 
ATOM   514  C  CD  . PRO A 1 64  ? -3.779  -3.467  5.122   1.00 28.77 ? 65  PRO A CD  1 
ATOM   515  N  N   . GLU A 1 65  ? -6.562  -2.737  7.778   1.00 31.57 ? 66  GLU A N   1 
ATOM   516  C  CA  . GLU A 1 65  ? -7.789  -2.589  8.588   1.00 33.16 ? 66  GLU A CA  1 
ATOM   517  C  C   . GLU A 1 65  ? -7.702  -3.388  9.895   1.00 33.09 ? 66  GLU A C   1 
ATOM   518  O  O   . GLU A 1 65  ? -8.151  -2.932  10.954  1.00 33.53 ? 66  GLU A O   1 
ATOM   519  C  CB  . GLU A 1 65  ? -9.028  -3.014  7.785   1.00 33.99 ? 66  GLU A CB  1 
ATOM   520  C  CG  . GLU A 1 65  ? -9.209  -2.285  6.447   1.00 37.69 ? 66  GLU A CG  1 
ATOM   521  C  CD  . GLU A 1 65  ? -10.139 -1.076  6.540   1.00 43.96 ? 66  GLU A CD  1 
ATOM   522  O  OE1 . GLU A 1 65  ? -10.006 -0.262  7.491   1.00 44.58 ? 66  GLU A OE1 1 
ATOM   523  O  OE2 . GLU A 1 65  ? -11.018 -0.948  5.648   1.00 46.26 ? 66  GLU A OE2 1 
ATOM   524  N  N   . ASP A 1 66  ? -7.120  -4.581  9.816   1.00 32.97 ? 67  ASP A N   1 
ATOM   525  C  CA  . ASP A 1 66  ? -6.826  -5.380  11.011  1.00 32.47 ? 67  ASP A CA  1 
ATOM   526  C  C   . ASP A 1 66  ? -5.718  -4.735  11.844  1.00 32.01 ? 67  ASP A C   1 
ATOM   527  O  O   . ASP A 1 66  ? -5.766  -4.755  13.074  1.00 31.69 ? 67  ASP A O   1 
ATOM   528  C  CB  . ASP A 1 66  ? -6.453  -6.816  10.614  1.00 32.57 ? 67  ASP A CB  1 
ATOM   529  C  CG  . ASP A 1 66  ? -7.566  -7.517  9.852   1.00 33.84 ? 67  ASP A CG  1 
ATOM   530  O  OD1 . ASP A 1 66  ? -8.744  -7.182  10.098  1.00 34.76 ? 67  ASP A OD1 1 
ATOM   531  O  OD2 . ASP A 1 66  ? -7.278  -8.400  9.011   1.00 34.42 ? 67  ASP A OD2 1 
ATOM   532  N  N   . VAL A 1 67  ? -4.729  -4.147  11.170  1.00 31.63 ? 68  VAL A N   1 
ATOM   533  C  CA  . VAL A 1 67  ? -3.640  -3.471  11.874  1.00 31.16 ? 68  VAL A CA  1 
ATOM   534  C  C   . VAL A 1 67  ? -4.211  -2.338  12.729  1.00 31.16 ? 68  VAL A C   1 
ATOM   535  O  O   . VAL A 1 67  ? -3.805  -2.144  13.870  1.00 30.75 ? 68  VAL A O   1 
ATOM   536  C  CB  . VAL A 1 67  ? -2.585  -2.890  10.894  1.00 31.15 ? 68  VAL A CB  1 
ATOM   537  C  CG1 . VAL A 1 67  ? -1.506  -2.146  11.645  1.00 29.23 ? 68  VAL A CG1 1 
ATOM   538  C  CG2 . VAL A 1 67  ? -1.980  -3.987  10.030  1.00 31.32 ? 68  VAL A CG2 1 
ATOM   539  N  N   . ALA A 1 68  ? -5.164  -1.604  12.162  1.00 31.79 ? 69  ALA A N   1 
ATOM   540  C  CA  . ALA A 1 68  ? -5.763  -0.460  12.846  1.00 32.07 ? 69  ALA A CA  1 
ATOM   541  C  C   . ALA A 1 68  ? -6.469  -0.913  14.110  1.00 32.25 ? 69  ALA A C   1 
ATOM   542  O  O   . ALA A 1 68  ? -6.342  -0.281  15.153  1.00 32.65 ? 69  ALA A O   1 
ATOM   543  C  CB  . ALA A 1 68  ? -6.725  0.273   11.919  1.00 31.91 ? 69  ALA A CB  1 
ATOM   544  N  N   . LEU A 1 69  ? -7.190  -2.024  14.018  1.00 32.89 ? 70  LEU A N   1 
ATOM   545  C  CA  . LEU A 1 69  ? -7.869  -2.596  15.179  1.00 33.75 ? 70  LEU A CA  1 
ATOM   546  C  C   . LEU A 1 69  ? -6.877  -3.054  16.245  1.00 33.82 ? 70  LEU A C   1 
ATOM   547  O  O   . LEU A 1 69  ? -7.094  -2.844  17.444  1.00 33.64 ? 70  LEU A O   1 
ATOM   548  C  CB  . LEU A 1 69  ? -8.810  -3.735  14.756  1.00 34.15 ? 70  LEU A CB  1 
ATOM   549  C  CG  . LEU A 1 69  ? -9.962  -3.320  13.829  1.00 35.56 ? 70  LEU A CG  1 
ATOM   550  C  CD1 . LEU A 1 69  ? -10.778 -4.529  13.388  1.00 36.44 ? 70  LEU A CD1 1 
ATOM   551  C  CD2 . LEU A 1 69  ? -10.872 -2.263  14.485  1.00 36.75 ? 70  LEU A CD2 1 
ATOM   552  N  N   . LEU A 1 70  ? -5.763  -3.639  15.812  1.00 34.34 ? 71  LEU A N   1 
ATOM   553  C  CA  . LEU A 1 70  ? -4.730  -4.048  16.761  1.00 35.08 ? 71  LEU A CA  1 
ATOM   554  C  C   . LEU A 1 70  ? -4.204  -2.860  17.573  1.00 35.82 ? 71  LEU A C   1 
ATOM   555  O  O   . LEU A 1 70  ? -4.102  -2.919  18.799  1.00 35.85 ? 71  LEU A O   1 
ATOM   556  C  CB  . LEU A 1 70  ? -3.584  -4.776  16.041  1.00 34.60 ? 71  LEU A CB  1 
ATOM   557  C  CG  . LEU A 1 70  ? -2.342  -5.106  16.877  1.00 34.31 ? 71  LEU A CG  1 
ATOM   558  C  CD1 . LEU A 1 70  ? -2.668  -6.108  17.986  1.00 34.17 ? 71  LEU A CD1 1 
ATOM   559  C  CD2 . LEU A 1 70  ? -1.233  -5.654  15.999  1.00 33.49 ? 71  LEU A CD2 1 
ATOM   560  N  N   . PHE A 1 71  ? -3.874  -1.778  16.886  1.00 37.33 ? 72  PHE A N   1 
ATOM   561  C  CA  . PHE A 1 71  ? -3.326  -0.613  17.570  1.00 39.16 ? 72  PHE A CA  1 
ATOM   562  C  C   . PHE A 1 71  ? -4.393  0.222   18.288  1.00 39.99 ? 72  PHE A C   1 
ATOM   563  O  O   . PHE A 1 71  ? -4.083  0.925   19.241  1.00 40.13 ? 72  PHE A O   1 
ATOM   564  C  CB  . PHE A 1 71  ? -2.464  0.223   16.621  1.00 39.17 ? 72  PHE A CB  1 
ATOM   565  C  CG  . PHE A 1 71  ? -1.147  -0.438  16.267  1.00 40.66 ? 72  PHE A CG  1 
ATOM   566  C  CD1 . PHE A 1 71  ? -0.843  -0.763  14.945  1.00 42.47 ? 72  PHE A CD1 1 
ATOM   567  C  CD2 . PHE A 1 71  ? -0.218  -0.749  17.256  1.00 40.78 ? 72  PHE A CD2 1 
ATOM   568  C  CE1 . PHE A 1 71  ? 0.377   -1.375  14.617  1.00 41.82 ? 72  PHE A CE1 1 
ATOM   569  C  CE2 . PHE A 1 71  ? 0.988   -1.362  16.935  1.00 41.36 ? 72  PHE A CE2 1 
ATOM   570  C  CZ  . PHE A 1 71  ? 1.283   -1.677  15.615  1.00 41.20 ? 72  PHE A CZ  1 
ATOM   571  N  N   . LYS A 1 72  ? -5.644  0.117   17.847  1.00 41.39 ? 73  LYS A N   1 
ATOM   572  C  CA  . LYS A 1 72  ? -6.771  0.748   18.554  1.00 43.19 ? 73  LYS A CA  1 
ATOM   573  C  C   . LYS A 1 72  ? -6.937  0.206   19.987  1.00 43.61 ? 73  LYS A C   1 
ATOM   574  O  O   . LYS A 1 72  ? -7.242  0.960   20.910  1.00 44.16 ? 73  LYS A O   1 
ATOM   575  C  CB  . LYS A 1 72  ? -8.069  0.575   17.749  1.00 43.42 ? 73  LYS A CB  1 
ATOM   576  C  CG  . LYS A 1 72  ? -9.272  1.340   18.292  1.00 45.57 ? 73  LYS A CG  1 
ATOM   577  C  CD  . LYS A 1 72  ? -10.406 1.402   17.271  1.00 48.34 ? 73  LYS A CD  1 
ATOM   578  C  CE  . LYS A 1 72  ? -11.703 1.865   17.933  1.00 50.50 ? 73  LYS A CE  1 
ATOM   579  N  NZ  . LYS A 1 72  ? -12.694 2.408   16.956  1.00 51.84 ? 73  LYS A NZ  1 
ATOM   580  N  N   . SER A 1 73  ? -6.699  -1.091  20.169  1.00 44.11 ? 74  SER A N   1 
ATOM   581  C  CA  . SER A 1 73  ? -6.902  -1.748  21.460  1.00 44.67 ? 74  SER A CA  1 
ATOM   582  C  C   . SER A 1 73  ? -5.663  -1.743  22.344  1.00 44.67 ? 74  SER A C   1 
ATOM   583  O  O   . SER A 1 73  ? -5.665  -2.333  23.426  1.00 45.16 ? 74  SER A O   1 
ATOM   584  C  CB  . SER A 1 73  ? -7.353  -3.191  21.241  1.00 44.75 ? 74  SER A CB  1 
ATOM   585  O  OG  . SER A 1 73  ? -6.356  -3.906  20.535  1.00 46.80 ? 74  SER A OG  1 
ATOM   586  N  N   . GLU A 1 74  ? -4.607  -1.079  21.887  1.00 44.54 ? 75  GLU A N   1 
ATOM   587  C  CA  . GLU A 1 74  ? -3.341  -1.046  22.614  1.00 44.12 ? 75  GLU A CA  1 
ATOM   588  C  C   . GLU A 1 74  ? -3.477  -0.430  24.010  1.00 43.72 ? 75  GLU A C   1 
ATOM   589  O  O   . GLU A 1 74  ? -4.184  0.566   24.193  1.00 43.68 ? 75  GLU A O   1 
ATOM   590  C  CB  . GLU A 1 74  ? -2.304  -0.273  21.802  1.00 44.14 ? 75  GLU A CB  1 
ATOM   591  C  CG  . GLU A 1 74  ? -0.911  -0.271  22.398  1.00 44.87 ? 75  GLU A CG  1 
ATOM   592  C  CD  . GLU A 1 74  ? 0.147   0.056   21.370  1.00 45.55 ? 75  GLU A CD  1 
ATOM   593  O  OE1 . GLU A 1 74  ? 0.710   1.169   21.442  1.00 46.71 ? 75  GLU A OE1 1 
ATOM   594  O  OE2 . GLU A 1 74  ? 0.388   -0.790  20.484  1.00 43.65 ? 75  GLU A OE2 1 
ATOM   595  N  N   . GLY A 1 75  ? -2.787  -1.032  24.978  1.00 43.01 ? 76  GLY A N   1 
ATOM   596  C  CA  . GLY A 1 75  ? -2.748  -0.539  26.350  1.00 42.10 ? 76  GLY A CA  1 
ATOM   597  C  C   . GLY A 1 75  ? -1.670  0.511   26.565  1.00 41.41 ? 76  GLY A C   1 
ATOM   598  O  O   . GLY A 1 75  ? -0.944  0.858   25.627  1.00 41.74 ? 76  GLY A O   1 
ATOM   599  N  N   . PRO A 1 76  ? -1.553  1.021   27.806  1.00 40.57 ? 77  PRO A N   1 
ATOM   600  C  CA  . PRO A 1 76  ? -0.639  2.130   28.117  1.00 39.70 ? 77  PRO A CA  1 
ATOM   601  C  C   . PRO A 1 76  ? 0.840   1.758   28.078  1.00 38.79 ? 77  PRO A C   1 
ATOM   602  O  O   . PRO A 1 76  ? 1.680   2.623   27.816  1.00 38.95 ? 77  PRO A O   1 
ATOM   603  C  CB  . PRO A 1 76  ? -1.038  2.534   29.543  1.00 39.89 ? 77  PRO A CB  1 
ATOM   604  C  CG  . PRO A 1 76  ? -1.702  1.321   30.120  1.00 40.42 ? 77  PRO A CG  1 
ATOM   605  C  CD  . PRO A 1 76  ? -2.372  0.626   28.972  1.00 40.50 ? 77  PRO A CD  1 
ATOM   606  N  N   . ASN A 1 77  ? 1.153   0.493   28.347  1.00 37.26 ? 78  ASN A N   1 
ATOM   607  C  CA  . ASN A 1 77  ? 2.537   0.026   28.373  1.00 35.70 ? 78  ASN A CA  1 
ATOM   608  C  C   . ASN A 1 77  ? 2.723   -1.175  27.432  1.00 33.99 ? 78  ASN A C   1 
ATOM   609  O  O   . ASN A 1 77  ? 2.877   -2.310  27.894  1.00 33.23 ? 78  ASN A O   1 
ATOM   610  C  CB  . ASN A 1 77  ? 2.951   -0.355  29.798  1.00 35.98 ? 78  ASN A CB  1 
ATOM   611  C  CG  . ASN A 1 77  ? 2.922   0.827   30.776  1.00 37.42 ? 78  ASN A CG  1 
ATOM   612  O  OD1 . ASN A 1 77  ? 3.424   1.925   30.493  1.00 37.93 ? 78  ASN A OD1 1 
ATOM   613  N  ND2 . ASN A 1 77  ? 2.358   0.585   31.952  1.00 36.68 ? 78  ASN A ND2 1 
ATOM   614  N  N   . PRO A 1 78  ? 2.724   -0.922  26.107  1.00 32.51 ? 79  PRO A N   1 
ATOM   615  C  CA  . PRO A 1 78  ? 2.755   -2.018  25.128  1.00 31.39 ? 79  PRO A CA  1 
ATOM   616  C  C   . PRO A 1 78  ? 4.044   -2.831  25.197  1.00 30.47 ? 79  PRO A C   1 
ATOM   617  O  O   . PRO A 1 78  ? 5.100   -2.300  25.546  1.00 29.98 ? 79  PRO A O   1 
ATOM   618  C  CB  . PRO A 1 78  ? 2.655   -1.314  23.772  1.00 31.11 ? 79  PRO A CB  1 
ATOM   619  C  CG  . PRO A 1 78  ? 2.664   0.135   24.039  1.00 31.60 ? 79  PRO A CG  1 
ATOM   620  C  CD  . PRO A 1 78  ? 2.920   0.393   25.480  1.00 31.95 ? 79  PRO A CD  1 
ATOM   621  N  N   . GLU A 1 79  ? 3.930   -4.118  24.881  1.00 29.75 ? 80  GLU A N   1 
ATOM   622  C  CA  . GLU A 1 79  ? 5.069   -5.026  24.818  1.00 28.78 ? 80  GLU A CA  1 
ATOM   623  C  C   . GLU A 1 79  ? 5.134   -5.634  23.431  1.00 27.12 ? 80  GLU A C   1 
ATOM   624  O  O   . GLU A 1 79  ? 4.114   -6.071  22.901  1.00 26.59 ? 80  GLU A O   1 
ATOM   625  C  CB  . GLU A 1 79  ? 4.920   -6.166  25.831  1.00 29.69 ? 80  GLU A CB  1 
ATOM   626  C  CG  . GLU A 1 79  ? 4.890   -5.763  27.300  1.00 32.88 ? 80  GLU A CG  1 
ATOM   627  C  CD  . GLU A 1 79  ? 4.571   -6.958  28.185  1.00 38.49 ? 80  GLU A CD  1 
ATOM   628  O  OE1 . GLU A 1 79  ? 5.522   -7.548  28.748  1.00 40.02 ? 80  GLU A OE1 1 
ATOM   629  O  OE2 . GLU A 1 79  ? 3.370   -7.336  28.280  1.00 41.05 ? 80  GLU A OE2 1 
ATOM   630  N  N   . ARG A 1 80  ? 6.334   -5.658  22.849  1.00 25.58 ? 81  ARG A N   1 
ATOM   631  C  CA  . ARG A 1 80  ? 6.563   -6.355  21.583  1.00 24.33 ? 81  ARG A CA  1 
ATOM   632  C  C   . ARG A 1 80  ? 7.304   -7.651  21.886  1.00 23.83 ? 81  ARG A C   1 
ATOM   633  O  O   . ARG A 1 80  ? 7.529   -7.980  23.057  1.00 24.06 ? 81  ARG A O   1 
ATOM   634  C  CB  . ARG A 1 80  ? 7.376   -5.497  20.614  1.00 23.97 ? 81  ARG A CB  1 
ATOM   635  C  CG  . ARG A 1 80  ? 8.824   -5.289  21.037  1.00 23.06 ? 81  ARG A CG  1 
ATOM   636  C  CD  . ARG A 1 80  ? 9.631   -4.557  19.980  1.00 21.02 ? 81  ARG A CD  1 
ATOM   637  N  NE  . ARG A 1 80  ? 9.258   -3.153  19.846  1.00 20.47 ? 81  ARG A NE  1 
ATOM   638  C  CZ  . ARG A 1 80  ? 9.752   -2.165  20.589  1.00 20.89 ? 81  ARG A CZ  1 
ATOM   639  N  NH1 . ARG A 1 80  ? 10.619  -2.408  21.563  1.00 18.23 ? 81  ARG A NH1 1 
ATOM   640  N  NH2 . ARG A 1 80  ? 9.360   -0.917  20.356  1.00 23.11 ? 81  ARG A NH2 1 
ATOM   641  N  N   . PHE A 1 81  ? 7.699   -8.368  20.837  1.00 22.97 ? 82  PHE A N   1 
ATOM   642  C  CA  . PHE A 1 81  ? 8.455   -9.594  20.994  1.00 22.42 ? 82  PHE A CA  1 
ATOM   643  C  C   . PHE A 1 81  ? 9.892   -9.279  21.374  1.00 22.21 ? 82  PHE A C   1 
ATOM   644  O  O   . PHE A 1 81  ? 10.561  -8.472  20.714  1.00 22.03 ? 82  PHE A O   1 
ATOM   645  C  CB  . PHE A 1 81  ? 8.390   -10.449 19.725  1.00 22.29 ? 82  PHE A CB  1 
ATOM   646  C  CG  . PHE A 1 81  ? 9.139   -11.753 19.835  1.00 22.08 ? 82  PHE A CG  1 
ATOM   647  C  CD1 . PHE A 1 81  ? 8.622   -12.807 20.596  1.00 21.22 ? 82  PHE A CD1 1 
ATOM   648  C  CD2 . PHE A 1 81  ? 10.364  -11.926 19.186  1.00 21.67 ? 82  PHE A CD2 1 
ATOM   649  C  CE1 . PHE A 1 81  ? 9.326   -14.031 20.710  1.00 22.75 ? 82  PHE A CE1 1 
ATOM   650  C  CE2 . PHE A 1 81  ? 11.078  -13.146 19.286  1.00 23.41 ? 82  PHE A CE2 1 
ATOM   651  C  CZ  . PHE A 1 81  ? 10.552  -14.201 20.048  1.00 21.36 ? 82  PHE A CZ  1 
ATOM   652  N  N   . LEU A 1 82  ? 10.347  -9.901  22.464  1.00 21.86 ? 83  LEU A N   1 
ATOM   653  C  CA  . LEU A 1 82  ? 11.722  -9.737  22.934  1.00 21.75 ? 83  LEU A CA  1 
ATOM   654  C  C   . LEU A 1 82  ? 12.591  -10.810 22.305  1.00 21.33 ? 83  LEU A C   1 
ATOM   655  O  O   . LEU A 1 82  ? 12.230  -11.979 22.331  1.00 21.28 ? 83  LEU A O   1 
ATOM   656  C  CB  . LEU A 1 82  ? 11.796  -9.813  24.464  1.00 21.65 ? 83  LEU A CB  1 
ATOM   657  C  CG  . LEU A 1 82  ? 11.081  -8.697  25.240  1.00 23.47 ? 83  LEU A CG  1 
ATOM   658  C  CD1 . LEU A 1 82  ? 10.957  -9.055  26.720  1.00 25.27 ? 83  LEU A CD1 1 
ATOM   659  C  CD2 . LEU A 1 82  ? 11.807  -7.377  25.074  1.00 24.24 ? 83  LEU A CD2 1 
ATOM   660  N  N   . ILE A 1 83  ? 13.743  -10.411 21.758  1.00 21.10 ? 84  ILE A N   1 
ATOM   661  C  CA  . ILE A 1 83  ? 14.665  -11.355 21.112  1.00 19.99 ? 84  ILE A CA  1 
ATOM   662  C  C   . ILE A 1 83  ? 15.362  -12.237 22.167  1.00 20.28 ? 84  ILE A C   1 
ATOM   663  O  O   . ILE A 1 83  ? 16.104  -11.736 22.990  1.00 20.43 ? 84  ILE A O   1 
ATOM   664  C  CB  . ILE A 1 83  ? 15.726  -10.614 20.256  1.00 19.89 ? 84  ILE A CB  1 
ATOM   665  C  CG1 . ILE A 1 83  ? 15.053  -9.624  19.261  1.00 18.32 ? 84  ILE A CG1 1 
ATOM   666  C  CG2 . ILE A 1 83  ? 16.634  -11.630 19.559  1.00 18.33 ? 84  ILE A CG2 1 
ATOM   667  C  CD1 . ILE A 1 83  ? 14.112  -10.308 18.235  1.00 18.15 ? 84  ILE A CD1 1 
ATOM   668  N  N   . PRO A 1 84  ? 15.112  -13.556 22.149  1.00 20.74 ? 85  PRO A N   1 
ATOM   669  C  CA  . PRO A 1 84  ? 15.593  -14.349 23.300  1.00 20.77 ? 85  PRO A CA  1 
ATOM   670  C  C   . PRO A 1 84  ? 17.116  -14.351 23.542  1.00 20.56 ? 85  PRO A C   1 
ATOM   671  O  O   . PRO A 1 84  ? 17.522  -14.273 24.687  1.00 20.94 ? 85  PRO A O   1 
ATOM   672  C  CB  . PRO A 1 84  ? 15.059  -15.766 22.999  1.00 20.73 ? 85  PRO A CB  1 
ATOM   673  C  CG  . PRO A 1 84  ? 13.838  -15.511 22.159  1.00 20.29 ? 85  PRO A CG  1 
ATOM   674  C  CD  . PRO A 1 84  ? 14.225  -14.351 21.275  1.00 20.03 ? 85  PRO A CD  1 
ATOM   675  N  N   . PRO A 1 85  ? 17.960  -14.424 22.486  1.00 20.38 ? 86  PRO A N   1 
ATOM   676  C  CA  . PRO A 1 85  ? 19.381  -14.351 22.857  1.00 20.09 ? 86  PRO A CA  1 
ATOM   677  C  C   . PRO A 1 85  ? 19.820  -13.009 23.462  1.00 19.86 ? 86  PRO A C   1 
ATOM   678  O  O   . PRO A 1 85  ? 20.795  -12.984 24.239  1.00 19.90 ? 86  PRO A O   1 
ATOM   679  C  CB  . PRO A 1 85  ? 20.116  -14.599 21.527  1.00 20.01 ? 86  PRO A CB  1 
ATOM   680  C  CG  . PRO A 1 85  ? 19.097  -14.251 20.463  1.00 20.72 ? 86  PRO A CG  1 
ATOM   681  C  CD  . PRO A 1 85  ? 17.794  -14.727 21.055  1.00 20.33 ? 86  PRO A CD  1 
ATOM   682  N  N   . TRP A 1 86  ? 19.141  -11.915 23.101  1.00 19.67 ? 87  TRP A N   1 
ATOM   683  C  CA  . TRP A 1 86  ? 19.430  -10.585 23.676  1.00 20.08 ? 87  TRP A CA  1 
ATOM   684  C  C   . TRP A 1 86  ? 19.101  -10.597 25.162  1.00 20.48 ? 87  TRP A C   1 
ATOM   685  O  O   . TRP A 1 86  ? 19.927  -10.199 25.983  1.00 20.81 ? 87  TRP A O   1 
ATOM   686  C  CB  . TRP A 1 86  ? 18.661  -9.435  22.960  1.00 19.00 ? 87  TRP A CB  1 
ATOM   687  C  CG  . TRP A 1 86  ? 18.970  -9.260  21.470  1.00 18.40 ? 87  TRP A CG  1 
ATOM   688  C  CD1 . TRP A 1 86  ? 19.731  -10.084 20.686  1.00 18.63 ? 87  TRP A CD1 1 
ATOM   689  C  CD2 . TRP A 1 86  ? 18.474  -8.231  20.592  1.00 18.35 ? 87  TRP A CD2 1 
ATOM   690  N  NE1 . TRP A 1 86  ? 19.768  -9.616  19.388  1.00 18.30 ? 87  TRP A NE1 1 
ATOM   691  C  CE2 . TRP A 1 86  ? 19.007  -8.486  19.300  1.00 17.68 ? 87  TRP A CE2 1 
ATOM   692  C  CE3 . TRP A 1 86  ? 17.649  -7.112  20.774  1.00 19.63 ? 87  TRP A CE3 1 
ATOM   693  C  CZ2 . TRP A 1 86  ? 18.737  -7.671  18.193  1.00 17.84 ? 87  TRP A CZ2 1 
ATOM   694  C  CZ3 . TRP A 1 86  ? 17.366  -6.295  19.653  1.00 21.83 ? 87  TRP A CZ3 1 
ATOM   695  C  CH2 . TRP A 1 86  ? 17.905  -6.598  18.379  1.00 19.68 ? 87  TRP A CH2 1 
ATOM   696  N  N   . VAL A 1 87  ? 17.890  -11.041 25.492  1.00 21.46 ? 88  VAL A N   1 
ATOM   697  C  CA  . VAL A 1 87  ? 17.437  -11.156 26.894  1.00 22.59 ? 88  VAL A CA  1 
ATOM   698  C  C   . VAL A 1 87  ? 18.388  -12.036 27.714  1.00 23.19 ? 88  VAL A C   1 
ATOM   699  O  O   . VAL A 1 87  ? 18.819  -11.660 28.826  1.00 23.61 ? 88  VAL A O   1 
ATOM   700  C  CB  . VAL A 1 87  ? 15.995  -11.757 26.967  1.00 22.74 ? 88  VAL A CB  1 
ATOM   701  C  CG1 . VAL A 1 87  ? 15.596  -12.064 28.420  1.00 23.21 ? 88  VAL A CG1 1 
ATOM   702  C  CG2 . VAL A 1 87  ? 14.983  -10.819 26.327  1.00 22.64 ? 88  VAL A CG2 1 
ATOM   703  N  N   . ALA A 1 88  ? 18.729  -13.200 27.162  1.00 23.63 ? 89  ALA A N   1 
ATOM   704  C  CA  . ALA A 1 88  ? 19.584  -14.156 27.876  1.00 24.27 ? 89  ALA A CA  1 
ATOM   705  C  C   . ALA A 1 88  ? 20.962  -13.576 28.154  1.00 24.78 ? 89  ALA A C   1 
ATOM   706  O  O   . ALA A 1 88  ? 21.492  -13.734 29.253  1.00 25.15 ? 89  ALA A O   1 
ATOM   707  C  CB  . ALA A 1 88  ? 19.695  -15.480 27.105  1.00 24.53 ? 89  ALA A CB  1 
ATOM   708  N  N   . TYR A 1 89  ? 21.539  -12.895 27.165  1.00 24.77 ? 90  TYR A N   1 
ATOM   709  C  CA  . TYR A 1 89  ? 22.825  -12.254 27.348  1.00 25.16 ? 90  TYR A CA  1 
ATOM   710  C  C   . TYR A 1 89  ? 22.788  -11.209 28.483  1.00 25.93 ? 90  TYR A C   1 
ATOM   711  O  O   . TYR A 1 89  ? 23.683  -11.181 29.324  1.00 26.11 ? 90  TYR A O   1 
ATOM   712  C  CB  . TYR A 1 89  ? 23.336  -11.616 26.044  1.00 24.24 ? 90  TYR A CB  1 
ATOM   713  C  CG  . TYR A 1 89  ? 24.531  -10.718 26.286  1.00 23.81 ? 90  TYR A CG  1 
ATOM   714  C  CD1 . TYR A 1 89  ? 25.820  -11.244 26.360  1.00 22.80 ? 90  TYR A CD1 1 
ATOM   715  C  CD2 . TYR A 1 89  ? 24.369  -9.344  26.487  1.00 22.95 ? 90  TYR A CD2 1 
ATOM   716  C  CE1 . TYR A 1 89  ? 26.922  -10.419 26.609  1.00 21.89 ? 90  TYR A CE1 1 
ATOM   717  C  CE2 . TYR A 1 89  ? 25.455  -8.522  26.736  1.00 22.23 ? 90  TYR A CE2 1 
ATOM   718  C  CZ  . TYR A 1 89  ? 26.725  -9.066  26.799  1.00 21.79 ? 90  TYR A CZ  1 
ATOM   719  O  OH  . TYR A 1 89  ? 27.805  -8.253  27.031  1.00 22.58 ? 90  TYR A OH  1 
ATOM   720  N  N   . HIS A 1 90  ? 21.774  -10.347 28.491  1.00 26.55 ? 91  HIS A N   1 
ATOM   721  C  CA  . HIS A 1 90  ? 21.692  -9.282  29.501  1.00 27.75 ? 91  HIS A CA  1 
ATOM   722  C  C   . HIS A 1 90  ? 21.480  -9.842  30.910  1.00 28.78 ? 91  HIS A C   1 
ATOM   723  O  O   . HIS A 1 90  ? 22.116  -9.377  31.861  1.00 28.31 ? 91  HIS A O   1 
ATOM   724  C  CB  . HIS A 1 90  ? 20.591  -8.264  29.166  1.00 27.42 ? 91  HIS A CB  1 
ATOM   725  C  CG  . HIS A 1 90  ? 20.923  -7.370  28.012  1.00 27.72 ? 91  HIS A CG  1 
ATOM   726  N  ND1 . HIS A 1 90  ? 20.949  -7.817  26.709  1.00 28.56 ? 91  HIS A ND1 1 
ATOM   727  C  CD2 . HIS A 1 90  ? 21.241  -6.054  27.962  1.00 28.39 ? 91  HIS A CD2 1 
ATOM   728  C  CE1 . HIS A 1 90  ? 21.268  -6.816  25.906  1.00 28.93 ? 91  HIS A CE1 1 
ATOM   729  N  NE2 . HIS A 1 90  ? 21.449  -5.735  26.643  1.00 29.16 ? 91  HIS A NE2 1 
ATOM   730  N  N   . GLN A 1 91  ? 20.584  -10.823 31.031  1.00 30.36 ? 92  GLN A N   1 
ATOM   731  C  CA  . GLN A 1 91  ? 20.274  -11.461 32.321  1.00 32.56 ? 92  GLN A CA  1 
ATOM   732  C  C   . GLN A 1 91  ? 21.475  -12.231 32.841  1.00 33.12 ? 92  GLN A C   1 
ATOM   733  O  O   . GLN A 1 91  ? 21.954  -11.955 33.933  1.00 33.06 ? 92  GLN A O   1 
ATOM   734  C  CB  . GLN A 1 91  ? 19.049  -12.388 32.219  1.00 32.76 ? 92  GLN A CB  1 
ATOM   735  C  CG  . GLN A 1 91  ? 17.739  -11.632 31.969  1.00 35.65 ? 92  GLN A CG  1 
ATOM   736  C  CD  . GLN A 1 91  ? 16.499  -12.534 31.899  1.00 38.28 ? 92  GLN A CD  1 
ATOM   737  O  OE1 . GLN A 1 91  ? 16.591  -13.741 31.635  1.00 39.40 ? 92  GLN A OE1 1 
ATOM   738  N  NE2 . GLN A 1 91  ? 15.328  -11.935 32.116  1.00 38.23 ? 92  GLN A NE2 1 
ATOM   739  N  N   . TYR A 1 92  ? 21.977  -13.170 32.042  1.00 34.50 ? 93  TYR A N   1 
ATOM   740  C  CA  . TYR A 1 92  ? 23.104  -13.994 32.461  1.00 35.85 ? 93  TYR A CA  1 
ATOM   741  C  C   . TYR A 1 92  ? 24.354  -13.196 32.821  1.00 36.35 ? 93  TYR A C   1 
ATOM   742  O  O   . TYR A 1 92  ? 24.972  -13.456 33.861  1.00 36.31 ? 93  TYR A O   1 
ATOM   743  C  CB  . TYR A 1 92  ? 23.448  -15.077 31.432  1.00 36.30 ? 93  TYR A CB  1 
ATOM   744  C  CG  . TYR A 1 92  ? 24.475  -16.070 31.955  1.00 39.13 ? 93  TYR A CG  1 
ATOM   745  C  CD1 . TYR A 1 92  ? 24.086  -17.148 32.766  1.00 40.88 ? 93  TYR A CD1 1 
ATOM   746  C  CD2 . TYR A 1 92  ? 25.837  -15.917 31.669  1.00 41.26 ? 93  TYR A CD2 1 
ATOM   747  C  CE1 . TYR A 1 92  ? 25.028  -18.062 33.255  1.00 42.33 ? 93  TYR A CE1 1 
ATOM   748  C  CE2 . TYR A 1 92  ? 26.793  -16.833 32.156  1.00 42.97 ? 93  TYR A CE2 1 
ATOM   749  C  CZ  . TYR A 1 92  ? 26.375  -17.897 32.945  1.00 43.24 ? 93  TYR A CZ  1 
ATOM   750  O  OH  . TYR A 1 92  ? 27.302  -18.793 33.429  1.00 45.06 ? 93  TYR A OH  1 
ATOM   751  N  N   . TYR A 1 93  ? 24.728  -12.233 31.977  1.00 36.68 ? 94  TYR A N   1 
ATOM   752  C  CA  . TYR A 1 93  ? 25.937  -11.450 32.230  1.00 37.16 ? 94  TYR A CA  1 
ATOM   753  C  C   . TYR A 1 93  ? 25.669  -10.185 33.036  1.00 37.24 ? 94  TYR A C   1 
ATOM   754  O  O   . TYR A 1 93  ? 26.560  -9.347  33.217  1.00 37.68 ? 94  TYR A O   1 
ATOM   755  C  CB  . TYR A 1 93  ? 26.702  -11.163 30.927  1.00 37.19 ? 94  TYR A CB  1 
ATOM   756  C  CG  . TYR A 1 93  ? 27.323  -12.405 30.335  1.00 37.86 ? 94  TYR A CG  1 
ATOM   757  C  CD1 . TYR A 1 93  ? 26.664  -13.134 29.342  1.00 37.67 ? 94  TYR A CD1 1 
ATOM   758  C  CD2 . TYR A 1 93  ? 28.565  -12.875 30.785  1.00 38.36 ? 94  TYR A CD2 1 
ATOM   759  C  CE1 . TYR A 1 93  ? 27.224  -14.295 28.805  1.00 37.22 ? 94  TYR A CE1 1 
ATOM   760  C  CE2 . TYR A 1 93  ? 29.136  -14.038 30.251  1.00 37.51 ? 94  TYR A CE2 1 
ATOM   761  C  CZ  . TYR A 1 93  ? 28.461  -14.741 29.262  1.00 37.94 ? 94  TYR A CZ  1 
ATOM   762  O  OH  . TYR A 1 93  ? 29.011  -15.890 28.728  1.00 37.71 ? 94  TYR A OH  1 
ATOM   763  N  N   . GLN A 1 94  ? 24.440  -10.064 33.529  1.00 37.50 ? 95  GLN A N   1 
ATOM   764  C  CA  . GLN A 1 94  ? 24.022  -8.961  34.418  1.00 37.76 ? 95  GLN A CA  1 
ATOM   765  C  C   . GLN A 1 94  ? 24.286  -7.550  33.853  1.00 37.34 ? 95  GLN A C   1 
ATOM   766  O  O   . GLN A 1 94  ? 24.759  -6.650  34.563  1.00 37.43 ? 95  GLN A O   1 
ATOM   767  C  CB  . GLN A 1 94  ? 24.612  -9.139  35.824  1.00 38.23 ? 95  GLN A CB  1 
ATOM   768  C  CG  . GLN A 1 94  ? 24.289  -10.506 36.459  1.00 40.49 ? 95  GLN A CG  1 
ATOM   769  C  CD  . GLN A 1 94  ? 24.748  -10.620 37.906  1.00 43.97 ? 95  GLN A CD  1 
ATOM   770  O  OE1 . GLN A 1 94  ? 25.923  -10.384 38.228  1.00 45.05 ? 95  GLN A OE1 1 
ATOM   771  N  NE2 . GLN A 1 94  ? 23.824  -10.999 38.788  1.00 45.00 ? 95  GLN A NE2 1 
ATOM   772  N  N   . ARG A 1 95  ? 23.963  -7.368  32.576  1.00 36.52 ? 96  ARG A N   1 
ATOM   773  C  CA  . ARG A 1 95  ? 24.121  -6.080  31.914  1.00 36.16 ? 96  ARG A CA  1 
ATOM   774  C  C   . ARG A 1 95  ? 22.890  -5.221  32.138  1.00 35.67 ? 96  ARG A C   1 
ATOM   775  O  O   . ARG A 1 95  ? 21.768  -5.690  31.954  1.00 35.43 ? 96  ARG A O   1 
ATOM   776  C  CB  . ARG A 1 95  ? 24.339  -6.264  30.417  1.00 36.50 ? 96  ARG A CB  1 
ATOM   777  C  CG  . ARG A 1 95  ? 25.497  -7.163  30.062  1.00 37.52 ? 96  ARG A CG  1 
ATOM   778  C  CD  . ARG A 1 95  ? 26.809  -6.406  29.922  1.00 40.09 ? 96  ARG A CD  1 
ATOM   779  N  NE  . ARG A 1 95  ? 27.902  -7.362  29.989  1.00 43.60 ? 96  ARG A NE  1 
ATOM   780  C  CZ  . ARG A 1 95  ? 29.191  -7.051  30.002  1.00 46.50 ? 96  ARG A CZ  1 
ATOM   781  N  NH1 . ARG A 1 95  ? 29.580  -5.781  29.925  1.00 47.55 ? 96  ARG A NH1 1 
ATOM   782  N  NH2 . ARG A 1 95  ? 30.095  -8.026  30.087  1.00 47.02 ? 96  ARG A NH2 1 
ATOM   783  N  N   . PRO A 1 96  ? 23.093  -3.952  32.524  1.00 35.14 ? 97  PRO A N   1 
ATOM   784  C  CA  . PRO A 1 96  ? 21.962  -3.051  32.743  1.00 34.68 ? 97  PRO A CA  1 
ATOM   785  C  C   . PRO A 1 96  ? 21.144  -2.880  31.470  1.00 33.80 ? 97  PRO A C   1 
ATOM   786  O  O   . PRO A 1 96  ? 21.696  -2.720  30.376  1.00 34.05 ? 97  PRO A O   1 
ATOM   787  C  CB  . PRO A 1 96  ? 22.633  -1.734  33.135  1.00 34.88 ? 97  PRO A CB  1 
ATOM   788  C  CG  . PRO A 1 96  ? 24.025  -1.831  32.554  1.00 35.60 ? 97  PRO A CG  1 
ATOM   789  C  CD  . PRO A 1 96  ? 24.387  -3.270  32.705  1.00 35.30 ? 97  PRO A CD  1 
ATOM   790  N  N   . ILE A 1 97  ? 19.834  -2.937  31.610  1.00 33.17 ? 98  ILE A N   1 
ATOM   791  C  CA  . ILE A 1 97  ? 18.966  -2.901  30.448  1.00 32.29 ? 98  ILE A CA  1 
ATOM   792  C  C   . ILE A 1 97  ? 18.442  -1.503  30.215  1.00 31.83 ? 98  ILE A C   1 
ATOM   793  O  O   . ILE A 1 97  ? 18.244  -0.727  31.165  1.00 31.39 ? 98  ILE A O   1 
ATOM   794  C  CB  . ILE A 1 97  ? 17.801  -3.924  30.541  1.00 32.28 ? 98  ILE A CB  1 
ATOM   795  C  CG1 . ILE A 1 97  ? 16.967  -3.711  31.811  1.00 31.47 ? 98  ILE A CG1 1 
ATOM   796  C  CG2 . ILE A 1 97  ? 18.355  -5.348  30.478  1.00 32.72 ? 98  ILE A CG2 1 
ATOM   797  C  CD1 . ILE A 1 97  ? 15.756  -4.627  31.906  1.00 30.67 ? 98  ILE A CD1 1 
ATOM   798  N  N   . GLY A 1 98  ? 18.251  -1.185  28.936  1.00 30.75 ? 99  GLY A N   1 
ATOM   799  C  CA  . GLY A 1 98  ? 17.620  0.048   28.549  1.00 29.46 ? 99  GLY A CA  1 
ATOM   800  C  C   . GLY A 1 98  ? 16.187  -0.189  28.123  1.00 29.01 ? 99  GLY A C   1 
ATOM   801  O  O   . GLY A 1 98  ? 15.604  -1.258  28.359  1.00 28.97 ? 99  GLY A O   1 
ATOM   802  N  N   . VAL A 1 99  ? 15.644  0.816   27.452  1.00 28.06 ? 100 VAL A N   1 
ATOM   803  C  CA  . VAL A 1 99  ? 14.228  0.918   27.167  1.00 27.48 ? 100 VAL A CA  1 
ATOM   804  C  C   . VAL A 1 99  ? 13.744  -0.247  26.293  1.00 27.43 ? 100 VAL A C   1 
ATOM   805  O  O   . VAL A 1 99  ? 12.612  -0.713  26.431  1.00 27.37 ? 100 VAL A O   1 
ATOM   806  C  CB  . VAL A 1 99  ? 13.918  2.338   26.591  1.00 27.71 ? 100 VAL A CB  1 
ATOM   807  C  CG1 . VAL A 1 99  ? 14.447  2.519   25.147  1.00 27.10 ? 100 VAL A CG1 1 
ATOM   808  C  CG2 . VAL A 1 99  ? 12.458  2.699   26.726  1.00 28.28 ? 100 VAL A CG2 1 
ATOM   809  N  N   . LEU A 1 100 ? 14.620  -0.756  25.432  1.00 27.49 ? 101 LEU A N   1 
ATOM   810  C  CA  . LEU A 1 100 ? 14.259  -1.893  24.583  1.00 27.67 ? 101 LEU A CA  1 
ATOM   811  C  C   . LEU A 1 100 ? 13.814  -3.145  25.366  1.00 27.73 ? 101 LEU A C   1 
ATOM   812  O  O   . LEU A 1 100 ? 12.850  -3.802  24.986  1.00 27.53 ? 101 LEU A O   1 
ATOM   813  C  CB  . LEU A 1 100 ? 15.411  -2.236  23.639  1.00 26.96 ? 101 LEU A CB  1 
ATOM   814  C  CG  . LEU A 1 100 ? 15.238  -3.476  22.762  1.00 27.65 ? 101 LEU A CG  1 
ATOM   815  C  CD1 . LEU A 1 100 ? 14.201  -3.239  21.698  1.00 27.28 ? 101 LEU A CD1 1 
ATOM   816  C  CD2 . LEU A 1 100 ? 16.572  -3.852  22.154  1.00 26.63 ? 101 LEU A CD2 1 
ATOM   817  N  N   . LEU A 1 101 ? 14.518  -3.457  26.446  1.00 28.22 ? 102 LEU A N   1 
ATOM   818  C  CA  . LEU A 1 101 ? 14.296  -4.705  27.183  1.00 29.09 ? 102 LEU A CA  1 
ATOM   819  C  C   . LEU A 1 101 ? 13.460  -4.559  28.466  1.00 29.90 ? 102 LEU A C   1 
ATOM   820  O  O   . LEU A 1 101 ? 13.235  -5.543  29.184  1.00 29.96 ? 102 LEU A O   1 
ATOM   821  C  CB  . LEU A 1 101 ? 15.633  -5.384  27.485  1.00 28.74 ? 102 LEU A CB  1 
ATOM   822  C  CG  . LEU A 1 101 ? 16.476  -5.825  26.274  1.00 29.95 ? 102 LEU A CG  1 
ATOM   823  C  CD1 . LEU A 1 101 ? 17.713  -6.581  26.716  1.00 30.49 ? 102 LEU A CD1 1 
ATOM   824  C  CD2 . LEU A 1 101 ? 15.675  -6.684  25.323  1.00 29.69 ? 102 LEU A CD2 1 
ATOM   825  N  N   . LYS A 1 102 ? 12.997  -3.339  28.738  1.00 30.32 ? 103 LYS A N   1 
ATOM   826  C  CA  . LYS A 1 102 ? 12.155  -3.058  29.900  1.00 30.86 ? 103 LYS A CA  1 
ATOM   827  C  C   . LYS A 1 102 ? 10.674  -3.181  29.561  1.00 31.52 ? 103 LYS A C   1 
ATOM   828  O  O   . LYS A 1 102 ? 10.291  -3.228  28.384  1.00 31.54 ? 103 LYS A O   1 
ATOM   829  C  CB  . LYS A 1 102 ? 12.439  -1.653  30.438  1.00 30.79 ? 103 LYS A CB  1 
ATOM   830  C  CG  . LYS A 1 102 ? 13.790  -1.505  31.086  1.00 29.52 ? 103 LYS A CG  1 
ATOM   831  C  CD  . LYS A 1 102 ? 13.940  -0.155  31.744  1.00 30.60 ? 103 LYS A CD  1 
ATOM   832  C  CE  . LYS A 1 102 ? 15.243  -0.102  32.517  1.00 29.65 ? 103 LYS A CE  1 
ATOM   833  N  NZ  . LYS A 1 102 ? 15.553  1.272   32.953  1.00 31.51 ? 103 LYS A NZ  1 
ATOM   834  N  N   . LYS A 1 103 ? 9.838   -3.234  30.596  1.00 32.37 ? 104 LYS A N   1 
ATOM   835  C  CA  . LYS A 1 103 ? 8.386   -3.306  30.403  1.00 33.33 ? 104 LYS A CA  1 
ATOM   836  C  C   . LYS A 1 103 ? 7.670   -2.452  31.454  1.00 33.59 ? 104 LYS A C   1 
ATOM   837  O  O   . LYS A 1 103 ? 8.313   -1.901  32.345  1.00 32.67 ? 104 LYS A O   1 
ATOM   838  C  CB  . LYS A 1 103 ? 7.901   -4.762  30.449  1.00 33.49 ? 104 LYS A CB  1 
ATOM   839  C  CG  . LYS A 1 103 ? 7.575   -5.281  31.839  1.00 35.56 ? 104 LYS A CG  1 
ATOM   840  C  CD  . LYS A 1 103 ? 7.494   -6.804  31.883  1.00 39.17 ? 104 LYS A CD  1 
ATOM   841  C  CE  . LYS A 1 103 ? 8.677   -7.386  32.650  1.00 41.39 ? 104 LYS A CE  1 
ATOM   842  N  NZ  . LYS A 1 103 ? 8.473   -7.360  34.139  1.00 43.57 ? 104 LYS A NZ  1 
ATOM   843  N  N   . SER A 1 104 ? 6.345   -2.354  31.313  1.00 34.38 ? 105 SER A N   1 
ATOM   844  C  CA  . SER A 1 104 ? 5.461   -1.566  32.179  1.00 35.14 ? 105 SER A CA  1 
ATOM   845  C  C   . SER A 1 104 ? 6.057   -0.250  32.683  1.00 35.04 ? 105 SER A C   1 
ATOM   846  O  O   . SER A 1 104 ? 6.598   0.538   31.893  1.00 34.82 ? 105 SER A O   1 
ATOM   847  C  CB  . SER A 1 104 ? 4.889   -2.418  33.328  1.00 35.66 ? 105 SER A CB  1 
ATOM   848  O  OG  . SER A 1 104 ? 5.924   -2.966  34.115  1.00 38.01 ? 105 SER A OG  1 
ATOM   849  N  N   . ALA A 1 105 ? 5.952   -0.017  33.990  1.00 34.92 ? 106 ALA A N   1 
ATOM   850  C  CA  . ALA A 1 105 ? 6.287   1.281   34.581  1.00 34.74 ? 106 ALA A CA  1 
ATOM   851  C  C   . ALA A 1 105 ? 7.763   1.637   34.449  1.00 34.17 ? 106 ALA A C   1 
ATOM   852  O  O   . ALA A 1 105 ? 8.102   2.806   34.270  1.00 34.09 ? 106 ALA A O   1 
ATOM   853  C  CB  . ALA A 1 105 ? 5.852   1.338   36.061  1.00 34.57 ? 106 ALA A CB  1 
ATOM   854  N  N   . ALA A 1 106 ? 8.639   0.639   34.552  1.00 33.34 ? 107 ALA A N   1 
ATOM   855  C  CA  . ALA A 1 106 ? 10.062  0.909   34.417  1.00 32.77 ? 107 ALA A CA  1 
ATOM   856  C  C   . ALA A 1 106 ? 10.409  1.313   32.972  1.00 32.37 ? 107 ALA A C   1 
ATOM   857  O  O   . ALA A 1 106 ? 11.325  2.109   32.758  1.00 31.79 ? 107 ALA A O   1 
ATOM   858  C  CB  . ALA A 1 106 ? 10.895  -0.271  34.883  1.00 33.00 ? 107 ALA A CB  1 
ATOM   859  N  N   . TRP A 1 107 ? 9.664   0.781   31.998  1.00 31.92 ? 108 TRP A N   1 
ATOM   860  C  CA  . TRP A 1 107 ? 9.839   1.182   30.593  1.00 31.73 ? 108 TRP A CA  1 
ATOM   861  C  C   . TRP A 1 107 ? 9.375   2.618   30.405  1.00 32.36 ? 108 TRP A C   1 
ATOM   862  O  O   . TRP A 1 107 ? 10.079  3.441   29.805  1.00 32.02 ? 108 TRP A O   1 
ATOM   863  C  CB  . TRP A 1 107 ? 9.063   0.274   29.627  1.00 30.99 ? 108 TRP A CB  1 
ATOM   864  C  CG  . TRP A 1 107 ? 8.932   0.902   28.259  1.00 29.88 ? 108 TRP A CG  1 
ATOM   865  C  CD1 . TRP A 1 107 ? 9.879   0.917   27.271  1.00 28.19 ? 108 TRP A CD1 1 
ATOM   866  C  CD2 . TRP A 1 107 ? 7.812   1.646   27.750  1.00 29.21 ? 108 TRP A CD2 1 
ATOM   867  N  NE1 . TRP A 1 107 ? 9.411   1.604   26.175  1.00 28.23 ? 108 TRP A NE1 1 
ATOM   868  C  CE2 . TRP A 1 107 ? 8.147   2.064   26.441  1.00 28.26 ? 108 TRP A CE2 1 
ATOM   869  C  CE3 . TRP A 1 107 ? 6.553   1.983   28.264  1.00 28.67 ? 108 TRP A CE3 1 
ATOM   870  C  CZ2 . TRP A 1 107 ? 7.276   2.815   25.648  1.00 26.88 ? 108 TRP A CZ2 1 
ATOM   871  C  CZ3 . TRP A 1 107 ? 5.684   2.731   27.469  1.00 28.91 ? 108 TRP A CZ3 1 
ATOM   872  C  CH2 . TRP A 1 107 ? 6.052   3.134   26.174  1.00 28.12 ? 108 TRP A CH2 1 
ATOM   873  N  N   . LYS A 1 108 ? 8.180   2.900   30.925  1.00 32.83 ? 109 LYS A N   1 
ATOM   874  C  CA  . LYS A 1 108 ? 7.538   4.203   30.792  1.00 33.71 ? 109 LYS A CA  1 
ATOM   875  C  C   . LYS A 1 108 ? 8.424   5.324   31.324  1.00 33.66 ? 109 LYS A C   1 
ATOM   876  O  O   . LYS A 1 108 ? 8.531   6.377   30.704  1.00 33.61 ? 109 LYS A O   1 
ATOM   877  C  CB  . LYS A 1 108 ? 6.187   4.199   31.516  1.00 33.99 ? 109 LYS A CB  1 
ATOM   878  C  CG  . LYS A 1 108 ? 5.382   5.480   31.362  1.00 35.65 ? 109 LYS A CG  1 
ATOM   879  C  CD  . LYS A 1 108 ? 4.873   5.675   29.936  1.00 37.34 ? 109 LYS A CD  1 
ATOM   880  C  CE  . LYS A 1 108 ? 3.933   6.867   29.865  1.00 38.31 ? 109 LYS A CE  1 
ATOM   881  N  NZ  . LYS A 1 108 ? 3.619   7.211   28.461  1.00 40.45 ? 109 LYS A NZ  1 
ATOM   882  N  N   . LYS A 1 109 ? 9.060   5.064   32.462  1.00 33.97 ? 110 LYS A N   1 
ATOM   883  C  CA  . LYS A 1 109 ? 9.955   6.006   33.128  1.00 34.60 ? 110 LYS A CA  1 
ATOM   884  C  C   . LYS A 1 109 ? 11.141  6.417   32.240  1.00 34.10 ? 110 LYS A C   1 
ATOM   885  O  O   . LYS A 1 109 ? 11.394  7.612   32.062  1.00 34.27 ? 110 LYS A O   1 
ATOM   886  C  CB  . LYS A 1 109 ? 10.446  5.399   34.444  1.00 35.03 ? 110 LYS A CB  1 
ATOM   887  C  CG  . LYS A 1 109 ? 10.881  6.414   35.486  1.00 37.19 ? 110 LYS A CG  1 
ATOM   888  C  CD  . LYS A 1 109 ? 11.677  5.734   36.600  1.00 40.08 ? 110 LYS A CD  1 
ATOM   889  C  CE  . LYS A 1 109 ? 12.490  6.742   37.389  1.00 42.34 ? 110 LYS A CE  1 
ATOM   890  N  NZ  . LYS A 1 109 ? 13.174  6.080   38.542  1.00 44.90 ? 110 LYS A NZ  1 
ATOM   891  N  N   . ASP A 1 110 ? 11.856  5.432   31.684  1.00 33.21 ? 111 ASP A N   1 
ATOM   892  C  CA  . ASP A 1 110 ? 12.934  5.697   30.718  1.00 32.37 ? 111 ASP A CA  1 
ATOM   893  C  C   . ASP A 1 110 ? 12.407  6.415   29.479  1.00 31.46 ? 111 ASP A C   1 
ATOM   894  O  O   . ASP A 1 110 ? 12.945  7.446   29.075  1.00 31.89 ? 111 ASP A O   1 
ATOM   895  C  CB  . ASP A 1 110 ? 13.640  4.395   30.297  1.00 32.38 ? 111 ASP A CB  1 
ATOM   896  C  CG  . ASP A 1 110 ? 14.680  3.930   31.311  1.00 34.40 ? 111 ASP A CG  1 
ATOM   897  O  OD1 . ASP A 1 110 ? 14.594  4.352   32.492  1.00 35.32 ? 111 ASP A OD1 1 
ATOM   898  O  OD2 . ASP A 1 110 ? 15.584  3.139   30.930  1.00 34.49 ? 111 ASP A OD2 1 
ATOM   899  N  N   . ARG A 1 111 ? 11.355  5.865   28.886  1.00 30.39 ? 112 ARG A N   1 
ATOM   900  C  CA  . ARG A 1 111 ? 10.810  6.375   27.642  1.00 30.06 ? 112 ARG A CA  1 
ATOM   901  C  C   . ARG A 1 111 ? 10.469  7.873   27.693  1.00 30.41 ? 112 ARG A C   1 
ATOM   902  O  O   . ARG A 1 111 ? 10.901  8.644   26.829  1.00 30.33 ? 112 ARG A O   1 
ATOM   903  C  CB  . ARG A 1 111 ? 9.595   5.555   27.193  1.00 28.95 ? 112 ARG A CB  1 
ATOM   904  C  CG  . ARG A 1 111 ? 9.109   5.887   25.782  1.00 28.63 ? 112 ARG A CG  1 
ATOM   905  C  CD  . ARG A 1 111 ? 10.196  5.649   24.696  1.00 26.68 ? 112 ARG A CD  1 
ATOM   906  N  NE  . ARG A 1 111 ? 9.806   6.198   23.394  1.00 25.54 ? 112 ARG A NE  1 
ATOM   907  C  CZ  . ARG A 1 111 ? 9.637   5.500   22.269  1.00 25.28 ? 112 ARG A CZ  1 
ATOM   908  N  NH1 . ARG A 1 111 ? 9.848   4.185   22.230  1.00 25.40 ? 112 ARG A NH1 1 
ATOM   909  N  NH2 . ARG A 1 111 ? 9.265   6.131   21.166  1.00 22.19 ? 112 ARG A NH2 1 
ATOM   910  N  N   . VAL A 1 112 ? 9.689   8.270   28.696  1.00 30.42 ? 113 VAL A N   1 
ATOM   911  C  CA  . VAL A 1 112 ? 9.329   9.671   28.880  1.00 30.21 ? 113 VAL A CA  1 
ATOM   912  C  C   . VAL A 1 112 ? 10.565  10.554  29.062  1.00 29.94 ? 113 VAL A C   1 
ATOM   913  O  O   . VAL A 1 112 ? 10.637  11.628  28.479  1.00 30.67 ? 113 VAL A O   1 
ATOM   914  C  CB  . VAL A 1 112 ? 8.314   9.866   30.042  1.00 30.48 ? 113 VAL A CB  1 
ATOM   915  C  CG1 . VAL A 1 112 ? 8.355   11.309  30.562  1.00 32.03 ? 113 VAL A CG1 1 
ATOM   916  C  CG2 . VAL A 1 112 ? 6.911   9.514   29.562  1.00 29.71 ? 113 VAL A CG2 1 
ATOM   917  N  N   . ALA A 1 113 ? 11.545  10.112  29.849  1.00 29.18 ? 114 ALA A N   1 
ATOM   918  C  CA  . ALA A 1 113 ? 12.765  10.902  29.994  1.00 28.51 ? 114 ALA A CA  1 
ATOM   919  C  C   . ALA A 1 113 ? 13.510  11.016  28.653  1.00 28.23 ? 114 ALA A C   1 
ATOM   920  O  O   . ALA A 1 113 ? 14.053  12.080  28.324  1.00 27.57 ? 114 ALA A O   1 
ATOM   921  C  CB  . ALA A 1 113 ? 13.676  10.321  31.073  1.00 28.07 ? 114 ALA A CB  1 
ATOM   922  N  N   . LEU A 1 114 ? 13.513  9.929   27.877  1.00 27.85 ? 115 LEU A N   1 
ATOM   923  C  CA  . LEU A 1 114 ? 14.261  9.901   26.616  1.00 28.07 ? 115 LEU A CA  1 
ATOM   924  C  C   . LEU A 1 114 ? 13.579  10.698  25.519  1.00 28.06 ? 115 LEU A C   1 
ATOM   925  O  O   . LEU A 1 114 ? 14.244  11.418  24.775  1.00 28.17 ? 115 LEU A O   1 
ATOM   926  C  CB  . LEU A 1 114 ? 14.540  8.466   26.158  1.00 27.70 ? 115 LEU A CB  1 
ATOM   927  C  CG  . LEU A 1 114 ? 15.593  7.729   26.995  1.00 28.43 ? 115 LEU A CG  1 
ATOM   928  C  CD1 . LEU A 1 114 ? 15.469  6.226   26.801  1.00 28.12 ? 115 LEU A CD1 1 
ATOM   929  C  CD2 . LEU A 1 114 ? 17.008  8.212   26.683  1.00 26.76 ? 115 LEU A CD2 1 
ATOM   930  N  N   . ASN A 1 115 ? 12.258  10.555  25.425  1.00 28.19 ? 116 ASN A N   1 
ATOM   931  C  CA  . ASN A 1 115 ? 11.437  11.329  24.505  1.00 28.76 ? 116 ASN A CA  1 
ATOM   932  C  C   . ASN A 1 115 ? 11.677  12.831  24.581  1.00 29.36 ? 116 ASN A C   1 
ATOM   933  O  O   . ASN A 1 115 ? 11.621  13.509  23.565  1.00 29.58 ? 116 ASN A O   1 
ATOM   934  C  CB  . ASN A 1 115 ? 9.949   11.056  24.740  1.00 28.59 ? 116 ASN A CB  1 
ATOM   935  C  CG  . ASN A 1 115 ? 9.476   9.764   24.098  1.00 29.31 ? 116 ASN A CG  1 
ATOM   936  O  OD1 . ASN A 1 115 ? 10.250  9.035   23.488  1.00 27.38 ? 116 ASN A OD1 1 
ATOM   937  N  ND2 . ASN A 1 115 ? 8.190   9.479   24.238  1.00 30.74 ? 116 ASN A ND2 1 
ATOM   938  N  N   . GLN A 1 116 ? 11.929  13.346  25.781  1.00 30.30 ? 117 GLN A N   1 
ATOM   939  C  CA  . GLN A 1 116 ? 12.194  14.780  25.967  1.00 31.65 ? 117 GLN A CA  1 
ATOM   940  C  C   . GLN A 1 116 ? 13.501  15.228  25.319  1.00 31.24 ? 117 GLN A C   1 
ATOM   941  O  O   . GLN A 1 116 ? 13.654  16.402  24.978  1.00 31.56 ? 117 GLN A O   1 
ATOM   942  C  CB  . GLN A 1 116 ? 12.202  15.155  27.458  1.00 31.93 ? 117 GLN A CB  1 
ATOM   943  C  CG  . GLN A 1 116 ? 10.951  14.714  28.238  1.00 35.89 ? 117 GLN A CG  1 
ATOM   944  C  CD  . GLN A 1 116 ? 9.690   15.513  27.907  1.00 41.04 ? 117 GLN A CD  1 
ATOM   945  O  OE1 . GLN A 1 116 ? 9.719   16.458  27.113  1.00 43.60 ? 117 GLN A OE1 1 
ATOM   946  N  NE2 . GLN A 1 116 ? 8.569   15.134  28.531  1.00 44.10 ? 117 GLN A NE2 1 
ATOM   947  N  N   . GLU A 1 117 ? 14.444  14.305  25.157  1.00 31.02 ? 118 GLU A N   1 
ATOM   948  C  CA  . GLU A 1 117 ? 15.730  14.655  24.552  1.00 31.02 ? 118 GLU A CA  1 
ATOM   949  C  C   . GLU A 1 117 ? 15.937  14.174  23.107  1.00 30.72 ? 118 GLU A C   1 
ATOM   950  O  O   . GLU A 1 117 ? 16.809  14.700  22.405  1.00 30.48 ? 118 GLU A O   1 
ATOM   951  C  CB  . GLU A 1 117 ? 16.901  14.211  25.438  1.00 31.22 ? 118 GLU A CB  1 
ATOM   952  C  CG  . GLU A 1 117 ? 17.007  14.942  26.774  1.00 32.78 ? 118 GLU A CG  1 
ATOM   953  C  CD  . GLU A 1 117 ? 16.892  16.465  26.669  1.00 35.44 ? 118 GLU A CD  1 
ATOM   954  O  OE1 . GLU A 1 117 ? 17.221  17.056  25.607  1.00 35.20 ? 118 GLU A OE1 1 
ATOM   955  O  OE2 . GLU A 1 117 ? 16.470  17.078  27.674  1.00 37.09 ? 118 GLU A OE2 1 
ATOM   956  N  N   . VAL A 1 118 ? 15.157  13.185  22.668  1.00 30.23 ? 119 VAL A N   1 
ATOM   957  C  CA  . VAL A 1 118 ? 15.364  12.598  21.333  1.00 30.43 ? 119 VAL A CA  1 
ATOM   958  C  C   . VAL A 1 118 ? 14.139  12.604  20.413  1.00 30.25 ? 119 VAL A C   1 
ATOM   959  O  O   . VAL A 1 118 ? 14.286  12.400  19.214  1.00 29.59 ? 119 VAL A O   1 
ATOM   960  C  CB  . VAL A 1 118 ? 16.006  11.164  21.380  1.00 30.39 ? 119 VAL A CB  1 
ATOM   961  C  CG1 . VAL A 1 118 ? 17.197  11.133  22.322  1.00 30.76 ? 119 VAL A CG1 1 
ATOM   962  C  CG2 . VAL A 1 118 ? 14.991  10.137  21.762  1.00 29.27 ? 119 VAL A CG2 1 
ATOM   963  N  N   . MET A 1 119 ? 12.942  12.815  20.965  1.00 30.68 ? 120 MET A N   1 
ATOM   964  C  CA  . MET A 1 119 ? 11.727  12.863  20.139  1.00 31.66 ? 120 MET A CA  1 
ATOM   965  C  C   . MET A 1 119 ? 11.132  14.282  20.034  1.00 31.94 ? 120 MET A C   1 
ATOM   966  O  O   . MET A 1 119 ? 10.659  14.673  18.964  1.00 31.84 ? 120 MET A O   1 
ATOM   967  C  CB  . MET A 1 119 ? 10.643  11.886  20.642  1.00 32.17 ? 120 MET A CB  1 
ATOM   968  C  CG  . MET A 1 119 ? 10.909  10.385  20.452  1.00 34.89 ? 120 MET A CG  1 
ATOM   969  S  SD  . MET A 1 119 ? 10.962  9.812   18.727  1.00 41.72 ? 120 MET A SD  1 
ATOM   970  C  CE  . MET A 1 119 ? 9.241   9.529   18.337  1.00 37.51 ? 120 MET A CE  1 
ATOM   971  N  N   . ALA A 1 120 ? 11.140  15.031  21.141  1.00 32.04 ? 121 ALA A N   1 
ATOM   972  C  CA  . ALA A 1 120 ? 10.470  16.343  21.192  1.00 32.58 ? 121 ALA A CA  1 
ATOM   973  C  C   . ALA A 1 120 ? 11.020  17.313  20.153  1.00 32.73 ? 121 ALA A C   1 
ATOM   974  O  O   . ALA A 1 120 ? 12.226  17.547  20.104  1.00 32.37 ? 121 ALA A O   1 
ATOM   975  C  CB  . ALA A 1 120 ? 10.554  16.964  22.605  1.00 32.20 ? 121 ALA A CB  1 
ATOM   976  N  N   . PRO A 1 121 ? 10.131  17.896  19.327  1.00 33.71 ? 122 PRO A N   1 
ATOM   977  C  CA  . PRO A 1 121 ? 10.576  18.835  18.278  1.00 34.43 ? 122 PRO A CA  1 
ATOM   978  C  C   . PRO A 1 121 ? 11.502  19.935  18.816  1.00 34.90 ? 122 PRO A C   1 
ATOM   979  O  O   . PRO A 1 121 ? 12.396  20.376  18.104  1.00 35.35 ? 122 PRO A O   1 
ATOM   980  C  CB  . PRO A 1 121 ? 9.263   19.422  17.742  1.00 34.30 ? 122 PRO A CB  1 
ATOM   981  C  CG  . PRO A 1 121 ? 8.214   18.393  18.099  1.00 34.49 ? 122 PRO A CG  1 
ATOM   982  C  CD  . PRO A 1 121 ? 8.660   17.801  19.402  1.00 33.56 ? 122 PRO A CD  1 
ATOM   983  N  N   . GLU A 1 122 ? 11.321  20.327  20.076  1.00 35.34 ? 123 GLU A N   1 
ATOM   984  C  CA  . GLU A 1 122 ? 12.150  21.363  20.706  1.00 36.04 ? 123 GLU A CA  1 
ATOM   985  C  C   . GLU A 1 122 ? 13.566  20.890  21.043  1.00 35.45 ? 123 GLU A C   1 
ATOM   986  O  O   . GLU A 1 122 ? 14.501  21.701  21.131  1.00 35.40 ? 123 GLU A O   1 
ATOM   987  C  CB  . GLU A 1 122 ? 11.466  21.913  21.962  1.00 36.94 ? 123 GLU A CB  1 
ATOM   988  C  CG  . GLU A 1 122 ? 10.091  22.565  21.699  1.00 39.91 ? 123 GLU A CG  1 
ATOM   989  C  CD  . GLU A 1 122 ? 8.944   21.556  21.598  1.00 45.06 ? 123 GLU A CD  1 
ATOM   990  O  OE1 . GLU A 1 122 ? 9.147   20.347  21.903  1.00 44.92 ? 123 GLU A OE1 1 
ATOM   991  O  OE2 . GLU A 1 122 ? 7.829   21.984  21.205  1.00 47.59 ? 123 GLU A OE2 1 
ATOM   992  N  N   . ALA A 1 123 ? 13.724  19.583  21.243  1.00 34.05 ? 124 ALA A N   1 
ATOM   993  C  CA  . ALA A 1 123 ? 15.061  18.994  21.375  1.00 33.05 ? 124 ALA A CA  1 
ATOM   994  C  C   . ALA A 1 123 ? 15.679  18.700  19.998  1.00 32.05 ? 124 ALA A C   1 
ATOM   995  O  O   . ALA A 1 123 ? 16.849  18.985  19.768  1.00 32.00 ? 124 ALA A O   1 
ATOM   996  C  CB  . ALA A 1 123 ? 15.011  17.717  22.230  1.00 32.61 ? 124 ALA A CB  1 
ATOM   997  N  N   . THR A 1 124 ? 14.884  18.152  19.086  1.00 31.16 ? 125 THR A N   1 
ATOM   998  C  CA  . THR A 1 124 ? 15.411  17.631  17.826  1.00 30.63 ? 125 THR A CA  1 
ATOM   999  C  C   . THR A 1 124 ? 15.908  18.720  16.864  1.00 30.38 ? 125 THR A C   1 
ATOM   1000 O  O   . THR A 1 124 ? 16.781  18.446  16.023  1.00 28.94 ? 125 THR A O   1 
ATOM   1001 C  CB  . THR A 1 124 ? 14.406  16.690  17.102  1.00 30.64 ? 125 THR A CB  1 
ATOM   1002 O  OG1 . THR A 1 124 ? 13.249  17.427  16.695  1.00 30.78 ? 125 THR A OG1 1 
ATOM   1003 C  CG2 . THR A 1 124 ? 13.985  15.510  18.001  1.00 30.51 ? 125 THR A CG2 1 
ATOM   1004 N  N   . LYS A 1 125 ? 15.366  19.944  16.989  1.00 30.14 ? 126 LYS A N   1 
ATOM   1005 C  CA  . LYS A 1 125 ? 15.827  21.065  16.151  1.00 30.23 ? 126 LYS A CA  1 
ATOM   1006 C  C   . LYS A 1 125 ? 17.333  21.282  16.331  1.00 29.51 ? 126 LYS A C   1 
ATOM   1007 O  O   . LYS A 1 125 ? 18.010  21.711  15.410  1.00 29.35 ? 126 LYS A O   1 
ATOM   1008 C  CB  . LYS A 1 125 ? 15.025  22.357  16.408  1.00 30.65 ? 126 LYS A CB  1 
ATOM   1009 C  CG  . LYS A 1 125 ? 15.400  23.105  17.685  1.00 32.89 ? 126 LYS A CG  1 
ATOM   1010 C  CD  . LYS A 1 125 ? 14.367  24.186  18.024  1.00 37.05 ? 126 LYS A CD  1 
ATOM   1011 C  CE  . LYS A 1 125 ? 14.927  25.184  19.026  1.00 39.20 ? 126 LYS A CE  1 
ATOM   1012 N  NZ  . LYS A 1 125 ? 15.052  24.585  20.395  1.00 41.02 ? 126 LYS A NZ  1 
ATOM   1013 N  N   . ASN A 1 126 ? 17.858  20.934  17.509  1.00 29.32 ? 127 ASN A N   1 
ATOM   1014 C  CA  . ASN A 1 126 ? 19.301  21.013  17.767  1.00 29.02 ? 127 ASN A CA  1 
ATOM   1015 C  C   . ASN A 1 126 ? 20.149  19.964  17.036  1.00 28.21 ? 127 ASN A C   1 
ATOM   1016 O  O   . ASN A 1 126 ? 21.376  20.068  17.003  1.00 27.49 ? 127 ASN A O   1 
ATOM   1017 C  CB  . ASN A 1 126 ? 19.570  20.939  19.261  1.00 29.27 ? 127 ASN A CB  1 
ATOM   1018 C  CG  . ASN A 1 126 ? 18.942  22.085  20.012  1.00 31.17 ? 127 ASN A CG  1 
ATOM   1019 O  OD1 . ASN A 1 126 ? 19.152  23.243  19.668  1.00 33.68 ? 127 ASN A OD1 1 
ATOM   1020 N  ND2 . ASN A 1 126 ? 18.146  21.770  21.031  1.00 31.05 ? 127 ASN A ND2 1 
ATOM   1021 N  N   . PHE A 1 127 ? 19.497  18.953  16.469  1.00 27.53 ? 128 PHE A N   1 
ATOM   1022 C  CA  . PHE A 1 127 ? 20.216  17.885  15.767  1.00 27.35 ? 128 PHE A CA  1 
ATOM   1023 C  C   . PHE A 1 127 ? 20.689  18.351  14.395  1.00 27.62 ? 128 PHE A C   1 
ATOM   1024 O  O   . PHE A 1 127 ? 21.685  17.835  13.868  1.00 27.51 ? 128 PHE A O   1 
ATOM   1025 C  CB  . PHE A 1 127 ? 19.342  16.630  15.604  1.00 26.98 ? 128 PHE A CB  1 
ATOM   1026 C  CG  . PHE A 1 127 ? 18.953  15.958  16.921  1.00 26.48 ? 128 PHE A CG  1 
ATOM   1027 C  CD1 . PHE A 1 127 ? 19.647  16.214  18.099  1.00 26.34 ? 128 PHE A CD1 1 
ATOM   1028 C  CD2 . PHE A 1 127 ? 17.908  15.041  16.955  1.00 26.18 ? 128 PHE A CD2 1 
ATOM   1029 C  CE1 . PHE A 1 127 ? 19.283  15.584  19.303  1.00 27.85 ? 128 PHE A CE1 1 
ATOM   1030 C  CE2 . PHE A 1 127 ? 17.540  14.396  18.149  1.00 25.18 ? 128 PHE A CE2 1 
ATOM   1031 C  CZ  . PHE A 1 127 ? 18.226  14.670  19.324  1.00 25.57 ? 128 PHE A CZ  1 
ATOM   1032 N  N   . LEU A 1 128 ? 19.965  19.316  13.821  1.00 27.45 ? 129 LEU A N   1 
ATOM   1033 C  CA  . LEU A 1 128 ? 20.181  19.726  12.431  1.00 27.73 ? 129 LEU A CA  1 
ATOM   1034 C  C   . LEU A 1 128 ? 21.640  20.061  12.093  1.00 27.25 ? 129 LEU A C   1 
ATOM   1035 O  O   . LEU A 1 128 ? 22.184  19.476  11.173  1.00 27.44 ? 129 LEU A O   1 
ATOM   1036 C  CB  . LEU A 1 128 ? 19.197  20.824  11.976  1.00 28.02 ? 129 LEU A CB  1 
ATOM   1037 C  CG  . LEU A 1 128 ? 17.693  20.637  12.249  1.00 29.34 ? 129 LEU A CG  1 
ATOM   1038 C  CD1 . LEU A 1 128 ? 16.881  21.514  11.296  1.00 29.72 ? 129 LEU A CD1 1 
ATOM   1039 C  CD2 . LEU A 1 128 ? 17.209  19.195  12.168  1.00 29.58 ? 129 LEU A CD2 1 
ATOM   1040 N  N   . PRO A 1 129 ? 22.278  20.989  12.843  1.00 27.17 ? 130 PRO A N   1 
ATOM   1041 C  CA  . PRO A 1 129 ? 23.685  21.323  12.565  1.00 26.76 ? 130 PRO A CA  1 
ATOM   1042 C  C   . PRO A 1 129 ? 24.646  20.136  12.730  1.00 26.26 ? 130 PRO A C   1 
ATOM   1043 O  O   . PRO A 1 129 ? 25.642  20.018  11.995  1.00 26.37 ? 130 PRO A O   1 
ATOM   1044 C  CB  . PRO A 1 129 ? 24.010  22.385  13.623  1.00 26.85 ? 130 PRO A CB  1 
ATOM   1045 C  CG  . PRO A 1 129 ? 22.683  22.953  14.021  1.00 27.38 ? 130 PRO A CG  1 
ATOM   1046 C  CD  . PRO A 1 129 ? 21.723  21.815  13.936  1.00 27.01 ? 130 PRO A CD  1 
ATOM   1047 N  N   . LEU A 1 130 ? 24.361  19.278  13.703  1.00 25.18 ? 131 LEU A N   1 
ATOM   1048 C  CA  . LEU A 1 130 ? 25.245  18.161  14.007  1.00 24.34 ? 131 LEU A CA  1 
ATOM   1049 C  C   . LEU A 1 130 ? 25.171  17.098  12.904  1.00 23.65 ? 131 LEU A C   1 
ATOM   1050 O  O   . LEU A 1 130 ? 26.197  16.529  12.533  1.00 23.43 ? 131 LEU A O   1 
ATOM   1051 C  CB  . LEU A 1 130 ? 24.927  17.571  15.390  1.00 24.00 ? 131 LEU A CB  1 
ATOM   1052 C  CG  . LEU A 1 130 ? 25.191  18.496  16.596  1.00 24.77 ? 131 LEU A CG  1 
ATOM   1053 C  CD1 . LEU A 1 130 ? 24.538  17.943  17.859  1.00 23.60 ? 131 LEU A CD1 1 
ATOM   1054 C  CD2 . LEU A 1 130 ? 26.683  18.735  16.833  1.00 23.29 ? 131 LEU A CD2 1 
ATOM   1055 N  N   . LEU A 1 131 ? 23.968  16.854  12.383  1.00 22.26 ? 132 LEU A N   1 
ATOM   1056 C  CA  . LEU A 1 131 ? 23.765  15.844  11.335  1.00 22.14 ? 132 LEU A CA  1 
ATOM   1057 C  C   . LEU A 1 131 ? 24.225  16.389  9.983   1.00 22.35 ? 132 LEU A C   1 
ATOM   1058 O  O   . LEU A 1 131 ? 24.786  15.650  9.173   1.00 21.87 ? 132 LEU A O   1 
ATOM   1059 C  CB  . LEU A 1 131 ? 22.290  15.406  11.243  1.00 21.55 ? 132 LEU A CB  1 
ATOM   1060 C  CG  . LEU A 1 131 ? 21.704  14.649  12.452  1.00 20.58 ? 132 LEU A CG  1 
ATOM   1061 C  CD1 . LEU A 1 131 ? 20.218  14.522  12.316  1.00 18.21 ? 132 LEU A CD1 1 
ATOM   1062 C  CD2 . LEU A 1 131 ? 22.354  13.279  12.648  1.00 20.70 ? 132 LEU A CD2 1 
ATOM   1063 N  N   . ASP A 1 132 ? 23.977  17.680  9.748   1.00 22.13 ? 133 ASP A N   1 
ATOM   1064 C  CA  . ASP A 1 132 ? 24.400  18.325  8.500   1.00 23.11 ? 133 ASP A CA  1 
ATOM   1065 C  C   . ASP A 1 132 ? 25.921  18.305  8.335   1.00 22.57 ? 133 ASP A C   1 
ATOM   1066 O  O   . ASP A 1 132 ? 26.420  17.947  7.265   1.00 22.82 ? 133 ASP A O   1 
ATOM   1067 C  CB  . ASP A 1 132 ? 23.835  19.741  8.397   1.00 23.64 ? 133 ASP A CB  1 
ATOM   1068 C  CG  . ASP A 1 132 ? 23.872  20.275  6.995   1.00 26.49 ? 133 ASP A CG  1 
ATOM   1069 O  OD1 . ASP A 1 132 ? 23.862  21.520  6.853   1.00 28.70 ? 133 ASP A OD1 1 
ATOM   1070 O  OD2 . ASP A 1 132 ? 23.911  19.455  6.040   1.00 28.00 ? 133 ASP A OD2 1 
ATOM   1071 N  N   . ALA A 1 133 ? 26.651  18.657  9.395   1.00 22.59 ? 134 ALA A N   1 
ATOM   1072 C  CA  . ALA A 1 133 ? 28.118  18.536  9.411   1.00 22.49 ? 134 ALA A CA  1 
ATOM   1073 C  C   . ALA A 1 133 ? 28.606  17.154  8.985   1.00 22.30 ? 134 ALA A C   1 
ATOM   1074 O  O   . ALA A 1 133 ? 29.602  17.037  8.259   1.00 21.93 ? 134 ALA A O   1 
ATOM   1075 C  CB  . ALA A 1 133 ? 28.693  18.874  10.806  1.00 22.88 ? 134 ALA A CB  1 
ATOM   1076 N  N   . VAL A 1 134 ? 27.939  16.103  9.454   1.00 21.82 ? 135 VAL A N   1 
ATOM   1077 C  CA  . VAL A 1 134 ? 28.380  14.756  9.088   1.00 21.34 ? 135 VAL A CA  1 
ATOM   1078 C  C   . VAL A 1 134 ? 28.089  14.470  7.614   1.00 21.09 ? 135 VAL A C   1 
ATOM   1079 O  O   . VAL A 1 134 ? 28.956  13.968  6.897   1.00 20.75 ? 135 VAL A O   1 
ATOM   1080 C  CB  . VAL A 1 134 ? 27.796  13.669  10.006  1.00 21.64 ? 135 VAL A CB  1 
ATOM   1081 C  CG1 . VAL A 1 134 ? 28.306  12.300  9.584   1.00 21.31 ? 135 VAL A CG1 1 
ATOM   1082 C  CG2 . VAL A 1 134 ? 28.192  13.947  11.470  1.00 21.19 ? 135 VAL A CG2 1 
ATOM   1083 N  N   . SER A 1 135 ? 26.886  14.804  7.160   1.00 21.22 ? 136 SER A N   1 
ATOM   1084 C  CA  . SER A 1 135 ? 26.531  14.552  5.764   1.00 22.20 ? 136 SER A CA  1 
ATOM   1085 C  C   . SER A 1 135 ? 27.424  15.326  4.787   1.00 22.31 ? 136 SER A C   1 
ATOM   1086 O  O   . SER A 1 135 ? 27.826  14.773  3.756   1.00 21.91 ? 136 SER A O   1 
ATOM   1087 C  CB  . SER A 1 135 ? 25.063  14.858  5.497   1.00 21.81 ? 136 SER A CB  1 
ATOM   1088 O  OG  . SER A 1 135 ? 24.264  13.834  6.029   1.00 24.20 ? 136 SER A OG  1 
ATOM   1089 N  N   . ARG A 1 136 ? 27.725  16.590  5.115   1.00 22.60 ? 137 ARG A N   1 
ATOM   1090 C  CA  . ARG A 1 136 ? 28.646  17.406  4.302   1.00 23.18 ? 137 ARG A CA  1 
ATOM   1091 C  C   . ARG A 1 136 ? 30.018  16.763  4.211   1.00 22.58 ? 137 ARG A C   1 
ATOM   1092 O  O   . ARG A 1 136 ? 30.646  16.808  3.153   1.00 22.13 ? 137 ARG A O   1 
ATOM   1093 C  CB  . ARG A 1 136 ? 28.788  18.841  4.826   1.00 23.49 ? 137 ARG A CB  1 
ATOM   1094 C  CG  . ARG A 1 136 ? 27.520  19.698  4.711   1.00 26.33 ? 137 ARG A CG  1 
ATOM   1095 C  CD  . ARG A 1 136 ? 27.736  21.111  5.283   1.00 31.40 ? 137 ARG A CD  1 
ATOM   1096 N  NE  . ARG A 1 136 ? 27.660  22.132  4.234   1.00 37.89 ? 137 ARG A NE  1 
ATOM   1097 C  CZ  . ARG A 1 136 ? 28.709  22.721  3.656   1.00 41.05 ? 137 ARG A CZ  1 
ATOM   1098 N  NH1 . ARG A 1 136 ? 29.954  22.406  4.006   1.00 43.25 ? 137 ARG A NH1 1 
ATOM   1099 N  NH2 . ARG A 1 136 ? 28.514  23.628  2.713   1.00 42.99 ? 137 ARG A NH2 1 
ATOM   1100 N  N   . ASP A 1 137 ? 30.495  16.188  5.315   1.00 22.69 ? 138 ASP A N   1 
ATOM   1101 C  CA  . ASP A 1 137 ? 31.760  15.429  5.280   1.00 23.02 ? 138 ASP A CA  1 
ATOM   1102 C  C   . ASP A 1 137 ? 31.672  14.152  4.425   1.00 22.60 ? 138 ASP A C   1 
ATOM   1103 O  O   . ASP A 1 137 ? 32.645  13.780  3.756   1.00 22.69 ? 138 ASP A O   1 
ATOM   1104 C  CB  . ASP A 1 137 ? 32.289  15.123  6.692   1.00 23.88 ? 138 ASP A CB  1 
ATOM   1105 C  CG  . ASP A 1 137 ? 32.848  16.370  7.389   1.00 25.71 ? 138 ASP A CG  1 
ATOM   1106 O  OD1 . ASP A 1 137 ? 33.041  17.405  6.712   1.00 27.84 ? 138 ASP A OD1 1 
ATOM   1107 O  OD2 . ASP A 1 137 ? 33.083  16.319  8.608   1.00 28.13 ? 138 ASP A OD2 1 
ATOM   1108 N  N   . PHE A 1 138 ? 30.506  13.499  4.421   1.00 21.92 ? 139 PHE A N   1 
ATOM   1109 C  CA  . PHE A 1 138 ? 30.307  12.341  3.539   1.00 22.19 ? 139 PHE A CA  1 
ATOM   1110 C  C   . PHE A 1 138 ? 30.455  12.755  2.075   1.00 22.28 ? 139 PHE A C   1 
ATOM   1111 O  O   . PHE A 1 138 ? 31.184  12.121  1.312   1.00 22.54 ? 139 PHE A O   1 
ATOM   1112 C  CB  . PHE A 1 138 ? 28.940  11.673  3.740   1.00 21.59 ? 139 PHE A CB  1 
ATOM   1113 C  CG  . PHE A 1 138 ? 28.856  10.321  3.106   1.00 21.12 ? 139 PHE A CG  1 
ATOM   1114 C  CD1 . PHE A 1 138 ? 29.257  9.191   3.807   1.00 21.01 ? 139 PHE A CD1 1 
ATOM   1115 C  CD2 . PHE A 1 138 ? 28.423  10.175  1.793   1.00 20.26 ? 139 PHE A CD2 1 
ATOM   1116 C  CE1 . PHE A 1 138 ? 29.202  7.929   3.208   1.00 21.27 ? 139 PHE A CE1 1 
ATOM   1117 C  CE2 . PHE A 1 138 ? 28.372  8.928   1.194   1.00 19.60 ? 139 PHE A CE2 1 
ATOM   1118 C  CZ  . PHE A 1 138 ? 28.766  7.804   1.903   1.00 19.39 ? 139 PHE A CZ  1 
ATOM   1119 N  N   . VAL A 1 139 ? 29.749  13.814  1.693   1.00 22.40 ? 140 VAL A N   1 
ATOM   1120 C  CA  . VAL A 1 139 ? 29.872  14.403  0.354   1.00 22.95 ? 140 VAL A CA  1 
ATOM   1121 C  C   . VAL A 1 139 ? 31.356  14.633  -0.007  1.00 23.33 ? 140 VAL A C   1 
ATOM   1122 O  O   . VAL A 1 139 ? 31.802  14.237  -1.088  1.00 23.09 ? 140 VAL A O   1 
ATOM   1123 C  CB  . VAL A 1 139 ? 29.046  15.732  0.253   1.00 22.81 ? 140 VAL A CB  1 
ATOM   1124 C  CG1 . VAL A 1 139 ? 29.476  16.576  -0.945  1.00 23.41 ? 140 VAL A CG1 1 
ATOM   1125 C  CG2 . VAL A 1 139 ? 27.540  15.426  0.183   1.00 22.75 ? 140 VAL A CG2 1 
ATOM   1126 N  N   . SER A 1 140 ? 32.109  15.249  0.908   1.00 23.97 ? 141 SER A N   1 
ATOM   1127 C  CA  . SER A 1 140 ? 33.554  15.497  0.706   1.00 25.21 ? 141 SER A CA  1 
ATOM   1128 C  C   . SER A 1 140 ? 34.377  14.242  0.460   1.00 24.94 ? 141 SER A C   1 
ATOM   1129 O  O   . SER A 1 140 ? 35.281  14.268  -0.363  1.00 25.92 ? 141 SER A O   1 
ATOM   1130 C  CB  . SER A 1 140 ? 34.158  16.275  1.878   1.00 25.46 ? 141 SER A CB  1 
ATOM   1131 O  OG  . SER A 1 140 ? 33.546  17.552  1.963   1.00 27.91 ? 141 SER A OG  1 
ATOM   1132 N  N   . VAL A 1 141 ? 34.081  13.160  1.180   1.00 25.36 ? 142 VAL A N   1 
ATOM   1133 C  CA  . VAL A 1 141 ? 34.719  11.861  0.940   1.00 25.33 ? 142 VAL A CA  1 
ATOM   1134 C  C   . VAL A 1 141 ? 34.548  11.432  -0.522  1.00 25.04 ? 142 VAL A C   1 
ATOM   1135 O  O   . VAL A 1 141 ? 35.519  11.038  -1.189  1.00 24.75 ? 142 VAL A O   1 
ATOM   1136 C  CB  . VAL A 1 141 ? 34.135  10.736  1.828   1.00 25.64 ? 142 VAL A CB  1 
ATOM   1137 C  CG1 . VAL A 1 141 ? 34.728  9.386   1.437   1.00 25.06 ? 142 VAL A CG1 1 
ATOM   1138 C  CG2 . VAL A 1 141 ? 34.380  11.016  3.317   1.00 27.45 ? 142 VAL A CG2 1 
ATOM   1139 N  N   . LEU A 1 142 ? 33.310  11.502  -1.004  1.00 24.15 ? 143 LEU A N   1 
ATOM   1140 C  CA  . LEU A 1 142 ? 33.009  11.096  -2.372  1.00 24.28 ? 143 LEU A CA  1 
ATOM   1141 C  C   . LEU A 1 142 ? 33.724  11.991  -3.399  1.00 24.26 ? 143 LEU A C   1 
ATOM   1142 O  O   . LEU A 1 142 ? 34.321  11.477  -4.341  1.00 23.74 ? 143 LEU A O   1 
ATOM   1143 C  CB  . LEU A 1 142 ? 31.496  11.029  -2.626  1.00 23.50 ? 143 LEU A CB  1 
ATOM   1144 C  CG  . LEU A 1 142 ? 30.719  9.894   -1.965  1.00 23.99 ? 143 LEU A CG  1 
ATOM   1145 C  CD1 . LEU A 1 142 ? 29.257  9.973   -2.340  1.00 23.19 ? 143 LEU A CD1 1 
ATOM   1146 C  CD2 . LEU A 1 142 ? 31.285  8.525   -2.363  1.00 25.17 ? 143 LEU A CD2 1 
ATOM   1147 N  N   . HIS A 1 143 ? 33.685  13.306  -3.202  1.00 24.66 ? 144 HIS A N   1 
ATOM   1148 C  CA  . HIS A 1 143 ? 34.415  14.227  -4.093  1.00 26.30 ? 144 HIS A CA  1 
ATOM   1149 C  C   . HIS A 1 143 ? 35.900  13.879  -4.152  1.00 26.98 ? 144 HIS A C   1 
ATOM   1150 O  O   . HIS A 1 143 ? 36.494  13.919  -5.221  1.00 27.40 ? 144 HIS A O   1 
ATOM   1151 C  CB  . HIS A 1 143 ? 34.232  15.710  -3.693  1.00 26.38 ? 144 HIS A CB  1 
ATOM   1152 C  CG  . HIS A 1 143 ? 32.926  16.301  -4.129  1.00 27.12 ? 144 HIS A CG  1 
ATOM   1153 N  ND1 . HIS A 1 143 ? 32.463  16.211  -5.425  1.00 29.50 ? 144 HIS A ND1 1 
ATOM   1154 C  CD2 . HIS A 1 143 ? 31.991  17.001  -3.445  1.00 28.38 ? 144 HIS A CD2 1 
ATOM   1155 C  CE1 . HIS A 1 143 ? 31.297  16.827  -5.521  1.00 29.61 ? 144 HIS A CE1 1 
ATOM   1156 N  NE2 . HIS A 1 143 ? 30.983  17.308  -4.330  1.00 30.34 ? 144 HIS A NE2 1 
ATOM   1157 N  N   . ARG A 1 144 ? 36.478  13.539  -2.999  1.00 27.58 ? 145 ARG A N   1 
ATOM   1158 C  CA  . ARG A 1 144 ? 37.865  13.082  -2.891  1.00 28.72 ? 145 ARG A CA  1 
ATOM   1159 C  C   . ARG A 1 144 ? 38.125  11.782  -3.678  1.00 28.47 ? 145 ARG A C   1 
ATOM   1160 O  O   . ARG A 1 144 ? 39.103  11.679  -4.442  1.00 28.62 ? 145 ARG A O   1 
ATOM   1161 C  CB  . ARG A 1 144 ? 38.249  12.941  -1.406  1.00 29.31 ? 145 ARG A CB  1 
ATOM   1162 C  CG  . ARG A 1 144 ? 39.456  12.057  -1.079  1.00 33.72 ? 145 ARG A CG  1 
ATOM   1163 C  CD  . ARG A 1 144 ? 39.960  12.307  0.368   1.00 39.20 ? 145 ARG A CD  1 
ATOM   1164 N  NE  . ARG A 1 144 ? 39.301  11.477  1.392   1.00 42.28 ? 145 ARG A NE  1 
ATOM   1165 C  CZ  . ARG A 1 144 ? 38.544  11.933  2.400   1.00 43.83 ? 145 ARG A CZ  1 
ATOM   1166 N  NH1 . ARG A 1 144 ? 38.311  13.234  2.550   1.00 44.62 ? 145 ARG A NH1 1 
ATOM   1167 N  NH2 . ARG A 1 144 ? 38.008  11.077  3.271   1.00 43.42 ? 145 ARG A NH2 1 
ATOM   1168 N  N   . ARG A 1 145 ? 37.249  10.801  -3.511  1.00 27.51 ? 146 ARG A N   1 
ATOM   1169 C  CA  . ARG A 1 145 ? 37.392  9.562   -4.261  1.00 27.06 ? 146 ARG A CA  1 
ATOM   1170 C  C   . ARG A 1 145 ? 37.229  9.780   -5.767  1.00 26.61 ? 146 ARG A C   1 
ATOM   1171 O  O   . ARG A 1 145 ? 37.885  9.112   -6.558  1.00 26.24 ? 146 ARG A O   1 
ATOM   1172 C  CB  . ARG A 1 145 ? 36.419  8.503   -3.750  1.00 26.74 ? 146 ARG A CB  1 
ATOM   1173 C  CG  . ARG A 1 145 ? 36.717  8.111   -2.336  1.00 26.18 ? 146 ARG A CG  1 
ATOM   1174 C  CD  . ARG A 1 145 ? 35.945  6.894   -1.921  1.00 26.66 ? 146 ARG A CD  1 
ATOM   1175 N  NE  . ARG A 1 145 ? 36.198  6.590   -0.522  1.00 27.12 ? 146 ARG A NE  1 
ATOM   1176 C  CZ  . ARG A 1 145 ? 35.468  5.757   0.200   1.00 29.52 ? 146 ARG A CZ  1 
ATOM   1177 N  NH1 . ARG A 1 145 ? 34.444  5.122   -0.361  1.00 30.54 ? 146 ARG A NH1 1 
ATOM   1178 N  NH2 . ARG A 1 145 ? 35.758  5.568   1.482   1.00 29.21 ? 146 ARG A NH2 1 
ATOM   1179 N  N   . ILE A 1 146 ? 36.353  10.705  -6.153  1.00 27.01 ? 147 ILE A N   1 
ATOM   1180 C  CA  . ILE A 1 146 ? 36.164  11.033  -7.573  1.00 27.79 ? 147 ILE A CA  1 
ATOM   1181 C  C   . ILE A 1 146 ? 37.458  11.620  -8.162  1.00 28.54 ? 147 ILE A C   1 
ATOM   1182 O  O   . ILE A 1 146 ? 37.921  11.190  -9.230  1.00 28.35 ? 147 ILE A O   1 
ATOM   1183 C  CB  . ILE A 1 146 ? 34.980  11.991  -7.796  1.00 27.59 ? 147 ILE A CB  1 
ATOM   1184 C  CG1 . ILE A 1 146 ? 33.654  11.257  -7.547  1.00 27.09 ? 147 ILE A CG1 1 
ATOM   1185 C  CG2 . ILE A 1 146 ? 35.022  12.595  -9.232  1.00 27.22 ? 147 ILE A CG2 1 
ATOM   1186 C  CD1 . ILE A 1 146 ? 32.404  12.149  -7.544  1.00 26.67 ? 147 ILE A CD1 1 
ATOM   1187 N  N   . LYS A 1 147 ? 38.033  12.589  -7.448  1.00 29.15 ? 148 LYS A N   1 
ATOM   1188 C  CA  . LYS A 1 147 ? 39.281  13.232  -7.861  1.00 30.42 ? 148 LYS A CA  1 
ATOM   1189 C  C   . LYS A 1 147 ? 40.376  12.186  -8.024  1.00 30.22 ? 148 LYS A C   1 
ATOM   1190 O  O   . LYS A 1 147 ? 41.021  12.110  -9.070  1.00 30.27 ? 148 LYS A O   1 
ATOM   1191 C  CB  . LYS A 1 147 ? 39.695  14.296  -6.836  1.00 31.04 ? 148 LYS A CB  1 
ATOM   1192 C  CG  . LYS A 1 147 ? 40.925  15.115  -7.225  1.00 33.86 ? 148 LYS A CG  1 
ATOM   1193 C  CD  . LYS A 1 147 ? 40.843  16.512  -6.618  1.00 37.61 ? 148 LYS A CD  1 
ATOM   1194 C  CE  . LYS A 1 147 ? 41.835  17.456  -7.280  1.00 39.39 ? 148 LYS A CE  1 
ATOM   1195 N  NZ  . LYS A 1 147 ? 43.231  17.069  -6.938  1.00 39.77 ? 148 LYS A NZ  1 
ATOM   1196 N  N   . LYS A 1 148 ? 40.553  11.374  -6.983  1.00 30.13 ? 149 LYS A N   1 
ATOM   1197 C  CA  . LYS A 1 148 ? 41.499  10.263  -6.964  1.00 29.91 ? 149 LYS A CA  1 
ATOM   1198 C  C   . LYS A 1 148 ? 41.350  9.292   -8.145  1.00 29.31 ? 149 LYS A C   1 
ATOM   1199 O  O   . LYS A 1 148 ? 42.359  8.850   -8.708  1.00 28.82 ? 149 LYS A O   1 
ATOM   1200 C  CB  . LYS A 1 148 ? 41.336  9.492   -5.651  1.00 30.94 ? 149 LYS A CB  1 
ATOM   1201 C  CG  . LYS A 1 148 ? 42.364  8.380   -5.415  1.00 33.24 ? 149 LYS A CG  1 
ATOM   1202 C  CD  . LYS A 1 148 ? 43.614  8.928   -4.738  1.00 39.05 ? 149 LYS A CD  1 
ATOM   1203 C  CE  . LYS A 1 148 ? 44.704  7.852   -4.638  1.00 41.87 ? 149 LYS A CE  1 
ATOM   1204 N  NZ  . LYS A 1 148 ? 44.174  6.583   -4.045  1.00 43.10 ? 149 LYS A NZ  1 
ATOM   1205 N  N   . ALA A 1 149 ? 40.105  8.962   -8.508  1.00 27.61 ? 150 ALA A N   1 
ATOM   1206 C  CA  . ALA A 1 149 ? 39.832  8.019   -9.603  1.00 27.04 ? 150 ALA A CA  1 
ATOM   1207 C  C   . ALA A 1 149 ? 40.303  8.541   -10.971 1.00 26.84 ? 150 ALA A C   1 
ATOM   1208 O  O   . ALA A 1 149 ? 40.671  7.752   -11.852 1.00 26.38 ? 150 ALA A O   1 
ATOM   1209 C  CB  . ALA A 1 149 ? 38.349  7.674   -9.656  1.00 26.57 ? 150 ALA A CB  1 
ATOM   1210 N  N   . GLY A 1 150 ? 40.265  9.864   -11.140 1.00 26.73 ? 151 GLY A N   1 
ATOM   1211 C  CA  . GLY A 1 150 ? 40.743  10.522  -12.355 1.00 26.78 ? 151 GLY A CA  1 
ATOM   1212 C  C   . GLY A 1 150 ? 39.816  10.370  -13.547 1.00 26.92 ? 151 GLY A C   1 
ATOM   1213 O  O   . GLY A 1 150 ? 40.157  10.777  -14.653 1.00 26.67 ? 151 GLY A O   1 
ATOM   1214 N  N   . SER A 1 151 ? 38.635  9.800   -13.321 1.00 26.49 ? 152 SER A N   1 
ATOM   1215 C  CA  . SER A 1 151 ? 37.711  9.477   -14.411 1.00 26.80 ? 152 SER A CA  1 
ATOM   1216 C  C   . SER A 1 151 ? 36.523  10.425  -14.515 1.00 27.13 ? 152 SER A C   1 
ATOM   1217 O  O   . SER A 1 151 ? 35.705  10.275  -15.408 1.00 28.29 ? 152 SER A O   1 
ATOM   1218 C  CB  . SER A 1 151 ? 37.185  8.049   -14.234 1.00 26.99 ? 152 SER A CB  1 
ATOM   1219 O  OG  . SER A 1 151 ? 36.743  7.854   -12.892 1.00 25.82 ? 152 SER A OG  1 
ATOM   1220 N  N   . GLY A 1 152 ? 36.402  11.380  -13.596 1.00 27.16 ? 153 GLY A N   1 
ATOM   1221 C  CA  . GLY A 1 152 ? 35.191  12.213  -13.531 1.00 27.10 ? 153 GLY A CA  1 
ATOM   1222 C  C   . GLY A 1 152 ? 34.041  11.534  -12.790 1.00 26.81 ? 153 GLY A C   1 
ATOM   1223 O  O   . GLY A 1 152 ? 32.925  12.057  -12.738 1.00 26.70 ? 153 GLY A O   1 
ATOM   1224 N  N   . ASN A 1 153 ? 34.298  10.353  -12.237 1.00 26.37 ? 154 ASN A N   1 
ATOM   1225 C  CA  . ASN A 1 153 ? 33.288  9.644   -11.446 1.00 25.94 ? 154 ASN A CA  1 
ATOM   1226 C  C   . ASN A 1 153 ? 33.918  8.720   -10.405 1.00 25.46 ? 154 ASN A C   1 
ATOM   1227 O  O   . ASN A 1 153 ? 35.139  8.616   -10.316 1.00 24.52 ? 154 ASN A O   1 
ATOM   1228 C  CB  . ASN A 1 153 ? 32.292  8.885   -12.344 1.00 26.32 ? 154 ASN A CB  1 
ATOM   1229 C  CG  . ASN A 1 153 ? 32.951  7.815   -13.201 1.00 28.79 ? 154 ASN A CG  1 
ATOM   1230 O  OD1 . ASN A 1 153 ? 32.870  7.863   -14.421 1.00 32.83 ? 154 ASN A OD1 1 
ATOM   1231 N  ND2 . ASN A 1 153 ? 33.583  6.833   -12.566 1.00 31.16 ? 154 ASN A ND2 1 
ATOM   1232 N  N   . TYR A 1 154 ? 33.076  8.067   -9.610  1.00 24.85 ? 155 TYR A N   1 
ATOM   1233 C  CA  . TYR A 1 154 ? 33.544  7.077   -8.648  1.00 24.40 ? 155 TYR A CA  1 
ATOM   1234 C  C   . TYR A 1 154 ? 32.551  5.920   -8.583  1.00 24.18 ? 155 TYR A C   1 
ATOM   1235 O  O   . TYR A 1 154 ? 31.345  6.131   -8.427  1.00 23.91 ? 155 TYR A O   1 
ATOM   1236 C  CB  . TYR A 1 154 ? 33.749  7.705   -7.262  1.00 24.38 ? 155 TYR A CB  1 
ATOM   1237 C  CG  . TYR A 1 154 ? 33.989  6.686   -6.178  1.00 24.79 ? 155 TYR A CG  1 
ATOM   1238 C  CD1 . TYR A 1 154 ? 35.175  5.953   -6.139  1.00 25.61 ? 155 TYR A CD1 1 
ATOM   1239 C  CD2 . TYR A 1 154 ? 33.029  6.453   -5.188  1.00 25.16 ? 155 TYR A CD2 1 
ATOM   1240 C  CE1 . TYR A 1 154 ? 35.398  5.009   -5.156  1.00 27.71 ? 155 TYR A CE1 1 
ATOM   1241 C  CE2 . TYR A 1 154 ? 33.241  5.515   -4.196  1.00 26.81 ? 155 TYR A CE2 1 
ATOM   1242 C  CZ  . TYR A 1 154 ? 34.430  4.795   -4.189  1.00 27.94 ? 155 TYR A CZ  1 
ATOM   1243 O  OH  . TYR A 1 154 ? 34.665  3.867   -3.210  1.00 30.72 ? 155 TYR A OH  1 
ATOM   1244 N  N   . SER A 1 155 ? 33.074  4.707   -8.733  1.00 23.68 ? 156 SER A N   1 
ATOM   1245 C  CA  . SER A 1 155 ? 32.290  3.492   -8.627  1.00 23.61 ? 156 SER A CA  1 
ATOM   1246 C  C   . SER A 1 155 ? 32.808  2.678   -7.469  1.00 23.27 ? 156 SER A C   1 
ATOM   1247 O  O   . SER A 1 155 ? 34.017  2.448   -7.351  1.00 23.01 ? 156 SER A O   1 
ATOM   1248 C  CB  . SER A 1 155 ? 32.415  2.653   -9.903  1.00 23.78 ? 156 SER A CB  1 
ATOM   1249 O  OG  . SER A 1 155 ? 31.762  3.287   -10.976 1.00 25.41 ? 156 SER A OG  1 
ATOM   1250 N  N   . GLY A 1 156 ? 31.889  2.240   -6.621  1.00 23.16 ? 157 GLY A N   1 
ATOM   1251 C  CA  . GLY A 1 156 ? 32.212  1.338   -5.527  1.00 22.24 ? 157 GLY A CA  1 
ATOM   1252 C  C   . GLY A 1 156 ? 31.008  0.902   -4.708  1.00 22.18 ? 157 GLY A C   1 
ATOM   1253 O  O   . GLY A 1 156 ? 29.916  1.476   -4.785  1.00 21.10 ? 157 GLY A O   1 
ATOM   1254 N  N   . ASP A 1 157 ? 31.241  -0.137  -3.922  1.00 22.56 ? 158 ASP A N   1 
ATOM   1255 C  CA  . ASP A 1 157 ? 30.359  -0.555  -2.844  1.00 23.12 ? 158 ASP A CA  1 
ATOM   1256 C  C   . ASP A 1 157 ? 30.685  0.372   -1.666  1.00 22.70 ? 158 ASP A C   1 
ATOM   1257 O  O   . ASP A 1 157 ? 31.809  0.359   -1.144  1.00 23.01 ? 158 ASP A O   1 
ATOM   1258 C  CB  . ASP A 1 157 ? 30.690  -2.021  -2.533  1.00 23.47 ? 158 ASP A CB  1 
ATOM   1259 C  CG  . ASP A 1 157 ? 29.960  -2.573  -1.319  1.00 25.54 ? 158 ASP A CG  1 
ATOM   1260 O  OD1 . ASP A 1 157 ? 29.332  -1.817  -0.554  1.00 25.12 ? 158 ASP A OD1 1 
ATOM   1261 O  OD2 . ASP A 1 157 ? 30.057  -3.811  -1.124  1.00 31.34 ? 158 ASP A OD2 1 
ATOM   1262 N  N   . ILE A 1 158 ? 29.709  1.167   -1.241  1.00 22.12 ? 159 ILE A N   1 
ATOM   1263 C  CA  . ILE A 1 158 ? 29.924  2.110   -0.139  1.00 21.46 ? 159 ILE A CA  1 
ATOM   1264 C  C   . ILE A 1 158 ? 29.263  1.702   1.180   1.00 20.95 ? 159 ILE A C   1 
ATOM   1265 O  O   . ILE A 1 158 ? 29.110  2.536   2.087   1.00 20.50 ? 159 ILE A O   1 
ATOM   1266 C  CB  . ILE A 1 158 ? 29.463  3.548   -0.512  1.00 21.58 ? 159 ILE A CB  1 
ATOM   1267 C  CG1 . ILE A 1 158 ? 27.955  3.561   -0.789  1.00 21.99 ? 159 ILE A CG1 1 
ATOM   1268 C  CG2 . ILE A 1 158 ? 30.289  4.079   -1.712  1.00 20.80 ? 159 ILE A CG2 1 
ATOM   1269 C  CD1 . ILE A 1 158 ? 27.317  4.925   -0.744  1.00 21.05 ? 159 ILE A CD1 1 
ATOM   1270 N  N   . SER A 1 159 ? 28.892  0.429   1.301   1.00 20.59 ? 160 SER A N   1 
ATOM   1271 C  CA  . SER A 1 159 ? 28.228  -0.052  2.525   1.00 20.78 ? 160 SER A CA  1 
ATOM   1272 C  C   . SER A 1 159 ? 29.059  0.204   3.788   1.00 21.04 ? 160 SER A C   1 
ATOM   1273 O  O   . SER A 1 159 ? 28.529  0.647   4.811   1.00 20.59 ? 160 SER A O   1 
ATOM   1274 C  CB  . SER A 1 159 ? 27.840  -1.535  2.408   1.00 20.95 ? 160 SER A CB  1 
ATOM   1275 O  OG  . SER A 1 159 ? 28.963  -2.359  2.149   1.00 21.54 ? 160 SER A OG  1 
ATOM   1276 N  N   . ASP A 1 160 ? 30.363  -0.058  3.715   1.00 21.13 ? 161 ASP A N   1 
ATOM   1277 C  CA  . ASP A 1 160 ? 31.250  0.229   4.844   1.00 21.80 ? 161 ASP A CA  1 
ATOM   1278 C  C   . ASP A 1 160 ? 31.342  1.706   5.192   1.00 21.29 ? 161 ASP A C   1 
ATOM   1279 O  O   . ASP A 1 160 ? 31.424  2.057   6.364   1.00 21.18 ? 161 ASP A O   1 
ATOM   1280 C  CB  . ASP A 1 160 ? 32.650  -0.335  4.604   1.00 22.30 ? 161 ASP A CB  1 
ATOM   1281 C  CG  . ASP A 1 160 ? 32.668  -1.853  4.617   1.00 26.21 ? 161 ASP A CG  1 
ATOM   1282 O  OD1 . ASP A 1 160 ? 31.712  -2.463  5.150   1.00 30.39 ? 161 ASP A OD1 1 
ATOM   1283 O  OD2 . ASP A 1 160 ? 33.635  -2.438  4.092   1.00 31.42 ? 161 ASP A OD2 1 
ATOM   1284 N  N   . ASP A 1 161 ? 31.351  2.565   4.174   1.00 20.92 ? 162 ASP A N   1 
ATOM   1285 C  CA  . ASP A 1 161 ? 31.279  4.008   4.385   1.00 20.74 ? 162 ASP A CA  1 
ATOM   1286 C  C   . ASP A 1 161 ? 29.944  4.437   5.023   1.00 20.12 ? 162 ASP A C   1 
ATOM   1287 O  O   . ASP A 1 161 ? 29.902  5.338   5.862   1.00 20.15 ? 162 ASP A O   1 
ATOM   1288 C  CB  . ASP A 1 161 ? 31.509  4.721   3.061   1.00 21.26 ? 162 ASP A CB  1 
ATOM   1289 C  CG  . ASP A 1 161 ? 32.802  4.280   2.391   1.00 22.86 ? 162 ASP A CG  1 
ATOM   1290 O  OD1 . ASP A 1 161 ? 33.869  4.447   3.007   1.00 25.68 ? 162 ASP A OD1 1 
ATOM   1291 O  OD2 . ASP A 1 161 ? 32.757  3.750   1.260   1.00 24.79 ? 162 ASP A OD2 1 
ATOM   1292 N  N   . LEU A 1 162 ? 28.856  3.785   4.620   1.00 19.37 ? 163 LEU A N   1 
ATOM   1293 C  CA  . LEU A 1 162 ? 27.549  4.104   5.151   1.00 19.01 ? 163 LEU A CA  1 
ATOM   1294 C  C   . LEU A 1 162 ? 27.423  3.693   6.621   1.00 18.63 ? 163 LEU A C   1 
ATOM   1295 O  O   . LEU A 1 162 ? 26.810  4.422   7.417   1.00 18.49 ? 163 LEU A O   1 
ATOM   1296 C  CB  . LEU A 1 162 ? 26.443  3.464   4.295   1.00 18.97 ? 163 LEU A CB  1 
ATOM   1297 C  CG  . LEU A 1 162 ? 26.178  4.125   2.933   1.00 20.60 ? 163 LEU A CG  1 
ATOM   1298 C  CD1 . LEU A 1 162 ? 25.159  3.314   2.168   1.00 20.76 ? 163 LEU A CD1 1 
ATOM   1299 C  CD2 . LEU A 1 162 ? 25.695  5.569   3.089   1.00 19.99 ? 163 LEU A CD2 1 
ATOM   1300 N  N   . PHE A 1 163 ? 27.982  2.537   6.986   1.00 18.59 ? 164 PHE A N   1 
ATOM   1301 C  CA  . PHE A 1 163 ? 28.052  2.178   8.424   1.00 18.92 ? 164 PHE A CA  1 
ATOM   1302 C  C   . PHE A 1 163 ? 28.835  3.227   9.227   1.00 18.41 ? 164 PHE A C   1 
ATOM   1303 O  O   . PHE A 1 163 ? 28.396  3.626   10.309  1.00 18.28 ? 164 PHE A O   1 
ATOM   1304 C  CB  . PHE A 1 163 ? 28.647  0.786   8.661   1.00 18.53 ? 164 PHE A CB  1 
ATOM   1305 C  CG  . PHE A 1 163 ? 27.826  -0.349  8.087   1.00 19.77 ? 164 PHE A CG  1 
ATOM   1306 C  CD1 . PHE A 1 163 ? 28.378  -1.202  7.145   1.00 21.10 ? 164 PHE A CD1 1 
ATOM   1307 C  CD2 . PHE A 1 163 ? 26.517  -0.576  8.503   1.00 20.47 ? 164 PHE A CD2 1 
ATOM   1308 C  CE1 . PHE A 1 163 ? 27.642  -2.260  6.605   1.00 22.02 ? 164 PHE A CE1 1 
ATOM   1309 C  CE2 . PHE A 1 163 ? 25.775  -1.635  7.984   1.00 21.75 ? 164 PHE A CE2 1 
ATOM   1310 C  CZ  . PHE A 1 163 ? 26.344  -2.478  7.028   1.00 22.67 ? 164 PHE A CZ  1 
ATOM   1311 N  N   . ARG A 1 164 ? 29.976  3.680   8.696   1.00 17.75 ? 165 ARG A N   1 
ATOM   1312 C  CA  . ARG A 1 164 ? 30.777  4.712   9.369   1.00 18.42 ? 165 ARG A CA  1 
ATOM   1313 C  C   . ARG A 1 164 ? 30.042  6.058   9.413   1.00 18.41 ? 165 ARG A C   1 
ATOM   1314 O  O   . ARG A 1 164 ? 30.147  6.804   10.390  1.00 18.14 ? 165 ARG A O   1 
ATOM   1315 C  CB  . ARG A 1 164 ? 32.164  4.885   8.726   1.00 18.54 ? 165 ARG A CB  1 
ATOM   1316 C  CG  . ARG A 1 164 ? 33.090  3.721   8.949   1.00 19.84 ? 165 ARG A CG  1 
ATOM   1317 C  CD  . ARG A 1 164 ? 34.503  3.953   8.377   1.00 19.44 ? 165 ARG A CD  1 
ATOM   1318 N  NE  . ARG A 1 164 ? 34.588  3.812   6.922   1.00 20.99 ? 165 ARG A NE  1 
ATOM   1319 C  CZ  . ARG A 1 164 ? 34.828  2.664   6.289   1.00 22.37 ? 165 ARG A CZ  1 
ATOM   1320 N  NH1 . ARG A 1 164 ? 35.004  1.544   6.983   1.00 21.67 ? 165 ARG A NH1 1 
ATOM   1321 N  NH2 . ARG A 1 164 ? 34.898  2.634   4.958   1.00 20.95 ? 165 ARG A NH2 1 
ATOM   1322 N  N   . PHE A 1 165 ? 29.282  6.350   8.358   1.00 18.44 ? 166 PHE A N   1 
ATOM   1323 C  CA  . PHE A 1 165 ? 28.440  7.543   8.346   1.00 18.30 ? 166 PHE A CA  1 
ATOM   1324 C  C   . PHE A 1 165 ? 27.374  7.505   9.455   1.00 18.25 ? 166 PHE A C   1 
ATOM   1325 O  O   . PHE A 1 165 ? 27.168  8.508   10.169  1.00 17.57 ? 166 PHE A O   1 
ATOM   1326 C  CB  . PHE A 1 165 ? 27.740  7.723   7.000   1.00 17.71 ? 166 PHE A CB  1 
ATOM   1327 C  CG  . PHE A 1 165 ? 26.629  8.729   7.049   1.00 19.32 ? 166 PHE A CG  1 
ATOM   1328 C  CD1 . PHE A 1 165 ? 26.912  10.093  7.057   1.00 18.22 ? 166 PHE A CD1 1 
ATOM   1329 C  CD2 . PHE A 1 165 ? 25.297  8.318   7.144   1.00 17.90 ? 166 PHE A CD2 1 
ATOM   1330 C  CE1 . PHE A 1 165 ? 25.892  11.031  7.143   1.00 18.48 ? 166 PHE A CE1 1 
ATOM   1331 C  CE2 . PHE A 1 165 ? 24.283  9.248   7.220   1.00 19.22 ? 166 PHE A CE2 1 
ATOM   1332 C  CZ  . PHE A 1 165 ? 24.578  10.609  7.231   1.00 19.16 ? 166 PHE A CZ  1 
ATOM   1333 N  N   . ALA A 1 166 ? 26.674  6.368   9.565   1.00 18.12 ? 167 ALA A N   1 
ATOM   1334 C  CA  . ALA A 1 166 ? 25.609  6.212   10.578  1.00 17.92 ? 167 ALA A CA  1 
ATOM   1335 C  C   . ALA A 1 166 ? 26.178  6.312   11.987  1.00 17.76 ? 167 ALA A C   1 
ATOM   1336 O  O   . ALA A 1 166 ? 25.562  6.914   12.867  1.00 18.69 ? 167 ALA A O   1 
ATOM   1337 C  CB  . ALA A 1 166 ? 24.873  4.874   10.406  1.00 17.61 ? 167 ALA A CB  1 
ATOM   1338 N  N   . PHE A 1 167 ? 27.336  5.701   12.200  1.00 17.84 ? 168 PHE A N   1 
ATOM   1339 C  CA  . PHE A 1 167 ? 28.037  5.767   13.495  1.00 18.64 ? 168 PHE A CA  1 
ATOM   1340 C  C   . PHE A 1 167 ? 28.462  7.200   13.867  1.00 18.94 ? 168 PHE A C   1 
ATOM   1341 O  O   . PHE A 1 167 ? 28.231  7.659   14.983  1.00 18.87 ? 168 PHE A O   1 
ATOM   1342 C  CB  . PHE A 1 167 ? 29.259  4.857   13.481  1.00 17.66 ? 168 PHE A CB  1 
ATOM   1343 C  CG  . PHE A 1 167 ? 30.109  4.949   14.726  1.00 20.32 ? 168 PHE A CG  1 
ATOM   1344 C  CD1 . PHE A 1 167 ? 29.753  4.264   15.887  1.00 20.79 ? 168 PHE A CD1 1 
ATOM   1345 C  CD2 . PHE A 1 167 ? 31.262  5.710   14.735  1.00 21.70 ? 168 PHE A CD2 1 
ATOM   1346 C  CE1 . PHE A 1 167 ? 30.545  4.342   17.037  1.00 23.02 ? 168 PHE A CE1 1 
ATOM   1347 C  CE2 . PHE A 1 167 ? 32.058  5.803   15.884  1.00 24.64 ? 168 PHE A CE2 1 
ATOM   1348 C  CZ  . PHE A 1 167 ? 31.699  5.112   17.036  1.00 22.50 ? 168 PHE A CZ  1 
ATOM   1349 N  N   . GLU A 1 168 ? 29.116  7.883   12.936  1.00 19.60 ? 169 GLU A N   1 
ATOM   1350 C  CA  . GLU A 1 168 ? 29.458  9.296   13.115  1.00 19.84 ? 169 GLU A CA  1 
ATOM   1351 C  C   . GLU A 1 168 ? 28.253  10.186  13.434  1.00 19.91 ? 169 GLU A C   1 
ATOM   1352 O  O   . GLU A 1 168 ? 28.362  11.096  14.272  1.00 19.69 ? 169 GLU A O   1 
ATOM   1353 C  CB  . GLU A 1 168 ? 30.173  9.828   11.871  1.00 20.22 ? 169 GLU A CB  1 
ATOM   1354 C  CG  . GLU A 1 168 ? 30.923  11.138  12.118  1.00 20.87 ? 169 GLU A CG  1 
ATOM   1355 C  CD  . GLU A 1 168 ? 32.296  10.941  12.738  1.00 23.02 ? 169 GLU A CD  1 
ATOM   1356 O  OE1 . GLU A 1 168 ? 32.649  9.799   13.107  1.00 23.64 ? 169 GLU A OE1 1 
ATOM   1357 O  OE2 . GLU A 1 168 ? 33.037  11.943  12.855  1.00 23.97 ? 169 GLU A OE2 1 
ATOM   1358 N  N   . SER A 1 169 ? 27.126  9.943   12.755  1.00 19.73 ? 170 SER A N   1 
ATOM   1359 C  CA  . SER A 1 169 ? 25.905  10.720  12.960  1.00 20.41 ? 170 SER A CA  1 
ATOM   1360 C  C   . SER A 1 169 ? 25.313  10.517  14.361  1.00 20.90 ? 170 SER A C   1 
ATOM   1361 O  O   . SER A 1 169 ? 25.035  11.486  15.064  1.00 21.26 ? 170 SER A O   1 
ATOM   1362 C  CB  . SER A 1 169 ? 24.849  10.384  11.896  1.00 19.70 ? 170 SER A CB  1 
ATOM   1363 O  OG  . SER A 1 169 ? 25.327  10.691  10.598  1.00 20.62 ? 170 SER A OG  1 
ATOM   1364 N  N   . ILE A 1 170 ? 25.129  9.259   14.760  1.00 20.86 ? 171 ILE A N   1 
ATOM   1365 C  CA  . ILE A 1 170 ? 24.561  8.962   16.080  1.00 20.72 ? 171 ILE A CA  1 
ATOM   1366 C  C   . ILE A 1 170 ? 25.477  9.408   17.233  1.00 20.99 ? 171 ILE A C   1 
ATOM   1367 O  O   . ILE A 1 170 ? 25.001  9.942   18.239  1.00 21.01 ? 171 ILE A O   1 
ATOM   1368 C  CB  . ILE A 1 170 ? 24.127  7.467   16.213  1.00 20.64 ? 171 ILE A CB  1 
ATOM   1369 C  CG1 . ILE A 1 170 ? 23.219  7.259   17.430  1.00 21.30 ? 171 ILE A CG1 1 
ATOM   1370 C  CG2 . ILE A 1 170 ? 25.343  6.520   16.261  1.00 19.63 ? 171 ILE A CG2 1 
ATOM   1371 C  CD1 . ILE A 1 170 ? 21.884  8.000   17.359  1.00 21.72 ? 171 ILE A CD1 1 
ATOM   1372 N  N   . THR A 1 171 ? 26.784  9.227   17.070  1.00 21.30 ? 172 THR A N   1 
ATOM   1373 C  CA  . THR A 1 171 ? 27.732  9.680   18.072  1.00 21.48 ? 172 THR A CA  1 
ATOM   1374 C  C   . THR A 1 171 ? 27.795  11.200  18.158  1.00 22.19 ? 172 THR A C   1 
ATOM   1375 O  O   . THR A 1 171 ? 27.988  11.749  19.242  1.00 22.17 ? 172 THR A O   1 
ATOM   1376 C  CB  . THR A 1 171 ? 29.154  9.097   17.858  1.00 21.71 ? 172 THR A CB  1 
ATOM   1377 O  OG1 . THR A 1 171 ? 29.632  9.413   16.539  1.00 22.40 ? 172 THR A OG1 1 
ATOM   1378 C  CG2 . THR A 1 171 ? 29.157  7.585   18.053  1.00 19.12 ? 172 THR A CG2 1 
ATOM   1379 N  N   . ASN A 1 172 ? 27.625  11.883  17.028  1.00 22.90 ? 173 ASN A N   1 
ATOM   1380 C  CA  . ASN A 1 172 ? 27.645  13.346  17.038  1.00 23.77 ? 173 ASN A CA  1 
ATOM   1381 C  C   . ASN A 1 172 ? 26.449  13.947  17.787  1.00 24.23 ? 173 ASN A C   1 
ATOM   1382 O  O   . ASN A 1 172 ? 26.626  14.892  18.555  1.00 24.67 ? 173 ASN A O   1 
ATOM   1383 C  CB  . ASN A 1 172 ? 27.772  13.939  15.618  1.00 23.63 ? 173 ASN A CB  1 
ATOM   1384 C  CG  . ASN A 1 172 ? 28.469  15.307  15.610  1.00 24.91 ? 173 ASN A CG  1 
ATOM   1385 O  OD1 . ASN A 1 172 ? 29.285  15.618  16.495  1.00 25.37 ? 173 ASN A OD1 1 
ATOM   1386 N  ND2 . ASN A 1 172 ? 28.167  16.116  14.601  1.00 23.08 ? 173 ASN A ND2 1 
ATOM   1387 N  N   . VAL A 1 173 ? 25.246  13.395  17.589  1.00 24.05 ? 174 VAL A N   1 
ATOM   1388 C  CA  . VAL A 1 173 ? 24.074  13.886  18.327  1.00 24.26 ? 174 VAL A CA  1 
ATOM   1389 C  C   . VAL A 1 173 ? 24.060  13.464  19.806  1.00 24.18 ? 174 VAL A C   1 
ATOM   1390 O  O   . VAL A 1 173 ? 23.537  14.183  20.652  1.00 23.37 ? 174 VAL A O   1 
ATOM   1391 C  CB  . VAL A 1 173 ? 22.707  13.592  17.621  1.00 24.34 ? 174 VAL A CB  1 
ATOM   1392 C  CG1 . VAL A 1 173 ? 22.708  14.194  16.222  1.00 24.98 ? 174 VAL A CG1 1 
ATOM   1393 C  CG2 . VAL A 1 173 ? 22.389  12.098  17.577  1.00 24.25 ? 174 VAL A CG2 1 
ATOM   1394 N  N   . ILE A 1 174 ? 24.663  12.320  20.109  1.00 24.12 ? 175 ILE A N   1 
ATOM   1395 C  CA  . ILE A 1 174 ? 24.731  11.857  21.487  1.00 24.47 ? 175 ILE A CA  1 
ATOM   1396 C  C   . ILE A 1 174 ? 25.807  12.608  22.263  1.00 24.60 ? 175 ILE A C   1 
ATOM   1397 O  O   . ILE A 1 174 ? 25.524  13.185  23.319  1.00 25.10 ? 175 ILE A O   1 
ATOM   1398 C  CB  . ILE A 1 174 ? 24.897  10.299  21.587  1.00 24.13 ? 175 ILE A CB  1 
ATOM   1399 C  CG1 . ILE A 1 174 ? 23.605  9.612   21.153  1.00 24.36 ? 175 ILE A CG1 1 
ATOM   1400 C  CG2 . ILE A 1 174 ? 25.240  9.871   23.011  1.00 24.66 ? 175 ILE A CG2 1 
ATOM   1401 C  CD1 . ILE A 1 174 ? 23.681  8.098   21.151  1.00 24.61 ? 175 ILE A CD1 1 
ATOM   1402 N  N   . PHE A 1 175 ? 27.016  12.639  21.718  1.00 24.53 ? 176 PHE A N   1 
ATOM   1403 C  CA  . PHE A 1 175 ? 28.168  13.162  22.423  1.00 25.26 ? 176 PHE A CA  1 
ATOM   1404 C  C   . PHE A 1 175 ? 28.528  14.613  22.100  1.00 25.89 ? 176 PHE A C   1 
ATOM   1405 O  O   . PHE A 1 175 ? 29.322  15.225  22.810  1.00 25.29 ? 176 PHE A O   1 
ATOM   1406 C  CB  . PHE A 1 175 ? 29.383  12.248  22.200  1.00 24.65 ? 176 PHE A CB  1 
ATOM   1407 C  CG  . PHE A 1 175 ? 29.184  10.853  22.723  1.00 25.40 ? 176 PHE A CG  1 
ATOM   1408 C  CD1 . PHE A 1 175 ? 29.062  9.777   21.851  1.00 26.34 ? 176 PHE A CD1 1 
ATOM   1409 C  CD2 . PHE A 1 175 ? 29.095  10.614  24.090  1.00 24.57 ? 176 PHE A CD2 1 
ATOM   1410 C  CE1 . PHE A 1 175 ? 28.867  8.481   22.346  1.00 27.51 ? 176 PHE A CE1 1 
ATOM   1411 C  CE2 . PHE A 1 175 ? 28.904  9.329   24.583  1.00 26.33 ? 176 PHE A CE2 1 
ATOM   1412 C  CZ  . PHE A 1 175 ? 28.788  8.260   23.706  1.00 25.89 ? 176 PHE A CZ  1 
ATOM   1413 N  N   . GLY A 1 176 ? 27.935  15.158  21.039  1.00 27.00 ? 177 GLY A N   1 
ATOM   1414 C  CA  . GLY A 1 176 ? 28.340  16.464  20.511  1.00 27.69 ? 177 GLY A CA  1 
ATOM   1415 C  C   . GLY A 1 176 ? 29.804  16.505  20.093  1.00 28.22 ? 177 GLY A C   1 
ATOM   1416 O  O   . GLY A 1 176 ? 30.411  17.564  20.091  1.00 28.20 ? 177 GLY A O   1 
ATOM   1417 N  N   . GLU A 1 177 ? 30.378  15.354  19.755  1.00 28.78 ? 178 GLU A N   1 
ATOM   1418 C  CA  . GLU A 1 177 ? 31.794  15.281  19.400  1.00 29.58 ? 178 GLU A CA  1 
ATOM   1419 C  C   . GLU A 1 177 ? 31.995  14.377  18.184  1.00 28.79 ? 178 GLU A C   1 
ATOM   1420 O  O   . GLU A 1 177 ? 31.398  13.303  18.110  1.00 28.28 ? 178 GLU A O   1 
ATOM   1421 C  CB  . GLU A 1 177 ? 32.615  14.732  20.569  1.00 30.14 ? 178 GLU A CB  1 
ATOM   1422 C  CG  . GLU A 1 177 ? 32.651  15.630  21.807  1.00 35.52 ? 178 GLU A CG  1 
ATOM   1423 C  CD  . GLU A 1 177 ? 33.321  14.966  23.010  1.00 40.92 ? 178 GLU A CD  1 
ATOM   1424 O  OE1 . GLU A 1 177 ? 33.095  13.750  23.241  1.00 43.29 ? 178 GLU A OE1 1 
ATOM   1425 O  OE2 . GLU A 1 177 ? 34.063  15.670  23.735  1.00 43.80 ? 178 GLU A OE2 1 
ATOM   1426 N  N   . ARG A 1 178 ? 32.840  14.818  17.253  1.00 28.04 ? 179 ARG A N   1 
ATOM   1427 C  CA  . ARG A 1 178 ? 33.185  14.036  16.067  1.00 27.73 ? 179 ARG A CA  1 
ATOM   1428 C  C   . ARG A 1 178 ? 34.134  12.912  16.417  1.00 27.93 ? 179 ARG A C   1 
ATOM   1429 O  O   . ARG A 1 178 ? 35.151  13.136  17.071  1.00 27.92 ? 179 ARG A O   1 
ATOM   1430 C  CB  . ARG A 1 178 ? 33.796  14.922  14.968  1.00 27.30 ? 179 ARG A CB  1 
ATOM   1431 C  CG  . ARG A 1 178 ? 32.815  15.956  14.409  1.00 26.09 ? 179 ARG A CG  1 
ATOM   1432 C  CD  . ARG A 1 178 ? 31.578  15.272  13.752  1.00 25.12 ? 179 ARG A CD  1 
ATOM   1433 N  NE  . ARG A 1 178 ? 31.955  14.518  12.556  1.00 23.87 ? 179 ARG A NE  1 
ATOM   1434 C  CZ  . ARG A 1 178 ? 32.117  15.067  11.351  1.00 24.38 ? 179 ARG A CZ  1 
ATOM   1435 N  NH1 . ARG A 1 178 ? 31.921  16.369  11.173  1.00 22.56 ? 179 ARG A NH1 1 
ATOM   1436 N  NH2 . ARG A 1 178 ? 32.471  14.316  10.320  1.00 23.36 ? 179 ARG A NH2 1 
ATOM   1437 N  N   . GLN A 1 179 ? 33.797  11.705  15.965  1.00 27.87 ? 180 GLN A N   1 
ATOM   1438 C  CA  . GLN A 1 179 ? 34.648  10.535  16.162  1.00 28.09 ? 180 GLN A CA  1 
ATOM   1439 C  C   . GLN A 1 179 ? 35.741  10.372  15.098  1.00 27.71 ? 180 GLN A C   1 
ATOM   1440 O  O   . GLN A 1 179 ? 36.651  9.559   15.272  1.00 27.69 ? 180 GLN A O   1 
ATOM   1441 C  CB  . GLN A 1 179 ? 33.793  9.269   16.261  1.00 27.77 ? 180 GLN A CB  1 
ATOM   1442 C  CG  . GLN A 1 179 ? 32.750  9.313   17.381  1.00 29.29 ? 180 GLN A CG  1 
ATOM   1443 C  CD  . GLN A 1 179 ? 33.350  9.534   18.764  1.00 33.58 ? 180 GLN A CD  1 
ATOM   1444 O  OE1 . GLN A 1 179 ? 34.144  8.721   19.244  1.00 35.12 ? 180 GLN A OE1 1 
ATOM   1445 N  NE2 . GLN A 1 179 ? 32.960  10.630  19.414  1.00 33.26 ? 180 GLN A NE2 1 
ATOM   1446 N  N   . GLY A 1 180 ? 35.650  11.134  14.005  1.00 27.49 ? 181 GLY A N   1 
ATOM   1447 C  CA  . GLY A 1 180 ? 36.665  11.089  12.935  1.00 27.35 ? 181 GLY A CA  1 
ATOM   1448 C  C   . GLY A 1 180 ? 36.529  9.924   11.954  1.00 27.73 ? 181 GLY A C   1 
ATOM   1449 O  O   . GLY A 1 180 ? 37.464  9.635   11.197  1.00 27.86 ? 181 GLY A O   1 
ATOM   1450 N  N   . MET A 1 181 ? 35.367  9.263   11.942  1.00 27.60 ? 182 MET A N   1 
ATOM   1451 C  CA  . MET A 1 181 ? 35.189  8.050   11.135  1.00 27.92 ? 182 MET A CA  1 
ATOM   1452 C  C   . MET A 1 181 ? 35.053  8.313   9.637   1.00 28.18 ? 182 MET A C   1 
ATOM   1453 O  O   . MET A 1 181 ? 35.042  7.377   8.853   1.00 28.06 ? 182 MET A O   1 
ATOM   1454 C  CB  . MET A 1 181 ? 34.021  7.183   11.640  1.00 28.44 ? 182 MET A CB  1 
ATOM   1455 C  CG  . MET A 1 181 ? 34.219  6.592   13.042  1.00 28.95 ? 182 MET A CG  1 
ATOM   1456 S  SD  . MET A 1 181 ? 35.833  5.810   13.296  1.00 33.55 ? 182 MET A SD  1 
ATOM   1457 C  CE  . MET A 1 181 ? 35.555  4.207   12.529  1.00 29.44 ? 182 MET A CE  1 
ATOM   1458 N  N   . LEU A 1 182 ? 34.963  9.578   9.236   1.00 28.78 ? 183 LEU A N   1 
ATOM   1459 C  CA  . LEU A 1 182 ? 34.944  9.901   7.812   1.00 30.07 ? 183 LEU A CA  1 
ATOM   1460 C  C   . LEU A 1 182 ? 36.299  10.424  7.271   1.00 31.32 ? 183 LEU A C   1 
ATOM   1461 O  O   . LEU A 1 182 ? 36.401  10.794  6.104   1.00 31.15 ? 183 LEU A O   1 
ATOM   1462 C  CB  . LEU A 1 182 ? 33.754  10.812  7.462   1.00 29.31 ? 183 LEU A CB  1 
ATOM   1463 C  CG  . LEU A 1 182 ? 32.330  10.264  7.713   1.00 28.81 ? 183 LEU A CG  1 
ATOM   1464 C  CD1 . LEU A 1 182 ? 31.277  11.290  7.272   1.00 26.86 ? 183 LEU A CD1 1 
ATOM   1465 C  CD2 . LEU A 1 182 ? 32.079  8.921   7.031   1.00 27.39 ? 183 LEU A CD2 1 
ATOM   1466 N  N   . GLU A 1 183 ? 37.330  10.431  8.125   1.00 33.04 ? 184 GLU A N   1 
ATOM   1467 C  CA  . GLU A 1 183 ? 38.705  10.786  7.724   1.00 34.89 ? 184 GLU A CA  1 
ATOM   1468 C  C   . GLU A 1 183 ? 39.359  9.626   6.992   1.00 35.52 ? 184 GLU A C   1 
ATOM   1469 O  O   . GLU A 1 183 ? 38.867  8.495   7.057   1.00 35.35 ? 184 GLU A O   1 
ATOM   1470 C  CB  . GLU A 1 183 ? 39.549  11.165  8.949   1.00 35.19 ? 184 GLU A CB  1 
ATOM   1471 C  CG  . GLU A 1 183 ? 39.009  12.367  9.721   1.00 39.11 ? 184 GLU A CG  1 
ATOM   1472 C  CD  . GLU A 1 183 ? 39.113  13.667  8.928   1.00 44.15 ? 184 GLU A CD  1 
ATOM   1473 O  OE1 . GLU A 1 183 ? 38.065  14.171  8.453   1.00 46.29 ? 184 GLU A OE1 1 
ATOM   1474 O  OE2 . GLU A 1 183 ? 40.250  14.178  8.767   1.00 46.44 ? 184 GLU A OE2 1 
ATOM   1475 N  N   . GLU A 1 184 ? 40.474  9.892   6.307   1.00 36.47 ? 185 GLU A N   1 
ATOM   1476 C  CA  . GLU A 1 184 ? 41.180  8.832   5.575   1.00 37.44 ? 185 GLU A CA  1 
ATOM   1477 C  C   . GLU A 1 184 ? 41.774  7.800   6.521   1.00 37.34 ? 185 GLU A C   1 
ATOM   1478 O  O   . GLU A 1 184 ? 41.830  6.624   6.195   1.00 37.23 ? 185 GLU A O   1 
ATOM   1479 C  CB  . GLU A 1 184 ? 42.261  9.399   4.642   1.00 37.98 ? 185 GLU A CB  1 
ATOM   1480 C  CG  . GLU A 1 184 ? 41.729  10.377  3.594   1.00 40.75 ? 185 GLU A CG  1 
ATOM   1481 C  CD  . GLU A 1 184 ? 42.600  10.453  2.338   1.00 45.43 ? 185 GLU A CD  1 
ATOM   1482 O  OE1 . GLU A 1 184 ? 43.076  9.390   1.868   1.00 47.39 ? 185 GLU A OE1 1 
ATOM   1483 O  OE2 . GLU A 1 184 ? 42.795  11.578  1.812   1.00 46.56 ? 185 GLU A OE2 1 
ATOM   1484 N  N   . VAL A 1 185 ? 42.206  8.246   7.696   1.00 37.80 ? 186 VAL A N   1 
ATOM   1485 C  CA  . VAL A 1 185 ? 42.762  7.349   8.710   1.00 38.16 ? 186 VAL A CA  1 
ATOM   1486 C  C   . VAL A 1 185 ? 41.795  7.311   9.888   1.00 38.24 ? 186 VAL A C   1 
ATOM   1487 O  O   . VAL A 1 185 ? 41.471  8.342   10.477  1.00 38.32 ? 186 VAL A O   1 
ATOM   1488 C  CB  . VAL A 1 185 ? 44.189  7.771   9.145   1.00 38.21 ? 186 VAL A CB  1 
ATOM   1489 C  CG1 . VAL A 1 185 ? 44.631  7.000   10.386  1.00 38.80 ? 186 VAL A CG1 1 
ATOM   1490 C  CG2 . VAL A 1 185 ? 45.173  7.553   7.994   1.00 38.41 ? 186 VAL A CG2 1 
ATOM   1491 N  N   . VAL A 1 186 ? 41.341  6.108   10.212  1.00 38.23 ? 187 VAL A N   1 
ATOM   1492 C  CA  . VAL A 1 186 ? 40.160  5.920   11.038  1.00 38.43 ? 187 VAL A CA  1 
ATOM   1493 C  C   . VAL A 1 186 ? 40.537  5.281   12.369  1.00 37.90 ? 187 VAL A C   1 
ATOM   1494 O  O   . VAL A 1 186 ? 41.506  4.535   12.440  1.00 38.34 ? 187 VAL A O   1 
ATOM   1495 C  CB  . VAL A 1 186 ? 39.106  5.070   10.236  1.00 38.58 ? 187 VAL A CB  1 
ATOM   1496 C  CG1 . VAL A 1 186 ? 38.512  3.939   11.064  1.00 38.63 ? 187 VAL A CG1 1 
ATOM   1497 C  CG2 . VAL A 1 186 ? 38.042  5.974   9.602   1.00 38.57 ? 187 VAL A CG2 1 
ATOM   1498 N  N   . ASN A 1 187 ? 39.785  5.600   13.422  1.00 37.27 ? 188 ASN A N   1 
ATOM   1499 C  CA  . ASN A 1 187 ? 39.968  4.964   14.723  1.00 36.22 ? 188 ASN A CA  1 
ATOM   1500 C  C   . ASN A 1 187 ? 39.590  3.471   14.642  1.00 35.29 ? 188 ASN A C   1 
ATOM   1501 O  O   . ASN A 1 187 ? 38.419  3.139   14.447  1.00 34.83 ? 188 ASN A O   1 
ATOM   1502 C  CB  . ASN A 1 187 ? 39.132  5.694   15.788  1.00 36.60 ? 188 ASN A CB  1 
ATOM   1503 C  CG  . ASN A 1 187 ? 39.356  5.150   17.194  1.00 37.95 ? 188 ASN A CG  1 
ATOM   1504 O  OD1 . ASN A 1 187 ? 39.873  4.050   17.375  1.00 40.85 ? 188 ASN A OD1 1 
ATOM   1505 N  ND2 . ASN A 1 187 ? 38.972  5.928   18.198  1.00 40.09 ? 188 ASN A ND2 1 
ATOM   1506 N  N   . PRO A 1 188 ? 40.583  2.567   14.778  1.00 34.34 ? 189 PRO A N   1 
ATOM   1507 C  CA  . PRO A 1 188 ? 40.291  1.133   14.657  1.00 33.24 ? 189 PRO A CA  1 
ATOM   1508 C  C   . PRO A 1 188 ? 39.401  0.586   15.784  1.00 32.19 ? 189 PRO A C   1 
ATOM   1509 O  O   . PRO A 1 188 ? 38.691  -0.400  15.586  1.00 31.23 ? 189 PRO A O   1 
ATOM   1510 C  CB  . PRO A 1 188 ? 41.677  0.480   14.688  1.00 33.63 ? 189 PRO A CB  1 
ATOM   1511 C  CG  . PRO A 1 188 ? 42.552  1.463   15.409  1.00 34.67 ? 189 PRO A CG  1 
ATOM   1512 C  CD  . PRO A 1 188 ? 42.008  2.826   15.079  1.00 34.64 ? 189 PRO A CD  1 
ATOM   1513 N  N   . GLU A 1 189 ? 39.426  1.231   16.944  1.00 31.01 ? 190 GLU A N   1 
ATOM   1514 C  CA  . GLU A 1 189 ? 38.595  0.798   18.061  1.00 30.46 ? 190 GLU A CA  1 
ATOM   1515 C  C   . GLU A 1 189 ? 37.116  1.134   17.843  1.00 28.94 ? 190 GLU A C   1 
ATOM   1516 O  O   . GLU A 1 189 ? 36.239  0.355   18.212  1.00 27.84 ? 190 GLU A O   1 
ATOM   1517 C  CB  . GLU A 1 189 ? 39.128  1.324   19.405  1.00 31.45 ? 190 GLU A CB  1 
ATOM   1518 C  CG  . GLU A 1 189 ? 40.493  0.701   19.816  1.00 34.54 ? 190 GLU A CG  1 
ATOM   1519 C  CD  . GLU A 1 189 ? 40.516  -0.832  19.697  1.00 40.30 ? 190 GLU A CD  1 
ATOM   1520 O  OE1 . GLU A 1 189 ? 39.674  -1.496  20.350  1.00 41.84 ? 190 GLU A OE1 1 
ATOM   1521 O  OE2 . GLU A 1 189 ? 41.368  -1.372  18.939  1.00 42.64 ? 190 GLU A OE2 1 
ATOM   1522 N  N   . ALA A 1 190 ? 36.855  2.286   17.230  1.00 27.45 ? 191 ALA A N   1 
ATOM   1523 C  CA  . ALA A 1 190 ? 35.513  2.623   16.752  1.00 26.43 ? 191 ALA A CA  1 
ATOM   1524 C  C   . ALA A 1 190 ? 35.064  1.679   15.605  1.00 25.47 ? 191 ALA A C   1 
ATOM   1525 O  O   . ALA A 1 190 ? 33.905  1.267   15.570  1.00 24.76 ? 191 ALA A O   1 
ATOM   1526 C  CB  . ALA A 1 190 ? 35.444  4.084   16.327  1.00 25.85 ? 191 ALA A CB  1 
ATOM   1527 N  N   . GLN A 1 191 ? 35.974  1.323   14.691  1.00 24.44 ? 192 GLN A N   1 
ATOM   1528 C  CA  . GLN A 1 191 ? 35.646  0.343   13.640  1.00 24.13 ? 192 GLN A CA  1 
ATOM   1529 C  C   . GLN A 1 191 ? 35.249  -1.027  14.231  1.00 24.33 ? 192 GLN A C   1 
ATOM   1530 O  O   . GLN A 1 191 ? 34.299  -1.675  13.756  1.00 23.51 ? 192 GLN A O   1 
ATOM   1531 C  CB  . GLN A 1 191 ? 36.779  0.195   12.617  1.00 24.33 ? 192 GLN A CB  1 
ATOM   1532 C  CG  . GLN A 1 191 ? 36.391  -0.641  11.394  1.00 23.94 ? 192 GLN A CG  1 
ATOM   1533 C  CD  . GLN A 1 191 ? 35.331  0.043   10.519  1.00 24.59 ? 192 GLN A CD  1 
ATOM   1534 O  OE1 . GLN A 1 191 ? 35.568  1.117   9.983   1.00 26.56 ? 192 GLN A OE1 1 
ATOM   1535 N  NE2 . GLN A 1 191 ? 34.164  -0.585  10.377  1.00 23.15 ? 192 GLN A NE2 1 
ATOM   1536 N  N   . ARG A 1 192 ? 35.971  -1.448  15.269  1.00 23.93 ? 193 ARG A N   1 
ATOM   1537 C  CA  . ARG A 1 192 ? 35.602  -2.632  16.050  1.00 24.55 ? 193 ARG A CA  1 
ATOM   1538 C  C   . ARG A 1 192 ? 34.181  -2.555  16.624  1.00 23.41 ? 193 ARG A C   1 
ATOM   1539 O  O   . ARG A 1 192 ? 33.447  -3.532  16.561  1.00 23.02 ? 193 ARG A O   1 
ATOM   1540 C  CB  . ARG A 1 192 ? 36.621  -2.889  17.174  1.00 24.97 ? 193 ARG A CB  1 
ATOM   1541 C  CG  . ARG A 1 192 ? 37.779  -3.828  16.773  1.00 29.69 ? 193 ARG A CG  1 
ATOM   1542 C  CD  . ARG A 1 192 ? 38.744  -4.154  17.957  1.00 34.20 ? 193 ARG A CD  1 
ATOM   1543 N  NE  . ARG A 1 192 ? 38.066  -4.201  19.264  1.00 38.89 ? 193 ARG A NE  1 
ATOM   1544 C  CZ  . ARG A 1 192 ? 37.639  -5.309  19.874  1.00 40.77 ? 193 ARG A CZ  1 
ATOM   1545 N  NH1 . ARG A 1 192 ? 37.812  -6.498  19.323  1.00 42.45 ? 193 ARG A NH1 1 
ATOM   1546 N  NH2 . ARG A 1 192 ? 37.035  -5.232  21.049  1.00 41.67 ? 193 ARG A NH2 1 
ATOM   1547 N  N   . PHE A 1 193 ? 33.805  -1.405  17.185  1.00 22.34 ? 194 PHE A N   1 
ATOM   1548 C  CA  . PHE A 1 193 ? 32.438  -1.212  17.658  1.00 21.94 ? 194 PHE A CA  1 
ATOM   1549 C  C   . PHE A 1 193 ? 31.425  -1.401  16.507  1.00 21.21 ? 194 PHE A C   1 
ATOM   1550 O  O   . PHE A 1 193 ? 30.475  -2.187  16.630  1.00 20.76 ? 194 PHE A O   1 
ATOM   1551 C  CB  . PHE A 1 193 ? 32.263  0.151   18.352  1.00 21.87 ? 194 PHE A CB  1 
ATOM   1552 C  CG  . PHE A 1 193 ? 30.862  0.395   18.866  1.00 23.09 ? 194 PHE A CG  1 
ATOM   1553 C  CD1 . PHE A 1 193 ? 30.485  -0.040  20.124  1.00 24.52 ? 194 PHE A CD1 1 
ATOM   1554 C  CD2 . PHE A 1 193 ? 29.924  1.050   18.082  1.00 25.48 ? 194 PHE A CD2 1 
ATOM   1555 C  CE1 . PHE A 1 193 ? 29.206  0.178   20.605  1.00 25.69 ? 194 PHE A CE1 1 
ATOM   1556 C  CE2 . PHE A 1 193 ? 28.629  1.276   18.555  1.00 27.55 ? 194 PHE A CE2 1 
ATOM   1557 C  CZ  . PHE A 1 193 ? 28.271  0.822   19.826  1.00 27.03 ? 194 PHE A CZ  1 
ATOM   1558 N  N   . ILE A 1 194 ? 31.661  -0.709  15.390  1.00 20.67 ? 195 ILE A N   1 
ATOM   1559 C  CA  . ILE A 1 194 ? 30.811  -0.828  14.194  1.00 20.34 ? 195 ILE A CA  1 
ATOM   1560 C  C   . ILE A 1 194 ? 30.622  -2.280  13.741  1.00 20.65 ? 195 ILE A C   1 
ATOM   1561 O  O   . ILE A 1 194 ? 29.492  -2.707  13.497  1.00 20.88 ? 195 ILE A O   1 
ATOM   1562 C  CB  . ILE A 1 194 ? 31.336  0.032   12.998  1.00 20.06 ? 195 ILE A CB  1 
ATOM   1563 C  CG1 . ILE A 1 194 ? 31.169  1.523   13.285  1.00 19.60 ? 195 ILE A CG1 1 
ATOM   1564 C  CG2 . ILE A 1 194 ? 30.591  -0.355  11.679  1.00 20.03 ? 195 ILE A CG2 1 
ATOM   1565 C  CD1 . ILE A 1 194 ? 32.028  2.442   12.391  1.00 20.42 ? 195 ILE A CD1 1 
ATOM   1566 N  N   . ASP A 1 195 ? 31.724  -3.019  13.619  1.00 20.74 ? 196 ASP A N   1 
ATOM   1567 C  CA  . ASP A 1 195 ? 31.701  -4.415  13.179  1.00 21.53 ? 196 ASP A CA  1 
ATOM   1568 C  C   . ASP A 1 195 ? 30.991  -5.336  14.179  1.00 20.58 ? 196 ASP A C   1 
ATOM   1569 O  O   . ASP A 1 195 ? 30.373  -6.308  13.782  1.00 20.78 ? 196 ASP A O   1 
ATOM   1570 C  CB  . ASP A 1 195 ? 33.127  -4.941  12.942  1.00 21.99 ? 196 ASP A CB  1 
ATOM   1571 C  CG  . ASP A 1 195 ? 33.868  -4.192  11.841  1.00 25.03 ? 196 ASP A CG  1 
ATOM   1572 O  OD1 . ASP A 1 195 ? 33.242  -3.444  11.053  1.00 26.35 ? 196 ASP A OD1 1 
ATOM   1573 O  OD2 . ASP A 1 195 ? 35.106  -4.367  11.757  1.00 29.45 ? 196 ASP A OD2 1 
ATOM   1574 N  N   . ALA A 1 196 ? 31.075  -5.021  15.468  1.00 19.83 ? 197 ALA A N   1 
ATOM   1575 C  CA  . ALA A 1 196 ? 30.414  -5.827  16.496  1.00 19.19 ? 197 ALA A CA  1 
ATOM   1576 C  C   . ALA A 1 196 ? 28.902  -5.734  16.413  1.00 19.01 ? 197 ALA A C   1 
ATOM   1577 O  O   . ALA A 1 196 ? 28.218  -6.704  16.719  1.00 18.81 ? 197 ALA A O   1 
ATOM   1578 C  CB  . ALA A 1 196 ? 30.884  -5.445  17.872  1.00 19.05 ? 197 ALA A CB  1 
ATOM   1579 N  N   . ILE A 1 197 ? 28.390  -4.571  16.002  1.00 19.00 ? 198 ILE A N   1 
ATOM   1580 C  CA  . ILE A 1 197 ? 26.943  -4.371  15.878  1.00 19.18 ? 198 ILE A CA  1 
ATOM   1581 C  C   . ILE A 1 197 ? 26.389  -5.277  14.796  1.00 19.16 ? 198 ILE A C   1 
ATOM   1582 O  O   . ILE A 1 197 ? 25.406  -5.962  15.012  1.00 18.54 ? 198 ILE A O   1 
ATOM   1583 C  CB  . ILE A 1 197 ? 26.561  -2.891  15.602  1.00 19.45 ? 198 ILE A CB  1 
ATOM   1584 C  CG1 . ILE A 1 197 ? 26.811  -2.050  16.870  1.00 20.03 ? 198 ILE A CG1 1 
ATOM   1585 C  CG2 . ILE A 1 197 ? 25.104  -2.789  15.180  1.00 17.94 ? 198 ILE A CG2 1 
ATOM   1586 C  CD1 . ILE A 1 197 ? 26.904  -0.571  16.613  1.00 22.19 ? 198 ILE A CD1 1 
ATOM   1587 N  N   . TYR A 1 198 ? 27.026  -5.279  13.631  1.00 19.67 ? 199 TYR A N   1 
ATOM   1588 C  CA  . TYR A 1 198 ? 26.615  -6.177  12.575  1.00 20.82 ? 199 TYR A CA  1 
ATOM   1589 C  C   . TYR A 1 198 ? 26.687  -7.636  13.052  1.00 20.33 ? 199 TYR A C   1 
ATOM   1590 O  O   . TYR A 1 198 ? 25.788  -8.421  12.761  1.00 19.93 ? 199 TYR A O   1 
ATOM   1591 C  CB  . TYR A 1 198 ? 27.487  -5.969  11.313  1.00 21.84 ? 199 TYR A CB  1 
ATOM   1592 C  CG  . TYR A 1 198 ? 27.141  -6.941  10.222  1.00 25.35 ? 199 TYR A CG  1 
ATOM   1593 C  CD1 . TYR A 1 198 ? 26.093  -6.683  9.338   1.00 31.27 ? 199 TYR A CD1 1 
ATOM   1594 C  CD2 . TYR A 1 198 ? 27.824  -8.140  10.099  1.00 28.47 ? 199 TYR A CD2 1 
ATOM   1595 C  CE1 . TYR A 1 198 ? 25.754  -7.600  8.336   1.00 32.89 ? 199 TYR A CE1 1 
ATOM   1596 C  CE2 . TYR A 1 198 ? 27.501  -9.054  9.112   1.00 32.08 ? 199 TYR A CE2 1 
ATOM   1597 C  CZ  . TYR A 1 198 ? 26.465  -8.778  8.236   1.00 34.08 ? 199 TYR A CZ  1 
ATOM   1598 O  OH  . TYR A 1 198 ? 26.148  -9.693  7.265   1.00 37.77 ? 199 TYR A OH  1 
ATOM   1599 N  N   . GLN A 1 199 ? 27.758  -7.993  13.774  1.00 20.06 ? 200 GLN A N   1 
ATOM   1600 C  CA  . GLN A 1 199 ? 27.945  -9.386  14.238  1.00 20.10 ? 200 GLN A CA  1 
ATOM   1601 C  C   . GLN A 1 199 ? 26.893  -9.809  15.256  1.00 19.34 ? 200 GLN A C   1 
ATOM   1602 O  O   . GLN A 1 199 ? 26.433  -10.949 15.241  1.00 19.17 ? 200 GLN A O   1 
ATOM   1603 C  CB  . GLN A 1 199 ? 29.345  -9.615  14.824  1.00 20.09 ? 200 GLN A CB  1 
ATOM   1604 C  CG  . GLN A 1 199 ? 30.416  -9.753  13.771  1.00 23.86 ? 200 GLN A CG  1 
ATOM   1605 C  CD  . GLN A 1 199 ? 30.119  -10.908 12.815  1.00 29.33 ? 200 GLN A CD  1 
ATOM   1606 O  OE1 . GLN A 1 199 ? 29.824  -12.034 13.252  1.00 29.44 ? 200 GLN A OE1 1 
ATOM   1607 N  NE2 . GLN A 1 199 ? 30.156  -10.622 11.504  1.00 28.93 ? 200 GLN A NE2 1 
ATOM   1608 N  N   . MET A 1 200 ? 26.543  -8.886  16.142  1.00 18.47 ? 201 MET A N   1 
ATOM   1609 C  CA  . MET A 1 200 ? 25.478  -9.106  17.130  1.00 18.12 ? 201 MET A CA  1 
ATOM   1610 C  C   . MET A 1 200 ? 24.150  -9.449  16.400  1.00 17.78 ? 201 MET A C   1 
ATOM   1611 O  O   . MET A 1 200 ? 23.479  -10.429 16.755  1.00 17.11 ? 201 MET A O   1 
ATOM   1612 C  CB  . MET A 1 200 ? 25.331  -7.873  18.016  1.00 17.64 ? 201 MET A CB  1 
ATOM   1613 C  CG  . MET A 1 200 ? 24.307  -8.007  19.157  1.00 17.92 ? 201 MET A CG  1 
ATOM   1614 S  SD  . MET A 1 200 ? 22.578  -7.918  18.640  1.00 21.16 ? 201 MET A SD  1 
ATOM   1615 C  CE  . MET A 1 200 ? 22.445  -6.191  18.195  1.00 18.94 ? 201 MET A CE  1 
ATOM   1616 N  N   . PHE A 1 201 ? 23.791  -8.662  15.382  1.00 17.63 ? 202 PHE A N   1 
ATOM   1617 C  CA  . PHE A 1 201 ? 22.586  -8.957  14.559  1.00 17.61 ? 202 PHE A CA  1 
ATOM   1618 C  C   . PHE A 1 201 ? 22.648  -10.290 13.809  1.00 17.85 ? 202 PHE A C   1 
ATOM   1619 O  O   . PHE A 1 201 ? 21.739  -11.129 13.918  1.00 18.19 ? 202 PHE A O   1 
ATOM   1620 C  CB  . PHE A 1 201 ? 22.335  -7.836  13.543  1.00 17.97 ? 202 PHE A CB  1 
ATOM   1621 C  CG  . PHE A 1 201 ? 21.757  -6.591  14.138  1.00 18.46 ? 202 PHE A CG  1 
ATOM   1622 C  CD1 . PHE A 1 201 ? 22.329  -5.350  13.873  1.00 19.54 ? 202 PHE A CD1 1 
ATOM   1623 C  CD2 . PHE A 1 201 ? 20.620  -6.648  14.942  1.00 19.46 ? 202 PHE A CD2 1 
ATOM   1624 C  CE1 . PHE A 1 201 ? 21.776  -4.179  14.415  1.00 21.07 ? 202 PHE A CE1 1 
ATOM   1625 C  CE2 . PHE A 1 201 ? 20.070  -5.479  15.492  1.00 19.25 ? 202 PHE A CE2 1 
ATOM   1626 C  CZ  . PHE A 1 201 ? 20.650  -4.255  15.240  1.00 18.68 ? 202 PHE A CZ  1 
ATOM   1627 N  N   . HIS A 1 202 ? 23.715  -10.467 13.032  1.00 18.08 ? 203 HIS A N   1 
ATOM   1628 C  CA  . HIS A 1 202 ? 23.942  -11.690 12.251  1.00 18.75 ? 203 HIS A CA  1 
ATOM   1629 C  C   . HIS A 1 202 ? 23.898  -12.958 13.125  1.00 18.31 ? 203 HIS A C   1 
ATOM   1630 O  O   . HIS A 1 202 ? 23.224  -13.931 12.779  1.00 17.25 ? 203 HIS A O   1 
ATOM   1631 C  CB  . HIS A 1 202 ? 25.273  -11.584 11.469  1.00 19.33 ? 203 HIS A CB  1 
ATOM   1632 C  CG  . HIS A 1 202 ? 25.548  -12.745 10.559  1.00 22.91 ? 203 HIS A CG  1 
ATOM   1633 N  ND1 . HIS A 1 202 ? 24.877  -12.941 9.371   1.00 27.32 ? 203 HIS A ND1 1 
ATOM   1634 C  CD2 . HIS A 1 202 ? 26.431  -13.768 10.656  1.00 26.89 ? 203 HIS A CD2 1 
ATOM   1635 C  CE1 . HIS A 1 202 ? 25.321  -14.036 8.782   1.00 26.52 ? 203 HIS A CE1 1 
ATOM   1636 N  NE2 . HIS A 1 202 ? 26.271  -14.553 9.537   1.00 27.63 ? 203 HIS A NE2 1 
ATOM   1637 N  N   . THR A 1 203 ? 24.583  -12.930 14.271  1.00 18.61 ? 204 THR A N   1 
ATOM   1638 C  CA  . THR A 1 203 ? 24.625  -14.106 15.155  1.00 18.75 ? 204 THR A CA  1 
ATOM   1639 C  C   . THR A 1 203 ? 23.312  -14.322 15.908  1.00 19.33 ? 204 THR A C   1 
ATOM   1640 O  O   . THR A 1 203 ? 23.106  -15.379 16.490  1.00 19.59 ? 204 THR A O   1 
ATOM   1641 C  CB  . THR A 1 203 ? 25.829  -14.089 16.150  1.00 18.21 ? 204 THR A CB  1 
ATOM   1642 O  OG1 . THR A 1 203 ? 25.783  -12.918 16.967  1.00 19.18 ? 204 THR A OG1 1 
ATOM   1643 C  CG2 . THR A 1 203 ? 27.136  -14.117 15.404  1.00 18.97 ? 204 THR A CG2 1 
ATOM   1644 N  N   . SER A 1 204 ? 22.408  -13.347 15.875  1.00 19.51 ? 205 SER A N   1 
ATOM   1645 C  CA  . SER A 1 204 ? 21.122  -13.518 16.540  1.00 20.26 ? 205 SER A CA  1 
ATOM   1646 C  C   . SER A 1 204 ? 20.294  -14.585 15.824  1.00 20.03 ? 205 SER A C   1 
ATOM   1647 O  O   . SER A 1 204 ? 19.560  -15.336 16.457  1.00 19.96 ? 205 SER A O   1 
ATOM   1648 C  CB  . SER A 1 204 ? 20.314  -12.218 16.564  1.00 19.93 ? 205 SER A CB  1 
ATOM   1649 O  OG  . SER A 1 204 ? 20.955  -11.209 17.312  1.00 22.38 ? 205 SER A OG  1 
ATOM   1650 N  N   . VAL A 1 205 ? 20.420  -14.625 14.501  1.00 20.06 ? 206 VAL A N   1 
ATOM   1651 C  CA  . VAL A 1 205 ? 19.505  -15.373 13.633  1.00 19.46 ? 206 VAL A CA  1 
ATOM   1652 C  C   . VAL A 1 205 ? 19.452  -16.897 13.907  1.00 19.91 ? 206 VAL A C   1 
ATOM   1653 O  O   . VAL A 1 205 ? 18.371  -17.456 13.966  1.00 20.34 ? 206 VAL A O   1 
ATOM   1654 C  CB  . VAL A 1 205 ? 19.779  -15.057 12.143  1.00 19.79 ? 206 VAL A CB  1 
ATOM   1655 C  CG1 . VAL A 1 205 ? 18.941  -15.948 11.211  1.00 18.59 ? 206 VAL A CG1 1 
ATOM   1656 C  CG2 . VAL A 1 205 ? 19.477  -13.572 11.872  1.00 18.55 ? 206 VAL A CG2 1 
ATOM   1657 N  N   . PRO A 1 206 ? 20.609  -17.565 14.085  1.00 20.84 ? 207 PRO A N   1 
ATOM   1658 C  CA  . PRO A 1 206 ? 20.485  -19.017 14.337  1.00 21.37 ? 207 PRO A CA  1 
ATOM   1659 C  C   . PRO A 1 206 ? 19.847  -19.374 15.684  1.00 22.37 ? 207 PRO A C   1 
ATOM   1660 O  O   . PRO A 1 206 ? 19.468  -20.533 15.881  1.00 22.86 ? 207 PRO A O   1 
ATOM   1661 C  CB  . PRO A 1 206 ? 21.937  -19.519 14.277  1.00 21.10 ? 207 PRO A CB  1 
ATOM   1662 C  CG  . PRO A 1 206 ? 22.671  -18.467 13.429  1.00 21.12 ? 207 PRO A CG  1 
ATOM   1663 C  CD  . PRO A 1 206 ? 22.020  -17.165 13.878  1.00 20.22 ? 207 PRO A CD  1 
ATOM   1664 N  N   . MET A 1 207 ? 19.676  -18.400 16.579  1.00 22.91 ? 208 MET A N   1 
ATOM   1665 C  CA  . MET A 1 207 ? 19.107  -18.695 17.889  1.00 24.65 ? 208 MET A CA  1 
ATOM   1666 C  C   . MET A 1 207 ? 17.629  -18.297 18.065  1.00 25.49 ? 208 MET A C   1 
ATOM   1667 O  O   . MET A 1 207 ? 17.048  -18.563 19.118  1.00 25.91 ? 208 MET A O   1 
ATOM   1668 C  CB  . MET A 1 207 ? 19.967  -18.091 19.019  1.00 24.13 ? 208 MET A CB  1 
ATOM   1669 C  CG  . MET A 1 207 ? 21.425  -18.588 19.037  1.00 24.11 ? 208 MET A CG  1 
ATOM   1670 S  SD  . MET A 1 207 ? 22.362  -17.785 20.344  1.00 22.57 ? 208 MET A SD  1 
ATOM   1671 C  CE  . MET A 1 207 ? 22.738  -16.187 19.618  1.00 19.13 ? 208 MET A CE  1 
ATOM   1672 N  N   . LEU A 1 208 ? 17.029  -17.721 17.024  1.00 26.18 ? 209 LEU A N   1 
ATOM   1673 C  CA  . LEU A 1 208 ? 15.744  -16.979 17.114  1.00 27.41 ? 209 LEU A CA  1 
ATOM   1674 C  C   . LEU A 1 208 ? 14.476  -17.624 17.666  1.00 27.68 ? 209 LEU A C   1 
ATOM   1675 O  O   . LEU A 1 208 ? 13.753  -17.010 18.502  1.00 29.06 ? 209 LEU A O   1 
ATOM   1676 C  CB  . LEU A 1 208 ? 15.392  -16.384 15.760  1.00 27.18 ? 209 LEU A CB  1 
ATOM   1677 C  CG  . LEU A 1 208 ? 15.946  -14.975 15.661  1.00 29.98 ? 209 LEU A CG  1 
ATOM   1678 C  CD1 . LEU A 1 208 ? 15.606  -14.437 14.286  1.00 29.24 ? 209 LEU A CD1 1 
ATOM   1679 C  CD2 . LEU A 1 208 ? 15.358  -14.086 16.772  1.00 29.75 ? 209 LEU A CD2 1 
ATOM   1680 N  N   . ASN A 1 209 ? 14.168  -18.809 17.169  1.00 26.58 ? 210 ASN A N   1 
ATOM   1681 C  CA  . ASN A 1 209 ? 12.935  -19.485 17.547  1.00 26.13 ? 210 ASN A CA  1 
ATOM   1682 C  C   . ASN A 1 209 ? 13.193  -20.588 18.589  1.00 26.13 ? 210 ASN A C   1 
ATOM   1683 O  O   . ASN A 1 209 ? 12.420  -21.546 18.684  1.00 26.39 ? 210 ASN A O   1 
ATOM   1684 C  CB  . ASN A 1 209 ? 12.281  -20.076 16.292  1.00 25.46 ? 210 ASN A CB  1 
ATOM   1685 C  CG  . ASN A 1 209 ? 11.923  -19.014 15.274  1.00 27.15 ? 210 ASN A CG  1 
ATOM   1686 O  OD1 . ASN A 1 209 ? 10.863  -18.381 15.363  1.00 28.70 ? 210 ASN A OD1 1 
ATOM   1687 N  ND2 . ASN A 1 209 ? 12.807  -18.791 14.321  1.00 24.41 ? 210 ASN A ND2 1 
ATOM   1688 N  N   . LEU A 1 210 ? 14.276  -20.442 19.358  1.00 25.72 ? 211 LEU A N   1 
ATOM   1689 C  CA  . LEU A 1 210 ? 14.697  -21.453 20.342  1.00 25.89 ? 211 LEU A CA  1 
ATOM   1690 C  C   . LEU A 1 210 ? 14.694  -20.899 21.757  1.00 26.08 ? 211 LEU A C   1 
ATOM   1691 O  O   . LEU A 1 210 ? 15.055  -19.745 21.966  1.00 26.44 ? 211 LEU A O   1 
ATOM   1692 C  CB  . LEU A 1 210 ? 16.117  -21.967 20.026  1.00 25.23 ? 211 LEU A CB  1 
ATOM   1693 C  CG  . LEU A 1 210 ? 16.426  -22.510 18.618  1.00 24.86 ? 211 LEU A CG  1 
ATOM   1694 C  CD1 . LEU A 1 210 ? 17.885  -22.935 18.517  1.00 23.65 ? 211 LEU A CD1 1 
ATOM   1695 C  CD2 . LEU A 1 210 ? 15.501  -23.669 18.251  1.00 24.78 ? 211 LEU A CD2 1 
ATOM   1696 N  N   . PRO A 1 211 ? 14.316  -21.726 22.747  1.00 26.72 ? 212 PRO A N   1 
ATOM   1697 C  CA  . PRO A 1 211 ? 14.499  -21.269 24.136  1.00 27.11 ? 212 PRO A CA  1 
ATOM   1698 C  C   . PRO A 1 211 ? 15.994  -21.245 24.521  1.00 27.12 ? 212 PRO A C   1 
ATOM   1699 O  O   . PRO A 1 211 ? 16.798  -21.923 23.882  1.00 26.41 ? 212 PRO A O   1 
ATOM   1700 C  CB  . PRO A 1 211 ? 13.711  -22.297 24.966  1.00 26.88 ? 212 PRO A CB  1 
ATOM   1701 C  CG  . PRO A 1 211 ? 13.629  -23.508 24.121  1.00 27.36 ? 212 PRO A CG  1 
ATOM   1702 C  CD  . PRO A 1 211 ? 13.728  -23.076 22.666  1.00 26.47 ? 212 PRO A CD  1 
ATOM   1703 N  N   . PRO A 1 212 ? 16.363  -20.438 25.533  1.00 27.93 ? 213 PRO A N   1 
ATOM   1704 C  CA  . PRO A 1 212 ? 17.769  -20.324 25.915  1.00 28.59 ? 213 PRO A CA  1 
ATOM   1705 C  C   . PRO A 1 212 ? 18.426  -21.664 26.263  1.00 29.05 ? 213 PRO A C   1 
ATOM   1706 O  O   . PRO A 1 212 ? 19.598  -21.834 25.970  1.00 29.32 ? 213 PRO A O   1 
ATOM   1707 C  CB  . PRO A 1 212 ? 17.754  -19.368 27.127  1.00 28.78 ? 213 PRO A CB  1 
ATOM   1708 C  CG  . PRO A 1 212 ? 16.332  -19.010 27.376  1.00 28.46 ? 213 PRO A CG  1 
ATOM   1709 C  CD  . PRO A 1 212 ? 15.525  -19.417 26.190  1.00 28.19 ? 213 PRO A CD  1 
ATOM   1710 N  N   . ASP A 1 213 ? 17.672  -22.606 26.835  1.00 29.62 ? 214 ASP A N   1 
ATOM   1711 C  CA  . ASP A 1 213 ? 18.187  -23.954 27.156  1.00 30.60 ? 214 ASP A CA  1 
ATOM   1712 C  C   . ASP A 1 213 ? 18.690  -24.712 25.925  1.00 30.85 ? 214 ASP A C   1 
ATOM   1713 O  O   . ASP A 1 213 ? 19.609  -25.543 26.034  1.00 30.64 ? 214 ASP A O   1 
ATOM   1714 C  CB  . ASP A 1 213 ? 17.101  -24.825 27.797  1.00 30.68 ? 214 ASP A CB  1 
ATOM   1715 C  CG  . ASP A 1 213 ? 16.885  -24.541 29.277  1.00 32.72 ? 214 ASP A CG  1 
ATOM   1716 O  OD1 . ASP A 1 213 ? 17.761  -23.931 29.938  1.00 33.64 ? 214 ASP A OD1 1 
ATOM   1717 O  OD2 . ASP A 1 213 ? 15.810  -24.959 29.779  1.00 35.86 ? 214 ASP A OD2 1 
ATOM   1718 N  N   . LEU A 1 214 ? 18.062  -24.460 24.774  1.00 30.62 ? 215 LEU A N   1 
ATOM   1719 C  CA  . LEU A 1 214 ? 18.391  -25.192 23.545  1.00 31.22 ? 215 LEU A CA  1 
ATOM   1720 C  C   . LEU A 1 214 ? 19.453  -24.510 22.693  1.00 31.48 ? 215 LEU A C   1 
ATOM   1721 O  O   . LEU A 1 214 ? 20.359  -25.177 22.182  1.00 31.28 ? 215 LEU A O   1 
ATOM   1722 C  CB  . LEU A 1 214 ? 17.148  -25.516 22.712  1.00 31.05 ? 215 LEU A CB  1 
ATOM   1723 C  CG  . LEU A 1 214 ? 16.125  -26.488 23.295  1.00 32.73 ? 215 LEU A CG  1 
ATOM   1724 C  CD1 . LEU A 1 214 ? 15.088  -26.841 22.220  1.00 33.01 ? 215 LEU A CD1 1 
ATOM   1725 C  CD2 . LEU A 1 214 ? 16.766  -27.768 23.871  1.00 31.72 ? 215 LEU A CD2 1 
ATOM   1726 N  N   . PHE A 1 215 ? 19.380  -23.183 22.553  1.00 31.98 ? 216 PHE A N   1 
ATOM   1727 C  CA  . PHE A 1 215 ? 20.448  -22.509 21.803  1.00 31.67 ? 216 PHE A CA  1 
ATOM   1728 C  C   . PHE A 1 215 ? 21.838  -22.620 22.479  1.00 32.32 ? 216 PHE A C   1 
ATOM   1729 O  O   . PHE A 1 215 ? 22.877  -22.703 21.816  1.00 32.71 ? 216 PHE A O   1 
ATOM   1730 C  CB  . PHE A 1 215 ? 20.044  -21.121 21.237  1.00 31.10 ? 216 PHE A CB  1 
ATOM   1731 C  CG  . PHE A 1 215 ? 19.761  -20.039 22.262  1.00 27.73 ? 216 PHE A CG  1 
ATOM   1732 C  CD1 . PHE A 1 215 ? 20.748  -19.585 23.126  1.00 26.50 ? 216 PHE A CD1 1 
ATOM   1733 C  CD2 . PHE A 1 215 ? 18.528  -19.393 22.267  1.00 27.03 ? 216 PHE A CD2 1 
ATOM   1734 C  CE1 . PHE A 1 215 ? 20.495  -18.538 24.030  1.00 25.87 ? 216 PHE A CE1 1 
ATOM   1735 C  CE2 . PHE A 1 215 ? 18.265  -18.337 23.150  1.00 26.35 ? 216 PHE A CE2 1 
ATOM   1736 C  CZ  . PHE A 1 215 ? 19.258  -17.919 24.045  1.00 25.06 ? 216 PHE A CZ  1 
ATOM   1737 N  N   . ARG A 1 216 ? 21.844  -22.728 23.795  1.00 33.19 ? 217 ARG A N   1 
ATOM   1738 C  CA  . ARG A 1 216 ? 23.078  -23.054 24.537  1.00 33.62 ? 217 ARG A CA  1 
ATOM   1739 C  C   . ARG A 1 216 ? 23.697  -24.398 24.109  1.00 33.12 ? 217 ARG A C   1 
ATOM   1740 O  O   . ARG A 1 216 ? 24.917  -24.579 24.137  1.00 34.17 ? 217 ARG A O   1 
ATOM   1741 C  CB  . ARG A 1 216 ? 22.749  -23.095 26.041  1.00 34.29 ? 217 ARG A CB  1 
ATOM   1742 C  CG  . ARG A 1 216 ? 23.965  -23.065 26.978  1.00 37.93 ? 217 ARG A CG  1 
ATOM   1743 C  CD  . ARG A 1 216 ? 23.772  -23.921 28.262  1.00 40.81 ? 217 ARG A CD  1 
ATOM   1744 N  NE  . ARG A 1 216 ? 22.378  -24.076 28.689  1.00 42.94 ? 217 ARG A NE  1 
ATOM   1745 C  CZ  . ARG A 1 216 ? 21.697  -23.208 29.437  1.00 44.54 ? 217 ARG A CZ  1 
ATOM   1746 N  NH1 . ARG A 1 216 ? 22.260  -22.087 29.867  1.00 45.60 ? 217 ARG A NH1 1 
ATOM   1747 N  NH2 . ARG A 1 216 ? 20.436  -23.466 29.755  1.00 46.50 ? 217 ARG A NH2 1 
ATOM   1748 N  N   . LEU A 1 217 ? 22.835  -25.337 23.715  1.00 32.21 ? 218 LEU A N   1 
ATOM   1749 C  CA  . LEU A 1 217 ? 23.185  -26.738 23.486  1.00 30.71 ? 218 LEU A CA  1 
ATOM   1750 C  C   . LEU A 1 217 ? 23.398  -27.089 22.016  1.00 29.63 ? 218 LEU A C   1 
ATOM   1751 O  O   . LEU A 1 217 ? 24.200  -27.960 21.692  1.00 29.36 ? 218 LEU A O   1 
ATOM   1752 C  CB  . LEU A 1 217 ? 22.046  -27.596 24.056  1.00 30.76 ? 218 LEU A CB  1 
ATOM   1753 C  CG  . LEU A 1 217 ? 22.202  -29.058 24.437  1.00 31.56 ? 218 LEU A CG  1 
ATOM   1754 C  CD1 . LEU A 1 217 ? 23.430  -29.309 25.288  1.00 29.19 ? 218 LEU A CD1 1 
ATOM   1755 C  CD2 . LEU A 1 217 ? 20.949  -29.483 25.164  1.00 31.53 ? 218 LEU A CD2 1 
ATOM   1756 N  N   . PHE A 1 218 ? 22.668  -26.418 21.124  1.00 27.88 ? 219 PHE A N   1 
ATOM   1757 C  CA  . PHE A 1 218 ? 22.752  -26.700 19.697  1.00 26.34 ? 219 PHE A CA  1 
ATOM   1758 C  C   . PHE A 1 218 ? 23.337  -25.550 18.869  1.00 26.01 ? 219 PHE A C   1 
ATOM   1759 O  O   . PHE A 1 218 ? 23.520  -25.676 17.658  1.00 25.31 ? 219 PHE A O   1 
ATOM   1760 C  CB  . PHE A 1 218 ? 21.372  -27.103 19.167  1.00 25.96 ? 219 PHE A CB  1 
ATOM   1761 C  CG  . PHE A 1 218 ? 20.844  -28.364 19.779  1.00 25.30 ? 219 PHE A CG  1 
ATOM   1762 C  CD1 . PHE A 1 218 ? 19.800  -28.325 20.699  1.00 26.43 ? 219 PHE A CD1 1 
ATOM   1763 C  CD2 . PHE A 1 218 ? 21.422  -29.592 19.468  1.00 26.11 ? 219 PHE A CD2 1 
ATOM   1764 C  CE1 . PHE A 1 218 ? 19.314  -29.504 21.275  1.00 27.57 ? 219 PHE A CE1 1 
ATOM   1765 C  CE2 . PHE A 1 218 ? 20.953  -30.774 20.035  1.00 26.26 ? 219 PHE A CE2 1 
ATOM   1766 C  CZ  . PHE A 1 218 ? 19.895  -30.730 20.945  1.00 26.54 ? 219 PHE A CZ  1 
ATOM   1767 N  N   . ARG A 1 219 ? 23.623  -24.432 19.528  1.00 25.20 ? 220 ARG A N   1 
ATOM   1768 C  CA  . ARG A 1 219 ? 24.138  -23.243 18.856  1.00 25.33 ? 220 ARG A CA  1 
ATOM   1769 C  C   . ARG A 1 219 ? 25.274  -22.662 19.683  1.00 25.49 ? 220 ARG A C   1 
ATOM   1770 O  O   . ARG A 1 219 ? 25.398  -21.452 19.825  1.00 25.37 ? 220 ARG A O   1 
ATOM   1771 C  CB  . ARG A 1 219 ? 23.010  -22.213 18.664  1.00 25.15 ? 220 ARG A CB  1 
ATOM   1772 C  CG  . ARG A 1 219 ? 21.847  -22.713 17.787  1.00 25.57 ? 220 ARG A CG  1 
ATOM   1773 C  CD  . ARG A 1 219 ? 22.289  -22.712 16.343  1.00 28.41 ? 220 ARG A CD  1 
ATOM   1774 N  NE  . ARG A 1 219 ? 21.809  -23.878 15.606  1.00 33.52 ? 220 ARG A NE  1 
ATOM   1775 C  CZ  . ARG A 1 219 ? 20.686  -23.879 14.912  1.00 33.84 ? 220 ARG A CZ  1 
ATOM   1776 N  NH1 . ARG A 1 219 ? 19.952  -22.789 14.892  1.00 38.51 ? 220 ARG A NH1 1 
ATOM   1777 N  NH2 . ARG A 1 219 ? 20.296  -24.947 14.251  1.00 34.40 ? 220 ARG A NH2 1 
ATOM   1778 N  N   . THR A 1 220 ? 26.105  -23.546 20.226  1.00 25.48 ? 221 THR A N   1 
ATOM   1779 C  CA  . THR A 1 220 ? 27.149  -23.171 21.188  1.00 25.83 ? 221 THR A CA  1 
ATOM   1780 C  C   . THR A 1 220 ? 28.152  -22.167 20.614  1.00 25.32 ? 221 THR A C   1 
ATOM   1781 O  O   . THR A 1 220 ? 28.478  -21.175 21.279  1.00 25.49 ? 221 THR A O   1 
ATOM   1782 C  CB  . THR A 1 220 ? 27.876  -24.427 21.745  1.00 26.25 ? 221 THR A CB  1 
ATOM   1783 O  OG1 . THR A 1 220 ? 26.889  -25.374 22.196  1.00 28.22 ? 221 THR A OG1 1 
ATOM   1784 C  CG2 . THR A 1 220 ? 28.795  -24.066 22.913  1.00 26.20 ? 221 THR A CG2 1 
ATOM   1785 N  N   . LYS A 1 221 ? 28.622  -22.412 19.390  1.00 24.82 ? 222 LYS A N   1 
ATOM   1786 C  CA  . LYS A 1 221 ? 29.540  -21.494 18.724  1.00 25.19 ? 222 LYS A CA  1 
ATOM   1787 C  C   . LYS A 1 221 ? 28.905  -20.131 18.417  1.00 24.27 ? 222 LYS A C   1 
ATOM   1788 O  O   . LYS A 1 221 ? 29.533  -19.096 18.615  1.00 23.94 ? 222 LYS A O   1 
ATOM   1789 C  CB  . LYS A 1 221 ? 30.120  -22.100 17.433  1.00 25.96 ? 222 LYS A CB  1 
ATOM   1790 C  CG  . LYS A 1 221 ? 31.245  -21.234 16.859  1.00 29.50 ? 222 LYS A CG  1 
ATOM   1791 C  CD  . LYS A 1 221 ? 31.864  -21.751 15.563  1.00 34.79 ? 222 LYS A CD  1 
ATOM   1792 C  CE  . LYS A 1 221 ? 32.751  -20.641 14.960  1.00 39.38 ? 222 LYS A CE  1 
ATOM   1793 N  NZ  . LYS A 1 221 ? 34.017  -21.158 14.327  1.00 41.65 ? 222 LYS A NZ  1 
ATOM   1794 N  N   . THR A 1 222 ? 27.673  -20.142 17.907  1.00 23.76 ? 223 THR A N   1 
ATOM   1795 C  CA  . THR A 1 222 ? 26.957  -18.902 17.598  1.00 23.20 ? 223 THR A CA  1 
ATOM   1796 C  C   . THR A 1 222 ? 26.709  -18.081 18.868  1.00 22.79 ? 223 THR A C   1 
ATOM   1797 O  O   . THR A 1 222 ? 26.921  -16.871 18.879  1.00 21.77 ? 223 THR A O   1 
ATOM   1798 C  CB  . THR A 1 222 ? 25.619  -19.178 16.859  1.00 23.38 ? 223 THR A CB  1 
ATOM   1799 O  OG1 . THR A 1 222 ? 25.894  -19.771 15.586  1.00 23.71 ? 223 THR A OG1 1 
ATOM   1800 C  CG2 . THR A 1 222 ? 24.856  -17.890 16.628  1.00 22.57 ? 223 THR A CG2 1 
ATOM   1801 N  N   . TRP A 1 223 ? 26.272  -18.751 19.932  1.00 22.92 ? 224 TRP A N   1 
ATOM   1802 C  CA  . TRP A 1 223 ? 26.026  -18.089 21.201  1.00 23.13 ? 224 TRP A CA  1 
ATOM   1803 C  C   . TRP A 1 223 ? 27.305  -17.423 21.697  1.00 23.69 ? 224 TRP A C   1 
ATOM   1804 O  O   . TRP A 1 223 ? 27.291  -16.271 22.140  1.00 23.23 ? 224 TRP A O   1 
ATOM   1805 C  CB  . TRP A 1 223 ? 25.493  -19.081 22.236  1.00 22.75 ? 224 TRP A CB  1 
ATOM   1806 C  CG  . TRP A 1 223 ? 25.447  -18.533 23.644  1.00 23.25 ? 224 TRP A CG  1 
ATOM   1807 C  CD1 . TRP A 1 223 ? 26.215  -18.932 24.693  1.00 24.72 ? 224 TRP A CD1 1 
ATOM   1808 C  CD2 . TRP A 1 223 ? 24.598  -17.488 24.144  1.00 22.72 ? 224 TRP A CD2 1 
ATOM   1809 N  NE1 . TRP A 1 223 ? 25.906  -18.202 25.817  1.00 25.13 ? 224 TRP A NE1 1 
ATOM   1810 C  CE2 . TRP A 1 223 ? 24.917  -17.308 25.508  1.00 24.74 ? 224 TRP A CE2 1 
ATOM   1811 C  CE3 . TRP A 1 223 ? 23.604  -16.686 23.572  1.00 23.93 ? 224 TRP A CE3 1 
ATOM   1812 C  CZ2 . TRP A 1 223 ? 24.258  -16.370 26.324  1.00 25.66 ? 224 TRP A CZ2 1 
ATOM   1813 C  CZ3 . TRP A 1 223 ? 22.954  -15.734 24.379  1.00 23.94 ? 224 TRP A CZ3 1 
ATOM   1814 C  CH2 . TRP A 1 223 ? 23.288  -15.589 25.739  1.00 25.15 ? 224 TRP A CH2 1 
ATOM   1815 N  N   . LYS A 1 224 ? 28.411  -18.156 21.612  1.00 24.57 ? 225 LYS A N   1 
ATOM   1816 C  CA  . LYS A 1 224 ? 29.714  -17.638 22.016  1.00 25.39 ? 225 LYS A CA  1 
ATOM   1817 C  C   . LYS A 1 224 ? 30.090  -16.377 21.212  1.00 24.86 ? 225 LYS A C   1 
ATOM   1818 O  O   . LYS A 1 224 ? 30.601  -15.410 21.779  1.00 24.49 ? 225 LYS A O   1 
ATOM   1819 C  CB  . LYS A 1 224 ? 30.761  -18.738 21.846  1.00 26.28 ? 225 LYS A CB  1 
ATOM   1820 C  CG  . LYS A 1 224 ? 32.208  -18.367 22.154  1.00 30.74 ? 225 LYS A CG  1 
ATOM   1821 C  CD  . LYS A 1 224 ? 33.100  -19.589 21.893  1.00 35.56 ? 225 LYS A CD  1 
ATOM   1822 C  CE  . LYS A 1 224 ? 34.529  -19.192 21.571  1.00 39.21 ? 225 LYS A CE  1 
ATOM   1823 N  NZ  . LYS A 1 224 ? 35.366  -19.082 22.803  1.00 40.97 ? 225 LYS A NZ  1 
ATOM   1824 N  N   . ASP A 1 225 ? 29.843  -16.396 19.900  1.00 24.04 ? 226 ASP A N   1 
ATOM   1825 C  CA  . ASP A 1 225 ? 30.201  -15.268 19.025  1.00 23.45 ? 226 ASP A CA  1 
ATOM   1826 C  C   . ASP A 1 225 ? 29.301  -14.064 19.324  1.00 22.93 ? 226 ASP A C   1 
ATOM   1827 O  O   . ASP A 1 225 ? 29.711  -12.901 19.237  1.00 23.54 ? 226 ASP A O   1 
ATOM   1828 C  CB  . ASP A 1 225 ? 30.061  -15.680 17.556  1.00 23.75 ? 226 ASP A CB  1 
ATOM   1829 C  CG  . ASP A 1 225 ? 31.220  -16.571 17.072  1.00 25.13 ? 226 ASP A CG  1 
ATOM   1830 O  OD1 . ASP A 1 225 ? 32.289  -16.578 17.700  1.00 26.52 ? 226 ASP A OD1 1 
ATOM   1831 O  OD2 . ASP A 1 225 ? 31.071  -17.251 16.046  1.00 26.92 ? 226 ASP A OD2 1 
ATOM   1832 N  N   . HIS A 1 226 ? 28.073  -14.374 19.689  1.00 21.62 ? 227 HIS A N   1 
ATOM   1833 C  CA  . HIS A 1 226 ? 27.064  -13.398 19.995  1.00 21.63 ? 227 HIS A CA  1 
ATOM   1834 C  C   . HIS A 1 226 ? 27.393  -12.683 21.306  1.00 21.38 ? 227 HIS A C   1 
ATOM   1835 O  O   . HIS A 1 226 ? 27.342  -11.453 21.377  1.00 21.41 ? 227 HIS A O   1 
ATOM   1836 C  CB  . HIS A 1 226 ? 25.723  -14.108 20.109  1.00 20.51 ? 227 HIS A CB  1 
ATOM   1837 C  CG  . HIS A 1 226 ? 24.571  -13.178 20.239  1.00 19.29 ? 227 HIS A CG  1 
ATOM   1838 N  ND1 . HIS A 1 226 ? 24.119  -12.412 19.187  1.00 18.17 ? 227 HIS A ND1 1 
ATOM   1839 C  CD2 . HIS A 1 226 ? 23.772  -12.890 21.292  1.00 17.63 ? 227 HIS A CD2 1 
ATOM   1840 C  CE1 . HIS A 1 226 ? 23.097  -11.680 19.594  1.00 16.94 ? 227 HIS A CE1 1 
ATOM   1841 N  NE2 . HIS A 1 226 ? 22.867  -11.952 20.863  1.00 16.63 ? 227 HIS A NE2 1 
ATOM   1842 N  N   . VAL A 1 227 ? 27.704  -13.466 22.337  1.00 21.38 ? 228 VAL A N   1 
ATOM   1843 C  CA  . VAL A 1 227 ? 28.214  -12.938 23.608  1.00 21.12 ? 228 VAL A CA  1 
ATOM   1844 C  C   . VAL A 1 227 ? 29.427  -12.030 23.357  1.00 20.74 ? 228 VAL A C   1 
ATOM   1845 O  O   . VAL A 1 227 ? 29.484  -10.937 23.891  1.00 20.55 ? 228 VAL A O   1 
ATOM   1846 C  CB  . VAL A 1 227 ? 28.552  -14.065 24.616  1.00 21.35 ? 228 VAL A CB  1 
ATOM   1847 C  CG1 . VAL A 1 227 ? 29.341  -13.519 25.842  1.00 20.80 ? 228 VAL A CG1 1 
ATOM   1848 C  CG2 . VAL A 1 227 ? 27.277  -14.732 25.088  1.00 21.54 ? 228 VAL A CG2 1 
ATOM   1849 N  N   . ALA A 1 228 ? 30.358  -12.463 22.510  1.00 20.49 ? 229 ALA A N   1 
ATOM   1850 C  CA  . ALA A 1 228 ? 31.542  -11.651 22.204  1.00 20.67 ? 229 ALA A CA  1 
ATOM   1851 C  C   . ALA A 1 228 ? 31.195  -10.333 21.496  1.00 20.85 ? 229 ALA A C   1 
ATOM   1852 O  O   . ALA A 1 228 ? 31.833  -9.322  21.760  1.00 21.28 ? 229 ALA A O   1 
ATOM   1853 C  CB  . ALA A 1 228 ? 32.575  -12.447 21.375  1.00 21.15 ? 229 ALA A CB  1 
ATOM   1854 N  N   . ALA A 1 229 ? 30.193  -10.344 20.608  1.00 20.54 ? 230 ALA A N   1 
ATOM   1855 C  CA  . ALA A 1 229 ? 29.752  -9.108  19.930  1.00 20.06 ? 230 ALA A CA  1 
ATOM   1856 C  C   . ALA A 1 229 ? 29.143  -8.121  20.937  1.00 19.69 ? 230 ALA A C   1 
ATOM   1857 O  O   . ALA A 1 229 ? 29.519  -6.957  20.970  1.00 19.72 ? 230 ALA A O   1 
ATOM   1858 C  CB  . ALA A 1 229 ? 28.763  -9.427  18.792  1.00 19.41 ? 230 ALA A CB  1 
ATOM   1859 N  N   . TRP A 1 230 ? 28.224  -8.584  21.771  1.00 19.51 ? 231 TRP A N   1 
ATOM   1860 C  CA  . TRP A 1 230 ? 27.618  -7.698  22.766  1.00 20.57 ? 231 TRP A CA  1 
ATOM   1861 C  C   . TRP A 1 230 ? 28.663  -7.157  23.760  1.00 21.35 ? 231 TRP A C   1 
ATOM   1862 O  O   . TRP A 1 230 ? 28.569  -6.003  24.187  1.00 22.10 ? 231 TRP A O   1 
ATOM   1863 C  CB  . TRP A 1 230 ? 26.524  -8.416  23.549  1.00 19.97 ? 231 TRP A CB  1 
ATOM   1864 C  CG  . TRP A 1 230 ? 25.123  -8.424  22.974  1.00 18.86 ? 231 TRP A CG  1 
ATOM   1865 C  CD1 . TRP A 1 230 ? 24.434  -9.523  22.548  1.00 18.71 ? 231 TRP A CD1 1 
ATOM   1866 C  CD2 . TRP A 1 230 ? 24.225  -7.317  22.836  1.00 18.90 ? 231 TRP A CD2 1 
ATOM   1867 N  NE1 . TRP A 1 230 ? 23.187  -9.170  22.122  1.00 19.33 ? 231 TRP A NE1 1 
ATOM   1868 C  CE2 . TRP A 1 230 ? 23.020  -7.825  22.293  1.00 17.75 ? 231 TRP A CE2 1 
ATOM   1869 C  CE3 . TRP A 1 230 ? 24.321  -5.940  23.101  1.00 18.38 ? 231 TRP A CE3 1 
ATOM   1870 C  CZ2 . TRP A 1 230 ? 21.919  -7.014  22.016  1.00 18.39 ? 231 TRP A CZ2 1 
ATOM   1871 C  CZ3 . TRP A 1 230 ? 23.225  -5.137  22.836  1.00 18.92 ? 231 TRP A CZ3 1 
ATOM   1872 C  CH2 . TRP A 1 230 ? 22.034  -5.674  22.304  1.00 17.80 ? 231 TRP A CH2 1 
ATOM   1873 N  N   . ASP A 1 231 ? 29.648  -7.984  24.126  1.00 22.08 ? 232 ASP A N   1 
ATOM   1874 C  CA  . ASP A 1 231 ? 30.714  -7.541  25.036  1.00 22.87 ? 232 ASP A CA  1 
ATOM   1875 C  C   . ASP A 1 231 ? 31.476  -6.345  24.462  1.00 23.04 ? 232 ASP A C   1 
ATOM   1876 O  O   . ASP A 1 231 ? 31.770  -5.407  25.197  1.00 22.82 ? 232 ASP A O   1 
ATOM   1877 C  CB  . ASP A 1 231 ? 31.671  -8.682  25.396  1.00 23.01 ? 232 ASP A CB  1 
ATOM   1878 C  CG  . ASP A 1 231 ? 31.146  -9.579  26.544  1.00 24.74 ? 232 ASP A CG  1 
ATOM   1879 O  OD1 . ASP A 1 231 ? 30.098  -9.289  27.182  1.00 26.63 ? 232 ASP A OD1 1 
ATOM   1880 O  OD2 . ASP A 1 231 ? 31.808  -10.595 26.819  1.00 27.61 ? 232 ASP A OD2 1 
ATOM   1881 N  N   . VAL A 1 232 ? 31.760  -6.356  23.153  1.00 23.29 ? 233 VAL A N   1 
ATOM   1882 C  CA  . VAL A 1 232 ? 32.439  -5.220  22.508  1.00 23.15 ? 233 VAL A CA  1 
ATOM   1883 C  C   . VAL A 1 232 ? 31.545  -3.977  22.568  1.00 23.50 ? 233 VAL A C   1 
ATOM   1884 O  O   . VAL A 1 232 ? 32.013  -2.874  22.900  1.00 22.48 ? 233 VAL A O   1 
ATOM   1885 C  CB  . VAL A 1 232 ? 32.843  -5.518  21.039  1.00 23.72 ? 233 VAL A CB  1 
ATOM   1886 C  CG1 . VAL A 1 232 ? 33.435  -4.281  20.377  1.00 23.47 ? 233 VAL A CG1 1 
ATOM   1887 C  CG2 . VAL A 1 232 ? 33.844  -6.691  20.960  1.00 23.37 ? 233 VAL A CG2 1 
ATOM   1888 N  N   . ILE A 1 233 ? 30.259  -4.177  22.259  1.00 23.07 ? 234 ILE A N   1 
ATOM   1889 C  CA  . ILE A 1 233 ? 29.263  -3.120  22.298  1.00 23.39 ? 234 ILE A CA  1 
ATOM   1890 C  C   . ILE A 1 233 ? 29.191  -2.434  23.676  1.00 23.88 ? 234 ILE A C   1 
ATOM   1891 O  O   . ILE A 1 233 ? 29.287  -1.212  23.761  1.00 23.68 ? 234 ILE A O   1 
ATOM   1892 C  CB  . ILE A 1 233 ? 27.843  -3.640  21.846  1.00 22.93 ? 234 ILE A CB  1 
ATOM   1893 C  CG1 . ILE A 1 233 ? 27.837  -3.983  20.346  1.00 23.00 ? 234 ILE A CG1 1 
ATOM   1894 C  CG2 . ILE A 1 233 ? 26.736  -2.627  22.206  1.00 22.00 ? 234 ILE A CG2 1 
ATOM   1895 C  CD1 . ILE A 1 233 ? 26.586  -4.754  19.873  1.00 20.51 ? 234 ILE A CD1 1 
ATOM   1896 N  N   . PHE A 1 234 ? 29.033  -3.221  24.740  1.00 25.13 ? 235 PHE A N   1 
ATOM   1897 C  CA  . PHE A 1 234 ? 28.896  -2.671  26.089  1.00 26.35 ? 235 PHE A CA  1 
ATOM   1898 C  C   . PHE A 1 234 ? 30.174  -2.033  26.569  1.00 27.42 ? 235 PHE A C   1 
ATOM   1899 O  O   . PHE A 1 234 ? 30.159  -0.925  27.108  1.00 28.19 ? 235 PHE A O   1 
ATOM   1900 C  CB  . PHE A 1 234 ? 28.411  -3.733  27.087  1.00 26.57 ? 235 PHE A CB  1 
ATOM   1901 C  CG  . PHE A 1 234 ? 26.926  -3.760  27.225  1.00 27.29 ? 235 PHE A CG  1 
ATOM   1902 C  CD1 . PHE A 1 234 ? 26.165  -4.641  26.470  1.00 26.30 ? 235 PHE A CD1 1 
ATOM   1903 C  CD2 . PHE A 1 234 ? 26.278  -2.857  28.069  1.00 27.43 ? 235 PHE A CD2 1 
ATOM   1904 C  CE1 . PHE A 1 234 ? 24.784  -4.651  26.570  1.00 26.44 ? 235 PHE A CE1 1 
ATOM   1905 C  CE2 . PHE A 1 234 ? 24.893  -2.850  28.162  1.00 28.24 ? 235 PHE A CE2 1 
ATOM   1906 C  CZ  . PHE A 1 234 ? 24.145  -3.755  27.422  1.00 27.39 ? 235 PHE A CZ  1 
ATOM   1907 N  N   . SER A 1 235 ? 31.280  -2.726  26.356  1.00 28.23 ? 236 SER A N   1 
ATOM   1908 C  CA  . SER A 1 235 ? 32.570  -2.232  26.772  1.00 29.77 ? 236 SER A CA  1 
ATOM   1909 C  C   . SER A 1 235 ? 32.923  -0.864  26.129  1.00 30.13 ? 236 SER A C   1 
ATOM   1910 O  O   . SER A 1 235 ? 33.343  0.062   26.829  1.00 30.52 ? 236 SER A O   1 
ATOM   1911 C  CB  . SER A 1 235 ? 33.625  -3.302  26.497  1.00 29.32 ? 236 SER A CB  1 
ATOM   1912 O  OG  . SER A 1 235 ? 34.832  -2.710  26.098  1.00 33.23 ? 236 SER A OG  1 
ATOM   1913 N  N   . LYS A 1 236 ? 32.714  -0.720  24.821  1.00 29.91 ? 237 LYS A N   1 
ATOM   1914 C  CA  . LYS A 1 236 ? 33.006  0.550   24.151  1.00 29.90 ? 237 LYS A CA  1 
ATOM   1915 C  C   . LYS A 1 236 ? 32.068  1.682   24.545  1.00 29.59 ? 237 LYS A C   1 
ATOM   1916 O  O   . LYS A 1 236 ? 32.515  2.803   24.827  1.00 28.87 ? 237 LYS A O   1 
ATOM   1917 C  CB  . LYS A 1 236 ? 33.020  0.392   22.636  1.00 30.32 ? 237 LYS A CB  1 
ATOM   1918 C  CG  . LYS A 1 236 ? 34.409  0.328   22.056  1.00 32.89 ? 237 LYS A CG  1 
ATOM   1919 C  CD  . LYS A 1 236 ? 34.927  -1.076  21.908  1.00 35.51 ? 237 LYS A CD  1 
ATOM   1920 C  CE  . LYS A 1 236 ? 36.363  -1.028  21.413  1.00 37.87 ? 237 LYS A CE  1 
ATOM   1921 N  NZ  . LYS A 1 236 ? 36.694  -2.222  20.611  1.00 40.75 ? 237 LYS A NZ  1 
ATOM   1922 N  N   . ALA A 1 237 ? 30.773  1.384   24.575  1.00 29.28 ? 238 ALA A N   1 
ATOM   1923 C  CA  . ALA A 1 237 ? 29.766  2.371   24.940  1.00 29.62 ? 238 ALA A CA  1 
ATOM   1924 C  C   . ALA A 1 237 ? 29.995  2.882   26.359  1.00 29.83 ? 238 ALA A C   1 
ATOM   1925 O  O   . ALA A 1 237 ? 29.865  4.073   26.628  1.00 29.66 ? 238 ALA A O   1 
ATOM   1926 C  CB  . ALA A 1 237 ? 28.362  1.780   24.822  1.00 29.17 ? 238 ALA A CB  1 
ATOM   1927 N  N   . ASP A 1 238 ? 30.311  1.968   27.266  1.00 29.95 ? 239 ASP A N   1 
ATOM   1928 C  CA  . ASP A 1 238 ? 30.544  2.331   28.658  1.00 30.87 ? 239 ASP A CA  1 
ATOM   1929 C  C   . ASP A 1 238 ? 31.767  3.241   28.834  1.00 30.23 ? 239 ASP A C   1 
ATOM   1930 O  O   . ASP A 1 238 ? 31.728  4.194   29.601  1.00 30.35 ? 239 ASP A O   1 
ATOM   1931 C  CB  . ASP A 1 238 ? 30.642  1.072   29.510  1.00 31.07 ? 239 ASP A CB  1 
ATOM   1932 C  CG  . ASP A 1 238 ? 29.296  0.366   29.651  1.00 35.32 ? 239 ASP A CG  1 
ATOM   1933 O  OD1 . ASP A 1 238 ? 28.340  0.704   28.898  1.00 40.37 ? 239 ASP A OD1 1 
ATOM   1934 O  OD2 . ASP A 1 238 ? 29.185  -0.531  30.509  1.00 38.63 ? 239 ASP A OD2 1 
ATOM   1935 N  N   . ILE A 1 239 ? 32.828  2.965   28.093  1.00 29.96 ? 240 ILE A N   1 
ATOM   1936 C  CA  . ILE A 1 239 ? 33.989  3.844   28.062  1.00 29.92 ? 240 ILE A CA  1 
ATOM   1937 C  C   . ILE A 1 239 ? 33.645  5.263   27.585  1.00 30.14 ? 240 ILE A C   1 
ATOM   1938 O  O   . ILE A 1 239 ? 34.019  6.240   28.242  1.00 29.74 ? 240 ILE A O   1 
ATOM   1939 C  CB  . ILE A 1 239 ? 35.118  3.203   27.241  1.00 30.27 ? 240 ILE A CB  1 
ATOM   1940 C  CG1 . ILE A 1 239 ? 35.739  2.078   28.072  1.00 30.34 ? 240 ILE A CG1 1 
ATOM   1941 C  CG2 . ILE A 1 239 ? 36.157  4.235   26.809  1.00 29.82 ? 240 ILE A CG2 1 
ATOM   1942 C  CD1 . ILE A 1 239 ? 36.384  0.981   27.259  1.00 32.66 ? 240 ILE A CD1 1 
ATOM   1943 N  N   . TYR A 1 240 ? 32.915  5.370   26.469  1.00 30.07 ? 241 TYR A N   1 
ATOM   1944 C  CA  . TYR A 1 240 ? 32.493  6.663   25.927  1.00 30.38 ? 241 TYR A CA  1 
ATOM   1945 C  C   . TYR A 1 240 ? 31.707  7.460   26.967  1.00 29.81 ? 241 TYR A C   1 
ATOM   1946 O  O   . TYR A 1 240 ? 31.951  8.646   27.157  1.00 28.68 ? 241 TYR A O   1 
ATOM   1947 C  CB  . TYR A 1 240 ? 31.618  6.505   24.675  1.00 31.00 ? 241 TYR A CB  1 
ATOM   1948 C  CG  . TYR A 1 240 ? 32.324  6.045   23.413  1.00 34.09 ? 241 TYR A CG  1 
ATOM   1949 C  CD1 . TYR A 1 240 ? 31.798  4.998   22.650  1.00 36.64 ? 241 TYR A CD1 1 
ATOM   1950 C  CD2 . TYR A 1 240 ? 33.501  6.659   22.970  1.00 37.34 ? 241 TYR A CD2 1 
ATOM   1951 C  CE1 . TYR A 1 240 ? 32.432  4.552   21.486  1.00 38.14 ? 241 TYR A CE1 1 
ATOM   1952 C  CE2 . TYR A 1 240 ? 34.149  6.218   21.788  1.00 39.53 ? 241 TYR A CE2 1 
ATOM   1953 C  CZ  . TYR A 1 240 ? 33.600  5.169   21.062  1.00 39.34 ? 241 TYR A CZ  1 
ATOM   1954 O  OH  . TYR A 1 240 ? 34.212  4.723   19.915  1.00 41.81 ? 241 TYR A OH  1 
ATOM   1955 N  N   . THR A 1 241 ? 30.775  6.787   27.635  1.00 29.37 ? 242 THR A N   1 
ATOM   1956 C  CA  . THR A 1 241 ? 29.869  7.440   28.571  1.00 29.58 ? 242 THR A CA  1 
ATOM   1957 C  C   . THR A 1 241 ? 30.594  7.906   29.830  1.00 29.81 ? 242 THR A C   1 
ATOM   1958 O  O   . THR A 1 241 ? 30.428  9.052   30.246  1.00 29.73 ? 242 THR A O   1 
ATOM   1959 C  CB  . THR A 1 241 ? 28.690  6.526   28.914  1.00 29.42 ? 242 THR A CB  1 
ATOM   1960 O  OG1 . THR A 1 241 ? 28.002  6.211   27.701  1.00 30.37 ? 242 THR A OG1 1 
ATOM   1961 C  CG2 . THR A 1 241 ? 27.708  7.212   29.901  1.00 27.58 ? 242 THR A CG2 1 
ATOM   1962 N  N   . GLN A 1 242 ? 31.384  7.008   30.415  1.00 30.28 ? 243 GLN A N   1 
ATOM   1963 C  CA  . GLN A 1 242 ? 32.221  7.305   31.575  1.00 31.18 ? 243 GLN A CA  1 
ATOM   1964 C  C   . GLN A 1 242 ? 33.208  8.438   31.327  1.00 30.63 ? 243 GLN A C   1 
ATOM   1965 O  O   . GLN A 1 242 ? 33.297  9.350   32.148  1.00 30.42 ? 243 GLN A O   1 
ATOM   1966 C  CB  . GLN A 1 242 ? 32.985  6.062   32.024  1.00 31.62 ? 243 GLN A CB  1 
ATOM   1967 C  CG  . GLN A 1 242 ? 32.097  4.999   32.674  1.00 35.81 ? 243 GLN A CG  1 
ATOM   1968 C  CD  . GLN A 1 242 ? 32.897  3.883   33.307  1.00 40.27 ? 243 GLN A CD  1 
ATOM   1969 O  OE1 . GLN A 1 242 ? 33.920  4.126   33.969  1.00 43.42 ? 243 GLN A OE1 1 
ATOM   1970 N  NE2 . GLN A 1 242 ? 32.432  2.649   33.124  1.00 41.75 ? 243 GLN A NE2 1 
ATOM   1971 N  N   . ASN A 1 243 ? 33.954  8.360   30.221  1.00 30.01 ? 244 ASN A N   1 
ATOM   1972 C  CA  . ASN A 1 243 ? 34.837  9.451   29.776  1.00 29.75 ? 244 ASN A CA  1 
ATOM   1973 C  C   . ASN A 1 243 ? 34.134  10.801  29.644  1.00 29.13 ? 244 ASN A C   1 
ATOM   1974 O  O   . ASN A 1 243 ? 34.650  11.812  30.113  1.00 29.17 ? 244 ASN A O   1 
ATOM   1975 C  CB  . ASN A 1 243 ? 35.544  9.107   28.464  1.00 29.64 ? 244 ASN A CB  1 
ATOM   1976 C  CG  . ASN A 1 243 ? 36.670  8.122   28.657  1.00 31.19 ? 244 ASN A CG  1 
ATOM   1977 O  OD1 . ASN A 1 243 ? 37.033  7.804   29.782  1.00 32.46 ? 244 ASN A OD1 1 
ATOM   1978 N  ND2 . ASN A 1 243 ? 37.225  7.623   27.556  1.00 32.52 ? 244 ASN A ND2 1 
ATOM   1979 N  N   . PHE A 1 244 ? 32.963  10.805  29.016  1.00 28.09 ? 245 PHE A N   1 
ATOM   1980 C  CA  . PHE A 1 244 ? 32.171  12.018  28.871  1.00 27.84 ? 245 PHE A CA  1 
ATOM   1981 C  C   . PHE A 1 244 ? 31.753  12.583  30.246  1.00 27.87 ? 245 PHE A C   1 
ATOM   1982 O  O   . PHE A 1 244 ? 31.759  13.800  30.473  1.00 26.79 ? 245 PHE A O   1 
ATOM   1983 C  CB  . PHE A 1 244 ? 30.928  11.705  28.042  1.00 27.39 ? 245 PHE A CB  1 
ATOM   1984 C  CG  . PHE A 1 244 ? 30.130  12.914  27.663  1.00 28.37 ? 245 PHE A CG  1 
ATOM   1985 C  CD1 . PHE A 1 244 ? 30.350  13.547  26.451  1.00 29.80 ? 245 PHE A CD1 1 
ATOM   1986 C  CD2 . PHE A 1 244 ? 29.155  13.417  28.515  1.00 29.79 ? 245 PHE A CD2 1 
ATOM   1987 C  CE1 . PHE A 1 244 ? 29.619  14.653  26.097  1.00 30.27 ? 245 PHE A CE1 1 
ATOM   1988 C  CE2 . PHE A 1 244 ? 28.417  14.521  28.164  1.00 30.59 ? 245 PHE A CE2 1 
ATOM   1989 C  CZ  . PHE A 1 244 ? 28.646  15.138  26.952  1.00 31.33 ? 245 PHE A CZ  1 
ATOM   1990 N  N   . TYR A 1 245 ? 31.370  11.676  31.140  1.00 28.13 ? 246 TYR A N   1 
ATOM   1991 C  CA  . TYR A 1 245 ? 30.946  12.021  32.500  1.00 29.38 ? 246 TYR A CA  1 
ATOM   1992 C  C   . TYR A 1 245 ? 32.059  12.759  33.225  1.00 29.29 ? 246 TYR A C   1 
ATOM   1993 O  O   . TYR A 1 245 ? 31.831  13.805  33.813  1.00 29.71 ? 246 TYR A O   1 
ATOM   1994 C  CB  . TYR A 1 245 ? 30.578  10.746  33.263  1.00 29.14 ? 246 TYR A CB  1 
ATOM   1995 C  CG  . TYR A 1 245 ? 30.172  10.916  34.713  1.00 30.50 ? 246 TYR A CG  1 
ATOM   1996 C  CD1 . TYR A 1 245 ? 28.830  11.008  35.066  1.00 31.22 ? 246 TYR A CD1 1 
ATOM   1997 C  CD2 . TYR A 1 245 ? 31.129  10.937  35.736  1.00 31.60 ? 246 TYR A CD2 1 
ATOM   1998 C  CE1 . TYR A 1 245 ? 28.432  11.132  36.400  1.00 33.02 ? 246 TYR A CE1 1 
ATOM   1999 C  CE2 . TYR A 1 245 ? 30.742  11.060  37.081  1.00 32.98 ? 246 TYR A CE2 1 
ATOM   2000 C  CZ  . TYR A 1 245 ? 29.387  11.150  37.397  1.00 33.97 ? 246 TYR A CZ  1 
ATOM   2001 O  OH  . TYR A 1 245 ? 28.978  11.278  38.714  1.00 38.08 ? 246 TYR A OH  1 
ATOM   2002 N  N   . TRP A 1 246 ? 33.263  12.213  33.151  1.00 30.31 ? 247 TRP A N   1 
ATOM   2003 C  CA  . TRP A 1 246 ? 34.402  12.776  33.863  1.00 31.83 ? 247 TRP A CA  1 
ATOM   2004 C  C   . TRP A 1 246 ? 34.948  14.044  33.216  1.00 32.96 ? 247 TRP A C   1 
ATOM   2005 O  O   . TRP A 1 246 ? 35.354  14.967  33.923  1.00 32.73 ? 247 TRP A O   1 
ATOM   2006 C  CB  . TRP A 1 246 ? 35.486  11.719  34.068  1.00 31.30 ? 247 TRP A CB  1 
ATOM   2007 C  CG  . TRP A 1 246 ? 35.123  10.810  35.206  1.00 31.95 ? 247 TRP A CG  1 
ATOM   2008 C  CD1 . TRP A 1 246 ? 34.796  9.478   35.142  1.00 31.91 ? 247 TRP A CD1 1 
ATOM   2009 C  CD2 . TRP A 1 246 ? 34.997  11.189  36.584  1.00 31.77 ? 247 TRP A CD2 1 
ATOM   2010 N  NE1 . TRP A 1 246 ? 34.496  9.006   36.406  1.00 31.34 ? 247 TRP A NE1 1 
ATOM   2011 C  CE2 . TRP A 1 246 ? 34.614  10.033  37.305  1.00 30.78 ? 247 TRP A CE2 1 
ATOM   2012 C  CE3 . TRP A 1 246 ? 35.180  12.394  37.281  1.00 30.67 ? 247 TRP A CE3 1 
ATOM   2013 C  CZ2 . TRP A 1 246 ? 34.417  10.048  38.691  1.00 31.86 ? 247 TRP A CZ2 1 
ATOM   2014 C  CZ3 . TRP A 1 246 ? 34.983  12.409  38.655  1.00 31.60 ? 247 TRP A CZ3 1 
ATOM   2015 C  CH2 . TRP A 1 246 ? 34.598  11.243  39.347  1.00 31.79 ? 247 TRP A CH2 1 
ATOM   2016 N  N   . GLU A 1 247 ? 34.920  14.092  31.884  1.00 34.21 ? 248 GLU A N   1 
ATOM   2017 C  CA  . GLU A 1 247 ? 35.333  15.283  31.126  1.00 36.14 ? 248 GLU A CA  1 
ATOM   2018 C  C   . GLU A 1 247 ? 34.458  16.477  31.432  1.00 36.60 ? 248 GLU A C   1 
ATOM   2019 O  O   . GLU A 1 247 ? 34.956  17.594  31.552  1.00 36.74 ? 248 GLU A O   1 
ATOM   2020 C  CB  . GLU A 1 247 ? 35.326  15.010  29.628  1.00 35.84 ? 248 GLU A CB  1 
ATOM   2021 C  CG  . GLU A 1 247 ? 36.563  14.299  29.156  1.00 38.61 ? 248 GLU A CG  1 
ATOM   2022 C  CD  . GLU A 1 247 ? 36.348  13.554  27.844  1.00 42.56 ? 248 GLU A CD  1 
ATOM   2023 O  OE1 . GLU A 1 247 ? 35.365  13.864  27.130  1.00 44.40 ? 248 GLU A OE1 1 
ATOM   2024 O  OE2 . GLU A 1 247 ? 37.162  12.654  27.535  1.00 43.56 ? 248 GLU A OE2 1 
ATOM   2025 N  N   . LEU A 1 248 ? 33.161  16.219  31.577  1.00 37.63 ? 249 LEU A N   1 
ATOM   2026 C  CA  . LEU A 1 248 ? 32.178  17.214  31.983  1.00 38.84 ? 249 LEU A CA  1 
ATOM   2027 C  C   . LEU A 1 248 ? 32.575  17.896  33.297  1.00 39.77 ? 249 LEU A C   1 
ATOM   2028 O  O   . LEU A 1 248 ? 32.397  19.106  33.463  1.00 39.75 ? 249 LEU A O   1 
ATOM   2029 C  CB  . LEU A 1 248 ? 30.832  16.526  32.172  1.00 38.99 ? 249 LEU A CB  1 
ATOM   2030 C  CG  . LEU A 1 248 ? 29.560  17.263  31.795  1.00 40.44 ? 249 LEU A CG  1 
ATOM   2031 C  CD1 . LEU A 1 248 ? 29.500  17.382  30.278  1.00 41.20 ? 249 LEU A CD1 1 
ATOM   2032 C  CD2 . LEU A 1 248 ? 28.351  16.518  32.337  1.00 40.71 ? 249 LEU A CD2 1 
ATOM   2033 N  N   . ARG A 1 249 ? 33.099  17.102  34.227  1.00 40.53 ? 250 ARG A N   1 
ATOM   2034 C  CA  . ARG A 1 249 ? 33.553  17.602  35.519  1.00 41.65 ? 250 ARG A CA  1 
ATOM   2035 C  C   . ARG A 1 249 ? 34.914  18.283  35.432  1.00 42.57 ? 250 ARG A C   1 
ATOM   2036 O  O   . ARG A 1 249 ? 35.193  19.199  36.205  1.00 42.59 ? 250 ARG A O   1 
ATOM   2037 C  CB  . ARG A 1 249 ? 33.559  16.474  36.550  1.00 41.17 ? 250 ARG A CB  1 
ATOM   2038 C  CG  . ARG A 1 249 ? 32.188  16.239  37.111  1.00 40.96 ? 250 ARG A CG  1 
ATOM   2039 C  CD  . ARG A 1 249 ? 31.885  14.785  37.378  1.00 41.50 ? 250 ARG A CD  1 
ATOM   2040 N  NE  . ARG A 1 249 ? 30.513  14.659  37.876  1.00 42.74 ? 250 ARG A NE  1 
ATOM   2041 C  CZ  . ARG A 1 249 ? 29.426  14.540  37.109  1.00 42.29 ? 250 ARG A CZ  1 
ATOM   2042 N  NH1 . ARG A 1 249 ? 29.530  14.500  35.779  1.00 41.53 ? 250 ARG A NH1 1 
ATOM   2043 N  NH2 . ARG A 1 249 ? 28.227  14.443  37.680  1.00 40.44 ? 250 ARG A NH2 1 
ATOM   2044 N  N   . GLN A 1 250 ? 35.740  17.848  34.481  1.00 43.83 ? 251 GLN A N   1 
ATOM   2045 C  CA  . GLN A 1 250 ? 37.051  18.448  34.256  1.00 45.96 ? 251 GLN A CA  1 
ATOM   2046 C  C   . GLN A 1 250 ? 36.942  19.861  33.666  1.00 47.27 ? 251 GLN A C   1 
ATOM   2047 O  O   . GLN A 1 250 ? 37.677  20.755  34.067  1.00 47.51 ? 251 GLN A O   1 
ATOM   2048 C  CB  . GLN A 1 250 ? 37.916  17.566  33.353  1.00 45.79 ? 251 GLN A CB  1 
ATOM   2049 C  CG  . GLN A 1 250 ? 38.325  16.243  33.970  1.00 46.68 ? 251 GLN A CG  1 
ATOM   2050 C  CD  . GLN A 1 250 ? 39.051  15.329  32.987  1.00 47.59 ? 251 GLN A CD  1 
ATOM   2051 O  OE1 . GLN A 1 250 ? 39.870  15.786  32.188  1.00 49.70 ? 251 GLN A OE1 1 
ATOM   2052 N  NE2 . GLN A 1 250 ? 38.756  14.033  33.045  1.00 46.46 ? 251 GLN A NE2 1 
ATOM   2053 N  N   . LYS A 1 251 ? 36.012  20.052  32.734  1.00 49.11 ? 252 LYS A N   1 
ATOM   2054 C  CA  . LYS A 1 251 ? 35.826  21.331  32.044  1.00 51.04 ? 252 LYS A CA  1 
ATOM   2055 C  C   . LYS A 1 251 ? 34.750  22.196  32.712  1.00 52.15 ? 252 LYS A C   1 
ATOM   2056 O  O   . LYS A 1 251 ? 34.595  23.371  32.372  1.00 52.61 ? 252 LYS A O   1 
ATOM   2057 C  CB  . LYS A 1 251 ? 35.486  21.088  30.570  1.00 51.10 ? 252 LYS A CB  1 
ATOM   2058 C  CG  . LYS A 1 251 ? 36.412  20.071  29.894  1.00 51.98 ? 252 LYS A CG  1 
ATOM   2059 C  CD  . LYS A 1 251 ? 35.735  19.403  28.712  1.00 53.70 ? 252 LYS A CD  1 
ATOM   2060 C  CE  . LYS A 1 251 ? 36.213  19.986  27.391  1.00 54.39 ? 252 LYS A CE  1 
ATOM   2061 N  NZ  . LYS A 1 251 ? 37.363  19.233  26.825  1.00 54.37 ? 252 LYS A NZ  1 
ATOM   2062 N  N   . GLY A 1 252 ? 34.024  21.596  33.658  1.00 53.41 ? 253 GLY A N   1 
ATOM   2063 C  CA  . GLY A 1 252 ? 32.974  22.240  34.471  1.00 54.91 ? 253 GLY A CA  1 
ATOM   2064 C  C   . GLY A 1 252 ? 32.553  23.671  34.173  1.00 56.11 ? 253 GLY A C   1 
ATOM   2065 O  O   . GLY A 1 252 ? 32.660  24.553  35.033  1.00 56.29 ? 253 GLY A O   1 
ATOM   2066 N  N   . SER A 1 253 ? 32.067  23.898  32.955  1.00 57.06 ? 254 SER A N   1 
ATOM   2067 C  CA  . SER A 1 253 ? 31.515  25.191  32.553  1.00 57.76 ? 254 SER A CA  1 
ATOM   2068 C  C   . SER A 1 253 ? 30.070  25.000  32.109  1.00 57.94 ? 254 SER A C   1 
ATOM   2069 O  O   . SER A 1 253 ? 29.770  24.089  31.331  1.00 58.18 ? 254 SER A O   1 
ATOM   2070 C  CB  . SER A 1 253 ? 32.332  25.786  31.405  1.00 58.00 ? 254 SER A CB  1 
ATOM   2071 O  OG  . SER A 1 253 ? 32.304  24.929  30.269  1.00 59.17 ? 254 SER A OG  1 
ATOM   2072 N  N   . VAL A 1 254 ? 29.169  25.841  32.609  1.00 57.93 ? 255 VAL A N   1 
ATOM   2073 C  CA  . VAL A 1 254 ? 27.781  25.777  32.166  1.00 57.75 ? 255 VAL A CA  1 
ATOM   2074 C  C   . VAL A 1 254 ? 27.704  26.341  30.746  1.00 57.42 ? 255 VAL A C   1 
ATOM   2075 O  O   . VAL A 1 254 ? 27.883  27.544  30.526  1.00 57.55 ? 255 VAL A O   1 
ATOM   2076 C  CB  . VAL A 1 254 ? 26.806  26.511  33.120  1.00 57.88 ? 255 VAL A CB  1 
ATOM   2077 C  CG1 . VAL A 1 254 ? 25.361  26.403  32.602  1.00 57.93 ? 255 VAL A CG1 1 
ATOM   2078 C  CG2 . VAL A 1 254 ? 26.915  25.948  34.538  1.00 58.07 ? 255 VAL A CG2 1 
ATOM   2079 N  N   . HIS A 1 255 ? 27.456  25.453  29.788  1.00 56.78 ? 256 HIS A N   1 
ATOM   2080 C  CA  . HIS A 1 255 ? 27.377  25.836  28.388  1.00 55.99 ? 256 HIS A CA  1 
ATOM   2081 C  C   . HIS A 1 255 ? 25.991  26.325  27.997  1.00 55.15 ? 256 HIS A C   1 
ATOM   2082 O  O   . HIS A 1 255 ? 24.977  25.799  28.464  1.00 54.98 ? 256 HIS A O   1 
ATOM   2083 C  CB  . HIS A 1 255 ? 27.825  24.686  27.491  1.00 56.27 ? 256 HIS A CB  1 
ATOM   2084 C  CG  . HIS A 1 255 ? 29.296  24.424  27.559  1.00 57.23 ? 256 HIS A CG  1 
ATOM   2085 N  ND1 . HIS A 1 255 ? 30.198  25.023  26.706  1.00 58.98 ? 256 HIS A ND1 1 
ATOM   2086 C  CD2 . HIS A 1 255 ? 30.025  23.645  28.393  1.00 57.78 ? 256 HIS A CD2 1 
ATOM   2087 C  CE1 . HIS A 1 255 ? 31.419  24.617  27.007  1.00 58.99 ? 256 HIS A CE1 1 
ATOM   2088 N  NE2 . HIS A 1 255 ? 31.341  23.779  28.025  1.00 58.92 ? 256 HIS A NE2 1 
ATOM   2089 N  N   . HIS A 1 256 ? 25.972  27.350  27.148  1.00 53.95 ? 257 HIS A N   1 
ATOM   2090 C  CA  . HIS A 1 256 ? 24.737  27.885  26.579  1.00 52.90 ? 257 HIS A CA  1 
ATOM   2091 C  C   . HIS A 1 256 ? 24.467  27.251  25.213  1.00 51.64 ? 257 HIS A C   1 
ATOM   2092 O  O   . HIS A 1 256 ? 23.310  27.067  24.828  1.00 51.55 ? 257 HIS A O   1 
ATOM   2093 C  CB  . HIS A 1 256 ? 24.811  29.412  26.460  1.00 53.12 ? 257 HIS A CB  1 
ATOM   2094 C  CG  . HIS A 1 256 ? 24.953  30.122  27.775  1.00 54.21 ? 257 HIS A CG  1 
ATOM   2095 N  ND1 . HIS A 1 256 ? 24.038  31.053  28.223  1.00 55.54 ? 257 HIS A ND1 1 
ATOM   2096 C  CD2 . HIS A 1 256 ? 25.909  30.047  28.733  1.00 54.77 ? 257 HIS A CD2 1 
ATOM   2097 C  CE1 . HIS A 1 256 ? 24.422  31.516  29.399  1.00 55.78 ? 257 HIS A CE1 1 
ATOM   2098 N  NE2 . HIS A 1 256 ? 25.554  30.921  29.732  1.00 55.53 ? 257 HIS A NE2 1 
ATOM   2099 N  N   . ASP A 1 257 ? 25.541  26.926  24.489  1.00 50.22 ? 258 ASP A N   1 
ATOM   2100 C  CA  . ASP A 1 257 ? 25.453  26.198  23.220  1.00 48.78 ? 258 ASP A CA  1 
ATOM   2101 C  C   . ASP A 1 257 ? 25.012  24.760  23.472  1.00 47.48 ? 258 ASP A C   1 
ATOM   2102 O  O   . ASP A 1 257 ? 25.344  24.182  24.510  1.00 47.53 ? 258 ASP A O   1 
ATOM   2103 C  CB  . ASP A 1 257 ? 26.799  26.201  22.489  1.00 48.98 ? 258 ASP A CB  1 
ATOM   2104 C  CG  . ASP A 1 257 ? 27.935  25.612  23.330  1.00 49.85 ? 258 ASP A CG  1 
ATOM   2105 O  OD1 . ASP A 1 257 ? 28.080  26.008  24.511  1.00 50.97 ? 258 ASP A OD1 1 
ATOM   2106 O  OD2 . ASP A 1 257 ? 28.697  24.766  22.805  1.00 49.56 ? 258 ASP A OD2 1 
ATOM   2107 N  N   . TYR A 1 258 ? 24.260  24.196  22.528  1.00 45.58 ? 259 TYR A N   1 
ATOM   2108 C  CA  . TYR A 1 258 ? 23.847  22.789  22.594  1.00 43.75 ? 259 TYR A CA  1 
ATOM   2109 C  C   . TYR A 1 258 ? 25.056  21.846  22.541  1.00 42.48 ? 259 TYR A C   1 
ATOM   2110 O  O   . TYR A 1 258 ? 25.955  22.019  21.714  1.00 42.16 ? 259 TYR A O   1 
ATOM   2111 C  CB  . TYR A 1 258 ? 22.864  22.470  21.469  1.00 43.42 ? 259 TYR A CB  1 
ATOM   2112 C  CG  . TYR A 1 258 ? 22.269  21.081  21.540  1.00 43.14 ? 259 TYR A CG  1 
ATOM   2113 C  CD1 . TYR A 1 258 ? 21.288  20.764  22.489  1.00 42.10 ? 259 TYR A CD1 1 
ATOM   2114 C  CD2 . TYR A 1 258 ? 22.683  20.084  20.653  1.00 42.18 ? 259 TYR A CD2 1 
ATOM   2115 C  CE1 . TYR A 1 258 ? 20.737  19.492  22.551  1.00 41.27 ? 259 TYR A CE1 1 
ATOM   2116 C  CE2 . TYR A 1 258 ? 22.138  18.810  20.701  1.00 41.41 ? 259 TYR A CE2 1 
ATOM   2117 C  CZ  . TYR A 1 258 ? 21.169  18.519  21.651  1.00 41.45 ? 259 TYR A CZ  1 
ATOM   2118 O  OH  . TYR A 1 258 ? 20.637  17.257  21.695  1.00 39.82 ? 259 TYR A OH  1 
ATOM   2119 N  N   . ARG A 1 259 ? 25.079  20.865  23.436  1.00 40.95 ? 260 ARG A N   1 
ATOM   2120 C  CA  . ARG A 1 259 ? 26.234  19.976  23.546  1.00 39.90 ? 260 ARG A CA  1 
ATOM   2121 C  C   . ARG A 1 259 ? 25.930  18.493  23.291  1.00 38.19 ? 260 ARG A C   1 
ATOM   2122 O  O   . ARG A 1 259 ? 26.814  17.649  23.456  1.00 38.02 ? 260 ARG A O   1 
ATOM   2123 C  CB  . ARG A 1 259 ? 26.903  20.116  24.917  1.00 40.31 ? 260 ARG A CB  1 
ATOM   2124 C  CG  . ARG A 1 259 ? 27.285  21.528  25.318  1.00 42.57 ? 260 ARG A CG  1 
ATOM   2125 C  CD  . ARG A 1 259 ? 28.697  21.539  25.882  1.00 45.89 ? 260 ARG A CD  1 
ATOM   2126 N  NE  . ARG A 1 259 ? 29.684  21.867  24.851  1.00 49.36 ? 260 ARG A NE  1 
ATOM   2127 C  CZ  . ARG A 1 259 ? 30.988  21.598  24.933  1.00 51.63 ? 260 ARG A CZ  1 
ATOM   2128 N  NH1 . ARG A 1 259 ? 31.488  20.977  26.001  1.00 52.42 ? 260 ARG A NH1 1 
ATOM   2129 N  NH2 . ARG A 1 259 ? 31.799  21.950  23.941  1.00 51.28 ? 260 ARG A NH2 1 
ATOM   2130 N  N   . GLY A 1 260 ? 24.698  18.179  22.904  1.00 36.22 ? 261 GLY A N   1 
ATOM   2131 C  CA  . GLY A 1 260 ? 24.314  16.795  22.636  1.00 34.24 ? 261 GLY A CA  1 
ATOM   2132 C  C   . GLY A 1 260 ? 23.307  16.223  23.625  1.00 33.00 ? 261 GLY A C   1 
ATOM   2133 O  O   . GLY A 1 260 ? 23.014  16.838  24.661  1.00 32.69 ? 261 GLY A O   1 
ATOM   2134 N  N   . ILE A 1 261 ? 22.774  15.047  23.289  1.00 30.91 ? 262 ILE A N   1 
ATOM   2135 C  CA  . ILE A 1 261 ? 21.777  14.362  24.108  1.00 29.45 ? 262 ILE A CA  1 
ATOM   2136 C  C   . ILE A 1 261 ? 22.290  13.990  25.514  1.00 29.33 ? 262 ILE A C   1 
ATOM   2137 O  O   . ILE A 1 261 ? 21.583  14.210  26.497  1.00 29.17 ? 262 ILE A O   1 
ATOM   2138 C  CB  . ILE A 1 261 ? 21.250  13.089  23.416  1.00 29.02 ? 262 ILE A CB  1 
ATOM   2139 C  CG1 . ILE A 1 261 ? 20.570  13.426  22.083  1.00 28.27 ? 262 ILE A CG1 1 
ATOM   2140 C  CG2 . ILE A 1 261 ? 20.280  12.354  24.325  1.00 27.06 ? 262 ILE A CG2 1 
ATOM   2141 C  CD1 . ILE A 1 261 ? 20.563  12.243  21.088  1.00 27.56 ? 262 ILE A CD1 1 
ATOM   2142 N  N   . LEU A 1 262 ? 23.493  13.416  25.589  1.00 28.72 ? 263 LEU A N   1 
ATOM   2143 C  CA  . LEU A 1 262 ? 24.079  12.960  26.854  1.00 28.92 ? 263 LEU A CA  1 
ATOM   2144 C  C   . LEU A 1 262 ? 24.269  14.099  27.859  1.00 29.42 ? 263 LEU A C   1 
ATOM   2145 O  O   . LEU A 1 262 ? 23.976  13.937  29.047  1.00 29.42 ? 263 LEU A O   1 
ATOM   2146 C  CB  . LEU A 1 262 ? 25.408  12.210  26.631  1.00 28.01 ? 263 LEU A CB  1 
ATOM   2147 C  CG  . LEU A 1 262 ? 26.031  11.531  27.873  1.00 27.79 ? 263 LEU A CG  1 
ATOM   2148 C  CD1 . LEU A 1 262 ? 25.002  10.729  28.663  1.00 26.31 ? 263 LEU A CD1 1 
ATOM   2149 C  CD2 . LEU A 1 262 ? 27.229  10.646  27.557  1.00 24.35 ? 263 LEU A CD2 1 
ATOM   2150 N  N   . TYR A 1 263 ? 24.769  15.233  27.378  1.00 30.15 ? 264 TYR A N   1 
ATOM   2151 C  CA  . TYR A 1 263 ? 24.895  16.450  28.191  1.00 31.19 ? 264 TYR A CA  1 
ATOM   2152 C  C   . TYR A 1 263 ? 23.558  16.845  28.807  1.00 31.59 ? 264 TYR A C   1 
ATOM   2153 O  O   . TYR A 1 263 ? 23.502  17.203  29.979  1.00 31.82 ? 264 TYR A O   1 
ATOM   2154 C  CB  . TYR A 1 263 ? 25.436  17.609  27.347  1.00 31.29 ? 264 TYR A CB  1 
ATOM   2155 C  CG  . TYR A 1 263 ? 25.793  18.862  28.133  1.00 32.40 ? 264 TYR A CG  1 
ATOM   2156 C  CD1 . TYR A 1 263 ? 27.084  19.052  28.625  1.00 32.50 ? 264 TYR A CD1 1 
ATOM   2157 C  CD2 . TYR A 1 263 ? 24.842  19.859  28.376  1.00 33.64 ? 264 TYR A CD2 1 
ATOM   2158 C  CE1 . TYR A 1 263 ? 27.425  20.198  29.347  1.00 34.43 ? 264 TYR A CE1 1 
ATOM   2159 C  CE2 . TYR A 1 263 ? 25.171  21.015  29.106  1.00 34.80 ? 264 TYR A CE2 1 
ATOM   2160 C  CZ  . TYR A 1 263 ? 26.464  21.176  29.583  1.00 35.46 ? 264 TYR A CZ  1 
ATOM   2161 O  OH  . TYR A 1 263 ? 26.805  22.317  30.286  1.00 38.02 ? 264 TYR A OH  1 
ATOM   2162 N  N   . ARG A 1 264 ? 22.489  16.784  28.012  1.00 32.39 ? 265 ARG A N   1 
ATOM   2163 C  CA  . ARG A 1 264 ? 21.157  17.144  28.485  1.00 33.18 ? 265 ARG A CA  1 
ATOM   2164 C  C   . ARG A 1 264 ? 20.652  16.161  29.539  1.00 34.05 ? 265 ARG A C   1 
ATOM   2165 O  O   . ARG A 1 264 ? 20.075  16.571  30.558  1.00 33.96 ? 265 ARG A O   1 
ATOM   2166 C  CB  . ARG A 1 264 ? 20.172  17.203  27.321  1.00 33.50 ? 265 ARG A CB  1 
ATOM   2167 C  CG  . ARG A 1 264 ? 20.313  18.406  26.413  1.00 34.82 ? 265 ARG A CG  1 
ATOM   2168 C  CD  . ARG A 1 264 ? 19.562  19.604  26.980  1.00 37.63 ? 265 ARG A CD  1 
ATOM   2169 N  NE  . ARG A 1 264 ? 19.482  20.715  26.026  1.00 39.15 ? 265 ARG A NE  1 
ATOM   2170 C  CZ  . ARG A 1 264 ? 18.481  20.910  25.163  1.00 40.09 ? 265 ARG A CZ  1 
ATOM   2171 N  NH1 . ARG A 1 264 ? 17.451  20.065  25.100  1.00 39.97 ? 265 ARG A NH1 1 
ATOM   2172 N  NH2 . ARG A 1 264 ? 18.513  21.958  24.352  1.00 39.94 ? 265 ARG A NH2 1 
ATOM   2173 N  N   . LEU A 1 265 ? 20.864  14.866  29.297  1.00 34.06 ? 266 LEU A N   1 
ATOM   2174 C  CA  . LEU A 1 265 ? 20.391  13.847  30.226  1.00 34.60 ? 266 LEU A CA  1 
ATOM   2175 C  C   . LEU A 1 265 ? 21.135  13.917  31.557  1.00 35.31 ? 266 LEU A C   1 
ATOM   2176 O  O   . LEU A 1 265 ? 20.516  13.832  32.613  1.00 35.21 ? 266 LEU A O   1 
ATOM   2177 C  CB  . LEU A 1 265 ? 20.494  12.441  29.622  1.00 33.85 ? 266 LEU A CB  1 
ATOM   2178 C  CG  . LEU A 1 265 ? 19.576  12.103  28.447  1.00 33.44 ? 266 LEU A CG  1 
ATOM   2179 C  CD1 . LEU A 1 265 ? 19.981  10.746  27.866  1.00 33.42 ? 266 LEU A CD1 1 
ATOM   2180 C  CD2 . LEU A 1 265 ? 18.082  12.118  28.828  1.00 30.85 ? 266 LEU A CD2 1 
ATOM   2181 N  N   . LEU A 1 266 ? 22.455  14.082  31.502  1.00 36.15 ? 267 LEU A N   1 
ATOM   2182 C  CA  . LEU A 1 266 ? 23.265  14.106  32.717  1.00 37.62 ? 267 LEU A CA  1 
ATOM   2183 C  C   . LEU A 1 266 ? 23.025  15.363  33.558  1.00 38.92 ? 267 LEU A C   1 
ATOM   2184 O  O   . LEU A 1 266 ? 23.164  15.327  34.775  1.00 39.50 ? 267 LEU A O   1 
ATOM   2185 C  CB  . LEU A 1 266 ? 24.750  13.961  32.395  1.00 36.87 ? 267 LEU A CB  1 
ATOM   2186 C  CG  . LEU A 1 266 ? 25.273  12.596  31.942  1.00 36.47 ? 267 LEU A CG  1 
ATOM   2187 C  CD1 . LEU A 1 266 ? 26.704  12.736  31.446  1.00 35.67 ? 267 LEU A CD1 1 
ATOM   2188 C  CD2 . LEU A 1 266 ? 25.196  11.539  33.044  1.00 34.59 ? 267 LEU A CD2 1 
ATOM   2189 N  N   . GLY A 1 267 ? 22.647  16.455  32.900  1.00 40.27 ? 268 GLY A N   1 
ATOM   2190 C  CA  . GLY A 1 267 ? 22.409  17.727  33.566  1.00 41.92 ? 268 GLY A CA  1 
ATOM   2191 C  C   . GLY A 1 267 ? 20.985  17.961  34.030  1.00 43.10 ? 268 GLY A C   1 
ATOM   2192 O  O   . GLY A 1 267 ? 20.771  18.622  35.048  1.00 43.29 ? 268 GLY A O   1 
ATOM   2193 N  N   . ASP A 1 268 ? 20.005  17.434  33.298  1.00 43.90 ? 269 ASP A N   1 
ATOM   2194 C  CA  . ASP A 1 268 ? 18.601  17.734  33.596  1.00 45.36 ? 269 ASP A CA  1 
ATOM   2195 C  C   . ASP A 1 268 ? 17.652  16.574  33.277  1.00 45.31 ? 269 ASP A C   1 
ATOM   2196 O  O   . ASP A 1 268 ? 16.770  16.702  32.428  1.00 46.02 ? 269 ASP A O   1 
ATOM   2197 C  CB  . ASP A 1 268 ? 18.164  19.019  32.856  1.00 45.99 ? 269 ASP A CB  1 
ATOM   2198 C  CG  . ASP A 1 268 ? 16.860  19.616  33.400  1.00 48.28 ? 269 ASP A CG  1 
ATOM   2199 O  OD1 . ASP A 1 268 ? 16.484  19.335  34.568  1.00 49.78 ? 269 ASP A OD1 1 
ATOM   2200 O  OD2 . ASP A 1 268 ? 16.212  20.387  32.648  1.00 50.82 ? 269 ASP A OD2 1 
ATOM   2201 N  N   . SER A 1 269 ? 17.817  15.458  33.984  1.00 45.24 ? 270 SER A N   1 
ATOM   2202 C  CA  . SER A 1 269 ? 16.990  14.267  33.762  1.00 45.02 ? 270 SER A CA  1 
ATOM   2203 C  C   . SER A 1 269 ? 16.585  13.619  35.080  1.00 44.62 ? 270 SER A C   1 
ATOM   2204 O  O   . SER A 1 269 ? 17.287  13.748  36.071  1.00 44.94 ? 270 SER A O   1 
ATOM   2205 C  CB  . SER A 1 269 ? 17.763  13.244  32.915  1.00 44.74 ? 270 SER A CB  1 
ATOM   2206 O  OG  . SER A 1 269 ? 16.921  12.217  32.427  1.00 45.06 ? 270 SER A OG  1 
ATOM   2207 N  N   . LYS A 1 270 ? 15.464  12.905  35.078  1.00 44.19 ? 271 LYS A N   1 
ATOM   2208 C  CA  . LYS A 1 270 ? 15.083  12.078  36.222  1.00 43.69 ? 271 LYS A CA  1 
ATOM   2209 C  C   . LYS A 1 270 ? 15.771  10.717  36.189  1.00 43.17 ? 271 LYS A C   1 
ATOM   2210 O  O   . LYS A 1 270 ? 15.704  9.960   37.164  1.00 43.08 ? 271 LYS A O   1 
ATOM   2211 C  CB  . LYS A 1 270 ? 13.570  11.888  36.279  1.00 43.97 ? 271 LYS A CB  1 
ATOM   2212 C  CG  . LYS A 1 270 ? 12.818  13.084  36.832  1.00 45.10 ? 271 LYS A CG  1 
ATOM   2213 C  CD  . LYS A 1 270 ? 11.335  12.950  36.570  1.00 46.44 ? 271 LYS A CD  1 
ATOM   2214 C  CE  . LYS A 1 270 ? 10.600  14.192  37.037  1.00 47.96 ? 271 LYS A CE  1 
ATOM   2215 N  NZ  . LYS A 1 270 ? 9.170   14.127  36.647  1.00 48.92 ? 271 LYS A NZ  1 
ATOM   2216 N  N   . MET A 1 271 ? 16.424  10.403  35.069  1.00 42.12 ? 272 MET A N   1 
ATOM   2217 C  CA  . MET A 1 271 ? 17.123  9.128   34.923  1.00 41.05 ? 272 MET A CA  1 
ATOM   2218 C  C   . MET A 1 271 ? 18.379  9.110   35.766  1.00 40.10 ? 272 MET A C   1 
ATOM   2219 O  O   . MET A 1 271 ? 19.121  10.099  35.821  1.00 40.33 ? 272 MET A O   1 
ATOM   2220 C  CB  . MET A 1 271 ? 17.504  8.860   33.458  1.00 41.08 ? 272 MET A CB  1 
ATOM   2221 C  CG  . MET A 1 271 ? 16.652  7.817   32.736  1.00 42.34 ? 272 MET A CG  1 
ATOM   2222 S  SD  . MET A 1 271 ? 17.322  7.353   31.100  1.00 44.64 ? 272 MET A SD  1 
ATOM   2223 C  CE  . MET A 1 271 ? 17.253  8.953   30.293  1.00 41.69 ? 272 MET A CE  1 
ATOM   2224 N  N   . SER A 1 272 ? 18.617  7.972   36.409  1.00 38.61 ? 273 SER A N   1 
ATOM   2225 C  CA  . SER A 1 272 ? 19.883  7.706   37.067  1.00 37.66 ? 273 SER A CA  1 
ATOM   2226 C  C   . SER A 1 272 ? 20.979  7.554   36.012  1.00 36.88 ? 273 SER A C   1 
ATOM   2227 O  O   . SER A 1 272 ? 20.691  7.336   34.821  1.00 36.49 ? 273 SER A O   1 
ATOM   2228 C  CB  . SER A 1 272 ? 19.785  6.423   37.901  1.00 37.92 ? 273 SER A CB  1 
ATOM   2229 O  OG  . SER A 1 272 ? 19.560  5.298   37.065  1.00 37.39 ? 273 SER A OG  1 
ATOM   2230 N  N   . PHE A 1 273 ? 22.228  7.671   36.452  1.00 35.45 ? 274 PHE A N   1 
ATOM   2231 C  CA  . PHE A 1 273 ? 23.360  7.484   35.572  1.00 34.67 ? 274 PHE A CA  1 
ATOM   2232 C  C   . PHE A 1 273 ? 23.365  6.098   34.921  1.00 34.62 ? 274 PHE A C   1 
ATOM   2233 O  O   . PHE A 1 273 ? 23.705  5.969   33.745  1.00 33.70 ? 274 PHE A O   1 
ATOM   2234 C  CB  . PHE A 1 273 ? 24.684  7.710   36.287  1.00 33.90 ? 274 PHE A CB  1 
ATOM   2235 C  CG  . PHE A 1 273 ? 25.870  7.367   35.443  1.00 31.96 ? 274 PHE A CG  1 
ATOM   2236 C  CD1 . PHE A 1 273 ? 26.330  8.256   34.481  1.00 30.35 ? 274 PHE A CD1 1 
ATOM   2237 C  CD2 . PHE A 1 273 ? 26.505  6.135   35.577  1.00 30.48 ? 274 PHE A CD2 1 
ATOM   2238 C  CE1 . PHE A 1 273 ? 27.423  7.928   33.672  1.00 28.72 ? 274 PHE A CE1 1 
ATOM   2239 C  CE2 . PHE A 1 273 ? 27.583  5.803   34.783  1.00 28.87 ? 274 PHE A CE2 1 
ATOM   2240 C  CZ  . PHE A 1 273 ? 28.047  6.706   33.829  1.00 28.03 ? 274 PHE A CZ  1 
ATOM   2241 N  N   . GLU A 1 274 ? 22.993  5.077   35.691  1.00 34.37 ? 275 GLU A N   1 
ATOM   2242 C  CA  . GLU A 1 274 ? 22.984  3.716   35.176  1.00 34.91 ? 275 GLU A CA  1 
ATOM   2243 C  C   . GLU A 1 274 ? 21.925  3.512   34.083  1.00 34.17 ? 275 GLU A C   1 
ATOM   2244 O  O   . GLU A 1 274 ? 22.190  2.827   33.097  1.00 34.56 ? 275 GLU A O   1 
ATOM   2245 C  CB  . GLU A 1 274 ? 22.833  2.691   36.302  1.00 35.52 ? 275 GLU A CB  1 
ATOM   2246 C  CG  . GLU A 1 274 ? 23.472  1.327   35.981  1.00 38.86 ? 275 GLU A CG  1 
ATOM   2247 C  CD  . GLU A 1 274 ? 25.014  1.345   35.947  1.00 43.05 ? 275 GLU A CD  1 
ATOM   2248 O  OE1 . GLU A 1 274 ? 25.640  2.339   36.396  1.00 45.90 ? 275 GLU A OE1 1 
ATOM   2249 O  OE2 . GLU A 1 274 ? 25.605  0.349   35.471  1.00 44.39 ? 275 GLU A OE2 1 
ATOM   2250 N  N   . ASP A 1 275 ? 20.745  4.105   34.253  1.00 33.17 ? 276 ASP A N   1 
ATOM   2251 C  CA  . ASP A 1 275 ? 19.722  4.089   33.197  1.00 32.70 ? 276 ASP A CA  1 
ATOM   2252 C  C   . ASP A 1 275 ? 20.195  4.844   31.959  1.00 31.54 ? 276 ASP A C   1 
ATOM   2253 O  O   . ASP A 1 275 ? 19.987  4.398   30.839  1.00 31.22 ? 276 ASP A O   1 
ATOM   2254 C  CB  . ASP A 1 275 ? 18.409  4.706   33.685  1.00 33.22 ? 276 ASP A CB  1 
ATOM   2255 C  CG  . ASP A 1 275 ? 17.769  3.911   34.822  1.00 35.64 ? 276 ASP A CG  1 
ATOM   2256 O  OD1 . ASP A 1 275 ? 17.686  2.671   34.713  1.00 37.73 ? 276 ASP A OD1 1 
ATOM   2257 O  OD2 . ASP A 1 275 ? 17.348  4.541   35.820  1.00 38.52 ? 276 ASP A OD2 1 
ATOM   2258 N  N   . ILE A 1 276 ? 20.827  5.992   32.177  1.00 30.34 ? 277 ILE A N   1 
ATOM   2259 C  CA  . ILE A 1 276 ? 21.351  6.798   31.089  1.00 29.52 ? 277 ILE A CA  1 
ATOM   2260 C  C   . ILE A 1 276 ? 22.395  6.020   30.283  1.00 28.81 ? 277 ILE A C   1 
ATOM   2261 O  O   . ILE A 1 276 ? 22.315  5.976   29.054  1.00 28.60 ? 277 ILE A O   1 
ATOM   2262 C  CB  . ILE A 1 276 ? 21.934  8.135   31.602  1.00 29.52 ? 277 ILE A CB  1 
ATOM   2263 C  CG1 . ILE A 1 276 ? 20.793  9.064   32.038  1.00 30.35 ? 277 ILE A CG1 1 
ATOM   2264 C  CG2 . ILE A 1 276 ? 22.781  8.812   30.525  1.00 28.35 ? 277 ILE A CG2 1 
ATOM   2265 C  CD1 . ILE A 1 276 ? 21.238  10.270  32.888  1.00 30.99 ? 277 ILE A CD1 1 
ATOM   2266 N  N   . LYS A 1 277 ? 23.353  5.407   30.975  1.00 27.87 ? 278 LYS A N   1 
ATOM   2267 C  CA  . LYS A 1 277 ? 24.411  4.633   30.326  1.00 27.27 ? 278 LYS A CA  1 
ATOM   2268 C  C   . LYS A 1 277 ? 23.853  3.413   29.559  1.00 26.59 ? 278 LYS A C   1 
ATOM   2269 O  O   . LYS A 1 277 ? 24.302  3.106   28.450  1.00 25.52 ? 278 LYS A O   1 
ATOM   2270 C  CB  . LYS A 1 277 ? 25.453  4.211   31.356  1.00 27.77 ? 278 LYS A CB  1 
ATOM   2271 C  CG  . LYS A 1 277 ? 26.581  3.321   30.818  1.00 29.77 ? 278 LYS A CG  1 
ATOM   2272 C  CD  . LYS A 1 277 ? 27.558  2.873   31.913  1.00 32.59 ? 278 LYS A CD  1 
ATOM   2273 C  CE  . LYS A 1 277 ? 26.862  2.189   33.094  1.00 35.97 ? 278 LYS A CE  1 
ATOM   2274 N  NZ  . LYS A 1 277 ? 25.724  1.258   32.723  1.00 39.06 ? 278 LYS A NZ  1 
ATOM   2275 N  N   . ALA A 1 278 ? 22.874  2.730   30.151  1.00 26.00 ? 279 ALA A N   1 
ATOM   2276 C  CA  . ALA A 1 278 ? 22.181  1.630   29.459  1.00 25.75 ? 279 ALA A CA  1 
ATOM   2277 C  C   . ALA A 1 278 ? 21.481  2.084   28.179  1.00 25.32 ? 279 ALA A C   1 
ATOM   2278 O  O   . ALA A 1 278 ? 21.495  1.373   27.168  1.00 25.17 ? 279 ALA A O   1 
ATOM   2279 C  CB  . ALA A 1 278 ? 21.175  0.957   30.377  1.00 25.76 ? 279 ALA A CB  1 
ATOM   2280 N  N   . ASN A 1 279 ? 20.851  3.257   28.223  1.00 24.90 ? 280 ASN A N   1 
ATOM   2281 C  CA  . ASN A 1 279 ? 20.121  3.733   27.060  1.00 24.96 ? 280 ASN A CA  1 
ATOM   2282 C  C   . ASN A 1 279 ? 21.029  4.328   25.992  1.00 24.17 ? 280 ASN A C   1 
ATOM   2283 O  O   . ASN A 1 279 ? 20.728  4.232   24.804  1.00 24.05 ? 280 ASN A O   1 
ATOM   2284 C  CB  . ASN A 1 279 ? 18.987  4.661   27.457  1.00 24.94 ? 280 ASN A CB  1 
ATOM   2285 C  CG  . ASN A 1 279 ? 17.814  3.899   28.037  1.00 27.28 ? 280 ASN A CG  1 
ATOM   2286 O  OD1 . ASN A 1 279 ? 17.120  3.158   27.327  1.00 28.98 ? 280 ASN A OD1 1 
ATOM   2287 N  ND2 . ASN A 1 279 ? 17.580  4.076   29.328  1.00 28.44 ? 280 ASN A ND2 1 
ATOM   2288 N  N   . VAL A 1 280 ? 22.143  4.920   26.418  1.00 23.10 ? 281 VAL A N   1 
ATOM   2289 C  CA  . VAL A 1 280 ? 23.177  5.362   25.476  1.00 22.65 ? 281 VAL A CA  1 
ATOM   2290 C  C   . VAL A 1 280 ? 23.688  4.187   24.654  1.00 22.23 ? 281 VAL A C   1 
ATOM   2291 O  O   . VAL A 1 280 ? 23.870  4.301   23.446  1.00 21.83 ? 281 VAL A O   1 
ATOM   2292 C  CB  . VAL A 1 280 ? 24.359  6.069   26.169  1.00 22.49 ? 281 VAL A CB  1 
ATOM   2293 C  CG1 . VAL A 1 280 ? 25.575  6.137   25.231  1.00 22.82 ? 281 VAL A CG1 1 
ATOM   2294 C  CG2 . VAL A 1 280 ? 23.965  7.491   26.602  1.00 21.94 ? 281 VAL A CG2 1 
ATOM   2295 N  N   . THR A 1 281 ? 23.885  3.053   25.317  1.00 22.30 ? 282 THR A N   1 
ATOM   2296 C  CA  . THR A 1 281 ? 24.401  1.853   24.673  1.00 22.51 ? 282 THR A CA  1 
ATOM   2297 C  C   . THR A 1 281 ? 23.457  1.374   23.564  1.00 22.18 ? 282 THR A C   1 
ATOM   2298 O  O   . THR A 1 281 ? 23.903  1.033   22.459  1.00 21.97 ? 282 THR A O   1 
ATOM   2299 C  CB  . THR A 1 281 ? 24.656  0.753   25.725  1.00 22.72 ? 282 THR A CB  1 
ATOM   2300 O  OG1 . THR A 1 281 ? 25.680  1.199   26.617  1.00 24.94 ? 282 THR A OG1 1 
ATOM   2301 C  CG2 . THR A 1 281 ? 25.116  -0.549  25.081  1.00 22.26 ? 282 THR A CG2 1 
ATOM   2302 N  N   . GLU A 1 282 ? 22.160  1.401   23.855  1.00 22.13 ? 283 GLU A N   1 
ATOM   2303 C  CA  . GLU A 1 282 ? 21.126  0.980   22.910  1.00 23.39 ? 283 GLU A CA  1 
ATOM   2304 C  C   . GLU A 1 282 ? 20.948  1.945   21.742  1.00 23.36 ? 283 GLU A C   1 
ATOM   2305 O  O   . GLU A 1 282 ? 20.713  1.525   20.614  1.00 23.12 ? 283 GLU A O   1 
ATOM   2306 C  CB  . GLU A 1 282 ? 19.777  0.792   23.611  1.00 22.82 ? 283 GLU A CB  1 
ATOM   2307 C  CG  . GLU A 1 282 ? 19.748  -0.434  24.521  1.00 25.82 ? 283 GLU A CG  1 
ATOM   2308 C  CD  . GLU A 1 282 ? 18.384  -0.707  25.116  1.00 28.85 ? 283 GLU A CD  1 
ATOM   2309 O  OE1 . GLU A 1 282 ? 17.416  0.013   24.778  1.00 31.22 ? 283 GLU A OE1 1 
ATOM   2310 O  OE2 . GLU A 1 282 ? 18.273  -1.662  25.919  1.00 32.33 ? 283 GLU A OE2 1 
ATOM   2311 N  N   . MET A 1 283 ? 21.038  3.235   22.027  1.00 23.71 ? 284 MET A N   1 
ATOM   2312 C  CA  . MET A 1 283 ? 20.864  4.249   20.987  1.00 24.31 ? 284 MET A CA  1 
ATOM   2313 C  C   . MET A 1 283 ? 22.005  4.145   19.990  1.00 24.09 ? 284 MET A C   1 
ATOM   2314 O  O   . MET A 1 283 ? 21.791  4.199   18.789  1.00 24.06 ? 284 MET A O   1 
ATOM   2315 C  CB  . MET A 1 283 ? 20.756  5.643   21.597  1.00 24.11 ? 284 MET A CB  1 
ATOM   2316 C  CG  . MET A 1 283 ? 19.448  5.841   22.382  1.00 26.91 ? 284 MET A CG  1 
ATOM   2317 S  SD  . MET A 1 283 ? 19.111  7.573   22.818  1.00 33.15 ? 284 MET A SD  1 
ATOM   2318 C  CE  . MET A 1 283 ? 20.653  8.079   23.598  1.00 32.53 ? 284 MET A CE  1 
ATOM   2319 N  N   . LEU A 1 284 ? 23.205  3.941   20.516  1.00 24.37 ? 285 LEU A N   1 
ATOM   2320 C  CA  . LEU A 1 284 ? 24.405  3.783   19.721  1.00 24.28 ? 285 LEU A CA  1 
ATOM   2321 C  C   . LEU A 1 284 ? 24.333  2.549   18.851  1.00 24.12 ? 285 LEU A C   1 
ATOM   2322 O  O   . LEU A 1 284 ? 24.652  2.614   17.663  1.00 24.78 ? 285 LEU A O   1 
ATOM   2323 C  CB  . LEU A 1 284 ? 25.629  3.679   20.623  1.00 24.37 ? 285 LEU A CB  1 
ATOM   2324 C  CG  . LEU A 1 284 ? 26.173  4.950   21.274  1.00 25.54 ? 285 LEU A CG  1 
ATOM   2325 C  CD1 . LEU A 1 284 ? 27.241  4.577   22.289  1.00 24.88 ? 285 LEU A CD1 1 
ATOM   2326 C  CD2 . LEU A 1 284 ? 26.757  5.894   20.215  1.00 27.40 ? 285 LEU A CD2 1 
ATOM   2327 N  N   . ALA A 1 285 ? 23.928  1.432   19.448  1.00 23.22 ? 286 ALA A N   1 
ATOM   2328 C  CA  . ALA A 1 285 ? 23.846  0.171   18.733  1.00 23.12 ? 286 ALA A CA  1 
ATOM   2329 C  C   . ALA A 1 285 ? 22.697  0.192   17.735  1.00 23.21 ? 286 ALA A C   1 
ATOM   2330 O  O   . ALA A 1 285 ? 22.811  -0.385  16.651  1.00 24.13 ? 286 ALA A O   1 
ATOM   2331 C  CB  . ALA A 1 285 ? 23.713  -1.006  19.696  1.00 22.28 ? 286 ALA A CB  1 
ATOM   2332 N  N   . GLY A 1 286 ? 21.597  0.850   18.096  1.00 22.54 ? 287 GLY A N   1 
ATOM   2333 C  CA  . GLY A 1 286 ? 20.453  0.946   17.205  1.00 22.64 ? 287 GLY A CA  1 
ATOM   2334 C  C   . GLY A 1 286 ? 20.705  1.848   15.999  1.00 22.71 ? 287 GLY A C   1 
ATOM   2335 O  O   . GLY A 1 286 ? 20.081  1.685   14.964  1.00 22.75 ? 287 GLY A O   1 
ATOM   2336 N  N   . GLY A 1 287 ? 21.618  2.799   16.145  1.00 22.64 ? 288 GLY A N   1 
ATOM   2337 C  CA  . GLY A 1 287 ? 21.843  3.813   15.119  1.00 23.08 ? 288 GLY A CA  1 
ATOM   2338 C  C   . GLY A 1 287 ? 22.689  3.422   13.913  1.00 22.98 ? 288 GLY A C   1 
ATOM   2339 O  O   . GLY A 1 287 ? 22.627  4.082   12.875  1.00 23.62 ? 288 GLY A O   1 
ATOM   2340 N  N   . VAL A 1 288 ? 23.475  2.362   14.037  1.00 22.41 ? 289 VAL A N   1 
ATOM   2341 C  CA  . VAL A 1 288 ? 24.529  2.090   13.059  1.00 22.48 ? 289 VAL A CA  1 
ATOM   2342 C  C   . VAL A 1 288 ? 24.057  1.289   11.823  1.00 22.65 ? 289 VAL A C   1 
ATOM   2343 O  O   . VAL A 1 288 ? 24.426  1.621   10.697  1.00 23.34 ? 289 VAL A O   1 
ATOM   2344 C  CB  . VAL A 1 288 ? 25.772  1.434   13.731  1.00 22.89 ? 289 VAL A CB  1 
ATOM   2345 C  CG1 . VAL A 1 288 ? 26.819  1.022   12.690  1.00 21.66 ? 289 VAL A CG1 1 
ATOM   2346 C  CG2 . VAL A 1 288 ? 26.383  2.383   14.788  1.00 22.31 ? 289 VAL A CG2 1 
ATOM   2347 N  N   . ASP A 1 289 ? 23.255  0.244   12.017  1.00 21.88 ? 290 ASP A N   1 
ATOM   2348 C  CA  . ASP A 1 289 ? 22.894  -0.619  10.880  1.00 22.08 ? 290 ASP A CA  1 
ATOM   2349 C  C   . ASP A 1 289 ? 21.534  -0.261  10.254  1.00 21.11 ? 290 ASP A C   1 
ATOM   2350 O  O   . ASP A 1 289 ? 21.194  -0.762  9.200   1.00 21.31 ? 290 ASP A O   1 
ATOM   2351 C  CB  . ASP A 1 289 ? 22.963  -2.112  11.251  1.00 21.86 ? 290 ASP A CB  1 
ATOM   2352 C  CG  . ASP A 1 289 ? 24.388  -2.631  11.370  1.00 24.84 ? 290 ASP A CG  1 
ATOM   2353 O  OD1 . ASP A 1 289 ? 25.353  -1.819  11.366  1.00 25.66 ? 290 ASP A OD1 1 
ATOM   2354 O  OD2 . ASP A 1 289 ? 24.545  -3.873  11.457  1.00 25.20 ? 290 ASP A OD2 1 
ATOM   2355 N  N   . THR A 1 290 ? 20.794  0.635   10.889  1.00 20.74 ? 291 THR A N   1 
ATOM   2356 C  CA  . THR A 1 290 ? 19.437  0.958   10.468  1.00 20.15 ? 291 THR A CA  1 
ATOM   2357 C  C   . THR A 1 290 ? 19.423  2.018   9.368   1.00 19.82 ? 291 THR A C   1 
ATOM   2358 O  O   . THR A 1 290 ? 18.994  1.743   8.261   1.00 19.96 ? 291 THR A O   1 
ATOM   2359 C  CB  . THR A 1 290 ? 18.566  1.405   11.658  1.00 20.31 ? 291 THR A CB  1 
ATOM   2360 O  OG1 . THR A 1 290 ? 19.283  2.379   12.429  1.00 19.46 ? 291 THR A OG1 1 
ATOM   2361 C  CG2 . THR A 1 290 ? 18.230  0.212   12.534  1.00 19.39 ? 291 THR A CG2 1 
ATOM   2362 N  N   . THR A 1 291 ? 19.897  3.217   9.670   1.00 19.70 ? 292 THR A N   1 
ATOM   2363 C  CA  . THR A 1 291 ? 19.894  4.301   8.689   1.00 19.97 ? 292 THR A CA  1 
ATOM   2364 C  C   . THR A 1 291 ? 20.809  3.989   7.513   1.00 19.78 ? 292 THR A C   1 
ATOM   2365 O  O   . THR A 1 291 ? 20.473  4.302   6.377   1.00 19.33 ? 292 THR A O   1 
ATOM   2366 C  CB  . THR A 1 291 ? 20.343  5.641   9.304   1.00 19.87 ? 292 THR A CB  1 
ATOM   2367 O  OG1 . THR A 1 291 ? 21.554  5.437   10.038  1.00 22.15 ? 292 THR A OG1 1 
ATOM   2368 C  CG2 . THR A 1 291 ? 19.313  6.166   10.240  1.00 20.71 ? 292 THR A CG2 1 
ATOM   2369 N  N   . SER A 1 292 ? 21.955  3.371   7.796   1.00 19.52 ? 293 SER A N   1 
ATOM   2370 C  CA  . SER A 1 292 ? 22.924  2.993   6.766   1.00 20.39 ? 293 SER A CA  1 
ATOM   2371 C  C   . SER A 1 292 ? 22.322  2.074   5.698   1.00 20.28 ? 293 SER A C   1 
ATOM   2372 O  O   . SER A 1 292 ? 22.472  2.338   4.510   1.00 20.20 ? 293 SER A O   1 
ATOM   2373 C  CB  . SER A 1 292 ? 24.150  2.315   7.390   1.00 20.00 ? 293 SER A CB  1 
ATOM   2374 O  OG  . SER A 1 292 ? 23.753  1.202   8.163   1.00 21.93 ? 293 SER A OG  1 
ATOM   2375 N  N   . MET A 1 293 ? 21.653  0.999   6.117   1.00 19.99 ? 294 MET A N   1 
ATOM   2376 C  CA  . MET A 1 293 ? 20.994  0.093   5.166   1.00 20.17 ? 294 MET A CA  1 
ATOM   2377 C  C   . MET A 1 293 ? 19.810  0.739   4.436   1.00 19.11 ? 294 MET A C   1 
ATOM   2378 O  O   . MET A 1 293 ? 19.613  0.515   3.239   1.00 18.07 ? 294 MET A O   1 
ATOM   2379 C  CB  . MET A 1 293 ? 20.588  -1.240  5.820   1.00 20.55 ? 294 MET A CB  1 
ATOM   2380 C  CG  . MET A 1 293 ? 21.784  -2.147  6.227   1.00 23.54 ? 294 MET A CG  1 
ATOM   2381 S  SD  . MET A 1 293 ? 22.938  -2.553  4.882   1.00 28.50 ? 294 MET A SD  1 
ATOM   2382 C  CE  . MET A 1 293 ? 24.022  -1.122  4.757   1.00 28.29 ? 294 MET A CE  1 
ATOM   2383 N  N   . THR A 1 294 ? 19.031  1.542   5.160   1.00 18.45 ? 295 THR A N   1 
ATOM   2384 C  CA  . THR A 1 294 ? 17.886  2.219   4.554   1.00 18.01 ? 295 THR A CA  1 
ATOM   2385 C  C   . THR A 1 294 ? 18.340  3.223   3.476   1.00 18.25 ? 295 THR A C   1 
ATOM   2386 O  O   . THR A 1 294 ? 17.723  3.326   2.409   1.00 17.95 ? 295 THR A O   1 
ATOM   2387 C  CB  . THR A 1 294 ? 17.011  2.899   5.622   1.00 18.43 ? 295 THR A CB  1 
ATOM   2388 O  OG1 . THR A 1 294 ? 16.638  1.925   6.622   1.00 19.23 ? 295 THR A OG1 1 
ATOM   2389 C  CG2 . THR A 1 294 ? 15.745  3.498   4.984   1.00 17.21 ? 295 THR A CG2 1 
ATOM   2390 N  N   . LEU A 1 295 ? 19.435  3.930   3.750   1.00 17.61 ? 296 LEU A N   1 
ATOM   2391 C  CA  . LEU A 1 295 ? 19.987  4.898   2.804   1.00 18.32 ? 296 LEU A CA  1 
ATOM   2392 C  C   . LEU A 1 295 ? 20.543  4.199   1.577   1.00 18.27 ? 296 LEU A C   1 
ATOM   2393 O  O   . LEU A 1 295 ? 20.346  4.660   0.441   1.00 17.96 ? 296 LEU A O   1 
ATOM   2394 C  CB  . LEU A 1 295 ? 21.077  5.741   3.476   1.00 18.32 ? 296 LEU A CB  1 
ATOM   2395 C  CG  . LEU A 1 295 ? 20.538  6.869   4.351   1.00 19.31 ? 296 LEU A CG  1 
ATOM   2396 C  CD1 . LEU A 1 295 ? 21.694  7.526   5.096   1.00 20.44 ? 296 LEU A CD1 1 
ATOM   2397 C  CD2 . LEU A 1 295 ? 19.803  7.894   3.451   1.00 18.00 ? 296 LEU A CD2 1 
ATOM   2398 N  N   . GLN A 1 296 ? 21.230  3.078   1.803   1.00 18.33 ? 297 GLN A N   1 
ATOM   2399 C  CA  . GLN A 1 296 ? 21.717  2.261   0.693   1.00 18.82 ? 297 GLN A CA  1 
ATOM   2400 C  C   . GLN A 1 296 ? 20.573  1.820   -0.235  1.00 18.48 ? 297 GLN A C   1 
ATOM   2401 O  O   . GLN A 1 296 ? 20.729  1.827   -1.461  1.00 18.23 ? 297 GLN A O   1 
ATOM   2402 C  CB  . GLN A 1 296 ? 22.516  1.044   1.163   1.00 18.73 ? 297 GLN A CB  1 
ATOM   2403 C  CG  . GLN A 1 296 ? 23.187  0.304   -0.002  1.00 20.61 ? 297 GLN A CG  1 
ATOM   2404 C  CD  . GLN A 1 296 ? 24.172  -0.768  0.432   1.00 22.94 ? 297 GLN A CD  1 
ATOM   2405 O  OE1 . GLN A 1 296 ? 25.322  -0.791  -0.029  1.00 22.22 ? 297 GLN A OE1 1 
ATOM   2406 N  NE2 . GLN A 1 296 ? 23.724  -1.676  1.312   1.00 21.08 ? 297 GLN A NE2 1 
ATOM   2407 N  N   . TRP A 1 297 ? 19.438  1.439   0.343   1.00 18.02 ? 298 TRP A N   1 
ATOM   2408 C  CA  . TRP A 1 297 ? 18.281  1.047   -0.484  1.00 17.81 ? 298 TRP A CA  1 
ATOM   2409 C  C   . TRP A 1 297 ? 17.675  2.238   -1.227  1.00 17.80 ? 298 TRP A C   1 
ATOM   2410 O  O   . TRP A 1 297 ? 17.211  2.096   -2.362  1.00 17.36 ? 298 TRP A O   1 
ATOM   2411 C  CB  . TRP A 1 297 ? 17.188  0.433   0.354   1.00 17.28 ? 298 TRP A CB  1 
ATOM   2412 C  CG  . TRP A 1 297 ? 17.352  -0.987  0.772   1.00 16.68 ? 298 TRP A CG  1 
ATOM   2413 C  CD1 . TRP A 1 297 ? 17.371  -1.456  2.052   1.00 16.31 ? 298 TRP A CD1 1 
ATOM   2414 C  CD2 . TRP A 1 297 ? 17.433  -2.139  -0.080  1.00 18.25 ? 298 TRP A CD2 1 
ATOM   2415 N  NE1 . TRP A 1 297 ? 17.477  -2.828  2.055   1.00 15.06 ? 298 TRP A NE1 1 
ATOM   2416 C  CE2 . TRP A 1 297 ? 17.509  -3.273  0.760   1.00 17.12 ? 298 TRP A CE2 1 
ATOM   2417 C  CE3 . TRP A 1 297 ? 17.452  -2.326  -1.475  1.00 16.55 ? 298 TRP A CE3 1 
ATOM   2418 C  CZ2 . TRP A 1 297 ? 17.590  -4.577  0.255   1.00 17.68 ? 298 TRP A CZ2 1 
ATOM   2419 C  CZ3 . TRP A 1 297 ? 17.542  -3.630  -1.972  1.00 18.12 ? 298 TRP A CZ3 1 
ATOM   2420 C  CH2 . TRP A 1 297 ? 17.623  -4.731  -1.108  1.00 16.47 ? 298 TRP A CH2 1 
ATOM   2421 N  N   . HIS A 1 298 ? 17.641  3.391   -0.563  1.00 17.58 ? 299 HIS A N   1 
ATOM   2422 C  CA  . HIS A 1 298 ? 17.171  4.614   -1.188  1.00 18.24 ? 299 HIS A CA  1 
ATOM   2423 C  C   . HIS A 1 298 ? 17.995  4.932   -2.451  1.00 18.12 ? 299 HIS A C   1 
ATOM   2424 O  O   . HIS A 1 298 ? 17.446  5.130   -3.543  1.00 18.06 ? 299 HIS A O   1 
ATOM   2425 C  CB  . HIS A 1 298 ? 17.194  5.795   -0.200  1.00 18.50 ? 299 HIS A CB  1 
ATOM   2426 C  CG  . HIS A 1 298 ? 16.502  7.007   -0.732  1.00 21.66 ? 299 HIS A CG  1 
ATOM   2427 N  ND1 . HIS A 1 298 ? 15.245  7.395   -0.311  1.00 24.64 ? 299 HIS A ND1 1 
ATOM   2428 C  CD2 . HIS A 1 298 ? 16.854  7.869   -1.714  1.00 22.18 ? 299 HIS A CD2 1 
ATOM   2429 C  CE1 . HIS A 1 298 ? 14.868  8.462   -0.993  1.00 24.18 ? 299 HIS A CE1 1 
ATOM   2430 N  NE2 . HIS A 1 298 ? 15.826  8.771   -1.848  1.00 25.31 ? 299 HIS A NE2 1 
ATOM   2431 N  N   . LEU A 1 299 ? 19.311  4.963   -2.288  1.00 18.18 ? 300 LEU A N   1 
ATOM   2432 C  CA  . LEU A 1 299 ? 20.242  5.181   -3.385  1.00 18.75 ? 300 LEU A CA  1 
ATOM   2433 C  C   . LEU A 1 299 ? 20.025  4.172   -4.503  1.00 19.30 ? 300 LEU A C   1 
ATOM   2434 O  O   . LEU A 1 299 ? 20.077  4.526   -5.674  1.00 20.23 ? 300 LEU A O   1 
ATOM   2435 C  CB  . LEU A 1 299 ? 21.693  5.120   -2.871  1.00 18.27 ? 300 LEU A CB  1 
ATOM   2436 C  CG  . LEU A 1 299 ? 22.150  6.263   -1.948  1.00 19.60 ? 300 LEU A CG  1 
ATOM   2437 C  CD1 . LEU A 1 299 ? 23.571  6.002   -1.364  1.00 18.72 ? 300 LEU A CD1 1 
ATOM   2438 C  CD2 . LEU A 1 299 ? 22.059  7.623   -2.646  1.00 21.31 ? 300 LEU A CD2 1 
ATOM   2439 N  N   . TYR A 1 300 ? 19.809  2.915   -4.123  1.00 19.37 ? 301 TYR A N   1 
ATOM   2440 C  CA  . TYR A 1 300 ? 19.510  1.844   -5.066  1.00 19.95 ? 301 TYR A CA  1 
ATOM   2441 C  C   . TYR A 1 300 ? 18.216  2.117   -5.851  1.00 19.75 ? 301 TYR A C   1 
ATOM   2442 O  O   . TYR A 1 300 ? 18.199  1.993   -7.078  1.00 19.59 ? 301 TYR A O   1 
ATOM   2443 C  CB  . TYR A 1 300 ? 19.455  0.504   -4.327  1.00 19.41 ? 301 TYR A CB  1 
ATOM   2444 C  CG  . TYR A 1 300 ? 18.891  -0.654  -5.123  1.00 20.82 ? 301 TYR A CG  1 
ATOM   2445 C  CD1 . TYR A 1 300 ? 19.703  -1.405  -5.985  1.00 21.86 ? 301 TYR A CD1 1 
ATOM   2446 C  CD2 . TYR A 1 300 ? 17.556  -1.024  -4.985  1.00 20.83 ? 301 TYR A CD2 1 
ATOM   2447 C  CE1 . TYR A 1 300 ? 19.184  -2.479  -6.701  1.00 22.79 ? 301 TYR A CE1 1 
ATOM   2448 C  CE2 . TYR A 1 300 ? 17.028  -2.104  -5.679  1.00 22.45 ? 301 TYR A CE2 1 
ATOM   2449 C  CZ  . TYR A 1 300 ? 17.839  -2.825  -6.532  1.00 24.14 ? 301 TYR A CZ  1 
ATOM   2450 O  OH  . TYR A 1 300 ? 17.293  -3.881  -7.223  1.00 26.57 ? 301 TYR A OH  1 
ATOM   2451 N  N   . GLU A 1 301 ? 17.157  2.514   -5.150  1.00 19.67 ? 302 GLU A N   1 
ATOM   2452 C  CA  . GLU A 1 301 ? 15.885  2.863   -5.806  1.00 20.59 ? 302 GLU A CA  1 
ATOM   2453 C  C   . GLU A 1 301 ? 15.982  4.130   -6.703  1.00 21.22 ? 302 GLU A C   1 
ATOM   2454 O  O   . GLU A 1 301 ? 15.314  4.216   -7.742  1.00 20.87 ? 302 GLU A O   1 
ATOM   2455 C  CB  . GLU A 1 301 ? 14.751  3.010   -4.783  1.00 20.27 ? 302 GLU A CB  1 
ATOM   2456 C  CG  . GLU A 1 301 ? 14.431  1.729   -3.988  1.00 23.36 ? 302 GLU A CG  1 
ATOM   2457 C  CD  . GLU A 1 301 ? 13.807  0.638   -4.841  1.00 27.76 ? 302 GLU A CD  1 
ATOM   2458 O  OE1 . GLU A 1 301 ? 13.776  -0.541  -4.408  1.00 29.02 ? 302 GLU A OE1 1 
ATOM   2459 O  OE2 . GLU A 1 301 ? 13.348  0.958   -5.964  1.00 30.42 ? 302 GLU A OE2 1 
ATOM   2460 N  N   . MET A 1 302 ? 16.818  5.090   -6.314  1.00 21.21 ? 303 MET A N   1 
ATOM   2461 C  CA  . MET A 1 302 ? 17.058  6.267   -7.159  1.00 22.15 ? 303 MET A CA  1 
ATOM   2462 C  C   . MET A 1 302 ? 17.791  5.912   -8.444  1.00 22.47 ? 303 MET A C   1 
ATOM   2463 O  O   . MET A 1 302 ? 17.469  6.446   -9.506  1.00 22.19 ? 303 MET A O   1 
ATOM   2464 C  CB  . MET A 1 302 ? 17.794  7.361   -6.395  1.00 22.44 ? 303 MET A CB  1 
ATOM   2465 C  CG  . MET A 1 302 ? 16.881  8.065   -5.392  1.00 24.50 ? 303 MET A CG  1 
ATOM   2466 S  SD  . MET A 1 302 ? 17.508  9.684   -4.942  1.00 29.96 ? 303 MET A SD  1 
ATOM   2467 C  CE  . MET A 1 302 ? 19.067  9.265   -4.190  1.00 28.68 ? 303 MET A CE  1 
ATOM   2468 N  N   . ALA A 1 303 ? 18.754  4.997   -8.335  1.00 22.82 ? 304 ALA A N   1 
ATOM   2469 C  CA  . ALA A 1 303 ? 19.525  4.516   -9.479  1.00 23.63 ? 304 ALA A CA  1 
ATOM   2470 C  C   . ALA A 1 303 ? 18.686  3.662   -10.432 1.00 24.31 ? 304 ALA A C   1 
ATOM   2471 O  O   . ALA A 1 303 ? 18.957  3.608   -11.637 1.00 24.35 ? 304 ALA A O   1 
ATOM   2472 C  CB  . ALA A 1 303 ? 20.766  3.733   -9.007  1.00 22.85 ? 304 ALA A CB  1 
ATOM   2473 N  N   . ARG A 1 304 ? 17.702  2.971   -9.867  1.00 25.49 ? 305 ARG A N   1 
ATOM   2474 C  CA  . ARG A 1 304 ? 16.789  2.105   -10.613 1.00 26.75 ? 305 ARG A CA  1 
ATOM   2475 C  C   . ARG A 1 304 ? 15.658  2.903   -11.236 1.00 26.64 ? 305 ARG A C   1 
ATOM   2476 O  O   . ARG A 1 304 ? 14.994  2.422   -12.139 1.00 26.65 ? 305 ARG A O   1 
ATOM   2477 C  CB  . ARG A 1 304 ? 16.189  1.030   -9.693  1.00 27.43 ? 305 ARG A CB  1 
ATOM   2478 C  CG  . ARG A 1 304 ? 16.645  -0.404  -9.999  1.00 31.71 ? 305 ARG A CG  1 
ATOM   2479 C  CD  . ARG A 1 304 ? 15.931  -1.481  -9.150  1.00 35.92 ? 305 ARG A CD  1 
ATOM   2480 N  NE  . ARG A 1 304 ? 14.762  -0.965  -8.435  1.00 39.17 ? 305 ARG A NE  1 
ATOM   2481 C  CZ  . ARG A 1 304 ? 13.500  -1.194  -8.794  1.00 41.05 ? 305 ARG A CZ  1 
ATOM   2482 N  NH1 . ARG A 1 304 ? 13.252  -1.914  -9.877  1.00 42.49 ? 305 ARG A NH1 1 
ATOM   2483 N  NH2 . ARG A 1 304 ? 12.486  -0.700  -8.086  1.00 40.39 ? 305 ARG A NH2 1 
ATOM   2484 N  N   . ASN A 1 305 ? 15.441  4.122   -10.742 1.00 26.78 ? 306 ASN A N   1 
ATOM   2485 C  CA  . ASN A 1 305 ? 14.319  4.942   -11.165 1.00 27.03 ? 306 ASN A CA  1 
ATOM   2486 C  C   . ASN A 1 305 ? 14.807  6.374   -11.426 1.00 26.46 ? 306 ASN A C   1 
ATOM   2487 O  O   . ASN A 1 305 ? 14.588  7.287   -10.624 1.00 26.08 ? 306 ASN A O   1 
ATOM   2488 C  CB  . ASN A 1 305 ? 13.174  4.884   -10.126 1.00 26.78 ? 306 ASN A CB  1 
ATOM   2489 C  CG  . ASN A 1 305 ? 12.733  3.440   -9.787  1.00 30.58 ? 306 ASN A CG  1 
ATOM   2490 O  OD1 . ASN A 1 305 ? 11.762  2.929   -10.359 1.00 36.19 ? 306 ASN A OD1 1 
ATOM   2491 N  ND2 . ASN A 1 305 ? 13.435  2.786   -8.842  1.00 30.05 ? 306 ASN A ND2 1 
ATOM   2492 N  N   . LEU A 1 306 ? 15.486  6.559   -12.551 1.00 26.88 ? 307 LEU A N   1 
ATOM   2493 C  CA  . LEU A 1 306 ? 16.177  7.829   -12.839 1.00 27.67 ? 307 LEU A CA  1 
ATOM   2494 C  C   . LEU A 1 306 ? 15.250  9.049   -12.956 1.00 28.01 ? 307 LEU A C   1 
ATOM   2495 O  O   . LEU A 1 306 ? 15.655  10.166  -12.619 1.00 27.98 ? 307 LEU A O   1 
ATOM   2496 C  CB  . LEU A 1 306 ? 17.094  7.700   -14.072 1.00 28.09 ? 307 LEU A CB  1 
ATOM   2497 C  CG  . LEU A 1 306 ? 18.279  6.719   -13.964 1.00 28.09 ? 307 LEU A CG  1 
ATOM   2498 C  CD1 . LEU A 1 306 ? 18.995  6.578   -15.320 1.00 30.35 ? 307 LEU A CD1 1 
ATOM   2499 C  CD2 . LEU A 1 306 ? 19.270  7.126   -12.880 1.00 27.06 ? 307 LEU A CD2 1 
ATOM   2500 N  N   . LYS A 1 307 ? 14.009  8.837   -13.395 1.00 28.06 ? 308 LYS A N   1 
ATOM   2501 C  CA  . LYS A 1 307 ? 13.037  9.928   -13.459 1.00 28.98 ? 308 LYS A CA  1 
ATOM   2502 C  C   . LYS A 1 307 ? 12.636  10.397  -12.073 1.00 28.29 ? 308 LYS A C   1 
ATOM   2503 O  O   . LYS A 1 307 ? 12.512  11.610  -11.825 1.00 28.28 ? 308 LYS A O   1 
ATOM   2504 C  CB  . LYS A 1 307 ? 11.787  9.558   -14.278 1.00 29.37 ? 308 LYS A CB  1 
ATOM   2505 C  CG  . LYS A 1 307 ? 12.056  9.162   -15.746 1.00 32.91 ? 308 LYS A CG  1 
ATOM   2506 C  CD  . LYS A 1 307 ? 13.261  9.915   -16.362 1.00 36.86 ? 308 LYS A CD  1 
ATOM   2507 C  CE  . LYS A 1 307 ? 13.816  9.189   -17.587 1.00 37.84 ? 308 LYS A CE  1 
ATOM   2508 N  NZ  . LYS A 1 307 ? 15.158  9.730   -17.976 1.00 38.37 ? 308 LYS A NZ  1 
ATOM   2509 N  N   . VAL A 1 308 ? 12.448  9.445   -11.164 1.00 27.36 ? 309 VAL A N   1 
ATOM   2510 C  CA  . VAL A 1 308 ? 12.197  9.795   -9.764  1.00 26.79 ? 309 VAL A CA  1 
ATOM   2511 C  C   . VAL A 1 308 ? 13.429  10.485  -9.156  1.00 26.13 ? 309 VAL A C   1 
ATOM   2512 O  O   . VAL A 1 308 ? 13.296  11.449  -8.404  1.00 26.20 ? 309 VAL A O   1 
ATOM   2513 C  CB  . VAL A 1 308 ? 11.785  8.562   -8.908  1.00 26.92 ? 309 VAL A CB  1 
ATOM   2514 C  CG1 . VAL A 1 308 ? 11.537  8.977   -7.466  1.00 26.57 ? 309 VAL A CG1 1 
ATOM   2515 C  CG2 . VAL A 1 308 ? 10.534  7.879   -9.494  1.00 26.95 ? 309 VAL A CG2 1 
ATOM   2516 N  N   . GLN A 1 309 ? 14.624  10.013  -9.487  1.00 25.79 ? 310 GLN A N   1 
ATOM   2517 C  CA  . GLN A 1 309 ? 15.823  10.682  -8.984  1.00 26.12 ? 310 GLN A CA  1 
ATOM   2518 C  C   . GLN A 1 309 ? 15.861  12.171  -9.426  1.00 26.72 ? 310 GLN A C   1 
ATOM   2519 O  O   . GLN A 1 309 ? 16.127  13.064  -8.611  1.00 26.43 ? 310 GLN A O   1 
ATOM   2520 C  CB  . GLN A 1 309 ? 17.096  9.947   -9.410  1.00 25.20 ? 310 GLN A CB  1 
ATOM   2521 C  CG  . GLN A 1 309 ? 18.363  10.492  -8.720  1.00 24.64 ? 310 GLN A CG  1 
ATOM   2522 C  CD  . GLN A 1 309 ? 19.634  9.835   -9.214  1.00 21.86 ? 310 GLN A CD  1 
ATOM   2523 O  OE1 . GLN A 1 309 ? 19.642  8.670   -9.626  1.00 23.50 ? 310 GLN A OE1 1 
ATOM   2524 N  NE2 . GLN A 1 309 ? 20.714  10.569  -9.169  1.00 22.01 ? 310 GLN A NE2 1 
ATOM   2525 N  N   . ASP A 1 310 ? 15.572  12.415  -10.705 1.00 27.30 ? 311 ASP A N   1 
ATOM   2526 C  CA  . ASP A 1 310 ? 15.489  13.783  -11.260 1.00 28.43 ? 311 ASP A CA  1 
ATOM   2527 C  C   . ASP A 1 310 ? 14.508  14.701  -10.519 1.00 28.53 ? 311 ASP A C   1 
ATOM   2528 O  O   . ASP A 1 310 ? 14.787  15.876  -10.304 1.00 28.58 ? 311 ASP A O   1 
ATOM   2529 C  CB  . ASP A 1 310 ? 15.075  13.719  -12.736 1.00 28.64 ? 311 ASP A CB  1 
ATOM   2530 C  CG  . ASP A 1 310 ? 16.171  13.163  -13.638 1.00 30.62 ? 311 ASP A CG  1 
ATOM   2531 O  OD1 . ASP A 1 310 ? 17.373  13.347  -13.333 1.00 32.89 ? 311 ASP A OD1 1 
ATOM   2532 O  OD2 . ASP A 1 310 ? 15.829  12.544  -14.669 1.00 33.83 ? 311 ASP A OD2 1 
ATOM   2533 N  N   . MET A 1 311 ? 13.352  14.155  -10.153 1.00 28.81 ? 312 MET A N   1 
ATOM   2534 C  CA  . MET A 1 311 ? 12.290  14.927  -9.502  1.00 29.24 ? 312 MET A CA  1 
ATOM   2535 C  C   . MET A 1 311 ? 12.667  15.259  -8.073  1.00 28.28 ? 312 MET A C   1 
ATOM   2536 O  O   . MET A 1 311 ? 12.288  16.314  -7.551  1.00 27.85 ? 312 MET A O   1 
ATOM   2537 C  CB  . MET A 1 311 ? 10.987  14.133  -9.474  1.00 29.68 ? 312 MET A CB  1 
ATOM   2538 C  CG  . MET A 1 311 ? 10.225  14.098  -10.776 1.00 34.93 ? 312 MET A CG  1 
ATOM   2539 S  SD  . MET A 1 311 ? 8.896   12.874  -10.677 1.00 44.59 ? 312 MET A SD  1 
ATOM   2540 C  CE  . MET A 1 311 ? 7.771   13.644  -9.498  1.00 42.09 ? 312 MET A CE  1 
ATOM   2541 N  N   . LEU A 1 312 ? 13.384  14.339  -7.426  1.00 26.92 ? 313 LEU A N   1 
ATOM   2542 C  CA  . LEU A 1 312 ? 13.813  14.578  -6.060  1.00 25.94 ? 313 LEU A CA  1 
ATOM   2543 C  C   . LEU A 1 312 ? 14.908  15.634  -6.067  1.00 25.22 ? 313 LEU A C   1 
ATOM   2544 O  O   . LEU A 1 312 ? 14.932  16.506  -5.200  1.00 25.18 ? 313 LEU A O   1 
ATOM   2545 C  CB  . LEU A 1 312 ? 14.275  13.276  -5.371  1.00 25.70 ? 313 LEU A CB  1 
ATOM   2546 C  CG  . LEU A 1 312 ? 13.224  12.175  -5.156  1.00 25.72 ? 313 LEU A CG  1 
ATOM   2547 C  CD1 . LEU A 1 312 ? 13.879  10.854  -4.769  1.00 26.15 ? 313 LEU A CD1 1 
ATOM   2548 C  CD2 . LEU A 1 312 ? 12.186  12.563  -4.110  1.00 24.92 ? 313 LEU A CD2 1 
ATOM   2549 N  N   . ARG A 1 313 ? 15.818  15.554  -7.036  1.00 25.21 ? 314 ARG A N   1 
ATOM   2550 C  CA  . ARG A 1 313 ? 16.865  16.574  -7.158  1.00 25.46 ? 314 ARG A CA  1 
ATOM   2551 C  C   . ARG A 1 313 ? 16.225  17.963  -7.379  1.00 25.87 ? 314 ARG A C   1 
ATOM   2552 O  O   . ARG A 1 313 ? 16.596  18.935  -6.701  1.00 25.55 ? 314 ARG A O   1 
ATOM   2553 C  CB  . ARG A 1 313 ? 17.860  16.235  -8.285  1.00 24.91 ? 314 ARG A CB  1 
ATOM   2554 C  CG  . ARG A 1 313 ? 19.031  17.208  -8.398  1.00 24.80 ? 314 ARG A CG  1 
ATOM   2555 C  CD  . ARG A 1 313 ? 20.190  16.665  -9.244  1.00 26.07 ? 314 ARG A CD  1 
ATOM   2556 N  NE  . ARG A 1 313 ? 20.752  15.445  -8.656  1.00 26.15 ? 314 ARG A NE  1 
ATOM   2557 C  CZ  . ARG A 1 313 ? 20.530  14.219  -9.123  1.00 25.52 ? 314 ARG A CZ  1 
ATOM   2558 N  NH1 . ARG A 1 313 ? 19.788  14.032  -10.211 1.00 24.76 ? 314 ARG A NH1 1 
ATOM   2559 N  NH2 . ARG A 1 313 ? 21.050  13.179  -8.502  1.00 23.06 ? 314 ARG A NH2 1 
ATOM   2560 N  N   . ALA A 1 314 ? 15.255  18.033  -8.299  1.00 26.04 ? 315 ALA A N   1 
ATOM   2561 C  CA  . ALA A 1 314 ? 14.613  19.309  -8.660  1.00 27.07 ? 315 ALA A CA  1 
ATOM   2562 C  C   . ALA A 1 314 ? 13.916  19.899  -7.452  1.00 27.58 ? 315 ALA A C   1 
ATOM   2563 O  O   . ALA A 1 314 ? 13.964  21.110  -7.236  1.00 27.70 ? 315 ALA A O   1 
ATOM   2564 C  CB  . ALA A 1 314 ? 13.624  19.141  -9.831  1.00 26.75 ? 315 ALA A CB  1 
ATOM   2565 N  N   . GLU A 1 315 ? 13.294  19.033  -6.649  1.00 27.97 ? 316 GLU A N   1 
ATOM   2566 C  CA  . GLU A 1 315 ? 12.642  19.471  -5.430  1.00 28.69 ? 316 GLU A CA  1 
ATOM   2567 C  C   . GLU A 1 315 ? 13.654  20.006  -4.412  1.00 28.39 ? 316 GLU A C   1 
ATOM   2568 O  O   . GLU A 1 315 ? 13.395  21.017  -3.763  1.00 28.38 ? 316 GLU A O   1 
ATOM   2569 C  CB  . GLU A 1 315 ? 11.799  18.352  -4.802  1.00 29.15 ? 316 GLU A CB  1 
ATOM   2570 C  CG  . GLU A 1 315 ? 11.024  18.845  -3.587  1.00 32.61 ? 316 GLU A CG  1 
ATOM   2571 C  CD  . GLU A 1 315 ? 10.265  17.750  -2.846  1.00 37.45 ? 316 GLU A CD  1 
ATOM   2572 O  OE1 . GLU A 1 315 ? 10.918  16.815  -2.324  1.00 38.79 ? 316 GLU A OE1 1 
ATOM   2573 O  OE2 . GLU A 1 315 ? 9.019   17.853  -2.758  1.00 38.67 ? 316 GLU A OE2 1 
ATOM   2574 N  N   . VAL A 1 316 ? 14.788  19.320  -4.269  1.00 27.92 ? 317 VAL A N   1 
ATOM   2575 C  CA  . VAL A 1 316 ? 15.812  19.720  -3.298  1.00 28.03 ? 317 VAL A CA  1 
ATOM   2576 C  C   . VAL A 1 316 ? 16.444  21.071  -3.667  1.00 28.36 ? 317 VAL A C   1 
ATOM   2577 O  O   . VAL A 1 316 ? 16.599  21.934  -2.807  1.00 28.49 ? 317 VAL A O   1 
ATOM   2578 C  CB  . VAL A 1 316 ? 16.890  18.611  -3.092  1.00 27.75 ? 317 VAL A CB  1 
ATOM   2579 C  CG1 . VAL A 1 316 ? 18.140  19.172  -2.465  1.00 27.36 ? 317 VAL A CG1 1 
ATOM   2580 C  CG2 . VAL A 1 316 ? 16.327  17.467  -2.221  1.00 27.07 ? 317 VAL A CG2 1 
ATOM   2581 N  N   . LEU A 1 317 ? 16.782  21.250  -4.941  1.00 28.92 ? 318 LEU A N   1 
ATOM   2582 C  CA  . LEU A 1 317 ? 17.326  22.530  -5.430  1.00 29.79 ? 318 LEU A CA  1 
ATOM   2583 C  C   . LEU A 1 317 ? 16.362  23.706  -5.193  1.00 30.32 ? 318 LEU A C   1 
ATOM   2584 O  O   . LEU A 1 317 ? 16.778  24.753  -4.698  1.00 30.41 ? 318 LEU A O   1 
ATOM   2585 C  CB  . LEU A 1 317 ? 17.735  22.436  -6.908  1.00 29.56 ? 318 LEU A CB  1 
ATOM   2586 C  CG  . LEU A 1 317 ? 18.784  21.391  -7.313  1.00 30.40 ? 318 LEU A CG  1 
ATOM   2587 C  CD1 . LEU A 1 317 ? 19.069  21.435  -8.809  1.00 30.24 ? 318 LEU A CD1 1 
ATOM   2588 C  CD2 . LEU A 1 317 ? 20.087  21.526  -6.536  1.00 31.50 ? 318 LEU A CD2 1 
ATOM   2589 N  N   . ALA A 1 318 ? 15.077  23.522  -5.503  1.00 30.81 ? 319 ALA A N   1 
ATOM   2590 C  CA  . ALA A 1 318 ? 14.078  24.570  -5.236  1.00 31.41 ? 319 ALA A CA  1 
ATOM   2591 C  C   . ALA A 1 318 ? 13.941  24.878  -3.748  1.00 32.03 ? 319 ALA A C   1 
ATOM   2592 O  O   . ALA A 1 318 ? 13.765  26.040  -3.368  1.00 31.99 ? 319 ALA A O   1 
ATOM   2593 C  CB  . ALA A 1 318 ? 12.726  24.201  -5.824  1.00 31.45 ? 319 ALA A CB  1 
ATOM   2594 N  N   . ALA A 1 319 ? 14.040  23.849  -2.902  1.00 32.28 ? 320 ALA A N   1 
ATOM   2595 C  CA  . ALA A 1 319 ? 13.872  24.046  -1.464  1.00 32.75 ? 320 ALA A CA  1 
ATOM   2596 C  C   . ALA A 1 319 ? 15.052  24.810  -0.876  1.00 33.16 ? 320 ALA A C   1 
ATOM   2597 O  O   . ALA A 1 319 ? 14.876  25.638  0.021   1.00 32.92 ? 320 ALA A O   1 
ATOM   2598 C  CB  . ALA A 1 319 ? 13.675  22.716  -0.745  1.00 32.74 ? 320 ALA A CB  1 
ATOM   2599 N  N   . ARG A 1 320 ? 16.245  24.528  -1.387  1.00 33.88 ? 321 ARG A N   1 
ATOM   2600 C  CA  . ARG A 1 320 ? 17.452  25.205  -0.930  1.00 35.49 ? 321 ARG A CA  1 
ATOM   2601 C  C   . ARG A 1 320 ? 17.393  26.693  -1.300  1.00 36.41 ? 321 ARG A C   1 
ATOM   2602 O  O   . ARG A 1 320 ? 17.730  27.556  -0.483  1.00 36.28 ? 321 ARG A O   1 
ATOM   2603 C  CB  . ARG A 1 320 ? 18.713  24.539  -1.501  1.00 34.83 ? 321 ARG A CB  1 
ATOM   2604 C  CG  . ARG A 1 320 ? 20.029  25.135  -1.007  1.00 35.49 ? 321 ARG A CG  1 
ATOM   2605 C  CD  . ARG A 1 320 ? 20.334  24.791  0.462   1.00 36.44 ? 321 ARG A CD  1 
ATOM   2606 N  NE  . ARG A 1 320 ? 21.020  23.501  0.627   1.00 34.22 ? 321 ARG A NE  1 
ATOM   2607 C  CZ  . ARG A 1 320 ? 21.568  23.076  1.767   1.00 34.12 ? 321 ARG A CZ  1 
ATOM   2608 N  NH1 . ARG A 1 320 ? 21.516  23.830  2.863   1.00 33.45 ? 321 ARG A NH1 1 
ATOM   2609 N  NH2 . ARG A 1 320 ? 22.179  21.894  1.819   1.00 31.37 ? 321 ARG A NH2 1 
ATOM   2610 N  N   . HIS A 1 321 ? 16.952  26.976  -2.525  1.00 37.60 ? 322 HIS A N   1 
ATOM   2611 C  CA  . HIS A 1 321 ? 16.740  28.352  -2.967  1.00 39.24 ? 322 HIS A CA  1 
ATOM   2612 C  C   . HIS A 1 321 ? 15.675  29.077  -2.128  1.00 39.77 ? 322 HIS A C   1 
ATOM   2613 O  O   . HIS A 1 321 ? 15.950  30.128  -1.548  1.00 39.74 ? 322 HIS A O   1 
ATOM   2614 C  CB  . HIS A 1 321 ? 16.377  28.385  -4.450  1.00 39.50 ? 322 HIS A CB  1 
ATOM   2615 C  CG  . HIS A 1 321 ? 16.168  29.769  -4.987  1.00 41.88 ? 322 HIS A CG  1 
ATOM   2616 N  ND1 . HIS A 1 321 ? 17.211  30.636  -5.231  1.00 43.34 ? 322 HIS A ND1 1 
ATOM   2617 C  CD2 . HIS A 1 321 ? 15.037  30.435  -5.323  1.00 42.93 ? 322 HIS A CD2 1 
ATOM   2618 C  CE1 . HIS A 1 321 ? 16.733  31.775  -5.701  1.00 44.59 ? 322 HIS A CE1 1 
ATOM   2619 N  NE2 . HIS A 1 321 ? 15.415  31.680  -5.764  1.00 45.02 ? 322 HIS A NE2 1 
ATOM   2620 N  N   . GLN A 1 322 ? 14.477  28.496  -2.049  1.00 40.63 ? 323 GLN A N   1 
ATOM   2621 C  CA  . GLN A 1 322 ? 13.347  29.099  -1.328  1.00 41.91 ? 323 GLN A CA  1 
ATOM   2622 C  C   . GLN A 1 322 ? 13.644  29.330  0.162   1.00 42.15 ? 323 GLN A C   1 
ATOM   2623 O  O   . GLN A 1 322 ? 13.170  30.301  0.746   1.00 42.20 ? 323 GLN A O   1 
ATOM   2624 C  CB  . GLN A 1 322 ? 12.076  28.258  -1.536  1.00 42.06 ? 323 GLN A CB  1 
ATOM   2625 C  CG  . GLN A 1 322 ? 10.805  28.732  -0.806  1.00 44.82 ? 323 GLN A CG  1 
ATOM   2626 C  CD  . GLN A 1 322 ? 10.337  30.127  -1.217  1.00 48.16 ? 323 GLN A CD  1 
ATOM   2627 O  OE1 . GLN A 1 322 ? 10.059  30.391  -2.394  1.00 48.68 ? 323 GLN A OE1 1 
ATOM   2628 N  NE2 . GLN A 1 322 ? 10.235  31.025  -0.235  1.00 49.01 ? 323 GLN A NE2 1 
ATOM   2629 N  N   . ALA A 1 323 ? 14.449  28.452  0.762   1.00 42.62 ? 324 ALA A N   1 
ATOM   2630 C  CA  . ALA A 1 323 ? 14.797  28.548  2.184   1.00 42.71 ? 324 ALA A CA  1 
ATOM   2631 C  C   . ALA A 1 323 ? 15.977  29.492  2.415   1.00 43.15 ? 324 ALA A C   1 
ATOM   2632 O  O   . ALA A 1 323 ? 16.368  29.746  3.565   1.00 42.99 ? 324 ALA A O   1 
ATOM   2633 C  CB  . ALA A 1 323 ? 15.112  27.161  2.742   1.00 42.91 ? 324 ALA A CB  1 
ATOM   2634 N  N   . GLN A 1 324 ? 16.543  29.999  1.316   1.00 43.31 ? 325 GLN A N   1 
ATOM   2635 C  CA  . GLN A 1 324 ? 17.730  30.855  1.348   1.00 43.72 ? 325 GLN A CA  1 
ATOM   2636 C  C   . GLN A 1 324 ? 18.915  30.175  2.041   1.00 43.49 ? 325 GLN A C   1 
ATOM   2637 O  O   . GLN A 1 324 ? 19.714  30.830  2.701   1.00 43.54 ? 325 GLN A O   1 
ATOM   2638 C  CB  . GLN A 1 324 ? 17.414  32.222  1.986   1.00 44.06 ? 325 GLN A CB  1 
ATOM   2639 C  CG  . GLN A 1 324 ? 17.003  33.299  0.994   1.00 46.01 ? 325 GLN A CG  1 
ATOM   2640 C  CD  . GLN A 1 324 ? 16.688  34.626  1.674   1.00 48.64 ? 325 GLN A CD  1 
ATOM   2641 O  OE1 . GLN A 1 324 ? 17.549  35.503  1.784   1.00 50.16 ? 325 GLN A OE1 1 
ATOM   2642 N  NE2 . GLN A 1 324 ? 15.451  34.773  2.145   1.00 49.08 ? 325 GLN A NE2 1 
ATOM   2643 N  N   . GLY A 1 325 ? 19.013  28.854  1.886   1.00 43.31 ? 326 GLY A N   1 
ATOM   2644 C  CA  . GLY A 1 325 ? 20.146  28.088  2.405   1.00 42.62 ? 326 GLY A CA  1 
ATOM   2645 C  C   . GLY A 1 325 ? 19.948  27.452  3.770   1.00 42.28 ? 326 GLY A C   1 
ATOM   2646 O  O   . GLY A 1 325 ? 20.673  26.518  4.112   1.00 42.54 ? 326 GLY A O   1 
ATOM   2647 N  N   . ASP A 1 326 ? 18.976  27.949  4.548   1.00 41.63 ? 327 ASP A N   1 
ATOM   2648 C  CA  . ASP A 1 326 ? 18.723  27.472  5.922   1.00 41.02 ? 327 ASP A CA  1 
ATOM   2649 C  C   . ASP A 1 326 ? 18.175  26.023  5.978   1.00 40.24 ? 327 ASP A C   1 
ATOM   2650 O  O   . ASP A 1 326 ? 17.107  25.735  5.432   1.00 39.83 ? 327 ASP A O   1 
ATOM   2651 C  CB  . ASP A 1 326 ? 17.766  28.434  6.650   1.00 41.10 ? 327 ASP A CB  1 
ATOM   2652 C  CG  . ASP A 1 326 ? 17.505  28.024  8.105   1.00 42.81 ? 327 ASP A CG  1 
ATOM   2653 O  OD1 . ASP A 1 326 ? 18.448  28.077  8.929   1.00 45.16 ? 327 ASP A OD1 1 
ATOM   2654 O  OD2 . ASP A 1 326 ? 16.354  27.664  8.438   1.00 44.68 ? 327 ASP A OD2 1 
ATOM   2655 N  N   . MET A 1 327 ? 18.892  25.122  6.653   1.00 39.46 ? 328 MET A N   1 
ATOM   2656 C  CA  . MET A 1 327 ? 18.472  23.706  6.710   1.00 38.56 ? 328 MET A CA  1 
ATOM   2657 C  C   . MET A 1 327 ? 17.108  23.520  7.379   1.00 37.83 ? 328 MET A C   1 
ATOM   2658 O  O   . MET A 1 327 ? 16.263  22.781  6.866   1.00 37.78 ? 328 MET A O   1 
ATOM   2659 C  CB  . MET A 1 327 ? 19.534  22.816  7.375   1.00 38.61 ? 328 MET A CB  1 
ATOM   2660 C  CG  . MET A 1 327 ? 19.185  21.299  7.406   1.00 38.20 ? 328 MET A CG  1 
ATOM   2661 S  SD  . MET A 1 327 ? 18.786  20.527  5.787   1.00 37.02 ? 328 MET A SD  1 
ATOM   2662 C  CE  . MET A 1 327 ? 20.385  20.517  4.959   1.00 36.69 ? 328 MET A CE  1 
ATOM   2663 N  N   . ALA A 1 328 ? 16.888  24.200  8.501   1.00 36.99 ? 329 ALA A N   1 
ATOM   2664 C  CA  . ALA A 1 328 ? 15.639  24.057  9.259   1.00 36.82 ? 329 ALA A CA  1 
ATOM   2665 C  C   . ALA A 1 328 ? 14.409  24.394  8.420   1.00 36.67 ? 329 ALA A C   1 
ATOM   2666 O  O   . ALA A 1 328 ? 13.393  23.692  8.472   1.00 36.50 ? 329 ALA A O   1 
ATOM   2667 C  CB  . ALA A 1 328 ? 15.677  24.909  10.529  1.00 37.18 ? 329 ALA A CB  1 
ATOM   2668 N  N   . THR A 1 329 ? 14.517  25.466  7.636   1.00 36.39 ? 330 THR A N   1 
ATOM   2669 C  CA  . THR A 1 329 ? 13.443  25.891  6.746   1.00 36.21 ? 330 THR A CA  1 
ATOM   2670 C  C   . THR A 1 329 ? 13.257  24.897  5.598   1.00 35.68 ? 330 THR A C   1 
ATOM   2671 O  O   . THR A 1 329 ? 12.135  24.542  5.243   1.00 35.29 ? 330 THR A O   1 
ATOM   2672 C  CB  . THR A 1 329 ? 13.730  27.294  6.175   1.00 36.40 ? 330 THR A CB  1 
ATOM   2673 O  OG1 . THR A 1 329 ? 14.155  28.163  7.236   1.00 37.90 ? 330 THR A OG1 1 
ATOM   2674 C  CG2 . THR A 1 329 ? 12.480  27.867  5.499   1.00 36.44 ? 330 THR A CG2 1 
ATOM   2675 N  N   . MET A 1 330 ? 14.377  24.459  5.039   1.00 34.98 ? 331 MET A N   1 
ATOM   2676 C  CA  . MET A 1 330 ? 14.420  23.537  3.912   1.00 35.33 ? 331 MET A CA  1 
ATOM   2677 C  C   . MET A 1 330 ? 13.672  22.223  4.152   1.00 34.89 ? 331 MET A C   1 
ATOM   2678 O  O   . MET A 1 330 ? 13.047  21.672  3.237   1.00 34.26 ? 331 MET A O   1 
ATOM   2679 C  CB  . MET A 1 330 ? 15.879  23.207  3.622   1.00 35.30 ? 331 MET A CB  1 
ATOM   2680 C  CG  . MET A 1 330 ? 16.178  23.017  2.190   1.00 37.28 ? 331 MET A CG  1 
ATOM   2681 S  SD  . MET A 1 330 ? 17.899  22.559  2.016   1.00 40.40 ? 331 MET A SD  1 
ATOM   2682 C  CE  . MET A 1 330 ? 17.736  21.644  0.484   1.00 38.89 ? 331 MET A CE  1 
ATOM   2683 N  N   . LEU A 1 331 ? 13.747  21.736  5.388   1.00 34.68 ? 332 LEU A N   1 
ATOM   2684 C  CA  . LEU A 1 331 ? 13.213  20.422  5.749   1.00 35.00 ? 332 LEU A CA  1 
ATOM   2685 C  C   . LEU A 1 331 ? 11.694  20.387  5.757   1.00 35.34 ? 332 LEU A C   1 
ATOM   2686 O  O   . LEU A 1 331 ? 11.102  19.318  5.839   1.00 35.84 ? 332 LEU A O   1 
ATOM   2687 C  CB  . LEU A 1 331 ? 13.776  19.962  7.105   1.00 34.64 ? 332 LEU A CB  1 
ATOM   2688 C  CG  . LEU A 1 331 ? 15.247  19.504  7.108   1.00 34.55 ? 332 LEU A CG  1 
ATOM   2689 C  CD1 . LEU A 1 331 ? 15.787  19.417  8.525   1.00 33.60 ? 332 LEU A CD1 1 
ATOM   2690 C  CD2 . LEU A 1 331 ? 15.412  18.164  6.395   1.00 33.53 ? 332 LEU A CD2 1 
ATOM   2691 N  N   . GLN A 1 332 ? 11.061  21.555  5.677   1.00 35.66 ? 333 GLN A N   1 
ATOM   2692 C  CA  . GLN A 1 332 ? 9.602   21.615  5.541   1.00 35.52 ? 333 GLN A CA  1 
ATOM   2693 C  C   . GLN A 1 332 ? 9.194   21.909  4.092   1.00 34.63 ? 333 GLN A C   1 
ATOM   2694 O  O   . GLN A 1 332 ? 8.015   22.116  3.802   1.00 34.73 ? 333 GLN A O   1 
ATOM   2695 C  CB  . GLN A 1 332 ? 8.989   22.629  6.529   1.00 36.09 ? 333 GLN A CB  1 
ATOM   2696 C  CG  . GLN A 1 332 ? 9.199   22.298  8.037   1.00 38.07 ? 333 GLN A CG  1 
ATOM   2697 C  CD  . GLN A 1 332 ? 8.709   20.889  8.451   1.00 41.81 ? 333 GLN A CD  1 
ATOM   2698 O  OE1 . GLN A 1 332 ? 9.458   20.116  9.063   1.00 43.45 ? 333 GLN A OE1 1 
ATOM   2699 N  NE2 . GLN A 1 332 ? 7.461   20.556  8.108   1.00 41.74 ? 333 GLN A NE2 1 
ATOM   2700 N  N   . LEU A 1 333 ? 10.170  21.894  3.183   1.00 33.75 ? 334 LEU A N   1 
ATOM   2701 C  CA  . LEU A 1 333 ? 9.922   22.186  1.770   1.00 32.46 ? 334 LEU A CA  1 
ATOM   2702 C  C   . LEU A 1 333 ? 10.295  21.038  0.839   1.00 31.73 ? 334 LEU A C   1 
ATOM   2703 O  O   . LEU A 1 333 ? 10.431  21.231  -0.370  1.00 30.53 ? 334 LEU A O   1 
ATOM   2704 C  CB  . LEU A 1 333 ? 10.666  23.455  1.356   1.00 33.33 ? 334 LEU A CB  1 
ATOM   2705 C  CG  . LEU A 1 333 ? 10.231  24.761  2.021   1.00 34.40 ? 334 LEU A CG  1 
ATOM   2706 C  CD1 . LEU A 1 333 ? 11.332  25.806  1.884   1.00 36.55 ? 334 LEU A CD1 1 
ATOM   2707 C  CD2 . LEU A 1 333 ? 8.933   25.250  1.396   1.00 36.59 ? 334 LEU A CD2 1 
ATOM   2708 N  N   . VAL A 1 334 ? 10.447  19.837  1.397   1.00 30.77 ? 335 VAL A N   1 
ATOM   2709 C  CA  . VAL A 1 334 ? 10.829  18.678  0.591   1.00 30.07 ? 335 VAL A CA  1 
ATOM   2710 C  C   . VAL A 1 334 ? 9.841   17.510  0.744   1.00 30.16 ? 335 VAL A C   1 
ATOM   2711 O  O   . VAL A 1 334 ? 10.263  16.399  1.101   1.00 29.92 ? 335 VAL A O   1 
ATOM   2712 C  CB  . VAL A 1 334 ? 12.304  18.226  0.888   1.00 30.34 ? 335 VAL A CB  1 
ATOM   2713 C  CG1 . VAL A 1 334 ? 13.308  19.233  0.327   1.00 29.54 ? 335 VAL A CG1 1 
ATOM   2714 C  CG2 . VAL A 1 334 ? 12.552  17.997  2.393   1.00 29.48 ? 335 VAL A CG2 1 
ATOM   2715 N  N   . PRO A 1 335 ? 8.524   17.749  0.476   1.00 29.78 ? 336 PRO A N   1 
ATOM   2716 C  CA  . PRO A 1 335 ? 7.517   16.714  0.735   1.00 29.00 ? 336 PRO A CA  1 
ATOM   2717 C  C   . PRO A 1 335 ? 7.751   15.410  -0.040  1.00 28.58 ? 336 PRO A C   1 
ATOM   2718 O  O   . PRO A 1 335 ? 7.503   14.328  0.496   1.00 27.61 ? 336 PRO A O   1 
ATOM   2719 C  CB  . PRO A 1 335 ? 6.190   17.381  0.308   1.00 29.10 ? 336 PRO A CB  1 
ATOM   2720 C  CG  . PRO A 1 335 ? 6.581   18.540  -0.551  1.00 29.50 ? 336 PRO A CG  1 
ATOM   2721 C  CD  . PRO A 1 335 ? 7.889   19.006  0.023   1.00 29.96 ? 336 PRO A CD  1 
ATOM   2722 N  N   . LEU A 1 336 ? 8.231   15.518  -1.277  1.00 28.10 ? 337 LEU A N   1 
ATOM   2723 C  CA  . LEU A 1 336 ? 8.451   14.349  -2.109  1.00 28.23 ? 337 LEU A CA  1 
ATOM   2724 C  C   . LEU A 1 336 ? 9.628   13.507  -1.626  1.00 27.50 ? 337 LEU A C   1 
ATOM   2725 O  O   . LEU A 1 336 ? 9.584   12.287  -1.714  1.00 27.10 ? 337 LEU A O   1 
ATOM   2726 C  CB  . LEU A 1 336 ? 8.651   14.733  -3.576  1.00 28.74 ? 337 LEU A CB  1 
ATOM   2727 C  CG  . LEU A 1 336 ? 8.618   13.599  -4.613  1.00 29.65 ? 337 LEU A CG  1 
ATOM   2728 C  CD1 . LEU A 1 336 ? 7.196   13.090  -4.826  1.00 31.51 ? 337 LEU A CD1 1 
ATOM   2729 C  CD2 . LEU A 1 336 ? 9.206   14.068  -5.945  1.00 32.91 ? 337 LEU A CD2 1 
ATOM   2730 N  N   . LEU A 1 337 ? 10.672  14.163  -1.126  1.00 27.00 ? 338 LEU A N   1 
ATOM   2731 C  CA  . LEU A 1 337 ? 11.833  13.472  -0.563  1.00 26.44 ? 338 LEU A CA  1 
ATOM   2732 C  C   . LEU A 1 337 ? 11.438  12.657  0.660   1.00 26.45 ? 338 LEU A C   1 
ATOM   2733 O  O   . LEU A 1 337 ? 11.817  11.479  0.780   1.00 26.52 ? 338 LEU A O   1 
ATOM   2734 C  CB  . LEU A 1 337 ? 12.947  14.461  -0.194  1.00 26.19 ? 338 LEU A CB  1 
ATOM   2735 C  CG  . LEU A 1 337 ? 14.248  13.855  0.363   1.00 26.05 ? 338 LEU A CG  1 
ATOM   2736 C  CD1 . LEU A 1 337 ? 14.828  12.817  -0.609  1.00 22.82 ? 338 LEU A CD1 1 
ATOM   2737 C  CD2 . LEU A 1 337 ? 15.277  14.956  0.681   1.00 23.81 ? 338 LEU A CD2 1 
ATOM   2738 N  N   . LYS A 1 338 ? 10.670  13.285  1.550   1.00 25.80 ? 339 LYS A N   1 
ATOM   2739 C  CA  . LYS A 1 338 ? 10.136  12.614  2.725   1.00 25.78 ? 339 LYS A CA  1 
ATOM   2740 C  C   . LYS A 1 338 ? 9.221   11.453  2.373   1.00 25.30 ? 339 LYS A C   1 
ATOM   2741 O  O   . LYS A 1 338 ? 9.209   10.432  3.059   1.00 25.14 ? 339 LYS A O   1 
ATOM   2742 C  CB  . LYS A 1 338 ? 9.421   13.607  3.643   1.00 26.15 ? 339 LYS A CB  1 
ATOM   2743 C  CG  . LYS A 1 338 ? 10.395  14.565  4.290   1.00 27.15 ? 339 LYS A CG  1 
ATOM   2744 C  CD  . LYS A 1 338 ? 9.738   15.382  5.363   1.00 30.42 ? 339 LYS A CD  1 
ATOM   2745 C  CE  . LYS A 1 338 ? 10.777  16.186  6.086   1.00 32.40 ? 339 LYS A CE  1 
ATOM   2746 N  NZ  . LYS A 1 338 ? 10.159  16.907  7.213   1.00 35.64 ? 339 LYS A NZ  1 
ATOM   2747 N  N   . ALA A 1 339 ? 8.463   11.618  1.300   1.00 24.82 ? 340 ALA A N   1 
ATOM   2748 C  CA  . ALA A 1 339 ? 7.623   10.548  0.785   1.00 24.85 ? 340 ALA A CA  1 
ATOM   2749 C  C   . ALA A 1 339 ? 8.501   9.433   0.245   1.00 23.94 ? 340 ALA A C   1 
ATOM   2750 O  O   . ALA A 1 339 ? 8.175   8.275   0.401   1.00 24.43 ? 340 ALA A O   1 
ATOM   2751 C  CB  . ALA A 1 339 ? 6.662   11.072  -0.318  1.00 23.93 ? 340 ALA A CB  1 
ATOM   2752 N  N   . SER A 1 340 ? 9.624   9.783   -0.375  1.00 23.62 ? 341 SER A N   1 
ATOM   2753 C  CA  . SER A 1 340 ? 10.492  8.771   -0.978  1.00 23.30 ? 341 SER A CA  1 
ATOM   2754 C  C   . SER A 1 340 ? 11.140  7.896   0.102   1.00 22.99 ? 341 SER A C   1 
ATOM   2755 O  O   . SER A 1 340 ? 11.561  6.775   -0.170  1.00 22.83 ? 341 SER A O   1 
ATOM   2756 C  CB  . SER A 1 340 ? 11.565  9.396   -1.881  1.00 22.42 ? 341 SER A CB  1 
ATOM   2757 O  OG  . SER A 1 340 ? 12.545  10.101  -1.133  1.00 23.03 ? 341 SER A OG  1 
ATOM   2758 N  N   . ILE A 1 341 ? 11.222  8.432   1.315   1.00 23.24 ? 342 ILE A N   1 
ATOM   2759 C  CA  . ILE A 1 341 ? 11.753  7.700   2.454   1.00 23.23 ? 342 ILE A CA  1 
ATOM   2760 C  C   . ILE A 1 341 ? 10.708  6.693   2.940   1.00 23.77 ? 342 ILE A C   1 
ATOM   2761 O  O   . ILE A 1 341 ? 11.035  5.523   3.177   1.00 22.50 ? 342 ILE A O   1 
ATOM   2762 C  CB  . ILE A 1 341 ? 12.251  8.657   3.558   1.00 23.41 ? 342 ILE A CB  1 
ATOM   2763 C  CG1 . ILE A 1 341 ? 13.508  9.391   3.057   1.00 22.59 ? 342 ILE A CG1 1 
ATOM   2764 C  CG2 . ILE A 1 341 ? 12.561  7.890   4.867   1.00 22.86 ? 342 ILE A CG2 1 
ATOM   2765 C  CD1 . ILE A 1 341 ? 13.979  10.546  3.962   1.00 23.16 ? 342 ILE A CD1 1 
ATOM   2766 N  N   . LYS A 1 342 ? 9.450   7.138   3.043   1.00 23.84 ? 343 LYS A N   1 
ATOM   2767 C  CA  . LYS A 1 342 ? 8.331   6.229   3.324   1.00 24.02 ? 343 LYS A CA  1 
ATOM   2768 C  C   . LYS A 1 342 ? 8.285   5.123   2.277   1.00 23.84 ? 343 LYS A C   1 
ATOM   2769 O  O   . LYS A 1 342 ? 8.090   3.947   2.592   1.00 24.12 ? 343 LYS A O   1 
ATOM   2770 C  CB  . LYS A 1 342 ? 6.999   6.987   3.322   1.00 24.40 ? 343 LYS A CB  1 
ATOM   2771 C  CG  . LYS A 1 342 ? 6.857   8.050   4.396   1.00 24.91 ? 343 LYS A CG  1 
ATOM   2772 C  CD  . LYS A 1 342 ? 5.476   8.701   4.328   1.00 28.59 ? 343 LYS A CD  1 
ATOM   2773 C  CE  . LYS A 1 342 ? 5.399   9.908   5.261   1.00 31.30 ? 343 LYS A CE  1 
ATOM   2774 N  NZ  . LYS A 1 342 ? 4.060   10.560  5.226   1.00 33.90 ? 343 LYS A NZ  1 
ATOM   2775 N  N   . GLU A 1 343 ? 8.494   5.505   1.023   1.00 23.45 ? 344 GLU A N   1 
ATOM   2776 C  CA  . GLU A 1 343 ? 8.473   4.553   -0.056  1.00 22.52 ? 344 GLU A CA  1 
ATOM   2777 C  C   . GLU A 1 343 ? 9.641   3.558   0.027   1.00 22.55 ? 344 GLU A C   1 
ATOM   2778 O  O   . GLU A 1 343 ? 9.475   2.382   -0.306  1.00 22.23 ? 344 GLU A O   1 
ATOM   2779 C  CB  . GLU A 1 343 ? 8.452   5.283   -1.393  1.00 22.83 ? 344 GLU A CB  1 
ATOM   2780 C  CG  . GLU A 1 343 ? 8.266   4.371   -2.600  1.00 22.06 ? 344 GLU A CG  1 
ATOM   2781 C  CD  . GLU A 1 343 ? 6.854   3.804   -2.731  1.00 23.40 ? 344 GLU A CD  1 
ATOM   2782 O  OE1 . GLU A 1 343 ? 6.064   3.846   -1.747  1.00 25.14 ? 344 GLU A OE1 1 
ATOM   2783 O  OE2 . GLU A 1 343 ? 6.545   3.309   -3.829  1.00 20.99 ? 344 GLU A OE2 1 
ATOM   2784 N  N   . THR A 1 344 ? 10.806  4.020   0.481   1.00 22.36 ? 345 THR A N   1 
ATOM   2785 C  CA  . THR A 1 344 ? 11.955  3.127   0.661   1.00 22.09 ? 345 THR A CA  1 
ATOM   2786 C  C   . THR A 1 344 ? 11.661  2.094   1.758   1.00 22.03 ? 345 THR A C   1 
ATOM   2787 O  O   . THR A 1 344 ? 11.908  0.902   1.565   1.00 22.08 ? 345 THR A O   1 
ATOM   2788 C  CB  . THR A 1 344 ? 13.268  3.898   0.945   1.00 21.76 ? 345 THR A CB  1 
ATOM   2789 O  OG1 . THR A 1 344 ? 13.611  4.659   -0.209  1.00 21.91 ? 345 THR A OG1 1 
ATOM   2790 C  CG2 . THR A 1 344 ? 14.421  2.935   1.228   1.00 21.71 ? 345 THR A CG2 1 
ATOM   2791 N  N   . LEU A 1 345 ? 11.122  2.550   2.884   1.00 21.42 ? 346 LEU A N   1 
ATOM   2792 C  CA  . LEU A 1 345 ? 10.764  1.650   3.984   1.00 21.77 ? 346 LEU A CA  1 
ATOM   2793 C  C   . LEU A 1 345 ? 9.601   0.704   3.678   1.00 21.57 ? 346 LEU A C   1 
ATOM   2794 O  O   . LEU A 1 345 ? 9.520   -0.367  4.263   1.00 21.98 ? 346 LEU A O   1 
ATOM   2795 C  CB  . LEU A 1 345 ? 10.481  2.444   5.258   1.00 22.10 ? 346 LEU A CB  1 
ATOM   2796 C  CG  . LEU A 1 345 ? 11.785  2.945   5.895   1.00 24.05 ? 346 LEU A CG  1 
ATOM   2797 C  CD1 . LEU A 1 345 ? 11.496  3.981   6.936   1.00 24.33 ? 346 LEU A CD1 1 
ATOM   2798 C  CD2 . LEU A 1 345 ? 12.577  1.768   6.488   1.00 26.02 ? 346 LEU A CD2 1 
ATOM   2799 N  N   . ARG A 1 346 ? 8.699   1.092   2.773   1.00 21.37 ? 347 ARG A N   1 
ATOM   2800 C  CA  . ARG A 1 346 ? 7.628   0.196   2.343   1.00 21.47 ? 347 ARG A CA  1 
ATOM   2801 C  C   . ARG A 1 346 ? 8.233   -1.061  1.706   1.00 21.06 ? 347 ARG A C   1 
ATOM   2802 O  O   . ARG A 1 346 ? 7.903   -2.191  2.074   1.00 21.21 ? 347 ARG A O   1 
ATOM   2803 C  CB  . ARG A 1 346 ? 6.694   0.896   1.333   1.00 21.55 ? 347 ARG A CB  1 
ATOM   2804 C  CG  . ARG A 1 346 ? 5.629   -0.026  0.729   1.00 21.18 ? 347 ARG A CG  1 
ATOM   2805 C  CD  . ARG A 1 346 ? 4.741   0.685   -0.298  1.00 22.73 ? 347 ARG A CD  1 
ATOM   2806 N  NE  . ARG A 1 346 ? 5.464   1.001   -1.534  1.00 22.06 ? 347 ARG A NE  1 
ATOM   2807 C  CZ  . ARG A 1 346 ? 5.699   0.127   -2.505  1.00 23.73 ? 347 ARG A CZ  1 
ATOM   2808 N  NH1 . ARG A 1 346 ? 5.290   -1.143  -2.401  1.00 24.76 ? 347 ARG A NH1 1 
ATOM   2809 N  NH2 . ARG A 1 346 ? 6.359   0.515   -3.582  1.00 24.31 ? 347 ARG A NH2 1 
ATOM   2810 N  N   . LEU A 1 347 ? 9.115   -0.843  0.745   1.00 20.37 ? 348 LEU A N   1 
ATOM   2811 C  CA  . LEU A 1 347 ? 9.726   -1.925  0.005   1.00 20.43 ? 348 LEU A CA  1 
ATOM   2812 C  C   . LEU A 1 347 ? 10.871  -2.584  0.770   1.00 20.01 ? 348 LEU A C   1 
ATOM   2813 O  O   . LEU A 1 347 ? 11.149  -3.764  0.582   1.00 20.42 ? 348 LEU A O   1 
ATOM   2814 C  CB  . LEU A 1 347 ? 10.274  -1.387  -1.316  1.00 20.53 ? 348 LEU A CB  1 
ATOM   2815 C  CG  . LEU A 1 347 ? 9.282   -1.169  -2.465  1.00 21.93 ? 348 LEU A CG  1 
ATOM   2816 C  CD1 . LEU A 1 347 ? 9.985   -0.330  -3.533  1.00 22.03 ? 348 LEU A CD1 1 
ATOM   2817 C  CD2 . LEU A 1 347 ? 8.833   -2.496  -3.057  1.00 20.40 ? 348 LEU A CD2 1 
ATOM   2818 N  N   . HIS A 1 348 ? 11.554  -1.806  1.597   1.00 19.18 ? 349 HIS A N   1 
ATOM   2819 C  CA  . HIS A 1 348 ? 12.732  -2.291  2.301   1.00 19.24 ? 349 HIS A CA  1 
ATOM   2820 C  C   . HIS A 1 348 ? 12.655  -1.950  3.797   1.00 18.88 ? 349 HIS A C   1 
ATOM   2821 O  O   . HIS A 1 348 ? 13.455  -1.154  4.301   1.00 19.28 ? 349 HIS A O   1 
ATOM   2822 C  CB  . HIS A 1 348 ? 14.002  -1.729  1.661   1.00 19.24 ? 349 HIS A CB  1 
ATOM   2823 C  CG  . HIS A 1 348 ? 14.059  -1.896  0.169   1.00 20.17 ? 349 HIS A CG  1 
ATOM   2824 N  ND1 . HIS A 1 348 ? 14.142  -3.129  -0.444  1.00 21.05 ? 349 HIS A ND1 1 
ATOM   2825 C  CD2 . HIS A 1 348 ? 14.053  -0.980  -0.832  1.00 20.20 ? 349 HIS A CD2 1 
ATOM   2826 C  CE1 . HIS A 1 348 ? 14.187  -2.967  -1.757  1.00 19.77 ? 349 HIS A CE1 1 
ATOM   2827 N  NE2 . HIS A 1 348 ? 14.145  -1.671  -2.018  1.00 19.86 ? 349 HIS A NE2 1 
ATOM   2828 N  N   . PRO A 1 349 ? 11.690  -2.564  4.517   1.00 18.44 ? 350 PRO A N   1 
ATOM   2829 C  CA  . PRO A 1 349 ? 11.575  -2.346  5.943   1.00 17.93 ? 350 PRO A CA  1 
ATOM   2830 C  C   . PRO A 1 349 ? 12.839  -2.853  6.654   1.00 18.24 ? 350 PRO A C   1 
ATOM   2831 O  O   . PRO A 1 349 ? 13.436  -3.849  6.228   1.00 18.47 ? 350 PRO A O   1 
ATOM   2832 C  CB  . PRO A 1 349 ? 10.365  -3.202  6.327   1.00 17.97 ? 350 PRO A CB  1 
ATOM   2833 C  CG  . PRO A 1 349 ? 10.290  -4.247  5.299   1.00 18.09 ? 350 PRO A CG  1 
ATOM   2834 C  CD  . PRO A 1 349 ? 10.753  -3.601  4.047   1.00 18.17 ? 350 PRO A CD  1 
ATOM   2835 N  N   . ILE A 1 350 ? 13.270  -2.155  7.695   1.00 18.10 ? 351 ILE A N   1 
ATOM   2836 C  CA  . ILE A 1 350 ? 14.312  -2.693  8.568   1.00 18.09 ? 351 ILE A CA  1 
ATOM   2837 C  C   . ILE A 1 350 ? 13.760  -3.881  9.380   1.00 18.19 ? 351 ILE A C   1 
ATOM   2838 O  O   . ILE A 1 350 ? 14.438  -4.899  9.557   1.00 18.13 ? 351 ILE A O   1 
ATOM   2839 C  CB  . ILE A 1 350 ? 14.862  -1.587  9.494   1.00 18.52 ? 351 ILE A CB  1 
ATOM   2840 C  CG1 . ILE A 1 350 ? 15.897  -0.737  8.741   1.00 18.07 ? 351 ILE A CG1 1 
ATOM   2841 C  CG2 . ILE A 1 350 ? 15.425  -2.166  10.815  1.00 18.25 ? 351 ILE A CG2 1 
ATOM   2842 C  CD1 . ILE A 1 350 ? 17.264  -1.376  8.554   1.00 16.96 ? 351 ILE A CD1 1 
ATOM   2843 N  N   . SER A 1 351 ? 12.543  -3.719  9.875   1.00 17.43 ? 352 SER A N   1 
ATOM   2844 C  CA  . SER A 1 351 ? 11.846  -4.686  10.727  1.00 18.47 ? 352 SER A CA  1 
ATOM   2845 C  C   . SER A 1 351 ? 10.833  -5.553  9.962   1.00 17.91 ? 352 SER A C   1 
ATOM   2846 O  O   . SER A 1 351 ? 9.863   -5.034  9.400   1.00 18.02 ? 352 SER A O   1 
ATOM   2847 C  CB  . SER A 1 351 ? 11.141  -3.892  11.815  1.00 18.50 ? 352 SER A CB  1 
ATOM   2848 O  OG  . SER A 1 351 ? 10.694  -4.745  12.856  1.00 21.21 ? 352 SER A OG  1 
ATOM   2849 N  N   . VAL A 1 352 ? 11.025  -6.879  9.927   1.00 17.24 ? 353 VAL A N   1 
ATOM   2850 C  CA  . VAL A 1 352 ? 10.106  -7.716  9.145   1.00 17.04 ? 353 VAL A CA  1 
ATOM   2851 C  C   . VAL A 1 352 ? 8.688   -7.610  9.607   1.00 17.22 ? 353 VAL A C   1 
ATOM   2852 O  O   . VAL A 1 352 ? 7.752   -7.594  8.807   1.00 17.50 ? 353 VAL A O   1 
ATOM   2853 C  CB  . VAL A 1 352 ? 10.487  -9.205  9.231   1.00 18.04 ? 353 VAL A CB  1 
ATOM   2854 C  CG1 . VAL A 1 352 ? 10.300  -9.721  10.650  1.00 16.74 ? 353 VAL A CG1 1 
ATOM   2855 C  CG2 . VAL A 1 352 ? 9.666   -10.022 8.246   1.00 15.99 ? 353 VAL A CG2 1 
ATOM   2856 N  N   . THR A 1 353 ? 8.504   -7.523  10.918  1.00 17.44 ? 354 THR A N   1 
ATOM   2857 C  CA  . THR A 1 353 ? 7.182   -7.389  11.503  1.00 18.02 ? 354 THR A CA  1 
ATOM   2858 C  C   . THR A 1 353 ? 7.174   -6.300  12.587  1.00 18.39 ? 354 THR A C   1 
ATOM   2859 O  O   . THR A 1 353 ? 8.226   -5.854  13.064  1.00 19.30 ? 354 THR A O   1 
ATOM   2860 C  CB  . THR A 1 353 ? 6.712   -8.691  12.188  1.00 17.16 ? 354 THR A CB  1 
ATOM   2861 O  OG1 . THR A 1 353 ? 7.589   -8.999  13.273  1.00 18.01 ? 354 THR A OG1 1 
ATOM   2862 C  CG2 . THR A 1 353 ? 6.685   -9.827  11.188  1.00 17.45 ? 354 THR A CG2 1 
ATOM   2863 N  N   . LEU A 1 354 ? 5.968   -5.913  12.933  1.00 18.71 ? 355 LEU A N   1 
ATOM   2864 C  CA  . LEU A 1 354 ? 5.717   -5.288  14.229  1.00 19.68 ? 355 LEU A CA  1 
ATOM   2865 C  C   . LEU A 1 354 ? 4.982   -6.335  15.053  1.00 19.62 ? 355 LEU A C   1 
ATOM   2866 O  O   . LEU A 1 354 ? 4.298   -7.179  14.494  1.00 18.88 ? 355 LEU A O   1 
ATOM   2867 C  CB  . LEU A 1 354 ? 4.819   -4.066  14.073  1.00 19.36 ? 355 LEU A CB  1 
ATOM   2868 C  CG  . LEU A 1 354 ? 5.291   -2.945  13.148  1.00 20.32 ? 355 LEU A CG  1 
ATOM   2869 C  CD1 . LEU A 1 354 ? 4.220   -1.837  13.100  1.00 21.06 ? 355 LEU A CD1 1 
ATOM   2870 C  CD2 . LEU A 1 354 ? 6.638   -2.394  13.563  1.00 19.25 ? 355 LEU A CD2 1 
ATOM   2871 N  N   . GLN A 1 355 ? 5.108   -6.262  16.372  1.00 19.90 ? 356 GLN A N   1 
ATOM   2872 C  CA  . GLN A 1 355 ? 4.431   -7.231  17.249  1.00 20.48 ? 356 GLN A CA  1 
ATOM   2873 C  C   . GLN A 1 355 ? 3.890   -6.542  18.497  1.00 20.94 ? 356 GLN A C   1 
ATOM   2874 O  O   . GLN A 1 355 ? 4.498   -5.605  19.000  1.00 20.23 ? 356 GLN A O   1 
ATOM   2875 C  CB  . GLN A 1 355 ? 5.361   -8.388  17.682  1.00 19.36 ? 356 GLN A CB  1 
ATOM   2876 C  CG  . GLN A 1 355 ? 6.515   -8.747  16.722  1.00 19.40 ? 356 GLN A CG  1 
ATOM   2877 C  CD  . GLN A 1 355 ? 7.688   -7.805  16.880  1.00 18.78 ? 356 GLN A CD  1 
ATOM   2878 O  OE1 . GLN A 1 355 ? 8.027   -7.427  18.002  1.00 20.23 ? 356 GLN A OE1 1 
ATOM   2879 N  NE2 . GLN A 1 355 ? 8.312   -7.407  15.756  1.00 16.39 ? 356 GLN A NE2 1 
ATOM   2880 N  N   . ARG A 1 356 ? 2.732   -7.007  18.961  1.00 22.44 ? 357 ARG A N   1 
ATOM   2881 C  CA  . ARG A 1 356 ? 2.169   -6.599  20.234  1.00 23.91 ? 357 ARG A CA  1 
ATOM   2882 C  C   . ARG A 1 356 ? 1.563   -7.825  20.927  1.00 24.68 ? 357 ARG A C   1 
ATOM   2883 O  O   . ARG A 1 356 ? 0.920   -8.643  20.290  1.00 24.87 ? 357 ARG A O   1 
ATOM   2884 C  CB  . ARG A 1 356 ? 1.100   -5.500  20.055  1.00 24.11 ? 357 ARG A CB  1 
ATOM   2885 C  CG  . ARG A 1 356 ? 1.615   -4.123  19.593  1.00 24.66 ? 357 ARG A CG  1 
ATOM   2886 C  CD  . ARG A 1 356 ? 2.570   -3.496  20.606  1.00 25.38 ? 357 ARG A CD  1 
ATOM   2887 N  NE  . ARG A 1 356 ? 2.955   -2.130  20.255  1.00 25.31 ? 357 ARG A NE  1 
ATOM   2888 C  CZ  . ARG A 1 356 ? 4.036   -1.791  19.543  1.00 25.52 ? 357 ARG A CZ  1 
ATOM   2889 N  NH1 . ARG A 1 356 ? 4.868   -2.718  19.054  1.00 22.64 ? 357 ARG A NH1 1 
ATOM   2890 N  NH2 . ARG A 1 356 ? 4.273   -0.512  19.301  1.00 23.18 ? 357 ARG A NH2 1 
ATOM   2891 N  N   . TYR A 1 357 ? 1.807   -7.952  22.225  1.00 25.88 ? 358 TYR A N   1 
ATOM   2892 C  CA  . TYR A 1 357 ? 1.068   -8.888  23.056  1.00 27.93 ? 358 TYR A CA  1 
ATOM   2893 C  C   . TYR A 1 357 ? -0.259  -8.248  23.435  1.00 28.94 ? 358 TYR A C   1 
ATOM   2894 O  O   . TYR A 1 357 ? -0.285  -7.134  23.965  1.00 29.28 ? 358 TYR A O   1 
ATOM   2895 C  CB  . TYR A 1 357 ? 1.846   -9.219  24.332  1.00 27.60 ? 358 TYR A CB  1 
ATOM   2896 C  CG  . TYR A 1 357 ? 3.010   -10.153 24.113  1.00 27.87 ? 358 TYR A CG  1 
ATOM   2897 C  CD1 . TYR A 1 357 ? 4.298   -9.653  23.925  1.00 27.24 ? 358 TYR A CD1 1 
ATOM   2898 C  CD2 . TYR A 1 357 ? 2.827   -11.543 24.107  1.00 27.19 ? 358 TYR A CD2 1 
ATOM   2899 C  CE1 . TYR A 1 357 ? 5.381   -10.513 23.740  1.00 27.61 ? 358 TYR A CE1 1 
ATOM   2900 C  CE2 . TYR A 1 357 ? 3.900   -12.413 23.902  1.00 26.30 ? 358 TYR A CE2 1 
ATOM   2901 C  CZ  . TYR A 1 357 ? 5.174   -11.890 23.724  1.00 26.82 ? 358 TYR A CZ  1 
ATOM   2902 O  OH  . TYR A 1 357 ? 6.248   -12.732 23.526  1.00 26.62 ? 358 TYR A OH  1 
ATOM   2903 N  N   . LEU A 1 358 ? -1.354  -8.948  23.163  1.00 30.39 ? 359 LEU A N   1 
ATOM   2904 C  CA  . LEU A 1 358 ? -2.680  -8.433  23.512  1.00 32.02 ? 359 LEU A CA  1 
ATOM   2905 C  C   . LEU A 1 358 ? -2.864  -8.291  25.022  1.00 33.09 ? 359 LEU A C   1 
ATOM   2906 O  O   . LEU A 1 358 ? -2.422  -9.140  25.802  1.00 33.27 ? 359 LEU A O   1 
ATOM   2907 C  CB  . LEU A 1 358 ? -3.789  -9.296  22.908  1.00 31.64 ? 359 LEU A CB  1 
ATOM   2908 C  CG  . LEU A 1 358 ? -3.865  -9.338  21.381  1.00 31.84 ? 359 LEU A CG  1 
ATOM   2909 C  CD1 . LEU A 1 358 ? -5.064  -10.136 20.940  1.00 31.11 ? 359 LEU A CD1 1 
ATOM   2910 C  CD2 . LEU A 1 358 ? -3.899  -7.920  20.775  1.00 30.86 ? 359 LEU A CD2 1 
ATOM   2911 N  N   . VAL A 1 359 ? -3.488  -7.187  25.418  1.00 34.84 ? 360 VAL A N   1 
ATOM   2912 C  CA  . VAL A 1 359 ? -3.836  -6.932  26.820  1.00 36.50 ? 360 VAL A CA  1 
ATOM   2913 C  C   . VAL A 1 359 ? -5.218  -7.524  27.109  1.00 37.17 ? 360 VAL A C   1 
ATOM   2914 O  O   . VAL A 1 359 ? -5.420  -8.188  28.132  1.00 38.19 ? 360 VAL A O   1 
ATOM   2915 C  CB  . VAL A 1 359 ? -3.791  -5.411  27.146  1.00 36.69 ? 360 VAL A CB  1 
ATOM   2916 C  CG1 . VAL A 1 359 ? -4.288  -5.136  28.570  1.00 37.41 ? 360 VAL A CG1 1 
ATOM   2917 C  CG2 . VAL A 1 359 ? -2.370  -4.883  26.985  1.00 36.70 ? 360 VAL A CG2 1 
ATOM   2918 N  N   . ASN A 1 360 ? -6.146  -7.290  26.185  1.00 37.89 ? 361 ASN A N   1 
ATOM   2919 C  CA  . ASN A 1 360 ? -7.506  -7.814  26.231  1.00 38.42 ? 361 ASN A CA  1 
ATOM   2920 C  C   . ASN A 1 360 ? -7.820  -8.678  25.013  1.00 38.76 ? 361 ASN A C   1 
ATOM   2921 O  O   . ASN A 1 360 ? -7.213  -8.507  23.950  1.00 38.50 ? 361 ASN A O   1 
ATOM   2922 C  CB  . ASN A 1 360 ? -8.510  -6.655  26.273  1.00 38.70 ? 361 ASN A CB  1 
ATOM   2923 C  CG  . ASN A 1 360 ? -8.301  -5.753  27.467  1.00 38.94 ? 361 ASN A CG  1 
ATOM   2924 O  OD1 . ASN A 1 360 ? -8.202  -6.222  28.594  1.00 39.00 ? 361 ASN A OD1 1 
ATOM   2925 N  ND2 . ASN A 1 360 ? -8.216  -4.454  27.223  1.00 39.15 ? 361 ASN A ND2 1 
ATOM   2926 N  N   . ASP A 1 361 ? -8.776  -9.595  25.174  1.00 38.86 ? 362 ASP A N   1 
ATOM   2927 C  CA  . ASP A 1 361 ? -9.334  -10.361 24.057  1.00 39.07 ? 362 ASP A CA  1 
ATOM   2928 C  C   . ASP A 1 361 ? -9.655  -9.406  22.911  1.00 38.81 ? 362 ASP A C   1 
ATOM   2929 O  O   . ASP A 1 361 ? -10.022 -8.254  23.142  1.00 38.86 ? 362 ASP A O   1 
ATOM   2930 C  CB  . ASP A 1 361 ? -10.609 -11.099 24.490  1.00 39.42 ? 362 ASP A CB  1 
ATOM   2931 C  CG  . ASP A 1 361 ? -10.337 -12.292 25.430  1.00 40.77 ? 362 ASP A CG  1 
ATOM   2932 O  OD1 . ASP A 1 361 ? -9.183  -12.531 25.851  1.00 41.72 ? 362 ASP A OD1 1 
ATOM   2933 O  OD2 . ASP A 1 361 ? -11.307 -13.006 25.753  1.00 43.97 ? 362 ASP A OD2 1 
ATOM   2934 N  N   . LEU A 1 362 ? -9.502  -9.879  21.678  1.00 38.46 ? 363 LEU A N   1 
ATOM   2935 C  CA  . LEU A 1 362 ? -9.705  -9.040  20.500  1.00 38.00 ? 363 LEU A CA  1 
ATOM   2936 C  C   . LEU A 1 362 ? -10.225 -9.868  19.337  1.00 37.87 ? 363 LEU A C   1 
ATOM   2937 O  O   . LEU A 1 362 ? -9.765  -10.986 19.105  1.00 37.77 ? 363 LEU A O   1 
ATOM   2938 C  CB  . LEU A 1 362 ? -8.394  -8.347  20.101  1.00 38.20 ? 363 LEU A CB  1 
ATOM   2939 C  CG  . LEU A 1 362 ? -8.347  -7.601  18.758  1.00 38.27 ? 363 LEU A CG  1 
ATOM   2940 C  CD1 . LEU A 1 362 ? -9.193  -6.332  18.806  1.00 39.06 ? 363 LEU A CD1 1 
ATOM   2941 C  CD2 . LEU A 1 362 ? -6.920  -7.276  18.353  1.00 39.14 ? 363 LEU A CD2 1 
ATOM   2942 N  N   . VAL A 1 363 ? -11.183 -9.317  18.601  1.00 37.63 ? 364 VAL A N   1 
ATOM   2943 C  CA  . VAL A 1 363 ? -11.672 -9.991  17.410  1.00 37.87 ? 364 VAL A CA  1 
ATOM   2944 C  C   . VAL A 1 363 ? -11.011 -9.430  16.164  1.00 37.96 ? 364 VAL A C   1 
ATOM   2945 O  O   . VAL A 1 363 ? -10.954 -8.217  15.986  1.00 38.13 ? 364 VAL A O   1 
ATOM   2946 C  CB  . VAL A 1 363 ? -13.221 -9.952  17.299  1.00 37.95 ? 364 VAL A CB  1 
ATOM   2947 C  CG1 . VAL A 1 363 ? -13.677 -10.598 16.006  1.00 37.55 ? 364 VAL A CG1 1 
ATOM   2948 C  CG2 . VAL A 1 363 ? -13.838 -10.685 18.485  1.00 37.36 ? 364 VAL A CG2 1 
ATOM   2949 N  N   . LEU A 1 364 ? -10.487 -10.327 15.330  1.00 38.12 ? 365 LEU A N   1 
ATOM   2950 C  CA  . LEU A 1 364 ? -9.940  -9.978  14.029  1.00 38.55 ? 365 LEU A CA  1 
ATOM   2951 C  C   . LEU A 1 364 ? -10.437 -10.945 12.975  1.00 39.06 ? 365 LEU A C   1 
ATOM   2952 O  O   . LEU A 1 364 ? -10.257 -12.159 13.093  1.00 39.12 ? 365 LEU A O   1 
ATOM   2953 C  CB  . LEU A 1 364 ? -8.400  -9.948  14.054  1.00 38.62 ? 365 LEU A CB  1 
ATOM   2954 C  CG  . LEU A 1 364 ? -7.738  -8.865  14.918  1.00 38.16 ? 365 LEU A CG  1 
ATOM   2955 C  CD1 . LEU A 1 364 ? -6.223  -9.010  14.944  1.00 39.69 ? 365 LEU A CD1 1 
ATOM   2956 C  CD2 . LEU A 1 364 ? -8.130  -7.467  14.463  1.00 38.19 ? 365 LEU A CD2 1 
ATOM   2957 N  N   . ARG A 1 365 ? -11.063 -10.386 11.941  1.00 39.72 ? 366 ARG A N   1 
ATOM   2958 C  CA  . ARG A 1 365 ? -11.660 -11.145 10.841  1.00 40.33 ? 366 ARG A CA  1 
ATOM   2959 C  C   . ARG A 1 365 ? -12.551 -12.288 11.328  1.00 40.56 ? 366 ARG A C   1 
ATOM   2960 O  O   . ARG A 1 365 ? -12.493 -13.405 10.797  1.00 40.44 ? 366 ARG A O   1 
ATOM   2961 C  CB  . ARG A 1 365 ? -10.589 -11.673 9.881   1.00 40.52 ? 366 ARG A CB  1 
ATOM   2962 C  CG  . ARG A 1 365 ? -9.546  -10.652 9.486   1.00 41.28 ? 366 ARG A CG  1 
ATOM   2963 C  CD  . ARG A 1 365 ? -8.795  -11.109 8.262   1.00 41.02 ? 366 ARG A CD  1 
ATOM   2964 N  NE  . ARG A 1 365 ? -9.591  -10.944 7.046   1.00 43.11 ? 366 ARG A NE  1 
ATOM   2965 C  CZ  . ARG A 1 365 ? -9.460  -9.942  6.178   1.00 43.32 ? 366 ARG A CZ  1 
ATOM   2966 N  NH1 . ARG A 1 365 ? -8.557  -8.986  6.375   1.00 43.80 ? 366 ARG A NH1 1 
ATOM   2967 N  NH2 . ARG A 1 365 ? -10.235 -9.898  5.101   1.00 43.40 ? 366 ARG A NH2 1 
ATOM   2968 N  N   . ASP A 1 366 ? -13.364 -11.994 12.344  1.00 40.82 ? 367 ASP A N   1 
ATOM   2969 C  CA  . ASP A 1 366 ? -14.351 -12.933 12.882  1.00 41.38 ? 367 ASP A CA  1 
ATOM   2970 C  C   . ASP A 1 366 ? -13.716 -14.069 13.698  1.00 40.93 ? 367 ASP A C   1 
ATOM   2971 O  O   . ASP A 1 366 ? -14.323 -15.122 13.875  1.00 41.02 ? 367 ASP A O   1 
ATOM   2972 C  CB  . ASP A 1 366 ? -15.243 -13.486 11.750  1.00 41.97 ? 367 ASP A CB  1 
ATOM   2973 C  CG  . ASP A 1 366 ? -16.689 -13.731 12.190  1.00 44.51 ? 367 ASP A CG  1 
ATOM   2974 O  OD1 . ASP A 1 366 ? -17.070 -13.315 13.309  1.00 45.54 ? 367 ASP A OD1 1 
ATOM   2975 O  OD2 . ASP A 1 366 ? -17.447 -14.346 11.396  1.00 47.90 ? 367 ASP A OD2 1 
ATOM   2976 N  N   . TYR A 1 367 ? -12.499 -13.842 14.196  1.00 40.15 ? 368 TYR A N   1 
ATOM   2977 C  CA  . TYR A 1 367 ? -11.806 -14.800 15.052  1.00 38.89 ? 368 TYR A CA  1 
ATOM   2978 C  C   . TYR A 1 367 ? -11.481 -14.160 16.394  1.00 38.97 ? 368 TYR A C   1 
ATOM   2979 O  O   . TYR A 1 367 ? -10.938 -13.058 16.445  1.00 38.60 ? 368 TYR A O   1 
ATOM   2980 C  CB  . TYR A 1 367 ? -10.486 -15.244 14.425  1.00 38.23 ? 368 TYR A CB  1 
ATOM   2981 C  CG  . TYR A 1 367 ? -10.566 -16.050 13.157  1.00 35.40 ? 368 TYR A CG  1 
ATOM   2982 C  CD1 . TYR A 1 367 ? -10.223 -15.479 11.941  1.00 33.23 ? 368 TYR A CD1 1 
ATOM   2983 C  CD2 . TYR A 1 367 ? -10.930 -17.396 13.176  1.00 32.04 ? 368 TYR A CD2 1 
ATOM   2984 C  CE1 . TYR A 1 367 ? -10.267 -16.204 10.774  1.00 32.24 ? 368 TYR A CE1 1 
ATOM   2985 C  CE2 . TYR A 1 367 ? -10.972 -18.136 12.008  1.00 31.21 ? 368 TYR A CE2 1 
ATOM   2986 C  CZ  . TYR A 1 367 ? -10.638 -17.531 10.808  1.00 31.44 ? 368 TYR A CZ  1 
ATOM   2987 O  OH  . TYR A 1 367 ? -10.661 -18.236 9.622   1.00 32.60 ? 368 TYR A OH  1 
ATOM   2988 N  N   . MET A 1 368 ? -11.791 -14.870 17.473  1.00 38.95 ? 369 MET A N   1 
ATOM   2989 C  CA  . MET A 1 368 ? -11.498 -14.404 18.815  1.00 39.28 ? 369 MET A CA  1 
ATOM   2990 C  C   . MET A 1 368 ? -10.036 -14.693 19.141  1.00 38.72 ? 369 MET A C   1 
ATOM   2991 O  O   . MET A 1 368 ? -9.603  -15.841 19.104  1.00 38.80 ? 369 MET A O   1 
ATOM   2992 C  CB  . MET A 1 368 ? -12.442 -15.075 19.826  1.00 39.98 ? 369 MET A CB  1 
ATOM   2993 C  CG  . MET A 1 368 ? -12.107 -14.850 21.300  1.00 42.61 ? 369 MET A CG  1 
ATOM   2994 S  SD  . MET A 1 368 ? -12.113 -13.137 21.867  1.00 50.04 ? 369 MET A SD  1 
ATOM   2995 C  CE  . MET A 1 368 ? -13.867 -12.813 22.104  1.00 47.98 ? 369 MET A CE  1 
ATOM   2996 N  N   . ILE A 1 369 ? -9.278  -13.645 19.447  1.00 37.73 ? 370 ILE A N   1 
ATOM   2997 C  CA  . ILE A 1 369 ? -7.886  -13.807 19.832  1.00 37.05 ? 370 ILE A CA  1 
ATOM   2998 C  C   . ILE A 1 369 ? -7.738  -13.445 21.303  1.00 36.52 ? 370 ILE A C   1 
ATOM   2999 O  O   . ILE A 1 369 ? -7.975  -12.293 21.683  1.00 36.63 ? 370 ILE A O   1 
ATOM   3000 C  CB  . ILE A 1 369 ? -6.933  -12.988 18.930  1.00 37.04 ? 370 ILE A CB  1 
ATOM   3001 C  CG1 . ILE A 1 369 ? -7.185  -13.330 17.458  1.00 37.63 ? 370 ILE A CG1 1 
ATOM   3002 C  CG2 . ILE A 1 369 ? -5.477  -13.304 19.258  1.00 37.50 ? 370 ILE A CG2 1 
ATOM   3003 C  CD1 . ILE A 1 369 ? -6.773  -12.264 16.500  1.00 37.56 ? 370 ILE A CD1 1 
ATOM   3004 N  N   . PRO A 1 370 ? -7.376  -14.436 22.144  1.00 35.97 ? 371 PRO A N   1 
ATOM   3005 C  CA  . PRO A 1 370 ? -7.337  -14.205 23.580  1.00 35.93 ? 371 PRO A CA  1 
ATOM   3006 C  C   . PRO A 1 370 ? -6.249  -13.260 24.024  1.00 35.61 ? 371 PRO A C   1 
ATOM   3007 O  O   . PRO A 1 370 ? -5.224  -13.119 23.354  1.00 35.81 ? 371 PRO A O   1 
ATOM   3008 C  CB  . PRO A 1 370 ? -7.094  -15.607 24.171  1.00 35.92 ? 371 PRO A CB  1 
ATOM   3009 C  CG  . PRO A 1 370 ? -6.602  -16.426 23.065  1.00 36.37 ? 371 PRO A CG  1 
ATOM   3010 C  CD  . PRO A 1 370 ? -7.219  -15.864 21.820  1.00 36.21 ? 371 PRO A CD  1 
ATOM   3011 N  N   . ALA A 1 371 ? -6.484  -12.622 25.165  1.00 34.95 ? 372 ALA A N   1 
ATOM   3012 C  CA  . ALA A 1 371 ? -5.504  -11.759 25.787  1.00 34.18 ? 372 ALA A CA  1 
ATOM   3013 C  C   . ALA A 1 371 ? -4.224  -12.541 26.023  1.00 33.92 ? 372 ALA A C   1 
ATOM   3014 O  O   . ALA A 1 371 ? -4.264  -13.751 26.268  1.00 33.57 ? 372 ALA A O   1 
ATOM   3015 C  CB  . ALA A 1 371 ? -6.041  -11.222 27.096  1.00 34.56 ? 372 ALA A CB  1 
ATOM   3016 N  N   . LYS A 1 372 ? -3.093  -11.835 25.939  1.00 33.13 ? 373 LYS A N   1 
ATOM   3017 C  CA  . LYS A 1 372 ? -1.763  -12.427 26.091  1.00 32.57 ? 373 LYS A CA  1 
ATOM   3018 C  C   . LYS A 1 372 ? -1.223  -13.113 24.819  1.00 31.11 ? 373 LYS A C   1 
ATOM   3019 O  O   . LYS A 1 372 ? -0.074  -13.546 24.799  1.00 31.02 ? 373 LYS A O   1 
ATOM   3020 C  CB  . LYS A 1 372 ? -1.689  -13.355 27.320  1.00 33.07 ? 373 LYS A CB  1 
ATOM   3021 C  CG  . LYS A 1 372 ? -1.871  -12.616 28.657  1.00 36.04 ? 373 LYS A CG  1 
ATOM   3022 C  CD  . LYS A 1 372 ? -1.793  -13.570 29.840  1.00 39.90 ? 373 LYS A CD  1 
ATOM   3023 C  CE  . LYS A 1 372 ? -1.844  -12.800 31.154  1.00 42.17 ? 373 LYS A CE  1 
ATOM   3024 N  NZ  . LYS A 1 372 ? -2.155  -13.710 32.304  1.00 45.22 ? 373 LYS A NZ  1 
ATOM   3025 N  N   . THR A 1 373 ? -2.037  -13.201 23.770  1.00 29.56 ? 374 THR A N   1 
ATOM   3026 C  CA  . THR A 1 373 ? -1.562  -13.701 22.475  1.00 28.40 ? 374 THR A CA  1 
ATOM   3027 C  C   . THR A 1 373 ? -0.617  -12.686 21.809  1.00 27.32 ? 374 THR A C   1 
ATOM   3028 O  O   . THR A 1 373 ? -0.848  -11.476 21.860  1.00 27.39 ? 374 THR A O   1 
ATOM   3029 C  CB  . THR A 1 373 ? -2.725  -13.981 21.491  1.00 28.78 ? 374 THR A CB  1 
ATOM   3030 O  OG1 . THR A 1 373 ? -3.733  -14.778 22.127  1.00 29.94 ? 374 THR A OG1 1 
ATOM   3031 C  CG2 . THR A 1 373 ? -2.226  -14.713 20.238  1.00 27.86 ? 374 THR A CG2 1 
ATOM   3032 N  N   . LEU A 1 374 ? 0.439   -13.193 21.177  1.00 25.67 ? 375 LEU A N   1 
ATOM   3033 C  CA  . LEU A 1 374 ? 1.331   -12.367 20.396  1.00 24.04 ? 375 LEU A CA  1 
ATOM   3034 C  C   . LEU A 1 374 ? 0.751   -12.220 19.002  1.00 23.32 ? 375 LEU A C   1 
ATOM   3035 O  O   . LEU A 1 374 ? 0.450   -13.219 18.342  1.00 22.33 ? 375 LEU A O   1 
ATOM   3036 C  CB  . LEU A 1 374 ? 2.730   -13.005 20.338  1.00 23.87 ? 375 LEU A CB  1 
ATOM   3037 C  CG  . LEU A 1 374 ? 3.809   -12.287 19.539  1.00 22.70 ? 375 LEU A CG  1 
ATOM   3038 C  CD1 . LEU A 1 374 ? 3.998   -10.884 20.110  1.00 23.02 ? 375 LEU A CD1 1 
ATOM   3039 C  CD2 . LEU A 1 374 ? 5.124   -13.071 19.604  1.00 22.78 ? 375 LEU A CD2 1 
ATOM   3040 N  N   . VAL A 1 375 ? 0.594   -10.970 18.565  1.00 22.61 ? 376 VAL A N   1 
ATOM   3041 C  CA  . VAL A 1 375 ? 0.089   -10.664 17.229  1.00 22.15 ? 376 VAL A CA  1 
ATOM   3042 C  C   . VAL A 1 375 ? 1.185   -9.912  16.487  1.00 22.14 ? 376 VAL A C   1 
ATOM   3043 O  O   . VAL A 1 375 ? 1.784   -8.991  17.041  1.00 22.03 ? 376 VAL A O   1 
ATOM   3044 C  CB  . VAL A 1 375 ? -1.214  -9.807  17.280  1.00 22.56 ? 376 VAL A CB  1 
ATOM   3045 C  CG1 . VAL A 1 375 ? -1.675  -9.420  15.880  1.00 20.50 ? 376 VAL A CG1 1 
ATOM   3046 C  CG2 . VAL A 1 375 ? -2.338  -10.578 18.001  1.00 24.17 ? 376 VAL A CG2 1 
ATOM   3047 N  N   . GLN A 1 376 ? 1.461   -10.346 15.256  1.00 21.82 ? 377 GLN A N   1 
ATOM   3048 C  CA  . GLN A 1 376 ? 2.495   -9.759  14.421  1.00 22.08 ? 377 GLN A CA  1 
ATOM   3049 C  C   . GLN A 1 376 ? 1.895   -9.227  13.123  1.00 21.42 ? 377 GLN A C   1 
ATOM   3050 O  O   . GLN A 1 376 ? 1.122   -9.911  12.453  1.00 20.69 ? 377 GLN A O   1 
ATOM   3051 C  CB  . GLN A 1 376 ? 3.622   -10.772 14.119  1.00 21.63 ? 377 GLN A CB  1 
ATOM   3052 C  CG  . GLN A 1 376 ? 4.330   -11.286 15.387  1.00 22.14 ? 377 GLN A CG  1 
ATOM   3053 C  CD  . GLN A 1 376 ? 5.687   -11.928 15.110  1.00 22.79 ? 377 GLN A CD  1 
ATOM   3054 O  OE1 . GLN A 1 376 ? 6.506   -11.406 14.336  1.00 19.47 ? 377 GLN A OE1 1 
ATOM   3055 N  NE2 . GLN A 1 376 ? 5.936   -13.060 15.749  1.00 21.68 ? 377 GLN A NE2 1 
ATOM   3056 N  N   . VAL A 1 377 ? 2.247   -7.993  12.798  1.00 21.23 ? 378 VAL A N   1 
ATOM   3057 C  CA  . VAL A 1 377 ? 1.867   -7.386  11.530  1.00 20.86 ? 378 VAL A CA  1 
ATOM   3058 C  C   . VAL A 1 377 ? 3.021   -7.592  10.571  1.00 21.28 ? 378 VAL A C   1 
ATOM   3059 O  O   . VAL A 1 377 ? 4.137   -7.117  10.823  1.00 21.23 ? 378 VAL A O   1 
ATOM   3060 C  CB  . VAL A 1 377 ? 1.638   -5.862  11.686  1.00 21.29 ? 378 VAL A CB  1 
ATOM   3061 C  CG1 . VAL A 1 377 ? 1.330   -5.230  10.329  1.00 20.52 ? 378 VAL A CG1 1 
ATOM   3062 C  CG2 . VAL A 1 377 ? 0.496   -5.588  12.695  1.00 21.51 ? 378 VAL A CG2 1 
ATOM   3063 N  N   . ALA A 1 378 ? 2.766   -8.296  9.479   1.00 20.79 ? 379 ALA A N   1 
ATOM   3064 C  CA  . ALA A 1 378 ? 3.818   -8.606  8.530   1.00 20.74 ? 379 ALA A CA  1 
ATOM   3065 C  C   . ALA A 1 378 ? 4.097   -7.428  7.590   1.00 21.22 ? 379 ALA A C   1 
ATOM   3066 O  O   . ALA A 1 378 ? 3.545   -7.345  6.496   1.00 21.22 ? 379 ALA A O   1 
ATOM   3067 C  CB  . ALA A 1 378 ? 3.486   -9.857  7.754   1.00 20.63 ? 379 ALA A CB  1 
ATOM   3068 N  N   . ILE A 1 379 ? 4.991   -6.555  8.045   1.00 20.91 ? 380 ILE A N   1 
ATOM   3069 C  CA  . ILE A 1 379 ? 5.320   -5.290  7.408   1.00 21.74 ? 380 ILE A CA  1 
ATOM   3070 C  C   . ILE A 1 379 ? 5.864   -5.512  6.008   1.00 20.75 ? 380 ILE A C   1 
ATOM   3071 O  O   . ILE A 1 379 ? 5.400   -4.890  5.059   1.00 20.03 ? 380 ILE A O   1 
ATOM   3072 C  CB  . ILE A 1 379 ? 6.356   -4.511  8.297   1.00 22.32 ? 380 ILE A CB  1 
ATOM   3073 C  CG1 . ILE A 1 379 ? 5.676   -4.027  9.575   1.00 24.38 ? 380 ILE A CG1 1 
ATOM   3074 C  CG2 . ILE A 1 379 ? 6.990   -3.349  7.558   1.00 24.18 ? 380 ILE A CG2 1 
ATOM   3075 C  CD1 . ILE A 1 379 ? 4.364   -3.287  9.347   1.00 22.98 ? 380 ILE A CD1 1 
ATOM   3076 N  N   . TYR A 1 380 ? 6.834   -6.421  5.897   1.00 20.11 ? 381 TYR A N   1 
ATOM   3077 C  CA  . TYR A 1 380 ? 7.435   -6.761  4.616   1.00 20.03 ? 381 TYR A CA  1 
ATOM   3078 C  C   . TYR A 1 380 ? 6.405   -7.299  3.622   1.00 19.83 ? 381 TYR A C   1 
ATOM   3079 O  O   . TYR A 1 380 ? 6.345   -6.851  2.480   1.00 19.56 ? 381 TYR A O   1 
ATOM   3080 C  CB  . TYR A 1 380 ? 8.569   -7.780  4.781   1.00 19.46 ? 381 TYR A CB  1 
ATOM   3081 C  CG  . TYR A 1 380 ? 9.158   -8.177  3.460   1.00 19.37 ? 381 TYR A CG  1 
ATOM   3082 C  CD1 . TYR A 1 380 ? 10.235  -7.475  2.923   1.00 19.06 ? 381 TYR A CD1 1 
ATOM   3083 C  CD2 . TYR A 1 380 ? 8.612   -9.238  2.714   1.00 20.74 ? 381 TYR A CD2 1 
ATOM   3084 C  CE1 . TYR A 1 380 ? 10.766  -7.809  1.692   1.00 19.66 ? 381 TYR A CE1 1 
ATOM   3085 C  CE2 . TYR A 1 380 ? 9.136   -9.581  1.468   1.00 21.24 ? 381 TYR A CE2 1 
ATOM   3086 C  CZ  . TYR A 1 380 ? 10.217  -8.858  0.966   1.00 20.90 ? 381 TYR A CZ  1 
ATOM   3087 O  OH  . TYR A 1 380 ? 10.760  -9.184  -0.253  1.00 21.38 ? 381 TYR A OH  1 
ATOM   3088 N  N   . ALA A 1 381 ? 5.628   -8.287  4.047   1.00 19.36 ? 382 ALA A N   1 
ATOM   3089 C  CA  . ALA A 1 381 ? 4.578   -8.869  3.191   1.00 19.81 ? 382 ALA A CA  1 
ATOM   3090 C  C   . ALA A 1 381 ? 3.550   -7.812  2.774   1.00 19.70 ? 382 ALA A C   1 
ATOM   3091 O  O   . ALA A 1 381 ? 3.136   -7.749  1.620   1.00 20.35 ? 382 ALA A O   1 
ATOM   3092 C  CB  . ALA A 1 381 ? 3.887   -10.041 3.914   1.00 19.40 ? 382 ALA A CB  1 
ATOM   3093 N  N   . LEU A 1 382 ? 3.139   -6.983  3.724   1.00 20.86 ? 383 LEU A N   1 
ATOM   3094 C  CA  . LEU A 1 382 ? 2.247   -5.875  3.423   1.00 21.04 ? 383 LEU A CA  1 
ATOM   3095 C  C   . LEU A 1 382 ? 2.782   -5.007  2.267   1.00 21.74 ? 383 LEU A C   1 
ATOM   3096 O  O   . LEU A 1 382 ? 2.074   -4.771  1.288   1.00 21.46 ? 383 LEU A O   1 
ATOM   3097 C  CB  . LEU A 1 382 ? 1.946   -5.072  4.681   1.00 20.84 ? 383 LEU A CB  1 
ATOM   3098 C  CG  . LEU A 1 382 ? 1.231   -3.708  4.554   1.00 22.59 ? 383 LEU A CG  1 
ATOM   3099 C  CD1 . LEU A 1 382 ? -0.006  -3.761  3.644   1.00 20.67 ? 383 LEU A CD1 1 
ATOM   3100 C  CD2 . LEU A 1 382 ? 0.855   -3.209  5.917   1.00 21.56 ? 383 LEU A CD2 1 
ATOM   3101 N  N   . GLY A 1 383 ? 4.046   -4.598  2.348   1.00 22.62 ? 384 GLY A N   1 
ATOM   3102 C  CA  . GLY A 1 383 ? 4.624   -3.698  1.358   1.00 22.92 ? 384 GLY A CA  1 
ATOM   3103 C  C   . GLY A 1 383 ? 4.670   -4.251  -0.057  1.00 23.31 ? 384 GLY A C   1 
ATOM   3104 O  O   . GLY A 1 383 ? 4.753   -3.485  -1.027  1.00 23.03 ? 384 GLY A O   1 
ATOM   3105 N  N   . ARG A 1 384 ? 4.628   -5.573  -0.190  1.00 23.33 ? 385 ARG A N   1 
ATOM   3106 C  CA  . ARG A 1 384 ? 4.719   -6.187  -1.514  1.00 23.99 ? 385 ARG A CA  1 
ATOM   3107 C  C   . ARG A 1 384 ? 3.345   -6.640  -2.023  1.00 24.41 ? 385 ARG A C   1 
ATOM   3108 O  O   . ARG A 1 384 ? 3.264   -7.214  -3.097  1.00 24.33 ? 385 ARG A O   1 
ATOM   3109 C  CB  . ARG A 1 384 ? 5.706   -7.386  -1.554  1.00 23.72 ? 385 ARG A CB  1 
ATOM   3110 C  CG  . ARG A 1 384 ? 7.128   -7.172  -0.990  1.00 23.49 ? 385 ARG A CG  1 
ATOM   3111 C  CD  . ARG A 1 384 ? 7.824   -6.072  -1.728  1.00 25.35 ? 385 ARG A CD  1 
ATOM   3112 N  NE  . ARG A 1 384 ? 9.157   -5.713  -1.227  1.00 25.30 ? 385 ARG A NE  1 
ATOM   3113 C  CZ  . ARG A 1 384 ? 10.283  -6.066  -1.835  1.00 26.83 ? 385 ARG A CZ  1 
ATOM   3114 N  NH1 . ARG A 1 384 ? 10.234  -6.823  -2.928  1.00 26.50 ? 385 ARG A NH1 1 
ATOM   3115 N  NH2 . ARG A 1 384 ? 11.456  -5.674  -1.357  1.00 26.36 ? 385 ARG A NH2 1 
ATOM   3116 N  N   . GLU A 1 385 ? 2.284   -6.384  -1.257  1.00 25.26 ? 386 GLU A N   1 
ATOM   3117 C  CA  . GLU A 1 385 ? 0.965   -6.964  -1.545  1.00 26.42 ? 386 GLU A CA  1 
ATOM   3118 C  C   . GLU A 1 385 ? 0.163   -6.049  -2.487  1.00 26.66 ? 386 GLU A C   1 
ATOM   3119 O  O   . GLU A 1 385 ? -0.168  -4.916  -2.111  1.00 25.72 ? 386 GLU A O   1 
ATOM   3120 C  CB  . GLU A 1 385 ? 0.178   -7.180  -0.254  1.00 26.19 ? 386 GLU A CB  1 
ATOM   3121 C  CG  . GLU A 1 385 ? -0.383  -8.588  -0.086  1.00 30.41 ? 386 GLU A CG  1 
ATOM   3122 C  CD  . GLU A 1 385 ? -1.248  -9.065  -1.252  1.00 34.20 ? 386 GLU A CD  1 
ATOM   3123 O  OE1 . GLU A 1 385 ? -1.024  -10.207 -1.706  1.00 36.02 ? 386 GLU A OE1 1 
ATOM   3124 O  OE2 . GLU A 1 385 ? -2.139  -8.307  -1.719  1.00 36.13 ? 386 GLU A OE2 1 
ATOM   3125 N  N   . PRO A 1 386 ? -0.142  -6.541  -3.709  1.00 27.23 ? 387 PRO A N   1 
ATOM   3126 C  CA  . PRO A 1 386 ? -0.825  -5.733  -4.738  1.00 27.75 ? 387 PRO A CA  1 
ATOM   3127 C  C   . PRO A 1 386 ? -2.260  -5.339  -4.415  1.00 28.31 ? 387 PRO A C   1 
ATOM   3128 O  O   . PRO A 1 386 ? -2.808  -4.462  -5.086  1.00 28.83 ? 387 PRO A O   1 
ATOM   3129 C  CB  . PRO A 1 386 ? -0.777  -6.615  -5.987  1.00 27.56 ? 387 PRO A CB  1 
ATOM   3130 C  CG  . PRO A 1 386 ? -0.526  -7.995  -5.490  1.00 28.37 ? 387 PRO A CG  1 
ATOM   3131 C  CD  . PRO A 1 386 ? 0.282   -7.852  -4.228  1.00 27.37 ? 387 PRO A CD  1 
ATOM   3132 N  N   . THR A 1 387 ? -2.869  -5.964  -3.410  1.00 28.51 ? 388 THR A N   1 
ATOM   3133 C  CA  . THR A 1 387 ? -4.197  -5.535  -2.989  1.00 29.10 ? 388 THR A CA  1 
ATOM   3134 C  C   . THR A 1 387 ? -4.129  -4.351  -2.062  1.00 29.19 ? 388 THR A C   1 
ATOM   3135 O  O   . THR A 1 387 ? -5.122  -3.668  -1.870  1.00 29.81 ? 388 THR A O   1 
ATOM   3136 C  CB  . THR A 1 387 ? -5.044  -6.660  -2.350  1.00 29.27 ? 388 THR A CB  1 
ATOM   3137 O  OG1 . THR A 1 387 ? -4.439  -7.119  -1.130  1.00 29.44 ? 388 THR A OG1 1 
ATOM   3138 C  CG2 . THR A 1 387 ? -5.200  -7.819  -3.330  1.00 29.32 ? 388 THR A CG2 1 
ATOM   3139 N  N   . PHE A 1 388 ? -2.958  -4.097  -1.486  1.00 29.34 ? 389 PHE A N   1 
ATOM   3140 C  CA  . PHE A 1 388 ? -2.813  -2.980  -0.562  1.00 29.46 ? 389 PHE A CA  1 
ATOM   3141 C  C   . PHE A 1 388 ? -2.003  -1.806  -1.130  1.00 29.42 ? 389 PHE A C   1 
ATOM   3142 O  O   . PHE A 1 388 ? -2.084  -0.697  -0.604  1.00 29.22 ? 389 PHE A O   1 
ATOM   3143 C  CB  . PHE A 1 388 ? -2.249  -3.443  0.786   1.00 29.57 ? 389 PHE A CB  1 
ATOM   3144 C  CG  . PHE A 1 388 ? -3.039  -4.558  1.426   1.00 31.04 ? 389 PHE A CG  1 
ATOM   3145 C  CD1 . PHE A 1 388 ? -2.419  -5.754  1.765   1.00 31.14 ? 389 PHE A CD1 1 
ATOM   3146 C  CD2 . PHE A 1 388 ? -4.409  -4.415  1.673   1.00 31.19 ? 389 PHE A CD2 1 
ATOM   3147 C  CE1 . PHE A 1 388 ? -3.142  -6.795  2.352   1.00 32.15 ? 389 PHE A CE1 1 
ATOM   3148 C  CE2 . PHE A 1 388 ? -5.140  -5.442  2.255   1.00 31.87 ? 389 PHE A CE2 1 
ATOM   3149 C  CZ  . PHE A 1 388 ? -4.503  -6.639  2.602   1.00 31.84 ? 389 PHE A CZ  1 
ATOM   3150 N  N   . PHE A 1 389 ? -1.225  -2.047  -2.180  1.00 29.86 ? 390 PHE A N   1 
ATOM   3151 C  CA  . PHE A 1 389 ? -0.515  -0.966  -2.873  1.00 30.77 ? 390 PHE A CA  1 
ATOM   3152 C  C   . PHE A 1 389 ? -0.602  -1.198  -4.377  1.00 31.81 ? 390 PHE A C   1 
ATOM   3153 O  O   . PHE A 1 389 ? -0.277  -2.284  -4.840  1.00 31.90 ? 390 PHE A O   1 
ATOM   3154 C  CB  . PHE A 1 389 ? 0.974   -0.883  -2.454  1.00 30.07 ? 390 PHE A CB  1 
ATOM   3155 C  CG  . PHE A 1 389 ? 1.200   -0.549  -0.993  1.00 28.39 ? 390 PHE A CG  1 
ATOM   3156 C  CD1 . PHE A 1 389 ? 1.441   -1.563  -0.061  1.00 27.35 ? 390 PHE A CD1 1 
ATOM   3157 C  CD2 . PHE A 1 389 ? 1.185   0.771   -0.555  1.00 25.67 ? 390 PHE A CD2 1 
ATOM   3158 C  CE1 . PHE A 1 389 ? 1.652   -1.271  1.291   1.00 24.74 ? 390 PHE A CE1 1 
ATOM   3159 C  CE2 . PHE A 1 389 ? 1.401   1.085   0.790   1.00 26.56 ? 390 PHE A CE2 1 
ATOM   3160 C  CZ  . PHE A 1 389 ? 1.636   0.054   1.719   1.00 26.13 ? 390 PHE A CZ  1 
ATOM   3161 N  N   . PHE A 1 390 ? -1.016  -0.177  -5.134  1.00 33.39 ? 391 PHE A N   1 
ATOM   3162 C  CA  . PHE A 1 390 ? -0.974  -0.219  -6.605  1.00 34.85 ? 391 PHE A CA  1 
ATOM   3163 C  C   . PHE A 1 390 ? 0.455   -0.426  -7.122  1.00 35.08 ? 391 PHE A C   1 
ATOM   3164 O  O   . PHE A 1 390 ? 1.359   0.310   -6.741  1.00 35.49 ? 391 PHE A O   1 
ATOM   3165 C  CB  . PHE A 1 390 ? -1.568  1.083   -7.204  1.00 35.99 ? 391 PHE A CB  1 
ATOM   3166 C  CG  . PHE A 1 390 ? -1.227  1.301   -8.672  1.00 39.00 ? 391 PHE A CG  1 
ATOM   3167 C  CD1 . PHE A 1 390 ? -2.050  0.793   -9.681  1.00 41.99 ? 391 PHE A CD1 1 
ATOM   3168 C  CD2 . PHE A 1 390 ? -0.084  2.016   -9.040  1.00 41.42 ? 391 PHE A CD2 1 
ATOM   3169 C  CE1 . PHE A 1 390 ? -1.739  0.977   -11.045 1.00 44.25 ? 391 PHE A CE1 1 
ATOM   3170 C  CE2 . PHE A 1 390 ? 0.247   2.208   -10.400 1.00 44.12 ? 391 PHE A CE2 1 
ATOM   3171 C  CZ  . PHE A 1 390 ? -0.584  1.687   -11.405 1.00 44.90 ? 391 PHE A CZ  1 
ATOM   3172 N  N   . ASP A 1 391 ? 0.636   -1.412  -8.003  1.00 35.63 ? 392 ASP A N   1 
ATOM   3173 C  CA  . ASP A 1 391 ? 1.937   -1.746  -8.617  1.00 36.65 ? 392 ASP A CA  1 
ATOM   3174 C  C   . ASP A 1 391 ? 3.069   -1.720  -7.563  1.00 36.51 ? 392 ASP A C   1 
ATOM   3175 O  O   . ASP A 1 391 ? 3.987   -0.893  -7.648  1.00 36.41 ? 392 ASP A O   1 
ATOM   3176 C  CB  . ASP A 1 391 ? 2.223   -0.815  -9.814  1.00 36.97 ? 392 ASP A CB  1 
ATOM   3177 C  CG  . ASP A 1 391 ? 3.450   -1.227  -10.626 1.00 39.48 ? 392 ASP A CG  1 
ATOM   3178 O  OD1 . ASP A 1 391 ? 3.796   -2.428  -10.680 1.00 42.57 ? 392 ASP A OD1 1 
ATOM   3179 O  OD2 . ASP A 1 391 ? 4.082   -0.331  -11.234 1.00 43.00 ? 392 ASP A OD2 1 
ATOM   3180 N  N   . PRO A 1 392 ? 2.988   -2.626  -6.558  1.00 36.31 ? 393 PRO A N   1 
ATOM   3181 C  CA  . PRO A 1 392 ? 3.882   -2.568  -5.389  1.00 36.04 ? 393 PRO A CA  1 
ATOM   3182 C  C   . PRO A 1 392 ? 5.383   -2.642  -5.701  1.00 35.46 ? 393 PRO A C   1 
ATOM   3183 O  O   . PRO A 1 392 ? 6.172   -2.059  -4.963  1.00 35.45 ? 393 PRO A O   1 
ATOM   3184 C  CB  . PRO A 1 392 ? 3.417   -3.749  -4.518  1.00 35.91 ? 393 PRO A CB  1 
ATOM   3185 C  CG  . PRO A 1 392 ? 2.696   -4.660  -5.451  1.00 36.22 ? 393 PRO A CG  1 
ATOM   3186 C  CD  . PRO A 1 392 ? 2.051   -3.766  -6.469  1.00 36.07 ? 393 PRO A CD  1 
ATOM   3187 N  N   . GLU A 1 393 ? 5.760   -3.306  -6.793  1.00 35.38 ? 394 GLU A N   1 
ATOM   3188 C  CA  . GLU A 1 393 ? 7.160   -3.350  -7.240  1.00 36.02 ? 394 GLU A CA  1 
ATOM   3189 C  C   . GLU A 1 393 ? 7.721   -2.004  -7.754  1.00 35.48 ? 394 GLU A C   1 
ATOM   3190 O  O   . GLU A 1 393 ? 8.937   -1.829  -7.830  1.00 35.20 ? 394 GLU A O   1 
ATOM   3191 C  CB  . GLU A 1 393 ? 7.379   -4.446  -8.298  1.00 36.68 ? 394 GLU A CB  1 
ATOM   3192 C  CG  . GLU A 1 393 ? 7.055   -5.878  -7.846  1.00 40.28 ? 394 GLU A CG  1 
ATOM   3193 C  CD  . GLU A 1 393 ? 7.967   -6.382  -6.720  1.00 45.62 ? 394 GLU A CD  1 
ATOM   3194 O  OE1 . GLU A 1 393 ? 9.179   -6.593  -6.972  1.00 47.96 ? 394 GLU A OE1 1 
ATOM   3195 O  OE2 . GLU A 1 393 ? 7.462   -6.586  -5.587  1.00 47.35 ? 394 GLU A OE2 1 
ATOM   3196 N  N   . ASN A 1 394 ? 6.846   -1.062  -8.097  1.00 34.64 ? 395 ASN A N   1 
ATOM   3197 C  CA  . ASN A 1 394 ? 7.293   0.245   -8.570  1.00 34.01 ? 395 ASN A CA  1 
ATOM   3198 C  C   . ASN A 1 394 ? 7.597   1.183   -7.410  1.00 32.65 ? 395 ASN A C   1 
ATOM   3199 O  O   . ASN A 1 394 ? 6.793   1.320   -6.480  1.00 32.82 ? 395 ASN A O   1 
ATOM   3200 C  CB  . ASN A 1 394 ? 6.247   0.878   -9.507  1.00 34.55 ? 395 ASN A CB  1 
ATOM   3201 C  CG  . ASN A 1 394 ? 6.768   2.141   -10.227 1.00 36.17 ? 395 ASN A CG  1 
ATOM   3202 O  OD1 . ASN A 1 394 ? 7.835   2.129   -10.863 1.00 37.09 ? 395 ASN A OD1 1 
ATOM   3203 N  ND2 . ASN A 1 394 ? 6.001   3.226   -10.138 1.00 36.18 ? 395 ASN A ND2 1 
ATOM   3204 N  N   . PHE A 1 395 ? 8.770   1.808   -7.470  1.00 31.04 ? 396 PHE A N   1 
ATOM   3205 C  CA  . PHE A 1 395 ? 9.181   2.835   -6.522  1.00 29.84 ? 396 PHE A CA  1 
ATOM   3206 C  C   . PHE A 1 395 ? 8.533   4.146   -6.956  1.00 29.83 ? 396 PHE A C   1 
ATOM   3207 O  O   . PHE A 1 395 ? 8.990   4.776   -7.908  1.00 29.30 ? 396 PHE A O   1 
ATOM   3208 C  CB  . PHE A 1 395 ? 10.718  2.944   -6.505  1.00 29.21 ? 396 PHE A CB  1 
ATOM   3209 C  CG  . PHE A 1 395 ? 11.268  3.948   -5.512  1.00 27.89 ? 396 PHE A CG  1 
ATOM   3210 C  CD1 . PHE A 1 395 ? 11.300  3.664   -4.152  1.00 25.11 ? 396 PHE A CD1 1 
ATOM   3211 C  CD2 . PHE A 1 395 ? 11.792  5.162   -5.951  1.00 27.58 ? 396 PHE A CD2 1 
ATOM   3212 C  CE1 . PHE A 1 395 ? 11.812  4.566   -3.247  1.00 25.14 ? 396 PHE A CE1 1 
ATOM   3213 C  CE2 . PHE A 1 395 ? 12.318  6.081   -5.043  1.00 27.17 ? 396 PHE A CE2 1 
ATOM   3214 C  CZ  . PHE A 1 395 ? 12.323  5.786   -3.687  1.00 26.51 ? 396 PHE A CZ  1 
ATOM   3215 N  N   . ASP A 1 396 ? 7.465   4.532   -6.256  1.00 30.17 ? 397 ASP A N   1 
ATOM   3216 C  CA  . ASP A 1 396 ? 6.672   5.731   -6.581  1.00 30.94 ? 397 ASP A CA  1 
ATOM   3217 C  C   . ASP A 1 396 ? 6.338   6.548   -5.329  1.00 30.23 ? 397 ASP A C   1 
ATOM   3218 O  O   . ASP A 1 396 ? 5.308   6.310   -4.688  1.00 29.86 ? 397 ASP A O   1 
ATOM   3219 C  CB  . ASP A 1 396 ? 5.372   5.353   -7.319  1.00 31.63 ? 397 ASP A CB  1 
ATOM   3220 C  CG  . ASP A 1 396 ? 4.433   6.566   -7.556  1.00 34.03 ? 397 ASP A CG  1 
ATOM   3221 O  OD1 . ASP A 1 396 ? 4.848   7.733   -7.343  1.00 36.94 ? 397 ASP A OD1 1 
ATOM   3222 O  OD2 . ASP A 1 396 ? 3.262   6.344   -7.946  1.00 36.13 ? 397 ASP A OD2 1 
ATOM   3223 N  N   . PRO A 1 397 ? 7.195   7.535   -4.996  1.00 29.88 ? 398 PRO A N   1 
ATOM   3224 C  CA  . PRO A 1 397 ? 6.990   8.380   -3.823  1.00 29.89 ? 398 PRO A CA  1 
ATOM   3225 C  C   . PRO A 1 397 ? 5.664   9.146   -3.795  1.00 29.72 ? 398 PRO A C   1 
ATOM   3226 O  O   . PRO A 1 397 ? 5.181   9.452   -2.714  1.00 29.52 ? 398 PRO A O   1 
ATOM   3227 C  CB  . PRO A 1 397 ? 8.165   9.366   -3.898  1.00 29.64 ? 398 PRO A CB  1 
ATOM   3228 C  CG  . PRO A 1 397 ? 9.205   8.632   -4.660  1.00 29.78 ? 398 PRO A CG  1 
ATOM   3229 C  CD  . PRO A 1 397 ? 8.448   7.879   -5.692  1.00 29.84 ? 398 PRO A CD  1 
ATOM   3230 N  N   . THR A 1 398 ? 5.091   9.465   -4.956  1.00 30.37 ? 399 THR A N   1 
ATOM   3231 C  CA  . THR A 1 398 ? 3.844   10.274  -5.002  1.00 31.33 ? 399 THR A CA  1 
ATOM   3232 C  C   . THR A 1 398 ? 2.627   9.565   -4.384  1.00 31.61 ? 399 THR A C   1 
ATOM   3233 O  O   . THR A 1 398 ? 1.671   10.229  -3.966  1.00 31.91 ? 399 THR A O   1 
ATOM   3234 C  CB  . THR A 1 398 ? 3.478   10.745  -6.442  1.00 31.25 ? 399 THR A CB  1 
ATOM   3235 O  OG1 . THR A 1 398 ? 3.092   9.616   -7.237  1.00 32.04 ? 399 THR A OG1 1 
ATOM   3236 C  CG2 . THR A 1 398 ? 4.668   11.462  -7.121  1.00 31.55 ? 399 THR A CG2 1 
ATOM   3237 N  N   . ARG A 1 399 ? 2.669   8.229   -4.306  1.00 31.74 ? 400 ARG A N   1 
ATOM   3238 C  CA  . ARG A 1 399 ? 1.588   7.464   -3.662  1.00 31.93 ? 400 ARG A CA  1 
ATOM   3239 C  C   . ARG A 1 399 ? 1.334   7.940   -2.231  1.00 32.31 ? 400 ARG A C   1 
ATOM   3240 O  O   . ARG A 1 399 ? 0.217   7.845   -1.737  1.00 32.97 ? 400 ARG A O   1 
ATOM   3241 C  CB  . ARG A 1 399 ? 1.823   5.937   -3.731  1.00 31.99 ? 400 ARG A CB  1 
ATOM   3242 C  CG  . ARG A 1 399 ? 2.825   5.371   -2.721  1.00 30.76 ? 400 ARG A CG  1 
ATOM   3243 C  CD  . ARG A 1 399 ? 2.853   3.820   -2.692  1.00 29.60 ? 400 ARG A CD  1 
ATOM   3244 N  NE  . ARG A 1 399 ? 3.582   3.207   -3.811  1.00 24.87 ? 400 ARG A NE  1 
ATOM   3245 C  CZ  . ARG A 1 399 ? 3.033   2.388   -4.709  1.00 26.79 ? 400 ARG A CZ  1 
ATOM   3246 N  NH1 . ARG A 1 399 ? 1.743   2.070   -4.645  1.00 28.56 ? 400 ARG A NH1 1 
ATOM   3247 N  NH2 . ARG A 1 399 ? 3.767   1.872   -5.672  1.00 26.28 ? 400 ARG A NH2 1 
ATOM   3248 N  N   . TRP A 1 400 ? 2.356   8.499   -1.589  1.00 32.45 ? 401 TRP A N   1 
ATOM   3249 C  CA  . TRP A 1 400 ? 2.241   8.997   -0.217  1.00 33.17 ? 401 TRP A CA  1 
ATOM   3250 C  C   . TRP A 1 400 ? 1.664   10.412  -0.130  1.00 34.78 ? 401 TRP A C   1 
ATOM   3251 O  O   . TRP A 1 400 ? 1.352   10.895  0.959   1.00 34.58 ? 401 TRP A O   1 
ATOM   3252 C  CB  . TRP A 1 400 ? 3.600   8.920   0.495   1.00 32.21 ? 401 TRP A CB  1 
ATOM   3253 C  CG  . TRP A 1 400 ? 4.084   7.504   0.576   1.00 29.95 ? 401 TRP A CG  1 
ATOM   3254 C  CD1 . TRP A 1 400 ? 4.972   6.889   -0.262  1.00 27.07 ? 401 TRP A CD1 1 
ATOM   3255 C  CD2 . TRP A 1 400 ? 3.640   6.506   1.500   1.00 26.47 ? 401 TRP A CD2 1 
ATOM   3256 N  NE1 . TRP A 1 400 ? 5.137   5.572   0.108   1.00 27.13 ? 401 TRP A NE1 1 
ATOM   3257 C  CE2 . TRP A 1 400 ? 4.333   5.313   1.190   1.00 27.27 ? 401 TRP A CE2 1 
ATOM   3258 C  CE3 . TRP A 1 400 ? 2.741   6.509   2.575   1.00 26.78 ? 401 TRP A CE3 1 
ATOM   3259 C  CZ2 . TRP A 1 400 ? 4.146   4.126   1.914   1.00 26.54 ? 401 TRP A CZ2 1 
ATOM   3260 C  CZ3 . TRP A 1 400 ? 2.558   5.321   3.302   1.00 26.55 ? 401 TRP A CZ3 1 
ATOM   3261 C  CH2 . TRP A 1 400 ? 3.260   4.153   2.965   1.00 24.48 ? 401 TRP A CH2 1 
ATOM   3262 N  N   . LEU A 1 401 ? 1.532   11.066  -1.277  1.00 37.15 ? 402 LEU A N   1 
ATOM   3263 C  CA  . LEU A 1 401 ? 0.958   12.407  -1.343  1.00 39.97 ? 402 LEU A CA  1 
ATOM   3264 C  C   . LEU A 1 401 ? -0.499  12.391  -1.835  1.00 42.11 ? 402 LEU A C   1 
ATOM   3265 O  O   . LEU A 1 401 ? -1.164  13.429  -1.851  1.00 42.80 ? 402 LEU A O   1 
ATOM   3266 C  CB  . LEU A 1 401 ? 1.818   13.311  -2.229  1.00 39.45 ? 402 LEU A CB  1 
ATOM   3267 C  CG  . LEU A 1 401 ? 3.273   13.540  -1.802  1.00 39.28 ? 402 LEU A CG  1 
ATOM   3268 C  CD1 . LEU A 1 401 ? 4.042   14.271  -2.898  1.00 37.39 ? 402 LEU A CD1 1 
ATOM   3269 C  CD2 . LEU A 1 401 ? 3.346   14.295  -0.476  1.00 39.10 ? 402 LEU A CD2 1 
ATOM   3270 N  N   . SER A 1 402 ? -0.979  11.214  -2.236  1.00 44.55 ? 403 SER A N   1 
ATOM   3271 C  CA  . SER A 1 402 ? -2.338  11.038  -2.750  1.00 47.03 ? 403 SER A CA  1 
ATOM   3272 C  C   . SER A 1 402 ? -3.354  11.720  -1.833  1.00 48.61 ? 403 SER A C   1 
ATOM   3273 O  O   . SER A 1 402 ? -3.350  11.501  -0.613  1.00 48.94 ? 403 SER A O   1 
ATOM   3274 C  CB  . SER A 1 402 ? -2.654  9.542   -2.889  1.00 47.01 ? 403 SER A CB  1 
ATOM   3275 O  OG  . SER A 1 402 ? -3.987  9.314   -3.321  1.00 47.17 ? 403 SER A OG  1 
ATOM   3276 N  N   . LYS A 1 403 ? -4.208  12.564  -2.411  1.00 50.76 ? 404 LYS A N   1 
ATOM   3277 C  CA  . LYS A 1 403 ? -5.245  13.249  -1.618  1.00 52.71 ? 404 LYS A CA  1 
ATOM   3278 C  C   . LYS A 1 403 ? -6.376  12.295  -1.208  1.00 53.57 ? 404 LYS A C   1 
ATOM   3279 O  O   . LYS A 1 403 ? -7.167  12.603  -0.309  1.00 54.20 ? 404 LYS A O   1 
ATOM   3280 C  CB  . LYS A 1 403 ? -5.779  14.499  -2.333  1.00 52.96 ? 404 LYS A CB  1 
ATOM   3281 C  CG  . LYS A 1 403 ? -6.217  15.611  -1.367  1.00 54.24 ? 404 LYS A CG  1 
ATOM   3282 C  CD  . LYS A 1 403 ? -6.230  16.983  -2.045  1.00 55.50 ? 404 LYS A CD  1 
ATOM   3283 C  CE  . LYS A 1 403 ? -6.165  18.124  -1.029  1.00 56.62 ? 404 LYS A CE  1 
ATOM   3284 N  NZ  . LYS A 1 403 ? -7.339  18.165  -0.106  1.00 57.36 ? 404 LYS A NZ  1 
ATOM   3285 N  N   . ASP A 1 404 ? -6.434  11.137  -1.869  1.00 54.34 ? 405 ASP A N   1 
ATOM   3286 C  CA  . ASP A 1 404 ? -7.224  9.996   -1.403  1.00 54.88 ? 405 ASP A CA  1 
ATOM   3287 C  C   . ASP A 1 404 ? -6.580  9.441   -0.124  1.00 55.11 ? 405 ASP A C   1 
ATOM   3288 O  O   . ASP A 1 404 ? -5.653  8.613   -0.174  1.00 55.13 ? 405 ASP A O   1 
ATOM   3289 C  CB  . ASP A 1 404 ? -7.301  8.917   -2.500  1.00 54.97 ? 405 ASP A CB  1 
ATOM   3290 C  CG  . ASP A 1 404 ? -8.230  7.757   -2.142  1.00 55.88 ? 405 ASP A CG  1 
ATOM   3291 O  OD1 . ASP A 1 404 ? -8.801  7.735   -1.025  1.00 56.93 ? 405 ASP A OD1 1 
ATOM   3292 O  OD2 . ASP A 1 404 ? -8.392  6.854   -2.997  1.00 56.11 ? 405 ASP A OD2 1 
ATOM   3293 N  N   . LYS A 1 405 ? -7.076  9.905   1.022   1.00 55.10 ? 406 LYS A N   1 
ATOM   3294 C  CA  . LYS A 1 405 ? -6.537  9.486   2.315   1.00 54.98 ? 406 LYS A CA  1 
ATOM   3295 C  C   . LYS A 1 405 ? -7.197  8.196   2.823   1.00 54.55 ? 406 LYS A C   1 
ATOM   3296 O  O   . LYS A 1 405 ? -7.639  8.100   3.971   1.00 54.45 ? 406 LYS A O   1 
ATOM   3297 C  CB  . LYS A 1 405 ? -6.581  10.631  3.341   1.00 55.23 ? 406 LYS A CB  1 
ATOM   3298 C  CG  . LYS A 1 405 ? -5.794  11.880  2.895   1.00 56.02 ? 406 LYS A CG  1 
ATOM   3299 C  CD  . LYS A 1 405 ? -5.024  12.534  4.036   1.00 56.34 ? 406 LYS A CD  1 
ATOM   3300 C  CE  . LYS A 1 405 ? -5.903  13.449  4.872   1.00 57.26 ? 406 LYS A CE  1 
ATOM   3301 N  NZ  . LYS A 1 405 ? -5.104  14.151  5.926   1.00 57.72 ? 406 LYS A NZ  1 
ATOM   3302 N  N   . ASN A 1 406 ? -7.263  7.219   1.921   1.00 53.84 ? 407 ASN A N   1 
ATOM   3303 C  CA  . ASN A 1 406 ? -7.552  5.827   2.237   1.00 53.22 ? 407 ASN A CA  1 
ATOM   3304 C  C   . ASN A 1 406 ? -6.523  4.950   1.522   1.00 51.92 ? 407 ASN A C   1 
ATOM   3305 O  O   . ASN A 1 406 ? -6.457  3.741   1.735   1.00 52.36 ? 407 ASN A O   1 
ATOM   3306 C  CB  . ASN A 1 406 ? -8.974  5.449   1.808   1.00 53.78 ? 407 ASN A CB  1 
ATOM   3307 C  CG  . ASN A 1 406 ? -9.334  4.008   2.167   1.00 55.79 ? 407 ASN A CG  1 
ATOM   3308 O  OD1 . ASN A 1 406 ? -9.396  3.641   3.350   1.00 58.28 ? 407 ASN A OD1 1 
ATOM   3309 N  ND2 . ASN A 1 406 ? -9.566  3.180   1.143   1.00 56.44 ? 407 ASN A ND2 1 
ATOM   3310 N  N   . ILE A 1 407 ? -5.723  5.577   0.665   1.00 50.14 ? 408 ILE A N   1 
ATOM   3311 C  CA  . ILE A 1 407 ? -4.626  4.902   -0.020  1.00 48.15 ? 408 ILE A CA  1 
ATOM   3312 C  C   . ILE A 1 407 ? -3.394  4.721   0.889   1.00 46.52 ? 408 ILE A C   1 
ATOM   3313 O  O   . ILE A 1 407 ? -2.547  3.864   0.627   1.00 46.20 ? 408 ILE A O   1 
ATOM   3314 C  CB  . ILE A 1 407 ? -4.284  5.616   -1.366  1.00 48.38 ? 408 ILE A CB  1 
ATOM   3315 C  CG1 . ILE A 1 407 ? -4.933  4.856   -2.530  1.00 48.66 ? 408 ILE A CG1 1 
ATOM   3316 C  CG2 . ILE A 1 407 ? -2.765  5.776   -1.574  1.00 48.51 ? 408 ILE A CG2 1 
ATOM   3317 C  CD1 . ILE A 1 407 ? -4.433  5.241   -3.910  1.00 49.12 ? 408 ILE A CD1 1 
ATOM   3318 N  N   . THR A 1 408 ? -3.322  5.512   1.961   1.00 44.49 ? 409 THR A N   1 
ATOM   3319 C  CA  . THR A 1 408 ? -2.180  5.491   2.887   1.00 42.28 ? 409 THR A CA  1 
ATOM   3320 C  C   . THR A 1 408 ? -2.577  5.138   4.331   1.00 40.91 ? 409 THR A C   1 
ATOM   3321 O  O   . THR A 1 408 ? -1.735  5.158   5.240   1.00 40.86 ? 409 THR A O   1 
ATOM   3322 C  CB  . THR A 1 408 ? -1.442  6.841   2.913   1.00 42.53 ? 409 THR A CB  1 
ATOM   3323 O  OG1 . THR A 1 408 ? -2.290  7.835   3.505   1.00 41.82 ? 409 THR A OG1 1 
ATOM   3324 C  CG2 . THR A 1 408 ? -1.025  7.270   1.504   1.00 41.93 ? 409 THR A CG2 1 
ATOM   3325 N  N   . TYR A 1 409 ? -3.855  4.826   4.538   1.00 38.55 ? 410 TYR A N   1 
ATOM   3326 C  CA  . TYR A 1 409 ? -4.360  4.410   5.845   1.00 36.43 ? 410 TYR A CA  1 
ATOM   3327 C  C   . TYR A 1 409 ? -3.573  3.215   6.424   1.00 34.74 ? 410 TYR A C   1 
ATOM   3328 O  O   . TYR A 1 409 ? -3.442  2.179   5.770   1.00 33.36 ? 410 TYR A O   1 
ATOM   3329 C  CB  . TYR A 1 409 ? -5.840  4.051   5.726   1.00 36.90 ? 410 TYR A CB  1 
ATOM   3330 C  CG  . TYR A 1 409 ? -6.503  3.815   7.047   1.00 37.47 ? 410 TYR A CG  1 
ATOM   3331 C  CD1 . TYR A 1 409 ? -6.621  4.847   7.974   1.00 38.74 ? 410 TYR A CD1 1 
ATOM   3332 C  CD2 . TYR A 1 409 ? -7.010  2.561   7.381   1.00 38.01 ? 410 TYR A CD2 1 
ATOM   3333 C  CE1 . TYR A 1 409 ? -7.238  4.639   9.208   1.00 39.95 ? 410 TYR A CE1 1 
ATOM   3334 C  CE2 . TYR A 1 409 ? -7.635  2.347   8.614   1.00 37.94 ? 410 TYR A CE2 1 
ATOM   3335 C  CZ  . TYR A 1 409 ? -7.741  3.388   9.514   1.00 38.24 ? 410 TYR A CZ  1 
ATOM   3336 O  OH  . TYR A 1 409 ? -8.343  3.203   10.731  1.00 40.20 ? 410 TYR A OH  1 
ATOM   3337 N  N   . PHE A 1 410 ? -3.070  3.386   7.648   1.00 33.15 ? 411 PHE A N   1 
ATOM   3338 C  CA  . PHE A 1 410 ? -2.164  2.426   8.316   1.00 32.25 ? 411 PHE A CA  1 
ATOM   3339 C  C   . PHE A 1 410 ? -1.159  1.719   7.379   1.00 31.52 ? 411 PHE A C   1 
ATOM   3340 O  O   . PHE A 1 410 ? -1.010  0.496   7.427   1.00 30.47 ? 411 PHE A O   1 
ATOM   3341 C  CB  . PHE A 1 410 ? -2.957  1.435   9.198   1.00 31.84 ? 411 PHE A CB  1 
ATOM   3342 C  CG  . PHE A 1 410 ? -3.306  1.989   10.556  1.00 31.69 ? 411 PHE A CG  1 
ATOM   3343 C  CD1 . PHE A 1 410 ? -4.388  2.851   10.715  1.00 30.80 ? 411 PHE A CD1 1 
ATOM   3344 C  CD2 . PHE A 1 410 ? -2.536  1.676   11.669  1.00 30.63 ? 411 PHE A CD2 1 
ATOM   3345 C  CE1 . PHE A 1 410 ? -4.699  3.385   11.957  1.00 30.57 ? 411 PHE A CE1 1 
ATOM   3346 C  CE2 . PHE A 1 410 ? -2.835  2.212   12.920  1.00 30.39 ? 411 PHE A CE2 1 
ATOM   3347 C  CZ  . PHE A 1 410 ? -3.926  3.063   13.064  1.00 31.28 ? 411 PHE A CZ  1 
ATOM   3348 N  N   . ARG A 1 411 ? -0.493  2.511   6.530   1.00 31.17 ? 412 ARG A N   1 
ATOM   3349 C  CA  . ARG A 1 411 ? 0.500   2.000   5.561   1.00 31.44 ? 412 ARG A CA  1 
ATOM   3350 C  C   . ARG A 1 411 ? 1.931   2.359   5.944   1.00 30.87 ? 412 ARG A C   1 
ATOM   3351 O  O   . ARG A 1 411 ? 2.862   1.680   5.540   1.00 31.09 ? 412 ARG A O   1 
ATOM   3352 C  CB  . ARG A 1 411 ? 0.278   2.552   4.142   1.00 31.38 ? 412 ARG A CB  1 
ATOM   3353 C  CG  . ARG A 1 411 ? -1.073  2.304   3.476   1.00 32.70 ? 412 ARG A CG  1 
ATOM   3354 C  CD  . ARG A 1 411 ? -1.443  0.863   3.454   1.00 31.62 ? 412 ARG A CD  1 
ATOM   3355 N  NE  . ARG A 1 411 ? -2.420  0.524   2.417   1.00 29.55 ? 412 ARG A NE  1 
ATOM   3356 C  CZ  . ARG A 1 411 ? -3.740  0.582   2.568   1.00 28.03 ? 412 ARG A CZ  1 
ATOM   3357 N  NH1 . ARG A 1 411 ? -4.278  1.020   3.697   1.00 27.04 ? 412 ARG A NH1 1 
ATOM   3358 N  NH2 . ARG A 1 411 ? -4.520  0.191   1.579   1.00 28.71 ? 412 ARG A NH2 1 
ATOM   3359 N  N   . ASN A 1 412 ? 2.099   3.455   6.680   1.00 30.35 ? 413 ASN A N   1 
ATOM   3360 C  CA  . ASN A 1 412 ? 3.425   3.969   7.023   1.00 29.45 ? 413 ASN A CA  1 
ATOM   3361 C  C   . ASN A 1 412 ? 3.878   3.385   8.353   1.00 28.68 ? 413 ASN A C   1 
ATOM   3362 O  O   . ASN A 1 412 ? 3.842   4.047   9.391   1.00 29.05 ? 413 ASN A O   1 
ATOM   3363 C  CB  . ASN A 1 412 ? 3.400   5.505   7.064   1.00 29.85 ? 413 ASN A CB  1 
ATOM   3364 C  CG  . ASN A 1 412 ? 4.786   6.123   7.215   1.00 30.47 ? 413 ASN A CG  1 
ATOM   3365 O  OD1 . ASN A 1 412 ? 5.795   5.568   6.777   1.00 31.92 ? 413 ASN A OD1 1 
ATOM   3366 N  ND2 . ASN A 1 412 ? 4.831   7.284   7.839   1.00 32.62 ? 413 ASN A ND2 1 
ATOM   3367 N  N   . LEU A 1 413 ? 4.321   2.138   8.313   1.00 27.49 ? 414 LEU A N   1 
ATOM   3368 C  CA  . LEU A 1 413 ? 4.498   1.360   9.531   1.00 26.46 ? 414 LEU A CA  1 
ATOM   3369 C  C   . LEU A 1 413 ? 5.957   1.015   9.840   1.00 26.07 ? 414 LEU A C   1 
ATOM   3370 O  O   . LEU A 1 413 ? 6.240   0.320   10.822  1.00 25.50 ? 414 LEU A O   1 
ATOM   3371 C  CB  . LEU A 1 413 ? 3.652   0.089   9.451   1.00 26.10 ? 414 LEU A CB  1 
ATOM   3372 C  CG  . LEU A 1 413 ? 2.123   0.223   9.370   1.00 26.25 ? 414 LEU A CG  1 
ATOM   3373 C  CD1 . LEU A 1 413 ? 1.467   -1.144  9.078   1.00 26.32 ? 414 LEU A CD1 1 
ATOM   3374 C  CD2 . LEU A 1 413 ? 1.572   0.810   10.644  1.00 23.91 ? 414 LEU A CD2 1 
ATOM   3375 N  N   . GLY A 1 414 ? 6.871   1.518   9.012   1.00 25.21 ? 415 GLY A N   1 
ATOM   3376 C  CA  . GLY A 1 414 ? 8.307   1.236   9.144   1.00 25.00 ? 415 GLY A CA  1 
ATOM   3377 C  C   . GLY A 1 414 ? 8.941   1.487   10.505  1.00 24.82 ? 415 GLY A C   1 
ATOM   3378 O  O   . GLY A 1 414 ? 9.850   0.749   10.907  1.00 24.56 ? 415 GLY A O   1 
ATOM   3379 N  N   . PHE A 1 415 ? 8.469   2.517   11.214  1.00 24.15 ? 416 PHE A N   1 
ATOM   3380 C  CA  . PHE A 1 415 ? 8.986   2.845   12.546  1.00 23.75 ? 416 PHE A CA  1 
ATOM   3381 C  C   . PHE A 1 415 ? 8.034   2.424   13.665  1.00 24.38 ? 416 PHE A C   1 
ATOM   3382 O  O   . PHE A 1 415 ? 8.184   2.852   14.820  1.00 24.45 ? 416 PHE A O   1 
ATOM   3383 C  CB  . PHE A 1 415 ? 9.251   4.340   12.673  1.00 23.85 ? 416 PHE A CB  1 
ATOM   3384 C  CG  . PHE A 1 415 ? 10.328  4.866   11.761  1.00 21.91 ? 416 PHE A CG  1 
ATOM   3385 C  CD1 . PHE A 1 415 ? 9.991   5.532   10.584  1.00 21.26 ? 416 PHE A CD1 1 
ATOM   3386 C  CD2 . PHE A 1 415 ? 11.662  4.738   12.102  1.00 20.51 ? 416 PHE A CD2 1 
ATOM   3387 C  CE1 . PHE A 1 415 ? 10.968  6.045   9.752   1.00 22.48 ? 416 PHE A CE1 1 
ATOM   3388 C  CE2 . PHE A 1 415 ? 12.679  5.256   11.275  1.00 20.67 ? 416 PHE A CE2 1 
ATOM   3389 C  CZ  . PHE A 1 415 ? 12.337  5.913   10.102  1.00 22.54 ? 416 PHE A CZ  1 
ATOM   3390 N  N   . GLY A 1 416 ? 7.060   1.587   13.332  1.00 24.33 ? 417 GLY A N   1 
ATOM   3391 C  CA  . GLY A 1 416 ? 6.072   1.172   14.309  1.00 25.61 ? 417 GLY A CA  1 
ATOM   3392 C  C   . GLY A 1 416 ? 5.017   2.232   14.573  1.00 26.26 ? 417 GLY A C   1 
ATOM   3393 O  O   . GLY A 1 416 ? 4.728   3.068   13.712  1.00 26.23 ? 417 GLY A O   1 
ATOM   3394 N  N   . TRP A 1 417 ? 4.452   2.216   15.772  1.00 26.83 ? 418 TRP A N   1 
ATOM   3395 C  CA  . TRP A 1 417 ? 3.273   3.040   16.059  1.00 28.01 ? 418 TRP A CA  1 
ATOM   3396 C  C   . TRP A 1 417 ? 3.148   3.319   17.554  1.00 27.14 ? 418 TRP A C   1 
ATOM   3397 O  O   . TRP A 1 417 ? 3.544   2.488   18.387  1.00 26.75 ? 418 TRP A O   1 
ATOM   3398 C  CB  . TRP A 1 417 ? 2.012   2.317   15.545  1.00 29.17 ? 418 TRP A CB  1 
ATOM   3399 C  CG  . TRP A 1 417 ? 0.724   3.099   15.644  1.00 34.39 ? 418 TRP A CG  1 
ATOM   3400 C  CD1 . TRP A 1 417 ? 0.181   3.917   14.681  1.00 37.26 ? 418 TRP A CD1 1 
ATOM   3401 C  CD2 . TRP A 1 417 ? -0.190  3.139   16.759  1.00 37.62 ? 418 TRP A CD2 1 
ATOM   3402 N  NE1 . TRP A 1 417 ? -0.997  4.469   15.134  1.00 38.06 ? 418 TRP A NE1 1 
ATOM   3403 C  CE2 . TRP A 1 417 ? -1.255  4.004   16.397  1.00 38.33 ? 418 TRP A CE2 1 
ATOM   3404 C  CE3 . TRP A 1 417 ? -0.213  2.529   18.023  1.00 40.55 ? 418 TRP A CE3 1 
ATOM   3405 C  CZ2 . TRP A 1 417 ? -2.336  4.274   17.256  1.00 39.33 ? 418 TRP A CZ2 1 
ATOM   3406 C  CZ3 . TRP A 1 417 ? -1.298  2.802   18.884  1.00 40.07 ? 418 TRP A CZ3 1 
ATOM   3407 C  CH2 . TRP A 1 417 ? -2.337  3.670   18.490  1.00 39.90 ? 418 TRP A CH2 1 
ATOM   3408 N  N   . GLY A 1 418 ? 2.618   4.499   17.880  1.00 26.46 ? 419 GLY A N   1 
ATOM   3409 C  CA  . GLY A 1 418 ? 2.176   4.813   19.230  1.00 25.44 ? 419 GLY A CA  1 
ATOM   3410 C  C   . GLY A 1 418 ? 3.316   5.141   20.154  1.00 25.66 ? 419 GLY A C   1 
ATOM   3411 O  O   . GLY A 1 418 ? 4.399   5.531   19.699  1.00 24.62 ? 419 GLY A O   1 
ATOM   3412 N  N   . VAL A 1 419 ? 3.069   4.982   21.458  1.00 25.06 ? 420 VAL A N   1 
ATOM   3413 C  CA  . VAL A 1 419 ? 4.025   5.374   22.496  1.00 25.03 ? 420 VAL A CA  1 
ATOM   3414 C  C   . VAL A 1 419 ? 5.319   4.575   22.490  1.00 24.46 ? 420 VAL A C   1 
ATOM   3415 O  O   . VAL A 1 419 ? 6.334   5.059   22.983  1.00 24.01 ? 420 VAL A O   1 
ATOM   3416 C  CB  . VAL A 1 419 ? 3.413   5.320   23.929  1.00 25.58 ? 420 VAL A CB  1 
ATOM   3417 C  CG1 . VAL A 1 419 ? 2.295   6.321   24.044  1.00 27.23 ? 420 VAL A CG1 1 
ATOM   3418 C  CG2 . VAL A 1 419 ? 2.913   3.900   24.270  1.00 25.38 ? 420 VAL A CG2 1 
ATOM   3419 N  N   . ARG A 1 420 ? 5.278   3.354   21.946  1.00 24.12 ? 421 ARG A N   1 
ATOM   3420 C  CA  . ARG A 1 420 ? 6.476   2.512   21.889  1.00 23.23 ? 421 ARG A CA  1 
ATOM   3421 C  C   . ARG A 1 420 ? 7.008   2.333   20.447  1.00 23.11 ? 421 ARG A C   1 
ATOM   3422 O  O   . ARG A 1 420 ? 7.703   1.370   20.141  1.00 22.81 ? 421 ARG A O   1 
ATOM   3423 C  CB  . ARG A 1 420 ? 6.250   1.161   22.604  1.00 23.23 ? 421 ARG A CB  1 
ATOM   3424 C  CG  . ARG A 1 420 ? 7.561   0.454   22.964  1.00 22.79 ? 421 ARG A CG  1 
ATOM   3425 C  CD  . ARG A 1 420 ? 7.447   -0.617  24.039  1.00 21.09 ? 421 ARG A CD  1 
ATOM   3426 N  NE  . ARG A 1 420 ? 8.781   -1.081  24.432  1.00 20.46 ? 421 ARG A NE  1 
ATOM   3427 C  CZ  . ARG A 1 420 ? 9.031   -1.982  25.380  1.00 22.81 ? 421 ARG A CZ  1 
ATOM   3428 N  NH1 . ARG A 1 420 ? 8.036   -2.550  26.075  1.00 21.87 ? 421 ARG A NH1 1 
ATOM   3429 N  NH2 . ARG A 1 420 ? 10.284  -2.315  25.635  1.00 22.51 ? 421 ARG A NH2 1 
ATOM   3430 N  N   . GLN A 1 421 ? 6.687   3.279   19.573  1.00 22.38 ? 422 GLN A N   1 
ATOM   3431 C  CA  . GLN A 1 421 ? 7.267   3.315   18.235  1.00 22.51 ? 422 GLN A CA  1 
ATOM   3432 C  C   . GLN A 1 421 ? 8.781   3.512   18.326  1.00 21.97 ? 422 GLN A C   1 
ATOM   3433 O  O   . GLN A 1 421 ? 9.316   3.758   19.411  1.00 22.59 ? 422 GLN A O   1 
ATOM   3434 C  CB  . GLN A 1 421 ? 6.639   4.453   17.433  1.00 22.82 ? 422 GLN A CB  1 
ATOM   3435 C  CG  . GLN A 1 421 ? 7.024   5.823   17.965  1.00 24.81 ? 422 GLN A CG  1 
ATOM   3436 C  CD  . GLN A 1 421 ? 6.337   6.945   17.230  1.00 29.35 ? 422 GLN A CD  1 
ATOM   3437 O  OE1 . GLN A 1 421 ? 5.350   7.494   17.720  1.00 32.14 ? 422 GLN A OE1 1 
ATOM   3438 N  NE2 . GLN A 1 421 ? 6.833   7.280   16.041  1.00 26.75 ? 422 GLN A NE2 1 
ATOM   3439 N  N   . CYS A 1 422 ? 9.477   3.410   17.199  1.00 21.76 ? 423 CYS A N   1 
ATOM   3440 C  CA  . CYS A 1 422 ? 10.931  3.573   17.188  1.00 21.12 ? 423 CYS A CA  1 
ATOM   3441 C  C   . CYS A 1 422 ? 11.365  4.788   18.020  1.00 21.81 ? 423 CYS A C   1 
ATOM   3442 O  O   . CYS A 1 422 ? 10.892  5.902   17.787  1.00 21.26 ? 423 CYS A O   1 
ATOM   3443 C  CB  . CYS A 1 422 ? 11.427  3.746   15.751  1.00 20.82 ? 423 CYS A CB  1 
ATOM   3444 S  SG  . CYS A 1 422 ? 13.195  4.145   15.678  1.00 21.04 ? 423 CYS A SG  1 
ATOM   3445 N  N   . LEU A 1 423 ? 12.265  4.583   18.980  1.00 22.33 ? 424 LEU A N   1 
ATOM   3446 C  CA  . LEU A 1 423 ? 12.774  5.711   19.783  1.00 22.43 ? 424 LEU A CA  1 
ATOM   3447 C  C   . LEU A 1 423 ? 13.668  6.624   18.945  1.00 22.19 ? 424 LEU A C   1 
ATOM   3448 O  O   . LEU A 1 423 ? 13.727  7.833   19.189  1.00 22.65 ? 424 LEU A O   1 
ATOM   3449 C  CB  . LEU A 1 423 ? 13.544  5.224   21.018  1.00 22.24 ? 424 LEU A CB  1 
ATOM   3450 C  CG  . LEU A 1 423 ? 14.194  6.310   21.900  1.00 23.90 ? 424 LEU A CG  1 
ATOM   3451 C  CD1 . LEU A 1 423 ? 13.131  7.244   22.525  1.00 24.13 ? 424 LEU A CD1 1 
ATOM   3452 C  CD2 . LEU A 1 423 ? 15.111  5.722   22.975  1.00 25.53 ? 424 LEU A CD2 1 
ATOM   3453 N  N   . GLY A 1 424 ? 14.379  6.049   17.976  1.00 21.76 ? 425 GLY A N   1 
ATOM   3454 C  CA  . GLY A 1 424 ? 15.291  6.830   17.133  1.00 20.86 ? 425 GLY A CA  1 
ATOM   3455 C  C   . GLY A 1 424 ? 14.661  7.427   15.884  1.00 20.56 ? 425 GLY A C   1 
ATOM   3456 O  O   . GLY A 1 424 ? 15.367  7.917   15.017  1.00 19.99 ? 425 GLY A O   1 
ATOM   3457 N  N   . ARG A 1 425 ? 13.336  7.396   15.797  1.00 20.49 ? 426 ARG A N   1 
ATOM   3458 C  CA  . ARG A 1 425 ? 12.633  7.793   14.581  1.00 21.46 ? 426 ARG A CA  1 
ATOM   3459 C  C   . ARG A 1 425 ? 12.987  9.197   14.054  1.00 21.86 ? 426 ARG A C   1 
ATOM   3460 O  O   . ARG A 1 425 ? 13.193  9.362   12.854  1.00 22.30 ? 426 ARG A O   1 
ATOM   3461 C  CB  . ARG A 1 425 ? 11.107  7.663   14.752  1.00 21.79 ? 426 ARG A CB  1 
ATOM   3462 C  CG  . ARG A 1 425 ? 10.339  7.921   13.442  1.00 21.94 ? 426 ARG A CG  1 
ATOM   3463 C  CD  . ARG A 1 425 ? 8.829   8.008   13.630  1.00 23.90 ? 426 ARG A CD  1 
ATOM   3464 N  NE  . ARG A 1 425 ? 8.166   7.981   12.328  1.00 26.05 ? 426 ARG A NE  1 
ATOM   3465 C  CZ  . ARG A 1 425 ? 6.931   7.546   12.116  1.00 29.18 ? 426 ARG A CZ  1 
ATOM   3466 N  NH1 . ARG A 1 425 ? 6.195   7.087   13.116  1.00 31.30 ? 426 ARG A NH1 1 
ATOM   3467 N  NH2 . ARG A 1 425 ? 6.432   7.549   10.890  1.00 31.76 ? 426 ARG A NH2 1 
ATOM   3468 N  N   . ARG A 1 426 ? 13.046  10.189  14.943  1.00 21.91 ? 427 ARG A N   1 
ATOM   3469 C  CA  . ARG A 1 426 ? 13.311  11.573  14.540  1.00 22.69 ? 427 ARG A CA  1 
ATOM   3470 C  C   . ARG A 1 426 ? 14.755  11.727  14.121  1.00 22.10 ? 427 ARG A C   1 
ATOM   3471 O  O   . ARG A 1 426 ? 15.034  12.353  13.110  1.00 22.00 ? 427 ARG A O   1 
ATOM   3472 C  CB  . ARG A 1 426 ? 12.990  12.565  15.665  1.00 23.23 ? 427 ARG A CB  1 
ATOM   3473 C  CG  . ARG A 1 426 ? 11.637  12.356  16.319  1.00 25.28 ? 427 ARG A CG  1 
ATOM   3474 C  CD  . ARG A 1 426 ? 10.564  13.099  15.578  1.00 31.67 ? 427 ARG A CD  1 
ATOM   3475 N  NE  . ARG A 1 426 ? 9.981   12.377  14.456  1.00 33.99 ? 427 ARG A NE  1 
ATOM   3476 C  CZ  . ARG A 1 426 ? 8.707   11.997  14.393  1.00 35.32 ? 427 ARG A CZ  1 
ATOM   3477 N  NH1 . ARG A 1 426 ? 7.888   12.249  15.404  1.00 36.64 ? 427 ARG A NH1 1 
ATOM   3478 N  NH2 . ARG A 1 426 ? 8.250   11.363  13.315  1.00 34.74 ? 427 ARG A NH2 1 
ATOM   3479 N  N   . ILE A 1 427 ? 15.662  11.140  14.902  1.00 21.63 ? 428 ILE A N   1 
ATOM   3480 C  CA  . ILE A 1 427 ? 17.083  11.112  14.566  1.00 21.56 ? 428 ILE A CA  1 
ATOM   3481 C  C   . ILE A 1 427 ? 17.269  10.483  13.187  1.00 21.44 ? 428 ILE A C   1 
ATOM   3482 O  O   . ILE A 1 427 ? 17.937  11.057  12.316  1.00 20.91 ? 428 ILE A O   1 
ATOM   3483 C  CB  . ILE A 1 427 ? 17.901  10.334  15.632  1.00 20.97 ? 428 ILE A CB  1 
ATOM   3484 C  CG1 . ILE A 1 427 ? 17.940  11.136  16.941  1.00 22.64 ? 428 ILE A CG1 1 
ATOM   3485 C  CG2 . ILE A 1 427 ? 19.309  10.044  15.123  1.00 21.83 ? 428 ILE A CG2 1 
ATOM   3486 C  CD1 . ILE A 1 427 ? 18.502  10.378  18.142  1.00 20.90 ? 428 ILE A CD1 1 
ATOM   3487 N  N   . ALA A 1 428 ? 16.642  9.322   12.991  1.00 21.21 ? 429 ALA A N   1 
ATOM   3488 C  CA  . ALA A 1 428 ? 16.729  8.591   11.724  1.00 21.94 ? 429 ALA A CA  1 
ATOM   3489 C  C   . ALA A 1 428 ? 16.118  9.347   10.553  1.00 22.01 ? 429 ALA A C   1 
ATOM   3490 O  O   . ALA A 1 428 ? 16.708  9.393   9.484   1.00 22.69 ? 429 ALA A O   1 
ATOM   3491 C  CB  . ALA A 1 428 ? 16.080  7.204   11.846  1.00 21.38 ? 429 ALA A CB  1 
ATOM   3492 N  N   . GLU A 1 429 ? 14.935  9.922   10.747  1.00 22.23 ? 430 GLU A N   1 
ATOM   3493 C  CA  . GLU A 1 429 ? 14.273  10.661  9.679   1.00 22.89 ? 430 GLU A CA  1 
ATOM   3494 C  C   . GLU A 1 429 ? 15.099  11.882  9.280   1.00 22.58 ? 430 GLU A C   1 
ATOM   3495 O  O   . GLU A 1 429 ? 15.289  12.134  8.092   1.00 21.94 ? 430 GLU A O   1 
ATOM   3496 C  CB  . GLU A 1 429 ? 12.851  11.079  10.081  1.00 23.12 ? 430 GLU A CB  1 
ATOM   3497 C  CG  . GLU A 1 429 ? 11.837  9.933   10.017  1.00 26.29 ? 430 GLU A CG  1 
ATOM   3498 C  CD  . GLU A 1 429 ? 10.486  10.275  10.656  1.00 29.67 ? 430 GLU A CD  1 
ATOM   3499 O  OE1 . GLU A 1 429 ? 10.394  11.225  11.478  1.00 30.94 ? 430 GLU A OE1 1 
ATOM   3500 O  OE2 . GLU A 1 429 ? 9.512   9.565   10.337  1.00 31.40 ? 430 GLU A OE2 1 
ATOM   3501 N  N   . LEU A 1 430 ? 15.597  12.615  10.277  1.00 22.22 ? 431 LEU A N   1 
ATOM   3502 C  CA  . LEU A 1 430 ? 16.416  13.807  10.035  1.00 22.49 ? 431 LEU A CA  1 
ATOM   3503 C  C   . LEU A 1 430 ? 17.777  13.471  9.429   1.00 22.08 ? 431 LEU A C   1 
ATOM   3504 O  O   . LEU A 1 430 ? 18.245  14.159  8.519   1.00 21.45 ? 431 LEU A O   1 
ATOM   3505 C  CB  . LEU A 1 430 ? 16.595  14.616  11.323  1.00 22.78 ? 431 LEU A CB  1 
ATOM   3506 C  CG  . LEU A 1 430 ? 15.349  15.313  11.923  1.00 23.19 ? 431 LEU A CG  1 
ATOM   3507 C  CD1 . LEU A 1 430 ? 15.619  15.801  13.340  1.00 22.73 ? 431 LEU A CD1 1 
ATOM   3508 C  CD2 . LEU A 1 430 ? 14.892  16.477  11.056  1.00 23.96 ? 431 LEU A CD2 1 
ATOM   3509 N  N   . GLU A 1 431 ? 18.401  12.409  9.929   1.00 21.82 ? 432 GLU A N   1 
ATOM   3510 C  CA  . GLU A 1 431 ? 19.697  11.966  9.417   1.00 21.51 ? 432 GLU A CA  1 
ATOM   3511 C  C   . GLU A 1 431 ? 19.569  11.589  7.940   1.00 20.78 ? 432 GLU A C   1 
ATOM   3512 O  O   . GLU A 1 431 ? 20.384  11.993  7.115   1.00 19.88 ? 432 GLU A O   1 
ATOM   3513 C  CB  . GLU A 1 431 ? 20.202  10.758  10.220  1.00 22.04 ? 432 GLU A CB  1 
ATOM   3514 C  CG  . GLU A 1 431 ? 21.546  10.202  9.747   1.00 24.06 ? 432 GLU A CG  1 
ATOM   3515 C  CD  . GLU A 1 431 ? 21.958  8.955   10.505  1.00 27.55 ? 432 GLU A CD  1 
ATOM   3516 O  OE1 . GLU A 1 431 ? 21.681  8.870   11.739  1.00 28.38 ? 432 GLU A OE1 1 
ATOM   3517 O  OE2 . GLU A 1 431 ? 22.562  8.057   9.866   1.00 27.50 ? 432 GLU A OE2 1 
ATOM   3518 N  N   . MET A 1 432 ? 18.525  10.834  7.612   1.00 20.11 ? 433 MET A N   1 
ATOM   3519 C  CA  . MET A 1 432 ? 18.329  10.395  6.236   1.00 20.13 ? 433 MET A CA  1 
ATOM   3520 C  C   . MET A 1 432 ? 17.959  11.529  5.286   1.00 19.89 ? 433 MET A C   1 
ATOM   3521 O  O   . MET A 1 432 ? 18.464  11.586  4.166   1.00 19.68 ? 433 MET A O   1 
ATOM   3522 C  CB  . MET A 1 432 ? 17.311  9.252   6.168   1.00 19.59 ? 433 MET A CB  1 
ATOM   3523 C  CG  . MET A 1 432 ? 17.864  7.985   6.846   1.00 21.48 ? 433 MET A CG  1 
ATOM   3524 S  SD  . MET A 1 432 ? 16.832  6.527   6.613   1.00 22.81 ? 433 MET A SD  1 
ATOM   3525 C  CE  . MET A 1 432 ? 15.351  6.978   7.527   1.00 20.74 ? 433 MET A CE  1 
ATOM   3526 N  N   . THR A 1 433 ? 17.102  12.440  5.734   1.00 19.73 ? 434 THR A N   1 
ATOM   3527 C  CA  . THR A 1 433 ? 16.642  13.527  4.851   1.00 20.25 ? 434 THR A CA  1 
ATOM   3528 C  C   . THR A 1 433 ? 17.781  14.497  4.550   1.00 19.82 ? 434 THR A C   1 
ATOM   3529 O  O   . THR A 1 433 ? 18.015  14.868  3.407   1.00 20.17 ? 434 THR A O   1 
ATOM   3530 C  CB  . THR A 1 433 ? 15.430  14.270  5.455   1.00 20.00 ? 434 THR A CB  1 
ATOM   3531 O  OG1 . THR A 1 433 ? 14.477  13.301  5.892   1.00 19.98 ? 434 THR A OG1 1 
ATOM   3532 C  CG2 . THR A 1 433 ? 14.774  15.159  4.396   1.00 19.89 ? 434 THR A CG2 1 
ATOM   3533 N  N   . ILE A 1 434 ? 18.510  14.867  5.594   1.00 20.37 ? 435 ILE A N   1 
ATOM   3534 C  CA  . ILE A 1 434 ? 19.679  15.714  5.474   1.00 19.90 ? 435 ILE A CA  1 
ATOM   3535 C  C   . ILE A 1 434 ? 20.734  15.040  4.596   1.00 19.70 ? 435 ILE A C   1 
ATOM   3536 O  O   . ILE A 1 434 ? 21.327  15.683  3.716   1.00 19.91 ? 435 ILE A O   1 
ATOM   3537 C  CB  . ILE A 1 434 ? 20.231  16.098  6.871   1.00 20.44 ? 435 ILE A CB  1 
ATOM   3538 C  CG1 . ILE A 1 434 ? 19.218  17.004  7.594   1.00 20.52 ? 435 ILE A CG1 1 
ATOM   3539 C  CG2 . ILE A 1 434 ? 21.555  16.830  6.743   1.00 20.32 ? 435 ILE A CG2 1 
ATOM   3540 C  CD1 . ILE A 1 434 ? 19.505  17.205  9.116   1.00 21.88 ? 435 ILE A CD1 1 
ATOM   3541 N  N   . PHE A 1 435 ? 20.937  13.739  4.794   1.00 19.29 ? 436 PHE A N   1 
ATOM   3542 C  CA  . PHE A 1 435 ? 21.912  13.005  3.993   1.00 18.96 ? 436 PHE A CA  1 
ATOM   3543 C  C   . PHE A 1 435 ? 21.555  13.099  2.518   1.00 18.65 ? 436 PHE A C   1 
ATOM   3544 O  O   . PHE A 1 435 ? 22.408  13.353  1.684   1.00 18.09 ? 436 PHE A O   1 
ATOM   3545 C  CB  . PHE A 1 435 ? 21.967  11.532  4.406   1.00 18.91 ? 436 PHE A CB  1 
ATOM   3546 C  CG  . PHE A 1 435 ? 22.814  10.670  3.497   1.00 18.55 ? 436 PHE A CG  1 
ATOM   3547 C  CD1 . PHE A 1 435 ? 24.154  10.460  3.773   1.00 18.58 ? 436 PHE A CD1 1 
ATOM   3548 C  CD2 . PHE A 1 435 ? 22.261  10.046  2.394   1.00 17.50 ? 436 PHE A CD2 1 
ATOM   3549 C  CE1 . PHE A 1 435 ? 24.926  9.649   2.945   1.00 19.81 ? 436 PHE A CE1 1 
ATOM   3550 C  CE2 . PHE A 1 435 ? 23.022  9.249   1.573   1.00 18.67 ? 436 PHE A CE2 1 
ATOM   3551 C  CZ  . PHE A 1 435 ? 24.358  9.050   1.849   1.00 19.69 ? 436 PHE A CZ  1 
ATOM   3552 N  N   . LEU A 1 436 ? 20.283  12.883  2.212   1.00 19.08 ? 437 LEU A N   1 
ATOM   3553 C  CA  . LEU A 1 436 ? 19.846  12.781  0.815   1.00 19.54 ? 437 LEU A CA  1 
ATOM   3554 C  C   . LEU A 1 436 ? 19.787  14.144  0.125   1.00 19.78 ? 437 LEU A C   1 
ATOM   3555 O  O   . LEU A 1 436 ? 20.019  14.230  -1.076  1.00 19.68 ? 437 LEU A O   1 
ATOM   3556 C  CB  . LEU A 1 436 ? 18.512  12.026  0.711   1.00 19.77 ? 437 LEU A CB  1 
ATOM   3557 C  CG  . LEU A 1 436 ? 18.610  10.513  0.979   1.00 19.45 ? 437 LEU A CG  1 
ATOM   3558 C  CD1 . LEU A 1 436 ? 17.248  9.916   1.239   1.00 19.93 ? 437 LEU A CD1 1 
ATOM   3559 C  CD2 . LEU A 1 436 ? 19.323  9.775   -0.162  1.00 20.22 ? 437 LEU A CD2 1 
ATOM   3560 N  N   . ILE A 1 437 ? 19.476  15.191  0.891   1.00 20.03 ? 438 ILE A N   1 
ATOM   3561 C  CA  . ILE A 1 437 ? 19.580  16.577  0.409   1.00 20.80 ? 438 ILE A CA  1 
ATOM   3562 C  C   . ILE A 1 437 ? 21.015  16.835  -0.077  1.00 20.86 ? 438 ILE A C   1 
ATOM   3563 O  O   . ILE A 1 437 ? 21.228  17.265  -1.222  1.00 21.22 ? 438 ILE A O   1 
ATOM   3564 C  CB  . ILE A 1 437 ? 19.170  17.596  1.521   1.00 20.59 ? 438 ILE A CB  1 
ATOM   3565 C  CG1 . ILE A 1 437 ? 17.650  17.593  1.722   1.00 20.81 ? 438 ILE A CG1 1 
ATOM   3566 C  CG2 . ILE A 1 437 ? 19.681  18.998  1.194   1.00 21.94 ? 438 ILE A CG2 1 
ATOM   3567 C  CD1 . ILE A 1 437 ? 17.168  18.335  2.988   1.00 19.86 ? 438 ILE A CD1 1 
ATOM   3568 N  N   . ASN A 1 438 ? 22.002  16.505  0.766   1.00 20.57 ? 439 ASN A N   1 
ATOM   3569 C  CA  . ASN A 1 438 ? 23.400  16.737  0.423   1.00 20.39 ? 439 ASN A CA  1 
ATOM   3570 C  C   . ASN A 1 438 ? 23.868  15.903  -0.781  1.00 20.04 ? 439 ASN A C   1 
ATOM   3571 O  O   . ASN A 1 438 ? 24.570  16.413  -1.660  1.00 19.21 ? 439 ASN A O   1 
ATOM   3572 C  CB  . ASN A 1 438 ? 24.299  16.514  1.636   1.00 20.35 ? 439 ASN A CB  1 
ATOM   3573 C  CG  . ASN A 1 438 ? 24.277  17.684  2.594   1.00 22.28 ? 439 ASN A CG  1 
ATOM   3574 O  OD1 . ASN A 1 438 ? 24.965  18.672  2.375   1.00 25.49 ? 439 ASN A OD1 1 
ATOM   3575 N  ND2 . ASN A 1 438 ? 23.499  17.576  3.671   1.00 21.42 ? 439 ASN A ND2 1 
ATOM   3576 N  N   . MET A 1 439 ? 23.476  14.629  -0.810  1.00 20.02 ? 440 MET A N   1 
ATOM   3577 C  CA  . MET A 1 439 ? 23.780  13.748  -1.938  1.00 20.68 ? 440 MET A CA  1 
ATOM   3578 C  C   . MET A 1 439 ? 23.130  14.216  -3.254  1.00 21.24 ? 440 MET A C   1 
ATOM   3579 O  O   . MET A 1 439 ? 23.772  14.200  -4.309  1.00 21.02 ? 440 MET A O   1 
ATOM   3580 C  CB  . MET A 1 439 ? 23.357  12.308  -1.620  1.00 20.71 ? 440 MET A CB  1 
ATOM   3581 C  CG  . MET A 1 439 ? 24.212  11.653  -0.522  1.00 21.01 ? 440 MET A CG  1 
ATOM   3582 S  SD  . MET A 1 439 ? 25.957  11.464  -1.008  1.00 22.89 ? 440 MET A SD  1 
ATOM   3583 C  CE  . MET A 1 439 ? 25.792  10.062  -2.115  1.00 17.92 ? 440 MET A CE  1 
ATOM   3584 N  N   . LEU A 1 440 ? 21.853  14.604  -3.192  1.00 21.46 ? 441 LEU A N   1 
ATOM   3585 C  CA  . LEU A 1 440 ? 21.124  15.015  -4.401  1.00 22.44 ? 441 LEU A CA  1 
ATOM   3586 C  C   . LEU A 1 440 ? 21.647  16.327  -5.000  1.00 22.54 ? 441 LEU A C   1 
ATOM   3587 O  O   . LEU A 1 440 ? 21.660  16.500  -6.217  1.00 22.60 ? 441 LEU A O   1 
ATOM   3588 C  CB  . LEU A 1 440 ? 19.622  15.106  -4.137  1.00 22.03 ? 441 LEU A CB  1 
ATOM   3589 C  CG  . LEU A 1 440 ? 18.916  13.743  -4.134  1.00 23.59 ? 441 LEU A CG  1 
ATOM   3590 C  CD1 . LEU A 1 440 ? 17.524  13.861  -3.502  1.00 24.30 ? 441 LEU A CD1 1 
ATOM   3591 C  CD2 . LEU A 1 440 ? 18.838  13.134  -5.536  1.00 24.10 ? 441 LEU A CD2 1 
ATOM   3592 N  N   . GLU A 1 441 ? 22.084  17.232  -4.135  1.00 23.19 ? 442 GLU A N   1 
ATOM   3593 C  CA  . GLU A 1 441 ? 22.708  18.477  -4.564  1.00 24.39 ? 442 GLU A CA  1 
ATOM   3594 C  C   . GLU A 1 441 ? 24.054  18.231  -5.236  1.00 23.93 ? 442 GLU A C   1 
ATOM   3595 O  O   . GLU A 1 441 ? 24.468  19.000  -6.095  1.00 24.86 ? 442 GLU A O   1 
ATOM   3596 C  CB  . GLU A 1 441 ? 22.903  19.408  -3.367  1.00 24.87 ? 442 GLU A CB  1 
ATOM   3597 C  CG  . GLU A 1 441 ? 21.622  20.037  -2.910  1.00 27.64 ? 442 GLU A CG  1 
ATOM   3598 C  CD  . GLU A 1 441 ? 21.762  20.869  -1.663  1.00 30.82 ? 442 GLU A CD  1 
ATOM   3599 O  OE1 . GLU A 1 441 ? 22.649  20.571  -0.825  1.00 33.40 ? 442 GLU A OE1 1 
ATOM   3600 O  OE2 . GLU A 1 441 ? 20.959  21.818  -1.516  1.00 33.08 ? 442 GLU A OE2 1 
ATOM   3601 N  N   . ASN A 1 442 ? 24.736  17.159  -4.852  1.00 22.90 ? 443 ASN A N   1 
ATOM   3602 C  CA  . ASN A 1 442 ? 26.122  16.972  -5.281  1.00 22.38 ? 443 ASN A CA  1 
ATOM   3603 C  C   . ASN A 1 442 ? 26.406  15.916  -6.331  1.00 21.92 ? 443 ASN A C   1 
ATOM   3604 O  O   . ASN A 1 442 ? 27.390  16.031  -7.064  1.00 22.17 ? 443 ASN A O   1 
ATOM   3605 C  CB  . ASN A 1 442 ? 27.011  16.740  -4.071  1.00 22.23 ? 443 ASN A CB  1 
ATOM   3606 C  CG  . ASN A 1 442 ? 27.447  18.032  -3.437  1.00 23.87 ? 443 ASN A CG  1 
ATOM   3607 O  OD1 . ASN A 1 442 ? 28.450  18.613  -3.843  1.00 26.61 ? 443 ASN A OD1 1 
ATOM   3608 N  ND2 . ASN A 1 442 ? 26.705  18.488  -2.427  1.00 21.26 ? 443 ASN A ND2 1 
ATOM   3609 N  N   . PHE A 1 443 ? 25.574  14.881  -6.405  1.00 21.10 ? 444 PHE A N   1 
ATOM   3610 C  CA  . PHE A 1 443 ? 25.841  13.796  -7.347  1.00 20.90 ? 444 PHE A CA  1 
ATOM   3611 C  C   . PHE A 1 443 ? 24.603  13.261  -8.002  1.00 21.54 ? 444 PHE A C   1 
ATOM   3612 O  O   . PHE A 1 443 ? 23.493  13.351  -7.457  1.00 20.83 ? 444 PHE A O   1 
ATOM   3613 C  CB  . PHE A 1 443 ? 26.532  12.604  -6.656  1.00 20.54 ? 444 PHE A CB  1 
ATOM   3614 C  CG  . PHE A 1 443 ? 27.607  12.994  -5.698  1.00 19.59 ? 444 PHE A CG  1 
ATOM   3615 C  CD1 . PHE A 1 443 ? 27.344  13.052  -4.338  1.00 18.43 ? 444 PHE A CD1 1 
ATOM   3616 C  CD2 . PHE A 1 443 ? 28.879  13.307  -6.147  1.00 21.37 ? 444 PHE A CD2 1 
ATOM   3617 C  CE1 . PHE A 1 443 ? 28.322  13.410  -3.447  1.00 19.18 ? 444 PHE A CE1 1 
ATOM   3618 C  CE2 . PHE A 1 443 ? 29.866  13.670  -5.252  1.00 20.38 ? 444 PHE A CE2 1 
ATOM   3619 C  CZ  . PHE A 1 443 ? 29.579  13.729  -3.898  1.00 21.07 ? 444 PHE A CZ  1 
ATOM   3620 N  N   . ARG A 1 444 ? 24.837  12.654  -9.160  1.00 22.51 ? 445 ARG A N   1 
ATOM   3621 C  CA  . ARG A 1 444 ? 23.915  11.736  -9.797  1.00 24.49 ? 445 ARG A CA  1 
ATOM   3622 C  C   . ARG A 1 444 ? 24.389  10.315  -9.470  1.00 24.42 ? 445 ARG A C   1 
ATOM   3623 O  O   . ARG A 1 444 ? 25.591  10.019  -9.523  1.00 23.94 ? 445 ARG A O   1 
ATOM   3624 C  CB  . ARG A 1 444 ? 23.909  11.949  -11.320 1.00 25.06 ? 445 ARG A CB  1 
ATOM   3625 C  CG  . ARG A 1 444 ? 23.613  13.387  -11.742 1.00 30.15 ? 445 ARG A CG  1 
ATOM   3626 C  CD  . ARG A 1 444 ? 23.691  13.538  -13.278 1.00 37.10 ? 445 ARG A CD  1 
ATOM   3627 N  NE  . ARG A 1 444 ? 22.400  13.251  -13.895 1.00 41.58 ? 445 ARG A NE  1 
ATOM   3628 C  CZ  . ARG A 1 444 ? 21.519  14.180  -14.265 1.00 45.08 ? 445 ARG A CZ  1 
ATOM   3629 N  NH1 . ARG A 1 444 ? 21.796  15.474  -14.101 1.00 45.74 ? 445 ARG A NH1 1 
ATOM   3630 N  NH2 . ARG A 1 444 ? 20.360  13.813  -14.811 1.00 46.00 ? 445 ARG A NH2 1 
ATOM   3631 N  N   . VAL A 1 445 ? 23.437  9.452   -9.123  1.00 25.15 ? 446 VAL A N   1 
ATOM   3632 C  CA  . VAL A 1 445 ? 23.713  8.077   -8.721  1.00 25.63 ? 446 VAL A CA  1 
ATOM   3633 C  C   . VAL A 1 445 ? 23.173  7.103   -9.756  1.00 26.02 ? 446 VAL A C   1 
ATOM   3634 O  O   . VAL A 1 445 ? 21.988  7.152   -10.109 1.00 25.45 ? 446 VAL A O   1 
ATOM   3635 C  CB  . VAL A 1 445 ? 23.026  7.717   -7.375  1.00 26.31 ? 446 VAL A CB  1 
ATOM   3636 C  CG1 . VAL A 1 445 ? 23.778  6.580   -6.697  1.00 25.10 ? 446 VAL A CG1 1 
ATOM   3637 C  CG2 . VAL A 1 445 ? 22.919  8.945   -6.444  1.00 27.74 ? 446 VAL A CG2 1 
ATOM   3638 N  N   . GLU A 1 446 ? 24.042  6.210   -10.221 1.00 26.07 ? 447 GLU A N   1 
ATOM   3639 C  CA  . GLU A 1 446 ? 23.657  5.166   -11.152 1.00 27.16 ? 447 GLU A CA  1 
ATOM   3640 C  C   . GLU A 1 446 ? 24.197  3.816   -10.681 1.00 27.02 ? 447 GLU A C   1 
ATOM   3641 O  O   . GLU A 1 446 ? 25.092  3.759   -9.839  1.00 26.46 ? 447 GLU A O   1 
ATOM   3642 C  CB  . GLU A 1 446 ? 24.182  5.495   -12.558 1.00 27.57 ? 447 GLU A CB  1 
ATOM   3643 C  CG  . GLU A 1 446 ? 23.545  6.761   -13.146 1.00 30.93 ? 447 GLU A CG  1 
ATOM   3644 C  CD  . GLU A 1 446 ? 23.986  7.098   -14.577 1.00 35.52 ? 447 GLU A CD  1 
ATOM   3645 O  OE1 . GLU A 1 446 ? 24.921  6.452   -15.117 1.00 37.13 ? 447 GLU A OE1 1 
ATOM   3646 O  OE2 . GLU A 1 446 ? 23.384  8.036   -15.157 1.00 37.91 ? 447 GLU A OE2 1 
ATOM   3647 N  N   . ILE A 1 447 ? 23.655  2.730   -11.215 1.00 27.39 ? 448 ILE A N   1 
ATOM   3648 C  CA  . ILE A 1 447 ? 24.285  1.418   -11.031 1.00 28.60 ? 448 ILE A CA  1 
ATOM   3649 C  C   . ILE A 1 447 ? 24.564  0.812   -12.398 1.00 30.10 ? 448 ILE A C   1 
ATOM   3650 O  O   . ILE A 1 447 ? 23.649  0.695   -13.211 1.00 30.07 ? 448 ILE A O   1 
ATOM   3651 C  CB  . ILE A 1 447 ? 23.421  0.453   -10.178 1.00 28.10 ? 448 ILE A CB  1 
ATOM   3652 C  CG1 . ILE A 1 447 ? 23.223  1.008   -8.763  1.00 27.15 ? 448 ILE A CG1 1 
ATOM   3653 C  CG2 . ILE A 1 447 ? 24.075  -0.952  -10.106 1.00 27.92 ? 448 ILE A CG2 1 
ATOM   3654 C  CD1 . ILE A 1 447 ? 22.118  0.296   -7.977  1.00 26.76 ? 448 ILE A CD1 1 
ATOM   3655 N  N   . GLN A 1 448 ? 25.826  0.463   -12.654 1.00 32.04 ? 449 GLN A N   1 
ATOM   3656 C  CA  . GLN A 1 448 ? 26.211  -0.253  -13.881 1.00 34.43 ? 449 GLN A CA  1 
ATOM   3657 C  C   . GLN A 1 448 ? 25.743  -1.699  -13.787 1.00 35.65 ? 449 GLN A C   1 
ATOM   3658 O  O   . GLN A 1 448 ? 25.847  -2.324  -12.720 1.00 36.07 ? 449 GLN A O   1 
ATOM   3659 C  CB  . GLN A 1 448 ? 27.729  -0.296  -14.041 1.00 34.51 ? 449 GLN A CB  1 
ATOM   3660 C  CG  . GLN A 1 448 ? 28.422  1.007   -14.338 1.00 36.46 ? 449 GLN A CG  1 
ATOM   3661 C  CD  . GLN A 1 448 ? 29.934  0.816   -14.395 1.00 39.94 ? 449 GLN A CD  1 
ATOM   3662 O  OE1 . GLN A 1 448 ? 30.440  -0.027  -15.147 1.00 41.03 ? 449 GLN A OE1 1 
ATOM   3663 N  NE2 . GLN A 1 448 ? 30.659  1.589   -13.593 1.00 40.08 ? 449 GLN A NE2 1 
ATOM   3664 N  N   . HIS A 1 449 ? 25.267  -2.244  -14.900 1.00 37.05 ? 450 HIS A N   1 
ATOM   3665 C  CA  . HIS A 1 449 ? 24.746  -3.621  -14.917 1.00 38.55 ? 450 HIS A CA  1 
ATOM   3666 C  C   . HIS A 1 449 ? 23.785  -3.821  -13.752 1.00 38.97 ? 450 HIS A C   1 
ATOM   3667 O  O   . HIS A 1 449 ? 23.994  -4.677  -12.887 1.00 39.30 ? 450 HIS A O   1 
ATOM   3668 C  CB  . HIS A 1 449 ? 25.890  -4.644  -14.883 1.00 38.91 ? 450 HIS A CB  1 
ATOM   3669 C  CG  . HIS A 1 449 ? 26.954  -4.378  -15.903 1.00 40.78 ? 450 HIS A CG  1 
ATOM   3670 N  ND1 . HIS A 1 449 ? 26.733  -4.512  -17.258 1.00 41.95 ? 450 HIS A ND1 1 
ATOM   3671 C  CD2 . HIS A 1 449 ? 28.237  -3.960  -15.769 1.00 42.85 ? 450 HIS A CD2 1 
ATOM   3672 C  CE1 . HIS A 1 449 ? 27.837  -4.198  -17.914 1.00 43.06 ? 450 HIS A CE1 1 
ATOM   3673 N  NE2 . HIS A 1 449 ? 28.764  -3.858  -17.035 1.00 43.94 ? 450 HIS A NE2 1 
ATOM   3674 N  N   . LEU A 1 450 ? 22.748  -2.993  -13.727 1.00 39.13 ? 451 LEU A N   1 
ATOM   3675 C  CA  . LEU A 1 450 ? 21.737  -3.059  -12.685 1.00 39.72 ? 451 LEU A CA  1 
ATOM   3676 C  C   . LEU A 1 450 ? 20.925  -4.351  -12.779 1.00 39.74 ? 451 LEU A C   1 
ATOM   3677 O  O   . LEU A 1 450 ? 20.368  -4.665  -13.826 1.00 40.18 ? 451 LEU A O   1 
ATOM   3678 C  CB  . LEU A 1 450 ? 20.830  -1.829  -12.755 1.00 39.57 ? 451 LEU A CB  1 
ATOM   3679 C  CG  . LEU A 1 450 ? 19.805  -1.544  -11.644 1.00 40.23 ? 451 LEU A CG  1 
ATOM   3680 C  CD1 . LEU A 1 450 ? 20.197  -2.097  -10.297 1.00 39.34 ? 451 LEU A CD1 1 
ATOM   3681 C  CD2 . LEU A 1 450 ? 19.590  -0.042  -11.546 1.00 40.07 ? 451 LEU A CD2 1 
ATOM   3682 N  N   . SER A 1 451 ? 20.896  -5.097  -11.678 1.00 39.81 ? 452 SER A N   1 
ATOM   3683 C  CA  . SER A 1 451 ? 20.091  -6.311  -11.550 1.00 39.56 ? 452 SER A CA  1 
ATOM   3684 C  C   . SER A 1 451 ? 19.330  -6.243  -10.231 1.00 39.01 ? 452 SER A C   1 
ATOM   3685 O  O   . SER A 1 451 ? 19.739  -5.529  -9.320  1.00 39.43 ? 452 SER A O   1 
ATOM   3686 C  CB  . SER A 1 451 ? 20.990  -7.539  -11.548 1.00 39.77 ? 452 SER A CB  1 
ATOM   3687 O  OG  . SER A 1 451 ? 21.738  -7.593  -10.344 1.00 41.45 ? 452 SER A OG  1 
ATOM   3688 N  N   . ASP A 1 452 ? 18.242  -6.995  -10.124 1.00 37.84 ? 453 ASP A N   1 
ATOM   3689 C  CA  . ASP A 1 452 ? 17.412  -6.976  -8.927  1.00 37.08 ? 453 ASP A CA  1 
ATOM   3690 C  C   . ASP A 1 452 ? 18.166  -7.502  -7.710  1.00 35.40 ? 453 ASP A C   1 
ATOM   3691 O  O   . ASP A 1 452 ? 18.737  -8.587  -7.735  1.00 35.43 ? 453 ASP A O   1 
ATOM   3692 C  CB  . ASP A 1 452 ? 16.130  -7.782  -9.154  1.00 37.80 ? 453 ASP A CB  1 
ATOM   3693 C  CG  . ASP A 1 452 ? 15.270  -7.207  -10.264 1.00 39.60 ? 453 ASP A CG  1 
ATOM   3694 O  OD1 . ASP A 1 452 ? 15.091  -5.967  -10.313 1.00 41.58 ? 453 ASP A OD1 1 
ATOM   3695 O  OD2 . ASP A 1 452 ? 14.764  -7.999  -11.089 1.00 43.12 ? 453 ASP A OD2 1 
ATOM   3696 N  N   . VAL A 1 453 ? 18.190  -6.712  -6.649  1.00 33.32 ? 454 VAL A N   1 
ATOM   3697 C  CA  . VAL A 1 453 ? 18.875  -7.131  -5.440  1.00 31.45 ? 454 VAL A CA  1 
ATOM   3698 C  C   . VAL A 1 453 ? 17.814  -7.545  -4.444  1.00 30.17 ? 454 VAL A C   1 
ATOM   3699 O  O   . VAL A 1 453 ? 16.912  -6.771  -4.129  1.00 29.36 ? 454 VAL A O   1 
ATOM   3700 C  CB  . VAL A 1 453 ? 19.794  -6.018  -4.887  1.00 31.86 ? 454 VAL A CB  1 
ATOM   3701 C  CG1 . VAL A 1 453 ? 20.272  -6.335  -3.458  1.00 30.65 ? 454 VAL A CG1 1 
ATOM   3702 C  CG2 . VAL A 1 453 ? 20.984  -5.798  -5.841  1.00 31.79 ? 454 VAL A CG2 1 
ATOM   3703 N  N   . GLY A 1 454 ? 17.913  -8.785  -3.977  1.00 28.69 ? 455 GLY A N   1 
ATOM   3704 C  CA  . GLY A 1 454 ? 16.954  -9.303  -3.028  1.00 26.88 ? 455 GLY A CA  1 
ATOM   3705 C  C   . GLY A 1 454 ? 17.356  -8.973  -1.607  1.00 25.82 ? 455 GLY A C   1 
ATOM   3706 O  O   . GLY A 1 454 ? 18.291  -8.208  -1.366  1.00 25.12 ? 455 GLY A O   1 
ATOM   3707 N  N   . THR A 1 455 ? 16.667  -9.615  -0.674  1.00 24.40 ? 456 THR A N   1 
ATOM   3708 C  CA  . THR A 1 455 ? 16.714  -9.262  0.732   1.00 23.61 ? 456 THR A CA  1 
ATOM   3709 C  C   . THR A 1 455 ? 17.052  -10.504 1.537   1.00 22.56 ? 456 THR A C   1 
ATOM   3710 O  O   . THR A 1 455 ? 16.596  -11.604 1.209   1.00 22.47 ? 456 THR A O   1 
ATOM   3711 C  CB  . THR A 1 455 ? 15.341  -8.685  1.148   1.00 23.80 ? 456 THR A CB  1 
ATOM   3712 O  OG1 . THR A 1 455 ? 15.102  -7.485  0.399   1.00 24.73 ? 456 THR A OG1 1 
ATOM   3713 C  CG2 . THR A 1 455 ? 15.270  -8.363  2.623   1.00 23.00 ? 456 THR A CG2 1 
ATOM   3714 N  N   . THR A 1 456 ? 17.865  -10.322 2.572   1.00 21.54 ? 457 THR A N   1 
ATOM   3715 C  CA  . THR A 1 456 ? 18.200  -11.393 3.494   1.00 21.40 ? 457 THR A CA  1 
ATOM   3716 C  C   . THR A 1 456 ? 17.884  -10.975 4.918   1.00 19.98 ? 457 THR A C   1 
ATOM   3717 O  O   . THR A 1 456 ? 18.053  -9.812  5.285   1.00 19.74 ? 457 THR A O   1 
ATOM   3718 C  CB  . THR A 1 456 ? 19.665  -11.868 3.374   1.00 21.81 ? 457 THR A CB  1 
ATOM   3719 O  OG1 . THR A 1 456 ? 19.860  -12.970 4.256   1.00 25.27 ? 457 THR A OG1 1 
ATOM   3720 C  CG2 . THR A 1 456 ? 20.641  -10.779 3.772   1.00 23.72 ? 457 THR A CG2 1 
ATOM   3721 N  N   . PHE A 1 457 ? 17.389  -11.922 5.705   1.00 18.33 ? 458 PHE A N   1 
ATOM   3722 C  CA  . PHE A 1 457 ? 17.040  -11.643 7.091   1.00 18.23 ? 458 PHE A CA  1 
ATOM   3723 C  C   . PHE A 1 457 ? 18.263  -11.913 7.947   1.00 18.24 ? 458 PHE A C   1 
ATOM   3724 O  O   . PHE A 1 457 ? 18.682  -13.060 8.098   1.00 18.46 ? 458 PHE A O   1 
ATOM   3725 C  CB  . PHE A 1 457 ? 15.853  -12.496 7.538   1.00 17.00 ? 458 PHE A CB  1 
ATOM   3726 C  CG  . PHE A 1 457 ? 15.496  -12.356 9.001   1.00 17.39 ? 458 PHE A CG  1 
ATOM   3727 C  CD1 . PHE A 1 457 ? 14.808  -11.230 9.471   1.00 15.89 ? 458 PHE A CD1 1 
ATOM   3728 C  CD2 . PHE A 1 457 ? 15.815  -13.382 9.902   1.00 16.74 ? 458 PHE A CD2 1 
ATOM   3729 C  CE1 . PHE A 1 457 ? 14.454  -11.118 10.822  1.00 16.65 ? 458 PHE A CE1 1 
ATOM   3730 C  CE2 . PHE A 1 457 ? 15.467  -13.290 11.252  1.00 16.71 ? 458 PHE A CE2 1 
ATOM   3731 C  CZ  . PHE A 1 457 ? 14.784  -12.157 11.720  1.00 14.88 ? 458 PHE A CZ  1 
ATOM   3732 N  N   . ASN A 1 458 ? 18.818  -10.835 8.490   1.00 18.15 ? 459 ASN A N   1 
ATOM   3733 C  CA  . ASN A 1 458 ? 20.002  -10.870 9.365   1.00 18.80 ? 459 ASN A CA  1 
ATOM   3734 C  C   . ASN A 1 458 ? 19.579  -10.188 10.662  1.00 18.45 ? 459 ASN A C   1 
ATOM   3735 O  O   . ASN A 1 458 ? 20.267  -9.304  11.164  1.00 18.60 ? 459 ASN A O   1 
ATOM   3736 C  CB  . ASN A 1 458 ? 21.155  -10.089 8.725   1.00 18.42 ? 459 ASN A CB  1 
ATOM   3737 C  CG  . ASN A 1 458 ? 21.965  -10.918 7.705   1.00 22.96 ? 459 ASN A CG  1 
ATOM   3738 O  OD1 . ASN A 1 458 ? 22.005  -12.154 7.754   1.00 23.89 ? 459 ASN A OD1 1 
ATOM   3739 N  ND2 . ASN A 1 458 ? 22.647  -10.215 6.793   1.00 24.13 ? 459 ASN A ND2 1 
ATOM   3740 N  N   . LEU A 1 459 ? 18.423  -10.613 11.169  1.00 18.68 ? 460 LEU A N   1 
ATOM   3741 C  CA  . LEU A 1 459 ? 17.677  -9.988  12.277  1.00 19.53 ? 460 LEU A CA  1 
ATOM   3742 C  C   . LEU A 1 459 ? 17.011  -8.681  11.852  1.00 19.91 ? 460 LEU A C   1 
ATOM   3743 O  O   . LEU A 1 459 ? 15.781  -8.576  11.875  1.00 19.88 ? 460 LEU A O   1 
ATOM   3744 C  CB  . LEU A 1 459 ? 18.464  -9.855  13.589  1.00 19.45 ? 460 LEU A CB  1 
ATOM   3745 C  CG  . LEU A 1 459 ? 17.284  -9.865  14.580  1.00 22.27 ? 460 LEU A CG  1 
ATOM   3746 C  CD1 . LEU A 1 459 ? 17.213  -11.119 15.426  1.00 20.65 ? 460 LEU A CD1 1 
ATOM   3747 C  CD2 . LEU A 1 459 ? 17.069  -8.559  15.357  1.00 19.08 ? 460 LEU A CD2 1 
ATOM   3748 N  N   . ILE A 1 460 ? 17.814  -7.698  11.461  1.00 19.90 ? 461 ILE A N   1 
ATOM   3749 C  CA  . ILE A 1 460 ? 17.303  -6.646  10.597  1.00 20.32 ? 461 ILE A CA  1 
ATOM   3750 C  C   . ILE A 1 460 ? 17.357  -7.159  9.159   1.00 19.74 ? 461 ILE A C   1 
ATOM   3751 O  O   . ILE A 1 460 ? 18.184  -8.035  8.813   1.00 19.21 ? 461 ILE A O   1 
ATOM   3752 C  CB  . ILE A 1 460 ? 18.099  -5.312  10.732  1.00 20.50 ? 461 ILE A CB  1 
ATOM   3753 C  CG1 . ILE A 1 460 ? 19.570  -5.544  10.426  1.00 22.79 ? 461 ILE A CG1 1 
ATOM   3754 C  CG2 . ILE A 1 460 ? 17.902  -4.683  12.133  1.00 21.02 ? 461 ILE A CG2 1 
ATOM   3755 C  CD1 . ILE A 1 460 ? 20.375  -4.281  10.310  1.00 26.44 ? 461 ILE A CD1 1 
ATOM   3756 N  N   . LEU A 1 461 ? 16.478  -6.636  8.317   1.00 19.13 ? 462 LEU A N   1 
ATOM   3757 C  CA  . LEU A 1 461 ? 16.493  -7.006  6.907   1.00 19.03 ? 462 LEU A CA  1 
ATOM   3758 C  C   . LEU A 1 461 ? 17.584  -6.195  6.215   1.00 19.27 ? 462 LEU A C   1 
ATOM   3759 O  O   . LEU A 1 461 ? 17.784  -5.033  6.546   1.00 19.00 ? 462 LEU A O   1 
ATOM   3760 C  CB  . LEU A 1 461 ? 15.128  -6.791  6.243   1.00 17.92 ? 462 LEU A CB  1 
ATOM   3761 C  CG  . LEU A 1 461 ? 13.996  -7.723  6.699   1.00 18.22 ? 462 LEU A CG  1 
ATOM   3762 C  CD1 . LEU A 1 461 ? 12.640  -7.194  6.267   1.00 17.03 ? 462 LEU A CD1 1 
ATOM   3763 C  CD2 . LEU A 1 461 ? 14.182  -9.180  6.208   1.00 17.61 ? 462 LEU A CD2 1 
ATOM   3764 N  N   . MET A 1 462 ? 18.287  -6.823  5.275   1.00 19.99 ? 463 MET A N   1 
ATOM   3765 C  CA  . MET A 1 462 ? 19.420  -6.202  4.588   1.00 21.52 ? 463 MET A CA  1 
ATOM   3766 C  C   . MET A 1 462 ? 19.480  -6.697  3.151   1.00 21.61 ? 463 MET A C   1 
ATOM   3767 O  O   . MET A 1 462 ? 18.904  -7.741  2.835   1.00 20.69 ? 463 MET A O   1 
ATOM   3768 C  CB  . MET A 1 462 ? 20.722  -6.622  5.270   1.00 22.61 ? 463 MET A CB  1 
ATOM   3769 C  CG  . MET A 1 462 ? 21.040  -5.939  6.586   1.00 26.79 ? 463 MET A CG  1 
ATOM   3770 S  SD  . MET A 1 462 ? 22.500  -6.798  7.192   1.00 35.01 ? 463 MET A SD  1 
ATOM   3771 C  CE  . MET A 1 462 ? 22.463  -6.370  8.920   1.00 34.01 ? 463 MET A CE  1 
ATOM   3772 N  N   . PRO A 1 463 ? 20.188  -5.961  2.267   1.00 22.28 ? 464 PRO A N   1 
ATOM   3773 C  CA  . PRO A 1 463 ? 20.350  -6.465  0.898   1.00 22.64 ? 464 PRO A CA  1 
ATOM   3774 C  C   . PRO A 1 463 ? 21.082  -7.784  0.914   1.00 23.12 ? 464 PRO A C   1 
ATOM   3775 O  O   . PRO A 1 463 ? 21.968  -7.986  1.740   1.00 22.70 ? 464 PRO A O   1 
ATOM   3776 C  CB  . PRO A 1 463 ? 21.198  -5.391  0.200   1.00 22.70 ? 464 PRO A CB  1 
ATOM   3777 C  CG  . PRO A 1 463 ? 21.657  -4.469  1.276   1.00 23.25 ? 464 PRO A CG  1 
ATOM   3778 C  CD  . PRO A 1 463 ? 20.719  -4.595  2.422   1.00 22.28 ? 464 PRO A CD  1 
ATOM   3779 N  N   . GLU A 1 464 ? 20.690  -8.675  0.016   1.00 23.71 ? 465 GLU A N   1 
ATOM   3780 C  CA  . GLU A 1 464 ? 21.253  -10.015 -0.052  1.00 25.25 ? 465 GLU A CA  1 
ATOM   3781 C  C   . GLU A 1 464 ? 22.671  -10.061 -0.650  1.00 24.66 ? 465 GLU A C   1 
ATOM   3782 O  O   . GLU A 1 464 ? 23.409  -11.004 -0.413  1.00 24.44 ? 465 GLU A O   1 
ATOM   3783 C  CB  . GLU A 1 464 ? 20.323  -10.909 -0.866  1.00 25.91 ? 465 GLU A CB  1 
ATOM   3784 C  CG  . GLU A 1 464 ? 20.594  -12.387 -0.688  1.00 32.50 ? 465 GLU A CG  1 
ATOM   3785 C  CD  . GLU A 1 464 ? 19.782  -13.248 -1.642  1.00 38.90 ? 465 GLU A CD  1 
ATOM   3786 O  OE1 . GLU A 1 464 ? 19.321  -12.716 -2.686  1.00 41.01 ? 465 GLU A OE1 1 
ATOM   3787 O  OE2 . GLU A 1 464 ? 19.614  -14.455 -1.335  1.00 40.48 ? 465 GLU A OE2 1 
ATOM   3788 N  N   . LYS A 1 465 ? 23.045  -9.044  -1.418  1.00 24.28 ? 466 LYS A N   1 
ATOM   3789 C  CA  . LYS A 1 465 ? 24.357  -9.027  -2.060  1.00 24.37 ? 466 LYS A CA  1 
ATOM   3790 C  C   . LYS A 1 465 ? 24.870  -7.580  -2.168  1.00 23.90 ? 466 LYS A C   1 
ATOM   3791 O  O   . LYS A 1 465 ? 24.102  -6.640  -1.973  1.00 23.11 ? 466 LYS A O   1 
ATOM   3792 C  CB  . LYS A 1 465 ? 24.293  -9.730  -3.429  1.00 24.09 ? 466 LYS A CB  1 
ATOM   3793 C  CG  . LYS A 1 465 ? 23.354  -9.080  -4.430  1.00 26.22 ? 466 LYS A CG  1 
ATOM   3794 C  CD  . LYS A 1 465 ? 23.226  -9.919  -5.716  1.00 29.71 ? 466 LYS A CD  1 
ATOM   3795 C  CE  . LYS A 1 465 ? 22.350  -9.202  -6.736  1.00 32.34 ? 466 LYS A CE  1 
ATOM   3796 N  NZ  . LYS A 1 465 ? 22.452  -9.792  -8.114  1.00 34.83 ? 466 LYS A NZ  1 
ATOM   3797 N  N   . PRO A 1 466 ? 26.175  -7.400  -2.439  1.00 23.80 ? 467 PRO A N   1 
ATOM   3798 C  CA  . PRO A 1 466 ? 26.712  -6.039  -2.484  1.00 23.73 ? 467 PRO A CA  1 
ATOM   3799 C  C   . PRO A 1 466 ? 26.089  -5.219  -3.617  1.00 24.05 ? 467 PRO A C   1 
ATOM   3800 O  O   . PRO A 1 466 ? 25.720  -5.780  -4.655  1.00 23.83 ? 467 PRO A O   1 
ATOM   3801 C  CB  . PRO A 1 466 ? 28.206  -6.268  -2.749  1.00 23.75 ? 467 PRO A CB  1 
ATOM   3802 C  CG  . PRO A 1 466 ? 28.475  -7.634  -2.179  1.00 24.14 ? 467 PRO A CG  1 
ATOM   3803 C  CD  . PRO A 1 466 ? 27.243  -8.416  -2.529  1.00 23.68 ? 467 PRO A CD  1 
ATOM   3804 N  N   . ILE A 1 467 ? 25.943  -3.917  -3.400  1.00 23.93 ? 468 ILE A N   1 
ATOM   3805 C  CA  . ILE A 1 467 ? 25.488  -3.009  -4.442  1.00 24.67 ? 468 ILE A CA  1 
ATOM   3806 C  C   . ILE A 1 467 ? 26.645  -2.064  -4.777  1.00 24.98 ? 468 ILE A C   1 
ATOM   3807 O  O   . ILE A 1 467 ? 27.186  -1.413  -3.885  1.00 25.03 ? 468 ILE A O   1 
ATOM   3808 C  CB  . ILE A 1 467 ? 24.241  -2.178  -3.998  1.00 24.88 ? 468 ILE A CB  1 
ATOM   3809 C  CG1 . ILE A 1 467 ? 23.055  -3.087  -3.641  1.00 24.54 ? 468 ILE A CG1 1 
ATOM   3810 C  CG2 . ILE A 1 467 ? 23.838  -1.162  -5.085  1.00 25.32 ? 468 ILE A CG2 1 
ATOM   3811 C  CD1 . ILE A 1 467 ? 21.965  -2.405  -2.782  1.00 25.87 ? 468 ILE A CD1 1 
ATOM   3812 N  N   . SER A 1 468 ? 27.031  -1.995  -6.052  1.00 24.98 ? 469 SER A N   1 
ATOM   3813 C  CA  . SER A 1 468 ? 28.115  -1.089  -6.472  1.00 25.24 ? 469 SER A CA  1 
ATOM   3814 C  C   . SER A 1 468 ? 27.543  0.102   -7.234  1.00 24.39 ? 469 SER A C   1 
ATOM   3815 O  O   . SER A 1 468 ? 26.963  -0.053  -8.308  1.00 24.76 ? 469 SER A O   1 
ATOM   3816 C  CB  . SER A 1 468 ? 29.161  -1.838  -7.315  1.00 25.89 ? 469 SER A CB  1 
ATOM   3817 O  OG  . SER A 1 468 ? 30.246  -0.984  -7.682  1.00 29.21 ? 469 SER A OG  1 
ATOM   3818 N  N   . PHE A 1 469 ? 27.682  1.292   -6.656  1.00 23.49 ? 470 PHE A N   1 
ATOM   3819 C  CA  . PHE A 1 469 ? 27.150  2.517   -7.252  1.00 22.60 ? 470 PHE A CA  1 
ATOM   3820 C  C   . PHE A 1 469 ? 28.206  3.215   -8.104  1.00 22.78 ? 470 PHE A C   1 
ATOM   3821 O  O   . PHE A 1 469 ? 29.403  3.041   -7.879  1.00 22.87 ? 470 PHE A O   1 
ATOM   3822 C  CB  . PHE A 1 469 ? 26.704  3.495   -6.152  1.00 21.93 ? 470 PHE A CB  1 
ATOM   3823 C  CG  . PHE A 1 469 ? 25.521  3.018   -5.347  1.00 21.59 ? 470 PHE A CG  1 
ATOM   3824 C  CD1 . PHE A 1 469 ? 25.702  2.483   -4.073  1.00 19.26 ? 470 PHE A CD1 1 
ATOM   3825 C  CD2 . PHE A 1 469 ? 24.225  3.114   -5.867  1.00 18.77 ? 470 PHE A CD2 1 
ATOM   3826 C  CE1 . PHE A 1 469 ? 24.606  2.052   -3.324  1.00 21.21 ? 470 PHE A CE1 1 
ATOM   3827 C  CE2 . PHE A 1 469 ? 23.123  2.695   -5.136  1.00 19.21 ? 470 PHE A CE2 1 
ATOM   3828 C  CZ  . PHE A 1 469 ? 23.302  2.154   -3.860  1.00 20.00 ? 470 PHE A CZ  1 
ATOM   3829 N  N   . THR A 1 470 ? 27.746  4.011   -9.062  1.00 22.47 ? 471 THR A N   1 
ATOM   3830 C  CA  . THR A 1 470 ? 28.586  4.977   -9.758  1.00 22.37 ? 471 THR A CA  1 
ATOM   3831 C  C   . THR A 1 470 ? 28.050  6.366   -9.423  1.00 22.23 ? 471 THR A C   1 
ATOM   3832 O  O   . THR A 1 470 ? 26.852  6.628   -9.581  1.00 22.04 ? 471 THR A O   1 
ATOM   3833 C  CB  . THR A 1 470 ? 28.622  4.729   -11.282 1.00 22.14 ? 471 THR A CB  1 
ATOM   3834 O  OG1 . THR A 1 470 ? 29.099  3.400   -11.520 1.00 22.26 ? 471 THR A OG1 1 
ATOM   3835 C  CG2 . THR A 1 470 ? 29.558  5.731   -11.984 1.00 21.94 ? 471 THR A CG2 1 
ATOM   3836 N  N   . PHE A 1 471 ? 28.925  7.223   -8.897  1.00 22.20 ? 472 PHE A N   1 
ATOM   3837 C  CA  . PHE A 1 471 ? 28.563  8.613   -8.591  1.00 22.72 ? 472 PHE A CA  1 
ATOM   3838 C  C   . PHE A 1 471 ? 29.231  9.567   -9.588  1.00 23.43 ? 472 PHE A C   1 
ATOM   3839 O  O   . PHE A 1 471 ? 30.445  9.471   -9.816  1.00 22.03 ? 472 PHE A O   1 
ATOM   3840 C  CB  . PHE A 1 471 ? 28.971  8.996   -7.174  1.00 22.31 ? 472 PHE A CB  1 
ATOM   3841 C  CG  . PHE A 1 471 ? 28.325  8.157   -6.103  1.00 23.60 ? 472 PHE A CG  1 
ATOM   3842 C  CD1 . PHE A 1 471 ? 28.949  6.994   -5.643  1.00 22.81 ? 472 PHE A CD1 1 
ATOM   3843 C  CD2 . PHE A 1 471 ? 27.100  8.532   -5.554  1.00 23.53 ? 472 PHE A CD2 1 
ATOM   3844 C  CE1 . PHE A 1 471 ? 28.359  6.215   -4.642  1.00 24.41 ? 472 PHE A CE1 1 
ATOM   3845 C  CE2 . PHE A 1 471 ? 26.498  7.759   -4.558  1.00 25.16 ? 472 PHE A CE2 1 
ATOM   3846 C  CZ  . PHE A 1 471 ? 27.130  6.593   -4.101  1.00 24.09 ? 472 PHE A CZ  1 
ATOM   3847 N  N   . TRP A 1 472 ? 28.422  10.459  -10.172 1.00 24.60 ? 473 TRP A N   1 
ATOM   3848 C  CA  . TRP A 1 472 ? 28.883  11.523  -11.072 1.00 26.82 ? 473 TRP A CA  1 
ATOM   3849 C  C   . TRP A 1 472 ? 28.623  12.876  -10.402 1.00 28.07 ? 473 TRP A C   1 
ATOM   3850 O  O   . TRP A 1 472 ? 27.516  13.113  -9.920  1.00 27.61 ? 473 TRP A O   1 
ATOM   3851 C  CB  . TRP A 1 472 ? 28.110  11.490  -12.393 1.00 26.95 ? 473 TRP A CB  1 
ATOM   3852 C  CG  . TRP A 1 472 ? 28.135  10.167  -13.127 1.00 28.65 ? 473 TRP A CG  1 
ATOM   3853 C  CD1 . TRP A 1 472 ? 27.345  9.084   -12.894 1.00 28.81 ? 473 TRP A CD1 1 
ATOM   3854 C  CD2 . TRP A 1 472 ? 28.978  9.824   -14.225 1.00 30.20 ? 473 TRP A CD2 1 
ATOM   3855 N  NE1 . TRP A 1 472 ? 27.655  8.074   -13.771 1.00 30.92 ? 473 TRP A NE1 1 
ATOM   3856 C  CE2 . TRP A 1 472 ? 28.654  8.506   -14.604 1.00 31.66 ? 473 TRP A CE2 1 
ATOM   3857 C  CE3 . TRP A 1 472 ? 29.983  10.505  -14.923 1.00 31.57 ? 473 TRP A CE3 1 
ATOM   3858 C  CZ2 . TRP A 1 472 ? 29.301  7.847   -15.652 1.00 33.42 ? 473 TRP A CZ2 1 
ATOM   3859 C  CZ3 . TRP A 1 472 ? 30.628  9.853   -15.971 1.00 34.07 ? 473 TRP A CZ3 1 
ATOM   3860 C  CH2 . TRP A 1 472 ? 30.283  8.535   -16.326 1.00 34.21 ? 473 TRP A CH2 1 
ATOM   3861 N  N   . PRO A 1 473 ? 29.631  13.768  -10.367 1.00 29.51 ? 474 PRO A N   1 
ATOM   3862 C  CA  . PRO A 1 473 ? 29.361  15.066  -9.736  1.00 31.32 ? 474 PRO A CA  1 
ATOM   3863 C  C   . PRO A 1 473 ? 28.348  15.852  -10.575 1.00 33.03 ? 474 PRO A C   1 
ATOM   3864 O  O   . PRO A 1 473 ? 28.345  15.743  -11.799 1.00 33.28 ? 474 PRO A O   1 
ATOM   3865 C  CB  . PRO A 1 473 ? 30.736  15.738  -9.681  1.00 31.44 ? 474 PRO A CB  1 
ATOM   3866 C  CG  . PRO A 1 473 ? 31.559  15.039  -10.742 1.00 30.59 ? 474 PRO A CG  1 
ATOM   3867 C  CD  . PRO A 1 473 ? 31.027  13.633  -10.819 1.00 29.49 ? 474 PRO A CD  1 
ATOM   3868 N  N   . PHE A 1 474 ? 27.456  16.584  -9.912  1.00 35.26 ? 475 PHE A N   1 
ATOM   3869 C  CA  . PHE A 1 474 ? 26.291  17.186  -10.585 1.00 36.86 ? 475 PHE A CA  1 
ATOM   3870 C  C   . PHE A 1 474 ? 26.502  18.676  -10.800 1.00 37.33 ? 475 PHE A C   1 
ATOM   3871 O  O   . PHE A 1 474 ? 27.017  19.360  -9.919  1.00 38.41 ? 475 PHE A O   1 
ATOM   3872 C  CB  . PHE A 1 474 ? 25.002  16.919  -9.779  1.00 37.40 ? 475 PHE A CB  1 
ATOM   3873 C  CG  . PHE A 1 474 ? 23.827  17.786  -10.180 1.00 39.23 ? 475 PHE A CG  1 
ATOM   3874 C  CD1 . PHE A 1 474 ? 23.191  17.606  -11.409 1.00 40.07 ? 475 PHE A CD1 1 
ATOM   3875 C  CD2 . PHE A 1 474 ? 23.342  18.777  -9.314  1.00 40.68 ? 475 PHE A CD2 1 
ATOM   3876 C  CE1 . PHE A 1 474 ? 22.096  18.413  -11.771 1.00 41.16 ? 475 PHE A CE1 1 
ATOM   3877 C  CE2 . PHE A 1 474 ? 22.256  19.591  -9.674  1.00 39.83 ? 475 PHE A CE2 1 
ATOM   3878 C  CZ  . PHE A 1 474 ? 21.632  19.405  -10.899 1.00 39.90 ? 475 PHE A CZ  1 
ATOM   3879 N  N   . PRO B 1 5   ? 71.062  14.989  -55.740 1.00 46.22 ? 6   PRO B N   1 
ATOM   3880 C  CA  . PRO B 1 5   ? 70.476  14.970  -54.394 1.00 46.06 ? 6   PRO B CA  1 
ATOM   3881 C  C   . PRO B 1 5   ? 70.573  16.328  -53.699 1.00 45.67 ? 6   PRO B C   1 
ATOM   3882 O  O   . PRO B 1 5   ? 71.668  16.903  -53.615 1.00 45.74 ? 6   PRO B O   1 
ATOM   3883 C  CB  . PRO B 1 5   ? 71.305  13.912  -53.652 1.00 45.94 ? 6   PRO B CB  1 
ATOM   3884 C  CG  . PRO B 1 5   ? 72.581  13.729  -54.474 1.00 46.55 ? 6   PRO B CG  1 
ATOM   3885 C  CD  . PRO B 1 5   ? 72.457  14.508  -55.757 1.00 46.49 ? 6   PRO B CD  1 
ATOM   3886 N  N   . ARG B 1 6   ? 69.432  16.828  -53.217 1.00 45.04 ? 7   ARG B N   1 
ATOM   3887 C  CA  . ARG B 1 6   ? 69.344  18.163  -52.605 1.00 44.46 ? 7   ARG B CA  1 
ATOM   3888 C  C   . ARG B 1 6   ? 70.114  18.271  -51.281 1.00 43.64 ? 7   ARG B C   1 
ATOM   3889 O  O   . ARG B 1 6   ? 70.325  17.254  -50.603 1.00 43.46 ? 7   ARG B O   1 
ATOM   3890 C  CB  . ARG B 1 6   ? 67.885  18.590  -52.415 1.00 44.70 ? 7   ARG B CB  1 
ATOM   3891 C  CG  . ARG B 1 6   ? 67.094  18.755  -53.712 1.00 46.29 ? 7   ARG B CG  1 
ATOM   3892 C  CD  . ARG B 1 6   ? 66.153  17.590  -53.924 1.00 48.89 ? 7   ARG B CD  1 
ATOM   3893 N  NE  . ARG B 1 6   ? 64.741  17.954  -53.772 1.00 50.46 ? 7   ARG B NE  1 
ATOM   3894 C  CZ  . ARG B 1 6   ? 63.789  17.136  -53.314 1.00 50.66 ? 7   ARG B CZ  1 
ATOM   3895 N  NH1 . ARG B 1 6   ? 64.091  15.909  -52.908 1.00 50.82 ? 7   ARG B NH1 1 
ATOM   3896 N  NH2 . ARG B 1 6   ? 62.531  17.554  -53.235 1.00 50.46 ? 7   ARG B NH2 1 
ATOM   3897 N  N   . PRO B 1 7   ? 70.564  19.499  -50.925 1.00 42.72 ? 8   PRO B N   1 
ATOM   3898 C  CA  . PRO B 1 7   ? 71.269  19.730  -49.660 1.00 41.87 ? 8   PRO B CA  1 
ATOM   3899 C  C   . PRO B 1 7   ? 70.354  19.545  -48.451 1.00 40.92 ? 8   PRO B C   1 
ATOM   3900 O  O   . PRO B 1 7   ? 69.134  19.711  -48.562 1.00 40.45 ? 8   PRO B O   1 
ATOM   3901 C  CB  . PRO B 1 7   ? 71.694  21.205  -49.746 1.00 41.76 ? 8   PRO B CB  1 
ATOM   3902 C  CG  . PRO B 1 7   ? 71.595  21.570  -51.179 1.00 42.30 ? 8   PRO B CG  1 
ATOM   3903 C  CD  . PRO B 1 7   ? 70.490  20.731  -51.733 1.00 42.82 ? 8   PRO B CD  1 
ATOM   3904 N  N   . PHE B 1 8   ? 70.962  19.216  -47.313 1.00 40.06 ? 9   PHE B N   1 
ATOM   3905 C  CA  . PHE B 1 8   ? 70.261  19.058  -46.036 1.00 39.16 ? 9   PHE B CA  1 
ATOM   3906 C  C   . PHE B 1 8   ? 69.293  20.203  -45.745 1.00 38.72 ? 9   PHE B C   1 
ATOM   3907 O  O   . PHE B 1 8   ? 68.171  19.968  -45.289 1.00 38.55 ? 9   PHE B O   1 
ATOM   3908 C  CB  . PHE B 1 8   ? 71.281  18.919  -44.897 1.00 39.04 ? 9   PHE B CB  1 
ATOM   3909 C  CG  . PHE B 1 8   ? 70.663  18.809  -43.529 1.00 38.71 ? 9   PHE B CG  1 
ATOM   3910 C  CD1 . PHE B 1 8   ? 70.144  17.598  -43.080 1.00 38.14 ? 9   PHE B CD1 1 
ATOM   3911 C  CD2 . PHE B 1 8   ? 70.618  19.918  -42.680 1.00 39.71 ? 9   PHE B CD2 1 
ATOM   3912 C  CE1 . PHE B 1 8   ? 69.584  17.485  -41.815 1.00 37.67 ? 9   PHE B CE1 1 
ATOM   3913 C  CE2 . PHE B 1 8   ? 70.055  19.821  -41.403 1.00 39.51 ? 9   PHE B CE2 1 
ATOM   3914 C  CZ  . PHE B 1 8   ? 69.533  18.596  -40.972 1.00 38.66 ? 9   PHE B CZ  1 
ATOM   3915 N  N   . ASN B 1 9   ? 69.724  21.435  -46.018 1.00 38.01 ? 10  ASN B N   1 
ATOM   3916 C  CA  . ASN B 1 9   ? 68.936  22.619  -45.688 1.00 37.44 ? 10  ASN B CA  1 
ATOM   3917 C  C   . ASN B 1 9   ? 67.659  22.783  -46.514 1.00 36.60 ? 10  ASN B C   1 
ATOM   3918 O  O   . ASN B 1 9   ? 66.819  23.617  -46.177 1.00 36.39 ? 10  ASN B O   1 
ATOM   3919 C  CB  . ASN B 1 9   ? 69.786  23.895  -45.779 1.00 38.09 ? 10  ASN B CB  1 
ATOM   3920 C  CG  . ASN B 1 9   ? 70.192  24.215  -47.202 1.00 39.43 ? 10  ASN B CG  1 
ATOM   3921 O  OD1 . ASN B 1 9   ? 71.150  23.655  -47.717 1.00 40.90 ? 10  ASN B OD1 1 
ATOM   3922 N  ND2 . ASN B 1 9   ? 69.446  25.106  -47.850 1.00 41.69 ? 10  ASN B ND2 1 
ATOM   3923 N  N   . GLU B 1 10  ? 67.510  21.997  -47.583 1.00 35.32 ? 11  GLU B N   1 
ATOM   3924 C  CA  . GLU B 1 10  ? 66.280  22.054  -48.387 1.00 34.69 ? 11  GLU B CA  1 
ATOM   3925 C  C   . GLU B 1 10  ? 65.150  21.144  -47.854 1.00 33.37 ? 11  GLU B C   1 
ATOM   3926 O  O   . GLU B 1 10  ? 63.989  21.302  -48.226 1.00 32.84 ? 11  GLU B O   1 
ATOM   3927 C  CB  . GLU B 1 10  ? 66.574  21.811  -49.875 1.00 35.10 ? 11  GLU B CB  1 
ATOM   3928 C  CG  . GLU B 1 10  ? 67.608  22.814  -50.443 1.00 37.57 ? 11  GLU B CG  1 
ATOM   3929 C  CD  . GLU B 1 10  ? 67.655  22.874  -51.960 1.00 40.96 ? 11  GLU B CD  1 
ATOM   3930 O  OE1 . GLU B 1 10  ? 67.098  21.967  -52.619 1.00 43.06 ? 11  GLU B OE1 1 
ATOM   3931 O  OE2 . GLU B 1 10  ? 68.262  23.834  -52.495 1.00 42.16 ? 11  GLU B OE2 1 
ATOM   3932 N  N   . ILE B 1 11  ? 65.494  20.217  -46.962 1.00 32.04 ? 12  ILE B N   1 
ATOM   3933 C  CA  . ILE B 1 11  ? 64.484  19.415  -46.261 1.00 30.71 ? 12  ILE B CA  1 
ATOM   3934 C  C   . ILE B 1 11  ? 63.504  20.374  -45.586 1.00 29.93 ? 12  ILE B C   1 
ATOM   3935 O  O   . ILE B 1 11  ? 63.934  21.265  -44.874 1.00 29.90 ? 12  ILE B O   1 
ATOM   3936 C  CB  . ILE B 1 11  ? 65.140  18.473  -45.216 1.00 30.53 ? 12  ILE B CB  1 
ATOM   3937 C  CG1 . ILE B 1 11  ? 65.990  17.423  -45.929 1.00 28.91 ? 12  ILE B CG1 1 
ATOM   3938 C  CG2 . ILE B 1 11  ? 64.071  17.793  -44.325 1.00 30.54 ? 12  ILE B CG2 1 
ATOM   3939 C  CD1 . ILE B 1 11  ? 66.993  16.714  -45.050 1.00 28.20 ? 12  ILE B CD1 1 
ATOM   3940 N  N   . PRO B 1 12  ? 62.188  20.211  -45.833 1.00 29.73 ? 13  PRO B N   1 
ATOM   3941 C  CA  . PRO B 1 12  ? 61.192  21.070  -45.202 1.00 29.63 ? 13  PRO B CA  1 
ATOM   3942 C  C   . PRO B 1 12  ? 61.378  21.171  -43.677 1.00 29.94 ? 13  PRO B C   1 
ATOM   3943 O  O   . PRO B 1 12  ? 61.802  20.200  -43.026 1.00 29.03 ? 13  PRO B O   1 
ATOM   3944 C  CB  . PRO B 1 12  ? 59.875  20.363  -45.525 1.00 29.72 ? 13  PRO B CB  1 
ATOM   3945 C  CG  . PRO B 1 12  ? 60.138  19.680  -46.808 1.00 29.31 ? 13  PRO B CG  1 
ATOM   3946 C  CD  . PRO B 1 12  ? 61.569  19.264  -46.782 1.00 29.56 ? 13  PRO B CD  1 
ATOM   3947 N  N   . SER B 1 13  ? 61.056  22.341  -43.134 1.00 29.98 ? 14  SER B N   1 
ATOM   3948 C  CA  . SER B 1 13  ? 61.329  22.665  -41.736 1.00 30.68 ? 14  SER B CA  1 
ATOM   3949 C  C   . SER B 1 13  ? 60.484  23.847  -41.287 1.00 30.93 ? 14  SER B C   1 
ATOM   3950 O  O   . SER B 1 13  ? 60.202  24.729  -42.088 1.00 30.84 ? 14  SER B O   1 
ATOM   3951 C  CB  . SER B 1 13  ? 62.803  23.034  -41.585 1.00 30.52 ? 14  SER B CB  1 
ATOM   3952 O  OG  . SER B 1 13  ? 63.096  23.460  -40.267 1.00 31.58 ? 14  SER B OG  1 
ATOM   3953 N  N   . PRO B 1 14  ? 60.080  23.878  -40.000 1.00 31.65 ? 15  PRO B N   1 
ATOM   3954 C  CA  . PRO B 1 14  ? 59.468  25.114  -39.472 1.00 31.79 ? 15  PRO B CA  1 
ATOM   3955 C  C   . PRO B 1 14  ? 60.458  26.274  -39.380 1.00 31.90 ? 15  PRO B C   1 
ATOM   3956 O  O   . PRO B 1 14  ? 60.038  27.421  -39.216 1.00 33.24 ? 15  PRO B O   1 
ATOM   3957 C  CB  . PRO B 1 14  ? 59.004  24.710  -38.066 1.00 31.95 ? 15  PRO B CB  1 
ATOM   3958 C  CG  . PRO B 1 14  ? 59.880  23.518  -37.708 1.00 31.96 ? 15  PRO B CG  1 
ATOM   3959 C  CD  . PRO B 1 14  ? 60.053  22.786  -39.006 1.00 31.33 ? 15  PRO B CD  1 
ATOM   3960 N  N   . GLY B 1 15  ? 61.752  25.980  -39.476 1.00 31.48 ? 16  GLY B N   1 
ATOM   3961 C  CA  . GLY B 1 15  ? 62.794  27.004  -39.387 1.00 31.20 ? 16  GLY B CA  1 
ATOM   3962 C  C   . GLY B 1 15  ? 63.980  26.582  -38.535 1.00 30.71 ? 16  GLY B C   1 
ATOM   3963 O  O   . GLY B 1 15  ? 63.954  25.523  -37.894 1.00 30.54 ? 16  GLY B O   1 
ATOM   3964 N  N   . ASP B 1 16  ? 65.012  27.421  -38.512 1.00 30.25 ? 17  ASP B N   1 
ATOM   3965 C  CA  . ASP B 1 16  ? 66.285  27.084  -37.870 1.00 30.36 ? 17  ASP B CA  1 
ATOM   3966 C  C   . ASP B 1 16  ? 66.391  27.468  -36.407 1.00 29.23 ? 17  ASP B C   1 
ATOM   3967 O  O   . ASP B 1 16  ? 67.329  27.067  -35.725 1.00 29.75 ? 17  ASP B O   1 
ATOM   3968 C  CB  . ASP B 1 16  ? 67.443  27.727  -38.623 1.00 31.56 ? 17  ASP B CB  1 
ATOM   3969 C  CG  . ASP B 1 16  ? 67.802  26.973  -39.877 1.00 34.64 ? 17  ASP B CG  1 
ATOM   3970 O  OD1 . ASP B 1 16  ? 67.957  25.730  -39.814 1.00 38.72 ? 17  ASP B OD1 1 
ATOM   3971 O  OD2 . ASP B 1 16  ? 67.930  27.624  -40.931 1.00 39.57 ? 17  ASP B OD2 1 
ATOM   3972 N  N   . ASN B 1 17  ? 65.449  28.258  -35.925 1.00 28.02 ? 18  ASN B N   1 
ATOM   3973 C  CA  . ASN B 1 17  ? 65.473  28.660  -34.530 1.00 27.17 ? 18  ASN B CA  1 
ATOM   3974 C  C   . ASN B 1 17  ? 64.792  27.635  -33.620 1.00 25.98 ? 18  ASN B C   1 
ATOM   3975 O  O   . ASN B 1 17  ? 63.565  27.586  -33.513 1.00 25.81 ? 18  ASN B O   1 
ATOM   3976 C  CB  . ASN B 1 17  ? 64.895  30.068  -34.350 1.00 26.58 ? 18  ASN B CB  1 
ATOM   3977 C  CG  . ASN B 1 17  ? 65.118  30.600  -32.948 1.00 28.10 ? 18  ASN B CG  1 
ATOM   3978 O  OD1 . ASN B 1 17  ? 65.181  29.826  -31.986 1.00 25.59 ? 18  ASN B OD1 1 
ATOM   3979 N  ND2 . ASN B 1 17  ? 65.238  31.925  -32.823 1.00 27.18 ? 18  ASN B ND2 1 
ATOM   3980 N  N   . GLY B 1 18  ? 65.622  26.819  -32.979 1.00 25.66 ? 19  GLY B N   1 
ATOM   3981 C  CA  . GLY B 1 18  ? 65.185  25.769  -32.058 1.00 25.33 ? 19  GLY B CA  1 
ATOM   3982 C  C   . GLY B 1 18  ? 64.313  26.236  -30.907 1.00 25.06 ? 19  GLY B C   1 
ATOM   3983 O  O   . GLY B 1 18  ? 63.379  25.528  -30.510 1.00 25.42 ? 19  GLY B O   1 
ATOM   3984 N  N   . TRP B 1 19  ? 64.604  27.427  -30.374 1.00 24.04 ? 20  TRP B N   1 
ATOM   3985 C  CA  . TRP B 1 19  ? 63.868  27.949  -29.216 1.00 23.65 ? 20  TRP B CA  1 
ATOM   3986 C  C   . TRP B 1 19  ? 62.500  28.468  -29.616 1.00 23.07 ? 20  TRP B C   1 
ATOM   3987 O  O   . TRP B 1 19  ? 61.524  28.286  -28.891 1.00 22.97 ? 20  TRP B O   1 
ATOM   3988 C  CB  . TRP B 1 19  ? 64.690  29.031  -28.476 1.00 23.76 ? 20  TRP B CB  1 
ATOM   3989 C  CG  . TRP B 1 19  ? 66.012  28.502  -28.076 1.00 24.27 ? 20  TRP B CG  1 
ATOM   3990 C  CD1 . TRP B 1 19  ? 67.242  28.845  -28.596 1.00 25.35 ? 20  TRP B CD1 1 
ATOM   3991 C  CD2 . TRP B 1 19  ? 66.253  27.463  -27.123 1.00 24.98 ? 20  TRP B CD2 1 
ATOM   3992 N  NE1 . TRP B 1 19  ? 68.223  28.094  -27.995 1.00 27.12 ? 20  TRP B NE1 1 
ATOM   3993 C  CE2 . TRP B 1 19  ? 67.642  27.243  -27.086 1.00 24.94 ? 20  TRP B CE2 1 
ATOM   3994 C  CE3 . TRP B 1 19  ? 65.423  26.703  -26.283 1.00 26.44 ? 20  TRP B CE3 1 
ATOM   3995 C  CZ2 . TRP B 1 19  ? 68.223  26.290  -26.247 1.00 27.75 ? 20  TRP B CZ2 1 
ATOM   3996 C  CZ3 . TRP B 1 19  ? 66.006  25.755  -25.440 1.00 26.21 ? 20  TRP B CZ3 1 
ATOM   3997 C  CH2 . TRP B 1 19  ? 67.385  25.551  -25.441 1.00 26.01 ? 20  TRP B CH2 1 
ATOM   3998 N  N   . LEU B 1 20  ? 62.439  29.122  -30.771 1.00 22.77 ? 21  LEU B N   1 
ATOM   3999 C  CA  . LEU B 1 20  ? 61.175  29.560  -31.338 1.00 22.24 ? 21  LEU B CA  1 
ATOM   4000 C  C   . LEU B 1 20  ? 60.328  28.349  -31.750 1.00 21.29 ? 21  LEU B C   1 
ATOM   4001 O  O   . LEU B 1 20  ? 59.108  28.355  -31.578 1.00 21.61 ? 21  LEU B O   1 
ATOM   4002 C  CB  . LEU B 1 20  ? 61.412  30.471  -32.561 1.00 22.32 ? 21  LEU B CB  1 
ATOM   4003 C  CG  . LEU B 1 20  ? 60.159  31.110  -33.195 1.00 24.75 ? 21  LEU B CG  1 
ATOM   4004 C  CD1 . LEU B 1 20  ? 59.384  32.029  -32.199 1.00 25.50 ? 21  LEU B CD1 1 
ATOM   4005 C  CD2 . LEU B 1 20  ? 60.537  31.895  -34.440 1.00 27.14 ? 21  LEU B CD2 1 
ATOM   4006 N  N   . ASN B 1 21  ? 60.960  27.329  -32.319 1.00 20.52 ? 22  ASN B N   1 
ATOM   4007 C  CA  . ASN B 1 21  ? 60.239  26.088  -32.648 1.00 20.36 ? 22  ASN B CA  1 
ATOM   4008 C  C   . ASN B 1 21  ? 59.635  25.446  -31.394 1.00 20.78 ? 22  ASN B C   1 
ATOM   4009 O  O   . ASN B 1 21  ? 58.473  25.022  -31.386 1.00 20.13 ? 22  ASN B O   1 
ATOM   4010 C  CB  . ASN B 1 21  ? 61.162  25.094  -33.340 1.00 20.19 ? 22  ASN B CB  1 
ATOM   4011 C  CG  . ASN B 1 21  ? 61.563  25.537  -34.723 1.00 20.95 ? 22  ASN B CG  1 
ATOM   4012 O  OD1 . ASN B 1 21  ? 60.886  26.350  -35.345 1.00 22.07 ? 22  ASN B OD1 1 
ATOM   4013 N  ND2 . ASN B 1 21  ? 62.672  25.010  -35.213 1.00 22.39 ? 22  ASN B ND2 1 
ATOM   4014 N  N   . LEU B 1 22  ? 60.433  25.405  -30.330 1.00 20.86 ? 23  LEU B N   1 
ATOM   4015 C  CA  . LEU B 1 22  ? 59.991  24.864  -29.047 1.00 22.09 ? 23  LEU B CA  1 
ATOM   4016 C  C   . LEU B 1 22  ? 58.811  25.660  -28.498 1.00 22.30 ? 23  LEU B C   1 
ATOM   4017 O  O   . LEU B 1 22  ? 57.840  25.086  -28.004 1.00 23.10 ? 23  LEU B O   1 
ATOM   4018 C  CB  . LEU B 1 22  ? 61.161  24.847  -28.049 1.00 21.33 ? 23  LEU B CB  1 
ATOM   4019 C  CG  . LEU B 1 22  ? 61.041  23.991  -26.783 1.00 22.05 ? 23  LEU B CG  1 
ATOM   4020 C  CD1 . LEU B 1 22  ? 60.685  22.529  -27.116 1.00 22.07 ? 23  LEU B CD1 1 
ATOM   4021 C  CD2 . LEU B 1 22  ? 62.341  24.072  -25.976 1.00 19.63 ? 23  LEU B CD2 1 
ATOM   4022 N  N   . TYR B 1 23  ? 58.882  26.984  -28.606 1.00 23.10 ? 24  TYR B N   1 
ATOM   4023 C  CA  . TYR B 1 23  ? 57.804  27.841  -28.135 1.00 23.85 ? 24  TYR B CA  1 
ATOM   4024 C  C   . TYR B 1 23  ? 56.482  27.554  -28.866 1.00 23.75 ? 24  TYR B C   1 
ATOM   4025 O  O   . TYR B 1 23  ? 55.416  27.497  -28.255 1.00 23.52 ? 24  TYR B O   1 
ATOM   4026 C  CB  . TYR B 1 23  ? 58.199  29.331  -28.253 1.00 24.43 ? 24  TYR B CB  1 
ATOM   4027 C  CG  . TYR B 1 23  ? 57.036  30.277  -28.079 1.00 26.80 ? 24  TYR B CG  1 
ATOM   4028 C  CD1 . TYR B 1 23  ? 56.446  30.475  -26.824 1.00 30.55 ? 24  TYR B CD1 1 
ATOM   4029 C  CD2 . TYR B 1 23  ? 56.511  30.961  -29.169 1.00 30.06 ? 24  TYR B CD2 1 
ATOM   4030 C  CE1 . TYR B 1 23  ? 55.356  31.337  -26.662 1.00 32.65 ? 24  TYR B CE1 1 
ATOM   4031 C  CE2 . TYR B 1 23  ? 55.427  31.830  -29.022 1.00 33.56 ? 24  TYR B CE2 1 
ATOM   4032 C  CZ  . TYR B 1 23  ? 54.859  32.013  -27.770 1.00 34.65 ? 24  TYR B CZ  1 
ATOM   4033 O  OH  . TYR B 1 23  ? 53.792  32.866  -27.643 1.00 37.51 ? 24  TYR B OH  1 
ATOM   4034 N  N   . HIS B 1 24  ? 56.552  27.371  -30.175 1.00 23.69 ? 25  HIS B N   1 
ATOM   4035 C  CA  . HIS B 1 24  ? 55.343  27.090  -30.938 1.00 24.56 ? 25  HIS B CA  1 
ATOM   4036 C  C   . HIS B 1 24  ? 54.800  25.697  -30.627 1.00 23.78 ? 25  HIS B C   1 
ATOM   4037 O  O   . HIS B 1 24  ? 53.598  25.519  -30.556 1.00 23.67 ? 25  HIS B O   1 
ATOM   4038 C  CB  . HIS B 1 24  ? 55.579  27.261  -32.436 1.00 24.82 ? 25  HIS B CB  1 
ATOM   4039 C  CG  . HIS B 1 24  ? 55.760  28.689  -32.849 1.00 28.15 ? 25  HIS B CG  1 
ATOM   4040 N  ND1 . HIS B 1 24  ? 54.825  29.667  -32.573 1.00 30.27 ? 25  HIS B ND1 1 
ATOM   4041 C  CD2 . HIS B 1 24  ? 56.761  29.305  -33.520 1.00 29.21 ? 25  HIS B CD2 1 
ATOM   4042 C  CE1 . HIS B 1 24  ? 55.246  30.825  -33.051 1.00 29.98 ? 25  HIS B CE1 1 
ATOM   4043 N  NE2 . HIS B 1 24  ? 56.419  30.632  -33.631 1.00 30.61 ? 25  HIS B NE2 1 
ATOM   4044 N  N   . PHE B 1 25  ? 55.696  24.732  -30.430 1.00 23.41 ? 26  PHE B N   1 
ATOM   4045 C  CA  . PHE B 1 25  ? 55.303  23.377  -30.056 1.00 23.28 ? 26  PHE B CA  1 
ATOM   4046 C  C   . PHE B 1 25  ? 54.535  23.395  -28.717 1.00 23.40 ? 26  PHE B C   1 
ATOM   4047 O  O   . PHE B 1 25  ? 53.397  22.945  -28.670 1.00 22.96 ? 26  PHE B O   1 
ATOM   4048 C  CB  . PHE B 1 25  ? 56.526  22.455  -30.050 1.00 22.84 ? 26  PHE B CB  1 
ATOM   4049 C  CG  . PHE B 1 25  ? 56.319  21.144  -29.348 1.00 22.76 ? 26  PHE B CG  1 
ATOM   4050 C  CD1 . PHE B 1 25  ? 55.164  20.391  -29.543 1.00 22.50 ? 26  PHE B CD1 1 
ATOM   4051 C  CD2 . PHE B 1 25  ? 57.316  20.638  -28.514 1.00 22.79 ? 26  PHE B CD2 1 
ATOM   4052 C  CE1 . PHE B 1 25  ? 54.990  19.175  -28.888 1.00 21.67 ? 26  PHE B CE1 1 
ATOM   4053 C  CE2 . PHE B 1 25  ? 57.153  19.427  -27.864 1.00 23.43 ? 26  PHE B CE2 1 
ATOM   4054 C  CZ  . PHE B 1 25  ? 55.994  18.691  -28.050 1.00 22.08 ? 26  PHE B CZ  1 
ATOM   4055 N  N   . TRP B 1 26  ? 55.117  23.977  -27.671 1.00 23.75 ? 27  TRP B N   1 
ATOM   4056 C  CA  . TRP B 1 26  ? 54.425  24.072  -26.370 1.00 24.42 ? 27  TRP B CA  1 
ATOM   4057 C  C   . TRP B 1 26  ? 53.097  24.797  -26.450 1.00 25.84 ? 27  TRP B C   1 
ATOM   4058 O  O   . TRP B 1 26  ? 52.124  24.345  -25.865 1.00 25.97 ? 27  TRP B O   1 
ATOM   4059 C  CB  . TRP B 1 26  ? 55.301  24.709  -25.276 1.00 23.86 ? 27  TRP B CB  1 
ATOM   4060 C  CG  . TRP B 1 26  ? 56.544  23.925  -24.955 1.00 21.82 ? 27  TRP B CG  1 
ATOM   4061 C  CD1 . TRP B 1 26  ? 56.845  22.677  -25.386 1.00 20.69 ? 27  TRP B CD1 1 
ATOM   4062 C  CD2 . TRP B 1 26  ? 57.643  24.343  -24.132 1.00 21.41 ? 27  TRP B CD2 1 
ATOM   4063 N  NE1 . TRP B 1 26  ? 58.067  22.288  -24.901 1.00 22.41 ? 27  TRP B NE1 1 
ATOM   4064 C  CE2 . TRP B 1 26  ? 58.576  23.291  -24.122 1.00 21.77 ? 27  TRP B CE2 1 
ATOM   4065 C  CE3 . TRP B 1 26  ? 57.929  25.510  -23.407 1.00 23.59 ? 27  TRP B CE3 1 
ATOM   4066 C  CZ2 . TRP B 1 26  ? 59.780  23.357  -23.409 1.00 23.57 ? 27  TRP B CZ2 1 
ATOM   4067 C  CZ3 . TRP B 1 26  ? 59.119  25.584  -22.701 1.00 23.66 ? 27  TRP B CZ3 1 
ATOM   4068 C  CH2 . TRP B 1 26  ? 60.036  24.514  -22.710 1.00 24.19 ? 27  TRP B CH2 1 
ATOM   4069 N  N   . ARG B 1 27  ? 53.061  25.911  -27.181 1.00 27.64 ? 28  ARG B N   1 
ATOM   4070 C  CA  . ARG B 1 27  ? 51.868  26.757  -27.251 1.00 29.80 ? 28  ARG B CA  1 
ATOM   4071 C  C   . ARG B 1 27  ? 50.700  26.121  -28.006 1.00 29.81 ? 28  ARG B C   1 
ATOM   4072 O  O   . ARG B 1 27  ? 49.561  26.189  -27.553 1.00 29.67 ? 28  ARG B O   1 
ATOM   4073 C  CB  . ARG B 1 27  ? 52.199  28.141  -27.854 1.00 30.68 ? 28  ARG B CB  1 
ATOM   4074 C  CG  . ARG B 1 27  ? 51.162  29.221  -27.488 1.00 34.56 ? 28  ARG B CG  1 
ATOM   4075 C  CD  . ARG B 1 27  ? 51.317  30.514  -28.284 1.00 40.43 ? 28  ARG B CD  1 
ATOM   4076 N  NE  . ARG B 1 27  ? 50.887  30.355  -29.672 1.00 44.71 ? 28  ARG B NE  1 
ATOM   4077 C  CZ  . ARG B 1 27  ? 51.713  30.276  -30.711 1.00 45.90 ? 28  ARG B CZ  1 
ATOM   4078 N  NH1 . ARG B 1 27  ? 53.022  30.352  -30.525 1.00 47.57 ? 28  ARG B NH1 1 
ATOM   4079 N  NH2 . ARG B 1 27  ? 51.231  30.127  -31.938 1.00 46.94 ? 28  ARG B NH2 1 
ATOM   4080 N  N   . GLU B 1 28  ? 50.989  25.512  -29.153 1.00 30.50 ? 29  GLU B N   1 
ATOM   4081 C  CA  . GLU B 1 28  ? 49.948  25.004  -30.044 1.00 31.53 ? 29  GLU B CA  1 
ATOM   4082 C  C   . GLU B 1 28  ? 49.518  23.595  -29.664 1.00 31.16 ? 29  GLU B C   1 
ATOM   4083 O  O   . GLU B 1 28  ? 48.329  23.278  -29.681 1.00 31.43 ? 29  GLU B O   1 
ATOM   4084 C  CB  . GLU B 1 28  ? 50.431  25.007  -31.497 1.00 32.16 ? 29  GLU B CB  1 
ATOM   4085 C  CG  . GLU B 1 28  ? 50.616  26.412  -32.090 1.00 36.61 ? 29  GLU B CG  1 
ATOM   4086 C  CD  . GLU B 1 28  ? 51.602  26.443  -33.262 1.00 42.17 ? 29  GLU B CD  1 
ATOM   4087 O  OE1 . GLU B 1 28  ? 51.534  25.566  -34.160 1.00 43.50 ? 29  GLU B OE1 1 
ATOM   4088 O  OE2 . GLU B 1 28  ? 52.451  27.364  -33.288 1.00 45.04 ? 29  GLU B OE2 1 
ATOM   4089 N  N   . THR B 1 29  ? 50.488  22.753  -29.320 1.00 30.33 ? 30  THR B N   1 
ATOM   4090 C  CA  . THR B 1 29  ? 50.214  21.331  -29.156 1.00 29.90 ? 30  THR B CA  1 
ATOM   4091 C  C   . THR B 1 29  ? 50.423  20.854  -27.726 1.00 29.08 ? 30  THR B C   1 
ATOM   4092 O  O   . THR B 1 29  ? 49.581  20.160  -27.184 1.00 28.98 ? 30  THR B O   1 
ATOM   4093 C  CB  . THR B 1 29  ? 51.036  20.505  -30.156 1.00 29.63 ? 30  THR B CB  1 
ATOM   4094 O  OG1 . THR B 1 29  ? 50.793  21.026  -31.465 1.00 30.61 ? 30  THR B OG1 1 
ATOM   4095 C  CG2 . THR B 1 29  ? 50.624  19.039  -30.133 1.00 29.73 ? 30  THR B CG2 1 
ATOM   4096 N  N   . GLY B 1 30  ? 51.531  21.242  -27.109 1.00 28.52 ? 31  GLY B N   1 
ATOM   4097 C  CA  . GLY B 1 30  ? 51.770  20.826  -25.749 1.00 27.90 ? 31  GLY B CA  1 
ATOM   4098 C  C   . GLY B 1 30  ? 52.718  19.652  -25.657 1.00 27.80 ? 31  GLY B C   1 
ATOM   4099 O  O   . GLY B 1 30  ? 52.674  18.700  -26.449 1.00 26.86 ? 31  GLY B O   1 
ATOM   4100 N  N   . THR B 1 31  ? 53.574  19.738  -24.655 1.00 27.76 ? 32  THR B N   1 
ATOM   4101 C  CA  . THR B 1 31  ? 54.624  18.775  -24.419 1.00 28.43 ? 32  THR B CA  1 
ATOM   4102 C  C   . THR B 1 31  ? 54.097  17.326  -24.258 1.00 27.72 ? 32  THR B C   1 
ATOM   4103 O  O   . THR B 1 31  ? 54.768  16.367  -24.662 1.00 27.67 ? 32  THR B O   1 
ATOM   4104 C  CB  . THR B 1 31  ? 55.486  19.273  -23.224 1.00 29.43 ? 32  THR B CB  1 
ATOM   4105 O  OG1 . THR B 1 31  ? 56.783  18.658  -23.249 1.00 32.77 ? 32  THR B OG1 1 
ATOM   4106 C  CG2 . THR B 1 31  ? 54.779  19.079  -21.889 1.00 28.61 ? 32  THR B CG2 1 
ATOM   4107 N  N   . HIS B 1 32  ? 52.876  17.185  -23.738 1.00 25.80 ? 33  HIS B N   1 
ATOM   4108 C  CA  . HIS B 1 32  ? 52.280  15.879  -23.508 1.00 25.60 ? 33  HIS B CA  1 
ATOM   4109 C  C   . HIS B 1 32  ? 51.540  15.326  -24.748 1.00 24.11 ? 33  HIS B C   1 
ATOM   4110 O  O   . HIS B 1 32  ? 50.908  14.276  -24.678 1.00 22.76 ? 33  HIS B O   1 
ATOM   4111 C  CB  . HIS B 1 32  ? 51.352  15.917  -22.267 1.00 26.20 ? 33  HIS B CB  1 
ATOM   4112 C  CG  . HIS B 1 32  ? 52.089  16.116  -20.975 1.00 29.52 ? 33  HIS B CG  1 
ATOM   4113 N  ND1 . HIS B 1 32  ? 52.766  15.095  -20.336 1.00 30.99 ? 33  HIS B ND1 1 
ATOM   4114 C  CD2 . HIS B 1 32  ? 52.270  17.222  -20.210 1.00 32.09 ? 33  HIS B CD2 1 
ATOM   4115 C  CE1 . HIS B 1 32  ? 53.327  15.563  -19.233 1.00 32.13 ? 33  HIS B CE1 1 
ATOM   4116 N  NE2 . HIS B 1 32  ? 53.047  16.850  -19.136 1.00 32.63 ? 33  HIS B NE2 1 
ATOM   4117 N  N   . LYS B 1 33  ? 51.653  16.034  -25.877 1.00 23.19 ? 34  LYS B N   1 
ATOM   4118 C  CA  . LYS B 1 33  ? 51.007  15.639  -27.129 1.00 22.23 ? 34  LYS B CA  1 
ATOM   4119 C  C   . LYS B 1 33  ? 52.008  15.628  -28.289 1.00 21.43 ? 34  LYS B C   1 
ATOM   4120 O  O   . LYS B 1 33  ? 51.673  15.956  -29.429 1.00 20.09 ? 34  LYS B O   1 
ATOM   4121 C  CB  . LYS B 1 33  ? 49.835  16.580  -27.455 1.00 22.48 ? 34  LYS B CB  1 
ATOM   4122 C  CG  . LYS B 1 33  ? 48.684  16.600  -26.426 1.00 24.91 ? 34  LYS B CG  1 
ATOM   4123 C  CD  . LYS B 1 33  ? 47.944  15.254  -26.361 1.00 27.65 ? 34  LYS B CD  1 
ATOM   4124 C  CE  . LYS B 1 33  ? 46.731  15.314  -25.434 1.00 28.90 ? 34  LYS B CE  1 
ATOM   4125 N  NZ  . LYS B 1 33  ? 46.099  13.986  -25.262 1.00 29.57 ? 34  LYS B NZ  1 
ATOM   4126 N  N   . VAL B 1 34  ? 53.239  15.242  -28.002 1.00 21.13 ? 35  VAL B N   1 
ATOM   4127 C  CA  . VAL B 1 34  ? 54.272  15.222  -29.030 1.00 21.50 ? 35  VAL B CA  1 
ATOM   4128 C  C   . VAL B 1 34  ? 53.907  14.276  -30.202 1.00 21.33 ? 35  VAL B C   1 
ATOM   4129 O  O   . VAL B 1 34  ? 54.273  14.543  -31.347 1.00 20.93 ? 35  VAL B O   1 
ATOM   4130 C  CB  . VAL B 1 34  ? 55.652  14.874  -28.439 1.00 22.21 ? 35  VAL B CB  1 
ATOM   4131 C  CG1 . VAL B 1 34  ? 55.692  13.443  -27.997 1.00 22.12 ? 35  VAL B CG1 1 
ATOM   4132 C  CG2 . VAL B 1 34  ? 56.782  15.142  -29.466 1.00 24.02 ? 35  VAL B CG2 1 
ATOM   4133 N  N   . HIS B 1 35  ? 53.187  13.188  -29.911 1.00 20.51 ? 36  HIS B N   1 
ATOM   4134 C  CA  . HIS B 1 35  ? 52.728  12.263  -30.956 1.00 21.26 ? 36  HIS B CA  1 
ATOM   4135 C  C   . HIS B 1 35  ? 51.830  12.971  -31.974 1.00 21.53 ? 36  HIS B C   1 
ATOM   4136 O  O   . HIS B 1 35  ? 51.937  12.721  -33.171 1.00 21.10 ? 36  HIS B O   1 
ATOM   4137 C  CB  . HIS B 1 35  ? 52.023  11.029  -30.356 1.00 20.54 ? 36  HIS B CB  1 
ATOM   4138 C  CG  . HIS B 1 35  ? 50.912  11.362  -29.410 1.00 20.89 ? 36  HIS B CG  1 
ATOM   4139 N  ND1 . HIS B 1 35  ? 51.115  12.070  -28.243 1.00 18.28 ? 36  HIS B ND1 1 
ATOM   4140 C  CD2 . HIS B 1 35  ? 49.588  11.083  -29.457 1.00 19.70 ? 36  HIS B CD2 1 
ATOM   4141 C  CE1 . HIS B 1 35  ? 49.967  12.201  -27.608 1.00 18.80 ? 36  HIS B CE1 1 
ATOM   4142 N  NE2 . HIS B 1 35  ? 49.024  11.619  -28.325 1.00 20.44 ? 36  HIS B NE2 1 
ATOM   4143 N  N   . LEU B 1 36  ? 50.966  13.863  -31.488 1.00 21.87 ? 37  LEU B N   1 
ATOM   4144 C  CA  . LEU B 1 36  ? 50.093  14.647  -32.363 1.00 22.52 ? 37  LEU B CA  1 
ATOM   4145 C  C   . LEU B 1 36  ? 50.881  15.670  -33.153 1.00 22.18 ? 37  LEU B C   1 
ATOM   4146 O  O   . LEU B 1 36  ? 50.574  15.945  -34.312 1.00 22.31 ? 37  LEU B O   1 
ATOM   4147 C  CB  . LEU B 1 36  ? 48.989  15.338  -31.576 1.00 22.07 ? 37  LEU B CB  1 
ATOM   4148 C  CG  . LEU B 1 36  ? 48.040  14.428  -30.788 1.00 23.51 ? 37  LEU B CG  1 
ATOM   4149 C  CD1 . LEU B 1 36  ? 46.906  15.282  -30.248 1.00 24.98 ? 37  LEU B CD1 1 
ATOM   4150 C  CD2 . LEU B 1 36  ? 47.498  13.212  -31.625 1.00 24.26 ? 37  LEU B CD2 1 
ATOM   4151 N  N   . HIS B 1 37  ? 51.907  16.214  -32.519 1.00 22.15 ? 38  HIS B N   1 
ATOM   4152 C  CA  . HIS B 1 37  ? 52.825  17.154  -33.155 1.00 21.94 ? 38  HIS B CA  1 
ATOM   4153 C  C   . HIS B 1 37  ? 53.454  16.490  -34.384 1.00 22.12 ? 38  HIS B C   1 
ATOM   4154 O  O   . HIS B 1 37  ? 53.550  17.117  -35.446 1.00 21.87 ? 38  HIS B O   1 
ATOM   4155 C  CB  . HIS B 1 37  ? 53.892  17.578  -32.138 1.00 22.16 ? 38  HIS B CB  1 
ATOM   4156 C  CG  . HIS B 1 37  ? 54.946  18.487  -32.685 1.00 22.74 ? 38  HIS B CG  1 
ATOM   4157 N  ND1 . HIS B 1 37  ? 54.678  19.770  -33.111 1.00 24.11 ? 38  HIS B ND1 1 
ATOM   4158 C  CD2 . HIS B 1 37  ? 56.281  18.310  -32.838 1.00 25.46 ? 38  HIS B CD2 1 
ATOM   4159 C  CE1 . HIS B 1 37  ? 55.801  20.338  -33.521 1.00 24.78 ? 38  HIS B CE1 1 
ATOM   4160 N  NE2 . HIS B 1 37  ? 56.789  19.475  -33.364 1.00 23.86 ? 38  HIS B NE2 1 
ATOM   4161 N  N   . HIS B 1 38  ? 53.874  15.233  -34.240 1.00 21.31 ? 39  HIS B N   1 
ATOM   4162 C  CA  . HIS B 1 38  ? 54.432  14.480  -35.365 1.00 22.30 ? 39  HIS B CA  1 
ATOM   4163 C  C   . HIS B 1 38  ? 53.419  14.310  -36.483 1.00 22.46 ? 39  HIS B C   1 
ATOM   4164 O  O   . HIS B 1 38  ? 53.729  14.610  -37.633 1.00 23.04 ? 39  HIS B O   1 
ATOM   4165 C  CB  . HIS B 1 38  ? 54.940  13.114  -34.926 1.00 21.98 ? 39  HIS B CB  1 
ATOM   4166 C  CG  . HIS B 1 38  ? 56.061  13.189  -33.939 1.00 22.13 ? 39  HIS B CG  1 
ATOM   4167 N  ND1 . HIS B 1 38  ? 56.374  12.150  -33.087 1.00 19.31 ? 39  HIS B ND1 1 
ATOM   4168 C  CD2 . HIS B 1 38  ? 56.935  14.189  -33.660 1.00 20.27 ? 39  HIS B CD2 1 
ATOM   4169 C  CE1 . HIS B 1 38  ? 57.410  12.504  -32.341 1.00 21.37 ? 39  HIS B CE1 1 
ATOM   4170 N  NE2 . HIS B 1 38  ? 57.764  13.736  -32.664 1.00 19.96 ? 39  HIS B NE2 1 
ATOM   4171 N  N   . VAL B 1 39  ? 52.206  13.877  -36.133 1.00 22.45 ? 40  VAL B N   1 
ATOM   4172 C  CA  . VAL B 1 39  ? 51.130  13.671  -37.122 1.00 22.81 ? 40  VAL B CA  1 
ATOM   4173 C  C   . VAL B 1 39  ? 50.881  14.950  -37.940 1.00 23.25 ? 40  VAL B C   1 
ATOM   4174 O  O   . VAL B 1 39  ? 50.871  14.904  -39.172 1.00 22.35 ? 40  VAL B O   1 
ATOM   4175 C  CB  . VAL B 1 39  ? 49.825  13.150  -36.461 1.00 22.32 ? 40  VAL B CB  1 
ATOM   4176 C  CG1 . VAL B 1 39  ? 48.633  13.183  -37.429 1.00 22.57 ? 40  VAL B CG1 1 
ATOM   4177 C  CG2 . VAL B 1 39  ? 50.030  11.753  -35.945 1.00 22.23 ? 40  VAL B CG2 1 
ATOM   4178 N  N   . GLN B 1 40  ? 50.699  16.073  -37.238 1.00 23.55 ? 41  GLN B N   1 
ATOM   4179 C  CA  . GLN B 1 40  ? 50.450  17.368  -37.871 1.00 24.60 ? 41  GLN B CA  1 
ATOM   4180 C  C   . GLN B 1 40  ? 51.604  17.836  -38.761 1.00 24.26 ? 41  GLN B C   1 
ATOM   4181 O  O   . GLN B 1 40  ? 51.359  18.430  -39.801 1.00 24.71 ? 41  GLN B O   1 
ATOM   4182 C  CB  . GLN B 1 40  ? 50.128  18.448  -36.831 1.00 24.57 ? 41  GLN B CB  1 
ATOM   4183 C  CG  . GLN B 1 40  ? 48.812  18.233  -36.072 1.00 28.20 ? 41  GLN B CG  1 
ATOM   4184 C  CD  . GLN B 1 40  ? 48.811  18.885  -34.690 1.00 32.29 ? 41  GLN B CD  1 
ATOM   4185 O  OE1 . GLN B 1 40  ? 49.754  19.583  -34.310 1.00 34.71 ? 41  GLN B OE1 1 
ATOM   4186 N  NE2 . GLN B 1 40  ? 47.749  18.657  -33.937 1.00 35.15 ? 41  GLN B NE2 1 
ATOM   4187 N  N   . ASN B 1 41  ? 52.841  17.578  -38.344 1.00 23.84 ? 42  ASN B N   1 
ATOM   4188 C  CA  . ASN B 1 41  ? 54.016  17.974  -39.104 1.00 23.90 ? 42  ASN B CA  1 
ATOM   4189 C  C   . ASN B 1 41  ? 54.124  17.235  -40.446 1.00 24.43 ? 42  ASN B C   1 
ATOM   4190 O  O   . ASN B 1 41  ? 54.460  17.849  -41.457 1.00 23.66 ? 42  ASN B O   1 
ATOM   4191 C  CB  . ASN B 1 41  ? 55.301  17.748  -38.307 1.00 23.64 ? 42  ASN B CB  1 
ATOM   4192 C  CG  . ASN B 1 41  ? 55.555  18.819  -37.238 1.00 25.04 ? 42  ASN B CG  1 
ATOM   4193 O  OD1 . ASN B 1 41  ? 54.875  19.839  -37.178 1.00 26.72 ? 42  ASN B OD1 1 
ATOM   4194 N  ND2 . ASN B 1 41  ? 56.536  18.567  -36.385 1.00 23.38 ? 42  ASN B ND2 1 
ATOM   4195 N  N   . PHE B 1 42  ? 53.873  15.923  -40.452 1.00 24.20 ? 43  PHE B N   1 
ATOM   4196 C  CA  . PHE B 1 42  ? 53.859  15.182  -41.727 1.00 25.08 ? 43  PHE B CA  1 
ATOM   4197 C  C   . PHE B 1 42  ? 52.727  15.654  -42.640 1.00 25.85 ? 43  PHE B C   1 
ATOM   4198 O  O   . PHE B 1 42  ? 52.901  15.710  -43.849 1.00 26.47 ? 43  PHE B O   1 
ATOM   4199 C  CB  . PHE B 1 42  ? 53.797  13.668  -41.522 1.00 24.22 ? 43  PHE B CB  1 
ATOM   4200 C  CG  . PHE B 1 42  ? 55.024  13.096  -40.889 1.00 22.47 ? 43  PHE B CG  1 
ATOM   4201 C  CD1 . PHE B 1 42  ? 54.965  12.551  -39.606 1.00 19.52 ? 43  PHE B CD1 1 
ATOM   4202 C  CD2 . PHE B 1 42  ? 56.235  13.095  -41.569 1.00 19.92 ? 43  PHE B CD2 1 
ATOM   4203 C  CE1 . PHE B 1 42  ? 56.110  12.021  -39.006 1.00 20.43 ? 43  PHE B CE1 1 
ATOM   4204 C  CE2 . PHE B 1 42  ? 57.382  12.563  -40.992 1.00 19.68 ? 43  PHE B CE2 1 
ATOM   4205 C  CZ  . PHE B 1 42  ? 57.320  12.018  -39.699 1.00 20.67 ? 43  PHE B CZ  1 
ATOM   4206 N  N   . GLN B 1 43  ? 51.587  16.019  -42.058 1.00 27.27 ? 44  GLN B N   1 
ATOM   4207 C  CA  . GLN B 1 43  ? 50.507  16.627  -42.830 1.00 28.73 ? 44  GLN B CA  1 
ATOM   4208 C  C   . GLN B 1 43  ? 50.925  17.969  -43.451 1.00 29.34 ? 44  GLN B C   1 
ATOM   4209 O  O   . GLN B 1 43  ? 50.516  18.285  -44.569 1.00 29.14 ? 44  GLN B O   1 
ATOM   4210 C  CB  . GLN B 1 43  ? 49.229  16.769  -41.997 1.00 28.61 ? 44  GLN B CB  1 
ATOM   4211 C  CG  . GLN B 1 43  ? 48.477  15.430  -41.824 1.00 33.06 ? 44  GLN B CG  1 
ATOM   4212 C  CD  . GLN B 1 43  ? 47.510  15.401  -40.637 1.00 37.60 ? 44  GLN B CD  1 
ATOM   4213 O  OE1 . GLN B 1 43  ? 47.252  16.422  -39.985 1.00 41.07 ? 44  GLN B OE1 1 
ATOM   4214 N  NE2 . GLN B 1 43  ? 46.971  14.216  -40.352 1.00 39.71 ? 44  GLN B NE2 1 
ATOM   4215 N  N   . LYS B 1 44  ? 51.755  18.738  -42.740 1.00 29.58 ? 45  LYS B N   1 
ATOM   4216 C  CA  . LYS B 1 44  ? 52.201  20.047  -43.229 1.00 30.29 ? 45  LYS B CA  1 
ATOM   4217 C  C   . LYS B 1 44  ? 53.411  19.992  -44.161 1.00 29.52 ? 45  LYS B C   1 
ATOM   4218 O  O   . LYS B 1 44  ? 53.500  20.786  -45.087 1.00 29.58 ? 45  LYS B O   1 
ATOM   4219 C  CB  . LYS B 1 44  ? 52.486  21.018  -42.075 1.00 30.48 ? 45  LYS B CB  1 
ATOM   4220 C  CG  . LYS B 1 44  ? 51.252  21.367  -41.262 1.00 34.39 ? 45  LYS B CG  1 
ATOM   4221 C  CD  . LYS B 1 44  ? 51.237  22.832  -40.762 1.00 40.08 ? 45  LYS B CD  1 
ATOM   4222 C  CE  . LYS B 1 44  ? 52.553  23.243  -40.095 1.00 42.02 ? 45  LYS B CE  1 
ATOM   4223 N  NZ  . LYS B 1 44  ? 52.875  22.377  -38.932 1.00 44.02 ? 45  LYS B NZ  1 
ATOM   4224 N  N   . TYR B 1 45  ? 54.339  19.073  -43.918 1.00 28.61 ? 46  TYR B N   1 
ATOM   4225 C  CA  . TYR B 1 45  ? 55.607  19.089  -44.656 1.00 28.47 ? 46  TYR B CA  1 
ATOM   4226 C  C   . TYR B 1 45  ? 55.777  17.975  -45.692 1.00 27.72 ? 46  TYR B C   1 
ATOM   4227 O  O   . TYR B 1 45  ? 56.678  18.037  -46.532 1.00 27.45 ? 46  TYR B O   1 
ATOM   4228 C  CB  . TYR B 1 45  ? 56.801  19.111  -43.692 1.00 28.30 ? 46  TYR B CB  1 
ATOM   4229 C  CG  . TYR B 1 45  ? 56.748  20.261  -42.713 1.00 31.15 ? 46  TYR B CG  1 
ATOM   4230 C  CD1 . TYR B 1 45  ? 56.660  20.026  -41.338 1.00 33.07 ? 46  TYR B CD1 1 
ATOM   4231 C  CD2 . TYR B 1 45  ? 56.751  21.589  -43.160 1.00 32.69 ? 46  TYR B CD2 1 
ATOM   4232 C  CE1 . TYR B 1 45  ? 56.587  21.079  -40.438 1.00 35.25 ? 46  TYR B CE1 1 
ATOM   4233 C  CE2 . TYR B 1 45  ? 56.681  22.646  -42.267 1.00 33.88 ? 46  TYR B CE2 1 
ATOM   4234 C  CZ  . TYR B 1 45  ? 56.597  22.385  -40.910 1.00 34.94 ? 46  TYR B CZ  1 
ATOM   4235 O  OH  . TYR B 1 45  ? 56.524  23.428  -40.017 1.00 36.58 ? 46  TYR B OH  1 
ATOM   4236 N  N   . GLY B 1 46  ? 54.911  16.967  -45.629 1.00 27.23 ? 47  GLY B N   1 
ATOM   4237 C  CA  . GLY B 1 46  ? 55.111  15.748  -46.410 1.00 26.77 ? 47  GLY B CA  1 
ATOM   4238 C  C   . GLY B 1 46  ? 55.833  14.686  -45.600 1.00 26.29 ? 47  GLY B C   1 
ATOM   4239 O  O   . GLY B 1 46  ? 55.906  14.790  -44.367 1.00 26.35 ? 47  GLY B O   1 
ATOM   4240 N  N   . PRO B 1 47  ? 56.398  13.674  -46.284 1.00 25.74 ? 48  PRO B N   1 
ATOM   4241 C  CA  . PRO B 1 47  ? 56.868  12.439  -45.629 1.00 25.29 ? 48  PRO B CA  1 
ATOM   4242 C  C   . PRO B 1 47  ? 58.246  12.534  -44.969 1.00 24.85 ? 48  PRO B C   1 
ATOM   4243 O  O   . PRO B 1 47  ? 58.730  11.553  -44.387 1.00 24.88 ? 48  PRO B O   1 
ATOM   4244 C  CB  . PRO B 1 47  ? 56.889  11.429  -46.782 1.00 25.57 ? 48  PRO B CB  1 
ATOM   4245 C  CG  . PRO B 1 47  ? 57.182  12.276  -48.014 1.00 25.97 ? 48  PRO B CG  1 
ATOM   4246 C  CD  . PRO B 1 47  ? 56.609  13.649  -47.745 1.00 25.64 ? 48  PRO B CD  1 
ATOM   4247 N  N   . ILE B 1 48  ? 58.873  13.703  -45.061 1.00 24.55 ? 49  ILE B N   1 
ATOM   4248 C  CA  . ILE B 1 48  ? 60.170  13.948  -44.437 1.00 24.08 ? 49  ILE B CA  1 
ATOM   4249 C  C   . ILE B 1 48  ? 60.302  15.421  -44.055 1.00 23.88 ? 49  ILE B C   1 
ATOM   4250 O  O   . ILE B 1 48  ? 59.917  16.321  -44.813 1.00 24.18 ? 49  ILE B O   1 
ATOM   4251 C  CB  . ILE B 1 48  ? 61.375  13.498  -45.315 1.00 24.37 ? 49  ILE B CB  1 
ATOM   4252 C  CG1 . ILE B 1 48  ? 62.689  13.659  -44.537 1.00 24.06 ? 49  ILE B CG1 1 
ATOM   4253 C  CG2 . ILE B 1 48  ? 61.416  14.284  -46.641 1.00 24.96 ? 49  ILE B CG2 1 
ATOM   4254 C  CD1 . ILE B 1 48  ? 63.868  12.855  -45.068 1.00 27.05 ? 49  ILE B CD1 1 
ATOM   4255 N  N   . TYR B 1 49  ? 60.817  15.664  -42.858 1.00 23.28 ? 50  TYR B N   1 
ATOM   4256 C  CA  . TYR B 1 49  ? 61.034  17.032  -42.406 1.00 22.86 ? 50  TYR B CA  1 
ATOM   4257 C  C   . TYR B 1 49  ? 62.171  17.052  -41.408 1.00 22.62 ? 50  TYR B C   1 
ATOM   4258 O  O   . TYR B 1 49  ? 62.596  16.008  -40.944 1.00 21.86 ? 50  TYR B O   1 
ATOM   4259 C  CB  . TYR B 1 49  ? 59.743  17.665  -41.861 1.00 22.26 ? 50  TYR B CB  1 
ATOM   4260 C  CG  . TYR B 1 49  ? 59.248  17.127  -40.517 1.00 24.19 ? 50  TYR B CG  1 
ATOM   4261 C  CD1 . TYR B 1 49  ? 59.643  17.731  -39.318 1.00 24.43 ? 50  TYR B CD1 1 
ATOM   4262 C  CD2 . TYR B 1 49  ? 58.374  16.031  -40.447 1.00 24.19 ? 50  TYR B CD2 1 
ATOM   4263 C  CE1 . TYR B 1 49  ? 59.199  17.254  -38.073 1.00 24.53 ? 50  TYR B CE1 1 
ATOM   4264 C  CE2 . TYR B 1 49  ? 57.923  15.547  -39.201 1.00 25.09 ? 50  TYR B CE2 1 
ATOM   4265 C  CZ  . TYR B 1 49  ? 58.346  16.169  -38.022 1.00 24.88 ? 50  TYR B CZ  1 
ATOM   4266 O  OH  . TYR B 1 49  ? 57.916  15.735  -36.792 1.00 25.20 ? 50  TYR B OH  1 
ATOM   4267 N  N   . ARG B 1 50  ? 62.692  18.243  -41.129 1.00 23.72 ? 51  ARG B N   1 
ATOM   4268 C  CA  . ARG B 1 50  ? 63.687  18.427  -40.088 1.00 25.21 ? 51  ARG B CA  1 
ATOM   4269 C  C   . ARG B 1 50  ? 63.153  19.461  -39.113 1.00 25.54 ? 51  ARG B C   1 
ATOM   4270 O  O   . ARG B 1 50  ? 62.466  20.405  -39.505 1.00 25.75 ? 51  ARG B O   1 
ATOM   4271 C  CB  . ARG B 1 50  ? 65.059  18.822  -40.659 1.00 25.27 ? 51  ARG B CB  1 
ATOM   4272 C  CG  . ARG B 1 50  ? 65.023  20.069  -41.506 1.00 27.51 ? 51  ARG B CG  1 
ATOM   4273 C  CD  . ARG B 1 50  ? 66.386  20.443  -42.062 1.00 31.45 ? 51  ARG B CD  1 
ATOM   4274 N  NE  . ARG B 1 50  ? 66.253  21.646  -42.890 1.00 34.53 ? 51  ARG B NE  1 
ATOM   4275 C  CZ  . ARG B 1 50  ? 66.409  22.889  -42.439 1.00 36.51 ? 51  ARG B CZ  1 
ATOM   4276 N  NH1 . ARG B 1 50  ? 66.734  23.106  -41.169 1.00 36.67 ? 51  ARG B NH1 1 
ATOM   4277 N  NH2 . ARG B 1 50  ? 66.260  23.921  -43.266 1.00 37.78 ? 51  ARG B NH2 1 
ATOM   4278 N  N   . GLU B 1 51  ? 63.409  19.247  -37.832 1.00 25.87 ? 52  GLU B N   1 
ATOM   4279 C  CA  . GLU B 1 51  ? 62.947  20.186  -36.822 1.00 26.91 ? 52  GLU B CA  1 
ATOM   4280 C  C   . GLU B 1 51  ? 63.929  20.215  -35.672 1.00 26.83 ? 52  GLU B C   1 
ATOM   4281 O  O   . GLU B 1 51  ? 64.191  19.184  -35.035 1.00 26.96 ? 52  GLU B O   1 
ATOM   4282 C  CB  . GLU B 1 51  ? 61.530  19.869  -36.319 1.00 27.19 ? 52  GLU B CB  1 
ATOM   4283 C  CG  . GLU B 1 51  ? 61.027  20.919  -35.275 1.00 30.33 ? 52  GLU B CG  1 
ATOM   4284 C  CD  . GLU B 1 51  ? 59.537  20.799  -34.926 1.00 34.72 ? 52  GLU B CD  1 
ATOM   4285 O  OE1 . GLU B 1 51  ? 59.071  19.686  -34.605 1.00 35.78 ? 52  GLU B OE1 1 
ATOM   4286 O  OE2 . GLU B 1 51  ? 58.834  21.836  -34.949 1.00 37.50 ? 52  GLU B OE2 1 
ATOM   4287 N  N   . LYS B 1 52  ? 64.506  21.390  -35.448 1.00 26.35 ? 53  LYS B N   1 
ATOM   4288 C  CA  . LYS B 1 52  ? 65.304  21.638  -34.264 1.00 26.66 ? 53  LYS B CA  1 
ATOM   4289 C  C   . LYS B 1 52  ? 64.366  22.026  -33.114 1.00 26.59 ? 53  LYS B C   1 
ATOM   4290 O  O   . LYS B 1 52  ? 63.612  22.995  -33.218 1.00 26.11 ? 53  LYS B O   1 
ATOM   4291 C  CB  . LYS B 1 52  ? 66.316  22.759  -34.524 1.00 26.68 ? 53  LYS B CB  1 
ATOM   4292 C  CG  . LYS B 1 52  ? 67.362  22.915  -33.431 1.00 28.12 ? 53  LYS B CG  1 
ATOM   4293 C  CD  . LYS B 1 52  ? 68.315  24.063  -33.746 1.00 32.38 ? 53  LYS B CD  1 
ATOM   4294 C  CE  . LYS B 1 52  ? 69.654  23.872  -33.062 1.00 35.90 ? 53  LYS B CE  1 
ATOM   4295 N  NZ  . LYS B 1 52  ? 70.548  25.069  -33.212 1.00 38.91 ? 53  LYS B NZ  1 
ATOM   4296 N  N   . LEU B 1 53  ? 64.391  21.251  -32.042 1.00 27.34 ? 54  LEU B N   1 
ATOM   4297 C  CA  . LEU B 1 53  ? 63.651  21.608  -30.824 1.00 28.87 ? 54  LEU B CA  1 
ATOM   4298 C  C   . LEU B 1 53  ? 64.635  21.877  -29.718 1.00 29.73 ? 54  LEU B C   1 
ATOM   4299 O  O   . LEU B 1 53  ? 65.356  20.975  -29.279 1.00 30.24 ? 54  LEU B O   1 
ATOM   4300 C  CB  . LEU B 1 53  ? 62.671  20.518  -30.395 1.00 28.32 ? 54  LEU B CB  1 
ATOM   4301 C  CG  . LEU B 1 53  ? 61.394  20.384  -31.211 1.00 28.52 ? 54  LEU B CG  1 
ATOM   4302 C  CD1 . LEU B 1 53  ? 60.541  19.211  -30.690 1.00 27.63 ? 54  LEU B CD1 1 
ATOM   4303 C  CD2 . LEU B 1 53  ? 60.595  21.689  -31.231 1.00 26.78 ? 54  LEU B CD2 1 
ATOM   4304 N  N   . GLY B 1 54  ? 64.686  23.135  -29.292 1.00 30.68 ? 55  GLY B N   1 
ATOM   4305 C  CA  . GLY B 1 54  ? 65.663  23.547  -28.301 1.00 31.44 ? 55  GLY B CA  1 
ATOM   4306 C  C   . GLY B 1 54  ? 67.037  23.352  -28.892 1.00 32.24 ? 55  GLY B C   1 
ATOM   4307 O  O   . GLY B 1 54  ? 67.374  23.959  -29.910 1.00 31.97 ? 55  GLY B O   1 
ATOM   4308 N  N   . ASN B 1 55  ? 67.821  22.486  -28.260 1.00 33.02 ? 56  ASN B N   1 
ATOM   4309 C  CA  . ASN B 1 55  ? 69.189  22.214  -28.698 1.00 34.27 ? 56  ASN B CA  1 
ATOM   4310 C  C   . ASN B 1 55  ? 69.328  21.115  -29.772 1.00 34.26 ? 56  ASN B C   1 
ATOM   4311 O  O   . ASN B 1 55  ? 70.295  21.120  -30.545 1.00 35.39 ? 56  ASN B O   1 
ATOM   4312 C  CB  . ASN B 1 55  ? 70.110  21.943  -27.488 1.00 34.63 ? 56  ASN B CB  1 
ATOM   4313 C  CG  . ASN B 1 55  ? 69.489  20.988  -26.430 1.00 36.61 ? 56  ASN B CG  1 
ATOM   4314 O  OD1 . ASN B 1 55  ? 70.222  20.245  -25.761 1.00 37.99 ? 56  ASN B OD1 1 
ATOM   4315 N  ND2 . ASN B 1 55  ? 68.159  21.027  -26.262 1.00 36.31 ? 56  ASN B ND2 1 
ATOM   4316 N  N   . VAL B 1 56  ? 68.346  20.214  -29.844 1.00 33.65 ? 57  VAL B N   1 
ATOM   4317 C  CA  . VAL B 1 56  ? 68.437  19.021  -30.706 1.00 32.79 ? 57  VAL B CA  1 
ATOM   4318 C  C   . VAL B 1 56  ? 67.665  19.116  -32.038 1.00 31.55 ? 57  VAL B C   1 
ATOM   4319 O  O   . VAL B 1 56  ? 66.447  19.353  -32.069 1.00 30.64 ? 57  VAL B O   1 
ATOM   4320 C  CB  . VAL B 1 56  ? 68.076  17.716  -29.926 1.00 32.95 ? 57  VAL B CB  1 
ATOM   4321 C  CG1 . VAL B 1 56  ? 66.649  17.759  -29.374 1.00 34.38 ? 57  VAL B CG1 1 
ATOM   4322 C  CG2 . VAL B 1 56  ? 68.309  16.462  -30.784 1.00 33.81 ? 57  VAL B CG2 1 
ATOM   4323 N  N   . GLU B 1 57  ? 68.402  18.936  -33.130 1.00 30.13 ? 58  GLU B N   1 
ATOM   4324 C  CA  . GLU B 1 57  ? 67.811  18.835  -34.455 1.00 29.53 ? 58  GLU B CA  1 
ATOM   4325 C  C   . GLU B 1 57  ? 67.687  17.368  -34.855 1.00 28.28 ? 58  GLU B C   1 
ATOM   4326 O  O   . GLU B 1 57  ? 68.589  16.566  -34.601 1.00 28.49 ? 58  GLU B O   1 
ATOM   4327 C  CB  . GLU B 1 57  ? 68.628  19.601  -35.519 1.00 29.82 ? 58  GLU B CB  1 
ATOM   4328 C  CG  . GLU B 1 57  ? 67.919  19.644  -36.898 1.00 31.88 ? 58  GLU B CG  1 
ATOM   4329 C  CD  . GLU B 1 57  ? 68.462  20.705  -37.866 1.00 36.92 ? 58  GLU B CD  1 
ATOM   4330 O  OE1 . GLU B 1 57  ? 69.699  20.813  -38.001 1.00 38.33 ? 58  GLU B OE1 1 
ATOM   4331 O  OE2 . GLU B 1 57  ? 67.641  21.412  -38.513 1.00 38.63 ? 58  GLU B OE2 1 
ATOM   4332 N  N   . SER B 1 58  ? 66.560  17.028  -35.464 1.00 26.44 ? 59  SER B N   1 
ATOM   4333 C  CA  . SER B 1 58  ? 66.364  15.693  -36.016 1.00 25.54 ? 59  SER B CA  1 
ATOM   4334 C  C   . SER B 1 58  ? 65.751  15.799  -37.388 1.00 24.08 ? 59  SER B C   1 
ATOM   4335 O  O   . SER B 1 58  ? 65.055  16.751  -37.689 1.00 23.63 ? 59  SER B O   1 
ATOM   4336 C  CB  . SER B 1 58  ? 65.411  14.854  -35.147 1.00 25.43 ? 59  SER B CB  1 
ATOM   4337 O  OG  . SER B 1 58  ? 65.814  14.837  -33.803 1.00 26.26 ? 59  SER B OG  1 
ATOM   4338 N  N   . VAL B 1 59  ? 66.013  14.791  -38.203 1.00 23.91 ? 60  VAL B N   1 
ATOM   4339 C  CA  . VAL B 1 59  ? 65.249  14.550  -39.414 1.00 23.94 ? 60  VAL B CA  1 
ATOM   4340 C  C   . VAL B 1 59  ? 64.214  13.506  -39.042 1.00 24.06 ? 60  VAL B C   1 
ATOM   4341 O  O   . VAL B 1 59  ? 64.525  12.527  -38.363 1.00 24.82 ? 60  VAL B O   1 
ATOM   4342 C  CB  . VAL B 1 59  ? 66.158  13.996  -40.554 1.00 23.85 ? 60  VAL B CB  1 
ATOM   4343 C  CG1 . VAL B 1 59  ? 65.322  13.432  -41.701 1.00 22.84 ? 60  VAL B CG1 1 
ATOM   4344 C  CG2 . VAL B 1 59  ? 67.110  15.087  -41.034 1.00 24.43 ? 60  VAL B CG2 1 
ATOM   4345 N  N   . TYR B 1 60  ? 62.988  13.723  -39.488 1.00 24.11 ? 61  TYR B N   1 
ATOM   4346 C  CA  . TYR B 1 60  ? 61.891  12.825  -39.188 1.00 24.26 ? 61  TYR B CA  1 
ATOM   4347 C  C   . TYR B 1 60  ? 61.381  12.171  -40.466 1.00 24.25 ? 61  TYR B C   1 
ATOM   4348 O  O   . TYR B 1 60  ? 61.150  12.861  -41.467 1.00 23.72 ? 61  TYR B O   1 
ATOM   4349 C  CB  . TYR B 1 60  ? 60.752  13.603  -38.554 1.00 23.99 ? 61  TYR B CB  1 
ATOM   4350 C  CG  . TYR B 1 60  ? 61.041  14.117  -37.149 1.00 24.89 ? 61  TYR B CG  1 
ATOM   4351 C  CD1 . TYR B 1 60  ? 61.624  15.367  -36.957 1.00 23.37 ? 61  TYR B CD1 1 
ATOM   4352 C  CD2 . TYR B 1 60  ? 60.717  13.345  -36.020 1.00 23.04 ? 61  TYR B CD2 1 
ATOM   4353 C  CE1 . TYR B 1 60  ? 61.867  15.857  -35.678 1.00 26.89 ? 61  TYR B CE1 1 
ATOM   4354 C  CE2 . TYR B 1 60  ? 60.964  13.820  -34.730 1.00 25.56 ? 61  TYR B CE2 1 
ATOM   4355 C  CZ  . TYR B 1 60  ? 61.540  15.069  -34.567 1.00 26.09 ? 61  TYR B CZ  1 
ATOM   4356 O  OH  . TYR B 1 60  ? 61.798  15.547  -33.316 1.00 26.63 ? 61  TYR B OH  1 
ATOM   4357 N  N   . VAL B 1 61  ? 61.199  10.851  -40.401 1.00 24.31 ? 62  VAL B N   1 
ATOM   4358 C  CA  . VAL B 1 61  ? 60.632  10.040  -41.490 1.00 24.36 ? 62  VAL B CA  1 
ATOM   4359 C  C   . VAL B 1 61  ? 59.439  9.211   -41.011 1.00 24.82 ? 62  VAL B C   1 
ATOM   4360 O  O   . VAL B 1 61  ? 59.322  8.873   -39.817 1.00 23.45 ? 62  VAL B O   1 
ATOM   4361 C  CB  . VAL B 1 61  ? 61.679  9.072   -42.106 1.00 24.95 ? 62  VAL B CB  1 
ATOM   4362 C  CG1 . VAL B 1 61  ? 62.838  9.846   -42.767 1.00 24.30 ? 62  VAL B CG1 1 
ATOM   4363 C  CG2 . VAL B 1 61  ? 62.201  8.074   -41.051 1.00 23.14 ? 62  VAL B CG2 1 
ATOM   4364 N  N   . ILE B 1 62  ? 58.558  8.899   -41.960 1.00 25.18 ? 63  ILE B N   1 
ATOM   4365 C  CA  . ILE B 1 62  ? 57.353  8.113   -41.712 1.00 25.67 ? 63  ILE B CA  1 
ATOM   4366 C  C   . ILE B 1 62  ? 57.216  6.877   -42.636 1.00 26.58 ? 63  ILE B C   1 
ATOM   4367 O  O   . ILE B 1 62  ? 56.676  5.843   -42.233 1.00 26.77 ? 63  ILE B O   1 
ATOM   4368 C  CB  . ILE B 1 62  ? 56.098  9.009   -41.792 1.00 25.66 ? 63  ILE B CB  1 
ATOM   4369 C  CG1 . ILE B 1 62  ? 54.889  8.291   -41.177 1.00 24.52 ? 63  ILE B CG1 1 
ATOM   4370 C  CG2 . ILE B 1 62  ? 55.862  9.524   -43.245 1.00 25.42 ? 63  ILE B CG2 1 
ATOM   4371 C  CD1 . ILE B 1 62  ? 53.651  9.148   -41.064 1.00 24.01 ? 63  ILE B CD1 1 
ATOM   4372 N  N   . ASP B 1 63  ? 57.722  6.987   -43.862 1.00 27.21 ? 64  ASP B N   1 
ATOM   4373 C  CA  . ASP B 1 63  ? 57.568  5.946   -44.892 1.00 27.86 ? 64  ASP B CA  1 
ATOM   4374 C  C   . ASP B 1 63  ? 58.442  4.719   -44.628 1.00 27.65 ? 64  ASP B C   1 
ATOM   4375 O  O   . ASP B 1 63  ? 59.658  4.845   -44.538 1.00 27.76 ? 64  ASP B O   1 
ATOM   4376 C  CB  . ASP B 1 63  ? 57.876  6.556   -46.281 1.00 28.47 ? 64  ASP B CB  1 
ATOM   4377 C  CG  . ASP B 1 63  ? 57.573  5.608   -47.451 1.00 29.98 ? 64  ASP B CG  1 
ATOM   4378 O  OD1 . ASP B 1 63  ? 57.434  4.381   -47.274 1.00 31.09 ? 64  ASP B OD1 1 
ATOM   4379 O  OD2 . ASP B 1 63  ? 57.490  6.113   -48.582 1.00 34.01 ? 64  ASP B OD2 1 
ATOM   4380 N  N   . PRO B 1 64  ? 57.825  3.509   -44.524 1.00 28.19 ? 65  PRO B N   1 
ATOM   4381 C  CA  . PRO B 1 64  ? 58.589  2.273   -44.310 1.00 28.88 ? 65  PRO B CA  1 
ATOM   4382 C  C   . PRO B 1 64  ? 59.762  2.059   -45.281 1.00 29.75 ? 65  PRO B C   1 
ATOM   4383 O  O   . PRO B 1 64  ? 60.778  1.477   -44.891 1.00 30.19 ? 65  PRO B O   1 
ATOM   4384 C  CB  . PRO B 1 64  ? 57.532  1.169   -44.464 1.00 28.76 ? 65  PRO B CB  1 
ATOM   4385 C  CG  . PRO B 1 64  ? 56.269  1.808   -44.009 1.00 28.82 ? 65  PRO B CG  1 
ATOM   4386 C  CD  . PRO B 1 64  ? 56.375  3.244   -44.541 1.00 27.88 ? 65  PRO B CD  1 
ATOM   4387 N  N   . GLU B 1 65  ? 59.649  2.553   -46.511 1.00 31.25 ? 66  GLU B N   1 
ATOM   4388 C  CA  . GLU B 1 65  ? 60.748  2.422   -47.492 1.00 32.96 ? 66  GLU B CA  1 
ATOM   4389 C  C   . GLU B 1 65  ? 61.989  3.202   -47.070 1.00 32.70 ? 66  GLU B C   1 
ATOM   4390 O  O   . GLU B 1 65  ? 63.118  2.729   -47.227 1.00 32.89 ? 66  GLU B O   1 
ATOM   4391 C  CB  . GLU B 1 65  ? 60.309  2.899   -48.876 1.00 33.61 ? 66  GLU B CB  1 
ATOM   4392 C  CG  . GLU B 1 65  ? 59.054  2.255   -49.398 1.00 37.96 ? 66  GLU B CG  1 
ATOM   4393 C  CD  . GLU B 1 65  ? 58.427  3.048   -50.533 1.00 44.46 ? 66  GLU B CD  1 
ATOM   4394 O  OE1 . GLU B 1 65  ? 58.423  4.307   -50.460 1.00 47.47 ? 66  GLU B OE1 1 
ATOM   4395 O  OE2 . GLU B 1 65  ? 57.940  2.413   -51.501 1.00 45.86 ? 66  GLU B OE2 1 
ATOM   4396 N  N   . ASP B 1 66  ? 61.773  4.410   -46.551 1.00 32.61 ? 67  ASP B N   1 
ATOM   4397 C  CA  . ASP B 1 66  ? 62.852  5.206   -45.949 1.00 32.22 ? 67  ASP B CA  1 
ATOM   4398 C  C   . ASP B 1 66  ? 63.379  4.581   -44.663 1.00 31.60 ? 67  ASP B C   1 
ATOM   4399 O  O   . ASP B 1 66  ? 64.579  4.669   -44.369 1.00 31.50 ? 67  ASP B O   1 
ATOM   4400 C  CB  . ASP B 1 66  ? 62.381  6.648   -45.698 1.00 32.54 ? 67  ASP B CB  1 
ATOM   4401 C  CG  . ASP B 1 66  ? 61.850  7.318   -46.964 1.00 34.09 ? 67  ASP B CG  1 
ATOM   4402 O  OD1 . ASP B 1 66  ? 62.252  6.902   -48.073 1.00 35.86 ? 67  ASP B OD1 1 
ATOM   4403 O  OD2 . ASP B 1 66  ? 61.029  8.254   -46.862 1.00 35.07 ? 67  ASP B OD2 1 
ATOM   4404 N  N   . VAL B 1 67  ? 62.484  3.945   -43.901 1.00 31.25 ? 68  VAL B N   1 
ATOM   4405 C  CA  . VAL B 1 67  ? 62.869  3.277   -42.659 1.00 30.59 ? 68  VAL B CA  1 
ATOM   4406 C  C   . VAL B 1 67  ? 63.832  2.162   -43.024 1.00 30.75 ? 68  VAL B C   1 
ATOM   4407 O  O   . VAL B 1 67  ? 64.899  2.021   -42.421 1.00 30.48 ? 68  VAL B O   1 
ATOM   4408 C  CB  . VAL B 1 67  ? 61.648  2.673   -41.889 1.00 30.55 ? 68  VAL B CB  1 
ATOM   4409 C  CG1 . VAL B 1 67  ? 62.105  1.943   -40.639 1.00 28.68 ? 68  VAL B CG1 1 
ATOM   4410 C  CG2 . VAL B 1 67  ? 60.647  3.741   -41.528 1.00 30.35 ? 68  VAL B CG2 1 
ATOM   4411 N  N   . ALA B 1 68  ? 63.459  1.386   -44.040 1.00 31.14 ? 69  ALA B N   1 
ATOM   4412 C  CA  . ALA B 1 68  ? 64.296  0.271   -44.497 1.00 31.24 ? 69  ALA B CA  1 
ATOM   4413 C  C   . ALA B 1 68  ? 65.694  0.757   -44.852 1.00 31.40 ? 69  ALA B C   1 
ATOM   4414 O  O   . ALA B 1 68  ? 66.693  0.118   -44.495 1.00 31.30 ? 69  ALA B O   1 
ATOM   4415 C  CB  . ALA B 1 68  ? 63.646  -0.437  -45.684 1.00 31.27 ? 69  ALA B CB  1 
ATOM   4416 N  N   . LEU B 1 69  ? 65.754  1.905   -45.524 1.00 31.74 ? 70  LEU B N   1 
ATOM   4417 C  CA  . LEU B 1 69  ? 67.019  2.504   -45.927 1.00 32.81 ? 70  LEU B CA  1 
ATOM   4418 C  C   . LEU B 1 69  ? 67.862  2.929   -44.727 1.00 32.85 ? 70  LEU B C   1 
ATOM   4419 O  O   . LEU B 1 69  ? 69.082  2.744   -44.712 1.00 32.54 ? 70  LEU B O   1 
ATOM   4420 C  CB  . LEU B 1 69  ? 66.777  3.685   -46.882 1.00 33.33 ? 70  LEU B CB  1 
ATOM   4421 C  CG  . LEU B 1 69  ? 66.387  3.335   -48.328 1.00 35.22 ? 70  LEU B CG  1 
ATOM   4422 C  CD1 . LEU B 1 69  ? 65.910  4.567   -49.099 1.00 36.72 ? 70  LEU B CD1 1 
ATOM   4423 C  CD2 . LEU B 1 69  ? 67.549  2.650   -49.069 1.00 37.40 ? 70  LEU B CD2 1 
ATOM   4424 N  N   . LEU B 1 70  ? 67.200  3.480   -43.711 1.00 33.20 ? 71  LEU B N   1 
ATOM   4425 C  CA  . LEU B 1 70  ? 67.881  3.904   -42.496 1.00 33.67 ? 71  LEU B CA  1 
ATOM   4426 C  C   . LEU B 1 70  ? 68.528  2.722   -41.772 1.00 34.64 ? 71  LEU B C   1 
ATOM   4427 O  O   . LEU B 1 70  ? 69.691  2.783   -41.361 1.00 34.45 ? 71  LEU B O   1 
ATOM   4428 C  CB  . LEU B 1 70  ? 66.905  4.655   -41.571 1.00 33.19 ? 71  LEU B CB  1 
ATOM   4429 C  CG  . LEU B 1 70  ? 67.379  4.980   -40.154 1.00 32.37 ? 71  LEU B CG  1 
ATOM   4430 C  CD1 . LEU B 1 70  ? 68.547  5.954   -40.190 1.00 32.50 ? 71  LEU B CD1 1 
ATOM   4431 C  CD2 . LEU B 1 70  ? 66.239  5.553   -39.338 1.00 31.39 ? 71  LEU B CD2 1 
ATOM   4432 N  N   . PHE B 1 71  ? 67.783  1.639   -41.617 1.00 35.99 ? 72  PHE B N   1 
ATOM   4433 C  CA  . PHE B 1 71  ? 68.331  0.498   -40.898 1.00 37.97 ? 72  PHE B CA  1 
ATOM   4434 C  C   . PHE B 1 71  ? 69.307  -0.337  -41.739 1.00 39.18 ? 72  PHE B C   1 
ATOM   4435 O  O   . PHE B 1 71  ? 70.164  -1.018  -41.188 1.00 39.48 ? 72  PHE B O   1 
ATOM   4436 C  CB  . PHE B 1 71  ? 67.220  -0.326  -40.247 1.00 38.13 ? 72  PHE B CB  1 
ATOM   4437 C  CG  . PHE B 1 71  ? 66.540  0.391   -39.091 1.00 38.87 ? 72  PHE B CG  1 
ATOM   4438 C  CD1 . PHE B 1 71  ? 65.251  0.906   -39.227 1.00 40.06 ? 72  PHE B CD1 1 
ATOM   4439 C  CD2 . PHE B 1 71  ? 67.201  0.572   -37.879 1.00 38.97 ? 72  PHE B CD2 1 
ATOM   4440 C  CE1 . PHE B 1 71  ? 64.621  1.574   -38.159 1.00 39.68 ? 72  PHE B CE1 1 
ATOM   4441 C  CE2 . PHE B 1 71  ? 66.583  1.242   -36.818 1.00 39.08 ? 72  PHE B CE2 1 
ATOM   4442 C  CZ  . PHE B 1 71  ? 65.295  1.749   -36.964 1.00 38.17 ? 72  PHE B CZ  1 
ATOM   4443 N  N   . LYS B 1 72  ? 69.203  -0.244  -43.063 1.00 40.53 ? 73  LYS B N   1 
ATOM   4444 C  CA  . LYS B 1 72  ? 70.185  -0.874  -43.965 1.00 42.48 ? 73  LYS B CA  1 
ATOM   4445 C  C   . LYS B 1 72  ? 71.590  -0.258  -43.814 1.00 42.88 ? 73  LYS B C   1 
ATOM   4446 O  O   . LYS B 1 72  ? 72.599  -0.928  -44.032 1.00 43.06 ? 73  LYS B O   1 
ATOM   4447 C  CB  . LYS B 1 72  ? 69.718  -0.776  -45.427 1.00 42.84 ? 73  LYS B CB  1 
ATOM   4448 C  CG  . LYS B 1 72  ? 70.406  -1.753  -46.380 1.00 45.28 ? 73  LYS B CG  1 
ATOM   4449 C  CD  . LYS B 1 72  ? 70.155  -1.383  -47.847 1.00 48.28 ? 73  LYS B CD  1 
ATOM   4450 C  CE  . LYS B 1 72  ? 70.872  -2.355  -48.783 1.00 50.60 ? 73  LYS B CE  1 
ATOM   4451 N  NZ  . LYS B 1 72  ? 71.115  -1.781  -50.150 1.00 51.84 ? 73  LYS B NZ  1 
ATOM   4452 N  N   . SER B 1 73  ? 71.644  1.010   -43.423 1.00 43.40 ? 74  SER B N   1 
ATOM   4453 C  CA  . SER B 1 73  ? 72.903  1.739   -43.349 1.00 43.98 ? 74  SER B CA  1 
ATOM   4454 C  C   . SER B 1 73  ? 73.458  1.783   -41.938 1.00 44.11 ? 74  SER B C   1 
ATOM   4455 O  O   . SER B 1 73  ? 74.429  2.491   -41.668 1.00 44.59 ? 74  SER B O   1 
ATOM   4456 C  CB  . SER B 1 73  ? 72.708  3.165   -43.863 1.00 44.16 ? 74  SER B CB  1 
ATOM   4457 O  OG  . SER B 1 73  ? 71.925  3.905   -42.949 1.00 45.12 ? 74  SER B OG  1 
ATOM   4458 N  N   . GLU B 1 74  ? 72.839  1.022   -41.041 1.00 44.00 ? 75  GLU B N   1 
ATOM   4459 C  CA  . GLU B 1 74  ? 73.196  1.029   -39.632 1.00 43.61 ? 75  GLU B CA  1 
ATOM   4460 C  C   . GLU B 1 74  ? 74.578  0.416   -39.392 1.00 43.28 ? 75  GLU B C   1 
ATOM   4461 O  O   . GLU B 1 74  ? 74.939  -0.578  -40.026 1.00 43.27 ? 75  GLU B O   1 
ATOM   4462 C  CB  . GLU B 1 74  ? 72.134  0.267   -38.841 1.00 43.72 ? 75  GLU B CB  1 
ATOM   4463 C  CG  . GLU B 1 74  ? 72.331  0.298   -37.348 1.00 44.68 ? 75  GLU B CG  1 
ATOM   4464 C  CD  . GLU B 1 74  ? 71.106  -0.150  -36.601 1.00 44.94 ? 75  GLU B CD  1 
ATOM   4465 O  OE1 . GLU B 1 74  ? 71.082  -1.318  -36.147 1.00 44.68 ? 75  GLU B OE1 1 
ATOM   4466 O  OE2 . GLU B 1 74  ? 70.169  0.661   -36.490 1.00 45.29 ? 75  GLU B OE2 1 
ATOM   4467 N  N   . GLY B 1 75  ? 75.336  1.014   -38.473 1.00 42.51 ? 76  GLY B N   1 
ATOM   4468 C  CA  . GLY B 1 75  ? 76.664  0.522   -38.108 1.00 41.68 ? 76  GLY B CA  1 
ATOM   4469 C  C   . GLY B 1 75  ? 76.622  -0.610  -37.094 1.00 40.83 ? 76  GLY B C   1 
ATOM   4470 O  O   . GLY B 1 75  ? 75.542  -1.057  -36.717 1.00 40.84 ? 76  GLY B O   1 
ATOM   4471 N  N   . PRO B 1 76  ? 77.804  -1.089  -36.652 1.00 40.15 ? 77  PRO B N   1 
ATOM   4472 C  CA  . PRO B 1 76  ? 77.878  -2.192  -35.683 1.00 39.27 ? 77  PRO B CA  1 
ATOM   4473 C  C   . PRO B 1 76  ? 77.498  -1.815  -34.244 1.00 38.30 ? 77  PRO B C   1 
ATOM   4474 O  O   . PRO B 1 76  ? 77.061  -2.678  -33.481 1.00 38.10 ? 77  PRO B O   1 
ATOM   4475 C  CB  . PRO B 1 76  ? 79.354  -2.614  -35.740 1.00 39.62 ? 77  PRO B CB  1 
ATOM   4476 C  CG  . PRO B 1 76  ? 80.081  -1.383  -36.222 1.00 40.14 ? 77  PRO B CG  1 
ATOM   4477 C  CD  . PRO B 1 76  ? 79.134  -0.742  -37.196 1.00 40.11 ? 77  PRO B CD  1 
ATOM   4478 N  N   . ASN B 1 77  ? 77.679  -0.549  -33.877 1.00 36.91 ? 78  ASN B N   1 
ATOM   4479 C  CA  . ASN B 1 77  ? 77.382  -0.097  -32.521 1.00 35.34 ? 78  ASN B CA  1 
ATOM   4480 C  C   . ASN B 1 77  ? 76.410  1.078   -32.535 1.00 33.94 ? 78  ASN B C   1 
ATOM   4481 O  O   . ASN B 1 77  ? 76.783  2.184   -32.153 1.00 33.09 ? 78  ASN B O   1 
ATOM   4482 C  CB  . ASN B 1 77  ? 78.678  0.285   -31.795 1.00 35.76 ? 78  ASN B CB  1 
ATOM   4483 C  CG  . ASN B 1 77  ? 79.556  -0.923  -31.470 1.00 36.79 ? 78  ASN B CG  1 
ATOM   4484 O  OD1 . ASN B 1 77  ? 79.063  -2.032  -31.238 1.00 38.29 ? 78  ASN B OD1 1 
ATOM   4485 N  ND2 . ASN B 1 77  ? 80.863  -0.706  -31.441 1.00 35.52 ? 78  ASN B ND2 1 
ATOM   4486 N  N   . PRO B 1 78  ? 75.148  0.836   -32.961 1.00 32.90 ? 79  PRO B N   1 
ATOM   4487 C  CA  . PRO B 1 78  ? 74.198  1.923   -33.203 1.00 31.76 ? 79  PRO B CA  1 
ATOM   4488 C  C   . PRO B 1 78  ? 73.866  2.719   -31.940 1.00 30.97 ? 79  PRO B C   1 
ATOM   4489 O  O   . PRO B 1 78  ? 73.938  2.190   -30.826 1.00 30.62 ? 79  PRO B O   1 
ATOM   4490 C  CB  . PRO B 1 78  ? 72.953  1.202   -33.714 1.00 31.95 ? 79  PRO B CB  1 
ATOM   4491 C  CG  . PRO B 1 78  ? 73.051  -0.169  -33.177 1.00 32.27 ? 79  PRO B CG  1 
ATOM   4492 C  CD  . PRO B 1 78  ? 74.508  -0.488  -33.082 1.00 32.82 ? 79  PRO B CD  1 
ATOM   4493 N  N   . GLU B 1 79  ? 73.538  3.991   -32.133 1.00 29.66 ? 80  GLU B N   1 
ATOM   4494 C  CA  . GLU B 1 79  ? 73.187  4.881   -31.036 1.00 28.79 ? 80  GLU B CA  1 
ATOM   4495 C  C   . GLU B 1 79  ? 71.830  5.512   -31.316 1.00 26.83 ? 80  GLU B C   1 
ATOM   4496 O  O   . GLU B 1 79  ? 71.576  5.957   -32.436 1.00 26.33 ? 80  GLU B O   1 
ATOM   4497 C  CB  . GLU B 1 79  ? 74.252  5.972   -30.855 1.00 29.45 ? 80  GLU B CB  1 
ATOM   4498 C  CG  . GLU B 1 79  ? 75.649  5.435   -30.499 1.00 33.08 ? 80  GLU B CG  1 
ATOM   4499 C  CD  . GLU B 1 79  ? 76.709  6.523   -30.378 1.00 38.33 ? 80  GLU B CD  1 
ATOM   4500 O  OE1 . GLU B 1 79  ? 76.387  7.665   -29.966 1.00 41.10 ? 80  GLU B OE1 1 
ATOM   4501 O  OE2 . GLU B 1 79  ? 77.885  6.225   -30.679 1.00 41.90 ? 80  GLU B OE2 1 
ATOM   4502 N  N   . ARG B 1 80  ? 70.963  5.516   -30.301 1.00 25.18 ? 81  ARG B N   1 
ATOM   4503 C  CA  . ARG B 1 80  ? 69.671  6.218   -30.374 1.00 23.86 ? 81  ARG B CA  1 
ATOM   4504 C  C   . ARG B 1 80  ? 69.782  7.513   -29.555 1.00 23.13 ? 81  ARG B C   1 
ATOM   4505 O  O   . ARG B 1 80  ? 70.863  7.828   -29.046 1.00 22.51 ? 81  ARG B O   1 
ATOM   4506 C  CB  . ARG B 1 80  ? 68.536  5.331   -29.844 1.00 23.22 ? 81  ARG B CB  1 
ATOM   4507 C  CG  . ARG B 1 80  ? 68.541  5.153   -28.320 1.00 23.40 ? 81  ARG B CG  1 
ATOM   4508 C  CD  . ARG B 1 80  ? 67.321  4.412   -27.808 1.00 20.30 ? 81  ARG B CD  1 
ATOM   4509 N  NE  . ARG B 1 80  ? 67.323  2.989   -28.150 1.00 20.42 ? 81  ARG B NE  1 
ATOM   4510 C  CZ  . ARG B 1 80  ? 67.946  2.032   -27.462 1.00 20.98 ? 81  ARG B CZ  1 
ATOM   4511 N  NH1 . ARG B 1 80  ? 68.694  2.324   -26.405 1.00 20.10 ? 81  ARG B NH1 1 
ATOM   4512 N  NH2 . ARG B 1 80  ? 67.848  0.762   -27.855 1.00 21.70 ? 81  ARG B NH2 1 
ATOM   4513 N  N   . PHE B 1 81  ? 68.675  8.246   -29.424 1.00 22.96 ? 82  PHE B N   1 
ATOM   4514 C  CA  . PHE B 1 81  ? 68.651  9.472   -28.637 1.00 23.10 ? 82  PHE B CA  1 
ATOM   4515 C  C   . PHE B 1 81  ? 68.682  9.127   -27.166 1.00 23.54 ? 82  PHE B C   1 
ATOM   4516 O  O   . PHE B 1 81  ? 67.883  8.303   -26.707 1.00 23.72 ? 82  PHE B O   1 
ATOM   4517 C  CB  . PHE B 1 81  ? 67.407  10.311  -28.960 1.00 23.66 ? 82  PHE B CB  1 
ATOM   4518 C  CG  . PHE B 1 81  ? 67.352  11.639  -28.236 1.00 22.28 ? 82  PHE B CG  1 
ATOM   4519 C  CD1 . PHE B 1 81  ? 68.192  12.693  -28.613 1.00 22.27 ? 82  PHE B CD1 1 
ATOM   4520 C  CD2 . PHE B 1 81  ? 66.441  11.845  -27.201 1.00 21.74 ? 82  PHE B CD2 1 
ATOM   4521 C  CE1 . PHE B 1 81  ? 68.139  13.933  -27.949 1.00 22.81 ? 82  PHE B CE1 1 
ATOM   4522 C  CE2 . PHE B 1 81  ? 66.372  13.089  -26.526 1.00 22.67 ? 82  PHE B CE2 1 
ATOM   4523 C  CZ  . PHE B 1 81  ? 67.227  14.131  -26.907 1.00 21.46 ? 82  PHE B CZ  1 
ATOM   4524 N  N   . LEU B 1 82  ? 69.630  9.733   -26.444 1.00 22.99 ? 83  LEU B N   1 
ATOM   4525 C  CA  . LEU B 1 82  ? 69.705  9.603   -24.989 1.00 23.25 ? 83  LEU B CA  1 
ATOM   4526 C  C   . LEU B 1 82  ? 68.858  10.689  -24.305 1.00 22.67 ? 83  LEU B C   1 
ATOM   4527 O  O   . LEU B 1 82  ? 68.909  11.856  -24.684 1.00 22.67 ? 83  LEU B O   1 
ATOM   4528 C  CB  . LEU B 1 82  ? 71.170  9.630   -24.511 1.00 22.91 ? 83  LEU B CB  1 
ATOM   4529 C  CG  . LEU B 1 82  ? 72.092  8.530   -25.075 1.00 24.92 ? 83  LEU B CG  1 
ATOM   4530 C  CD1 . LEU B 1 82  ? 73.573  8.935   -24.969 1.00 26.37 ? 83  LEU B CD1 1 
ATOM   4531 C  CD2 . LEU B 1 82  ? 71.868  7.187   -24.396 1.00 24.77 ? 83  LEU B CD2 1 
ATOM   4532 N  N   . ILE B 1 83  ? 68.075  10.286  -23.305 1.00 22.56 ? 84  ILE B N   1 
ATOM   4533 C  CA  . ILE B 1 83  ? 67.194  11.202  -22.585 1.00 21.82 ? 84  ILE B CA  1 
ATOM   4534 C  C   . ILE B 1 83  ? 68.063  12.071  -21.652 1.00 21.88 ? 84  ILE B C   1 
ATOM   4535 O  O   . ILE B 1 83  ? 68.656  11.567  -20.713 1.00 21.67 ? 84  ILE B O   1 
ATOM   4536 C  CB  . ILE B 1 83  ? 66.105  10.434  -21.760 1.00 21.80 ? 84  ILE B CB  1 
ATOM   4537 C  CG1 . ILE B 1 83  ? 65.265  9.477   -22.650 1.00 21.07 ? 84  ILE B CG1 1 
ATOM   4538 C  CG2 . ILE B 1 83  ? 65.188  11.423  -21.017 1.00 20.95 ? 84  ILE B CG2 1 
ATOM   4539 C  CD1 . ILE B 1 83  ? 64.412  10.169  -23.728 1.00 20.03 ? 84  ILE B CD1 1 
ATOM   4540 N  N   . PRO B 1 84  ? 68.148  13.381  -21.917 1.00 21.94 ? 85  PRO B N   1 
ATOM   4541 C  CA  . PRO B 1 84  ? 69.147  14.176  -21.166 1.00 22.06 ? 85  PRO B CA  1 
ATOM   4542 C  C   . PRO B 1 84  ? 68.982  14.200  -19.626 1.00 21.72 ? 85  PRO B C   1 
ATOM   4543 O  O   . PRO B 1 84  ? 69.981  14.137  -18.926 1.00 22.25 ? 85  PRO B O   1 
ATOM   4544 C  CB  . PRO B 1 84  ? 69.003  15.579  -21.770 1.00 21.98 ? 85  PRO B CB  1 
ATOM   4545 C  CG  . PRO B 1 84  ? 68.465  15.322  -23.154 1.00 22.13 ? 85  PRO B CG  1 
ATOM   4546 C  CD  . PRO B 1 84  ? 67.486  14.186  -22.958 1.00 21.33 ? 85  PRO B CD  1 
ATOM   4547 N  N   . PRO B 1 85  ? 67.747  14.269  -19.094 1.00 21.34 ? 86  PRO B N   1 
ATOM   4548 C  CA  . PRO B 1 85  ? 67.743  14.197  -17.614 1.00 21.14 ? 86  PRO B CA  1 
ATOM   4549 C  C   . PRO B 1 85  ? 68.238  12.860  -17.036 1.00 21.00 ? 86  PRO B C   1 
ATOM   4550 O  O   . PRO B 1 85  ? 68.778  12.843  -15.912 1.00 21.29 ? 86  PRO B O   1 
ATOM   4551 C  CB  . PRO B 1 85  ? 66.272  14.420  -17.236 1.00 20.94 ? 86  PRO B CB  1 
ATOM   4552 C  CG  . PRO B 1 85  ? 65.486  14.175  -18.509 1.00 21.33 ? 86  PRO B CG  1 
ATOM   4553 C  CD  . PRO B 1 85  ? 66.408  14.571  -19.638 1.00 21.44 ? 86  PRO B CD  1 
ATOM   4554 N  N   . TRP B 1 86  ? 68.059  11.764  -17.779 1.00 20.26 ? 87  TRP B N   1 
ATOM   4555 C  CA  . TRP B 1 86  ? 68.511  10.431  -17.342 1.00 19.77 ? 87  TRP B CA  1 
ATOM   4556 C  C   . TRP B 1 86  ? 70.024  10.409  -17.285 1.00 20.09 ? 87  TRP B C   1 
ATOM   4557 O  O   . TRP B 1 86  ? 70.623  9.945   -16.300 1.00 19.93 ? 87  TRP B O   1 
ATOM   4558 C  CB  . TRP B 1 86  ? 67.995  9.310   -18.287 1.00 18.69 ? 87  TRP B CB  1 
ATOM   4559 C  CG  . TRP B 1 86  ? 66.476  9.148   -18.324 1.00 18.54 ? 87  TRP B CG  1 
ATOM   4560 C  CD1 . TRP B 1 86  ? 65.553  9.951   -17.730 1.00 18.51 ? 87  TRP B CD1 1 
ATOM   4561 C  CD2 . TRP B 1 86  ? 65.731  8.134   -19.021 1.00 18.32 ? 87  TRP B CD2 1 
ATOM   4562 N  NE1 . TRP B 1 86  ? 64.276  9.495   -17.995 1.00 20.16 ? 87  TRP B NE1 1 
ATOM   4563 C  CE2 . TRP B 1 86  ? 64.360  8.383   -18.786 1.00 18.53 ? 87  TRP B CE2 1 
ATOM   4564 C  CE3 . TRP B 1 86  ? 66.096  7.032   -19.813 1.00 20.72 ? 87  TRP B CE3 1 
ATOM   4565 C  CZ2 . TRP B 1 86  ? 63.348  7.577   -19.310 1.00 17.61 ? 87  TRP B CZ2 1 
ATOM   4566 C  CZ3 . TRP B 1 86  ? 65.084  6.231   -20.351 1.00 19.87 ? 87  TRP B CZ3 1 
ATOM   4567 C  CH2 . TRP B 1 86  ? 63.727  6.517   -20.105 1.00 19.70 ? 87  TRP B CH2 1 
ATOM   4568 N  N   . VAL B 1 87  ? 70.632  10.892  -18.365 1.00 20.95 ? 88  VAL B N   1 
ATOM   4569 C  CA  . VAL B 1 87  ? 72.081  11.010  -18.461 1.00 22.11 ? 88  VAL B CA  1 
ATOM   4570 C  C   . VAL B 1 87  ? 72.618  11.891  -17.322 1.00 22.59 ? 88  VAL B C   1 
ATOM   4571 O  O   . VAL B 1 87  ? 73.551  11.492  -16.607 1.00 23.23 ? 88  VAL B O   1 
ATOM   4572 C  CB  . VAL B 1 87  ? 72.486  11.578  -19.849 1.00 22.32 ? 88  VAL B CB  1 
ATOM   4573 C  CG1 . VAL B 1 87  ? 73.977  11.972  -19.879 1.00 22.67 ? 88  VAL B CG1 1 
ATOM   4574 C  CG2 . VAL B 1 87  ? 72.149  10.546  -20.962 1.00 22.92 ? 88  VAL B CG2 1 
ATOM   4575 N  N   . ALA B 1 88  ? 72.024  13.075  -17.144 1.00 22.82 ? 89  ALA B N   1 
ATOM   4576 C  CA  . ALA B 1 88  ? 72.502  14.027  -16.119 1.00 23.16 ? 89  ALA B CA  1 
ATOM   4577 C  C   . ALA B 1 88  ? 72.475  13.403  -14.732 1.00 23.52 ? 89  ALA B C   1 
ATOM   4578 O  O   . ALA B 1 88  ? 73.438  13.528  -13.973 1.00 23.70 ? 89  ALA B O   1 
ATOM   4579 C  CB  . ALA B 1 88  ? 71.671  15.307  -16.135 1.00 23.02 ? 89  ALA B CB  1 
ATOM   4580 N  N   . TYR B 1 89  ? 71.378  12.721  -14.412 1.00 23.34 ? 90  TYR B N   1 
ATOM   4581 C  CA  . TYR B 1 89  ? 71.234  12.073  -13.113 1.00 24.11 ? 90  TYR B CA  1 
ATOM   4582 C  C   . TYR B 1 89  ? 72.337  11.045  -12.863 1.00 24.78 ? 90  TYR B C   1 
ATOM   4583 O  O   . TYR B 1 89  ? 72.928  11.027  -11.788 1.00 24.93 ? 90  TYR B O   1 
ATOM   4584 C  CB  . TYR B 1 89  ? 69.856  11.414  -12.962 1.00 23.05 ? 90  TYR B CB  1 
ATOM   4585 C  CG  . TYR B 1 89  ? 69.778  10.526  -11.734 1.00 23.69 ? 90  TYR B CG  1 
ATOM   4586 C  CD1 . TYR B 1 89  ? 69.469  11.059  -10.480 1.00 20.98 ? 90  TYR B CD1 1 
ATOM   4587 C  CD2 . TYR B 1 89  ? 70.040  9.158   -11.821 1.00 22.10 ? 90  TYR B CD2 1 
ATOM   4588 C  CE1 . TYR B 1 89  ? 69.410  10.242  -9.352  1.00 23.06 ? 90  TYR B CE1 1 
ATOM   4589 C  CE2 . TYR B 1 89  ? 69.977  8.338   -10.694 1.00 23.65 ? 90  TYR B CE2 1 
ATOM   4590 C  CZ  . TYR B 1 89  ? 69.668  8.888   -9.468  1.00 22.39 ? 90  TYR B CZ  1 
ATOM   4591 O  OH  . TYR B 1 89  ? 69.603  8.084   -8.358  1.00 22.75 ? 90  TYR B OH  1 
ATOM   4592 N  N   . HIS B 1 90  ? 72.592  10.189  -13.851 1.00 25.95 ? 91  HIS B N   1 
ATOM   4593 C  CA  . HIS B 1 90  ? 73.584  9.122   -13.729 1.00 27.76 ? 91  HIS B CA  1 
ATOM   4594 C  C   . HIS B 1 90  ? 74.993  9.703   -13.618 1.00 29.10 ? 91  HIS B C   1 
ATOM   4595 O  O   . HIS B 1 90  ? 75.808  9.227   -12.820 1.00 29.43 ? 91  HIS B O   1 
ATOM   4596 C  CB  . HIS B 1 90  ? 73.516  8.166   -14.929 1.00 27.42 ? 91  HIS B CB  1 
ATOM   4597 C  CG  . HIS B 1 90  ? 72.381  7.193   -14.872 1.00 27.27 ? 91  HIS B CG  1 
ATOM   4598 N  ND1 . HIS B 1 90  ? 71.090  7.535   -15.212 1.00 28.00 ? 91  HIS B ND1 1 
ATOM   4599 C  CD2 . HIS B 1 90  ? 72.342  5.886   -14.518 1.00 27.85 ? 91  HIS B CD2 1 
ATOM   4600 C  CE1 . HIS B 1 90  ? 70.307  6.480   -15.074 1.00 27.02 ? 91  HIS B CE1 1 
ATOM   4601 N  NE2 . HIS B 1 90  ? 71.041  5.467   -14.654 1.00 27.41 ? 91  HIS B NE2 1 
ATOM   4602 N  N   . GLN B 1 91  ? 75.273  10.724  -14.423 1.00 30.87 ? 92  GLN B N   1 
ATOM   4603 C  CA  . GLN B 1 91  ? 76.594  11.357  -14.426 1.00 32.89 ? 92  GLN B CA  1 
ATOM   4604 C  C   . GLN B 1 91  ? 76.816  12.142  -13.130 1.00 33.39 ? 92  GLN B C   1 
ATOM   4605 O  O   . GLN B 1 91  ? 77.778  11.882  -12.406 1.00 33.60 ? 92  GLN B O   1 
ATOM   4606 C  CB  . GLN B 1 91  ? 76.801  12.217  -15.685 1.00 32.93 ? 92  GLN B CB  1 
ATOM   4607 C  CG  . GLN B 1 91  ? 77.015  11.362  -16.966 1.00 35.60 ? 92  GLN B CG  1 
ATOM   4608 C  CD  . GLN B 1 91  ? 77.211  12.176  -18.253 1.00 37.26 ? 92  GLN B CD  1 
ATOM   4609 O  OE1 . GLN B 1 91  ? 77.006  13.397  -18.283 1.00 39.56 ? 92  GLN B OE1 1 
ATOM   4610 N  NE2 . GLN B 1 91  ? 77.600  11.490  -19.327 1.00 37.09 ? 92  GLN B NE2 1 
ATOM   4611 N  N   . TYR B 1 92  ? 75.899  13.052  -12.814 1.00 34.30 ? 93  TYR B N   1 
ATOM   4612 C  CA  . TYR B 1 92  ? 76.023  13.873  -11.608 1.00 35.51 ? 93  TYR B CA  1 
ATOM   4613 C  C   . TYR B 1 92  ? 76.071  13.083  -10.301 1.00 35.96 ? 93  TYR B C   1 
ATOM   4614 O  O   . TYR B 1 92  ? 76.931  13.341  -9.449  1.00 35.89 ? 93  TYR B O   1 
ATOM   4615 C  CB  . TYR B 1 92  ? 74.938  14.959  -11.536 1.00 35.73 ? 93  TYR B CB  1 
ATOM   4616 C  CG  . TYR B 1 92  ? 75.164  15.953  -10.408 1.00 38.24 ? 93  TYR B CG  1 
ATOM   4617 C  CD1 . TYR B 1 92  ? 76.079  17.008  -10.548 1.00 39.56 ? 93  TYR B CD1 1 
ATOM   4618 C  CD2 . TYR B 1 92  ? 74.483  15.829  -9.188  1.00 40.06 ? 93  TYR B CD2 1 
ATOM   4619 C  CE1 . TYR B 1 92  ? 76.296  17.922  -9.510  1.00 40.53 ? 93  TYR B CE1 1 
ATOM   4620 C  CE2 . TYR B 1 92  ? 74.691  16.748  -8.141  1.00 41.43 ? 93  TYR B CE2 1 
ATOM   4621 C  CZ  . TYR B 1 92  ? 75.601  17.786  -8.315  1.00 41.96 ? 93  TYR B CZ  1 
ATOM   4622 O  OH  . TYR B 1 92  ? 75.818  18.689  -7.291  1.00 44.21 ? 93  TYR B OH  1 
ATOM   4623 N  N   . TYR B 1 93  ? 75.169  12.117  -10.135 1.00 36.34 ? 94  TYR B N   1 
ATOM   4624 C  CA  . TYR B 1 93  ? 75.157  11.326  -8.901  1.00 36.80 ? 94  TYR B CA  1 
ATOM   4625 C  C   . TYR B 1 93  ? 75.981  10.044  -8.994  1.00 37.05 ? 94  TYR B C   1 
ATOM   4626 O  O   . TYR B 1 93  ? 75.922  9.189   -8.105  1.00 37.29 ? 94  TYR B O   1 
ATOM   4627 C  CB  . TYR B 1 93  ? 73.724  11.065  -8.423  1.00 36.98 ? 94  TYR B CB  1 
ATOM   4628 C  CG  . TYR B 1 93  ? 72.977  12.329  -8.037  1.00 37.66 ? 94  TYR B CG  1 
ATOM   4629 C  CD1 . TYR B 1 93  ? 72.204  13.022  -8.973  1.00 37.58 ? 94  TYR B CD1 1 
ATOM   4630 C  CD2 . TYR B 1 93  ? 73.054  12.842  -6.735  1.00 38.29 ? 94  TYR B CD2 1 
ATOM   4631 C  CE1 . TYR B 1 93  ? 71.523  14.189  -8.627  1.00 38.22 ? 94  TYR B CE1 1 
ATOM   4632 C  CE2 . TYR B 1 93  ? 72.370  14.007  -6.377  1.00 38.34 ? 94  TYR B CE2 1 
ATOM   4633 C  CZ  . TYR B 1 93  ? 71.607  14.675  -7.325  1.00 38.97 ? 94  TYR B CZ  1 
ATOM   4634 O  OH  . TYR B 1 93  ? 70.930  15.827  -6.984  1.00 39.14 ? 94  TYR B OH  1 
ATOM   4635 N  N   . GLN B 1 94  ? 76.758  9.925   -10.069 1.00 37.32 ? 95  GLN B N   1 
ATOM   4636 C  CA  . GLN B 1 94  ? 77.712  8.811   -10.277 1.00 37.68 ? 95  GLN B CA  1 
ATOM   4637 C  C   . GLN B 1 94  ? 77.140  7.382   -10.156 1.00 37.23 ? 95  GLN B C   1 
ATOM   4638 O  O   . GLN B 1 94  ? 77.765  6.477   -9.574  1.00 37.32 ? 95  GLN B O   1 
ATOM   4639 C  CB  . GLN B 1 94  ? 78.970  8.999   -9.423  1.00 37.97 ? 95  GLN B CB  1 
ATOM   4640 C  CG  . GLN B 1 94  ? 79.880  10.124  -9.941  1.00 40.37 ? 95  GLN B CG  1 
ATOM   4641 C  CD  . GLN B 1 94  ? 80.931  10.564  -8.933  1.00 42.32 ? 95  GLN B CD  1 
ATOM   4642 O  OE1 . GLN B 1 94  ? 80.680  10.610  -7.720  1.00 41.71 ? 95  GLN B OE1 1 
ATOM   4643 N  NE2 . GLN B 1 94  ? 82.117  10.904  -9.435  1.00 43.80 ? 95  GLN B NE2 1 
ATOM   4644 N  N   . ARG B 1 95  ? 75.966  7.185   -10.744 1.00 36.55 ? 96  ARG B N   1 
ATOM   4645 C  CA  . ARG B 1 95  ? 75.296  5.890   -10.732 1.00 35.95 ? 96  ARG B CA  1 
ATOM   4646 C  C   . ARG B 1 95  ? 75.818  5.008   -11.858 1.00 35.67 ? 96  ARG B C   1 
ATOM   4647 O  O   . ARG B 1 95  ? 75.946  5.467   -12.991 1.00 35.12 ? 96  ARG B O   1 
ATOM   4648 C  CB  . ARG B 1 95  ? 73.789  6.076   -10.870 1.00 36.28 ? 96  ARG B CB  1 
ATOM   4649 C  CG  . ARG B 1 95  ? 73.160  6.891   -9.751  1.00 36.72 ? 96  ARG B CG  1 
ATOM   4650 C  CD  . ARG B 1 95  ? 72.741  6.006   -8.607  1.00 38.73 ? 96  ARG B CD  1 
ATOM   4651 N  NE  . ARG B 1 95  ? 72.337  6.782   -7.444  1.00 42.42 ? 96  ARG B NE  1 
ATOM   4652 C  CZ  . ARG B 1 95  ? 72.100  6.260   -6.244  1.00 45.04 ? 96  ARG B CZ  1 
ATOM   4653 N  NH1 . ARG B 1 95  ? 72.225  4.952   -6.042  1.00 46.07 ? 96  ARG B NH1 1 
ATOM   4654 N  NH2 . ARG B 1 95  ? 71.742  7.049   -5.238  1.00 47.30 ? 96  ARG B NH2 1 
ATOM   4655 N  N   . PRO B 1 96  ? 76.121  3.732   -11.547 1.00 35.23 ? 97  PRO B N   1 
ATOM   4656 C  CA  . PRO B 1 96  ? 76.599  2.793   -12.559 1.00 35.00 ? 97  PRO B CA  1 
ATOM   4657 C  C   . PRO B 1 96  ? 75.587  2.698   -13.693 1.00 34.40 ? 97  PRO B C   1 
ATOM   4658 O  O   . PRO B 1 96  ? 74.381  2.588   -13.443 1.00 34.77 ? 97  PRO B O   1 
ATOM   4659 C  CB  . PRO B 1 96  ? 76.674  1.461   -11.801 1.00 35.10 ? 97  PRO B CB  1 
ATOM   4660 C  CG  . PRO B 1 96  ? 75.765  1.646   -10.597 1.00 35.93 ? 97  PRO B CG  1 
ATOM   4661 C  CD  . PRO B 1 96  ? 75.942  3.085   -10.234 1.00 35.25 ? 97  PRO B CD  1 
ATOM   4662 N  N   . ILE B 1 97  ? 76.065  2.783   -14.926 1.00 33.47 ? 98  ILE B N   1 
ATOM   4663 C  CA  . ILE B 1 97  ? 75.161  2.781   -16.068 1.00 32.73 ? 98  ILE B CA  1 
ATOM   4664 C  C   . ILE B 1 97  ? 75.083  1.396   -16.686 1.00 32.09 ? 98  ILE B C   1 
ATOM   4665 O  O   . ILE B 1 97  ? 76.056  0.626   -16.650 1.00 31.65 ? 98  ILE B O   1 
ATOM   4666 C  CB  . ILE B 1 97  ? 75.539  3.848   -17.133 1.00 32.57 ? 98  ILE B CB  1 
ATOM   4667 C  CG1 . ILE B 1 97  ? 76.942  3.601   -17.702 1.00 31.75 ? 98  ILE B CG1 1 
ATOM   4668 C  CG2 . ILE B 1 97  ? 75.425  5.241   -16.534 1.00 33.43 ? 98  ILE B CG2 1 
ATOM   4669 C  CD1 . ILE B 1 97  ? 77.338  4.546   -18.828 1.00 30.48 ? 98  ILE B CD1 1 
ATOM   4670 N  N   . GLY B 1 98  ? 73.907  1.081   -17.225 1.00 31.05 ? 99  GLY B N   1 
ATOM   4671 C  CA  . GLY B 1 98  ? 73.714  -0.150  -17.948 1.00 29.31 ? 99  GLY B CA  1 
ATOM   4672 C  C   . GLY B 1 98  ? 73.653  0.086   -19.440 1.00 28.72 ? 99  GLY B C   1 
ATOM   4673 O  O   . GLY B 1 98  ? 73.938  1.181   -19.948 1.00 28.71 ? 99  GLY B O   1 
ATOM   4674 N  N   . VAL B 1 99  ? 73.255  -0.965  -20.134 1.00 27.66 ? 100 VAL B N   1 
ATOM   4675 C  CA  . VAL B 1 99  ? 73.287  -1.047  -21.579 1.00 27.25 ? 100 VAL B CA  1 
ATOM   4676 C  C   . VAL B 1 99  ? 72.523  0.128   -22.243 1.00 27.24 ? 100 VAL B C   1 
ATOM   4677 O  O   . VAL B 1 99  ? 72.914  0.611   -23.307 1.00 26.77 ? 100 VAL B O   1 
ATOM   4678 C  CB  . VAL B 1 99  ? 72.798  -2.468  -22.007 1.00 27.24 ? 100 VAL B CB  1 
ATOM   4679 C  CG1 . VAL B 1 99  ? 71.269  -2.643  -21.795 1.00 26.75 ? 100 VAL B CG1 1 
ATOM   4680 C  CG2 . VAL B 1 99  ? 73.230  -2.828  -23.397 1.00 28.13 ? 100 VAL B CG2 1 
ATOM   4681 N  N   . LEU B 1 100 ? 71.459  0.611   -21.597 1.00 27.04 ? 101 LEU B N   1 
ATOM   4682 C  CA  . LEU B 1 100 ? 70.705  1.751   -22.132 1.00 26.95 ? 101 LEU B CA  1 
ATOM   4683 C  C   . LEU B 1 100 ? 71.548  3.019   -22.369 1.00 26.98 ? 101 LEU B C   1 
ATOM   4684 O  O   . LEU B 1 100 ? 71.354  3.729   -23.346 1.00 25.98 ? 101 LEU B O   1 
ATOM   4685 C  CB  . LEU B 1 100 ? 69.525  2.084   -21.218 1.00 26.88 ? 101 LEU B CB  1 
ATOM   4686 C  CG  . LEU B 1 100 ? 68.649  3.279   -21.609 1.00 27.13 ? 101 LEU B CG  1 
ATOM   4687 C  CD1 . LEU B 1 100 ? 67.876  2.988   -22.866 1.00 27.79 ? 101 LEU B CD1 1 
ATOM   4688 C  CD2 . LEU B 1 100 ? 67.722  3.626   -20.480 1.00 26.46 ? 101 LEU B CD2 1 
ATOM   4689 N  N   . LEU B 1 101 ? 72.480  3.288   -21.465 1.00 27.69 ? 102 LEU B N   1 
ATOM   4690 C  CA  . LEU B 1 101 ? 73.225  4.542   -21.479 1.00 28.67 ? 102 LEU B CA  1 
ATOM   4691 C  C   . LEU B 1 101 ? 74.663  4.407   -22.004 1.00 29.50 ? 102 LEU B C   1 
ATOM   4692 O  O   . LEU B 1 101 ? 75.392  5.400   -22.091 1.00 29.67 ? 102 LEU B O   1 
ATOM   4693 C  CB  . LEU B 1 101 ? 73.202  5.165   -20.084 1.00 28.60 ? 102 LEU B CB  1 
ATOM   4694 C  CG  . LEU B 1 101 ? 71.795  5.481   -19.543 1.00 29.65 ? 102 LEU B CG  1 
ATOM   4695 C  CD1 . LEU B 1 101 ? 71.893  6.210   -18.226 1.00 31.40 ? 102 LEU B CD1 1 
ATOM   4696 C  CD2 . LEU B 1 101 ? 70.981  6.314   -20.519 1.00 31.25 ? 102 LEU B CD2 1 
ATOM   4697 N  N   . LYS B 1 102 ? 75.049  3.184   -22.367 1.00 29.62 ? 103 LYS B N   1 
ATOM   4698 C  CA  . LYS B 1 102 ? 76.369  2.909   -22.915 1.00 30.24 ? 103 LYS B CA  1 
ATOM   4699 C  C   . LYS B 1 102 ? 76.398  3.055   -24.428 1.00 30.48 ? 103 LYS B C   1 
ATOM   4700 O  O   . LYS B 1 102 ? 75.355  3.101   -25.085 1.00 30.77 ? 103 LYS B O   1 
ATOM   4701 C  CB  . LYS B 1 102 ? 76.827  1.501   -22.515 1.00 30.16 ? 103 LYS B CB  1 
ATOM   4702 C  CG  . LYS B 1 102 ? 77.149  1.377   -21.042 1.00 30.13 ? 103 LYS B CG  1 
ATOM   4703 C  CD  . LYS B 1 102 ? 77.711  0.010   -20.712 1.00 32.04 ? 103 LYS B CD  1 
ATOM   4704 C  CE  . LYS B 1 102 ? 78.188  -0.022  -19.270 1.00 31.42 ? 103 LYS B CE  1 
ATOM   4705 N  NZ  . LYS B 1 102 ? 78.510  -1.398  -18.862 1.00 32.59 ? 103 LYS B NZ  1 
ATOM   4706 N  N   . LYS B 1 103 ? 77.606  3.125   -24.975 1.00 31.19 ? 104 LYS B N   1 
ATOM   4707 C  CA  . LYS B 1 103 ? 77.813  3.214   -26.421 1.00 31.80 ? 104 LYS B CA  1 
ATOM   4708 C  C   . LYS B 1 103 ? 79.022  2.361   -26.824 1.00 31.94 ? 104 LYS B C   1 
ATOM   4709 O  O   . LYS B 1 103 ? 79.736  1.848   -25.964 1.00 31.12 ? 104 LYS B O   1 
ATOM   4710 C  CB  . LYS B 1 103 ? 78.039  4.670   -26.841 1.00 31.99 ? 104 LYS B CB  1 
ATOM   4711 C  CG  . LYS B 1 103 ? 79.247  5.360   -26.168 1.00 34.80 ? 104 LYS B CG  1 
ATOM   4712 C  CD  . LYS B 1 103 ? 79.516  6.751   -26.751 1.00 37.52 ? 104 LYS B CD  1 
ATOM   4713 C  CE  . LYS B 1 103 ? 80.181  6.650   -28.131 1.00 39.24 ? 104 LYS B CE  1 
ATOM   4714 N  NZ  . LYS B 1 103 ? 79.657  7.667   -29.098 1.00 40.27 ? 104 LYS B NZ  1 
ATOM   4715 N  N   . SER B 1 104 ? 79.220  2.205   -28.132 1.00 32.65 ? 105 SER B N   1 
ATOM   4716 C  CA  . SER B 1 104 ? 80.421  1.593   -28.693 1.00 33.21 ? 105 SER B CA  1 
ATOM   4717 C  C   . SER B 1 104 ? 80.690  0.208   -28.090 1.00 33.24 ? 105 SER B C   1 
ATOM   4718 O  O   . SER B 1 104 ? 79.743  -0.540  -27.778 1.00 32.70 ? 105 SER B O   1 
ATOM   4719 C  CB  . SER B 1 104 ? 81.626  2.543   -28.520 1.00 33.77 ? 105 SER B CB  1 
ATOM   4720 O  OG  . SER B 1 104 ? 82.727  2.151   -29.334 1.00 36.04 ? 105 SER B OG  1 
ATOM   4721 N  N   . ALA B 1 105 ? 81.973  -0.121  -27.918 1.00 32.96 ? 106 ALA B N   1 
ATOM   4722 C  CA  . ALA B 1 105 ? 82.403  -1.451  -27.484 1.00 32.68 ? 106 ALA B CA  1 
ATOM   4723 C  C   . ALA B 1 105 ? 81.889  -1.808  -26.096 1.00 32.38 ? 106 ALA B C   1 
ATOM   4724 O  O   . ALA B 1 105 ? 81.591  -2.974  -25.829 1.00 32.51 ? 106 ALA B O   1 
ATOM   4725 C  CB  . ALA B 1 105 ? 83.946  -1.565  -27.529 1.00 32.68 ? 106 ALA B CB  1 
ATOM   4726 N  N   . ALA B 1 106 ? 81.793  -0.817  -25.210 1.00 31.45 ? 107 ALA B N   1 
ATOM   4727 C  CA  . ALA B 1 106 ? 81.319  -1.091  -23.860 1.00 30.96 ? 107 ALA B CA  1 
ATOM   4728 C  C   . ALA B 1 106 ? 79.827  -1.466  -23.855 1.00 30.58 ? 107 ALA B C   1 
ATOM   4729 O  O   . ALA B 1 106 ? 79.396  -2.270  -23.029 1.00 30.61 ? 107 ALA B O   1 
ATOM   4730 C  CB  . ALA B 1 106 ? 81.605  0.068   -22.922 1.00 31.06 ? 107 ALA B CB  1 
ATOM   4731 N  N   . TRP B 1 107 ? 79.055  -0.909  -24.785 1.00 29.82 ? 108 TRP B N   1 
ATOM   4732 C  CA  . TRP B 1 107 ? 77.658  -1.312  -24.945 1.00 29.61 ? 108 TRP B CA  1 
ATOM   4733 C  C   . TRP B 1 107 ? 77.580  -2.744  -25.469 1.00 30.21 ? 108 TRP B C   1 
ATOM   4734 O  O   . TRP B 1 107 ? 76.803  -3.559  -24.964 1.00 29.61 ? 108 TRP B O   1 
ATOM   4735 C  CB  . TRP B 1 107 ? 76.881  -0.365  -25.880 1.00 28.81 ? 108 TRP B CB  1 
ATOM   4736 C  CG  . TRP B 1 107 ? 75.584  -0.982  -26.334 1.00 28.34 ? 108 TRP B CG  1 
ATOM   4737 C  CD1 . TRP B 1 107 ? 74.400  -0.995  -25.651 1.00 27.27 ? 108 TRP B CD1 1 
ATOM   4738 C  CD2 . TRP B 1 107 ? 75.355  -1.719  -27.547 1.00 27.77 ? 108 TRP B CD2 1 
ATOM   4739 N  NE1 . TRP B 1 107 ? 73.449  -1.679  -26.369 1.00 26.62 ? 108 TRP B NE1 1 
ATOM   4740 C  CE2 . TRP B 1 107 ? 74.009  -2.136  -27.533 1.00 27.30 ? 108 TRP B CE2 1 
ATOM   4741 C  CE3 . TRP B 1 107 ? 76.157  -2.054  -28.649 1.00 28.16 ? 108 TRP B CE3 1 
ATOM   4742 C  CZ2 . TRP B 1 107 ? 73.445  -2.888  -28.572 1.00 25.85 ? 108 TRP B CZ2 1 
ATOM   4743 C  CZ3 . TRP B 1 107 ? 75.588  -2.799  -29.689 1.00 27.81 ? 108 TRP B CZ3 1 
ATOM   4744 C  CH2 . TRP B 1 107 ? 74.243  -3.197  -29.637 1.00 26.86 ? 108 TRP B CH2 1 
ATOM   4745 N  N   . LYS B 1 108 ? 78.400  -3.039  -26.478 1.00 31.09 ? 109 LYS B N   1 
ATOM   4746 C  CA  . LYS B 1 108 ? 78.385  -4.341  -27.138 1.00 32.17 ? 109 LYS B CA  1 
ATOM   4747 C  C   . LYS B 1 108 ? 78.695  -5.474  -26.157 1.00 32.38 ? 109 LYS B C   1 
ATOM   4748 O  O   . LYS B 1 108 ? 78.038  -6.511  -26.191 1.00 31.93 ? 109 LYS B O   1 
ATOM   4749 C  CB  . LYS B 1 108 ? 79.340  -4.351  -28.343 1.00 32.87 ? 109 LYS B CB  1 
ATOM   4750 C  CG  . LYS B 1 108 ? 79.372  -5.681  -29.117 1.00 35.21 ? 109 LYS B CG  1 
ATOM   4751 C  CD  . LYS B 1 108 ? 77.999  -6.059  -29.686 1.00 37.76 ? 109 LYS B CD  1 
ATOM   4752 C  CE  . LYS B 1 108 ? 77.951  -5.942  -31.204 1.00 40.55 ? 109 LYS B CE  1 
ATOM   4753 N  NZ  . LYS B 1 108 ? 78.565  -7.125  -31.878 1.00 41.23 ? 109 LYS B NZ  1 
ATOM   4754 N  N   . LYS B 1 109 ? 79.663  -5.239  -25.269 1.00 32.69 ? 110 LYS B N   1 
ATOM   4755 C  CA  . LYS B 1 109 ? 80.070  -6.194  -24.238 1.00 33.87 ? 110 LYS B CA  1 
ATOM   4756 C  C   . LYS B 1 109 ? 78.914  -6.582  -23.303 1.00 33.60 ? 110 LYS B C   1 
ATOM   4757 O  O   . LYS B 1 109 ? 78.667  -7.763  -23.079 1.00 33.59 ? 110 LYS B O   1 
ATOM   4758 C  CB  . LYS B 1 109 ? 81.241  -5.623  -23.429 1.00 34.52 ? 110 LYS B CB  1 
ATOM   4759 C  CG  . LYS B 1 109 ? 81.858  -6.591  -22.434 1.00 36.74 ? 110 LYS B CG  1 
ATOM   4760 C  CD  . LYS B 1 109 ? 82.884  -5.895  -21.559 1.00 39.38 ? 110 LYS B CD  1 
ATOM   4761 C  CE  . LYS B 1 109 ? 83.642  -6.902  -20.722 1.00 40.94 ? 110 LYS B CE  1 
ATOM   4762 N  NZ  . LYS B 1 109 ? 84.490  -6.222  -19.704 1.00 42.63 ? 110 LYS B NZ  1 
ATOM   4763 N  N   . ASP B 1 110 ? 78.219  -5.585  -22.756 1.00 33.45 ? 111 ASP B N   1 
ATOM   4764 C  CA  . ASP B 1 110 ? 77.009  -5.821  -21.959 1.00 33.12 ? 111 ASP B CA  1 
ATOM   4765 C  C   . ASP B 1 110 ? 75.925  -6.531  -22.769 1.00 32.46 ? 111 ASP B C   1 
ATOM   4766 O  O   . ASP B 1 110 ? 75.336  -7.513  -22.314 1.00 32.77 ? 111 ASP B O   1 
ATOM   4767 C  CB  . ASP B 1 110 ? 76.442  -4.499  -21.414 1.00 33.39 ? 111 ASP B CB  1 
ATOM   4768 C  CG  . ASP B 1 110 ? 77.127  -4.045  -20.132 1.00 35.56 ? 111 ASP B CG  1 
ATOM   4769 O  OD1 . ASP B 1 110 ? 78.249  -4.527  -19.843 1.00 37.28 ? 111 ASP B OD1 1 
ATOM   4770 O  OD2 . ASP B 1 110 ? 76.535  -3.206  -19.403 1.00 37.58 ? 111 ASP B OD2 1 
ATOM   4771 N  N   . ARG B 1 111 ? 75.660  -6.026  -23.965 1.00 31.58 ? 112 ARG B N   1 
ATOM   4772 C  CA  . ARG B 1 111 ? 74.550  -6.517  -24.760 1.00 31.22 ? 112 ARG B CA  1 
ATOM   4773 C  C   . ARG B 1 111 ? 74.684  -8.014  -25.079 1.00 31.54 ? 112 ARG B C   1 
ATOM   4774 O  O   . ARG B 1 111 ? 73.747  -8.778  -24.842 1.00 31.38 ? 112 ARG B O   1 
ATOM   4775 C  CB  . ARG B 1 111 ? 74.372  -5.693  -26.036 1.00 30.47 ? 112 ARG B CB  1 
ATOM   4776 C  CG  . ARG B 1 111 ? 73.128  -6.065  -26.854 1.00 29.26 ? 112 ARG B CG  1 
ATOM   4777 C  CD  . ARG B 1 111 ? 71.824  -5.814  -26.087 1.00 27.19 ? 112 ARG B CD  1 
ATOM   4778 N  NE  . ARG B 1 111 ? 70.676  -6.372  -26.801 1.00 25.56 ? 112 ARG B NE  1 
ATOM   4779 C  CZ  . ARG B 1 111 ? 69.627  -5.682  -27.244 1.00 24.15 ? 112 ARG B CZ  1 
ATOM   4780 N  NH1 . ARG B 1 111 ? 69.526  -4.368  -27.044 1.00 23.27 ? 112 ARG B NH1 1 
ATOM   4781 N  NH2 . ARG B 1 111 ? 68.662  -6.323  -27.885 1.00 21.73 ? 112 ARG B NH2 1 
ATOM   4782 N  N   . VAL B 1 112 ? 75.842  -8.419  -25.601 1.00 31.57 ? 113 VAL B N   1 
ATOM   4783 C  CA  . VAL B 1 112 ? 76.065  -9.825  -25.952 1.00 31.77 ? 113 VAL B CA  1 
ATOM   4784 C  C   . VAL B 1 112 ? 75.999  -10.731 -24.732 1.00 31.52 ? 113 VAL B C   1 
ATOM   4785 O  O   . VAL B 1 112 ? 75.434  -11.811 -24.817 1.00 32.16 ? 113 VAL B O   1 
ATOM   4786 C  CB  . VAL B 1 112 ? 77.360  -10.080 -26.782 1.00 31.75 ? 113 VAL B CB  1 
ATOM   4787 C  CG1 . VAL B 1 112 ? 77.265  -9.405  -28.132 1.00 31.92 ? 113 VAL B CG1 1 
ATOM   4788 C  CG2 . VAL B 1 112 ? 78.608  -9.636  -26.042 1.00 32.23 ? 113 VAL B CG2 1 
ATOM   4789 N  N   . ALA B 1 113 ? 76.533  -10.288 -23.594 1.00 31.01 ? 114 ALA B N   1 
ATOM   4790 C  CA  . ALA B 1 113 ? 76.397  -11.070 -22.365 1.00 30.56 ? 114 ALA B CA  1 
ATOM   4791 C  C   . ALA B 1 113 ? 74.924  -11.191 -21.945 1.00 30.24 ? 114 ALA B C   1 
ATOM   4792 O  O   . ALA B 1 113 ? 74.477  -12.278 -21.554 1.00 29.81 ? 114 ALA B O   1 
ATOM   4793 C  CB  . ALA B 1 113 ? 77.237  -10.486 -21.236 1.00 30.09 ? 114 ALA B CB  1 
ATOM   4794 N  N   . LEU B 1 114 ? 74.184  -10.078 -22.034 1.00 29.72 ? 115 LEU B N   1 
ATOM   4795 C  CA  . LEU B 1 114 ? 72.773  -10.056 -21.638 1.00 29.25 ? 115 LEU B CA  1 
ATOM   4796 C  C   . LEU B 1 114 ? 71.874  -10.840 -22.591 1.00 29.14 ? 115 LEU B C   1 
ATOM   4797 O  O   . LEU B 1 114 ? 70.998  -11.575 -22.144 1.00 28.77 ? 115 LEU B O   1 
ATOM   4798 C  CB  . LEU B 1 114 ? 72.251  -8.624  -21.478 1.00 28.99 ? 115 LEU B CB  1 
ATOM   4799 C  CG  . LEU B 1 114 ? 72.705  -7.884  -20.218 1.00 28.54 ? 115 LEU B CG  1 
ATOM   4800 C  CD1 . LEU B 1 114 ? 72.412  -6.407  -20.359 1.00 28.00 ? 115 LEU B CD1 1 
ATOM   4801 C  CD2 . LEU B 1 114 ? 72.092  -8.440  -18.951 1.00 26.71 ? 115 LEU B CD2 1 
ATOM   4802 N  N   . ASN B 1 115 ? 72.097  -10.679 -23.893 1.00 29.14 ? 116 ASN B N   1 
ATOM   4803 C  CA  . ASN B 1 115 ? 71.369  -11.437 -24.911 1.00 29.51 ? 116 ASN B CA  1 
ATOM   4804 C  C   . ASN B 1 115 ? 71.376  -12.954 -24.678 1.00 30.15 ? 116 ASN B C   1 
ATOM   4805 O  O   . ASN B 1 115 ? 70.420  -13.637 -25.032 1.00 29.93 ? 116 ASN B O   1 
ATOM   4806 C  CB  . ASN B 1 115 ? 71.941  -11.158 -26.300 1.00 29.26 ? 116 ASN B CB  1 
ATOM   4807 C  CG  . ASN B 1 115 ? 71.436  -9.858  -26.907 1.00 29.80 ? 116 ASN B CG  1 
ATOM   4808 O  OD1 . ASN B 1 115 ? 70.673  -9.105  -26.294 1.00 27.16 ? 116 ASN B OD1 1 
ATOM   4809 N  ND2 . ASN B 1 115 ? 71.866  -9.592  -28.138 1.00 29.04 ? 116 ASN B ND2 1 
ATOM   4810 N  N   . GLN B 1 116 ? 72.454  -13.468 -24.090 1.00 31.04 ? 117 GLN B N   1 
ATOM   4811 C  CA  . GLN B 1 116 ? 72.605  -14.908 -23.846 1.00 32.53 ? 117 GLN B CA  1 
ATOM   4812 C  C   . GLN B 1 116 ? 71.667  -15.421 -22.755 1.00 32.37 ? 117 GLN B C   1 
ATOM   4813 O  O   . GLN B 1 116 ? 71.339  -16.618 -22.718 1.00 32.00 ? 117 GLN B O   1 
ATOM   4814 C  CB  . GLN B 1 116 ? 74.056  -15.254 -23.468 1.00 32.96 ? 117 GLN B CB  1 
ATOM   4815 C  CG  . GLN B 1 116 ? 75.117  -14.873 -24.522 1.00 36.70 ? 117 GLN B CG  1 
ATOM   4816 C  CD  . GLN B 1 116 ? 75.179  -15.820 -25.715 1.00 41.43 ? 117 GLN B CD  1 
ATOM   4817 O  OE1 . GLN B 1 116 ? 74.372  -16.744 -25.843 1.00 44.50 ? 117 GLN B OE1 1 
ATOM   4818 N  NE2 . GLN B 1 116 ? 76.153  -15.592 -26.600 1.00 44.51 ? 117 GLN B NE2 1 
ATOM   4819 N  N   . GLU B 1 117 ? 71.260  -14.525 -21.858 1.00 32.26 ? 118 GLU B N   1 
ATOM   4820 C  CA  . GLU B 1 117 ? 70.371  -14.897 -20.762 1.00 32.49 ? 118 GLU B CA  1 
ATOM   4821 C  C   . GLU B 1 117 ? 68.943  -14.390 -20.935 1.00 32.25 ? 118 GLU B C   1 
ATOM   4822 O  O   . GLU B 1 117 ? 68.020  -14.856 -20.262 1.00 31.81 ? 118 GLU B O   1 
ATOM   4823 C  CB  . GLU B 1 117 ? 70.950  -14.438 -19.425 1.00 32.98 ? 118 GLU B CB  1 
ATOM   4824 C  CG  . GLU B 1 117 ? 72.213  -15.208 -19.017 1.00 35.36 ? 118 GLU B CG  1 
ATOM   4825 C  CD  . GLU B 1 117 ? 72.062  -16.731 -19.162 1.00 37.68 ? 118 GLU B CD  1 
ATOM   4826 O  OE1 . GLU B 1 117 ? 70.931  -17.252 -19.023 1.00 37.48 ? 118 GLU B OE1 1 
ATOM   4827 O  OE2 . GLU B 1 117 ? 73.080  -17.408 -19.415 1.00 39.53 ? 118 GLU B OE2 1 
ATOM   4828 N  N   . VAL B 1 118 ? 68.764  -13.470 -21.874 1.00 31.81 ? 119 VAL B N   1 
ATOM   4829 C  CA  . VAL B 1 118 ? 67.544  -12.690 -21.942 1.00 32.05 ? 119 VAL B CA  1 
ATOM   4830 C  C   . VAL B 1 118 ? 66.860  -12.763 -23.309 1.00 31.80 ? 119 VAL B C   1 
ATOM   4831 O  O   . VAL B 1 118 ? 65.642  -12.622 -23.395 1.00 31.23 ? 119 VAL B O   1 
ATOM   4832 C  CB  . VAL B 1 118 ? 67.854  -11.227 -21.477 1.00 32.23 ? 119 VAL B CB  1 
ATOM   4833 C  CG1 . VAL B 1 118 ? 67.042  -10.214 -22.197 1.00 31.64 ? 119 VAL B CG1 1 
ATOM   4834 C  CG2 . VAL B 1 118 ? 67.701  -11.119 -19.977 1.00 31.99 ? 119 VAL B CG2 1 
ATOM   4835 N  N   . MET B 1 119 ? 67.638  -13.011 -24.362 1.00 32.17 ? 120 MET B N   1 
ATOM   4836 C  CA  . MET B 1 119 ? 67.098  -13.046 -25.721 1.00 33.21 ? 120 MET B CA  1 
ATOM   4837 C  C   . MET B 1 119 ? 67.158  -14.436 -26.365 1.00 33.49 ? 120 MET B C   1 
ATOM   4838 O  O   . MET B 1 119 ? 66.269  -14.792 -27.146 1.00 33.45 ? 120 MET B O   1 
ATOM   4839 C  CB  . MET B 1 119 ? 67.802  -12.028 -26.635 1.00 33.56 ? 120 MET B CB  1 
ATOM   4840 C  CG  . MET B 1 119 ? 67.591  -10.557 -26.292 1.00 36.12 ? 120 MET B CG  1 
ATOM   4841 S  SD  . MET B 1 119 ? 65.926  -9.907  -26.625 1.00 43.16 ? 120 MET B SD  1 
ATOM   4842 C  CE  . MET B 1 119 ? 66.028  -9.445  -28.352 1.00 40.49 ? 120 MET B CE  1 
ATOM   4843 N  N   . ALA B 1 120 ? 68.201  -15.207 -26.055 1.00 33.79 ? 121 ALA B N   1 
ATOM   4844 C  CA  . ALA B 1 120 ? 68.422  -16.513 -26.705 1.00 34.41 ? 121 ALA B CA  1 
ATOM   4845 C  C   . ALA B 1 120 ? 67.269  -17.475 -26.447 1.00 34.68 ? 121 ALA B C   1 
ATOM   4846 O  O   . ALA B 1 120 ? 66.886  -17.679 -25.292 1.00 34.75 ? 121 ALA B O   1 
ATOM   4847 C  CB  . ALA B 1 120 ? 69.752  -17.136 -26.251 1.00 34.15 ? 121 ALA B CB  1 
ATOM   4848 N  N   . PRO B 1 121 ? 66.715  -18.080 -27.518 1.00 35.49 ? 122 PRO B N   1 
ATOM   4849 C  CA  . PRO B 1 121 ? 65.563  -18.992 -27.340 1.00 36.04 ? 122 PRO B CA  1 
ATOM   4850 C  C   . PRO B 1 121 ? 65.847  -20.076 -26.293 1.00 36.34 ? 122 PRO B C   1 
ATOM   4851 O  O   . PRO B 1 121 ? 64.944  -20.490 -25.566 1.00 36.51 ? 122 PRO B O   1 
ATOM   4852 C  CB  . PRO B 1 121 ? 65.362  -19.598 -28.735 1.00 36.16 ? 122 PRO B CB  1 
ATOM   4853 C  CG  . PRO B 1 121 ? 66.007  -18.601 -29.684 1.00 36.03 ? 122 PRO B CG  1 
ATOM   4854 C  CD  . PRO B 1 121 ? 67.150  -17.991 -28.928 1.00 35.45 ? 122 PRO B CD  1 
ATOM   4855 N  N   . GLU B 1 122 ? 67.115  -20.466 -26.179 1.00 36.74 ? 123 GLU B N   1 
ATOM   4856 C  CA  . GLU B 1 122 ? 67.551  -21.501 -25.244 1.00 37.31 ? 123 GLU B CA  1 
ATOM   4857 C  C   . GLU B 1 122 ? 67.530  -21.072 -23.769 1.00 36.79 ? 123 GLU B C   1 
ATOM   4858 O  O   . GLU B 1 122 ? 67.437  -21.914 -22.867 1.00 37.04 ? 123 GLU B O   1 
ATOM   4859 C  CB  . GLU B 1 122 ? 68.939  -22.007 -25.644 1.00 38.12 ? 123 GLU B CB  1 
ATOM   4860 C  CG  . GLU B 1 122 ? 68.974  -22.720 -27.016 1.00 40.88 ? 123 GLU B CG  1 
ATOM   4861 C  CD  . GLU B 1 122 ? 69.158  -21.767 -28.219 1.00 45.66 ? 123 GLU B CD  1 
ATOM   4862 O  OE1 . GLU B 1 122 ? 69.295  -20.526 -28.030 1.00 46.05 ? 123 GLU B OE1 1 
ATOM   4863 O  OE2 . GLU B 1 122 ? 69.162  -22.274 -29.368 1.00 47.24 ? 123 GLU B OE2 1 
ATOM   4864 N  N   . ALA B 1 123 ? 67.634  -19.765 -23.532 1.00 35.72 ? 124 ALA B N   1 
ATOM   4865 C  CA  . ALA B 1 123 ? 67.434  -19.194 -22.198 1.00 34.69 ? 124 ALA B CA  1 
ATOM   4866 C  C   . ALA B 1 123 ? 65.951  -18.902 -21.931 1.00 33.60 ? 124 ALA B C   1 
ATOM   4867 O  O   . ALA B 1 123 ? 65.435  -19.236 -20.865 1.00 33.55 ? 124 ALA B O   1 
ATOM   4868 C  CB  . ALA B 1 123 ? 68.276  -17.913 -22.026 1.00 34.44 ? 124 ALA B CB  1 
ATOM   4869 N  N   . THR B 1 124 ? 65.272  -18.302 -22.907 1.00 32.70 ? 125 THR B N   1 
ATOM   4870 C  CA  . THR B 1 124 ? 63.915  -17.795 -22.706 1.00 32.04 ? 125 THR B CA  1 
ATOM   4871 C  C   . THR B 1 124 ? 62.853  -18.875 -22.476 1.00 31.82 ? 125 THR B C   1 
ATOM   4872 O  O   . THR B 1 124 ? 61.829  -18.605 -21.822 1.00 30.89 ? 125 THR B O   1 
ATOM   4873 C  CB  . THR B 1 124 ? 63.457  -16.833 -23.833 1.00 32.04 ? 125 THR B CB  1 
ATOM   4874 O  OG1 . THR B 1 124 ? 63.340  -17.552 -25.064 1.00 31.47 ? 125 THR B OG1 1 
ATOM   4875 C  CG2 . THR B 1 124 ? 64.442  -15.646 -23.994 1.00 32.07 ? 125 THR B CG2 1 
ATOM   4876 N  N   . LYS B 1 125 ? 63.100  -20.090 -22.982 1.00 31.36 ? 126 LYS B N   1 
ATOM   4877 C  CA  . LYS B 1 125 ? 62.199  -21.227 -22.731 1.00 31.18 ? 126 LYS B CA  1 
ATOM   4878 C  C   . LYS B 1 125 ? 62.016  -21.463 -21.231 1.00 30.58 ? 126 LYS B C   1 
ATOM   4879 O  O   . LYS B 1 125 ? 60.959  -21.908 -20.790 1.00 30.11 ? 126 LYS B O   1 
ATOM   4880 C  CB  . LYS B 1 125 ? 62.683  -22.505 -23.433 1.00 31.81 ? 126 LYS B CB  1 
ATOM   4881 C  CG  . LYS B 1 125 ? 63.949  -23.125 -22.829 1.00 33.52 ? 126 LYS B CG  1 
ATOM   4882 C  CD  . LYS B 1 125 ? 64.326  -24.439 -23.517 1.00 37.92 ? 126 LYS B CD  1 
ATOM   4883 C  CE  . LYS B 1 125 ? 65.164  -25.313 -22.590 1.00 39.86 ? 126 LYS B CE  1 
ATOM   4884 N  NZ  . LYS B 1 125 ? 66.514  -24.718 -22.344 1.00 42.32 ? 126 LYS B NZ  1 
ATOM   4885 N  N   . ASN B 1 126 ? 63.036  -21.123 -20.449 1.00 30.20 ? 127 ASN B N   1 
ATOM   4886 C  CA  . ASN B 1 126 ? 62.953  -21.224 -18.986 1.00 29.95 ? 127 ASN B CA  1 
ATOM   4887 C  C   . ASN B 1 126 ? 62.026  -20.187 -18.332 1.00 29.35 ? 127 ASN B C   1 
ATOM   4888 O  O   . ASN B 1 126 ? 61.592  -20.357 -17.177 1.00 29.17 ? 127 ASN B O   1 
ATOM   4889 C  CB  . ASN B 1 126 ? 64.349  -21.139 -18.393 1.00 30.29 ? 127 ASN B CB  1 
ATOM   4890 C  CG  . ASN B 1 126 ? 65.238  -22.272 -18.856 1.00 31.27 ? 127 ASN B CG  1 
ATOM   4891 O  OD1 . ASN B 1 126 ? 64.951  -23.432 -18.600 1.00 33.54 ? 127 ASN B OD1 1 
ATOM   4892 N  ND2 . ASN B 1 126 ? 66.311  -21.943 -19.553 1.00 31.48 ? 127 ASN B ND2 1 
ATOM   4893 N  N   . PHE B 1 127 ? 61.716  -19.125 -19.076 1.00 28.36 ? 128 PHE B N   1 
ATOM   4894 C  CA  . PHE B 1 127 ? 60.815  -18.076 -18.587 1.00 27.91 ? 128 PHE B CA  1 
ATOM   4895 C  C   . PHE B 1 127 ? 59.375  -18.566 -18.467 1.00 28.02 ? 128 PHE B C   1 
ATOM   4896 O  O   . PHE B 1 127 ? 58.635  -18.092 -17.597 1.00 27.91 ? 128 PHE B O   1 
ATOM   4897 C  CB  . PHE B 1 127 ? 60.837  -16.829 -19.489 1.00 27.38 ? 128 PHE B CB  1 
ATOM   4898 C  CG  . PHE B 1 127 ? 62.187  -16.134 -19.574 1.00 26.29 ? 128 PHE B CG  1 
ATOM   4899 C  CD1 . PHE B 1 127 ? 63.180  -16.352 -18.619 1.00 26.24 ? 128 PHE B CD1 1 
ATOM   4900 C  CD2 . PHE B 1 127 ? 62.442  -15.228 -20.598 1.00 26.02 ? 128 PHE B CD2 1 
ATOM   4901 C  CE1 . PHE B 1 127 ? 64.412  -15.696 -18.699 1.00 26.09 ? 128 PHE B CE1 1 
ATOM   4902 C  CE2 . PHE B 1 127 ? 63.676  -14.558 -20.685 1.00 24.75 ? 128 PHE B CE2 1 
ATOM   4903 C  CZ  . PHE B 1 127 ? 64.662  -14.798 -19.738 1.00 24.44 ? 128 PHE B CZ  1 
ATOM   4904 N  N   . LEU B 1 128 ? 58.984  -19.516 -19.323 1.00 27.87 ? 129 LEU B N   1 
ATOM   4905 C  CA  . LEU B 1 128 ? 57.566  -19.870 -19.474 1.00 28.08 ? 129 LEU B CA  1 
ATOM   4906 C  C   . LEU B 1 128 ? 56.878  -20.255 -18.159 1.00 27.80 ? 129 LEU B C   1 
ATOM   4907 O  O   . LEU B 1 128 ? 55.817  -19.719 -17.871 1.00 27.65 ? 129 LEU B O   1 
ATOM   4908 C  CB  . LEU B 1 128 ? 57.312  -20.918 -20.579 1.00 28.47 ? 129 LEU B CB  1 
ATOM   4909 C  CG  . LEU B 1 128 ? 57.975  -20.735 -21.950 1.00 30.31 ? 129 LEU B CG  1 
ATOM   4910 C  CD1 . LEU B 1 128 ? 57.390  -21.701 -22.970 1.00 31.59 ? 129 LEU B CD1 1 
ATOM   4911 C  CD2 . LEU B 1 128 ? 57.885  -19.308 -22.470 1.00 30.95 ? 129 LEU B CD2 1 
ATOM   4912 N  N   . PRO B 1 129 ? 57.481  -21.160 -17.351 1.00 27.75 ? 130 PRO B N   1 
ATOM   4913 C  CA  . PRO B 1 129 ? 56.790  -21.509 -16.106 1.00 27.51 ? 130 PRO B CA  1 
ATOM   4914 C  C   . PRO B 1 129 ? 56.719  -20.341 -15.118 1.00 27.11 ? 130 PRO B C   1 
ATOM   4915 O  O   . PRO B 1 129 ? 55.749  -20.234 -14.355 1.00 27.50 ? 130 PRO B O   1 
ATOM   4916 C  CB  . PRO B 1 129 ? 57.652  -22.636 -15.516 1.00 27.54 ? 130 PRO B CB  1 
ATOM   4917 C  CG  . PRO B 1 129 ? 58.512  -23.114 -16.643 1.00 27.82 ? 130 PRO B CG  1 
ATOM   4918 C  CD  . PRO B 1 129 ? 58.725  -21.938 -17.526 1.00 27.55 ? 130 PRO B CD  1 
ATOM   4919 N  N   . LEU B 1 130 ? 57.735  -19.479 -15.125 1.00 26.50 ? 131 LEU B N   1 
ATOM   4920 C  CA  . LEU B 1 130 ? 57.777  -18.357 -14.175 1.00 25.76 ? 131 LEU B CA  1 
ATOM   4921 C  C   . LEU B 1 130 ? 56.742  -17.285 -14.502 1.00 25.52 ? 131 LEU B C   1 
ATOM   4922 O  O   . LEU B 1 130 ? 56.156  -16.685 -13.586 1.00 25.89 ? 131 LEU B O   1 
ATOM   4923 C  CB  . LEU B 1 130 ? 59.186  -17.756 -14.067 1.00 25.52 ? 131 LEU B CB  1 
ATOM   4924 C  CG  . LEU B 1 130 ? 60.284  -18.696 -13.541 1.00 25.61 ? 131 LEU B CG  1 
ATOM   4925 C  CD1 . LEU B 1 130 ? 61.642  -18.190 -13.961 1.00 25.17 ? 131 LEU B CD1 1 
ATOM   4926 C  CD2 . LEU B 1 130 ? 60.234  -18.889 -12.014 1.00 24.50 ? 131 LEU B CD2 1 
ATOM   4927 N  N   . LEU B 1 131 ? 56.515  -17.048 -15.794 1.00 24.57 ? 132 LEU B N   1 
ATOM   4928 C  CA  . LEU B 1 131 ? 55.549  -16.032 -16.232 1.00 24.11 ? 132 LEU B CA  1 
ATOM   4929 C  C   . LEU B 1 131 ? 54.125  -16.562 -16.137 1.00 24.02 ? 132 LEU B C   1 
ATOM   4930 O  O   . LEU B 1 131 ? 53.201  -15.827 -15.768 1.00 23.85 ? 132 LEU B O   1 
ATOM   4931 C  CB  . LEU B 1 131 ? 55.841  -15.555 -17.665 1.00 23.77 ? 132 LEU B CB  1 
ATOM   4932 C  CG  . LEU B 1 131 ? 57.197  -14.877 -17.931 1.00 22.57 ? 132 LEU B CG  1 
ATOM   4933 C  CD1 . LEU B 1 131 ? 57.459  -14.781 -19.423 1.00 19.30 ? 132 LEU B CD1 1 
ATOM   4934 C  CD2 . LEU B 1 131 ? 57.268  -13.514 -17.269 1.00 21.73 ? 132 LEU B CD2 1 
ATOM   4935 N  N   . ASP B 1 132 ? 53.953  -17.839 -16.475 1.00 23.71 ? 133 ASP B N   1 
ATOM   4936 C  CA  . ASP B 1 132 ? 52.658  -18.503 -16.353 1.00 24.22 ? 133 ASP B CA  1 
ATOM   4937 C  C   . ASP B 1 132 ? 52.127  -18.522 -14.918 1.00 23.65 ? 133 ASP B C   1 
ATOM   4938 O  O   . ASP B 1 132 ? 50.953  -18.229 -14.698 1.00 23.11 ? 133 ASP B O   1 
ATOM   4939 C  CB  . ASP B 1 132 ? 52.723  -19.920 -16.926 1.00 25.03 ? 133 ASP B CB  1 
ATOM   4940 C  CG  . ASP B 1 132 ? 51.359  -20.480 -17.240 1.00 28.22 ? 133 ASP B CG  1 
ATOM   4941 O  OD1 . ASP B 1 132 ? 51.264  -21.722 -17.362 1.00 32.45 ? 133 ASP B OD1 1 
ATOM   4942 O  OD2 . ASP B 1 132 ? 50.386  -19.690 -17.368 1.00 29.42 ? 133 ASP B OD2 1 
ATOM   4943 N  N   . ALA B 1 133 ? 52.981  -18.859 -13.950 1.00 23.49 ? 134 ALA B N   1 
ATOM   4944 C  CA  . ALA B 1 133 ? 52.586  -18.791 -12.534 1.00 23.93 ? 134 ALA B CA  1 
ATOM   4945 C  C   . ALA B 1 133 ? 52.059  -17.402 -12.152 1.00 23.77 ? 134 ALA B C   1 
ATOM   4946 O  O   . ALA B 1 133 ? 51.084  -17.296 -11.411 1.00 23.89 ? 134 ALA B O   1 
ATOM   4947 C  CB  . ALA B 1 133 ? 53.746  -19.194 -11.598 1.00 24.18 ? 134 ALA B CB  1 
ATOM   4948 N  N   . VAL B 1 134 ? 52.689  -16.339 -12.657 1.00 23.42 ? 135 VAL B N   1 
ATOM   4949 C  CA  . VAL B 1 134 ? 52.227  -14.984 -12.305 1.00 22.68 ? 135 VAL B CA  1 
ATOM   4950 C  C   . VAL B 1 134 ? 50.869  -14.679 -12.948 1.00 22.56 ? 135 VAL B C   1 
ATOM   4951 O  O   . VAL B 1 134 ? 49.934  -14.221 -12.263 1.00 22.25 ? 135 VAL B O   1 
ATOM   4952 C  CB  . VAL B 1 134 ? 53.272  -13.890 -12.604 1.00 22.46 ? 135 VAL B CB  1 
ATOM   4953 C  CG1 . VAL B 1 134 ? 52.722  -12.528 -12.203 1.00 22.77 ? 135 VAL B CG1 1 
ATOM   4954 C  CG2 . VAL B 1 134 ? 54.580  -14.174 -11.825 1.00 22.02 ? 135 VAL B CG2 1 
ATOM   4955 N  N   . SER B 1 135 ? 50.754  -14.970 -14.242 1.00 22.32 ? 136 SER B N   1 
ATOM   4956 C  CA  . SER B 1 135 ? 49.491  -14.789 -14.967 1.00 22.86 ? 136 SER B CA  1 
ATOM   4957 C  C   . SER B 1 135 ? 48.338  -15.587 -14.364 1.00 22.70 ? 136 SER B C   1 
ATOM   4958 O  O   . SER B 1 135 ? 47.230  -15.070 -14.260 1.00 21.75 ? 136 SER B O   1 
ATOM   4959 C  CB  . SER B 1 135 ? 49.653  -15.137 -16.442 1.00 22.62 ? 136 SER B CB  1 
ATOM   4960 O  OG  . SER B 1 135 ? 50.237  -14.044 -17.110 1.00 25.41 ? 136 SER B OG  1 
ATOM   4961 N  N   . ARG B 1 136 ? 48.601  -16.837 -13.968 1.00 23.15 ? 137 ARG B N   1 
ATOM   4962 C  CA  . ARG B 1 136 ? 47.582  -17.651 -13.288 1.00 24.16 ? 137 ARG B CA  1 
ATOM   4963 C  C   . ARG B 1 136 ? 47.132  -17.021 -11.976 1.00 23.36 ? 137 ARG B C   1 
ATOM   4964 O  O   . ARG B 1 136 ? 45.957  -17.044 -11.664 1.00 23.27 ? 137 ARG B O   1 
ATOM   4965 C  CB  . ARG B 1 136 ? 48.051  -19.088 -13.062 1.00 24.74 ? 137 ARG B CB  1 
ATOM   4966 C  CG  . ARG B 1 136 ? 48.211  -19.891 -14.350 1.00 28.05 ? 137 ARG B CG  1 
ATOM   4967 C  CD  . ARG B 1 136 ? 48.890  -21.226 -14.080 1.00 34.86 ? 137 ARG B CD  1 
ATOM   4968 N  NE  . ARG B 1 136 ? 47.962  -22.161 -13.456 1.00 41.65 ? 137 ARG B NE  1 
ATOM   4969 C  CZ  . ARG B 1 136 ? 47.117  -22.951 -14.116 1.00 44.44 ? 137 ARG B CZ  1 
ATOM   4970 N  NH1 . ARG B 1 136 ? 47.072  -22.945 -15.447 1.00 46.61 ? 137 ARG B NH1 1 
ATOM   4971 N  NH2 . ARG B 1 136 ? 46.314  -23.757 -13.435 1.00 46.33 ? 137 ARG B NH2 1 
ATOM   4972 N  N   . ASP B 1 137 ? 48.070  -16.457 -11.221 1.00 23.58 ? 138 ASP B N   1 
ATOM   4973 C  CA  . ASP B 1 137 ? 47.738  -15.682 -10.019 1.00 23.71 ? 138 ASP B CA  1 
ATOM   4974 C  C   . ASP B 1 137 ? 46.894  -14.417 -10.308 1.00 23.38 ? 138 ASP B C   1 
ATOM   4975 O  O   . ASP B 1 137 ? 45.981  -14.087 -9.551  1.00 23.43 ? 138 ASP B O   1 
ATOM   4976 C  CB  . ASP B 1 137 ? 49.012  -15.364 -9.212  1.00 24.20 ? 138 ASP B CB  1 
ATOM   4977 C  CG  . ASP B 1 137 ? 49.503  -16.573 -8.394  1.00 26.97 ? 138 ASP B CG  1 
ATOM   4978 O  OD1 . ASP B 1 137 ? 48.729  -17.541 -8.246  1.00 30.09 ? 138 ASP B OD1 1 
ATOM   4979 O  OD2 . ASP B 1 137 ? 50.653  -16.572 -7.898  1.00 29.78 ? 138 ASP B OD2 1 
ATOM   4980 N  N   . PHE B 1 138 ? 47.176  -13.730 -11.416 1.00 22.85 ? 139 PHE B N   1 
ATOM   4981 C  CA  . PHE B 1 138 ? 46.375  -12.575 -11.803 1.00 22.54 ? 139 PHE B CA  1 
ATOM   4982 C  C   . PHE B 1 138 ? 44.920  -12.988 -12.045 1.00 22.83 ? 139 PHE B C   1 
ATOM   4983 O  O   . PHE B 1 138 ? 43.994  -12.339 -11.548 1.00 22.79 ? 139 PHE B O   1 
ATOM   4984 C  CB  . PHE B 1 138 ? 46.947  -11.880 -13.046 1.00 21.64 ? 139 PHE B CB  1 
ATOM   4985 C  CG  . PHE B 1 138 ? 46.336  -10.545 -13.307 1.00 20.87 ? 139 PHE B CG  1 
ATOM   4986 C  CD1 . PHE B 1 138 ? 46.864  -9.399  -12.717 1.00 19.26 ? 139 PHE B CD1 1 
ATOM   4987 C  CD2 . PHE B 1 138 ? 45.211  -10.423 -14.122 1.00 20.02 ? 139 PHE B CD2 1 
ATOM   4988 C  CE1 . PHE B 1 138 ? 46.296  -8.148  -12.950 1.00 19.60 ? 139 PHE B CE1 1 
ATOM   4989 C  CE2 . PHE B 1 138 ? 44.631  -9.184  -14.354 1.00 20.07 ? 139 PHE B CE2 1 
ATOM   4990 C  CZ  . PHE B 1 138 ? 45.173  -8.035  -13.761 1.00 20.10 ? 139 PHE B CZ  1 
ATOM   4991 N  N   . VAL B 1 139 ? 44.733  -14.064 -12.806 1.00 23.12 ? 140 VAL B N   1 
ATOM   4992 C  CA  . VAL B 1 139 ? 43.410  -14.650 -13.042 1.00 24.03 ? 140 VAL B CA  1 
ATOM   4993 C  C   . VAL B 1 139 ? 42.696  -14.943 -11.706 1.00 24.88 ? 140 VAL B C   1 
ATOM   4994 O  O   . VAL B 1 139 ? 41.527  -14.583 -11.535 1.00 24.57 ? 140 VAL B O   1 
ATOM   4995 C  CB  . VAL B 1 139 ? 43.527  -15.925 -13.923 1.00 24.29 ? 140 VAL B CB  1 
ATOM   4996 C  CG1 . VAL B 1 139 ? 42.284  -16.800 -13.830 1.00 24.80 ? 140 VAL B CG1 1 
ATOM   4997 C  CG2 . VAL B 1 139 ? 43.814  -15.532 -15.403 1.00 24.94 ? 140 VAL B CG2 1 
ATOM   4998 N  N   . SER B 1 140 ? 43.404  -15.564 -10.759 1.00 25.41 ? 141 SER B N   1 
ATOM   4999 C  CA  . SER B 1 140 ? 42.820  -15.856 -9.435  1.00 27.09 ? 141 SER B CA  1 
ATOM   5000 C  C   . SER B 1 140 ? 42.340  -14.607 -8.725  1.00 27.50 ? 141 SER B C   1 
ATOM   5001 O  O   . SER B 1 140 ? 41.257  -14.612 -8.153  1.00 28.60 ? 141 SER B O   1 
ATOM   5002 C  CB  . SER B 1 140 ? 43.805  -16.604 -8.528  1.00 27.06 ? 141 SER B CB  1 
ATOM   5003 O  OG  . SER B 1 140 ? 44.160  -17.832 -9.118  1.00 28.11 ? 141 SER B OG  1 
ATOM   5004 N  N   . VAL B 1 141 ? 43.144  -13.543 -8.761  1.00 28.31 ? 142 VAL B N   1 
ATOM   5005 C  CA  . VAL B 1 141 ? 42.729  -12.237 -8.231  1.00 28.80 ? 142 VAL B CA  1 
ATOM   5006 C  C   . VAL B 1 141 ? 41.390  -11.784 -8.836  1.00 28.67 ? 142 VAL B C   1 
ATOM   5007 O  O   . VAL B 1 141 ? 40.440  -11.479 -8.100  1.00 28.76 ? 142 VAL B O   1 
ATOM   5008 C  CB  . VAL B 1 141 ? 43.821  -11.146 -8.438  1.00 29.09 ? 142 VAL B CB  1 
ATOM   5009 C  CG1 . VAL B 1 141 ? 43.288  -9.756  -8.095  1.00 29.34 ? 142 VAL B CG1 1 
ATOM   5010 C  CG2 . VAL B 1 141 ? 45.042  -11.457 -7.587  1.00 30.44 ? 142 VAL B CG2 1 
ATOM   5011 N  N   . LEU B 1 142 ? 41.303  -11.756 -10.165 1.00 27.65 ? 143 LEU B N   1 
ATOM   5012 C  CA  . LEU B 1 142 ? 40.050  -11.340 -10.800 1.00 27.11 ? 143 LEU B CA  1 
ATOM   5013 C  C   . LEU B 1 142 ? 38.869  -12.210 -10.364 1.00 26.67 ? 143 LEU B C   1 
ATOM   5014 O  O   . LEU B 1 142 ? 37.823  -11.672 -10.027 1.00 25.79 ? 143 LEU B O   1 
ATOM   5015 C  CB  . LEU B 1 142 ? 40.159  -11.261 -12.331 1.00 26.47 ? 143 LEU B CB  1 
ATOM   5016 C  CG  . LEU B 1 142 ? 40.965  -10.073 -12.865 1.00 27.84 ? 143 LEU B CG  1 
ATOM   5017 C  CD1 . LEU B 1 142 ? 40.947  -10.068 -14.381 1.00 27.07 ? 143 LEU B CD1 1 
ATOM   5018 C  CD2 . LEU B 1 142 ? 40.439  -8.736  -12.319 1.00 27.08 ? 143 LEU B CD2 1 
ATOM   5019 N  N   . HIS B 1 143 ? 39.049  -13.532 -10.360 1.00 26.67 ? 144 HIS B N   1 
ATOM   5020 C  CA  . HIS B 1 143 ? 37.974  -14.452 -9.944  1.00 28.23 ? 144 HIS B CA  1 
ATOM   5021 C  C   . HIS B 1 143 ? 37.461  -14.143 -8.541  1.00 28.79 ? 144 HIS B C   1 
ATOM   5022 O  O   . HIS B 1 143 ? 36.266  -14.182 -8.297  1.00 28.94 ? 144 HIS B O   1 
ATOM   5023 C  CB  . HIS B 1 143 ? 38.402  -15.925 -10.034 1.00 27.94 ? 144 HIS B CB  1 
ATOM   5024 C  CG  . HIS B 1 143 ? 38.223  -16.522 -11.398 1.00 29.00 ? 144 HIS B CG  1 
ATOM   5025 N  ND1 . HIS B 1 143 ? 37.035  -16.439 -12.097 1.00 28.55 ? 144 HIS B ND1 1 
ATOM   5026 C  CD2 . HIS B 1 143 ? 39.081  -17.208 -12.193 1.00 28.49 ? 144 HIS B CD2 1 
ATOM   5027 C  CE1 . HIS B 1 143 ? 37.167  -17.054 -13.261 1.00 29.57 ? 144 HIS B CE1 1 
ATOM   5028 N  NE2 . HIS B 1 143 ? 38.401  -17.525 -13.346 1.00 29.73 ? 144 HIS B NE2 1 
ATOM   5029 N  N   . ARG B 1 144 ? 38.385  -13.829 -7.640  1.00 29.60 ? 145 ARG B N   1 
ATOM   5030 C  CA  . ARG B 1 144 ? 38.070  -13.498 -6.258  1.00 31.03 ? 145 ARG B CA  1 
ATOM   5031 C  C   . ARG B 1 144 ? 37.287  -12.188 -6.156  1.00 31.03 ? 145 ARG B C   1 
ATOM   5032 O  O   . ARG B 1 144 ? 36.317  -12.092 -5.381  1.00 31.48 ? 145 ARG B O   1 
ATOM   5033 C  CB  . ARG B 1 144 ? 39.372  -13.403 -5.458  1.00 31.62 ? 145 ARG B CB  1 
ATOM   5034 C  CG  . ARG B 1 144 ? 39.248  -13.604 -3.969  1.00 34.62 ? 145 ARG B CG  1 
ATOM   5035 C  CD  . ARG B 1 144 ? 40.613  -13.395 -3.331  1.00 39.70 ? 145 ARG B CD  1 
ATOM   5036 N  NE  . ARG B 1 144 ? 41.626  -14.212 -4.001  1.00 42.92 ? 145 ARG B NE  1 
ATOM   5037 C  CZ  . ARG B 1 144 ? 42.859  -13.798 -4.294  1.00 44.66 ? 145 ARG B CZ  1 
ATOM   5038 N  NH1 . ARG B 1 144 ? 43.244  -12.555 -3.987  1.00 44.36 ? 145 ARG B NH1 1 
ATOM   5039 N  NH2 . ARG B 1 144 ? 43.700  -14.625 -4.909  1.00 43.36 ? 145 ARG B NH2 1 
ATOM   5040 N  N   . ARG B 1 145 ? 37.695  -11.189 -6.940  1.00 30.51 ? 146 ARG B N   1 
ATOM   5041 C  CA  . ARG B 1 145 ? 36.999  -9.901  -6.959  1.00 30.48 ? 146 ARG B CA  1 
ATOM   5042 C  C   . ARG B 1 145 ? 35.570  -10.007 -7.516  1.00 29.98 ? 146 ARG B C   1 
ATOM   5043 O  O   . ARG B 1 145 ? 34.672  -9.298  -7.056  1.00 29.53 ? 146 ARG B O   1 
ATOM   5044 C  CB  . ARG B 1 145 ? 37.785  -8.861  -7.749  1.00 30.51 ? 146 ARG B CB  1 
ATOM   5045 C  CG  . ARG B 1 145 ? 39.098  -8.487  -7.121  1.00 31.49 ? 146 ARG B CG  1 
ATOM   5046 C  CD  . ARG B 1 145 ? 39.716  -7.305  -7.839  1.00 31.43 ? 146 ARG B CD  1 
ATOM   5047 N  NE  . ARG B 1 145 ? 40.993  -6.938  -7.241  1.00 34.55 ? 146 ARG B NE  1 
ATOM   5048 C  CZ  . ARG B 1 145 ? 41.822  -6.023  -7.731  1.00 34.80 ? 146 ARG B CZ  1 
ATOM   5049 N  NH1 . ARG B 1 145 ? 41.508  -5.356  -8.834  1.00 36.27 ? 146 ARG B NH1 1 
ATOM   5050 N  NH2 . ARG B 1 145 ? 42.969  -5.778  -7.116  1.00 34.26 ? 146 ARG B NH2 1 
ATOM   5051 N  N   . ILE B 1 146 ? 35.390  -10.869 -8.515  1.00 29.56 ? 147 ILE B N   1 
ATOM   5052 C  CA  . ILE B 1 146 ? 34.076  -11.157 -9.099  1.00 29.92 ? 147 ILE B CA  1 
ATOM   5053 C  C   . ILE B 1 146 ? 33.154  -11.801 -8.050  1.00 30.75 ? 147 ILE B C   1 
ATOM   5054 O  O   . ILE B 1 146 ? 32.001  -11.388 -7.869  1.00 30.60 ? 147 ILE B O   1 
ATOM   5055 C  CB  . ILE B 1 146 ? 34.204  -12.103 -10.322 1.00 29.33 ? 147 ILE B CB  1 
ATOM   5056 C  CG1 . ILE B 1 146 ? 34.724  -11.329 -11.544 1.00 28.28 ? 147 ILE B CG1 1 
ATOM   5057 C  CG2 . ILE B 1 146 ? 32.854  -12.778 -10.648 1.00 28.91 ? 147 ILE B CG2 1 
ATOM   5058 C  CD1 . ILE B 1 146 ? 35.245  -12.219 -12.697 1.00 27.42 ? 147 ILE B CD1 1 
ATOM   5059 N  N   . LYS B 1 147 ? 33.681  -12.822 -7.374  1.00 31.60 ? 148 LYS B N   1 
ATOM   5060 C  CA  . LYS B 1 147 ? 32.962  -13.522 -6.320  1.00 32.74 ? 148 LYS B CA  1 
ATOM   5061 C  C   . LYS B 1 147 ? 32.538  -12.533 -5.227  1.00 32.61 ? 148 LYS B C   1 
ATOM   5062 O  O   . LYS B 1 147 ? 31.384  -12.512 -4.838  1.00 32.57 ? 148 LYS B O   1 
ATOM   5063 C  CB  . LYS B 1 147 ? 33.840  -14.655 -5.774  1.00 33.09 ? 148 LYS B CB  1 
ATOM   5064 C  CG  . LYS B 1 147 ? 33.439  -15.198 -4.426  1.00 36.41 ? 148 LYS B CG  1 
ATOM   5065 C  CD  . LYS B 1 147 ? 33.864  -16.657 -4.273  1.00 40.27 ? 148 LYS B CD  1 
ATOM   5066 C  CE  . LYS B 1 147 ? 33.231  -17.260 -3.023  1.00 42.18 ? 148 LYS B CE  1 
ATOM   5067 N  NZ  . LYS B 1 147 ? 33.036  -18.720 -3.192  1.00 44.08 ? 148 LYS B NZ  1 
ATOM   5068 N  N   . LYS B 1 148 ? 33.472  -11.696 -4.776  1.00 33.15 ? 149 LYS B N   1 
ATOM   5069 C  CA  . LYS B 1 148 ? 33.204  -10.671 -3.768  1.00 33.19 ? 149 LYS B CA  1 
ATOM   5070 C  C   . LYS B 1 148 ? 32.179  -9.625  -4.224  1.00 32.89 ? 149 LYS B C   1 
ATOM   5071 O  O   . LYS B 1 148 ? 31.345  -9.184  -3.419  1.00 32.65 ? 149 LYS B O   1 
ATOM   5072 C  CB  . LYS B 1 148 ? 34.493  -9.960  -3.354  1.00 33.85 ? 149 LYS B CB  1 
ATOM   5073 C  CG  . LYS B 1 148 ? 34.346  -9.159  -2.048  1.00 36.17 ? 149 LYS B CG  1 
ATOM   5074 C  CD  . LYS B 1 148 ? 35.111  -7.845  -2.074  1.00 40.00 ? 149 LYS B CD  1 
ATOM   5075 C  CE  . LYS B 1 148 ? 34.961  -7.109  -0.741  1.00 41.81 ? 149 LYS B CE  1 
ATOM   5076 N  NZ  . LYS B 1 148 ? 35.965  -6.012  -0.603  1.00 43.94 ? 149 LYS B NZ  1 
ATOM   5077 N  N   . ALA B 1 149 ? 32.244  -9.223  -5.496  1.00 31.50 ? 150 ALA B N   1 
ATOM   5078 C  CA  . ALA B 1 149 ? 31.303  -8.235  -6.035  1.00 30.88 ? 150 ALA B CA  1 
ATOM   5079 C  C   . ALA B 1 149 ? 29.881  -8.802  -6.075  1.00 30.47 ? 150 ALA B C   1 
ATOM   5080 O  O   . ALA B 1 149 ? 28.914  -8.055  -6.050  1.00 30.45 ? 150 ALA B O   1 
ATOM   5081 C  CB  . ALA B 1 149 ? 31.738  -7.760  -7.408  1.00 30.72 ? 150 ALA B CB  1 
ATOM   5082 N  N   . GLY B 1 150 ? 29.777  -10.127 -6.154  1.00 30.35 ? 151 GLY B N   1 
ATOM   5083 C  CA  . GLY B 1 150 ? 28.531  -10.841 -5.891  1.00 30.16 ? 151 GLY B CA  1 
ATOM   5084 C  C   . GLY B 1 150 ? 27.487  -10.950 -6.988  1.00 30.25 ? 151 GLY B C   1 
ATOM   5085 O  O   . GLY B 1 150 ? 26.518  -11.683 -6.828  1.00 30.18 ? 151 GLY B O   1 
ATOM   5086 N  N   . SER B 1 151 ? 27.658  -10.231 -8.095  1.00 30.13 ? 152 SER B N   1 
ATOM   5087 C  CA  . SER B 1 151 ? 26.662  -10.269 -9.177  1.00 30.32 ? 152 SER B CA  1 
ATOM   5088 C  C   . SER B 1 151 ? 27.186  -10.843 -10.494 1.00 29.89 ? 152 SER B C   1 
ATOM   5089 O  O   . SER B 1 151 ? 26.671  -10.507 -11.562 1.00 30.31 ? 152 SER B O   1 
ATOM   5090 C  CB  . SER B 1 151 ? 26.082  -8.876  -9.421  1.00 30.44 ? 152 SER B CB  1 
ATOM   5091 O  OG  . SER B 1 151 ? 25.108  -8.561  -8.447  1.00 33.31 ? 152 SER B OG  1 
ATOM   5092 N  N   . GLY B 1 152 ? 28.216  -11.679 -10.428 1.00 29.38 ? 153 GLY B N   1 
ATOM   5093 C  CA  . GLY B 1 152 ? 28.704  -12.380 -11.617 1.00 29.26 ? 153 GLY B CA  1 
ATOM   5094 C  C   . GLY B 1 152 ? 29.660  -11.604 -12.516 1.00 29.07 ? 153 GLY B C   1 
ATOM   5095 O  O   . GLY B 1 152 ? 30.029  -12.088 -13.585 1.00 29.03 ? 153 GLY B O   1 
ATOM   5096 N  N   . ASN B 1 153 ? 30.052  -10.403 -12.096 1.00 28.59 ? 154 ASN B N   1 
ATOM   5097 C  CA  . ASN B 1 153 ? 31.063  -9.612  -12.813 1.00 28.55 ? 154 ASN B CA  1 
ATOM   5098 C  C   . ASN B 1 153 ? 31.916  -8.747  -11.879 1.00 28.02 ? 154 ASN B C   1 
ATOM   5099 O  O   . ASN B 1 153 ? 31.607  -8.598  -10.697 1.00 27.65 ? 154 ASN B O   1 
ATOM   5100 C  CB  . ASN B 1 153 ? 30.404  -8.723  -13.877 1.00 28.89 ? 154 ASN B CB  1 
ATOM   5101 C  CG  . ASN B 1 153 ? 29.470  -7.683  -13.272 1.00 30.67 ? 154 ASN B CG  1 
ATOM   5102 O  OD1 . ASN B 1 153 ? 29.896  -6.607  -12.857 1.00 33.51 ? 154 ASN B OD1 1 
ATOM   5103 N  ND2 . ASN B 1 153 ? 28.193  -8.002  -13.228 1.00 32.08 ? 154 ASN B ND2 1 
ATOM   5104 N  N   . TYR B 1 154 ? 32.993  -8.186  -12.423 1.00 27.02 ? 155 TYR B N   1 
ATOM   5105 C  CA  . TYR B 1 154 ? 33.787  -7.189  -11.721 1.00 26.06 ? 155 TYR B CA  1 
ATOM   5106 C  C   . TYR B 1 154 ? 34.113  -6.056  -12.692 1.00 25.60 ? 155 TYR B C   1 
ATOM   5107 O  O   . TYR B 1 154 ? 34.572  -6.302  -13.813 1.00 24.49 ? 155 TYR B O   1 
ATOM   5108 C  CB  . TYR B 1 154 ? 35.077  -7.795  -11.157 1.00 26.32 ? 155 TYR B CB  1 
ATOM   5109 C  CG  . TYR B 1 154 ? 36.052  -6.757  -10.642 1.00 27.33 ? 155 TYR B CG  1 
ATOM   5110 C  CD1 . TYR B 1 154 ? 35.757  -6.015  -9.497  1.00 27.59 ? 155 TYR B CD1 1 
ATOM   5111 C  CD2 . TYR B 1 154 ? 37.274  -6.531  -11.286 1.00 27.86 ? 155 TYR B CD2 1 
ATOM   5112 C  CE1 . TYR B 1 154 ? 36.634  -5.056  -9.013  1.00 30.12 ? 155 TYR B CE1 1 
ATOM   5113 C  CE2 . TYR B 1 154 ? 38.168  -5.569  -10.808 1.00 30.27 ? 155 TYR B CE2 1 
ATOM   5114 C  CZ  . TYR B 1 154 ? 37.834  -4.836  -9.671  1.00 30.76 ? 155 TYR B CZ  1 
ATOM   5115 O  OH  . TYR B 1 154 ? 38.686  -3.886  -9.169  1.00 33.19 ? 155 TYR B OH  1 
ATOM   5116 N  N   . SER B 1 155 ? 33.851  -4.829  -12.258 1.00 24.74 ? 156 SER B N   1 
ATOM   5117 C  CA  . SER B 1 155 ? 34.136  -3.641  -13.048 1.00 24.52 ? 156 SER B CA  1 
ATOM   5118 C  C   . SER B 1 155 ? 35.109  -2.775  -12.280 1.00 23.99 ? 156 SER B C   1 
ATOM   5119 O  O   . SER B 1 155 ? 34.938  -2.542  -11.075 1.00 22.80 ? 156 SER B O   1 
ATOM   5120 C  CB  . SER B 1 155 ? 32.860  -2.834  -13.300 1.00 24.82 ? 156 SER B CB  1 
ATOM   5121 O  OG  . SER B 1 155 ? 31.954  -3.559  -14.122 1.00 27.38 ? 156 SER B OG  1 
ATOM   5122 N  N   . GLY B 1 156 ? 36.133  -2.305  -12.980 1.00 23.57 ? 157 GLY B N   1 
ATOM   5123 C  CA  . GLY B 1 156 ? 37.093  -1.388  -12.391 1.00 23.17 ? 157 GLY B CA  1 
ATOM   5124 C  C   . GLY B 1 156 ? 38.244  -1.031  -13.311 1.00 23.13 ? 157 GLY B C   1 
ATOM   5125 O  O   . GLY B 1 156 ? 38.442  -1.630  -14.380 1.00 22.22 ? 157 GLY B O   1 
ATOM   5126 N  N   . ASP B 1 157 ? 39.007  -0.042  -12.860 1.00 23.45 ? 158 ASP B N   1 
ATOM   5127 C  CA  . ASP B 1 157 ? 40.251  0.369   -13.476 1.00 23.91 ? 158 ASP B CA  1 
ATOM   5128 C  C   . ASP B 1 157 ? 41.315  -0.518  -12.846 1.00 23.31 ? 158 ASP B C   1 
ATOM   5129 O  O   . ASP B 1 157 ? 41.530  -0.481  -11.637 1.00 23.71 ? 158 ASP B O   1 
ATOM   5130 C  CB  . ASP B 1 157 ? 40.485  1.853   -13.152 1.00 24.54 ? 158 ASP B CB  1 
ATOM   5131 C  CG  . ASP B 1 157 ? 41.858  2.352   -13.550 1.00 26.17 ? 158 ASP B CG  1 
ATOM   5132 O  OD1 . ASP B 1 157 ? 42.712  1.566   -14.016 1.00 26.31 ? 158 ASP B OD1 1 
ATOM   5133 O  OD2 . ASP B 1 157 ? 42.085  3.569   -13.375 1.00 30.58 ? 158 ASP B OD2 1 
ATOM   5134 N  N   . ILE B 1 158 ? 41.968  -1.323  -13.670 1.00 22.34 ? 159 ILE B N   1 
ATOM   5135 C  CA  . ILE B 1 158 ? 42.940  -2.278  -13.182 1.00 21.48 ? 159 ILE B CA  1 
ATOM   5136 C  C   . ILE B 1 158 ? 44.391  -1.881  -13.475 1.00 21.45 ? 159 ILE B C   1 
ATOM   5137 O  O   . ILE B 1 158 ? 45.286  -2.723  -13.376 1.00 21.18 ? 159 ILE B O   1 
ATOM   5138 C  CB  . ILE B 1 158 ? 42.646  -3.723  -13.709 1.00 21.61 ? 159 ILE B CB  1 
ATOM   5139 C  CG1 . ILE B 1 158 ? 42.755  -3.774  -15.239 1.00 21.27 ? 159 ILE B CG1 1 
ATOM   5140 C  CG2 . ILE B 1 158 ? 41.257  -4.222  -13.206 1.00 19.36 ? 159 ILE B CG2 1 
ATOM   5141 C  CD1 . ILE B 1 158 ? 43.024  -5.171  -15.796 1.00 19.44 ? 159 ILE B CD1 1 
ATOM   5142 N  N   . SER B 1 159 ? 44.633  -0.610  -13.821 1.00 21.27 ? 160 SER B N   1 
ATOM   5143 C  CA  . SER B 1 159 ? 45.999  -0.162  -14.160 1.00 21.08 ? 160 SER B CA  1 
ATOM   5144 C  C   . SER B 1 159 ? 47.004  -0.441  -13.034 1.00 21.09 ? 160 SER B C   1 
ATOM   5145 O  O   . SER B 1 159 ? 48.133  -0.850  -13.299 1.00 20.39 ? 160 SER B O   1 
ATOM   5146 C  CB  . SER B 1 159 ? 46.040  1.321   -14.562 1.00 20.89 ? 160 SER B CB  1 
ATOM   5147 O  OG  . SER B 1 159 ? 45.476  2.144   -13.555 1.00 22.04 ? 160 SER B OG  1 
ATOM   5148 N  N   . ASP B 1 160 ? 46.587  -0.227  -11.785 1.00 20.90 ? 161 ASP B N   1 
ATOM   5149 C  CA  . ASP B 1 160 ? 47.467  -0.482  -10.634 1.00 22.17 ? 161 ASP B CA  1 
ATOM   5150 C  C   . ASP B 1 160 ? 47.760  -1.959  -10.438 1.00 21.35 ? 161 ASP B C   1 
ATOM   5151 O  O   . ASP B 1 160 ? 48.853  -2.325  -10.026 1.00 21.32 ? 161 ASP B O   1 
ATOM   5152 C  CB  . ASP B 1 160 ? 46.889  0.112   -9.338  1.00 22.44 ? 161 ASP B CB  1 
ATOM   5153 C  CG  . ASP B 1 160 ? 46.928  1.649   -9.326  1.00 26.25 ? 161 ASP B CG  1 
ATOM   5154 O  OD1 . ASP B 1 160 ? 47.608  2.262   -10.184 1.00 28.40 ? 161 ASP B OD1 1 
ATOM   5155 O  OD2 . ASP B 1 160 ? 46.273  2.251   -8.454  1.00 31.45 ? 161 ASP B OD2 1 
ATOM   5156 N  N   . ASP B 1 161 ? 46.777  -2.803  -10.729 1.00 21.33 ? 162 ASP B N   1 
ATOM   5157 C  CA  . ASP B 1 161 ? 46.976  -4.258  -10.710 1.00 21.06 ? 162 ASP B CA  1 
ATOM   5158 C  C   . ASP B 1 161 ? 47.917  -4.697  -11.843 1.00 20.18 ? 162 ASP B C   1 
ATOM   5159 O  O   . ASP B 1 161 ? 48.720  -5.620  -11.681 1.00 19.29 ? 162 ASP B O   1 
ATOM   5160 C  CB  . ASP B 1 161 ? 45.631  -4.954  -10.829 1.00 21.58 ? 162 ASP B CB  1 
ATOM   5161 C  CG  . ASP B 1 161 ? 44.656  -4.487  -9.761  1.00 24.25 ? 162 ASP B CG  1 
ATOM   5162 O  OD1 . ASP B 1 161 ? 44.992  -4.625  -8.573  1.00 27.25 ? 162 ASP B OD1 1 
ATOM   5163 O  OD2 . ASP B 1 161 ? 43.567  -3.967  -10.100 1.00 27.49 ? 162 ASP B OD2 1 
ATOM   5164 N  N   . LEU B 1 162 ? 47.806  -4.027  -12.984 1.00 18.84 ? 163 LEU B N   1 
ATOM   5165 C  CA  . LEU B 1 162 ? 48.634  -4.356  -14.128 1.00 18.74 ? 163 LEU B CA  1 
ATOM   5166 C  C   . LEU B 1 162 ? 50.090  -3.964  -13.891 1.00 18.50 ? 163 LEU B C   1 
ATOM   5167 O  O   . LEU B 1 162 ? 50.990  -4.694  -14.319 1.00 18.67 ? 163 LEU B O   1 
ATOM   5168 C  CB  . LEU B 1 162 ? 48.093  -3.702  -15.409 1.00 18.35 ? 163 LEU B CB  1 
ATOM   5169 C  CG  . LEU B 1 162 ? 46.823  -4.312  -15.997 1.00 20.35 ? 163 LEU B CG  1 
ATOM   5170 C  CD1 . LEU B 1 162 ? 46.317  -3.453  -17.151 1.00 20.10 ? 163 LEU B CD1 1 
ATOM   5171 C  CD2 . LEU B 1 162 ? 47.060  -5.758  -16.440 1.00 19.68 ? 163 LEU B CD2 1 
ATOM   5172 N  N   . PHE B 1 163 ? 50.322  -2.822  -13.226 1.00 18.61 ? 164 PHE B N   1 
ATOM   5173 C  CA  . PHE B 1 163 ? 51.691  -2.431  -12.811 1.00 18.78 ? 164 PHE B CA  1 
ATOM   5174 C  C   . PHE B 1 163 ? 52.273  -3.467  -11.836 1.00 18.69 ? 164 PHE B C   1 
ATOM   5175 O  O   . PHE B 1 163 ? 53.444  -3.863  -11.958 1.00 18.33 ? 164 PHE B O   1 
ATOM   5176 C  CB  . PHE B 1 163 ? 51.726  -1.036  -12.159 1.00 18.50 ? 164 PHE B CB  1 
ATOM   5177 C  CG  . PHE B 1 163 ? 51.435  0.124   -13.112 1.00 22.18 ? 164 PHE B CG  1 
ATOM   5178 C  CD1 . PHE B 1 163 ? 50.438  1.043   -12.814 1.00 22.61 ? 164 PHE B CD1 1 
ATOM   5179 C  CD2 . PHE B 1 163 ? 52.184  0.314   -14.275 1.00 22.45 ? 164 PHE B CD2 1 
ATOM   5180 C  CE1 . PHE B 1 163 ? 50.154  2.114   -13.664 1.00 23.90 ? 164 PHE B CE1 1 
ATOM   5181 C  CE2 . PHE B 1 163 ? 51.921  1.396   -15.130 1.00 24.32 ? 164 PHE B CE2 1 
ATOM   5182 C  CZ  . PHE B 1 163 ? 50.905  2.296   -14.818 1.00 25.95 ? 164 PHE B CZ  1 
ATOM   5183 N  N   . ARG B 1 164 ? 51.456  -3.897  -10.866 1.00 17.79 ? 165 ARG B N   1 
ATOM   5184 C  CA  . ARG B 1 164 ? 51.871  -4.958  -9.945  1.00 18.45 ? 165 ARG B CA  1 
ATOM   5185 C  C   . ARG B 1 164 ? 52.124  -6.292  -10.648 1.00 18.31 ? 165 ARG B C   1 
ATOM   5186 O  O   . ARG B 1 164 ? 53.085  -7.004  -10.317 1.00 18.13 ? 165 ARG B O   1 
ATOM   5187 C  CB  . ARG B 1 164 ? 50.868  -5.142  -8.804  1.00 18.22 ? 165 ARG B CB  1 
ATOM   5188 C  CG  . ARG B 1 164 ? 51.040  -4.106  -7.716  1.00 19.53 ? 165 ARG B CG  1 
ATOM   5189 C  CD  . ARG B 1 164 ? 50.101  -4.317  -6.514  1.00 19.64 ? 165 ARG B CD  1 
ATOM   5190 N  NE  . ARG B 1 164 ? 48.696  -4.099  -6.844  1.00 21.73 ? 165 ARG B NE  1 
ATOM   5191 C  CZ  . ARG B 1 164 ? 48.051  -2.938  -6.739  1.00 22.40 ? 165 ARG B CZ  1 
ATOM   5192 N  NH1 . ARG B 1 164 ? 48.668  -1.851  -6.297  1.00 23.54 ? 165 ARG B NH1 1 
ATOM   5193 N  NH2 . ARG B 1 164 ? 46.770  -2.866  -7.071  1.00 21.78 ? 165 ARG B NH2 1 
ATOM   5194 N  N   . PHE B 1 165 ? 51.274  -6.622  -11.622 1.00 18.07 ? 166 PHE B N   1 
ATOM   5195 C  CA  . PHE B 1 165 ? 51.476  -7.826  -12.419 1.00 18.17 ? 166 PHE B CA  1 
ATOM   5196 C  C   . PHE B 1 165 ? 52.818  -7.777  -13.162 1.00 18.63 ? 166 PHE B C   1 
ATOM   5197 O  O   . PHE B 1 165 ? 53.594  -8.751  -13.152 1.00 18.81 ? 166 PHE B O   1 
ATOM   5198 C  CB  . PHE B 1 165 ? 50.349  -8.009  -13.442 1.00 18.03 ? 166 PHE B CB  1 
ATOM   5199 C  CG  . PHE B 1 165 ? 50.687  -9.004  -14.502 1.00 18.19 ? 166 PHE B CG  1 
ATOM   5200 C  CD1 . PHE B 1 165 ? 50.660  -10.361 -14.220 1.00 16.30 ? 166 PHE B CD1 1 
ATOM   5201 C  CD2 . PHE B 1 165 ? 51.094  -8.584  -15.771 1.00 17.99 ? 166 PHE B CD2 1 
ATOM   5202 C  CE1 . PHE B 1 165 ? 51.017  -11.299 -15.187 1.00 18.26 ? 166 PHE B CE1 1 
ATOM   5203 C  CE2 . PHE B 1 165 ? 51.440  -9.517  -16.741 1.00 19.71 ? 166 PHE B CE2 1 
ATOM   5204 C  CZ  . PHE B 1 165 ? 51.417  -10.881 -16.435 1.00 19.60 ? 166 PHE B CZ  1 
ATOM   5205 N  N   . ALA B 1 166 ? 53.070  -6.642  -13.820 1.00 18.45 ? 167 ALA B N   1 
ATOM   5206 C  CA  . ALA B 1 166 ? 54.276  -6.466  -14.609 1.00 18.53 ? 167 ALA B CA  1 
ATOM   5207 C  C   . ALA B 1 166 ? 55.523  -6.538  -13.710 1.00 18.10 ? 167 ALA B C   1 
ATOM   5208 O  O   . ALA B 1 166 ? 56.515  -7.143  -14.087 1.00 18.29 ? 167 ALA B O   1 
ATOM   5209 C  CB  . ALA B 1 166 ? 54.224  -5.119  -15.369 1.00 18.18 ? 167 ALA B CB  1 
ATOM   5210 N  N   . PHE B 1 167 ? 55.451  -5.932  -12.526 1.00 17.97 ? 168 PHE B N   1 
ATOM   5211 C  CA  . PHE B 1 167 ? 56.551  -5.974  -11.546 1.00 18.51 ? 168 PHE B CA  1 
ATOM   5212 C  C   . PHE B 1 167 ? 56.833  -7.406  -11.050 1.00 18.82 ? 168 PHE B C   1 
ATOM   5213 O  O   . PHE B 1 167 ? 57.983  -7.815  -10.945 1.00 18.49 ? 168 PHE B O   1 
ATOM   5214 C  CB  . PHE B 1 167 ? 56.250  -5.061  -10.351 1.00 17.59 ? 168 PHE B CB  1 
ATOM   5215 C  CG  . PHE B 1 167 ? 57.284  -5.138  -9.243  1.00 20.11 ? 168 PHE B CG  1 
ATOM   5216 C  CD1 . PHE B 1 167 ? 58.485  -4.431  -9.336  1.00 19.87 ? 168 PHE B CD1 1 
ATOM   5217 C  CD2 . PHE B 1 167 ? 57.048  -5.895  -8.107  1.00 20.91 ? 168 PHE B CD2 1 
ATOM   5218 C  CE1 . PHE B 1 167 ? 59.433  -4.506  -8.322  1.00 21.59 ? 168 PHE B CE1 1 
ATOM   5219 C  CE2 . PHE B 1 167 ? 57.995  -5.966  -7.081  1.00 22.94 ? 168 PHE B CE2 1 
ATOM   5220 C  CZ  . PHE B 1 167 ? 59.188  -5.269  -7.193  1.00 19.73 ? 168 PHE B CZ  1 
ATOM   5221 N  N   . GLU B 1 168 ? 55.776  -8.135  -10.713 1.00 19.55 ? 169 GLU B N   1 
ATOM   5222 C  CA  . GLU B 1 168 ? 55.874  -9.537  -10.279 1.00 20.05 ? 169 GLU B CA  1 
ATOM   5223 C  C   . GLU B 1 168 ? 56.462  -10.435 -11.372 1.00 20.42 ? 169 GLU B C   1 
ATOM   5224 O  O   . GLU B 1 168 ? 57.247  -11.343 -11.083 1.00 20.59 ? 169 GLU B O   1 
ATOM   5225 C  CB  . GLU B 1 168 ? 54.491  -10.041 -9.860  1.00 20.49 ? 169 GLU B CB  1 
ATOM   5226 C  CG  . GLU B 1 168 ? 54.487  -11.350 -9.059  1.00 22.17 ? 169 GLU B CG  1 
ATOM   5227 C  CD  . GLU B 1 168 ? 54.791  -11.175 -7.574  1.00 25.29 ? 169 GLU B CD  1 
ATOM   5228 O  OE1 . GLU B 1 168 ? 54.802  -12.215 -6.857  1.00 25.39 ? 169 GLU B OE1 1 
ATOM   5229 O  OE2 . GLU B 1 168 ? 55.014  -10.020 -7.121  1.00 25.59 ? 169 GLU B OE2 1 
ATOM   5230 N  N   . SER B 1 169 ? 56.092  -10.176 -12.627 1.00 20.24 ? 170 SER B N   1 
ATOM   5231 C  CA  . SER B 1 169 ? 56.601  -10.954 -13.757 1.00 20.50 ? 170 SER B CA  1 
ATOM   5232 C  C   . SER B 1 169 ? 58.106  -10.747 -13.985 1.00 20.72 ? 170 SER B C   1 
ATOM   5233 O  O   . SER B 1 169 ? 58.854  -11.714 -14.115 1.00 20.79 ? 170 SER B O   1 
ATOM   5234 C  CB  . SER B 1 169 ? 55.819  -10.628 -15.042 1.00 19.95 ? 170 SER B CB  1 
ATOM   5235 O  OG  . SER B 1 169 ? 54.452  -10.950 -14.872 1.00 19.85 ? 170 SER B OG  1 
ATOM   5236 N  N   . ILE B 1 170 ? 58.542  -9.492  -14.051 1.00 21.07 ? 171 ILE B N   1 
ATOM   5237 C  CA  . ILE B 1 170 ? 59.957  -9.206  -14.302 1.00 20.92 ? 171 ILE B CA  1 
ATOM   5238 C  C   . ILE B 1 170 ? 60.839  -9.659  -13.127 1.00 20.89 ? 171 ILE B C   1 
ATOM   5239 O  O   . ILE B 1 170 ? 61.902  -10.238 -13.348 1.00 20.41 ? 171 ILE B O   1 
ATOM   5240 C  CB  . ILE B 1 170 ? 60.213  -7.709  -14.710 1.00 21.00 ? 171 ILE B CB  1 
ATOM   5241 C  CG1 . ILE B 1 170 ? 61.634  -7.523  -15.249 1.00 21.85 ? 171 ILE B CG1 1 
ATOM   5242 C  CG2 . ILE B 1 170 ? 59.934  -6.730  -13.543 1.00 20.62 ? 171 ILE B CG2 1 
ATOM   5243 C  CD1 . ILE B 1 170 ? 61.917  -8.286  -16.525 1.00 21.62 ? 171 ILE B CD1 1 
ATOM   5244 N  N   . THR B 1 171 ? 60.383  -9.417  -11.894 1.00 20.58 ? 172 THR B N   1 
ATOM   5245 C  CA  . THR B 1 171 ? 61.118  -9.875  -10.724 1.00 21.34 ? 172 THR B CA  1 
ATOM   5246 C  C   . THR B 1 171 ? 61.168  -11.396 -10.630 1.00 21.84 ? 172 THR B C   1 
ATOM   5247 O  O   . THR B 1 171 ? 62.154  -11.944 -10.175 1.00 21.40 ? 172 THR B O   1 
ATOM   5248 C  CB  . THR B 1 171 ? 60.577  -9.306  -9.380  1.00 21.20 ? 172 THR B CB  1 
ATOM   5249 O  OG1 . THR B 1 171 ? 59.197  -9.653  -9.222  1.00 21.39 ? 172 THR B OG1 1 
ATOM   5250 C  CG2 . THR B 1 171 ? 60.739  -7.788  -9.321  1.00 20.23 ? 172 THR B CG2 1 
ATOM   5251 N  N   . ASN B 1 172 ? 60.096  -12.071 -11.039 1.00 23.13 ? 173 ASN B N   1 
ATOM   5252 C  CA  . ASN B 1 172 ? 60.096  -13.527 -11.043 1.00 24.04 ? 173 ASN B CA  1 
ATOM   5253 C  C   . ASN B 1 172 ? 61.107  -14.094 -12.038 1.00 24.42 ? 173 ASN B C   1 
ATOM   5254 O  O   . ASN B 1 172 ? 61.792  -15.075 -11.722 1.00 24.32 ? 173 ASN B O   1 
ATOM   5255 C  CB  . ASN B 1 172 ? 58.700  -14.118 -11.297 1.00 24.11 ? 173 ASN B CB  1 
ATOM   5256 C  CG  . ASN B 1 172 ? 58.522  -15.496 -10.648 1.00 25.92 ? 173 ASN B CG  1 
ATOM   5257 O  OD1 . ASN B 1 172 ? 59.184  -15.822 -9.652  1.00 26.48 ? 173 ASN B OD1 1 
ATOM   5258 N  ND2 . ASN B 1 172 ? 57.619  -16.303 -11.202 1.00 25.13 ? 173 ASN B ND2 1 
ATOM   5259 N  N   . VAL B 1 173 ? 61.223  -13.491 -13.226 1.00 24.60 ? 174 VAL B N   1 
ATOM   5260 C  CA  . VAL B 1 173 ? 62.201  -14.018 -14.191 1.00 25.08 ? 174 VAL B CA  1 
ATOM   5261 C  C   . VAL B 1 173 ? 63.644  -13.651 -13.832 1.00 24.89 ? 174 VAL B C   1 
ATOM   5262 O  O   . VAL B 1 173 ? 64.567  -14.406 -14.124 1.00 24.69 ? 174 VAL B O   1 
ATOM   5263 C  CB  . VAL B 1 173 ? 61.885  -13.709 -15.676 1.00 25.18 ? 174 VAL B CB  1 
ATOM   5264 C  CG1 . VAL B 1 173 ? 60.614  -14.428 -16.097 1.00 26.51 ? 174 VAL B CG1 1 
ATOM   5265 C  CG2 . VAL B 1 173 ? 61.783  -12.212 -15.941 1.00 25.92 ? 174 VAL B CG2 1 
ATOM   5266 N  N   . ILE B 1 174 ? 63.827  -12.504 -13.183 1.00 24.49 ? 175 ILE B N   1 
ATOM   5267 C  CA  . ILE B 1 174 ? 65.156  -12.064 -12.826 1.00 24.60 ? 175 ILE B CA  1 
ATOM   5268 C  C   . ILE B 1 174 ? 65.637  -12.812 -11.584 1.00 24.97 ? 175 ILE B C   1 
ATOM   5269 O  O   . ILE B 1 174 ? 66.736  -13.349 -11.571 1.00 25.19 ? 175 ILE B O   1 
ATOM   5270 C  CB  . ILE B 1 174 ? 65.230  -10.522 -12.637 1.00 24.45 ? 175 ILE B CB  1 
ATOM   5271 C  CG1 . ILE B 1 174 ? 65.045  -9.806  -13.985 1.00 24.34 ? 175 ILE B CG1 1 
ATOM   5272 C  CG2 . ILE B 1 174 ? 66.564  -10.117 -12.013 1.00 24.01 ? 175 ILE B CG2 1 
ATOM   5273 C  CD1 . ILE B 1 174 ? 65.116  -8.298  -13.875 1.00 24.13 ? 175 ILE B CD1 1 
ATOM   5274 N  N   . PHE B 1 175 ? 64.793  -12.859 -10.560 1.00 25.20 ? 176 PHE B N   1 
ATOM   5275 C  CA  . PHE B 1 175 ? 65.195  -13.364 -9.264  1.00 26.17 ? 176 PHE B CA  1 
ATOM   5276 C  C   . PHE B 1 175 ? 64.781  -14.820 -9.019  1.00 26.81 ? 176 PHE B C   1 
ATOM   5277 O  O   . PHE B 1 175 ? 65.283  -15.459 -8.091  1.00 25.96 ? 176 PHE B O   1 
ATOM   5278 C  CB  . PHE B 1 175 ? 64.655  -12.444 -8.157  1.00 25.55 ? 176 PHE B CB  1 
ATOM   5279 C  CG  . PHE B 1 175 ? 65.211  -11.044 -8.216  1.00 26.66 ? 176 PHE B CG  1 
ATOM   5280 C  CD1 . PHE B 1 175 ? 64.424  -9.978  -8.648  1.00 26.83 ? 176 PHE B CD1 1 
ATOM   5281 C  CD2 . PHE B 1 175 ? 66.534  -10.789 -7.859  1.00 26.49 ? 176 PHE B CD2 1 
ATOM   5282 C  CE1 . PHE B 1 175 ? 64.955  -8.674  -8.706  1.00 27.21 ? 176 PHE B CE1 1 
ATOM   5283 C  CE2 . PHE B 1 175 ? 67.063  -9.490  -7.924  1.00 27.20 ? 176 PHE B CE2 1 
ATOM   5284 C  CZ  . PHE B 1 175 ? 66.262  -8.437  -8.351  1.00 25.78 ? 176 PHE B CZ  1 
ATOM   5285 N  N   . GLY B 1 176 ? 63.869  -15.336 -9.850  1.00 27.81 ? 177 GLY B N   1 
ATOM   5286 C  CA  . GLY B 1 176 ? 63.251  -16.653 -9.618  1.00 28.41 ? 177 GLY B CA  1 
ATOM   5287 C  C   . GLY B 1 176 ? 62.533  -16.739 -8.278  1.00 28.95 ? 177 GLY B C   1 
ATOM   5288 O  O   . GLY B 1 176 ? 62.360  -17.823 -7.731  1.00 28.94 ? 177 GLY B O   1 
ATOM   5289 N  N   . GLU B 1 177 ? 62.124  -15.595 -7.741  1.00 29.51 ? 178 GLU B N   1 
ATOM   5290 C  CA  . GLU B 1 177 ? 61.401  -15.548 -6.463  1.00 30.30 ? 178 GLU B CA  1 
ATOM   5291 C  C   . GLU B 1 177 ? 60.180  -14.642 -6.605  1.00 29.68 ? 178 GLU B C   1 
ATOM   5292 O  O   . GLU B 1 177 ? 60.256  -13.605 -7.274  1.00 29.40 ? 178 GLU B O   1 
ATOM   5293 C  CB  . GLU B 1 177 ? 62.297  -15.011 -5.340  1.00 30.70 ? 178 GLU B CB  1 
ATOM   5294 C  CG  . GLU B 1 177 ? 63.510  -15.893 -4.995  1.00 35.57 ? 178 GLU B CG  1 
ATOM   5295 C  CD  . GLU B 1 177 ? 64.473  -15.245 -3.992  1.00 40.70 ? 178 GLU B CD  1 
ATOM   5296 O  OE1 . GLU B 1 177 ? 64.319  -14.040 -3.685  1.00 42.72 ? 178 GLU B OE1 1 
ATOM   5297 O  OE2 . GLU B 1 177 ? 65.390  -15.947 -3.503  1.00 43.53 ? 178 GLU B OE2 1 
ATOM   5298 N  N   . ARG B 1 178 ? 59.076  -15.036 -5.967  1.00 29.11 ? 179 ARG B N   1 
ATOM   5299 C  CA  . ARG B 1 178 ? 57.832  -14.279 -5.988  1.00 28.88 ? 179 ARG B CA  1 
ATOM   5300 C  C   . ARG B 1 178 ? 57.861  -13.151 -4.970  1.00 29.29 ? 179 ARG B C   1 
ATOM   5301 O  O   . ARG B 1 178 ? 58.144  -13.381 -3.796  1.00 29.16 ? 179 ARG B O   1 
ATOM   5302 C  CB  . ARG B 1 178 ? 56.622  -15.191 -5.735  1.00 28.46 ? 179 ARG B CB  1 
ATOM   5303 C  CG  . ARG B 1 178 ? 56.334  -16.184 -6.873  1.00 26.80 ? 179 ARG B CG  1 
ATOM   5304 C  CD  . ARG B 1 178 ? 55.914  -15.460 -8.175  1.00 24.19 ? 179 ARG B CD  1 
ATOM   5305 N  NE  . ARG B 1 178 ? 54.668  -14.721 -7.995  1.00 23.98 ? 179 ARG B NE  1 
ATOM   5306 C  CZ  . ARG B 1 178 ? 53.456  -15.243 -8.185  1.00 24.61 ? 179 ARG B CZ  1 
ATOM   5307 N  NH1 . ARG B 1 178 ? 53.322  -16.514 -8.568  1.00 24.88 ? 179 ARG B NH1 1 
ATOM   5308 N  NH2 . ARG B 1 178 ? 52.375  -14.503 -7.974  1.00 21.99 ? 179 ARG B NH2 1 
ATOM   5309 N  N   . GLN B 1 179 ? 57.545  -11.939 -5.422  1.00 29.07 ? 180 GLN B N   1 
ATOM   5310 C  CA  . GLN B 1 179 ? 57.519  -10.772 -4.541  1.00 29.38 ? 180 GLN B CA  1 
ATOM   5311 C  C   . GLN B 1 179 ? 56.211  -10.624 -3.760  1.00 29.27 ? 180 GLN B C   1 
ATOM   5312 O  O   . GLN B 1 179 ? 56.115  -9.802  -2.847  1.00 29.21 ? 180 GLN B O   1 
ATOM   5313 C  CB  . GLN B 1 179 ? 57.825  -9.508  -5.344  1.00 29.24 ? 180 GLN B CB  1 
ATOM   5314 C  CG  . GLN B 1 179 ? 59.174  -9.578  -6.069  1.00 29.85 ? 180 GLN B CG  1 
ATOM   5315 C  CD  . GLN B 1 179 ? 60.346  -9.797  -5.117  1.00 33.16 ? 180 GLN B CD  1 
ATOM   5316 O  OE1 . GLN B 1 179 ? 60.617  -8.956  -4.258  1.00 35.05 ? 180 GLN B OE1 1 
ATOM   5317 N  NE2 . GLN B 1 179 ? 61.037  -10.931 -5.262  1.00 31.30 ? 180 GLN B NE2 1 
ATOM   5318 N  N   . GLY B 1 180 ? 55.210  -11.414 -4.129  1.00 28.97 ? 181 GLY B N   1 
ATOM   5319 C  CA  . GLY B 1 180 ? 53.911  -11.393 -3.445  1.00 29.77 ? 181 GLY B CA  1 
ATOM   5320 C  C   . GLY B 1 180 ? 53.013  -10.210 -3.779  1.00 29.77 ? 181 GLY B C   1 
ATOM   5321 O  O   . GLY B 1 180 ? 52.094  -9.904  -3.020  1.00 29.95 ? 181 GLY B O   1 
ATOM   5322 N  N   . MET B 1 181 ? 53.256  -9.553  -4.915  1.00 29.81 ? 182 MET B N   1 
ATOM   5323 C  CA  . MET B 1 181 ? 52.519  -8.329  -5.260  1.00 30.27 ? 182 MET B CA  1 
ATOM   5324 C  C   . MET B 1 181 ? 51.087  -8.569  -5.745  1.00 30.41 ? 182 MET B C   1 
ATOM   5325 O  O   . MET B 1 181 ? 50.327  -7.619  -5.903  1.00 30.11 ? 182 MET B O   1 
ATOM   5326 C  CB  . MET B 1 181 ? 53.300  -7.457  -6.269  1.00 30.77 ? 182 MET B CB  1 
ATOM   5327 C  CG  . MET B 1 181 ? 54.628  -6.903  -5.738  1.00 31.14 ? 182 MET B CG  1 
ATOM   5328 S  SD  . MET B 1 181 ? 54.465  -6.053  -4.140  1.00 33.73 ? 182 MET B SD  1 
ATOM   5329 C  CE  . MET B 1 181 ? 53.854  -4.447  -4.689  1.00 31.13 ? 182 MET B CE  1 
ATOM   5330 N  N   . LEU B 1 182 ? 50.717  -9.828  -5.975  1.00 30.71 ? 183 LEU B N   1 
ATOM   5331 C  CA  . LEU B 1 182 ? 49.324  -10.155 -6.302  1.00 32.02 ? 183 LEU B CA  1 
ATOM   5332 C  C   . LEU B 1 182 ? 48.493  -10.728 -5.120  1.00 33.23 ? 183 LEU B C   1 
ATOM   5333 O  O   . LEU B 1 182 ? 47.366  -11.173 -5.322  1.00 33.43 ? 183 LEU B O   1 
ATOM   5334 C  CB  . LEU B 1 182 ? 49.234  -11.045 -7.556  1.00 31.23 ? 183 LEU B CB  1 
ATOM   5335 C  CG  . LEU B 1 182 ? 49.889  -10.539 -8.860  1.00 31.20 ? 183 LEU B CG  1 
ATOM   5336 C  CD1 . LEU B 1 182 ? 49.592  -11.494 -10.031 1.00 29.13 ? 183 LEU B CD1 1 
ATOM   5337 C  CD2 . LEU B 1 182 ? 49.459  -9.118  -9.206  1.00 29.77 ? 183 LEU B CD2 1 
ATOM   5338 N  N   . GLU B 1 183 ? 49.045  -10.696 -3.901  1.00 34.74 ? 184 GLU B N   1 
ATOM   5339 C  CA  . GLU B 1 183 ? 48.290  -11.051 -2.676  1.00 36.62 ? 184 GLU B CA  1 
ATOM   5340 C  C   . GLU B 1 183 ? 47.449  -9.857  -2.226  1.00 37.27 ? 184 GLU B C   1 
ATOM   5341 O  O   . GLU B 1 183 ? 47.604  -8.749  -2.745  1.00 36.80 ? 184 GLU B O   1 
ATOM   5342 C  CB  . GLU B 1 183 ? 49.228  -11.448 -1.519  1.00 36.68 ? 184 GLU B CB  1 
ATOM   5343 C  CG  . GLU B 1 183 ? 50.383  -12.371 -1.883  1.00 39.86 ? 184 GLU B CG  1 
ATOM   5344 C  CD  . GLU B 1 183 ? 50.001  -13.842 -1.980  1.00 44.49 ? 184 GLU B CD  1 
ATOM   5345 O  OE1 . GLU B 1 183 ? 48.955  -14.252 -1.420  1.00 46.46 ? 184 GLU B OE1 1 
ATOM   5346 O  OE2 . GLU B 1 183 ? 50.779  -14.601 -2.604  1.00 46.56 ? 184 GLU B OE2 1 
ATOM   5347 N  N   . GLU B 1 184 ? 46.574  -10.076 -1.244  1.00 38.62 ? 185 GLU B N   1 
ATOM   5348 C  CA  . GLU B 1 184 ? 45.710  -9.000  -0.739  1.00 40.00 ? 185 GLU B CA  1 
ATOM   5349 C  C   . GLU B 1 184 ? 46.472  -7.965  0.077   1.00 39.88 ? 185 GLU B C   1 
ATOM   5350 O  O   . GLU B 1 184 ? 46.165  -6.778  0.019   1.00 40.06 ? 185 GLU B O   1 
ATOM   5351 C  CB  . GLU B 1 184 ? 44.531  -9.559  0.060   1.00 40.66 ? 185 GLU B CB  1 
ATOM   5352 C  CG  . GLU B 1 184 ? 43.519  -10.276 -0.813  1.00 43.70 ? 185 GLU B CG  1 
ATOM   5353 C  CD  . GLU B 1 184 ? 42.186  -10.500 -0.121  1.00 47.49 ? 185 GLU B CD  1 
ATOM   5354 O  OE1 . GLU B 1 184 ? 41.540  -9.502  0.284   1.00 48.38 ? 185 GLU B OE1 1 
ATOM   5355 O  OE2 . GLU B 1 184 ? 41.782  -11.679 0.000   1.00 48.97 ? 185 GLU B OE2 1 
ATOM   5356 N  N   . VAL B 1 185 ? 47.464  -8.418  0.832   1.00 40.23 ? 186 VAL B N   1 
ATOM   5357 C  CA  . VAL B 1 185 ? 48.320  -7.514  1.597   1.00 40.43 ? 186 VAL B CA  1 
ATOM   5358 C  C   . VAL B 1 185 ? 49.688  -7.476  0.933   1.00 40.38 ? 186 VAL B C   1 
ATOM   5359 O  O   . VAL B 1 185 ? 50.399  -8.482  0.880   1.00 40.28 ? 186 VAL B O   1 
ATOM   5360 C  CB  . VAL B 1 185 ? 48.436  -7.925  3.086   1.00 40.47 ? 186 VAL B CB  1 
ATOM   5361 C  CG1 . VAL B 1 185 ? 49.568  -7.152  3.779   1.00 40.90 ? 186 VAL B CG1 1 
ATOM   5362 C  CG2 . VAL B 1 185 ? 47.121  -7.672  3.797   1.00 41.00 ? 186 VAL B CG2 1 
ATOM   5363 N  N   . VAL B 1 186 ? 50.033  -6.295  0.435   1.00 40.23 ? 187 VAL B N   1 
ATOM   5364 C  CA  . VAL B 1 186 ? 51.169  -6.094  -0.452  1.00 40.05 ? 187 VAL B CA  1 
ATOM   5365 C  C   . VAL B 1 186 ? 52.371  -5.497  0.289   1.00 39.51 ? 187 VAL B C   1 
ATOM   5366 O  O   . VAL B 1 186 ? 52.205  -4.760  1.258   1.00 39.58 ? 187 VAL B O   1 
ATOM   5367 C  CB  . VAL B 1 186 ? 50.714  -5.208  -1.673  1.00 40.40 ? 187 VAL B CB  1 
ATOM   5368 C  CG1 . VAL B 1 186 ? 51.695  -4.077  -1.998  1.00 40.04 ? 187 VAL B CG1 1 
ATOM   5369 C  CG2 . VAL B 1 186 ? 50.398  -6.086  -2.892  1.00 40.45 ? 187 VAL B CG2 1 
ATOM   5370 N  N   . ASN B 1 187 ? 53.572  -5.839  -0.171  1.00 38.53 ? 188 ASN B N   1 
ATOM   5371 C  CA  . ASN B 1 187 ? 54.793  -5.209  0.294   1.00 37.81 ? 188 ASN B CA  1 
ATOM   5372 C  C   . ASN B 1 187 ? 54.822  -3.696  -0.035  1.00 36.89 ? 188 ASN B C   1 
ATOM   5373 O  O   . ASN B 1 187 ? 54.918  -3.317  -1.202  1.00 36.40 ? 188 ASN B O   1 
ATOM   5374 C  CB  . ASN B 1 187 ? 55.999  -5.926  -0.325  1.00 38.16 ? 188 ASN B CB  1 
ATOM   5375 C  CG  . ASN B 1 187 ? 57.317  -5.467  0.263   1.00 39.29 ? 188 ASN B CG  1 
ATOM   5376 O  OD1 . ASN B 1 187 ? 57.435  -4.355  0.770   1.00 41.25 ? 188 ASN B OD1 1 
ATOM   5377 N  ND2 . ASN B 1 187 ? 58.318  -6.329  0.202   1.00 42.35 ? 188 ASN B ND2 1 
ATOM   5378 N  N   . PRO B 1 188 ? 54.740  -2.828  0.997   1.00 36.19 ? 189 PRO B N   1 
ATOM   5379 C  CA  . PRO B 1 188 ? 54.683  -1.384  0.716   1.00 35.01 ? 189 PRO B CA  1 
ATOM   5380 C  C   . PRO B 1 188 ? 55.957  -0.828  0.071   1.00 33.70 ? 189 PRO B C   1 
ATOM   5381 O  O   . PRO B 1 188 ? 55.881  0.142   -0.675  1.00 32.91 ? 189 PRO B O   1 
ATOM   5382 C  CB  . PRO B 1 188 ? 54.454  -0.755  2.095   1.00 35.54 ? 189 PRO B CB  1 
ATOM   5383 C  CG  . PRO B 1 188 ? 54.943  -1.774  3.079   1.00 36.17 ? 189 PRO B CG  1 
ATOM   5384 C  CD  . PRO B 1 188 ? 54.705  -3.117  2.446   1.00 36.14 ? 189 PRO B CD  1 
ATOM   5385 N  N   . GLU B 1 189 ? 57.102  -1.445  0.348   1.00 32.44 ? 190 GLU B N   1 
ATOM   5386 C  CA  . GLU B 1 189 ? 58.366  -1.011  -0.236  1.00 31.89 ? 190 GLU B CA  1 
ATOM   5387 C  C   . GLU B 1 189 ? 58.494  -1.352  -1.724  1.00 30.35 ? 190 GLU B C   1 
ATOM   5388 O  O   . GLU B 1 189 ? 59.089  -0.583  -2.489  1.00 29.37 ? 190 GLU B O   1 
ATOM   5389 C  CB  . GLU B 1 189 ? 59.569  -1.527  0.568   1.00 32.82 ? 190 GLU B CB  1 
ATOM   5390 C  CG  . GLU B 1 189 ? 59.660  -0.904  1.968   1.00 35.82 ? 190 GLU B CG  1 
ATOM   5391 C  CD  . GLU B 1 189 ? 59.604  0.624   1.937   1.00 41.06 ? 190 GLU B CD  1 
ATOM   5392 O  OE1 . GLU B 1 189 ? 60.539  1.246   1.383   1.00 41.79 ? 190 GLU B OE1 1 
ATOM   5393 O  OE2 . GLU B 1 189 ? 58.619  1.207   2.459   1.00 44.34 ? 190 GLU B OE2 1 
ATOM   5394 N  N   . ALA B 1 190 ? 57.934  -2.493  -2.127  1.00 28.59 ? 191 ALA B N   1 
ATOM   5395 C  CA  . ALA B 1 190 ? 57.848  -2.826  -3.552  1.00 27.81 ? 191 ALA B CA  1 
ATOM   5396 C  C   . ALA B 1 190 ? 56.858  -1.895  -4.276  1.00 27.15 ? 191 ALA B C   1 
ATOM   5397 O  O   . ALA B 1 190 ? 57.118  -1.492  -5.400  1.00 26.63 ? 191 ALA B O   1 
ATOM   5398 C  CB  . ALA B 1 190 ? 57.483  -4.287  -3.764  1.00 27.08 ? 191 ALA B CB  1 
ATOM   5399 N  N   . GLN B 1 191 ? 55.746  -1.541  -3.626  1.00 26.21 ? 192 GLN B N   1 
ATOM   5400 C  CA  . GLN B 1 191 ? 54.818  -0.559  -4.200  1.00 26.27 ? 192 GLN B CA  1 
ATOM   5401 C  C   . GLN B 1 191 ? 55.513  0.800   -4.448  1.00 26.27 ? 192 GLN B C   1 
ATOM   5402 O  O   . GLN B 1 191 ? 55.320  1.430   -5.499  1.00 25.58 ? 192 GLN B O   1 
ATOM   5403 C  CB  . GLN B 1 191 ? 53.553  -0.411  -3.338  1.00 26.31 ? 192 GLN B CB  1 
ATOM   5404 C  CG  . GLN B 1 191 ? 52.407  0.372   -3.998  1.00 25.82 ? 192 GLN B CG  1 
ATOM   5405 C  CD  . GLN B 1 191 ? 51.831  -0.303  -5.254  1.00 26.19 ? 192 GLN B CD  1 
ATOM   5406 O  OE1 . GLN B 1 191 ? 51.187  -1.356  -5.177  1.00 25.09 ? 192 GLN B OE1 1 
ATOM   5407 N  NE2 . GLN B 1 191 ? 52.038  0.329   -6.418  1.00 23.67 ? 192 GLN B NE2 1 
ATOM   5408 N  N   . ARG B 1 192 ? 56.327  1.228   -3.481  1.00 25.98 ? 193 ARG B N   1 
ATOM   5409 C  CA  . ARG B 1 192 ? 57.138  2.440   -3.601  1.00 26.12 ? 193 ARG B CA  1 
ATOM   5410 C  C   . ARG B 1 192 ? 58.046  2.371   -4.834  1.00 24.90 ? 193 ARG B C   1 
ATOM   5411 O  O   . ARG B 1 192 ? 58.177  3.356   -5.539  1.00 24.11 ? 193 ARG B O   1 
ATOM   5412 C  CB  . ARG B 1 192 ? 57.991  2.657   -2.343  1.00 26.41 ? 193 ARG B CB  1 
ATOM   5413 C  CG  . ARG B 1 192 ? 57.337  3.516   -1.241  1.00 30.65 ? 193 ARG B CG  1 
ATOM   5414 C  CD  . ARG B 1 192 ? 58.321  3.774   -0.048  1.00 34.53 ? 193 ARG B CD  1 
ATOM   5415 N  NE  . ARG B 1 192 ? 59.701  4.031   -0.485  1.00 39.37 ? 193 ARG B NE  1 
ATOM   5416 C  CZ  . ARG B 1 192 ? 60.271  5.234   -0.534  1.00 41.70 ? 193 ARG B CZ  1 
ATOM   5417 N  NH1 . ARG B 1 192 ? 59.592  6.311   -0.162  1.00 43.91 ? 193 ARG B NH1 1 
ATOM   5418 N  NH2 . ARG B 1 192 ? 61.521  5.367   -0.954  1.00 41.34 ? 193 ARG B NH2 1 
ATOM   5419 N  N   . PHE B 1 193 ? 58.669  1.213   -5.082  1.00 23.84 ? 194 PHE B N   1 
ATOM   5420 C  CA  . PHE B 1 193 ? 59.455  1.018   -6.304  1.00 23.17 ? 194 PHE B CA  1 
ATOM   5421 C  C   . PHE B 1 193 ? 58.567  1.194   -7.560  1.00 22.66 ? 194 PHE B C   1 
ATOM   5422 O  O   . PHE B 1 193 ? 58.919  1.945   -8.471  1.00 22.41 ? 194 PHE B O   1 
ATOM   5423 C  CB  . PHE B 1 193 ? 60.192  -0.344  -6.296  1.00 23.15 ? 194 PHE B CB  1 
ATOM   5424 C  CG  . PHE B 1 193 ? 61.054  -0.591  -7.527  1.00 23.70 ? 194 PHE B CG  1 
ATOM   5425 C  CD1 . PHE B 1 193 ? 62.345  -0.093  -7.608  1.00 24.45 ? 194 PHE B CD1 1 
ATOM   5426 C  CD2 . PHE B 1 193 ? 60.565  -1.327  -8.598  1.00 24.98 ? 194 PHE B CD2 1 
ATOM   5427 C  CE1 . PHE B 1 193 ? 63.142  -0.319  -8.741  1.00 25.39 ? 194 PHE B CE1 1 
ATOM   5428 C  CE2 . PHE B 1 193 ? 61.349  -1.562  -9.737  1.00 26.72 ? 194 PHE B CE2 1 
ATOM   5429 C  CZ  . PHE B 1 193 ? 62.649  -1.043  -9.804  1.00 26.35 ? 194 PHE B CZ  1 
ATOM   5430 N  N   . ILE B 1 194 ? 57.415  0.521   -7.589  1.00 22.38 ? 195 ILE B N   1 
ATOM   5431 C  CA  . ILE B 1 194 ? 56.479  0.626   -8.731  1.00 22.15 ? 195 ILE B CA  1 
ATOM   5432 C  C   . ILE B 1 194 ? 56.120  2.084   -9.042  1.00 21.89 ? 195 ILE B C   1 
ATOM   5433 O  O   . ILE B 1 194 ? 56.308  2.539   -10.179 1.00 21.80 ? 195 ILE B O   1 
ATOM   5434 C  CB  . ILE B 1 194 ? 55.199  -0.249  -8.551  1.00 22.14 ? 195 ILE B CB  1 
ATOM   5435 C  CG1 . ILE B 1 194 ? 55.555  -1.742  -8.639  1.00 23.56 ? 195 ILE B CG1 1 
ATOM   5436 C  CG2 . ILE B 1 194 ? 54.164  0.096   -9.620  1.00 22.29 ? 195 ILE B CG2 1 
ATOM   5437 C  CD1 . ILE B 1 194 ? 54.511  -2.715  -8.080  1.00 22.14 ? 195 ILE B CD1 1 
ATOM   5438 N  N   . ASP B 1 195 ? 55.640  2.808   -8.026  1.00 21.16 ? 196 ASP B N   1 
ATOM   5439 C  CA  . ASP B 1 195 ? 55.267  4.219   -8.137  1.00 21.21 ? 196 ASP B CA  1 
ATOM   5440 C  C   . ASP B 1 195 ? 56.420  5.120   -8.580  1.00 19.84 ? 196 ASP B C   1 
ATOM   5441 O  O   . ASP B 1 195 ? 56.206  6.081   -9.297  1.00 19.57 ? 196 ASP B O   1 
ATOM   5442 C  CB  . ASP B 1 195 ? 54.698  4.744   -6.804  1.00 21.96 ? 196 ASP B CB  1 
ATOM   5443 C  CG  . ASP B 1 195 ? 53.434  4.002   -6.364  1.00 25.67 ? 196 ASP B CG  1 
ATOM   5444 O  OD1 . ASP B 1 195 ? 52.908  3.164   -7.137  1.00 26.11 ? 196 ASP B OD1 1 
ATOM   5445 O  OD2 . ASP B 1 195 ? 52.960  4.261   -5.226  1.00 30.84 ? 196 ASP B OD2 1 
ATOM   5446 N  N   . ALA B 1 196 ? 57.634  4.806   -8.148  1.00 19.06 ? 197 ALA B N   1 
ATOM   5447 C  CA  . ALA B 1 196 ? 58.800  5.591   -8.506  1.00 18.99 ? 197 ALA B CA  1 
ATOM   5448 C  C   . ALA B 1 196 ? 59.105  5.516   -10.008 1.00 19.16 ? 197 ALA B C   1 
ATOM   5449 O  O   . ALA B 1 196 ? 59.544  6.502   -10.613 1.00 18.85 ? 197 ALA B O   1 
ATOM   5450 C  CB  . ALA B 1 196 ? 59.982  5.147   -7.710  1.00 18.86 ? 197 ALA B CB  1 
ATOM   5451 N  N   . ILE B 1 197 ? 58.851  4.354   -10.607 1.00 19.29 ? 198 ILE B N   1 
ATOM   5452 C  CA  . ILE B 1 197 ? 59.097  4.175   -12.035 1.00 19.63 ? 198 ILE B CA  1 
ATOM   5453 C  C   . ILE B 1 197 ? 58.188  5.081   -12.838 1.00 20.25 ? 198 ILE B C   1 
ATOM   5454 O  O   . ILE B 1 197 ? 58.651  5.767   -13.748 1.00 20.14 ? 198 ILE B O   1 
ATOM   5455 C  CB  . ILE B 1 197 ? 58.950  2.703   -12.473 1.00 20.10 ? 198 ILE B CB  1 
ATOM   5456 C  CG1 . ILE B 1 197 ? 60.060  1.877   -11.794 1.00 20.16 ? 198 ILE B CG1 1 
ATOM   5457 C  CG2 . ILE B 1 197 ? 59.006  2.583   -14.007 1.00 17.37 ? 198 ILE B CG2 1 
ATOM   5458 C  CD1 . ILE B 1 197 ? 59.805  0.409   -11.797 1.00 21.92 ? 198 ILE B CD1 1 
ATOM   5459 N  N   . TYR B 1 198 ? 56.906  5.100   -12.494 1.00 20.54 ? 199 TYR B N   1 
ATOM   5460 C  CA  . TYR B 1 198 ? 55.974  5.969   -13.176 1.00 21.83 ? 199 TYR B CA  1 
ATOM   5461 C  C   . TYR B 1 198 ? 56.386  7.431   -12.957 1.00 21.36 ? 199 TYR B C   1 
ATOM   5462 O  O   . TYR B 1 198 ? 56.355  8.246   -13.892 1.00 20.20 ? 199 TYR B O   1 
ATOM   5463 C  CB  . TYR B 1 198 ? 54.523  5.713   -12.710 1.00 22.87 ? 199 TYR B CB  1 
ATOM   5464 C  CG  . TYR B 1 198 ? 53.551  6.724   -13.272 1.00 27.05 ? 199 TYR B CG  1 
ATOM   5465 C  CD1 . TYR B 1 198 ? 52.939  6.529   -14.516 1.00 32.53 ? 199 TYR B CD1 1 
ATOM   5466 C  CD2 . TYR B 1 198 ? 53.279  7.906   -12.584 1.00 29.70 ? 199 TYR B CD2 1 
ATOM   5467 C  CE1 . TYR B 1 198 ? 52.059  7.498   -15.047 1.00 33.54 ? 199 TYR B CE1 1 
ATOM   5468 C  CE2 . TYR B 1 198 ? 52.417  8.858   -13.092 1.00 31.82 ? 199 TYR B CE2 1 
ATOM   5469 C  CZ  . TYR B 1 198 ? 51.812  8.654   -14.319 1.00 34.38 ? 199 TYR B CZ  1 
ATOM   5470 O  OH  . TYR B 1 198 ? 50.963  9.625   -14.795 1.00 37.17 ? 199 TYR B OH  1 
ATOM   5471 N  N   . GLN B 1 199 ? 56.798  7.755   -11.727 1.00 21.18 ? 200 GLN B N   1 
ATOM   5472 C  CA  . GLN B 1 199 ? 57.235  9.129   -11.428 1.00 21.27 ? 200 GLN B CA  1 
ATOM   5473 C  C   . GLN B 1 199 ? 58.462  9.542   -12.246 1.00 20.46 ? 200 GLN B C   1 
ATOM   5474 O  O   . GLN B 1 199 ? 58.501  10.641  -12.777 1.00 20.59 ? 200 GLN B O   1 
ATOM   5475 C  CB  . GLN B 1 199 ? 57.462  9.359   -9.930  1.00 21.61 ? 200 GLN B CB  1 
ATOM   5476 C  CG  . GLN B 1 199 ? 56.155  9.492   -9.145  1.00 24.67 ? 200 GLN B CG  1 
ATOM   5477 C  CD  . GLN B 1 199 ? 55.264  10.620  -9.703  1.00 29.77 ? 200 GLN B CD  1 
ATOM   5478 O  OE1 . GLN B 1 199 ? 55.756  11.722  -10.014 1.00 29.12 ? 200 GLN B OE1 1 
ATOM   5479 N  NE2 . GLN B 1 199 ? 53.957  10.335  -9.856  1.00 28.80 ? 200 GLN B NE2 1 
ATOM   5480 N  N   . MET B 1 200 ? 59.443  8.657   -12.350 1.00 19.49 ? 201 MET B N   1 
ATOM   5481 C  CA  . MET B 1 200 ? 60.639  8.907   -13.173 1.00 19.06 ? 201 MET B CA  1 
ATOM   5482 C  C   . MET B 1 200 ? 60.258  9.269   -14.637 1.00 18.35 ? 201 MET B C   1 
ATOM   5483 O  O   . MET B 1 200 ? 60.757  10.254  -15.185 1.00 17.98 ? 201 MET B O   1 
ATOM   5484 C  CB  . MET B 1 200 ? 61.564  7.698   -13.121 1.00 18.84 ? 201 MET B CB  1 
ATOM   5485 C  CG  . MET B 1 200 ? 62.900  7.892   -13.829 1.00 19.28 ? 201 MET B CG  1 
ATOM   5486 S  SD  . MET B 1 200 ? 62.858  7.675   -15.616 1.00 20.84 ? 201 MET B SD  1 
ATOM   5487 C  CE  . MET B 1 200 ? 62.623  5.898   -15.715 1.00 20.02 ? 201 MET B CE  1 
ATOM   5488 N  N   . PHE B 1 201 ? 59.348  8.504   -15.235 1.00 18.20 ? 202 PHE B N   1 
ATOM   5489 C  CA  . PHE B 1 201 ? 58.870  8.785   -16.600 1.00 18.42 ? 202 PHE B CA  1 
ATOM   5490 C  C   . PHE B 1 201 ? 58.118  10.097  -16.720 1.00 18.76 ? 202 PHE B C   1 
ATOM   5491 O  O   . PHE B 1 201 ? 58.448  10.930  -17.585 1.00 18.33 ? 202 PHE B O   1 
ATOM   5492 C  CB  . PHE B 1 201 ? 57.977  7.662   -17.106 1.00 18.96 ? 202 PHE B CB  1 
ATOM   5493 C  CG  . PHE B 1 201 ? 58.717  6.441   -17.526 1.00 18.65 ? 202 PHE B CG  1 
ATOM   5494 C  CD1 . PHE B 1 201 ? 58.388  5.203   -16.994 1.00 19.65 ? 202 PHE B CD1 1 
ATOM   5495 C  CD2 . PHE B 1 201 ? 59.717  6.516   -18.494 1.00 20.06 ? 202 PHE B CD2 1 
ATOM   5496 C  CE1 . PHE B 1 201 ? 59.067  4.043   -17.414 1.00 20.66 ? 202 PHE B CE1 1 
ATOM   5497 C  CE2 . PHE B 1 201 ? 60.397  5.363   -18.914 1.00 18.52 ? 202 PHE B CE2 1 
ATOM   5498 C  CZ  . PHE B 1 201 ? 60.077  4.138   -18.369 1.00 19.13 ? 202 PHE B CZ  1 
ATOM   5499 N  N   . HIS B 1 202 ? 57.104  10.268  -15.864 1.00 18.61 ? 203 HIS B N   1 
ATOM   5500 C  CA  . HIS B 1 202 ? 56.320  11.504  -15.809 1.00 19.65 ? 203 HIS B CA  1 
ATOM   5501 C  C   . HIS B 1 202 ? 57.186  12.761  -15.639 1.00 19.30 ? 203 HIS B C   1 
ATOM   5502 O  O   . HIS B 1 202 ? 57.036  13.734  -16.394 1.00 18.33 ? 203 HIS B O   1 
ATOM   5503 C  CB  . HIS B 1 202 ? 55.242  11.421  -14.714 1.00 20.75 ? 203 HIS B CB  1 
ATOM   5504 C  CG  . HIS B 1 202 ? 54.292  12.580  -14.702 1.00 24.25 ? 203 HIS B CG  1 
ATOM   5505 N  ND1 . HIS B 1 202 ? 53.224  12.678  -15.567 1.00 27.69 ? 203 HIS B ND1 1 
ATOM   5506 C  CD2 . HIS B 1 202 ? 54.230  13.679  -13.909 1.00 27.27 ? 203 HIS B CD2 1 
ATOM   5507 C  CE1 . HIS B 1 202 ? 52.553  13.791  -15.321 1.00 26.26 ? 203 HIS B CE1 1 
ATOM   5508 N  NE2 . HIS B 1 202 ? 53.139  14.413  -14.315 1.00 27.69 ? 203 HIS B NE2 1 
ATOM   5509 N  N   . THR B 1 203 ? 58.126  12.730  -14.690 1.00 19.13 ? 204 THR B N   1 
ATOM   5510 C  CA  . THR B 1 203 ? 58.955  13.915  -14.428 1.00 18.85 ? 204 THR B CA  1 
ATOM   5511 C  C   . THR B 1 203 ? 59.993  14.166  -15.521 1.00 18.89 ? 204 THR B C   1 
ATOM   5512 O  O   . THR B 1 203 ? 60.572  15.245  -15.586 1.00 18.54 ? 204 THR B O   1 
ATOM   5513 C  CB  . THR B 1 203 ? 59.630  13.874  -13.048 1.00 18.65 ? 204 THR B CB  1 
ATOM   5514 O  OG1 . THR B 1 203 ? 60.437  12.702  -12.946 1.00 20.10 ? 204 THR B OG1 1 
ATOM   5515 C  CG2 . THR B 1 203 ? 58.585  13.861  -11.953 1.00 19.13 ? 204 THR B CG2 1 
ATOM   5516 N  N   . SER B 1 204 ? 60.201  13.198  -16.408 1.00 18.45 ? 205 SER B N   1 
ATOM   5517 C  CA  . SER B 1 204 ? 61.161  13.384  -17.494 1.00 18.85 ? 205 SER B CA  1 
ATOM   5518 C  C   . SER B 1 204 ? 60.671  14.436  -18.485 1.00 18.78 ? 205 SER B C   1 
ATOM   5519 O  O   . SER B 1 204 ? 61.477  15.166  -19.058 1.00 18.25 ? 205 SER B O   1 
ATOM   5520 C  CB  . SER B 1 204 ? 61.379  12.084  -18.272 1.00 18.19 ? 205 SER B CB  1 
ATOM   5521 O  OG  . SER B 1 204 ? 61.956  11.077  -17.482 1.00 20.37 ? 205 SER B OG  1 
ATOM   5522 N  N   . VAL B 1 205 ? 59.351  14.478  -18.696 1.00 18.92 ? 206 VAL B N   1 
ATOM   5523 C  CA  . VAL B 1 205 ? 58.742  15.244  -19.794 1.00 19.28 ? 206 VAL B CA  1 
ATOM   5524 C  C   . VAL B 1 205 ? 59.039  16.766  -19.770 1.00 19.99 ? 206 VAL B C   1 
ATOM   5525 O  O   . VAL B 1 205 ? 59.450  17.323  -20.786 1.00 20.39 ? 206 VAL B O   1 
ATOM   5526 C  CB  . VAL B 1 205 ? 57.216  14.942  -19.920 1.00 19.12 ? 206 VAL B CB  1 
ATOM   5527 C  CG1 . VAL B 1 205 ? 56.579  15.815  -20.975 1.00 18.03 ? 206 VAL B CG1 1 
ATOM   5528 C  CG2 . VAL B 1 205 ? 57.015  13.458  -20.278 1.00 19.42 ? 206 VAL B CG2 1 
ATOM   5529 N  N   . PRO B 1 206 ? 58.868  17.436  -18.612 1.00 20.65 ? 207 PRO B N   1 
ATOM   5530 C  CA  . PRO B 1 206 ? 59.137  18.885  -18.677 1.00 21.33 ? 207 PRO B CA  1 
ATOM   5531 C  C   . PRO B 1 206 ? 60.607  19.245  -18.939 1.00 22.33 ? 207 PRO B C   1 
ATOM   5532 O  O   . PRO B 1 206 ? 60.917  20.423  -19.168 1.00 23.09 ? 207 PRO B O   1 
ATOM   5533 C  CB  . PRO B 1 206 ? 58.732  19.395  -17.284 1.00 20.89 ? 207 PRO B CB  1 
ATOM   5534 C  CG  . PRO B 1 206 ? 57.838  18.320  -16.696 1.00 21.22 ? 207 PRO B CG  1 
ATOM   5535 C  CD  . PRO B 1 206 ? 58.390  17.019  -17.276 1.00 19.84 ? 207 PRO B CD  1 
ATOM   5536 N  N   . MET B 1 207 ? 61.501  18.265  -18.916 1.00 22.68 ? 208 MET B N   1 
ATOM   5537 C  CA  . MET B 1 207 ? 62.923  18.554  -19.100 1.00 24.44 ? 208 MET B CA  1 
ATOM   5538 C  C   . MET B 1 207 ? 63.483  18.157  -20.474 1.00 25.12 ? 208 MET B C   1 
ATOM   5539 O  O   . MET B 1 207 ? 64.675  18.360  -20.745 1.00 25.83 ? 208 MET B O   1 
ATOM   5540 C  CB  . MET B 1 207 ? 63.756  17.903  -17.984 1.00 23.44 ? 208 MET B CB  1 
ATOM   5541 C  CG  . MET B 1 207 ? 63.401  18.394  -16.553 1.00 24.42 ? 208 MET B CG  1 
ATOM   5542 S  SD  . MET B 1 207 ? 64.508  17.624  -15.357 1.00 23.08 ? 208 MET B SD  1 
ATOM   5543 C  CE  . MET B 1 207 ? 63.740  16.018  -15.167 1.00 22.05 ? 208 MET B CE  1 
ATOM   5544 N  N   . LEU B 1 208 ? 62.615  17.643  -21.338 1.00 25.79 ? 209 LEU B N   1 
ATOM   5545 C  CA  . LEU B 1 208 ? 63.012  16.861  -22.523 1.00 27.50 ? 209 LEU B CA  1 
ATOM   5546 C  C   . LEU B 1 208 ? 63.867  17.496  -23.637 1.00 27.89 ? 209 LEU B C   1 
ATOM   5547 O  O   . LEU B 1 208 ? 64.867  16.879  -24.120 1.00 29.22 ? 209 LEU B O   1 
ATOM   5548 C  CB  . LEU B 1 208 ? 61.765  16.229  -23.137 1.00 27.57 ? 209 LEU B CB  1 
ATOM   5549 C  CG  . LEU B 1 208 ? 61.972  14.934  -23.914 1.00 30.52 ? 209 LEU B CG  1 
ATOM   5550 C  CD1 . LEU B 1 208 ? 62.944  13.971  -23.194 1.00 31.19 ? 209 LEU B CD1 1 
ATOM   5551 C  CD2 . LEU B 1 208 ? 60.614  14.285  -24.112 1.00 28.09 ? 209 LEU B CD2 1 
ATOM   5552 N  N   . ASN B 1 209 ? 63.478  18.687  -24.071 1.00 26.85 ? 210 ASN B N   1 
ATOM   5553 C  CA  . ASN B 1 209 ? 64.174  19.353  -25.175 1.00 26.51 ? 210 ASN B CA  1 
ATOM   5554 C  C   . ASN B 1 209 ? 65.104  20.468  -24.677 1.00 26.37 ? 210 ASN B C   1 
ATOM   5555 O  O   . ASN B 1 209 ? 65.350  21.445  -25.382 1.00 26.89 ? 210 ASN B O   1 
ATOM   5556 C  CB  . ASN B 1 209 ? 63.143  19.929  -26.147 1.00 25.74 ? 210 ASN B CB  1 
ATOM   5557 C  CG  . ASN B 1 209 ? 62.313  18.853  -26.795 1.00 27.55 ? 210 ASN B CG  1 
ATOM   5558 O  OD1 . ASN B 1 209 ? 62.744  18.209  -27.765 1.00 27.74 ? 210 ASN B OD1 1 
ATOM   5559 N  ND2 . ASN B 1 209 ? 61.137  18.616  -26.247 1.00 23.62 ? 210 ASN B ND2 1 
ATOM   5560 N  N   . LEU B 1 210 ? 65.619  20.304  -23.462 1.00 25.84 ? 211 LEU B N   1 
ATOM   5561 C  CA  . LEU B 1 210 ? 66.432  21.328  -22.814 1.00 25.71 ? 211 LEU B CA  1 
ATOM   5562 C  C   . LEU B 1 210 ? 67.788  20.772  -22.439 1.00 25.50 ? 211 LEU B C   1 
ATOM   5563 O  O   . LEU B 1 210 ? 67.877  19.631  -22.004 1.00 25.64 ? 211 LEU B O   1 
ATOM   5564 C  CB  . LEU B 1 210 ? 65.742  21.823  -21.531 1.00 25.58 ? 211 LEU B CB  1 
ATOM   5565 C  CG  . LEU B 1 210 ? 64.315  22.353  -21.647 1.00 24.52 ? 211 LEU B CG  1 
ATOM   5566 C  CD1 . LEU B 1 210 ? 63.719  22.629  -20.274 1.00 23.60 ? 211 LEU B CD1 1 
ATOM   5567 C  CD2 . LEU B 1 210 ? 64.307  23.605  -22.526 1.00 25.51 ? 211 LEU B CD2 1 
ATOM   5568 N  N   . PRO B 1 211 ? 68.848  21.584  -22.573 1.00 25.69 ? 212 PRO B N   1 
ATOM   5569 C  CA  . PRO B 1 211 ? 70.153  21.142  -22.066 1.00 26.13 ? 212 PRO B CA  1 
ATOM   5570 C  C   . PRO B 1 211 ? 70.168  21.083  -20.532 1.00 26.20 ? 212 PRO B C   1 
ATOM   5571 O  O   . PRO B 1 211 ? 69.364  21.767  -19.883 1.00 25.68 ? 212 PRO B O   1 
ATOM   5572 C  CB  . PRO B 1 211 ? 71.123  22.205  -22.605 1.00 26.30 ? 212 PRO B CB  1 
ATOM   5573 C  CG  . PRO B 1 211 ? 70.304  23.430  -22.762 1.00 26.26 ? 212 PRO B CG  1 
ATOM   5574 C  CD  . PRO B 1 211 ? 68.898  22.954  -23.122 1.00 25.86 ? 212 PRO B CD  1 
ATOM   5575 N  N   . PRO B 1 212 ? 71.047  20.245  -19.952 1.00 27.01 ? 213 PRO B N   1 
ATOM   5576 C  CA  . PRO B 1 212 ? 71.084  20.122  -18.501 1.00 27.71 ? 213 PRO B CA  1 
ATOM   5577 C  C   . PRO B 1 212 ? 71.293  21.450  -17.758 1.00 28.55 ? 213 PRO B C   1 
ATOM   5578 O  O   . PRO B 1 212 ? 70.797  21.586  -16.654 1.00 28.84 ? 213 PRO B O   1 
ATOM   5579 C  CB  . PRO B 1 212 ? 72.245  19.136  -18.243 1.00 28.03 ? 213 PRO B CB  1 
ATOM   5580 C  CG  . PRO B 1 212 ? 72.906  18.917  -19.564 1.00 27.75 ? 213 PRO B CG  1 
ATOM   5581 C  CD  . PRO B 1 212 ? 71.899  19.235  -20.608 1.00 26.72 ? 213 PRO B CD  1 
ATOM   5582 N  N   . ASP B 1 213 ? 71.981  22.422  -18.358 1.00 29.10 ? 214 ASP B N   1 
ATOM   5583 C  CA  . ASP B 1 213 ? 72.142  23.750  -17.730 1.00 30.14 ? 214 ASP B CA  1 
ATOM   5584 C  C   . ASP B 1 213 ? 70.828  24.511  -17.517 1.00 30.38 ? 214 ASP B C   1 
ATOM   5585 O  O   . ASP B 1 213 ? 70.721  25.308  -16.570 1.00 30.06 ? 214 ASP B O   1 
ATOM   5586 C  CB  . ASP B 1 213 ? 73.080  24.657  -18.541 1.00 30.28 ? 214 ASP B CB  1 
ATOM   5587 C  CG  . ASP B 1 213 ? 74.555  24.310  -18.364 1.00 32.45 ? 214 ASP B CG  1 
ATOM   5588 O  OD1 . ASP B 1 213 ? 74.940  23.695  -17.338 1.00 34.11 ? 214 ASP B OD1 1 
ATOM   5589 O  OD2 . ASP B 1 213 ? 75.334  24.662  -19.278 1.00 36.27 ? 214 ASP B OD2 1 
ATOM   5590 N  N   . LEU B 1 214 ? 69.851  24.303  -18.404 1.00 30.11 ? 215 LEU B N   1 
ATOM   5591 C  CA  . LEU B 1 214 ? 68.581  25.038  -18.312 1.00 30.30 ? 215 LEU B CA  1 
ATOM   5592 C  C   . LEU B 1 214 ? 67.533  24.346  -17.458 1.00 30.66 ? 215 LEU B C   1 
ATOM   5593 O  O   . LEU B 1 214 ? 66.812  25.007  -16.692 1.00 30.28 ? 215 LEU B O   1 
ATOM   5594 C  CB  . LEU B 1 214 ? 68.012  25.375  -19.690 1.00 30.37 ? 215 LEU B CB  1 
ATOM   5595 C  CG  . LEU B 1 214 ? 68.848  26.264  -20.609 1.00 31.84 ? 215 LEU B CG  1 
ATOM   5596 C  CD1 . LEU B 1 214 ? 68.006  26.656  -21.829 1.00 32.35 ? 215 LEU B CD1 1 
ATOM   5597 C  CD2 . LEU B 1 214 ? 69.407  27.522  -19.901 1.00 30.34 ? 215 LEU B CD2 1 
ATOM   5598 N  N   . PHE B 1 215 ? 67.438  23.016  -17.551 1.00 31.30 ? 216 PHE B N   1 
ATOM   5599 C  CA  . PHE B 1 215 ? 66.435  22.350  -16.717 1.00 30.97 ? 216 PHE B CA  1 
ATOM   5600 C  C   . PHE B 1 215 ? 66.708  22.454  -15.203 1.00 31.51 ? 216 PHE B C   1 
ATOM   5601 O  O   . PHE B 1 215 ? 65.789  22.568  -14.376 1.00 31.71 ? 216 PHE B O   1 
ATOM   5602 C  CB  . PHE B 1 215 ? 65.974  20.964  -17.251 1.00 30.41 ? 216 PHE B CB  1 
ATOM   5603 C  CG  . PHE B 1 215 ? 67.042  19.892  -17.354 1.00 27.99 ? 216 PHE B CG  1 
ATOM   5604 C  CD1 . PHE B 1 215 ? 67.674  19.382  -16.219 1.00 26.89 ? 216 PHE B CD1 1 
ATOM   5605 C  CD2 . PHE B 1 215 ? 67.306  19.293  -18.590 1.00 26.80 ? 216 PHE B CD2 1 
ATOM   5606 C  CE1 . PHE B 1 215 ? 68.610  18.331  -16.321 1.00 25.60 ? 216 PHE B CE1 1 
ATOM   5607 C  CE2 . PHE B 1 215 ? 68.213  18.240  -18.707 1.00 26.51 ? 216 PHE B CE2 1 
ATOM   5608 C  CZ  . PHE B 1 215 ? 68.882  17.764  -17.565 1.00 25.24 ? 216 PHE B CZ  1 
ATOM   5609 N  N   . ARG B 1 216 ? 67.975  22.544  -14.846 1.00 32.23 ? 217 ARG B N   1 
ATOM   5610 C  CA  . ARG B 1 216 ? 68.339  22.866  -13.456 1.00 32.24 ? 217 ARG B CA  1 
ATOM   5611 C  C   . ARG B 1 216 ? 67.831  24.244  -13.008 1.00 31.76 ? 217 ARG B C   1 
ATOM   5612 O  O   . ARG B 1 216 ? 67.551  24.461  -11.827 1.00 32.50 ? 217 ARG B O   1 
ATOM   5613 C  CB  . ARG B 1 216 ? 69.864  22.762  -13.273 1.00 32.86 ? 217 ARG B CB  1 
ATOM   5614 C  CG  . ARG B 1 216 ? 70.428  21.378  -13.586 1.00 35.78 ? 217 ARG B CG  1 
ATOM   5615 C  CD  . ARG B 1 216 ? 71.648  21.011  -12.716 1.00 41.36 ? 217 ARG B CD  1 
ATOM   5616 N  NE  . ARG B 1 216 ? 72.082  19.617  -12.899 1.00 43.65 ? 217 ARG B NE  1 
ATOM   5617 C  CZ  . ARG B 1 216 ? 73.046  19.218  -13.734 1.00 44.79 ? 217 ARG B CZ  1 
ATOM   5618 N  NH1 . ARG B 1 216 ? 73.698  20.090  -14.497 1.00 43.72 ? 217 ARG B NH1 1 
ATOM   5619 N  NH2 . ARG B 1 216 ? 73.357  17.931  -13.813 1.00 45.62 ? 217 ARG B NH2 1 
ATOM   5620 N  N   . LEU B 1 217 ? 67.705  25.167  -13.965 1.00 30.95 ? 218 LEU B N   1 
ATOM   5621 C  CA  . LEU B 1 217 ? 67.379  26.578  -13.722 1.00 29.48 ? 218 LEU B CA  1 
ATOM   5622 C  C   . LEU B 1 217 ? 65.886  26.901  -13.886 1.00 28.55 ? 218 LEU B C   1 
ATOM   5623 O  O   . LEU B 1 217 ? 65.344  27.775  -13.205 1.00 28.33 ? 218 LEU B O   1 
ATOM   5624 C  CB  . LEU B 1 217 ? 68.210  27.427  -14.706 1.00 29.40 ? 218 LEU B CB  1 
ATOM   5625 C  CG  . LEU B 1 217 ? 68.476  28.908  -14.467 1.00 29.53 ? 218 LEU B CG  1 
ATOM   5626 C  CD1 . LEU B 1 217 ? 69.028  29.159  -13.072 1.00 26.58 ? 218 LEU B CD1 1 
ATOM   5627 C  CD2 . LEU B 1 217 ? 69.427  29.426  -15.536 1.00 29.48 ? 218 LEU B CD2 1 
ATOM   5628 N  N   . PHE B 1 218 ? 65.212  26.195  -14.793 1.00 26.86 ? 219 PHE B N   1 
ATOM   5629 C  CA  . PHE B 1 218 ? 63.810  26.489  -15.092 1.00 25.64 ? 219 PHE B CA  1 
ATOM   5630 C  C   . PHE B 1 218 ? 62.840  25.352  -14.755 1.00 25.13 ? 219 PHE B C   1 
ATOM   5631 O  O   . PHE B 1 218 ? 61.622  25.489  -14.895 1.00 25.13 ? 219 PHE B O   1 
ATOM   5632 C  CB  . PHE B 1 218 ? 63.679  26.888  -16.563 1.00 25.31 ? 219 PHE B CB  1 
ATOM   5633 C  CG  . PHE B 1 218 ? 64.325  28.196  -16.892 1.00 25.14 ? 219 PHE B CG  1 
ATOM   5634 C  CD1 . PHE B 1 218 ? 65.401  28.252  -17.776 1.00 26.25 ? 219 PHE B CD1 1 
ATOM   5635 C  CD2 . PHE B 1 218 ? 63.859  29.379  -16.314 1.00 24.94 ? 219 PHE B CD2 1 
ATOM   5636 C  CE1 . PHE B 1 218 ? 66.001  29.469  -18.089 1.00 26.40 ? 219 PHE B CE1 1 
ATOM   5637 C  CE2 . PHE B 1 218 ? 64.448  30.597  -16.613 1.00 25.26 ? 219 PHE B CE2 1 
ATOM   5638 C  CZ  . PHE B 1 218 ? 65.526  30.643  -17.504 1.00 26.04 ? 219 PHE B CZ  1 
ATOM   5639 N  N   . ARG B 1 219 ? 63.384  24.224  -14.320 1.00 24.66 ? 220 ARG B N   1 
ATOM   5640 C  CA  . ARG B 1 219 ? 62.590  23.044  -14.001 1.00 24.21 ? 220 ARG B CA  1 
ATOM   5641 C  C   . ARG B 1 219 ? 63.135  22.449  -12.708 1.00 24.55 ? 220 ARG B C   1 
ATOM   5642 O  O   . ARG B 1 219 ? 63.208  21.232  -12.550 1.00 23.81 ? 220 ARG B O   1 
ATOM   5643 C  CB  . ARG B 1 219 ? 62.680  22.025  -15.151 1.00 24.20 ? 220 ARG B CB  1 
ATOM   5644 C  CG  . ARG B 1 219 ? 62.154  22.527  -16.510 1.00 23.99 ? 220 ARG B CG  1 
ATOM   5645 C  CD  . ARG B 1 219 ? 60.647  22.481  -16.497 1.00 24.64 ? 220 ARG B CD  1 
ATOM   5646 N  NE  . ARG B 1 219 ? 60.024  22.895  -17.752 1.00 25.28 ? 220 ARG B NE  1 
ATOM   5647 C  CZ  . ARG B 1 219 ? 59.590  24.125  -18.004 1.00 26.40 ? 220 ARG B CZ  1 
ATOM   5648 N  NH1 . ARG B 1 219 ? 59.745  25.100  -17.106 1.00 25.20 ? 220 ARG B NH1 1 
ATOM   5649 N  NH2 . ARG B 1 219 ? 59.001  24.388  -19.157 1.00 25.71 ? 220 ARG B NH2 1 
ATOM   5650 N  N   . THR B 1 220 ? 63.516  23.329  -11.783 1.00 25.02 ? 221 THR B N   1 
ATOM   5651 C  CA  . THR B 1 220 ? 64.204  22.948  -10.547 1.00 25.91 ? 221 THR B CA  1 
ATOM   5652 C  C   . THR B 1 220 ? 63.372  21.973  -9.717  1.00 25.24 ? 221 THR B C   1 
ATOM   5653 O  O   . THR B 1 220 ? 63.904  21.007  -9.166  1.00 25.37 ? 221 THR B O   1 
ATOM   5654 C  CB  . THR B 1 220 ? 64.523  24.188  -9.654  1.00 26.38 ? 221 THR B CB  1 
ATOM   5655 O  OG1 . THR B 1 220 ? 64.966  25.273  -10.478 1.00 28.23 ? 221 THR B OG1 1 
ATOM   5656 C  CG2 . THR B 1 220 ? 65.625  23.854  -8.642  1.00 26.97 ? 221 THR B CG2 1 
ATOM   5657 N  N   . LYS B 1 221 ? 62.076  22.240  -9.625  1.00 25.05 ? 222 LYS B N   1 
ATOM   5658 C  CA  . LYS B 1 221 ? 61.178  21.383  -8.872  1.00 25.67 ? 222 LYS B CA  1 
ATOM   5659 C  C   . LYS B 1 221 ? 61.046  20.012  -9.561  1.00 24.82 ? 222 LYS B C   1 
ATOM   5660 O  O   . LYS B 1 221 ? 61.109  18.970  -8.917  1.00 24.39 ? 222 LYS B O   1 
ATOM   5661 C  CB  . LYS B 1 221 ? 59.807  22.041  -8.715  1.00 26.33 ? 222 LYS B CB  1 
ATOM   5662 C  CG  . LYS B 1 221 ? 58.989  21.407  -7.595  1.00 30.17 ? 222 LYS B CG  1 
ATOM   5663 C  CD  . LYS B 1 221 ? 57.501  21.408  -7.891  1.00 35.20 ? 222 LYS B CD  1 
ATOM   5664 C  CE  . LYS B 1 221 ? 56.816  20.274  -7.118  1.00 37.88 ? 222 LYS B CE  1 
ATOM   5665 N  NZ  . LYS B 1 221 ? 55.370  20.162  -7.463  1.00 40.61 ? 222 LYS B NZ  1 
ATOM   5666 N  N   . THR B 1 222 ? 60.889  20.022  -10.880 1.00 24.29 ? 223 THR B N   1 
ATOM   5667 C  CA  . THR B 1 222 ? 60.756  18.763  -11.626 1.00 23.45 ? 223 THR B CA  1 
ATOM   5668 C  C   . THR B 1 222 ? 62.025  17.917  -11.508 1.00 23.14 ? 223 THR B C   1 
ATOM   5669 O  O   . THR B 1 222 ? 61.955  16.722  -11.255 1.00 22.49 ? 223 THR B O   1 
ATOM   5670 C  CB  . THR B 1 222 ? 60.369  19.026  -13.088 1.00 23.25 ? 223 THR B CB  1 
ATOM   5671 O  OG1 . THR B 1 222 ? 59.039  19.566  -13.116 1.00 22.89 ? 223 THR B OG1 1 
ATOM   5672 C  CG2 . THR B 1 222 ? 60.391  17.725  -13.900 1.00 22.77 ? 223 THR B CG2 1 
ATOM   5673 N  N   . TRP B 1 223 ? 63.177  18.569  -11.651 1.00 23.18 ? 224 TRP B N   1 
ATOM   5674 C  CA  . TRP B 1 223 ? 64.464  17.925  -11.519 1.00 23.39 ? 224 TRP B CA  1 
ATOM   5675 C  C   . TRP B 1 223 ? 64.615  17.247  -10.169 1.00 23.81 ? 224 TRP B C   1 
ATOM   5676 O  O   . TRP B 1 223 ? 65.057  16.094  -10.091 1.00 23.28 ? 224 TRP B O   1 
ATOM   5677 C  CB  . TRP B 1 223 ? 65.590  18.940  -11.731 1.00 23.44 ? 224 TRP B CB  1 
ATOM   5678 C  CG  . TRP B 1 223 ? 66.968  18.383  -11.465 1.00 23.21 ? 224 TRP B CG  1 
ATOM   5679 C  CD1 . TRP B 1 223 ? 67.826  18.777  -10.484 1.00 23.65 ? 224 TRP B CD1 1 
ATOM   5680 C  CD2 . TRP B 1 223 ? 67.632  17.329  -12.181 1.00 22.95 ? 224 TRP B CD2 1 
ATOM   5681 N  NE1 . TRP B 1 223 ? 68.985  18.040  -10.543 1.00 25.08 ? 224 TRP B NE1 1 
ATOM   5682 C  CE2 . TRP B 1 223 ? 68.892  17.141  -11.571 1.00 25.54 ? 224 TRP B CE2 1 
ATOM   5683 C  CE3 . TRP B 1 223 ? 67.281  16.521  -13.269 1.00 24.10 ? 224 TRP B CE3 1 
ATOM   5684 C  CZ2 . TRP B 1 223 ? 69.823  16.191  -12.032 1.00 26.33 ? 224 TRP B CZ2 1 
ATOM   5685 C  CZ3 . TRP B 1 223 ? 68.194  15.563  -13.722 1.00 24.26 ? 224 TRP B CZ3 1 
ATOM   5686 C  CH2 . TRP B 1 223 ? 69.452  15.410  -13.103 1.00 25.94 ? 224 TRP B CH2 1 
ATOM   5687 N  N   . LYS B 1 224 ? 64.252  17.977  -9.114  1.00 24.63 ? 225 LYS B N   1 
ATOM   5688 C  CA  . LYS B 1 224 ? 64.292  17.467  -7.749  1.00 25.30 ? 225 LYS B CA  1 
ATOM   5689 C  C   . LYS B 1 224 ? 63.449  16.189  -7.612  1.00 24.51 ? 225 LYS B C   1 
ATOM   5690 O  O   . LYS B 1 224 ? 63.924  15.200  -7.057  1.00 24.28 ? 225 LYS B O   1 
ATOM   5691 C  CB  . LYS B 1 224 ? 63.816  18.563  -6.780  1.00 25.93 ? 225 LYS B CB  1 
ATOM   5692 C  CG  . LYS B 1 224 ? 63.509  18.131  -5.346  1.00 29.73 ? 225 LYS B CG  1 
ATOM   5693 C  CD  . LYS B 1 224 ? 63.351  19.384  -4.458  1.00 35.29 ? 225 LYS B CD  1 
ATOM   5694 C  CE  . LYS B 1 224 ? 62.373  19.171  -3.303  1.00 38.47 ? 225 LYS B CE  1 
ATOM   5695 N  NZ  . LYS B 1 224 ? 63.052  18.716  -2.040  1.00 41.45 ? 225 LYS B NZ  1 
ATOM   5696 N  N   . ASP B 1 225 ? 62.212  16.222  -8.116  1.00 23.97 ? 226 ASP B N   1 
ATOM   5697 C  CA  . ASP B 1 225 ? 61.291  15.076  -8.046  1.00 23.41 ? 226 ASP B CA  1 
ATOM   5698 C  C   . ASP B 1 225 ? 61.829  13.900  -8.874  1.00 22.37 ? 226 ASP B C   1 
ATOM   5699 O  O   . ASP B 1 225 ? 61.672  12.729  -8.517  1.00 23.17 ? 226 ASP B O   1 
ATOM   5700 C  CB  . ASP B 1 225 ? 59.899  15.486  -8.557  1.00 23.73 ? 226 ASP B CB  1 
ATOM   5701 C  CG  . ASP B 1 225 ? 59.162  16.432  -7.596  1.00 26.11 ? 226 ASP B CG  1 
ATOM   5702 O  OD1 . ASP B 1 225 ? 59.607  16.602  -6.445  1.00 28.95 ? 226 ASP B OD1 1 
ATOM   5703 O  OD2 . ASP B 1 225 ? 58.125  17.004  -7.986  1.00 26.27 ? 226 ASP B OD2 1 
ATOM   5704 N  N   . HIS B 1 226 ? 62.459  14.229  -9.987  1.00 21.11 ? 227 HIS B N   1 
ATOM   5705 C  CA  . HIS B 1 226 ? 63.012  13.245  -10.895 1.00 20.74 ? 227 HIS B CA  1 
ATOM   5706 C  C   . HIS B 1 226 ? 64.191  12.491  -10.246 1.00 20.87 ? 227 HIS B C   1 
ATOM   5707 O  O   . HIS B 1 226 ? 64.239  11.245  -10.245 1.00 20.97 ? 227 HIS B O   1 
ATOM   5708 C  CB  . HIS B 1 226 ? 63.485  13.960  -12.154 1.00 20.15 ? 227 HIS B CB  1 
ATOM   5709 C  CG  . HIS B 1 226 ? 63.919  13.032  -13.233 1.00 17.91 ? 227 HIS B CG  1 
ATOM   5710 N  ND1 . HIS B 1 226 ? 63.026  12.262  -13.945 1.00 16.63 ? 227 HIS B ND1 1 
ATOM   5711 C  CD2 . HIS B 1 226 ? 65.142  12.758  -13.737 1.00 16.88 ? 227 HIS B CD2 1 
ATOM   5712 C  CE1 . HIS B 1 226 ? 63.686  11.541  -14.833 1.00 16.25 ? 227 HIS B CE1 1 
ATOM   5713 N  NE2 . HIS B 1 226 ? 64.967  11.828  -14.732 1.00 16.46 ? 227 HIS B NE2 1 
ATOM   5714 N  N   . VAL B 1 227 ? 65.127  13.259  -9.699  1.00 20.35 ? 228 VAL B N   1 
ATOM   5715 C  CA  . VAL B 1 227 ? 66.218  12.736  -8.889  1.00 20.25 ? 228 VAL B CA  1 
ATOM   5716 C  C   . VAL B 1 227 ? 65.675  11.839  -7.773  1.00 20.22 ? 228 VAL B C   1 
ATOM   5717 O  O   . VAL B 1 227 ? 66.190  10.764  -7.564  1.00 19.91 ? 228 VAL B O   1 
ATOM   5718 C  CB  . VAL B 1 227 ? 67.101  13.882  -8.311  1.00 20.83 ? 228 VAL B CB  1 
ATOM   5719 C  CG1 . VAL B 1 227 ? 68.093  13.369  -7.221  1.00 20.23 ? 228 VAL B CG1 1 
ATOM   5720 C  CG2 . VAL B 1 227 ? 67.856  14.568  -9.417  1.00 20.79 ? 228 VAL B CG2 1 
ATOM   5721 N  N   . ALA B 1 228 ? 64.617  12.260  -7.083  1.00 20.39 ? 229 ALA B N   1 
ATOM   5722 C  CA  . ALA B 1 228 ? 64.071  11.439  -6.004  1.00 20.32 ? 229 ALA B CA  1 
ATOM   5723 C  C   . ALA B 1 228 ? 63.498  10.117  -6.509  1.00 20.64 ? 229 ALA B C   1 
ATOM   5724 O  O   . ALA B 1 228 ? 63.625  9.105   -5.827  1.00 21.34 ? 229 ALA B O   1 
ATOM   5725 C  CB  . ALA B 1 228 ? 63.004  12.207  -5.192  1.00 20.59 ? 229 ALA B CB  1 
ATOM   5726 N  N   . ALA B 1 229 ? 62.862  10.126  -7.686  1.00 20.29 ? 230 ALA B N   1 
ATOM   5727 C  CA  . ALA B 1 229 ? 62.301  8.902   -8.262  1.00 19.61 ? 230 ALA B CA  1 
ATOM   5728 C  C   . ALA B 1 229 ? 63.423  7.931   -8.641  1.00 19.23 ? 230 ALA B C   1 
ATOM   5729 O  O   . ALA B 1 229 ? 63.381  6.759   -8.303  1.00 19.34 ? 230 ALA B O   1 
ATOM   5730 C  CB  . ALA B 1 229 ? 61.387  9.217   -9.463  1.00 18.50 ? 230 ALA B CB  1 
ATOM   5731 N  N   . TRP B 1 230 ? 64.442  8.421   -9.319  1.00 19.31 ? 231 TRP B N   1 
ATOM   5732 C  CA  . TRP B 1 230 ? 65.571  7.566   -9.665  1.00 20.21 ? 231 TRP B CA  1 
ATOM   5733 C  C   . TRP B 1 230 ? 66.300  7.020   -8.419  1.00 21.06 ? 231 TRP B C   1 
ATOM   5734 O  O   . TRP B 1 230 ? 66.801  5.891   -8.451  1.00 21.15 ? 231 TRP B O   1 
ATOM   5735 C  CB  . TRP B 1 230 ? 66.576  8.319   -10.515 1.00 19.90 ? 231 TRP B CB  1 
ATOM   5736 C  CG  . TRP B 1 230 ? 66.402  8.291   -12.005 1.00 18.54 ? 231 TRP B CG  1 
ATOM   5737 C  CD1 . TRP B 1 230 ? 66.215  9.381   -12.815 1.00 18.46 ? 231 TRP B CD1 1 
ATOM   5738 C  CD2 . TRP B 1 230 ? 66.493  7.159   -12.875 1.00 18.50 ? 231 TRP B CD2 1 
ATOM   5739 N  NE1 . TRP B 1 230 ? 66.150  8.993   -14.126 1.00 18.83 ? 231 TRP B NE1 1 
ATOM   5740 C  CE2 . TRP B 1 230 ? 66.321  7.638   -14.200 1.00 17.30 ? 231 TRP B CE2 1 
ATOM   5741 C  CE3 . TRP B 1 230 ? 66.684  5.778   -12.671 1.00 18.61 ? 231 TRP B CE3 1 
ATOM   5742 C  CZ2 . TRP B 1 230 ? 66.337  6.797   -15.312 1.00 18.03 ? 231 TRP B CZ2 1 
ATOM   5743 C  CZ3 . TRP B 1 230 ? 66.714  4.941   -13.779 1.00 18.28 ? 231 TRP B CZ3 1 
ATOM   5744 C  CH2 . TRP B 1 230 ? 66.537  5.450   -15.087 1.00 17.80 ? 231 TRP B CH2 1 
ATOM   5745 N  N   . ASP B 1 231 ? 66.357  7.815   -7.343  1.00 21.40 ? 232 ASP B N   1 
ATOM   5746 C  CA  . ASP B 1 231 ? 66.986  7.372   -6.092  1.00 22.79 ? 232 ASP B CA  1 
ATOM   5747 C  C   . ASP B 1 231 ? 66.248  6.174   -5.479  1.00 23.29 ? 232 ASP B C   1 
ATOM   5748 O  O   . ASP B 1 231 ? 66.897  5.263   -4.951  1.00 23.66 ? 232 ASP B O   1 
ATOM   5749 C  CB  . ASP B 1 231 ? 67.053  8.506   -5.069  1.00 23.00 ? 232 ASP B CB  1 
ATOM   5750 C  CG  . ASP B 1 231 ? 68.245  9.445   -5.279  1.00 25.92 ? 232 ASP B CG  1 
ATOM   5751 O  OD1 . ASP B 1 231 ? 69.187  9.138   -6.060  1.00 28.40 ? 232 ASP B OD1 1 
ATOM   5752 O  OD2 . ASP B 1 231 ? 68.236  10.514  -4.636  1.00 28.90 ? 232 ASP B OD2 1 
ATOM   5753 N  N   . VAL B 1 232 ? 64.909  6.176   -5.550  1.00 22.86 ? 233 VAL B N   1 
ATOM   5754 C  CA  . VAL B 1 232 ? 64.102  5.048   -5.082  1.00 23.11 ? 233 VAL B CA  1 
ATOM   5755 C  C   . VAL B 1 232 ? 64.410  3.797   -5.929  1.00 23.55 ? 233 VAL B C   1 
ATOM   5756 O  O   . VAL B 1 232 ? 64.591  2.707   -5.388  1.00 23.28 ? 233 VAL B O   1 
ATOM   5757 C  CB  . VAL B 1 232 ? 62.563  5.351   -5.102  1.00 23.20 ? 233 VAL B CB  1 
ATOM   5758 C  CG1 . VAL B 1 232 ? 61.766  4.160   -4.622  1.00 23.22 ? 233 VAL B CG1 1 
ATOM   5759 C  CG2 . VAL B 1 232 ? 62.211  6.571   -4.235  1.00 22.55 ? 233 VAL B CG2 1 
ATOM   5760 N  N   . ILE B 1 233 ? 64.467  3.986   -7.248  1.00 23.63 ? 234 ILE B N   1 
ATOM   5761 C  CA  . ILE B 1 233 ? 64.721  2.927   -8.222  1.00 23.85 ? 234 ILE B CA  1 
ATOM   5762 C  C   . ILE B 1 233 ? 66.055  2.237   -7.947  1.00 24.47 ? 234 ILE B C   1 
ATOM   5763 O  O   . ILE B 1 233 ? 66.124  1.010   -7.885  1.00 24.33 ? 234 ILE B O   1 
ATOM   5764 C  CB  . ILE B 1 233 ? 64.689  3.489   -9.700  1.00 23.48 ? 234 ILE B CB  1 
ATOM   5765 C  CG1 . ILE B 1 233 ? 63.243  3.820   -10.124 1.00 24.33 ? 234 ILE B CG1 1 
ATOM   5766 C  CG2 . ILE B 1 233 ? 65.340  2.503   -10.674 1.00 22.81 ? 234 ILE B CG2 1 
ATOM   5767 C  CD1 . ILE B 1 233 ? 63.126  4.627   -11.447 1.00 22.24 ? 234 ILE B CD1 1 
ATOM   5768 N  N   . PHE B 1 234 ? 67.110  3.038   -7.797  1.00 25.12 ? 235 PHE B N   1 
ATOM   5769 C  CA  . PHE B 1 234 ? 68.437  2.531   -7.446  1.00 25.96 ? 235 PHE B CA  1 
ATOM   5770 C  C   . PHE B 1 234 ? 68.563  1.899   -6.066  1.00 26.86 ? 235 PHE B C   1 
ATOM   5771 O  O   . PHE B 1 234 ? 69.108  0.801   -5.957  1.00 27.54 ? 235 PHE B O   1 
ATOM   5772 C  CB  . PHE B 1 234 ? 69.505  3.607   -7.658  1.00 26.42 ? 235 PHE B CB  1 
ATOM   5773 C  CG  . PHE B 1 234 ? 70.047  3.611   -9.048  1.00 26.33 ? 235 PHE B CG  1 
ATOM   5774 C  CD1 . PHE B 1 234 ? 69.504  4.441   -10.012 1.00 26.29 ? 235 PHE B CD1 1 
ATOM   5775 C  CD2 . PHE B 1 234 ? 71.056  2.731   -9.409  1.00 27.89 ? 235 PHE B CD2 1 
ATOM   5776 C  CE1 . PHE B 1 234 ? 69.982  4.421   -11.314 1.00 27.32 ? 235 PHE B CE1 1 
ATOM   5777 C  CE2 . PHE B 1 234 ? 71.535  2.697   -10.710 1.00 27.73 ? 235 PHE B CE2 1 
ATOM   5778 C  CZ  . PHE B 1 234 ? 70.995  3.548   -11.661 1.00 27.81 ? 235 PHE B CZ  1 
ATOM   5779 N  N   . SER B 1 235 ? 68.062  2.567   -5.025  1.00 27.52 ? 236 SER B N   1 
ATOM   5780 C  CA  . SER B 1 235 ? 68.083  1.994   -3.679  1.00 28.60 ? 236 SER B CA  1 
ATOM   5781 C  C   . SER B 1 235 ? 67.518  0.583   -3.677  1.00 28.34 ? 236 SER B C   1 
ATOM   5782 O  O   . SER B 1 235 ? 68.187  -0.345  -3.227  1.00 27.89 ? 236 SER B O   1 
ATOM   5783 C  CB  . SER B 1 235 ? 67.264  2.819   -2.681  1.00 28.00 ? 236 SER B CB  1 
ATOM   5784 O  OG  . SER B 1 235 ? 67.745  4.136   -2.586  1.00 32.81 ? 236 SER B OG  1 
ATOM   5785 N  N   . LYS B 1 236 ? 66.278  0.444   -4.159  1.00 27.96 ? 237 LYS B N   1 
ATOM   5786 C  CA  . LYS B 1 236 ? 65.566  -0.827  -4.087  1.00 28.51 ? 237 LYS B CA  1 
ATOM   5787 C  C   . LYS B 1 236 ? 66.210  -1.904  -4.941  1.00 28.45 ? 237 LYS B C   1 
ATOM   5788 O  O   . LYS B 1 236 ? 66.374  -3.035  -4.488  1.00 28.11 ? 237 LYS B O   1 
ATOM   5789 C  CB  . LYS B 1 236 ? 64.092  -0.666  -4.459  1.00 28.63 ? 237 LYS B CB  1 
ATOM   5790 C  CG  . LYS B 1 236 ? 63.185  -0.446  -3.260  1.00 30.98 ? 237 LYS B CG  1 
ATOM   5791 C  CD  . LYS B 1 236 ? 63.010  1.019   -2.933  1.00 33.41 ? 237 LYS B CD  1 
ATOM   5792 C  CE  . LYS B 1 236 ? 61.754  1.257   -2.111  1.00 34.02 ? 237 LYS B CE  1 
ATOM   5793 N  NZ  . LYS B 1 236 ? 62.009  1.069   -0.663  1.00 36.37 ? 237 LYS B NZ  1 
ATOM   5794 N  N   . ALA B 1 237 ? 66.578  -1.543  -6.169  1.00 28.47 ? 238 ALA B N   1 
ATOM   5795 C  CA  . ALA B 1 237 ? 67.205  -2.473  -7.098  1.00 29.00 ? 238 ALA B CA  1 
ATOM   5796 C  C   . ALA B 1 237 ? 68.506  -3.018  -6.509  1.00 29.65 ? 238 ALA B C   1 
ATOM   5797 O  O   . ALA B 1 237 ? 68.797  -4.205  -6.610  1.00 29.43 ? 238 ALA B O   1 
ATOM   5798 C  CB  . ALA B 1 237 ? 67.493  -1.786  -8.401  1.00 28.79 ? 238 ALA B CB  1 
ATOM   5799 N  N   . ASP B 1 238 ? 69.289  -2.137  -5.905  1.00 29.89 ? 239 ASP B N   1 
ATOM   5800 C  CA  . ASP B 1 238 ? 70.583  -2.527  -5.377  1.00 31.03 ? 239 ASP B CA  1 
ATOM   5801 C  C   . ASP B 1 238 ? 70.422  -3.426  -4.135  1.00 30.57 ? 239 ASP B C   1 
ATOM   5802 O  O   . ASP B 1 238 ? 71.110  -4.426  -4.005  1.00 30.18 ? 239 ASP B O   1 
ATOM   5803 C  CB  . ASP B 1 238 ? 71.448  -1.287  -5.135  1.00 31.36 ? 239 ASP B CB  1 
ATOM   5804 C  CG  . ASP B 1 238 ? 71.900  -0.615  -6.454  1.00 35.03 ? 239 ASP B CG  1 
ATOM   5805 O  OD1 . ASP B 1 238 ? 71.422  -0.993  -7.565  1.00 38.82 ? 239 ASP B OD1 1 
ATOM   5806 O  OD2 . ASP B 1 238 ? 72.747  0.297   -6.388  1.00 37.99 ? 239 ASP B OD2 1 
ATOM   5807 N  N   . ILE B 1 239 ? 69.475  -3.094  -3.269  1.00 30.52 ? 240 ILE B N   1 
ATOM   5808 C  CA  . ILE B 1 239 ? 69.104  -3.977  -2.159  1.00 30.96 ? 240 ILE B CA  1 
ATOM   5809 C  C   . ILE B 1 239 ? 68.748  -5.394  -2.647  1.00 31.08 ? 240 ILE B C   1 
ATOM   5810 O  O   . ILE B 1 239 ? 69.277  -6.379  -2.121  1.00 30.94 ? 240 ILE B O   1 
ATOM   5811 C  CB  . ILE B 1 239 ? 67.972  -3.353  -1.303  1.00 31.18 ? 240 ILE B CB  1 
ATOM   5812 C  CG1 . ILE B 1 239 ? 68.528  -2.179  -0.489  1.00 31.24 ? 240 ILE B CG1 1 
ATOM   5813 C  CG2 . ILE B 1 239 ? 67.292  -4.404  -0.396  1.00 31.79 ? 240 ILE B CG2 1 
ATOM   5814 C  CD1 . ILE B 1 239 ? 67.467  -1.153  -0.045  1.00 32.29 ? 240 ILE B CD1 1 
ATOM   5815 N  N   . TYR B 1 240 ? 67.874  -5.494  -3.652  1.00 30.85 ? 241 TYR B N   1 
ATOM   5816 C  CA  . TYR B 1 240 ? 67.491  -6.786  -4.223  1.00 30.82 ? 241 TYR B CA  1 
ATOM   5817 C  C   . TYR B 1 240 ? 68.687  -7.601  -4.716  1.00 30.28 ? 241 TYR B C   1 
ATOM   5818 O  O   . TYR B 1 240 ? 68.790  -8.790  -4.416  1.00 29.38 ? 241 TYR B O   1 
ATOM   5819 C  CB  . TYR B 1 240 ? 66.511  -6.629  -5.389  1.00 31.30 ? 241 TYR B CB  1 
ATOM   5820 C  CG  . TYR B 1 240 ? 65.120  -6.170  -5.027  1.00 34.07 ? 241 TYR B CG  1 
ATOM   5821 C  CD1 . TYR B 1 240 ? 64.458  -5.234  -5.825  1.00 36.11 ? 241 TYR B CD1 1 
ATOM   5822 C  CD2 . TYR B 1 240 ? 64.459  -6.669  -3.899  1.00 36.79 ? 241 TYR B CD2 1 
ATOM   5823 C  CE1 . TYR B 1 240 ? 63.178  -4.792  -5.508  1.00 38.17 ? 241 TYR B CE1 1 
ATOM   5824 C  CE2 . TYR B 1 240 ? 63.169  -6.231  -3.572  1.00 39.32 ? 241 TYR B CE2 1 
ATOM   5825 C  CZ  . TYR B 1 240 ? 62.540  -5.294  -4.387  1.00 39.32 ? 241 TYR B CZ  1 
ATOM   5826 O  OH  . TYR B 1 240 ? 61.274  -4.862  -4.091  1.00 40.67 ? 241 TYR B OH  1 
ATOM   5827 N  N   . THR B 1 241 ? 69.571  -6.960  -5.480  1.00 29.76 ? 242 THR B N   1 
ATOM   5828 C  CA  . THR B 1 241 ? 70.708  -7.647  -6.096  1.00 29.85 ? 242 THR B CA  1 
ATOM   5829 C  C   . THR B 1 241 ? 71.740  -8.096  -5.051  1.00 30.13 ? 242 THR B C   1 
ATOM   5830 O  O   . THR B 1 241 ? 72.214  -9.238  -5.104  1.00 29.54 ? 242 THR B O   1 
ATOM   5831 C  CB  . THR B 1 241 ? 71.383  -6.778  -7.178  1.00 29.62 ? 242 THR B CB  1 
ATOM   5832 O  OG1 . THR B 1 241 ? 70.394  -6.360  -8.130  1.00 30.44 ? 242 THR B OG1 1 
ATOM   5833 C  CG2 . THR B 1 241 ? 72.481  -7.558  -7.910  1.00 29.12 ? 242 THR B CG2 1 
ATOM   5834 N  N   . GLN B 1 242 ? 72.069  -7.194  -4.126  1.00 30.45 ? 243 GLN B N   1 
ATOM   5835 C  CA  . GLN B 1 242 ? 72.997  -7.467  -3.027  1.00 31.76 ? 243 GLN B CA  1 
ATOM   5836 C  C   . GLN B 1 242 ? 72.519  -8.620  -2.147  1.00 31.31 ? 243 GLN B C   1 
ATOM   5837 O  O   . GLN B 1 242 ? 73.283  -9.545  -1.898  1.00 31.04 ? 243 GLN B O   1 
ATOM   5838 C  CB  . GLN B 1 242 ? 73.192  -6.224  -2.159  1.00 32.16 ? 243 GLN B CB  1 
ATOM   5839 C  CG  . GLN B 1 242 ? 74.072  -5.146  -2.792  1.00 36.69 ? 243 GLN B CG  1 
ATOM   5840 C  CD  . GLN B 1 242 ? 73.999  -3.824  -2.047  1.00 41.00 ? 243 GLN B CD  1 
ATOM   5841 O  OE1 . GLN B 1 242 ? 73.776  -3.796  -0.833  1.00 43.48 ? 243 GLN B OE1 1 
ATOM   5842 N  NE2 . GLN B 1 242 ? 74.190  -2.720  -2.769  1.00 42.89 ? 243 GLN B NE2 1 
ATOM   5843 N  N   . ASN B 1 243 ? 71.270  -8.539  -1.681  1.00 31.06 ? 244 ASN B N   1 
ATOM   5844 C  CA  . ASN B 1 243 ? 70.602  -9.624  -0.943  1.00 31.15 ? 244 ASN B CA  1 
ATOM   5845 C  C   . ASN B 1 243 ? 70.656  -10.976 -1.656  1.00 30.70 ? 244 ASN B C   1 
ATOM   5846 O  O   . ASN B 1 243 ? 70.974  -12.000 -1.042  1.00 30.99 ? 244 ASN B O   1 
ATOM   5847 C  CB  . ASN B 1 243 ? 69.141  -9.273  -0.641  1.00 31.31 ? 244 ASN B CB  1 
ATOM   5848 C  CG  . ASN B 1 243 ? 68.997  -8.340  0.540   1.00 32.67 ? 244 ASN B CG  1 
ATOM   5849 O  OD1 . ASN B 1 243 ? 69.945  -8.115  1.285   1.00 34.66 ? 244 ASN B OD1 1 
ATOM   5850 N  ND2 . ASN B 1 243 ? 67.801  -7.798  0.724   1.00 33.27 ? 244 ASN B ND2 1 
ATOM   5851 N  N   . PHE B 1 244 ? 70.352  -10.980 -2.948  1.00 29.72 ? 245 PHE B N   1 
ATOM   5852 C  CA  . PHE B 1 244 ? 70.409  -12.205 -3.741  1.00 29.30 ? 245 PHE B CA  1 
ATOM   5853 C  C   . PHE B 1 244 ? 71.840  -12.775 -3.798  1.00 29.16 ? 245 PHE B C   1 
ATOM   5854 O  O   . PHE B 1 244 ? 72.049  -13.990 -3.665  1.00 28.39 ? 245 PHE B O   1 
ATOM   5855 C  CB  . PHE B 1 244 ? 69.894  -11.915 -5.145  1.00 28.85 ? 245 PHE B CB  1 
ATOM   5856 C  CG  . PHE B 1 244 ? 69.688  -13.130 -5.981  1.00 29.93 ? 245 PHE B CG  1 
ATOM   5857 C  CD1 . PHE B 1 244 ? 68.443  -13.738 -6.044  1.00 31.39 ? 245 PHE B CD1 1 
ATOM   5858 C  CD2 . PHE B 1 244 ? 70.729  -13.656 -6.731  1.00 31.07 ? 245 PHE B CD2 1 
ATOM   5859 C  CE1 . PHE B 1 244 ? 68.250  -14.864 -6.829  1.00 31.79 ? 245 PHE B CE1 1 
ATOM   5860 C  CE2 . PHE B 1 244 ? 70.537  -14.774 -7.520  1.00 31.55 ? 245 PHE B CE2 1 
ATOM   5861 C  CZ  . PHE B 1 244 ? 69.296  -15.376 -7.569  1.00 31.59 ? 245 PHE B CZ  1 
ATOM   5862 N  N   . TYR B 1 245 ? 72.814  -11.890 -4.004  1.00 28.99 ? 246 TYR B N   1 
ATOM   5863 C  CA  . TYR B 1 245 ? 74.243  -12.267 -4.034  1.00 29.63 ? 246 TYR B CA  1 
ATOM   5864 C  C   . TYR B 1 245 ? 74.639  -12.990 -2.753  1.00 29.49 ? 246 TYR B C   1 
ATOM   5865 O  O   . TYR B 1 245 ? 75.229  -14.063 -2.797  1.00 30.12 ? 246 TYR B O   1 
ATOM   5866 C  CB  . TYR B 1 245 ? 75.093  -11.005 -4.220  1.00 29.31 ? 246 TYR B CB  1 
ATOM   5867 C  CG  . TYR B 1 245 ? 76.606  -11.154 -4.236  1.00 29.63 ? 246 TYR B CG  1 
ATOM   5868 C  CD1 . TYR B 1 245 ? 77.298  -11.245 -5.446  1.00 29.80 ? 246 TYR B CD1 1 
ATOM   5869 C  CD2 . TYR B 1 245 ? 77.351  -11.120 -3.049  1.00 29.89 ? 246 TYR B CD2 1 
ATOM   5870 C  CE1 . TYR B 1 245 ? 78.690  -11.329 -5.485  1.00 30.85 ? 246 TYR B CE1 1 
ATOM   5871 C  CE2 . TYR B 1 245 ? 78.759  -11.200 -3.073  1.00 30.56 ? 246 TYR B CE2 1 
ATOM   5872 C  CZ  . TYR B 1 245 ? 79.414  -11.303 -4.299  1.00 32.17 ? 246 TYR B CZ  1 
ATOM   5873 O  OH  . TYR B 1 245 ? 80.798  -11.397 -4.353  1.00 36.13 ? 246 TYR B OH  1 
ATOM   5874 N  N   . TRP B 1 246 ? 74.290  -12.405 -1.615  1.00 30.08 ? 247 TRP B N   1 
ATOM   5875 C  CA  . TRP B 1 246 ? 74.650  -12.983 -0.333  1.00 31.58 ? 247 TRP B CA  1 
ATOM   5876 C  C   . TRP B 1 246 ? 73.892  -14.260 0.004   1.00 32.71 ? 247 TRP B C   1 
ATOM   5877 O  O   . TRP B 1 246 ? 74.485  -15.178 0.547   1.00 32.54 ? 247 TRP B O   1 
ATOM   5878 C  CB  . TRP B 1 246 ? 74.566  -11.941 0.781   1.00 31.00 ? 247 TRP B CB  1 
ATOM   5879 C  CG  . TRP B 1 246 ? 75.755  -11.047 0.720   1.00 31.40 ? 247 TRP B CG  1 
ATOM   5880 C  CD1 . TRP B 1 246 ? 75.779  -9.731  0.377   1.00 31.80 ? 247 TRP B CD1 1 
ATOM   5881 C  CD2 . TRP B 1 246 ? 77.122  -11.432 0.948   1.00 31.88 ? 247 TRP B CD2 1 
ATOM   5882 N  NE1 . TRP B 1 246 ? 77.078  -9.259  0.407   1.00 32.26 ? 247 TRP B NE1 1 
ATOM   5883 C  CE2 . TRP B 1 246 ? 77.918  -10.284 0.753   1.00 31.30 ? 247 TRP B CE2 1 
ATOM   5884 C  CE3 . TRP B 1 246 ? 77.746  -12.634 1.314   1.00 30.83 ? 247 TRP B CE3 1 
ATOM   5885 C  CZ2 . TRP B 1 246 ? 79.310  -10.300 0.915   1.00 32.33 ? 247 TRP B CZ2 1 
ATOM   5886 C  CZ3 . TRP B 1 246 ? 79.130  -12.651 1.472   1.00 32.11 ? 247 TRP B CZ3 1 
ATOM   5887 C  CH2 . TRP B 1 246 ? 79.896  -11.492 1.267   1.00 32.24 ? 247 TRP B CH2 1 
ATOM   5888 N  N   . GLU B 1 247 ? 72.602  -14.315 -0.345  1.00 34.16 ? 248 GLU B N   1 
ATOM   5889 C  CA  . GLU B 1 247 ? 71.787  -15.537 -0.204  1.00 35.92 ? 248 GLU B CA  1 
ATOM   5890 C  C   . GLU B 1 247 ? 72.302  -16.717 -1.014  1.00 36.51 ? 248 GLU B C   1 
ATOM   5891 O  O   . GLU B 1 247 ? 72.221  -17.852 -0.543  1.00 36.60 ? 248 GLU B O   1 
ATOM   5892 C  CB  . GLU B 1 247 ? 70.316  -15.275 -0.533  1.00 35.76 ? 248 GLU B CB  1 
ATOM   5893 C  CG  . GLU B 1 247 ? 69.531  -14.717 0.650   1.00 38.56 ? 248 GLU B CG  1 
ATOM   5894 C  CD  . GLU B 1 247 ? 68.251  -13.985 0.238   1.00 42.22 ? 248 GLU B CD  1 
ATOM   5895 O  OE1 . GLU B 1 247 ? 67.761  -14.208 -0.893  1.00 42.92 ? 248 GLU B OE1 1 
ATOM   5896 O  OE2 . GLU B 1 247 ? 67.740  -13.179 1.050   1.00 42.54 ? 248 GLU B OE2 1 
ATOM   5897 N  N   . LEU B 1 248 ? 72.838  -16.454 -2.209  1.00 37.29 ? 249 LEU B N   1 
ATOM   5898 C  CA  . LEU B 1 248 ? 73.493  -17.497 -3.003  1.00 38.51 ? 249 LEU B CA  1 
ATOM   5899 C  C   . LEU B 1 248 ? 74.622  -18.135 -2.210  1.00 39.40 ? 249 LEU B C   1 
ATOM   5900 O  O   . LEU B 1 248 ? 74.838  -19.342 -2.291  1.00 39.53 ? 249 LEU B O   1 
ATOM   5901 C  CB  . LEU B 1 248 ? 74.120  -16.932 -4.275  1.00 38.35 ? 249 LEU B CB  1 
ATOM   5902 C  CG  . LEU B 1 248 ? 73.336  -16.600 -5.532  1.00 39.59 ? 249 LEU B CG  1 
ATOM   5903 C  CD1 . LEU B 1 248 ? 74.308  -16.741 -6.686  1.00 39.68 ? 249 LEU B CD1 1 
ATOM   5904 C  CD2 . LEU B 1 248 ? 72.135  -17.532 -5.708  1.00 40.68 ? 249 LEU B CD2 1 
ATOM   5905 N  N   . ARG B 1 249 ? 75.355  -17.302 -1.475  1.00 40.02 ? 250 ARG B N   1 
ATOM   5906 C  CA  . ARG B 1 249 ? 76.489  -17.757 -0.685  1.00 41.02 ? 250 ARG B CA  1 
ATOM   5907 C  C   . ARG B 1 249 ? 76.037  -18.441 0.603   1.00 41.95 ? 250 ARG B C   1 
ATOM   5908 O  O   . ARG B 1 249 ? 76.665  -19.403 1.037   1.00 42.03 ? 250 ARG B O   1 
ATOM   5909 C  CB  . ARG B 1 249 ? 77.465  -16.602 -0.437  1.00 40.54 ? 250 ARG B CB  1 
ATOM   5910 C  CG  . ARG B 1 249 ? 78.326  -16.340 -1.645  1.00 39.83 ? 250 ARG B CG  1 
ATOM   5911 C  CD  . ARG B 1 249 ? 78.680  -14.882 -1.856  1.00 39.62 ? 250 ARG B CD  1 
ATOM   5912 N  NE  . ARG B 1 249 ? 79.467  -14.737 -3.087  1.00 40.13 ? 250 ARG B NE  1 
ATOM   5913 C  CZ  . ARG B 1 249 ? 78.956  -14.611 -4.319  1.00 40.90 ? 250 ARG B CZ  1 
ATOM   5914 N  NH1 . ARG B 1 249 ? 77.634  -14.581 -4.519  1.00 39.29 ? 250 ARG B NH1 1 
ATOM   5915 N  NH2 . ARG B 1 249 ? 79.774  -14.501 -5.365  1.00 39.68 ? 250 ARG B NH2 1 
ATOM   5916 N  N   . GLN B 1 250 ? 74.931  -17.970 1.177   1.00 43.26 ? 251 GLN B N   1 
ATOM   5917 C  CA  . GLN B 1 250 ? 74.349  -18.567 2.377   1.00 45.41 ? 251 GLN B CA  1 
ATOM   5918 C  C   . GLN B 1 250 ? 73.792  -19.973 2.107   1.00 46.89 ? 251 GLN B C   1 
ATOM   5919 O  O   . GLN B 1 250 ? 74.074  -20.912 2.849   1.00 47.03 ? 251 GLN B O   1 
ATOM   5920 C  CB  . GLN B 1 250 ? 73.245  -17.676 2.951   1.00 45.19 ? 251 GLN B CB  1 
ATOM   5921 C  CG  . GLN B 1 250 ? 73.714  -16.329 3.456   1.00 46.18 ? 251 GLN B CG  1 
ATOM   5922 C  CD  . GLN B 1 250 ? 72.566  -15.403 3.870   1.00 47.85 ? 251 GLN B CD  1 
ATOM   5923 O  OE1 . GLN B 1 250 ? 71.525  -15.853 4.362   1.00 49.48 ? 251 GLN B OE1 1 
ATOM   5924 N  NE2 . GLN B 1 250 ? 72.757  -14.104 3.676   1.00 47.04 ? 251 GLN B NE2 1 
ATOM   5925 N  N   . LYS B 1 251 ? 73.007  -20.103 1.040   1.00 48.79 ? 252 LYS B N   1 
ATOM   5926 C  CA  . LYS B 1 251 ? 72.416  -21.378 0.641   1.00 50.76 ? 252 LYS B CA  1 
ATOM   5927 C  C   . LYS B 1 251 ? 73.395  -22.158 -0.235  1.00 51.94 ? 252 LYS B C   1 
ATOM   5928 O  O   . LYS B 1 251 ? 73.196  -23.343 -0.495  1.00 52.11 ? 252 LYS B O   1 
ATOM   5929 C  CB  . LYS B 1 251 ? 71.083  -21.144 -0.077  1.00 50.85 ? 252 LYS B CB  1 
ATOM   5930 C  CG  . LYS B 1 251 ? 70.212  -20.110 0.634   1.00 51.71 ? 252 LYS B CG  1 
ATOM   5931 C  CD  . LYS B 1 251 ? 68.942  -19.783 -0.123  1.00 53.75 ? 252 LYS B CD  1 
ATOM   5932 C  CE  . LYS B 1 251 ? 67.724  -20.334 0.600   1.00 54.36 ? 252 LYS B CE  1 
ATOM   5933 N  NZ  . LYS B 1 251 ? 66.513  -19.498 0.342   1.00 55.53 ? 252 LYS B NZ  1 
ATOM   5934 N  N   . GLY B 1 252 ? 74.450  -21.467 -0.670  1.00 53.43 ? 253 GLY B N   1 
ATOM   5935 C  CA  . GLY B 1 252 ? 75.601  -22.035 -1.386  1.00 55.16 ? 253 GLY B CA  1 
ATOM   5936 C  C   . GLY B 1 252 ? 75.442  -23.420 -1.961  1.00 56.50 ? 253 GLY B C   1 
ATOM   5937 O  O   . GLY B 1 252 ? 76.125  -24.366 -1.547  1.00 56.76 ? 253 GLY B O   1 
ATOM   5938 N  N   . SER B 1 253 ? 74.529  -23.537 -2.918  1.00 57.61 ? 254 SER B N   1 
ATOM   5939 C  CA  . SER B 1 253 ? 74.285  -24.808 -3.584  1.00 58.50 ? 254 SER B CA  1 
ATOM   5940 C  C   . SER B 1 253 ? 74.352  -24.624 -5.092  1.00 58.92 ? 254 SER B C   1 
ATOM   5941 O  O   . SER B 1 253 ? 74.002  -23.559 -5.616  1.00 59.30 ? 254 SER B O   1 
ATOM   5942 C  CB  . SER B 1 253 ? 72.923  -25.373 -3.177  1.00 58.57 ? 254 SER B CB  1 
ATOM   5943 O  OG  . SER B 1 253 ? 72.852  -26.765 -3.436  1.00 58.89 ? 254 SER B OG  1 
ATOM   5944 N  N   . VAL B 1 254 ? 74.835  -25.652 -5.784  1.00 59.07 ? 255 VAL B N   1 
ATOM   5945 C  CA  . VAL B 1 254 ? 74.700  -25.698 -7.228  1.00 59.14 ? 255 VAL B CA  1 
ATOM   5946 C  C   . VAL B 1 254 ? 73.315  -26.288 -7.488  1.00 59.01 ? 255 VAL B C   1 
ATOM   5947 O  O   . VAL B 1 254 ? 73.017  -27.410 -7.069  1.00 59.09 ? 255 VAL B O   1 
ATOM   5948 C  CB  . VAL B 1 254 ? 75.818  -26.534 -7.915  1.00 59.37 ? 255 VAL B CB  1 
ATOM   5949 C  CG1 . VAL B 1 254 ? 75.673  -26.487 -9.446  1.00 59.08 ? 255 VAL B CG1 1 
ATOM   5950 C  CG2 . VAL B 1 254 ? 77.209  -26.040 -7.489  1.00 59.50 ? 255 VAL B CG2 1 
ATOM   5951 N  N   . HIS B 1 255 ? 72.465  -25.499 -8.143  1.00 58.57 ? 256 HIS B N   1 
ATOM   5952 C  CA  . HIS B 1 255 ? 71.111  -25.918 -8.467  1.00 57.95 ? 256 HIS B CA  1 
ATOM   5953 C  C   . HIS B 1 255 ? 71.037  -26.437 -9.894  1.00 57.32 ? 256 HIS B C   1 
ATOM   5954 O  O   . HIS B 1 255 ? 71.659  -25.879 -10.806 1.00 57.15 ? 256 HIS B O   1 
ATOM   5955 C  CB  . HIS B 1 255 ? 70.129  -24.764 -8.270  1.00 58.24 ? 256 HIS B CB  1 
ATOM   5956 C  CG  . HIS B 1 255 ? 70.016  -24.308 -6.849  1.00 59.31 ? 256 HIS B CG  1 
ATOM   5957 N  ND1 . HIS B 1 255 ? 69.124  -24.864 -5.959  1.00 60.41 ? 256 HIS B ND1 1 
ATOM   5958 C  CD2 . HIS B 1 255 ? 70.693  -23.357 -6.161  1.00 60.26 ? 256 HIS B CD2 1 
ATOM   5959 C  CE1 . HIS B 1 255 ? 69.253  -24.274 -4.783  1.00 60.85 ? 256 HIS B CE1 1 
ATOM   5960 N  NE2 . HIS B 1 255 ? 70.196  -23.353 -4.880  1.00 60.92 ? 256 HIS B NE2 1 
ATOM   5961 N  N   . HIS B 1 256 ? 70.278  -27.517 -10.065 1.00 56.37 ? 257 HIS B N   1 
ATOM   5962 C  CA  . HIS B 1 256 ? 70.016  -28.110 -11.372 1.00 55.52 ? 257 HIS B CA  1 
ATOM   5963 C  C   . HIS B 1 256 ? 68.755  -27.513 -11.999 1.00 54.46 ? 257 HIS B C   1 
ATOM   5964 O  O   . HIS B 1 256 ? 68.654  -27.407 -13.222 1.00 54.44 ? 257 HIS B O   1 
ATOM   5965 C  CB  . HIS B 1 256 ? 69.893  -29.630 -11.251 1.00 55.71 ? 257 HIS B CB  1 
ATOM   5966 C  CG  . HIS B 1 256 ? 71.136  -30.296 -10.740 1.00 56.74 ? 257 HIS B CG  1 
ATOM   5967 N  ND1 . HIS B 1 256 ? 71.979  -31.024 -11.552 1.00 57.84 ? 257 HIS B ND1 1 
ATOM   5968 C  CD2 . HIS B 1 256 ? 71.684  -30.334 -9.502  1.00 57.61 ? 257 HIS B CD2 1 
ATOM   5969 C  CE1 . HIS B 1 256 ? 72.988  -31.487 -10.837 1.00 58.23 ? 257 HIS B CE1 1 
ATOM   5970 N  NE2 . HIS B 1 256 ? 72.833  -31.083 -9.589  1.00 58.44 ? 257 HIS B NE2 1 
ATOM   5971 N  N   . ASP B 1 257 ? 67.800  -27.128 -11.153 1.00 53.15 ? 258 ASP B N   1 
ATOM   5972 C  CA  . ASP B 1 257 ? 66.603  -26.413 -11.594 1.00 51.94 ? 258 ASP B CA  1 
ATOM   5973 C  C   . ASP B 1 257 ? 66.965  -24.992 -12.029 1.00 50.64 ? 258 ASP B C   1 
ATOM   5974 O  O   . ASP B 1 257 ? 67.958  -24.422 -11.557 1.00 50.56 ? 258 ASP B O   1 
ATOM   5975 C  CB  . ASP B 1 257 ? 65.546  -26.372 -10.480 1.00 52.37 ? 258 ASP B CB  1 
ATOM   5976 C  CG  . ASP B 1 257 ? 66.067  -25.740 -9.183  1.00 53.23 ? 258 ASP B CG  1 
ATOM   5977 O  OD1 . ASP B 1 257 ? 67.224  -26.015 -8.799  1.00 54.76 ? 258 ASP B OD1 1 
ATOM   5978 O  OD2 . ASP B 1 257 ? 65.311  -24.983 -8.533  1.00 53.79 ? 258 ASP B OD2 1 
ATOM   5979 N  N   . TYR B 1 258 ? 66.167  -24.429 -12.935 1.00 48.79 ? 259 TYR B N   1 
ATOM   5980 C  CA  . TYR B 1 258 ? 66.360  -23.043 -13.359 1.00 46.95 ? 259 TYR B CA  1 
ATOM   5981 C  C   . TYR B 1 258 ? 66.043  -22.083 -12.210 1.00 45.59 ? 259 TYR B C   1 
ATOM   5982 O  O   . TYR B 1 258 ? 65.056  -22.263 -11.489 1.00 45.19 ? 259 TYR B O   1 
ATOM   5983 C  CB  . TYR B 1 258 ? 65.506  -22.727 -14.580 1.00 46.82 ? 259 TYR B CB  1 
ATOM   5984 C  CG  . TYR B 1 258 ? 65.744  -21.343 -15.126 1.00 46.76 ? 259 TYR B CG  1 
ATOM   5985 C  CD1 . TYR B 1 258 ? 66.905  -21.045 -15.851 1.00 46.10 ? 259 TYR B CD1 1 
ATOM   5986 C  CD2 . TYR B 1 258 ? 64.813  -20.323 -14.909 1.00 45.94 ? 259 TYR B CD2 1 
ATOM   5987 C  CE1 . TYR B 1 258 ? 67.123  -19.767 -16.355 1.00 45.82 ? 259 TYR B CE1 1 
ATOM   5988 C  CE2 . TYR B 1 258 ? 65.016  -19.051 -15.411 1.00 45.23 ? 259 TYR B CE2 1 
ATOM   5989 C  CZ  . TYR B 1 258 ? 66.171  -18.775 -16.126 1.00 45.21 ? 259 TYR B CZ  1 
ATOM   5990 O  OH  . TYR B 1 258 ? 66.367  -17.508 -16.611 1.00 43.31 ? 259 TYR B OH  1 
ATOM   5991 N  N   . ARG B 1 259 ? 66.893  -21.077 -12.032 1.00 44.05 ? 260 ARG B N   1 
ATOM   5992 C  CA  . ARG B 1 259 ? 66.786  -20.211 -10.863 1.00 42.76 ? 260 ARG B CA  1 
ATOM   5993 C  C   . ARG B 1 259 ? 66.620  -18.726 -11.193 1.00 41.05 ? 260 ARG B C   1 
ATOM   5994 O  O   . ARG B 1 259 ? 66.566  -17.894 -10.282 1.00 41.39 ? 260 ARG B O   1 
ATOM   5995 C  CB  . ARG B 1 259 ? 67.988  -20.417 -9.934  1.00 43.17 ? 260 ARG B CB  1 
ATOM   5996 C  CG  . ARG B 1 259 ? 68.190  -21.849 -9.455  1.00 45.02 ? 260 ARG B CG  1 
ATOM   5997 C  CD  . ARG B 1 259 ? 67.227  -22.216 -8.337  1.00 48.95 ? 260 ARG B CD  1 
ATOM   5998 N  NE  . ARG B 1 259 ? 67.665  -21.658 -7.062  1.00 52.42 ? 260 ARG B NE  1 
ATOM   5999 C  CZ  . ARG B 1 259 ? 67.100  -21.916 -5.884  1.00 54.67 ? 260 ARG B CZ  1 
ATOM   6000 N  NH1 . ARG B 1 259 ? 66.055  -22.734 -5.793  1.00 54.37 ? 260 ARG B NH1 1 
ATOM   6001 N  NH2 . ARG B 1 259 ? 67.590  -21.352 -4.786  1.00 55.51 ? 260 ARG B NH2 1 
ATOM   6002 N  N   . GLY B 1 260 ? 66.534  -18.396 -12.478 1.00 38.79 ? 261 GLY B N   1 
ATOM   6003 C  CA  . GLY B 1 260 ? 66.338  -17.015 -12.903 1.00 36.50 ? 261 GLY B CA  1 
ATOM   6004 C  C   . GLY B 1 260 ? 67.544  -16.404 -13.598 1.00 35.07 ? 261 GLY B C   1 
ATOM   6005 O  O   . GLY B 1 260 ? 68.643  -16.974 -13.571 1.00 34.73 ? 261 GLY B O   1 
ATOM   6006 N  N   . ILE B 1 261 ? 67.335  -15.238 -14.212 1.00 32.94 ? 262 ILE B N   1 
ATOM   6007 C  CA  . ILE B 1 261 ? 68.381  -14.532 -14.955 1.00 31.22 ? 262 ILE B CA  1 
ATOM   6008 C  C   . ILE B 1 261 ? 69.605  -14.149 -14.095 1.00 31.05 ? 262 ILE B C   1 
ATOM   6009 O  O   . ILE B 1 261 ? 70.738  -14.362 -14.513 1.00 31.01 ? 262 ILE B O   1 
ATOM   6010 C  CB  . ILE B 1 261 ? 67.832  -13.263 -15.657 1.00 30.91 ? 262 ILE B CB  1 
ATOM   6011 C  CG1 . ILE B 1 261 ? 66.723  -13.619 -16.658 1.00 29.74 ? 262 ILE B CG1 1 
ATOM   6012 C  CG2 . ILE B 1 261 ? 68.950  -12.502 -16.363 1.00 29.35 ? 262 ILE B CG2 1 
ATOM   6013 C  CD1 . ILE B 1 261 ? 65.892  -12.413 -17.105 1.00 29.71 ? 262 ILE B CD1 1 
ATOM   6014 N  N   . LEU B 1 262 ? 69.370  -13.570 -12.920 1.00 30.57 ? 263 LEU B N   1 
ATOM   6015 C  CA  . LEU B 1 262 ? 70.447  -13.108 -12.048 1.00 30.74 ? 263 LEU B CA  1 
ATOM   6016 C  C   . LEU B 1 262 ? 71.385  -14.244 -11.632 1.00 31.13 ? 263 LEU B C   1 
ATOM   6017 O  O   . LEU B 1 262 ? 72.608  -14.081 -11.632 1.00 31.19 ? 263 LEU B O   1 
ATOM   6018 C  CB  . LEU B 1 262 ? 69.890  -12.398 -10.801 1.00 29.99 ? 263 LEU B CB  1 
ATOM   6019 C  CG  . LEU B 1 262 ? 70.964  -11.721 -9.928  1.00 29.44 ? 263 LEU B CG  1 
ATOM   6020 C  CD1 . LEU B 1 262 ? 71.947  -10.903 -10.770 1.00 28.14 ? 263 LEU B CD1 1 
ATOM   6021 C  CD2 . LEU B 1 262 ? 70.368  -10.861 -8.831  1.00 27.90 ? 263 LEU B CD2 1 
ATOM   6022 N  N   . TYR B 1 263 ? 70.803  -15.384 -11.276 1.00 31.78 ? 264 TYR B N   1 
ATOM   6023 C  CA  . TYR B 1 263 ? 71.570  -16.578 -10.923 1.00 32.77 ? 264 TYR B CA  1 
ATOM   6024 C  C   . TYR B 1 263 ? 72.513  -16.976 -12.054 1.00 32.89 ? 264 TYR B C   1 
ATOM   6025 O  O   . TYR B 1 263 ? 73.667  -17.338 -11.806 1.00 32.51 ? 264 TYR B O   1 
ATOM   6026 C  CB  . TYR B 1 263 ? 70.618  -17.734 -10.596 1.00 33.05 ? 264 TYR B CB  1 
ATOM   6027 C  CG  . TYR B 1 263 ? 71.296  -18.984 -10.091 1.00 35.41 ? 264 TYR B CG  1 
ATOM   6028 C  CD1 . TYR B 1 263 ? 71.387  -19.240 -8.722  1.00 36.65 ? 264 TYR B CD1 1 
ATOM   6029 C  CD2 . TYR B 1 263 ? 71.832  -19.923 -10.979 1.00 36.08 ? 264 TYR B CD2 1 
ATOM   6030 C  CE1 . TYR B 1 263 ? 72.006  -20.389 -8.250  1.00 38.87 ? 264 TYR B CE1 1 
ATOM   6031 C  CE2 . TYR B 1 263 ? 72.457  -21.069 -10.515 1.00 37.61 ? 264 TYR B CE2 1 
ATOM   6032 C  CZ  . TYR B 1 263 ? 72.538  -21.298 -9.155  1.00 38.51 ? 264 TYR B CZ  1 
ATOM   6033 O  OH  . TYR B 1 263 ? 73.146  -22.442 -8.693  1.00 41.22 ? 264 TYR B OH  1 
ATOM   6034 N  N   . ARG B 1 264 ? 72.009  -16.909 -13.288 1.00 33.41 ? 265 ARG B N   1 
ATOM   6035 C  CA  . ARG B 1 264 ? 72.780  -17.262 -14.475 1.00 34.28 ? 265 ARG B CA  1 
ATOM   6036 C  C   . ARG B 1 264 ? 73.944  -16.299 -14.709 1.00 34.85 ? 265 ARG B C   1 
ATOM   6037 O  O   . ARG B 1 264 ? 75.052  -16.728 -15.036 1.00 34.97 ? 265 ARG B O   1 
ATOM   6038 C  CB  . ARG B 1 264 ? 71.878  -17.289 -15.709 1.00 34.71 ? 265 ARG B CB  1 
ATOM   6039 C  CG  . ARG B 1 264 ? 70.918  -18.474 -15.789 1.00 36.21 ? 265 ARG B CG  1 
ATOM   6040 C  CD  . ARG B 1 264 ? 71.645  -19.721 -16.255 1.00 39.04 ? 265 ARG B CD  1 
ATOM   6041 N  NE  . ARG B 1 264 ? 70.745  -20.831 -16.582 1.00 41.29 ? 265 ARG B NE  1 
ATOM   6042 C  CZ  . ARG B 1 264 ? 70.216  -21.055 -17.786 1.00 42.50 ? 265 ARG B CZ  1 
ATOM   6043 N  NH1 . ARG B 1 264 ? 70.463  -20.229 -18.804 1.00 41.61 ? 265 ARG B NH1 1 
ATOM   6044 N  NH2 . ARG B 1 264 ? 69.427  -22.111 -17.971 1.00 41.85 ? 265 ARG B NH2 1 
ATOM   6045 N  N   . LEU B 1 265 ? 73.690  -15.002 -14.534 1.00 35.18 ? 266 LEU B N   1 
ATOM   6046 C  CA  . LEU B 1 265 ? 74.715  -13.986 -14.762 1.00 35.30 ? 266 LEU B CA  1 
ATOM   6047 C  C   . LEU B 1 265 ? 75.791  -14.013 -13.678 1.00 35.93 ? 266 LEU B C   1 
ATOM   6048 O  O   . LEU B 1 265 ? 76.968  -13.865 -13.971 1.00 35.44 ? 266 LEU B O   1 
ATOM   6049 C  CB  . LEU B 1 265 ? 74.092  -12.589 -14.870 1.00 34.80 ? 266 LEU B CB  1 
ATOM   6050 C  CG  . LEU B 1 265 ? 73.213  -12.286 -16.085 1.00 33.74 ? 266 LEU B CG  1 
ATOM   6051 C  CD1 . LEU B 1 265 ? 72.546  -10.925 -15.909 1.00 33.36 ? 266 LEU B CD1 1 
ATOM   6052 C  CD2 . LEU B 1 265 ? 73.992  -12.341 -17.397 1.00 31.65 ? 266 LEU B CD2 1 
ATOM   6053 N  N   . LEU B 1 266 ? 75.381  -14.201 -12.427 1.00 36.71 ? 267 LEU B N   1 
ATOM   6054 C  CA  . LEU B 1 266 ? 76.339  -14.305 -11.335 1.00 38.20 ? 267 LEU B CA  1 
ATOM   6055 C  C   . LEU B 1 266 ? 77.030  -15.672 -11.328 1.00 39.71 ? 267 LEU B C   1 
ATOM   6056 O  O   . LEU B 1 266 ? 78.073  -15.834 -10.702 1.00 40.27 ? 267 LEU B O   1 
ATOM   6057 C  CB  . LEU B 1 266 ? 75.656  -14.076 -9.990  1.00 37.69 ? 267 LEU B CB  1 
ATOM   6058 C  CG  . LEU B 1 266 ? 75.134  -12.696 -9.611  1.00 36.31 ? 267 LEU B CG  1 
ATOM   6059 C  CD1 . LEU B 1 266 ? 74.237  -12.852 -8.395  1.00 34.66 ? 267 LEU B CD1 1 
ATOM   6060 C  CD2 . LEU B 1 266 ? 76.269  -11.705 -9.333  1.00 34.23 ? 267 LEU B CD2 1 
ATOM   6061 N  N   . GLY B 1 267 ? 76.438  -16.644 -12.021 1.00 41.04 ? 268 GLY B N   1 
ATOM   6062 C  CA  . GLY B 1 267 ? 76.974  -18.000 -12.078 1.00 42.76 ? 268 GLY B CA  1 
ATOM   6063 C  C   . GLY B 1 267 ? 78.064  -18.133 -13.115 1.00 43.98 ? 268 GLY B C   1 
ATOM   6064 O  O   . GLY B 1 267 ? 79.145  -18.656 -12.823 1.00 44.21 ? 268 GLY B O   1 
ATOM   6065 N  N   . ASP B 1 268 ? 77.777  -17.669 -14.329 1.00 44.88 ? 269 ASP B N   1 
ATOM   6066 C  CA  . ASP B 1 268 ? 78.744  -17.707 -15.424 1.00 46.27 ? 269 ASP B CA  1 
ATOM   6067 C  C   . ASP B 1 268 ? 78.454  -16.642 -16.484 1.00 46.36 ? 269 ASP B C   1 
ATOM   6068 O  O   . ASP B 1 268 ? 77.616  -16.835 -17.363 1.00 46.78 ? 269 ASP B O   1 
ATOM   6069 C  CB  . ASP B 1 268 ? 78.832  -19.114 -16.052 1.00 46.86 ? 269 ASP B CB  1 
ATOM   6070 C  CG  . ASP B 1 268 ? 77.500  -19.602 -16.623 1.00 48.85 ? 269 ASP B CG  1 
ATOM   6071 O  OD1 . ASP B 1 268 ? 76.437  -19.422 -15.968 1.00 49.71 ? 269 ASP B OD1 1 
ATOM   6072 O  OD2 . ASP B 1 268 ? 77.529  -20.180 -17.736 1.00 51.56 ? 269 ASP B OD2 1 
ATOM   6073 N  N   . SER B 1 269 ? 79.160  -15.520 -16.380 1.00 46.53 ? 270 SER B N   1 
ATOM   6074 C  CA  . SER B 1 269 ? 79.041  -14.407 -17.319 1.00 46.38 ? 270 SER B CA  1 
ATOM   6075 C  C   . SER B 1 269 ? 80.391  -13.705 -17.395 1.00 46.21 ? 270 SER B C   1 
ATOM   6076 O  O   . SER B 1 269 ? 81.173  -13.765 -16.452 1.00 46.21 ? 270 SER B O   1 
ATOM   6077 C  CB  . SER B 1 269 ? 77.975  -13.414 -16.834 1.00 46.23 ? 270 SER B CB  1 
ATOM   6078 O  OG  . SER B 1 269 ? 77.755  -12.367 -17.768 1.00 46.18 ? 270 SER B OG  1 
ATOM   6079 N  N   . LYS B 1 270 ? 80.660  -13.034 -18.508 1.00 45.90 ? 271 LYS B N   1 
ATOM   6080 C  CA  . LYS B 1 270 ? 81.861  -12.211 -18.619 1.00 45.48 ? 271 LYS B CA  1 
ATOM   6081 C  C   . LYS B 1 270 ? 81.673  -10.850 -17.935 1.00 45.01 ? 271 LYS B C   1 
ATOM   6082 O  O   . LYS B 1 270 ? 82.603  -10.041 -17.878 1.00 45.15 ? 271 LYS B O   1 
ATOM   6083 C  CB  . LYS B 1 270 ? 82.259  -12.038 -20.084 1.00 45.79 ? 271 LYS B CB  1 
ATOM   6084 C  CG  . LYS B 1 270 ? 82.684  -13.338 -20.759 1.00 46.96 ? 271 LYS B CG  1 
ATOM   6085 C  CD  . LYS B 1 270 ? 83.247  -13.083 -22.142 1.00 48.86 ? 271 LYS B CD  1 
ATOM   6086 C  CE  . LYS B 1 270 ? 83.580  -14.390 -22.836 1.00 49.77 ? 271 LYS B CE  1 
ATOM   6087 N  NZ  . LYS B 1 270 ? 84.105  -14.135 -24.201 1.00 51.27 ? 271 LYS B NZ  1 
ATOM   6088 N  N   . MET B 1 271 ? 80.470  -10.612 -17.410 1.00 44.00 ? 272 MET B N   1 
ATOM   6089 C  CA  . MET B 1 271 ? 80.123  -9.344  -16.774 1.00 43.14 ? 272 MET B CA  1 
ATOM   6090 C  C   . MET B 1 271 ? 80.597  -9.295  -15.334 1.00 42.09 ? 272 MET B C   1 
ATOM   6091 O  O   . MET B 1 271 ? 80.487  -10.282 -14.598 1.00 42.10 ? 272 MET B O   1 
ATOM   6092 C  CB  . MET B 1 271 ? 78.606  -9.145  -16.773 1.00 43.46 ? 272 MET B CB  1 
ATOM   6093 C  CG  . MET B 1 271 ? 78.024  -8.448  -17.980 1.00 45.48 ? 272 MET B CG  1 
ATOM   6094 S  SD  . MET B 1 271 ? 76.288  -8.026  -17.670 1.00 48.74 ? 272 MET B SD  1 
ATOM   6095 C  CE  . MET B 1 271 ? 75.975  -7.000  -19.073 1.00 48.39 ? 272 MET B CE  1 
ATOM   6096 N  N   . SER B 1 272 ? 81.098  -8.133  -14.927 1.00 40.50 ? 273 SER B N   1 
ATOM   6097 C  CA  . SER B 1 272 ? 81.423  -7.888  -13.527 1.00 39.34 ? 273 SER B CA  1 
ATOM   6098 C  C   . SER B 1 272 ? 80.142  -7.701  -12.714 1.00 38.24 ? 273 SER B C   1 
ATOM   6099 O  O   . SER B 1 272 ? 79.068  -7.428  -13.275 1.00 37.92 ? 273 SER B O   1 
ATOM   6100 C  CB  . SER B 1 272 ? 82.302  -6.644  -13.401 1.00 39.56 ? 273 SER B CB  1 
ATOM   6101 O  OG  . SER B 1 272 ? 81.629  -5.510  -13.915 1.00 39.31 ? 273 SER B OG  1 
ATOM   6102 N  N   . PHE B 1 273 ? 80.255  -7.831  -11.395 1.00 36.67 ? 274 PHE B N   1 
ATOM   6103 C  CA  . PHE B 1 273 ? 79.106  -7.629  -10.527 1.00 35.37 ? 274 PHE B CA  1 
ATOM   6104 C  C   . PHE B 1 273 ? 78.438  -6.260  -10.713 1.00 35.12 ? 274 PHE B C   1 
ATOM   6105 O  O   . PHE B 1 273 ? 77.206  -6.157  -10.663 1.00 34.07 ? 274 PHE B O   1 
ATOM   6106 C  CB  . PHE B 1 273 ? 79.460  -7.796  -9.060  1.00 34.68 ? 274 PHE B CB  1 
ATOM   6107 C  CG  . PHE B 1 273 ? 78.312  -7.489  -8.139  1.00 33.16 ? 274 PHE B CG  1 
ATOM   6108 C  CD1 . PHE B 1 273 ? 77.301  -8.426  -7.933  1.00 30.88 ? 274 PHE B CD1 1 
ATOM   6109 C  CD2 . PHE B 1 273 ? 78.215  -6.246  -7.515  1.00 30.72 ? 274 PHE B CD2 1 
ATOM   6110 C  CE1 . PHE B 1 273 ? 76.224  -8.141  -7.089  1.00 30.12 ? 274 PHE B CE1 1 
ATOM   6111 C  CE2 . PHE B 1 273 ? 77.147  -5.950  -6.681  1.00 30.13 ? 274 PHE B CE2 1 
ATOM   6112 C  CZ  . PHE B 1 273 ? 76.146  -6.902  -6.461  1.00 30.11 ? 274 PHE B CZ  1 
ATOM   6113 N  N   . GLU B 1 274 ? 79.248  -5.217  -10.903 1.00 34.69 ? 275 GLU B N   1 
ATOM   6114 C  CA  . GLU B 1 274 ? 78.705  -3.870  -10.982 1.00 34.89 ? 275 GLU B CA  1 
ATOM   6115 C  C   . GLU B 1 274 ? 77.952  -3.636  -12.292 1.00 33.93 ? 275 GLU B C   1 
ATOM   6116 O  O   . GLU B 1 274 ? 76.968  -2.898  -12.312 1.00 34.23 ? 275 GLU B O   1 
ATOM   6117 C  CB  . GLU B 1 274 ? 79.779  -2.803  -10.757 1.00 35.24 ? 275 GLU B CB  1 
ATOM   6118 C  CG  . GLU B 1 274 ? 79.192  -1.462  -10.273 1.00 38.09 ? 275 GLU B CG  1 
ATOM   6119 C  CD  . GLU B 1 274 ? 78.901  -1.397  -8.761  1.00 41.58 ? 275 GLU B CD  1 
ATOM   6120 O  OE1 . GLU B 1 274 ? 79.113  -2.396  -8.042  1.00 44.32 ? 275 GLU B OE1 1 
ATOM   6121 O  OE2 . GLU B 1 274 ? 78.462  -0.325  -8.281  1.00 44.00 ? 275 GLU B OE2 1 
ATOM   6122 N  N   . ASP B 1 275 ? 78.406  -4.268  -13.371 1.00 32.79 ? 276 ASP B N   1 
ATOM   6123 C  CA  . ASP B 1 275 ? 77.681  -4.213  -14.642 1.00 32.20 ? 276 ASP B CA  1 
ATOM   6124 C  C   . ASP B 1 275 ? 76.362  -4.986  -14.567 1.00 30.95 ? 276 ASP B C   1 
ATOM   6125 O  O   . ASP B 1 275 ? 75.336  -4.524  -15.060 1.00 30.76 ? 276 ASP B O   1 
ATOM   6126 C  CB  . ASP B 1 275 ? 78.556  -4.705  -15.806 1.00 32.74 ? 276 ASP B CB  1 
ATOM   6127 C  CG  . ASP B 1 275 ? 79.467  -3.599  -16.366 1.00 34.38 ? 276 ASP B CG  1 
ATOM   6128 O  OD1 . ASP B 1 275 ? 79.201  -2.411  -16.105 1.00 36.46 ? 276 ASP B OD1 1 
ATOM   6129 O  OD2 . ASP B 1 275 ? 80.445  -3.910  -17.078 1.00 36.20 ? 276 ASP B OD2 1 
ATOM   6130 N  N   . ILE B 1 276 ? 76.402  -6.153  -13.931 1.00 29.59 ? 277 ILE B N   1 
ATOM   6131 C  CA  . ILE B 1 276 ? 75.218  -6.954  -13.681 1.00 28.19 ? 277 ILE B CA  1 
ATOM   6132 C  C   . ILE B 1 276 ? 74.186  -6.172  -12.863 1.00 27.67 ? 277 ILE B C   1 
ATOM   6133 O  O   . ILE B 1 276 ? 73.017  -6.115  -13.239 1.00 27.13 ? 277 ILE B O   1 
ATOM   6134 C  CB  . ILE B 1 276 ? 75.575  -8.298  -12.994 1.00 28.44 ? 277 ILE B CB  1 
ATOM   6135 C  CG1 . ILE B 1 276 ? 76.375  -9.184  -13.964 1.00 28.48 ? 277 ILE B CG1 1 
ATOM   6136 C  CG2 . ILE B 1 276 ? 74.307  -9.032  -12.539 1.00 26.97 ? 277 ILE B CG2 1 
ATOM   6137 C  CD1 . ILE B 1 276 ? 76.942  -10.486 -13.345 1.00 29.05 ? 277 ILE B CD1 1 
ATOM   6138 N  N   . LYS B 1 277 ? 74.621  -5.565  -11.760 1.00 26.55 ? 278 LYS B N   1 
ATOM   6139 C  CA  . LYS B 1 277 ? 73.726  -4.792  -10.895 1.00 25.98 ? 278 LYS B CA  1 
ATOM   6140 C  C   . LYS B 1 277 ? 73.089  -3.586  -11.612 1.00 25.46 ? 278 LYS B C   1 
ATOM   6141 O  O   . LYS B 1 277 ? 71.891  -3.296  -11.438 1.00 24.91 ? 278 LYS B O   1 
ATOM   6142 C  CB  . LYS B 1 277 ? 74.485  -4.312  -9.670  1.00 26.08 ? 278 LYS B CB  1 
ATOM   6143 C  CG  . LYS B 1 277 ? 73.619  -3.618  -8.621  1.00 28.03 ? 278 LYS B CG  1 
ATOM   6144 C  CD  . LYS B 1 277 ? 74.387  -3.376  -7.333  1.00 30.97 ? 278 LYS B CD  1 
ATOM   6145 C  CE  . LYS B 1 277 ? 75.363  -2.233  -7.477  1.00 34.36 ? 278 LYS B CE  1 
ATOM   6146 N  NZ  . LYS B 1 277 ? 75.751  -1.711  -6.136  1.00 38.20 ? 278 LYS B NZ  1 
ATOM   6147 N  N   . ALA B 1 278 ? 73.904  -2.892  -12.402 1.00 24.96 ? 279 ALA B N   1 
ATOM   6148 C  CA  . ALA B 1 278 ? 73.451  -1.764  -13.208 1.00 24.76 ? 279 ALA B CA  1 
ATOM   6149 C  C   . ALA B 1 278 ? 72.381  -2.198  -14.200 1.00 24.65 ? 279 ALA B C   1 
ATOM   6150 O  O   . ALA B 1 278 ? 71.354  -1.520  -14.365 1.00 25.26 ? 279 ALA B O   1 
ATOM   6151 C  CB  . ALA B 1 278 ? 74.625  -1.133  -13.941 1.00 24.78 ? 279 ALA B CB  1 
ATOM   6152 N  N   . ASN B 1 279 ? 72.608  -3.340  -14.843 1.00 24.35 ? 280 ASN B N   1 
ATOM   6153 C  CA  . ASN B 1 279 ? 71.663  -3.855  -15.820 1.00 24.32 ? 280 ASN B CA  1 
ATOM   6154 C  C   . ASN B 1 279 ? 70.406  -4.460  -15.222 1.00 24.29 ? 280 ASN B C   1 
ATOM   6155 O  O   . ASN B 1 279 ? 69.319  -4.324  -15.804 1.00 24.27 ? 280 ASN B O   1 
ATOM   6156 C  CB  . ASN B 1 279 ? 72.347  -4.798  -16.797 1.00 24.42 ? 280 ASN B CB  1 
ATOM   6157 C  CG  . ASN B 1 279 ? 73.208  -4.055  -17.796 1.00 25.66 ? 280 ASN B CG  1 
ATOM   6158 O  OD1 . ASN B 1 279 ? 72.700  -3.334  -18.659 1.00 27.77 ? 280 ASN B OD1 1 
ATOM   6159 N  ND2 . ASN B 1 279 ? 74.512  -4.235  -17.696 1.00 26.40 ? 280 ASN B ND2 1 
ATOM   6160 N  N   . VAL B 1 280 ? 70.541  -5.118  -14.069 1.00 23.58 ? 281 VAL B N   1 
ATOM   6161 C  CA  . VAL B 1 280 ? 69.359  -5.566  -13.320 1.00 23.57 ? 281 VAL B CA  1 
ATOM   6162 C  C   . VAL B 1 280 ? 68.426  -4.393  -13.013 1.00 23.10 ? 281 VAL B C   1 
ATOM   6163 O  O   . VAL B 1 280 ? 67.210  -4.491  -13.203 1.00 22.94 ? 281 VAL B O   1 
ATOM   6164 C  CB  . VAL B 1 280 ? 69.720  -6.346  -12.035 1.00 23.32 ? 281 VAL B CB  1 
ATOM   6165 C  CG1 . VAL B 1 280 ? 68.515  -6.494  -11.132 1.00 23.93 ? 281 VAL B CG1 1 
ATOM   6166 C  CG2 . VAL B 1 280 ? 70.249  -7.734  -12.396 1.00 24.13 ? 281 VAL B CG2 1 
ATOM   6167 N  N   . THR B 1 281 ? 69.006  -3.274  -12.585 1.00 23.16 ? 282 THR B N   1 
ATOM   6168 C  CA  . THR B 1 281 ? 68.239  -2.070  -12.288 1.00 23.52 ? 282 THR B CA  1 
ATOM   6169 C  C   . THR B 1 281 ? 67.424  -1.613  -13.497 1.00 23.21 ? 282 THR B C   1 
ATOM   6170 O  O   . THR B 1 281 ? 66.232  -1.307  -13.362 1.00 22.82 ? 282 THR B O   1 
ATOM   6171 C  CB  . THR B 1 281 ? 69.170  -0.944  -11.798 1.00 24.19 ? 282 THR B CB  1 
ATOM   6172 O  OG1 . THR B 1 281 ? 69.795  -1.370  -10.589 1.00 26.49 ? 282 THR B OG1 1 
ATOM   6173 C  CG2 . THR B 1 281 ? 68.413  0.344   -11.528 1.00 23.39 ? 282 THR B CG2 1 
ATOM   6174 N  N   . GLU B 1 282 ? 68.067  -1.598  -14.665 1.00 23.22 ? 283 GLU B N   1 
ATOM   6175 C  CA  . GLU B 1 282 ? 67.440  -1.160  -15.917 1.00 24.04 ? 283 GLU B CA  1 
ATOM   6176 C  C   . GLU B 1 282 ? 66.345  -2.119  -16.393 1.00 24.08 ? 283 GLU B C   1 
ATOM   6177 O  O   . GLU B 1 282 ? 65.310  -1.695  -16.911 1.00 23.88 ? 283 GLU B O   1 
ATOM   6178 C  CB  . GLU B 1 282 ? 68.488  -0.960  -17.021 1.00 23.86 ? 283 GLU B CB  1 
ATOM   6179 C  CG  . GLU B 1 282 ? 69.399  0.254   -16.782 1.00 26.43 ? 283 GLU B CG  1 
ATOM   6180 C  CD  . GLU B 1 282 ? 70.282  0.610   -17.981 1.00 30.33 ? 283 GLU B CD  1 
ATOM   6181 O  OE1 . GLU B 1 282 ? 70.293  -0.144  -18.983 1.00 33.38 ? 283 GLU B OE1 1 
ATOM   6182 O  OE2 . GLU B 1 282 ? 70.968  1.662   -17.930 1.00 33.45 ? 283 GLU B OE2 1 
ATOM   6183 N  N   . MET B 1 283 ? 66.582  -3.412  -16.219 1.00 24.10 ? 284 MET B N   1 
ATOM   6184 C  CA  . MET B 1 283 ? 65.594  -4.420  -16.609 1.00 24.50 ? 284 MET B CA  1 
ATOM   6185 C  C   . MET B 1 283 ? 64.354  -4.331  -15.727 1.00 24.02 ? 284 MET B C   1 
ATOM   6186 O  O   . MET B 1 283 ? 63.228  -4.432  -16.211 1.00 23.70 ? 284 MET B O   1 
ATOM   6187 C  CB  . MET B 1 283 ? 66.207  -5.816  -16.574 1.00 24.31 ? 284 MET B CB  1 
ATOM   6188 C  CG  . MET B 1 283 ? 67.231  -6.044  -17.695 1.00 27.53 ? 284 MET B CG  1 
ATOM   6189 S  SD  . MET B 1 283 ? 67.846  -7.755  -17.691 1.00 34.79 ? 284 MET B SD  1 
ATOM   6190 C  CE  . MET B 1 283 ? 66.312  -8.676  -17.854 1.00 35.95 ? 284 MET B CE  1 
ATOM   6191 N  N   . LEU B 1 284 ? 64.571  -4.116  -14.437 1.00 24.10 ? 285 LEU B N   1 
ATOM   6192 C  CA  . LEU B 1 284 ? 63.473  -3.986  -13.485 1.00 24.18 ? 285 LEU B CA  1 
ATOM   6193 C  C   . LEU B 1 284 ? 62.655  -2.761  -13.820 1.00 24.21 ? 285 LEU B C   1 
ATOM   6194 O  O   . LEU B 1 284 ? 61.427  -2.844  -13.949 1.00 24.88 ? 285 LEU B O   1 
ATOM   6195 C  CB  . LEU B 1 284 ? 63.999  -3.890  -12.052 1.00 24.67 ? 285 LEU B CB  1 
ATOM   6196 C  CG  . LEU B 1 284 ? 64.536  -5.174  -11.409 1.00 25.60 ? 285 LEU B CG  1 
ATOM   6197 C  CD1 . LEU B 1 284 ? 65.213  -4.874  -10.078 1.00 24.62 ? 285 LEU B CD1 1 
ATOM   6198 C  CD2 . LEU B 1 284 ? 63.393  -6.182  -11.210 1.00 26.51 ? 285 LEU B CD2 1 
ATOM   6199 N  N   . ALA B 1 285 ? 63.342  -1.635  -13.982 1.00 24.03 ? 286 ALA B N   1 
ATOM   6200 C  CA  . ALA B 1 285 ? 62.685  -0.378  -14.297 1.00 24.32 ? 286 ALA B CA  1 
ATOM   6201 C  C   . ALA B 1 285 ? 61.969  -0.437  -15.640 1.00 24.32 ? 286 ALA B C   1 
ATOM   6202 O  O   . ALA B 1 285 ? 60.842  0.054   -15.756 1.00 24.98 ? 286 ALA B O   1 
ATOM   6203 C  CB  . ALA B 1 285 ? 63.673  0.784   -14.262 1.00 23.76 ? 286 ALA B CB  1 
ATOM   6204 N  N   . GLY B 1 286 ? 62.619  -1.022  -16.649 1.00 24.11 ? 287 GLY B N   1 
ATOM   6205 C  CA  . GLY B 1 286 ? 62.027  -1.104  -17.989 1.00 23.79 ? 287 GLY B CA  1 
ATOM   6206 C  C   . GLY B 1 286 ? 60.800  -2.012  -18.058 1.00 23.73 ? 287 GLY B C   1 
ATOM   6207 O  O   . GLY B 1 286 ? 59.923  -1.814  -18.891 1.00 23.84 ? 287 GLY B O   1 
ATOM   6208 N  N   . GLY B 1 287 ? 60.748  -3.008  -17.180 1.00 23.48 ? 288 GLY B N   1 
ATOM   6209 C  CA  . GLY B 1 287 ? 59.688  -4.015  -17.197 1.00 23.59 ? 288 GLY B CA  1 
ATOM   6210 C  C   . GLY B 1 287 ? 58.301  -3.626  -16.680 1.00 23.34 ? 288 GLY B C   1 
ATOM   6211 O  O   . GLY B 1 287 ? 57.318  -4.293  -17.009 1.00 23.58 ? 288 GLY B O   1 
ATOM   6212 N  N   . VAL B 1 288 ? 58.212  -2.557  -15.887 1.00 22.76 ? 289 VAL B N   1 
ATOM   6213 C  CA  . VAL B 1 288 ? 57.009  -2.283  -15.091 1.00 22.25 ? 289 VAL B CA  1 
ATOM   6214 C  C   . VAL B 1 288 ? 55.930  -1.489  -15.854 1.00 22.77 ? 289 VAL B C   1 
ATOM   6215 O  O   . VAL B 1 288 ? 54.760  -1.845  -15.802 1.00 23.14 ? 289 VAL B O   1 
ATOM   6216 C  CB  . VAL B 1 288 ? 57.357  -1.600  -13.713 1.00 22.66 ? 289 VAL B CB  1 
ATOM   6217 C  CG1 . VAL B 1 288 ? 56.104  -1.139  -12.993 1.00 20.52 ? 289 VAL B CG1 1 
ATOM   6218 C  CG2 . VAL B 1 288 ? 58.159  -2.570  -12.801 1.00 22.99 ? 289 VAL B CG2 1 
ATOM   6219 N  N   . ASP B 1 289 ? 56.314  -0.420  -16.551 1.00 22.34 ? 290 ASP B N   1 
ATOM   6220 C  CA  . ASP B 1 289 ? 55.325  0.444   -17.204 1.00 22.83 ? 290 ASP B CA  1 
ATOM   6221 C  C   . ASP B 1 289 ? 55.043  0.082   -18.669 1.00 22.01 ? 290 ASP B C   1 
ATOM   6222 O  O   . ASP B 1 289 ? 54.096  0.569   -19.257 1.00 22.70 ? 290 ASP B O   1 
ATOM   6223 C  CB  . ASP B 1 289 ? 55.703  1.932   -17.050 1.00 22.68 ? 290 ASP B CB  1 
ATOM   6224 C  CG  . ASP B 1 289 ? 55.434  2.466   -15.648 1.00 24.53 ? 290 ASP B CG  1 
ATOM   6225 O  OD1 . ASP B 1 289 ? 55.159  1.658   -14.721 1.00 26.64 ? 290 ASP B OD1 1 
ATOM   6226 O  OD2 . ASP B 1 289 ? 55.502  3.700   -15.467 1.00 24.75 ? 290 ASP B OD2 1 
ATOM   6227 N  N   . THR B 1 290 ? 55.852  -0.807  -19.227 1.00 21.55 ? 291 THR B N   1 
ATOM   6228 C  CA  . THR B 1 290 ? 55.772  -1.166  -20.634 1.00 20.11 ? 291 THR B CA  1 
ATOM   6229 C  C   . THR B 1 290 ? 54.716  -2.220  -20.931 1.00 19.70 ? 291 THR B C   1 
ATOM   6230 O  O   . THR B 1 290 ? 53.723  -1.945  -21.611 1.00 19.29 ? 291 THR B O   1 
ATOM   6231 C  CB  . THR B 1 290 ? 57.155  -1.606  -21.163 1.00 20.49 ? 291 THR B CB  1 
ATOM   6232 O  OG1 . THR B 1 290 ? 57.760  -2.543  -20.248 1.00 19.03 ? 291 THR B OG1 1 
ATOM   6233 C  CG2 . THR B 1 290 ? 58.038  -0.386  -21.320 1.00 20.13 ? 291 THR B CG2 1 
ATOM   6234 N  N   . THR B 1 291 ? 54.911  -3.422  -20.409 1.00 19.25 ? 292 THR B N   1 
ATOM   6235 C  CA  . THR B 1 291 ? 53.977  -4.505  -20.677 1.00 19.45 ? 292 THR B CA  1 
ATOM   6236 C  C   . THR B 1 291 ? 52.607  -4.191  -20.088 1.00 19.15 ? 292 THR B C   1 
ATOM   6237 O  O   . THR B 1 291 ? 51.587  -4.474  -20.706 1.00 18.45 ? 292 THR B O   1 
ATOM   6238 C  CB  . THR B 1 291 ? 54.477  -5.831  -20.093 1.00 19.75 ? 292 THR B CB  1 
ATOM   6239 O  OG1 . THR B 1 291 ? 54.807  -5.629  -18.715 1.00 21.29 ? 292 THR B OG1 1 
ATOM   6240 C  CG2 . THR B 1 291 ? 55.705  -6.302  -20.833 1.00 19.33 ? 292 THR B CG2 1 
ATOM   6241 N  N   . SER B 1 292 ? 52.600  -3.574  -18.911 1.00 18.80 ? 293 SER B N   1 
ATOM   6242 C  CA  . SER B 1 292 ? 51.367  -3.204  -18.234 1.00 19.43 ? 293 SER B CA  1 
ATOM   6243 C  C   . SER B 1 292 ? 50.477  -2.249  -19.070 1.00 19.25 ? 293 SER B C   1 
ATOM   6244 O  O   . SER B 1 292 ? 49.288  -2.492  -19.201 1.00 18.88 ? 293 SER B O   1 
ATOM   6245 C  CB  . SER B 1 292 ? 51.684  -2.583  -16.870 1.00 19.02 ? 293 SER B CB  1 
ATOM   6246 O  OG  . SER B 1 292 ? 52.397  -1.376  -17.055 1.00 19.65 ? 293 SER B OG  1 
ATOM   6247 N  N   . MET B 1 293 ? 51.046  -1.176  -19.627 1.00 19.50 ? 294 MET B N   1 
ATOM   6248 C  CA  . MET B 1 293 ? 50.272  -0.276  -20.508 1.00 19.92 ? 294 MET B CA  1 
ATOM   6249 C  C   . MET B 1 293 ? 49.837  -0.951  -21.818 1.00 19.25 ? 294 MET B C   1 
ATOM   6250 O  O   . MET B 1 293 ? 48.728  -0.718  -22.309 1.00 18.33 ? 294 MET B O   1 
ATOM   6251 C  CB  . MET B 1 293 ? 51.040  1.013   -20.827 1.00 20.66 ? 294 MET B CB  1 
ATOM   6252 C  CG  . MET B 1 293 ? 51.093  2.051   -19.683 1.00 24.36 ? 294 MET B CG  1 
ATOM   6253 S  SD  . MET B 1 293 ? 49.552  2.417   -18.810 1.00 30.30 ? 294 MET B SD  1 
ATOM   6254 C  CE  . MET B 1 293 ? 49.276  0.980   -17.764 1.00 29.81 ? 294 MET B CE  1 
ATOM   6255 N  N   . THR B 1 294 ? 50.724  -1.771  -22.383 1.00 18.82 ? 295 THR B N   1 
ATOM   6256 C  CA  . THR B 1 294 ? 50.431  -2.450  -23.651 1.00 18.38 ? 295 THR B CA  1 
ATOM   6257 C  C   . THR B 1 294 ? 49.286  -3.454  -23.485 1.00 18.45 ? 295 THR B C   1 
ATOM   6258 O  O   . THR B 1 294 ? 48.356  -3.504  -24.302 1.00 18.69 ? 295 THR B O   1 
ATOM   6259 C  CB  . THR B 1 294 ? 51.701  -3.100  -24.243 1.00 18.57 ? 295 THR B CB  1 
ATOM   6260 O  OG1 . THR B 1 294 ? 52.724  -2.093  -24.378 1.00 18.87 ? 295 THR B OG1 1 
ATOM   6261 C  CG2 . THR B 1 294 ? 51.401  -3.736  -25.632 1.00 16.42 ? 295 THR B CG2 1 
ATOM   6262 N  N   . LEU B 1 295 ? 49.322  -4.203  -22.389 1.00 17.70 ? 296 LEU B N   1 
ATOM   6263 C  CA  . LEU B 1 295 ? 48.253  -5.142  -22.058 1.00 17.63 ? 296 LEU B CA  1 
ATOM   6264 C  C   . LEU B 1 295 ? 46.923  -4.440  -21.843 1.00 17.39 ? 296 LEU B C   1 
ATOM   6265 O  O   . LEU B 1 295 ? 45.867  -4.886  -22.332 1.00 16.79 ? 296 LEU B O   1 
ATOM   6266 C  CB  . LEU B 1 295 ? 48.650  -5.939  -20.809 1.00 17.37 ? 296 LEU B CB  1 
ATOM   6267 C  CG  . LEU B 1 295 ? 49.632  -7.061  -21.075 1.00 19.23 ? 296 LEU B CG  1 
ATOM   6268 C  CD1 . LEU B 1 295 ? 50.033  -7.716  -19.746 1.00 19.11 ? 296 LEU B CD1 1 
ATOM   6269 C  CD2 . LEU B 1 295 ? 49.011  -8.109  -22.060 1.00 18.14 ? 296 LEU B CD2 1 
ATOM   6270 N  N   . GLN B 1 296 ? 46.967  -3.326  -21.110 1.00 17.57 ? 297 GLN B N   1 
ATOM   6271 C  CA  . GLN B 1 296 ? 45.777  -2.512  -20.915 1.00 17.77 ? 297 GLN B CA  1 
ATOM   6272 C  C   . GLN B 1 296 ? 45.164  -2.067  -22.255 1.00 17.54 ? 297 GLN B C   1 
ATOM   6273 O  O   . GLN B 1 296 ? 43.937  -2.089  -22.416 1.00 16.96 ? 297 GLN B O   1 
ATOM   6274 C  CB  . GLN B 1 296 ? 46.054  -1.291  -20.026 1.00 17.99 ? 297 GLN B CB  1 
ATOM   6275 C  CG  . GLN B 1 296 ? 44.789  -0.515  -19.700 1.00 18.61 ? 297 GLN B CG  1 
ATOM   6276 C  CD  . GLN B 1 296 ? 45.007  0.603   -18.688 1.00 21.52 ? 297 GLN B CD  1 
ATOM   6277 O  OE1 . GLN B 1 296 ? 44.353  0.641   -17.636 1.00 22.22 ? 297 GLN B OE1 1 
ATOM   6278 N  NE2 . GLN B 1 296 ? 45.936  1.519   -18.997 1.00 19.04 ? 297 GLN B NE2 1 
ATOM   6279 N  N   . TRP B 1 297 ? 46.006  -1.649  -23.200 1.00 17.26 ? 298 TRP B N   1 
ATOM   6280 C  CA  . TRP B 1 297 ? 45.506  -1.296  -24.549 1.00 17.12 ? 298 TRP B CA  1 
ATOM   6281 C  C   . TRP B 1 297 ? 44.960  -2.506  -25.309 1.00 17.19 ? 298 TRP B C   1 
ATOM   6282 O  O   . TRP B 1 297 ? 43.965  -2.395  -26.041 1.00 16.76 ? 298 TRP B O   1 
ATOM   6283 C  CB  . TRP B 1 297 ? 46.593  -0.664  -25.419 1.00 16.41 ? 298 TRP B CB  1 
ATOM   6284 C  CG  . TRP B 1 297 ? 46.935  0.767   -25.113 1.00 15.74 ? 298 TRP B CG  1 
ATOM   6285 C  CD1 . TRP B 1 297 ? 48.146  1.244   -24.738 1.00 14.70 ? 298 TRP B CD1 1 
ATOM   6286 C  CD2 . TRP B 1 297 ? 46.070  1.908   -25.221 1.00 17.12 ? 298 TRP B CD2 1 
ATOM   6287 N  NE1 . TRP B 1 297 ? 48.094  2.606   -24.586 1.00 14.22 ? 298 TRP B NE1 1 
ATOM   6288 C  CE2 . TRP B 1 297 ? 46.828  3.037   -24.868 1.00 15.96 ? 298 TRP B CE2 1 
ATOM   6289 C  CE3 . TRP B 1 297 ? 44.714  2.081   -25.564 1.00 16.87 ? 298 TRP B CE3 1 
ATOM   6290 C  CZ2 . TRP B 1 297 ? 46.296  4.332   -24.874 1.00 17.44 ? 298 TRP B CZ2 1 
ATOM   6291 C  CZ3 . TRP B 1 297 ? 44.187  3.376   -25.554 1.00 17.82 ? 298 TRP B CZ3 1 
ATOM   6292 C  CH2 . TRP B 1 297 ? 44.972  4.471   -25.204 1.00 15.57 ? 298 TRP B CH2 1 
ATOM   6293 N  N   . HIS B 1 298 ? 45.627  -3.640  -25.169 1.00 17.37 ? 299 HIS B N   1 
ATOM   6294 C  CA  . HIS B 1 298 ? 45.134  -4.853  -25.798 1.00 19.06 ? 299 HIS B CA  1 
ATOM   6295 C  C   . HIS B 1 298 ? 43.727  -5.181  -25.295 1.00 19.29 ? 299 HIS B C   1 
ATOM   6296 O  O   . HIS B 1 298 ? 42.789  -5.356  -26.085 1.00 19.17 ? 299 HIS B O   1 
ATOM   6297 C  CB  . HIS B 1 298 ? 46.084  -6.038  -25.586 1.00 19.03 ? 299 HIS B CB  1 
ATOM   6298 C  CG  . HIS B 1 298 ? 45.714  -7.233  -26.404 1.00 21.07 ? 299 HIS B CG  1 
ATOM   6299 N  ND1 . HIS B 1 298 ? 46.429  -7.627  -27.517 1.00 23.48 ? 299 HIS B ND1 1 
ATOM   6300 C  CD2 . HIS B 1 298 ? 44.668  -8.090  -26.301 1.00 21.28 ? 299 HIS B CD2 1 
ATOM   6301 C  CE1 . HIS B 1 298 ? 45.850  -8.688  -28.053 1.00 22.29 ? 299 HIS B CE1 1 
ATOM   6302 N  NE2 . HIS B 1 298 ? 44.783  -8.991  -27.333 1.00 24.04 ? 299 HIS B NE2 1 
ATOM   6303 N  N   . LEU B 1 299 ? 43.579  -5.224  -23.970 1.00 20.33 ? 300 LEU B N   1 
ATOM   6304 C  CA  . LEU B 1 299 ? 42.280  -5.428  -23.351 1.00 20.75 ? 300 LEU B CA  1 
ATOM   6305 C  C   . LEU B 1 299 ? 41.264  -4.417  -23.871 1.00 21.28 ? 300 LEU B C   1 
ATOM   6306 O  O   . LEU B 1 299 ? 40.126  -4.772  -24.189 1.00 22.36 ? 300 LEU B O   1 
ATOM   6307 C  CB  . LEU B 1 299 ? 42.383  -5.370  -21.818 1.00 20.42 ? 300 LEU B CB  1 
ATOM   6308 C  CG  . LEU B 1 299 ? 43.135  -6.551  -21.195 1.00 21.49 ? 300 LEU B CG  1 
ATOM   6309 C  CD1 . LEU B 1 299 ? 43.323  -6.334  -19.688 1.00 21.08 ? 300 LEU B CD1 1 
ATOM   6310 C  CD2 . LEU B 1 299 ? 42.417  -7.872  -21.499 1.00 22.25 ? 300 LEU B CD2 1 
ATOM   6311 N  N   . TYR B 1 300 ? 41.684  -3.164  -23.970 1.00 20.73 ? 301 TYR B N   1 
ATOM   6312 C  CA  . TYR B 1 300 ? 40.806  -2.103  -24.469 1.00 20.72 ? 301 TYR B CA  1 
ATOM   6313 C  C   . TYR B 1 300 ? 40.343  -2.358  -25.912 1.00 20.27 ? 301 TYR B C   1 
ATOM   6314 O  O   . TYR B 1 300 ? 39.156  -2.222  -26.214 1.00 20.05 ? 301 TYR B O   1 
ATOM   6315 C  CB  . TYR B 1 300 ? 41.493  -0.747  -24.316 1.00 20.53 ? 301 TYR B CB  1 
ATOM   6316 C  CG  . TYR B 1 300 ? 40.828  0.420   -25.015 1.00 21.20 ? 301 TYR B CG  1 
ATOM   6317 C  CD1 . TYR B 1 300 ? 39.791  1.129   -24.407 1.00 23.79 ? 301 TYR B CD1 1 
ATOM   6318 C  CD2 . TYR B 1 300 ? 41.266  0.836   -26.264 1.00 22.04 ? 301 TYR B CD2 1 
ATOM   6319 C  CE1 . TYR B 1 300 ? 39.200  2.221   -25.043 1.00 25.12 ? 301 TYR B CE1 1 
ATOM   6320 C  CE2 . TYR B 1 300 ? 40.689  1.929   -26.909 1.00 23.98 ? 301 TYR B CE2 1 
ATOM   6321 C  CZ  . TYR B 1 300 ? 39.670  2.610   -26.301 1.00 25.79 ? 301 TYR B CZ  1 
ATOM   6322 O  OH  . TYR B 1 300 ? 39.115  3.679   -26.958 1.00 29.15 ? 301 TYR B OH  1 
ATOM   6323 N  N   . GLU B 1 301 ? 41.268  -2.749  -26.782 1.00 20.08 ? 302 GLU B N   1 
ATOM   6324 C  CA  . GLU B 1 301 ? 40.920  -3.072  -28.176 1.00 21.06 ? 302 GLU B CA  1 
ATOM   6325 C  C   . GLU B 1 301 ? 40.030  -4.335  -28.321 1.00 21.17 ? 302 GLU B C   1 
ATOM   6326 O  O   . GLU B 1 301 ? 39.120  -4.366  -29.145 1.00 21.35 ? 302 GLU B O   1 
ATOM   6327 C  CB  . GLU B 1 301 ? 42.179  -3.166  -29.048 1.00 21.04 ? 302 GLU B CB  1 
ATOM   6328 C  CG  . GLU B 1 301 ? 43.014  -1.868  -29.111 1.00 23.95 ? 302 GLU B CG  1 
ATOM   6329 C  CD  . GLU B 1 301 ? 42.290  -0.733  -29.810 1.00 27.64 ? 302 GLU B CD  1 
ATOM   6330 O  OE1 . GLU B 1 301 ? 42.786  0.414   -29.775 1.00 30.44 ? 302 GLU B OE1 1 
ATOM   6331 O  OE2 . GLU B 1 301 ? 41.211  -0.981  -30.392 1.00 29.04 ? 302 GLU B OE2 1 
ATOM   6332 N  N   . MET B 1 302 ? 40.270  -5.354  -27.508 1.00 21.31 ? 303 MET B N   1 
ATOM   6333 C  CA  . MET B 1 302 ? 39.381  -6.528  -27.479 1.00 22.45 ? 303 MET B CA  1 
ATOM   6334 C  C   . MET B 1 302 ? 37.962  -6.191  -27.056 1.00 22.71 ? 303 MET B C   1 
ATOM   6335 O  O   . MET B 1 302 ? 37.014  -6.699  -27.637 1.00 22.70 ? 303 MET B O   1 
ATOM   6336 C  CB  . MET B 1 302 ? 39.936  -7.642  -26.598 1.00 21.92 ? 303 MET B CB  1 
ATOM   6337 C  CG  . MET B 1 302 ? 41.135  -8.329  -27.205 1.00 24.46 ? 303 MET B CG  1 
ATOM   6338 S  SD  . MET B 1 302 ? 41.432  -9.967  -26.504 1.00 27.98 ? 303 MET B SD  1 
ATOM   6339 C  CE  . MET B 1 302 ? 41.571  -9.591  -24.765 1.00 27.39 ? 303 MET B CE  1 
ATOM   6340 N  N   . ALA B 1 303 ? 37.824  -5.330  -26.052 1.00 23.39 ? 304 ALA B N   1 
ATOM   6341 C  CA  . ALA B 1 303 ? 36.504  -4.879  -25.594 1.00 23.88 ? 304 ALA B CA  1 
ATOM   6342 C  C   . ALA B 1 303 ? 35.783  -3.988  -26.606 1.00 24.50 ? 304 ALA B C   1 
ATOM   6343 O  O   . ALA B 1 303 ? 34.546  -3.939  -26.631 1.00 23.82 ? 304 ALA B O   1 
ATOM   6344 C  CB  . ALA B 1 303 ? 36.620  -4.152  -24.242 1.00 23.84 ? 304 ALA B CB  1 
ATOM   6345 N  N   . ARG B 1 304 ? 36.562  -3.259  -27.405 1.00 25.57 ? 305 ARG B N   1 
ATOM   6346 C  CA  . ARG B 1 304 ? 36.027  -2.367  -28.444 1.00 27.27 ? 305 ARG B CA  1 
ATOM   6347 C  C   . ARG B 1 304 ? 35.642  -3.166  -29.689 1.00 27.15 ? 305 ARG B C   1 
ATOM   6348 O  O   . ARG B 1 304 ? 34.799  -2.735  -30.463 1.00 27.74 ? 305 ARG B O   1 
ATOM   6349 C  CB  . ARG B 1 304 ? 37.088  -1.339  -28.863 1.00 27.78 ? 305 ARG B CB  1 
ATOM   6350 C  CG  . ARG B 1 304 ? 36.933  0.069   -28.296 1.00 32.26 ? 305 ARG B CG  1 
ATOM   6351 C  CD  . ARG B 1 304 ? 37.992  1.026   -28.898 1.00 36.33 ? 305 ARG B CD  1 
ATOM   6352 N  NE  . ARG B 1 304 ? 37.708  1.422   -30.284 1.00 41.17 ? 305 ARG B NE  1 
ATOM   6353 C  CZ  . ARG B 1 304 ? 38.438  1.081   -31.352 1.00 43.12 ? 305 ARG B CZ  1 
ATOM   6354 N  NH1 . ARG B 1 304 ? 39.524  0.338   -31.224 1.00 43.90 ? 305 ARG B NH1 1 
ATOM   6355 N  NH2 . ARG B 1 304 ? 38.087  1.493   -32.565 1.00 44.52 ? 305 ARG B NH2 1 
ATOM   6356 N  N   . ASN B 1 305 ? 36.285  -4.321  -29.866 1.00 27.00 ? 306 ASN B N   1 
ATOM   6357 C  CA  . ASN B 1 305 ? 36.175  -5.128  -31.062 1.00 27.02 ? 306 ASN B CA  1 
ATOM   6358 C  C   . ASN B 1 305 ? 35.810  -6.573  -30.658 1.00 26.54 ? 306 ASN B C   1 
ATOM   6359 O  O   . ASN B 1 305 ? 36.638  -7.478  -30.689 1.00 25.46 ? 306 ASN B O   1 
ATOM   6360 C  CB  . ASN B 1 305 ? 37.477  -5.054  -31.884 1.00 26.73 ? 306 ASN B CB  1 
ATOM   6361 C  CG  . ASN B 1 305 ? 37.888  -3.595  -32.245 1.00 30.44 ? 306 ASN B CG  1 
ATOM   6362 O  OD1 . ASN B 1 305 ? 37.563  -3.095  -33.334 1.00 34.88 ? 306 ASN B OD1 1 
ATOM   6363 N  ND2 . ASN B 1 305 ? 38.613  -2.920  -31.335 1.00 29.62 ? 306 ASN B ND2 1 
ATOM   6364 N  N   . LEU B 1 306 ? 34.553  -6.766  -30.268 1.00 26.85 ? 307 LEU B N   1 
ATOM   6365 C  CA  . LEU B 1 306 ? 34.111  -8.031  -29.657 1.00 27.53 ? 307 LEU B CA  1 
ATOM   6366 C  C   . LEU B 1 306 ? 34.186  -9.256  -30.592 1.00 27.81 ? 307 LEU B C   1 
ATOM   6367 O  O   . LEU B 1 306 ? 34.369  -10.376 -30.124 1.00 27.87 ? 307 LEU B O   1 
ATOM   6368 C  CB  . LEU B 1 306 ? 32.714  -7.879  -29.039 1.00 27.72 ? 307 LEU B CB  1 
ATOM   6369 C  CG  . LEU B 1 306 ? 32.628  -6.952  -27.819 1.00 27.76 ? 307 LEU B CG  1 
ATOM   6370 C  CD1 . LEU B 1 306 ? 31.172  -6.639  -27.472 1.00 30.09 ? 307 LEU B CD1 1 
ATOM   6371 C  CD2 . LEU B 1 306 ? 33.356  -7.537  -26.614 1.00 27.87 ? 307 LEU B CD2 1 
ATOM   6372 N  N   . LYS B 1 307 ? 34.101  -9.033  -31.903 1.00 28.18 ? 308 LYS B N   1 
ATOM   6373 C  CA  . LYS B 1 307 ? 34.235  -10.111 -32.887 1.00 28.92 ? 308 LYS B CA  1 
ATOM   6374 C  C   . LYS B 1 307 ? 35.670  -10.595 -32.927 1.00 28.06 ? 308 LYS B C   1 
ATOM   6375 O  O   . LYS B 1 307 ? 35.932  -11.805 -32.976 1.00 27.81 ? 308 LYS B O   1 
ATOM   6376 C  CB  . LYS B 1 307 ? 33.788  -9.654  -34.284 1.00 29.79 ? 308 LYS B CB  1 
ATOM   6377 C  CG  . LYS B 1 307 ? 32.347  -10.032 -34.671 1.00 33.61 ? 308 LYS B CG  1 
ATOM   6378 C  CD  . LYS B 1 307 ? 31.292  -9.411  -33.749 1.00 39.09 ? 308 LYS B CD  1 
ATOM   6379 C  CE  . LYS B 1 307 ? 29.895  -9.460  -34.365 1.00 41.87 ? 308 LYS B CE  1 
ATOM   6380 N  NZ  . LYS B 1 307 ? 29.756  -8.491  -35.502 1.00 43.88 ? 308 LYS B NZ  1 
ATOM   6381 N  N   . VAL B 1 308 ? 36.605  -9.645  -32.883 1.00 27.03 ? 309 VAL B N   1 
ATOM   6382 C  CA  . VAL B 1 308 ? 38.022  -9.980  -32.733 1.00 26.01 ? 309 VAL B CA  1 
ATOM   6383 C  C   . VAL B 1 308 ? 38.284  -10.707 -31.400 1.00 25.09 ? 309 VAL B C   1 
ATOM   6384 O  O   . VAL B 1 308 ? 39.025  -11.678 -31.366 1.00 25.03 ? 309 VAL B O   1 
ATOM   6385 C  CB  . VAL B 1 308 ? 38.923  -8.725  -32.870 1.00 26.32 ? 309 VAL B CB  1 
ATOM   6386 C  CG1 . VAL B 1 308 ? 40.386  -9.102  -32.745 1.00 25.49 ? 309 VAL B CG1 1 
ATOM   6387 C  CG2 . VAL B 1 308 ? 38.666  -8.029  -34.215 1.00 26.31 ? 309 VAL B CG2 1 
ATOM   6388 N  N   . GLN B 1 309 ? 37.680  -10.239 -30.313 1.00 24.35 ? 310 GLN B N   1 
ATOM   6389 C  CA  . GLN B 1 309 ? 37.827  -10.927 -29.029 1.00 24.78 ? 310 GLN B CA  1 
ATOM   6390 C  C   . GLN B 1 309 ? 37.386  -12.410 -29.111 1.00 25.00 ? 310 GLN B C   1 
ATOM   6391 O  O   . GLN B 1 309 ? 38.110  -13.297 -28.659 1.00 24.50 ? 310 GLN B O   1 
ATOM   6392 C  CB  . GLN B 1 309 ? 37.090  -10.190 -27.896 1.00 23.62 ? 310 GLN B CB  1 
ATOM   6393 C  CG  . GLN B 1 309 ? 37.392  -10.791 -26.521 1.00 22.44 ? 310 GLN B CG  1 
ATOM   6394 C  CD  . GLN B 1 309 ? 36.693  -10.076 -25.388 1.00 21.03 ? 310 GLN B CD  1 
ATOM   6395 O  OE1 . GLN B 1 309 ? 36.291  -8.916  -25.514 1.00 23.47 ? 310 GLN B OE1 1 
ATOM   6396 N  NE2 . GLN B 1 309 ? 36.557  -10.755 -24.268 1.00 19.67 ? 310 GLN B NE2 1 
ATOM   6397 N  N   . ASP B 1 310 ? 36.214  -12.659 -29.703 1.00 26.24 ? 311 ASP B N   1 
ATOM   6398 C  CA  . ASP B 1 310 ? 35.736  -14.029 -29.975 1.00 28.08 ? 311 ASP B CA  1 
ATOM   6399 C  C   . ASP B 1 310 ? 36.720  -14.876 -30.802 1.00 28.10 ? 311 ASP B C   1 
ATOM   6400 O  O   . ASP B 1 310 ? 36.951  -16.037 -30.480 1.00 28.37 ? 311 ASP B O   1 
ATOM   6401 C  CB  . ASP B 1 310 ? 34.384  -13.994 -30.700 1.00 28.77 ? 311 ASP B CB  1 
ATOM   6402 C  CG  . ASP B 1 310 ? 33.263  -13.424 -29.842 1.00 31.50 ? 311 ASP B CG  1 
ATOM   6403 O  OD1 . ASP B 1 310 ? 33.242  -13.691 -28.614 1.00 34.61 ? 311 ASP B OD1 1 
ATOM   6404 O  OD2 . ASP B 1 310 ? 32.385  -12.723 -30.406 1.00 34.33 ? 311 ASP B OD2 1 
ATOM   6405 N  N   . MET B 1 311 ? 37.301  -14.304 -31.858 1.00 28.56 ? 312 MET B N   1 
ATOM   6406 C  CA  . MET B 1 311 ? 38.268  -15.051 -32.694 1.00 28.79 ? 312 MET B CA  1 
ATOM   6407 C  C   . MET B 1 311 ? 39.543  -15.386 -31.919 1.00 28.10 ? 312 MET B C   1 
ATOM   6408 O  O   . MET B 1 311 ? 40.133  -16.464 -32.102 1.00 27.88 ? 312 MET B O   1 
ATOM   6409 C  CB  . MET B 1 311 ? 38.670  -14.247 -33.928 1.00 29.47 ? 312 MET B CB  1 
ATOM   6410 C  CG  . MET B 1 311 ? 37.685  -14.255 -35.072 1.00 34.03 ? 312 MET B CG  1 
ATOM   6411 S  SD  . MET B 1 311 ? 38.186  -13.020 -36.315 1.00 44.51 ? 312 MET B SD  1 
ATOM   6412 C  CE  . MET B 1 311 ? 39.699  -13.734 -36.979 1.00 40.56 ? 312 MET B CE  1 
ATOM   6413 N  N   . LEU B 1 312 ? 39.989  -14.454 -31.072 1.00 26.23 ? 313 LEU B N   1 
ATOM   6414 C  CA  . LEU B 1 312 ? 41.200  -14.702 -30.301 1.00 25.11 ? 313 LEU B CA  1 
ATOM   6415 C  C   . LEU B 1 312 ? 40.933  -15.803 -29.272 1.00 24.22 ? 313 LEU B C   1 
ATOM   6416 O  O   . LEU B 1 312 ? 41.763  -16.682 -29.072 1.00 24.54 ? 313 LEU B O   1 
ATOM   6417 C  CB  . LEU B 1 312 ? 41.726  -13.411 -29.641 1.00 24.71 ? 313 LEU B CB  1 
ATOM   6418 C  CG  . LEU B 1 312 ? 42.278  -12.317 -30.578 1.00 24.89 ? 313 LEU B CG  1 
ATOM   6419 C  CD1 . LEU B 1 312 ? 42.614  -11.017 -29.839 1.00 24.68 ? 313 LEU B CD1 1 
ATOM   6420 C  CD2 . LEU B 1 312 ? 43.499  -12.807 -31.306 1.00 23.14 ? 313 LEU B CD2 1 
ATOM   6421 N  N   . ARG B 1 313 ? 39.773  -15.756 -28.630 1.00 23.81 ? 314 ARG B N   1 
ATOM   6422 C  CA  . ARG B 1 313 ? 39.439  -16.766 -27.621 1.00 24.16 ? 314 ARG B CA  1 
ATOM   6423 C  C   . ARG B 1 313 ? 39.339  -18.161 -28.268 1.00 24.22 ? 314 ARG B C   1 
ATOM   6424 O  O   . ARG B 1 313 ? 39.915  -19.122 -27.753 1.00 23.90 ? 314 ARG B O   1 
ATOM   6425 C  CB  . ARG B 1 313 ? 38.146  -16.406 -26.877 1.00 23.94 ? 314 ARG B CB  1 
ATOM   6426 C  CG  . ARG B 1 313 ? 37.747  -17.403 -25.783 1.00 22.98 ? 314 ARG B CG  1 
ATOM   6427 C  CD  . ARG B 1 313 ? 36.552  -16.908 -24.979 1.00 25.06 ? 314 ARG B CD  1 
ATOM   6428 N  NE  . ARG B 1 313 ? 36.876  -15.683 -24.247 1.00 25.33 ? 314 ARG B NE  1 
ATOM   6429 C  CZ  . ARG B 1 313 ? 36.457  -14.465 -24.583 1.00 25.33 ? 314 ARG B CZ  1 
ATOM   6430 N  NH1 . ARG B 1 313 ? 35.644  -14.280 -25.618 1.00 24.17 ? 314 ARG B NH1 1 
ATOM   6431 N  NH2 . ARG B 1 313 ? 36.844  -13.426 -23.870 1.00 22.84 ? 314 ARG B NH2 1 
ATOM   6432 N  N   . ALA B 1 314 ? 38.649  -18.249 -29.410 1.00 24.91 ? 315 ALA B N   1 
ATOM   6433 C  CA  . ALA B 1 314 ? 38.500  -19.531 -30.140 1.00 26.00 ? 315 ALA B CA  1 
ATOM   6434 C  C   . ALA B 1 314 ? 39.860  -20.108 -30.502 1.00 26.53 ? 315 ALA B C   1 
ATOM   6435 O  O   . ALA B 1 314 ? 40.075  -21.312 -30.382 1.00 27.30 ? 315 ALA B O   1 
ATOM   6436 C  CB  . ALA B 1 314 ? 37.615  -19.369 -31.400 1.00 25.25 ? 315 ALA B CB  1 
ATOM   6437 N  N   . GLU B 1 315 ? 40.793  -19.244 -30.903 1.00 26.83 ? 316 GLU B N   1 
ATOM   6438 C  CA  . GLU B 1 315 ? 42.138  -19.701 -31.239 1.00 27.43 ? 316 GLU B CA  1 
ATOM   6439 C  C   . GLU B 1 315 ? 42.874  -20.241 -30.009 1.00 26.97 ? 316 GLU B C   1 
ATOM   6440 O  O   . GLU B 1 315 ? 43.551  -21.251 -30.091 1.00 26.85 ? 316 GLU B O   1 
ATOM   6441 C  CB  . GLU B 1 315 ? 42.966  -18.605 -31.926 1.00 27.72 ? 316 GLU B CB  1 
ATOM   6442 C  CG  . GLU B 1 315 ? 44.323  -19.116 -32.416 1.00 31.23 ? 316 GLU B CG  1 
ATOM   6443 C  CD  . GLU B 1 315 ? 45.189  -18.037 -33.065 1.00 35.99 ? 316 GLU B CD  1 
ATOM   6444 O  OE1 . GLU B 1 315 ? 45.529  -17.058 -32.369 1.00 38.66 ? 316 GLU B OE1 1 
ATOM   6445 O  OE2 . GLU B 1 315 ? 45.556  -18.186 -34.254 1.00 36.52 ? 316 GLU B OE2 1 
ATOM   6446 N  N   . VAL B 1 316 ? 42.740  -19.556 -28.880 1.00 26.64 ? 317 VAL B N   1 
ATOM   6447 C  CA  . VAL B 1 316 ? 43.428  -19.951 -27.656 1.00 26.66 ? 317 VAL B CA  1 
ATOM   6448 C  C   . VAL B 1 316 ? 42.894  -21.295 -27.116 1.00 26.90 ? 317 VAL B C   1 
ATOM   6449 O  O   . VAL B 1 316 ? 43.678  -22.162 -26.702 1.00 26.58 ? 317 VAL B O   1 
ATOM   6450 C  CB  . VAL B 1 316 ? 43.361  -18.812 -26.584 1.00 26.56 ? 317 VAL B CB  1 
ATOM   6451 C  CG1 . VAL B 1 316 ? 43.613  -19.337 -25.192 1.00 25.18 ? 317 VAL B CG1 1 
ATOM   6452 C  CG2 . VAL B 1 316 ? 44.361  -17.670 -26.941 1.00 26.65 ? 317 VAL B CG2 1 
ATOM   6453 N  N   . LEU B 1 317 ? 41.573  -21.456 -27.131 1.00 27.46 ? 318 LEU B N   1 
ATOM   6454 C  CA  . LEU B 1 317 ? 40.932  -22.721 -26.730 1.00 28.52 ? 318 LEU B CA  1 
ATOM   6455 C  C   . LEU B 1 317 ? 41.382  -23.890 -27.616 1.00 28.79 ? 318 LEU B C   1 
ATOM   6456 O  O   . LEU B 1 317 ? 41.708  -24.960 -27.107 1.00 29.23 ? 318 LEU B O   1 
ATOM   6457 C  CB  . LEU B 1 317 ? 39.406  -22.598 -26.747 1.00 28.27 ? 318 LEU B CB  1 
ATOM   6458 C  CG  . LEU B 1 317 ? 38.743  -21.590 -25.799 1.00 29.72 ? 318 LEU B CG  1 
ATOM   6459 C  CD1 . LEU B 1 317 ? 37.220  -21.689 -25.896 1.00 29.07 ? 318 LEU B CD1 1 
ATOM   6460 C  CD2 . LEU B 1 317 ? 39.223  -21.762 -24.352 1.00 29.20 ? 318 LEU B CD2 1 
ATOM   6461 N  N   . ALA B 1 318 ? 41.411  -23.676 -28.931 1.00 29.26 ? 319 ALA B N   1 
ATOM   6462 C  CA  . ALA B 1 318 ? 41.922  -24.696 -29.872 1.00 29.72 ? 319 ALA B CA  1 
ATOM   6463 C  C   . ALA B 1 318 ? 43.382  -25.005 -29.588 1.00 30.05 ? 319 ALA B C   1 
ATOM   6464 O  O   . ALA B 1 318 ? 43.786  -26.176 -29.595 1.00 30.09 ? 319 ALA B O   1 
ATOM   6465 C  CB  . ALA B 1 318 ? 41.750  -24.247 -31.326 1.00 29.41 ? 319 ALA B CB  1 
ATOM   6466 N  N   . ALA B 1 319 ? 44.167  -23.961 -29.316 1.00 30.21 ? 320 ALA B N   1 
ATOM   6467 C  CA  . ALA B 1 319 ? 45.594  -24.134 -29.063 1.00 30.93 ? 320 ALA B CA  1 
ATOM   6468 C  C   . ALA B 1 319 ? 45.858  -24.955 -27.801 1.00 31.38 ? 320 ALA B C   1 
ATOM   6469 O  O   . ALA B 1 319 ? 46.746  -25.805 -27.796 1.00 31.38 ? 320 ALA B O   1 
ATOM   6470 C  CB  . ALA B 1 319 ? 46.302  -22.791 -28.984 1.00 30.85 ? 320 ALA B CB  1 
ATOM   6471 N  N   . ARG B 1 320 ? 45.097  -24.693 -26.743 1.00 32.21 ? 321 ARG B N   1 
ATOM   6472 C  CA  . ARG B 1 320 ? 45.277  -25.393 -25.472 1.00 33.92 ? 321 ARG B CA  1 
ATOM   6473 C  C   . ARG B 1 320 ? 44.957  -26.883 -25.622 1.00 34.83 ? 321 ARG B C   1 
ATOM   6474 O  O   . ARG B 1 320 ? 45.702  -27.730 -25.139 1.00 34.90 ? 321 ARG B O   1 
ATOM   6475 C  CB  . ARG B 1 320 ? 44.420  -24.761 -24.364 1.00 33.41 ? 321 ARG B CB  1 
ATOM   6476 C  CG  . ARG B 1 320 ? 44.590  -25.395 -22.974 1.00 34.04 ? 321 ARG B CG  1 
ATOM   6477 C  CD  . ARG B 1 320 ? 45.940  -25.055 -22.315 1.00 35.01 ? 321 ARG B CD  1 
ATOM   6478 N  NE  . ARG B 1 320 ? 45.914  -23.740 -21.664 1.00 34.33 ? 321 ARG B NE  1 
ATOM   6479 C  CZ  . ARG B 1 320 ? 46.866  -23.269 -20.861 1.00 33.74 ? 321 ARG B CZ  1 
ATOM   6480 N  NH1 . ARG B 1 320 ? 47.946  -23.997 -20.597 1.00 32.89 ? 321 ARG B NH1 1 
ATOM   6481 N  NH2 . ARG B 1 320 ? 46.728  -22.068 -20.305 1.00 31.74 ? 321 ARG B NH2 1 
ATOM   6482 N  N   . HIS B 1 321 ? 43.852  -27.181 -26.301 1.00 36.12 ? 322 HIS B N   1 
ATOM   6483 C  CA  . HIS B 1 321 ? 43.453  -28.556 -26.595 1.00 37.80 ? 322 HIS B CA  1 
ATOM   6484 C  C   . HIS B 1 321 ? 44.538  -29.286 -27.404 1.00 38.25 ? 322 HIS B C   1 
ATOM   6485 O  O   . HIS B 1 321 ? 45.030  -30.342 -26.994 1.00 37.87 ? 322 HIS B O   1 
ATOM   6486 C  CB  . HIS B 1 321 ? 42.108  -28.563 -27.337 1.00 38.14 ? 322 HIS B CB  1 
ATOM   6487 C  CG  . HIS B 1 321 ? 41.687  -29.916 -27.826 1.00 40.66 ? 322 HIS B CG  1 
ATOM   6488 N  ND1 . HIS B 1 321 ? 41.177  -30.886 -26.988 1.00 42.62 ? 322 HIS B ND1 1 
ATOM   6489 C  CD2 . HIS B 1 321 ? 41.687  -30.454 -29.069 1.00 42.34 ? 322 HIS B CD2 1 
ATOM   6490 C  CE1 . HIS B 1 321 ? 40.891  -31.966 -27.693 1.00 44.57 ? 322 HIS B CE1 1 
ATOM   6491 N  NE2 . HIS B 1 321 ? 41.192  -31.730 -28.959 1.00 44.35 ? 322 HIS B NE2 1 
ATOM   6492 N  N   . GLN B 1 322 ? 44.926  -28.696 -28.533 1.00 39.13 ? 323 GLN B N   1 
ATOM   6493 C  CA  . GLN B 1 322 ? 45.883  -29.321 -29.443 1.00 40.32 ? 323 GLN B CA  1 
ATOM   6494 C  C   . GLN B 1 322 ? 47.263  -29.521 -28.811 1.00 40.57 ? 323 GLN B C   1 
ATOM   6495 O  O   . GLN B 1 322 ? 47.977  -30.452 -29.172 1.00 40.66 ? 323 GLN B O   1 
ATOM   6496 C  CB  . GLN B 1 322 ? 45.998  -28.523 -30.738 1.00 40.44 ? 323 GLN B CB  1 
ATOM   6497 C  CG  . GLN B 1 322 ? 46.560  -29.333 -31.883 1.00 43.51 ? 323 GLN B CG  1 
ATOM   6498 C  CD  . GLN B 1 322 ? 47.113  -28.468 -32.983 1.00 45.76 ? 323 GLN B CD  1 
ATOM   6499 O  OE1 . GLN B 1 322 ? 46.417  -27.597 -33.514 1.00 48.42 ? 323 GLN B OE1 1 
ATOM   6500 N  NE2 . GLN B 1 322 ? 48.379  -28.700 -33.340 1.00 46.64 ? 323 GLN B NE2 1 
ATOM   6501 N  N   . ALA B 1 323 ? 47.626  -28.653 -27.867 1.00 40.76 ? 324 ALA B N   1 
ATOM   6502 C  CA  . ALA B 1 323 ? 48.913  -28.748 -27.172 1.00 41.18 ? 324 ALA B CA  1 
ATOM   6503 C  C   . ALA B 1 323 ? 48.836  -29.667 -25.953 1.00 41.64 ? 324 ALA B C   1 
ATOM   6504 O  O   . ALA B 1 323 ? 49.847  -29.905 -25.279 1.00 41.69 ? 324 ALA B O   1 
ATOM   6505 C  CB  . ALA B 1 323 ? 49.394  -27.353 -26.760 1.00 41.35 ? 324 ALA B CB  1 
ATOM   6506 N  N   . GLN B 1 324 ? 47.631  -30.177 -25.683 1.00 41.88 ? 325 GLN B N   1 
ATOM   6507 C  CA  . GLN B 1 324 ? 47.334  -31.004 -24.505 1.00 42.35 ? 325 GLN B CA  1 
ATOM   6508 C  C   . GLN B 1 324 ? 47.757  -30.319 -23.203 1.00 42.17 ? 325 GLN B C   1 
ATOM   6509 O  O   . GLN B 1 324 ? 48.230  -30.970 -22.283 1.00 42.08 ? 325 GLN B O   1 
ATOM   6510 C  CB  . GLN B 1 324 ? 47.952  -32.412 -24.623 1.00 42.74 ? 325 GLN B CB  1 
ATOM   6511 C  CG  . GLN B 1 324 ? 47.340  -33.298 -25.710 1.00 44.86 ? 325 GLN B CG  1 
ATOM   6512 C  CD  . GLN B 1 324 ? 48.152  -34.569 -25.965 1.00 47.58 ? 325 GLN B CD  1 
ATOM   6513 O  OE1 . GLN B 1 324 ? 48.167  -35.492 -25.147 1.00 48.59 ? 325 GLN B OE1 1 
ATOM   6514 N  NE2 . GLN B 1 324 ? 48.822  -34.622 -27.114 1.00 48.26 ? 325 GLN B NE2 1 
ATOM   6515 N  N   . GLY B 1 325 ? 47.584  -28.996 -23.142 1.00 42.04 ? 326 GLY B N   1 
ATOM   6516 C  CA  . GLY B 1 325 ? 47.844  -28.233 -21.917 1.00 41.45 ? 326 GLY B CA  1 
ATOM   6517 C  C   . GLY B 1 325 ? 49.235  -27.632 -21.775 1.00 41.14 ? 326 GLY B C   1 
ATOM   6518 O  O   . GLY B 1 325 ? 49.439  -26.764 -20.927 1.00 41.51 ? 326 GLY B O   1 
ATOM   6519 N  N   . ASP B 1 326 ? 50.186  -28.086 -22.598 1.00 40.39 ? 327 ASP B N   1 
ATOM   6520 C  CA  . ASP B 1 326 ? 51.588  -27.644 -22.522 1.00 39.50 ? 327 ASP B CA  1 
ATOM   6521 C  C   . ASP B 1 326 ? 51.796  -26.203 -23.041 1.00 38.49 ? 327 ASP B C   1 
ATOM   6522 O  O   . ASP B 1 326 ? 51.542  -25.921 -24.213 1.00 38.64 ? 327 ASP B O   1 
ATOM   6523 C  CB  . ASP B 1 326 ? 52.487  -28.618 -23.300 1.00 39.62 ? 327 ASP B CB  1 
ATOM   6524 C  CG  . ASP B 1 326 ? 53.974  -28.314 -23.126 1.00 41.34 ? 327 ASP B CG  1 
ATOM   6525 O  OD1 . ASP B 1 326 ? 54.450  -28.279 -21.967 1.00 44.01 ? 327 ASP B OD1 1 
ATOM   6526 O  OD2 . ASP B 1 326 ? 54.672  -28.114 -24.144 1.00 42.70 ? 327 ASP B OD2 1 
ATOM   6527 N  N   . MET B 1 327 ? 52.273  -25.303 -22.181 1.00 37.32 ? 328 MET B N   1 
ATOM   6528 C  CA  . MET B 1 327 ? 52.433  -23.886 -22.564 1.00 35.95 ? 328 MET B CA  1 
ATOM   6529 C  C   . MET B 1 327 ? 53.429  -23.691 -23.709 1.00 34.92 ? 328 MET B C   1 
ATOM   6530 O  O   . MET B 1 327 ? 53.161  -22.931 -24.637 1.00 34.51 ? 328 MET B O   1 
ATOM   6531 C  CB  . MET B 1 327 ? 52.830  -23.008 -21.366 1.00 35.86 ? 328 MET B CB  1 
ATOM   6532 C  CG  . MET B 1 327 ? 52.911  -21.497 -21.679 1.00 35.02 ? 328 MET B CG  1 
ATOM   6533 S  SD  . MET B 1 327 ? 51.425  -20.778 -22.463 1.00 32.48 ? 328 MET B SD  1 
ATOM   6534 C  CE  . MET B 1 327 ? 50.241  -20.825 -21.106 1.00 32.23 ? 328 MET B CE  1 
ATOM   6535 N  N   . ALA B 1 328 ? 54.567  -24.374 -23.645 1.00 34.14 ? 329 ALA B N   1 
ATOM   6536 C  CA  . ALA B 1 328 ? 55.592  -24.247 -24.692 1.00 33.92 ? 329 ALA B CA  1 
ATOM   6537 C  C   . ALA B 1 328 ? 55.049  -24.582 -26.075 1.00 33.83 ? 329 ALA B C   1 
ATOM   6538 O  O   . ALA B 1 328 ? 55.290  -23.854 -27.042 1.00 33.95 ? 329 ALA B O   1 
ATOM   6539 C  CB  . ALA B 1 328 ? 56.818  -25.103 -24.364 1.00 34.06 ? 329 ALA B CB  1 
ATOM   6540 N  N   . THR B 1 329 ? 54.295  -25.677 -26.157 1.00 33.48 ? 330 THR B N   1 
ATOM   6541 C  CA  . THR B 1 329 ? 53.686  -26.117 -27.410 1.00 33.16 ? 330 THR B CA  1 
ATOM   6542 C  C   . THR B 1 329 ? 52.652  -25.110 -27.916 1.00 32.63 ? 330 THR B C   1 
ATOM   6543 O  O   . THR B 1 329 ? 52.645  -24.736 -29.091 1.00 32.02 ? 330 THR B O   1 
ATOM   6544 C  CB  . THR B 1 329 ? 53.008  -27.497 -27.232 1.00 33.31 ? 330 THR B CB  1 
ATOM   6545 O  OG1 . THR B 1 329 ? 53.914  -28.391 -26.567 1.00 34.28 ? 330 THR B OG1 1 
ATOM   6546 C  CG2 . THR B 1 329 ? 52.589  -28.079 -28.588 1.00 33.53 ? 330 THR B CG2 1 
ATOM   6547 N  N   . MET B 1 330 ? 51.789  -24.687 -27.003 1.00 32.08 ? 331 MET B N   1 
ATOM   6548 C  CA  . MET B 1 330 ? 50.703  -23.748 -27.256 1.00 32.60 ? 331 MET B CA  1 
ATOM   6549 C  C   . MET B 1 330 ? 51.133  -22.430 -27.914 1.00 32.39 ? 331 MET B C   1 
ATOM   6550 O  O   . MET B 1 330 ? 50.425  -21.883 -28.769 1.00 31.58 ? 331 MET B O   1 
ATOM   6551 C  CB  . MET B 1 330 ? 50.076  -23.408 -25.916 1.00 32.76 ? 331 MET B CB  1 
ATOM   6552 C  CG  . MET B 1 330 ? 48.632  -23.158 -25.964 1.00 34.77 ? 331 MET B CG  1 
ATOM   6553 S  SD  . MET B 1 330 ? 48.083  -22.750 -24.301 1.00 37.38 ? 331 MET B SD  1 
ATOM   6554 C  CE  . MET B 1 330 ? 46.597  -21.892 -24.790 1.00 35.03 ? 331 MET B CE  1 
ATOM   6555 N  N   . LEU B 1 331 ? 52.290  -21.931 -27.494 1.00 32.24 ? 332 LEU B N   1 
ATOM   6556 C  CA  . LEU B 1 331 ? 52.761  -20.618 -27.915 1.00 33.27 ? 332 LEU B CA  1 
ATOM   6557 C  C   . LEU B 1 331 ? 53.197  -20.594 -29.375 1.00 33.84 ? 332 LEU B C   1 
ATOM   6558 O  O   . LEU B 1 331 ? 53.478  -19.531 -29.917 1.00 34.20 ? 332 LEU B O   1 
ATOM   6559 C  CB  . LEU B 1 331 ? 53.908  -20.152 -27.010 1.00 32.97 ? 332 LEU B CB  1 
ATOM   6560 C  CG  . LEU B 1 331 ? 53.516  -19.681 -25.606 1.00 32.92 ? 332 LEU B CG  1 
ATOM   6561 C  CD1 . LEU B 1 331 ? 54.725  -19.721 -24.688 1.00 32.67 ? 332 LEU B CD1 1 
ATOM   6562 C  CD2 . LEU B 1 331 ? 52.914  -18.290 -25.653 1.00 31.07 ? 332 LEU B CD2 1 
ATOM   6563 N  N   . GLN B 1 332 ? 53.268  -21.765 -30.006 1.00 34.39 ? 333 GLN B N   1 
ATOM   6564 C  CA  . GLN B 1 332 ? 53.524  -21.824 -31.445 1.00 34.83 ? 333 GLN B CA  1 
ATOM   6565 C  C   . GLN B 1 332 ? 52.217  -22.084 -32.202 1.00 33.96 ? 333 GLN B C   1 
ATOM   6566 O  O   . GLN B 1 332 ? 52.220  -22.259 -33.421 1.00 34.46 ? 333 GLN B O   1 
ATOM   6567 C  CB  . GLN B 1 332 ? 54.604  -22.868 -31.784 1.00 35.43 ? 333 GLN B CB  1 
ATOM   6568 C  CG  . GLN B 1 332 ? 56.003  -22.610 -31.154 1.00 38.30 ? 333 GLN B CG  1 
ATOM   6569 C  CD  . GLN B 1 332 ? 56.628  -21.261 -31.549 1.00 41.95 ? 333 GLN B CD  1 
ATOM   6570 O  OE1 . GLN B 1 332 ? 56.794  -20.946 -32.735 1.00 44.61 ? 333 GLN B OE1 1 
ATOM   6571 N  NE2 . GLN B 1 332 ? 56.986  -20.465 -30.546 1.00 43.23 ? 333 GLN B NE2 1 
ATOM   6572 N  N   . LEU B 1 333 ? 51.098  -22.065 -31.481 1.00 32.92 ? 334 LEU B N   1 
ATOM   6573 C  CA  . LEU B 1 333 ? 49.788  -22.366 -32.075 1.00 31.44 ? 334 LEU B CA  1 
ATOM   6574 C  C   . LEU B 1 333 ? 48.789  -21.214 -31.990 1.00 30.80 ? 334 LEU B C   1 
ATOM   6575 O  O   . LEU B 1 333 ? 47.588  -21.404 -32.205 1.00 29.93 ? 334 LEU B O   1 
ATOM   6576 C  CB  . LEU B 1 333 ? 49.203  -23.640 -31.446 1.00 32.15 ? 334 LEU B CB  1 
ATOM   6577 C  CG  . LEU B 1 333 ? 50.048  -24.916 -31.570 1.00 32.31 ? 334 LEU B CG  1 
ATOM   6578 C  CD1 . LEU B 1 333 ? 49.416  -26.060 -30.800 1.00 33.78 ? 334 LEU B CD1 1 
ATOM   6579 C  CD2 . LEU B 1 333 ? 50.223  -25.285 -33.035 1.00 34.19 ? 334 LEU B CD2 1 
ATOM   6580 N  N   . VAL B 1 334 ? 49.286  -20.009 -31.707 1.00 29.89 ? 335 VAL B N   1 
ATOM   6581 C  CA  . VAL B 1 334 ? 48.419  -18.846 -31.563 1.00 29.29 ? 335 VAL B CA  1 
ATOM   6582 C  C   . VAL B 1 334 ? 48.849  -17.665 -32.457 1.00 29.60 ? 335 VAL B C   1 
ATOM   6583 O  O   . VAL B 1 334 ? 49.067  -16.560 -31.947 1.00 29.48 ? 335 VAL B O   1 
ATOM   6584 C  CB  . VAL B 1 334 ? 48.310  -18.403 -30.074 1.00 29.67 ? 335 VAL B CB  1 
ATOM   6585 C  CG1 . VAL B 1 334 ? 47.407  -19.355 -29.288 1.00 29.36 ? 335 VAL B CG1 1 
ATOM   6586 C  CG2 . VAL B 1 334 ? 49.710  -18.298 -29.398 1.00 28.44 ? 335 VAL B CG2 1 
ATOM   6587 N  N   . PRO B 1 335 ? 48.962  -17.884 -33.793 1.00 29.37 ? 336 PRO B N   1 
ATOM   6588 C  CA  . PRO B 1 335 ? 49.457  -16.813 -34.656 1.00 28.79 ? 336 PRO B CA  1 
ATOM   6589 C  C   . PRO B 1 335 ? 48.611  -15.533 -34.625 1.00 28.25 ? 336 PRO B C   1 
ATOM   6590 O  O   . PRO B 1 335 ? 49.167  -14.443 -34.685 1.00 27.66 ? 336 PRO B O   1 
ATOM   6591 C  CB  . PRO B 1 335 ? 49.444  -17.454 -36.061 1.00 29.22 ? 336 PRO B CB  1 
ATOM   6592 C  CG  . PRO B 1 335 ? 48.485  -18.594 -35.961 1.00 29.28 ? 336 PRO B CG  1 
ATOM   6593 C  CD  . PRO B 1 335 ? 48.742  -19.123 -34.573 1.00 29.48 ? 336 PRO B CD  1 
ATOM   6594 N  N   . LEU B 1 336 ? 47.293  -15.668 -34.514 1.00 27.69 ? 337 LEU B N   1 
ATOM   6595 C  CA  . LEU B 1 336 ? 46.414  -14.511 -34.489 1.00 27.71 ? 337 LEU B CA  1 
ATOM   6596 C  C   . LEU B 1 336 ? 46.576  -13.677 -33.219 1.00 27.36 ? 337 LEU B C   1 
ATOM   6597 O  O   . LEU B 1 336 ? 46.481  -12.456 -33.274 1.00 27.21 ? 337 LEU B O   1 
ATOM   6598 C  CB  . LEU B 1 336 ? 44.947  -14.913 -34.672 1.00 27.83 ? 337 LEU B CB  1 
ATOM   6599 C  CG  . LEU B 1 336 ? 43.949  -13.774 -34.915 1.00 27.94 ? 337 LEU B CG  1 
ATOM   6600 C  CD1 . LEU B 1 336 ? 44.098  -13.189 -36.316 1.00 29.33 ? 337 LEU B CD1 1 
ATOM   6601 C  CD2 . LEU B 1 336 ? 42.515  -14.228 -34.693 1.00 29.38 ? 337 LEU B CD2 1 
ATOM   6602 N  N   . LEU B 1 337 ? 46.830  -14.336 -32.090 1.00 26.68 ? 338 LEU B N   1 
ATOM   6603 C  CA  . LEU B 1 337 ? 47.087  -13.639 -30.824 1.00 26.28 ? 338 LEU B CA  1 
ATOM   6604 C  C   . LEU B 1 337 ? 48.399  -12.859 -30.886 1.00 26.26 ? 338 LEU B C   1 
ATOM   6605 O  O   . LEU B 1 337 ? 48.487  -11.715 -30.413 1.00 26.10 ? 338 LEU B O   1 
ATOM   6606 C  CB  . LEU B 1 337 ? 47.103  -14.616 -29.631 1.00 25.45 ? 338 LEU B CB  1 
ATOM   6607 C  CG  . LEU B 1 337 ? 47.314  -14.022 -28.225 1.00 25.05 ? 338 LEU B CG  1 
ATOM   6608 C  CD1 . LEU B 1 337 ? 46.270  -12.947 -27.910 1.00 21.12 ? 338 LEU B CD1 1 
ATOM   6609 C  CD2 . LEU B 1 337 ? 47.302  -15.125 -27.146 1.00 21.51 ? 338 LEU B CD2 1 
ATOM   6610 N  N   . LYS B 1 338 ? 49.414  -13.485 -31.466 1.00 26.07 ? 339 LYS B N   1 
ATOM   6611 C  CA  . LYS B 1 338 ? 50.682  -12.821 -31.681 1.00 25.94 ? 339 LYS B CA  1 
ATOM   6612 C  C   . LYS B 1 338 ? 50.539  -11.649 -32.637 1.00 25.81 ? 339 LYS B C   1 
ATOM   6613 O  O   . LYS B 1 338 ? 51.197  -10.624 -32.462 1.00 25.40 ? 339 LYS B O   1 
ATOM   6614 C  CB  . LYS B 1 338 ? 51.733  -13.808 -32.161 1.00 26.62 ? 339 LYS B CB  1 
ATOM   6615 C  CG  . LYS B 1 338 ? 52.044  -14.842 -31.093 1.00 27.92 ? 339 LYS B CG  1 
ATOM   6616 C  CD  . LYS B 1 338 ? 53.262  -15.639 -31.456 1.00 31.27 ? 339 LYS B CD  1 
ATOM   6617 C  CE  . LYS B 1 338 ? 53.735  -16.427 -30.263 1.00 32.80 ? 339 LYS B CE  1 
ATOM   6618 N  NZ  . LYS B 1 338 ? 55.112  -16.925 -30.476 1.00 34.47 ? 339 LYS B NZ  1 
ATOM   6619 N  N   . ALA B 1 339 ? 49.664  -11.806 -33.631 1.00 24.87 ? 340 ALA B N   1 
ATOM   6620 C  CA  . ALA B 1 339 ? 49.349  -10.728 -34.555 1.00 24.73 ? 340 ALA B CA  1 
ATOM   6621 C  C   . ALA B 1 339 ? 48.637  -9.590  -33.836 1.00 23.97 ? 340 ALA B C   1 
ATOM   6622 O  O   . ALA B 1 339 ? 48.849  -8.435  -34.168 1.00 24.46 ? 340 ALA B O   1 
ATOM   6623 C  CB  . ALA B 1 339 ? 48.481  -11.241 -35.745 1.00 23.80 ? 340 ALA B CB  1 
ATOM   6624 N  N   . SER B 1 340 ? 47.783  -9.921  -32.863 1.00 23.13 ? 341 SER B N   1 
ATOM   6625 C  CA  . SER B 1 340 ? 46.988  -8.918  -32.167 1.00 22.27 ? 341 SER B CA  1 
ATOM   6626 C  C   . SER B 1 340 ? 47.866  -8.022  -31.292 1.00 22.03 ? 341 SER B C   1 
ATOM   6627 O  O   . SER B 1 340 ? 47.510  -6.885  -30.999 1.00 22.04 ? 341 SER B O   1 
ATOM   6628 C  CB  . SER B 1 340 ? 45.890  -9.577  -31.317 1.00 21.59 ? 341 SER B CB  1 
ATOM   6629 O  OG  . SER B 1 340 ? 46.456  -10.402 -30.307 1.00 22.57 ? 341 SER B OG  1 
ATOM   6630 N  N   . ILE B 1 341 ? 48.996  -8.564  -30.866 1.00 22.36 ? 342 ILE B N   1 
ATOM   6631 C  CA  . ILE B 1 341 ? 49.983  -7.844  -30.085 1.00 22.69 ? 342 ILE B CA  1 
ATOM   6632 C  C   . ILE B 1 341 ? 50.743  -6.848  -30.968 1.00 23.35 ? 342 ILE B C   1 
ATOM   6633 O  O   . ILE B 1 341 ? 50.935  -5.696  -30.577 1.00 22.50 ? 342 ILE B O   1 
ATOM   6634 C  CB  . ILE B 1 341 ? 50.927  -8.826  -29.389 1.00 22.68 ? 342 ILE B CB  1 
ATOM   6635 C  CG1 . ILE B 1 341 ? 50.145  -9.572  -28.284 1.00 23.18 ? 342 ILE B CG1 1 
ATOM   6636 C  CG2 . ILE B 1 341 ? 52.138  -8.099  -28.811 1.00 20.83 ? 342 ILE B CG2 1 
ATOM   6637 C  CD1 . ILE B 1 341 ? 50.937  -10.671 -27.594 1.00 23.80 ? 342 ILE B CD1 1 
ATOM   6638 N  N   . LYS B 1 342 ? 51.153  -7.299  -32.157 1.00 23.40 ? 343 LYS B N   1 
ATOM   6639 C  CA  . LYS B 1 342 ? 51.687  -6.409  -33.189 1.00 23.71 ? 343 LYS B CA  1 
ATOM   6640 C  C   . LYS B 1 342 ? 50.673  -5.318  -33.519 1.00 23.32 ? 343 LYS B C   1 
ATOM   6641 O  O   . LYS B 1 342 ? 51.015  -4.137  -33.638 1.00 23.97 ? 343 LYS B O   1 
ATOM   6642 C  CB  . LYS B 1 342 ? 52.013  -7.213  -34.452 1.00 23.98 ? 343 LYS B CB  1 
ATOM   6643 C  CG  . LYS B 1 342 ? 53.122  -8.246  -34.296 1.00 24.54 ? 343 LYS B CG  1 
ATOM   6644 C  CD  . LYS B 1 342 ? 53.273  -9.017  -35.611 1.00 28.02 ? 343 LYS B CD  1 
ATOM   6645 C  CE  . LYS B 1 342 ? 54.295  -10.139 -35.493 1.00 30.23 ? 343 LYS B CE  1 
ATOM   6646 N  NZ  . LYS B 1 342 ? 54.399  -10.914 -36.768 1.00 32.16 ? 343 LYS B NZ  1 
ATOM   6647 N  N   . GLU B 1 343 ? 49.408  -5.711  -33.631 1.00 22.73 ? 344 GLU B N   1 
ATOM   6648 C  CA  . GLU B 1 343 ? 48.353  -4.767  -33.952 1.00 21.65 ? 344 GLU B CA  1 
ATOM   6649 C  C   . GLU B 1 343 ? 48.109  -3.767  -32.798 1.00 21.65 ? 344 GLU B C   1 
ATOM   6650 O  O   . GLU B 1 343 ? 47.757  -2.599  -33.031 1.00 20.29 ? 344 GLU B O   1 
ATOM   6651 C  CB  . GLU B 1 343 ? 47.077  -5.523  -34.334 1.00 21.50 ? 344 GLU B CB  1 
ATOM   6652 C  CG  . GLU B 1 343 ? 45.920  -4.634  -34.801 1.00 21.29 ? 344 GLU B CG  1 
ATOM   6653 C  CD  . GLU B 1 343 ? 46.172  -3.963  -36.166 1.00 22.01 ? 344 GLU B CD  1 
ATOM   6654 O  OE1 . GLU B 1 343 ? 47.325  -3.982  -36.667 1.00 22.71 ? 344 GLU B OE1 1 
ATOM   6655 O  OE2 . GLU B 1 343 ? 45.213  -3.419  -36.730 1.00 19.33 ? 344 GLU B OE2 1 
ATOM   6656 N  N   . THR B 1 344 ? 48.312  -4.223  -31.563 1.00 21.18 ? 345 THR B N   1 
ATOM   6657 C  CA  . THR B 1 344 ? 48.183  -3.324  -30.407 1.00 21.32 ? 345 THR B CA  1 
ATOM   6658 C  C   . THR B 1 344 ? 49.323  -2.316  -30.402 1.00 21.18 ? 345 THR B C   1 
ATOM   6659 O  O   . THR B 1 344 ? 49.098  -1.126  -30.192 1.00 21.60 ? 345 THR B O   1 
ATOM   6660 C  CB  . THR B 1 344 ? 48.095  -4.083  -29.061 1.00 20.87 ? 345 THR B CB  1 
ATOM   6661 O  OG1 . THR B 1 344 ? 46.882  -4.840  -29.040 1.00 21.33 ? 345 THR B OG1 1 
ATOM   6662 C  CG2 . THR B 1 344 ? 48.090  -3.100  -27.867 1.00 20.28 ? 345 THR B CG2 1 
ATOM   6663 N  N   . LEU B 1 345 ? 50.541  -2.785  -30.639 1.00 21.51 ? 346 LEU B N   1 
ATOM   6664 C  CA  . LEU B 1 345 ? 51.680  -1.875  -30.692 1.00 22.19 ? 346 LEU B CA  1 
ATOM   6665 C  C   . LEU B 1 345 ? 51.627  -0.912  -31.881 1.00 22.04 ? 346 LEU B C   1 
ATOM   6666 O  O   . LEU B 1 345 ? 52.167  0.186   -31.801 1.00 22.82 ? 346 LEU B O   1 
ATOM   6667 C  CB  . LEU B 1 345 ? 53.000  -2.638  -30.664 1.00 22.56 ? 346 LEU B CB  1 
ATOM   6668 C  CG  . LEU B 1 345 ? 53.291  -3.148  -29.247 1.00 24.15 ? 346 LEU B CG  1 
ATOM   6669 C  CD1 . LEU B 1 345 ? 54.254  -4.297  -29.302 1.00 23.07 ? 346 LEU B CD1 1 
ATOM   6670 C  CD2 . LEU B 1 345 ? 53.816  -2.003  -28.337 1.00 24.86 ? 346 LEU B CD2 1 
ATOM   6671 N  N   . ARG B 1 346 ? 50.957  -1.303  -32.965 1.00 22.16 ? 347 ARG B N   1 
ATOM   6672 C  CA  . ARG B 1 346 ? 50.809  -0.407  -34.116 1.00 22.01 ? 347 ARG B CA  1 
ATOM   6673 C  C   . ARG B 1 346 ? 50.004  0.828   -33.724 1.00 21.42 ? 347 ARG B C   1 
ATOM   6674 O  O   . ARG B 1 346 ? 50.393  1.961   -34.030 1.00 21.59 ? 347 ARG B O   1 
ATOM   6675 C  CB  . ARG B 1 346 ? 50.139  -1.111  -35.307 1.00 21.74 ? 347 ARG B CB  1 
ATOM   6676 C  CG  . ARG B 1 346 ? 49.912  -0.184  -36.504 1.00 21.80 ? 347 ARG B CG  1 
ATOM   6677 C  CD  . ARG B 1 346 ? 49.128  -0.870  -37.627 1.00 23.70 ? 347 ARG B CD  1 
ATOM   6678 N  NE  . ARG B 1 346 ? 47.757  -1.200  -37.235 1.00 22.16 ? 347 ARG B NE  1 
ATOM   6679 C  CZ  . ARG B 1 346 ? 46.752  -0.332  -37.197 1.00 22.43 ? 347 ARG B CZ  1 
ATOM   6680 N  NH1 . ARG B 1 346 ? 46.932  0.949   -37.515 1.00 25.20 ? 347 ARG B NH1 1 
ATOM   6681 N  NH2 . ARG B 1 346 ? 45.549  -0.743  -36.842 1.00 23.23 ? 347 ARG B NH2 1 
ATOM   6682 N  N   . LEU B 1 347 ? 48.883  0.606   -33.052 1.00 21.06 ? 348 LEU B N   1 
ATOM   6683 C  CA  . LEU B 1 347 ? 48.008  1.703   -32.687 1.00 21.43 ? 348 LEU B CA  1 
ATOM   6684 C  C   . LEU B 1 347 ? 48.470  2.408   -31.420 1.00 20.92 ? 348 LEU B C   1 
ATOM   6685 O  O   . LEU B 1 347 ? 48.216  3.605   -31.243 1.00 21.10 ? 348 LEU B O   1 
ATOM   6686 C  CB  . LEU B 1 347 ? 46.572  1.208   -32.488 1.00 21.42 ? 348 LEU B CB  1 
ATOM   6687 C  CG  . LEU B 1 347 ? 45.658  1.036   -33.708 1.00 22.89 ? 348 LEU B CG  1 
ATOM   6688 C  CD1 . LEU B 1 347 ? 44.442  0.247   -33.275 1.00 21.89 ? 348 LEU B CD1 1 
ATOM   6689 C  CD2 . LEU B 1 347 ? 45.219  2.374   -34.298 1.00 20.66 ? 348 LEU B CD2 1 
ATOM   6690 N  N   . HIS B 1 348 ? 49.100  1.643   -30.532 1.00 20.49 ? 349 HIS B N   1 
ATOM   6691 C  CA  . HIS B 1 348 ? 49.499  2.122   -29.215 1.00 20.09 ? 349 HIS B CA  1 
ATOM   6692 C  C   . HIS B 1 348 ? 50.959  1.782   -28.903 1.00 20.03 ? 349 HIS B C   1 
ATOM   6693 O  O   . HIS B 1 348 ? 51.235  0.965   -28.007 1.00 19.97 ? 349 HIS B O   1 
ATOM   6694 C  CB  . HIS B 1 348 ? 48.576  1.539   -28.138 1.00 20.66 ? 349 HIS B CB  1 
ATOM   6695 C  CG  . HIS B 1 348 ? 47.125  1.731   -28.432 1.00 20.41 ? 349 HIS B CG  1 
ATOM   6696 N  ND1 . HIS B 1 348 ? 46.522  2.972   -28.422 1.00 20.56 ? 349 HIS B ND1 1 
ATOM   6697 C  CD2 . HIS B 1 348 ? 46.156  0.841   -28.760 1.00 19.44 ? 349 HIS B CD2 1 
ATOM   6698 C  CE1 . HIS B 1 348 ? 45.243  2.838   -28.730 1.00 20.57 ? 349 HIS B CE1 1 
ATOM   6699 N  NE2 . HIS B 1 348 ? 44.995  1.554   -28.934 1.00 20.72 ? 349 HIS B NE2 1 
ATOM   6700 N  N   . PRO B 1 349 ? 51.910  2.403   -29.636 1.00 19.13 ? 350 PRO B N   1 
ATOM   6701 C  CA  . PRO B 1 349 ? 53.310  2.155   -29.357 1.00 18.86 ? 350 PRO B CA  1 
ATOM   6702 C  C   . PRO B 1 349 ? 53.670  2.683   -27.973 1.00 19.05 ? 350 PRO B C   1 
ATOM   6703 O  O   . PRO B 1 349 ? 53.064  3.645   -27.498 1.00 19.73 ? 350 PRO B O   1 
ATOM   6704 C  CB  . PRO B 1 349 ? 54.034  2.982   -30.427 1.00 18.54 ? 350 PRO B CB  1 
ATOM   6705 C  CG  . PRO B 1 349 ? 53.100  3.994   -30.832 1.00 17.81 ? 350 PRO B CG  1 
ATOM   6706 C  CD  . PRO B 1 349 ? 51.738  3.429   -30.673 1.00 19.50 ? 350 PRO B CD  1 
ATOM   6707 N  N   . ILE B 1 350 ? 54.632  2.043   -27.335 1.00 19.20 ? 351 ILE B N   1 
ATOM   6708 C  CA  . ILE B 1 350 ? 55.205  2.556   -26.105 1.00 18.44 ? 351 ILE B CA  1 
ATOM   6709 C  C   . ILE B 1 350 ? 56.115  3.744   -26.443 1.00 18.66 ? 351 ILE B C   1 
ATOM   6710 O  O   . ILE B 1 350 ? 56.107  4.784   -25.757 1.00 18.42 ? 351 ILE B O   1 
ATOM   6711 C  CB  . ILE B 1 350 ? 55.970  1.418   -25.368 1.00 18.79 ? 351 ILE B CB  1 
ATOM   6712 C  CG1 . ILE B 1 350 ? 54.987  0.535   -24.578 1.00 18.32 ? 351 ILE B CG1 1 
ATOM   6713 C  CG2 . ILE B 1 350 ? 57.119  1.956   -24.493 1.00 17.85 ? 351 ILE B CG2 1 
ATOM   6714 C  CD1 . ILE B 1 350 ? 54.383  1.177   -23.314 1.00 15.24 ? 351 ILE B CD1 1 
ATOM   6715 N  N   . SER B 1 351 ? 56.890  3.551   -27.499 1.00 17.61 ? 352 SER B N   1 
ATOM   6716 C  CA  . SER B 1 351 ? 57.890  4.509   -27.995 1.00 18.88 ? 352 SER B CA  1 
ATOM   6717 C  C   . SER B 1 351 ? 57.383  5.365   -29.129 1.00 18.25 ? 352 SER B C   1 
ATOM   6718 O  O   . SER B 1 351 ? 57.076  4.852   -30.211 1.00 18.50 ? 352 SER B O   1 
ATOM   6719 C  CB  . SER B 1 351 ? 59.096  3.724   -28.472 1.00 18.64 ? 352 SER B CB  1 
ATOM   6720 O  OG  . SER B 1 351 ? 60.271  4.495   -28.372 1.00 20.90 ? 352 SER B OG  1 
ATOM   6721 N  N   . VAL B 1 352 ? 57.277  6.684   -28.938 1.00 17.42 ? 353 VAL B N   1 
ATOM   6722 C  CA  . VAL B 1 352 ? 56.748  7.534   -30.013 1.00 17.65 ? 353 VAL B CA  1 
ATOM   6723 C  C   . VAL B 1 352 ? 57.536  7.434   -31.300 1.00 17.03 ? 353 VAL B C   1 
ATOM   6724 O  O   . VAL B 1 352 ? 56.979  7.468   -32.405 1.00 16.84 ? 353 VAL B O   1 
ATOM   6725 C  CB  . VAL B 1 352 ? 56.736  9.018   -29.604 1.00 18.16 ? 353 VAL B CB  1 
ATOM   6726 C  CG1 . VAL B 1 352 ? 58.155  9.533   -29.426 1.00 18.24 ? 353 VAL B CG1 1 
ATOM   6727 C  CG2 . VAL B 1 352 ? 55.985  9.848   -30.635 1.00 17.40 ? 353 VAL B CG2 1 
ATOM   6728 N  N   . THR B 1 353 ? 58.843  7.332   -31.167 1.00 17.22 ? 354 THR B N   1 
ATOM   6729 C  CA  . THR B 1 353 ? 59.729  7.234   -32.306 1.00 17.75 ? 354 THR B CA  1 
ATOM   6730 C  C   . THR B 1 353 ? 60.807  6.175   -32.018 1.00 18.27 ? 354 THR B C   1 
ATOM   6731 O  O   . THR B 1 353 ? 61.006  5.763   -30.872 1.00 19.04 ? 354 THR B O   1 
ATOM   6732 C  CB  . THR B 1 353 ? 60.471  8.534   -32.554 1.00 17.33 ? 354 THR B CB  1 
ATOM   6733 O  OG1 . THR B 1 353 ? 61.370  8.757   -31.463 1.00 18.14 ? 354 THR B OG1 1 
ATOM   6734 C  CG2 . THR B 1 353 ? 59.484  9.682   -32.679 1.00 17.03 ? 354 THR B CG2 1 
ATOM   6735 N  N   . LEU B 1 354 ? 61.463  5.771   -33.081 1.00 17.93 ? 355 LEU B N   1 
ATOM   6736 C  CA  . LEU B 1 354 ? 62.769  5.152   -32.999 1.00 18.46 ? 355 LEU B CA  1 
ATOM   6737 C  C   . LEU B 1 354 ? 63.743  6.197   -33.532 1.00 18.36 ? 355 LEU B C   1 
ATOM   6738 O  O   . LEU B 1 354 ? 63.365  7.025   -34.353 1.00 17.18 ? 355 LEU B O   1 
ATOM   6739 C  CB  . LEU B 1 354 ? 62.837  3.916   -33.905 1.00 18.13 ? 355 LEU B CB  1 
ATOM   6740 C  CG  . LEU B 1 354 ? 61.868  2.768   -33.659 1.00 19.11 ? 355 LEU B CG  1 
ATOM   6741 C  CD1 . LEU B 1 354 ? 62.015  1.697   -34.761 1.00 20.00 ? 355 LEU B CD1 1 
ATOM   6742 C  CD2 . LEU B 1 354 ? 62.043  2.157   -32.276 1.00 19.71 ? 355 LEU B CD2 1 
ATOM   6743 N  N   . GLN B 1 355 ? 64.985  6.155   -33.062 1.00 19.12 ? 356 GLN B N   1 
ATOM   6744 C  CA  . GLN B 1 355 ? 66.002  7.094   -33.531 1.00 19.75 ? 356 GLN B CA  1 
ATOM   6745 C  C   . GLN B 1 355 ? 67.356  6.400   -33.731 1.00 20.61 ? 356 GLN B C   1 
ATOM   6746 O  O   . GLN B 1 355 ? 67.700  5.447   -33.016 1.00 20.03 ? 356 GLN B O   1 
ATOM   6747 C  CB  . GLN B 1 355 ? 66.181  8.284   -32.565 1.00 19.48 ? 356 GLN B CB  1 
ATOM   6748 C  CG  . GLN B 1 355 ? 64.982  8.623   -31.639 1.00 18.22 ? 356 GLN B CG  1 
ATOM   6749 C  CD  . GLN B 1 355 ? 64.849  7.659   -30.461 1.00 19.00 ? 356 GLN B CD  1 
ATOM   6750 O  OE1 . GLN B 1 355 ? 65.842  7.277   -29.846 1.00 19.58 ? 356 GLN B OE1 1 
ATOM   6751 N  NE2 . GLN B 1 355 ? 63.615  7.260   -30.144 1.00 17.96 ? 356 GLN B NE2 1 
ATOM   6752 N  N   . ARG B 1 356 ? 68.104  6.888   -34.716 1.00 21.24 ? 357 ARG B N   1 
ATOM   6753 C  CA  . ARG B 1 356 ? 69.465  6.466   -34.955 1.00 22.59 ? 357 ARG B CA  1 
ATOM   6754 C  C   . ARG B 1 356 ? 70.280  7.684   -35.392 1.00 22.93 ? 357 ARG B C   1 
ATOM   6755 O  O   . ARG B 1 356 ? 69.810  8.475   -36.191 1.00 22.84 ? 357 ARG B O   1 
ATOM   6756 C  CB  . ARG B 1 356 ? 69.527  5.368   -36.037 1.00 22.53 ? 357 ARG B CB  1 
ATOM   6757 C  CG  . ARG B 1 356 ? 68.962  3.991   -35.633 1.00 23.71 ? 357 ARG B CG  1 
ATOM   6758 C  CD  . ARG B 1 356 ? 69.752  3.329   -34.507 1.00 23.60 ? 357 ARG B CD  1 
ATOM   6759 N  NE  . ARG B 1 356 ? 69.275  1.977   -34.192 1.00 24.57 ? 357 ARG B NE  1 
ATOM   6760 C  CZ  . ARG B 1 356 ? 68.382  1.661   -33.248 1.00 24.61 ? 357 ARG B CZ  1 
ATOM   6761 N  NH1 . ARG B 1 356 ? 67.790  2.603   -32.500 1.00 23.57 ? 357 ARG B NH1 1 
ATOM   6762 N  NH2 . ARG B 1 356 ? 68.062  0.385   -33.060 1.00 23.77 ? 357 ARG B NH2 1 
ATOM   6763 N  N   . TYR B 1 357 ? 71.473  7.839   -34.828 1.00 23.96 ? 358 TYR B N   1 
ATOM   6764 C  CA  . TYR B 1 357 ? 72.462  8.768   -35.346 1.00 26.01 ? 358 TYR B CA  1 
ATOM   6765 C  C   . TYR B 1 357 ? 73.197  8.105   -36.517 1.00 27.01 ? 358 TYR B C   1 
ATOM   6766 O  O   . TYR B 1 357 ? 73.701  6.984   -36.388 1.00 26.66 ? 358 TYR B O   1 
ATOM   6767 C  CB  . TYR B 1 357 ? 73.493  9.137   -34.276 1.00 25.63 ? 358 TYR B CB  1 
ATOM   6768 C  CG  . TYR B 1 357 ? 72.975  10.049  -33.185 1.00 26.52 ? 358 TYR B CG  1 
ATOM   6769 C  CD1 . TYR B 1 357 ? 72.534  9.525   -31.971 1.00 25.17 ? 358 TYR B CD1 1 
ATOM   6770 C  CD2 . TYR B 1 357 ? 72.958  11.439  -33.357 1.00 25.85 ? 358 TYR B CD2 1 
ATOM   6771 C  CE1 . TYR B 1 357 ? 72.083  10.354  -30.949 1.00 26.05 ? 358 TYR B CE1 1 
ATOM   6772 C  CE2 . TYR B 1 357 ? 72.490  12.281  -32.345 1.00 25.33 ? 358 TYR B CE2 1 
ATOM   6773 C  CZ  . TYR B 1 357 ? 72.056  11.725  -31.148 1.00 25.84 ? 358 TYR B CZ  1 
ATOM   6774 O  OH  . TYR B 1 357 ? 71.604  12.535  -30.142 1.00 25.14 ? 358 TYR B OH  1 
ATOM   6775 N  N   . LEU B 1 358 ? 73.270  8.810   -37.639 1.00 28.36 ? 359 LEU B N   1 
ATOM   6776 C  CA  . LEU B 1 358 ? 73.944  8.279   -38.836 1.00 30.17 ? 359 LEU B CA  1 
ATOM   6777 C  C   . LEU B 1 358 ? 75.445  8.178   -38.644 1.00 31.36 ? 359 LEU B C   1 
ATOM   6778 O  O   . LEU B 1 358 ? 76.073  9.098   -38.122 1.00 31.63 ? 359 LEU B O   1 
ATOM   6779 C  CB  . LEU B 1 358 ? 73.624  9.115   -40.076 1.00 29.57 ? 359 LEU B CB  1 
ATOM   6780 C  CG  . LEU B 1 358 ? 72.150  9.198   -40.473 1.00 30.06 ? 359 LEU B CG  1 
ATOM   6781 C  CD1 . LEU B 1 358 ? 71.938  10.063  -41.700 1.00 28.82 ? 359 LEU B CD1 1 
ATOM   6782 C  CD2 . LEU B 1 358 ? 71.557  7.799   -40.673 1.00 30.22 ? 359 LEU B CD2 1 
ATOM   6783 N  N   . VAL B 1 359 ? 76.009  7.045   -39.048 1.00 33.26 ? 360 VAL B N   1 
ATOM   6784 C  CA  . VAL B 1 359 ? 77.469  6.862   -39.046 1.00 35.35 ? 360 VAL B CA  1 
ATOM   6785 C  C   . VAL B 1 359 ? 78.058  7.435   -40.339 1.00 36.05 ? 360 VAL B C   1 
ATOM   6786 O  O   . VAL B 1 359 ? 79.095  8.101   -40.308 1.00 37.10 ? 360 VAL B O   1 
ATOM   6787 C  CB  . VAL B 1 359 ? 77.865  5.374   -38.825 1.00 35.43 ? 360 VAL B CB  1 
ATOM   6788 C  CG1 . VAL B 1 359 ? 79.382  5.185   -38.886 1.00 36.81 ? 360 VAL B CG1 1 
ATOM   6789 C  CG2 . VAL B 1 359 ? 77.350  4.889   -37.472 1.00 36.26 ? 360 VAL B CG2 1 
ATOM   6790 N  N   . ASN B 1 360 ? 77.370  7.199   -41.455 1.00 36.96 ? 361 ASN B N   1 
ATOM   6791 C  CA  . ASN B 1 360 ? 77.739  7.731   -42.768 1.00 37.93 ? 361 ASN B CA  1 
ATOM   6792 C  C   . ASN B 1 360 ? 76.625  8.577   -43.381 1.00 38.25 ? 361 ASN B C   1 
ATOM   6793 O  O   . ASN B 1 360 ? 75.452  8.427   -43.015 1.00 38.20 ? 361 ASN B O   1 
ATOM   6794 C  CB  . ASN B 1 360 ? 78.055  6.582   -43.736 1.00 38.43 ? 361 ASN B CB  1 
ATOM   6795 C  CG  . ASN B 1 360 ? 79.145  5.666   -43.222 1.00 39.35 ? 361 ASN B CG  1 
ATOM   6796 O  OD1 . ASN B 1 360 ? 80.203  6.120   -42.794 1.00 40.49 ? 361 ASN B OD1 1 
ATOM   6797 N  ND2 . ASN B 1 360 ? 78.886  4.362   -43.258 1.00 40.70 ? 361 ASN B ND2 1 
ATOM   6798 N  N   . ASP B 1 361 ? 76.999  9.458   -44.313 1.00 38.44 ? 362 ASP B N   1 
ATOM   6799 C  CA  . ASP B 1 361 ? 76.041  10.221  -45.119 1.00 38.83 ? 362 ASP B CA  1 
ATOM   6800 C  C   . ASP B 1 361 ? 75.004  9.274   -45.700 1.00 38.76 ? 362 ASP B C   1 
ATOM   6801 O  O   . ASP B 1 361 ? 75.309  8.113   -45.995 1.00 38.73 ? 362 ASP B O   1 
ATOM   6802 C  CB  . ASP B 1 361 ? 76.736  10.943  -46.290 1.00 39.34 ? 362 ASP B CB  1 
ATOM   6803 C  CG  . ASP B 1 361 ? 77.800  11.951  -45.847 1.00 40.22 ? 362 ASP B CG  1 
ATOM   6804 O  OD1 . ASP B 1 361 ? 77.739  12.495  -44.720 1.00 40.41 ? 362 ASP B OD1 1 
ATOM   6805 O  OD2 . ASP B 1 361 ? 78.715  12.208  -46.659 1.00 42.49 ? 362 ASP B OD2 1 
ATOM   6806 N  N   . LEU B 1 362 ? 73.785  9.770   -45.882 1.00 38.60 ? 363 LEU B N   1 
ATOM   6807 C  CA  . LEU B 1 362 ? 72.699  8.939   -46.378 1.00 38.52 ? 363 LEU B CA  1 
ATOM   6808 C  C   . LEU B 1 362 ? 71.695  9.768   -47.154 1.00 38.66 ? 363 LEU B C   1 
ATOM   6809 O  O   . LEU B 1 362 ? 71.343  10.874  -46.747 1.00 38.70 ? 363 LEU B O   1 
ATOM   6810 C  CB  . LEU B 1 362 ? 72.000  8.220   -45.214 1.00 38.62 ? 363 LEU B CB  1 
ATOM   6811 C  CG  . LEU B 1 362 ? 70.843  7.273   -45.561 1.00 38.70 ? 363 LEU B CG  1 
ATOM   6812 C  CD1 . LEU B 1 362 ? 71.333  6.080   -46.395 1.00 37.95 ? 363 LEU B CD1 1 
ATOM   6813 C  CD2 . LEU B 1 362 ? 70.143  6.801   -44.297 1.00 39.00 ? 363 LEU B CD2 1 
ATOM   6814 N  N   . VAL B 1 363 ? 71.234  9.225   -48.275 1.00 38.73 ? 364 VAL B N   1 
ATOM   6815 C  CA  . VAL B 1 363 ? 70.238  9.906   -49.080 1.00 39.08 ? 364 VAL B CA  1 
ATOM   6816 C  C   . VAL B 1 363 ? 68.865  9.312   -48.822 1.00 39.05 ? 364 VAL B C   1 
ATOM   6817 O  O   . VAL B 1 363 ? 68.656  8.119   -49.008 1.00 39.42 ? 364 VAL B O   1 
ATOM   6818 C  CB  . VAL B 1 363 ? 70.578  9.876   -50.598 1.00 39.24 ? 364 VAL B CB  1 
ATOM   6819 C  CG1 . VAL B 1 363 ? 69.573  10.706  -51.377 1.00 38.66 ? 364 VAL B CG1 1 
ATOM   6820 C  CG2 . VAL B 1 363 ? 71.986  10.418  -50.840 1.00 38.91 ? 364 VAL B CG2 1 
ATOM   6821 N  N   . LEU B 1 364 ? 67.943  10.156  -48.365 1.00 39.21 ? 365 LEU B N   1 
ATOM   6822 C  CA  . LEU B 1 364 ? 66.541  9.787   -48.229 1.00 39.25 ? 365 LEU B CA  1 
ATOM   6823 C  C   . LEU B 1 364 ? 65.687  10.802  -48.953 1.00 39.54 ? 365 LEU B C   1 
ATOM   6824 O  O   . LEU B 1 364 ? 65.853  12.008  -48.754 1.00 39.32 ? 365 LEU B O   1 
ATOM   6825 C  CB  . LEU B 1 364 ? 66.121  9.703   -46.749 1.00 39.26 ? 365 LEU B CB  1 
ATOM   6826 C  CG  . LEU B 1 364 ? 66.753  8.602   -45.887 1.00 39.11 ? 365 LEU B CG  1 
ATOM   6827 C  CD1 . LEU B 1 364 ? 66.403  8.773   -44.414 1.00 39.98 ? 365 LEU B CD1 1 
ATOM   6828 C  CD2 . LEU B 1 364 ? 66.338  7.218   -46.368 1.00 37.72 ? 365 LEU B CD2 1 
ATOM   6829 N  N   . ARG B 1 365 ? 64.774  10.311  -49.793 1.00 40.11 ? 366 ARG B N   1 
ATOM   6830 C  CA  . ARG B 1 365 ? 63.806  11.163  -50.498 1.00 40.68 ? 366 ARG B CA  1 
ATOM   6831 C  C   . ARG B 1 365 ? 64.509  12.220  -51.360 1.00 40.58 ? 366 ARG B C   1 
ATOM   6832 O  O   . ARG B 1 365 ? 64.010  13.334  -51.522 1.00 40.56 ? 366 ARG B O   1 
ATOM   6833 C  CB  . ARG B 1 365 ? 62.853  11.840  -49.498 1.00 40.87 ? 366 ARG B CB  1 
ATOM   6834 C  CG  . ARG B 1 365 ? 61.823  10.927  -48.837 1.00 42.10 ? 366 ARG B CG  1 
ATOM   6835 C  CD  . ARG B 1 365 ? 60.483  10.994  -49.548 1.00 43.50 ? 366 ARG B CD  1 
ATOM   6836 N  NE  . ARG B 1 365 ? 59.629  9.893   -49.120 1.00 46.54 ? 366 ARG B NE  1 
ATOM   6837 C  CZ  . ARG B 1 365 ? 58.469  9.559   -49.676 1.00 47.22 ? 366 ARG B CZ  1 
ATOM   6838 N  NH1 . ARG B 1 365 ? 57.980  10.244  -50.705 1.00 46.81 ? 366 ARG B NH1 1 
ATOM   6839 N  NH2 . ARG B 1 365 ? 57.788  8.533   -49.181 1.00 47.56 ? 366 ARG B NH2 1 
ATOM   6840 N  N   . ASP B 1 366 ? 65.669  11.852  -51.902 1.00 40.97 ? 367 ASP B N   1 
ATOM   6841 C  CA  . ASP B 1 366 ? 66.512  12.742  -52.718 1.00 41.31 ? 367 ASP B CA  1 
ATOM   6842 C  C   . ASP B 1 366 ? 67.075  13.938  -51.930 1.00 40.90 ? 367 ASP B C   1 
ATOM   6843 O  O   . ASP B 1 366 ? 67.353  14.999  -52.493 1.00 41.11 ? 367 ASP B O   1 
ATOM   6844 C  CB  . ASP B 1 366 ? 65.783  13.195  -53.999 1.00 41.77 ? 367 ASP B CB  1 
ATOM   6845 C  CG  . ASP B 1 366 ? 66.748  13.642  -55.104 1.00 44.29 ? 367 ASP B CG  1 
ATOM   6846 O  OD1 . ASP B 1 366 ? 67.889  13.121  -55.151 1.00 46.17 ? 367 ASP B OD1 1 
ATOM   6847 O  OD2 . ASP B 1 366 ? 66.364  14.516  -55.925 1.00 46.32 ? 367 ASP B OD2 1 
ATOM   6848 N  N   . TYR B 1 367 ? 67.240  13.758  -50.622 1.00 40.00 ? 368 TYR B N   1 
ATOM   6849 C  CA  . TYR B 1 367 ? 67.923  14.747  -49.799 1.00 38.81 ? 368 TYR B CA  1 
ATOM   6850 C  C   . TYR B 1 367 ? 69.134  14.087  -49.175 1.00 38.74 ? 368 TYR B C   1 
ATOM   6851 O  O   . TYR B 1 367 ? 69.065  12.939  -48.752 1.00 38.67 ? 368 TYR B O   1 
ATOM   6852 C  CB  . TYR B 1 367 ? 67.018  15.261  -48.682 1.00 38.30 ? 368 TYR B CB  1 
ATOM   6853 C  CG  . TYR B 1 367 ? 65.776  16.005  -49.100 1.00 35.54 ? 368 TYR B CG  1 
ATOM   6854 C  CD1 . TYR B 1 367 ? 64.544  15.368  -49.119 1.00 33.22 ? 368 TYR B CD1 1 
ATOM   6855 C  CD2 . TYR B 1 367 ? 65.823  17.363  -49.415 1.00 33.34 ? 368 TYR B CD2 1 
ATOM   6856 C  CE1 . TYR B 1 367 ? 63.392  16.049  -49.469 1.00 32.32 ? 368 TYR B CE1 1 
ATOM   6857 C  CE2 . TYR B 1 367 ? 64.674  18.055  -49.764 1.00 31.63 ? 368 TYR B CE2 1 
ATOM   6858 C  CZ  . TYR B 1 367 ? 63.466  17.392  -49.790 1.00 31.45 ? 368 TYR B CZ  1 
ATOM   6859 O  OH  . TYR B 1 367 ? 62.317  18.064  -50.135 1.00 33.10 ? 368 TYR B OH  1 
ATOM   6860 N  N   . MET B 1 368 ? 70.236  14.824  -49.108 1.00 38.80 ? 369 MET B N   1 
ATOM   6861 C  CA  . MET B 1 368 ? 71.472  14.320  -48.526 1.00 39.19 ? 369 MET B CA  1 
ATOM   6862 C  C   . MET B 1 368 ? 71.478  14.591  -47.022 1.00 38.53 ? 369 MET B C   1 
ATOM   6863 O  O   . MET B 1 368 ? 71.375  15.740  -46.601 1.00 38.56 ? 369 MET B O   1 
ATOM   6864 C  CB  . MET B 1 368 ? 72.683  14.968  -49.216 1.00 39.63 ? 369 MET B CB  1 
ATOM   6865 C  CG  . MET B 1 368 ? 74.035  14.753  -48.531 1.00 42.55 ? 369 MET B CG  1 
ATOM   6866 S  SD  . MET B 1 368 ? 74.591  13.037  -48.363 1.00 49.16 ? 369 MET B SD  1 
ATOM   6867 C  CE  . MET B 1 368 ? 75.054  12.625  -50.053 1.00 47.20 ? 369 MET B CE  1 
ATOM   6868 N  N   . ILE B 1 369 ? 71.583  13.527  -46.225 1.00 37.60 ? 370 ILE B N   1 
ATOM   6869 C  CA  . ILE B 1 369 ? 71.619  13.664  -44.776 1.00 36.73 ? 370 ILE B CA  1 
ATOM   6870 C  C   . ILE B 1 369 ? 73.008  13.297  -44.246 1.00 36.17 ? 370 ILE B C   1 
ATOM   6871 O  O   . ILE B 1 369 ? 73.428  12.145  -44.346 1.00 36.35 ? 370 ILE B O   1 
ATOM   6872 C  CB  . ILE B 1 369 ? 70.498  12.856  -44.074 1.00 36.72 ? 370 ILE B CB  1 
ATOM   6873 C  CG1 . ILE B 1 369 ? 69.155  13.079  -44.778 1.00 37.27 ? 370 ILE B CG1 1 
ATOM   6874 C  CG2 . ILE B 1 369 ? 70.368  13.292  -42.617 1.00 36.33 ? 370 ILE B CG2 1 
ATOM   6875 C  CD1 . ILE B 1 369 ? 68.180  11.964  -44.606 1.00 37.60 ? 370 ILE B CD1 1 
ATOM   6876 N  N   . PRO B 1 370 ? 73.728  14.289  -43.691 1.00 35.61 ? 371 PRO B N   1 
ATOM   6877 C  CA  . PRO B 1 370 ? 75.119  14.106  -43.293 1.00 35.54 ? 371 PRO B CA  1 
ATOM   6878 C  C   . PRO B 1 370 ? 75.314  13.168  -42.123 1.00 35.35 ? 371 PRO B C   1 
ATOM   6879 O  O   . PRO B 1 370 ? 74.453  13.074  -41.249 1.00 35.62 ? 371 PRO B O   1 
ATOM   6880 C  CB  . PRO B 1 370 ? 75.571  15.523  -42.902 1.00 35.39 ? 371 PRO B CB  1 
ATOM   6881 C  CG  . PRO B 1 370 ? 74.341  16.261  -42.635 1.00 35.78 ? 371 PRO B CG  1 
ATOM   6882 C  CD  . PRO B 1 370 ? 73.306  15.692  -43.551 1.00 35.64 ? 371 PRO B CD  1 
ATOM   6883 N  N   . ALA B 1 371 ? 76.460  12.494  -42.107 1.00 34.86 ? 372 ALA B N   1 
ATOM   6884 C  CA  . ALA B 1 371 ? 76.868  11.670  -40.979 1.00 34.17 ? 372 ALA B CA  1 
ATOM   6885 C  C   . ALA B 1 371 ? 76.684  12.430  -39.671 1.00 33.87 ? 372 ALA B C   1 
ATOM   6886 O  O   . ALA B 1 371 ? 76.885  13.648  -39.611 1.00 33.73 ? 372 ALA B O   1 
ATOM   6887 C  CB  . ALA B 1 371 ? 78.322  11.240  -41.141 1.00 34.56 ? 372 ALA B CB  1 
ATOM   6888 N  N   . LYS B 1 372 ? 76.289  11.696  -38.628 1.00 33.15 ? 373 LYS B N   1 
ATOM   6889 C  CA  . LYS B 1 372 ? 76.052  12.247  -37.287 1.00 32.20 ? 373 LYS B CA  1 
ATOM   6890 C  C   . LYS B 1 372 ? 74.697  12.949  -37.092 1.00 30.70 ? 373 LYS B C   1 
ATOM   6891 O  O   . LYS B 1 372 ? 74.369  13.342  -35.975 1.00 30.59 ? 373 LYS B O   1 
ATOM   6892 C  CB  . LYS B 1 372 ? 77.231  13.116  -36.810 1.00 32.66 ? 373 LYS B CB  1 
ATOM   6893 C  CG  . LYS B 1 372 ? 78.545  12.348  -36.791 1.00 34.72 ? 373 LYS B CG  1 
ATOM   6894 C  CD  . LYS B 1 372 ? 79.666  13.092  -36.096 1.00 37.19 ? 373 LYS B CD  1 
ATOM   6895 C  CE  . LYS B 1 372 ? 80.946  12.281  -36.224 1.00 39.15 ? 373 LYS B CE  1 
ATOM   6896 N  NZ  . LYS B 1 372 ? 81.856  12.482  -35.065 1.00 42.11 ? 373 LYS B NZ  1 
ATOM   6897 N  N   . THR B 1 373 ? 73.908  13.084  -38.157 1.00 29.04 ? 374 THR B N   1 
ATOM   6898 C  CA  . THR B 1 373 ? 72.546  13.613  -38.026 1.00 27.95 ? 374 THR B CA  1 
ATOM   6899 C  C   . THR B 1 373 ? 71.669  12.601  -37.278 1.00 26.94 ? 374 THR B C   1 
ATOM   6900 O  O   . THR B 1 373 ? 71.743  11.396  -37.525 1.00 27.35 ? 374 THR B O   1 
ATOM   6901 C  CB  . THR B 1 373 ? 71.887  13.891  -39.395 1.00 27.93 ? 374 THR B CB  1 
ATOM   6902 O  OG1 . THR B 1 373 ? 72.749  14.705  -40.201 1.00 29.84 ? 374 THR B OG1 1 
ATOM   6903 C  CG2 . THR B 1 373 ? 70.570  14.609  -39.227 1.00 27.18 ? 374 THR B CG2 1 
ATOM   6904 N  N   . LEU B 1 374 ? 70.835  13.096  -36.374 1.00 25.45 ? 375 LEU B N   1 
ATOM   6905 C  CA  . LEU B 1 374 ? 69.860  12.253  -35.706 1.00 23.92 ? 375 LEU B CA  1 
ATOM   6906 C  C   . LEU B 1 374 ? 68.654  12.070  -36.606 1.00 23.10 ? 375 LEU B C   1 
ATOM   6907 O  O   . LEU B 1 374 ? 68.053  13.051  -37.052 1.00 22.96 ? 375 LEU B O   1 
ATOM   6908 C  CB  . LEU B 1 374 ? 69.448  12.874  -34.371 1.00 23.52 ? 375 LEU B CB  1 
ATOM   6909 C  CG  . LEU B 1 374 ? 68.430  12.113  -33.535 1.00 22.21 ? 375 LEU B CG  1 
ATOM   6910 C  CD1 . LEU B 1 374 ? 68.973  10.705  -33.212 1.00 21.26 ? 375 LEU B CD1 1 
ATOM   6911 C  CD2 . LEU B 1 374 ? 68.151  12.911  -32.271 1.00 21.66 ? 375 LEU B CD2 1 
ATOM   6912 N  N   . VAL B 1 375 ? 68.308  10.815  -36.889 1.00 22.05 ? 376 VAL B N   1 
ATOM   6913 C  CA  . VAL B 1 375 ? 67.113  10.516  -37.676 1.00 21.09 ? 376 VAL B CA  1 
ATOM   6914 C  C   . VAL B 1 375 ? 66.111  9.751   -36.810 1.00 20.89 ? 376 VAL B C   1 
ATOM   6915 O  O   . VAL B 1 375 ? 66.483  8.790   -36.122 1.00 20.24 ? 376 VAL B O   1 
ATOM   6916 C  CB  . VAL B 1 375 ? 67.448  9.719   -38.964 1.00 21.59 ? 376 VAL B CB  1 
ATOM   6917 C  CG1 . VAL B 1 375 ? 66.176  9.295   -39.706 1.00 19.93 ? 376 VAL B CG1 1 
ATOM   6918 C  CG2 . VAL B 1 375 ? 68.351  10.562  -39.895 1.00 22.79 ? 376 VAL B CG2 1 
ATOM   6919 N  N   . GLN B 1 376 ? 64.853  10.195  -36.850 1.00 20.46 ? 377 GLN B N   1 
ATOM   6920 C  CA  . GLN B 1 376 ? 63.784  9.608   -36.047 1.00 20.91 ? 377 GLN B CA  1 
ATOM   6921 C  C   . GLN B 1 376 ? 62.686  9.060   -36.951 1.00 20.82 ? 377 GLN B C   1 
ATOM   6922 O  O   . GLN B 1 376 ? 62.249  9.720   -37.896 1.00 20.41 ? 377 GLN B O   1 
ATOM   6923 C  CB  . GLN B 1 376 ? 63.197  10.644  -35.062 1.00 20.41 ? 377 GLN B CB  1 
ATOM   6924 C  CG  . GLN B 1 376 ? 64.241  11.262  -34.145 1.00 19.81 ? 377 GLN B CG  1 
ATOM   6925 C  CD  . GLN B 1 376 ? 63.657  11.831  -32.865 1.00 20.97 ? 377 GLN B CD  1 
ATOM   6926 O  OE1 . GLN B 1 376 ? 62.715  11.269  -32.274 1.00 19.35 ? 377 GLN B OE1 1 
ATOM   6927 N  NE2 . GLN B 1 376 ? 64.209  12.952  -32.426 1.00 20.24 ? 377 GLN B NE2 1 
ATOM   6928 N  N   . VAL B 1 377 ? 62.268  7.835   -36.670 1.00 21.12 ? 378 VAL B N   1 
ATOM   6929 C  CA  . VAL B 1 377 ? 61.149  7.227   -37.379 1.00 21.34 ? 378 VAL B CA  1 
ATOM   6930 C  C   . VAL B 1 377 ? 59.923  7.438   -36.518 1.00 21.67 ? 378 VAL B C   1 
ATOM   6931 O  O   . VAL B 1 377 ? 59.891  6.991   -35.375 1.00 21.81 ? 378 VAL B O   1 
ATOM   6932 C  CB  . VAL B 1 377 ? 61.364  5.703   -37.547 1.00 21.73 ? 378 VAL B CB  1 
ATOM   6933 C  CG1 . VAL B 1 377 ? 60.152  5.069   -38.228 1.00 21.39 ? 378 VAL B CG1 1 
ATOM   6934 C  CG2 . VAL B 1 377 ? 62.665  5.428   -38.334 1.00 22.02 ? 378 VAL B CG2 1 
ATOM   6935 N  N   . ALA B 1 378 ? 58.913  8.100   -37.058 1.00 21.50 ? 379 ALA B N   1 
ATOM   6936 C  CA  . ALA B 1 378 ? 57.737  8.421   -36.282 1.00 21.42 ? 379 ALA B CA  1 
ATOM   6937 C  C   . ALA B 1 378 ? 56.755  7.247   -36.246 1.00 21.99 ? 379 ALA B C   1 
ATOM   6938 O  O   . ALA B 1 378 ? 55.776  7.202   -37.011 1.00 21.65 ? 379 ALA B O   1 
ATOM   6939 C  CB  . ALA B 1 378 ? 57.083  9.685   -36.801 1.00 21.10 ? 379 ALA B CB  1 
ATOM   6940 N  N   . ILE B 1 379 ? 57.033  6.333   -35.311 1.00 21.93 ? 380 ILE B N   1 
ATOM   6941 C  CA  . ILE B 1 379 ? 56.315  5.081   -35.112 1.00 22.45 ? 380 ILE B CA  1 
ATOM   6942 C  C   . ILE B 1 379 ? 54.832  5.330   -34.939 1.00 21.47 ? 380 ILE B C   1 
ATOM   6943 O  O   . ILE B 1 379 ? 54.022  4.679   -35.604 1.00 20.43 ? 380 ILE B O   1 
ATOM   6944 C  CB  . ILE B 1 379 ? 56.885  4.299   -33.861 1.00 23.38 ? 380 ILE B CB  1 
ATOM   6945 C  CG1 . ILE B 1 379 ? 58.295  3.796   -34.140 1.00 25.94 ? 380 ILE B CG1 1 
ATOM   6946 C  CG2 . ILE B 1 379 ? 56.002  3.119   -33.466 1.00 24.94 ? 380 ILE B CG2 1 
ATOM   6947 C  CD1 . ILE B 1 379 ? 58.475  3.192   -35.540 1.00 27.86 ? 380 ILE B CD1 1 
ATOM   6948 N  N   . TYR B 1 380 ? 54.485  6.274   -34.054 1.00 20.56 ? 381 TYR B N   1 
ATOM   6949 C  CA  . TYR B 1 380 ? 53.086  6.591   -33.781 1.00 19.78 ? 381 TYR B CA  1 
ATOM   6950 C  C   . TYR B 1 380 ? 52.383  7.131   -35.017 1.00 19.88 ? 381 TYR B C   1 
ATOM   6951 O  O   . TYR B 1 380 ? 51.264  6.699   -35.341 1.00 19.52 ? 381 TYR B O   1 
ATOM   6952 C  CB  . TYR B 1 380 ? 52.924  7.603   -32.630 1.00 19.47 ? 381 TYR B CB  1 
ATOM   6953 C  CG  . TYR B 1 380 ? 51.470  7.980   -32.396 1.00 19.70 ? 381 TYR B CG  1 
ATOM   6954 C  CD1 . TYR B 1 380 ? 50.689  7.273   -31.482 1.00 17.22 ? 381 TYR B CD1 1 
ATOM   6955 C  CD2 . TYR B 1 380 ? 50.873  9.030   -33.106 1.00 21.49 ? 381 TYR B CD2 1 
ATOM   6956 C  CE1 . TYR B 1 380 ? 49.360  7.585   -31.286 1.00 20.84 ? 381 TYR B CE1 1 
ATOM   6957 C  CE2 . TYR B 1 380 ? 49.532  9.365   -32.912 1.00 21.50 ? 381 TYR B CE2 1 
ATOM   6958 C  CZ  . TYR B 1 380 ? 48.780  8.633   -32.001 1.00 20.85 ? 381 TYR B CZ  1 
ATOM   6959 O  OH  . TYR B 1 380 ? 47.460  8.942   -31.782 1.00 20.79 ? 381 TYR B OH  1 
ATOM   6960 N  N   . ALA B 1 381 ? 53.008  8.102   -35.680 1.00 18.84 ? 382 ALA B N   1 
ATOM   6961 C  CA  . ALA B 1 381 ? 52.397  8.704   -36.884 1.00 19.21 ? 382 ALA B CA  1 
ATOM   6962 C  C   . ALA B 1 381 ? 52.224  7.654   -37.981 1.00 18.71 ? 382 ALA B C   1 
ATOM   6963 O  O   . ALA B 1 381 ? 51.174  7.581   -38.631 1.00 19.49 ? 382 ALA B O   1 
ATOM   6964 C  CB  . ALA B 1 381 ? 53.231  9.879   -37.392 1.00 18.04 ? 382 ALA B CB  1 
ATOM   6965 N  N   . LEU B 1 382 ? 53.252  6.840   -38.168 1.00 19.75 ? 383 LEU B N   1 
ATOM   6966 C  CA  . LEU B 1 382 ? 53.187  5.700   -39.092 1.00 20.37 ? 383 LEU B CA  1 
ATOM   6967 C  C   . LEU B 1 382 ? 51.937  4.832   -38.850 1.00 21.31 ? 383 LEU B C   1 
ATOM   6968 O  O   . LEU B 1 382 ? 51.175  4.570   -39.780 1.00 21.42 ? 383 LEU B O   1 
ATOM   6969 C  CB  . LEU B 1 382 ? 54.459  4.875   -39.015 1.00 19.77 ? 383 LEU B CB  1 
ATOM   6970 C  CG  . LEU B 1 382 ? 54.622  3.583   -39.864 1.00 21.72 ? 383 LEU B CG  1 
ATOM   6971 C  CD1 . LEU B 1 382 ? 54.013  3.677   -41.270 1.00 19.60 ? 383 LEU B CD1 1 
ATOM   6972 C  CD2 . LEU B 1 382 ? 56.077  3.231   -39.961 1.00 21.87 ? 383 LEU B CD2 1 
ATOM   6973 N  N   . GLY B 1 383 ? 51.708  4.429   -37.599 1.00 21.86 ? 384 GLY B N   1 
ATOM   6974 C  CA  . GLY B 1 383 ? 50.615  3.522   -37.275 1.00 22.29 ? 384 GLY B CA  1 
ATOM   6975 C  C   . GLY B 1 383 ? 49.242  4.059   -37.615 1.00 22.46 ? 384 GLY B C   1 
ATOM   6976 O  O   . GLY B 1 383 ? 48.311  3.290   -37.856 1.00 22.75 ? 384 GLY B O   1 
ATOM   6977 N  N   . ARG B 1 384 ? 49.104  5.381   -37.624 1.00 22.89 ? 385 ARG B N   1 
ATOM   6978 C  CA  . ARG B 1 384 ? 47.812  6.006   -37.902 1.00 23.45 ? 385 ARG B CA  1 
ATOM   6979 C  C   . ARG B 1 384 ? 47.700  6.490   -39.364 1.00 23.75 ? 385 ARG B C   1 
ATOM   6980 O  O   . ARG B 1 384 ? 46.696  7.084   -39.725 1.00 23.71 ? 385 ARG B O   1 
ATOM   6981 C  CB  . ARG B 1 384 ? 47.537  7.204   -36.954 1.00 23.52 ? 385 ARG B CB  1 
ATOM   6982 C  CG  . ARG B 1 384 ? 47.777  7.002   -35.437 1.00 24.09 ? 385 ARG B CG  1 
ATOM   6983 C  CD  . ARG B 1 384 ? 46.923  5.876   -34.927 1.00 26.65 ? 385 ARG B CD  1 
ATOM   6984 N  NE  . ARG B 1 384 ? 47.045  5.571   -33.496 1.00 26.18 ? 385 ARG B NE  1 
ATOM   6985 C  CZ  . ARG B 1 384 ? 46.190  5.991   -32.570 1.00 26.07 ? 385 ARG B CZ  1 
ATOM   6986 N  NH1 . ARG B 1 384 ? 45.181  6.790   -32.900 1.00 26.08 ? 385 ARG B NH1 1 
ATOM   6987 N  NH2 . ARG B 1 384 ? 46.344  5.620   -31.310 1.00 26.62 ? 385 ARG B NH2 1 
ATOM   6988 N  N   . GLU B 1 385 ? 48.704  6.239   -40.196 1.00 24.27 ? 386 GLU B N   1 
ATOM   6989 C  CA  . GLU B 1 385 ? 48.705  6.837   -41.541 1.00 25.87 ? 386 GLU B CA  1 
ATOM   6990 C  C   . GLU B 1 385 ? 47.974  5.960   -42.575 1.00 26.28 ? 386 GLU B C   1 
ATOM   6991 O  O   . GLU B 1 385 ? 48.400  4.827   -42.844 1.00 25.30 ? 386 GLU B O   1 
ATOM   6992 C  CB  . GLU B 1 385 ? 50.120  7.120   -42.013 1.00 25.41 ? 386 GLU B CB  1 
ATOM   6993 C  CG  . GLU B 1 385 ? 50.313  8.552   -42.499 1.00 29.15 ? 386 GLU B CG  1 
ATOM   6994 C  CD  . GLU B 1 385 ? 49.449  8.924   -43.700 1.00 31.34 ? 386 GLU B CD  1 
ATOM   6995 O  OE1 . GLU B 1 385 ? 48.911  10.044  -43.682 1.00 34.13 ? 386 GLU B OE1 1 
ATOM   6996 O  OE2 . GLU B 1 385 ? 49.300  8.108   -44.648 1.00 32.38 ? 386 GLU B OE2 1 
ATOM   6997 N  N   . PRO B 1 386 ? 46.870  6.481   -43.146 1.00 26.92 ? 387 PRO B N   1 
ATOM   6998 C  CA  . PRO B 1 386 ? 46.051  5.635   -44.031 1.00 27.59 ? 387 PRO B CA  1 
ATOM   6999 C  C   . PRO B 1 386 ? 46.693  5.244   -45.357 1.00 28.39 ? 387 PRO B C   1 
ATOM   7000 O  O   . PRO B 1 386 ? 46.158  4.350   -46.028 1.00 29.22 ? 387 PRO B O   1 
ATOM   7001 C  CB  . PRO B 1 386 ? 44.768  6.442   -44.245 1.00 27.44 ? 387 PRO B CB  1 
ATOM   7002 C  CG  . PRO B 1 386 ? 45.106  7.847   -43.863 1.00 28.15 ? 387 PRO B CG  1 
ATOM   7003 C  CD  . PRO B 1 386 ? 46.233  7.778   -42.857 1.00 27.27 ? 387 PRO B CD  1 
ATOM   7004 N  N   . THR B 1 387 ? 47.818  5.868   -45.725 1.00 28.33 ? 388 THR B N   1 
ATOM   7005 C  CA  . THR B 1 387 ? 48.568  5.423   -46.906 1.00 28.73 ? 388 THR B CA  1 
ATOM   7006 C  C   . THR B 1 387 ? 49.444  4.232   -46.629 1.00 28.88 ? 388 THR B C   1 
ATOM   7007 O  O   . THR B 1 387 ? 49.853  3.548   -47.558 1.00 29.53 ? 388 THR B O   1 
ATOM   7008 C  CB  . THR B 1 387 ? 49.426  6.531   -47.605 1.00 28.65 ? 388 THR B CB  1 
ATOM   7009 O  OG1 . THR B 1 387 ? 50.508  6.962   -46.759 1.00 28.52 ? 388 THR B OG1 1 
ATOM   7010 C  CG2 . THR B 1 387 ? 48.560  7.700   -47.995 1.00 27.97 ? 388 THR B CG2 1 
ATOM   7011 N  N   . PHE B 1 388 ? 49.747  3.979   -45.361 1.00 29.17 ? 389 PHE B N   1 
ATOM   7012 C  CA  . PHE B 1 388 ? 50.601  2.851   -45.017 1.00 29.52 ? 389 PHE B CA  1 
ATOM   7013 C  C   . PHE B 1 388 ? 49.834  1.679   -44.378 1.00 29.62 ? 389 PHE B C   1 
ATOM   7014 O  O   . PHE B 1 388 ? 50.317  0.549   -44.381 1.00 28.80 ? 389 PHE B O   1 
ATOM   7015 C  CB  . PHE B 1 388 ? 51.780  3.293   -44.144 1.00 29.77 ? 389 PHE B CB  1 
ATOM   7016 C  CG  . PHE B 1 388 ? 52.599  4.407   -44.743 1.00 31.40 ? 389 PHE B CG  1 
ATOM   7017 C  CD1 . PHE B 1 388 ? 52.669  5.644   -44.119 1.00 32.41 ? 389 PHE B CD1 1 
ATOM   7018 C  CD2 . PHE B 1 388 ? 53.296  4.219   -45.940 1.00 32.53 ? 389 PHE B CD2 1 
ATOM   7019 C  CE1 . PHE B 1 388 ? 53.433  6.686   -44.676 1.00 32.82 ? 389 PHE B CE1 1 
ATOM   7020 C  CE2 . PHE B 1 388 ? 54.056  5.247   -46.499 1.00 32.76 ? 389 PHE B CE2 1 
ATOM   7021 C  CZ  . PHE B 1 388 ? 54.126  6.483   -45.864 1.00 31.90 ? 389 PHE B CZ  1 
ATOM   7022 N  N   . PHE B 1 389 ? 48.652  1.951   -43.834 1.00 29.97 ? 390 PHE B N   1 
ATOM   7023 C  CA  . PHE B 1 389 ? 47.789  0.889   -43.326 1.00 30.77 ? 390 PHE B CA  1 
ATOM   7024 C  C   . PHE B 1 389 ? 46.367  1.115   -43.805 1.00 31.88 ? 390 PHE B C   1 
ATOM   7025 O  O   . PHE B 1 389 ? 45.842  2.213   -43.687 1.00 32.15 ? 390 PHE B O   1 
ATOM   7026 C  CB  . PHE B 1 389 ? 47.812  0.819   -41.786 1.00 30.03 ? 390 PHE B CB  1 
ATOM   7027 C  CG  . PHE B 1 389 ? 49.145  0.416   -41.211 1.00 28.36 ? 390 PHE B CG  1 
ATOM   7028 C  CD1 . PHE B 1 389 ? 50.043  1.383   -40.757 1.00 26.40 ? 390 PHE B CD1 1 
ATOM   7029 C  CD2 . PHE B 1 389 ? 49.506  -0.926  -41.125 1.00 26.58 ? 390 PHE B CD2 1 
ATOM   7030 C  CE1 . PHE B 1 389 ? 51.287  1.023   -40.227 1.00 24.35 ? 390 PHE B CE1 1 
ATOM   7031 C  CE2 . PHE B 1 389 ? 50.745  -1.302  -40.586 1.00 26.83 ? 390 PHE B CE2 1 
ATOM   7032 C  CZ  . PHE B 1 389 ? 51.638  -0.315  -40.133 1.00 25.70 ? 390 PHE B CZ  1 
ATOM   7033 N  N   . PHE B 1 390 ? 45.750  0.062   -44.337 1.00 33.38 ? 391 PHE B N   1 
ATOM   7034 C  CA  . PHE B 1 390 ? 44.342  0.070   -44.719 1.00 35.14 ? 391 PHE B CA  1 
ATOM   7035 C  C   . PHE B 1 390 ? 43.437  0.266   -43.488 1.00 35.43 ? 391 PHE B C   1 
ATOM   7036 O  O   . PHE B 1 390 ? 43.524  -0.501  -42.535 1.00 35.73 ? 391 PHE B O   1 
ATOM   7037 C  CB  . PHE B 1 390 ? 44.036  -1.252  -45.460 1.00 35.96 ? 391 PHE B CB  1 
ATOM   7038 C  CG  . PHE B 1 390 ? 42.584  -1.662  -45.438 1.00 39.40 ? 391 PHE B CG  1 
ATOM   7039 C  CD1 . PHE B 1 390 ? 41.722  -1.275  -46.463 1.00 42.93 ? 391 PHE B CD1 1 
ATOM   7040 C  CD2 . PHE B 1 390 ? 42.086  -2.467  -44.410 1.00 41.91 ? 391 PHE B CD2 1 
ATOM   7041 C  CE1 . PHE B 1 390 ? 40.366  -1.653  -46.455 1.00 45.03 ? 391 PHE B CE1 1 
ATOM   7042 C  CE2 . PHE B 1 390 ? 40.735  -2.852  -44.383 1.00 45.03 ? 391 PHE B CE2 1 
ATOM   7043 C  CZ  . PHE B 1 390 ? 39.872  -2.445  -45.410 1.00 45.62 ? 391 PHE B CZ  1 
ATOM   7044 N  N   . ASP B 1 391 ? 42.561  1.274   -43.531 1.00 36.09 ? 392 ASP B N   1 
ATOM   7045 C  CA  . ASP B 1 391 ? 41.678  1.652   -42.402 1.00 37.04 ? 392 ASP B CA  1 
ATOM   7046 C  C   . ASP B 1 391 ? 42.437  1.582   -41.059 1.00 36.58 ? 392 ASP B C   1 
ATOM   7047 O  O   . ASP B 1 391 ? 42.146  0.726   -40.212 1.00 36.61 ? 392 ASP B O   1 
ATOM   7048 C  CB  . ASP B 1 391 ? 40.383  0.808   -42.372 1.00 37.50 ? 392 ASP B CB  1 
ATOM   7049 C  CG  . ASP B 1 391 ? 39.336  1.356   -41.393 1.00 40.05 ? 392 ASP B CG  1 
ATOM   7050 O  OD1 . ASP B 1 391 ? 39.350  2.569   -41.096 1.00 43.84 ? 392 ASP B OD1 1 
ATOM   7051 O  OD2 . ASP B 1 391 ? 38.484  0.575   -40.912 1.00 42.97 ? 392 ASP B OD2 1 
ATOM   7052 N  N   . PRO B 1 392 ? 43.417  2.488   -40.873 1.00 36.20 ? 393 PRO B N   1 
ATOM   7053 C  CA  . PRO B 1 392 ? 44.353  2.395   -39.748 1.00 35.72 ? 393 PRO B CA  1 
ATOM   7054 C  C   . PRO B 1 392 ? 43.716  2.492   -38.347 1.00 35.24 ? 393 PRO B C   1 
ATOM   7055 O  O   . PRO B 1 392 ? 44.327  2.036   -37.385 1.00 35.11 ? 393 PRO B O   1 
ATOM   7056 C  CB  . PRO B 1 392 ? 45.339  3.544   -40.012 1.00 35.59 ? 393 PRO B CB  1 
ATOM   7057 C  CG  . PRO B 1 392 ? 44.559  4.526   -40.824 1.00 35.94 ? 393 PRO B CG  1 
ATOM   7058 C  CD  . PRO B 1 392 ? 43.653  3.704   -41.685 1.00 35.99 ? 393 PRO B CD  1 
ATOM   7059 N  N   . GLU B 1 393 ? 42.507  3.042   -38.236 1.00 35.01 ? 394 GLU B N   1 
ATOM   7060 C  CA  . GLU B 1 393 ? 41.804  3.092   -36.944 1.00 35.45 ? 394 GLU B CA  1 
ATOM   7061 C  C   . GLU B 1 393 ? 41.068  1.793   -36.563 1.00 34.79 ? 394 GLU B C   1 
ATOM   7062 O  O   . GLU B 1 393 ? 40.541  1.667   -35.458 1.00 34.17 ? 394 GLU B O   1 
ATOM   7063 C  CB  . GLU B 1 393 ? 40.838  4.282   -36.868 1.00 36.05 ? 394 GLU B CB  1 
ATOM   7064 C  CG  . GLU B 1 393 ? 41.473  5.670   -37.082 1.00 39.76 ? 394 GLU B CG  1 
ATOM   7065 C  CD  . GLU B 1 393 ? 42.617  5.996   -36.110 1.00 44.18 ? 394 GLU B CD  1 
ATOM   7066 O  OE1 . GLU B 1 393 ? 42.673  5.432   -34.989 1.00 46.21 ? 394 GLU B OE1 1 
ATOM   7067 O  OE2 . GLU B 1 393 ? 43.470  6.835   -36.478 1.00 46.26 ? 394 GLU B OE2 1 
ATOM   7068 N  N   . ASN B 1 394 ? 41.033  0.834   -37.480 1.00 33.98 ? 395 ASN B N   1 
ATOM   7069 C  CA  . ASN B 1 394 ? 40.431  -0.454  -37.191 1.00 33.13 ? 395 ASN B CA  1 
ATOM   7070 C  C   . ASN B 1 394 ? 41.466  -1.368  -36.555 1.00 31.75 ? 395 ASN B C   1 
ATOM   7071 O  O   . ASN B 1 394 ? 42.605  -1.465  -37.020 1.00 32.02 ? 395 ASN B O   1 
ATOM   7072 C  CB  . ASN B 1 394 ? 39.845  -1.075  -38.475 1.00 33.68 ? 395 ASN B CB  1 
ATOM   7073 C  CG  . ASN B 1 394 ? 39.029  -2.347  -38.212 1.00 34.91 ? 395 ASN B CG  1 
ATOM   7074 O  OD1 . ASN B 1 394 ? 38.149  -2.387  -37.339 1.00 35.28 ? 395 ASN B OD1 1 
ATOM   7075 N  ND2 . ASN B 1 394 ? 39.306  -3.384  -38.995 1.00 35.26 ? 395 ASN B ND2 1 
ATOM   7076 N  N   . PHE B 1 395 ? 41.079  -2.009  -35.462 1.00 30.44 ? 396 PHE B N   1 
ATOM   7077 C  CA  . PHE B 1 395 ? 41.915  -3.016  -34.835 1.00 29.03 ? 396 PHE B CA  1 
ATOM   7078 C  C   . PHE B 1 395 ? 41.692  -4.308  -35.611 1.00 28.84 ? 396 PHE B C   1 
ATOM   7079 O  O   . PHE B 1 395 ? 40.653  -4.934  -35.467 1.00 28.14 ? 396 PHE B O   1 
ATOM   7080 C  CB  . PHE B 1 395 ? 41.539  -3.158  -33.355 1.00 28.27 ? 396 PHE B CB  1 
ATOM   7081 C  CG  . PHE B 1 395 ? 42.359  -4.177  -32.593 1.00 26.56 ? 396 PHE B CG  1 
ATOM   7082 C  CD1 . PHE B 1 395 ? 43.651  -3.880  -32.168 1.00 24.91 ? 396 PHE B CD1 1 
ATOM   7083 C  CD2 . PHE B 1 395 ? 41.815  -5.419  -32.258 1.00 24.92 ? 396 PHE B CD2 1 
ATOM   7084 C  CE1 . PHE B 1 395 ? 44.400  -4.805  -31.457 1.00 24.62 ? 396 PHE B CE1 1 
ATOM   7085 C  CE2 . PHE B 1 395 ? 42.556  -6.355  -31.537 1.00 24.76 ? 396 PHE B CE2 1 
ATOM   7086 C  CZ  . PHE B 1 395 ? 43.850  -6.051  -31.133 1.00 24.91 ? 396 PHE B CZ  1 
ATOM   7087 N  N   . ASP B 1 396 ? 42.661  -4.672  -36.454 1.00 29.32 ? 397 ASP B N   1 
ATOM   7088 C  CA  . ASP B 1 396 ? 42.568  -5.867  -37.316 1.00 29.83 ? 397 ASP B CA  1 
ATOM   7089 C  C   . ASP B 1 396 ? 43.845  -6.703  -37.299 1.00 29.16 ? 397 ASP B C   1 
ATOM   7090 O  O   . ASP B 1 396 ? 44.730  -6.499  -38.136 1.00 28.89 ? 397 ASP B O   1 
ATOM   7091 C  CB  . ASP B 1 396 ? 42.220  -5.479  -38.764 1.00 30.62 ? 397 ASP B CB  1 
ATOM   7092 C  CG  . ASP B 1 396 ? 42.087  -6.699  -39.699 1.00 33.78 ? 397 ASP B CG  1 
ATOM   7093 O  OD1 . ASP B 1 396 ? 42.146  -7.861  -39.222 1.00 37.28 ? 397 ASP B OD1 1 
ATOM   7094 O  OD2 . ASP B 1 396 ? 41.928  -6.488  -40.925 1.00 36.97 ? 397 ASP B OD2 1 
ATOM   7095 N  N   . PRO B 1 397 ? 43.933  -7.669  -36.362 1.00 28.75 ? 398 PRO B N   1 
ATOM   7096 C  CA  . PRO B 1 397 ? 45.098  -8.539  -36.243 1.00 28.65 ? 398 PRO B CA  1 
ATOM   7097 C  C   . PRO B 1 397 ? 45.442  -9.329  -37.518 1.00 28.78 ? 398 PRO B C   1 
ATOM   7098 O  O   . PRO B 1 397 ? 46.614  -9.630  -37.730 1.00 28.45 ? 398 PRO B O   1 
ATOM   7099 C  CB  . PRO B 1 397 ? 44.704  -9.503  -35.110 1.00 28.67 ? 398 PRO B CB  1 
ATOM   7100 C  CG  . PRO B 1 397 ? 43.635  -8.785  -34.361 1.00 28.51 ? 398 PRO B CG  1 
ATOM   7101 C  CD  . PRO B 1 397 ? 42.882  -8.040  -35.393 1.00 28.69 ? 398 PRO B CD  1 
ATOM   7102 N  N   . THR B 1 398 ? 44.447  -9.658  -38.347 1.00 29.32 ? 399 THR B N   1 
ATOM   7103 C  CA  . THR B 1 398 ? 44.696  -10.433 -39.594 1.00 30.07 ? 399 THR B CA  1 
ATOM   7104 C  C   . THR B 1 398 ? 45.600  -9.705  -40.606 1.00 30.48 ? 399 THR B C   1 
ATOM   7105 O  O   . THR B 1 398 ? 46.230  -10.352 -41.460 1.00 30.13 ? 399 THR B O   1 
ATOM   7106 C  CB  . THR B 1 398 ? 43.378  -10.879 -40.316 1.00 30.02 ? 399 THR B CB  1 
ATOM   7107 O  OG1 . THR B 1 398 ? 42.665  -9.733  -40.802 1.00 31.28 ? 399 THR B OG1 1 
ATOM   7108 C  CG2 . THR B 1 398 ? 42.458  -11.677 -39.369 1.00 30.23 ? 399 THR B CG2 1 
ATOM   7109 N  N   . ARG B 1 399 ? 45.682  -8.371  -40.502 1.00 30.71 ? 400 ARG B N   1 
ATOM   7110 C  CA  . ARG B 1 399 ? 46.549  -7.599  -41.402 1.00 31.25 ? 400 ARG B CA  1 
ATOM   7111 C  C   . ARG B 1 399 ? 47.996  -8.113  -41.348 1.00 31.50 ? 400 ARG B C   1 
ATOM   7112 O  O   . ARG B 1 399 ? 48.716  -8.034  -42.335 1.00 31.83 ? 400 ARG B O   1 
ATOM   7113 C  CB  . ARG B 1 399 ? 46.437  -6.075  -41.170 1.00 31.24 ? 400 ARG B CB  1 
ATOM   7114 C  CG  . ARG B 1 399 ? 47.297  -5.492  -40.035 1.00 30.91 ? 400 ARG B CG  1 
ATOM   7115 C  CD  . ARG B 1 399 ? 47.256  -3.932  -39.982 1.00 29.52 ? 400 ARG B CD  1 
ATOM   7116 N  NE  . ARG B 1 399 ? 45.969  -3.357  -39.552 1.00 26.14 ? 400 ARG B NE  1 
ATOM   7117 C  CZ  . ARG B 1 399 ? 45.194  -2.578  -40.308 1.00 28.14 ? 400 ARG B CZ  1 
ATOM   7118 N  NH1 . ARG B 1 399 ? 45.544  -2.266  -41.549 1.00 29.25 ? 400 ARG B NH1 1 
ATOM   7119 N  NH2 . ARG B 1 399 ? 44.058  -2.094  -39.828 1.00 28.79 ? 400 ARG B NH2 1 
ATOM   7120 N  N   . TRP B 1 400 ? 48.387  -8.696  -40.216 1.00 31.56 ? 401 TRP B N   1 
ATOM   7121 C  CA  . TRP B 1 400 ? 49.746  -9.207  -40.026 1.00 32.38 ? 401 TRP B CA  1 
ATOM   7122 C  C   . TRP B 1 400 ? 49.939  -10.643 -40.544 1.00 33.72 ? 401 TRP B C   1 
ATOM   7123 O  O   . TRP B 1 400 ? 51.062  -11.145 -40.589 1.00 33.09 ? 401 TRP B O   1 
ATOM   7124 C  CB  . TRP B 1 400 ? 50.144  -9.101  -38.550 1.00 31.89 ? 401 TRP B CB  1 
ATOM   7125 C  CG  . TRP B 1 400 ? 50.052  -7.679  -38.048 1.00 30.54 ? 401 TRP B CG  1 
ATOM   7126 C  CD1 . TRP B 1 400 ? 48.995  -7.100  -37.396 1.00 28.66 ? 401 TRP B CD1 1 
ATOM   7127 C  CD2 . TRP B 1 400 ? 51.037  -6.654  -38.209 1.00 28.66 ? 401 TRP B CD2 1 
ATOM   7128 N  NE1 . TRP B 1 400 ? 49.270  -5.776  -37.128 1.00 28.93 ? 401 TRP B NE1 1 
ATOM   7129 C  CE2 . TRP B 1 400 ? 50.524  -5.480  -37.604 1.00 29.46 ? 401 TRP B CE2 1 
ATOM   7130 C  CE3 . TRP B 1 400 ? 52.313  -6.615  -38.788 1.00 29.41 ? 401 TRP B CE3 1 
ATOM   7131 C  CZ2 . TRP B 1 400 ? 51.243  -4.274  -37.574 1.00 28.40 ? 401 TRP B CZ2 1 
ATOM   7132 C  CZ3 . TRP B 1 400 ? 53.032  -5.411  -38.753 1.00 29.01 ? 401 TRP B CZ3 1 
ATOM   7133 C  CH2 . TRP B 1 400 ? 52.489  -4.261  -38.154 1.00 27.82 ? 401 TRP B CH2 1 
ATOM   7134 N  N   . LEU B 1 401 ? 48.839  -11.290 -40.915 1.00 35.62 ? 402 LEU B N   1 
ATOM   7135 C  CA  . LEU B 1 401 ? 48.879  -12.636 -41.488 1.00 38.40 ? 402 LEU B CA  1 
ATOM   7136 C  C   . LEU B 1 401 ? 48.650  -12.593 -43.006 1.00 40.20 ? 402 LEU B C   1 
ATOM   7137 O  O   . LEU B 1 401 ? 48.351  -13.617 -43.624 1.00 40.73 ? 402 LEU B O   1 
ATOM   7138 C  CB  . LEU B 1 401 ? 47.821  -13.530 -40.826 1.00 37.89 ? 402 LEU B CB  1 
ATOM   7139 C  CG  . LEU B 1 401 ? 47.841  -13.753 -39.311 1.00 38.11 ? 402 LEU B CG  1 
ATOM   7140 C  CD1 . LEU B 1 401 ? 46.580  -14.500 -38.856 1.00 37.05 ? 402 LEU B CD1 1 
ATOM   7141 C  CD2 . LEU B 1 401 ? 49.094  -14.503 -38.898 1.00 38.51 ? 402 LEU B CD2 1 
ATOM   7142 N  N   . SER B 1 402 ? 48.774  -11.402 -43.590 1.00 42.34 ? 403 SER B N   1 
ATOM   7143 C  CA  . SER B 1 402 ? 48.469  -11.174 -45.002 1.00 44.81 ? 403 SER B CA  1 
ATOM   7144 C  C   . SER B 1 402 ? 49.436  -11.911 -45.933 1.00 46.31 ? 403 SER B C   1 
ATOM   7145 O  O   . SER B 1 402 ? 50.647  -11.967 -45.668 1.00 46.51 ? 403 SER B O   1 
ATOM   7146 C  CB  . SER B 1 402 ? 48.494  -9.670  -45.308 1.00 44.95 ? 403 SER B CB  1 
ATOM   7147 O  OG  . SER B 1 402 ? 48.190  -9.403  -46.669 1.00 45.50 ? 403 SER B OG  1 
ATOM   7148 N  N   . LYS B 1 403 ? 48.885  -12.472 -47.014 1.00 48.35 ? 404 LYS B N   1 
ATOM   7149 C  CA  . LYS B 1 403 ? 49.668  -13.121 -48.083 1.00 50.19 ? 404 LYS B CA  1 
ATOM   7150 C  C   . LYS B 1 403 ? 50.695  -12.138 -48.640 1.00 50.99 ? 404 LYS B C   1 
ATOM   7151 O  O   . LYS B 1 403 ? 51.865  -12.482 -48.856 1.00 51.73 ? 404 LYS B O   1 
ATOM   7152 C  CB  . LYS B 1 403 ? 48.763  -13.581 -49.242 1.00 50.27 ? 404 LYS B CB  1 
ATOM   7153 C  CG  . LYS B 1 403 ? 47.270  -13.739 -48.929 1.00 51.80 ? 404 LYS B CG  1 
ATOM   7154 C  CD  . LYS B 1 403 ? 46.897  -15.154 -48.494 1.00 53.43 ? 404 LYS B CD  1 
ATOM   7155 C  CE  . LYS B 1 403 ? 45.455  -15.206 -47.991 1.00 54.66 ? 404 LYS B CE  1 
ATOM   7156 N  NZ  . LYS B 1 403 ? 45.162  -16.454 -47.213 1.00 53.92 ? 404 LYS B NZ  1 
ATOM   7157 N  N   . ASP B 1 404 ? 50.234  -10.909 -48.856 1.00 51.78 ? 405 ASP B N   1 
ATOM   7158 C  CA  . ASP B 1 404 ? 51.028  -9.841  -49.443 1.00 52.40 ? 405 ASP B CA  1 
ATOM   7159 C  C   . ASP B 1 404 ? 52.128  -9.355  -48.490 1.00 52.74 ? 405 ASP B C   1 
ATOM   7160 O  O   . ASP B 1 404 ? 51.859  -8.652  -47.502 1.00 52.61 ? 405 ASP B O   1 
ATOM   7161 C  CB  . ASP B 1 404 ? 50.104  -8.688  -49.861 1.00 52.38 ? 405 ASP B CB  1 
ATOM   7162 C  CG  . ASP B 1 404 ? 50.798  -7.658  -50.735 1.00 53.11 ? 405 ASP B CG  1 
ATOM   7163 O  OD1 . ASP B 1 404 ? 50.168  -6.613  -51.022 1.00 53.08 ? 405 ASP B OD1 1 
ATOM   7164 O  OD2 . ASP B 1 404 ? 51.965  -7.885  -51.134 1.00 53.38 ? 405 ASP B OD2 1 
ATOM   7165 N  N   . LYS B 1 405 ? 53.368  -9.725  -48.809 1.00 52.96 ? 406 LYS B N   1 
ATOM   7166 C  CA  . LYS B 1 405 ? 54.529  -9.299  -48.032 1.00 53.16 ? 406 LYS B CA  1 
ATOM   7167 C  C   . LYS B 1 405 ? 54.980  -7.899  -48.463 1.00 52.86 ? 406 LYS B C   1 
ATOM   7168 O  O   . LYS B 1 405 ? 56.175  -7.614  -48.520 1.00 53.39 ? 406 LYS B O   1 
ATOM   7169 C  CB  . LYS B 1 405 ? 55.680  -10.311 -48.147 1.00 53.39 ? 406 LYS B CB  1 
ATOM   7170 C  CG  . LYS B 1 405 ? 55.286  -11.788 -47.967 1.00 54.56 ? 406 LYS B CG  1 
ATOM   7171 C  CD  . LYS B 1 405 ? 55.153  -12.200 -46.496 1.00 56.34 ? 406 LYS B CD  1 
ATOM   7172 C  CE  . LYS B 1 405 ? 54.887  -13.694 -46.374 1.00 56.91 ? 406 LYS B CE  1 
ATOM   7173 N  NZ  . LYS B 1 405 ? 54.626  -14.115 -44.967 1.00 58.19 ? 406 LYS B NZ  1 
ATOM   7174 N  N   . ASN B 1 406 ? 54.007  -7.047  -48.787 1.00 52.22 ? 407 ASN B N   1 
ATOM   7175 C  CA  . ASN B 1 406 ? 54.214  -5.608  -48.976 1.00 51.39 ? 407 ASN B CA  1 
ATOM   7176 C  C   . ASN B 1 406 ? 53.347  -4.827  -47.998 1.00 50.14 ? 407 ASN B C   1 
ATOM   7177 O  O   . ASN B 1 406 ? 53.468  -3.609  -47.862 1.00 50.30 ? 407 ASN B O   1 
ATOM   7178 C  CB  . ASN B 1 406 ? 53.862  -5.187  -50.407 1.00 51.84 ? 407 ASN B CB  1 
ATOM   7179 C  CG  . ASN B 1 406 ? 55.031  -5.336  -51.380 1.00 53.27 ? 407 ASN B CG  1 
ATOM   7180 O  OD1 . ASN B 1 406 ? 56.148  -5.693  -50.992 1.00 55.00 ? 407 ASN B OD1 1 
ATOM   7181 N  ND2 . ASN B 1 406 ? 54.774  -5.052  -52.657 1.00 54.19 ? 407 ASN B ND2 1 
ATOM   7182 N  N   . ILE B 1 407 ? 52.453  -5.545  -47.331 1.00 48.65 ? 408 ILE B N   1 
ATOM   7183 C  CA  . ILE B 1 407 ? 51.522  -4.955  -46.377 1.00 47.08 ? 408 ILE B CA  1 
ATOM   7184 C  C   . ILE B 1 407 ? 52.150  -4.852  -44.980 1.00 45.45 ? 408 ILE B C   1 
ATOM   7185 O  O   . ILE B 1 407 ? 51.728  -4.028  -44.166 1.00 45.20 ? 408 ILE B O   1 
ATOM   7186 C  CB  . ILE B 1 407 ? 50.166  -5.723  -46.386 1.00 47.34 ? 408 ILE B CB  1 
ATOM   7187 C  CG1 . ILE B 1 407 ? 49.275  -5.178  -47.510 1.00 47.84 ? 408 ILE B CG1 1 
ATOM   7188 C  CG2 . ILE B 1 407 ? 49.447  -5.650  -45.030 1.00 47.94 ? 408 ILE B CG2 1 
ATOM   7189 C  CD1 . ILE B 1 407 ? 47.924  -5.850  -47.625 1.00 48.85 ? 408 ILE B CD1 1 
ATOM   7190 N  N   . THR B 1 408 ? 53.175  -5.668  -44.731 1.00 43.60 ? 409 THR B N   1 
ATOM   7191 C  CA  . THR B 1 408 ? 53.848  -5.711  -43.429 1.00 41.80 ? 409 THR B CA  1 
ATOM   7192 C  C   . THR B 1 408 ? 55.336  -5.303  -43.487 1.00 40.32 ? 409 THR B C   1 
ATOM   7193 O  O   . THR B 1 408 ? 56.037  -5.321  -42.463 1.00 40.05 ? 409 THR B O   1 
ATOM   7194 C  CB  . THR B 1 408 ? 53.712  -7.110  -42.772 1.00 42.23 ? 409 THR B CB  1 
ATOM   7195 O  OG1 . THR B 1 408 ? 54.421  -8.084  -43.549 1.00 42.25 ? 409 THR B OG1 1 
ATOM   7196 C  CG2 . THR B 1 408 ? 52.248  -7.514  -42.662 1.00 41.98 ? 409 THR B CG2 1 
ATOM   7197 N  N   . TYR B 1 409 ? 55.806  -4.927  -44.680 1.00 38.13 ? 410 TYR B N   1 
ATOM   7198 C  CA  . TYR B 1 409 ? 57.188  -4.480  -44.881 1.00 36.15 ? 410 TYR B CA  1 
ATOM   7199 C  C   . TYR B 1 409 ? 57.570  -3.312  -43.958 1.00 34.48 ? 410 TYR B C   1 
ATOM   7200 O  O   . TYR B 1 409 ? 56.918  -2.273  -43.984 1.00 33.37 ? 410 TYR B O   1 
ATOM   7201 C  CB  . TYR B 1 409 ? 57.410  -4.060  -46.339 1.00 36.66 ? 410 TYR B CB  1 
ATOM   7202 C  CG  . TYR B 1 409 ? 58.865  -3.841  -46.667 1.00 36.90 ? 410 TYR B CG  1 
ATOM   7203 C  CD1 . TYR B 1 409 ? 59.777  -4.887  -46.561 1.00 38.14 ? 410 TYR B CD1 1 
ATOM   7204 C  CD2 . TYR B 1 409 ? 59.333  -2.591  -47.069 1.00 37.72 ? 410 TYR B CD2 1 
ATOM   7205 C  CE1 . TYR B 1 409 ? 61.125  -4.698  -46.853 1.00 39.98 ? 410 TYR B CE1 1 
ATOM   7206 C  CE2 . TYR B 1 409 ? 60.685  -2.392  -47.367 1.00 38.05 ? 410 TYR B CE2 1 
ATOM   7207 C  CZ  . TYR B 1 409 ? 61.566  -3.448  -47.253 1.00 38.98 ? 410 TYR B CZ  1 
ATOM   7208 O  OH  . TYR B 1 409 ? 62.897  -3.284  -47.534 1.00 42.21 ? 410 TYR B OH  1 
ATOM   7209 N  N   . PHE B 1 410 ? 58.630  -3.511  -43.172 1.00 32.87 ? 411 PHE B N   1 
ATOM   7210 C  CA  . PHE B 1 410 ? 59.107  -2.562  -42.148 1.00 32.02 ? 411 PHE B CA  1 
ATOM   7211 C  C   . PHE B 1 410 ? 58.001  -1.824  -41.376 1.00 31.21 ? 411 PHE B C   1 
ATOM   7212 O  O   . PHE B 1 410 ? 58.016  -0.600  -41.241 1.00 30.36 ? 411 PHE B O   1 
ATOM   7213 C  CB  . PHE B 1 410 ? 60.145  -1.596  -42.736 1.00 31.63 ? 411 PHE B CB  1 
ATOM   7214 C  CG  . PHE B 1 410 ? 61.548  -2.125  -42.677 1.00 30.92 ? 411 PHE B CG  1 
ATOM   7215 C  CD1 . PHE B 1 410 ? 62.024  -2.976  -43.669 1.00 30.21 ? 411 PHE B CD1 1 
ATOM   7216 C  CD2 . PHE B 1 410 ? 62.387  -1.785  -41.625 1.00 29.24 ? 411 PHE B CD2 1 
ATOM   7217 C  CE1 . PHE B 1 410 ? 63.320  -3.472  -43.625 1.00 29.53 ? 411 PHE B CE1 1 
ATOM   7218 C  CE2 . PHE B 1 410 ? 63.689  -2.282  -41.559 1.00 29.58 ? 411 PHE B CE2 1 
ATOM   7219 C  CZ  . PHE B 1 410 ? 64.157  -3.130  -42.571 1.00 30.47 ? 411 PHE B CZ  1 
ATOM   7220 N  N   . ARG B 1 411 ? 57.033  -2.591  -40.888 1.00 30.78 ? 412 ARG B N   1 
ATOM   7221 C  CA  . ARG B 1 411 ? 55.886  -2.008  -40.208 1.00 30.93 ? 412 ARG B CA  1 
ATOM   7222 C  C   . ARG B 1 411 ? 55.714  -2.492  -38.765 1.00 30.47 ? 412 ARG B C   1 
ATOM   7223 O  O   . ARG B 1 411 ? 55.030  -1.848  -37.981 1.00 30.46 ? 412 ARG B O   1 
ATOM   7224 C  CB  . ARG B 1 411 ? 54.616  -2.152  -41.058 1.00 31.52 ? 412 ARG B CB  1 
ATOM   7225 C  CG  . ARG B 1 411 ? 54.570  -1.062  -42.153 1.00 31.74 ? 412 ARG B CG  1 
ATOM   7226 C  CD  . ARG B 1 411 ? 53.523  -1.261  -43.245 1.00 32.07 ? 412 ARG B CD  1 
ATOM   7227 N  NE  . ARG B 1 411 ? 54.131  -1.019  -44.560 1.00 34.07 ? 412 ARG B NE  1 
ATOM   7228 C  CZ  . ARG B 1 411 ? 53.518  -0.463  -45.592 1.00 34.53 ? 412 ARG B CZ  1 
ATOM   7229 N  NH1 . ARG B 1 411 ? 52.271  -0.048  -45.501 1.00 36.19 ? 412 ARG B NH1 1 
ATOM   7230 N  NH2 . ARG B 1 411 ? 54.167  -0.294  -46.721 1.00 38.40 ? 412 ARG B NH2 1 
ATOM   7231 N  N   . ASN B 1 412 ? 56.364  -3.606  -38.418 1.00 29.75 ? 413 ASN B N   1 
ATOM   7232 C  CA  . ASN B 1 412 ? 56.349  -4.131  -37.042 1.00 29.36 ? 413 ASN B CA  1 
ATOM   7233 C  C   . ASN B 1 412 ? 57.544  -3.567  -36.276 1.00 28.68 ? 413 ASN B C   1 
ATOM   7234 O  O   . ASN B 1 412 ? 58.555  -4.226  -36.121 1.00 29.13 ? 413 ASN B O   1 
ATOM   7235 C  CB  . ASN B 1 412 ? 56.364  -5.674  -37.040 1.00 29.34 ? 413 ASN B CB  1 
ATOM   7236 C  CG  . ASN B 1 412 ? 56.290  -6.272  -35.631 1.00 29.91 ? 413 ASN B CG  1 
ATOM   7237 O  OD1 . ASN B 1 412 ? 55.586  -5.769  -34.755 1.00 30.14 ? 413 ASN B OD1 1 
ATOM   7238 N  ND2 . ASN B 1 412 ? 57.027  -7.349  -35.416 1.00 31.18 ? 413 ASN B ND2 1 
ATOM   7239 N  N   . LEU B 1 413 ? 57.419  -2.337  -35.797 1.00 28.06 ? 414 LEU B N   1 
ATOM   7240 C  CA  . LEU B 1 413 ? 58.578  -1.583  -35.334 1.00 27.27 ? 414 LEU B CA  1 
ATOM   7241 C  C   . LEU B 1 413 ? 58.512  -1.225  -33.849 1.00 26.99 ? 414 LEU B C   1 
ATOM   7242 O  O   . LEU B 1 413 ? 59.390  -0.529  -33.340 1.00 26.83 ? 414 LEU B O   1 
ATOM   7243 C  CB  . LEU B 1 413 ? 58.746  -0.304  -36.167 1.00 27.02 ? 414 LEU B CB  1 
ATOM   7244 C  CG  . LEU B 1 413 ? 59.024  -0.424  -37.674 1.00 27.73 ? 414 LEU B CG  1 
ATOM   7245 C  CD1 . LEU B 1 413 ? 58.893  0.949   -38.366 1.00 28.02 ? 414 LEU B CD1 1 
ATOM   7246 C  CD2 . LEU B 1 413 ? 60.380  -1.028  -37.923 1.00 26.03 ? 414 LEU B CD2 1 
ATOM   7247 N  N   . GLY B 1 414 ? 57.478  -1.705  -33.168 1.00 25.98 ? 415 GLY B N   1 
ATOM   7248 C  CA  . GLY B 1 414 ? 57.249  -1.379  -31.762 1.00 25.45 ? 415 GLY B CA  1 
ATOM   7249 C  C   . GLY B 1 414 ? 58.424  -1.647  -30.825 1.00 24.78 ? 415 GLY B C   1 
ATOM   7250 O  O   . GLY B 1 414 ? 58.600  -0.914  -29.851 1.00 24.48 ? 415 GLY B O   1 
ATOM   7251 N  N   . PHE B 1 415 ? 59.217  -2.686  -31.111 1.00 23.76 ? 416 PHE B N   1 
ATOM   7252 C  CA  . PHE B 1 415 ? 60.398  -3.010  -30.296 1.00 23.22 ? 416 PHE B CA  1 
ATOM   7253 C  C   . PHE B 1 415 ? 61.712  -2.583  -30.939 1.00 23.56 ? 416 PHE B C   1 
ATOM   7254 O  O   . PHE B 1 415 ? 62.782  -3.019  -30.508 1.00 23.51 ? 416 PHE B O   1 
ATOM   7255 C  CB  . PHE B 1 415 ? 60.485  -4.509  -29.990 1.00 23.16 ? 416 PHE B CB  1 
ATOM   7256 C  CG  . PHE B 1 415 ? 59.360  -5.035  -29.158 1.00 21.77 ? 416 PHE B CG  1 
ATOM   7257 C  CD1 . PHE B 1 415 ? 58.286  -5.693  -29.762 1.00 21.75 ? 416 PHE B CD1 1 
ATOM   7258 C  CD2 . PHE B 1 415 ? 59.376  -4.892  -27.780 1.00 21.31 ? 416 PHE B CD2 1 
ATOM   7259 C  CE1 . PHE B 1 415 ? 57.246  -6.203  -28.999 1.00 22.42 ? 416 PHE B CE1 1 
ATOM   7260 C  CE2 . PHE B 1 415 ? 58.335  -5.403  -26.988 1.00 22.03 ? 416 PHE B CE2 1 
ATOM   7261 C  CZ  . PHE B 1 415 ? 57.266  -6.060  -27.599 1.00 22.76 ? 416 PHE B CZ  1 
ATOM   7262 N  N   . GLY B 1 416 ? 61.641  -1.736  -31.958 1.00 23.37 ? 417 GLY B N   1 
ATOM   7263 C  CA  . GLY B 1 416 ? 62.840  -1.355  -32.675 1.00 24.90 ? 417 GLY B CA  1 
ATOM   7264 C  C   . GLY B 1 416 ? 63.347  -2.424  -33.626 1.00 25.80 ? 417 GLY B C   1 
ATOM   7265 O  O   . GLY B 1 416 ? 62.582  -3.283  -34.064 1.00 25.30 ? 417 GLY B O   1 
ATOM   7266 N  N   . TRP B 1 417 ? 64.645  -2.378  -33.922 1.00 26.65 ? 418 TRP B N   1 
ATOM   7267 C  CA  . TRP B 1 417 ? 65.231  -3.185  -34.994 1.00 28.17 ? 418 TRP B CA  1 
ATOM   7268 C  C   . TRP B 1 417 ? 66.701  -3.477  -34.699 1.00 27.40 ? 418 TRP B C   1 
ATOM   7269 O  O   . TRP B 1 417 ? 67.384  -2.663  -34.066 1.00 27.25 ? 418 TRP B O   1 
ATOM   7270 C  CB  . TRP B 1 417 ? 65.108  -2.410  -36.312 1.00 29.37 ? 418 TRP B CB  1 
ATOM   7271 C  CG  . TRP B 1 417 ? 65.514  -3.156  -37.546 1.00 35.46 ? 418 TRP B CG  1 
ATOM   7272 C  CD1 . TRP B 1 417 ? 64.698  -3.897  -38.362 1.00 38.52 ? 418 TRP B CD1 1 
ATOM   7273 C  CD2 . TRP B 1 417 ? 66.834  -3.231  -38.127 1.00 39.31 ? 418 TRP B CD2 1 
ATOM   7274 N  NE1 . TRP B 1 417 ? 65.427  -4.436  -39.400 1.00 40.76 ? 418 TRP B NE1 1 
ATOM   7275 C  CE2 . TRP B 1 417 ? 66.735  -4.040  -39.286 1.00 39.76 ? 418 TRP B CE2 1 
ATOM   7276 C  CE3 . TRP B 1 417 ? 68.087  -2.702  -37.774 1.00 41.49 ? 418 TRP B CE3 1 
ATOM   7277 C  CZ2 . TRP B 1 417 ? 67.837  -4.332  -40.098 1.00 40.71 ? 418 TRP B CZ2 1 
ATOM   7278 C  CZ3 . TRP B 1 417 ? 69.190  -2.992  -38.587 1.00 41.60 ? 418 TRP B CZ3 1 
ATOM   7279 C  CH2 . TRP B 1 417 ? 69.052  -3.803  -39.734 1.00 41.47 ? 418 TRP B CH2 1 
ATOM   7280 N  N   . GLY B 1 418 ? 67.173  -4.644  -35.147 1.00 26.74 ? 419 GLY B N   1 
ATOM   7281 C  CA  . GLY B 1 418 ? 68.596  -4.968  -35.188 1.00 25.46 ? 419 GLY B CA  1 
ATOM   7282 C  C   . GLY B 1 418 ? 69.195  -5.297  -33.848 1.00 25.73 ? 419 GLY B C   1 
ATOM   7283 O  O   . GLY B 1 418 ? 68.466  -5.639  -32.903 1.00 25.18 ? 419 GLY B O   1 
ATOM   7284 N  N   . VAL B 1 419 ? 70.524  -5.186  -33.764 1.00 25.10 ? 420 VAL B N   1 
ATOM   7285 C  CA  . VAL B 1 419 ? 71.283  -5.544  -32.558 1.00 24.99 ? 420 VAL B CA  1 
ATOM   7286 C  C   . VAL B 1 419 ? 70.944  -4.714  -31.319 1.00 24.42 ? 420 VAL B C   1 
ATOM   7287 O  O   . VAL B 1 419 ? 71.170  -5.161  -30.191 1.00 24.05 ? 420 VAL B O   1 
ATOM   7288 C  CB  . VAL B 1 419 ? 72.824  -5.482  -32.778 1.00 25.44 ? 420 VAL B CB  1 
ATOM   7289 C  CG1 . VAL B 1 419 ? 73.277  -6.586  -33.696 1.00 27.19 ? 420 VAL B CG1 1 
ATOM   7290 C  CG2 . VAL B 1 419 ? 73.268  -4.105  -33.323 1.00 25.37 ? 420 VAL B CG2 1 
ATOM   7291 N  N   . ARG B 1 420 ? 70.414  -3.508  -31.516 1.00 24.30 ? 421 ARG B N   1 
ATOM   7292 C  CA  . ARG B 1 420 ? 70.060  -2.668  -30.360 1.00 23.94 ? 421 ARG B CA  1 
ATOM   7293 C  C   . ARG B 1 420 ? 68.535  -2.482  -30.184 1.00 23.74 ? 421 ARG B C   1 
ATOM   7294 O  O   . ARG B 1 420 ? 68.077  -1.548  -29.520 1.00 23.54 ? 421 ARG B O   1 
ATOM   7295 C  CB  . ARG B 1 420 ? 70.827  -1.337  -30.371 1.00 23.68 ? 421 ARG B CB  1 
ATOM   7296 C  CG  . ARG B 1 420 ? 70.828  -0.644  -28.997 1.00 25.36 ? 421 ARG B CG  1 
ATOM   7297 C  CD  . ARG B 1 420 ? 71.873  0.449   -28.858 1.00 25.38 ? 421 ARG B CD  1 
ATOM   7298 N  NE  . ARG B 1 420 ? 71.936  0.943   -27.478 1.00 24.41 ? 421 ARG B NE  1 
ATOM   7299 C  CZ  . ARG B 1 420 ? 72.808  1.848   -27.038 1.00 25.91 ? 421 ARG B CZ  1 
ATOM   7300 N  NH1 . ARG B 1 420 ? 73.718  2.383   -27.857 1.00 23.80 ? 421 ARG B NH1 1 
ATOM   7301 N  NH2 . ARG B 1 420 ? 72.768  2.228   -25.770 1.00 25.55 ? 421 ARG B NH2 1 
ATOM   7302 N  N   . GLN B 1 421 ? 67.758  -3.400  -30.754 1.00 22.98 ? 422 GLN B N   1 
ATOM   7303 C  CA  . GLN B 1 421 ? 66.325  -3.470  -30.481 1.00 22.73 ? 422 GLN B CA  1 
ATOM   7304 C  C   . GLN B 1 421 ? 66.078  -3.680  -28.987 1.00 22.07 ? 422 GLN B C   1 
ATOM   7305 O  O   . GLN B 1 421 ? 67.011  -3.951  -28.222 1.00 22.35 ? 422 GLN B O   1 
ATOM   7306 C  CB  . GLN B 1 421 ? 65.680  -4.599  -31.287 1.00 23.45 ? 422 GLN B CB  1 
ATOM   7307 C  CG  . GLN B 1 421 ? 66.112  -5.987  -30.848 1.00 25.29 ? 422 GLN B CG  1 
ATOM   7308 C  CD  . GLN B 1 421 ? 65.532  -7.070  -31.733 1.00 31.24 ? 422 GLN B CD  1 
ATOM   7309 O  OE1 . GLN B 1 421 ? 66.164  -7.501  -32.702 1.00 33.17 ? 422 GLN B OE1 1 
ATOM   7310 N  NE2 . GLN B 1 421 ? 64.317  -7.499  -31.423 1.00 31.15 ? 422 GLN B NE2 1 
ATOM   7311 N  N   . CYS B 1 422 ? 64.825  -3.542  -28.572 1.00 21.71 ? 423 CYS B N   1 
ATOM   7312 C  CA  . CYS B 1 422 ? 64.451  -3.727  -27.168 1.00 21.34 ? 423 CYS B CA  1 
ATOM   7313 C  C   . CYS B 1 422 ? 65.096  -4.975  -26.562 1.00 21.85 ? 423 CYS B C   1 
ATOM   7314 O  O   . CYS B 1 422 ? 64.906  -6.097  -27.067 1.00 21.47 ? 423 CYS B O   1 
ATOM   7315 C  CB  . CYS B 1 422 ? 62.930  -3.827  -27.028 1.00 20.92 ? 423 CYS B CB  1 
ATOM   7316 S  SG  . CYS B 1 422 ? 62.373  -4.289  -25.359 1.00 20.49 ? 423 CYS B SG  1 
ATOM   7317 N  N   . LEU B 1 423 ? 65.874  -4.775  -25.503 1.00 21.79 ? 424 LEU B N   1 
ATOM   7318 C  CA  . LEU B 1 423 ? 66.473  -5.895  -24.774 1.00 22.45 ? 424 LEU B CA  1 
ATOM   7319 C  C   . LEU B 1 423 ? 65.412  -6.779  -24.116 1.00 22.11 ? 424 LEU B C   1 
ATOM   7320 O  O   . LEU B 1 423 ? 65.608  -7.989  -23.958 1.00 22.79 ? 424 LEU B O   1 
ATOM   7321 C  CB  . LEU B 1 423 ? 67.453  -5.394  -23.703 1.00 22.09 ? 424 LEU B CB  1 
ATOM   7322 C  CG  . LEU B 1 423 ? 68.221  -6.431  -22.876 1.00 23.26 ? 424 LEU B CG  1 
ATOM   7323 C  CD1 . LEU B 1 423 ? 69.175  -7.261  -23.763 1.00 26.02 ? 424 LEU B CD1 1 
ATOM   7324 C  CD2 . LEU B 1 423 ? 68.987  -5.765  -21.732 1.00 26.15 ? 424 LEU B CD2 1 
ATOM   7325 N  N   . GLY B 1 424 ? 64.304  -6.182  -23.700 1.00 22.00 ? 425 GLY B N   1 
ATOM   7326 C  CA  . GLY B 1 424 ? 63.268  -6.946  -23.014 1.00 21.83 ? 425 GLY B CA  1 
ATOM   7327 C  C   . GLY B 1 424 ? 62.247  -7.591  -23.930 1.00 21.96 ? 425 GLY B C   1 
ATOM   7328 O  O   . GLY B 1 424 ? 61.226  -8.068  -23.459 1.00 21.65 ? 425 GLY B O   1 
ATOM   7329 N  N   . ARG B 1 425 ? 62.515  -7.618  -25.233 1.00 21.92 ? 426 ARG B N   1 
ATOM   7330 C  CA  . ARG B 1 425 ? 61.485  -8.010  -26.202 1.00 23.05 ? 426 ARG B CA  1 
ATOM   7331 C  C   . ARG B 1 425 ? 60.884  -9.404  -25.984 1.00 22.90 ? 426 ARG B C   1 
ATOM   7332 O  O   . ARG B 1 425 ? 59.663  -9.584  -26.067 1.00 22.58 ? 426 ARG B O   1 
ATOM   7333 C  CB  . ARG B 1 425 ? 61.990  -7.876  -27.644 1.00 23.45 ? 426 ARG B CB  1 
ATOM   7334 C  CG  . ARG B 1 425 ? 60.922  -8.215  -28.688 1.00 24.02 ? 426 ARG B CG  1 
ATOM   7335 C  CD  . ARG B 1 425 ? 61.494  -8.182  -30.098 1.00 25.17 ? 426 ARG B CD  1 
ATOM   7336 N  NE  . ARG B 1 425 ? 60.439  -8.142  -31.107 1.00 26.28 ? 426 ARG B NE  1 
ATOM   7337 C  CZ  . ARG B 1 425 ? 60.607  -7.683  -32.344 1.00 28.93 ? 426 ARG B CZ  1 
ATOM   7338 N  NH1 . ARG B 1 425 ? 61.788  -7.219  -32.734 1.00 31.01 ? 426 ARG B NH1 1 
ATOM   7339 N  NH2 . ARG B 1 425 ? 59.590  -7.672  -33.192 1.00 30.80 ? 426 ARG B NH2 1 
ATOM   7340 N  N   . ARG B 1 426 ? 61.738  -10.383 -25.709 1.00 23.24 ? 427 ARG B N   1 
ATOM   7341 C  CA  . ARG B 1 426 ? 61.275  -11.756 -25.568 1.00 23.80 ? 427 ARG B CA  1 
ATOM   7342 C  C   . ARG B 1 426 ? 60.519  -11.893 -24.270 1.00 23.30 ? 427 ARG B C   1 
ATOM   7343 O  O   . ARG B 1 426 ? 59.470  -12.509 -24.239 1.00 23.46 ? 427 ARG B O   1 
ATOM   7344 C  CB  . ARG B 1 426 ? 62.441  -12.737 -25.626 1.00 24.32 ? 427 ARG B CB  1 
ATOM   7345 C  CG  . ARG B 1 426 ? 63.289  -12.581 -26.879 1.00 26.93 ? 427 ARG B CG  1 
ATOM   7346 C  CD  . ARG B 1 426 ? 62.723  -13.378 -28.015 1.00 33.26 ? 427 ARG B CD  1 
ATOM   7347 N  NE  . ARG B 1 426 ? 61.878  -12.619 -28.921 1.00 36.62 ? 427 ARG B NE  1 
ATOM   7348 C  CZ  . ARG B 1 426 ? 62.270  -12.160 -30.106 1.00 37.57 ? 427 ARG B CZ  1 
ATOM   7349 N  NH1 . ARG B 1 426 ? 63.512  -12.362 -30.522 1.00 39.59 ? 427 ARG B NH1 1 
ATOM   7350 N  NH2 . ARG B 1 426 ? 61.412  -11.500 -30.874 1.00 37.93 ? 427 ARG B NH2 1 
ATOM   7351 N  N   . ILE B 1 427 ? 61.046  -11.287 -23.207 1.00 22.66 ? 428 ILE B N   1 
ATOM   7352 C  CA  . ILE B 1 427 ? 60.363  -11.277 -21.918 1.00 22.52 ? 428 ILE B CA  1 
ATOM   7353 C  C   . ILE B 1 427 ? 58.976  -10.670 -22.091 1.00 22.26 ? 428 ILE B C   1 
ATOM   7354 O  O   . ILE B 1 427 ? 57.984  -11.267 -21.689 1.00 21.84 ? 428 ILE B O   1 
ATOM   7355 C  CB  . ILE B 1 427 ? 61.178  -10.513 -20.850 1.00 21.70 ? 428 ILE B CB  1 
ATOM   7356 C  CG1 . ILE B 1 427 ? 62.454  -11.301 -20.505 1.00 22.34 ? 428 ILE B CG1 1 
ATOM   7357 C  CG2 . ILE B 1 427 ? 60.343  -10.280 -19.607 1.00 22.77 ? 428 ILE B CG2 1 
ATOM   7358 C  CD1 . ILE B 1 427 ? 63.490  -10.505 -19.753 1.00 20.75 ? 428 ILE B CD1 1 
ATOM   7359 N  N   . ALA B 1 428 ? 58.928  -9.498  -22.724 1.00 21.89 ? 429 ALA B N   1 
ATOM   7360 C  CA  . ALA B 1 428 ? 57.689  -8.781  -22.974 1.00 21.82 ? 429 ALA B CA  1 
ATOM   7361 C  C   . ALA B 1 428 ? 56.704  -9.540  -23.856 1.00 21.68 ? 429 ALA B C   1 
ATOM   7362 O  O   . ALA B 1 428 ? 55.521  -9.594  -23.536 1.00 21.92 ? 429 ALA B O   1 
ATOM   7363 C  CB  . ALA B 1 428 ? 57.975  -7.386  -23.565 1.00 21.48 ? 429 ALA B CB  1 
ATOM   7364 N  N   . GLU B 1 429 ? 57.178  -10.111 -24.960 1.00 21.36 ? 430 GLU B N   1 
ATOM   7365 C  CA  . GLU B 1 429 ? 56.321  -10.888 -25.850 1.00 22.43 ? 430 GLU B CA  1 
ATOM   7366 C  C   . GLU B 1 429 ? 55.725  -12.095 -25.150 1.00 22.44 ? 430 GLU B C   1 
ATOM   7367 O  O   . GLU B 1 429 ? 54.521  -12.339 -25.258 1.00 22.58 ? 430 GLU B O   1 
ATOM   7368 C  CB  . GLU B 1 429 ? 57.069  -11.354 -27.104 1.00 22.36 ? 430 GLU B CB  1 
ATOM   7369 C  CG  . GLU B 1 429 ? 57.374  -10.228 -28.049 1.00 25.50 ? 430 GLU B CG  1 
ATOM   7370 C  CD  . GLU B 1 429 ? 58.266  -10.642 -29.216 1.00 27.21 ? 430 GLU B CD  1 
ATOM   7371 O  OE1 . GLU B 1 429 ? 59.046  -11.616 -29.094 1.00 27.60 ? 430 GLU B OE1 1 
ATOM   7372 O  OE2 . GLU B 1 429 ? 58.175  -9.964  -30.252 1.00 28.97 ? 430 GLU B OE2 1 
ATOM   7373 N  N   . LEU B 1 430 ? 56.572  -12.834 -24.434 1.00 21.95 ? 431 LEU B N   1 
ATOM   7374 C  CA  . LEU B 1 430 ? 56.139  -14.018 -23.699 1.00 21.82 ? 431 LEU B CA  1 
ATOM   7375 C  C   . LEU B 1 430 ? 55.192  -13.659 -22.552 1.00 21.52 ? 431 LEU B C   1 
ATOM   7376 O  O   . LEU B 1 430 ? 54.147  -14.276 -22.397 1.00 21.02 ? 431 LEU B O   1 
ATOM   7377 C  CB  . LEU B 1 430 ? 57.354  -14.804 -23.180 1.00 22.00 ? 431 LEU B CB  1 
ATOM   7378 C  CG  . LEU B 1 430 ? 58.229  -15.521 -24.230 1.00 22.50 ? 431 LEU B CG  1 
ATOM   7379 C  CD1 . LEU B 1 430 ? 59.540  -16.048 -23.623 1.00 21.73 ? 431 LEU B CD1 1 
ATOM   7380 C  CD2 . LEU B 1 430 ? 57.448  -16.660 -24.924 1.00 23.35 ? 431 LEU B CD2 1 
ATOM   7381 N  N   . GLU B 1 431 ? 55.557  -12.643 -21.771 1.00 21.47 ? 432 GLU B N   1 
ATOM   7382 C  CA  . GLU B 1 431 ? 54.698  -12.136 -20.697 1.00 21.46 ? 432 GLU B CA  1 
ATOM   7383 C  C   . GLU B 1 431 ? 53.289  -11.781 -21.181 1.00 20.76 ? 432 GLU B C   1 
ATOM   7384 O  O   . GLU B 1 431 ? 52.306  -12.195 -20.580 1.00 20.39 ? 432 GLU B O   1 
ATOM   7385 C  CB  . GLU B 1 431 ? 55.339  -10.910 -20.036 1.00 22.07 ? 432 GLU B CB  1 
ATOM   7386 C  CG  . GLU B 1 431 ? 54.592  -10.409 -18.820 1.00 24.13 ? 432 GLU B CG  1 
ATOM   7387 C  CD  . GLU B 1 431 ? 55.223  -9.164  -18.230 1.00 29.42 ? 432 GLU B CD  1 
ATOM   7388 O  OE1 . GLU B 1 431 ? 56.485  -9.067  -18.195 1.00 31.15 ? 432 GLU B OE1 1 
ATOM   7389 O  OE2 . GLU B 1 431 ? 54.452  -8.278  -17.791 1.00 31.43 ? 432 GLU B OE2 1 
ATOM   7390 N  N   . MET B 1 432 ? 53.205  -11.015 -22.266 1.00 19.88 ? 433 MET B N   1 
ATOM   7391 C  CA  . MET B 1 432 ? 51.928  -10.571 -22.802 1.00 19.69 ? 433 MET B CA  1 
ATOM   7392 C  C   . MET B 1 432 ? 51.131  -11.698 -23.452 1.00 19.50 ? 433 MET B C   1 
ATOM   7393 O  O   . MET B 1 432 ? 49.920  -11.759 -23.300 1.00 19.58 ? 433 MET B O   1 
ATOM   7394 C  CB  . MET B 1 432 ? 52.132  -9.435  -23.800 1.00 19.05 ? 433 MET B CB  1 
ATOM   7395 C  CG  . MET B 1 432 ? 52.647  -8.174  -23.125 1.00 21.64 ? 433 MET B CG  1 
ATOM   7396 S  SD  . MET B 1 432 ? 52.698  -6.756  -24.224 1.00 23.92 ? 433 MET B SD  1 
ATOM   7397 C  CE  . MET B 1 432 ? 54.001  -7.233  -25.352 1.00 21.54 ? 433 MET B CE  1 
ATOM   7398 N  N   . THR B 1 433 ? 51.806  -12.584 -24.177 1.00 19.37 ? 434 THR B N   1 
ATOM   7399 C  CA  . THR B 1 433 ? 51.107  -13.691 -24.835 1.00 19.75 ? 434 THR B CA  1 
ATOM   7400 C  C   . THR B 1 433 ? 50.531  -14.671 -23.801 1.00 19.44 ? 434 THR B C   1 
ATOM   7401 O  O   . THR B 1 433 ? 49.396  -15.079 -23.907 1.00 20.17 ? 434 THR B O   1 
ATOM   7402 C  CB  . THR B 1 433 ? 52.017  -14.420 -25.868 1.00 19.24 ? 434 THR B CB  1 
ATOM   7403 O  OG1 . THR B 1 433 ? 52.614  -13.444 -26.726 1.00 19.83 ? 434 THR B OG1 1 
ATOM   7404 C  CG2 . THR B 1 433 ? 51.190  -15.339 -26.722 1.00 19.88 ? 434 THR B CG2 1 
ATOM   7405 N  N   . ILE B 1 434 ? 51.325  -15.019 -22.800 1.00 19.65 ? 435 ILE B N   1 
ATOM   7406 C  CA  . ILE B 1 434 ? 50.893  -15.893 -21.711 1.00 19.59 ? 435 ILE B CA  1 
ATOM   7407 C  C   . ILE B 1 434 ? 49.794  -15.247 -20.857 1.00 19.62 ? 435 ILE B C   1 
ATOM   7408 O  O   . ILE B 1 434 ? 48.836  -15.917 -20.457 1.00 20.22 ? 435 ILE B O   1 
ATOM   7409 C  CB  . ILE B 1 434 ? 52.094  -16.334 -20.841 1.00 19.51 ? 435 ILE B CB  1 
ATOM   7410 C  CG1 . ILE B 1 434 ? 53.041  -17.222 -21.666 1.00 19.01 ? 435 ILE B CG1 1 
ATOM   7411 C  CG2 . ILE B 1 434 ? 51.610  -17.110 -19.609 1.00 20.28 ? 435 ILE B CG2 1 
ATOM   7412 C  CD1 . ILE B 1 434 ? 54.451  -17.423 -21.036 1.00 18.75 ? 435 ILE B CD1 1 
ATOM   7413 N  N   . PHE B 1 435 ? 49.910  -13.942 -20.608 1.00 19.49 ? 436 PHE B N   1 
ATOM   7414 C  CA  . PHE B 1 435 ? 48.877  -13.218 -19.853 1.00 19.44 ? 436 PHE B CA  1 
ATOM   7415 C  C   . PHE B 1 435 ? 47.544  -13.297 -20.591 1.00 19.26 ? 436 PHE B C   1 
ATOM   7416 O  O   . PHE B 1 435 ? 46.509  -13.576 -19.991 1.00 18.93 ? 436 PHE B O   1 
ATOM   7417 C  CB  . PHE B 1 435 ? 49.281  -11.747 -19.634 1.00 19.10 ? 436 PHE B CB  1 
ATOM   7418 C  CG  . PHE B 1 435 ? 48.190  -10.891 -19.049 1.00 18.84 ? 436 PHE B CG  1 
ATOM   7419 C  CD1 . PHE B 1 435 ? 48.099  -10.702 -17.677 1.00 18.78 ? 436 PHE B CD1 1 
ATOM   7420 C  CD2 . PHE B 1 435 ? 47.268  -10.257 -19.871 1.00 18.60 ? 436 PHE B CD2 1 
ATOM   7421 C  CE1 . PHE B 1 435 ? 47.096  -9.895  -17.135 1.00 19.73 ? 436 PHE B CE1 1 
ATOM   7422 C  CE2 . PHE B 1 435 ? 46.268  -9.461  -19.340 1.00 20.20 ? 436 PHE B CE2 1 
ATOM   7423 C  CZ  . PHE B 1 435 ? 46.185  -9.285  -17.957 1.00 20.63 ? 436 PHE B CZ  1 
ATOM   7424 N  N   . LEU B 1 436 ? 47.582  -13.061 -21.897 1.00 19.47 ? 437 LEU B N   1 
ATOM   7425 C  CA  . LEU B 1 436 ? 46.350  -12.981 -22.699 1.00 19.90 ? 437 LEU B CA  1 
ATOM   7426 C  C   . LEU B 1 436 ? 45.702  -14.348 -22.931 1.00 19.91 ? 437 LEU B C   1 
ATOM   7427 O  O   . LEU B 1 436 ? 44.480  -14.437 -23.055 1.00 19.76 ? 437 LEU B O   1 
ATOM   7428 C  CB  . LEU B 1 436 ? 46.609  -12.262 -24.030 1.00 19.87 ? 437 LEU B CB  1 
ATOM   7429 C  CG  . LEU B 1 436 ? 46.968  -10.761 -23.933 1.00 20.28 ? 437 LEU B CG  1 
ATOM   7430 C  CD1 . LEU B 1 436 ? 47.462  -10.223 -25.265 1.00 19.22 ? 437 LEU B CD1 1 
ATOM   7431 C  CD2 . LEU B 1 436 ? 45.803  -9.926  -23.412 1.00 19.12 ? 437 LEU B CD2 1 
ATOM   7432 N  N   . ILE B 1 437 ? 46.526  -15.393 -23.012 1.00 20.58 ? 438 ILE B N   1 
ATOM   7433 C  CA  . ILE B 1 437 ? 46.034  -16.781 -23.049 1.00 21.29 ? 438 ILE B CA  1 
ATOM   7434 C  C   . ILE B 1 437 ? 45.236  -17.065 -21.779 1.00 21.49 ? 438 ILE B C   1 
ATOM   7435 O  O   . ILE B 1 437 ? 44.109  -17.558 -21.842 1.00 21.69 ? 438 ILE B O   1 
ATOM   7436 C  CB  . ILE B 1 437 ? 47.209  -17.807 -23.197 1.00 21.35 ? 438 ILE B CB  1 
ATOM   7437 C  CG1 . ILE B 1 437 ? 47.748  -17.813 -24.633 1.00 20.94 ? 438 ILE B CG1 1 
ATOM   7438 C  CG2 . ILE B 1 437 ? 46.772  -19.223 -22.803 1.00 21.66 ? 438 ILE B CG2 1 
ATOM   7439 C  CD1 . ILE B 1 437 ? 49.060  -18.563 -24.791 1.00 19.60 ? 438 ILE B CD1 1 
ATOM   7440 N  N   . ASN B 1 438 ? 45.804  -16.709 -20.625 1.00 21.72 ? 439 ASN B N   1 
ATOM   7441 C  CA  . ASN B 1 438 ? 45.131  -16.950 -19.348 1.00 21.98 ? 439 ASN B CA  1 
ATOM   7442 C  C   . ASN B 1 438 ? 43.847  -16.149 -19.199 1.00 21.73 ? 439 ASN B C   1 
ATOM   7443 O  O   . ASN B 1 438 ? 42.822  -16.675 -18.738 1.00 21.08 ? 439 ASN B O   1 
ATOM   7444 C  CB  . ASN B 1 438 ? 46.080  -16.708 -18.171 1.00 22.14 ? 439 ASN B CB  1 
ATOM   7445 C  CG  . ASN B 1 438 ? 46.992  -17.883 -17.927 1.00 23.55 ? 439 ASN B CG  1 
ATOM   7446 O  OD1 . ASN B 1 438 ? 46.600  -18.847 -17.278 1.00 27.09 ? 439 ASN B OD1 1 
ATOM   7447 N  ND2 . ASN B 1 438 ? 48.214  -17.819 -18.446 1.00 23.88 ? 439 ASN B ND2 1 
ATOM   7448 N  N   . MET B 1 439 ? 43.903  -14.885 -19.608 1.00 21.46 ? 440 MET B N   1 
ATOM   7449 C  CA  . MET B 1 439 ? 42.749  -14.009 -19.541 1.00 21.75 ? 440 MET B CA  1 
ATOM   7450 C  C   . MET B 1 439 ? 41.621  -14.458 -20.486 1.00 22.08 ? 440 MET B C   1 
ATOM   7451 O  O   . MET B 1 439 ? 40.436  -14.437 -20.107 1.00 21.62 ? 440 MET B O   1 
ATOM   7452 C  CB  . MET B 1 439 ? 43.156  -12.556 -19.842 1.00 22.22 ? 440 MET B CB  1 
ATOM   7453 C  CG  . MET B 1 439 ? 43.962  -11.902 -18.723 1.00 22.12 ? 440 MET B CG  1 
ATOM   7454 S  SD  . MET B 1 439 ? 43.025  -11.637 -17.193 1.00 24.38 ? 440 MET B SD  1 
ATOM   7455 C  CE  . MET B 1 439 ? 41.985  -10.266 -17.675 1.00 18.93 ? 440 MET B CE  1 
ATOM   7456 N  N   . LEU B 1 440 ? 41.980  -14.820 -21.725 1.00 21.60 ? 441 LEU B N   1 
ATOM   7457 C  CA  . LEU B 1 440 ? 40.968  -15.214 -22.712 1.00 21.96 ? 441 LEU B CA  1 
ATOM   7458 C  C   . LEU B 1 440 ? 40.242  -16.524 -22.339 1.00 21.75 ? 441 LEU B C   1 
ATOM   7459 O  O   . LEU B 1 440 ? 39.069  -16.677 -22.635 1.00 21.61 ? 441 LEU B O   1 
ATOM   7460 C  CB  . LEU B 1 440 ? 41.560  -15.286 -24.127 1.00 21.47 ? 441 LEU B CB  1 
ATOM   7461 C  CG  . LEU B 1 440 ? 41.706  -13.931 -24.863 1.00 23.59 ? 441 LEU B CG  1 
ATOM   7462 C  CD1 . LEU B 1 440 ? 42.612  -14.065 -26.110 1.00 23.18 ? 441 LEU B CD1 1 
ATOM   7463 C  CD2 . LEU B 1 440 ? 40.357  -13.310 -25.240 1.00 22.76 ? 441 LEU B CD2 1 
ATOM   7464 N  N   . GLU B 1 441 ? 40.953  -17.454 -21.704 1.00 22.10 ? 442 GLU B N   1 
ATOM   7465 C  CA  . GLU B 1 441 ? 40.364  -18.714 -21.227 1.00 23.18 ? 442 GLU B CA  1 
ATOM   7466 C  C   . GLU B 1 441 ? 39.414  -18.485 -20.040 1.00 22.96 ? 442 GLU B C   1 
ATOM   7467 O  O   . GLU B 1 441 ? 38.512  -19.279 -19.787 1.00 23.23 ? 442 GLU B O   1 
ATOM   7468 C  CB  . GLU B 1 441 ? 41.461  -19.700 -20.811 1.00 23.22 ? 442 GLU B CB  1 
ATOM   7469 C  CG  . GLU B 1 441 ? 42.286  -20.245 -21.960 1.00 26.73 ? 442 GLU B CG  1 
ATOM   7470 C  CD  . GLU B 1 441 ? 43.497  -21.070 -21.506 1.00 31.47 ? 442 GLU B CD  1 
ATOM   7471 O  OE1 . GLU B 1 441 ? 44.170  -20.689 -20.519 1.00 31.76 ? 442 GLU B OE1 1 
ATOM   7472 O  OE2 . GLU B 1 441 ? 43.790  -22.098 -22.163 1.00 34.51 ? 442 GLU B OE2 1 
ATOM   7473 N  N   . ASN B 1 442 ? 39.618  -17.397 -19.314 1.00 22.31 ? 443 ASN B N   1 
ATOM   7474 C  CA  . ASN B 1 442 ? 38.862  -17.178 -18.079 1.00 22.40 ? 443 ASN B CA  1 
ATOM   7475 C  C   . ASN B 1 442 ? 37.774  -16.112 -18.102 1.00 21.84 ? 443 ASN B C   1 
ATOM   7476 O  O   . ASN B 1 442 ? 36.794  -16.214 -17.361 1.00 22.35 ? 443 ASN B O   1 
ATOM   7477 C  CB  . ASN B 1 442 ? 39.844  -16.941 -16.943 1.00 22.00 ? 443 ASN B CB  1 
ATOM   7478 C  CG  . ASN B 1 442 ? 40.460  -18.236 -16.449 1.00 23.91 ? 443 ASN B CG  1 
ATOM   7479 O  OD1 . ASN B 1 442 ? 39.875  -18.909 -15.613 1.00 26.28 ? 443 ASN B OD1 1 
ATOM   7480 N  ND2 . ASN B 1 442 ? 41.635  -18.592 -16.963 1.00 22.41 ? 443 ASN B ND2 1 
ATOM   7481 N  N   . PHE B 1 443 ? 37.932  -15.087 -18.937 1.00 21.21 ? 444 PHE B N   1 
ATOM   7482 C  CA  . PHE B 1 443 ? 37.010  -13.955 -18.909 1.00 21.18 ? 444 PHE B CA  1 
ATOM   7483 C  C   . PHE B 1 443 ? 36.637  -13.435 -20.282 1.00 22.06 ? 444 PHE B C   1 
ATOM   7484 O  O   . PHE B 1 443 ? 37.428  -13.521 -21.231 1.00 21.16 ? 444 PHE B O   1 
ATOM   7485 C  CB  . PHE B 1 443 ? 37.620  -12.773 -18.126 1.00 21.21 ? 444 PHE B CB  1 
ATOM   7486 C  CG  . PHE B 1 443 ? 38.213  -13.159 -16.810 1.00 20.77 ? 444 PHE B CG  1 
ATOM   7487 C  CD1 . PHE B 1 443 ? 39.585  -13.310 -16.677 1.00 21.00 ? 444 PHE B CD1 1 
ATOM   7488 C  CD2 . PHE B 1 443 ? 37.395  -13.407 -15.710 1.00 23.20 ? 444 PHE B CD2 1 
ATOM   7489 C  CE1 . PHE B 1 443 ? 40.142  -13.680 -15.468 1.00 22.02 ? 444 PHE B CE1 1 
ATOM   7490 C  CE2 . PHE B 1 443 ? 37.951  -13.783 -14.488 1.00 23.26 ? 444 PHE B CE2 1 
ATOM   7491 C  CZ  . PHE B 1 443 ? 39.325  -13.931 -14.375 1.00 22.57 ? 444 PHE B CZ  1 
ATOM   7492 N  N   . ARG B 1 444 ? 35.432  -12.871 -20.348 1.00 22.88 ? 445 ARG B N   1 
ATOM   7493 C  CA  . ARG B 1 444 ? 35.025  -11.948 -21.388 1.00 24.56 ? 445 ARG B CA  1 
ATOM   7494 C  C   . ARG B 1 444 ? 35.244  -10.535 -20.851 1.00 24.65 ? 445 ARG B C   1 
ATOM   7495 O  O   . ARG B 1 444 ? 34.920  -10.241 -19.697 1.00 23.96 ? 445 ARG B O   1 
ATOM   7496 C  CB  . ARG B 1 444 ? 33.532  -12.104 -21.726 1.00 24.82 ? 445 ARG B CB  1 
ATOM   7497 C  CG  . ARG B 1 444 ? 33.143  -13.390 -22.464 1.00 29.47 ? 445 ARG B CG  1 
ATOM   7498 C  CD  . ARG B 1 444 ? 31.615  -13.423 -22.743 1.00 34.81 ? 445 ARG B CD  1 
ATOM   7499 N  NE  . ARG B 1 444 ? 30.828  -13.740 -21.541 1.00 40.10 ? 445 ARG B NE  1 
ATOM   7500 C  CZ  . ARG B 1 444 ? 29.881  -12.967 -20.997 1.00 42.30 ? 445 ARG B CZ  1 
ATOM   7501 N  NH1 . ARG B 1 444 ? 29.550  -11.786 -21.531 1.00 43.72 ? 445 ARG B NH1 1 
ATOM   7502 N  NH2 . ARG B 1 444 ? 29.246  -13.389 -19.907 1.00 42.75 ? 445 ARG B NH2 1 
ATOM   7503 N  N   . VAL B 1 445 ? 35.750  -9.654  -21.706 1.00 25.54 ? 446 VAL B N   1 
ATOM   7504 C  CA  . VAL B 1 445 ? 36.047  -8.285  -21.306 1.00 26.26 ? 446 VAL B CA  1 
ATOM   7505 C  C   . VAL B 1 445 ? 35.235  -7.278  -22.114 1.00 27.32 ? 446 VAL B C   1 
ATOM   7506 O  O   . VAL B 1 445 ? 35.136  -7.366  -23.353 1.00 26.36 ? 446 VAL B O   1 
ATOM   7507 C  CB  . VAL B 1 445 ? 37.584  -7.988  -21.355 1.00 26.01 ? 446 VAL B CB  1 
ATOM   7508 C  CG1 . VAL B 1 445 ? 38.117  -8.041  -22.759 1.00 27.15 ? 446 VAL B CG1 1 
ATOM   7509 C  CG2 . VAL B 1 445 ? 37.913  -6.639  -20.720 1.00 25.27 ? 446 VAL B CG2 1 
ATOM   7510 N  N   . GLU B 1 446 ? 34.650  -6.337  -21.380 1.00 28.47 ? 447 GLU B N   1 
ATOM   7511 C  CA  . GLU B 1 446 ? 33.860  -5.260  -21.944 1.00 31.25 ? 447 GLU B CA  1 
ATOM   7512 C  C   . GLU B 1 446 ? 34.276  -3.910  -21.361 1.00 32.24 ? 447 GLU B C   1 
ATOM   7513 O  O   . GLU B 1 446 ? 34.928  -3.839  -20.317 1.00 31.04 ? 447 GLU B O   1 
ATOM   7514 C  CB  . GLU B 1 446 ? 32.367  -5.507  -21.693 1.00 31.62 ? 447 GLU B CB  1 
ATOM   7515 C  CG  . GLU B 1 446 ? 31.849  -6.780  -22.373 1.00 35.20 ? 447 GLU B CG  1 
ATOM   7516 C  CD  . GLU B 1 446 ? 30.353  -7.011  -22.196 1.00 39.31 ? 447 GLU B CD  1 
ATOM   7517 O  OE1 . GLU B 1 446 ? 29.770  -6.568  -21.170 1.00 42.62 ? 447 GLU B OE1 1 
ATOM   7518 O  OE2 . GLU B 1 446 ? 29.767  -7.662  -23.086 1.00 41.32 ? 447 GLU B OE2 1 
ATOM   7519 N  N   . ILE B 1 447 ? 33.910  -2.850  -22.073 1.00 34.68 ? 448 ILE B N   1 
ATOM   7520 C  CA  . ILE B 1 447 ? 34.017  -1.482  -21.590 1.00 37.70 ? 448 ILE B CA  1 
ATOM   7521 C  C   . ILE B 1 447 ? 32.613  -0.887  -21.663 1.00 40.24 ? 448 ILE B C   1 
ATOM   7522 O  O   . ILE B 1 447 ? 31.945  -1.000  -22.683 1.00 40.24 ? 448 ILE B O   1 
ATOM   7523 C  CB  . ILE B 1 447 ? 35.053  -0.653  -22.404 1.00 37.47 ? 448 ILE B CB  1 
ATOM   7524 C  CG1 . ILE B 1 447 ? 34.883  -0.884  -23.916 1.00 38.13 ? 448 ILE B CG1 1 
ATOM   7525 C  CG2 . ILE B 1 447 ? 36.471  -1.014  -21.976 1.00 37.10 ? 448 ILE B CG2 1 
ATOM   7526 C  CD1 . ILE B 1 447 ? 35.801  -0.039  -24.812 1.00 39.60 ? 448 ILE B CD1 1 
ATOM   7527 N  N   . GLN B 1 448 ? 32.157  -0.297  -20.561 1.00 44.00 ? 449 GLN B N   1 
ATOM   7528 C  CA  . GLN B 1 448 ? 30.750  0.120   -20.403 1.00 47.44 ? 449 GLN B CA  1 
ATOM   7529 C  C   . GLN B 1 448 ? 30.385  1.344   -21.238 1.00 49.33 ? 449 GLN B C   1 
ATOM   7530 O  O   . GLN B 1 448 ? 29.213  1.748   -21.303 1.00 50.10 ? 449 GLN B O   1 
ATOM   7531 C  CB  . GLN B 1 448 ? 30.441  0.397   -18.923 1.00 47.70 ? 449 GLN B CB  1 
ATOM   7532 C  CG  . GLN B 1 448 ? 29.383  -0.513  -18.298 1.00 49.66 ? 449 GLN B CG  1 
ATOM   7533 C  CD  . GLN B 1 448 ? 28.022  0.166   -18.178 1.00 53.02 ? 449 GLN B CD  1 
ATOM   7534 O  OE1 . GLN B 1 448 ? 27.935  1.388   -18.008 1.00 55.03 ? 449 GLN B OE1 1 
ATOM   7535 N  NE2 . GLN B 1 448 ? 26.951  -0.625  -18.258 1.00 54.09 ? 449 GLN B NE2 1 
ATOM   7536 N  N   . HIS B 1 449 ? 31.391  1.911   -21.892 1.00 51.25 ? 450 HIS B N   1 
ATOM   7537 C  CA  . HIS B 1 449 ? 31.287  3.232   -22.497 1.00 52.99 ? 450 HIS B CA  1 
ATOM   7538 C  C   . HIS B 1 449 ? 31.506  3.175   -23.998 1.00 53.37 ? 450 HIS B C   1 
ATOM   7539 O  O   . HIS B 1 449 ? 30.752  3.799   -24.760 1.00 53.68 ? 450 HIS B O   1 
ATOM   7540 C  CB  . HIS B 1 449 ? 32.296  4.175   -21.827 1.00 53.41 ? 450 HIS B CB  1 
ATOM   7541 C  CG  . HIS B 1 449 ? 33.301  3.456   -20.977 1.00 55.91 ? 450 HIS B CG  1 
ATOM   7542 N  ND1 . HIS B 1 449 ? 33.012  3.010   -19.702 1.00 57.35 ? 450 HIS B ND1 1 
ATOM   7543 C  CD2 . HIS B 1 449 ? 34.574  3.062   -21.235 1.00 57.34 ? 450 HIS B CD2 1 
ATOM   7544 C  CE1 . HIS B 1 449 ? 34.068  2.387   -19.207 1.00 57.35 ? 450 HIS B CE1 1 
ATOM   7545 N  NE2 . HIS B 1 449 ? 35.028  2.402   -20.117 1.00 57.32 ? 450 HIS B NE2 1 
ATOM   7546 N  N   . LEU B 1 450 ? 32.520  2.407   -24.411 1.00 53.50 ? 451 LEU B N   1 
ATOM   7547 C  CA  . LEU B 1 450 ? 32.985  2.365   -25.806 1.00 53.69 ? 451 LEU B CA  1 
ATOM   7548 C  C   . LEU B 1 450 ? 33.500  3.743   -26.271 1.00 53.28 ? 451 LEU B C   1 
ATOM   7549 O  O   . LEU B 1 450 ? 33.683  3.988   -27.475 1.00 53.77 ? 451 LEU B O   1 
ATOM   7550 C  CB  . LEU B 1 450 ? 31.892  1.818   -26.750 1.00 54.05 ? 451 LEU B CB  1 
ATOM   7551 C  CG  . LEU B 1 450 ? 31.775  0.317   -27.084 1.00 55.32 ? 451 LEU B CG  1 
ATOM   7552 C  CD1 . LEU B 1 450 ? 31.631  -0.605  -25.860 1.00 55.29 ? 451 LEU B CD1 1 
ATOM   7553 C  CD2 . LEU B 1 450 ? 30.600  0.101   -28.052 1.00 56.09 ? 451 LEU B CD2 1 
ATOM   7554 N  N   . SER B 1 451 ? 33.740  4.627   -25.300 1.00 52.11 ? 452 SER B N   1 
ATOM   7555 C  CA  . SER B 1 451 ? 34.281  5.964   -25.550 1.00 50.76 ? 452 SER B CA  1 
ATOM   7556 C  C   . SER B 1 451 ? 35.732  5.893   -26.020 1.00 49.18 ? 452 SER B C   1 
ATOM   7557 O  O   . SER B 1 451 ? 36.486  5.021   -25.592 1.00 49.65 ? 452 SER B O   1 
ATOM   7558 C  CB  . SER B 1 451 ? 34.184  6.813   -24.277 1.00 51.00 ? 452 SER B CB  1 
ATOM   7559 O  OG  . SER B 1 451 ? 34.728  8.109   -24.481 1.00 51.74 ? 452 SER B OG  1 
ATOM   7560 N  N   . ASP B 1 452 ? 36.111  6.820   -26.894 1.00 47.13 ? 453 ASP B N   1 
ATOM   7561 C  CA  . ASP B 1 452 ? 37.447  6.858   -27.474 1.00 44.87 ? 453 ASP B CA  1 
ATOM   7562 C  C   . ASP B 1 452 ? 38.464  7.421   -26.497 1.00 42.31 ? 453 ASP B C   1 
ATOM   7563 O  O   . ASP B 1 452 ? 38.437  8.608   -26.183 1.00 42.36 ? 453 ASP B O   1 
ATOM   7564 C  CB  . ASP B 1 452 ? 37.449  7.699   -28.753 1.00 45.74 ? 453 ASP B CB  1 
ATOM   7565 C  CG  . ASP B 1 452 ? 36.504  7.157   -29.804 1.00 47.74 ? 453 ASP B CG  1 
ATOM   7566 O  OD1 . ASP B 1 452 ? 36.499  5.920   -30.020 1.00 49.57 ? 453 ASP B OD1 1 
ATOM   7567 O  OD2 . ASP B 1 452 ? 35.762  7.969   -30.410 1.00 49.81 ? 453 ASP B OD2 1 
ATOM   7568 N  N   . VAL B 1 453 ? 39.360  6.566   -26.021 1.00 38.95 ? 454 VAL B N   1 
ATOM   7569 C  CA  . VAL B 1 453 ? 40.404  7.002   -25.108 1.00 35.51 ? 454 VAL B CA  1 
ATOM   7570 C  C   . VAL B 1 453 ? 41.626  7.384   -25.934 1.00 33.66 ? 454 VAL B C   1 
ATOM   7571 O  O   . VAL B 1 453 ? 42.162  6.561   -26.690 1.00 33.01 ? 454 VAL B O   1 
ATOM   7572 C  CB  . VAL B 1 453 ? 40.734  5.920   -24.059 1.00 35.86 ? 454 VAL B CB  1 
ATOM   7573 C  CG1 . VAL B 1 453 ? 41.936  6.332   -23.201 1.00 34.99 ? 454 VAL B CG1 1 
ATOM   7574 C  CG2 . VAL B 1 453 ? 39.509  5.645   -23.185 1.00 34.75 ? 454 VAL B CG2 1 
ATOM   7575 N  N   . GLY B 1 454 ? 42.032  8.645   -25.810 1.00 30.95 ? 455 GLY B N   1 
ATOM   7576 C  CA  . GLY B 1 454 ? 43.195  9.154   -26.508 1.00 28.54 ? 455 GLY B CA  1 
ATOM   7577 C  C   . GLY B 1 454 ? 44.473  8.859   -25.744 1.00 27.05 ? 455 GLY B C   1 
ATOM   7578 O  O   . GLY B 1 454 ? 44.459  8.137   -24.739 1.00 26.47 ? 455 GLY B O   1 
ATOM   7579 N  N   . THR B 1 455 ? 45.559  9.473   -26.202 1.00 25.33 ? 456 THR B N   1 
ATOM   7580 C  CA  . THR B 1 455 ? 46.913  9.139   -25.774 1.00 24.62 ? 456 THR B CA  1 
ATOM   7581 C  C   . THR B 1 455 ? 47.633  10.363  -25.237 1.00 23.83 ? 456 THR B C   1 
ATOM   7582 O  O   . THR B 1 455 ? 47.493  11.455  -25.795 1.00 23.96 ? 456 THR B O   1 
ATOM   7583 C  CB  . THR B 1 455 ? 47.708  8.545   -26.970 1.00 24.81 ? 456 THR B CB  1 
ATOM   7584 O  OG1 . THR B 1 455 ? 47.037  7.367   -27.433 1.00 25.45 ? 456 THR B OG1 1 
ATOM   7585 C  CG2 . THR B 1 455 ? 49.114  8.172   -26.584 1.00 23.74 ? 456 THR B CG2 1 
ATOM   7586 N  N   . THR B 1 456 ? 48.391  10.173  -24.156 1.00 22.57 ? 457 THR B N   1 
ATOM   7587 C  CA  . THR B 1 456 ? 49.234  11.221  -23.585 1.00 22.34 ? 457 THR B CA  1 
ATOM   7588 C  C   . THR B 1 456 ? 50.696  10.815  -23.551 1.00 20.82 ? 457 THR B C   1 
ATOM   7589 O  O   . THR B 1 456 ? 51.035  9.674   -23.243 1.00 20.25 ? 457 THR B O   1 
ATOM   7590 C  CB  . THR B 1 456 ? 48.804  11.662  -22.157 1.00 22.74 ? 457 THR B CB  1 
ATOM   7591 O  OG1 . THR B 1 456 ? 49.577  12.801  -21.778 1.00 25.05 ? 457 THR B OG1 1 
ATOM   7592 C  CG2 . THR B 1 456 ? 49.072  10.567  -21.133 1.00 23.81 ? 457 THR B CG2 1 
ATOM   7593 N  N   . PHE B 1 457 ? 51.563  11.761  -23.884 1.00 19.18 ? 458 PHE B N   1 
ATOM   7594 C  CA  . PHE B 1 457 ? 52.995  11.500  -23.863 1.00 18.79 ? 458 PHE B CA  1 
ATOM   7595 C  C   . PHE B 1 457 ? 53.516  11.767  -22.452 1.00 18.77 ? 458 PHE B C   1 
ATOM   7596 O  O   . PHE B 1 457 ? 53.542  12.925  -22.005 1.00 19.39 ? 458 PHE B O   1 
ATOM   7597 C  CB  . PHE B 1 457 ? 53.722  12.350  -24.924 1.00 17.67 ? 458 PHE B CB  1 
ATOM   7598 C  CG  . PHE B 1 457 ? 55.213  12.244  -24.875 1.00 17.67 ? 458 PHE B CG  1 
ATOM   7599 C  CD1 . PHE B 1 457 ? 55.873  11.129  -25.420 1.00 17.36 ? 458 PHE B CD1 1 
ATOM   7600 C  CD2 . PHE B 1 457 ? 55.973  13.270  -24.310 1.00 17.22 ? 458 PHE B CD2 1 
ATOM   7601 C  CE1 . PHE B 1 457 ? 57.263  11.031  -25.376 1.00 15.10 ? 458 PHE B CE1 1 
ATOM   7602 C  CE2 . PHE B 1 457 ? 57.372  13.182  -24.259 1.00 15.68 ? 458 PHE B CE2 1 
ATOM   7603 C  CZ  . PHE B 1 457 ? 58.013  12.060  -24.792 1.00 16.18 ? 458 PHE B CZ  1 
ATOM   7604 N  N   . ASN B 1 458 ? 53.908  10.687  -21.774 1.00 18.45 ? 459 ASN B N   1 
ATOM   7605 C  CA  . ASN B 1 458 ? 54.545  10.704  -20.438 1.00 18.97 ? 459 ASN B CA  1 
ATOM   7606 C  C   . ASN B 1 458 ? 55.903  10.011  -20.511 1.00 18.59 ? 459 ASN B C   1 
ATOM   7607 O  O   . ASN B 1 458 ? 56.213  9.123   -19.711 1.00 17.45 ? 459 ASN B O   1 
ATOM   7608 C  CB  . ASN B 1 458 ? 53.681  9.960   -19.414 1.00 18.96 ? 459 ASN B CB  1 
ATOM   7609 C  CG  . ASN B 1 458 ? 52.531  10.804  -18.881 1.00 22.74 ? 459 ASN B CG  1 
ATOM   7610 O  OD1 . ASN B 1 458 ? 52.619  12.035  -18.802 1.00 24.04 ? 459 ASN B OD1 1 
ATOM   7611 N  ND2 . ASN B 1 458 ? 51.436  10.134  -18.501 1.00 23.06 ? 459 ASN B ND2 1 
ATOM   7612 N  N   . LEU B 1 459 ? 56.698  10.447  -21.491 1.00 19.12 ? 460 LEU B N   1 
ATOM   7613 C  CA  . LEU B 1 459 ? 57.954  9.832   -21.902 1.00 19.51 ? 460 LEU B CA  1 
ATOM   7614 C  C   . LEU B 1 459 ? 57.665  8.520   -22.636 1.00 19.93 ? 460 LEU B C   1 
ATOM   7615 O  O   . LEU B 1 459 ? 57.979  8.401   -23.816 1.00 19.46 ? 460 LEU B O   1 
ATOM   7616 C  CB  . LEU B 1 459 ? 58.990  9.699   -20.771 1.00 19.90 ? 460 LEU B CB  1 
ATOM   7617 C  CG  . LEU B 1 459 ? 60.284  9.661   -21.602 1.00 23.74 ? 460 LEU B CG  1 
ATOM   7618 C  CD1 . LEU B 1 459 ? 61.197  10.850  -21.409 1.00 25.10 ? 460 LEU B CD1 1 
ATOM   7619 C  CD2 . LEU B 1 459 ? 60.997  8.292   -21.627 1.00 22.72 ? 460 LEU B CD2 1 
ATOM   7620 N  N   . ILE B 1 460 ? 57.032  7.567   -21.951 1.00 19.26 ? 461 ILE B N   1 
ATOM   7621 C  CA  . ILE B 1 460 ? 56.324  6.497   -22.641 1.00 19.60 ? 461 ILE B CA  1 
ATOM   7622 C  C   . ILE B 1 460 ? 54.923  6.990   -22.963 1.00 18.89 ? 461 ILE B C   1 
ATOM   7623 O  O   . ILE B 1 460 ? 54.403  7.911   -22.306 1.00 18.64 ? 461 ILE B O   1 
ATOM   7624 C  CB  . ILE B 1 460 ? 56.264  5.176   -21.814 1.00 19.91 ? 461 ILE B CB  1 
ATOM   7625 C  CG1 . ILE B 1 460 ? 55.568  5.428   -20.474 1.00 21.65 ? 461 ILE B CG1 1 
ATOM   7626 C  CG2 . ILE B 1 460 ? 57.676  4.591   -21.648 1.00 19.11 ? 461 ILE B CG2 1 
ATOM   7627 C  CD1 . ILE B 1 460 ? 55.388  4.200   -19.608 1.00 23.96 ? 461 ILE B CD1 1 
ATOM   7628 N  N   . LEU B 1 461 ? 54.321  6.423   -24.002 1.00 18.56 ? 462 LEU B N   1 
ATOM   7629 C  CA  . LEU B 1 461 ? 52.963  6.814   -24.377 1.00 18.28 ? 462 LEU B CA  1 
ATOM   7630 C  C   . LEU B 1 461 ? 52.006  6.046   -23.506 1.00 18.12 ? 462 LEU B C   1 
ATOM   7631 O  O   . LEU B 1 461 ? 52.260  4.883   -23.197 1.00 17.01 ? 462 LEU B O   1 
ATOM   7632 C  CB  . LEU B 1 461 ? 52.671  6.575   -25.866 1.00 17.29 ? 462 LEU B CB  1 
ATOM   7633 C  CG  . LEU B 1 461 ? 53.396  7.516   -26.842 1.00 17.79 ? 462 LEU B CG  1 
ATOM   7634 C  CD1 . LEU B 1 461 ? 53.340  6.976   -28.272 1.00 16.75 ? 462 LEU B CD1 1 
ATOM   7635 C  CD2 . LEU B 1 461 ? 52.840  8.955   -26.796 1.00 16.83 ? 462 LEU B CD2 1 
ATOM   7636 N  N   . MET B 1 462 ? 50.912  6.704   -23.109 1.00 19.48 ? 463 MET B N   1 
ATOM   7637 C  CA  . MET B 1 462 ? 49.948  6.116   -22.172 1.00 20.93 ? 463 MET B CA  1 
ATOM   7638 C  C   . MET B 1 462 ? 48.536  6.597   -22.482 1.00 20.95 ? 463 MET B C   1 
ATOM   7639 O  O   . MET B 1 462 ? 48.371  7.588   -23.187 1.00 19.86 ? 463 MET B O   1 
ATOM   7640 C  CB  . MET B 1 462 ? 50.295  6.553   -20.756 1.00 21.85 ? 463 MET B CB  1 
ATOM   7641 C  CG  . MET B 1 462 ? 51.520  5.884   -20.181 1.00 25.62 ? 463 MET B CG  1 
ATOM   7642 S  SD  . MET B 1 462 ? 51.870  6.654   -18.592 1.00 33.96 ? 463 MET B SD  1 
ATOM   7643 C  CE  . MET B 1 462 ? 50.548  5.931   -17.602 1.00 33.10 ? 463 MET B CE  1 
ATOM   7644 N  N   . PRO B 1 463 ? 47.508  5.907   -21.941 1.00 20.95 ? 464 PRO B N   1 
ATOM   7645 C  CA  . PRO B 1 463 ? 46.161  6.460   -22.118 1.00 21.57 ? 464 PRO B CA  1 
ATOM   7646 C  C   . PRO B 1 463 ? 46.037  7.790   -21.398 1.00 22.32 ? 464 PRO B C   1 
ATOM   7647 O  O   . PRO B 1 463 ? 46.662  7.991   -20.359 1.00 21.11 ? 464 PRO B O   1 
ATOM   7648 C  CB  . PRO B 1 463 ? 45.230  5.401   -21.512 1.00 21.62 ? 464 PRO B CB  1 
ATOM   7649 C  CG  . PRO B 1 463 ? 46.128  4.425   -20.793 1.00 21.91 ? 464 PRO B CG  1 
ATOM   7650 C  CD  . PRO B 1 463 ? 47.499  4.552   -21.367 1.00 20.97 ? 464 PRO B CD  1 
ATOM   7651 N  N   . GLU B 1 464 ? 45.260  8.689   -21.998 1.00 23.07 ? 465 GLU B N   1 
ATOM   7652 C  CA  . GLU B 1 464 ? 45.103  10.052  -21.537 1.00 24.47 ? 465 GLU B CA  1 
ATOM   7653 C  C   . GLU B 1 464 ? 44.197  10.090  -20.309 1.00 24.33 ? 465 GLU B C   1 
ATOM   7654 O  O   . GLU B 1 464 ? 44.271  11.021  -19.533 1.00 24.21 ? 465 GLU B O   1 
ATOM   7655 C  CB  . GLU B 1 464 ? 44.496  10.924  -22.648 1.00 24.74 ? 465 GLU B CB  1 
ATOM   7656 C  CG  . GLU B 1 464 ? 43.067  10.484  -23.009 1.00 29.88 ? 465 GLU B CG  1 
ATOM   7657 C  CD  . GLU B 1 464 ? 42.326  11.412  -23.949 1.00 36.06 ? 465 GLU B CD  1 
ATOM   7658 O  OE1 . GLU B 1 464 ? 42.856  12.504  -24.262 1.00 38.00 ? 465 GLU B OE1 1 
ATOM   7659 O  OE2 . GLU B 1 464 ? 41.194  11.032  -24.367 1.00 38.19 ? 465 GLU B OE2 1 
ATOM   7660 N  N   . LYS B 1 465 ? 43.342  9.079   -20.159 1.00 24.73 ? 466 LYS B N   1 
ATOM   7661 C  CA  . LYS B 1 465 ? 42.423  8.982   -19.021 1.00 24.97 ? 466 LYS B CA  1 
ATOM   7662 C  C   . LYS B 1 465 ? 42.232  7.506   -18.631 1.00 24.58 ? 466 LYS B C   1 
ATOM   7663 O  O   . LYS B 1 465 ? 42.594  6.611   -19.404 1.00 23.65 ? 466 LYS B O   1 
ATOM   7664 C  CB  . LYS B 1 465 ? 41.080  9.644   -19.358 1.00 25.33 ? 466 LYS B CB  1 
ATOM   7665 C  CG  . LYS B 1 465 ? 40.319  8.943   -20.461 1.00 27.76 ? 466 LYS B CG  1 
ATOM   7666 C  CD  . LYS B 1 465 ? 39.099  9.744   -20.881 1.00 33.03 ? 466 LYS B CD  1 
ATOM   7667 C  CE  . LYS B 1 465 ? 38.269  8.958   -21.883 1.00 35.58 ? 466 LYS B CE  1 
ATOM   7668 N  NZ  . LYS B 1 465 ? 37.147  9.787   -22.426 1.00 38.62 ? 466 LYS B NZ  1 
ATOM   7669 N  N   . PRO B 1 466 ? 41.690  7.249   -17.421 1.00 24.12 ? 467 PRO B N   1 
ATOM   7670 C  CA  . PRO B 1 466 ? 41.531  5.877   -16.955 1.00 23.77 ? 467 PRO B CA  1 
ATOM   7671 C  C   . PRO B 1 466 ? 40.568  5.084   -17.828 1.00 23.84 ? 467 PRO B C   1 
ATOM   7672 O  O   . PRO B 1 466 ? 39.603  5.638   -18.366 1.00 23.85 ? 467 PRO B O   1 
ATOM   7673 C  CB  . PRO B 1 466 ? 40.952  6.048   -15.538 1.00 23.63 ? 467 PRO B CB  1 
ATOM   7674 C  CG  . PRO B 1 466 ? 41.443  7.380   -15.089 1.00 23.32 ? 467 PRO B CG  1 
ATOM   7675 C  CD  . PRO B 1 466 ? 41.443  8.227   -16.340 1.00 24.44 ? 467 PRO B CD  1 
ATOM   7676 N  N   . ILE B 1 467 ? 40.855  3.797   -17.971 1.00 23.41 ? 468 ILE B N   1 
ATOM   7677 C  CA  . ILE B 1 467 ? 39.971  2.875   -18.663 1.00 23.49 ? 468 ILE B CA  1 
ATOM   7678 C  C   . ILE B 1 467 ? 39.366  1.934   -17.617 1.00 23.31 ? 468 ILE B C   1 
ATOM   7679 O  O   . ILE B 1 467 ? 40.095  1.284   -16.876 1.00 22.70 ? 468 ILE B O   1 
ATOM   7680 C  CB  . ILE B 1 467 ? 40.732  2.050   -19.726 1.00 23.02 ? 468 ILE B CB  1 
ATOM   7681 C  CG1 . ILE B 1 467 ? 41.359  2.976   -20.790 1.00 23.09 ? 468 ILE B CG1 1 
ATOM   7682 C  CG2 . ILE B 1 467 ? 39.794  1.030   -20.362 1.00 24.57 ? 468 ILE B CG2 1 
ATOM   7683 C  CD1 . ILE B 1 467 ? 42.462  2.338   -21.607 1.00 22.12 ? 468 ILE B CD1 1 
ATOM   7684 N  N   . SER B 1 468 ? 38.040  1.872   -17.560 1.00 23.57 ? 469 SER B N   1 
ATOM   7685 C  CA  . SER B 1 468 ? 37.360  0.968   -16.629 1.00 24.60 ? 469 SER B CA  1 
ATOM   7686 C  C   . SER B 1 468 ? 36.754  -0.222  -17.371 1.00 24.06 ? 469 SER B C   1 
ATOM   7687 O  O   . SER B 1 468 ? 35.930  -0.055  -18.268 1.00 24.46 ? 469 SER B O   1 
ATOM   7688 C  CB  . SER B 1 468 ? 36.287  1.720   -15.825 1.00 24.97 ? 469 SER B CB  1 
ATOM   7689 O  OG  . SER B 1 468 ? 35.629  0.839   -14.915 1.00 28.20 ? 469 SER B OG  1 
ATOM   7690 N  N   . PHE B 1 469 ? 37.171  -1.424  -16.990 1.00 23.80 ? 470 PHE B N   1 
ATOM   7691 C  CA  . PHE B 1 469 ? 36.741  -2.656  -17.653 1.00 23.30 ? 470 PHE B CA  1 
ATOM   7692 C  C   . PHE B 1 469 ? 35.688  -3.368  -16.843 1.00 23.50 ? 470 PHE B C   1 
ATOM   7693 O  O   . PHE B 1 469 ? 35.637  -3.210  -15.629 1.00 24.01 ? 470 PHE B O   1 
ATOM   7694 C  CB  . PHE B 1 469 ? 37.912  -3.632  -17.771 1.00 22.48 ? 470 PHE B CB  1 
ATOM   7695 C  CG  . PHE B 1 469 ? 39.000  -3.184  -18.703 1.00 22.99 ? 470 PHE B CG  1 
ATOM   7696 C  CD1 . PHE B 1 469 ? 40.198  -2.704  -18.198 1.00 21.88 ? 470 PHE B CD1 1 
ATOM   7697 C  CD2 . PHE B 1 469 ? 38.827  -3.253  -20.091 1.00 21.29 ? 470 PHE B CD2 1 
ATOM   7698 C  CE1 . PHE B 1 469 ? 41.225  -2.297  -19.059 1.00 23.69 ? 470 PHE B CE1 1 
ATOM   7699 C  CE2 . PHE B 1 469 ? 39.835  -2.840  -20.956 1.00 21.66 ? 470 PHE B CE2 1 
ATOM   7700 C  CZ  . PHE B 1 469 ? 41.037  -2.364  -20.442 1.00 23.70 ? 470 PHE B CZ  1 
ATOM   7701 N  N   . THR B 1 470 ? 34.890  -4.191  -17.521 1.00 23.08 ? 471 THR B N   1 
ATOM   7702 C  CA  . THR B 1 470 ? 34.036  -5.180  -16.874 1.00 22.56 ? 471 THR B CA  1 
ATOM   7703 C  C   . THR B 1 470 ? 34.484  -6.574  -17.294 1.00 22.39 ? 471 THR B C   1 
ATOM   7704 O  O   . THR B 1 470 ? 34.620  -6.863  -18.489 1.00 22.16 ? 471 THR B O   1 
ATOM   7705 C  CB  . THR B 1 470 ? 32.520  -4.964  -17.207 1.00 22.47 ? 471 THR B CB  1 
ATOM   7706 O  OG1 . THR B 1 470 ? 32.121  -3.658  -16.772 1.00 20.92 ? 471 THR B OG1 1 
ATOM   7707 C  CG2 . THR B 1 470 ? 31.664  -5.998  -16.496 1.00 22.80 ? 471 THR B CG2 1 
ATOM   7708 N  N   . PHE B 1 471 ? 34.724  -7.426  -16.303 1.00 22.27 ? 472 PHE B N   1 
ATOM   7709 C  CA  . PHE B 1 471 ? 35.115  -8.819  -16.525 1.00 22.55 ? 472 PHE B CA  1 
ATOM   7710 C  C   . PHE B 1 471 ? 33.973  -9.755  -16.133 1.00 23.43 ? 472 PHE B C   1 
ATOM   7711 O  O   . PHE B 1 471 ? 33.392  -9.612  -15.041 1.00 21.93 ? 472 PHE B O   1 
ATOM   7712 C  CB  . PHE B 1 471 ? 36.390  -9.149  -15.747 1.00 22.27 ? 472 PHE B CB  1 
ATOM   7713 C  CG  . PHE B 1 471 ? 37.572  -8.297  -16.146 1.00 22.82 ? 472 PHE B CG  1 
ATOM   7714 C  CD1 . PHE B 1 471 ? 37.904  -7.151  -15.412 1.00 21.25 ? 472 PHE B CD1 1 
ATOM   7715 C  CD2 . PHE B 1 471 ? 38.339  -8.629  -17.277 1.00 22.69 ? 472 PHE B CD2 1 
ATOM   7716 C  CE1 . PHE B 1 471 ? 39.003  -6.350  -15.788 1.00 22.58 ? 472 PHE B CE1 1 
ATOM   7717 C  CE2 . PHE B 1 471 ? 39.423  -7.834  -17.669 1.00 22.78 ? 472 PHE B CE2 1 
ATOM   7718 C  CZ  . PHE B 1 471 ? 39.764  -6.692  -16.916 1.00 22.45 ? 472 PHE B CZ  1 
ATOM   7719 N  N   . TRP B 1 472 ? 33.636  -10.655 -17.064 1.00 24.12 ? 473 TRP B N   1 
ATOM   7720 C  CA  . TRP B 1 472 ? 32.659  -11.727 -16.862 1.00 25.88 ? 473 TRP B CA  1 
ATOM   7721 C  C   . TRP B 1 472 ? 33.366  -13.071 -17.000 1.00 26.95 ? 473 TRP B C   1 
ATOM   7722 O  O   . TRP B 1 472 ? 34.100  -13.274 -17.965 1.00 26.54 ? 473 TRP B O   1 
ATOM   7723 C  CB  . TRP B 1 472 ? 31.557  -11.685 -17.927 1.00 25.77 ? 473 TRP B CB  1 
ATOM   7724 C  CG  . TRP B 1 472 ? 30.859  -10.374 -18.071 1.00 26.82 ? 473 TRP B CG  1 
ATOM   7725 C  CD1 . TRP B 1 472 ? 31.255  -9.312  -18.829 1.00 26.76 ? 473 TRP B CD1 1 
ATOM   7726 C  CD2 . TRP B 1 472 ? 29.625  -9.997  -17.458 1.00 27.97 ? 473 TRP B CD2 1 
ATOM   7727 N  NE1 . TRP B 1 472 ? 30.352  -8.280  -18.711 1.00 29.49 ? 473 TRP B NE1 1 
ATOM   7728 C  CE2 . TRP B 1 472 ? 29.340  -8.675  -17.874 1.00 29.26 ? 473 TRP B CE2 1 
ATOM   7729 C  CE3 . TRP B 1 472 ? 28.734  -10.643 -16.589 1.00 28.86 ? 473 TRP B CE3 1 
ATOM   7730 C  CZ2 . TRP B 1 472 ? 28.197  -7.989  -17.460 1.00 30.24 ? 473 TRP B CZ2 1 
ATOM   7731 C  CZ3 . TRP B 1 472 ? 27.594  -9.958  -16.173 1.00 31.55 ? 473 TRP B CZ3 1 
ATOM   7732 C  CH2 . TRP B 1 472 ? 27.337  -8.642  -16.610 1.00 31.50 ? 473 TRP B CH2 1 
ATOM   7733 N  N   . PRO B 1 473 ? 33.125  -14.003 -16.060 1.00 28.33 ? 474 PRO B N   1 
ATOM   7734 C  CA  . PRO B 1 473 ? 33.727  -15.334 -16.175 1.00 29.88 ? 474 PRO B CA  1 
ATOM   7735 C  C   . PRO B 1 473 ? 33.227  -16.039 -17.440 1.00 31.45 ? 474 PRO B C   1 
ATOM   7736 O  O   . PRO B 1 473 ? 32.020  -16.040 -17.712 1.00 31.52 ? 474 PRO B O   1 
ATOM   7737 C  CB  . PRO B 1 473 ? 33.274  -16.068 -14.905 1.00 30.15 ? 474 PRO B CB  1 
ATOM   7738 C  CG  . PRO B 1 473 ? 32.279  -15.196 -14.226 1.00 29.10 ? 474 PRO B CG  1 
ATOM   7739 C  CD  . PRO B 1 473 ? 32.243  -13.855 -14.888 1.00 28.60 ? 474 PRO B CD  1 
ATOM   7740 N  N   . PHE B 1 474 ? 34.159  -16.570 -18.235 1.00 33.05 ? 475 PHE B N   1 
ATOM   7741 C  CA  . PHE B 1 474 ? 33.816  -17.247 -19.497 1.00 34.33 ? 475 PHE B CA  1 
ATOM   7742 C  C   . PHE B 1 474 ? 33.552  -18.727 -19.245 1.00 34.64 ? 475 PHE B C   1 
ATOM   7743 O  O   . PHE B 1 474 ? 34.096  -19.305 -18.306 1.00 35.64 ? 475 PHE B O   1 
ATOM   7744 C  CB  . PHE B 1 474 ? 34.921  -17.061 -20.555 1.00 34.53 ? 475 PHE B CB  1 
ATOM   7745 C  CG  . PHE B 1 474 ? 34.829  -18.028 -21.710 1.00 36.68 ? 475 PHE B CG  1 
ATOM   7746 C  CD1 . PHE B 1 474 ? 33.856  -17.867 -22.699 1.00 38.42 ? 475 PHE B CD1 1 
ATOM   7747 C  CD2 . PHE B 1 474 ? 35.712  -19.111 -21.807 1.00 38.20 ? 475 PHE B CD2 1 
ATOM   7748 C  CE1 . PHE B 1 474 ? 33.771  -18.767 -23.766 1.00 38.90 ? 475 PHE B CE1 1 
ATOM   7749 C  CE2 . PHE B 1 474 ? 35.627  -20.016 -22.858 1.00 37.75 ? 475 PHE B CE2 1 
ATOM   7750 C  CZ  . PHE B 1 474 ? 34.660  -19.844 -23.841 1.00 38.86 ? 475 PHE B CZ  1 
ATOM   7751 N  N   . SER C 2 27  ? 0.101   24.824  25.779  1.00 85.97 ? 28  SER C N   1 
ATOM   7752 C  CA  . SER C 2 27  ? -0.540  23.817  24.882  1.00 86.01 ? 28  SER C CA  1 
ATOM   7753 C  C   . SER C 2 27  ? -1.835  23.257  25.477  1.00 85.97 ? 28  SER C C   1 
ATOM   7754 O  O   . SER C 2 27  ? -2.038  23.302  26.692  1.00 85.91 ? 28  SER C O   1 
ATOM   7755 C  CB  . SER C 2 27  ? 0.435   22.675  24.577  1.00 85.98 ? 28  SER C CB  1 
ATOM   7756 O  OG  . SER C 2 27  ? 0.739   21.935  25.748  1.00 86.01 ? 28  SER C OG  1 
ATOM   7757 N  N   . LEU C 2 28  ? -2.695  22.721  24.611  1.00 85.96 ? 29  LEU C N   1 
ATOM   7758 C  CA  . LEU C 2 28  ? -3.954  22.094  25.030  1.00 86.02 ? 29  LEU C CA  1 
ATOM   7759 C  C   . LEU C 2 28  ? -3.743  20.812  25.837  1.00 86.13 ? 29  LEU C C   1 
ATOM   7760 O  O   . LEU C 2 28  ? -4.648  20.358  26.539  1.00 86.06 ? 29  LEU C O   1 
ATOM   7761 C  CB  . LEU C 2 28  ? -4.849  21.804  23.822  1.00 85.98 ? 29  LEU C CB  1 
ATOM   7762 C  CG  . LEU C 2 28  ? -5.308  22.962  22.933  1.00 85.96 ? 29  LEU C CG  1 
ATOM   7763 C  CD1 . LEU C 2 28  ? -6.230  22.432  21.854  1.00 85.72 ? 29  LEU C CD1 1 
ATOM   7764 C  CD2 . LEU C 2 28  ? -6.004  24.055  23.738  1.00 86.18 ? 29  LEU C CD2 1 
ATOM   7765 N  N   . LEU C 2 29  ? -2.552  20.229  25.719  1.00 86.28 ? 30  LEU C N   1 
ATOM   7766 C  CA  . LEU C 2 29  ? -2.160  19.086  26.538  1.00 86.42 ? 30  LEU C CA  1 
ATOM   7767 C  C   . LEU C 2 29  ? -1.912  19.534  27.978  1.00 86.49 ? 30  LEU C C   1 
ATOM   7768 O  O   . LEU C 2 29  ? -2.460  18.945  28.910  1.00 86.44 ? 30  LEU C O   1 
ATOM   7769 C  CB  . LEU C 2 29  ? -0.917  18.396  25.947  1.00 86.40 ? 30  LEU C CB  1 
ATOM   7770 C  CG  . LEU C 2 29  ? -0.351  17.067  26.487  1.00 86.39 ? 30  LEU C CG  1 
ATOM   7771 C  CD1 . LEU C 2 29  ? 0.717   17.280  27.568  1.00 86.31 ? 30  LEU C CD1 1 
ATOM   7772 C  CD2 . LEU C 2 29  ? -1.444  16.100  26.965  1.00 86.19 ? 30  LEU C CD2 1 
ATOM   7773 N  N   . ASP C 2 30  ? -1.098  20.580  28.145  1.00 86.64 ? 31  ASP C N   1 
ATOM   7774 C  CA  . ASP C 2 30  ? -0.763  21.139  29.464  1.00 86.79 ? 31  ASP C CA  1 
ATOM   7775 C  C   . ASP C 2 30  ? -2.001  21.618  30.224  1.00 86.77 ? 31  ASP C C   1 
ATOM   7776 O  O   . ASP C 2 30  ? -2.002  21.671  31.457  1.00 86.69 ? 31  ASP C O   1 
ATOM   7777 C  CB  . ASP C 2 30  ? 0.255   22.283  29.332  1.00 86.86 ? 31  ASP C CB  1 
ATOM   7778 C  CG  . ASP C 2 30  ? 1.692   21.787  29.196  1.00 87.15 ? 31  ASP C CG  1 
ATOM   7779 O  OD1 . ASP C 2 30  ? 1.990   20.651  29.626  1.00 87.78 ? 31  ASP C OD1 1 
ATOM   7780 O  OD2 . ASP C 2 30  ? 2.533   22.543  28.664  1.00 87.19 ? 31  ASP C OD2 1 
ATOM   7781 N  N   . VAL C 2 31  ? -3.043  21.966  29.471  1.00 86.82 ? 32  VAL C N   1 
ATOM   7782 C  CA  . VAL C 2 31  ? -4.352  22.301  30.026  1.00 86.90 ? 32  VAL C CA  1 
ATOM   7783 C  C   . VAL C 2 31  ? -4.966  21.068  30.699  1.00 86.89 ? 32  VAL C C   1 
ATOM   7784 O  O   . VAL C 2 31  ? -5.256  21.095  31.895  1.00 86.88 ? 32  VAL C O   1 
ATOM   7785 C  CB  . VAL C 2 31  ? -5.302  22.873  28.932  1.00 86.92 ? 32  VAL C CB  1 
ATOM   7786 C  CG1 . VAL C 2 31  ? -6.747  22.949  29.429  1.00 87.12 ? 32  VAL C CG1 1 
ATOM   7787 C  CG2 . VAL C 2 31  ? -4.821  24.243  28.469  1.00 86.86 ? 32  VAL C CG2 1 
ATOM   7788 N  N   . VAL C 2 32  ? -5.130  19.991  29.929  1.00 86.82 ? 33  VAL C N   1 
ATOM   7789 C  CA  . VAL C 2 32  ? -5.697  18.730  30.423  1.00 86.74 ? 33  VAL C CA  1 
ATOM   7790 C  C   . VAL C 2 32  ? -4.900  18.148  31.605  1.00 86.71 ? 33  VAL C C   1 
ATOM   7791 O  O   . VAL C 2 32  ? -5.482  17.561  32.521  1.00 86.74 ? 33  VAL C O   1 
ATOM   7792 C  CB  . VAL C 2 32  ? -5.821  17.679  29.278  1.00 86.75 ? 33  VAL C CB  1 
ATOM   7793 C  CG1 . VAL C 2 32  ? -6.417  16.367  29.786  1.00 86.71 ? 33  VAL C CG1 1 
ATOM   7794 C  CG2 . VAL C 2 32  ? -6.665  18.226  28.132  1.00 86.72 ? 33  VAL C CG2 1 
ATOM   7795 N  N   . VAL C 2 33  ? -3.580  18.332  31.583  1.00 86.59 ? 34  VAL C N   1 
ATOM   7796 C  CA  . VAL C 2 33  ? -2.686  17.781  32.607  1.00 86.50 ? 34  VAL C CA  1 
ATOM   7797 C  C   . VAL C 2 33  ? -2.881  18.432  33.986  1.00 86.41 ? 34  VAL C C   1 
ATOM   7798 O  O   . VAL C 2 33  ? -3.123  17.735  34.973  1.00 86.38 ? 34  VAL C O   1 
ATOM   7799 C  CB  . VAL C 2 33  ? -1.188  17.837  32.160  1.00 86.52 ? 34  VAL C CB  1 
ATOM   7800 C  CG1 . VAL C 2 33  ? -0.245  17.483  33.311  1.00 86.56 ? 34  VAL C CG1 1 
ATOM   7801 C  CG2 . VAL C 2 33  ? -0.945  16.905  30.980  1.00 86.48 ? 34  VAL C CG2 1 
ATOM   7802 N  N   . GLU C 2 34  ? -2.787  19.759  34.047  1.00 86.27 ? 35  GLU C N   1 
ATOM   7803 C  CA  . GLU C 2 34  ? -2.862  20.474  35.323  1.00 86.20 ? 35  GLU C CA  1 
ATOM   7804 C  C   . GLU C 2 34  ? -4.302  20.819  35.728  1.00 85.98 ? 35  GLU C C   1 
ATOM   7805 O  O   . GLU C 2 34  ? -4.570  21.125  36.891  1.00 85.87 ? 35  GLU C O   1 
ATOM   7806 C  CB  . GLU C 2 34  ? -1.976  21.725  35.295  1.00 86.28 ? 35  GLU C CB  1 
ATOM   7807 C  CG  . GLU C 2 34  ? -1.340  22.085  36.645  1.00 86.67 ? 35  GLU C CG  1 
ATOM   7808 C  CD  . GLU C 2 34  ? -0.299  21.069  37.128  1.00 86.95 ? 35  GLU C CD  1 
ATOM   7809 O  OE1 . GLU C 2 34  ? -0.077  20.996  38.357  1.00 86.97 ? 35  GLU C OE1 1 
ATOM   7810 O  OE2 . GLU C 2 34  ? 0.296   20.350  36.294  1.00 86.72 ? 35  GLU C OE2 1 
ATOM   7811 N  N   . ASN C 2 35  ? -5.215  20.765  34.759  1.00 85.74 ? 36  ASN C N   1 
ATOM   7812 C  CA  . ASN C 2 35  ? -6.650  20.902  35.013  1.00 85.47 ? 36  ASN C CA  1 
ATOM   7813 C  C   . ASN C 2 35  ? -7.252  19.585  35.523  1.00 85.29 ? 36  ASN C C   1 
ATOM   7814 O  O   . ASN C 2 35  ? -8.344  19.575  36.102  1.00 85.41 ? 36  ASN C O   1 
ATOM   7815 C  CB  . ASN C 2 35  ? -7.368  21.367  33.740  1.00 85.48 ? 36  ASN C CB  1 
ATOM   7816 C  CG  . ASN C 2 35  ? -8.809  21.766  33.983  1.00 85.48 ? 36  ASN C CG  1 
ATOM   7817 O  OD1 . ASN C 2 35  ? -9.732  21.058  33.580  1.00 85.39 ? 36  ASN C OD1 1 
ATOM   7818 N  ND2 . ASN C 2 35  ? -9.010  22.904  34.641  1.00 85.50 ? 36  ASN C ND2 1 
ATOM   7819 N  N   . ASN C 2 36  ? -6.525  18.487  35.298  1.00 84.90 ? 37  ASN C N   1 
ATOM   7820 C  CA  . ASN C 2 36  ? -6.900  17.131  35.733  1.00 84.45 ? 37  ASN C CA  1 
ATOM   7821 C  C   . ASN C 2 36  ? -8.233  16.617  35.173  1.00 84.07 ? 37  ASN C C   1 
ATOM   7822 O  O   . ASN C 2 36  ? -9.115  16.213  35.931  1.00 84.17 ? 37  ASN C O   1 
ATOM   7823 C  CB  . ASN C 2 36  ? -6.860  17.002  37.270  1.00 84.49 ? 37  ASN C CB  1 
ATOM   7824 C  CG  . ASN C 2 36  ? -5.452  17.141  37.843  1.00 84.61 ? 37  ASN C CG  1 
ATOM   7825 O  OD1 . ASN C 2 36  ? -4.522  16.451  37.423  1.00 84.70 ? 37  ASN C OD1 1 
ATOM   7826 N  ND2 . ASN C 2 36  ? -5.299  18.025  38.823  1.00 84.53 ? 37  ASN C ND2 1 
ATOM   7827 N  N   . LEU C 2 37  ? -8.368  16.625  33.846  1.00 83.53 ? 38  LEU C N   1 
ATOM   7828 C  CA  . LEU C 2 37  ? -9.566  16.096  33.178  1.00 82.99 ? 38  LEU C CA  1 
ATOM   7829 C  C   . LEU C 2 37  ? -9.652  14.558  33.191  1.00 82.62 ? 38  LEU C C   1 
ATOM   7830 O  O   . LEU C 2 37  ? -8.897  13.889  33.903  1.00 82.63 ? 38  LEU C O   1 
ATOM   7831 C  CB  . LEU C 2 37  ? -9.680  16.635  31.744  1.00 83.02 ? 38  LEU C CB  1 
ATOM   7832 C  CG  . LEU C 2 37  ? -10.459 17.934  31.506  1.00 82.98 ? 38  LEU C CG  1 
ATOM   7833 C  CD1 . LEU C 2 37  ? -10.150 18.508  30.129  1.00 82.73 ? 38  LEU C CD1 1 
ATOM   7834 C  CD2 . LEU C 2 37  ? -11.964 17.724  31.676  1.00 83.13 ? 38  LEU C CD2 1 
ATOM   7835 N  N   . ASP C 2 38  ? -10.573 14.014  32.394  1.00 82.10 ? 39  ASP C N   1 
ATOM   7836 C  CA  . ASP C 2 38  ? -10.908 12.585  32.423  1.00 81.48 ? 39  ASP C CA  1 
ATOM   7837 C  C   . ASP C 2 38  ? -10.101 11.691  31.478  1.00 80.94 ? 39  ASP C C   1 
ATOM   7838 O  O   . ASP C 2 38  ? -9.315  10.858  31.937  1.00 80.93 ? 39  ASP C O   1 
ATOM   7839 C  CB  . ASP C 2 38  ? -12.409 12.380  32.160  1.00 81.65 ? 39  ASP C CB  1 
ATOM   7840 C  CG  . ASP C 2 38  ? -13.183 12.016  33.419  1.00 81.86 ? 39  ASP C CG  1 
ATOM   7841 O  OD1 . ASP C 2 38  ? -12.835 11.005  34.068  1.00 82.14 ? 39  ASP C OD1 1 
ATOM   7842 O  OD2 . ASP C 2 38  ? -14.152 12.731  33.747  1.00 81.96 ? 39  ASP C OD2 1 
ATOM   7843 N  N   . ILE C 2 39  ? -10.304 11.880  30.171  1.00 80.08 ? 40  ILE C N   1 
ATOM   7844 C  CA  . ILE C 2 39  ? -9.914  10.916  29.122  1.00 79.15 ? 40  ILE C CA  1 
ATOM   7845 C  C   . ILE C 2 39  ? -8.717  10.014  29.465  1.00 78.41 ? 40  ILE C C   1 
ATOM   7846 O  O   . ILE C 2 39  ? -7.612  10.499  29.727  1.00 78.42 ? 40  ILE C O   1 
ATOM   7847 C  CB  . ILE C 2 39  ? -9.704  11.589  27.728  1.00 79.20 ? 40  ILE C CB  1 
ATOM   7848 C  CG1 . ILE C 2 39  ? -10.787 12.637  27.438  1.00 79.24 ? 40  ILE C CG1 1 
ATOM   7849 C  CG2 . ILE C 2 39  ? -9.682  10.531  26.618  1.00 79.17 ? 40  ILE C CG2 1 
ATOM   7850 C  CD1 . ILE C 2 39  ? -10.408 14.063  27.828  1.00 79.18 ? 40  ILE C CD1 1 
ATOM   7851 N  N   . ASP C 2 40  ? -8.968  8.702   29.460  1.00 77.37 ? 41  ASP C N   1 
ATOM   7852 C  CA  . ASP C 2 40  ? -7.959  7.686   29.773  1.00 76.21 ? 41  ASP C CA  1 
ATOM   7853 C  C   . ASP C 2 40  ? -6.776  7.773   28.815  1.00 75.09 ? 41  ASP C C   1 
ATOM   7854 O  O   . ASP C 2 40  ? -6.959  7.810   27.591  1.00 75.00 ? 41  ASP C O   1 
ATOM   7855 C  CB  . ASP C 2 40  ? -8.556  6.268   29.697  1.00 76.41 ? 41  ASP C CB  1 
ATOM   7856 C  CG  . ASP C 2 40  ? -9.818  6.095   30.544  1.00 76.95 ? 41  ASP C CG  1 
ATOM   7857 O  OD1 . ASP C 2 40  ? -10.167 6.998   31.339  1.00 77.33 ? 41  ASP C OD1 1 
ATOM   7858 O  OD2 . ASP C 2 40  ? -10.466 5.034   30.410  1.00 77.56 ? 41  ASP C OD2 1 
ATOM   7859 N  N   . GLY C 2 41  ? -5.570  7.820   29.383  1.00 73.69 ? 42  GLY C N   1 
ATOM   7860 C  CA  . GLY C 2 41  ? -4.324  7.779   28.612  1.00 71.85 ? 42  GLY C CA  1 
ATOM   7861 C  C   . GLY C 2 41  ? -4.153  8.846   27.540  1.00 70.49 ? 42  GLY C C   1 
ATOM   7862 O  O   . GLY C 2 41  ? -3.313  8.698   26.645  1.00 70.52 ? 42  GLY C O   1 
ATOM   7863 N  N   . PHE C 2 42  ? -4.952  9.912   27.624  1.00 68.90 ? 43  PHE C N   1 
ATOM   7864 C  CA  . PHE C 2 42  ? -4.823  11.067  26.733  1.00 67.20 ? 43  PHE C CA  1 
ATOM   7865 C  C   . PHE C 2 42  ? -3.470  11.736  26.967  1.00 66.14 ? 43  PHE C C   1 
ATOM   7866 O  O   . PHE C 2 42  ? -3.128  12.090  28.100  1.00 66.00 ? 43  PHE C O   1 
ATOM   7867 C  CB  . PHE C 2 42  ? -5.970  12.063  26.972  1.00 67.14 ? 43  PHE C CB  1 
ATOM   7868 C  CG  . PHE C 2 42  ? -5.917  13.300  26.099  1.00 66.21 ? 43  PHE C CG  1 
ATOM   7869 C  CD1 . PHE C 2 42  ? -5.101  14.384  26.440  1.00 65.36 ? 43  PHE C CD1 1 
ATOM   7870 C  CD2 . PHE C 2 42  ? -6.704  13.393  24.955  1.00 65.58 ? 43  PHE C CD2 1 
ATOM   7871 C  CE1 . PHE C 2 42  ? -5.052  15.530  25.643  1.00 64.48 ? 43  PHE C CE1 1 
ATOM   7872 C  CE2 . PHE C 2 42  ? -6.665  14.539  24.151  1.00 65.08 ? 43  PHE C CE2 1 
ATOM   7873 C  CZ  . PHE C 2 42  ? -5.836  15.610  24.502  1.00 64.62 ? 43  PHE C CZ  1 
ATOM   7874 N  N   . GLY C 2 43  ? -2.705  11.896  25.892  1.00 64.87 ? 44  GLY C N   1 
ATOM   7875 C  CA  . GLY C 2 43  ? -1.377  12.499  25.974  1.00 63.28 ? 44  GLY C CA  1 
ATOM   7876 C  C   . GLY C 2 43  ? -0.365  11.545  26.576  1.00 62.07 ? 44  GLY C C   1 
ATOM   7877 O  O   . GLY C 2 43  ? 0.377   11.908  27.494  1.00 61.97 ? 44  GLY C O   1 
ATOM   7878 N  N   . ALA C 2 44  ? -0.333  10.326  26.041  1.00 60.82 ? 45  ALA C N   1 
ATOM   7879 C  CA  . ALA C 2 44  ? 0.491   9.252   26.591  1.00 59.57 ? 45  ALA C CA  1 
ATOM   7880 C  C   . ALA C 2 44  ? 2.004   9.505   26.489  1.00 58.80 ? 45  ALA C C   1 
ATOM   7881 O  O   . ALA C 2 44  ? 2.738   9.228   27.440  1.00 58.67 ? 45  ALA C O   1 
ATOM   7882 C  CB  . ALA C 2 44  ? 0.108   7.924   25.962  1.00 59.51 ? 45  ALA C CB  1 
ATOM   7883 N  N   . CYS C 2 45  ? 2.464   10.052  25.361  1.00 57.82 ? 46  CYS C N   1 
ATOM   7884 C  CA  . CYS C 2 45  ? 3.893   10.342  25.174  1.00 56.84 ? 46  CYS C CA  1 
ATOM   7885 C  C   . CYS C 2 45  ? 4.333   11.600  25.928  1.00 56.48 ? 46  CYS C C   1 
ATOM   7886 O  O   . CYS C 2 45  ? 5.534   11.861  26.075  1.00 56.19 ? 46  CYS C O   1 
ATOM   7887 C  CB  . CYS C 2 45  ? 4.247   10.451  23.685  1.00 56.76 ? 46  CYS C CB  1 
ATOM   7888 S  SG  . CYS C 2 45  ? 3.882   12.046  22.929  1.00 55.56 ? 46  CYS C SG  1 
ATOM   7889 N  N   . GLU C 2 46  ? 3.341   12.360  26.400  1.00 56.12 ? 47  GLU C N   1 
ATOM   7890 C  CA  . GLU C 2 46  ? 3.528   13.582  27.205  1.00 55.72 ? 47  GLU C CA  1 
ATOM   7891 C  C   . GLU C 2 46  ? 4.070   14.774  26.398  1.00 55.13 ? 47  GLU C C   1 
ATOM   7892 O  O   . GLU C 2 46  ? 5.069   15.395  26.766  1.00 55.10 ? 47  GLU C O   1 
ATOM   7893 C  CB  . GLU C 2 46  ? 4.347   13.303  28.483  1.00 55.77 ? 47  GLU C CB  1 
ATOM   7894 C  CG  . GLU C 2 46  ? 3.601   12.415  29.497  1.00 56.93 ? 47  GLU C CG  1 
ATOM   7895 C  CD  . GLU C 2 46  ? 4.436   12.014  30.712  1.00 58.05 ? 47  GLU C CD  1 
ATOM   7896 O  OE1 . GLU C 2 46  ? 5.508   12.614  30.946  1.00 58.61 ? 47  GLU C OE1 1 
ATOM   7897 O  OE2 . GLU C 2 46  ? 4.010   11.090  31.442  1.00 58.31 ? 47  GLU C OE2 1 
ATOM   7898 N  N   . GLY C 2 47  ? 3.394   15.076  25.292  1.00 54.45 ? 48  GLY C N   1 
ATOM   7899 C  CA  . GLY C 2 47  ? 3.668   16.276  24.500  1.00 54.09 ? 48  GLY C CA  1 
ATOM   7900 C  C   . GLY C 2 47  ? 4.974   16.331  23.723  1.00 53.81 ? 48  GLY C C   1 
ATOM   7901 O  O   . GLY C 2 47  ? 5.547   17.414  23.547  1.00 53.77 ? 48  GLY C O   1 
ATOM   7902 N  N   . THR C 2 48  ? 5.445   15.177  23.247  1.00 53.24 ? 49  THR C N   1 
ATOM   7903 C  CA  . THR C 2 48  ? 6.706   15.109  22.500  1.00 52.64 ? 49  THR C CA  1 
ATOM   7904 C  C   . THR C 2 48  ? 6.480   14.730  21.034  1.00 52.62 ? 49  THR C C   1 
ATOM   7905 O  O   . THR C 2 48  ? 7.432   14.401  20.319  1.00 52.53 ? 49  THR C O   1 
ATOM   7906 C  CB  . THR C 2 48  ? 7.717   14.127  23.147  1.00 52.54 ? 49  THR C CB  1 
ATOM   7907 O  OG1 . THR C 2 48  ? 7.139   12.820  23.214  1.00 51.90 ? 49  THR C OG1 1 
ATOM   7908 C  CG2 . THR C 2 48  ? 8.116   14.583  24.549  1.00 52.03 ? 49  THR C CG2 1 
ATOM   7909 N  N   . LEU C 2 49  ? 5.218   14.780  20.601  1.00 52.55 ? 50  LEU C N   1 
ATOM   7910 C  CA  . LEU C 2 49  ? 4.815   14.414  19.234  1.00 52.70 ? 50  LEU C CA  1 
ATOM   7911 C  C   . LEU C 2 49  ? 5.306   12.993  18.887  1.00 53.05 ? 50  LEU C C   1 
ATOM   7912 O  O   . LEU C 2 49  ? 5.900   12.752  17.829  1.00 52.78 ? 50  LEU C O   1 
ATOM   7913 C  CB  . LEU C 2 49  ? 5.261   15.498  18.225  1.00 52.47 ? 50  LEU C CB  1 
ATOM   7914 C  CG  . LEU C 2 49  ? 5.023   15.441  16.706  1.00 52.30 ? 50  LEU C CG  1 
ATOM   7915 C  CD1 . LEU C 2 49  ? 3.637   14.944  16.319  1.00 51.19 ? 50  LEU C CD1 1 
ATOM   7916 C  CD2 . LEU C 2 49  ? 5.309   16.795  16.069  1.00 52.11 ? 50  LEU C CD2 1 
ATOM   7917 N  N   . ALA C 2 50  ? 5.029   12.067  19.809  1.00 53.49 ? 51  ALA C N   1 
ATOM   7918 C  CA  . ALA C 2 50  ? 5.552   10.700  19.776  1.00 54.12 ? 51  ALA C CA  1 
ATOM   7919 C  C   . ALA C 2 50  ? 4.466   9.667   20.098  1.00 54.66 ? 51  ALA C C   1 
ATOM   7920 O  O   . ALA C 2 50  ? 4.759   8.525   20.463  1.00 54.54 ? 51  ALA C O   1 
ATOM   7921 C  CB  . ALA C 2 50  ? 6.721   10.568  20.744  1.00 53.91 ? 51  ALA C CB  1 
ATOM   7922 N  N   . CYS C 2 51  ? 3.213   10.104  19.991  1.00 55.43 ? 52  CYS C N   1 
ATOM   7923 C  CA  . CYS C 2 51  ? 2.036   9.232   19.978  1.00 56.18 ? 52  CYS C CA  1 
ATOM   7924 C  C   . CYS C 2 51  ? 0.985   9.985   19.173  1.00 57.01 ? 52  CYS C C   1 
ATOM   7925 O  O   . CYS C 2 51  ? 1.337   10.840  18.358  1.00 57.67 ? 52  CYS C O   1 
ATOM   7926 C  CB  . CYS C 2 51  ? 1.548   8.900   21.397  1.00 56.01 ? 52  CYS C CB  1 
ATOM   7927 S  SG  . CYS C 2 51  ? 0.656   10.210  22.297  1.00 54.80 ? 52  CYS C SG  1 
ATOM   7928 N  N   . SER C 2 52  ? -0.290  9.674   19.376  1.00 57.75 ? 53  SER C N   1 
ATOM   7929 C  CA  . SER C 2 52  ? -1.371  10.454  18.773  1.00 58.29 ? 53  SER C CA  1 
ATOM   7930 C  C   . SER C 2 52  ? -2.621  10.415  19.654  1.00 58.96 ? 53  SER C C   1 
ATOM   7931 O  O   . SER C 2 52  ? -3.747  10.535  19.162  1.00 58.97 ? 53  SER C O   1 
ATOM   7932 C  CB  . SER C 2 52  ? -1.680  9.954   17.358  1.00 58.08 ? 53  SER C CB  1 
ATOM   7933 O  OG  . SER C 2 52  ? -2.058  8.592   17.378  1.00 57.76 ? 53  SER C OG  1 
ATOM   7934 N  N   . THR C 2 53  ? -2.407  10.252  20.958  1.00 59.79 ? 54  THR C N   1 
ATOM   7935 C  CA  . THR C 2 53  ? -3.502  10.108  21.920  1.00 60.74 ? 54  THR C CA  1 
ATOM   7936 C  C   . THR C 2 53  ? -4.112  11.458  22.307  1.00 61.51 ? 54  THR C C   1 
ATOM   7937 O  O   . THR C 2 53  ? -5.227  11.516  22.832  1.00 61.51 ? 54  THR C O   1 
ATOM   7938 C  CB  . THR C 2 53  ? -3.067  9.317   23.183  1.00 60.57 ? 54  THR C CB  1 
ATOM   7939 O  OG1 . THR C 2 53  ? -1.967  9.977   23.821  1.00 60.52 ? 54  THR C OG1 1 
ATOM   7940 C  CG2 . THR C 2 53  ? -2.653  7.892   22.816  1.00 60.55 ? 54  THR C CG2 1 
ATOM   7941 N  N   . CYS C 2 54  ? -3.374  12.533  22.024  1.00 62.53 ? 55  CYS C N   1 
ATOM   7942 C  CA  . CYS C 2 54  ? -3.825  13.911  22.244  1.00 63.44 ? 55  CYS C CA  1 
ATOM   7943 C  C   . CYS C 2 54  ? -4.709  14.419  21.100  1.00 64.48 ? 55  CYS C C   1 
ATOM   7944 O  O   . CYS C 2 54  ? -4.992  15.618  21.002  1.00 64.73 ? 55  CYS C O   1 
ATOM   7945 C  CB  . CYS C 2 54  ? -2.617  14.834  22.406  1.00 63.36 ? 55  CYS C CB  1 
ATOM   7946 S  SG  . CYS C 2 54  ? -1.585  14.957  20.903  1.00 62.64 ? 55  CYS C SG  1 
ATOM   7947 N  N   . HIS C 2 55  ? -5.133  13.495  20.241  1.00 65.64 ? 56  HIS C N   1 
ATOM   7948 C  CA  . HIS C 2 55  ? -5.957  13.781  19.069  1.00 66.85 ? 56  HIS C CA  1 
ATOM   7949 C  C   . HIS C 2 55  ? -7.252  14.518  19.438  1.00 67.90 ? 56  HIS C C   1 
ATOM   7950 O  O   . HIS C 2 55  ? -7.988  14.088  20.330  1.00 67.83 ? 56  HIS C O   1 
ATOM   7951 C  CB  . HIS C 2 55  ? -6.250  12.458  18.345  1.00 66.70 ? 56  HIS C CB  1 
ATOM   7952 C  CG  . HIS C 2 55  ? -7.134  12.585  17.145  1.00 66.66 ? 56  HIS C CG  1 
ATOM   7953 N  ND1 . HIS C 2 55  ? -7.050  13.637  16.258  1.00 67.00 ? 56  HIS C ND1 1 
ATOM   7954 C  CD2 . HIS C 2 55  ? -8.098  11.765  16.664  1.00 66.96 ? 56  HIS C CD2 1 
ATOM   7955 C  CE1 . HIS C 2 55  ? -7.938  13.469  15.295  1.00 67.05 ? 56  HIS C CE1 1 
ATOM   7956 N  NE2 . HIS C 2 55  ? -8.586  12.340  15.516  1.00 67.02 ? 56  HIS C NE2 1 
ATOM   7957 N  N   . LEU C 2 56  ? -7.506  15.638  18.759  1.00 69.18 ? 57  LEU C N   1 
ATOM   7958 C  CA  . LEU C 2 56  ? -8.691  16.469  19.015  1.00 70.56 ? 57  LEU C CA  1 
ATOM   7959 C  C   . LEU C 2 56  ? -9.309  17.021  17.730  1.00 71.59 ? 57  LEU C C   1 
ATOM   7960 O  O   . LEU C 2 56  ? -8.602  17.267  16.748  1.00 71.70 ? 57  LEU C O   1 
ATOM   7961 C  CB  . LEU C 2 56  ? -8.360  17.621  19.973  1.00 70.28 ? 57  LEU C CB  1 
ATOM   7962 C  CG  . LEU C 2 56  ? -8.284  17.315  21.475  1.00 70.42 ? 57  LEU C CG  1 
ATOM   7963 C  CD1 . LEU C 2 56  ? -7.647  18.476  22.226  1.00 70.11 ? 57  LEU C CD1 1 
ATOM   7964 C  CD2 . LEU C 2 56  ? -9.662  16.977  22.062  1.00 70.21 ? 57  LEU C CD2 1 
ATOM   7965 N  N   . ILE C 2 57  ? -10.629 17.217  17.754  1.00 72.80 ? 58  ILE C N   1 
ATOM   7966 C  CA  . ILE C 2 57  ? -11.376 17.731  16.603  1.00 74.00 ? 58  ILE C CA  1 
ATOM   7967 C  C   . ILE C 2 57  ? -11.762 19.200  16.814  1.00 74.84 ? 58  ILE C C   1 
ATOM   7968 O  O   . ILE C 2 57  ? -12.427 19.544  17.797  1.00 75.02 ? 58  ILE C O   1 
ATOM   7969 C  CB  . ILE C 2 57  ? -12.636 16.876  16.312  1.00 73.90 ? 58  ILE C CB  1 
ATOM   7970 C  CG1 . ILE C 2 57  ? -12.275 15.385  16.283  1.00 74.13 ? 58  ILE C CG1 1 
ATOM   7971 C  CG2 . ILE C 2 57  ? -13.286 17.310  14.994  1.00 74.01 ? 58  ILE C CG2 1 
ATOM   7972 C  CD1 . ILE C 2 57  ? -13.442 14.443  16.547  1.00 74.64 ? 58  ILE C CD1 1 
ATOM   7973 N  N   . PHE C 2 58  ? -11.336 20.052  15.882  1.00 75.84 ? 59  PHE C N   1 
ATOM   7974 C  CA  . PHE C 2 58  ? -11.544 21.502  15.965  1.00 76.87 ? 59  PHE C CA  1 
ATOM   7975 C  C   . PHE C 2 58  ? -12.634 21.975  15.004  1.00 77.56 ? 59  PHE C C   1 
ATOM   7976 O  O   . PHE C 2 58  ? -12.771 21.444  13.895  1.00 77.64 ? 59  PHE C O   1 
ATOM   7977 C  CB  . PHE C 2 58  ? -10.242 22.251  15.641  1.00 76.79 ? 59  PHE C CB  1 
ATOM   7978 C  CG  . PHE C 2 58  ? -9.155  22.080  16.672  1.00 77.00 ? 59  PHE C CG  1 
ATOM   7979 C  CD1 . PHE C 2 58  ? -8.413  20.899  16.744  1.00 77.27 ? 59  PHE C CD1 1 
ATOM   7980 C  CD2 . PHE C 2 58  ? -8.854  23.110  17.557  1.00 76.70 ? 59  PHE C CD2 1 
ATOM   7981 C  CE1 . PHE C 2 58  ? -7.404  20.742  17.695  1.00 77.02 ? 59  PHE C CE1 1 
ATOM   7982 C  CE2 . PHE C 2 58  ? -7.844  22.964  18.507  1.00 76.82 ? 59  PHE C CE2 1 
ATOM   7983 C  CZ  . PHE C 2 58  ? -7.118  21.777  18.573  1.00 76.84 ? 59  PHE C CZ  1 
ATOM   7984 N  N   . GLU C 2 59  ? -13.398 22.982  15.425  1.00 78.46 ? 60  GLU C N   1 
ATOM   7985 C  CA  . GLU C 2 59  ? -14.389 23.607  14.541  1.00 79.21 ? 60  GLU C CA  1 
ATOM   7986 C  C   . GLU C 2 59  ? -13.729 24.587  13.569  1.00 79.56 ? 60  GLU C C   1 
ATOM   7987 O  O   . GLU C 2 59  ? -12.681 25.169  13.871  1.00 79.62 ? 60  GLU C O   1 
ATOM   7988 C  CB  . GLU C 2 59  ? -15.531 24.267  15.329  1.00 79.28 ? 60  GLU C CB  1 
ATOM   7989 C  CG  . GLU C 2 59  ? -15.105 25.258  16.412  1.00 79.99 ? 60  GLU C CG  1 
ATOM   7990 C  CD  . GLU C 2 59  ? -16.274 25.738  17.265  1.00 80.90 ? 60  GLU C CD  1 
ATOM   7991 O  OE1 . GLU C 2 59  ? -16.022 26.382  18.306  1.00 81.37 ? 60  GLU C OE1 1 
ATOM   7992 O  OE2 . GLU C 2 59  ? -17.443 25.477  16.898  1.00 81.22 ? 60  GLU C OE2 1 
ATOM   7993 N  N   . ASP C 2 60  ? -14.367 24.762  12.414  1.00 80.07 ? 61  ASP C N   1 
ATOM   7994 C  CA  . ASP C 2 60  ? -13.798 25.462  11.255  1.00 80.53 ? 61  ASP C CA  1 
ATOM   7995 C  C   . ASP C 2 60  ? -13.082 26.784  11.545  1.00 80.75 ? 61  ASP C C   1 
ATOM   7996 O  O   . ASP C 2 60  ? -11.960 26.995  11.072  1.00 80.85 ? 61  ASP C O   1 
ATOM   7997 C  CB  . ASP C 2 60  ? -14.877 25.666  10.181  1.00 80.70 ? 61  ASP C CB  1 
ATOM   7998 C  CG  . ASP C 2 60  ? -15.645 24.387  9.864   1.00 81.15 ? 61  ASP C CG  1 
ATOM   7999 O  OD1 . ASP C 2 60  ? -15.152 23.282  10.193  1.00 81.50 ? 61  ASP C OD1 1 
ATOM   8000 O  OD2 . ASP C 2 60  ? -16.747 24.490  9.281   1.00 81.51 ? 61  ASP C OD2 1 
ATOM   8001 N  N   . HIS C 2 61  ? -13.718 27.663  12.319  1.00 80.92 ? 62  HIS C N   1 
ATOM   8002 C  CA  . HIS C 2 61  ? -13.163 28.999  12.577  1.00 81.06 ? 62  HIS C CA  1 
ATOM   8003 C  C   . HIS C 2 61  ? -11.907 28.998  13.466  1.00 81.14 ? 62  HIS C C   1 
ATOM   8004 O  O   . HIS C 2 61  ? -11.080 29.912  13.376  1.00 81.17 ? 62  HIS C O   1 
ATOM   8005 C  CB  . HIS C 2 61  ? -14.239 29.965  13.109  1.00 81.05 ? 62  HIS C CB  1 
ATOM   8006 C  CG  . HIS C 2 61  ? -14.686 29.680  14.511  1.00 81.12 ? 62  HIS C CG  1 
ATOM   8007 N  ND1 . HIS C 2 61  ? -15.766 28.871  14.800  1.00 81.21 ? 62  HIS C ND1 1 
ATOM   8008 C  CD2 . HIS C 2 61  ? -14.211 30.111  15.704  1.00 80.97 ? 62  HIS C CD2 1 
ATOM   8009 C  CE1 . HIS C 2 61  ? -15.931 28.811  16.109  1.00 80.97 ? 62  HIS C CE1 1 
ATOM   8010 N  NE2 . HIS C 2 61  ? -14.998 29.552  16.681  1.00 80.83 ? 62  HIS C NE2 1 
ATOM   8011 N  N   . ILE C 2 62  ? -11.771 27.969  14.305  1.00 81.21 ? 63  ILE C N   1 
ATOM   8012 C  CA  . ILE C 2 62  ? -10.591 27.793  15.163  1.00 81.23 ? 63  ILE C CA  1 
ATOM   8013 C  C   . ILE C 2 62  ? -9.441  27.122  14.400  1.00 81.23 ? 63  ILE C C   1 
ATOM   8014 O  O   . ILE C 2 62  ? -8.267  27.418  14.647  1.00 81.31 ? 63  ILE C O   1 
ATOM   8015 C  CB  . ILE C 2 62  ? -10.930 26.984  16.461  1.00 81.27 ? 63  ILE C CB  1 
ATOM   8016 C  CG1 . ILE C 2 62  ? -12.020 27.686  17.294  1.00 81.19 ? 63  ILE C CG1 1 
ATOM   8017 C  CG2 . ILE C 2 62  ? -9.674  26.718  17.310  1.00 81.26 ? 63  ILE C CG2 1 
ATOM   8018 C  CD1 . ILE C 2 62  ? -11.598 29.008  17.966  1.00 81.03 ? 63  ILE C CD1 1 
ATOM   8019 N  N   . TYR C 2 63  ? -9.796  26.235  13.468  1.00 81.15 ? 64  TYR C N   1 
ATOM   8020 C  CA  . TYR C 2 63  ? -8.836  25.431  12.695  1.00 80.96 ? 64  TYR C CA  1 
ATOM   8021 C  C   . TYR C 2 63  ? -7.872  26.270  11.842  1.00 80.72 ? 64  TYR C C   1 
ATOM   8022 O  O   . TYR C 2 63  ? -6.650  26.122  11.957  1.00 80.55 ? 64  TYR C O   1 
ATOM   8023 C  CB  . TYR C 2 63  ? -9.586  24.403  11.827  1.00 80.97 ? 64  TYR C CB  1 
ATOM   8024 C  CG  . TYR C 2 63  ? -8.701  23.441  11.052  1.00 81.04 ? 64  TYR C CG  1 
ATOM   8025 C  CD1 . TYR C 2 63  ? -8.151  22.310  11.666  1.00 81.02 ? 64  TYR C CD1 1 
ATOM   8026 C  CD2 . TYR C 2 63  ? -8.430  23.649  9.697   1.00 80.95 ? 64  TYR C CD2 1 
ATOM   8027 C  CE1 . TYR C 2 63  ? -7.342  21.421  10.951  1.00 80.70 ? 64  TYR C CE1 1 
ATOM   8028 C  CE2 . TYR C 2 63  ? -7.624  22.768  8.976   1.00 80.73 ? 64  TYR C CE2 1 
ATOM   8029 C  CZ  . TYR C 2 63  ? -7.085  21.658  9.608   1.00 80.66 ? 64  TYR C CZ  1 
ATOM   8030 O  OH  . TYR C 2 63  ? -6.291  20.791  8.894   1.00 80.14 ? 64  TYR C OH  1 
ATOM   8031 N  N   . GLU C 2 64  ? -8.427  27.145  11.001  1.00 80.39 ? 65  GLU C N   1 
ATOM   8032 C  CA  . GLU C 2 64  ? -7.631  27.987  10.101  1.00 80.01 ? 65  GLU C CA  1 
ATOM   8033 C  C   . GLU C 2 64  ? -6.798  29.040  10.839  1.00 79.56 ? 65  GLU C C   1 
ATOM   8034 O  O   . GLU C 2 64  ? -5.847  29.589  10.276  1.00 79.42 ? 65  GLU C O   1 
ATOM   8035 C  CB  . GLU C 2 64  ? -8.521  28.648  9.042   1.00 80.23 ? 65  GLU C CB  1 
ATOM   8036 C  CG  . GLU C 2 64  ? -8.704  27.828  7.758   1.00 80.77 ? 65  GLU C CG  1 
ATOM   8037 C  CD  . GLU C 2 64  ? -9.768  26.739  7.871   1.00 81.67 ? 65  GLU C CD  1 
ATOM   8038 O  OE1 . GLU C 2 64  ? -9.546  25.633  7.325   1.00 82.03 ? 65  GLU C OE1 1 
ATOM   8039 O  OE2 . GLU C 2 64  ? -10.826 26.983  8.492   1.00 81.75 ? 65  GLU C OE2 1 
ATOM   8040 N  N   . LYS C 2 65  ? -7.159  29.305  12.095  1.00 79.02 ? 66  LYS C N   1 
ATOM   8041 C  CA  . LYS C 2 65  ? -6.429  30.237  12.965  1.00 78.43 ? 66  LYS C CA  1 
ATOM   8042 C  C   . LYS C 2 65  ? -5.051  29.719  13.402  1.00 77.84 ? 66  LYS C C   1 
ATOM   8043 O  O   . LYS C 2 65  ? -4.220  30.494  13.885  1.00 77.76 ? 66  LYS C O   1 
ATOM   8044 C  CB  . LYS C 2 65  ? -7.261  30.575  14.210  1.00 78.49 ? 66  LYS C CB  1 
ATOM   8045 C  CG  . LYS C 2 65  ? -8.259  31.719  14.025  1.00 78.82 ? 66  LYS C CG  1 
ATOM   8046 C  CD  . LYS C 2 65  ? -9.163  31.904  15.255  1.00 79.16 ? 66  LYS C CD  1 
ATOM   8047 C  CE  . LYS C 2 65  ? -8.422  32.496  16.460  1.00 79.27 ? 66  LYS C CE  1 
ATOM   8048 N  NZ  . LYS C 2 65  ? -7.981  33.903  16.226  1.00 79.47 ? 66  LYS C NZ  1 
ATOM   8049 N  N   . LEU C 2 66  ? -4.815  28.418  13.232  1.00 77.03 ? 67  LEU C N   1 
ATOM   8050 C  CA  . LEU C 2 66  ? -3.581  27.786  13.713  1.00 76.14 ? 67  LEU C CA  1 
ATOM   8051 C  C   . LEU C 2 66  ? -2.545  27.517  12.620  1.00 75.39 ? 67  LEU C C   1 
ATOM   8052 O  O   . LEU C 2 66  ? -2.887  27.169  11.485  1.00 75.23 ? 67  LEU C O   1 
ATOM   8053 C  CB  . LEU C 2 66  ? -3.900  26.509  14.496  1.00 76.26 ? 67  LEU C CB  1 
ATOM   8054 C  CG  . LEU C 2 66  ? -4.415  26.770  15.916  1.00 76.33 ? 67  LEU C CG  1 
ATOM   8055 C  CD1 . LEU C 2 66  ? -5.464  25.742  16.319  1.00 76.59 ? 67  LEU C CD1 1 
ATOM   8056 C  CD2 . LEU C 2 66  ? -3.262  26.823  16.919  1.00 76.32 ? 67  LEU C CD2 1 
ATOM   8057 N  N   . ASP C 2 67  ? -1.278  27.684  12.994  1.00 74.43 ? 68  ASP C N   1 
ATOM   8058 C  CA  . ASP C 2 67  ? -0.137  27.578  12.075  1.00 73.53 ? 68  ASP C CA  1 
ATOM   8059 C  C   . ASP C 2 67  ? -0.063  26.250  11.322  1.00 72.62 ? 68  ASP C C   1 
ATOM   8060 O  O   . ASP C 2 67  ? -0.620  25.238  11.764  1.00 72.54 ? 68  ASP C O   1 
ATOM   8061 C  CB  . ASP C 2 67  ? 1.187   27.858  12.810  1.00 73.71 ? 68  ASP C CB  1 
ATOM   8062 C  CG  . ASP C 2 67  ? 1.265   27.186  14.182  1.00 74.16 ? 68  ASP C CG  1 
ATOM   8063 O  OD1 . ASP C 2 67  ? 0.350   26.412  14.542  1.00 74.69 ? 68  ASP C OD1 1 
ATOM   8064 O  OD2 . ASP C 2 67  ? 2.251   27.443  14.908  1.00 74.64 ? 68  ASP C OD2 1 
ATOM   8065 N  N   . ALA C 2 68  ? 0.629   26.278  10.182  1.00 71.39 ? 69  ALA C N   1 
ATOM   8066 C  CA  . ALA C 2 68  ? 0.753   25.131  9.281   1.00 70.17 ? 69  ALA C CA  1 
ATOM   8067 C  C   . ALA C 2 68  ? 1.212   23.853  9.988   1.00 69.29 ? 69  ALA C C   1 
ATOM   8068 O  O   . ALA C 2 68  ? 1.998   23.892  10.940  1.00 69.07 ? 69  ALA C O   1 
ATOM   8069 C  CB  . ALA C 2 68  ? 1.684   25.467  8.120   1.00 70.24 ? 69  ALA C CB  1 
ATOM   8070 N  N   . ILE C 2 69  ? 0.696   22.727  9.508   1.00 68.11 ? 70  ILE C N   1 
ATOM   8071 C  CA  . ILE C 2 69  ? 0.968   21.421  10.096  1.00 67.00 ? 70  ILE C CA  1 
ATOM   8072 C  C   . ILE C 2 69  ? 2.300   20.855  9.590   1.00 66.00 ? 70  ILE C C   1 
ATOM   8073 O  O   . ILE C 2 69  ? 2.516   20.745  8.378   1.00 65.56 ? 70  ILE C O   1 
ATOM   8074 C  CB  . ILE C 2 69  ? -0.217  20.437  9.842   1.00 67.18 ? 70  ILE C CB  1 
ATOM   8075 C  CG1 . ILE C 2 69  ? 0.051   19.072  10.490  1.00 67.15 ? 70  ILE C CG1 1 
ATOM   8076 C  CG2 . ILE C 2 69  ? -0.545  20.330  8.332   1.00 67.15 ? 70  ILE C CG2 1 
ATOM   8077 C  CD1 . ILE C 2 69  ? -1.140  18.128  10.479  1.00 67.60 ? 70  ILE C CD1 1 
ATOM   8078 N  N   . THR C 2 70  ? 3.190   20.516  10.526  1.00 64.90 ? 71  THR C N   1 
ATOM   8079 C  CA  . THR C 2 70  ? 4.480   19.900  10.188  1.00 63.88 ? 71  THR C CA  1 
ATOM   8080 C  C   . THR C 2 70  ? 4.277   18.512  9.587   1.00 63.23 ? 71  THR C C   1 
ATOM   8081 O  O   . THR C 2 70  ? 3.252   17.859  9.835   1.00 62.93 ? 71  THR C O   1 
ATOM   8082 C  CB  . THR C 2 70  ? 5.437   19.775  11.407  1.00 63.86 ? 71  THR C CB  1 
ATOM   8083 O  OG1 . THR C 2 70  ? 4.903   18.846  12.359  1.00 63.60 ? 71  THR C OG1 1 
ATOM   8084 C  CG2 . THR C 2 70  ? 5.675   21.130  12.071  1.00 63.89 ? 71  THR C CG2 1 
ATOM   8085 N  N   . ASP C 2 71  ? 5.258   18.075  8.799   1.00 62.32 ? 72  ASP C N   1 
ATOM   8086 C  CA  . ASP C 2 71  ? 5.249   16.745  8.188   1.00 61.61 ? 72  ASP C CA  1 
ATOM   8087 C  C   . ASP C 2 71  ? 5.092   15.632  9.235   1.00 60.92 ? 72  ASP C C   1 
ATOM   8088 O  O   . ASP C 2 71  ? 4.390   14.649  8.994   1.00 60.57 ? 72  ASP C O   1 
ATOM   8089 C  CB  . ASP C 2 71  ? 6.524   16.525  7.361   1.00 61.63 ? 72  ASP C CB  1 
ATOM   8090 C  CG  . ASP C 2 71  ? 6.732   17.600  6.287   1.00 62.34 ? 72  ASP C CG  1 
ATOM   8091 O  OD1 . ASP C 2 71  ? 7.901   17.966  6.024   1.00 62.31 ? 72  ASP C OD1 1 
ATOM   8092 O  OD2 . ASP C 2 71  ? 5.736   18.078  5.701   1.00 63.07 ? 72  ASP C OD2 1 
ATOM   8093 N  N   . GLU C 2 72  ? 5.734   15.814  10.392  1.00 60.23 ? 73  GLU C N   1 
ATOM   8094 C  CA  . GLU C 2 72  ? 5.727   14.835  11.491  1.00 59.93 ? 73  GLU C CA  1 
ATOM   8095 C  C   . GLU C 2 72  ? 4.332   14.667  12.086  1.00 59.66 ? 73  GLU C C   1 
ATOM   8096 O  O   . GLU C 2 72  ? 3.913   13.550  12.385  1.00 59.30 ? 73  GLU C O   1 
ATOM   8097 C  CB  . GLU C 2 72  ? 6.720   15.231  12.601  1.00 59.88 ? 73  GLU C CB  1 
ATOM   8098 C  CG  . GLU C 2 72  ? 8.193   15.298  12.185  1.00 60.14 ? 73  GLU C CG  1 
ATOM   8099 C  CD  . GLU C 2 72  ? 8.513   16.485  11.273  1.00 61.07 ? 73  GLU C CD  1 
ATOM   8100 O  OE1 . GLU C 2 72  ? 8.463   17.647  11.740  1.00 61.67 ? 73  GLU C OE1 1 
ATOM   8101 O  OE2 . GLU C 2 72  ? 8.815   16.251  10.085  1.00 60.35 ? 73  GLU C OE2 1 
ATOM   8102 N  N   . GLU C 2 73  ? 3.622   15.785  12.248  1.00 59.53 ? 74  GLU C N   1 
ATOM   8103 C  CA  . GLU C 2 73  ? 2.251   15.775  12.760  1.00 59.60 ? 74  GLU C CA  1 
ATOM   8104 C  C   . GLU C 2 73  ? 1.289   15.110  11.773  1.00 59.42 ? 74  GLU C C   1 
ATOM   8105 O  O   . GLU C 2 73  ? 0.436   14.317  12.177  1.00 59.12 ? 74  GLU C O   1 
ATOM   8106 C  CB  . GLU C 2 73  ? 1.782   17.194  13.124  1.00 59.68 ? 74  GLU C CB  1 
ATOM   8107 C  CG  . GLU C 2 73  ? 0.415   17.239  13.822  1.00 60.26 ? 74  GLU C CG  1 
ATOM   8108 C  CD  . GLU C 2 73  ? 0.095   18.574  14.502  1.00 61.34 ? 74  GLU C CD  1 
ATOM   8109 O  OE1 . GLU C 2 73  ? 0.949   19.487  14.513  1.00 61.04 ? 74  GLU C OE1 1 
ATOM   8110 O  OE2 . GLU C 2 73  ? -1.027  18.702  15.040  1.00 61.42 ? 74  GLU C OE2 1 
ATOM   8111 N  N   . ASN C 2 74  ? 1.441   15.434  10.488  1.00 59.43 ? 75  ASN C N   1 
ATOM   8112 C  CA  . ASN C 2 74  ? 0.674   14.798  9.409   1.00 59.66 ? 75  ASN C CA  1 
ATOM   8113 C  C   . ASN C 2 74  ? 0.793   13.272  9.403   1.00 59.61 ? 75  ASN C C   1 
ATOM   8114 O  O   . ASN C 2 74  ? -0.204  12.565  9.222   1.00 59.49 ? 75  ASN C O   1 
ATOM   8115 C  CB  . ASN C 2 74  ? 1.084   15.362  8.038   1.00 59.67 ? 75  ASN C CB  1 
ATOM   8116 C  CG  . ASN C 2 74  ? 0.085   16.376  7.492   1.00 60.46 ? 75  ASN C CG  1 
ATOM   8117 O  OD1 . ASN C 2 74  ? -1.125  16.133  7.488   1.00 61.19 ? 75  ASN C OD1 1 
ATOM   8118 N  ND2 . ASN C 2 74  ? 0.591   17.511  7.011   1.00 60.11 ? 75  ASN C ND2 1 
ATOM   8119 N  N   . ASP C 2 75  ? 2.015   12.781  9.602   1.00 59.63 ? 76  ASP C N   1 
ATOM   8120 C  CA  . ASP C 2 75  ? 2.290   11.346  9.641   1.00 59.76 ? 76  ASP C CA  1 
ATOM   8121 C  C   . ASP C 2 75  ? 1.605   10.661  10.826  1.00 59.90 ? 76  ASP C C   1 
ATOM   8122 O  O   . ASP C 2 75  ? 0.999   9.601   10.661  1.00 59.69 ? 76  ASP C O   1 
ATOM   8123 C  CB  . ASP C 2 75  ? 3.799   11.089  9.670   1.00 59.63 ? 76  ASP C CB  1 
ATOM   8124 C  CG  . ASP C 2 75  ? 4.509   11.590  8.416   1.00 59.97 ? 76  ASP C CG  1 
ATOM   8125 O  OD1 . ASP C 2 75  ? 3.827   11.926  7.421   1.00 59.73 ? 76  ASP C OD1 1 
ATOM   8126 O  OD2 . ASP C 2 75  ? 5.760   11.652  8.431   1.00 60.16 ? 76  ASP C OD2 1 
ATOM   8127 N  N   . MET C 2 76  ? 1.702   11.275  12.006  1.00 60.26 ? 77  MET C N   1 
ATOM   8128 C  CA  . MET C 2 76  ? 1.032   10.778  13.211  1.00 60.93 ? 77  MET C CA  1 
ATOM   8129 C  C   . MET C 2 76  ? -0.488  10.751  13.037  1.00 61.58 ? 77  MET C C   1 
ATOM   8130 O  O   . MET C 2 76  ? -1.152  9.811   13.482  1.00 61.52 ? 77  MET C O   1 
ATOM   8131 C  CB  . MET C 2 76  ? 1.403   11.621  14.434  1.00 60.70 ? 77  MET C CB  1 
ATOM   8132 C  CG  . MET C 2 76  ? 2.851   11.496  14.908  1.00 61.15 ? 77  MET C CG  1 
ATOM   8133 S  SD  . MET C 2 76  ? 3.254   9.932   15.733  1.00 61.25 ? 77  MET C SD  1 
ATOM   8134 C  CE  . MET C 2 76  ? 3.618   8.892   14.328  1.00 61.56 ? 77  MET C CE  1 
ATOM   8135 N  N   . LEU C 2 77  ? -1.019  11.784  12.380  1.00 62.42 ? 78  LEU C N   1 
ATOM   8136 C  CA  . LEU C 2 77  ? -2.454  11.917  12.114  1.00 63.49 ? 78  LEU C CA  1 
ATOM   8137 C  C   . LEU C 2 77  ? -3.035  10.850  11.184  1.00 64.08 ? 78  LEU C C   1 
ATOM   8138 O  O   . LEU C 2 77  ? -4.173  10.422  11.377  1.00 64.21 ? 78  LEU C O   1 
ATOM   8139 C  CB  . LEU C 2 77  ? -2.778  13.318  11.577  1.00 63.44 ? 78  LEU C CB  1 
ATOM   8140 C  CG  . LEU C 2 77  ? -3.622  14.281  12.424  1.00 63.81 ? 78  LEU C CG  1 
ATOM   8141 C  CD1 . LEU C 2 77  ? -3.198  14.336  13.887  1.00 63.46 ? 78  LEU C CD1 1 
ATOM   8142 C  CD2 . LEU C 2 77  ? -3.599  15.679  11.806  1.00 64.25 ? 78  LEU C CD2 1 
ATOM   8143 N  N   . ASP C 2 78  ? -2.266  10.428  10.182  1.00 65.00 ? 79  ASP C N   1 
ATOM   8144 C  CA  . ASP C 2 78  ? -2.721  9.386   9.256   1.00 66.03 ? 79  ASP C CA  1 
ATOM   8145 C  C   . ASP C 2 78  ? -2.872  8.019   9.938   1.00 66.64 ? 79  ASP C C   1 
ATOM   8146 O  O   . ASP C 2 78  ? -3.571  7.140   9.428   1.00 66.87 ? 79  ASP C O   1 
ATOM   8147 C  CB  . ASP C 2 78  ? -1.799  9.287   8.028   1.00 66.10 ? 79  ASP C CB  1 
ATOM   8148 C  CG  . ASP C 2 78  ? -2.060  10.389  6.998   1.00 66.82 ? 79  ASP C CG  1 
ATOM   8149 O  OD1 . ASP C 2 78  ? -1.101  10.796  6.304   1.00 67.38 ? 79  ASP C OD1 1 
ATOM   8150 O  OD2 . ASP C 2 78  ? -3.219  10.848  6.876   1.00 67.24 ? 79  ASP C OD2 1 
ATOM   8151 N  N   . LEU C 2 79  ? -2.221  7.852   11.090  1.00 67.39 ? 80  LEU C N   1 
ATOM   8152 C  CA  . LEU C 2 79  ? -2.323  6.620   11.873  1.00 68.17 ? 80  LEU C CA  1 
ATOM   8153 C  C   . LEU C 2 79  ? -3.125  6.802   13.158  1.00 68.81 ? 80  LEU C C   1 
ATOM   8154 O  O   . LEU C 2 79  ? -3.126  5.931   14.027  1.00 68.89 ? 80  LEU C O   1 
ATOM   8155 C  CB  . LEU C 2 79  ? -0.936  6.047   12.191  1.00 68.08 ? 80  LEU C CB  1 
ATOM   8156 C  CG  . LEU C 2 79  ? -0.008  5.598   11.057  1.00 68.29 ? 80  LEU C CG  1 
ATOM   8157 C  CD1 . LEU C 2 79  ? 1.107   4.724   11.607  1.00 68.75 ? 80  LEU C CD1 1 
ATOM   8158 C  CD2 . LEU C 2 79  ? -0.759  4.853   9.976   1.00 68.09 ? 80  LEU C CD2 1 
ATOM   8159 N  N   . ALA C 2 80  ? -3.799  7.941   13.280  1.00 69.76 ? 81  ALA C N   1 
ATOM   8160 C  CA  . ALA C 2 80  ? -4.715  8.171   14.388  1.00 70.53 ? 81  ALA C CA  1 
ATOM   8161 C  C   . ALA C 2 80  ? -6.088  7.659   13.978  1.00 71.18 ? 81  ALA C C   1 
ATOM   8162 O  O   . ALA C 2 80  ? -6.588  8.002   12.903  1.00 71.20 ? 81  ALA C O   1 
ATOM   8163 C  CB  . ALA C 2 80  ? -4.770  9.644   14.739  1.00 70.52 ? 81  ALA C CB  1 
ATOM   8164 N  N   . TYR C 2 81  ? -6.687  6.825   14.825  1.00 72.08 ? 82  TYR C N   1 
ATOM   8165 C  CA  . TYR C 2 81  ? -7.986  6.233   14.506  1.00 72.93 ? 82  TYR C CA  1 
ATOM   8166 C  C   . TYR C 2 81  ? -9.116  7.252   14.627  1.00 73.13 ? 82  TYR C C   1 
ATOM   8167 O  O   . TYR C 2 81  ? -9.104  8.109   15.518  1.00 73.14 ? 82  TYR C O   1 
ATOM   8168 C  CB  . TYR C 2 81  ? -8.257  4.963   15.329  1.00 73.13 ? 82  TYR C CB  1 
ATOM   8169 C  CG  . TYR C 2 81  ? -8.381  5.156   16.825  1.00 74.13 ? 82  TYR C CG  1 
ATOM   8170 C  CD1 . TYR C 2 81  ? -9.613  5.467   17.410  1.00 75.08 ? 82  TYR C CD1 1 
ATOM   8171 C  CD2 . TYR C 2 81  ? -7.276  4.989   17.663  1.00 75.26 ? 82  TYR C CD2 1 
ATOM   8172 C  CE1 . TYR C 2 81  ? -9.739  5.633   18.796  1.00 75.80 ? 82  TYR C CE1 1 
ATOM   8173 C  CE2 . TYR C 2 81  ? -7.389  5.150   19.054  1.00 75.85 ? 82  TYR C CE2 1 
ATOM   8174 C  CZ  . TYR C 2 81  ? -8.623  5.472   19.610  1.00 76.01 ? 82  TYR C CZ  1 
ATOM   8175 O  OH  . TYR C 2 81  ? -8.744  5.632   20.973  1.00 76.08 ? 82  TYR C OH  1 
ATOM   8176 N  N   . GLY C 2 82  ? -10.080 7.154   13.714  1.00 73.48 ? 83  GLY C N   1 
ATOM   8177 C  CA  . GLY C 2 82  ? -11.144 8.145   13.598  1.00 73.91 ? 83  GLY C CA  1 
ATOM   8178 C  C   . GLY C 2 82  ? -10.558 9.495   13.236  1.00 74.21 ? 83  GLY C C   1 
ATOM   8179 O  O   . GLY C 2 82  ? -10.423 10.371  14.093  1.00 74.31 ? 83  GLY C O   1 
ATOM   8180 N  N   . LEU C 2 83  ? -10.192 9.653   11.966  1.00 74.42 ? 84  LEU C N   1 
ATOM   8181 C  CA  . LEU C 2 83  ? -9.550  10.877  11.490  1.00 74.58 ? 84  LEU C CA  1 
ATOM   8182 C  C   . LEU C 2 83  ? -10.563 11.844  10.875  1.00 74.60 ? 84  LEU C C   1 
ATOM   8183 O  O   . LEU C 2 83  ? -11.521 11.423  10.224  1.00 74.63 ? 84  LEU C O   1 
ATOM   8184 C  CB  . LEU C 2 83  ? -8.434  10.541  10.484  1.00 74.53 ? 84  LEU C CB  1 
ATOM   8185 C  CG  . LEU C 2 83  ? -7.651  11.671  9.797   1.00 74.66 ? 84  LEU C CG  1 
ATOM   8186 C  CD1 . LEU C 2 83  ? -6.767  12.441  10.782  1.00 74.29 ? 84  LEU C CD1 1 
ATOM   8187 C  CD2 . LEU C 2 83  ? -6.825  11.129  8.635   1.00 74.79 ? 84  LEU C CD2 1 
ATOM   8188 N  N   . THR C 2 84  ? -10.341 13.138  11.101  1.00 74.68 ? 85  THR C N   1 
ATOM   8189 C  CA  . THR C 2 84  ? -11.136 14.203  10.485  1.00 74.60 ? 85  THR C CA  1 
ATOM   8190 C  C   . THR C 2 84  ? -10.213 15.170  9.744   1.00 74.46 ? 85  THR C C   1 
ATOM   8191 O  O   . THR C 2 84  ? -9.042  15.319  10.102  1.00 74.34 ? 85  THR C O   1 
ATOM   8192 C  CB  . THR C 2 84  ? -11.952 14.998  11.538  1.00 74.69 ? 85  THR C CB  1 
ATOM   8193 O  OG1 . THR C 2 84  ? -12.461 14.106  12.539  1.00 74.54 ? 85  THR C OG1 1 
ATOM   8194 C  CG2 . THR C 2 84  ? -13.119 15.747  10.880  1.00 74.82 ? 85  THR C CG2 1 
ATOM   8195 N  N   . ASP C 2 85  ? -10.748 15.822  8.712   1.00 74.34 ? 86  ASP C N   1 
ATOM   8196 C  CA  . ASP C 2 85  ? -10.020 16.864  7.983   1.00 74.22 ? 86  ASP C CA  1 
ATOM   8197 C  C   . ASP C 2 85  ? -9.998  18.199  8.743   1.00 73.80 ? 86  ASP C C   1 
ATOM   8198 O  O   . ASP C 2 85  ? -9.501  19.206  8.230   1.00 73.79 ? 86  ASP C O   1 
ATOM   8199 C  CB  . ASP C 2 85  ? -10.585 17.042  6.565   1.00 74.38 ? 86  ASP C CB  1 
ATOM   8200 C  CG  . ASP C 2 85  ? -12.107 17.112  6.539   1.00 75.22 ? 86  ASP C CG  1 
ATOM   8201 O  OD1 . ASP C 2 85  ? -12.687 17.996  7.213   1.00 75.47 ? 86  ASP C OD1 1 
ATOM   8202 O  OD2 . ASP C 2 85  ? -12.723 16.281  5.834   1.00 75.87 ? 86  ASP C OD2 1 
ATOM   8203 N  N   . ARG C 2 86  ? -10.534 18.196  9.963   1.00 73.20 ? 87  ARG C N   1 
ATOM   8204 C  CA  . ARG C 2 86  ? -10.486 19.369  10.837  1.00 72.72 ? 87  ARG C CA  1 
ATOM   8205 C  C   . ARG C 2 86  ? -9.846  19.042  12.191  1.00 72.05 ? 87  ARG C C   1 
ATOM   8206 O  O   . ARG C 2 86  ? -10.048 19.756  13.178  1.00 72.06 ? 87  ARG C O   1 
ATOM   8207 C  CB  . ARG C 2 86  ? -11.890 19.979  11.023  1.00 72.88 ? 87  ARG C CB  1 
ATOM   8208 C  CG  . ARG C 2 86  ? -12.567 20.489  9.737   1.00 73.80 ? 87  ARG C CG  1 
ATOM   8209 C  CD  . ARG C 2 86  ? -11.704 21.504  8.973   1.00 75.46 ? 87  ARG C CD  1 
ATOM   8210 N  NE  . ARG C 2 86  ? -12.208 21.766  7.620   1.00 76.59 ? 87  ARG C NE  1 
ATOM   8211 C  CZ  . ARG C 2 86  ? -11.457 22.157  6.589   1.00 77.08 ? 87  ARG C CZ  1 
ATOM   8212 N  NH1 . ARG C 2 86  ? -10.146 22.328  6.727   1.00 77.01 ? 87  ARG C NH1 1 
ATOM   8213 N  NH2 . ARG C 2 86  ? -12.019 22.369  5.407   1.00 77.31 ? 87  ARG C NH2 1 
ATOM   8214 N  N   . SER C 2 87  ? -9.054  17.972  12.226  1.00 71.17 ? 88  SER C N   1 
ATOM   8215 C  CA  . SER C 2 87  ? -8.461  17.493  13.474  1.00 70.22 ? 88  SER C CA  1 
ATOM   8216 C  C   . SER C 2 87  ? -6.956  17.734  13.558  1.00 69.48 ? 88  SER C C   1 
ATOM   8217 O  O   . SER C 2 87  ? -6.260  17.716  12.543  1.00 69.30 ? 88  SER C O   1 
ATOM   8218 C  CB  . SER C 2 87  ? -8.770  16.011  13.664  1.00 70.35 ? 88  SER C CB  1 
ATOM   8219 O  OG  . SER C 2 87  ? -8.201  15.237  12.625  1.00 70.59 ? 88  SER C OG  1 
ATOM   8220 N  N   . ARG C 2 88  ? -6.472  17.967  14.778  1.00 68.61 ? 89  ARG C N   1 
ATOM   8221 C  CA  . ARG C 2 88  ? -5.053  18.225  15.044  1.00 67.86 ? 89  ARG C CA  1 
ATOM   8222 C  C   . ARG C 2 88  ? -4.612  17.582  16.364  1.00 67.37 ? 89  ARG C C   1 
ATOM   8223 O  O   . ARG C 2 88  ? -5.442  17.128  17.153  1.00 67.40 ? 89  ARG C O   1 
ATOM   8224 C  CB  . ARG C 2 88  ? -4.758  19.736  15.078  1.00 67.85 ? 89  ARG C CB  1 
ATOM   8225 C  CG  . ARG C 2 88  ? -4.908  20.478  13.748  1.00 67.64 ? 89  ARG C CG  1 
ATOM   8226 C  CD  . ARG C 2 88  ? -3.752  20.219  12.788  1.00 67.34 ? 89  ARG C CD  1 
ATOM   8227 N  NE  . ARG C 2 88  ? -2.480  20.725  13.307  1.00 67.98 ? 89  ARG C NE  1 
ATOM   8228 C  CZ  . ARG C 2 88  ? -1.974  21.929  13.047  1.00 67.75 ? 89  ARG C CZ  1 
ATOM   8229 N  NH1 . ARG C 2 88  ? -2.619  22.785  12.265  1.00 67.78 ? 89  ARG C NH1 1 
ATOM   8230 N  NH2 . ARG C 2 88  ? -0.811  22.277  13.575  1.00 67.66 ? 89  ARG C NH2 1 
ATOM   8231 N  N   . LEU C 2 89  ? -3.302  17.549  16.596  1.00 66.66 ? 90  LEU C N   1 
ATOM   8232 C  CA  . LEU C 2 89  ? -2.753  16.982  17.822  1.00 65.99 ? 90  LEU C CA  1 
ATOM   8233 C  C   . LEU C 2 89  ? -2.715  18.019  18.930  1.00 65.47 ? 90  LEU C C   1 
ATOM   8234 O  O   . LEU C 2 89  ? -2.082  19.068  18.789  1.00 65.34 ? 90  LEU C O   1 
ATOM   8235 C  CB  . LEU C 2 89  ? -1.356  16.394  17.584  1.00 65.96 ? 90  LEU C CB  1 
ATOM   8236 C  CG  . LEU C 2 89  ? -1.277  15.076  16.807  1.00 65.97 ? 90  LEU C CG  1 
ATOM   8237 C  CD1 . LEU C 2 89  ? 0.167   14.664  16.578  1.00 65.43 ? 90  LEU C CD1 1 
ATOM   8238 C  CD2 . LEU C 2 89  ? -2.053  13.958  17.502  1.00 65.84 ? 90  LEU C CD2 1 
ATOM   8239 N  N   . GLY C 2 90  ? -3.394  17.702  20.031  1.00 64.91 ? 91  GLY C N   1 
ATOM   8240 C  CA  . GLY C 2 90  ? -3.550  18.604  21.170  1.00 64.13 ? 91  GLY C CA  1 
ATOM   8241 C  C   . GLY C 2 90  ? -2.276  19.195  21.747  1.00 63.62 ? 91  GLY C C   1 
ATOM   8242 O  O   . GLY C 2 90  ? -2.276  20.348  22.185  1.00 63.72 ? 91  GLY C O   1 
ATOM   8243 N  N   . CYS C 2 91  ? -1.190  18.421  21.746  1.00 62.85 ? 92  CYS C N   1 
ATOM   8244 C  CA  . CYS C 2 91  ? 0.073   18.876  22.344  1.00 62.03 ? 92  CYS C CA  1 
ATOM   8245 C  C   . CYS C 2 91  ? 0.865   19.846  21.461  1.00 61.82 ? 92  CYS C C   1 
ATOM   8246 O  O   . CYS C 2 91  ? 1.909   20.351  21.873  1.00 61.66 ? 92  CYS C O   1 
ATOM   8247 C  CB  . CYS C 2 91  ? 0.948   17.684  22.773  1.00 62.16 ? 92  CYS C CB  1 
ATOM   8248 S  SG  . CYS C 2 91  ? 1.689   16.687  21.433  1.00 60.10 ? 92  CYS C SG  1 
ATOM   8249 N  N   . GLN C 2 92  ? 0.354   20.110  20.262  1.00 61.68 ? 93  GLN C N   1 
ATOM   8250 C  CA  . GLN C 2 92  ? 1.019   20.984  19.297  1.00 61.75 ? 93  GLN C CA  1 
ATOM   8251 C  C   . GLN C 2 92  ? 0.242   22.284  19.054  1.00 62.32 ? 93  GLN C C   1 
ATOM   8252 O  O   . GLN C 2 92  ? 0.582   23.070  18.165  1.00 62.08 ? 93  GLN C O   1 
ATOM   8253 C  CB  . GLN C 2 92  ? 1.251   20.234  17.976  1.00 61.45 ? 93  GLN C CB  1 
ATOM   8254 C  CG  . GLN C 2 92  ? 2.150   18.998  18.105  1.00 60.14 ? 93  GLN C CG  1 
ATOM   8255 C  CD  . GLN C 2 92  ? 3.509   19.315  18.709  1.00 57.88 ? 93  GLN C CD  1 
ATOM   8256 O  OE1 . GLN C 2 92  ? 4.314   20.024  18.112  1.00 57.80 ? 93  GLN C OE1 1 
ATOM   8257 N  NE2 . GLN C 2 92  ? 3.767   18.786  19.897  1.00 56.92 ? 93  GLN C NE2 1 
ATOM   8258 N  N   . ILE C 2 93  ? -0.797  22.501  19.860  1.00 63.01 ? 94  ILE C N   1 
ATOM   8259 C  CA  . ILE C 2 93  ? -1.653  23.680  19.747  1.00 63.58 ? 94  ILE C CA  1 
ATOM   8260 C  C   . ILE C 2 93  ? -1.461  24.599  20.957  1.00 64.10 ? 94  ILE C C   1 
ATOM   8261 O  O   . ILE C 2 93  ? -1.774  24.220  22.091  1.00 64.20 ? 94  ILE C O   1 
ATOM   8262 C  CB  . ILE C 2 93  ? -3.152  23.281  19.603  1.00 63.56 ? 94  ILE C CB  1 
ATOM   8263 C  CG1 . ILE C 2 93  ? -3.380  22.377  18.374  1.00 63.28 ? 94  ILE C CG1 1 
ATOM   8264 C  CG2 . ILE C 2 93  ? -4.049  24.516  19.585  1.00 63.62 ? 94  ILE C CG2 1 
ATOM   8265 C  CD1 . ILE C 2 93  ? -2.901  22.943  17.029  1.00 62.85 ? 94  ILE C CD1 1 
ATOM   8266 N  N   . CYS C 2 94  ? -0.943  25.800  20.705  1.00 64.62 ? 95  CYS C N   1 
ATOM   8267 C  CA  . CYS C 2 94  ? -0.686  26.784  21.761  1.00 65.31 ? 95  CYS C CA  1 
ATOM   8268 C  C   . CYS C 2 94  ? -1.936  27.605  22.084  1.00 65.29 ? 95  CYS C C   1 
ATOM   8269 O  O   . CYS C 2 94  ? -2.672  28.016  21.180  1.00 65.44 ? 95  CYS C O   1 
ATOM   8270 C  CB  . CYS C 2 94  ? 0.465   27.711  21.359  1.00 65.29 ? 95  CYS C CB  1 
ATOM   8271 S  SG  . CYS C 2 94  ? 2.012   26.851  20.943  1.00 67.17 ? 95  CYS C SG  1 
ATOM   8272 N  N   . SER D 2 27  ? 75.647  -25.072 -36.040 1.00 89.91 ? 28  SER D N   1 
ATOM   8273 C  CA  . SER D 2 27  ? 74.897  -23.976 -36.722 1.00 89.88 ? 28  SER D CA  1 
ATOM   8274 C  C   . SER D 2 27  ? 75.760  -23.217 -37.729 1.00 89.83 ? 28  SER D C   1 
ATOM   8275 O  O   . SER D 2 27  ? 76.976  -23.105 -37.558 1.00 89.75 ? 28  SER D O   1 
ATOM   8276 C  CB  . SER D 2 27  ? 74.300  -23.015 -35.693 1.00 89.93 ? 28  SER D CB  1 
ATOM   8277 O  OG  . SER D 2 27  ? 73.334  -23.679 -34.894 1.00 89.98 ? 28  SER D OG  1 
ATOM   8278 N  N   . LEU D 2 28  ? 75.111  -22.690 -38.767 1.00 89.78 ? 29  LEU D N   1 
ATOM   8279 C  CA  . LEU D 2 28  ? 75.788  -21.998 -39.873 1.00 89.80 ? 29  LEU D CA  1 
ATOM   8280 C  C   . LEU D 2 28  ? 76.556  -20.737 -39.474 1.00 89.88 ? 29  LEU D C   1 
ATOM   8281 O  O   . LEU D 2 28  ? 77.412  -20.264 -40.225 1.00 89.86 ? 29  LEU D O   1 
ATOM   8282 C  CB  . LEU D 2 28  ? 74.793  -21.680 -40.991 1.00 89.76 ? 29  LEU D CB  1 
ATOM   8283 C  CG  . LEU D 2 28  ? 74.389  -22.853 -41.886 1.00 89.67 ? 29  LEU D CG  1 
ATOM   8284 C  CD1 . LEU D 2 28  ? 73.169  -22.495 -42.709 1.00 89.51 ? 29  LEU D CD1 1 
ATOM   8285 C  CD2 . LEU D 2 28  ? 75.542  -23.274 -42.789 1.00 89.51 ? 29  LEU D CD2 1 
ATOM   8286 N  N   . LEU D 2 29  ? 76.239  -20.194 -38.302 1.00 90.01 ? 30  LEU D N   1 
ATOM   8287 C  CA  . LEU D 2 29  ? 77.007  -19.096 -37.725 1.00 90.14 ? 30  LEU D CA  1 
ATOM   8288 C  C   . LEU D 2 29  ? 78.356  -19.611 -37.227 1.00 90.19 ? 30  LEU D C   1 
ATOM   8289 O  O   . LEU D 2 29  ? 79.386  -18.978 -37.462 1.00 90.16 ? 30  LEU D O   1 
ATOM   8290 C  CB  . LEU D 2 29  ? 76.222  -18.422 -36.588 1.00 90.13 ? 30  LEU D CB  1 
ATOM   8291 C  CG  . LEU D 2 29  ? 76.893  -17.324 -35.752 1.00 90.14 ? 30  LEU D CG  1 
ATOM   8292 C  CD1 . LEU D 2 29  ? 75.898  -16.229 -35.432 1.00 90.22 ? 30  LEU D CD1 1 
ATOM   8293 C  CD2 . LEU D 2 29  ? 77.525  -17.874 -34.467 1.00 89.97 ? 30  LEU D CD2 1 
ATOM   8294 N  N   . ASP D 2 30  ? 78.335  -20.762 -36.550 1.00 90.35 ? 31  ASP D N   1 
ATOM   8295 C  CA  . ASP D 2 30  ? 79.541  -21.388 -35.991 1.00 90.51 ? 31  ASP D CA  1 
ATOM   8296 C  C   . ASP D 2 30  ? 80.560  -21.779 -37.067 1.00 90.50 ? 31  ASP D C   1 
ATOM   8297 O  O   . ASP D 2 30  ? 81.744  -21.959 -36.774 1.00 90.45 ? 31  ASP D O   1 
ATOM   8298 C  CB  . ASP D 2 30  ? 79.177  -22.607 -35.131 1.00 90.54 ? 31  ASP D CB  1 
ATOM   8299 C  CG  . ASP D 2 30  ? 78.434  -22.231 -33.855 1.00 90.70 ? 31  ASP D CG  1 
ATOM   8300 O  OD1 . ASP D 2 30  ? 77.442  -22.915 -33.525 1.00 90.85 ? 31  ASP D OD1 1 
ATOM   8301 O  OD2 . ASP D 2 30  ? 78.839  -21.258 -33.180 1.00 90.90 ? 31  ASP D OD2 1 
ATOM   8302 N  N   . VAL D 2 31  ? 80.081  -21.910 -38.303 1.00 90.60 ? 32  VAL D N   1 
ATOM   8303 C  CA  . VAL D 2 31  ? 80.931  -22.117 -39.476 1.00 90.68 ? 32  VAL D CA  1 
ATOM   8304 C  C   . VAL D 2 31  ? 81.858  -20.911 -39.670 1.00 90.71 ? 32  VAL D C   1 
ATOM   8305 O  O   . VAL D 2 31  ? 83.071  -21.065 -39.830 1.00 90.71 ? 32  VAL D O   1 
ATOM   8306 C  CB  . VAL D 2 31  ? 80.074  -22.343 -40.758 1.00 90.71 ? 32  VAL D CB  1 
ATOM   8307 C  CG1 . VAL D 2 31  ? 80.951  -22.452 -42.005 1.00 90.70 ? 32  VAL D CG1 1 
ATOM   8308 C  CG2 . VAL D 2 31  ? 79.192  -23.581 -40.610 1.00 90.59 ? 32  VAL D CG2 1 
ATOM   8309 N  N   . VAL D 2 32  ? 81.272  -19.716 -39.624 1.00 90.71 ? 33  VAL D N   1 
ATOM   8310 C  CA  . VAL D 2 32  ? 81.987  -18.461 -39.859 1.00 90.72 ? 33  VAL D CA  1 
ATOM   8311 C  C   . VAL D 2 32  ? 82.907  -18.074 -38.679 1.00 90.74 ? 33  VAL D C   1 
ATOM   8312 O  O   . VAL D 2 32  ? 83.672  -17.108 -38.768 1.00 90.77 ? 33  VAL D O   1 
ATOM   8313 C  CB  . VAL D 2 32  ? 80.982  -17.313 -40.200 1.00 90.73 ? 33  VAL D CB  1 
ATOM   8314 C  CG1 . VAL D 2 32  ? 81.695  -16.102 -40.793 1.00 90.73 ? 33  VAL D CG1 1 
ATOM   8315 C  CG2 . VAL D 2 32  ? 79.908  -17.804 -41.170 1.00 90.57 ? 33  VAL D CG2 1 
ATOM   8316 N  N   . VAL D 2 33  ? 82.848  -18.847 -37.594 1.00 90.78 ? 34  VAL D N   1 
ATOM   8317 C  CA  . VAL D 2 33  ? 83.603  -18.553 -36.365 1.00 90.86 ? 34  VAL D CA  1 
ATOM   8318 C  C   . VAL D 2 33  ? 85.126  -18.691 -36.523 1.00 90.82 ? 34  VAL D C   1 
ATOM   8319 O  O   . VAL D 2 33  ? 85.865  -17.746 -36.231 1.00 90.87 ? 34  VAL D O   1 
ATOM   8320 C  CB  . VAL D 2 33  ? 83.063  -19.368 -35.141 1.00 90.94 ? 34  VAL D CB  1 
ATOM   8321 C  CG1 . VAL D 2 33  ? 84.111  -19.498 -34.027 1.00 90.95 ? 34  VAL D CG1 1 
ATOM   8322 C  CG2 . VAL D 2 33  ? 81.781  -18.731 -34.603 1.00 91.00 ? 34  VAL D CG2 1 
ATOM   8323 N  N   . GLU D 2 34  ? 85.590  -19.854 -36.980 1.00 90.73 ? 35  GLU D N   1 
ATOM   8324 C  CA  . GLU D 2 34  ? 87.025  -20.066 -37.214 1.00 90.57 ? 35  GLU D CA  1 
ATOM   8325 C  C   . GLU D 2 34  ? 87.441  -19.701 -38.644 1.00 90.32 ? 35  GLU D C   1 
ATOM   8326 O  O   . GLU D 2 34  ? 88.579  -19.280 -38.875 1.00 90.26 ? 35  GLU D O   1 
ATOM   8327 C  CB  . GLU D 2 34  ? 87.455  -21.499 -36.854 1.00 90.69 ? 35  GLU D CB  1 
ATOM   8328 C  CG  . GLU D 2 34  ? 87.003  -22.601 -37.824 1.00 91.14 ? 35  GLU D CG  1 
ATOM   8329 C  CD  . GLU D 2 34  ? 85.511  -22.905 -37.751 1.00 91.85 ? 35  GLU D CD  1 
ATOM   8330 O  OE1 . GLU D 2 34  ? 84.871  -22.583 -36.723 1.00 91.92 ? 35  GLU D OE1 1 
ATOM   8331 O  OE2 . GLU D 2 34  ? 84.980  -23.476 -38.729 1.00 92.11 ? 35  GLU D OE2 1 
ATOM   8332 N  N   . ASN D 2 35  ? 86.511  -19.858 -39.588 1.00 89.96 ? 36  ASN D N   1 
ATOM   8333 C  CA  . ASN D 2 35  ? 86.745  -19.522 -40.996 1.00 89.56 ? 36  ASN D CA  1 
ATOM   8334 C  C   . ASN D 2 35  ? 87.022  -18.036 -41.217 1.00 89.25 ? 36  ASN D C   1 
ATOM   8335 O  O   . ASN D 2 35  ? 87.738  -17.670 -42.153 1.00 89.26 ? 36  ASN D O   1 
ATOM   8336 C  CB  . ASN D 2 35  ? 85.565  -19.971 -41.868 1.00 89.54 ? 36  ASN D CB  1 
ATOM   8337 C  CG  . ASN D 2 35  ? 85.392  -21.483 -41.897 1.00 89.55 ? 36  ASN D CG  1 
ATOM   8338 O  OD1 . ASN D 2 35  ? 86.044  -22.216 -41.152 1.00 89.73 ? 36  ASN D OD1 1 
ATOM   8339 N  ND2 . ASN D 2 35  ? 84.501  -21.955 -42.760 1.00 89.53 ? 36  ASN D ND2 1 
ATOM   8340 N  N   . ASN D 2 36  ? 86.456  -17.196 -40.347 1.00 88.79 ? 37  ASN D N   1 
ATOM   8341 C  CA  . ASN D 2 36  ? 86.609  -15.736 -40.412 1.00 88.36 ? 37  ASN D CA  1 
ATOM   8342 C  C   . ASN D 2 36  ? 86.260  -15.163 -41.789 1.00 87.97 ? 37  ASN D C   1 
ATOM   8343 O  O   . ASN D 2 36  ? 86.966  -14.295 -42.310 1.00 88.01 ? 37  ASN D O   1 
ATOM   8344 C  CB  . ASN D 2 36  ? 88.024  -15.304 -39.980 1.00 88.42 ? 37  ASN D CB  1 
ATOM   8345 C  CG  . ASN D 2 36  ? 88.231  -15.368 -38.470 1.00 88.42 ? 37  ASN D CG  1 
ATOM   8346 O  OD1 . ASN D 2 36  ? 88.308  -14.335 -37.804 1.00 88.52 ? 37  ASN D OD1 1 
ATOM   8347 N  ND2 . ASN D 2 36  ? 88.331  -16.580 -37.928 1.00 88.13 ? 37  ASN D ND2 1 
ATOM   8348 N  N   . LEU D 2 37  ? 85.162  -15.655 -42.365 1.00 87.43 ? 38  LEU D N   1 
ATOM   8349 C  CA  . LEU D 2 37  ? 84.746  -15.287 -43.723 1.00 86.88 ? 38  LEU D CA  1 
ATOM   8350 C  C   . LEU D 2 37  ? 84.518  -13.777 -43.893 1.00 86.45 ? 38  LEU D C   1 
ATOM   8351 O  O   . LEU D 2 37  ? 84.121  -13.088 -42.949 1.00 86.41 ? 38  LEU D O   1 
ATOM   8352 C  CB  . LEU D 2 37  ? 83.505  -16.089 -44.152 1.00 86.95 ? 38  LEU D CB  1 
ATOM   8353 C  CG  . LEU D 2 37  ? 83.563  -17.627 -44.124 1.00 86.91 ? 38  LEU D CG  1 
ATOM   8354 C  CD1 . LEU D 2 37  ? 82.187  -18.229 -44.390 1.00 86.75 ? 38  LEU D CD1 1 
ATOM   8355 C  CD2 . LEU D 2 37  ? 84.589  -18.190 -45.109 1.00 87.05 ? 38  LEU D CD2 1 
ATOM   8356 N  N   . ASP D 2 38  ? 84.775  -13.290 -45.110 1.00 85.84 ? 39  ASP D N   1 
ATOM   8357 C  CA  . ASP D 2 38  ? 84.823  -11.854 -45.437 1.00 85.18 ? 39  ASP D CA  1 
ATOM   8358 C  C   . ASP D 2 38  ? 83.619  -11.006 -45.019 1.00 84.49 ? 39  ASP D C   1 
ATOM   8359 O  O   . ASP D 2 38  ? 83.782  -9.821  -44.711 1.00 84.46 ? 39  ASP D O   1 
ATOM   8360 C  CB  . ASP D 2 38  ? 85.073  -11.656 -46.942 1.00 85.33 ? 39  ASP D CB  1 
ATOM   8361 C  CG  . ASP D 2 38  ? 86.550  -11.520 -47.284 1.00 85.75 ? 39  ASP D CG  1 
ATOM   8362 O  OD1 . ASP D 2 38  ? 86.931  -10.482 -47.873 1.00 86.02 ? 39  ASP D OD1 1 
ATOM   8363 O  OD2 . ASP D 2 38  ? 87.330  -12.446 -46.969 1.00 86.22 ? 39  ASP D OD2 1 
ATOM   8364 N  N   . ILE D 2 39  ? 82.427  -11.610 -45.019 1.00 83.55 ? 40  ILE D N   1 
ATOM   8365 C  CA  . ILE D 2 39  ? 81.164  -10.885 -44.798 1.00 82.51 ? 40  ILE D CA  1 
ATOM   8366 C  C   . ILE D 2 39  ? 81.265  -9.826  -43.692 1.00 81.66 ? 40  ILE D C   1 
ATOM   8367 O  O   . ILE D 2 39  ? 81.526  -10.146 -42.526 1.00 81.63 ? 40  ILE D O   1 
ATOM   8368 C  CB  . ILE D 2 39  ? 79.954  -11.842 -44.524 1.00 82.56 ? 40  ILE D CB  1 
ATOM   8369 C  CG1 . ILE D 2 39  ? 79.725  -12.803 -45.694 1.00 82.43 ? 40  ILE D CG1 1 
ATOM   8370 C  CG2 . ILE D 2 39  ? 78.673  -11.051 -44.269 1.00 82.66 ? 40  ILE D CG2 1 
ATOM   8371 C  CD1 . ILE D 2 39  ? 80.270  -14.199 -45.466 1.00 82.55 ? 40  ILE D CD1 1 
ATOM   8372 N  N   . ASP D 2 40  ? 81.080  -8.566  -44.090 1.00 80.46 ? 41  ASP D N   1 
ATOM   8373 C  CA  . ASP D 2 40  ? 81.006  -7.443  -43.160 1.00 79.22 ? 41  ASP D CA  1 
ATOM   8374 C  C   . ASP D 2 40  ? 79.797  -7.613  -42.239 1.00 78.13 ? 41  ASP D C   1 
ATOM   8375 O  O   . ASP D 2 40  ? 78.647  -7.615  -42.697 1.00 77.98 ? 41  ASP D O   1 
ATOM   8376 C  CB  . ASP D 2 40  ? 80.924  -6.112  -43.924 1.00 79.37 ? 41  ASP D CB  1 
ATOM   8377 C  CG  . ASP D 2 40  ? 82.290  -5.476  -44.153 1.00 79.75 ? 41  ASP D CG  1 
ATOM   8378 O  OD1 . ASP D 2 40  ? 82.834  -5.596  -45.273 1.00 80.11 ? 41  ASP D OD1 1 
ATOM   8379 O  OD2 . ASP D 2 40  ? 82.823  -4.852  -43.211 1.00 80.12 ? 41  ASP D OD2 1 
ATOM   8380 N  N   . GLY D 2 41  ? 80.077  -7.785  -40.948 1.00 76.75 ? 42  GLY D N   1 
ATOM   8381 C  CA  . GLY D 2 41  ? 79.042  -7.907  -39.919 1.00 74.88 ? 42  GLY D CA  1 
ATOM   8382 C  C   . GLY D 2 41  ? 78.094  -9.079  -40.104 1.00 73.46 ? 42  GLY D C   1 
ATOM   8383 O  O   . GLY D 2 41  ? 76.930  -8.895  -40.468 1.00 73.48 ? 42  GLY D O   1 
ATOM   8384 N  N   . PHE D 2 42  ? 78.597  -10.286 -39.864 1.00 71.88 ? 43  PHE D N   1 
ATOM   8385 C  CA  . PHE D 2 42  ? 77.758  -11.480 -39.872 1.00 70.18 ? 43  PHE D CA  1 
ATOM   8386 C  C   . PHE D 2 42  ? 77.598  -11.988 -38.447 1.00 69.21 ? 43  PHE D C   1 
ATOM   8387 O  O   . PHE D 2 42  ? 78.587  -12.147 -37.722 1.00 69.12 ? 43  PHE D O   1 
ATOM   8388 C  CB  . PHE D 2 42  ? 78.355  -12.574 -40.767 1.00 70.15 ? 43  PHE D CB  1 
ATOM   8389 C  CG  . PHE D 2 42  ? 77.434  -13.754 -40.993 1.00 69.13 ? 43  PHE D CG  1 
ATOM   8390 C  CD1 . PHE D 2 42  ? 77.479  -14.866 -40.150 1.00 68.06 ? 43  PHE D CD1 1 
ATOM   8391 C  CD2 . PHE D 2 42  ? 76.532  -13.756 -42.054 1.00 68.04 ? 43  PHE D CD2 1 
ATOM   8392 C  CE1 . PHE D 2 42  ? 76.633  -15.957 -40.356 1.00 67.61 ? 43  PHE D CE1 1 
ATOM   8393 C  CE2 . PHE D 2 42  ? 75.682  -14.844 -42.271 1.00 67.59 ? 43  PHE D CE2 1 
ATOM   8394 C  CZ  . PHE D 2 42  ? 75.734  -15.946 -41.419 1.00 67.37 ? 43  PHE D CZ  1 
ATOM   8395 N  N   . GLY D 2 43  ? 76.350  -12.233 -38.053 1.00 67.90 ? 44  GLY D N   1 
ATOM   8396 C  CA  . GLY D 2 43  ? 76.036  -12.740 -36.717 1.00 66.23 ? 44  GLY D CA  1 
ATOM   8397 C  C   . GLY D 2 43  ? 76.321  -11.730 -35.623 1.00 65.07 ? 44  GLY D C   1 
ATOM   8398 O  O   . GLY D 2 43  ? 76.929  -12.061 -34.599 1.00 64.89 ? 44  GLY D O   1 
ATOM   8399 N  N   . ALA D 2 44  ? 75.868  -10.497 -35.843 1.00 63.80 ? 45  ALA D N   1 
ATOM   8400 C  CA  . ALA D 2 44  ? 76.181  -9.377  -34.957 1.00 62.65 ? 45  ALA D CA  1 
ATOM   8401 C  C   . ALA D 2 44  ? 75.728  -9.574  -33.503 1.00 61.80 ? 45  ALA D C   1 
ATOM   8402 O  O   . ALA D 2 44  ? 76.427  -9.162  -32.576 1.00 61.78 ? 45  ALA D O   1 
ATOM   8403 C  CB  . ALA D 2 44  ? 75.632  -8.084  -35.532 1.00 62.53 ? 45  ALA D CB  1 
ATOM   8404 N  N   . CYS D 2 45  ? 74.581  -10.227 -33.309 1.00 60.83 ? 46  CYS D N   1 
ATOM   8405 C  CA  . CYS D 2 45  ? 74.056  -10.492 -31.962 1.00 59.88 ? 46  CYS D CA  1 
ATOM   8406 C  C   . CYS D 2 45  ? 74.652  -11.757 -31.325 1.00 59.29 ? 46  CYS D C   1 
ATOM   8407 O  O   . CYS D 2 45  ? 74.273  -12.133 -30.212 1.00 59.16 ? 46  CYS D O   1 
ATOM   8408 C  CB  . CYS D 2 45  ? 72.524  -10.573 -31.986 1.00 59.87 ? 46  CYS D CB  1 
ATOM   8409 S  SG  . CYS D 2 45  ? 71.876  -12.184 -32.488 1.00 59.31 ? 46  CYS D SG  1 
ATOM   8410 N  N   . GLU D 2 46  ? 75.585  -12.391 -32.038 1.00 58.63 ? 47  GLU D N   1 
ATOM   8411 C  CA  . GLU D 2 46  ? 76.268  -13.620 -31.600 1.00 57.88 ? 47  GLU D CA  1 
ATOM   8412 C  C   . GLU D 2 46  ? 75.333  -14.831 -31.460 1.00 57.29 ? 47  GLU D C   1 
ATOM   8413 O  O   . GLU D 2 46  ? 75.451  -15.620 -30.520 1.00 57.11 ? 47  GLU D O   1 
ATOM   8414 C  CB  . GLU D 2 46  ? 77.109  -13.375 -30.338 1.00 57.97 ? 47  GLU D CB  1 
ATOM   8415 C  CG  . GLU D 2 46  ? 78.611  -13.336 -30.601 1.00 58.48 ? 47  GLU D CG  1 
ATOM   8416 C  CD  . GLU D 2 46  ? 79.304  -12.146 -29.959 1.00 58.89 ? 47  GLU D CD  1 
ATOM   8417 O  OE1 . GLU D 2 46  ? 79.819  -12.282 -28.829 1.00 59.05 ? 47  GLU D OE1 1 
ATOM   8418 O  OE2 . GLU D 2 46  ? 79.335  -11.070 -30.591 1.00 59.38 ? 47  GLU D OE2 1 
ATOM   8419 N  N   . GLY D 2 47  ? 74.404  -14.952 -32.409 1.00 56.63 ? 48  GLY D N   1 
ATOM   8420 C  CA  . GLY D 2 47  ? 73.526  -16.117 -32.523 1.00 56.25 ? 48  GLY D CA  1 
ATOM   8421 C  C   . GLY D 2 47  ? 72.396  -16.271 -31.520 1.00 56.00 ? 48  GLY D C   1 
ATOM   8422 O  O   . GLY D 2 47  ? 71.996  -17.395 -31.214 1.00 55.93 ? 48  GLY D O   1 
ATOM   8423 N  N   . THR D 2 48  ? 71.860  -15.156 -31.024 1.00 55.62 ? 49  THR D N   1 
ATOM   8424 C  CA  . THR D 2 48  ? 70.796  -15.200 -30.015 1.00 55.13 ? 49  THR D CA  1 
ATOM   8425 C  C   . THR D 2 48  ? 69.410  -14.890 -30.594 1.00 55.26 ? 49  THR D C   1 
ATOM   8426 O  O   . THR D 2 48  ? 68.454  -14.664 -29.844 1.00 55.19 ? 49  THR D O   1 
ATOM   8427 C  CB  . THR D 2 48  ? 71.095  -14.252 -28.826 1.00 55.11 ? 49  THR D CB  1 
ATOM   8428 O  OG1 . THR D 2 48  ? 71.250  -12.911 -29.309 1.00 54.37 ? 49  THR D OG1 1 
ATOM   8429 C  CG2 . THR D 2 48  ? 72.362  -14.679 -28.084 1.00 54.19 ? 49  THR D CG2 1 
ATOM   8430 N  N   . LEU D 2 49  ? 69.305  -14.896 -31.923 1.00 55.34 ? 50  LEU D N   1 
ATOM   8431 C  CA  . LEU D 2 49  ? 68.064  -14.545 -32.633 1.00 55.78 ? 50  LEU D CA  1 
ATOM   8432 C  C   . LEU D 2 49  ? 67.582  -13.131 -32.244 1.00 56.19 ? 50  LEU D C   1 
ATOM   8433 O  O   . LEU D 2 49  ? 66.394  -12.902 -31.992 1.00 56.04 ? 50  LEU D O   1 
ATOM   8434 C  CB  . LEU D 2 49  ? 66.985  -15.635 -32.433 1.00 55.55 ? 50  LEU D CB  1 
ATOM   8435 C  CG  . LEU D 2 49  ? 65.585  -15.595 -33.074 1.00 55.40 ? 50  LEU D CG  1 
ATOM   8436 C  CD1 . LEU D 2 49  ? 65.592  -15.118 -34.518 1.00 54.89 ? 50  LEU D CD1 1 
ATOM   8437 C  CD2 . LEU D 2 49  ? 64.899  -16.952 -32.964 1.00 55.25 ? 50  LEU D CD2 1 
ATOM   8438 N  N   . ALA D 2 50  ? 68.533  -12.195 -32.213 1.00 56.72 ? 51  ALA D N   1 
ATOM   8439 C  CA  . ALA D 2 50  ? 68.303  -10.828 -31.736 1.00 57.40 ? 51  ALA D CA  1 
ATOM   8440 C  C   . ALA D 2 50  ? 68.790  -9.770  -32.735 1.00 58.04 ? 51  ALA D C   1 
ATOM   8441 O  O   . ALA D 2 50  ? 68.866  -8.583  -32.412 1.00 58.02 ? 51  ALA D O   1 
ATOM   8442 C  CB  . ALA D 2 50  ? 68.960  -10.631 -30.375 1.00 57.10 ? 51  ALA D CB  1 
ATOM   8443 N  N   . CYS D 2 51  ? 69.139  -10.223 -33.938 1.00 58.85 ? 52  CYS D N   1 
ATOM   8444 C  CA  . CYS D 2 51  ? 69.390  -9.356  -35.096 1.00 59.55 ? 52  CYS D CA  1 
ATOM   8445 C  C   . CYS D 2 51  ? 68.885  -10.101 -36.333 1.00 60.34 ? 52  CYS D C   1 
ATOM   8446 O  O   . CYS D 2 51  ? 68.042  -10.996 -36.213 1.00 60.66 ? 52  CYS D O   1 
ATOM   8447 C  CB  . CYS D 2 51  ? 70.878  -8.985  -35.215 1.00 59.52 ? 52  CYS D CB  1 
ATOM   8448 S  SG  . CYS D 2 51  ? 72.029  -10.309 -35.732 1.00 58.34 ? 52  CYS D SG  1 
ATOM   8449 N  N   . SER D 2 52  ? 69.370  -9.735  -37.515 1.00 61.05 ? 53  SER D N   1 
ATOM   8450 C  CA  . SER D 2 52  ? 69.092  -10.524 -38.721 1.00 61.68 ? 53  SER D CA  1 
ATOM   8451 C  C   . SER D 2 52  ? 70.281  -10.515 -39.691 1.00 62.31 ? 53  SER D C   1 
ATOM   8452 O  O   . SER D 2 52  ? 70.117  -10.685 -40.902 1.00 62.25 ? 53  SER D O   1 
ATOM   8453 C  CB  . SER D 2 52  ? 67.797  -10.065 -39.400 1.00 61.41 ? 53  SER D CB  1 
ATOM   8454 O  OG  . SER D 2 52  ? 67.852  -8.693  -39.733 1.00 61.14 ? 53  SER D OG  1 
ATOM   8455 N  N   . THR D 2 53  ? 71.479  -10.332 -39.134 1.00 63.15 ? 54  THR D N   1 
ATOM   8456 C  CA  . THR D 2 53  ? 72.708  -10.226 -39.924 1.00 63.96 ? 54  THR D CA  1 
ATOM   8457 C  C   . THR D 2 53  ? 73.209  -11.595 -40.403 1.00 64.81 ? 54  THR D C   1 
ATOM   8458 O  O   . THR D 2 53  ? 74.080  -11.677 -41.275 1.00 64.72 ? 54  THR D O   1 
ATOM   8459 C  CB  . THR D 2 53  ? 73.826  -9.490  -39.145 1.00 63.81 ? 54  THR D CB  1 
ATOM   8460 O  OG1 . THR D 2 53  ? 74.128  -10.197 -37.936 1.00 63.45 ? 54  THR D OG1 1 
ATOM   8461 C  CG2 . THR D 2 53  ? 73.401  -8.064  -38.803 1.00 63.82 ? 54  THR D CG2 1 
ATOM   8462 N  N   . CYS D 2 54  ? 72.645  -12.660 -39.833 1.00 65.85 ? 55  CYS D N   1 
ATOM   8463 C  CA  . CYS D 2 54  ? 72.984  -14.032 -40.210 1.00 66.97 ? 55  CYS D CA  1 
ATOM   8464 C  C   . CYS D 2 54  ? 72.091  -14.569 -41.336 1.00 67.98 ? 55  CYS D C   1 
ATOM   8465 O  O   . CYS D 2 54  ? 72.050  -15.779 -41.581 1.00 68.06 ? 55  CYS D O   1 
ATOM   8466 C  CB  . CYS D 2 54  ? 72.895  -14.948 -38.992 1.00 66.87 ? 55  CYS D CB  1 
ATOM   8467 S  SG  . CYS D 2 54  ? 71.199  -15.175 -38.397 1.00 66.25 ? 55  CYS D SG  1 
ATOM   8468 N  N   . HIS D 2 55  ? 71.385  -13.663 -42.012 1.00 69.30 ? 56  HIS D N   1 
ATOM   8469 C  CA  . HIS D 2 55  ? 70.473  -14.006 -43.103 1.00 70.72 ? 56  HIS D CA  1 
ATOM   8470 C  C   . HIS D 2 55  ? 71.204  -14.721 -44.244 1.00 71.96 ? 56  HIS D C   1 
ATOM   8471 O  O   . HIS D 2 55  ? 72.250  -14.261 -44.707 1.00 72.01 ? 56  HIS D O   1 
ATOM   8472 C  CB  . HIS D 2 55  ? 69.769  -12.736 -43.602 1.00 70.52 ? 56  HIS D CB  1 
ATOM   8473 C  CG  . HIS D 2 55  ? 68.809  -12.963 -44.730 1.00 70.41 ? 56  HIS D CG  1 
ATOM   8474 N  ND1 . HIS D 2 55  ? 68.528  -11.992 -45.668 1.00 70.33 ? 56  HIS D ND1 1 
ATOM   8475 C  CD2 . HIS D 2 55  ? 68.061  -14.040 -45.070 1.00 70.32 ? 56  HIS D CD2 1 
ATOM   8476 C  CE1 . HIS D 2 55  ? 67.648  -12.459 -46.535 1.00 70.17 ? 56  HIS D CE1 1 
ATOM   8477 N  NE2 . HIS D 2 55  ? 67.352  -13.702 -46.198 1.00 70.52 ? 56  HIS D NE2 1 
ATOM   8478 N  N   . LEU D 2 56  ? 70.651  -15.854 -44.674 1.00 73.54 ? 57  LEU D N   1 
ATOM   8479 C  CA  . LEU D 2 56  ? 71.253  -16.674 -45.729 1.00 75.07 ? 57  LEU D CA  1 
ATOM   8480 C  C   . LEU D 2 56  ? 70.210  -17.222 -46.701 1.00 76.35 ? 57  LEU D C   1 
ATOM   8481 O  O   . LEU D 2 56  ? 69.080  -17.536 -46.306 1.00 76.52 ? 57  LEU D O   1 
ATOM   8482 C  CB  . LEU D 2 56  ? 72.080  -17.820 -45.129 1.00 74.88 ? 57  LEU D CB  1 
ATOM   8483 C  CG  . LEU D 2 56  ? 73.443  -17.476 -44.514 1.00 74.72 ? 57  LEU D CG  1 
ATOM   8484 C  CD1 . LEU D 2 56  ? 73.952  -18.620 -43.651 1.00 74.47 ? 57  LEU D CD1 1 
ATOM   8485 C  CD2 . LEU D 2 56  ? 74.469  -17.110 -45.584 1.00 74.51 ? 57  LEU D CD2 1 
ATOM   8486 N  N   . ILE D 2 57  ? 70.607  -17.338 -47.968 1.00 77.91 ? 58  ILE D N   1 
ATOM   8487 C  CA  . ILE D 2 57  ? 69.712  -17.774 -49.042 1.00 79.44 ? 58  ILE D CA  1 
ATOM   8488 C  C   . ILE D 2 57  ? 69.967  -19.236 -49.445 1.00 80.46 ? 58  ILE D C   1 
ATOM   8489 O  O   . ILE D 2 57  ? 71.028  -19.571 -49.986 1.00 80.62 ? 58  ILE D O   1 
ATOM   8490 C  CB  . ILE D 2 57  ? 69.811  -16.834 -50.278 1.00 79.47 ? 58  ILE D CB  1 
ATOM   8491 C  CG1 . ILE D 2 57  ? 69.534  -15.380 -49.869 1.00 79.83 ? 58  ILE D CG1 1 
ATOM   8492 C  CG2 . ILE D 2 57  ? 68.851  -17.291 -51.386 1.00 79.58 ? 58  ILE D CG2 1 
ATOM   8493 C  CD1 . ILE D 2 57  ? 70.069  -14.331 -50.842 1.00 80.64 ? 58  ILE D CD1 1 
ATOM   8494 N  N   . PHE D 2 58  ? 68.982  -20.091 -49.167 1.00 81.67 ? 59  PHE D N   1 
ATOM   8495 C  CA  . PHE D 2 58  ? 69.036  -21.518 -49.508 1.00 82.86 ? 59  PHE D CA  1 
ATOM   8496 C  C   . PHE D 2 58  ? 68.336  -21.767 -50.845 1.00 83.60 ? 59  PHE D C   1 
ATOM   8497 O  O   . PHE D 2 58  ? 67.484  -20.971 -51.256 1.00 83.87 ? 59  PHE D O   1 
ATOM   8498 C  CB  . PHE D 2 58  ? 68.387  -22.363 -48.400 1.00 82.87 ? 59  PHE D CB  1 
ATOM   8499 C  CG  . PHE D 2 58  ? 69.063  -22.237 -47.055 1.00 83.14 ? 59  PHE D CG  1 
ATOM   8500 C  CD1 . PHE D 2 58  ? 68.743  -21.188 -46.191 1.00 83.50 ? 59  PHE D CD1 1 
ATOM   8501 C  CD2 . PHE D 2 58  ? 70.015  -23.168 -46.649 1.00 82.97 ? 59  PHE D CD2 1 
ATOM   8502 C  CE1 . PHE D 2 58  ? 69.368  -21.067 -44.947 1.00 83.22 ? 59  PHE D CE1 1 
ATOM   8503 C  CE2 . PHE D 2 58  ? 70.641  -23.057 -45.407 1.00 82.93 ? 59  PHE D CE2 1 
ATOM   8504 C  CZ  . PHE D 2 58  ? 70.314  -22.006 -44.556 1.00 83.03 ? 59  PHE D CZ  1 
ATOM   8505 N  N   . GLU D 2 59  ? 68.688  -22.866 -51.518 1.00 84.46 ? 60  GLU D N   1 
ATOM   8506 C  CA  . GLU D 2 59  ? 68.165  -23.138 -52.870 1.00 85.18 ? 60  GLU D CA  1 
ATOM   8507 C  C   . GLU D 2 59  ? 66.677  -23.528 -52.915 1.00 85.58 ? 60  GLU D C   1 
ATOM   8508 O  O   . GLU D 2 59  ? 65.806  -22.676 -52.700 1.00 85.73 ? 60  GLU D O   1 
ATOM   8509 C  CB  . GLU D 2 59  ? 69.065  -24.107 -53.666 1.00 85.20 ? 60  GLU D CB  1 
ATOM   8510 C  CG  . GLU D 2 59  ? 69.699  -25.251 -52.874 1.00 85.63 ? 60  GLU D CG  1 
ATOM   8511 C  CD  . GLU D 2 59  ? 70.790  -25.969 -53.660 1.00 86.00 ? 60  GLU D CD  1 
ATOM   8512 O  OE1 . GLU D 2 59  ? 71.897  -26.159 -53.105 1.00 86.37 ? 60  GLU D OE1 1 
ATOM   8513 O  OE2 . GLU D 2 59  ? 70.549  -26.337 -54.833 1.00 86.03 ? 60  GLU D OE2 1 
ATOM   8514 N  N   . ASP D 2 60  ? 66.397  -24.802 -53.196 1.00 85.99 ? 61  ASP D N   1 
ATOM   8515 C  CA  . ASP D 2 60  ? 65.025  -25.298 -53.342 1.00 86.34 ? 61  ASP D CA  1 
ATOM   8516 C  C   . ASP D 2 60  ? 64.786  -26.583 -52.551 1.00 86.60 ? 61  ASP D C   1 
ATOM   8517 O  O   . ASP D 2 60  ? 63.831  -26.671 -51.775 1.00 86.62 ? 61  ASP D O   1 
ATOM   8518 C  CB  . ASP D 2 60  ? 64.684  -25.529 -54.824 1.00 86.35 ? 61  ASP D CB  1 
ATOM   8519 C  CG  . ASP D 2 60  ? 64.142  -24.280 -55.516 1.00 86.38 ? 61  ASP D CG  1 
ATOM   8520 O  OD1 . ASP D 2 60  ? 64.033  -23.212 -54.874 1.00 86.25 ? 61  ASP D OD1 1 
ATOM   8521 O  OD2 . ASP D 2 60  ? 63.816  -24.374 -56.718 1.00 86.21 ? 61  ASP D OD2 1 
ATOM   8522 N  N   . HIS D 2 61  ? 65.654  -27.573 -52.752 1.00 86.88 ? 62  HIS D N   1 
ATOM   8523 C  CA  . HIS D 2 61  ? 65.476  -28.896 -52.146 1.00 87.17 ? 62  HIS D CA  1 
ATOM   8524 C  C   . HIS D 2 61  ? 65.867  -28.974 -50.662 1.00 87.22 ? 62  HIS D C   1 
ATOM   8525 O  O   . HIS D 2 61  ? 65.343  -29.814 -49.923 1.00 87.35 ? 62  HIS D O   1 
ATOM   8526 C  CB  . HIS D 2 61  ? 66.191  -29.985 -52.967 1.00 87.23 ? 62  HIS D CB  1 
ATOM   8527 C  CG  . HIS D 2 61  ? 67.678  -29.814 -53.052 1.00 87.63 ? 62  HIS D CG  1 
ATOM   8528 N  ND1 . HIS D 2 61  ? 68.300  -29.211 -54.125 1.00 87.96 ? 62  HIS D ND1 1 
ATOM   8529 C  CD2 . HIS D 2 61  ? 68.669  -30.181 -52.203 1.00 87.73 ? 62  HIS D CD2 1 
ATOM   8530 C  CE1 . HIS D 2 61  ? 69.607  -29.207 -53.931 1.00 87.75 ? 62  HIS D CE1 1 
ATOM   8531 N  NE2 . HIS D 2 61  ? 69.857  -29.787 -52.771 1.00 87.75 ? 62  HIS D NE2 1 
ATOM   8532 N  N   . ILE D 2 62  ? 66.779  -28.102 -50.232 1.00 87.18 ? 63  ILE D N   1 
ATOM   8533 C  CA  . ILE D 2 62  ? 67.192  -28.042 -48.823 1.00 87.12 ? 63  ILE D CA  1 
ATOM   8534 C  C   . ILE D 2 62  ? 66.058  -27.498 -47.939 1.00 87.10 ? 63  ILE D C   1 
ATOM   8535 O  O   . ILE D 2 62  ? 65.821  -28.001 -46.836 1.00 87.03 ? 63  ILE D O   1 
ATOM   8536 C  CB  . ILE D 2 62  ? 68.479  -27.180 -48.626 1.00 87.14 ? 63  ILE D CB  1 
ATOM   8537 C  CG1 . ILE D 2 62  ? 69.579  -27.563 -49.637 1.00 87.13 ? 63  ILE D CG1 1 
ATOM   8538 C  CG2 . ILE D 2 62  ? 68.980  -27.248 -47.168 1.00 87.04 ? 63  ILE D CG2 1 
ATOM   8539 C  CD1 . ILE D 2 62  ? 70.328  -28.869 -49.339 1.00 86.96 ? 63  ILE D CD1 1 
ATOM   8540 N  N   . TYR D 2 63  ? 65.355  -26.489 -48.457 1.00 87.03 ? 64  TYR D N   1 
ATOM   8541 C  CA  . TYR D 2 63  ? 64.335  -25.740 -47.714 1.00 86.86 ? 64  TYR D CA  1 
ATOM   8542 C  C   . TYR D 2 63  ? 63.283  -26.610 -47.016 1.00 86.65 ? 64  TYR D C   1 
ATOM   8543 O  O   . TYR D 2 63  ? 63.016  -26.423 -45.823 1.00 86.64 ? 64  TYR D O   1 
ATOM   8544 C  CB  . TYR D 2 63  ? 63.664  -24.700 -48.627 1.00 86.89 ? 64  TYR D CB  1 
ATOM   8545 C  CG  . TYR D 2 63  ? 62.811  -23.681 -47.895 1.00 87.15 ? 64  TYR D CG  1 
ATOM   8546 C  CD1 . TYR D 2 63  ? 63.383  -22.534 -47.333 1.00 87.28 ? 64  TYR D CD1 1 
ATOM   8547 C  CD2 . TYR D 2 63  ? 61.431  -23.861 -47.767 1.00 87.28 ? 64  TYR D CD2 1 
ATOM   8548 C  CE1 . TYR D 2 63  ? 62.598  -21.594 -46.657 1.00 86.99 ? 64  TYR D CE1 1 
ATOM   8549 C  CE2 . TYR D 2 63  ? 60.641  -22.930 -47.093 1.00 87.15 ? 64  TYR D CE2 1 
ATOM   8550 C  CZ  . TYR D 2 63  ? 61.230  -21.802 -46.545 1.00 86.98 ? 64  TYR D CZ  1 
ATOM   8551 O  OH  . TYR D 2 63  ? 60.447  -20.887 -45.886 1.00 86.52 ? 64  TYR D OH  1 
ATOM   8552 N  N   . GLU D 2 64  ? 62.701  -27.557 -47.754 1.00 86.26 ? 65  GLU D N   1 
ATOM   8553 C  CA  . GLU D 2 64  ? 61.647  -28.427 -47.219 1.00 85.88 ? 65  GLU D CA  1 
ATOM   8554 C  C   . GLU D 2 64  ? 62.077  -29.225 -45.990 1.00 85.43 ? 65  GLU D C   1 
ATOM   8555 O  O   . GLU D 2 64  ? 61.267  -29.467 -45.093 1.00 85.38 ? 65  GLU D O   1 
ATOM   8556 C  CB  . GLU D 2 64  ? 61.126  -29.386 -48.294 1.00 86.07 ? 65  GLU D CB  1 
ATOM   8557 C  CG  . GLU D 2 64  ? 59.858  -28.917 -48.999 1.00 86.54 ? 65  GLU D CG  1 
ATOM   8558 C  CD  . GLU D 2 64  ? 60.128  -28.116 -50.263 1.00 87.41 ? 65  GLU D CD  1 
ATOM   8559 O  OE1 . GLU D 2 64  ? 59.225  -28.064 -51.126 1.00 87.61 ? 65  GLU D OE1 1 
ATOM   8560 O  OE2 . GLU D 2 64  ? 61.234  -27.543 -50.401 1.00 87.78 ? 65  GLU D OE2 1 
ATOM   8561 N  N   . LYS D 2 65  ? 63.347  -29.626 -45.956 1.00 84.85 ? 66  LYS D N   1 
ATOM   8562 C  CA  . LYS D 2 65  ? 63.869  -30.457 -44.868 1.00 84.25 ? 66  LYS D CA  1 
ATOM   8563 C  C   . LYS D 2 65  ? 64.441  -29.669 -43.682 1.00 83.63 ? 66  LYS D C   1 
ATOM   8564 O  O   . LYS D 2 65  ? 65.105  -30.239 -42.809 1.00 83.58 ? 66  LYS D O   1 
ATOM   8565 C  CB  . LYS D 2 65  ? 64.889  -31.475 -45.401 1.00 84.41 ? 66  LYS D CB  1 
ATOM   8566 C  CG  . LYS D 2 65  ? 64.312  -32.878 -45.644 1.00 84.76 ? 66  LYS D CG  1 
ATOM   8567 C  CD  . LYS D 2 65  ? 64.541  -33.834 -44.454 1.00 85.15 ? 66  LYS D CD  1 
ATOM   8568 C  CE  . LYS D 2 65  ? 63.515  -33.663 -43.320 1.00 85.09 ? 66  LYS D CE  1 
ATOM   8569 N  NZ  . LYS D 2 65  ? 62.153  -34.156 -43.678 1.00 84.86 ? 66  LYS D NZ  1 
ATOM   8570 N  N   . LEU D 2 66  ? 64.170  -28.364 -43.657 1.00 82.78 ? 67  LEU D N   1 
ATOM   8571 C  CA  . LEU D 2 66  ? 64.533  -27.505 -42.526 1.00 81.86 ? 67  LEU D CA  1 
ATOM   8572 C  C   . LEU D 2 66  ? 63.405  -27.473 -41.498 1.00 81.06 ? 67  LEU D C   1 
ATOM   8573 O  O   . LEU D 2 66  ? 62.226  -27.536 -41.860 1.00 80.91 ? 67  LEU D O   1 
ATOM   8574 C  CB  . LEU D 2 66  ? 64.836  -26.079 -43.000 1.00 81.98 ? 67  LEU D CB  1 
ATOM   8575 C  CG  . LEU D 2 66  ? 65.997  -25.843 -43.972 1.00 82.21 ? 67  LEU D CG  1 
ATOM   8576 C  CD1 . LEU D 2 66  ? 65.950  -24.412 -44.502 1.00 82.26 ? 67  LEU D CD1 1 
ATOM   8577 C  CD2 . LEU D 2 66  ? 67.353  -26.144 -43.323 1.00 82.46 ? 67  LEU D CD2 1 
ATOM   8578 N  N   . ASP D 2 67  ? 63.777  -27.367 -40.222 1.00 80.06 ? 68  ASP D N   1 
ATOM   8579 C  CA  . ASP D 2 67  ? 62.811  -27.287 -39.119 1.00 79.15 ? 68  ASP D CA  1 
ATOM   8580 C  C   . ASP D 2 67  ? 61.788  -26.173 -39.331 1.00 78.30 ? 68  ASP D C   1 
ATOM   8581 O  O   . ASP D 2 67  ? 62.078  -25.173 -39.995 1.00 78.26 ? 68  ASP D O   1 
ATOM   8582 C  CB  . ASP D 2 67  ? 63.533  -27.064 -37.784 1.00 79.27 ? 68  ASP D CB  1 
ATOM   8583 C  CG  . ASP D 2 67  ? 64.430  -28.228 -37.393 1.00 79.57 ? 68  ASP D CG  1 
ATOM   8584 O  OD1 . ASP D 2 67  ? 64.119  -29.386 -37.752 1.00 80.14 ? 68  ASP D OD1 1 
ATOM   8585 O  OD2 . ASP D 2 67  ? 65.448  -27.981 -36.711 1.00 79.61 ? 68  ASP D OD2 1 
ATOM   8586 N  N   . ALA D 2 68  ? 60.595  -26.357 -38.764 1.00 77.16 ? 69  ALA D N   1 
ATOM   8587 C  CA  . ALA D 2 68  ? 59.535  -25.349 -38.812 1.00 76.01 ? 69  ALA D CA  1 
ATOM   8588 C  C   . ALA D 2 68  ? 60.021  -23.998 -38.275 1.00 75.19 ? 69  ALA D C   1 
ATOM   8589 O  O   . ALA D 2 68  ? 60.784  -23.936 -37.305 1.00 74.99 ? 69  ALA D O   1 
ATOM   8590 C  CB  . ALA D 2 68  ? 58.308  -25.825 -38.045 1.00 76.06 ? 69  ALA D CB  1 
ATOM   8591 N  N   . ILE D 2 69  ? 59.582  -22.926 -38.926 1.00 74.09 ? 70  ILE D N   1 
ATOM   8592 C  CA  . ILE D 2 69  ? 60.042  -21.577 -38.604 1.00 73.01 ? 70  ILE D CA  1 
ATOM   8593 C  C   . ILE D 2 69  ? 59.241  -20.952 -37.454 1.00 72.04 ? 70  ILE D C   1 
ATOM   8594 O  O   . ILE D 2 69  ? 58.012  -20.854 -37.523 1.00 71.79 ? 70  ILE D O   1 
ATOM   8595 C  CB  . ILE D 2 69  ? 60.061  -20.666 -39.872 1.00 73.16 ? 70  ILE D CB  1 
ATOM   8596 C  CG1 . ILE D 2 69  ? 60.728  -19.323 -39.566 1.00 73.23 ? 70  ILE D CG1 1 
ATOM   8597 C  CG2 . ILE D 2 69  ? 58.649  -20.498 -40.480 1.00 73.13 ? 70  ILE D CG2 1 
ATOM   8598 C  CD1 . ILE D 2 69  ? 61.291  -18.632 -40.785 1.00 74.05 ? 70  ILE D CD1 1 
ATOM   8599 N  N   . THR D 2 70  ? 59.948  -20.554 -36.395 1.00 70.86 ? 71  THR D N   1 
ATOM   8600 C  CA  . THR D 2 70  ? 59.322  -19.897 -35.244 1.00 69.76 ? 71  THR D CA  1 
ATOM   8601 C  C   . THR D 2 70  ? 58.774  -18.528 -35.631 1.00 69.00 ? 71  THR D C   1 
ATOM   8602 O  O   . THR D 2 70  ? 59.247  -17.907 -36.590 1.00 68.69 ? 71  THR D O   1 
ATOM   8603 C  CB  . THR D 2 70  ? 60.296  -19.721 -34.046 1.00 69.80 ? 71  THR D CB  1 
ATOM   8604 O  OG1 . THR D 2 70  ? 61.431  -18.942 -34.447 1.00 69.64 ? 71  THR D OG1 1 
ATOM   8605 C  CG2 . THR D 2 70  ? 60.761  -21.070 -33.503 1.00 69.74 ? 71  THR D CG2 1 
ATOM   8606 N  N   . ASP D 2 71  ? 57.770  -18.073 -34.882 1.00 68.12 ? 72  ASP D N   1 
ATOM   8607 C  CA  . ASP D 2 71  ? 57.200  -16.737 -35.049 1.00 67.32 ? 72  ASP D CA  1 
ATOM   8608 C  C   . ASP D 2 71  ? 58.273  -15.650 -34.926 1.00 66.69 ? 72  ASP D C   1 
ATOM   8609 O  O   . ASP D 2 71  ? 58.228  -14.651 -35.642 1.00 66.43 ? 72  ASP D O   1 
ATOM   8610 C  CB  . ASP D 2 71  ? 56.088  -16.493 -34.020 1.00 67.44 ? 72  ASP D CB  1 
ATOM   8611 C  CG  . ASP D 2 71  ? 55.002  -17.569 -34.046 1.00 67.72 ? 72  ASP D CG  1 
ATOM   8612 O  OD1 . ASP D 2 71  ? 54.397  -17.797 -35.116 1.00 68.05 ? 72  ASP D OD1 1 
ATOM   8613 O  OD2 . ASP D 2 71  ? 54.743  -18.178 -32.986 1.00 67.80 ? 72  ASP D OD2 1 
ATOM   8614 N  N   . GLU D 2 72  ? 59.237  -15.871 -34.028 1.00 65.97 ? 73  GLU D N   1 
ATOM   8615 C  CA  . GLU D 2 72  ? 60.343  -14.940 -33.778 1.00 65.58 ? 73  GLU D CA  1 
ATOM   8616 C  C   . GLU D 2 72  ? 61.174  -14.740 -35.036 1.00 65.17 ? 73  GLU D C   1 
ATOM   8617 O  O   . GLU D 2 72  ? 61.434  -13.606 -35.444 1.00 64.82 ? 73  GLU D O   1 
ATOM   8618 C  CB  . GLU D 2 72  ? 61.271  -15.452 -32.663 1.00 65.66 ? 73  GLU D CB  1 
ATOM   8619 C  CG  . GLU D 2 72  ? 60.727  -16.596 -31.809 1.00 66.46 ? 73  GLU D CG  1 
ATOM   8620 C  CD  . GLU D 2 72  ? 59.539  -16.182 -30.968 1.00 67.25 ? 73  GLU D CD  1 
ATOM   8621 O  OE1 . GLU D 2 72  ? 59.684  -15.214 -30.193 1.00 67.91 ? 73  GLU D OE1 1 
ATOM   8622 O  OE2 . GLU D 2 72  ? 58.468  -16.819 -31.091 1.00 66.56 ? 73  GLU D OE2 1 
ATOM   8623 N  N   . GLU D 2 73  ? 61.584  -15.857 -35.637 1.00 64.74 ? 74  GLU D N   1 
ATOM   8624 C  CA  . GLU D 2 73  ? 62.403  -15.845 -36.843 1.00 64.59 ? 74  GLU D CA  1 
ATOM   8625 C  C   . GLU D 2 73  ? 61.658  -15.202 -38.004 1.00 64.29 ? 74  GLU D C   1 
ATOM   8626 O  O   . GLU D 2 73  ? 62.242  -14.433 -38.762 1.00 64.13 ? 74  GLU D O   1 
ATOM   8627 C  CB  . GLU D 2 73  ? 62.856  -17.260 -37.209 1.00 64.67 ? 74  GLU D CB  1 
ATOM   8628 C  CG  . GLU D 2 73  ? 64.110  -17.298 -38.082 1.00 65.35 ? 74  GLU D CG  1 
ATOM   8629 C  CD  . GLU D 2 73  ? 64.513  -18.706 -38.517 1.00 65.81 ? 74  GLU D CD  1 
ATOM   8630 O  OE1 . GLU D 2 73  ? 64.042  -19.690 -37.908 1.00 65.61 ? 74  GLU D OE1 1 
ATOM   8631 O  OE2 . GLU D 2 73  ? 65.310  -18.821 -39.473 1.00 65.73 ? 74  GLU D OE2 1 
ATOM   8632 N  N   . ASN D 2 74  ? 60.369  -15.511 -38.126 1.00 64.13 ? 75  ASN D N   1 
ATOM   8633 C  CA  . ASN D 2 74  ? 59.516  -14.889 -39.138 1.00 64.28 ? 75  ASN D CA  1 
ATOM   8634 C  C   . ASN D 2 74  ? 59.430  -13.371 -39.008 1.00 64.25 ? 75  ASN D C   1 
ATOM   8635 O  O   . ASN D 2 74  ? 59.455  -12.656 -40.013 1.00 64.15 ? 75  ASN D O   1 
ATOM   8636 C  CB  . ASN D 2 74  ? 58.113  -15.509 -39.136 1.00 64.33 ? 75  ASN D CB  1 
ATOM   8637 C  CG  . ASN D 2 74  ? 57.968  -16.633 -40.151 1.00 64.71 ? 75  ASN D CG  1 
ATOM   8638 O  OD1 . ASN D 2 74  ? 58.608  -16.622 -41.206 1.00 64.80 ? 75  ASN D OD1 1 
ATOM   8639 N  ND2 . ASN D 2 74  ? 57.113  -17.605 -39.843 1.00 64.68 ? 75  ASN D ND2 1 
ATOM   8640 N  N   . ASP D 2 75  ? 59.337  -12.891 -37.771 1.00 64.28 ? 76  ASP D N   1 
ATOM   8641 C  CA  . ASP D 2 75  ? 59.309  -11.455 -37.494 1.00 64.40 ? 76  ASP D CA  1 
ATOM   8642 C  C   . ASP D 2 75  ? 60.640  -10.774 -37.821 1.00 64.49 ? 76  ASP D C   1 
ATOM   8643 O  O   . ASP D 2 75  ? 60.659  -9.671  -38.370 1.00 64.28 ? 76  ASP D O   1 
ATOM   8644 C  CB  . ASP D 2 75  ? 58.909  -11.197 -36.038 1.00 64.29 ? 76  ASP D CB  1 
ATOM   8645 C  CG  . ASP D 2 75  ? 57.499  -11.675 -35.721 1.00 64.49 ? 76  ASP D CG  1 
ATOM   8646 O  OD1 . ASP D 2 75  ? 56.785  -12.123 -36.649 1.00 64.03 ? 76  ASP D OD1 1 
ATOM   8647 O  OD2 . ASP D 2 75  ? 57.106  -11.605 -34.534 1.00 64.83 ? 76  ASP D OD2 1 
ATOM   8648 N  N   . MET D 2 76  ? 61.745  -11.439 -37.489 1.00 64.89 ? 77  MET D N   1 
ATOM   8649 C  CA  . MET D 2 76  ? 63.081  -10.955 -37.841 1.00 65.47 ? 77  MET D CA  1 
ATOM   8650 C  C   . MET D 2 76  ? 63.290  -10.925 -39.358 1.00 66.04 ? 77  MET D C   1 
ATOM   8651 O  O   . MET D 2 76  ? 63.963  -10.035 -39.878 1.00 65.99 ? 77  MET D O   1 
ATOM   8652 C  CB  . MET D 2 76  ? 64.168  -11.803 -37.170 1.00 65.29 ? 77  MET D CB  1 
ATOM   8653 C  CG  . MET D 2 76  ? 64.256  -11.669 -35.649 1.00 65.55 ? 77  MET D CG  1 
ATOM   8654 S  SD  . MET D 2 76  ? 64.961  -10.104 -35.066 1.00 65.89 ? 77  MET D SD  1 
ATOM   8655 C  CE  . MET D 2 76  ? 63.530  -9.032  -35.111 1.00 66.00 ? 77  MET D CE  1 
ATOM   8656 N  N   . LEU D 2 77  ? 62.695  -11.897 -40.052 1.00 66.70 ? 78  LEU D N   1 
ATOM   8657 C  CA  . LEU D 2 77  ? 62.786  -12.018 -41.509 1.00 67.63 ? 78  LEU D CA  1 
ATOM   8658 C  C   . LEU D 2 77  ? 62.008  -10.959 -42.287 1.00 68.22 ? 78  LEU D C   1 
ATOM   8659 O  O   . LEU D 2 77  ? 62.410  -10.584 -43.389 1.00 68.43 ? 78  LEU D O   1 
ATOM   8660 C  CB  . LEU D 2 77  ? 62.342  -13.415 -41.961 1.00 67.59 ? 78  LEU D CB  1 
ATOM   8661 C  CG  . LEU D 2 77  ? 63.398  -14.408 -42.460 1.00 67.71 ? 78  LEU D CG  1 
ATOM   8662 C  CD1 . LEU D 2 77  ? 64.613  -14.491 -41.547 1.00 67.57 ? 78  LEU D CD1 1 
ATOM   8663 C  CD2 . LEU D 2 77  ? 62.769  -15.785 -42.652 1.00 67.74 ? 78  LEU D CD2 1 
ATOM   8664 N  N   . ASP D 2 78  ? 60.897  -10.488 -41.729 1.00 68.98 ? 79  ASP D N   1 
ATOM   8665 C  CA  . ASP D 2 78  ? 60.088  -9.470  -42.394 1.00 69.91 ? 79  ASP D CA  1 
ATOM   8666 C  C   . ASP D 2 78  ? 60.774  -8.100  -42.397 1.00 70.46 ? 79  ASP D C   1 
ATOM   8667 O  O   . ASP D 2 78  ? 60.400  -7.212  -43.168 1.00 70.62 ? 79  ASP D O   1 
ATOM   8668 C  CB  . ASP D 2 78  ? 58.685  -9.385  -41.772 1.00 69.98 ? 79  ASP D CB  1 
ATOM   8669 C  CG  . ASP D 2 78  ? 57.813  -10.599 -42.105 1.00 70.72 ? 79  ASP D CG  1 
ATOM   8670 O  OD1 . ASP D 2 78  ? 56.910  -10.922 -41.298 1.00 71.31 ? 79  ASP D OD1 1 
ATOM   8671 O  OD2 . ASP D 2 78  ? 58.021  -11.232 -43.167 1.00 71.09 ? 79  ASP D OD2 1 
ATOM   8672 N  N   . LEU D 2 79  ? 61.779  -7.940  -41.536 1.00 71.09 ? 80  LEU D N   1 
ATOM   8673 C  CA  . LEU D 2 79  ? 62.550  -6.699  -41.462 1.00 71.77 ? 80  LEU D CA  1 
ATOM   8674 C  C   . LEU D 2 79  ? 63.991  -6.890  -41.928 1.00 72.26 ? 80  LEU D C   1 
ATOM   8675 O  O   . LEU D 2 79  ? 64.844  -6.040  -41.683 1.00 72.39 ? 80  LEU D O   1 
ATOM   8676 C  CB  . LEU D 2 79  ? 62.522  -6.110  -40.044 1.00 71.68 ? 80  LEU D CB  1 
ATOM   8677 C  CG  . LEU D 2 79  ? 61.185  -5.829  -39.341 1.00 72.02 ? 80  LEU D CG  1 
ATOM   8678 C  CD1 . LEU D 2 79  ? 61.416  -5.026  -38.067 1.00 72.31 ? 80  LEU D CD1 1 
ATOM   8679 C  CD2 . LEU D 2 79  ? 60.190  -5.112  -40.239 1.00 71.79 ? 80  LEU D CD2 1 
ATOM   8680 N  N   . ALA D 2 80  ? 64.259  -8.011  -42.592 1.00 72.98 ? 81  ALA D N   1 
ATOM   8681 C  CA  . ALA D 2 80  ? 65.564  -8.253  -43.194 1.00 73.64 ? 81  ALA D CA  1 
ATOM   8682 C  C   . ALA D 2 80  ? 65.557  -7.709  -44.615 1.00 74.17 ? 81  ALA D C   1 
ATOM   8683 O  O   . ALA D 2 80  ? 64.616  -7.957  -45.379 1.00 74.04 ? 81  ALA D O   1 
ATOM   8684 C  CB  . ALA D 2 80  ? 65.890  -9.733  -43.188 1.00 73.61 ? 81  ALA D CB  1 
ATOM   8685 N  N   . TYR D 2 81  ? 66.598  -6.955  -44.961 1.00 74.99 ? 82  TYR D N   1 
ATOM   8686 C  CA  . TYR D 2 81  ? 66.687  -6.352  -46.292 1.00 75.85 ? 82  TYR D CA  1 
ATOM   8687 C  C   . TYR D 2 81  ? 67.037  -7.389  -47.364 1.00 76.06 ? 82  TYR D C   1 
ATOM   8688 O  O   . TYR D 2 81  ? 67.903  -8.247  -47.158 1.00 76.03 ? 82  TYR D O   1 
ATOM   8689 C  CB  . TYR D 2 81  ? 67.636  -5.139  -46.311 1.00 76.02 ? 82  TYR D CB  1 
ATOM   8690 C  CG  . TYR D 2 81  ? 69.109  -5.432  -46.080 1.00 76.94 ? 82  TYR D CG  1 
ATOM   8691 C  CD1 . TYR D 2 81  ? 69.966  -5.703  -47.155 1.00 77.72 ? 82  TYR D CD1 1 
ATOM   8692 C  CD2 . TYR D 2 81  ? 69.657  -5.399  -44.794 1.00 77.85 ? 82  TYR D CD2 1 
ATOM   8693 C  CE1 . TYR D 2 81  ? 71.330  -5.961  -46.953 1.00 78.01 ? 82  TYR D CE1 1 
ATOM   8694 C  CE2 . TYR D 2 81  ? 71.025  -5.653  -44.580 1.00 78.05 ? 82  TYR D CE2 1 
ATOM   8695 C  CZ  . TYR D 2 81  ? 71.850  -5.932  -45.664 1.00 78.13 ? 82  TYR D CZ  1 
ATOM   8696 O  OH  . TYR D 2 81  ? 73.190  -6.185  -45.467 1.00 77.87 ? 82  TYR D OH  1 
ATOM   8697 N  N   . GLY D 2 82  ? 66.339  -7.309  -48.496 1.00 76.43 ? 83  GLY D N   1 
ATOM   8698 C  CA  . GLY D 2 82  ? 66.475  -8.289  -49.571 1.00 76.89 ? 83  GLY D CA  1 
ATOM   8699 C  C   . GLY D 2 82  ? 65.988  -9.654  -49.128 1.00 77.21 ? 83  GLY D C   1 
ATOM   8700 O  O   . GLY D 2 82  ? 66.788  -10.557 -48.877 1.00 77.33 ? 83  GLY D O   1 
ATOM   8701 N  N   . LEU D 2 83  ? 64.670  -9.798  -49.025 1.00 77.48 ? 84  LEU D N   1 
ATOM   8702 C  CA  . LEU D 2 83  ? 64.063  -11.029 -48.535 1.00 77.69 ? 84  LEU D CA  1 
ATOM   8703 C  C   . LEU D 2 83  ? 63.685  -11.950 -49.693 1.00 77.86 ? 84  LEU D C   1 
ATOM   8704 O  O   . LEU D 2 83  ? 62.993  -11.534 -50.625 1.00 77.89 ? 84  LEU D O   1 
ATOM   8705 C  CB  . LEU D 2 83  ? 62.837  -10.705 -47.668 1.00 77.62 ? 84  LEU D CB  1 
ATOM   8706 C  CG  . LEU D 2 83  ? 62.029  -11.842 -47.032 1.00 77.56 ? 84  LEU D CG  1 
ATOM   8707 C  CD1 . LEU D 2 83  ? 62.820  -12.568 -45.945 1.00 77.16 ? 84  LEU D CD1 1 
ATOM   8708 C  CD2 . LEU D 2 83  ? 60.717  -11.307 -46.478 1.00 77.52 ? 84  LEU D CD2 1 
ATOM   8709 N  N   . THR D 2 84  ? 64.140  -13.200 -49.620 1.00 78.05 ? 85  THR D N   1 
ATOM   8710 C  CA  . THR D 2 84  ? 63.841  -14.204 -50.651 1.00 78.20 ? 85  THR D CA  1 
ATOM   8711 C  C   . THR D 2 84  ? 62.714  -15.160 -50.231 1.00 78.10 ? 85  THR D C   1 
ATOM   8712 O  O   . THR D 2 84  ? 62.360  -15.245 -49.047 1.00 78.06 ? 85  THR D O   1 
ATOM   8713 C  CB  . THR D 2 84  ? 65.107  -15.018 -51.073 1.00 78.30 ? 85  THR D CB  1 
ATOM   8714 O  OG1 . THR D 2 84  ? 65.513  -15.891 -50.009 1.00 78.65 ? 85  THR D OG1 1 
ATOM   8715 C  CG2 . THR D 2 84  ? 66.268  -14.090 -51.451 1.00 78.31 ? 85  THR D CG2 1 
ATOM   8716 N  N   . ASP D 2 85  ? 62.162  -15.872 -51.215 1.00 77.96 ? 86  ASP D N   1 
ATOM   8717 C  CA  . ASP D 2 85  ? 61.099  -16.858 -51.003 1.00 77.70 ? 86  ASP D CA  1 
ATOM   8718 C  C   . ASP D 2 85  ? 61.601  -18.038 -50.171 1.00 77.35 ? 86  ASP D C   1 
ATOM   8719 O  O   . ASP D 2 85  ? 60.816  -18.759 -49.551 1.00 77.27 ? 86  ASP D O   1 
ATOM   8720 C  CB  . ASP D 2 85  ? 60.574  -17.355 -52.358 1.00 77.90 ? 86  ASP D CB  1 
ATOM   8721 C  CG  . ASP D 2 85  ? 59.158  -17.926 -52.280 1.00 78.20 ? 86  ASP D CG  1 
ATOM   8722 O  OD1 . ASP D 2 85  ? 58.509  -17.827 -51.216 1.00 78.67 ? 86  ASP D OD1 1 
ATOM   8723 O  OD2 . ASP D 2 85  ? 58.688  -18.471 -53.303 1.00 78.18 ? 86  ASP D OD2 1 
ATOM   8724 N  N   . ARG D 2 86  ? 62.917  -18.225 -50.165 1.00 76.93 ? 87  ARG D N   1 
ATOM   8725 C  CA  . ARG D 2 86  ? 63.543  -19.327 -49.445 1.00 76.59 ? 87  ARG D CA  1 
ATOM   8726 C  C   . ARG D 2 86  ? 64.609  -18.790 -48.479 1.00 76.02 ? 87  ARG D C   1 
ATOM   8727 O  O   . ARG D 2 86  ? 65.757  -19.247 -48.475 1.00 76.03 ? 87  ARG D O   1 
ATOM   8728 C  CB  . ARG D 2 86  ? 64.133  -20.350 -50.436 1.00 76.85 ? 87  ARG D CB  1 
ATOM   8729 C  CG  . ARG D 2 86  ? 63.191  -20.767 -51.585 1.00 77.58 ? 87  ARG D CG  1 
ATOM   8730 C  CD  . ARG D 2 86  ? 62.209  -21.878 -51.185 1.00 79.23 ? 87  ARG D CD  1 
ATOM   8731 N  NE  . ARG D 2 86  ? 60.923  -21.755 -51.879 1.00 80.27 ? 87  ARG D NE  1 
ATOM   8732 C  CZ  . ARG D 2 86  ? 59.738  -21.635 -51.277 1.00 80.71 ? 87  ARG D CZ  1 
ATOM   8733 N  NH1 . ARG D 2 86  ? 59.647  -21.643 -49.953 1.00 80.79 ? 87  ARG D NH1 1 
ATOM   8734 N  NH2 . ARG D 2 86  ? 58.632  -21.519 -52.005 1.00 80.87 ? 87  ARG D NH2 1 
ATOM   8735 N  N   . SER D 2 87  ? 64.211  -17.819 -47.657 1.00 75.25 ? 88  SER D N   1 
ATOM   8736 C  CA  . SER D 2 87  ? 65.105  -17.191 -46.682 1.00 74.37 ? 88  SER D CA  1 
ATOM   8737 C  C   . SER D 2 87  ? 64.995  -17.827 -45.302 1.00 73.74 ? 88  SER D C   1 
ATOM   8738 O  O   . SER D 2 87  ? 63.899  -18.179 -44.862 1.00 73.69 ? 88  SER D O   1 
ATOM   8739 C  CB  . SER D 2 87  ? 64.794  -15.699 -46.566 1.00 74.46 ? 88  SER D CB  1 
ATOM   8740 O  OG  . SER D 2 87  ? 65.334  -14.969 -47.651 1.00 74.46 ? 88  SER D OG  1 
ATOM   8741 N  N   . ARG D 2 88  ? 66.138  -17.966 -44.629 1.00 72.89 ? 89  ARG D N   1 
ATOM   8742 C  CA  . ARG D 2 88  ? 66.200  -18.432 -43.238 1.00 72.23 ? 89  ARG D CA  1 
ATOM   8743 C  C   . ARG D 2 88  ? 67.367  -17.766 -42.510 1.00 71.75 ? 89  ARG D C   1 
ATOM   8744 O  O   . ARG D 2 88  ? 68.358  -17.381 -43.134 1.00 71.84 ? 89  ARG D O   1 
ATOM   8745 C  CB  . ARG D 2 88  ? 66.349  -19.962 -43.155 1.00 72.22 ? 89  ARG D CB  1 
ATOM   8746 C  CG  . ARG D 2 88  ? 65.105  -20.782 -43.508 1.00 72.20 ? 89  ARG D CG  1 
ATOM   8747 C  CD  . ARG D 2 88  ? 63.954  -20.578 -42.523 1.00 72.30 ? 89  ARG D CD  1 
ATOM   8748 N  NE  . ARG D 2 88  ? 64.332  -20.916 -41.151 1.00 72.85 ? 89  ARG D NE  1 
ATOM   8749 C  CZ  . ARG D 2 88  ? 64.092  -22.084 -40.559 1.00 73.20 ? 89  ARG D CZ  1 
ATOM   8750 N  NH1 . ARG D 2 88  ? 63.464  -23.060 -41.206 1.00 73.50 ? 89  ARG D NH1 1 
ATOM   8751 N  NH2 . ARG D 2 88  ? 64.485  -22.279 -39.309 1.00 73.23 ? 89  ARG D NH2 1 
ATOM   8752 N  N   . LEU D 2 89  ? 67.250  -17.634 -41.191 1.00 71.02 ? 90  LEU D N   1 
ATOM   8753 C  CA  . LEU D 2 89  ? 68.342  -17.105 -40.378 1.00 70.30 ? 90  LEU D CA  1 
ATOM   8754 C  C   . LEU D 2 89  ? 69.376  -18.185 -40.115 1.00 69.79 ? 90  LEU D C   1 
ATOM   8755 O  O   . LEU D 2 89  ? 69.040  -19.274 -39.649 1.00 69.75 ? 90  LEU D O   1 
ATOM   8756 C  CB  . LEU D 2 89  ? 67.828  -16.519 -39.057 1.00 70.23 ? 90  LEU D CB  1 
ATOM   8757 C  CG  . LEU D 2 89  ? 67.152  -15.144 -39.106 1.00 70.00 ? 90  LEU D CG  1 
ATOM   8758 C  CD1 . LEU D 2 89  ? 66.751  -14.698 -37.716 1.00 69.70 ? 90  LEU D CD1 1 
ATOM   8759 C  CD2 . LEU D 2 89  ? 68.036  -14.092 -39.765 1.00 69.55 ? 90  LEU D CD2 1 
ATOM   8760 N  N   . GLY D 2 90  ? 70.632  -17.866 -40.415 1.00 69.28 ? 91  GLY D N   1 
ATOM   8761 C  CA  . GLY D 2 90  ? 71.742  -18.812 -40.312 1.00 68.60 ? 91  GLY D CA  1 
ATOM   8762 C  C   . GLY D 2 90  ? 71.982  -19.401 -38.934 1.00 68.14 ? 91  GLY D C   1 
ATOM   8763 O  O   . GLY D 2 90  ? 72.309  -20.586 -38.815 1.00 68.04 ? 91  GLY D O   1 
ATOM   8764 N  N   . CYS D 2 91  ? 71.813  -18.585 -37.892 1.00 67.53 ? 92  CYS D N   1 
ATOM   8765 C  CA  . CYS D 2 91  ? 72.087  -19.025 -36.519 1.00 66.90 ? 92  CYS D CA  1 
ATOM   8766 C  C   . CYS D 2 91  ? 71.034  -19.993 -35.960 1.00 66.60 ? 92  CYS D C   1 
ATOM   8767 O  O   . CYS D 2 91  ? 71.201  -20.525 -34.863 1.00 66.34 ? 92  CYS D O   1 
ATOM   8768 C  CB  . CYS D 2 91  ? 72.295  -17.824 -35.578 1.00 67.07 ? 92  CYS D CB  1 
ATOM   8769 S  SG  . CYS D 2 91  ? 70.812  -16.845 -35.168 1.00 65.74 ? 92  CYS D SG  1 
ATOM   8770 N  N   . GLN D 2 92  ? 69.969  -20.221 -36.728 1.00 66.40 ? 93  GLN D N   1 
ATOM   8771 C  CA  . GLN D 2 92  ? 68.888  -21.132 -36.338 1.00 66.35 ? 93  GLN D CA  1 
ATOM   8772 C  C   . GLN D 2 92  ? 68.854  -22.406 -37.199 1.00 66.76 ? 93  GLN D C   1 
ATOM   8773 O  O   . GLN D 2 92  ? 68.012  -23.284 -36.989 1.00 66.62 ? 93  GLN D O   1 
ATOM   8774 C  CB  . GLN D 2 92  ? 67.532  -20.412 -36.384 1.00 66.11 ? 93  GLN D CB  1 
ATOM   8775 C  CG  . GLN D 2 92  ? 67.428  -19.191 -35.466 1.00 64.88 ? 93  GLN D CG  1 
ATOM   8776 C  CD  . GLN D 2 92  ? 67.637  -19.525 -33.999 1.00 62.94 ? 93  GLN D CD  1 
ATOM   8777 O  OE1 . GLN D 2 92  ? 66.816  -20.203 -33.382 1.00 62.20 ? 93  GLN D OE1 1 
ATOM   8778 N  NE2 . GLN D 2 92  ? 68.736  -19.039 -33.431 1.00 61.91 ? 93  GLN D NE2 1 
ATOM   8779 N  N   . ILE D 2 93  ? 69.773  -22.486 -38.164 1.00 67.24 ? 94  ILE D N   1 
ATOM   8780 C  CA  . ILE D 2 93  ? 69.956  -23.658 -39.027 1.00 67.57 ? 94  ILE D CA  1 
ATOM   8781 C  C   . ILE D 2 93  ? 71.228  -24.394 -38.597 1.00 67.99 ? 94  ILE D C   1 
ATOM   8782 O  O   . ILE D 2 93  ? 72.341  -23.882 -38.778 1.00 68.00 ? 94  ILE D O   1 
ATOM   8783 C  CB  . ILE D 2 93  ? 70.080  -23.251 -40.527 1.00 67.47 ? 94  ILE D CB  1 
ATOM   8784 C  CG1 . ILE D 2 93  ? 68.929  -22.330 -40.966 1.00 67.10 ? 94  ILE D CG1 1 
ATOM   8785 C  CG2 . ILE D 2 93  ? 70.204  -24.478 -41.427 1.00 67.59 ? 94  ILE D CG2 1 
ATOM   8786 C  CD1 . ILE D 2 93  ? 67.544  -22.977 -41.018 1.00 67.18 ? 94  ILE D CD1 1 
ATOM   8787 N  N   . CYS D 2 94  ? 71.060  -25.590 -38.032 1.00 68.42 ? 95  CYS D N   1 
ATOM   8788 C  CA  . CYS D 2 94  ? 72.184  -26.364 -37.488 1.00 68.98 ? 95  CYS D CA  1 
ATOM   8789 C  C   . CYS D 2 94  ? 72.443  -27.684 -38.222 1.00 68.87 ? 95  CYS D C   1 
ATOM   8790 O  O   . CYS D 2 94  ? 72.131  -27.817 -39.419 1.00 68.81 ? 95  CYS D O   1 
ATOM   8791 C  CB  . CYS D 2 94  ? 71.972  -26.624 -35.994 1.00 69.19 ? 95  CYS D CB  1 
ATOM   8792 S  SG  . CYS D 2 94  ? 70.320  -27.251 -35.579 1.00 70.76 ? 95  CYS D SG  1 
HETATM 8793 C  CHA . HEM E 3 .   ? 12.265  0.438   17.982  1.00 19.78 ? 601 HEM A CHA 1 
HETATM 8794 C  CHB . HEM E 3 .   ? 12.634  0.669   13.096  1.00 20.74 ? 601 HEM A CHB 1 
HETATM 8795 C  CHC . HEM E 3 .   ? 16.455  3.597   13.610  1.00 20.94 ? 601 HEM A CHC 1 
HETATM 8796 C  CHD . HEM E 3 .   ? 16.495  2.790   18.395  1.00 20.48 ? 601 HEM A CHD 1 
HETATM 8797 C  C1A . HEM E 3 .   ? 12.043  0.283   16.627  1.00 20.68 ? 601 HEM A C1A 1 
HETATM 8798 C  C2A . HEM E 3 .   ? 10.919  -0.435  16.051  1.00 19.35 ? 601 HEM A C2A 1 
HETATM 8799 C  C3A . HEM E 3 .   ? 11.031  -0.371  14.723  1.00 18.69 ? 601 HEM A C3A 1 
HETATM 8800 C  C4A . HEM E 3 .   ? 12.211  0.399   14.388  1.00 19.62 ? 601 HEM A C4A 1 
HETATM 8801 C  CMA . HEM E 3 .   ? 10.068  -0.988  13.688  1.00 16.10 ? 601 HEM A CMA 1 
HETATM 8802 C  CAA . HEM E 3 .   ? 9.778   -1.145  16.839  1.00 20.02 ? 601 HEM A CAA 1 
HETATM 8803 C  CBA . HEM E 3 .   ? 8.665   -0.090  17.020  1.00 21.85 ? 601 HEM A CBA 1 
HETATM 8804 C  CGA . HEM E 3 .   ? 7.353   -0.648  17.572  1.00 22.56 ? 601 HEM A CGA 1 
HETATM 8805 O  O1A . HEM E 3 .   ? 7.346   -1.721  18.230  1.00 22.08 ? 601 HEM A O1A 1 
HETATM 8806 O  O2A . HEM E 3 .   ? 6.284   -0.017  17.348  1.00 22.43 ? 601 HEM A O2A 1 
HETATM 8807 C  C1B . HEM E 3 .   ? 13.683  1.518   12.781  1.00 21.61 ? 601 HEM A C1B 1 
HETATM 8808 C  C2B . HEM E 3 .   ? 14.047  2.023   11.472  1.00 21.36 ? 601 HEM A C2B 1 
HETATM 8809 C  C3B . HEM E 3 .   ? 15.119  2.825   11.642  1.00 21.87 ? 601 HEM A C3B 1 
HETATM 8810 C  C4B . HEM E 3 .   ? 15.443  2.863   13.049  1.00 21.97 ? 601 HEM A C4B 1 
HETATM 8811 C  CMB . HEM E 3 .   ? 13.314  1.669   10.143  1.00 19.24 ? 601 HEM A CMB 1 
HETATM 8812 C  CAB . HEM E 3 .   ? 15.928  3.640   10.609  1.00 23.58 ? 601 HEM A CAB 1 
HETATM 8813 C  CBB . HEM E 3 .   ? 15.916  3.376   9.302   1.00 25.77 ? 601 HEM A CBB 1 
HETATM 8814 C  C1C . HEM E 3 .   ? 16.790  3.653   14.938  1.00 21.83 ? 601 HEM A C1C 1 
HETATM 8815 C  C2C . HEM E 3 .   ? 17.845  4.451   15.507  1.00 21.57 ? 601 HEM A C2C 1 
HETATM 8816 C  C3C . HEM E 3 .   ? 17.850  4.213   16.818  1.00 21.18 ? 601 HEM A C3C 1 
HETATM 8817 C  C4C . HEM E 3 .   ? 16.800  3.280   17.143  1.00 20.34 ? 601 HEM A C4C 1 
HETATM 8818 C  CMC . HEM E 3 .   ? 18.804  5.414   14.744  1.00 23.09 ? 601 HEM A CMC 1 
HETATM 8819 C  CAC . HEM E 3 .   ? 18.816  4.862   17.816  1.00 23.18 ? 601 HEM A CAC 1 
HETATM 8820 C  CBC . HEM E 3 .   ? 18.350  5.836   18.593  1.00 25.43 ? 601 HEM A CBC 1 
HETATM 8821 C  C1D . HEM E 3 .   ? 15.380  2.072   18.754  1.00 21.33 ? 601 HEM A C1D 1 
HETATM 8822 C  C2D . HEM E 3 .   ? 15.065  1.651   20.103  1.00 21.39 ? 601 HEM A C2D 1 
HETATM 8823 C  C3D . HEM E 3 .   ? 13.745  0.902   19.977  1.00 19.81 ? 601 HEM A C3D 1 
HETATM 8824 C  C4D . HEM E 3 .   ? 13.394  0.968   18.570  1.00 21.33 ? 601 HEM A C4D 1 
HETATM 8825 C  CMD . HEM E 3 .   ? 15.918  1.881   21.379  1.00 20.41 ? 601 HEM A CMD 1 
HETATM 8826 C  CAD . HEM E 3 .   ? 12.926  0.265   21.123  1.00 19.09 ? 601 HEM A CAD 1 
HETATM 8827 C  CBD . HEM E 3 .   ? 12.093  1.425   21.678  1.00 18.55 ? 601 HEM A CBD 1 
HETATM 8828 C  CGD . HEM E 3 .   ? 11.246  1.022   22.879  1.00 20.43 ? 601 HEM A CGD 1 
HETATM 8829 O  O1D . HEM E 3 .   ? 10.773  1.910   23.624  1.00 20.03 ? 601 HEM A O1D 1 
HETATM 8830 O  O2D . HEM E 3 .   ? 11.013  -0.181  23.118  1.00 22.42 ? 601 HEM A O2D 1 
HETATM 8831 N  NA  . HEM E 3 .   ? 12.791  0.817   15.583  1.00 19.78 ? 601 HEM A NA  1 
HETATM 8832 N  NB  . HEM E 3 .   ? 14.531  2.085   13.718  1.00 21.58 ? 601 HEM A NB  1 
HETATM 8833 N  NC  . HEM E 3 .   ? 16.146  2.983   15.975  1.00 20.98 ? 601 HEM A NC  1 
HETATM 8834 N  ND  . HEM E 3 .   ? 14.360  1.685   17.893  1.00 20.28 ? 601 HEM A ND  1 
HETATM 8835 FE FE  . HEM E 3 .   ? 14.401  1.958   15.780  1.00 21.19 ? 601 HEM A FE  1 
HETATM 8836 C  C1  . CLR F 4 .   ? 12.968  -9.499  14.313  1.00 15.59 ? 602 CLR A C1  1 
HETATM 8837 C  C2  . CLR F 4 .   ? 12.064  -10.693 13.929  1.00 16.05 ? 602 CLR A C2  1 
HETATM 8838 C  C3  . CLR F 4 .   ? 11.347  -11.247 15.166  1.00 16.64 ? 602 CLR A C3  1 
HETATM 8839 C  C4  . CLR F 4 .   ? 10.430  -10.158 15.721  1.00 16.08 ? 602 CLR A C4  1 
HETATM 8840 C  C5  . CLR F 4 .   ? 11.239  -8.906  15.978  1.00 15.74 ? 602 CLR A C5  1 
HETATM 8841 C  C6  . CLR F 4 .   ? 11.094  -8.339  17.191  1.00 14.90 ? 602 CLR A C6  1 
HETATM 8842 C  C7  . CLR F 4 .   ? 11.915  -7.161  17.664  1.00 16.98 ? 602 CLR A C7  1 
HETATM 8843 C  C8  . CLR F 4 .   ? 12.432  -6.332  16.477  1.00 17.16 ? 602 CLR A C8  1 
HETATM 8844 C  C9  . CLR F 4 .   ? 13.112  -7.276  15.478  1.00 16.08 ? 602 CLR A C9  1 
HETATM 8845 C  C10 . CLR F 4 .   ? 12.149  -8.341  14.897  1.00 15.08 ? 602 CLR A C10 1 
HETATM 8846 C  C11 . CLR F 4 .   ? 13.895  -6.510  14.381  1.00 15.89 ? 602 CLR A C11 1 
HETATM 8847 C  C12 . CLR F 4 .   ? 14.873  -5.486  14.943  1.00 16.50 ? 602 CLR A C12 1 
HETATM 8848 C  C13 . CLR F 4 .   ? 14.138  -4.466  15.831  1.00 17.62 ? 602 CLR A C13 1 
HETATM 8849 C  C14 . CLR F 4 .   ? 13.457  -5.268  16.933  1.00 16.73 ? 602 CLR A C14 1 
HETATM 8850 C  C15 . CLR F 4 .   ? 13.052  -4.245  17.989  1.00 18.35 ? 602 CLR A C15 1 
HETATM 8851 C  C16 . CLR F 4 .   ? 14.233  -3.282  17.971  1.00 18.48 ? 602 CLR A C16 1 
HETATM 8852 C  C17 . CLR F 4 .   ? 15.062  -3.607  16.705  1.00 18.28 ? 602 CLR A C17 1 
HETATM 8853 C  C18 . CLR F 4 .   ? 13.168  -3.559  15.033  1.00 16.63 ? 602 CLR A C18 1 
HETATM 8854 C  C19 . CLR F 4 .   ? 11.295  -7.734  13.785  1.00 13.32 ? 602 CLR A C19 1 
HETATM 8855 C  C20 . CLR F 4 .   ? 15.695  -2.325  16.108  1.00 19.08 ? 602 CLR A C20 1 
HETATM 8856 C  C21 . CLR F 4 .   ? 16.576  -2.571  14.867  1.00 18.77 ? 602 CLR A C21 1 
HETATM 8857 C  C22 . CLR F 4 .   ? 16.497  -1.546  17.161  1.00 19.04 ? 602 CLR A C22 1 
HETATM 8858 C  C23 . CLR F 4 .   ? 17.657  -2.360  17.750  1.00 21.80 ? 602 CLR A C23 1 
HETATM 8859 C  C24 . CLR F 4 .   ? 18.324  -1.711  18.968  1.00 23.36 ? 602 CLR A C24 1 
HETATM 8860 C  C25 . CLR F 4 .   ? 19.220  -2.673  19.752  1.00 25.19 ? 602 CLR A C25 1 
HETATM 8861 C  C26 . CLR F 4 .   ? 19.710  -2.024  21.051  1.00 25.86 ? 602 CLR A C26 1 
HETATM 8862 C  C27 . CLR F 4 .   ? 20.427  -3.110  18.916  1.00 25.40 ? 602 CLR A C27 1 
HETATM 8863 O  O1  . CLR F 4 .   ? 10.564  -12.421 14.865  1.00 18.29 ? 602 CLR A O1  1 
HETATM 8864 C  CHA . HEM G 3 .   ? 64.810  -0.571  -25.695 1.00 18.68 ? 601 HEM B CHA 1 
HETATM 8865 C  CHB . HEM G 3 .   ? 60.042  -0.841  -26.603 1.00 17.35 ? 601 HEM B CHB 1 
HETATM 8866 C  CHC . HEM G 3 .   ? 59.530  -3.731  -22.705 1.00 18.14 ? 601 HEM B CHC 1 
HETATM 8867 C  CHD . HEM G 3 .   ? 64.191  -3.064  -21.526 1.00 20.40 ? 601 HEM B CHD 1 
HETATM 8868 C  C1A . HEM G 3 .   ? 63.572  -0.416  -26.276 1.00 19.27 ? 601 HEM B C1A 1 
HETATM 8869 C  C2A . HEM G 3 .   ? 63.313  0.293   -27.518 1.00 18.65 ? 601 HEM B C2A 1 
HETATM 8870 C  C3A . HEM G 3 .   ? 62.007  0.218   -27.766 1.00 17.56 ? 601 HEM B C3A 1 
HETATM 8871 C  C4A . HEM G 3 .   ? 61.384  -0.544  -26.695 1.00 17.72 ? 601 HEM B C4A 1 
HETATM 8872 C  CMA . HEM G 3 .   ? 61.245  0.809   -28.978 1.00 16.24 ? 601 HEM B CMA 1 
HETATM 8873 C  CAA . HEM G 3 .   ? 64.402  0.979   -28.393 1.00 19.31 ? 601 HEM B CAA 1 
HETATM 8874 C  CBA . HEM G 3 .   ? 64.863  -0.101  -29.395 1.00 20.90 ? 601 HEM B CBA 1 
HETATM 8875 C  CGA . HEM G 3 .   ? 65.651  0.486   -30.556 1.00 21.30 ? 601 HEM B CGA 1 
HETATM 8876 O  O1A . HEM G 3 .   ? 66.310  1.544   -30.411 1.00 22.71 ? 601 HEM B O1A 1 
HETATM 8877 O  O2A . HEM G 3 .   ? 65.631  -0.099  -31.659 1.00 21.98 ? 601 HEM B O2A 1 
HETATM 8878 C  C1B . HEM G 3 .   ? 59.482  -1.664  -25.640 1.00 18.97 ? 601 HEM B C1B 1 
HETATM 8879 C  C2B . HEM G 3 .   ? 58.100  -2.128  -25.587 1.00 18.04 ? 601 HEM B C2B 1 
HETATM 8880 C  C3B . HEM G 3 .   ? 57.988  -2.916  -24.505 1.00 17.88 ? 601 HEM B C3B 1 
HETATM 8881 C  C4B . HEM G 3 .   ? 59.273  -2.985  -23.841 1.00 18.96 ? 601 HEM B C4B 1 
HETATM 8882 C  CMB . HEM G 3 .   ? 56.982  -1.778  -26.623 1.00 17.91 ? 601 HEM B CMB 1 
HETATM 8883 C  CAB . HEM G 3 .   ? 56.758  -3.680  -23.966 1.00 21.29 ? 601 HEM B CAB 1 
HETATM 8884 C  CBB . HEM G 3 .   ? 55.686  -3.935  -24.718 1.00 24.19 ? 601 HEM B CBB 1 
HETATM 8885 C  C1C . HEM G 3 .   ? 60.737  -3.852  -22.052 1.00 20.13 ? 601 HEM B C1C 1 
HETATM 8886 C  C2C . HEM G 3 .   ? 61.045  -4.695  -20.911 1.00 20.73 ? 601 HEM B C2C 1 
HETATM 8887 C  C3C . HEM G 3 .   ? 62.325  -4.499  -20.609 1.00 20.79 ? 601 HEM B C3C 1 
HETATM 8888 C  C4C . HEM G 3 .   ? 62.893  -3.535  -21.530 1.00 21.00 ? 601 HEM B C4C 1 
HETATM 8889 C  CMC . HEM G 3 .   ? 60.115  -5.686  -20.157 1.00 21.28 ? 601 HEM B CMC 1 
HETATM 8890 C  CAC . HEM G 3 .   ? 63.061  -5.198  -19.467 1.00 21.85 ? 601 HEM B CAC 1 
HETATM 8891 C  CBC . HEM G 3 .   ? 63.889  -6.190  -19.784 1.00 26.67 ? 601 HEM B CBC 1 
HETATM 8892 C  C1D . HEM G 3 .   ? 64.792  -2.303  -22.512 1.00 21.30 ? 601 HEM B C1D 1 
HETATM 8893 C  C2D . HEM G 3 .   ? 66.170  -1.860  -22.496 1.00 21.02 ? 601 HEM B C2D 1 
HETATM 8894 C  C3D . HEM G 3 .   ? 66.350  -1.090  -23.794 1.00 20.42 ? 601 HEM B C3D 1 
HETATM 8895 C  C4D . HEM G 3 .   ? 65.082  -1.161  -24.473 1.00 20.89 ? 601 HEM B C4D 1 
HETATM 8896 C  CMD . HEM G 3 .   ? 67.232  -2.099  -21.397 1.00 21.65 ? 601 HEM B CMD 1 
HETATM 8897 C  CAD . HEM G 3 .   ? 67.633  -0.421  -24.316 1.00 20.25 ? 601 HEM B CAD 1 
HETATM 8898 C  CBD . HEM G 3 .   ? 68.415  -1.602  -24.898 1.00 20.60 ? 601 HEM B CBD 1 
HETATM 8899 C  CGD . HEM G 3 .   ? 69.765  -1.180  -25.456 1.00 22.02 ? 601 HEM B CGD 1 
HETATM 8900 O  O1D . HEM G 3 .   ? 70.607  -2.073  -25.731 1.00 20.88 ? 601 HEM B O1D 1 
HETATM 8901 O  O2D . HEM G 3 .   ? 70.000  0.034   -25.652 1.00 22.79 ? 601 HEM B O2D 1 
HETATM 8902 N  NA  . HEM G 3 .   ? 62.378  -0.942  -25.818 1.00 18.15 ? 601 HEM B NA  1 
HETATM 8903 N  NB  . HEM G 3 .   ? 60.177  -2.233  -24.582 1.00 17.87 ? 601 HEM B NB  1 
HETATM 8904 N  NC  . HEM G 3 .   ? 61.903  -3.196  -22.426 1.00 18.93 ? 601 HEM B NC  1 
HETATM 8905 N  ND  . HEM G 3 .   ? 64.193  -1.889  -23.694 1.00 19.03 ? 601 HEM B ND  1 
HETATM 8906 FE FE  . HEM G 3 .   ? 62.160  -2.127  -24.190 1.00 19.39 ? 601 HEM B FE  1 
HETATM 8907 C  C1  . CLR H 4 .   ? 61.067  9.355   -25.928 1.00 16.18 ? 602 CLR B C1  1 
HETATM 8908 C  C2  . CLR H 4 .   ? 60.939  10.560  -26.883 1.00 16.96 ? 602 CLR B C2  1 
HETATM 8909 C  C3  . CLR H 4 .   ? 62.331  11.057  -27.287 1.00 17.73 ? 602 CLR B C3  1 
HETATM 8910 C  C4  . CLR H 4 .   ? 63.013  9.953   -28.085 1.00 16.53 ? 602 CLR B C4  1 
HETATM 8911 C  C5  . CLR H 4 .   ? 63.074  8.714   -27.217 1.00 16.07 ? 602 CLR B C5  1 
HETATM 8912 C  C6  . CLR H 4 .   ? 64.291  8.168   -27.028 1.00 14.08 ? 602 CLR B C6  1 
HETATM 8913 C  C7  . CLR H 4 .   ? 64.550  6.989   -26.131 1.00 16.57 ? 602 CLR B C7  1 
HETATM 8914 C  C8  . CLR H 4 .   ? 63.274  6.170   -25.924 1.00 16.17 ? 602 CLR B C8  1 
HETATM 8915 C  C9  . CLR H 4 .   ? 62.143  7.120   -25.495 1.00 16.36 ? 602 CLR B C9  1 
HETATM 8916 C  C10 . CLR H 4 .   ? 61.800  8.173   -26.583 1.00 16.50 ? 602 CLR B C10 1 
HETATM 8917 C  C11 . CLR H 4 .   ? 60.885  6.371   -24.989 1.00 15.38 ? 602 CLR B C11 1 
HETATM 8918 C  C12 . CLR H 4 .   ? 61.209  5.312   -23.945 1.00 16.98 ? 602 CLR B C12 1 
HETATM 8919 C  C13 . CLR H 4 .   ? 62.252  4.302   -24.453 1.00 17.55 ? 602 CLR B C13 1 
HETATM 8920 C  C14 . CLR H 4 .   ? 63.486  5.102   -24.846 1.00 16.86 ? 602 CLR B C14 1 
HETATM 8921 C  C15 . CLR H 4 .   ? 64.593  4.071   -25.025 1.00 18.48 ? 602 CLR B C15 1 
HETATM 8922 C  C16 . CLR H 4 .   ? 64.295  3.106   -23.878 1.00 19.11 ? 602 CLR B C16 1 
HETATM 8923 C  C17 . CLR H 4 .   ? 62.882  3.443   -23.351 1.00 18.85 ? 602 CLR B C17 1 
HETATM 8924 C  C18 . CLR H 4 .   ? 61.732  3.419   -25.610 1.00 17.38 ? 602 CLR B C18 1 
HETATM 8925 C  C19 . CLR H 4 .   ? 60.917  7.537   -27.662 1.00 16.10 ? 602 CLR B C19 1 
HETATM 8926 C  C20 . CLR H 4 .   ? 62.150  2.169   -22.867 1.00 20.07 ? 602 CLR B C20 1 
HETATM 8927 C  C21 . CLR H 4 .   ? 60.720  2.431   -22.372 1.00 18.82 ? 602 CLR B C21 1 
HETATM 8928 C  C22 . CLR H 4 .   ? 62.966  1.412   -21.803 1.00 18.80 ? 602 CLR B C22 1 
HETATM 8929 C  C23 . CLR H 4 .   ? 63.169  2.213   -20.504 1.00 23.21 ? 602 CLR B C23 1 
HETATM 8930 C  C24 . CLR H 4 .   ? 64.342  1.689   -19.663 1.00 25.37 ? 602 CLR B C24 1 
HETATM 8931 C  C25 . CLR H 4 .   ? 64.747  2.558   -18.469 1.00 26.49 ? 602 CLR B C25 1 
HETATM 8932 C  C26 . CLR H 4 .   ? 65.873  1.854   -17.713 1.00 25.94 ? 602 CLR B C26 1 
HETATM 8933 C  C27 . CLR H 4 .   ? 63.589  2.806   -17.502 1.00 25.94 ? 602 CLR B C27 1 
HETATM 8934 O  O1  . CLR H 4 .   ? 62.269  12.242  -28.083 1.00 19.11 ? 602 CLR B O1  1 
HETATM 8935 FE FE1 . FES I 5 .   ? 1.938   12.280  22.293  1.00 47.11 ? 150 FES C FE1 1 
HETATM 8936 FE FE2 . FES I 5 .   ? 0.472   14.809  21.608  1.00 50.42 ? 150 FES C FE2 1 
HETATM 8937 S  S1  . FES I 5 .   ? 1.408   13.219  20.379  1.00 48.94 ? 150 FES C S1  1 
HETATM 8938 S  S2  . FES I 5 .   ? 0.699   13.685  23.470  1.00 50.77 ? 150 FES C S2  1 
HETATM 8939 FE FE1 . FES J 5 .   ? 71.680  -12.441 -34.474 1.00 47.55 ? 151 FES D FE1 1 
HETATM 8940 FE FE2 . FES J 5 .   ? 71.261  -14.825 -36.347 1.00 51.46 ? 151 FES D FE2 1 
HETATM 8941 S  S1  . FES J 5 .   ? 69.929  -13.270 -35.507 1.00 48.26 ? 151 FES D S1  1 
HETATM 8942 S  S2  . FES J 5 .   ? 73.022  -13.956 -35.375 1.00 49.98 ? 151 FES D S2  1 
HETATM 8943 O  O   . HOH K 6 .   ? 26.425  -22.785 16.331  1.00 25.64 ? 1   HOH A O   1 
HETATM 8944 O  O   . HOH K 6 .   ? 15.838  -0.557  5.112   1.00 20.60 ? 489 HOH A O   1 
HETATM 8945 O  O   . HOH K 6 .   ? 8.124   -4.928  1.410   1.00 23.03 ? 490 HOH A O   1 
HETATM 8946 O  O   . HOH K 6 .   ? 26.122  15.235  24.926  1.00 23.88 ? 491 HOH A O   1 
HETATM 8947 O  O   . HOH K 6 .   ? 3.195   1.832   20.764  1.00 20.57 ? 492 HOH A O   1 
HETATM 8948 O  O   . HOH K 6 .   ? 14.348  10.038  17.622  1.00 19.43 ? 493 HOH A O   1 
HETATM 8949 O  O   . HOH K 6 .   ? 13.680  -7.545  10.479  1.00 12.89 ? 494 HOH A O   1 
HETATM 8950 O  O   . HOH K 6 .   ? 11.220  -4.791  23.186  1.00 19.95 ? 495 HOH A O   1 
HETATM 8951 O  O   . HOH K 6 .   ? 32.263  0.220   8.339   1.00 18.51 ? 496 HOH A O   1 
HETATM 8952 O  O   . HOH K 6 .   ? 27.017  0.324   -1.705  1.00 20.55 ? 497 HOH A O   1 
HETATM 8953 O  O   . HOH K 6 .   ? 29.673  18.785  14.408  1.00 24.92 ? 498 HOH A O   1 
HETATM 8954 O  O   . HOH K 6 .   ? 7.172   -4.290  17.091  1.00 17.34 ? 499 HOH A O   1 
HETATM 8955 O  O   . HOH K 6 .   ? 6.647   -9.464  6.927   1.00 20.01 ? 500 HOH A O   1 
HETATM 8956 O  O   . HOH K 6 .   ? 5.223   -17.236 10.130  1.00 28.38 ? 501 HOH A O   1 
HETATM 8957 O  O   . HOH K 6 .   ? 10.850  -1.045  9.286   1.00 20.61 ? 502 HOH A O   1 
HETATM 8958 O  O   . HOH K 6 .   ? 21.810  -0.624  14.188  1.00 22.26 ? 503 HOH A O   1 
HETATM 8959 O  O   . HOH K 6 .   ? 27.909  -2.624  11.412  1.00 26.64 ? 504 HOH A O   1 
HETATM 8960 O  O   . HOH K 6 .   ? 34.124  6.209   5.368   1.00 31.05 ? 505 HOH A O   1 
HETATM 8961 O  O   . HOH K 6 .   ? 32.151  -0.897  1.443   1.00 27.52 ? 506 HOH A O   1 
HETATM 8962 O  O   . HOH K 6 .   ? 8.464   13.868  17.656  1.00 40.27 ? 507 HOH A O   1 
HETATM 8963 O  O   . HOH K 6 .   ? 2.598   -28.792 13.295  1.00 31.74 ? 508 HOH A O   1 
HETATM 8964 O  O   . HOH K 6 .   ? 5.878   3.907   11.381  1.00 24.57 ? 509 HOH A O   1 
HETATM 8965 O  O   . HOH K 6 .   ? 21.416  3.424   -12.874 1.00 24.93 ? 510 HOH A O   1 
HETATM 8966 O  O   . HOH K 6 .   ? 12.344  -6.406  21.195  1.00 26.14 ? 515 HOH A O   1 
HETATM 8967 O  O   . HOH K 6 .   ? 15.601  4.315   -14.515 1.00 29.59 ? 516 HOH A O   1 
HETATM 8968 O  O   . HOH K 6 .   ? 15.264  -22.132 28.197  1.00 36.27 ? 517 HOH A O   1 
HETATM 8969 O  O   . HOH K 6 .   ? 30.933  11.795  15.550  1.00 25.59 ? 518 HOH A O   1 
HETATM 8970 O  O   . HOH K 6 .   ? 36.009  4.466   -9.450  1.00 25.49 ? 519 HOH A O   1 
HETATM 8971 O  O   . HOH K 6 .   ? 14.079  -5.312  1.318   1.00 22.13 ? 520 HOH A O   1 
HETATM 8972 O  O   . HOH K 6 .   ? 14.948  -16.858 11.180  1.00 27.62 ? 521 HOH A O   1 
HETATM 8973 O  O   . HOH K 6 .   ? 20.487  -1.511  1.622   1.00 25.61 ? 522 HOH A O   1 
HETATM 8974 O  O   . HOH K 6 .   ? 8.772   -5.703  24.393  1.00 28.34 ? 523 HOH A O   1 
HETATM 8975 O  O   . HOH K 6 .   ? -6.724  -16.593 6.643   1.00 27.62 ? 524 HOH A O   1 
HETATM 8976 O  O   . HOH K 6 .   ? 27.943  1.063   -10.629 1.00 27.84 ? 525 HOH A O   1 
HETATM 8977 O  O   . HOH K 6 .   ? 7.930   -15.095 12.010  1.00 25.28 ? 526 HOH A O   1 
HETATM 8978 O  O   . HOH K 6 .   ? 32.258  -15.212 23.788  1.00 29.75 ? 527 HOH A O   1 
HETATM 8979 O  O   . HOH K 6 .   ? 14.450  -11.336 -1.081  1.00 27.56 ? 528 HOH A O   1 
HETATM 8980 O  O   . HOH K 6 .   ? 34.528  12.071  10.500  1.00 26.97 ? 529 HOH A O   1 
HETATM 8981 O  O   . HOH K 6 .   ? 34.252  -9.448  22.830  1.00 28.55 ? 530 HOH A O   1 
HETATM 8982 O  O   . HOH K 6 .   ? 8.350   -21.798 4.527   1.00 33.11 ? 531 HOH A O   1 
HETATM 8983 O  O   . HOH K 6 .   ? 31.073  -7.424  11.573  1.00 32.57 ? 532 HOH A O   1 
HETATM 8984 O  O   . HOH K 6 .   ? 30.232  19.009  1.355   1.00 31.29 ? 533 HOH A O   1 
HETATM 8985 O  O   . HOH K 6 .   ? 38.273  4.579   -7.660  1.00 26.05 ? 534 HOH A O   1 
HETATM 8986 O  O   . HOH K 6 .   ? -4.946  -9.288  7.889   1.00 26.28 ? 535 HOH A O   1 
HETATM 8987 O  O   . HOH K 6 .   ? 19.770  -10.726 -4.715  1.00 44.49 ? 536 HOH A O   1 
HETATM 8988 O  O   . HOH K 6 .   ? 6.757   7.722   22.454  1.00 31.71 ? 537 HOH A O   1 
HETATM 8989 O  O   . HOH K 6 .   ? 8.560   -12.290 12.926  1.00 27.34 ? 538 HOH A O   1 
HETATM 8990 O  O   . HOH K 6 .   ? 8.762   -11.931 24.266  1.00 21.90 ? 539 HOH A O   1 
HETATM 8991 O  O   . HOH K 6 .   ? 3.782   5.741   13.505  1.00 35.33 ? 540 HOH A O   1 
HETATM 8992 O  O   . HOH K 6 .   ? 6.016   -15.452 23.471  1.00 32.49 ? 541 HOH A O   1 
HETATM 8993 O  O   . HOH K 6 .   ? 26.203  -7.991  -6.066  1.00 25.80 ? 542 HOH A O   1 
HETATM 8994 O  O   . HOH K 6 .   ? 29.320  -5.159  0.814   1.00 36.10 ? 543 HOH A O   1 
HETATM 8995 O  O   . HOH K 6 .   ? -14.279 -9.157  13.122  1.00 36.98 ? 544 HOH A O   1 
HETATM 8996 O  O   . HOH K 6 .   ? 30.177  3.177   34.489  1.00 35.72 ? 545 HOH A O   1 
HETATM 8997 O  O   . HOH K 6 .   ? 1.461   -12.671 0.642   1.00 28.25 ? 546 HOH A O   1 
HETATM 8998 O  O   . HOH K 6 .   ? 30.304  18.006  16.873  1.00 26.68 ? 547 HOH A O   1 
HETATM 8999 O  O   . HOH K 6 .   ? 5.518   11.137  12.622  1.00 39.68 ? 548 HOH A O   1 
HETATM 9000 O  O   . HOH K 6 .   ? 38.098  1.306   9.250   1.00 37.25 ? 549 HOH A O   1 
HETATM 9001 O  O   . HOH K 6 .   ? 32.856  20.453  37.484  1.00 38.59 ? 550 HOH A O   1 
HETATM 9002 O  O   . HOH K 6 .   ? 26.663  -2.911  -0.827  1.00 22.64 ? 551 HOH A O   1 
HETATM 9003 O  O   . HOH K 6 .   ? 2.382   -19.902 -0.641  1.00 39.40 ? 552 HOH A O   1 
HETATM 9004 O  O   . HOH K 6 .   ? 23.397  19.593  25.195  1.00 36.25 ? 553 HOH A O   1 
HETATM 9005 O  O   . HOH K 6 .   ? 9.592   -4.625  15.297  1.00 24.43 ? 554 HOH A O   1 
HETATM 9006 O  O   . HOH K 6 .   ? 9.631   10.520  5.819   1.00 30.82 ? 555 HOH A O   1 
HETATM 9007 O  O   . HOH K 6 .   ? -0.538  2.735   -3.324  1.00 37.76 ? 556 HOH A O   1 
HETATM 9008 O  O   . HOH K 6 .   ? 5.818   14.138  2.319   1.00 22.39 ? 557 HOH A O   1 
HETATM 9009 O  O   . HOH K 6 .   ? 18.414  16.775  23.232  1.00 32.14 ? 558 HOH A O   1 
HETATM 9010 O  O   . HOH K 6 .   ? -10.097 -1.087  10.773  1.00 46.70 ? 559 HOH A O   1 
HETATM 9011 O  O   . HOH K 6 .   ? 16.660  23.810  22.327  1.00 44.46 ? 560 HOH A O   1 
HETATM 9012 O  O   . HOH K 6 .   ? 4.414   -28.133 9.694   1.00 32.92 ? 561 HOH A O   1 
HETATM 9013 O  O   . HOH K 6 .   ? 9.490   8.401   7.678   1.00 32.90 ? 562 HOH A O   1 
HETATM 9014 O  O   . HOH K 6 .   ? 18.351  15.636  -12.304 1.00 36.17 ? 563 HOH A O   1 
HETATM 9015 O  O   . HOH K 6 .   ? 0.175   4.618   21.898  1.00 40.33 ? 564 HOH A O   1 
HETATM 9016 O  O   . HOH K 6 .   ? 3.038   -10.128 0.195   1.00 26.30 ? 565 HOH A O   1 
HETATM 9017 O  O   . HOH K 6 .   ? 5.944   -2.287  4.223   1.00 31.66 ? 566 HOH A O   1 
HETATM 9018 O  O   . HOH K 6 .   ? 0.288   5.796   6.933   1.00 48.61 ? 567 HOH A O   1 
HETATM 9019 O  O   . HOH K 6 .   ? -6.643  -3.437  -4.194  1.00 37.36 ? 568 HOH A O   1 
HETATM 9020 O  O   . HOH K 6 .   ? 31.613  -12.149 17.519  1.00 22.48 ? 569 HOH A O   1 
HETATM 9021 O  O   . HOH K 6 .   ? 14.566  22.719  -9.157  1.00 29.33 ? 570 HOH A O   1 
HETATM 9022 O  O   . HOH K 6 .   ? 2.122   6.391   15.925  1.00 31.33 ? 571 HOH A O   1 
HETATM 9023 O  O   . HOH K 6 .   ? 13.312  -2.767  -5.765  1.00 33.94 ? 572 HOH A O   1 
HETATM 9024 O  O   . HOH K 6 .   ? 8.858   -13.745 16.359  1.00 32.12 ? 573 HOH A O   1 
HETATM 9025 O  O   . HOH K 6 .   ? 14.610  -19.920 12.972  1.00 26.47 ? 574 HOH A O   1 
HETATM 9026 O  O   . HOH K 6 .   ? 34.449  -6.142  16.338  1.00 30.45 ? 575 HOH A O   1 
HETATM 9027 O  O   . HOH K 6 .   ? 4.024   0.693   3.498   1.00 45.80 ? 576 HOH A O   1 
HETATM 9028 O  O   . HOH K 6 .   ? 4.886   -27.639 19.861  1.00 32.70 ? 577 HOH A O   1 
HETATM 9029 O  O   . HOH K 6 .   ? 24.169  12.825  9.655   1.00 22.47 ? 578 HOH A O   1 
HETATM 9030 O  O   . HOH K 6 .   ? 10.848  -13.386 23.923  1.00 21.38 ? 579 HOH A O   1 
HETATM 9031 O  O   . HOH K 6 .   ? 22.756  6.739   12.849  1.00 25.64 ? 580 HOH A O   1 
HETATM 9032 O  O   . HOH K 6 .   ? 32.293  13.918  -14.282 1.00 31.97 ? 581 HOH A O   1 
HETATM 9033 O  O   . HOH K 6 .   ? 26.310  -4.068  -8.040  1.00 31.33 ? 582 HOH A O   1 
HETATM 9034 O  O   . HOH K 6 .   ? 33.280  10.060  25.331  1.00 40.97 ? 583 HOH A O   1 
HETATM 9035 O  O   . HOH K 6 .   ? 5.503   -17.167 15.796  1.00 34.13 ? 584 HOH A O   1 
HETATM 9036 O  O   . HOH K 6 .   ? 13.230  2.760   34.233  1.00 37.32 ? 585 HOH A O   1 
HETATM 9037 O  O   . HOH K 6 .   ? 21.916  -1.295  27.895  1.00 34.14 ? 586 HOH A O   1 
HETATM 9038 O  O   . HOH K 6 .   ? 27.890  20.999  14.031  1.00 41.74 ? 587 HOH A O   1 
HETATM 9039 O  O   . HOH K 6 .   ? 9.493   18.680  3.759   1.00 35.37 ? 588 HOH A O   1 
HETATM 9040 O  O   . HOH K 6 .   ? 0.595   -23.159 14.666  1.00 29.68 ? 589 HOH A O   1 
HETATM 9041 O  O   . HOH K 6 .   ? -0.938  -2.948  24.152  1.00 49.42 ? 590 HOH A O   1 
HETATM 9042 O  O   . HOH K 6 .   ? 8.287   -1.757  36.171  1.00 33.79 ? 591 HOH A O   1 
HETATM 9043 O  O   . HOH K 6 .   ? 14.827  -4.424  3.795   1.00 17.75 ? 592 HOH A O   1 
HETATM 9044 O  O   . HOH K 6 .   ? 32.425  -9.575  18.059  1.00 30.04 ? 593 HOH A O   1 
HETATM 9045 O  O   . HOH K 6 .   ? 38.164  2.484   -6.102  1.00 31.34 ? 594 HOH A O   1 
HETATM 9046 O  O   . HOH K 6 .   ? 30.990  -12.973 15.105  1.00 25.77 ? 595 HOH A O   1 
HETATM 9047 O  O   . HOH K 6 .   ? 38.994  6.704   -6.031  1.00 24.27 ? 596 HOH A O   1 
HETATM 9048 O  O   . HOH K 6 .   ? 8.143   -8.844  -4.176  1.00 34.97 ? 597 HOH A O   1 
HETATM 9049 O  O   . HOH K 6 .   ? 18.125  -19.005 4.766   1.00 38.70 ? 598 HOH A O   1 
HETATM 9050 O  O   . HOH K 6 .   ? 22.117  9.641   -13.180 1.00 58.07 ? 599 HOH A O   1 
HETATM 9051 O  O   . HOH K 6 .   ? 19.054  -17.622 2.819   1.00 35.54 ? 600 HOH A O   1 
HETATM 9052 O  O   . HOH K 6 .   ? 9.782   -16.454 13.532  1.00 32.44 ? 603 HOH A O   1 
HETATM 9053 O  O   . HOH K 6 .   ? 14.497  -7.562  22.090  1.00 24.76 ? 604 HOH A O   1 
HETATM 9054 O  O   . HOH K 6 .   ? 31.556  -2.614  7.698   1.00 39.66 ? 605 HOH A O   1 
HETATM 9055 O  O   . HOH K 6 .   ? 29.788  -4.029  3.998   1.00 34.54 ? 606 HOH A O   1 
HETATM 9056 O  O   . HOH K 6 .   ? 17.032  -19.869 14.065  1.00 35.43 ? 607 HOH A O   1 
HETATM 9057 O  O   . HOH K 6 .   ? 10.365  -16.496 23.238  1.00 33.82 ? 608 HOH A O   1 
HETATM 9058 O  O   . HOH K 6 .   ? 33.021  0.351   -15.732 1.00 37.07 ? 609 HOH A O   1 
HETATM 9059 O  O   . HOH K 6 .   ? 33.873  -1.381  -4.110  1.00 36.54 ? 610 HOH A O   1 
HETATM 9060 O  O   . HOH K 6 .   ? -9.430  -16.401 7.161   1.00 38.47 ? 611 HOH A O   1 
HETATM 9061 O  O   . HOH K 6 .   ? 6.155   -10.958 -3.288  1.00 40.81 ? 612 HOH A O   1 
HETATM 9062 O  O   . HOH K 6 .   ? 21.329  23.240  -3.903  1.00 41.56 ? 613 HOH A O   1 
HETATM 9063 O  O   . HOH K 6 .   ? 9.415   -10.689 -2.011  1.00 41.00 ? 614 HOH A O   1 
HETATM 9064 O  O   . HOH K 6 .   ? 33.153  -12.935 25.153  1.00 41.32 ? 615 HOH A O   1 
HETATM 9065 O  O   . HOH K 6 .   ? 37.838  15.474  1.976   1.00 42.30 ? 616 HOH A O   1 
HETATM 9066 O  O   . HOH K 6 .   ? 17.740  2.947   -13.917 1.00 33.26 ? 617 HOH A O   1 
HETATM 9067 O  O   . HOH K 6 .   ? 39.287  -2.026  13.612  1.00 34.62 ? 618 HOH A O   1 
HETATM 9068 O  O   . HOH K 6 .   ? 25.566  -12.379 -0.763  1.00 44.82 ? 619 HOH A O   1 
HETATM 9069 O  O   . HOH K 6 .   ? 8.461   -16.433 15.896  1.00 39.36 ? 620 HOH A O   1 
HETATM 9070 O  O   . HOH K 6 .   ? 19.032  -21.846 12.968  1.00 25.36 ? 621 HOH A O   1 
HETATM 9071 O  O   . HOH K 6 .   ? 32.815  -8.166  15.902  1.00 30.55 ? 622 HOH A O   1 
HETATM 9072 O  O   . HOH K 6 .   ? 18.711  -23.639 10.748  1.00 41.61 ? 623 HOH A O   1 
HETATM 9073 O  O   . HOH K 6 .   ? 16.992  -3.194  4.910   1.00 17.53 ? 624 HOH A O   1 
HETATM 9074 O  O   . HOH K 6 .   ? 12.828  14.688  8.444   1.00 45.22 ? 625 HOH A O   1 
HETATM 9075 O  O   . HOH K 6 .   ? 22.196  -4.000  -8.743  1.00 31.83 ? 626 HOH A O   1 
HETATM 9076 O  O   . HOH K 6 .   ? 31.607  18.588  12.736  1.00 26.81 ? 627 HOH A O   1 
HETATM 9077 O  O   . HOH K 6 .   ? 28.019  -24.654 17.604  1.00 32.29 ? 628 HOH A O   1 
HETATM 9078 O  O   . HOH K 6 .   ? 25.213  -4.020  2.721   1.00 37.23 ? 629 HOH A O   1 
HETATM 9079 O  O   . HOH K 6 .   ? 5.507   -20.734 3.574   1.00 43.58 ? 630 HOH A O   1 
HETATM 9080 O  O   . HOH K 6 .   ? 16.400  17.091  -11.804 1.00 32.06 ? 631 HOH A O   1 
HETATM 9081 O  O   . HOH K 6 .   ? 6.745   3.354   5.006   1.00 33.30 ? 632 HOH A O   1 
HETATM 9082 O  O   . HOH K 6 .   ? 1.247   -16.168 21.567  1.00 25.61 ? 633 HOH A O   1 
HETATM 9083 O  O   . HOH K 6 .   ? 8.864   -5.435  27.039  1.00 30.72 ? 634 HOH A O   1 
HETATM 9084 O  O   . HOH K 6 .   ? 27.335  -1.926  31.262  1.00 39.38 ? 635 HOH A O   1 
HETATM 9085 O  O   . HOH K 6 .   ? 6.438   -23.814 8.997   1.00 26.80 ? 636 HOH A O   1 
HETATM 9086 O  O   . HOH K 6 .   ? 33.365  4.314   -12.867 1.00 32.98 ? 637 HOH A O   1 
HETATM 9087 O  O   . HOH K 6 .   ? 16.072  -15.554 26.681  1.00 34.13 ? 638 HOH A O   1 
HETATM 9088 O  O   . HOH K 6 .   ? 12.871  -8.995  -1.601  1.00 52.44 ? 639 HOH A O   1 
HETATM 9089 O  O   . HOH K 6 .   ? 15.084  -28.336 8.535   1.00 32.85 ? 640 HOH A O   1 
HETATM 9090 O  O   . HOH K 6 .   ? 4.904   -25.270 7.427   1.00 44.04 ? 641 HOH A O   1 
HETATM 9091 O  O   . HOH K 6 .   ? 12.377  -16.689 12.457  1.00 35.41 ? 642 HOH A O   1 
HETATM 9092 O  O   . HOH K 6 .   ? 22.882  23.344  5.280   1.00 36.79 ? 643 HOH A O   1 
HETATM 9093 O  O   . HOH K 6 .   ? 21.973  21.714  26.821  1.00 43.92 ? 644 HOH A O   1 
HETATM 9094 O  O   . HOH K 6 .   ? 36.022  14.426  11.366  1.00 46.36 ? 645 HOH A O   1 
HETATM 9095 O  O   . HOH K 6 .   ? 1.238   -4.921  24.423  1.00 28.67 ? 646 HOH A O   1 
HETATM 9096 O  O   . HOH K 6 .   ? 11.320  -3.622  33.175  1.00 32.28 ? 647 HOH A O   1 
HETATM 9097 O  O   . HOH K 6 .   ? 36.012  1.300   -6.110  1.00 36.52 ? 648 HOH A O   1 
HETATM 9098 O  O   . HOH K 6 .   ? 11.082  22.286  -3.112  1.00 42.97 ? 649 HOH A O   1 
HETATM 9099 O  O   . HOH K 6 .   ? 31.399  19.103  8.186   1.00 35.59 ? 650 HOH A O   1 
HETATM 9100 O  O   . HOH K 6 .   ? 26.674  21.940  10.545  1.00 34.12 ? 651 HOH A O   1 
HETATM 9101 O  O   . HOH K 6 .   ? 31.375  -5.877  28.062  1.00 50.05 ? 652 HOH A O   1 
HETATM 9102 O  O   . HOH K 6 .   ? 10.241  -8.836  30.305  1.00 47.70 ? 653 HOH A O   1 
HETATM 9103 O  O   . HOH K 6 .   ? 36.638  6.928   6.242   1.00 46.42 ? 654 HOH A O   1 
HETATM 9104 O  O   . HOH K 6 .   ? 31.468  -5.472  -2.725  1.00 38.88 ? 655 HOH A O   1 
HETATM 9105 O  O   . HOH K 6 .   ? 3.851   6.523   10.954  1.00 35.84 ? 657 HOH A O   1 
HETATM 9106 O  O   . HOH K 6 .   ? -2.924  -17.165 22.934  1.00 31.76 ? 658 HOH A O   1 
HETATM 9107 O  O   . HOH K 6 .   ? -6.722  -24.001 12.030  1.00 43.95 ? 659 HOH A O   1 
HETATM 9108 O  O   . HOH K 6 .   ? 13.640  -16.376 26.292  1.00 32.73 ? 660 HOH A O   1 
HETATM 9109 O  O   . HOH K 6 .   ? 12.577  -10.086 29.873  1.00 31.93 ? 661 HOH A O   1 
HETATM 9110 O  O   . HOH K 6 .   ? 9.459   -3.825  35.143  1.00 37.60 ? 662 HOH A O   1 
HETATM 9111 O  O   . HOH K 6 .   ? 11.944  -12.375 28.244  1.00 39.49 ? 663 HOH A O   1 
HETATM 9112 O  O   . HOH K 6 .   ? 37.978  12.428  -11.897 1.00 25.31 ? 664 HOH A O   1 
HETATM 9113 O  O   . HOH K 6 .   ? 28.974  -3.469  9.641   1.00 31.51 ? 665 HOH A O   1 
HETATM 9114 O  O   . HOH K 6 .   ? 4.545   -3.252  29.461  1.00 53.16 ? 666 HOH A O   1 
HETATM 9115 O  O   . HOH K 6 .   ? 27.560  -11.530 36.172  1.00 59.16 ? 667 HOH A O   1 
HETATM 9116 O  O   . HOH K 6 .   ? 26.892  3.804   27.833  1.00 43.22 ? 668 HOH A O   1 
HETATM 9117 O  O   . HOH K 6 .   ? -5.273  12.683  -4.996  1.00 63.20 ? 669 HOH A O   1 
HETATM 9118 O  O   . HOH K 6 .   ? 4.669   -7.382  -5.098  1.00 35.17 ? 670 HOH A O   1 
HETATM 9119 O  O   . HOH K 6 .   ? 35.791  -1.019  5.981   1.00 40.00 ? 671 HOH A O   1 
HETATM 9120 O  O   . HOH K 6 .   ? 5.532   -27.570 4.545   1.00 58.54 ? 672 HOH A O   1 
HETATM 9121 O  O   . HOH K 6 .   ? -10.623 -17.955 21.207  1.00 42.63 ? 673 HOH A O   1 
HETATM 9122 O  O   . HOH K 6 .   ? 25.448  18.410  31.597  1.00 41.00 ? 674 HOH A O   1 
HETATM 9123 O  O   . HOH K 6 .   ? 41.725  16.112  34.597  1.00 38.34 ? 675 HOH A O   1 
HETATM 9124 O  O   . HOH K 6 .   ? 4.313   11.829  2.754   1.00 40.81 ? 676 HOH A O   1 
HETATM 9125 O  O   . HOH K 6 .   ? 14.824  -4.464  -7.207  1.00 52.25 ? 677 HOH A O   1 
HETATM 9126 O  O   . HOH K 6 .   ? 21.758  24.024  18.419  1.00 46.18 ? 678 HOH A O   1 
HETATM 9127 O  O   . HOH K 6 .   ? 36.529  16.575  -1.024  1.00 41.12 ? 679 HOH A O   1 
HETATM 9128 O  O   . HOH K 6 .   ? 19.093  11.876  -11.729 1.00 35.63 ? 680 HOH A O   1 
HETATM 9129 O  O   . HOH K 6 .   ? 23.109  21.931  17.832  1.00 35.58 ? 681 HOH A O   1 
HETATM 9130 O  O   . HOH K 6 .   ? 24.379  20.845  3.384   1.00 31.28 ? 682 HOH A O   1 
HETATM 9131 O  O   . HOH K 6 .   ? 6.575   8.905   -8.926  1.00 37.04 ? 683 HOH A O   1 
HETATM 9132 O  O   . HOH K 6 .   ? 33.352  18.580  4.427   1.00 38.59 ? 684 HOH A O   1 
HETATM 9133 O  O   . HOH K 6 .   ? 21.475  -26.414 27.789  1.00 27.31 ? 685 HOH A O   1 
HETATM 9134 O  O   . HOH K 6 .   ? 16.163  16.099  29.885  1.00 44.81 ? 686 HOH A O   1 
HETATM 9135 O  O   . HOH K 6 .   ? -1.975  1.993   -1.121  1.00 38.61 ? 687 HOH A O   1 
HETATM 9136 O  O   . HOH K 6 .   ? -10.977 -7.780  11.511  1.00 35.69 ? 688 HOH A O   1 
HETATM 9137 O  O   . HOH K 6 .   ? 36.059  5.839   -11.646 1.00 39.50 ? 689 HOH A O   1 
HETATM 9138 O  O   . HOH K 6 .   ? 30.167  -0.538  -10.622 1.00 45.75 ? 690 HOH A O   1 
HETATM 9139 O  O   . HOH K 6 .   ? -12.692 -7.114  19.772  1.00 41.62 ? 691 HOH A O   1 
HETATM 9140 O  O   . HOH K 6 .   ? -9.862  -9.521  27.658  1.00 45.59 ? 692 HOH A O   1 
HETATM 9141 O  O   . HOH K 6 .   ? 33.338  11.222  22.566  1.00 47.86 ? 693 HOH A O   1 
HETATM 9142 O  O   . HOH K 6 .   ? 29.504  17.669  24.014  1.00 46.44 ? 694 HOH A O   1 
HETATM 9143 O  O   . HOH K 6 .   ? 13.687  -24.984 27.465  1.00 49.40 ? 695 HOH A O   1 
HETATM 9144 O  O   . HOH K 6 .   ? 14.473  13.844  30.174  1.00 31.31 ? 696 HOH A O   1 
HETATM 9145 O  O   . HOH K 6 .   ? 5.918   -1.494  28.223  1.00 41.65 ? 697 HOH A O   1 
HETATM 9146 O  O   . HOH K 6 .   ? 11.434  -17.684 20.224  1.00 47.50 ? 698 HOH A O   1 
HETATM 9147 O  O   . HOH K 6 .   ? 11.591  13.779  11.601  1.00 36.25 ? 699 HOH A O   1 
HETATM 9148 O  O   . HOH K 6 .   ? 16.872  -15.883 29.490  1.00 44.18 ? 700 HOH A O   1 
HETATM 9149 O  O   . HOH K 6 .   ? -6.251  -22.371 2.640   1.00 44.13 ? 701 HOH A O   1 
HETATM 9150 O  O   . HOH K 6 .   ? 26.131  24.521  19.736  1.00 50.99 ? 702 HOH A O   1 
HETATM 9151 O  O   . HOH K 6 .   ? -3.585  -27.016 10.520  1.00 50.55 ? 703 HOH A O   1 
HETATM 9152 O  O   . HOH K 6 .   ? 42.823  11.463  -15.112 1.00 39.74 ? 704 HOH A O   1 
HETATM 9153 O  O   . HOH K 6 .   ? 38.879  8.004   0.680   1.00 47.88 ? 705 HOH A O   1 
HETATM 9154 O  O   . HOH K 6 .   ? 20.669  29.488  8.451   1.00 47.63 ? 706 HOH A O   1 
HETATM 9155 O  O   . HOH K 6 .   ? 36.368  -5.644  14.119  1.00 56.86 ? 707 HOH A O   1 
HETATM 9156 O  O   . HOH K 6 .   ? 41.438  13.839  -10.862 1.00 44.15 ? 708 HOH A O   1 
HETATM 9157 O  O   . HOH K 6 .   ? 26.124  -7.743  0.623   1.00 57.34 ? 709 HOH A O   1 
HETATM 9158 O  O   . HOH K 6 .   ? 21.659  25.450  6.808   1.00 47.86 ? 710 HOH A O   1 
HETATM 9159 O  O   . HOH K 6 .   ? 12.017  16.391  -12.930 1.00 43.89 ? 711 HOH A O   1 
HETATM 9160 O  O   . HOH K 6 .   ? 10.529  17.772  -11.150 1.00 50.90 ? 712 HOH A O   1 
HETATM 9161 O  O   . HOH K 6 .   ? 32.138  -14.564 28.293  1.00 47.73 ? 713 HOH A O   1 
HETATM 9162 O  O   . HOH K 6 .   ? 35.738  -7.268  11.374  1.00 49.62 ? 714 HOH A O   1 
HETATM 9163 O  O   . HOH K 6 .   ? 6.698   0.954   6.281   1.00 39.99 ? 715 HOH A O   1 
HETATM 9164 O  O   . HOH K 6 .   ? -9.554  -21.977 20.588  1.00 44.76 ? 716 HOH A O   1 
HETATM 9165 O  O   . HOH K 6 .   ? 28.991  -14.113 12.085  1.00 39.60 ? 717 HOH A O   1 
HETATM 9166 O  O   . HOH K 6 .   ? 24.911  21.323  -0.889  1.00 50.20 ? 718 HOH A O   1 
HETATM 9167 O  O   . HOH K 6 .   ? 35.980  1.805   -9.851  1.00 29.07 ? 719 HOH A O   1 
HETATM 9168 O  O   . HOH K 6 .   ? 37.961  11.854  31.355  1.00 43.61 ? 720 HOH A O   1 
HETATM 9169 O  O   . HOH K 6 .   ? 37.540  3.821   -2.686  1.00 51.99 ? 721 HOH A O   1 
HETATM 9170 O  O   . HOH K 6 .   ? 11.330  -6.294  30.913  1.00 50.79 ? 722 HOH A O   1 
HETATM 9171 O  O   . HOH K 6 .   ? 13.365  13.555  -15.866 1.00 46.70 ? 723 HOH A O   1 
HETATM 9172 O  O   . HOH K 6 .   ? 19.345  0.124   33.730  1.00 44.45 ? 724 HOH A O   1 
HETATM 9173 O  O   . HOH K 6 .   ? 39.179  5.856   -3.557  1.00 39.76 ? 725 HOH A O   1 
HETATM 9174 O  O   . HOH K 6 .   ? 36.644  22.068  36.860  1.00 48.13 ? 726 HOH A O   1 
HETATM 9175 O  O   . HOH K 6 .   ? 24.321  23.130  9.566   1.00 43.31 ? 727 HOH A O   1 
HETATM 9176 O  O   . HOH K 6 .   ? 10.186  17.717  -8.590  1.00 34.11 ? 728 HOH A O   1 
HETATM 9177 O  O   . HOH K 6 .   ? 6.549   5.039   34.936  1.00 43.45 ? 729 HOH A O   1 
HETATM 9178 O  O   . HOH K 6 .   ? -0.240  -8.863  27.550  1.00 37.76 ? 730 HOH A O   1 
HETATM 9179 O  O   . HOH K 6 .   ? 41.896  3.856   8.814   1.00 55.30 ? 731 HOH A O   1 
HETATM 9180 O  O   . HOH K 6 .   ? 14.224  -8.346  29.017  1.00 39.16 ? 732 HOH A O   1 
HETATM 9181 O  O   . HOH K 6 .   ? 1.271   -6.386  26.999  1.00 44.18 ? 733 HOH A O   1 
HETATM 9182 O  O   . HOH K 6 .   ? 23.599  25.525  20.163  1.00 47.84 ? 734 HOH A O   1 
HETATM 9183 O  O   . HOH K 6 .   ? 19.662  -17.608 29.953  1.00 54.39 ? 735 HOH A O   1 
HETATM 9184 O  O   . HOH K 6 .   ? 12.593  19.588  15.556  1.00 63.18 ? 736 HOH A O   1 
HETATM 9185 O  O   . HOH K 6 .   ? 26.374  -26.519 19.261  1.00 46.52 ? 737 HOH A O   1 
HETATM 9186 O  O   . HOH K 6 .   ? 35.602  1.890   -3.651  1.00 50.12 ? 738 HOH A O   1 
HETATM 9187 O  O   . HOH K 6 .   ? 11.637  13.556  -13.824 1.00 44.64 ? 739 HOH A O   1 
HETATM 9188 O  O   . HOH K 6 .   ? 13.519  13.456  33.010  1.00 42.55 ? 740 HOH A O   1 
HETATM 9189 O  O   . HOH K 6 .   ? 20.452  11.171  -13.863 1.00 60.61 ? 741 HOH A O   1 
HETATM 9190 O  O   . HOH K 6 .   ? 27.813  -17.875 28.121  1.00 39.96 ? 742 HOH A O   1 
HETATM 9191 O  O   . HOH K 6 .   ? 36.213  0.221   3.683   1.00 53.93 ? 743 HOH A O   1 
HETATM 9192 O  O   . HOH K 6 .   ? 7.863   -28.482 23.428  1.00 50.46 ? 744 HOH A O   1 
HETATM 9193 O  O   . HOH K 6 .   ? 40.798  13.403  6.312   1.00 48.45 ? 745 HOH A O   1 
HETATM 9194 O  O   . HOH K 6 .   ? 10.423  -21.179 -0.420  1.00 45.92 ? 746 HOH A O   1 
HETATM 9195 O  O   . HOH K 6 .   ? -16.846 -22.032 13.338  1.00 56.02 ? 747 HOH A O   1 
HETATM 9196 O  O   . HOH K 6 .   ? 37.549  11.406  25.290  1.00 55.82 ? 748 HOH A O   1 
HETATM 9197 O  O   . HOH K 6 .   ? 13.012  6.272   -14.688 1.00 50.51 ? 749 HOH A O   1 
HETATM 9198 O  O   . HOH K 6 .   ? 11.046  12.271  32.743  1.00 38.54 ? 750 HOH A O   1 
HETATM 9199 O  O   . HOH K 6 .   ? 26.193  4.000   -14.912 1.00 53.63 ? 751 HOH A O   1 
HETATM 9200 O  O   . HOH K 6 .   ? 10.831  9.797   33.412  1.00 36.21 ? 752 HOH A O   1 
HETATM 9201 O  O   . HOH K 6 .   ? -10.306 3.852   5.817   1.00 53.49 ? 753 HOH A O   1 
HETATM 9202 O  O   . HOH K 6 .   ? 4.109   -4.288  -9.102  1.00 43.39 ? 754 HOH A O   1 
HETATM 9203 O  O   . HOH K 6 .   ? 20.334  -3.036  26.595  1.00 38.87 ? 755 HOH A O   1 
HETATM 9204 O  O   . HOH K 6 .   ? 23.448  4.706   38.769  1.00 30.34 ? 756 HOH A O   1 
HETATM 9205 O  O   . HOH L 6 .   ? 64.057  -10.158 -23.766 1.00 21.25 ? 489 HOH B O   1 
HETATM 9206 O  O   . HOH L 6 .   ? 47.085  1.355   -21.843 1.00 20.97 ? 490 HOH B O   1 
HETATM 9207 O  O   . HOH L 6 .   ? 49.813  4.655   -33.927 1.00 20.32 ? 491 HOH B O   1 
HETATM 9208 O  O   . HOH L 6 .   ? 29.211  -8.474  -9.541  1.00 26.94 ? 492 HOH B O   1 
HETATM 9209 O  O   . HOH L 6 .   ? 68.086  -15.504 -10.653 1.00 26.30 ? 493 HOH B O   1 
HETATM 9210 O  O   . HOH L 6 .   ? 57.113  7.348   -26.213 1.00 11.36 ? 494 HOH B O   1 
HETATM 9211 O  O   . HOH L 6 .   ? 54.619  2.376   -12.211 1.00 23.46 ? 495 HOH B O   1 
HETATM 9212 O  O   . HOH L 6 .   ? 56.775  1.027   -29.221 1.00 19.53 ? 496 HOH B O   1 
HETATM 9213 O  O   . HOH L 6 .   ? 58.985  17.096  -34.556 1.00 28.51 ? 497 HOH B O   1 
HETATM 9214 O  O   . HOH L 6 .   ? 62.737  28.708  -36.387 1.00 33.06 ? 498 HOH B O   1 
HETATM 9215 O  O   . HOH L 6 .   ? 65.165  4.121   -30.884 1.00 20.37 ? 499 HOH B O   1 
HETATM 9216 O  O   . HOH L 6 .   ? 42.117  -0.518  -16.389 1.00 24.21 ? 500 HOH B O   1 
HETATM 9217 O  O   . HOH L 6 .   ? 57.949  -12.084 -8.336  1.00 23.50 ? 501 HOH B O   1 
HETATM 9218 O  O   . HOH L 6 .   ? 69.784  -1.826  -33.908 1.00 22.37 ? 502 HOH B O   1 
HETATM 9219 O  O   . HOH L 6 .   ? 43.845  0.728   -10.689 1.00 28.16 ? 503 HOH B O   1 
HETATM 9220 O  O   . HOH L 6 .   ? 51.425  0.378   -25.415 1.00 19.06 ? 504 HOH B O   1 
HETATM 9221 O  O   . HOH L 6 .   ? 50.671  -0.516  -8.855  1.00 20.07 ? 505 HOH B O   1 
HETATM 9222 O  O   . HOH L 6 .   ? 55.427  9.363   -33.996 1.00 22.80 ? 506 HOH B O   1 
HETATM 9223 O  O   . HOH L 6 .   ? 45.843  11.199  -28.371 1.00 23.56 ? 507 HOH B O   1 
HETATM 9224 O  O   . HOH L 6 .   ? 77.531  -21.730 0.658   1.00 33.39 ? 508 HOH B O   1 
HETATM 9225 O  O   . HOH L 6 .   ? 29.531  -12.803 -8.407  1.00 23.59 ? 515 HOH B O   1 
HETATM 9226 O  O   . HOH L 6 .   ? 43.271  2.731   -16.612 1.00 23.55 ? 516 HOH B O   1 
HETATM 9227 O  O   . HOH L 6 .   ? 32.735  -3.727  -24.674 1.00 25.25 ? 517 HOH B O   1 
HETATM 9228 O  O   . HOH L 6 .   ? 65.380  -6.591  -36.215 1.00 32.43 ? 518 HOH B O   1 
HETATM 9229 O  O   . HOH L 6 .   ? 52.069  -12.365 -5.970  1.00 23.48 ? 519 HOH B O   1 
HETATM 9230 O  O   . HOH L 6 .   ? 50.861  3.045   -24.499 1.00 22.51 ? 520 HOH B O   1 
HETATM 9231 O  O   . HOH L 6 .   ? 68.472  27.416  -32.324 1.00 30.65 ? 521 HOH B O   1 
HETATM 9232 O  O   . HOH L 6 .   ? 38.369  1.240   -10.294 1.00 28.93 ? 522 HOH B O   1 
HETATM 9233 O  O   . HOH L 6 .   ? 66.482  17.551  -22.102 1.00 41.21 ? 523 HOH B O   1 
HETATM 9234 O  O   . HOH L 6 .   ? 53.876  7.262   -9.298  1.00 32.90 ? 524 HOH B O   1 
HETATM 9235 O  O   . HOH L 6 .   ? 73.726  -24.007 -11.044 1.00 54.71 ? 525 HOH B O   1 
HETATM 9236 O  O   . HOH L 6 .   ? 57.481  16.716  -24.824 1.00 28.82 ? 526 HOH B O   1 
HETATM 9237 O  O   . HOH L 6 .   ? 71.745  11.820  -27.550 1.00 21.56 ? 527 HOH B O   1 
HETATM 9238 O  O   . HOH L 6 .   ? 69.206  -19.766 -13.147 1.00 36.38 ? 528 HOH B O   1 
HETATM 9239 O  O   . HOH L 6 .   ? 54.932  -18.943 -8.400  1.00 29.82 ? 529 HOH B O   1 
HETATM 9240 O  O   . HOH L 6 .   ? 48.280  5.145   -28.127 1.00 19.85 ? 530 HOH B O   1 
HETATM 9241 O  O   . HOH L 6 .   ? 51.836  -18.769 -32.086 1.00 34.63 ? 531 HOH B O   1 
HETATM 9242 O  O   . HOH L 6 .   ? 53.806  -10.740 -31.215 1.00 32.58 ? 532 HOH B O   1 
HETATM 9243 O  O   . HOH L 6 .   ? 58.791  0.416   -17.478 1.00 26.47 ? 533 HOH B O   1 
HETATM 9244 O  O   . HOH L 6 .   ? 59.892  -4.134  -33.625 1.00 22.78 ? 534 HOH B O   1 
HETATM 9245 O  O   . HOH L 6 .   ? 50.647  12.481  -40.608 1.00 24.35 ? 535 HOH B O   1 
HETATM 9246 O  O   . HOH L 6 .   ? 40.309  5.166   -12.272 1.00 27.37 ? 536 HOH B O   1 
HETATM 9247 O  O   . HOH L 6 .   ? 47.005  5.088   -10.224 1.00 41.75 ? 537 HOH B O   1 
HETATM 9248 O  O   . HOH L 6 .   ? 68.504  -16.875 -18.419 1.00 34.00 ? 538 HOH B O   1 
HETATM 9249 O  O   . HOH L 6 .   ? 57.296  -6.915  -16.961 1.00 21.30 ? 539 HOH B O   1 
HETATM 9250 O  O   . HOH L 6 .   ? 65.340  -14.104 -29.479 1.00 38.42 ? 540 HOH B O   1 
HETATM 9251 O  O   . HOH L 6 .   ? 63.827  16.284  -29.873 1.00 39.25 ? 541 HOH B O   1 
HETATM 9252 O  O   . HOH L 6 .   ? 62.895  4.429   -29.020 1.00 21.93 ? 542 HOH B O   1 
HETATM 9253 O  O   . HOH L 6 .   ? 44.324  -19.278 -12.356 1.00 33.40 ? 543 HOH B O   1 
HETATM 9254 O  O   . HOH L 6 .   ? 68.205  7.405   -22.543 1.00 24.25 ? 544 HOH B O   1 
HETATM 9255 O  O   . HOH L 6 .   ? 49.124  19.712  -39.919 1.00 40.04 ? 545 HOH B O   1 
HETATM 9256 O  O   . HOH L 6 .   ? 47.258  -6.472  -7.772  1.00 30.80 ? 546 HOH B O   1 
HETATM 9257 O  O   . HOH L 6 .   ? 38.153  -22.994 -30.449 1.00 33.40 ? 547 HOH B O   1 
HETATM 9258 O  O   . HOH L 6 .   ? 59.533  12.005  -7.033  1.00 24.49 ? 548 HOH B O   1 
HETATM 9259 O  O   . HOH L 6 .   ? 59.661  19.831  -22.105 1.00 28.51 ? 549 HOH B O   1 
HETATM 9260 O  O   . HOH L 6 .   ? 76.301  -20.930 4.652   1.00 30.35 ? 550 HOH B O   1 
HETATM 9261 O  O   . HOH L 6 .   ? 49.928  -1.481  -2.878  1.00 31.53 ? 551 HOH B O   1 
HETATM 9262 O  O   . HOH L 6 .   ? 34.027  -15.897 -27.431 1.00 33.25 ? 552 HOH B O   1 
HETATM 9263 O  O   . HOH L 6 .   ? 49.913  9.981   -39.129 1.00 27.59 ? 553 HOH B O   1 
HETATM 9264 O  O   . HOH L 6 .   ? 50.417  4.238   -26.871 1.00 20.30 ? 554 HOH B O   1 
HETATM 9265 O  O   . HOH L 6 .   ? 66.833  9.097   -52.703 1.00 42.46 ? 555 HOH B O   1 
HETATM 9266 O  O   . HOH L 6 .   ? 70.908  13.357  -25.680 1.00 22.67 ? 556 HOH B O   1 
HETATM 9267 O  O   . HOH L 6 .   ? 53.903  -13.078 -16.401 1.00 28.03 ? 557 HOH B O   1 
HETATM 9268 O  O   . HOH L 6 .   ? 64.471  22.997  -37.749 1.00 29.16 ? 558 HOH B O   1 
HETATM 9269 O  O   . HOH L 6 .   ? 60.824  12.025  -30.488 1.00 25.27 ? 559 HOH B O   1 
HETATM 9270 O  O   . HOH L 6 .   ? 36.422  3.835   -18.611 1.00 34.18 ? 560 HOH B O   1 
HETATM 9271 O  O   . HOH L 6 .   ? 52.672  21.680  -32.846 1.00 32.55 ? 561 HOH B O   1 
HETATM 9272 O  O   . HOH L 6 .   ? 63.849  9.296   -3.204  1.00 28.06 ? 562 HOH B O   1 
HETATM 9273 O  O   . HOH L 6 .   ? 56.036  2.510   -48.540 1.00 41.39 ? 563 HOH B O   1 
HETATM 9274 O  O   . HOH L 6 .   ? 58.905  28.065  -35.506 1.00 30.67 ? 564 HOH B O   1 
HETATM 9275 O  O   . HOH L 6 .   ? 41.539  2.605   -30.540 1.00 35.82 ? 565 HOH B O   1 
HETATM 9276 O  O   . HOH L 6 .   ? 59.421  19.562  -24.692 1.00 27.37 ? 566 HOH B O   1 
HETATM 9277 O  O   . HOH L 6 .   ? 47.013  3.851   -12.313 1.00 34.53 ? 567 HOH B O   1 
HETATM 9278 O  O   . HOH L 6 .   ? 66.603  -10.213 -3.798  1.00 46.38 ? 568 HOH B O   1 
HETATM 9279 O  O   . HOH L 6 .   ? 44.171  5.058   -13.600 1.00 34.71 ? 569 HOH B O   1 
HETATM 9280 O  O   . HOH L 6 .   ? 53.165  2.180   -35.278 1.00 29.15 ? 570 HOH B O   1 
HETATM 9281 O  O   . HOH L 6 .   ? 53.743  -3.744  -34.202 1.00 34.73 ? 571 HOH B O   1 
HETATM 9282 O  O   . HOH L 6 .   ? 47.886  -21.207 -17.882 1.00 29.78 ? 572 HOH B O   1 
HETATM 9283 O  O   . HOH L 6 .   ? 64.400  17.109  -32.894 1.00 38.08 ? 573 HOH B O   1 
HETATM 9284 O  O   . HOH L 6 .   ? 65.519  15.053  -4.923  1.00 29.37 ? 574 HOH B O   1 
HETATM 9285 O  O   . HOH L 6 .   ? 57.764  5.937   -4.619  1.00 29.61 ? 575 HOH B O   1 
HETATM 9286 O  O   . HOH L 6 .   ? 71.896  5.456   -27.293 1.00 28.25 ? 576 HOH B O   1 
HETATM 9287 O  O   . HOH L 6 .   ? 71.465  15.189  -30.635 1.00 38.34 ? 577 HOH B O   1 
HETATM 9288 O  O   . HOH L 6 .   ? 32.567  -3.122  -28.382 1.00 38.60 ? 578 HOH B O   1 
HETATM 9289 O  O   . HOH L 6 .   ? 60.190  14.939  -31.367 1.00 29.38 ? 579 HOH B O   1 
HETATM 9290 O  O   . HOH L 6 .   ? 50.368  18.809  -23.326 1.00 43.01 ? 580 HOH B O   1 
HETATM 9291 O  O   . HOH L 6 .   ? 56.743  20.564  -47.605 1.00 33.89 ? 581 HOH B O   1 
HETATM 9292 O  O   . HOH L 6 .   ? 55.687  -8.717  -30.815 1.00 32.77 ? 582 HOH B O   1 
HETATM 9293 O  O   . HOH L 6 .   ? 64.671  29.743  -40.199 1.00 45.24 ? 583 HOH B O   1 
HETATM 9294 O  O   . HOH L 6 .   ? 58.949  7.153   -2.510  1.00 40.05 ? 584 HOH B O   1 
HETATM 9295 O  O   . HOH L 6 .   ? 38.105  7.507   -17.504 1.00 26.25 ? 585 HOH B O   1 
HETATM 9296 O  O   . HOH L 6 .   ? 59.507  9.053   -44.884 1.00 25.74 ? 586 HOH B O   1 
HETATM 9297 O  O   . HOH L 6 .   ? 59.343  -18.283 -8.571  1.00 24.87 ? 587 HOH B O   1 
HETATM 9298 O  O   . HOH L 6 .   ? 62.698  -5.778  -35.025 1.00 34.99 ? 588 HOH B O   1 
HETATM 9299 O  O   . HOH L 6 .   ? 32.549  -4.685  -30.793 1.00 33.83 ? 589 HOH B O   1 
HETATM 9300 O  O   . HOH L 6 .   ? 64.124  13.611  -29.483 1.00 31.71 ? 590 HOH B O   1 
HETATM 9301 O  O   . HOH L 6 .   ? 42.734  12.699  -17.763 1.00 43.67 ? 591 HOH B O   1 
HETATM 9302 O  O   . HOH L 6 .   ? 42.714  4.987   -28.934 1.00 46.27 ? 592 HOH B O   1 
HETATM 9303 O  O   . HOH L 6 .   ? 73.555  17.022  -39.031 1.00 33.34 ? 593 HOH B O   1 
HETATM 9304 O  O   . HOH L 6 .   ? 48.789  28.111  -25.513 1.00 50.32 ? 594 HOH B O   1 
HETATM 9305 O  O   . HOH L 6 .   ? 73.792  4.799   -34.769 1.00 28.72 ? 595 HOH B O   1 
HETATM 9306 O  O   . HOH L 6 .   ? 28.474  -5.407  -6.760  1.00 29.05 ? 596 HOH B O   1 
HETATM 9307 O  O   . HOH L 6 .   ? 58.314  21.698  -20.538 1.00 27.03 ? 597 HOH B O   1 
HETATM 9308 O  O   . HOH L 6 .   ? 80.257  -2.881  -20.911 1.00 36.06 ? 598 HOH B O   1 
HETATM 9309 O  O   . HOH L 6 .   ? 32.444  -4.500  -9.614  1.00 36.84 ? 599 HOH B O   1 
HETATM 9310 O  O   . HOH L 6 .   ? 53.665  -23.147 -17.714 1.00 51.71 ? 600 HOH B O   1 
HETATM 9311 O  O   . HOH L 6 .   ? 33.145  -6.748  -33.131 1.00 42.00 ? 603 HOH B O   1 
HETATM 9312 O  O   . HOH L 6 .   ? 50.463  -19.460 -9.847  1.00 35.54 ? 604 HOH B O   1 
HETATM 9313 O  O   . HOH L 6 .   ? 57.388  12.945  -8.376  1.00 32.41 ? 605 HOH B O   1 
HETATM 9314 O  O   . HOH L 6 .   ? 41.501  -23.537 -22.456 1.00 43.36 ? 606 HOH B O   1 
HETATM 9315 O  O   . HOH L 6 .   ? 49.895  -23.719 -18.608 1.00 33.64 ? 607 HOH B O   1 
HETATM 9316 O  O   . HOH L 6 .   ? 52.494  -13.960 -18.322 1.00 26.22 ? 609 HOH B O   1 
HETATM 9317 O  O   . HOH L 6 .   ? 33.168  -1.112  -18.008 1.00 41.64 ? 610 HOH B O   1 
HETATM 9318 O  O   . HOH L 6 .   ? 40.821  -25.584 -24.565 1.00 28.06 ? 611 HOH B O   1 
HETATM 9319 O  O   . HOH L 6 .   ? 59.285  16.513  -26.957 1.00 28.79 ? 612 HOH B O   1 
HETATM 9320 O  O   . HOH L 6 .   ? 32.760  -3.314  -32.935 1.00 46.02 ? 613 HOH B O   1 
HETATM 9321 O  O   . HOH L 6 .   ? 35.238  -2.635  -34.089 1.00 49.47 ? 614 HOH B O   1 
HETATM 9322 O  O   . HOH L 6 .   ? 70.015  4.580   -25.376 1.00 21.06 ? 615 HOH B O   1 
HETATM 9323 O  O   . HOH L 6 .   ? 67.824  6.312   -24.837 1.00 24.17 ? 616 HOH B O   1 
HETATM 9324 O  O   . HOH L 6 .   ? 38.704  -6.093  -37.088 1.00 37.54 ? 617 HOH B O   1 
HETATM 9325 O  O   . HOH L 6 .   ? 36.261  3.348   -28.855 1.00 43.59 ? 618 HOH B O   1 
HETATM 9326 O  O   . HOH L 6 .   ? 31.117  -20.425 -19.671 1.00 55.26 ? 619 HOH B O   1 
HETATM 9327 O  O   . HOH L 6 .   ? 72.523  21.533  -25.534 1.00 53.44 ? 620 HOH B O   1 
HETATM 9328 O  O   . HOH L 6 .   ? 73.802  22.219  -20.375 1.00 34.58 ? 621 HOH B O   1 
HETATM 9329 O  O   . HOH L 6 .   ? 70.534  -3.983  -9.236  1.00 44.58 ? 622 HOH B O   1 
HETATM 9330 O  O   . HOH L 6 .   ? 48.061  1.143   -5.893  1.00 36.09 ? 623 HOH B O   1 
HETATM 9331 O  O   . HOH L 6 .   ? 57.089  -18.998 -9.808  1.00 27.86 ? 624 HOH B O   1 
HETATM 9332 O  O   . HOH L 6 .   ? 35.044  -6.856  -6.022  1.00 31.50 ? 625 HOH B O   1 
HETATM 9333 O  O   . HOH L 6 .   ? 79.853  3.572   -22.600 1.00 31.78 ? 626 HOH B O   1 
HETATM 9334 O  O   . HOH L 6 .   ? 47.059  18.899  -28.676 1.00 45.06 ? 627 HOH B O   1 
HETATM 9335 O  O   . HOH L 6 .   ? 70.965  15.943  -35.586 1.00 27.69 ? 628 HOH B O   1 
HETATM 9336 O  O   . HOH L 6 .   ? 78.602  -20.578 -1.147  1.00 31.96 ? 629 HOH B O   1 
HETATM 9337 O  O   . HOH L 6 .   ? 58.078  27.003  -19.450 1.00 42.48 ? 630 HOH B O   1 
HETATM 9338 O  O   . HOH L 6 .   ? 52.050  -11.936 -37.332 1.00 34.39 ? 631 HOH B O   1 
HETATM 9339 O  O   . HOH L 6 .   ? 69.268  25.991  -30.405 1.00 47.71 ? 632 HOH B O   1 
HETATM 9340 O  O   . HOH L 6 .   ? 30.205  -10.582 -1.466  1.00 44.26 ? 633 HOH B O   1 
HETATM 9341 O  O   . HOH L 6 .   ? 44.628  -22.449 -32.198 1.00 38.21 ? 634 HOH B O   1 
HETATM 9342 O  O   . HOH L 6 .   ? 28.565  -13.992 -14.798 1.00 32.88 ? 635 HOH B O   1 
HETATM 9343 O  O   . HOH L 6 .   ? 75.567  7.902   -27.439 1.00 44.15 ? 636 HOH B O   1 
HETATM 9344 O  O   . HOH L 6 .   ? 56.021  23.622  -21.527 1.00 41.74 ? 637 HOH B O   1 
HETATM 9345 O  O   . HOH L 6 .   ? 35.047  -17.355 -29.249 1.00 32.07 ? 638 HOH B O   1 
HETATM 9346 O  O   . HOH L 6 .   ? 71.125  2.947   -15.715 1.00 35.97 ? 639 HOH B O   1 
HETATM 9347 O  O   . HOH L 6 .   ? 52.127  -10.067 -52.635 1.00 51.97 ? 640 HOH B O   1 
HETATM 9348 O  O   . HOH L 6 .   ? 66.246  -18.091 -7.334  1.00 39.19 ? 641 HOH B O   1 
HETATM 9349 O  O   . HOH L 6 .   ? 40.520  -16.807 -7.153  1.00 41.33 ? 642 HOH B O   1 
HETATM 9350 O  O   . HOH L 6 .   ? 72.208  15.483  -19.933 1.00 36.06 ? 643 HOH B O   1 
HETATM 9351 O  O   . HOH L 6 .   ? 77.293  8.693   -24.584 1.00 49.86 ? 644 HOH B O   1 
HETATM 9352 O  O   . HOH L 6 .   ? 71.971  1.075   -13.830 1.00 37.08 ? 645 HOH B O   1 
HETATM 9353 O  O   . HOH L 6 .   ? 57.426  23.630  -33.527 1.00 30.18 ? 646 HOH B O   1 
HETATM 9354 O  O   . HOH L 6 .   ? 36.316  -13.060 -2.869  1.00 35.10 ? 647 HOH B O   1 
HETATM 9355 O  O   . HOH L 6 .   ? 80.232  -9.853  -23.134 1.00 37.38 ? 648 HOH B O   1 
HETATM 9356 O  O   . HOH L 6 .   ? 57.142  -21.164 -11.456 1.00 35.79 ? 649 HOH B O   1 
HETATM 9357 O  O   . HOH L 6 .   ? 39.944  -18.075 -34.206 1.00 31.40 ? 650 HOH B O   1 
HETATM 9358 O  O   . HOH L 6 .   ? 66.660  12.303  -3.534  1.00 44.55 ? 651 HOH B O   1 
HETATM 9359 O  O   . HOH L 6 .   ? 60.621  -19.130 -25.515 1.00 52.21 ? 652 HOH B O   1 
HETATM 9360 O  O   . HOH L 6 .   ? 74.003  2.917   -36.979 1.00 52.72 ? 653 HOH B O   1 
HETATM 9361 O  O   . HOH L 6 .   ? 63.779  -11.556 -4.499  1.00 38.86 ? 654 HOH B O   1 
HETATM 9362 O  O   . HOH L 6 .   ? 71.971  17.912  -37.326 1.00 35.73 ? 655 HOH B O   1 
HETATM 9363 O  O   . HOH L 6 .   ? 31.906  -20.721 -17.116 1.00 60.82 ? 656 HOH B O   1 
HETATM 9364 O  O   . HOH L 6 .   ? 45.810  8.744   -29.807 1.00 47.71 ? 657 HOH B O   1 
HETATM 9365 O  O   . HOH L 6 .   ? 41.334  -17.986 -36.440 1.00 47.44 ? 658 HOH B O   1 
HETATM 9366 O  O   . HOH L 6 .   ? 40.297  -9.176  -37.898 1.00 42.44 ? 659 HOH B O   1 
HETATM 9367 O  O   . HOH L 6 .   ? 47.269  20.833  -31.807 1.00 50.65 ? 660 HOH B O   1 
HETATM 9368 O  O   . HOH L 6 .   ? 47.417  -6.939  -5.004  1.00 37.74 ? 661 HOH B O   1 
HETATM 9369 O  O   . HOH L 6 .   ? 61.973  -22.324 -15.236 1.00 39.80 ? 662 HOH B O   1 
HETATM 9370 O  O   . HOH L 6 .   ? 76.214  10.019  -22.562 1.00 27.92 ? 663 HOH B O   1 
HETATM 9371 O  O   . HOH L 6 .   ? 72.662  15.941  -22.466 1.00 33.55 ? 664 HOH B O   1 
HETATM 9372 O  O   . HOH L 6 .   ? 51.343  -14.184 -35.953 1.00 30.83 ? 665 HOH B O   1 
HETATM 9373 O  O   . HOH L 6 .   ? 74.852  12.155  -23.487 1.00 34.79 ? 666 HOH B O   1 
HETATM 9374 O  O   . HOH L 6 .   ? 52.132  -15.994 -38.045 1.00 44.48 ? 667 HOH B O   1 
HETATM 9375 O  O   . HOH L 6 .   ? 79.336  -12.439 -23.168 1.00 37.69 ? 668 HOH B O   1 
HETATM 9376 O  O   . HOH L 6 .   ? 72.311  13.395  -23.393 1.00 35.98 ? 669 HOH B O   1 
HETATM 9377 O  O   . HOH L 6 .   ? 58.632  16.411  -47.033 1.00 27.72 ? 670 HOH B O   1 
HETATM 9378 O  O   . HOH L 6 .   ? 29.543  -4.132  -20.313 1.00 48.64 ? 671 HOH B O   1 
HETATM 9379 O  O   . HOH L 6 .   ? 67.187  17.542  -26.171 1.00 41.56 ? 672 HOH B O   1 
HETATM 9380 O  O   . HOH L 6 .   ? 76.521  1.666   -29.405 1.00 43.57 ? 673 HOH B O   1 
HETATM 9381 O  O   . HOH L 6 .   ? 40.145  4.417   -29.314 1.00 41.56 ? 674 HOH B O   1 
HETATM 9382 O  O   . HOH L 6 .   ? 74.639  -18.594 -9.638  1.00 47.59 ? 675 HOH B O   1 
HETATM 9383 O  O   . HOH L 6 .   ? 69.468  5.658   -4.366  1.00 49.85 ? 676 HOH B O   1 
HETATM 9384 O  O   . HOH L 6 .   ? 63.876  -16.081 -27.340 1.00 39.43 ? 677 HOH B O   1 
HETATM 9385 O  O   . HOH L 6 .   ? 63.208  1.065   -49.368 1.00 42.17 ? 678 HOH B O   1 
HETATM 9386 O  O   . HOH L 6 .   ? 46.210  10.640  -33.477 1.00 42.27 ? 679 HOH B O   1 
HETATM 9387 O  O   . HOH L 6 .   ? 59.605  24.100  -45.210 1.00 36.84 ? 680 HOH B O   1 
HETATM 9388 O  O   . HOH L 6 .   ? 49.701  -2.101  -44.255 1.00 42.11 ? 681 HOH B O   1 
HETATM 9389 O  O   . HOH L 6 .   ? 45.661  0.289   -6.289  1.00 39.27 ? 682 HOH B O   1 
HETATM 9390 O  O   . HOH L 6 .   ? 71.277  17.805  -23.958 1.00 42.70 ? 683 HOH B O   1 
HETATM 9391 O  O   . HOH L 6 .   ? 29.711  -14.685 -17.437 1.00 43.30 ? 684 HOH B O   1 
HETATM 9392 O  O   . HOH L 6 .   ? 78.955  -13.579 -20.857 1.00 41.81 ? 685 HOH B O   1 
HETATM 9393 O  O   . HOH L 6 .   ? 51.872  -25.570 -19.599 1.00 50.16 ? 686 HOH B O   1 
HETATM 9394 O  O   . HOH L 6 .   ? 56.323  2.516   2.288   1.00 59.11 ? 687 HOH B O   1 
HETATM 9395 O  O   . HOH L 6 .   ? 61.417  -11.331 -33.653 1.00 38.76 ? 688 HOH B O   1 
HETATM 9396 O  O   . HOH L 6 .   ? 44.711  8.669   -35.284 1.00 38.97 ? 689 HOH B O   1 
HETATM 9397 O  O   . HOH L 6 .   ? 61.132  15.491  -4.172  1.00 50.38 ? 690 HOH B O   1 
HETATM 9398 O  O   . HOH L 6 .   ? 74.306  5.250   -26.699 1.00 38.88 ? 691 HOH B O   1 
HETATM 9399 O  O   . HOH L 6 .   ? 69.093  6.133   -1.242  1.00 55.29 ? 692 HOH B O   1 
HETATM 9400 O  O   . HOH L 6 .   ? 45.072  -11.461 -43.576 1.00 41.79 ? 693 HOH B O   1 
HETATM 9401 O  O   . HOH L 6 .   ? 70.357  16.326  -26.232 1.00 39.54 ? 694 HOH B O   1 
HETATM 9402 O  O   . HOH L 6 .   ? 40.435  -20.874 -33.756 1.00 42.18 ? 695 HOH B O   1 
HETATM 9403 O  O   . HOH L 6 .   ? 83.296  1.597   -25.027 1.00 43.77 ? 696 HOH B O   1 
HETATM 9404 O  O   . HOH L 6 .   ? 82.673  -13.964 -6.469  1.00 43.04 ? 698 HOH B O   1 
HETATM 9405 O  O   . HOH L 6 .   ? 78.986  -1.962  -5.434  1.00 43.72 ? 699 HOH B O   1 
HETATM 9406 O  O   . HOH L 6 .   ? 53.240  26.950  -35.668 1.00 50.69 ? 700 HOH B O   1 
HETATM 9407 O  O   . HOH L 6 .   ? 25.921  -13.020 -4.615  1.00 35.98 ? 701 HOH B O   1 
HETATM 9408 O  O   . HOH L 6 .   ? 46.370  12.678  -19.548 1.00 42.88 ? 702 HOH B O   1 
HETATM 9409 O  O   . HOH L 6 .   ? 72.329  9.364   -5.522  1.00 47.56 ? 703 HOH B O   1 
HETATM 9410 O  O   . HOH L 6 .   ? 52.124  -9.829  -0.398  1.00 41.33 ? 704 HOH B O   1 
HETATM 9411 O  O   . HOH L 6 .   ? 54.007  2.105   -0.698  1.00 47.08 ? 705 HOH B O   1 
HETATM 9412 O  O   . HOH L 6 .   ? 52.459  20.495  -35.630 1.00 49.18 ? 706 HOH B O   1 
HETATM 9413 O  O   . HOH L 6 .   ? 71.957  26.227  -14.488 1.00 33.01 ? 707 HOH B O   1 
HETATM 9414 O  O   . HOH L 6 .   ? 39.569  -8.198  -41.955 1.00 50.61 ? 708 HOH B O   1 
HETATM 9415 O  O   . HOH L 6 .   ? 33.398  6.346   -29.923 1.00 52.80 ? 709 HOH B O   1 
HETATM 9416 O  O   . HOH L 6 .   ? 47.261  -2.913  -43.327 1.00 34.34 ? 710 HOH B O   1 
HETATM 9417 O  O   . HOH L 6 .   ? 47.256  15.445  -35.169 1.00 43.97 ? 711 HOH B O   1 
HETATM 9418 O  O   . HOH L 6 .   ? 68.899  18.421  -24.515 1.00 54.75 ? 712 HOH B O   1 
HETATM 9419 O  O   . HOH L 6 .   ? 46.906  -25.117 -35.287 1.00 47.61 ? 713 HOH B O   1 
HETATM 9420 O  O   . HOH L 6 .   ? 46.192  -12.745 -0.636  1.00 44.64 ? 714 HOH B O   1 
HETATM 9421 O  O   . HOH L 6 .   ? 70.276  7.576   -2.863  1.00 48.20 ? 715 HOH B O   1 
HETATM 9422 O  O   . HOH L 6 .   ? 34.170  -13.474 -34.491 1.00 45.02 ? 716 HOH B O   1 
HETATM 9423 O  O   . HOH L 6 .   ? 55.448  -25.937 -20.972 1.00 43.03 ? 717 HOH B O   1 
HETATM 9424 O  O   . HOH L 6 .   ? 54.029  -12.373 -29.035 1.00 41.80 ? 718 HOH B O   1 
HETATM 9425 O  O   . HOH L 6 .   ? 82.797  -8.407  -10.263 1.00 39.33 ? 719 HOH B O   1 
HETATM 9426 O  O   . HOH L 6 .   ? 75.184  -16.124 -18.364 1.00 49.30 ? 720 HOH B O   1 
HETATM 9427 O  O   . HOH L 6 .   ? 82.641  -5.057  -27.153 1.00 45.30 ? 721 HOH B O   1 
HETATM 9428 O  O   . HOH L 6 .   ? 47.286  9.901   -39.241 1.00 40.05 ? 722 HOH B O   1 
HETATM 9429 O  O   . HOH L 6 .   ? 75.567  13.976  -33.706 1.00 53.62 ? 723 HOH B O   1 
HETATM 9430 O  O   . HOH L 6 .   ? 81.411  -7.601  -27.246 1.00 49.30 ? 725 HOH B O   1 
HETATM 9431 O  O   . HOH L 6 .   ? 65.049  7.187   -2.147  1.00 39.58 ? 726 HOH B O   1 
HETATM 9432 O  O   . HOH L 6 .   ? 47.584  -22.470 -35.405 1.00 46.13 ? 727 HOH B O   1 
HETATM 9433 O  O   . HOH L 6 .   ? 43.204  3.653   -45.351 1.00 35.95 ? 729 HOH B O   1 
HETATM 9434 O  O   . HOH L 6 .   ? 52.419  -14.560 -4.602  1.00 48.45 ? 730 HOH B O   1 
HETATM 9435 O  O   . HOH L 6 .   ? 47.809  4.986   -7.973  1.00 57.59 ? 731 HOH B O   1 
HETATM 9436 O  O   . HOH L 6 .   ? 53.255  -16.908 -4.705  1.00 39.82 ? 732 HOH B O   1 
HETATM 9437 O  O   . HOH L 6 .   ? 82.885  -12.034 -14.941 1.00 56.75 ? 733 HOH B O   1 
HETATM 9438 O  O   . HOH L 6 .   ? 64.895  33.506  -35.240 1.00 44.52 ? 734 HOH B O   1 
HETATM 9439 O  O   . HOH L 6 .   ? 34.554  -16.100 -10.911 1.00 34.25 ? 735 HOH B O   1 
HETATM 9440 O  O   . HOH L 6 .   ? 25.635  -8.097  -13.372 1.00 49.23 ? 736 HOH B O   1 
HETATM 9441 O  O   . HOH L 6 .   ? 41.389  -8.215  -4.196  1.00 43.50 ? 737 HOH B O   1 
HETATM 9442 O  O   . HOH M 6 .   ? 7.272   11.594  10.629  1.00 42.37 ? 291 HOH C O   1 
HETATM 9443 O  O   . HOH M 6 .   ? 3.085   20.425  13.901  1.00 46.01 ? 376 HOH C O   1 
HETATM 9444 O  O   . HOH N 6 .   ? 58.819  -11.562 -32.421 1.00 37.95 ? 314 HOH D O   1 
HETATM 9445 O  O   . HOH N 6 .   ? 58.876  -14.081 -28.007 1.00 36.93 ? 326 HOH D O   1 
HETATM 9446 O  O   . HOH N 6 .   ? 63.120  -20.630 -35.702 1.00 47.13 ? 358 HOH D O   1 
HETATM 9447 O  O   . HOH N 6 .   ? 64.251  -5.847  -49.611 1.00 45.69 ? 428 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   2   ?   ?   ?   A . n 
A 1 2   THR 2   3   ?   ?   ?   A . n 
A 1 3   ARG 3   4   ?   ?   ?   A . n 
A 1 4   SER 4   5   5   SER SER A . n 
A 1 5   PRO 5   6   6   PRO PRO A . n 
A 1 6   ARG 6   7   7   ARG ARG A . n 
A 1 7   PRO 7   8   8   PRO PRO A . n 
A 1 8   PHE 8   9   9   PHE PHE A . n 
A 1 9   ASN 9   10  10  ASN ASN A . n 
A 1 10  GLU 10  11  11  GLU GLU A . n 
A 1 11  ILE 11  12  12  ILE ILE A . n 
A 1 12  PRO 12  13  13  PRO PRO A . n 
A 1 13  SER 13  14  14  SER SER A . n 
A 1 14  PRO 14  15  15  PRO PRO A . n 
A 1 15  GLY 15  16  16  GLY GLY A . n 
A 1 16  ASP 16  17  17  ASP ASP A . n 
A 1 17  ASN 17  18  18  ASN ASN A . n 
A 1 18  GLY 18  19  19  GLY GLY A . n 
A 1 19  TRP 19  20  20  TRP TRP A . n 
A 1 20  LEU 20  21  21  LEU LEU A . n 
A 1 21  ASN 21  22  22  ASN ASN A . n 
A 1 22  LEU 22  23  23  LEU LEU A . n 
A 1 23  TYR 23  24  24  TYR TYR A . n 
A 1 24  HIS 24  25  25  HIS HIS A . n 
A 1 25  PHE 25  26  26  PHE PHE A . n 
A 1 26  TRP 26  27  27  TRP TRP A . n 
A 1 27  ARG 27  28  28  ARG ARG A . n 
A 1 28  GLU 28  29  29  GLU GLU A . n 
A 1 29  THR 29  30  30  THR THR A . n 
A 1 30  GLY 30  31  31  GLY GLY A . n 
A 1 31  THR 31  32  32  THR THR A . n 
A 1 32  HIS 32  33  33  HIS HIS A . n 
A 1 33  LYS 33  34  34  LYS LYS A . n 
A 1 34  VAL 34  35  35  VAL VAL A . n 
A 1 35  HIS 35  36  36  HIS HIS A . n 
A 1 36  LEU 36  37  37  LEU LEU A . n 
A 1 37  HIS 37  38  38  HIS HIS A . n 
A 1 38  HIS 38  39  39  HIS HIS A . n 
A 1 39  VAL 39  40  40  VAL VAL A . n 
A 1 40  GLN 40  41  41  GLN GLN A . n 
A 1 41  ASN 41  42  42  ASN ASN A . n 
A 1 42  PHE 42  43  43  PHE PHE A . n 
A 1 43  GLN 43  44  44  GLN GLN A . n 
A 1 44  LYS 44  45  45  LYS LYS A . n 
A 1 45  TYR 45  46  46  TYR TYR A . n 
A 1 46  GLY 46  47  47  GLY GLY A . n 
A 1 47  PRO 47  48  48  PRO PRO A . n 
A 1 48  ILE 48  49  49  ILE ILE A . n 
A 1 49  TYR 49  50  50  TYR TYR A . n 
A 1 50  ARG 50  51  51  ARG ARG A . n 
A 1 51  GLU 51  52  52  GLU GLU A . n 
A 1 52  LYS 52  53  53  LYS LYS A . n 
A 1 53  LEU 53  54  54  LEU LEU A . n 
A 1 54  GLY 54  55  55  GLY GLY A . n 
A 1 55  ASN 55  56  56  ASN ASN A . n 
A 1 56  VAL 56  57  57  VAL VAL A . n 
A 1 57  GLU 57  58  58  GLU GLU A . n 
A 1 58  SER 58  59  59  SER SER A . n 
A 1 59  VAL 59  60  60  VAL VAL A . n 
A 1 60  TYR 60  61  61  TYR TYR A . n 
A 1 61  VAL 61  62  62  VAL VAL A . n 
A 1 62  ILE 62  63  63  ILE ILE A . n 
A 1 63  ASP 63  64  64  ASP ASP A . n 
A 1 64  PRO 64  65  65  PRO PRO A . n 
A 1 65  GLU 65  66  66  GLU GLU A . n 
A 1 66  ASP 66  67  67  ASP ASP A . n 
A 1 67  VAL 67  68  68  VAL VAL A . n 
A 1 68  ALA 68  69  69  ALA ALA A . n 
A 1 69  LEU 69  70  70  LEU LEU A . n 
A 1 70  LEU 70  71  71  LEU LEU A . n 
A 1 71  PHE 71  72  72  PHE PHE A . n 
A 1 72  LYS 72  73  73  LYS LYS A . n 
A 1 73  SER 73  74  74  SER SER A . n 
A 1 74  GLU 74  75  75  GLU GLU A . n 
A 1 75  GLY 75  76  76  GLY GLY A . n 
A 1 76  PRO 76  77  77  PRO PRO A . n 
A 1 77  ASN 77  78  78  ASN ASN A . n 
A 1 78  PRO 78  79  79  PRO PRO A . n 
A 1 79  GLU 79  80  80  GLU GLU A . n 
A 1 80  ARG 80  81  81  ARG ARG A . n 
A 1 81  PHE 81  82  82  PHE PHE A . n 
A 1 82  LEU 82  83  83  LEU LEU A . n 
A 1 83  ILE 83  84  84  ILE ILE A . n 
A 1 84  PRO 84  85  85  PRO PRO A . n 
A 1 85  PRO 85  86  86  PRO PRO A . n 
A 1 86  TRP 86  87  87  TRP TRP A . n 
A 1 87  VAL 87  88  88  VAL VAL A . n 
A 1 88  ALA 88  89  89  ALA ALA A . n 
A 1 89  TYR 89  90  90  TYR TYR A . n 
A 1 90  HIS 90  91  91  HIS HIS A . n 
A 1 91  GLN 91  92  92  GLN GLN A . n 
A 1 92  TYR 92  93  93  TYR TYR A . n 
A 1 93  TYR 93  94  94  TYR TYR A . n 
A 1 94  GLN 94  95  95  GLN GLN A . n 
A 1 95  ARG 95  96  96  ARG ARG A . n 
A 1 96  PRO 96  97  97  PRO PRO A . n 
A 1 97  ILE 97  98  98  ILE ILE A . n 
A 1 98  GLY 98  99  99  GLY GLY A . n 
A 1 99  VAL 99  100 100 VAL VAL A . n 
A 1 100 LEU 100 101 101 LEU LEU A . n 
A 1 101 LEU 101 102 102 LEU LEU A . n 
A 1 102 LYS 102 103 103 LYS LYS A . n 
A 1 103 LYS 103 104 104 LYS LYS A . n 
A 1 104 SER 104 105 105 SER SER A . n 
A 1 105 ALA 105 106 106 ALA ALA A . n 
A 1 106 ALA 106 107 107 ALA ALA A . n 
A 1 107 TRP 107 108 108 TRP TRP A . n 
A 1 108 LYS 108 109 109 LYS LYS A . n 
A 1 109 LYS 109 110 110 LYS LYS A . n 
A 1 110 ASP 110 111 111 ASP ASP A . n 
A 1 111 ARG 111 112 112 ARG ARG A . n 
A 1 112 VAL 112 113 113 VAL VAL A . n 
A 1 113 ALA 113 114 114 ALA ALA A . n 
A 1 114 LEU 114 115 115 LEU LEU A . n 
A 1 115 ASN 115 116 116 ASN ASN A . n 
A 1 116 GLN 116 117 117 GLN GLN A . n 
A 1 117 GLU 117 118 118 GLU GLU A . n 
A 1 118 VAL 118 119 119 VAL VAL A . n 
A 1 119 MET 119 120 120 MET MET A . n 
A 1 120 ALA 120 121 121 ALA ALA A . n 
A 1 121 PRO 121 122 122 PRO PRO A . n 
A 1 122 GLU 122 123 123 GLU GLU A . n 
A 1 123 ALA 123 124 124 ALA ALA A . n 
A 1 124 THR 124 125 125 THR THR A . n 
A 1 125 LYS 125 126 126 LYS LYS A . n 
A 1 126 ASN 126 127 127 ASN ASN A . n 
A 1 127 PHE 127 128 128 PHE PHE A . n 
A 1 128 LEU 128 129 129 LEU LEU A . n 
A 1 129 PRO 129 130 130 PRO PRO A . n 
A 1 130 LEU 130 131 131 LEU LEU A . n 
A 1 131 LEU 131 132 132 LEU LEU A . n 
A 1 132 ASP 132 133 133 ASP ASP A . n 
A 1 133 ALA 133 134 134 ALA ALA A . n 
A 1 134 VAL 134 135 135 VAL VAL A . n 
A 1 135 SER 135 136 136 SER SER A . n 
A 1 136 ARG 136 137 137 ARG ARG A . n 
A 1 137 ASP 137 138 138 ASP ASP A . n 
A 1 138 PHE 138 139 139 PHE PHE A . n 
A 1 139 VAL 139 140 140 VAL VAL A . n 
A 1 140 SER 140 141 141 SER SER A . n 
A 1 141 VAL 141 142 142 VAL VAL A . n 
A 1 142 LEU 142 143 143 LEU LEU A . n 
A 1 143 HIS 143 144 144 HIS HIS A . n 
A 1 144 ARG 144 145 145 ARG ARG A . n 
A 1 145 ARG 145 146 146 ARG ARG A . n 
A 1 146 ILE 146 147 147 ILE ILE A . n 
A 1 147 LYS 147 148 148 LYS LYS A . n 
A 1 148 LYS 148 149 149 LYS LYS A . n 
A 1 149 ALA 149 150 150 ALA ALA A . n 
A 1 150 GLY 150 151 151 GLY GLY A . n 
A 1 151 SER 151 152 152 SER SER A . n 
A 1 152 GLY 152 153 153 GLY GLY A . n 
A 1 153 ASN 153 154 154 ASN ASN A . n 
A 1 154 TYR 154 155 155 TYR TYR A . n 
A 1 155 SER 155 156 156 SER SER A . n 
A 1 156 GLY 156 157 157 GLY GLY A . n 
A 1 157 ASP 157 158 158 ASP ASP A . n 
A 1 158 ILE 158 159 159 ILE ILE A . n 
A 1 159 SER 159 160 160 SER SER A . n 
A 1 160 ASP 160 161 161 ASP ASP A . n 
A 1 161 ASP 161 162 162 ASP ASP A . n 
A 1 162 LEU 162 163 163 LEU LEU A . n 
A 1 163 PHE 163 164 164 PHE PHE A . n 
A 1 164 ARG 164 165 165 ARG ARG A . n 
A 1 165 PHE 165 166 166 PHE PHE A . n 
A 1 166 ALA 166 167 167 ALA ALA A . n 
A 1 167 PHE 167 168 168 PHE PHE A . n 
A 1 168 GLU 168 169 169 GLU GLU A . n 
A 1 169 SER 169 170 170 SER SER A . n 
A 1 170 ILE 170 171 171 ILE ILE A . n 
A 1 171 THR 171 172 172 THR THR A . n 
A 1 172 ASN 172 173 173 ASN ASN A . n 
A 1 173 VAL 173 174 174 VAL VAL A . n 
A 1 174 ILE 174 175 175 ILE ILE A . n 
A 1 175 PHE 175 176 176 PHE PHE A . n 
A 1 176 GLY 176 177 177 GLY GLY A . n 
A 1 177 GLU 177 178 178 GLU GLU A . n 
A 1 178 ARG 178 179 179 ARG ARG A . n 
A 1 179 GLN 179 180 180 GLN GLN A . n 
A 1 180 GLY 180 181 181 GLY GLY A . n 
A 1 181 MET 181 182 182 MET MET A . n 
A 1 182 LEU 182 183 183 LEU LEU A . n 
A 1 183 GLU 183 184 184 GLU GLU A . n 
A 1 184 GLU 184 185 185 GLU GLU A . n 
A 1 185 VAL 185 186 186 VAL VAL A . n 
A 1 186 VAL 186 187 187 VAL VAL A . n 
A 1 187 ASN 187 188 188 ASN ASN A . n 
A 1 188 PRO 188 189 189 PRO PRO A . n 
A 1 189 GLU 189 190 190 GLU GLU A . n 
A 1 190 ALA 190 191 191 ALA ALA A . n 
A 1 191 GLN 191 192 192 GLN GLN A . n 
A 1 192 ARG 192 193 193 ARG ARG A . n 
A 1 193 PHE 193 194 194 PHE PHE A . n 
A 1 194 ILE 194 195 195 ILE ILE A . n 
A 1 195 ASP 195 196 196 ASP ASP A . n 
A 1 196 ALA 196 197 197 ALA ALA A . n 
A 1 197 ILE 197 198 198 ILE ILE A . n 
A 1 198 TYR 198 199 199 TYR TYR A . n 
A 1 199 GLN 199 200 200 GLN GLN A . n 
A 1 200 MET 200 201 201 MET MET A . n 
A 1 201 PHE 201 202 202 PHE PHE A . n 
A 1 202 HIS 202 203 203 HIS HIS A . n 
A 1 203 THR 203 204 204 THR THR A . n 
A 1 204 SER 204 205 205 SER SER A . n 
A 1 205 VAL 205 206 206 VAL VAL A . n 
A 1 206 PRO 206 207 207 PRO PRO A . n 
A 1 207 MET 207 208 208 MET MET A . n 
A 1 208 LEU 208 209 209 LEU LEU A . n 
A 1 209 ASN 209 210 210 ASN ASN A . n 
A 1 210 LEU 210 211 211 LEU LEU A . n 
A 1 211 PRO 211 212 212 PRO PRO A . n 
A 1 212 PRO 212 213 213 PRO PRO A . n 
A 1 213 ASP 213 214 214 ASP ASP A . n 
A 1 214 LEU 214 215 215 LEU LEU A . n 
A 1 215 PHE 215 216 216 PHE PHE A . n 
A 1 216 ARG 216 217 217 ARG ARG A . n 
A 1 217 LEU 217 218 218 LEU LEU A . n 
A 1 218 PHE 218 219 219 PHE PHE A . n 
A 1 219 ARG 219 220 220 ARG ARG A . n 
A 1 220 THR 220 221 221 THR THR A . n 
A 1 221 LYS 221 222 222 LYS LYS A . n 
A 1 222 THR 222 223 223 THR THR A . n 
A 1 223 TRP 223 224 224 TRP TRP A . n 
A 1 224 LYS 224 225 225 LYS LYS A . n 
A 1 225 ASP 225 226 226 ASP ASP A . n 
A 1 226 HIS 226 227 227 HIS HIS A . n 
A 1 227 VAL 227 228 228 VAL VAL A . n 
A 1 228 ALA 228 229 229 ALA ALA A . n 
A 1 229 ALA 229 230 230 ALA ALA A . n 
A 1 230 TRP 230 231 231 TRP TRP A . n 
A 1 231 ASP 231 232 232 ASP ASP A . n 
A 1 232 VAL 232 233 233 VAL VAL A . n 
A 1 233 ILE 233 234 234 ILE ILE A . n 
A 1 234 PHE 234 235 235 PHE PHE A . n 
A 1 235 SER 235 236 236 SER SER A . n 
A 1 236 LYS 236 237 237 LYS LYS A . n 
A 1 237 ALA 237 238 238 ALA ALA A . n 
A 1 238 ASP 238 239 239 ASP ASP A . n 
A 1 239 ILE 239 240 240 ILE ILE A . n 
A 1 240 TYR 240 241 241 TYR TYR A . n 
A 1 241 THR 241 242 242 THR THR A . n 
A 1 242 GLN 242 243 243 GLN GLN A . n 
A 1 243 ASN 243 244 244 ASN ASN A . n 
A 1 244 PHE 244 245 245 PHE PHE A . n 
A 1 245 TYR 245 246 246 TYR TYR A . n 
A 1 246 TRP 246 247 247 TRP TRP A . n 
A 1 247 GLU 247 248 248 GLU GLU A . n 
A 1 248 LEU 248 249 249 LEU LEU A . n 
A 1 249 ARG 249 250 250 ARG ARG A . n 
A 1 250 GLN 250 251 251 GLN GLN A . n 
A 1 251 LYS 251 252 252 LYS LYS A . n 
A 1 252 GLY 252 253 253 GLY GLY A . n 
A 1 253 SER 253 254 254 SER SER A . n 
A 1 254 VAL 254 255 255 VAL VAL A . n 
A 1 255 HIS 255 256 256 HIS HIS A . n 
A 1 256 HIS 256 257 257 HIS HIS A . n 
A 1 257 ASP 257 258 258 ASP ASP A . n 
A 1 258 TYR 258 259 259 TYR TYR A . n 
A 1 259 ARG 259 260 260 ARG ARG A . n 
A 1 260 GLY 260 261 261 GLY GLY A . n 
A 1 261 ILE 261 262 262 ILE ILE A . n 
A 1 262 LEU 262 263 263 LEU LEU A . n 
A 1 263 TYR 263 264 264 TYR TYR A . n 
A 1 264 ARG 264 265 265 ARG ARG A . n 
A 1 265 LEU 265 266 266 LEU LEU A . n 
A 1 266 LEU 266 267 267 LEU LEU A . n 
A 1 267 GLY 267 268 268 GLY GLY A . n 
A 1 268 ASP 268 269 269 ASP ASP A . n 
A 1 269 SER 269 270 270 SER SER A . n 
A 1 270 LYS 270 271 271 LYS LYS A . n 
A 1 271 MET 271 272 272 MET MET A . n 
A 1 272 SER 272 273 273 SER SER A . n 
A 1 273 PHE 273 274 274 PHE PHE A . n 
A 1 274 GLU 274 275 275 GLU GLU A . n 
A 1 275 ASP 275 276 276 ASP ASP A . n 
A 1 276 ILE 276 277 277 ILE ILE A . n 
A 1 277 LYS 277 278 278 LYS LYS A . n 
A 1 278 ALA 278 279 279 ALA ALA A . n 
A 1 279 ASN 279 280 280 ASN ASN A . n 
A 1 280 VAL 280 281 281 VAL VAL A . n 
A 1 281 THR 281 282 282 THR THR A . n 
A 1 282 GLU 282 283 283 GLU GLU A . n 
A 1 283 MET 283 284 284 MET MET A . n 
A 1 284 LEU 284 285 285 LEU LEU A . n 
A 1 285 ALA 285 286 286 ALA ALA A . n 
A 1 286 GLY 286 287 287 GLY GLY A . n 
A 1 287 GLY 287 288 288 GLY GLY A . n 
A 1 288 VAL 288 289 289 VAL VAL A . n 
A 1 289 ASP 289 290 290 ASP ASP A . n 
A 1 290 THR 290 291 291 THR THR A . n 
A 1 291 THR 291 292 292 THR THR A . n 
A 1 292 SER 292 293 293 SER SER A . n 
A 1 293 MET 293 294 294 MET MET A . n 
A 1 294 THR 294 295 295 THR THR A . n 
A 1 295 LEU 295 296 296 LEU LEU A . n 
A 1 296 GLN 296 297 297 GLN GLN A . n 
A 1 297 TRP 297 298 298 TRP TRP A . n 
A 1 298 HIS 298 299 299 HIS HIS A . n 
A 1 299 LEU 299 300 300 LEU LEU A . n 
A 1 300 TYR 300 301 301 TYR TYR A . n 
A 1 301 GLU 301 302 302 GLU GLU A . n 
A 1 302 MET 302 303 303 MET MET A . n 
A 1 303 ALA 303 304 304 ALA ALA A . n 
A 1 304 ARG 304 305 305 ARG ARG A . n 
A 1 305 ASN 305 306 306 ASN ASN A . n 
A 1 306 LEU 306 307 307 LEU LEU A . n 
A 1 307 LYS 307 308 308 LYS LYS A . n 
A 1 308 VAL 308 309 309 VAL VAL A . n 
A 1 309 GLN 309 310 310 GLN GLN A . n 
A 1 310 ASP 310 311 311 ASP ASP A . n 
A 1 311 MET 311 312 312 MET MET A . n 
A 1 312 LEU 312 313 313 LEU LEU A . n 
A 1 313 ARG 313 314 314 ARG ARG A . n 
A 1 314 ALA 314 315 315 ALA ALA A . n 
A 1 315 GLU 315 316 316 GLU GLU A . n 
A 1 316 VAL 316 317 317 VAL VAL A . n 
A 1 317 LEU 317 318 318 LEU LEU A . n 
A 1 318 ALA 318 319 319 ALA ALA A . n 
A 1 319 ALA 319 320 320 ALA ALA A . n 
A 1 320 ARG 320 321 321 ARG ARG A . n 
A 1 321 HIS 321 322 322 HIS HIS A . n 
A 1 322 GLN 322 323 323 GLN GLN A . n 
A 1 323 ALA 323 324 324 ALA ALA A . n 
A 1 324 GLN 324 325 325 GLN GLN A . n 
A 1 325 GLY 325 326 326 GLY GLY A . n 
A 1 326 ASP 326 327 327 ASP ASP A . n 
A 1 327 MET 327 328 328 MET MET A . n 
A 1 328 ALA 328 329 329 ALA ALA A . n 
A 1 329 THR 329 330 330 THR THR A . n 
A 1 330 MET 330 331 331 MET MET A . n 
A 1 331 LEU 331 332 332 LEU LEU A . n 
A 1 332 GLN 332 333 333 GLN GLN A . n 
A 1 333 LEU 333 334 334 LEU LEU A . n 
A 1 334 VAL 334 335 335 VAL VAL A . n 
A 1 335 PRO 335 336 336 PRO PRO A . n 
A 1 336 LEU 336 337 337 LEU LEU A . n 
A 1 337 LEU 337 338 338 LEU LEU A . n 
A 1 338 LYS 338 339 339 LYS LYS A . n 
A 1 339 ALA 339 340 340 ALA ALA A . n 
A 1 340 SER 340 341 341 SER SER A . n 
A 1 341 ILE 341 342 342 ILE ILE A . n 
A 1 342 LYS 342 343 343 LYS LYS A . n 
A 1 343 GLU 343 344 344 GLU GLU A . n 
A 1 344 THR 344 345 345 THR THR A . n 
A 1 345 LEU 345 346 346 LEU LEU A . n 
A 1 346 ARG 346 347 347 ARG ARG A . n 
A 1 347 LEU 347 348 348 LEU LEU A . n 
A 1 348 HIS 348 349 349 HIS HIS A . n 
A 1 349 PRO 349 350 350 PRO PRO A . n 
A 1 350 ILE 350 351 351 ILE ILE A . n 
A 1 351 SER 351 352 352 SER SER A . n 
A 1 352 VAL 352 353 353 VAL VAL A . n 
A 1 353 THR 353 354 354 THR THR A . n 
A 1 354 LEU 354 355 355 LEU LEU A . n 
A 1 355 GLN 355 356 356 GLN GLN A . n 
A 1 356 ARG 356 357 357 ARG ARG A . n 
A 1 357 TYR 357 358 358 TYR TYR A . n 
A 1 358 LEU 358 359 359 LEU LEU A . n 
A 1 359 VAL 359 360 360 VAL VAL A . n 
A 1 360 ASN 360 361 361 ASN ASN A . n 
A 1 361 ASP 361 362 362 ASP ASP A . n 
A 1 362 LEU 362 363 363 LEU LEU A . n 
A 1 363 VAL 363 364 364 VAL VAL A . n 
A 1 364 LEU 364 365 365 LEU LEU A . n 
A 1 365 ARG 365 366 366 ARG ARG A . n 
A 1 366 ASP 366 367 367 ASP ASP A . n 
A 1 367 TYR 367 368 368 TYR TYR A . n 
A 1 368 MET 368 369 369 MET MET A . n 
A 1 369 ILE 369 370 370 ILE ILE A . n 
A 1 370 PRO 370 371 371 PRO PRO A . n 
A 1 371 ALA 371 372 372 ALA ALA A . n 
A 1 372 LYS 372 373 373 LYS LYS A . n 
A 1 373 THR 373 374 374 THR THR A . n 
A 1 374 LEU 374 375 375 LEU LEU A . n 
A 1 375 VAL 375 376 376 VAL VAL A . n 
A 1 376 GLN 376 377 377 GLN GLN A . n 
A 1 377 VAL 377 378 378 VAL VAL A . n 
A 1 378 ALA 378 379 379 ALA ALA A . n 
A 1 379 ILE 379 380 380 ILE ILE A . n 
A 1 380 TYR 380 381 381 TYR TYR A . n 
A 1 381 ALA 381 382 382 ALA ALA A . n 
A 1 382 LEU 382 383 383 LEU LEU A . n 
A 1 383 GLY 383 384 384 GLY GLY A . n 
A 1 384 ARG 384 385 385 ARG ARG A . n 
A 1 385 GLU 385 386 386 GLU GLU A . n 
A 1 386 PRO 386 387 387 PRO PRO A . n 
A 1 387 THR 387 388 388 THR THR A . n 
A 1 388 PHE 388 389 389 PHE PHE A . n 
A 1 389 PHE 389 390 390 PHE PHE A . n 
A 1 390 PHE 390 391 391 PHE PHE A . n 
A 1 391 ASP 391 392 392 ASP ASP A . n 
A 1 392 PRO 392 393 393 PRO PRO A . n 
A 1 393 GLU 393 394 394 GLU GLU A . n 
A 1 394 ASN 394 395 395 ASN ASN A . n 
A 1 395 PHE 395 396 396 PHE PHE A . n 
A 1 396 ASP 396 397 397 ASP ASP A . n 
A 1 397 PRO 397 398 398 PRO PRO A . n 
A 1 398 THR 398 399 399 THR THR A . n 
A 1 399 ARG 399 400 400 ARG ARG A . n 
A 1 400 TRP 400 401 401 TRP TRP A . n 
A 1 401 LEU 401 402 402 LEU LEU A . n 
A 1 402 SER 402 403 403 SER SER A . n 
A 1 403 LYS 403 404 404 LYS LYS A . n 
A 1 404 ASP 404 405 405 ASP ASP A . n 
A 1 405 LYS 405 406 406 LYS LYS A . n 
A 1 406 ASN 406 407 407 ASN ASN A . n 
A 1 407 ILE 407 408 408 ILE ILE A . n 
A 1 408 THR 408 409 409 THR THR A . n 
A 1 409 TYR 409 410 410 TYR TYR A . n 
A 1 410 PHE 410 411 411 PHE PHE A . n 
A 1 411 ARG 411 412 412 ARG ARG A . n 
A 1 412 ASN 412 413 413 ASN ASN A . n 
A 1 413 LEU 413 414 414 LEU LEU A . n 
A 1 414 GLY 414 415 415 GLY GLY A . n 
A 1 415 PHE 415 416 416 PHE PHE A . n 
A 1 416 GLY 416 417 417 GLY GLY A . n 
A 1 417 TRP 417 418 418 TRP TRP A . n 
A 1 418 GLY 418 419 419 GLY GLY A . n 
A 1 419 VAL 419 420 420 VAL VAL A . n 
A 1 420 ARG 420 421 421 ARG ARG A . n 
A 1 421 GLN 421 422 422 GLN GLN A . n 
A 1 422 CYS 422 423 423 CYS CYS A . n 
A 1 423 LEU 423 424 424 LEU LEU A . n 
A 1 424 GLY 424 425 425 GLY GLY A . n 
A 1 425 ARG 425 426 426 ARG ARG A . n 
A 1 426 ARG 426 427 427 ARG ARG A . n 
A 1 427 ILE 427 428 428 ILE ILE A . n 
A 1 428 ALA 428 429 429 ALA ALA A . n 
A 1 429 GLU 429 430 430 GLU GLU A . n 
A 1 430 LEU 430 431 431 LEU LEU A . n 
A 1 431 GLU 431 432 432 GLU GLU A . n 
A 1 432 MET 432 433 433 MET MET A . n 
A 1 433 THR 433 434 434 THR THR A . n 
A 1 434 ILE 434 435 435 ILE ILE A . n 
A 1 435 PHE 435 436 436 PHE PHE A . n 
A 1 436 LEU 436 437 437 LEU LEU A . n 
A 1 437 ILE 437 438 438 ILE ILE A . n 
A 1 438 ASN 438 439 439 ASN ASN A . n 
A 1 439 MET 439 440 440 MET MET A . n 
A 1 440 LEU 440 441 441 LEU LEU A . n 
A 1 441 GLU 441 442 442 GLU GLU A . n 
A 1 442 ASN 442 443 443 ASN ASN A . n 
A 1 443 PHE 443 444 444 PHE PHE A . n 
A 1 444 ARG 444 445 445 ARG ARG A . n 
A 1 445 VAL 445 446 446 VAL VAL A . n 
A 1 446 GLU 446 447 447 GLU GLU A . n 
A 1 447 ILE 447 448 448 ILE ILE A . n 
A 1 448 GLN 448 449 449 GLN GLN A . n 
A 1 449 HIS 449 450 450 HIS HIS A . n 
A 1 450 LEU 450 451 451 LEU LEU A . n 
A 1 451 SER 451 452 452 SER SER A . n 
A 1 452 ASP 452 453 453 ASP ASP A . n 
A 1 453 VAL 453 454 454 VAL VAL A . n 
A 1 454 GLY 454 455 455 GLY GLY A . n 
A 1 455 THR 455 456 456 THR THR A . n 
A 1 456 THR 456 457 457 THR THR A . n 
A 1 457 PHE 457 458 458 PHE PHE A . n 
A 1 458 ASN 458 459 459 ASN ASN A . n 
A 1 459 LEU 459 460 460 LEU LEU A . n 
A 1 460 ILE 460 461 461 ILE ILE A . n 
A 1 461 LEU 461 462 462 LEU LEU A . n 
A 1 462 MET 462 463 463 MET MET A . n 
A 1 463 PRO 463 464 464 PRO PRO A . n 
A 1 464 GLU 464 465 465 GLU GLU A . n 
A 1 465 LYS 465 466 466 LYS LYS A . n 
A 1 466 PRO 466 467 467 PRO PRO A . n 
A 1 467 ILE 467 468 468 ILE ILE A . n 
A 1 468 SER 468 469 469 SER SER A . n 
A 1 469 PHE 469 470 470 PHE PHE A . n 
A 1 470 THR 470 471 471 THR THR A . n 
A 1 471 PHE 471 472 472 PHE PHE A . n 
A 1 472 TRP 472 473 473 TRP TRP A . n 
A 1 473 PRO 473 474 474 PRO PRO A . n 
A 1 474 PHE 474 475 475 PHE PHE A . n 
A 1 475 ASN 475 476 ?   ?   ?   A . n 
A 1 476 GLN 476 477 ?   ?   ?   A . n 
A 1 477 GLU 477 478 ?   ?   ?   A . n 
A 1 478 ALA 478 479 ?   ?   ?   A . n 
A 1 479 THR 479 480 ?   ?   ?   A . n 
A 1 480 GLN 480 481 ?   ?   ?   A . n 
A 1 481 GLN 481 482 ?   ?   ?   A . n 
A 1 482 HIS 482 483 ?   ?   ?   A . n 
A 1 483 HIS 483 484 ?   ?   ?   A . n 
A 1 484 HIS 484 485 ?   ?   ?   A . n 
A 1 485 HIS 485 486 ?   ?   ?   A . n 
A 1 486 HIS 486 487 ?   ?   ?   A . n 
A 1 487 HIS 487 488 ?   ?   ?   A . n 
B 1 1   SER 1   2   ?   ?   ?   B . n 
B 1 2   THR 2   3   ?   ?   ?   B . n 
B 1 3   ARG 3   4   ?   ?   ?   B . n 
B 1 4   SER 4   5   ?   ?   ?   B . n 
B 1 5   PRO 5   6   6   PRO PRO B . n 
B 1 6   ARG 6   7   7   ARG ARG B . n 
B 1 7   PRO 7   8   8   PRO PRO B . n 
B 1 8   PHE 8   9   9   PHE PHE B . n 
B 1 9   ASN 9   10  10  ASN ASN B . n 
B 1 10  GLU 10  11  11  GLU GLU B . n 
B 1 11  ILE 11  12  12  ILE ILE B . n 
B 1 12  PRO 12  13  13  PRO PRO B . n 
B 1 13  SER 13  14  14  SER SER B . n 
B 1 14  PRO 14  15  15  PRO PRO B . n 
B 1 15  GLY 15  16  16  GLY GLY B . n 
B 1 16  ASP 16  17  17  ASP ASP B . n 
B 1 17  ASN 17  18  18  ASN ASN B . n 
B 1 18  GLY 18  19  19  GLY GLY B . n 
B 1 19  TRP 19  20  20  TRP TRP B . n 
B 1 20  LEU 20  21  21  LEU LEU B . n 
B 1 21  ASN 21  22  22  ASN ASN B . n 
B 1 22  LEU 22  23  23  LEU LEU B . n 
B 1 23  TYR 23  24  24  TYR TYR B . n 
B 1 24  HIS 24  25  25  HIS HIS B . n 
B 1 25  PHE 25  26  26  PHE PHE B . n 
B 1 26  TRP 26  27  27  TRP TRP B . n 
B 1 27  ARG 27  28  28  ARG ARG B . n 
B 1 28  GLU 28  29  29  GLU GLU B . n 
B 1 29  THR 29  30  30  THR THR B . n 
B 1 30  GLY 30  31  31  GLY GLY B . n 
B 1 31  THR 31  32  32  THR THR B . n 
B 1 32  HIS 32  33  33  HIS HIS B . n 
B 1 33  LYS 33  34  34  LYS LYS B . n 
B 1 34  VAL 34  35  35  VAL VAL B . n 
B 1 35  HIS 35  36  36  HIS HIS B . n 
B 1 36  LEU 36  37  37  LEU LEU B . n 
B 1 37  HIS 37  38  38  HIS HIS B . n 
B 1 38  HIS 38  39  39  HIS HIS B . n 
B 1 39  VAL 39  40  40  VAL VAL B . n 
B 1 40  GLN 40  41  41  GLN GLN B . n 
B 1 41  ASN 41  42  42  ASN ASN B . n 
B 1 42  PHE 42  43  43  PHE PHE B . n 
B 1 43  GLN 43  44  44  GLN GLN B . n 
B 1 44  LYS 44  45  45  LYS LYS B . n 
B 1 45  TYR 45  46  46  TYR TYR B . n 
B 1 46  GLY 46  47  47  GLY GLY B . n 
B 1 47  PRO 47  48  48  PRO PRO B . n 
B 1 48  ILE 48  49  49  ILE ILE B . n 
B 1 49  TYR 49  50  50  TYR TYR B . n 
B 1 50  ARG 50  51  51  ARG ARG B . n 
B 1 51  GLU 51  52  52  GLU GLU B . n 
B 1 52  LYS 52  53  53  LYS LYS B . n 
B 1 53  LEU 53  54  54  LEU LEU B . n 
B 1 54  GLY 54  55  55  GLY GLY B . n 
B 1 55  ASN 55  56  56  ASN ASN B . n 
B 1 56  VAL 56  57  57  VAL VAL B . n 
B 1 57  GLU 57  58  58  GLU GLU B . n 
B 1 58  SER 58  59  59  SER SER B . n 
B 1 59  VAL 59  60  60  VAL VAL B . n 
B 1 60  TYR 60  61  61  TYR TYR B . n 
B 1 61  VAL 61  62  62  VAL VAL B . n 
B 1 62  ILE 62  63  63  ILE ILE B . n 
B 1 63  ASP 63  64  64  ASP ASP B . n 
B 1 64  PRO 64  65  65  PRO PRO B . n 
B 1 65  GLU 65  66  66  GLU GLU B . n 
B 1 66  ASP 66  67  67  ASP ASP B . n 
B 1 67  VAL 67  68  68  VAL VAL B . n 
B 1 68  ALA 68  69  69  ALA ALA B . n 
B 1 69  LEU 69  70  70  LEU LEU B . n 
B 1 70  LEU 70  71  71  LEU LEU B . n 
B 1 71  PHE 71  72  72  PHE PHE B . n 
B 1 72  LYS 72  73  73  LYS LYS B . n 
B 1 73  SER 73  74  74  SER SER B . n 
B 1 74  GLU 74  75  75  GLU GLU B . n 
B 1 75  GLY 75  76  76  GLY GLY B . n 
B 1 76  PRO 76  77  77  PRO PRO B . n 
B 1 77  ASN 77  78  78  ASN ASN B . n 
B 1 78  PRO 78  79  79  PRO PRO B . n 
B 1 79  GLU 79  80  80  GLU GLU B . n 
B 1 80  ARG 80  81  81  ARG ARG B . n 
B 1 81  PHE 81  82  82  PHE PHE B . n 
B 1 82  LEU 82  83  83  LEU LEU B . n 
B 1 83  ILE 83  84  84  ILE ILE B . n 
B 1 84  PRO 84  85  85  PRO PRO B . n 
B 1 85  PRO 85  86  86  PRO PRO B . n 
B 1 86  TRP 86  87  87  TRP TRP B . n 
B 1 87  VAL 87  88  88  VAL VAL B . n 
B 1 88  ALA 88  89  89  ALA ALA B . n 
B 1 89  TYR 89  90  90  TYR TYR B . n 
B 1 90  HIS 90  91  91  HIS HIS B . n 
B 1 91  GLN 91  92  92  GLN GLN B . n 
B 1 92  TYR 92  93  93  TYR TYR B . n 
B 1 93  TYR 93  94  94  TYR TYR B . n 
B 1 94  GLN 94  95  95  GLN GLN B . n 
B 1 95  ARG 95  96  96  ARG ARG B . n 
B 1 96  PRO 96  97  97  PRO PRO B . n 
B 1 97  ILE 97  98  98  ILE ILE B . n 
B 1 98  GLY 98  99  99  GLY GLY B . n 
B 1 99  VAL 99  100 100 VAL VAL B . n 
B 1 100 LEU 100 101 101 LEU LEU B . n 
B 1 101 LEU 101 102 102 LEU LEU B . n 
B 1 102 LYS 102 103 103 LYS LYS B . n 
B 1 103 LYS 103 104 104 LYS LYS B . n 
B 1 104 SER 104 105 105 SER SER B . n 
B 1 105 ALA 105 106 106 ALA ALA B . n 
B 1 106 ALA 106 107 107 ALA ALA B . n 
B 1 107 TRP 107 108 108 TRP TRP B . n 
B 1 108 LYS 108 109 109 LYS LYS B . n 
B 1 109 LYS 109 110 110 LYS LYS B . n 
B 1 110 ASP 110 111 111 ASP ASP B . n 
B 1 111 ARG 111 112 112 ARG ARG B . n 
B 1 112 VAL 112 113 113 VAL VAL B . n 
B 1 113 ALA 113 114 114 ALA ALA B . n 
B 1 114 LEU 114 115 115 LEU LEU B . n 
B 1 115 ASN 115 116 116 ASN ASN B . n 
B 1 116 GLN 116 117 117 GLN GLN B . n 
B 1 117 GLU 117 118 118 GLU GLU B . n 
B 1 118 VAL 118 119 119 VAL VAL B . n 
B 1 119 MET 119 120 120 MET MET B . n 
B 1 120 ALA 120 121 121 ALA ALA B . n 
B 1 121 PRO 121 122 122 PRO PRO B . n 
B 1 122 GLU 122 123 123 GLU GLU B . n 
B 1 123 ALA 123 124 124 ALA ALA B . n 
B 1 124 THR 124 125 125 THR THR B . n 
B 1 125 LYS 125 126 126 LYS LYS B . n 
B 1 126 ASN 126 127 127 ASN ASN B . n 
B 1 127 PHE 127 128 128 PHE PHE B . n 
B 1 128 LEU 128 129 129 LEU LEU B . n 
B 1 129 PRO 129 130 130 PRO PRO B . n 
B 1 130 LEU 130 131 131 LEU LEU B . n 
B 1 131 LEU 131 132 132 LEU LEU B . n 
B 1 132 ASP 132 133 133 ASP ASP B . n 
B 1 133 ALA 133 134 134 ALA ALA B . n 
B 1 134 VAL 134 135 135 VAL VAL B . n 
B 1 135 SER 135 136 136 SER SER B . n 
B 1 136 ARG 136 137 137 ARG ARG B . n 
B 1 137 ASP 137 138 138 ASP ASP B . n 
B 1 138 PHE 138 139 139 PHE PHE B . n 
B 1 139 VAL 139 140 140 VAL VAL B . n 
B 1 140 SER 140 141 141 SER SER B . n 
B 1 141 VAL 141 142 142 VAL VAL B . n 
B 1 142 LEU 142 143 143 LEU LEU B . n 
B 1 143 HIS 143 144 144 HIS HIS B . n 
B 1 144 ARG 144 145 145 ARG ARG B . n 
B 1 145 ARG 145 146 146 ARG ARG B . n 
B 1 146 ILE 146 147 147 ILE ILE B . n 
B 1 147 LYS 147 148 148 LYS LYS B . n 
B 1 148 LYS 148 149 149 LYS LYS B . n 
B 1 149 ALA 149 150 150 ALA ALA B . n 
B 1 150 GLY 150 151 151 GLY GLY B . n 
B 1 151 SER 151 152 152 SER SER B . n 
B 1 152 GLY 152 153 153 GLY GLY B . n 
B 1 153 ASN 153 154 154 ASN ASN B . n 
B 1 154 TYR 154 155 155 TYR TYR B . n 
B 1 155 SER 155 156 156 SER SER B . n 
B 1 156 GLY 156 157 157 GLY GLY B . n 
B 1 157 ASP 157 158 158 ASP ASP B . n 
B 1 158 ILE 158 159 159 ILE ILE B . n 
B 1 159 SER 159 160 160 SER SER B . n 
B 1 160 ASP 160 161 161 ASP ASP B . n 
B 1 161 ASP 161 162 162 ASP ASP B . n 
B 1 162 LEU 162 163 163 LEU LEU B . n 
B 1 163 PHE 163 164 164 PHE PHE B . n 
B 1 164 ARG 164 165 165 ARG ARG B . n 
B 1 165 PHE 165 166 166 PHE PHE B . n 
B 1 166 ALA 166 167 167 ALA ALA B . n 
B 1 167 PHE 167 168 168 PHE PHE B . n 
B 1 168 GLU 168 169 169 GLU GLU B . n 
B 1 169 SER 169 170 170 SER SER B . n 
B 1 170 ILE 170 171 171 ILE ILE B . n 
B 1 171 THR 171 172 172 THR THR B . n 
B 1 172 ASN 172 173 173 ASN ASN B . n 
B 1 173 VAL 173 174 174 VAL VAL B . n 
B 1 174 ILE 174 175 175 ILE ILE B . n 
B 1 175 PHE 175 176 176 PHE PHE B . n 
B 1 176 GLY 176 177 177 GLY GLY B . n 
B 1 177 GLU 177 178 178 GLU GLU B . n 
B 1 178 ARG 178 179 179 ARG ARG B . n 
B 1 179 GLN 179 180 180 GLN GLN B . n 
B 1 180 GLY 180 181 181 GLY GLY B . n 
B 1 181 MET 181 182 182 MET MET B . n 
B 1 182 LEU 182 183 183 LEU LEU B . n 
B 1 183 GLU 183 184 184 GLU GLU B . n 
B 1 184 GLU 184 185 185 GLU GLU B . n 
B 1 185 VAL 185 186 186 VAL VAL B . n 
B 1 186 VAL 186 187 187 VAL VAL B . n 
B 1 187 ASN 187 188 188 ASN ASN B . n 
B 1 188 PRO 188 189 189 PRO PRO B . n 
B 1 189 GLU 189 190 190 GLU GLU B . n 
B 1 190 ALA 190 191 191 ALA ALA B . n 
B 1 191 GLN 191 192 192 GLN GLN B . n 
B 1 192 ARG 192 193 193 ARG ARG B . n 
B 1 193 PHE 193 194 194 PHE PHE B . n 
B 1 194 ILE 194 195 195 ILE ILE B . n 
B 1 195 ASP 195 196 196 ASP ASP B . n 
B 1 196 ALA 196 197 197 ALA ALA B . n 
B 1 197 ILE 197 198 198 ILE ILE B . n 
B 1 198 TYR 198 199 199 TYR TYR B . n 
B 1 199 GLN 199 200 200 GLN GLN B . n 
B 1 200 MET 200 201 201 MET MET B . n 
B 1 201 PHE 201 202 202 PHE PHE B . n 
B 1 202 HIS 202 203 203 HIS HIS B . n 
B 1 203 THR 203 204 204 THR THR B . n 
B 1 204 SER 204 205 205 SER SER B . n 
B 1 205 VAL 205 206 206 VAL VAL B . n 
B 1 206 PRO 206 207 207 PRO PRO B . n 
B 1 207 MET 207 208 208 MET MET B . n 
B 1 208 LEU 208 209 209 LEU LEU B . n 
B 1 209 ASN 209 210 210 ASN ASN B . n 
B 1 210 LEU 210 211 211 LEU LEU B . n 
B 1 211 PRO 211 212 212 PRO PRO B . n 
B 1 212 PRO 212 213 213 PRO PRO B . n 
B 1 213 ASP 213 214 214 ASP ASP B . n 
B 1 214 LEU 214 215 215 LEU LEU B . n 
B 1 215 PHE 215 216 216 PHE PHE B . n 
B 1 216 ARG 216 217 217 ARG ARG B . n 
B 1 217 LEU 217 218 218 LEU LEU B . n 
B 1 218 PHE 218 219 219 PHE PHE B . n 
B 1 219 ARG 219 220 220 ARG ARG B . n 
B 1 220 THR 220 221 221 THR THR B . n 
B 1 221 LYS 221 222 222 LYS LYS B . n 
B 1 222 THR 222 223 223 THR THR B . n 
B 1 223 TRP 223 224 224 TRP TRP B . n 
B 1 224 LYS 224 225 225 LYS LYS B . n 
B 1 225 ASP 225 226 226 ASP ASP B . n 
B 1 226 HIS 226 227 227 HIS HIS B . n 
B 1 227 VAL 227 228 228 VAL VAL B . n 
B 1 228 ALA 228 229 229 ALA ALA B . n 
B 1 229 ALA 229 230 230 ALA ALA B . n 
B 1 230 TRP 230 231 231 TRP TRP B . n 
B 1 231 ASP 231 232 232 ASP ASP B . n 
B 1 232 VAL 232 233 233 VAL VAL B . n 
B 1 233 ILE 233 234 234 ILE ILE B . n 
B 1 234 PHE 234 235 235 PHE PHE B . n 
B 1 235 SER 235 236 236 SER SER B . n 
B 1 236 LYS 236 237 237 LYS LYS B . n 
B 1 237 ALA 237 238 238 ALA ALA B . n 
B 1 238 ASP 238 239 239 ASP ASP B . n 
B 1 239 ILE 239 240 240 ILE ILE B . n 
B 1 240 TYR 240 241 241 TYR TYR B . n 
B 1 241 THR 241 242 242 THR THR B . n 
B 1 242 GLN 242 243 243 GLN GLN B . n 
B 1 243 ASN 243 244 244 ASN ASN B . n 
B 1 244 PHE 244 245 245 PHE PHE B . n 
B 1 245 TYR 245 246 246 TYR TYR B . n 
B 1 246 TRP 246 247 247 TRP TRP B . n 
B 1 247 GLU 247 248 248 GLU GLU B . n 
B 1 248 LEU 248 249 249 LEU LEU B . n 
B 1 249 ARG 249 250 250 ARG ARG B . n 
B 1 250 GLN 250 251 251 GLN GLN B . n 
B 1 251 LYS 251 252 252 LYS LYS B . n 
B 1 252 GLY 252 253 253 GLY GLY B . n 
B 1 253 SER 253 254 254 SER SER B . n 
B 1 254 VAL 254 255 255 VAL VAL B . n 
B 1 255 HIS 255 256 256 HIS HIS B . n 
B 1 256 HIS 256 257 257 HIS HIS B . n 
B 1 257 ASP 257 258 258 ASP ASP B . n 
B 1 258 TYR 258 259 259 TYR TYR B . n 
B 1 259 ARG 259 260 260 ARG ARG B . n 
B 1 260 GLY 260 261 261 GLY GLY B . n 
B 1 261 ILE 261 262 262 ILE ILE B . n 
B 1 262 LEU 262 263 263 LEU LEU B . n 
B 1 263 TYR 263 264 264 TYR TYR B . n 
B 1 264 ARG 264 265 265 ARG ARG B . n 
B 1 265 LEU 265 266 266 LEU LEU B . n 
B 1 266 LEU 266 267 267 LEU LEU B . n 
B 1 267 GLY 267 268 268 GLY GLY B . n 
B 1 268 ASP 268 269 269 ASP ASP B . n 
B 1 269 SER 269 270 270 SER SER B . n 
B 1 270 LYS 270 271 271 LYS LYS B . n 
B 1 271 MET 271 272 272 MET MET B . n 
B 1 272 SER 272 273 273 SER SER B . n 
B 1 273 PHE 273 274 274 PHE PHE B . n 
B 1 274 GLU 274 275 275 GLU GLU B . n 
B 1 275 ASP 275 276 276 ASP ASP B . n 
B 1 276 ILE 276 277 277 ILE ILE B . n 
B 1 277 LYS 277 278 278 LYS LYS B . n 
B 1 278 ALA 278 279 279 ALA ALA B . n 
B 1 279 ASN 279 280 280 ASN ASN B . n 
B 1 280 VAL 280 281 281 VAL VAL B . n 
B 1 281 THR 281 282 282 THR THR B . n 
B 1 282 GLU 282 283 283 GLU GLU B . n 
B 1 283 MET 283 284 284 MET MET B . n 
B 1 284 LEU 284 285 285 LEU LEU B . n 
B 1 285 ALA 285 286 286 ALA ALA B . n 
B 1 286 GLY 286 287 287 GLY GLY B . n 
B 1 287 GLY 287 288 288 GLY GLY B . n 
B 1 288 VAL 288 289 289 VAL VAL B . n 
B 1 289 ASP 289 290 290 ASP ASP B . n 
B 1 290 THR 290 291 291 THR THR B . n 
B 1 291 THR 291 292 292 THR THR B . n 
B 1 292 SER 292 293 293 SER SER B . n 
B 1 293 MET 293 294 294 MET MET B . n 
B 1 294 THR 294 295 295 THR THR B . n 
B 1 295 LEU 295 296 296 LEU LEU B . n 
B 1 296 GLN 296 297 297 GLN GLN B . n 
B 1 297 TRP 297 298 298 TRP TRP B . n 
B 1 298 HIS 298 299 299 HIS HIS B . n 
B 1 299 LEU 299 300 300 LEU LEU B . n 
B 1 300 TYR 300 301 301 TYR TYR B . n 
B 1 301 GLU 301 302 302 GLU GLU B . n 
B 1 302 MET 302 303 303 MET MET B . n 
B 1 303 ALA 303 304 304 ALA ALA B . n 
B 1 304 ARG 304 305 305 ARG ARG B . n 
B 1 305 ASN 305 306 306 ASN ASN B . n 
B 1 306 LEU 306 307 307 LEU LEU B . n 
B 1 307 LYS 307 308 308 LYS LYS B . n 
B 1 308 VAL 308 309 309 VAL VAL B . n 
B 1 309 GLN 309 310 310 GLN GLN B . n 
B 1 310 ASP 310 311 311 ASP ASP B . n 
B 1 311 MET 311 312 312 MET MET B . n 
B 1 312 LEU 312 313 313 LEU LEU B . n 
B 1 313 ARG 313 314 314 ARG ARG B . n 
B 1 314 ALA 314 315 315 ALA ALA B . n 
B 1 315 GLU 315 316 316 GLU GLU B . n 
B 1 316 VAL 316 317 317 VAL VAL B . n 
B 1 317 LEU 317 318 318 LEU LEU B . n 
B 1 318 ALA 318 319 319 ALA ALA B . n 
B 1 319 ALA 319 320 320 ALA ALA B . n 
B 1 320 ARG 320 321 321 ARG ARG B . n 
B 1 321 HIS 321 322 322 HIS HIS B . n 
B 1 322 GLN 322 323 323 GLN GLN B . n 
B 1 323 ALA 323 324 324 ALA ALA B . n 
B 1 324 GLN 324 325 325 GLN GLN B . n 
B 1 325 GLY 325 326 326 GLY GLY B . n 
B 1 326 ASP 326 327 327 ASP ASP B . n 
B 1 327 MET 327 328 328 MET MET B . n 
B 1 328 ALA 328 329 329 ALA ALA B . n 
B 1 329 THR 329 330 330 THR THR B . n 
B 1 330 MET 330 331 331 MET MET B . n 
B 1 331 LEU 331 332 332 LEU LEU B . n 
B 1 332 GLN 332 333 333 GLN GLN B . n 
B 1 333 LEU 333 334 334 LEU LEU B . n 
B 1 334 VAL 334 335 335 VAL VAL B . n 
B 1 335 PRO 335 336 336 PRO PRO B . n 
B 1 336 LEU 336 337 337 LEU LEU B . n 
B 1 337 LEU 337 338 338 LEU LEU B . n 
B 1 338 LYS 338 339 339 LYS LYS B . n 
B 1 339 ALA 339 340 340 ALA ALA B . n 
B 1 340 SER 340 341 341 SER SER B . n 
B 1 341 ILE 341 342 342 ILE ILE B . n 
B 1 342 LYS 342 343 343 LYS LYS B . n 
B 1 343 GLU 343 344 344 GLU GLU B . n 
B 1 344 THR 344 345 345 THR THR B . n 
B 1 345 LEU 345 346 346 LEU LEU B . n 
B 1 346 ARG 346 347 347 ARG ARG B . n 
B 1 347 LEU 347 348 348 LEU LEU B . n 
B 1 348 HIS 348 349 349 HIS HIS B . n 
B 1 349 PRO 349 350 350 PRO PRO B . n 
B 1 350 ILE 350 351 351 ILE ILE B . n 
B 1 351 SER 351 352 352 SER SER B . n 
B 1 352 VAL 352 353 353 VAL VAL B . n 
B 1 353 THR 353 354 354 THR THR B . n 
B 1 354 LEU 354 355 355 LEU LEU B . n 
B 1 355 GLN 355 356 356 GLN GLN B . n 
B 1 356 ARG 356 357 357 ARG ARG B . n 
B 1 357 TYR 357 358 358 TYR TYR B . n 
B 1 358 LEU 358 359 359 LEU LEU B . n 
B 1 359 VAL 359 360 360 VAL VAL B . n 
B 1 360 ASN 360 361 361 ASN ASN B . n 
B 1 361 ASP 361 362 362 ASP ASP B . n 
B 1 362 LEU 362 363 363 LEU LEU B . n 
B 1 363 VAL 363 364 364 VAL VAL B . n 
B 1 364 LEU 364 365 365 LEU LEU B . n 
B 1 365 ARG 365 366 366 ARG ARG B . n 
B 1 366 ASP 366 367 367 ASP ASP B . n 
B 1 367 TYR 367 368 368 TYR TYR B . n 
B 1 368 MET 368 369 369 MET MET B . n 
B 1 369 ILE 369 370 370 ILE ILE B . n 
B 1 370 PRO 370 371 371 PRO PRO B . n 
B 1 371 ALA 371 372 372 ALA ALA B . n 
B 1 372 LYS 372 373 373 LYS LYS B . n 
B 1 373 THR 373 374 374 THR THR B . n 
B 1 374 LEU 374 375 375 LEU LEU B . n 
B 1 375 VAL 375 376 376 VAL VAL B . n 
B 1 376 GLN 376 377 377 GLN GLN B . n 
B 1 377 VAL 377 378 378 VAL VAL B . n 
B 1 378 ALA 378 379 379 ALA ALA B . n 
B 1 379 ILE 379 380 380 ILE ILE B . n 
B 1 380 TYR 380 381 381 TYR TYR B . n 
B 1 381 ALA 381 382 382 ALA ALA B . n 
B 1 382 LEU 382 383 383 LEU LEU B . n 
B 1 383 GLY 383 384 384 GLY GLY B . n 
B 1 384 ARG 384 385 385 ARG ARG B . n 
B 1 385 GLU 385 386 386 GLU GLU B . n 
B 1 386 PRO 386 387 387 PRO PRO B . n 
B 1 387 THR 387 388 388 THR THR B . n 
B 1 388 PHE 388 389 389 PHE PHE B . n 
B 1 389 PHE 389 390 390 PHE PHE B . n 
B 1 390 PHE 390 391 391 PHE PHE B . n 
B 1 391 ASP 391 392 392 ASP ASP B . n 
B 1 392 PRO 392 393 393 PRO PRO B . n 
B 1 393 GLU 393 394 394 GLU GLU B . n 
B 1 394 ASN 394 395 395 ASN ASN B . n 
B 1 395 PHE 395 396 396 PHE PHE B . n 
B 1 396 ASP 396 397 397 ASP ASP B . n 
B 1 397 PRO 397 398 398 PRO PRO B . n 
B 1 398 THR 398 399 399 THR THR B . n 
B 1 399 ARG 399 400 400 ARG ARG B . n 
B 1 400 TRP 400 401 401 TRP TRP B . n 
B 1 401 LEU 401 402 402 LEU LEU B . n 
B 1 402 SER 402 403 403 SER SER B . n 
B 1 403 LYS 403 404 404 LYS LYS B . n 
B 1 404 ASP 404 405 405 ASP ASP B . n 
B 1 405 LYS 405 406 406 LYS LYS B . n 
B 1 406 ASN 406 407 407 ASN ASN B . n 
B 1 407 ILE 407 408 408 ILE ILE B . n 
B 1 408 THR 408 409 409 THR THR B . n 
B 1 409 TYR 409 410 410 TYR TYR B . n 
B 1 410 PHE 410 411 411 PHE PHE B . n 
B 1 411 ARG 411 412 412 ARG ARG B . n 
B 1 412 ASN 412 413 413 ASN ASN B . n 
B 1 413 LEU 413 414 414 LEU LEU B . n 
B 1 414 GLY 414 415 415 GLY GLY B . n 
B 1 415 PHE 415 416 416 PHE PHE B . n 
B 1 416 GLY 416 417 417 GLY GLY B . n 
B 1 417 TRP 417 418 418 TRP TRP B . n 
B 1 418 GLY 418 419 419 GLY GLY B . n 
B 1 419 VAL 419 420 420 VAL VAL B . n 
B 1 420 ARG 420 421 421 ARG ARG B . n 
B 1 421 GLN 421 422 422 GLN GLN B . n 
B 1 422 CYS 422 423 423 CYS CYS B . n 
B 1 423 LEU 423 424 424 LEU LEU B . n 
B 1 424 GLY 424 425 425 GLY GLY B . n 
B 1 425 ARG 425 426 426 ARG ARG B . n 
B 1 426 ARG 426 427 427 ARG ARG B . n 
B 1 427 ILE 427 428 428 ILE ILE B . n 
B 1 428 ALA 428 429 429 ALA ALA B . n 
B 1 429 GLU 429 430 430 GLU GLU B . n 
B 1 430 LEU 430 431 431 LEU LEU B . n 
B 1 431 GLU 431 432 432 GLU GLU B . n 
B 1 432 MET 432 433 433 MET MET B . n 
B 1 433 THR 433 434 434 THR THR B . n 
B 1 434 ILE 434 435 435 ILE ILE B . n 
B 1 435 PHE 435 436 436 PHE PHE B . n 
B 1 436 LEU 436 437 437 LEU LEU B . n 
B 1 437 ILE 437 438 438 ILE ILE B . n 
B 1 438 ASN 438 439 439 ASN ASN B . n 
B 1 439 MET 439 440 440 MET MET B . n 
B 1 440 LEU 440 441 441 LEU LEU B . n 
B 1 441 GLU 441 442 442 GLU GLU B . n 
B 1 442 ASN 442 443 443 ASN ASN B . n 
B 1 443 PHE 443 444 444 PHE PHE B . n 
B 1 444 ARG 444 445 445 ARG ARG B . n 
B 1 445 VAL 445 446 446 VAL VAL B . n 
B 1 446 GLU 446 447 447 GLU GLU B . n 
B 1 447 ILE 447 448 448 ILE ILE B . n 
B 1 448 GLN 448 449 449 GLN GLN B . n 
B 1 449 HIS 449 450 450 HIS HIS B . n 
B 1 450 LEU 450 451 451 LEU LEU B . n 
B 1 451 SER 451 452 452 SER SER B . n 
B 1 452 ASP 452 453 453 ASP ASP B . n 
B 1 453 VAL 453 454 454 VAL VAL B . n 
B 1 454 GLY 454 455 455 GLY GLY B . n 
B 1 455 THR 455 456 456 THR THR B . n 
B 1 456 THR 456 457 457 THR THR B . n 
B 1 457 PHE 457 458 458 PHE PHE B . n 
B 1 458 ASN 458 459 459 ASN ASN B . n 
B 1 459 LEU 459 460 460 LEU LEU B . n 
B 1 460 ILE 460 461 461 ILE ILE B . n 
B 1 461 LEU 461 462 462 LEU LEU B . n 
B 1 462 MET 462 463 463 MET MET B . n 
B 1 463 PRO 463 464 464 PRO PRO B . n 
B 1 464 GLU 464 465 465 GLU GLU B . n 
B 1 465 LYS 465 466 466 LYS LYS B . n 
B 1 466 PRO 466 467 467 PRO PRO B . n 
B 1 467 ILE 467 468 468 ILE ILE B . n 
B 1 468 SER 468 469 469 SER SER B . n 
B 1 469 PHE 469 470 470 PHE PHE B . n 
B 1 470 THR 470 471 471 THR THR B . n 
B 1 471 PHE 471 472 472 PHE PHE B . n 
B 1 472 TRP 472 473 473 TRP TRP B . n 
B 1 473 PRO 473 474 474 PRO PRO B . n 
B 1 474 PHE 474 475 475 PHE PHE B . n 
B 1 475 ASN 475 476 ?   ?   ?   B . n 
B 1 476 GLN 476 477 ?   ?   ?   B . n 
B 1 477 GLU 477 478 ?   ?   ?   B . n 
B 1 478 ALA 478 479 ?   ?   ?   B . n 
B 1 479 THR 479 480 ?   ?   ?   B . n 
B 1 480 GLN 480 481 ?   ?   ?   B . n 
B 1 481 GLN 481 482 ?   ?   ?   B . n 
B 1 482 HIS 482 483 ?   ?   ?   B . n 
B 1 483 HIS 483 484 ?   ?   ?   B . n 
B 1 484 HIS 484 485 ?   ?   ?   B . n 
B 1 485 HIS 485 486 ?   ?   ?   B . n 
B 1 486 HIS 486 487 ?   ?   ?   B . n 
B 1 487 HIS 487 488 ?   ?   ?   B . n 
C 2 1   SER 1   2   ?   ?   ?   C . n 
C 2 2   SER 2   3   ?   ?   ?   C . n 
C 2 3   GLU 3   4   ?   ?   ?   C . n 
C 2 4   ASP 4   5   ?   ?   ?   C . n 
C 2 5   LYS 5   6   ?   ?   ?   C . n 
C 2 6   ILE 6   7   ?   ?   ?   C . n 
C 2 7   THR 7   8   ?   ?   ?   C . n 
C 2 8   VAL 8   9   ?   ?   ?   C . n 
C 2 9   HIS 9   10  ?   ?   ?   C . n 
C 2 10  PHE 10  11  ?   ?   ?   C . n 
C 2 11  ILE 11  12  ?   ?   ?   C . n 
C 2 12  ASN 12  13  ?   ?   ?   C . n 
C 2 13  ARG 13  14  ?   ?   ?   C . n 
C 2 14  ASP 14  15  ?   ?   ?   C . n 
C 2 15  GLY 15  16  ?   ?   ?   C . n 
C 2 16  GLU 16  17  ?   ?   ?   C . n 
C 2 17  THR 17  18  ?   ?   ?   C . n 
C 2 18  LEU 18  19  ?   ?   ?   C . n 
C 2 19  THR 19  20  ?   ?   ?   C . n 
C 2 20  THR 20  21  ?   ?   ?   C . n 
C 2 21  LYS 21  22  ?   ?   ?   C . n 
C 2 22  GLY 22  23  ?   ?   ?   C . n 
C 2 23  LYS 23  24  ?   ?   ?   C . n 
C 2 24  VAL 24  25  ?   ?   ?   C . n 
C 2 25  GLY 25  26  ?   ?   ?   C . n 
C 2 26  ASP 26  27  ?   ?   ?   C . n 
C 2 27  SER 27  28  28  SER SER C . n 
C 2 28  LEU 28  29  29  LEU LEU C . n 
C 2 29  LEU 29  30  30  LEU LEU C . n 
C 2 30  ASP 30  31  31  ASP ASP C . n 
C 2 31  VAL 31  32  32  VAL VAL C . n 
C 2 32  VAL 32  33  33  VAL VAL C . n 
C 2 33  VAL 33  34  34  VAL VAL C . n 
C 2 34  GLU 34  35  35  GLU GLU C . n 
C 2 35  ASN 35  36  36  ASN ASN C . n 
C 2 36  ASN 36  37  37  ASN ASN C . n 
C 2 37  LEU 37  38  38  LEU LEU C . n 
C 2 38  ASP 38  39  39  ASP ASP C . n 
C 2 39  ILE 39  40  40  ILE ILE C . n 
C 2 40  ASP 40  41  41  ASP ASP C . n 
C 2 41  GLY 41  42  42  GLY GLY C . n 
C 2 42  PHE 42  43  43  PHE PHE C . n 
C 2 43  GLY 43  44  44  GLY GLY C . n 
C 2 44  ALA 44  45  45  ALA ALA C . n 
C 2 45  CYS 45  46  46  CYS CYS C . n 
C 2 46  GLU 46  47  47  GLU GLU C . n 
C 2 47  GLY 47  48  48  GLY GLY C . n 
C 2 48  THR 48  49  49  THR THR C . n 
C 2 49  LEU 49  50  50  LEU LEU C . n 
C 2 50  ALA 50  51  51  ALA ALA C . n 
C 2 51  CYS 51  52  52  CYS CYS C . n 
C 2 52  SER 52  53  53  SER SER C . n 
C 2 53  THR 53  54  54  THR THR C . n 
C 2 54  CYS 54  55  55  CYS CYS C . n 
C 2 55  HIS 55  56  56  HIS HIS C . n 
C 2 56  LEU 56  57  57  LEU LEU C . n 
C 2 57  ILE 57  58  58  ILE ILE C . n 
C 2 58  PHE 58  59  59  PHE PHE C . n 
C 2 59  GLU 59  60  60  GLU GLU C . n 
C 2 60  ASP 60  61  61  ASP ASP C . n 
C 2 61  HIS 61  62  62  HIS HIS C . n 
C 2 62  ILE 62  63  63  ILE ILE C . n 
C 2 63  TYR 63  64  64  TYR TYR C . n 
C 2 64  GLU 64  65  65  GLU GLU C . n 
C 2 65  LYS 65  66  66  LYS LYS C . n 
C 2 66  LEU 66  67  67  LEU LEU C . n 
C 2 67  ASP 67  68  68  ASP ASP C . n 
C 2 68  ALA 68  69  69  ALA ALA C . n 
C 2 69  ILE 69  70  70  ILE ILE C . n 
C 2 70  THR 70  71  71  THR THR C . n 
C 2 71  ASP 71  72  72  ASP ASP C . n 
C 2 72  GLU 72  73  73  GLU GLU C . n 
C 2 73  GLU 73  74  74  GLU GLU C . n 
C 2 74  ASN 74  75  75  ASN ASN C . n 
C 2 75  ASP 75  76  76  ASP ASP C . n 
C 2 76  MET 76  77  77  MET MET C . n 
C 2 77  LEU 77  78  78  LEU LEU C . n 
C 2 78  ASP 78  79  79  ASP ASP C . n 
C 2 79  LEU 79  80  80  LEU LEU C . n 
C 2 80  ALA 80  81  81  ALA ALA C . n 
C 2 81  TYR 81  82  82  TYR TYR C . n 
C 2 82  GLY 82  83  83  GLY GLY C . n 
C 2 83  LEU 83  84  84  LEU LEU C . n 
C 2 84  THR 84  85  85  THR THR C . n 
C 2 85  ASP 85  86  86  ASP ASP C . n 
C 2 86  ARG 86  87  87  ARG ARG C . n 
C 2 87  SER 87  88  88  SER SER C . n 
C 2 88  ARG 88  89  89  ARG ARG C . n 
C 2 89  LEU 89  90  90  LEU LEU C . n 
C 2 90  GLY 90  91  91  GLY GLY C . n 
C 2 91  CYS 91  92  92  CYS CYS C . n 
C 2 92  GLN 92  93  93  GLN GLN C . n 
C 2 93  ILE 93  94  94  ILE ILE C . n 
C 2 94  CYS 94  95  95  CYS CYS C . n 
C 2 95  LEU 95  96  ?   ?   ?   C . n 
C 2 96  THR 96  97  ?   ?   ?   C . n 
C 2 97  LYS 97  98  ?   ?   ?   C . n 
C 2 98  SER 98  99  ?   ?   ?   C . n 
C 2 99  MET 99  100 ?   ?   ?   C . n 
C 2 100 ASP 100 101 ?   ?   ?   C . n 
C 2 101 ASN 101 102 ?   ?   ?   C . n 
C 2 102 MET 102 103 ?   ?   ?   C . n 
C 2 103 THR 103 104 ?   ?   ?   C . n 
C 2 104 VAL 104 105 ?   ?   ?   C . n 
C 2 105 ARG 105 106 ?   ?   ?   C . n 
C 2 106 VAL 106 107 ?   ?   ?   C . n 
C 2 107 PRO 107 108 ?   ?   ?   C . n 
C 2 108 GLU 108 109 ?   ?   ?   C . n 
C 2 109 THR 109 110 ?   ?   ?   C . n 
C 2 110 VAL 110 111 ?   ?   ?   C . n 
C 2 111 ALA 111 112 ?   ?   ?   C . n 
C 2 112 ASP 112 113 ?   ?   ?   C . n 
C 2 113 ALA 113 114 ?   ?   ?   C . n 
C 2 114 ARG 114 115 ?   ?   ?   C . n 
D 2 1   SER 1   2   ?   ?   ?   D . n 
D 2 2   SER 2   3   ?   ?   ?   D . n 
D 2 3   GLU 3   4   ?   ?   ?   D . n 
D 2 4   ASP 4   5   ?   ?   ?   D . n 
D 2 5   LYS 5   6   ?   ?   ?   D . n 
D 2 6   ILE 6   7   ?   ?   ?   D . n 
D 2 7   THR 7   8   ?   ?   ?   D . n 
D 2 8   VAL 8   9   ?   ?   ?   D . n 
D 2 9   HIS 9   10  ?   ?   ?   D . n 
D 2 10  PHE 10  11  ?   ?   ?   D . n 
D 2 11  ILE 11  12  ?   ?   ?   D . n 
D 2 12  ASN 12  13  ?   ?   ?   D . n 
D 2 13  ARG 13  14  ?   ?   ?   D . n 
D 2 14  ASP 14  15  ?   ?   ?   D . n 
D 2 15  GLY 15  16  ?   ?   ?   D . n 
D 2 16  GLU 16  17  ?   ?   ?   D . n 
D 2 17  THR 17  18  ?   ?   ?   D . n 
D 2 18  LEU 18  19  ?   ?   ?   D . n 
D 2 19  THR 19  20  ?   ?   ?   D . n 
D 2 20  THR 20  21  ?   ?   ?   D . n 
D 2 21  LYS 21  22  ?   ?   ?   D . n 
D 2 22  GLY 22  23  ?   ?   ?   D . n 
D 2 23  LYS 23  24  ?   ?   ?   D . n 
D 2 24  VAL 24  25  ?   ?   ?   D . n 
D 2 25  GLY 25  26  ?   ?   ?   D . n 
D 2 26  ASP 26  27  ?   ?   ?   D . n 
D 2 27  SER 27  28  28  SER SER D . n 
D 2 28  LEU 28  29  29  LEU LEU D . n 
D 2 29  LEU 29  30  30  LEU LEU D . n 
D 2 30  ASP 30  31  31  ASP ASP D . n 
D 2 31  VAL 31  32  32  VAL VAL D . n 
D 2 32  VAL 32  33  33  VAL VAL D . n 
D 2 33  VAL 33  34  34  VAL VAL D . n 
D 2 34  GLU 34  35  35  GLU GLU D . n 
D 2 35  ASN 35  36  36  ASN ASN D . n 
D 2 36  ASN 36  37  37  ASN ASN D . n 
D 2 37  LEU 37  38  38  LEU LEU D . n 
D 2 38  ASP 38  39  39  ASP ASP D . n 
D 2 39  ILE 39  40  40  ILE ILE D . n 
D 2 40  ASP 40  41  41  ASP ASP D . n 
D 2 41  GLY 41  42  42  GLY GLY D . n 
D 2 42  PHE 42  43  43  PHE PHE D . n 
D 2 43  GLY 43  44  44  GLY GLY D . n 
D 2 44  ALA 44  45  45  ALA ALA D . n 
D 2 45  CYS 45  46  46  CYS CYS D . n 
D 2 46  GLU 46  47  47  GLU GLU D . n 
D 2 47  GLY 47  48  48  GLY GLY D . n 
D 2 48  THR 48  49  49  THR THR D . n 
D 2 49  LEU 49  50  50  LEU LEU D . n 
D 2 50  ALA 50  51  51  ALA ALA D . n 
D 2 51  CYS 51  52  52  CYS CYS D . n 
D 2 52  SER 52  53  53  SER SER D . n 
D 2 53  THR 53  54  54  THR THR D . n 
D 2 54  CYS 54  55  55  CYS CYS D . n 
D 2 55  HIS 55  56  56  HIS HIS D . n 
D 2 56  LEU 56  57  57  LEU LEU D . n 
D 2 57  ILE 57  58  58  ILE ILE D . n 
D 2 58  PHE 58  59  59  PHE PHE D . n 
D 2 59  GLU 59  60  60  GLU GLU D . n 
D 2 60  ASP 60  61  61  ASP ASP D . n 
D 2 61  HIS 61  62  62  HIS HIS D . n 
D 2 62  ILE 62  63  63  ILE ILE D . n 
D 2 63  TYR 63  64  64  TYR TYR D . n 
D 2 64  GLU 64  65  65  GLU GLU D . n 
D 2 65  LYS 65  66  66  LYS LYS D . n 
D 2 66  LEU 66  67  67  LEU LEU D . n 
D 2 67  ASP 67  68  68  ASP ASP D . n 
D 2 68  ALA 68  69  69  ALA ALA D . n 
D 2 69  ILE 69  70  70  ILE ILE D . n 
D 2 70  THR 70  71  71  THR THR D . n 
D 2 71  ASP 71  72  72  ASP ASP D . n 
D 2 72  GLU 72  73  73  GLU GLU D . n 
D 2 73  GLU 73  74  74  GLU GLU D . n 
D 2 74  ASN 74  75  75  ASN ASN D . n 
D 2 75  ASP 75  76  76  ASP ASP D . n 
D 2 76  MET 76  77  77  MET MET D . n 
D 2 77  LEU 77  78  78  LEU LEU D . n 
D 2 78  ASP 78  79  79  ASP ASP D . n 
D 2 79  LEU 79  80  80  LEU LEU D . n 
D 2 80  ALA 80  81  81  ALA ALA D . n 
D 2 81  TYR 81  82  82  TYR TYR D . n 
D 2 82  GLY 82  83  83  GLY GLY D . n 
D 2 83  LEU 83  84  84  LEU LEU D . n 
D 2 84  THR 84  85  85  THR THR D . n 
D 2 85  ASP 85  86  86  ASP ASP D . n 
D 2 86  ARG 86  87  87  ARG ARG D . n 
D 2 87  SER 87  88  88  SER SER D . n 
D 2 88  ARG 88  89  89  ARG ARG D . n 
D 2 89  LEU 89  90  90  LEU LEU D . n 
D 2 90  GLY 90  91  91  GLY GLY D . n 
D 2 91  CYS 91  92  92  CYS CYS D . n 
D 2 92  GLN 92  93  93  GLN GLN D . n 
D 2 93  ILE 93  94  94  ILE ILE D . n 
D 2 94  CYS 94  95  95  CYS CYS D . n 
D 2 95  LEU 95  96  ?   ?   ?   D . n 
D 2 96  THR 96  97  ?   ?   ?   D . n 
D 2 97  LYS 97  98  ?   ?   ?   D . n 
D 2 98  SER 98  99  ?   ?   ?   D . n 
D 2 99  MET 99  100 ?   ?   ?   D . n 
D 2 100 ASP 100 101 ?   ?   ?   D . n 
D 2 101 ASN 101 102 ?   ?   ?   D . n 
D 2 102 MET 102 103 ?   ?   ?   D . n 
D 2 103 THR 103 104 ?   ?   ?   D . n 
D 2 104 VAL 104 105 ?   ?   ?   D . n 
D 2 105 ARG 105 106 ?   ?   ?   D . n 
D 2 106 VAL 106 107 ?   ?   ?   D . n 
D 2 107 PRO 107 108 ?   ?   ?   D . n 
D 2 108 GLU 108 109 ?   ?   ?   D . n 
D 2 109 THR 109 110 ?   ?   ?   D . n 
D 2 110 VAL 110 111 ?   ?   ?   D . n 
D 2 111 ALA 111 112 ?   ?   ?   D . n 
D 2 112 ASP 112 113 ?   ?   ?   D . n 
D 2 113 ALA 113 114 ?   ?   ?   D . n 
D 2 114 ARG 114 115 ?   ?   ?   D . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HEM 1   601 601 HEM HEM A . 
F 4 CLR 1   602 602 CLR CLR A . 
G 3 HEM 1   601 601 HEM HEM B . 
H 4 CLR 1   602 602 CLR CLR B . 
I 5 FES 1   150 150 FES FES C . 
J 5 FES 1   151 151 FES FES D . 
K 6 HOH 1   1   1   HOH HOH A . 
K 6 HOH 2   489 2   HOH HOH A . 
K 6 HOH 3   490 4   HOH HOH A . 
K 6 HOH 4   491 5   HOH HOH A . 
K 6 HOH 5   492 12  HOH HOH A . 
K 6 HOH 6   493 13  HOH HOH A . 
K 6 HOH 7   494 15  HOH HOH A . 
K 6 HOH 8   495 18  HOH HOH A . 
K 6 HOH 9   496 20  HOH HOH A . 
K 6 HOH 10  497 21  HOH HOH A . 
K 6 HOH 11  498 22  HOH HOH A . 
K 6 HOH 12  499 25  HOH HOH A . 
K 6 HOH 13  500 27  HOH HOH A . 
K 6 HOH 14  501 29  HOH HOH A . 
K 6 HOH 15  502 30  HOH HOH A . 
K 6 HOH 16  503 33  HOH HOH A . 
K 6 HOH 17  504 34  HOH HOH A . 
K 6 HOH 18  505 35  HOH HOH A . 
K 6 HOH 19  506 36  HOH HOH A . 
K 6 HOH 20  507 39  HOH HOH A . 
K 6 HOH 21  508 40  HOH HOH A . 
K 6 HOH 22  509 42  HOH HOH A . 
K 6 HOH 23  510 43  HOH HOH A . 
K 6 HOH 24  515 515 HOH HOH A . 
K 6 HOH 25  516 516 HOH HOH A . 
K 6 HOH 26  517 517 HOH HOH A . 
K 6 HOH 27  518 518 HOH HOH A . 
K 6 HOH 28  519 519 HOH HOH A . 
K 6 HOH 29  520 520 HOH HOH A . 
K 6 HOH 30  521 521 HOH HOH A . 
K 6 HOH 31  522 522 HOH HOH A . 
K 6 HOH 32  523 523 HOH HOH A . 
K 6 HOH 33  524 524 HOH HOH A . 
K 6 HOH 34  525 525 HOH HOH A . 
K 6 HOH 35  526 526 HOH HOH A . 
K 6 HOH 36  527 527 HOH HOH A . 
K 6 HOH 37  528 528 HOH HOH A . 
K 6 HOH 38  529 529 HOH HOH A . 
K 6 HOH 39  530 530 HOH HOH A . 
K 6 HOH 40  531 531 HOH HOH A . 
K 6 HOH 41  532 532 HOH HOH A . 
K 6 HOH 42  533 533 HOH HOH A . 
K 6 HOH 43  534 534 HOH HOH A . 
K 6 HOH 44  535 535 HOH HOH A . 
K 6 HOH 45  536 536 HOH HOH A . 
K 6 HOH 46  537 537 HOH HOH A . 
K 6 HOH 47  538 538 HOH HOH A . 
K 6 HOH 48  539 539 HOH HOH A . 
K 6 HOH 49  540 540 HOH HOH A . 
K 6 HOH 50  541 541 HOH HOH A . 
K 6 HOH 51  542 542 HOH HOH A . 
K 6 HOH 52  543 543 HOH HOH A . 
K 6 HOH 53  544 544 HOH HOH A . 
K 6 HOH 54  545 545 HOH HOH A . 
K 6 HOH 55  546 546 HOH HOH A . 
K 6 HOH 56  547 547 HOH HOH A . 
K 6 HOH 57  548 548 HOH HOH A . 
K 6 HOH 58  549 549 HOH HOH A . 
K 6 HOH 59  550 550 HOH HOH A . 
K 6 HOH 60  551 551 HOH HOH A . 
K 6 HOH 61  552 552 HOH HOH A . 
K 6 HOH 62  553 553 HOH HOH A . 
K 6 HOH 63  554 554 HOH HOH A . 
K 6 HOH 64  555 555 HOH HOH A . 
K 6 HOH 65  556 556 HOH HOH A . 
K 6 HOH 66  557 557 HOH HOH A . 
K 6 HOH 67  558 558 HOH HOH A . 
K 6 HOH 68  559 559 HOH HOH A . 
K 6 HOH 69  560 560 HOH HOH A . 
K 6 HOH 70  561 561 HOH HOH A . 
K 6 HOH 71  562 562 HOH HOH A . 
K 6 HOH 72  563 563 HOH HOH A . 
K 6 HOH 73  564 564 HOH HOH A . 
K 6 HOH 74  565 565 HOH HOH A . 
K 6 HOH 75  566 566 HOH HOH A . 
K 6 HOH 76  567 567 HOH HOH A . 
K 6 HOH 77  568 568 HOH HOH A . 
K 6 HOH 78  569 569 HOH HOH A . 
K 6 HOH 79  570 570 HOH HOH A . 
K 6 HOH 80  571 571 HOH HOH A . 
K 6 HOH 81  572 572 HOH HOH A . 
K 6 HOH 82  573 573 HOH HOH A . 
K 6 HOH 83  574 574 HOH HOH A . 
K 6 HOH 84  575 575 HOH HOH A . 
K 6 HOH 85  576 576 HOH HOH A . 
K 6 HOH 86  577 577 HOH HOH A . 
K 6 HOH 87  578 578 HOH HOH A . 
K 6 HOH 88  579 579 HOH HOH A . 
K 6 HOH 89  580 580 HOH HOH A . 
K 6 HOH 90  581 581 HOH HOH A . 
K 6 HOH 91  582 582 HOH HOH A . 
K 6 HOH 92  583 583 HOH HOH A . 
K 6 HOH 93  584 584 HOH HOH A . 
K 6 HOH 94  585 585 HOH HOH A . 
K 6 HOH 95  586 586 HOH HOH A . 
K 6 HOH 96  587 587 HOH HOH A . 
K 6 HOH 97  588 588 HOH HOH A . 
K 6 HOH 98  589 589 HOH HOH A . 
K 6 HOH 99  590 590 HOH HOH A . 
K 6 HOH 100 591 591 HOH HOH A . 
K 6 HOH 101 592 592 HOH HOH A . 
K 6 HOH 102 593 593 HOH HOH A . 
K 6 HOH 103 594 594 HOH HOH A . 
K 6 HOH 104 595 595 HOH HOH A . 
K 6 HOH 105 596 596 HOH HOH A . 
K 6 HOH 106 597 597 HOH HOH A . 
K 6 HOH 107 598 598 HOH HOH A . 
K 6 HOH 108 599 599 HOH HOH A . 
K 6 HOH 109 600 600 HOH HOH A . 
K 6 HOH 110 603 603 HOH HOH A . 
K 6 HOH 111 604 604 HOH HOH A . 
K 6 HOH 112 605 605 HOH HOH A . 
K 6 HOH 113 606 606 HOH HOH A . 
K 6 HOH 114 607 607 HOH HOH A . 
K 6 HOH 115 608 608 HOH HOH A . 
K 6 HOH 116 609 609 HOH HOH A . 
K 6 HOH 117 610 610 HOH HOH A . 
K 6 HOH 118 611 611 HOH HOH A . 
K 6 HOH 119 612 612 HOH HOH A . 
K 6 HOH 120 613 613 HOH HOH A . 
K 6 HOH 121 614 614 HOH HOH A . 
K 6 HOH 122 615 615 HOH HOH A . 
K 6 HOH 123 616 616 HOH HOH A . 
K 6 HOH 124 617 617 HOH HOH A . 
K 6 HOH 125 618 618 HOH HOH A . 
K 6 HOH 126 619 619 HOH HOH A . 
K 6 HOH 127 620 620 HOH HOH A . 
K 6 HOH 128 621 621 HOH HOH A . 
K 6 HOH 129 622 622 HOH HOH A . 
K 6 HOH 130 623 623 HOH HOH A . 
K 6 HOH 131 624 624 HOH HOH A . 
K 6 HOH 132 625 625 HOH HOH A . 
K 6 HOH 133 626 626 HOH HOH A . 
K 6 HOH 134 627 627 HOH HOH A . 
K 6 HOH 135 628 628 HOH HOH A . 
K 6 HOH 136 629 629 HOH HOH A . 
K 6 HOH 137 630 630 HOH HOH A . 
K 6 HOH 138 631 631 HOH HOH A . 
K 6 HOH 139 632 632 HOH HOH A . 
K 6 HOH 140 633 633 HOH HOH A . 
K 6 HOH 141 634 634 HOH HOH A . 
K 6 HOH 142 635 635 HOH HOH A . 
K 6 HOH 143 636 636 HOH HOH A . 
K 6 HOH 144 637 637 HOH HOH A . 
K 6 HOH 145 638 638 HOH HOH A . 
K 6 HOH 146 639 639 HOH HOH A . 
K 6 HOH 147 640 640 HOH HOH A . 
K 6 HOH 148 641 641 HOH HOH A . 
K 6 HOH 149 642 642 HOH HOH A . 
K 6 HOH 150 643 643 HOH HOH A . 
K 6 HOH 151 644 644 HOH HOH A . 
K 6 HOH 152 645 645 HOH HOH A . 
K 6 HOH 153 646 646 HOH HOH A . 
K 6 HOH 154 647 647 HOH HOH A . 
K 6 HOH 155 648 648 HOH HOH A . 
K 6 HOH 156 649 649 HOH HOH A . 
K 6 HOH 157 650 650 HOH HOH A . 
K 6 HOH 158 651 651 HOH HOH A . 
K 6 HOH 159 652 652 HOH HOH A . 
K 6 HOH 160 653 653 HOH HOH A . 
K 6 HOH 161 654 654 HOH HOH A . 
K 6 HOH 162 655 655 HOH HOH A . 
K 6 HOH 163 657 657 HOH HOH A . 
K 6 HOH 164 658 658 HOH HOH A . 
K 6 HOH 165 659 659 HOH HOH A . 
K 6 HOH 166 660 660 HOH HOH A . 
K 6 HOH 167 661 661 HOH HOH A . 
K 6 HOH 168 662 662 HOH HOH A . 
K 6 HOH 169 663 663 HOH HOH A . 
K 6 HOH 170 664 664 HOH HOH A . 
K 6 HOH 171 665 665 HOH HOH A . 
K 6 HOH 172 666 666 HOH HOH A . 
K 6 HOH 173 667 667 HOH HOH A . 
K 6 HOH 174 668 668 HOH HOH A . 
K 6 HOH 175 669 669 HOH HOH A . 
K 6 HOH 176 670 670 HOH HOH A . 
K 6 HOH 177 671 671 HOH HOH A . 
K 6 HOH 178 672 672 HOH HOH A . 
K 6 HOH 179 673 673 HOH HOH A . 
K 6 HOH 180 674 674 HOH HOH A . 
K 6 HOH 181 675 675 HOH HOH A . 
K 6 HOH 182 676 676 HOH HOH A . 
K 6 HOH 183 677 677 HOH HOH A . 
K 6 HOH 184 678 678 HOH HOH A . 
K 6 HOH 185 679 679 HOH HOH A . 
K 6 HOH 186 680 680 HOH HOH A . 
K 6 HOH 187 681 681 HOH HOH A . 
K 6 HOH 188 682 682 HOH HOH A . 
K 6 HOH 189 683 683 HOH HOH A . 
K 6 HOH 190 684 684 HOH HOH A . 
K 6 HOH 191 685 685 HOH HOH A . 
K 6 HOH 192 686 686 HOH HOH A . 
K 6 HOH 193 687 687 HOH HOH A . 
K 6 HOH 194 688 688 HOH HOH A . 
K 6 HOH 195 689 689 HOH HOH A . 
K 6 HOH 196 690 690 HOH HOH A . 
K 6 HOH 197 691 691 HOH HOH A . 
K 6 HOH 198 692 692 HOH HOH A . 
K 6 HOH 199 693 693 HOH HOH A . 
K 6 HOH 200 694 694 HOH HOH A . 
K 6 HOH 201 695 695 HOH HOH A . 
K 6 HOH 202 696 696 HOH HOH A . 
K 6 HOH 203 697 697 HOH HOH A . 
K 6 HOH 204 698 698 HOH HOH A . 
K 6 HOH 205 699 699 HOH HOH A . 
K 6 HOH 206 700 700 HOH HOH A . 
K 6 HOH 207 701 701 HOH HOH A . 
K 6 HOH 208 702 702 HOH HOH A . 
K 6 HOH 209 703 703 HOH HOH A . 
K 6 HOH 210 704 704 HOH HOH A . 
K 6 HOH 211 705 705 HOH HOH A . 
K 6 HOH 212 706 706 HOH HOH A . 
K 6 HOH 213 707 707 HOH HOH A . 
K 6 HOH 214 708 708 HOH HOH A . 
K 6 HOH 215 709 709 HOH HOH A . 
K 6 HOH 216 710 710 HOH HOH A . 
K 6 HOH 217 711 711 HOH HOH A . 
K 6 HOH 218 712 712 HOH HOH A . 
K 6 HOH 219 713 713 HOH HOH A . 
K 6 HOH 220 714 714 HOH HOH A . 
K 6 HOH 221 715 715 HOH HOH A . 
K 6 HOH 222 716 716 HOH HOH A . 
K 6 HOH 223 717 717 HOH HOH A . 
K 6 HOH 224 718 718 HOH HOH A . 
K 6 HOH 225 719 719 HOH HOH A . 
K 6 HOH 226 720 720 HOH HOH A . 
K 6 HOH 227 721 721 HOH HOH A . 
K 6 HOH 228 722 722 HOH HOH A . 
K 6 HOH 229 723 723 HOH HOH A . 
K 6 HOH 230 724 724 HOH HOH A . 
K 6 HOH 231 725 725 HOH HOH A . 
K 6 HOH 232 726 726 HOH HOH A . 
K 6 HOH 233 727 727 HOH HOH A . 
K 6 HOH 234 728 728 HOH HOH A . 
K 6 HOH 235 729 729 HOH HOH A . 
K 6 HOH 236 730 730 HOH HOH A . 
K 6 HOH 237 731 731 HOH HOH A . 
K 6 HOH 238 732 732 HOH HOH A . 
K 6 HOH 239 733 733 HOH HOH A . 
K 6 HOH 240 734 734 HOH HOH A . 
K 6 HOH 241 735 735 HOH HOH A . 
K 6 HOH 242 736 736 HOH HOH A . 
K 6 HOH 243 737 737 HOH HOH A . 
K 6 HOH 244 738 738 HOH HOH A . 
K 6 HOH 245 739 739 HOH HOH A . 
K 6 HOH 246 740 740 HOH HOH A . 
K 6 HOH 247 741 741 HOH HOH A . 
K 6 HOH 248 742 742 HOH HOH A . 
K 6 HOH 249 743 743 HOH HOH A . 
K 6 HOH 250 744 744 HOH HOH A . 
K 6 HOH 251 745 745 HOH HOH A . 
K 6 HOH 252 746 746 HOH HOH A . 
K 6 HOH 253 747 747 HOH HOH A . 
K 6 HOH 254 748 748 HOH HOH A . 
K 6 HOH 255 749 749 HOH HOH A . 
K 6 HOH 256 750 750 HOH HOH A . 
K 6 HOH 257 751 751 HOH HOH A . 
K 6 HOH 258 752 752 HOH HOH A . 
K 6 HOH 259 753 753 HOH HOH A . 
K 6 HOH 260 754 754 HOH HOH A . 
K 6 HOH 261 755 755 HOH HOH A . 
K 6 HOH 262 756 756 HOH HOH A . 
L 6 HOH 1   489 3   HOH HOH B . 
L 6 HOH 2   490 6   HOH HOH B . 
L 6 HOH 3   491 7   HOH HOH B . 
L 6 HOH 4   492 8   HOH HOH B . 
L 6 HOH 5   493 9   HOH HOH B . 
L 6 HOH 6   494 10  HOH HOH B . 
L 6 HOH 7   495 11  HOH HOH B . 
L 6 HOH 8   496 14  HOH HOH B . 
L 6 HOH 9   497 16  HOH HOH B . 
L 6 HOH 10  498 17  HOH HOH B . 
L 6 HOH 11  499 19  HOH HOH B . 
L 6 HOH 12  500 23  HOH HOH B . 
L 6 HOH 13  501 24  HOH HOH B . 
L 6 HOH 14  502 26  HOH HOH B . 
L 6 HOH 15  503 28  HOH HOH B . 
L 6 HOH 16  504 31  HOH HOH B . 
L 6 HOH 17  505 32  HOH HOH B . 
L 6 HOH 18  506 37  HOH HOH B . 
L 6 HOH 19  507 38  HOH HOH B . 
L 6 HOH 20  508 41  HOH HOH B . 
L 6 HOH 21  515 515 HOH HOH B . 
L 6 HOH 22  516 516 HOH HOH B . 
L 6 HOH 23  517 517 HOH HOH B . 
L 6 HOH 24  518 518 HOH HOH B . 
L 6 HOH 25  519 519 HOH HOH B . 
L 6 HOH 26  520 520 HOH HOH B . 
L 6 HOH 27  521 521 HOH HOH B . 
L 6 HOH 28  522 522 HOH HOH B . 
L 6 HOH 29  523 523 HOH HOH B . 
L 6 HOH 30  524 524 HOH HOH B . 
L 6 HOH 31  525 525 HOH HOH B . 
L 6 HOH 32  526 526 HOH HOH B . 
L 6 HOH 33  527 527 HOH HOH B . 
L 6 HOH 34  528 528 HOH HOH B . 
L 6 HOH 35  529 529 HOH HOH B . 
L 6 HOH 36  530 530 HOH HOH B . 
L 6 HOH 37  531 531 HOH HOH B . 
L 6 HOH 38  532 532 HOH HOH B . 
L 6 HOH 39  533 533 HOH HOH B . 
L 6 HOH 40  534 534 HOH HOH B . 
L 6 HOH 41  535 535 HOH HOH B . 
L 6 HOH 42  536 536 HOH HOH B . 
L 6 HOH 43  537 537 HOH HOH B . 
L 6 HOH 44  538 538 HOH HOH B . 
L 6 HOH 45  539 539 HOH HOH B . 
L 6 HOH 46  540 540 HOH HOH B . 
L 6 HOH 47  541 541 HOH HOH B . 
L 6 HOH 48  542 542 HOH HOH B . 
L 6 HOH 49  543 543 HOH HOH B . 
L 6 HOH 50  544 544 HOH HOH B . 
L 6 HOH 51  545 545 HOH HOH B . 
L 6 HOH 52  546 546 HOH HOH B . 
L 6 HOH 53  547 547 HOH HOH B . 
L 6 HOH 54  548 548 HOH HOH B . 
L 6 HOH 55  549 549 HOH HOH B . 
L 6 HOH 56  550 550 HOH HOH B . 
L 6 HOH 57  551 551 HOH HOH B . 
L 6 HOH 58  552 552 HOH HOH B . 
L 6 HOH 59  553 553 HOH HOH B . 
L 6 HOH 60  554 554 HOH HOH B . 
L 6 HOH 61  555 555 HOH HOH B . 
L 6 HOH 62  556 556 HOH HOH B . 
L 6 HOH 63  557 557 HOH HOH B . 
L 6 HOH 64  558 558 HOH HOH B . 
L 6 HOH 65  559 559 HOH HOH B . 
L 6 HOH 66  560 560 HOH HOH B . 
L 6 HOH 67  561 561 HOH HOH B . 
L 6 HOH 68  562 562 HOH HOH B . 
L 6 HOH 69  563 563 HOH HOH B . 
L 6 HOH 70  564 564 HOH HOH B . 
L 6 HOH 71  565 565 HOH HOH B . 
L 6 HOH 72  566 566 HOH HOH B . 
L 6 HOH 73  567 567 HOH HOH B . 
L 6 HOH 74  568 568 HOH HOH B . 
L 6 HOH 75  569 569 HOH HOH B . 
L 6 HOH 76  570 570 HOH HOH B . 
L 6 HOH 77  571 571 HOH HOH B . 
L 6 HOH 78  572 572 HOH HOH B . 
L 6 HOH 79  573 573 HOH HOH B . 
L 6 HOH 80  574 574 HOH HOH B . 
L 6 HOH 81  575 575 HOH HOH B . 
L 6 HOH 82  576 576 HOH HOH B . 
L 6 HOH 83  577 577 HOH HOH B . 
L 6 HOH 84  578 578 HOH HOH B . 
L 6 HOH 85  579 579 HOH HOH B . 
L 6 HOH 86  580 580 HOH HOH B . 
L 6 HOH 87  581 581 HOH HOH B . 
L 6 HOH 88  582 582 HOH HOH B . 
L 6 HOH 89  583 583 HOH HOH B . 
L 6 HOH 90  584 584 HOH HOH B . 
L 6 HOH 91  585 585 HOH HOH B . 
L 6 HOH 92  586 586 HOH HOH B . 
L 6 HOH 93  587 587 HOH HOH B . 
L 6 HOH 94  588 588 HOH HOH B . 
L 6 HOH 95  589 589 HOH HOH B . 
L 6 HOH 96  590 590 HOH HOH B . 
L 6 HOH 97  591 591 HOH HOH B . 
L 6 HOH 98  592 592 HOH HOH B . 
L 6 HOH 99  593 593 HOH HOH B . 
L 6 HOH 100 594 594 HOH HOH B . 
L 6 HOH 101 595 595 HOH HOH B . 
L 6 HOH 102 596 596 HOH HOH B . 
L 6 HOH 103 597 597 HOH HOH B . 
L 6 HOH 104 598 598 HOH HOH B . 
L 6 HOH 105 599 599 HOH HOH B . 
L 6 HOH 106 600 600 HOH HOH B . 
L 6 HOH 107 603 603 HOH HOH B . 
L 6 HOH 108 604 604 HOH HOH B . 
L 6 HOH 109 605 605 HOH HOH B . 
L 6 HOH 110 606 606 HOH HOH B . 
L 6 HOH 111 607 607 HOH HOH B . 
L 6 HOH 112 609 609 HOH HOH B . 
L 6 HOH 113 610 610 HOH HOH B . 
L 6 HOH 114 611 611 HOH HOH B . 
L 6 HOH 115 612 612 HOH HOH B . 
L 6 HOH 116 613 613 HOH HOH B . 
L 6 HOH 117 614 614 HOH HOH B . 
L 6 HOH 118 615 615 HOH HOH B . 
L 6 HOH 119 616 616 HOH HOH B . 
L 6 HOH 120 617 617 HOH HOH B . 
L 6 HOH 121 618 618 HOH HOH B . 
L 6 HOH 122 619 619 HOH HOH B . 
L 6 HOH 123 620 620 HOH HOH B . 
L 6 HOH 124 621 621 HOH HOH B . 
L 6 HOH 125 622 622 HOH HOH B . 
L 6 HOH 126 623 623 HOH HOH B . 
L 6 HOH 127 624 624 HOH HOH B . 
L 6 HOH 128 625 625 HOH HOH B . 
L 6 HOH 129 626 626 HOH HOH B . 
L 6 HOH 130 627 627 HOH HOH B . 
L 6 HOH 131 628 628 HOH HOH B . 
L 6 HOH 132 629 629 HOH HOH B . 
L 6 HOH 133 630 630 HOH HOH B . 
L 6 HOH 134 631 631 HOH HOH B . 
L 6 HOH 135 632 632 HOH HOH B . 
L 6 HOH 136 633 633 HOH HOH B . 
L 6 HOH 137 634 634 HOH HOH B . 
L 6 HOH 138 635 635 HOH HOH B . 
L 6 HOH 139 636 636 HOH HOH B . 
L 6 HOH 140 637 637 HOH HOH B . 
L 6 HOH 141 638 638 HOH HOH B . 
L 6 HOH 142 639 639 HOH HOH B . 
L 6 HOH 143 640 640 HOH HOH B . 
L 6 HOH 144 641 641 HOH HOH B . 
L 6 HOH 145 642 642 HOH HOH B . 
L 6 HOH 146 643 643 HOH HOH B . 
L 6 HOH 147 644 644 HOH HOH B . 
L 6 HOH 148 645 645 HOH HOH B . 
L 6 HOH 149 646 646 HOH HOH B . 
L 6 HOH 150 647 647 HOH HOH B . 
L 6 HOH 151 648 648 HOH HOH B . 
L 6 HOH 152 649 649 HOH HOH B . 
L 6 HOH 153 650 650 HOH HOH B . 
L 6 HOH 154 651 651 HOH HOH B . 
L 6 HOH 155 652 652 HOH HOH B . 
L 6 HOH 156 653 653 HOH HOH B . 
L 6 HOH 157 654 654 HOH HOH B . 
L 6 HOH 158 655 655 HOH HOH B . 
L 6 HOH 159 656 656 HOH HOH B . 
L 6 HOH 160 657 657 HOH HOH B . 
L 6 HOH 161 658 658 HOH HOH B . 
L 6 HOH 162 659 659 HOH HOH B . 
L 6 HOH 163 660 660 HOH HOH B . 
L 6 HOH 164 661 661 HOH HOH B . 
L 6 HOH 165 662 662 HOH HOH B . 
L 6 HOH 166 663 663 HOH HOH B . 
L 6 HOH 167 664 664 HOH HOH B . 
L 6 HOH 168 665 665 HOH HOH B . 
L 6 HOH 169 666 666 HOH HOH B . 
L 6 HOH 170 667 667 HOH HOH B . 
L 6 HOH 171 668 668 HOH HOH B . 
L 6 HOH 172 669 669 HOH HOH B . 
L 6 HOH 173 670 670 HOH HOH B . 
L 6 HOH 174 671 671 HOH HOH B . 
L 6 HOH 175 672 672 HOH HOH B . 
L 6 HOH 176 673 673 HOH HOH B . 
L 6 HOH 177 674 674 HOH HOH B . 
L 6 HOH 178 675 675 HOH HOH B . 
L 6 HOH 179 676 676 HOH HOH B . 
L 6 HOH 180 677 677 HOH HOH B . 
L 6 HOH 181 678 678 HOH HOH B . 
L 6 HOH 182 679 679 HOH HOH B . 
L 6 HOH 183 680 680 HOH HOH B . 
L 6 HOH 184 681 681 HOH HOH B . 
L 6 HOH 185 682 682 HOH HOH B . 
L 6 HOH 186 683 683 HOH HOH B . 
L 6 HOH 187 684 684 HOH HOH B . 
L 6 HOH 188 685 685 HOH HOH B . 
L 6 HOH 189 686 686 HOH HOH B . 
L 6 HOH 190 687 687 HOH HOH B . 
L 6 HOH 191 688 688 HOH HOH B . 
L 6 HOH 192 689 689 HOH HOH B . 
L 6 HOH 193 690 690 HOH HOH B . 
L 6 HOH 194 691 691 HOH HOH B . 
L 6 HOH 195 692 692 HOH HOH B . 
L 6 HOH 196 693 693 HOH HOH B . 
L 6 HOH 197 694 694 HOH HOH B . 
L 6 HOH 198 695 695 HOH HOH B . 
L 6 HOH 199 696 696 HOH HOH B . 
L 6 HOH 200 698 698 HOH HOH B . 
L 6 HOH 201 699 699 HOH HOH B . 
L 6 HOH 202 700 700 HOH HOH B . 
L 6 HOH 203 701 701 HOH HOH B . 
L 6 HOH 204 702 702 HOH HOH B . 
L 6 HOH 205 703 703 HOH HOH B . 
L 6 HOH 206 704 704 HOH HOH B . 
L 6 HOH 207 705 705 HOH HOH B . 
L 6 HOH 208 706 706 HOH HOH B . 
L 6 HOH 209 707 707 HOH HOH B . 
L 6 HOH 210 708 708 HOH HOH B . 
L 6 HOH 211 709 709 HOH HOH B . 
L 6 HOH 212 710 710 HOH HOH B . 
L 6 HOH 213 711 711 HOH HOH B . 
L 6 HOH 214 712 712 HOH HOH B . 
L 6 HOH 215 713 713 HOH HOH B . 
L 6 HOH 216 714 714 HOH HOH B . 
L 6 HOH 217 715 715 HOH HOH B . 
L 6 HOH 218 716 716 HOH HOH B . 
L 6 HOH 219 717 717 HOH HOH B . 
L 6 HOH 220 718 718 HOH HOH B . 
L 6 HOH 221 719 719 HOH HOH B . 
L 6 HOH 222 720 720 HOH HOH B . 
L 6 HOH 223 721 721 HOH HOH B . 
L 6 HOH 224 722 722 HOH HOH B . 
L 6 HOH 225 723 723 HOH HOH B . 
L 6 HOH 226 725 725 HOH HOH B . 
L 6 HOH 227 726 726 HOH HOH B . 
L 6 HOH 228 727 727 HOH HOH B . 
L 6 HOH 229 729 729 HOH HOH B . 
L 6 HOH 230 730 730 HOH HOH B . 
L 6 HOH 231 731 731 HOH HOH B . 
L 6 HOH 232 732 732 HOH HOH B . 
L 6 HOH 233 733 733 HOH HOH B . 
L 6 HOH 234 734 734 HOH HOH B . 
L 6 HOH 235 735 735 HOH HOH B . 
L 6 HOH 236 736 736 HOH HOH B . 
L 6 HOH 237 737 737 HOH HOH B . 
M 6 HOH 1   291 291 HOH HOH C . 
M 6 HOH 2   376 376 HOH HOH C . 
N 6 HOH 1   314 314 HOH HOH D . 
N 6 HOH 2   326 326 HOH HOH D . 
N 6 HOH 3   358 358 HOH HOH D . 
N 6 HOH 4   428 428 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,F,I,K,M 
2 1 B,D,G,H,J,L,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4440  ? 
1 MORE         -44   ? 
1 'SSA (A^2)'  23030 ? 
2 'ABSA (A^2)' 4380  ? 
2 MORE         -43   ? 
2 'SSA (A^2)'  22810 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? D CYS 45  ? D CYS 46  ? 1_555 FE1 ? J FES . ? D FES 151 ? 1_555 S1 ? J FES .  ? D FES 151 ? 1_555 126.2 ? 
2  SG ? D CYS 45  ? D CYS 46  ? 1_555 FE1 ? J FES . ? D FES 151 ? 1_555 S2 ? J FES .  ? D FES 151 ? 1_555 115.5 ? 
3  S1 ? J FES .   ? D FES 151 ? 1_555 FE1 ? J FES . ? D FES 151 ? 1_555 S2 ? J FES .  ? D FES 151 ? 1_555 91.9  ? 
4  SG ? D CYS 45  ? D CYS 46  ? 1_555 FE1 ? J FES . ? D FES 151 ? 1_555 SG ? D CYS 51 ? D CYS 52  ? 1_555 112.0 ? 
5  S1 ? J FES .   ? D FES 151 ? 1_555 FE1 ? J FES . ? D FES 151 ? 1_555 SG ? D CYS 51 ? D CYS 52  ? 1_555 101.3 ? 
6  S2 ? J FES .   ? D FES 151 ? 1_555 FE1 ? J FES . ? D FES 151 ? 1_555 SG ? D CYS 51 ? D CYS 52  ? 1_555 107.1 ? 
7  SG ? C CYS 45  ? C CYS 46  ? 1_555 FE1 ? I FES . ? C FES 150 ? 1_555 S1 ? I FES .  ? C FES 150 ? 1_555 123.1 ? 
8  SG ? C CYS 45  ? C CYS 46  ? 1_555 FE1 ? I FES . ? C FES 150 ? 1_555 S2 ? I FES .  ? C FES 150 ? 1_555 115.9 ? 
9  S1 ? I FES .   ? C FES 150 ? 1_555 FE1 ? I FES . ? C FES 150 ? 1_555 S2 ? I FES .  ? C FES 150 ? 1_555 93.3  ? 
10 SG ? C CYS 45  ? C CYS 46  ? 1_555 FE1 ? I FES . ? C FES 150 ? 1_555 SG ? C CYS 51 ? C CYS 52  ? 1_555 113.6 ? 
11 S1 ? I FES .   ? C FES 150 ? 1_555 FE1 ? I FES . ? C FES 150 ? 1_555 SG ? C CYS 51 ? C CYS 52  ? 1_555 103.8 ? 
12 S2 ? I FES .   ? C FES 150 ? 1_555 FE1 ? I FES . ? C FES 150 ? 1_555 SG ? C CYS 51 ? C CYS 52  ? 1_555 104.1 ? 
13 SG ? D CYS 54  ? D CYS 55  ? 1_555 FE2 ? J FES . ? D FES 151 ? 1_555 S1 ? J FES .  ? D FES 151 ? 1_555 118.3 ? 
14 SG ? D CYS 54  ? D CYS 55  ? 1_555 FE2 ? J FES . ? D FES 151 ? 1_555 S2 ? J FES .  ? D FES 151 ? 1_555 121.9 ? 
15 S1 ? J FES .   ? D FES 151 ? 1_555 FE2 ? J FES . ? D FES 151 ? 1_555 S2 ? J FES .  ? D FES 151 ? 1_555 92.1  ? 
16 SG ? D CYS 54  ? D CYS 55  ? 1_555 FE2 ? J FES . ? D FES 151 ? 1_555 SG ? D CYS 91 ? D CYS 92  ? 1_555 109.8 ? 
17 S1 ? J FES .   ? D FES 151 ? 1_555 FE2 ? J FES . ? D FES 151 ? 1_555 SG ? D CYS 91 ? D CYS 92  ? 1_555 107.1 ? 
18 S2 ? J FES .   ? D FES 151 ? 1_555 FE2 ? J FES . ? D FES 151 ? 1_555 SG ? D CYS 91 ? D CYS 92  ? 1_555 105.6 ? 
19 SG ? C CYS 54  ? C CYS 55  ? 1_555 FE2 ? I FES . ? C FES 150 ? 1_555 S1 ? I FES .  ? C FES 150 ? 1_555 105.5 ? 
20 SG ? C CYS 54  ? C CYS 55  ? 1_555 FE2 ? I FES . ? C FES 150 ? 1_555 S2 ? I FES .  ? C FES 150 ? 1_555 114.1 ? 
21 S1 ? I FES .   ? C FES 150 ? 1_555 FE2 ? I FES . ? C FES 150 ? 1_555 S2 ? I FES .  ? C FES 150 ? 1_555 93.4  ? 
22 SG ? C CYS 54  ? C CYS 55  ? 1_555 FE2 ? I FES . ? C FES 150 ? 1_555 SG ? C CYS 91 ? C CYS 92  ? 1_555 115.4 ? 
23 S1 ? I FES .   ? C FES 150 ? 1_555 FE2 ? I FES . ? C FES 150 ? 1_555 SG ? C CYS 91 ? C CYS 92  ? 1_555 109.1 ? 
24 S2 ? I FES .   ? C FES 150 ? 1_555 FE2 ? I FES . ? C FES 150 ? 1_555 SG ? C CYS 91 ? C CYS 92  ? 1_555 116.1 ? 
25 SG ? B CYS 422 ? B CYS 423 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 NA ? G HEM .  ? B HEM 601 ? 1_555 97.0  ? 
26 SG ? B CYS 422 ? B CYS 423 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 NB ? G HEM .  ? B HEM 601 ? 1_555 87.0  ? 
27 NA ? G HEM .   ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 NB ? G HEM .  ? B HEM 601 ? 1_555 88.9  ? 
28 SG ? B CYS 422 ? B CYS 423 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 NC ? G HEM .  ? B HEM 601 ? 1_555 87.8  ? 
29 NA ? G HEM .   ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 NC ? G HEM .  ? B HEM 601 ? 1_555 175.1 ? 
30 NB ? G HEM .   ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 NC ? G HEM .  ? B HEM 601 ? 1_555 90.9  ? 
31 SG ? B CYS 422 ? B CYS 423 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 ND ? G HEM .  ? B HEM 601 ? 1_555 97.3  ? 
32 NA ? G HEM .   ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 ND ? G HEM .  ? B HEM 601 ? 1_555 91.1  ? 
33 NB ? G HEM .   ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 ND ? G HEM .  ? B HEM 601 ? 1_555 175.7 ? 
34 NC ? G HEM .   ? B HEM 601 ? 1_555 FE  ? G HEM . ? B HEM 601 ? 1_555 ND ? G HEM .  ? B HEM 601 ? 1_555 88.7  ? 
35 SG ? A CYS 422 ? A CYS 423 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 NA ? E HEM .  ? A HEM 601 ? 1_555 96.2  ? 
36 SG ? A CYS 422 ? A CYS 423 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 NB ? E HEM .  ? A HEM 601 ? 1_555 86.3  ? 
37 NA ? E HEM .   ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 NB ? E HEM .  ? A HEM 601 ? 1_555 89.3  ? 
38 SG ? A CYS 422 ? A CYS 423 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 NC ? E HEM .  ? A HEM 601 ? 1_555 88.7  ? 
39 NA ? E HEM .   ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 NC ? E HEM .  ? A HEM 601 ? 1_555 175.1 ? 
40 NB ? E HEM .   ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 NC ? E HEM .  ? A HEM 601 ? 1_555 90.6  ? 
41 SG ? A CYS 422 ? A CYS 423 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 ND ? E HEM .  ? A HEM 601 ? 1_555 98.2  ? 
42 NA ? E HEM .   ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 ND ? E HEM .  ? A HEM 601 ? 1_555 90.5  ? 
43 NB ? E HEM .   ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 ND ? E HEM .  ? A HEM 601 ? 1_555 175.4 ? 
44 NC ? E HEM .   ? A HEM 601 ? 1_555 FE  ? E HEM . ? A HEM 601 ? 1_555 ND ? E HEM .  ? A HEM 601 ? 1_555 89.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-06-08 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .        ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com      'data reduction'  
http://www.hkl-xray.com/                     ?          ? 
2 SCALEPACK   .        ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com      'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
3 REFMAC      5.5.0102 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
4 PDB_EXTRACT 3.100    'May. 21, 2010' package PDB                  help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA A LEU 460 ? ? CB A LEU 460 ? ? CG A LEU 460 ? ? 99.00 115.30 -16.30 2.30 N 
2 1 CA B LEU 460 ? ? CB B LEU 460 ? ? CG B LEU 460 ? ? 99.87 115.30 -15.43 2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 105 ? ? 36.01   -131.06 
2  1 LYS A 373 ? ? 81.45   -5.50   
3  1 ASP A 405 ? ? -68.57  94.31   
4  1 LYS A 406 ? ? -86.79  48.24   
5  1 PHE A 411 ? ? 36.06   47.59   
6  1 LEU A 460 ? ? 72.82   -62.47  
7  1 SER B 105 ? ? 53.84   -144.70 
8  1 LYS B 373 ? ? 80.10   -4.75   
9  1 LYS B 406 ? ? -82.84  36.57   
10 1 PHE B 411 ? ? 37.65   49.03   
11 1 LEU B 460 ? ? 72.15   -61.16  
12 1 LEU C 38  ? ? -73.35  -167.93 
13 1 ASP C 39  ? ? -90.49  -67.07  
14 1 ILE C 40  ? ? -27.66  120.15  
15 1 GLU C 47  ? ? 71.87   52.48   
16 1 CYS C 52  ? ? -152.15 -157.12 
17 1 SER C 53  ? ? -150.45 28.31   
18 1 CYS D 52  ? ? -144.42 -158.95 
19 1 SER D 53  ? ? -145.46 26.92   
20 1 GLU D 60  ? ? -71.37  -108.37 
21 1 ASP D 61  ? ? -132.09 -51.81  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A SER 2   ? A SER 1   
2   1 Y 1 A THR 3   ? A THR 2   
3   1 Y 1 A ARG 4   ? A ARG 3   
4   1 Y 1 A ASN 476 ? A ASN 475 
5   1 Y 1 A GLN 477 ? A GLN 476 
6   1 Y 1 A GLU 478 ? A GLU 477 
7   1 Y 1 A ALA 479 ? A ALA 478 
8   1 Y 1 A THR 480 ? A THR 479 
9   1 Y 1 A GLN 481 ? A GLN 480 
10  1 Y 1 A GLN 482 ? A GLN 481 
11  1 Y 1 A HIS 483 ? A HIS 482 
12  1 Y 1 A HIS 484 ? A HIS 483 
13  1 Y 1 A HIS 485 ? A HIS 484 
14  1 Y 1 A HIS 486 ? A HIS 485 
15  1 Y 1 A HIS 487 ? A HIS 486 
16  1 Y 1 A HIS 488 ? A HIS 487 
17  1 Y 1 B SER 2   ? B SER 1   
18  1 Y 1 B THR 3   ? B THR 2   
19  1 Y 1 B ARG 4   ? B ARG 3   
20  1 Y 1 B SER 5   ? B SER 4   
21  1 Y 1 B ASN 476 ? B ASN 475 
22  1 Y 1 B GLN 477 ? B GLN 476 
23  1 Y 1 B GLU 478 ? B GLU 477 
24  1 Y 1 B ALA 479 ? B ALA 478 
25  1 Y 1 B THR 480 ? B THR 479 
26  1 Y 1 B GLN 481 ? B GLN 480 
27  1 Y 1 B GLN 482 ? B GLN 481 
28  1 Y 1 B HIS 483 ? B HIS 482 
29  1 Y 1 B HIS 484 ? B HIS 483 
30  1 Y 1 B HIS 485 ? B HIS 484 
31  1 Y 1 B HIS 486 ? B HIS 485 
32  1 Y 1 B HIS 487 ? B HIS 486 
33  1 Y 1 B HIS 488 ? B HIS 487 
34  1 Y 1 C SER 2   ? C SER 1   
35  1 Y 1 C SER 3   ? C SER 2   
36  1 Y 1 C GLU 4   ? C GLU 3   
37  1 Y 1 C ASP 5   ? C ASP 4   
38  1 Y 1 C LYS 6   ? C LYS 5   
39  1 Y 1 C ILE 7   ? C ILE 6   
40  1 Y 1 C THR 8   ? C THR 7   
41  1 Y 1 C VAL 9   ? C VAL 8   
42  1 Y 1 C HIS 10  ? C HIS 9   
43  1 Y 1 C PHE 11  ? C PHE 10  
44  1 Y 1 C ILE 12  ? C ILE 11  
45  1 Y 1 C ASN 13  ? C ASN 12  
46  1 Y 1 C ARG 14  ? C ARG 13  
47  1 Y 1 C ASP 15  ? C ASP 14  
48  1 Y 1 C GLY 16  ? C GLY 15  
49  1 Y 1 C GLU 17  ? C GLU 16  
50  1 Y 1 C THR 18  ? C THR 17  
51  1 Y 1 C LEU 19  ? C LEU 18  
52  1 Y 1 C THR 20  ? C THR 19  
53  1 Y 1 C THR 21  ? C THR 20  
54  1 Y 1 C LYS 22  ? C LYS 21  
55  1 Y 1 C GLY 23  ? C GLY 22  
56  1 Y 1 C LYS 24  ? C LYS 23  
57  1 Y 1 C VAL 25  ? C VAL 24  
58  1 Y 1 C GLY 26  ? C GLY 25  
59  1 Y 1 C ASP 27  ? C ASP 26  
60  1 Y 1 C LEU 96  ? C LEU 95  
61  1 Y 1 C THR 97  ? C THR 96  
62  1 Y 1 C LYS 98  ? C LYS 97  
63  1 Y 1 C SER 99  ? C SER 98  
64  1 Y 1 C MET 100 ? C MET 99  
65  1 Y 1 C ASP 101 ? C ASP 100 
66  1 Y 1 C ASN 102 ? C ASN 101 
67  1 Y 1 C MET 103 ? C MET 102 
68  1 Y 1 C THR 104 ? C THR 103 
69  1 Y 1 C VAL 105 ? C VAL 104 
70  1 Y 1 C ARG 106 ? C ARG 105 
71  1 Y 1 C VAL 107 ? C VAL 106 
72  1 Y 1 C PRO 108 ? C PRO 107 
73  1 Y 1 C GLU 109 ? C GLU 108 
74  1 Y 1 C THR 110 ? C THR 109 
75  1 Y 1 C VAL 111 ? C VAL 110 
76  1 Y 1 C ALA 112 ? C ALA 111 
77  1 Y 1 C ASP 113 ? C ASP 112 
78  1 Y 1 C ALA 114 ? C ALA 113 
79  1 Y 1 C ARG 115 ? C ARG 114 
80  1 Y 1 D SER 2   ? D SER 1   
81  1 Y 1 D SER 3   ? D SER 2   
82  1 Y 1 D GLU 4   ? D GLU 3   
83  1 Y 1 D ASP 5   ? D ASP 4   
84  1 Y 1 D LYS 6   ? D LYS 5   
85  1 Y 1 D ILE 7   ? D ILE 6   
86  1 Y 1 D THR 8   ? D THR 7   
87  1 Y 1 D VAL 9   ? D VAL 8   
88  1 Y 1 D HIS 10  ? D HIS 9   
89  1 Y 1 D PHE 11  ? D PHE 10  
90  1 Y 1 D ILE 12  ? D ILE 11  
91  1 Y 1 D ASN 13  ? D ASN 12  
92  1 Y 1 D ARG 14  ? D ARG 13  
93  1 Y 1 D ASP 15  ? D ASP 14  
94  1 Y 1 D GLY 16  ? D GLY 15  
95  1 Y 1 D GLU 17  ? D GLU 16  
96  1 Y 1 D THR 18  ? D THR 17  
97  1 Y 1 D LEU 19  ? D LEU 18  
98  1 Y 1 D THR 20  ? D THR 19  
99  1 Y 1 D THR 21  ? D THR 20  
100 1 Y 1 D LYS 22  ? D LYS 21  
101 1 Y 1 D GLY 23  ? D GLY 22  
102 1 Y 1 D LYS 24  ? D LYS 23  
103 1 Y 1 D VAL 25  ? D VAL 24  
104 1 Y 1 D GLY 26  ? D GLY 25  
105 1 Y 1 D ASP 27  ? D ASP 26  
106 1 Y 1 D LEU 96  ? D LEU 95  
107 1 Y 1 D THR 97  ? D THR 96  
108 1 Y 1 D LYS 98  ? D LYS 97  
109 1 Y 1 D SER 99  ? D SER 98  
110 1 Y 1 D MET 100 ? D MET 99  
111 1 Y 1 D ASP 101 ? D ASP 100 
112 1 Y 1 D ASN 102 ? D ASN 101 
113 1 Y 1 D MET 103 ? D MET 102 
114 1 Y 1 D THR 104 ? D THR 103 
115 1 Y 1 D VAL 105 ? D VAL 104 
116 1 Y 1 D ARG 106 ? D ARG 105 
117 1 Y 1 D VAL 107 ? D VAL 106 
118 1 Y 1 D PRO 108 ? D PRO 107 
119 1 Y 1 D GLU 109 ? D GLU 108 
120 1 Y 1 D THR 110 ? D THR 109 
121 1 Y 1 D VAL 111 ? D VAL 110 
122 1 Y 1 D ALA 112 ? D ALA 111 
123 1 Y 1 D ASP 113 ? D ASP 112 
124 1 Y 1 D ALA 114 ? D ALA 113 
125 1 Y 1 D ARG 115 ? D ARG 114 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'PROTOPORPHYRIN IX CONTAINING FE' HEM 
4 CHOLESTEROL                       CLR 
5 'FE2/S2 (INORGANIC) CLUSTER'      FES 
6 water                             HOH 
#